data_5I75
# 
_entry.id   5I75 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5I75         
WWPDB D_1000218382 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5I74 unspecified 
PDB . 5I73 unspecified 
PDB . 5I71 unspecified 
PDB . 5I6Z unspecified 
PDB . 5I6X unspecified 
PDB . 5I66 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5I75 
_pdbx_database_status.recvd_initial_deposition_date   2016-02-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Coleman, J.A.' 1 
'Green, E.M.'   2 
'Gouaux, E.'    3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            532 
_citation.language                  ? 
_citation.page_first                334 
_citation.page_last                 339 
_citation.title                     'X-ray structures and mechanism of the human serotonin transporter.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature17629 
_citation.pdbx_database_id_PubMed   27049939 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Coleman, J.A.' 1 
primary 'Green, E.M.'   2 
primary 'Gouaux, E.'    3 
# 
_cell.entry_id           5I75 
_cell.length_a           129.600 
_cell.length_b           163.410 
_cell.length_c           140.470 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5I75 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Sodium-dependent serotonin transporter'                                                      61689.766 1 ? ? ? 
? 
2 polymer     man '8B6 antibody, heavy chain'                                                                   23688.365 1 ? ? ? 
? 
3 polymer     man '8B6 antibody, light chain'                                                                   23718.217 1 ? ? ? 
? 
4 non-polymer syn '(1S)-1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile' 324.392   1 ? ? ? 
? 
5 non-polymer man N-ACETYL-D-GLUCOSAMINE                                                                        221.208   2 ? ? ? 
? 
6 non-polymer syn CHOLESTEROL                                                                                   386.654   1 ? ? ? 
? 
7 non-polymer syn TETRADECANE                                                                                   198.388   1 ? ? ? 
? 
8 non-polymer syn '(1S)-1-(4-bromophenyl)-1-[3-(dimethylamino)propyl]-1,3-dihydro-2-benzofuran-5-carbonitrile'  385.298   1 ? ? ? 
? 
9 non-polymer syn 'SODIUM ION'                                                                                  22.990    1 ? ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SERT,5HT transporter,5HTT,Solute carrier family 6 member 4' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRK
ICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYT
RHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYL
KPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNED
VSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSSFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITC
FFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFII
ASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTLVPR
;
;GSQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICAQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRK
ICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYT
RHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIALSVLLVRGATLPGAWRGVLFYL
KPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNED
VSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSSFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITC
FFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFII
ASFLMSPPQLRLFQYNYPYWSIILGYAIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTLVPR
;
A ? 
2 'polypeptide(L)' no no 
;EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSYNQKFKGKATLTVDKSSTTAY
MELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTW
NSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGP
;
;EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSYNQKFKGKATLTVDKSSTTAY
MELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTW
NSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGP
;
B ? 
3 'polypeptide(L)' no no 
;DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQA
EDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQA
EDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLN n 
1 4   GLY n 
1 5   GLU n 
1 6   ARG n 
1 7   GLU n 
1 8   THR n 
1 9   TRP n 
1 10  GLY n 
1 11  LYS n 
1 12  LYS n 
1 13  VAL n 
1 14  ASP n 
1 15  PHE n 
1 16  LEU n 
1 17  LEU n 
1 18  SER n 
1 19  VAL n 
1 20  ILE n 
1 21  GLY n 
1 22  TYR n 
1 23  ALA n 
1 24  VAL n 
1 25  ASP n 
1 26  LEU n 
1 27  GLY n 
1 28  ASN n 
1 29  VAL n 
1 30  TRP n 
1 31  ARG n 
1 32  PHE n 
1 33  PRO n 
1 34  TYR n 
1 35  ILE n 
1 36  CYS n 
1 37  ALA n 
1 38  GLN n 
1 39  ASN n 
1 40  GLY n 
1 41  GLY n 
1 42  GLY n 
1 43  ALA n 
1 44  PHE n 
1 45  LEU n 
1 46  LEU n 
1 47  PRO n 
1 48  TYR n 
1 49  THR n 
1 50  ILE n 
1 51  MET n 
1 52  ALA n 
1 53  ILE n 
1 54  PHE n 
1 55  GLY n 
1 56  GLY n 
1 57  ILE n 
1 58  PRO n 
1 59  LEU n 
1 60  PHE n 
1 61  TYR n 
1 62  MET n 
1 63  GLU n 
1 64  LEU n 
1 65  ALA n 
1 66  LEU n 
1 67  GLY n 
1 68  GLN n 
1 69  TYR n 
1 70  HIS n 
1 71  ARG n 
1 72  ASN n 
1 73  GLY n 
1 74  CYS n 
1 75  ILE n 
1 76  SER n 
1 77  ILE n 
1 78  TRP n 
1 79  ARG n 
1 80  LYS n 
1 81  ILE n 
1 82  CYS n 
1 83  PRO n 
1 84  ILE n 
1 85  PHE n 
1 86  LYS n 
1 87  GLY n 
1 88  ILE n 
1 89  GLY n 
1 90  TYR n 
1 91  ALA n 
1 92  ILE n 
1 93  CYS n 
1 94  ILE n 
1 95  ILE n 
1 96  ALA n 
1 97  PHE n 
1 98  TYR n 
1 99  ILE n 
1 100 ALA n 
1 101 SER n 
1 102 TYR n 
1 103 TYR n 
1 104 ASN n 
1 105 THR n 
1 106 ILE n 
1 107 MET n 
1 108 ALA n 
1 109 TRP n 
1 110 ALA n 
1 111 LEU n 
1 112 TYR n 
1 113 TYR n 
1 114 LEU n 
1 115 ILE n 
1 116 SER n 
1 117 SER n 
1 118 PHE n 
1 119 THR n 
1 120 ASP n 
1 121 GLN n 
1 122 LEU n 
1 123 PRO n 
1 124 TRP n 
1 125 THR n 
1 126 SER n 
1 127 CYS n 
1 128 LYS n 
1 129 ASN n 
1 130 SER n 
1 131 TRP n 
1 132 ASN n 
1 133 THR n 
1 134 GLY n 
1 135 ASN n 
1 136 CYS n 
1 137 THR n 
1 138 ASN n 
1 139 TYR n 
1 140 PHE n 
1 141 SER n 
1 142 GLU n 
1 143 ASP n 
1 144 ASN n 
1 145 ILE n 
1 146 THR n 
1 147 TRP n 
1 148 THR n 
1 149 LEU n 
1 150 HIS n 
1 151 SER n 
1 152 THR n 
1 153 SER n 
1 154 PRO n 
1 155 ALA n 
1 156 GLU n 
1 157 GLU n 
1 158 PHE n 
1 159 TYR n 
1 160 THR n 
1 161 ARG n 
1 162 HIS n 
1 163 VAL n 
1 164 LEU n 
1 165 GLN n 
1 166 ILE n 
1 167 HIS n 
1 168 ARG n 
1 169 SER n 
1 170 LYS n 
1 171 GLY n 
1 172 LEU n 
1 173 GLN n 
1 174 ASP n 
1 175 LEU n 
1 176 GLY n 
1 177 GLY n 
1 178 ILE n 
1 179 SER n 
1 180 TRP n 
1 181 GLN n 
1 182 LEU n 
1 183 ALA n 
1 184 LEU n 
1 185 CYS n 
1 186 ILE n 
1 187 MET n 
1 188 LEU n 
1 189 ILE n 
1 190 PHE n 
1 191 THR n 
1 192 VAL n 
1 193 ILE n 
1 194 TYR n 
1 195 PHE n 
1 196 SER n 
1 197 ILE n 
1 198 TRP n 
1 199 LYS n 
1 200 GLY n 
1 201 VAL n 
1 202 LYS n 
1 203 THR n 
1 204 SER n 
1 205 GLY n 
1 206 LYS n 
1 207 VAL n 
1 208 VAL n 
1 209 TRP n 
1 210 VAL n 
1 211 THR n 
1 212 ALA n 
1 213 THR n 
1 214 PHE n 
1 215 PRO n 
1 216 TYR n 
1 217 ILE n 
1 218 ALA n 
1 219 LEU n 
1 220 SER n 
1 221 VAL n 
1 222 LEU n 
1 223 LEU n 
1 224 VAL n 
1 225 ARG n 
1 226 GLY n 
1 227 ALA n 
1 228 THR n 
1 229 LEU n 
1 230 PRO n 
1 231 GLY n 
1 232 ALA n 
1 233 TRP n 
1 234 ARG n 
1 235 GLY n 
1 236 VAL n 
1 237 LEU n 
1 238 PHE n 
1 239 TYR n 
1 240 LEU n 
1 241 LYS n 
1 242 PRO n 
1 243 ASN n 
1 244 TRP n 
1 245 GLN n 
1 246 LYS n 
1 247 LEU n 
1 248 LEU n 
1 249 GLU n 
1 250 THR n 
1 251 GLY n 
1 252 VAL n 
1 253 TRP n 
1 254 ILE n 
1 255 ASP n 
1 256 ALA n 
1 257 ALA n 
1 258 ALA n 
1 259 GLN n 
1 260 ILE n 
1 261 PHE n 
1 262 PHE n 
1 263 SER n 
1 264 LEU n 
1 265 GLY n 
1 266 PRO n 
1 267 GLY n 
1 268 PHE n 
1 269 GLY n 
1 270 VAL n 
1 271 LEU n 
1 272 LEU n 
1 273 ALA n 
1 274 PHE n 
1 275 ALA n 
1 276 SER n 
1 277 TYR n 
1 278 ASN n 
1 279 LYS n 
1 280 PHE n 
1 281 ASN n 
1 282 ASN n 
1 283 ASN n 
1 284 CYS n 
1 285 TYR n 
1 286 GLN n 
1 287 ASP n 
1 288 ALA n 
1 289 LEU n 
1 290 VAL n 
1 291 THR n 
1 292 SER n 
1 293 VAL n 
1 294 VAL n 
1 295 ASN n 
1 296 CYS n 
1 297 MET n 
1 298 THR n 
1 299 SER n 
1 300 PHE n 
1 301 VAL n 
1 302 SER n 
1 303 GLY n 
1 304 PHE n 
1 305 VAL n 
1 306 ILE n 
1 307 PHE n 
1 308 THR n 
1 309 VAL n 
1 310 LEU n 
1 311 GLY n 
1 312 TYR n 
1 313 MET n 
1 314 ALA n 
1 315 GLU n 
1 316 MET n 
1 317 ARG n 
1 318 ASN n 
1 319 GLU n 
1 320 ASP n 
1 321 VAL n 
1 322 SER n 
1 323 GLU n 
1 324 VAL n 
1 325 ALA n 
1 326 LYS n 
1 327 ASP n 
1 328 ALA n 
1 329 GLY n 
1 330 PRO n 
1 331 SER n 
1 332 LEU n 
1 333 LEU n 
1 334 PHE n 
1 335 ILE n 
1 336 THR n 
1 337 TYR n 
1 338 ALA n 
1 339 GLU n 
1 340 ALA n 
1 341 ILE n 
1 342 ALA n 
1 343 ASN n 
1 344 MET n 
1 345 PRO n 
1 346 ALA n 
1 347 SER n 
1 348 THR n 
1 349 PHE n 
1 350 PHE n 
1 351 ALA n 
1 352 ILE n 
1 353 ILE n 
1 354 PHE n 
1 355 PHE n 
1 356 LEU n 
1 357 MET n 
1 358 LEU n 
1 359 ILE n 
1 360 THR n 
1 361 LEU n 
1 362 GLY n 
1 363 LEU n 
1 364 ASP n 
1 365 SER n 
1 366 SER n 
1 367 PHE n 
1 368 ALA n 
1 369 GLY n 
1 370 LEU n 
1 371 GLU n 
1 372 GLY n 
1 373 VAL n 
1 374 ILE n 
1 375 THR n 
1 376 ALA n 
1 377 VAL n 
1 378 LEU n 
1 379 ASP n 
1 380 GLU n 
1 381 PHE n 
1 382 PRO n 
1 383 HIS n 
1 384 VAL n 
1 385 TRP n 
1 386 ALA n 
1 387 LYS n 
1 388 ARG n 
1 389 ARG n 
1 390 GLU n 
1 391 ARG n 
1 392 PHE n 
1 393 VAL n 
1 394 LEU n 
1 395 ALA n 
1 396 VAL n 
1 397 VAL n 
1 398 ILE n 
1 399 THR n 
1 400 CYS n 
1 401 PHE n 
1 402 PHE n 
1 403 GLY n 
1 404 SER n 
1 405 LEU n 
1 406 VAL n 
1 407 THR n 
1 408 LEU n 
1 409 THR n 
1 410 PHE n 
1 411 GLY n 
1 412 GLY n 
1 413 ALA n 
1 414 TYR n 
1 415 VAL n 
1 416 VAL n 
1 417 LYS n 
1 418 LEU n 
1 419 LEU n 
1 420 GLU n 
1 421 GLU n 
1 422 TYR n 
1 423 ALA n 
1 424 THR n 
1 425 GLY n 
1 426 PRO n 
1 427 ALA n 
1 428 VAL n 
1 429 LEU n 
1 430 THR n 
1 431 VAL n 
1 432 ALA n 
1 433 LEU n 
1 434 ILE n 
1 435 GLU n 
1 436 ALA n 
1 437 VAL n 
1 438 ALA n 
1 439 VAL n 
1 440 SER n 
1 441 TRP n 
1 442 PHE n 
1 443 TYR n 
1 444 GLY n 
1 445 ILE n 
1 446 THR n 
1 447 GLN n 
1 448 PHE n 
1 449 CYS n 
1 450 ARG n 
1 451 ASP n 
1 452 VAL n 
1 453 LYS n 
1 454 GLU n 
1 455 MET n 
1 456 LEU n 
1 457 GLY n 
1 458 PHE n 
1 459 SER n 
1 460 PRO n 
1 461 GLY n 
1 462 TRP n 
1 463 PHE n 
1 464 TRP n 
1 465 ARG n 
1 466 ILE n 
1 467 CYS n 
1 468 TRP n 
1 469 VAL n 
1 470 ALA n 
1 471 ILE n 
1 472 SER n 
1 473 PRO n 
1 474 LEU n 
1 475 PHE n 
1 476 LEU n 
1 477 LEU n 
1 478 PHE n 
1 479 ILE n 
1 480 ILE n 
1 481 ALA n 
1 482 SER n 
1 483 PHE n 
1 484 LEU n 
1 485 MET n 
1 486 SER n 
1 487 PRO n 
1 488 PRO n 
1 489 GLN n 
1 490 LEU n 
1 491 ARG n 
1 492 LEU n 
1 493 PHE n 
1 494 GLN n 
1 495 TYR n 
1 496 ASN n 
1 497 TYR n 
1 498 PRO n 
1 499 TYR n 
1 500 TRP n 
1 501 SER n 
1 502 ILE n 
1 503 ILE n 
1 504 LEU n 
1 505 GLY n 
1 506 TYR n 
1 507 ALA n 
1 508 ILE n 
1 509 GLY n 
1 510 THR n 
1 511 SER n 
1 512 SER n 
1 513 PHE n 
1 514 ILE n 
1 515 CYS n 
1 516 ILE n 
1 517 PRO n 
1 518 THR n 
1 519 TYR n 
1 520 ILE n 
1 521 ALA n 
1 522 TYR n 
1 523 ARG n 
1 524 LEU n 
1 525 ILE n 
1 526 ILE n 
1 527 THR n 
1 528 PRO n 
1 529 GLY n 
1 530 THR n 
1 531 PHE n 
1 532 LYS n 
1 533 GLU n 
1 534 ARG n 
1 535 ILE n 
1 536 ILE n 
1 537 LYS n 
1 538 SER n 
1 539 ILE n 
1 540 THR n 
1 541 PRO n 
1 542 GLU n 
1 543 THR n 
1 544 PRO n 
1 545 THR n 
1 546 LEU n 
1 547 VAL n 
1 548 PRO n 
1 549 ARG n 
2 1   GLU n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   GLN n 
2 6   GLN n 
2 7   SER n 
2 8   GLY n 
2 9   PRO n 
2 10  GLU n 
2 11  LEU n 
2 12  VAL n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  ALA n 
2 17  SER n 
2 18  VAL n 
2 19  LYS n 
2 20  ILE n 
2 21  SER n 
2 22  CYS n 
2 23  LYS n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  TYR n 
2 28  THR n 
2 29  PHE n 
2 30  THR n 
2 31  ASP n 
2 32  TYR n 
2 33  TYR n 
2 34  MET n 
2 35  ASN n 
2 36  TRP n 
2 37  VAL n 
2 38  LYS n 
2 39  GLN n 
2 40  SER n 
2 41  HIS n 
2 42  GLY n 
2 43  LYS n 
2 44  SER n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  ILE n 
2 49  GLY n 
2 50  ASN n 
2 51  ILE n 
2 52  ASN n 
2 53  PRO n 
2 54  ASN n 
2 55  ASN n 
2 56  GLY n 
2 57  GLY n 
2 58  THR n 
2 59  SER n 
2 60  TYR n 
2 61  ASN n 
2 62  GLN n 
2 63  LYS n 
2 64  PHE n 
2 65  LYS n 
2 66  GLY n 
2 67  LYS n 
2 68  ALA n 
2 69  THR n 
2 70  LEU n 
2 71  THR n 
2 72  VAL n 
2 73  ASP n 
2 74  LYS n 
2 75  SER n 
2 76  SER n 
2 77  THR n 
2 78  THR n 
2 79  ALA n 
2 80  TYR n 
2 81  MET n 
2 82  GLU n 
2 83  LEU n 
2 84  ARG n 
2 85  SER n 
2 86  LEU n 
2 87  THR n 
2 88  SER n 
2 89  GLU n 
2 90  ASP n 
2 91  SER n 
2 92  ALA n 
2 93  VAL n 
2 94  TYR n 
2 95  TYR n 
2 96  CYS n 
2 97  THR n 
2 98  ARG n 
2 99  SER n 
2 100 PRO n 
2 101 VAL n 
2 102 ARG n 
2 103 PRO n 
2 104 TYR n 
2 105 TYR n 
2 106 PHE n 
2 107 ASP n 
2 108 TYR n 
2 109 TRP n 
2 110 GLY n 
2 111 GLN n 
2 112 GLY n 
2 113 THR n 
2 114 THR n 
2 115 LEU n 
2 116 THR n 
2 117 VAL n 
2 118 SER n 
2 119 SER n 
2 120 ALA n 
2 121 LYS n 
2 122 THR n 
2 123 THR n 
2 124 PRO n 
2 125 PRO n 
2 126 SER n 
2 127 VAL n 
2 128 TYR n 
2 129 PRO n 
2 130 LEU n 
2 131 ALA n 
2 132 PRO n 
2 133 GLY n 
2 134 CYS n 
2 135 GLY n 
2 136 ASP n 
2 137 THR n 
2 138 THR n 
2 139 GLY n 
2 140 SER n 
2 141 SER n 
2 142 VAL n 
2 143 THR n 
2 144 LEU n 
2 145 GLY n 
2 146 CYS n 
2 147 LEU n 
2 148 VAL n 
2 149 LYS n 
2 150 GLY n 
2 151 TYR n 
2 152 PHE n 
2 153 PRO n 
2 154 GLU n 
2 155 SER n 
2 156 VAL n 
2 157 THR n 
2 158 VAL n 
2 159 THR n 
2 160 TRP n 
2 161 ASN n 
2 162 SER n 
2 163 GLY n 
2 164 SER n 
2 165 LEU n 
2 166 SER n 
2 167 SER n 
2 168 SER n 
2 169 VAL n 
2 170 HIS n 
2 171 THR n 
2 172 PHE n 
2 173 PRO n 
2 174 ALA n 
2 175 LEU n 
2 176 LEU n 
2 177 GLN n 
2 178 SER n 
2 179 GLY n 
2 180 LEU n 
2 181 TYR n 
2 182 THR n 
2 183 MET n 
2 184 SER n 
2 185 SER n 
2 186 SER n 
2 187 VAL n 
2 188 THR n 
2 189 VAL n 
2 190 PRO n 
2 191 SER n 
2 192 SER n 
2 193 THR n 
2 194 TRP n 
2 195 PRO n 
2 196 SER n 
2 197 GLN n 
2 198 THR n 
2 199 VAL n 
2 200 THR n 
2 201 CYS n 
2 202 SER n 
2 203 VAL n 
2 204 ALA n 
2 205 HIS n 
2 206 PRO n 
2 207 ALA n 
2 208 SER n 
2 209 SER n 
2 210 THR n 
2 211 THR n 
2 212 VAL n 
2 213 ASP n 
2 214 LYS n 
2 215 LYS n 
2 216 LEU n 
2 217 GLU n 
2 218 PRO n 
2 219 SER n 
2 220 GLY n 
2 221 PRO n 
3 1   ASP n 
3 2   ILE n 
3 3   VAL n 
3 4   MET n 
3 5   THR n 
3 6   GLN n 
3 7   SER n 
3 8   HIS n 
3 9   LYS n 
3 10  PHE n 
3 11  MET n 
3 12  SER n 
3 13  THR n 
3 14  SER n 
3 15  VAL n 
3 16  GLY n 
3 17  ASP n 
3 18  ARG n 
3 19  VAL n 
3 20  SER n 
3 21  ILE n 
3 22  THR n 
3 23  CYS n 
3 24  LYS n 
3 25  ALA n 
3 26  SER n 
3 27  GLN n 
3 28  ASP n 
3 29  VAL n 
3 30  SER n 
3 31  THR n 
3 32  ALA n 
3 33  VAL n 
3 34  ALA n 
3 35  TRP n 
3 36  TYR n 
3 37  GLN n 
3 38  GLN n 
3 39  LYS n 
3 40  PRO n 
3 41  GLY n 
3 42  GLN n 
3 43  SER n 
3 44  PRO n 
3 45  LYS n 
3 46  LEU n 
3 47  LEU n 
3 48  ILE n 
3 49  TYR n 
3 50  SER n 
3 51  ALA n 
3 52  SER n 
3 53  TYR n 
3 54  ARG n 
3 55  TYR n 
3 56  THR n 
3 57  GLY n 
3 58  VAL n 
3 59  PRO n 
3 60  ASP n 
3 61  ARG n 
3 62  PHE n 
3 63  THR n 
3 64  GLY n 
3 65  SER n 
3 66  GLY n 
3 67  SER n 
3 68  GLY n 
3 69  THR n 
3 70  ASP n 
3 71  PHE n 
3 72  THR n 
3 73  PHE n 
3 74  THR n 
3 75  ILE n 
3 76  SER n 
3 77  SER n 
3 78  VAL n 
3 79  GLN n 
3 80  ALA n 
3 81  GLU n 
3 82  ASP n 
3 83  LEU n 
3 84  ALA n 
3 85  VAL n 
3 86  TYR n 
3 87  TYR n 
3 88  CYS n 
3 89  GLN n 
3 90  GLN n 
3 91  HIS n 
3 92  TYR n 
3 93  SER n 
3 94  ILE n 
3 95  PRO n 
3 96  ARG n 
3 97  THR n 
3 98  PHE n 
3 99  GLY n 
3 100 GLY n 
3 101 GLY n 
3 102 THR n 
3 103 LYS n 
3 104 LEU n 
3 105 GLU n 
3 106 ILE n 
3 107 LYS n 
3 108 ARG n 
3 109 ALA n 
3 110 ASP n 
3 111 ALA n 
3 112 ALA n 
3 113 PRO n 
3 114 THR n 
3 115 VAL n 
3 116 SER n 
3 117 ILE n 
3 118 PHE n 
3 119 PRO n 
3 120 PRO n 
3 121 SER n 
3 122 SER n 
3 123 GLU n 
3 124 GLN n 
3 125 LEU n 
3 126 THR n 
3 127 SER n 
3 128 GLY n 
3 129 GLY n 
3 130 ALA n 
3 131 SER n 
3 132 VAL n 
3 133 VAL n 
3 134 CYS n 
3 135 PHE n 
3 136 LEU n 
3 137 ASN n 
3 138 ASN n 
3 139 PHE n 
3 140 TYR n 
3 141 PRO n 
3 142 LYS n 
3 143 ASP n 
3 144 ILE n 
3 145 ASN n 
3 146 VAL n 
3 147 LYS n 
3 148 TRP n 
3 149 LYS n 
3 150 ILE n 
3 151 ASP n 
3 152 GLY n 
3 153 SER n 
3 154 GLU n 
3 155 ARG n 
3 156 GLN n 
3 157 ASN n 
3 158 GLY n 
3 159 VAL n 
3 160 LEU n 
3 161 ASN n 
3 162 SER n 
3 163 TRP n 
3 164 THR n 
3 165 ASP n 
3 166 GLN n 
3 167 ASP n 
3 168 SER n 
3 169 LYS n 
3 170 ASP n 
3 171 SER n 
3 172 THR n 
3 173 TYR n 
3 174 SER n 
3 175 MET n 
3 176 SER n 
3 177 SER n 
3 178 THR n 
3 179 LEU n 
3 180 THR n 
3 181 LEU n 
3 182 THR n 
3 183 LYS n 
3 184 ASP n 
3 185 GLU n 
3 186 TYR n 
3 187 GLU n 
3 188 ARG n 
3 189 HIS n 
3 190 ASN n 
3 191 SER n 
3 192 TYR n 
3 193 THR n 
3 194 CYS n 
3 195 GLU n 
3 196 ALA n 
3 197 THR n 
3 198 HIS n 
3 199 LYS n 
3 200 THR n 
3 201 SER n 
3 202 THR n 
3 203 SER n 
3 204 PRO n 
3 205 ILE n 
3 206 VAL n 
3 207 LYS n 
3 208 SER n 
3 209 PHE n 
3 210 ASN n 
3 211 ARG n 
3 212 ASN n 
3 213 GLU n 
3 214 CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 549 Human ? 'SLC6A4, HTT, SERT' ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 'Homo sapiens' 
9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 221 ?     ? ?                   ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 214 ?     ? ?                   ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP SC6A4_HUMAN P31645 ? 1 
;QGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKIC
PIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRH
VLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKP
NWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVS
EVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFF
GSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICS
FLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPT
;
76 
2 PDB 5I75        5I75   ? 2 ? 1  
3 PDB 5I75        5I75   ? 3 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5I75 A 3 ? 545 ? P31645 76 ? 618 ? 76 618 
2 2 5I75 B 1 ? 221 ? 5I75   20 ? 240 ? 20 240 
3 3 5I75 C 1 ? 214 ? 5I75   21 ? 234 ? 21 234 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5I6Z GLY A 1   ? UNP P31645 ?   ?   'cloning artifact'    74  1  
1 5I6Z SER A 2   ? UNP P31645 ?   ?   'cloning artifact'    75  2  
1 5I6Z ALA A 218 ? UNP P31645 ILE 291 'engineered mutation' 291 3  
1 5I6Z SER A 366 ? UNP P31645 THR 439 'engineered mutation' 439 4  
1 5I6Z ALA A 481 ? UNP P31645 CYS 554 'engineered mutation' 554 5  
1 5I6Z ALA A 507 ? UNP P31645 CYS 580 'engineered mutation' 580 6  
1 5I6Z LEU A 546 ? UNP P31645 ?   ?   'cloning artifact'    619 7  
1 5I6Z VAL A 547 ? UNP P31645 ?   ?   'cloning artifact'    620 8  
1 5I6Z PRO A 548 ? UNP P31645 ?   ?   'cloning artifact'    621 9  
1 5I6Z ARG A 549 ? UNP P31645 ?   ?   'cloning artifact'    622 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
68P non-polymer         . '(1S)-1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile' ? 
'C20 H21 F N2 O'  324.392 
69D non-polymer         . '(1S)-1-(4-bromophenyl)-1-[3-(dimethylamino)propyl]-1,3-dihydro-2-benzofuran-5-carbonitrile'  ? 
'C20 H21 Br N2 O' 385.298 
ALA 'L-peptide linking' y ALANINE                                                                                       ? 
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                                      ? 
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                    ? 
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                               ? 
'C4 H7 N O4'      133.103 
C14 non-polymer         . TETRADECANE                                                                                   ? 
'C14 H30'         198.388 
CLR non-polymer         . CHOLESTEROL                                                                                   ? 
'C27 H46 O'       386.654 
CYS 'L-peptide linking' y CYSTEINE                                                                                      ? 
'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                     ? 
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                               ? 
'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                                       ? 
'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                     ? 
'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                                    ? 
'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                       ? 
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                                        ? 
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                                    ? 
'C5 H11 N O2 S'   149.211 
NA  non-polymer         . 'SODIUM ION'                                                                                  ? 'Na 1' 
22.990  
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE                                                                        ? 
'C8 H15 N O6'     221.208 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                 ? 
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                                       ? 
'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                                        ? 
'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                                     ? 
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                    ? 
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                      ? 
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                                        ? 
'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5I75 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.37 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         63.52 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM Tris pH 8.5, 25-125 mM KCl, 32.5-34% PEG 400, 0.5% 6-aminohexanoic acid' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-09-20 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.900 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.900 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5I75 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             82.290 
_reflns.d_resolution_high            3.490 
_reflns.number_obs                   38122 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.08439 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.7600 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              11.00 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5I75 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     36305 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.420 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             82.29 
_refine.ls_d_res_high                            3.49 
_refine.ls_percent_reflns_obs                    99.0 
_refine.ls_R_factor_obs                          0.246 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.244 
_refine.ls_R_factor_R_free                       0.286 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1817 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.640 
_refine.pdbx_overall_phase_error                 30.740 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7497 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         113 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7610 
_refine_hist.d_res_high                       3.49 
_refine_hist.d_res_low                        82.29 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.021  ? ? 7846  'X-RAY DIFFRACTION' ? 
f_angle_d          0.737  ? ? 10712 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.224 ? ? 2690  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.319  ? ? 1210  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 1316  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.4894 3.5837  2421 0.3661 90.00  0.3790 . . 130 . . . . 
'X-RAY DIFFRACTION' . 3.5837 3.6892  2623 0.3601 99.00  0.3651 . . 138 . . . . 
'X-RAY DIFFRACTION' . 3.6892 3.8083  2694 0.3250 99.00  0.3547 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.8083 3.9444  2659 0.3139 100.00 0.3571 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.9444 4.1023  2637 0.2893 99.00  0.3215 . . 138 . . . . 
'X-RAY DIFFRACTION' . 4.1023 4.2890  2702 0.2463 100.00 0.3219 . . 139 . . . . 
'X-RAY DIFFRACTION' . 4.2890 4.5151  2692 0.2195 100.00 0.2302 . . 142 . . . . 
'X-RAY DIFFRACTION' . 4.5151 4.7979  2664 0.2039 100.00 0.2579 . . 143 . . . . 
'X-RAY DIFFRACTION' . 4.7979 5.1683  2694 0.1972 100.00 0.2261 . . 147 . . . . 
'X-RAY DIFFRACTION' . 5.1683 5.6883  2646 0.2160 100.00 0.2362 . . 139 . . . . 
'X-RAY DIFFRACTION' . 5.6883 6.5112  2707 0.2352 100.00 0.3003 . . 142 . . . . 
'X-RAY DIFFRACTION' . 6.5112 8.2022  2663 0.2374 100.00 0.2867 . . 138 . . . . 
'X-RAY DIFFRACTION' . 8.2022 82.3152 2686 0.2271 100.00 0.2758 . . 141 . . . . 
# 
_struct.entry_id                     5I75 
_struct.title                        
;X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at the central site and Br-citalopram at the allosteric site
;
_struct.pdbx_descriptor              'Sodium-dependent serotonin transporter, Heavy chain, Anti-colorectal carcinoma light chain' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5I75 
_struct_keywords.text            'Membrane protein' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 8 ? 
I N N 5 ? 
J N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 11  ? VAL A 24  ? LYS A 84  VAL A 97  1 ? 14 
HELX_P HELX_P2  AA2 ASP A 25  ? GLN A 38  ? ASP A 98  GLN A 111 1 ? 14 
HELX_P HELX_P3  AA3 GLY A 40  ? ALA A 43  ? GLY A 113 ALA A 116 5 ? 4  
HELX_P HELX_P4  AA4 PHE A 44  ? GLY A 55  ? PHE A 117 GLY A 128 1 ? 12 
HELX_P HELX_P5  AA5 GLY A 55  ? ARG A 71  ? GLY A 128 ARG A 144 1 ? 17 
HELX_P HELX_P6  AA6 ILE A 75  ? LYS A 80  ? ILE A 148 LYS A 153 1 ? 6  
HELX_P HELX_P7  AA7 CYS A 82  ? ILE A 84  ? CYS A 155 ILE A 157 5 ? 3  
HELX_P HELX_P8  AA8 PHE A 85  ? SER A 116 ? PHE A 158 SER A 189 1 ? 32 
HELX_P HELX_P9  AA9 SER A 153 ? HIS A 162 ? SER A 226 HIS A 235 1 ? 10 
HELX_P HELX_P10 AB1 GLN A 165 ? SER A 169 ? GLN A 238 SER A 242 5 ? 5  
HELX_P HELX_P11 AB2 SER A 179 ? ILE A 193 ? SER A 252 ILE A 266 1 ? 15 
HELX_P HELX_P12 AB3 GLY A 200 ? GLY A 205 ? GLY A 273 GLY A 278 1 ? 6  
HELX_P HELX_P13 AB4 VAL A 207 ? LEU A 229 ? VAL A 280 LEU A 302 1 ? 23 
HELX_P HELX_P14 AB5 ALA A 232 ? LYS A 241 ? ALA A 305 LYS A 314 1 ? 10 
HELX_P HELX_P15 AB6 ASN A 243 ? LEU A 248 ? ASN A 316 LEU A 321 5 ? 6  
HELX_P HELX_P16 AB7 GLU A 249 ? GLY A 265 ? GLU A 322 GLY A 338 1 ? 17 
HELX_P HELX_P17 AB8 GLY A 269 ? TYR A 277 ? GLY A 342 TYR A 350 1 ? 9  
HELX_P HELX_P18 AB9 CYS A 284 ? ARG A 317 ? CYS A 357 ARG A 390 1 ? 34 
HELX_P HELX_P19 AC1 ASP A 320 ? ALA A 325 ? ASP A 393 ALA A 398 1 ? 6  
HELX_P HELX_P20 AC2 PRO A 330 ? ILE A 335 ? PRO A 403 ILE A 408 1 ? 6  
HELX_P HELX_P21 AC3 ILE A 335 ? ASN A 343 ? ILE A 408 ASN A 416 1 ? 9  
HELX_P HELX_P22 AC4 ALA A 346 ? PHE A 381 ? ALA A 419 PHE A 454 1 ? 36 
HELX_P HELX_P23 AC5 ARG A 388 ? SER A 404 ? ARG A 461 SER A 477 1 ? 17 
HELX_P HELX_P24 AC6 GLY A 411 ? TYR A 422 ? GLY A 484 TYR A 495 1 ? 12 
HELX_P HELX_P25 AC7 ALA A 423 ? PHE A 442 ? ALA A 496 PHE A 515 1 ? 20 
HELX_P HELX_P26 AC8 GLY A 444 ? LEU A 456 ? GLY A 517 LEU A 529 1 ? 13 
HELX_P HELX_P27 AC9 GLY A 461 ? ALA A 470 ? GLY A 534 ALA A 543 1 ? 10 
HELX_P HELX_P28 AD1 ALA A 470 ? SER A 486 ? ALA A 543 SER A 559 1 ? 17 
HELX_P HELX_P29 AD2 TRP A 500 ? SER A 511 ? TRP A 573 SER A 584 1 ? 12 
HELX_P HELX_P30 AD3 ILE A 514 ? THR A 527 ? ILE A 587 THR A 600 1 ? 14 
HELX_P HELX_P31 AD4 THR A 530 ? THR A 540 ? THR A 603 THR A 613 1 ? 11 
HELX_P HELX_P32 AD5 THR B 28  ? TYR B 32  ? THR B 47  TYR B 51  5 ? 5  
HELX_P HELX_P33 AD6 GLN B 62  ? LYS B 65  ? GLN B 81  LYS B 84  5 ? 4  
HELX_P HELX_P34 AD7 THR B 87  ? SER B 91  ? THR B 106 SER B 110 5 ? 5  
HELX_P HELX_P35 AD8 GLN C 79  ? LEU C 83  ? GLN C 99  LEU C 103 5 ? 5  
HELX_P HELX_P36 AD9 SER C 121 ? GLY C 128 ? SER C 141 GLY C 148 1 ? 8  
HELX_P HELX_P37 AE1 LYS C 183 ? GLU C 187 ? LYS C 203 GLU C 207 1 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ?   ? A CYS 127 SG  ? ? ? 1_555 A CYS 136 SG ? ? A CYS 200 A CYS 209 1_555 ? ? ? ? ? ? ? 2.077 ? 
disulf2 disulf ?   ? B CYS 22  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 41  B CYS 115 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf3 disulf ?   ? B CYS 134 SG  ? ? ? 1_555 C CYS 214 SG ? ? B CYS 153 C CYS 234 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf4 disulf ?   ? B CYS 146 SG  ? ? ? 1_555 B CYS 201 SG ? ? B CYS 165 B CYS 220 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf5 disulf ?   ? C CYS 23  SG  ? ? ? 1_555 C CYS 88  SG ? ? C CYS 43  C CYS 108 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf6 disulf ?   ? C CYS 134 SG  ? ? ? 1_555 C CYS 194 SG ? ? C CYS 154 C CYS 214 1_555 ? ? ? ? ? ? ? 2.031 ? 
metalc1 metalc ?   ? A GLY 21  O   ? ? ? 1_555 J NA  .   NA ? ? A GLY 94  A NA  707 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc2 metalc ?   ? A VAL 24  O   ? ? ? 1_555 J NA  .   NA ? ? A VAL 97  A NA  707 1_555 ? ? ? ? ? ? ? 2.509 ? 
covale1 covale one ? A ASN 135 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 208 A NAG 702 1_555 ? ? ? ? ? ? ? 1.396 ? 
covale2 covale one ? A ASN 144 ND2 ? ? ? 1_555 I NAG .   C1 ? ? A ASN 217 A NAG 706 1_555 ? ? ? ? ? ? ? 1.444 ? 
metalc3 metalc ?   ? A LEU 361 O   ? ? ? 1_555 J NA  .   NA ? ? A LEU 434 A NA  707 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc4 metalc ?   ? A ASP 364 OD1 ? ? ? 1_555 J NA  .   NA ? ? A ASP 437 A NA  707 1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc5 metalc ?   ? A SER 365 OG  ? ? ? 1_555 J NA  .   NA ? ? A SER 438 A NA  707 1_555 ? ? ? ? ? ? ? 2.628 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 176 A . ? GLY 249 A GLY 177 A ? GLY 250 A 1 1.26  
2 ARG 102 B . ? ARG 121 B PRO 103 B ? PRO 122 B 1 -3.93 
3 PHE 152 B . ? PHE 171 B PRO 153 B ? PRO 172 B 1 -3.20 
4 SER 164 B . ? SER 183 B LEU 165 B ? LEU 184 B 1 -0.14 
5 TRP 194 B . ? TRP 213 B PRO 195 B ? PRO 214 B 1 -1.48 
6 ILE 94  C . ? ILE 114 C PRO 95  C ? PRO 115 C 1 0.48  
7 TYR 140 C . ? TYR 160 C PRO 141 C ? PRO 161 C 1 2.33  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 6 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 3 ? 
AA6 ? 6 ? 
AA7 ? 3 ? 
AA8 ? 4 ? 
AA9 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA6 5 6 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN B 3   ? GLN B 6   ? GLN B 22  GLN B 25  
AA1 2 VAL B 18  ? SER B 25  ? VAL B 37  SER B 44  
AA1 3 THR B 78  ? LEU B 83  ? THR B 97  LEU B 102 
AA1 4 ALA B 68  ? ASP B 73  ? ALA B 87  ASP B 92  
AA2 1 GLU B 10  ? VAL B 12  ? GLU B 29  VAL B 31  
AA2 2 THR B 113 ? VAL B 117 ? THR B 132 VAL B 136 
AA2 3 VAL B 93  ? SER B 99  ? VAL B 112 SER B 118 
AA2 4 TYR B 33  ? GLN B 39  ? TYR B 52  GLN B 58  
AA2 5 LEU B 45  ? ILE B 51  ? LEU B 64  ILE B 70  
AA2 6 SER B 59  ? TYR B 60  ? SER B 78  TYR B 79  
AA3 1 GLU B 10  ? VAL B 12  ? GLU B 29  VAL B 31  
AA3 2 THR B 113 ? VAL B 117 ? THR B 132 VAL B 136 
AA3 3 VAL B 93  ? SER B 99  ? VAL B 112 SER B 118 
AA3 4 TYR B 108 ? TRP B 109 ? TYR B 127 TRP B 128 
AA4 1 SER B 126 ? LEU B 130 ? SER B 145 LEU B 149 
AA4 2 SER B 141 ? TYR B 151 ? SER B 160 TYR B 170 
AA4 3 LEU B 180 ? PRO B 190 ? LEU B 199 PRO B 209 
AA4 4 VAL B 169 ? GLN B 177 ? VAL B 188 GLN B 196 
AA5 1 THR B 157 ? TRP B 160 ? THR B 176 TRP B 179 
AA5 2 THR B 200 ? HIS B 205 ? THR B 219 HIS B 224 
AA5 3 THR B 210 ? LYS B 215 ? THR B 229 LYS B 234 
AA6 1 PHE C 10  ? SER C 14  ? PHE C 30  SER C 34  
AA6 2 THR C 102 ? LYS C 107 ? THR C 122 LYS C 127 
AA6 3 VAL C 85  ? GLN C 90  ? VAL C 105 GLN C 110 
AA6 4 VAL C 33  ? GLN C 38  ? VAL C 53  GLN C 58  
AA6 5 LYS C 45  ? TYR C 49  ? LYS C 65  TYR C 69  
AA6 6 TYR C 53  ? ARG C 54  ? TYR C 73  ARG C 74  
AA7 1 VAL C 19  ? LYS C 24  ? VAL C 39  LYS C 44  
AA7 2 ASP C 70  ? ILE C 75  ? ASP C 90  ILE C 95  
AA7 3 PHE C 62  ? GLY C 66  ? PHE C 82  GLY C 86  
AA8 1 THR C 114 ? PHE C 118 ? THR C 134 PHE C 138 
AA8 2 GLY C 129 ? PHE C 139 ? GLY C 149 PHE C 159 
AA8 3 TYR C 173 ? THR C 182 ? TYR C 193 THR C 202 
AA8 4 VAL C 159 ? TRP C 163 ? VAL C 179 TRP C 183 
AA9 1 GLU C 154 ? ARG C 155 ? GLU C 174 ARG C 175 
AA9 2 ASN C 145 ? LYS C 149 ? ASN C 165 LYS C 169 
AA9 3 SER C 191 ? THR C 197 ? SER C 211 THR C 217 
AA9 4 ILE C 205 ? ASN C 210 ? ILE C 225 ASN C 230 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLN B 5   ? N GLN B 24  O LYS B 23  ? O LYS B 42  
AA1 2 3 N VAL B 18  ? N VAL B 37  O LEU B 83  ? O LEU B 102 
AA1 3 4 O TYR B 80  ? O TYR B 99  N THR B 71  ? N THR B 90  
AA2 1 2 N GLU B 10  ? N GLU B 29  O THR B 116 ? O THR B 135 
AA2 2 3 O THR B 113 ? O THR B 132 N TYR B 94  ? N TYR B 113 
AA2 3 4 O TYR B 95  ? O TYR B 114 N VAL B 37  ? N VAL B 56  
AA2 4 5 N LYS B 38  ? N LYS B 57  O GLU B 46  ? O GLU B 65  
AA2 5 6 N ASN B 50  ? N ASN B 69  O SER B 59  ? O SER B 78  
AA3 1 2 N GLU B 10  ? N GLU B 29  O THR B 116 ? O THR B 135 
AA3 2 3 O THR B 113 ? O THR B 132 N TYR B 94  ? N TYR B 113 
AA3 3 4 N ARG B 98  ? N ARG B 117 O TYR B 108 ? O TYR B 127 
AA4 1 2 N TYR B 128 ? N TYR B 147 O LEU B 147 ? O LEU B 166 
AA4 2 3 N TYR B 151 ? N TYR B 170 O TYR B 181 ? O TYR B 200 
AA4 3 4 O LEU B 180 ? O LEU B 199 N GLN B 177 ? N GLN B 196 
AA5 1 2 N THR B 159 ? N THR B 178 O SER B 202 ? O SER B 221 
AA5 2 3 N CYS B 201 ? N CYS B 220 O LYS B 214 ? O LYS B 233 
AA6 1 2 N THR C 13  ? N THR C 33  O LYS C 107 ? O LYS C 127 
AA6 2 3 O THR C 102 ? O THR C 122 N TYR C 86  ? N TYR C 106 
AA6 3 4 O TYR C 87  ? O TYR C 107 N TYR C 36  ? N TYR C 56  
AA6 4 5 N GLN C 37  ? N GLN C 57  O LYS C 45  ? O LYS C 65  
AA6 5 6 N TYR C 49  ? N TYR C 69  O TYR C 53  ? O TYR C 73  
AA7 1 2 N VAL C 19  ? N VAL C 39  O ILE C 75  ? O ILE C 95  
AA7 2 3 O THR C 74  ? O THR C 94  N THR C 63  ? N THR C 83  
AA8 1 2 N SER C 116 ? N SER C 136 O PHE C 135 ? O PHE C 155 
AA8 2 3 N CYS C 134 ? N CYS C 154 O SER C 177 ? O SER C 197 
AA8 3 4 O THR C 178 ? O THR C 198 N LEU C 160 ? N LEU C 180 
AA9 1 2 O ARG C 155 ? O ARG C 175 N TRP C 148 ? N TRP C 168 
AA9 2 3 N LYS C 147 ? N LYS C 167 O GLU C 195 ? O GLU C 215 
AA9 3 4 N CYS C 194 ? N CYS C 214 O LYS C 207 ? O LYS C 227 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 68P 701 ? 13 'binding site for residue 68P A 701'                            
AC2 Software A CLR 703 ? 7  'binding site for residue CLR A 703'                            
AC3 Software A C14 704 ? 4  'binding site for residue C14 A 704'                            
AC4 Software A 69D 705 ? 8  'binding site for residue 69D A 705'                            
AC5 Software A NA  707 ? 5  'binding site for residue NA A 707'                             
AC6 Software A NAG 702 ? 4  'binding site for Mono-Saccharide NAG A 702 bound to ASN A 208' 
AC7 Software A NAG 706 ? 2  'binding site for Mono-Saccharide NAG A 706 bound to ASN A 217' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 TYR A 22  ? TYR A 95  . ? 1_555 ? 
2  AC1 13 ALA A 23  ? ALA A 96  . ? 1_555 ? 
3  AC1 13 ASP A 25  ? ASP A 98  . ? 1_555 ? 
4  AC1 13 ILE A 99  ? ILE A 172 . ? 1_555 ? 
5  AC1 13 ALA A 100 ? ALA A 173 . ? 1_555 ? 
6  AC1 13 PHE A 262 ? PHE A 335 . ? 1_555 ? 
7  AC1 13 SER A 263 ? SER A 336 . ? 1_555 ? 
8  AC1 13 GLY A 265 ? GLY A 338 . ? 1_555 ? 
9  AC1 13 PHE A 268 ? PHE A 341 . ? 1_555 ? 
10 AC1 13 GLY A 369 ? GLY A 442 . ? 1_555 ? 
11 AC1 13 THR A 424 ? THR A 497 . ? 1_555 ? 
12 AC1 13 GLY A 425 ? GLY A 498 . ? 1_555 ? 
13 AC1 13 VAL A 428 ? VAL A 501 . ? 1_555 ? 
14 AC2 7  LEU A 433 ? LEU A 506 . ? 4_575 ? 
15 AC2 7  ILE A 434 ? ILE A 507 . ? 4_575 ? 
16 AC2 7  TRP A 441 ? TRP A 514 . ? 4_575 ? 
17 AC2 7  LEU A 477 ? LEU A 550 . ? 4_575 ? 
18 AC2 7  TRP A 500 ? TRP A 573 . ? 1_555 ? 
19 AC2 7  LEU A 504 ? LEU A 577 . ? 1_555 ? 
20 AC2 7  ALA A 507 ? ALA A 580 . ? 1_555 ? 
21 AC3 4  TYR A 506 ? TYR A 579 . ? 1_555 ? 
22 AC3 4  TYR A 506 ? TYR A 579 . ? 4_575 ? 
23 AC3 4  PHE A 513 ? PHE A 586 . ? 4_575 ? 
24 AC3 4  PHE A 513 ? PHE A 586 . ? 1_555 ? 
25 AC4 8  GLN A 259 ? GLN A 332 . ? 1_555 ? 
26 AC4 8  PHE A 262 ? PHE A 335 . ? 1_555 ? 
27 AC4 8  GLU A 420 ? GLU A 493 . ? 1_555 ? 
28 AC4 8  GLU A 421 ? GLU A 494 . ? 1_555 ? 
29 AC4 8  GLY A 425 ? GLY A 498 . ? 1_555 ? 
30 AC4 8  PRO A 426 ? PRO A 499 . ? 1_555 ? 
31 AC4 8  LEU A 429 ? LEU A 502 . ? 1_555 ? 
32 AC4 8  PHE A 483 ? PHE A 556 . ? 1_555 ? 
33 AC5 5  GLY A 21  ? GLY A 94  . ? 1_555 ? 
34 AC5 5  VAL A 24  ? VAL A 97  . ? 1_555 ? 
35 AC5 5  LEU A 361 ? LEU A 434 . ? 1_555 ? 
36 AC5 5  ASP A 364 ? ASP A 437 . ? 1_555 ? 
37 AC5 5  SER A 365 ? SER A 438 . ? 1_555 ? 
38 AC6 4  ASN A 135 ? ASN A 208 . ? 1_555 ? 
39 AC6 4  HIS A 150 ? HIS A 223 . ? 1_555 ? 
40 AC6 4  GLU B 1   ? GLU B 20  . ? 1_555 ? 
41 AC6 4  GLY B 26  ? GLY B 45  . ? 1_555 ? 
42 AC7 2  ASN A 144 ? ASN A 217 . ? 1_555 ? 
43 AC7 2  THR A 146 ? THR A 219 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5I75 
_atom_sites.fract_transf_matrix[1][1]   0.007716 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006120 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007119 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
F  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 4   ? 134.286 192.460 -8.530  1.00 237.93 ? 77  GLY A N   1 
ATOM   2    C  CA  . GLY A 1 4   ? 134.595 192.581 -9.943  1.00 233.90 ? 77  GLY A CA  1 
ATOM   3    C  C   . GLY A 1 4   ? 136.080 192.512 -10.245 1.00 225.73 ? 77  GLY A C   1 
ATOM   4    O  O   . GLY A 1 4   ? 136.556 191.558 -10.859 1.00 231.64 ? 77  GLY A O   1 
ATOM   5    N  N   . GLU A 1 5   ? 136.814 193.530 -9.807  1.00 218.56 ? 78  GLU A N   1 
ATOM   6    C  CA  . GLU A 1 5   ? 138.220 193.692 -10.139 1.00 204.60 ? 78  GLU A CA  1 
ATOM   7    C  C   . GLU A 1 5   ? 139.041 193.801 -8.861  1.00 222.98 ? 78  GLU A C   1 
ATOM   8    O  O   . GLU A 1 5   ? 138.522 194.124 -7.789  1.00 235.31 ? 78  GLU A O   1 
ATOM   9    C  CB  . GLU A 1 5   ? 138.448 194.929 -11.022 1.00 200.56 ? 78  GLU A CB  1 
ATOM   10   C  CG  . GLU A 1 5   ? 137.839 196.212 -10.476 1.00 206.46 ? 78  GLU A CG  1 
ATOM   11   C  CD  . GLU A 1 5   ? 137.921 197.363 -11.461 1.00 211.65 ? 78  GLU A CD  1 
ATOM   12   O  OE1 . GLU A 1 5   ? 138.502 197.178 -12.552 1.00 217.53 ? 78  GLU A OE1 1 
ATOM   13   O  OE2 . GLU A 1 5   ? 137.406 198.456 -11.144 1.00 207.68 ? 78  GLU A OE2 1 
ATOM   14   N  N   . ARG A 1 6   ? 140.336 193.522 -8.987  1.00 207.45 ? 79  ARG A N   1 
ATOM   15   C  CA  . ARG A 1 6   ? 141.244 193.589 -7.855  1.00 203.42 ? 79  ARG A CA  1 
ATOM   16   C  C   . ARG A 1 6   ? 141.884 194.974 -7.778  1.00 219.24 ? 79  ARG A C   1 
ATOM   17   O  O   . ARG A 1 6   ? 141.694 195.827 -8.649  1.00 224.97 ? 79  ARG A O   1 
ATOM   18   C  CB  . ARG A 1 6   ? 142.305 192.493 -7.957  1.00 173.13 ? 79  ARG A CB  1 
ATOM   19   N  N   . GLU A 1 7   ? 142.662 195.198 -6.722  1.00 230.18 ? 80  GLU A N   1 
ATOM   20   C  CA  . GLU A 1 7   ? 143.296 196.488 -6.503  1.00 231.92 ? 80  GLU A CA  1 
ATOM   21   C  C   . GLU A 1 7   ? 144.563 196.610 -7.348  1.00 208.00 ? 80  GLU A C   1 
ATOM   22   O  O   . GLU A 1 7   ? 144.967 195.683 -8.055  1.00 202.48 ? 80  GLU A O   1 
ATOM   23   C  CB  . GLU A 1 7   ? 143.603 196.681 -5.019  1.00 243.47 ? 80  GLU A CB  1 
ATOM   24   C  CG  . GLU A 1 7   ? 142.371 196.892 -4.149  1.00 254.97 ? 80  GLU A CG  1 
ATOM   25   C  CD  . GLU A 1 7   ? 141.657 198.199 -4.445  1.00 265.08 ? 80  GLU A CD  1 
ATOM   26   O  OE1 . GLU A 1 7   ? 140.429 198.270 -4.229  1.00 266.45 ? 80  GLU A OE1 1 
ATOM   27   O  OE2 . GLU A 1 7   ? 142.325 199.158 -4.889  1.00 270.90 ? 80  GLU A OE2 1 
ATOM   28   N  N   . THR A 1 8   ? 145.197 197.777 -7.278  1.00 188.90 ? 81  THR A N   1 
ATOM   29   C  CA  . THR A 1 8   ? 146.414 198.047 -8.028  1.00 180.42 ? 81  THR A CA  1 
ATOM   30   C  C   . THR A 1 8   ? 147.392 198.759 -7.100  1.00 192.38 ? 81  THR A C   1 
ATOM   31   O  O   . THR A 1 8   ? 147.200 198.806 -5.881  1.00 170.65 ? 81  THR A O   1 
ATOM   32   C  CB  . THR A 1 8   ? 146.107 198.871 -9.287  1.00 175.94 ? 81  THR A CB  1 
ATOM   33   O  OG1 . THR A 1 8   ? 147.327 199.180 -9.972  1.00 192.64 ? 81  THR A OG1 1 
ATOM   34   C  CG2 . THR A 1 8   ? 145.408 200.171 -8.912  1.00 165.59 ? 81  THR A CG2 1 
ATOM   35   N  N   . TRP A 1 9   ? 148.454 199.308 -7.679  1.00 187.81 ? 82  TRP A N   1 
ATOM   36   C  CA  . TRP A 1 9   ? 149.467 200.022 -6.919  1.00 176.95 ? 82  TRP A CA  1 
ATOM   37   C  C   . TRP A 1 9   ? 149.104 201.496 -6.782  1.00 180.10 ? 82  TRP A C   1 
ATOM   38   O  O   . TRP A 1 9   ? 148.432 202.074 -7.641  1.00 197.84 ? 82  TRP A O   1 
ATOM   39   C  CB  . TRP A 1 9   ? 150.839 199.884 -7.582  1.00 157.05 ? 82  TRP A CB  1 
ATOM   40   N  N   . GLY A 1 10  ? 149.562 202.102 -5.684  1.00 178.33 ? 83  GLY A N   1 
ATOM   41   C  CA  . GLY A 1 10  ? 149.339 203.522 -5.481  1.00 173.19 ? 83  GLY A CA  1 
ATOM   42   C  C   . GLY A 1 10  ? 150.309 204.370 -6.271  1.00 184.72 ? 83  GLY A C   1 
ATOM   43   O  O   . GLY A 1 10  ? 150.004 205.519 -6.606  1.00 195.55 ? 83  GLY A O   1 
ATOM   44   N  N   . LYS A 1 11  ? 151.487 203.826 -6.560  1.00 165.24 ? 84  LYS A N   1 
ATOM   45   C  CA  . LYS A 1 11  ? 152.522 204.498 -7.329  1.00 174.79 ? 84  LYS A CA  1 
ATOM   46   C  C   . LYS A 1 11  ? 153.517 203.442 -7.784  1.00 189.09 ? 84  LYS A C   1 
ATOM   47   O  O   . LYS A 1 11  ? 153.743 202.446 -7.092  1.00 215.89 ? 84  LYS A O   1 
ATOM   48   C  CB  . LYS A 1 11  ? 153.219 205.599 -6.517  1.00 167.66 ? 84  LYS A CB  1 
ATOM   49   C  CG  . LYS A 1 11  ? 154.376 206.281 -7.242  1.00 167.98 ? 84  LYS A CG  1 
ATOM   50   C  CD  . LYS A 1 11  ? 154.597 207.704 -6.757  1.00 171.87 ? 84  LYS A CD  1 
ATOM   51   C  CE  . LYS A 1 11  ? 153.448 208.613 -7.166  1.00 208.39 ? 84  LYS A CE  1 
ATOM   52   N  NZ  . LYS A 1 11  ? 153.708 210.033 -6.802  1.00 217.24 ? 84  LYS A NZ  1 
ATOM   53   N  N   . LYS A 1 12  ? 154.084 203.660 -8.973  1.00 181.95 ? 85  LYS A N   1 
ATOM   54   C  CA  . LYS A 1 12  ? 155.106 202.761 -9.501  1.00 200.28 ? 85  LYS A CA  1 
ATOM   55   C  C   . LYS A 1 12  ? 156.251 202.561 -8.515  1.00 207.74 ? 85  LYS A C   1 
ATOM   56   O  O   . LYS A 1 12  ? 156.723 201.436 -8.316  1.00 216.68 ? 85  LYS A O   1 
ATOM   57   C  CB  . LYS A 1 12  ? 155.633 203.280 -10.836 1.00 195.73 ? 85  LYS A CB  1 
ATOM   58   C  CG  . LYS A 1 12  ? 156.776 202.439 -11.350 1.00 187.60 ? 85  LYS A CG  1 
ATOM   59   C  CD  . LYS A 1 12  ? 156.278 201.134 -11.920 1.00 170.91 ? 85  LYS A CD  1 
ATOM   60   C  CE  . LYS A 1 12  ? 157.405 200.389 -12.586 1.00 164.96 ? 85  LYS A CE  1 
ATOM   61   N  NZ  . LYS A 1 12  ? 156.908 199.163 -13.236 1.00 161.39 ? 85  LYS A NZ  1 
ATOM   62   N  N   . VAL A 1 13  ? 156.709 203.646 -7.889  1.00 191.28 ? 86  VAL A N   1 
ATOM   63   C  CA  . VAL A 1 13  ? 157.850 203.583 -6.982  1.00 163.82 ? 86  VAL A CA  1 
ATOM   64   C  C   . VAL A 1 13  ? 157.543 202.714 -5.769  1.00 163.75 ? 86  VAL A C   1 
ATOM   65   O  O   . VAL A 1 13  ? 158.451 202.100 -5.196  1.00 150.70 ? 86  VAL A O   1 
ATOM   66   C  CB  . VAL A 1 13  ? 158.271 205.007 -6.567  1.00 183.59 ? 86  VAL A CB  1 
ATOM   67   C  CG1 . VAL A 1 13  ? 159.572 204.977 -5.779  1.00 157.29 ? 86  VAL A CG1 1 
ATOM   68   C  CG2 . VAL A 1 13  ? 158.396 205.899 -7.792  1.00 194.95 ? 86  VAL A CG2 1 
ATOM   69   N  N   . ASP A 1 14  ? 156.278 202.651 -5.345  1.00 208.10 ? 87  ASP A N   1 
ATOM   70   C  CA  . ASP A 1 14  ? 155.938 201.871 -4.156  1.00 217.11 ? 87  ASP A CA  1 
ATOM   71   C  C   . ASP A 1 14  ? 156.272 200.396 -4.352  1.00 213.92 ? 87  ASP A C   1 
ATOM   72   O  O   . ASP A 1 14  ? 156.965 199.791 -3.525  1.00 224.76 ? 87  ASP A O   1 
ATOM   73   C  CB  . ASP A 1 14  ? 154.454 202.041 -3.829  1.00 221.65 ? 87  ASP A CB  1 
ATOM   74   C  CG  . ASP A 1 14  ? 154.123 203.427 -3.320  1.00 237.46 ? 87  ASP A CG  1 
ATOM   75   O  OD1 . ASP A 1 14  ? 154.840 204.384 -3.679  1.00 246.76 ? 87  ASP A OD1 1 
ATOM   76   O  OD2 . ASP A 1 14  ? 153.134 203.561 -2.570  1.00 238.08 ? 87  ASP A OD2 1 
ATOM   77   N  N   . PHE A 1 15  ? 155.797 199.797 -5.445  1.00 199.79 ? 88  PHE A N   1 
ATOM   78   C  CA  . PHE A 1 15  ? 156.120 198.396 -5.696  1.00 185.45 ? 88  PHE A CA  1 
ATOM   79   C  C   . PHE A 1 15  ? 157.532 198.233 -6.236  1.00 173.79 ? 88  PHE A C   1 
ATOM   80   O  O   . PHE A 1 15  ? 158.174 197.208 -5.973  1.00 197.31 ? 88  PHE A O   1 
ATOM   81   C  CB  . PHE A 1 15  ? 155.106 197.759 -6.644  1.00 181.33 ? 88  PHE A CB  1 
ATOM   82   C  CG  . PHE A 1 15  ? 153.885 197.240 -5.948  1.00 184.31 ? 88  PHE A CG  1 
ATOM   83   C  CD1 . PHE A 1 15  ? 153.815 197.237 -4.563  1.00 190.12 ? 88  PHE A CD1 1 
ATOM   84   C  CD2 . PHE A 1 15  ? 152.825 196.724 -6.667  1.00 178.07 ? 88  PHE A CD2 1 
ATOM   85   C  CE1 . PHE A 1 15  ? 152.702 196.750 -3.912  1.00 177.62 ? 88  PHE A CE1 1 
ATOM   86   C  CE2 . PHE A 1 15  ? 151.711 196.234 -6.019  1.00 174.89 ? 88  PHE A CE2 1 
ATOM   87   C  CZ  . PHE A 1 15  ? 151.650 196.247 -4.643  1.00 171.13 ? 88  PHE A CZ  1 
ATOM   88   N  N   . LEU A 1 16  ? 158.033 199.233 -6.967  1.00 145.50 ? 89  LEU A N   1 
ATOM   89   C  CA  . LEU A 1 16  ? 159.411 199.181 -7.442  1.00 162.03 ? 89  LEU A CA  1 
ATOM   90   C  C   . LEU A 1 16  ? 160.382 199.093 -6.275  1.00 172.65 ? 89  LEU A C   1 
ATOM   91   O  O   . LEU A 1 16  ? 161.445 198.474 -6.394  1.00 172.75 ? 89  LEU A O   1 
ATOM   92   C  CB  . LEU A 1 16  ? 159.711 200.410 -8.299  1.00 145.13 ? 89  LEU A CB  1 
ATOM   93   C  CG  . LEU A 1 16  ? 161.081 200.472 -8.973  1.00 156.35 ? 89  LEU A CG  1 
ATOM   94   C  CD1 . LEU A 1 16  ? 161.282 199.276 -9.890  1.00 163.64 ? 89  LEU A CD1 1 
ATOM   95   C  CD2 . LEU A 1 16  ? 161.233 201.775 -9.740  1.00 156.44 ? 89  LEU A CD2 1 
ATOM   96   N  N   . LEU A 1 17  ? 160.026 199.685 -5.137  1.00 167.89 ? 90  LEU A N   1 
ATOM   97   C  CA  . LEU A 1 17  ? 160.833 199.583 -3.932  1.00 162.85 ? 90  LEU A CA  1 
ATOM   98   C  C   . LEU A 1 17  ? 160.388 198.428 -3.055  1.00 138.86 ? 90  LEU A C   1 
ATOM   99   O  O   . LEU A 1 17  ? 161.150 197.997 -2.183  1.00 150.69 ? 90  LEU A O   1 
ATOM   100  C  CB  . LEU A 1 17  ? 160.774 200.884 -3.125  1.00 144.66 ? 90  LEU A CB  1 
ATOM   101  C  CG  . LEU A 1 17  ? 161.901 201.895 -3.344  1.00 153.83 ? 90  LEU A CG  1 
ATOM   102  C  CD1 . LEU A 1 17  ? 161.953 202.366 -4.792  1.00 169.14 ? 90  LEU A CD1 1 
ATOM   103  C  CD2 . LEU A 1 17  ? 161.750 203.073 -2.393  1.00 149.39 ? 90  LEU A CD2 1 
ATOM   104  N  N   . SER A 1 18  ? 159.170 197.927 -3.267  1.00 155.47 ? 91  SER A N   1 
ATOM   105  C  CA  . SER A 1 18  ? 158.674 196.807 -2.479  1.00 171.05 ? 91  SER A CA  1 
ATOM   106  C  C   . SER A 1 18  ? 159.388 195.524 -2.880  1.00 168.00 ? 91  SER A C   1 
ATOM   107  O  O   . SER A 1 18  ? 159.824 194.743 -2.023  1.00 170.79 ? 91  SER A O   1 
ATOM   108  C  CB  . SER A 1 18  ? 157.162 196.674 -2.647  1.00 180.96 ? 91  SER A CB  1 
ATOM   109  O  OG  . SER A 1 18  ? 156.637 195.731 -1.733  1.00 186.86 ? 91  SER A OG  1 
ATOM   110  N  N   . VAL A 1 19  ? 159.521 195.293 -4.190  1.00 149.34 ? 92  VAL A N   1 
ATOM   111  C  CA  . VAL A 1 19  ? 160.207 194.096 -4.664  1.00 156.69 ? 92  VAL A CA  1 
ATOM   112  C  C   . VAL A 1 19  ? 161.683 194.156 -4.283  1.00 162.90 ? 92  VAL A C   1 
ATOM   113  O  O   . VAL A 1 19  ? 162.285 193.139 -3.916  1.00 167.79 ? 92  VAL A O   1 
ATOM   114  C  CB  . VAL A 1 19  ? 160.001 193.926 -6.182  1.00 129.04 ? 92  VAL A CB  1 
ATOM   115  C  CG1 . VAL A 1 19  ? 160.439 195.176 -6.938  1.00 131.46 ? 92  VAL A CG1 1 
ATOM   116  C  CG2 . VAL A 1 19  ? 160.735 192.700 -6.691  1.00 125.67 ? 92  VAL A CG2 1 
ATOM   117  N  N   . ILE A 1 20  ? 162.284 195.348 -4.347  1.00 164.28 ? 93  ILE A N   1 
ATOM   118  C  CA  . ILE A 1 20  ? 163.684 195.508 -3.962  1.00 150.33 ? 93  ILE A CA  1 
ATOM   119  C  C   . ILE A 1 20  ? 163.845 195.247 -2.471  1.00 127.63 ? 93  ILE A C   1 
ATOM   120  O  O   . ILE A 1 20  ? 164.783 194.568 -2.036  1.00 150.11 ? 93  ILE A O   1 
ATOM   121  C  CB  . ILE A 1 20  ? 164.190 196.914 -4.336  1.00 131.30 ? 93  ILE A CB  1 
ATOM   122  C  CG1 . ILE A 1 20  ? 164.272 197.080 -5.849  1.00 149.51 ? 93  ILE A CG1 1 
ATOM   123  C  CG2 . ILE A 1 20  ? 165.552 197.180 -3.712  1.00 130.61 ? 93  ILE A CG2 1 
ATOM   124  C  CD1 . ILE A 1 20  ? 164.760 198.445 -6.279  1.00 135.59 ? 93  ILE A CD1 1 
ATOM   125  N  N   . GLY A 1 21  ? 162.927 195.785 -1.670  1.00 134.58 ? 94  GLY A N   1 
ATOM   126  C  CA  . GLY A 1 21  ? 162.955 195.547 -0.239  1.00 145.62 ? 94  GLY A CA  1 
ATOM   127  C  C   . GLY A 1 21  ? 162.829 194.080 0.122   1.00 142.98 ? 94  GLY A C   1 
ATOM   128  O  O   . GLY A 1 21  ? 163.494 193.601 1.042   1.00 136.53 ? 94  GLY A O   1 
ATOM   129  N  N   . TYR A 1 22  ? 161.975 193.344 -0.592  1.00 125.27 ? 95  TYR A N   1 
ATOM   130  C  CA  . TYR A 1 22  ? 161.943 191.899 -0.389  1.00 122.20 ? 95  TYR A CA  1 
ATOM   131  C  C   . TYR A 1 22  ? 163.247 191.234 -0.819  1.00 136.11 ? 95  TYR A C   1 
ATOM   132  O  O   . TYR A 1 22  ? 163.751 190.347 -0.121  1.00 137.90 ? 95  TYR A O   1 
ATOM   133  C  CB  . TYR A 1 22  ? 160.769 191.296 -1.159  1.00 122.20 ? 95  TYR A CB  1 
ATOM   134  C  CG  . TYR A 1 22  ? 160.972 189.876 -1.655  1.00 119.10 ? 95  TYR A CG  1 
ATOM   135  C  CD1 . TYR A 1 22  ? 160.604 188.789 -0.871  1.00 117.35 ? 95  TYR A CD1 1 
ATOM   136  C  CD2 . TYR A 1 22  ? 161.504 189.621 -2.915  1.00 118.09 ? 95  TYR A CD2 1 
ATOM   137  C  CE1 . TYR A 1 22  ? 160.775 187.491 -1.318  1.00 114.70 ? 95  TYR A CE1 1 
ATOM   138  C  CE2 . TYR A 1 22  ? 161.684 188.325 -3.366  1.00 140.16 ? 95  TYR A CE2 1 
ATOM   139  C  CZ  . TYR A 1 22  ? 161.317 187.264 -2.565  1.00 113.77 ? 95  TYR A CZ  1 
ATOM   140  O  OH  . TYR A 1 22  ? 161.491 185.974 -3.015  1.00 111.31 ? 95  TYR A OH  1 
ATOM   141  N  N   . ALA A 1 23  ? 163.815 191.650 -1.955  1.00 125.07 ? 96  ALA A N   1 
ATOM   142  C  CA  . ALA A 1 23  ? 165.045 191.022 -2.434  1.00 124.72 ? 96  ALA A CA  1 
ATOM   143  C  C   . ALA A 1 23  ? 166.231 191.280 -1.506  1.00 138.18 ? 96  ALA A C   1 
ATOM   144  O  O   . ALA A 1 23  ? 167.095 190.409 -1.344  1.00 142.63 ? 96  ALA A O   1 
ATOM   145  C  CB  . ALA A 1 23  ? 165.360 191.507 -3.848  1.00 136.10 ? 96  ALA A CB  1 
ATOM   146  N  N   . VAL A 1 24  ? 166.299 192.463 -0.898  1.00 144.57 ? 97  VAL A N   1 
ATOM   147  C  CA  . VAL A 1 24  ? 167.424 192.840 -0.046  1.00 148.22 ? 97  VAL A CA  1 
ATOM   148  C  C   . VAL A 1 24  ? 167.135 192.475 1.405   1.00 141.99 ? 97  VAL A C   1 
ATOM   149  O  O   . VAL A 1 24  ? 166.091 192.850 1.952   1.00 130.44 ? 97  VAL A O   1 
ATOM   150  C  CB  . VAL A 1 24  ? 167.728 194.341 -0.180  1.00 126.05 ? 97  VAL A CB  1 
ATOM   151  C  CG1 . VAL A 1 24  ? 168.686 194.788 0.911   1.00 123.04 ? 97  VAL A CG1 1 
ATOM   152  C  CG2 . VAL A 1 24  ? 168.311 194.640 -1.553  1.00 136.17 ? 97  VAL A CG2 1 
ATOM   153  N  N   . ASP A 1 25  ? 168.062 191.757 2.032   1.00 155.93 ? 98  ASP A N   1 
ATOM   154  C  CA  . ASP A 1 25  ? 167.863 191.295 3.404   1.00 151.79 ? 98  ASP A CA  1 
ATOM   155  C  C   . ASP A 1 25  ? 169.222 191.183 4.096   1.00 126.90 ? 98  ASP A C   1 
ATOM   156  O  O   . ASP A 1 25  ? 170.210 191.785 3.662   1.00 128.33 ? 98  ASP A O   1 
ATOM   157  C  CB  . ASP A 1 25  ? 167.062 189.978 3.426   1.00 153.63 ? 98  ASP A CB  1 
ATOM   158  C  CG  . ASP A 1 25  ? 167.799 188.813 2.773   1.00 156.01 ? 98  ASP A CG  1 
ATOM   159  O  OD1 . ASP A 1 25  ? 168.996 188.939 2.440   1.00 169.08 ? 98  ASP A OD1 1 
ATOM   160  O  OD2 . ASP A 1 25  ? 167.172 187.746 2.615   1.00 140.08 ? 98  ASP A OD2 1 
ATOM   161  N  N   . LEU A 1 26  ? 169.259 190.399 5.179   1.00 136.23 ? 99  LEU A N   1 
ATOM   162  C  CA  . LEU A 1 26  ? 170.484 190.163 5.944   1.00 140.38 ? 99  LEU A CA  1 
ATOM   163  C  C   . LEU A 1 26  ? 171.563 189.495 5.099   1.00 120.21 ? 99  LEU A C   1 
ATOM   164  O  O   . LEU A 1 26  ? 172.743 189.876 5.157   1.00 124.02 ? 99  LEU A O   1 
ATOM   165  C  CB  . LEU A 1 26  ? 170.167 189.318 7.174   1.00 149.55 ? 99  LEU A CB  1 
ATOM   166  C  CG  . LEU A 1 26  ? 169.221 190.014 8.150   1.00 167.87 ? 99  LEU A CG  1 
ATOM   167  C  CD1 . LEU A 1 26  ? 168.827 189.079 9.272   1.00 166.65 ? 99  LEU A CD1 1 
ATOM   168  C  CD2 . LEU A 1 26  ? 169.859 191.280 8.692   1.00 171.95 ? 99  LEU A CD2 1 
ATOM   169  N  N   . GLY A 1 27  ? 171.179 188.479 4.327   1.00 107.65 ? 100 GLY A N   1 
ATOM   170  C  CA  . GLY A 1 27  ? 172.166 187.704 3.598   1.00 105.55 ? 100 GLY A CA  1 
ATOM   171  C  C   . GLY A 1 27  ? 172.950 188.552 2.620   1.00 106.65 ? 100 GLY A C   1 
ATOM   172  O  O   . GLY A 1 27  ? 174.146 188.333 2.417   1.00 136.83 ? 100 GLY A O   1 
ATOM   173  N  N   . ASN A 1 28  ? 172.281 189.506 1.970   1.00 122.73 ? 101 ASN A N   1 
ATOM   174  C  CA  . ASN A 1 28  ? 173.008 190.459 1.143   1.00 130.30 ? 101 ASN A CA  1 
ATOM   175  C  C   . ASN A 1 28  ? 174.108 191.151 1.943   1.00 140.33 ? 101 ASN A C   1 
ATOM   176  O  O   . ASN A 1 28  ? 175.200 191.412 1.423   1.00 154.24 ? 101 ASN A O   1 
ATOM   177  C  CB  . ASN A 1 28  ? 172.028 191.502 0.603   1.00 129.60 ? 101 ASN A CB  1 
ATOM   178  C  CG  . ASN A 1 28  ? 171.355 191.068 -0.679  1.00 142.69 ? 101 ASN A CG  1 
ATOM   179  O  OD1 . ASN A 1 28  ? 170.294 190.443 -0.652  1.00 139.14 ? 101 ASN A OD1 1 
ATOM   180  N  ND2 . ASN A 1 28  ? 171.956 191.409 -1.811  1.00 160.40 ? 101 ASN A ND2 1 
ATOM   181  N  N   . VAL A 1 29  ? 173.838 191.447 3.218   1.00 136.28 ? 102 VAL A N   1 
ATOM   182  C  CA  . VAL A 1 29  ? 174.796 192.189 4.034   1.00 128.03 ? 102 VAL A CA  1 
ATOM   183  C  C   . VAL A 1 29  ? 175.982 191.326 4.444   1.00 122.36 ? 102 VAL A C   1 
ATOM   184  O  O   . VAL A 1 29  ? 177.133 191.770 4.379   1.00 131.89 ? 102 VAL A O   1 
ATOM   185  C  CB  . VAL A 1 29  ? 174.094 192.793 5.260   1.00 134.22 ? 102 VAL A CB  1 
ATOM   186  C  CG1 . VAL A 1 29  ? 174.999 193.805 5.944   1.00 126.06 ? 102 VAL A CG1 1 
ATOM   187  C  CG2 . VAL A 1 29  ? 172.816 193.446 4.821   1.00 157.34 ? 102 VAL A CG2 1 
ATOM   188  N  N   . TRP A 1 30  ? 175.732 190.090 4.886   1.00 108.21 ? 103 TRP A N   1 
ATOM   189  C  CA  . TRP A 1 30  ? 176.810 189.334 5.520   1.00 106.75 ? 103 TRP A CA  1 
ATOM   190  C  C   . TRP A 1 30  ? 177.162 188.022 4.835   1.00 131.90 ? 103 TRP A C   1 
ATOM   191  O  O   . TRP A 1 30  ? 178.325 187.615 4.880   1.00 152.68 ? 103 TRP A O   1 
ATOM   192  C  CB  . TRP A 1 30  ? 176.485 189.035 6.995   1.00 112.22 ? 103 TRP A CB  1 
ATOM   193  C  CG  . TRP A 1 30  ? 175.310 188.141 7.217   1.00 132.93 ? 103 TRP A CG  1 
ATOM   194  C  CD1 . TRP A 1 30  ? 174.025 188.516 7.464   1.00 151.22 ? 103 TRP A CD1 1 
ATOM   195  C  CD2 . TRP A 1 30  ? 175.328 186.708 7.264   1.00 115.50 ? 103 TRP A CD2 1 
ATOM   196  N  NE1 . TRP A 1 30  ? 173.233 187.404 7.636   1.00 154.57 ? 103 TRP A NE1 1 
ATOM   197  C  CE2 . TRP A 1 30  ? 174.011 186.283 7.521   1.00 120.19 ? 103 TRP A CE2 1 
ATOM   198  C  CE3 . TRP A 1 30  ? 176.328 185.746 7.104   1.00 111.48 ? 103 TRP A CE3 1 
ATOM   199  C  CZ2 . TRP A 1 30  ? 173.668 184.936 7.619   1.00 110.44 ? 103 TRP A CZ2 1 
ATOM   200  C  CZ3 . TRP A 1 30  ? 175.985 184.410 7.200   1.00 118.42 ? 103 TRP A CZ3 1 
ATOM   201  C  CH2 . TRP A 1 30  ? 174.667 184.018 7.456   1.00 119.67 ? 103 TRP A CH2 1 
ATOM   202  N  N   . ARG A 1 31  ? 176.196 187.353 4.206   1.00 123.80 ? 104 ARG A N   1 
ATOM   203  C  CA  . ARG A 1 31  ? 176.480 186.114 3.487   1.00 131.29 ? 104 ARG A CA  1 
ATOM   204  C  C   . ARG A 1 31  ? 177.338 186.346 2.249   1.00 126.85 ? 104 ARG A C   1 
ATOM   205  O  O   . ARG A 1 31  ? 178.293 185.598 2.007   1.00 124.83 ? 104 ARG A O   1 
ATOM   206  C  CB  . ARG A 1 31  ? 175.175 185.420 3.102   1.00 147.81 ? 104 ARG A CB  1 
ATOM   207  C  CG  . ARG A 1 31  ? 175.194 183.918 3.328   1.00 156.62 ? 104 ARG A CG  1 
ATOM   208  C  CD  . ARG A 1 31  ? 173.865 183.420 3.866   1.00 172.24 ? 104 ARG A CD  1 
ATOM   209  N  NE  . ARG A 1 31  ? 173.917 182.004 4.220   1.00 182.88 ? 104 ARG A NE  1 
ATOM   210  C  CZ  . ARG A 1 31  ? 172.925 181.345 4.811   1.00 195.93 ? 104 ARG A CZ  1 
ATOM   211  N  NH1 . ARG A 1 31  ? 173.063 180.059 5.103   1.00 200.52 ? 104 ARG A NH1 1 
ATOM   212  N  NH2 . ARG A 1 31  ? 171.797 181.973 5.111   1.00 198.07 ? 104 ARG A NH2 1 
ATOM   213  N  N   . PHE A 1 32  ? 177.039 187.376 1.469   1.00 122.60 ? 105 PHE A N   1 
ATOM   214  C  CA  . PHE A 1 32  ? 177.842 187.651 0.283   1.00 119.17 ? 105 PHE A CA  1 
ATOM   215  C  C   . PHE A 1 32  ? 179.286 188.055 0.581   1.00 119.29 ? 105 PHE A C   1 
ATOM   216  O  O   . PHE A 1 32  ? 180.191 187.589 -0.125  1.00 112.46 ? 105 PHE A O   1 
ATOM   217  C  CB  . PHE A 1 32  ? 177.163 188.736 -0.561  1.00 105.34 ? 105 PHE A CB  1 
ATOM   218  C  CG  . PHE A 1 32  ? 177.979 189.188 -1.738  1.00 109.75 ? 105 PHE A CG  1 
ATOM   219  C  CD1 . PHE A 1 32  ? 178.098 188.390 -2.863  1.00 121.65 ? 105 PHE A CD1 1 
ATOM   220  C  CD2 . PHE A 1 32  ? 178.616 190.419 -1.724  1.00 115.82 ? 105 PHE A CD2 1 
ATOM   221  C  CE1 . PHE A 1 32  ? 178.848 188.804 -3.948  1.00 125.81 ? 105 PHE A CE1 1 
ATOM   222  C  CE2 . PHE A 1 32  ? 179.365 190.840 -2.806  1.00 126.16 ? 105 PHE A CE2 1 
ATOM   223  C  CZ  . PHE A 1 32  ? 179.481 190.032 -3.920  1.00 129.44 ? 105 PHE A CZ  1 
ATOM   224  N  N   . PRO A 1 33  ? 179.570 188.902 1.580   1.00 114.27 ? 106 PRO A N   1 
ATOM   225  C  CA  . PRO A 1 33  ? 180.985 189.222 1.837   1.00 104.94 ? 106 PRO A CA  1 
ATOM   226  C  C   . PRO A 1 33  ? 181.830 188.023 2.235   1.00 118.31 ? 106 PRO A C   1 
ATOM   227  O  O   . PRO A 1 33  ? 182.963 187.893 1.753   1.00 121.67 ? 106 PRO A O   1 
ATOM   228  C  CB  . PRO A 1 33  ? 180.903 190.251 2.973   1.00 106.80 ? 106 PRO A CB  1 
ATOM   229  C  CG  . PRO A 1 33  ? 179.583 190.873 2.810   1.00 108.33 ? 106 PRO A CG  1 
ATOM   230  C  CD  . PRO A 1 33  ? 178.672 189.779 2.353   1.00 111.43 ? 106 PRO A CD  1 
ATOM   231  N  N   . TYR A 1 34  ? 181.320 187.141 3.100   1.00 106.08 ? 107 TYR A N   1 
ATOM   232  C  CA  . TYR A 1 34  ? 182.107 185.979 3.512   1.00 109.28 ? 107 TYR A CA  1 
ATOM   233  C  C   . TYR A 1 34  ? 182.356 185.031 2.343   1.00 119.76 ? 107 TYR A C   1 
ATOM   234  O  O   . TYR A 1 34  ? 183.507 184.675 2.050   1.00 140.46 ? 107 TYR A O   1 
ATOM   235  C  CB  . TYR A 1 34  ? 181.421 185.248 4.666   1.00 126.99 ? 107 TYR A CB  1 
ATOM   236  C  CG  . TYR A 1 34  ? 182.140 183.978 5.071   1.00 150.23 ? 107 TYR A CG  1 
ATOM   237  C  CD1 . TYR A 1 34  ? 183.202 184.021 5.966   1.00 173.89 ? 107 TYR A CD1 1 
ATOM   238  C  CD2 . TYR A 1 34  ? 181.763 182.740 4.561   1.00 164.07 ? 107 TYR A CD2 1 
ATOM   239  C  CE1 . TYR A 1 34  ? 183.869 182.872 6.341   1.00 190.47 ? 107 TYR A CE1 1 
ATOM   240  C  CE2 . TYR A 1 34  ? 182.428 181.584 4.930   1.00 168.68 ? 107 TYR A CE2 1 
ATOM   241  C  CZ  . TYR A 1 34  ? 183.477 181.656 5.823   1.00 196.74 ? 107 TYR A CZ  1 
ATOM   242  O  OH  . TYR A 1 34  ? 184.142 180.511 6.199   1.00 211.06 ? 107 TYR A OH  1 
ATOM   243  N  N   . ILE A 1 35  ? 181.287 184.631 1.647   1.00 115.66 ? 108 ILE A N   1 
ATOM   244  C  CA  . ILE A 1 35  ? 181.425 183.676 0.555   1.00 105.18 ? 108 ILE A CA  1 
ATOM   245  C  C   . ILE A 1 35  ? 182.228 184.282 -0.578  1.00 124.03 ? 108 ILE A C   1 
ATOM   246  O  O   . ILE A 1 35  ? 182.849 183.554 -1.360  1.00 134.48 ? 108 ILE A O   1 
ATOM   247  C  CB  . ILE A 1 35  ? 180.046 183.202 0.052   1.00 107.41 ? 108 ILE A CB  1 
ATOM   248  C  CG1 . ILE A 1 35  ? 180.192 181.940 -0.798  1.00 109.53 ? 108 ILE A CG1 1 
ATOM   249  C  CG2 . ILE A 1 35  ? 179.350 184.297 -0.750  1.00 107.37 ? 108 ILE A CG2 1 
ATOM   250  C  CD1 . ILE A 1 35  ? 178.890 181.450 -1.388  1.00 127.39 ? 108 ILE A CD1 1 
ATOM   251  N  N   . CYS A 1 36  ? 182.254 185.610 -0.664  1.00 120.94 ? 109 CYS A N   1 
ATOM   252  C  CA  . CYS A 1 36  ? 183.041 186.273 -1.688  1.00 115.84 ? 109 CYS A CA  1 
ATOM   253  C  C   . CYS A 1 36  ? 184.506 186.307 -1.285  1.00 120.50 ? 109 CYS A C   1 
ATOM   254  O  O   . CYS A 1 36  ? 185.387 186.241 -2.148  1.00 120.74 ? 109 CYS A O   1 
ATOM   255  C  CB  . CYS A 1 36  ? 182.507 187.686 -1.920  1.00 102.66 ? 109 CYS A CB  1 
ATOM   256  S  SG  . CYS A 1 36  ? 183.461 188.658 -3.085  1.00 130.29 ? 109 CYS A SG  1 
ATOM   257  N  N   . ALA A 1 37  ? 184.774 186.397 0.020   1.00 122.14 ? 110 ALA A N   1 
ATOM   258  C  CA  . ALA A 1 37  ? 186.142 186.472 0.514   1.00 115.91 ? 110 ALA A CA  1 
ATOM   259  C  C   . ALA A 1 37  ? 186.825 185.113 0.465   1.00 113.79 ? 110 ALA A C   1 
ATOM   260  O  O   . ALA A 1 37  ? 188.019 185.029 0.157   1.00 119.90 ? 110 ALA A O   1 
ATOM   261  C  CB  . ALA A 1 37  ? 186.165 187.021 1.936   1.00 116.56 ? 110 ALA A CB  1 
ATOM   262  N  N   . GLN A 1 38  ? 186.095 184.041 0.774   1.00 98.42  ? 111 GLN A N   1 
ATOM   263  C  CA  . GLN A 1 38  ? 186.727 182.733 0.870   1.00 102.51 ? 111 GLN A CA  1 
ATOM   264  C  C   . GLN A 1 38  ? 186.690 181.960 -0.440  1.00 110.25 ? 111 GLN A C   1 
ATOM   265  O  O   . GLN A 1 38  ? 187.219 180.845 -0.496  1.00 132.44 ? 111 GLN A O   1 
ATOM   266  C  CB  . GLN A 1 38  ? 186.068 181.883 1.961   1.00 114.75 ? 111 GLN A CB  1 
ATOM   267  C  CG  . GLN A 1 38  ? 184.703 181.342 1.581   1.00 134.98 ? 111 GLN A CG  1 
ATOM   268  C  CD  . GLN A 1 38  ? 184.251 180.225 2.503   1.00 146.12 ? 111 GLN A CD  1 
ATOM   269  O  OE1 . GLN A 1 38  ? 184.912 179.919 3.494   1.00 141.78 ? 111 GLN A OE1 1 
ATOM   270  N  NE2 . GLN A 1 38  ? 183.124 179.602 2.174   1.00 148.13 ? 111 GLN A NE2 1 
ATOM   271  N  N   . ASN A 1 39  ? 186.081 182.514 -1.488  1.00 113.57 ? 112 ASN A N   1 
ATOM   272  C  CA  . ASN A 1 39  ? 185.998 181.822 -2.768  1.00 134.21 ? 112 ASN A CA  1 
ATOM   273  C  C   . ASN A 1 39  ? 186.585 182.674 -3.885  1.00 142.29 ? 112 ASN A C   1 
ATOM   274  O  O   . ASN A 1 39  ? 185.882 183.037 -4.833  1.00 150.60 ? 112 ASN A O   1 
ATOM   275  C  CB  . ASN A 1 39  ? 184.553 181.440 -3.092  1.00 140.96 ? 112 ASN A CB  1 
ATOM   276  C  CG  . ASN A 1 39  ? 184.042 180.305 -2.224  1.00 141.93 ? 112 ASN A CG  1 
ATOM   277  O  OD1 . ASN A 1 39  ? 184.817 179.462 -1.769  1.00 159.97 ? 112 ASN A OD1 1 
ATOM   278  N  ND2 . ASN A 1 39  ? 182.734 180.272 -1.999  1.00 109.30 ? 112 ASN A ND2 1 
ATOM   279  N  N   . GLY A 1 40  ? 187.873 182.996 -3.784  1.00 127.95 ? 113 GLY A N   1 
ATOM   280  C  CA  . GLY A 1 40  ? 188.571 183.720 -4.823  1.00 161.28 ? 113 GLY A CA  1 
ATOM   281  C  C   . GLY A 1 40  ? 188.719 185.205 -4.580  1.00 152.13 ? 113 GLY A C   1 
ATOM   282  O  O   . GLY A 1 40  ? 189.391 185.879 -5.372  1.00 137.35 ? 113 GLY A O   1 
ATOM   283  N  N   . GLY A 1 41  ? 188.110 185.735 -3.525  1.00 190.93 ? 114 GLY A N   1 
ATOM   284  C  CA  . GLY A 1 41  ? 188.189 187.167 -3.298  1.00 195.37 ? 114 GLY A CA  1 
ATOM   285  C  C   . GLY A 1 41  ? 187.451 187.910 -4.390  1.00 194.65 ? 114 GLY A C   1 
ATOM   286  O  O   . GLY A 1 41  ? 186.314 187.574 -4.743  1.00 200.33 ? 114 GLY A O   1 
ATOM   287  N  N   . GLY A 1 42  ? 188.117 188.916 -4.961  1.00 163.61 ? 115 GLY A N   1 
ATOM   288  C  CA  . GLY A 1 42  ? 187.515 189.662 -6.050  1.00 107.83 ? 115 GLY A CA  1 
ATOM   289  C  C   . GLY A 1 42  ? 187.160 188.798 -7.243  1.00 136.28 ? 115 GLY A C   1 
ATOM   290  O  O   . GLY A 1 42  ? 186.207 189.098 -7.967  1.00 142.79 ? 115 GLY A O   1 
ATOM   291  N  N   . ALA A 1 43  ? 187.900 187.705 -7.455  1.00 127.14 ? 116 ALA A N   1 
ATOM   292  C  CA  . ALA A 1 43  ? 187.597 186.817 -8.571  1.00 131.29 ? 116 ALA A CA  1 
ATOM   293  C  C   . ALA A 1 43  ? 186.250 186.122 -8.422  1.00 120.05 ? 116 ALA A C   1 
ATOM   294  O  O   . ALA A 1 43  ? 185.695 185.665 -9.433  1.00 108.24 ? 116 ALA A O   1 
ATOM   295  C  CB  . ALA A 1 43  ? 188.701 185.769 -8.721  1.00 126.71 ? 116 ALA A CB  1 
ATOM   296  N  N   . PHE A 1 44  ? 185.622 186.211 -7.248  1.00 120.69 ? 117 PHE A N   1 
ATOM   297  C  CA  . PHE A 1 44  ? 184.302 185.618 -7.110  1.00 129.22 ? 117 PHE A CA  1 
ATOM   298  C  C   . PHE A 1 44  ? 183.277 186.463 -7.831  1.00 134.37 ? 117 PHE A C   1 
ATOM   299  O  O   . PHE A 1 44  ? 182.153 186.007 -8.065  1.00 149.89 ? 117 PHE A O   1 
ATOM   300  C  CB  . PHE A 1 44  ? 183.943 185.461 -5.631  1.00 135.21 ? 117 PHE A CB  1 
ATOM   301  C  CG  . PHE A 1 44  ? 182.629 184.777 -5.395  1.00 131.37 ? 117 PHE A CG  1 
ATOM   302  C  CD1 . PHE A 1 44  ? 182.509 183.405 -5.548  1.00 119.46 ? 117 PHE A CD1 1 
ATOM   303  C  CD2 . PHE A 1 44  ? 181.516 185.504 -5.008  1.00 128.10 ? 117 PHE A CD2 1 
ATOM   304  C  CE1 . PHE A 1 44  ? 181.300 182.773 -5.331  1.00 121.45 ? 117 PHE A CE1 1 
ATOM   305  C  CE2 . PHE A 1 44  ? 180.305 184.879 -4.787  1.00 120.02 ? 117 PHE A CE2 1 
ATOM   306  C  CZ  . PHE A 1 44  ? 180.196 183.512 -4.948  1.00 121.17 ? 117 PHE A CZ  1 
ATOM   307  N  N   . LEU A 1 45  ? 183.661 187.685 -8.189  1.00 104.90 ? 118 LEU A N   1 
ATOM   308  C  CA  . LEU A 1 45  ? 182.774 188.570 -8.914  1.00 106.74 ? 118 LEU A CA  1 
ATOM   309  C  C   . LEU A 1 45  ? 182.508 188.008 -10.302 1.00 132.95 ? 118 LEU A C   1 
ATOM   310  O  O   . LEU A 1 45  ? 181.458 188.285 -10.894 1.00 138.03 ? 118 LEU A O   1 
ATOM   311  C  CB  . LEU A 1 45  ? 183.390 189.965 -8.998  1.00 109.28 ? 118 LEU A CB  1 
ATOM   312  C  CG  . LEU A 1 45  ? 183.452 190.722 -7.671  1.00 110.06 ? 118 LEU A CG  1 
ATOM   313  C  CD1 . LEU A 1 45  ? 184.060 192.097 -7.873  1.00 124.71 ? 118 LEU A CD1 1 
ATOM   314  C  CD2 . LEU A 1 45  ? 182.070 190.828 -7.048  1.00 110.04 ? 118 LEU A CD2 1 
ATOM   315  N  N   . LEU A 1 46  ? 183.443 187.195 -10.833 1.00 125.86 ? 119 LEU A N   1 
ATOM   316  C  CA  . LEU A 1 46  ? 183.251 186.687 -12.191 1.00 123.54 ? 119 LEU A CA  1 
ATOM   317  C  C   . LEU A 1 46  ? 182.153 185.632 -12.257 1.00 126.26 ? 119 LEU A C   1 
ATOM   318  O  O   . LEU A 1 46  ? 181.217 185.802 -13.059 1.00 104.44 ? 119 LEU A O   1 
ATOM   319  C  CB  . LEU A 1 46  ? 184.585 186.174 -12.747 1.00 122.91 ? 119 LEU A CB  1 
ATOM   320  C  CG  . LEU A 1 46  ? 184.635 185.643 -14.180 1.00 105.18 ? 119 LEU A CG  1 
ATOM   321  C  CD1 . LEU A 1 46  ? 185.889 186.145 -14.873 1.00 106.68 ? 119 LEU A CD1 1 
ATOM   322  C  CD2 . LEU A 1 46  ? 184.606 184.122 -14.188 1.00 102.90 ? 119 LEU A CD2 1 
ATOM   323  N  N   . PRO A 1 47  ? 182.171 184.551 -11.463 1.00 132.69 ? 120 PRO A N   1 
ATOM   324  C  CA  . PRO A 1 47  ? 181.076 183.575 -11.571 1.00 123.68 ? 120 PRO A CA  1 
ATOM   325  C  C   . PRO A 1 47  ? 179.788 184.062 -10.936 1.00 136.38 ? 120 PRO A C   1 
ATOM   326  O  O   . PRO A 1 47  ? 178.720 183.520 -11.246 1.00 140.16 ? 120 PRO A O   1 
ATOM   327  C  CB  . PRO A 1 47  ? 181.628 182.345 -10.843 1.00 105.07 ? 120 PRO A CB  1 
ATOM   328  C  CG  . PRO A 1 47  ? 182.540 182.916 -9.832  1.00 105.34 ? 120 PRO A CG  1 
ATOM   329  C  CD  . PRO A 1 47  ? 183.181 184.109 -10.482 1.00 116.43 ? 120 PRO A CD  1 
ATOM   330  N  N   . TYR A 1 48  ? 179.855 185.079 -10.072 1.00 118.32 ? 121 TYR A N   1 
ATOM   331  C  CA  . TYR A 1 48  ? 178.651 185.598 -9.434  1.00 114.42 ? 121 TYR A CA  1 
ATOM   332  C  C   . TYR A 1 48  ? 177.743 186.274 -10.447 1.00 132.46 ? 121 TYR A C   1 
ATOM   333  O  O   . TYR A 1 48  ? 176.515 186.184 -10.340 1.00 152.99 ? 121 TYR A O   1 
ATOM   334  C  CB  . TYR A 1 48  ? 179.030 186.570 -8.317  1.00 104.88 ? 121 TYR A CB  1 
ATOM   335  C  CG  . TYR A 1 48  ? 177.853 187.196 -7.606  1.00 125.21 ? 121 TYR A CG  1 
ATOM   336  C  CD1 . TYR A 1 48  ? 177.126 186.485 -6.661  1.00 138.17 ? 121 TYR A CD1 1 
ATOM   337  C  CD2 . TYR A 1 48  ? 177.481 188.509 -7.866  1.00 125.15 ? 121 TYR A CD2 1 
ATOM   338  C  CE1 . TYR A 1 48  ? 176.051 187.062 -6.005  1.00 133.82 ? 121 TYR A CE1 1 
ATOM   339  C  CE2 . TYR A 1 48  ? 176.410 189.093 -7.214  1.00 119.43 ? 121 TYR A CE2 1 
ATOM   340  C  CZ  . TYR A 1 48  ? 175.700 188.366 -6.286  1.00 120.29 ? 121 TYR A CZ  1 
ATOM   341  O  OH  . TYR A 1 48  ? 174.636 188.946 -5.637  1.00 123.95 ? 121 TYR A OH  1 
ATOM   342  N  N   . THR A 1 49  ? 178.331 186.929 -11.445 1.00 105.60 ? 122 THR A N   1 
ATOM   343  C  CA  . THR A 1 49  ? 177.551 187.612 -12.466 1.00 119.08 ? 122 THR A CA  1 
ATOM   344  C  C   . THR A 1 49  ? 177.065 186.626 -13.520 1.00 128.40 ? 122 THR A C   1 
ATOM   345  O  O   . THR A 1 49  ? 175.927 186.729 -13.992 1.00 131.66 ? 122 THR A O   1 
ATOM   346  C  CB  . THR A 1 49  ? 178.382 188.724 -13.100 1.00 122.62 ? 122 THR A CB  1 
ATOM   347  O  OG1 . THR A 1 49  ? 179.594 188.172 -13.627 1.00 141.17 ? 122 THR A OG1 1 
ATOM   348  C  CG2 . THR A 1 49  ? 178.736 189.766 -12.051 1.00 110.79 ? 122 THR A CG2 1 
ATOM   349  N  N   . ILE A 1 50  ? 177.913 185.662 -13.886 1.00 130.10 ? 123 ILE A N   1 
ATOM   350  C  CA  . ILE A 1 50  ? 177.536 184.674 -14.892 1.00 126.89 ? 123 ILE A CA  1 
ATOM   351  C  C   . ILE A 1 50  ? 176.311 183.892 -14.432 1.00 129.33 ? 123 ILE A C   1 
ATOM   352  O  O   . ILE A 1 50  ? 175.383 183.649 -15.215 1.00 138.79 ? 123 ILE A O   1 
ATOM   353  C  CB  . ILE A 1 50  ? 178.730 183.747 -15.194 1.00 113.06 ? 123 ILE A CB  1 
ATOM   354  C  CG1 . ILE A 1 50  ? 179.888 184.544 -15.797 1.00 120.92 ? 123 ILE A CG1 1 
ATOM   355  C  CG2 . ILE A 1 50  ? 178.319 182.625 -16.133 1.00 132.69 ? 123 ILE A CG2 1 
ATOM   356  C  CD1 . ILE A 1 50  ? 181.103 183.704 -16.125 1.00 124.72 ? 123 ILE A CD1 1 
ATOM   357  N  N   . MET A 1 51  ? 176.265 183.522 -13.148 1.00 116.63 ? 124 MET A N   1 
ATOM   358  C  CA  . MET A 1 51  ? 175.105 182.805 -12.625 1.00 109.15 ? 124 MET A CA  1 
ATOM   359  C  C   . MET A 1 51  ? 173.878 183.695 -12.514 1.00 109.84 ? 124 MET A C   1 
ATOM   360  O  O   . MET A 1 51  ? 172.763 183.179 -12.379 1.00 110.02 ? 124 MET A O   1 
ATOM   361  C  CB  . MET A 1 51  ? 175.420 182.207 -11.255 1.00 98.86  ? 124 MET A CB  1 
ATOM   362  C  CG  . MET A 1 51  ? 176.390 181.056 -11.294 1.00 97.05  ? 124 MET A CG  1 
ATOM   363  S  SD  . MET A 1 51  ? 175.781 179.765 -12.387 1.00 96.11  ? 124 MET A SD  1 
ATOM   364  C  CE  . MET A 1 51  ? 177.081 178.547 -12.211 1.00 148.45 ? 124 MET A CE  1 
ATOM   365  N  N   . ALA A 1 52  ? 174.059 185.013 -12.559 1.00 104.18 ? 125 ALA A N   1 
ATOM   366  C  CA  . ALA A 1 52  ? 172.924 185.925 -12.524 1.00 106.04 ? 125 ALA A CA  1 
ATOM   367  C  C   . ALA A 1 52  ? 172.346 186.112 -13.920 1.00 117.93 ? 125 ALA A C   1 
ATOM   368  O  O   . ALA A 1 52  ? 171.158 185.863 -14.153 1.00 107.59 ? 125 ALA A O   1 
ATOM   369  C  CB  . ALA A 1 52  ? 173.347 187.269 -11.924 1.00 107.82 ? 125 ALA A CB  1 
ATOM   370  N  N   . ILE A 1 53  ? 173.187 186.544 -14.862 1.00 136.51 ? 126 ILE A N   1 
ATOM   371  C  CA  . ILE A 1 53  ? 172.738 186.831 -16.222 1.00 139.95 ? 126 ILE A CA  1 
ATOM   372  C  C   . ILE A 1 53  ? 172.083 185.607 -16.852 1.00 139.59 ? 126 ILE A C   1 
ATOM   373  O  O   . ILE A 1 53  ? 171.062 185.718 -17.542 1.00 150.83 ? 126 ILE A O   1 
ATOM   374  C  CB  . ILE A 1 53  ? 173.924 187.331 -17.067 1.00 128.02 ? 126 ILE A CB  1 
ATOM   375  C  CG1 . ILE A 1 53  ? 174.505 188.615 -16.469 1.00 132.55 ? 126 ILE A CG1 1 
ATOM   376  C  CG2 . ILE A 1 53  ? 173.508 187.555 -18.510 1.00 146.33 ? 126 ILE A CG2 1 
ATOM   377  C  CD1 . ILE A 1 53  ? 175.690 189.159 -17.235 1.00 135.11 ? 126 ILE A CD1 1 
ATOM   378  N  N   . PHE A 1 54  ? 172.635 184.420 -16.606 1.00 115.63 ? 127 PHE A N   1 
ATOM   379  C  CA  . PHE A 1 54  ? 172.123 183.209 -17.233 1.00 115.29 ? 127 PHE A CA  1 
ATOM   380  C  C   . PHE A 1 54  ? 171.124 182.453 -16.367 1.00 111.68 ? 127 PHE A C   1 
ATOM   381  O  O   . PHE A 1 54  ? 170.283 181.727 -16.908 1.00 103.42 ? 127 PHE A O   1 
ATOM   382  C  CB  . PHE A 1 54  ? 173.283 182.272 -17.587 1.00 125.27 ? 127 PHE A CB  1 
ATOM   383  C  CG  . PHE A 1 54  ? 174.236 182.841 -18.601 1.00 104.77 ? 127 PHE A CG  1 
ATOM   384  C  CD1 . PHE A 1 54  ? 173.832 183.833 -19.478 1.00 106.98 ? 127 PHE A CD1 1 
ATOM   385  C  CD2 . PHE A 1 54  ? 175.540 182.377 -18.676 1.00 103.87 ? 127 PHE A CD2 1 
ATOM   386  C  CE1 . PHE A 1 54  ? 174.714 184.357 -20.404 1.00 108.27 ? 127 PHE A CE1 1 
ATOM   387  C  CE2 . PHE A 1 54  ? 176.422 182.892 -19.601 1.00 105.17 ? 127 PHE A CE2 1 
ATOM   388  C  CZ  . PHE A 1 54  ? 176.011 183.883 -20.466 1.00 107.36 ? 127 PHE A CZ  1 
ATOM   389  N  N   . GLY A 1 55  ? 171.184 182.617 -15.048 1.00 115.85 ? 128 GLY A N   1 
ATOM   390  C  CA  . GLY A 1 55  ? 170.329 181.878 -14.139 1.00 102.26 ? 128 GLY A CA  1 
ATOM   391  C  C   . GLY A 1 55  ? 169.352 182.747 -13.373 1.00 103.58 ? 128 GLY A C   1 
ATOM   392  O  O   . GLY A 1 55  ? 168.138 182.530 -13.432 1.00 103.98 ? 128 GLY A O   1 
ATOM   393  N  N   . GLY A 1 56  ? 169.879 183.713 -12.625 1.00 104.01 ? 129 GLY A N   1 
ATOM   394  C  CA  . GLY A 1 56  ? 169.084 184.575 -11.769 1.00 105.37 ? 129 GLY A CA  1 
ATOM   395  C  C   . GLY A 1 56  ? 168.133 185.497 -12.508 1.00 144.39 ? 129 GLY A C   1 
ATOM   396  O  O   . GLY A 1 56  ? 166.925 185.493 -12.245 1.00 108.43 ? 129 GLY A O   1 
ATOM   397  N  N   . ILE A 1 57  ? 168.675 186.326 -13.407 1.00 137.16 ? 130 ILE A N   1 
ATOM   398  C  CA  . ILE A 1 57  ? 167.840 187.291 -14.130 1.00 126.27 ? 130 ILE A CA  1 
ATOM   399  C  C   . ILE A 1 57  ? 166.742 186.613 -14.938 1.00 130.51 ? 130 ILE A C   1 
ATOM   400  O  O   . ILE A 1 57  ? 165.606 187.108 -14.924 1.00 139.54 ? 130 ILE A O   1 
ATOM   401  C  CB  . ILE A 1 57  ? 168.712 188.231 -14.969 1.00 113.37 ? 130 ILE A CB  1 
ATOM   402  C  CG1 . ILE A 1 57  ? 169.934 188.704 -14.184 1.00 113.10 ? 130 ILE A CG1 1 
ATOM   403  C  CG2 . ILE A 1 57  ? 167.907 189.435 -15.419 1.00 125.14 ? 130 ILE A CG2 1 
ATOM   404  C  CD1 . ILE A 1 57  ? 169.585 189.526 -12.969 1.00 114.18 ? 130 ILE A CD1 1 
ATOM   405  N  N   . PRO A 1 58  ? 166.988 185.522 -15.680 1.00 129.17 ? 131 PRO A N   1 
ATOM   406  C  CA  . PRO A 1 58  ? 165.865 184.916 -16.418 1.00 127.22 ? 131 PRO A CA  1 
ATOM   407  C  C   . PRO A 1 58  ? 164.760 184.405 -15.506 1.00 121.14 ? 131 PRO A C   1 
ATOM   408  O  O   . PRO A 1 58  ? 163.581 184.523 -15.857 1.00 131.68 ? 131 PRO A O   1 
ATOM   409  C  CB  . PRO A 1 58  ? 166.538 183.783 -17.207 1.00 116.76 ? 131 PRO A CB  1 
ATOM   410  C  CG  . PRO A 1 58  ? 167.958 184.215 -17.342 1.00 108.55 ? 131 PRO A CG  1 
ATOM   411  C  CD  . PRO A 1 58  ? 168.275 184.902 -16.054 1.00 114.72 ? 131 PRO A CD  1 
ATOM   412  N  N   . LEU A 1 59  ? 165.103 183.797 -14.366 1.00 130.72 ? 132 LEU A N   1 
ATOM   413  C  CA  . LEU A 1 59  ? 164.068 183.351 -13.435 1.00 136.61 ? 132 LEU A CA  1 
ATOM   414  C  C   . LEU A 1 59  ? 163.351 184.535 -12.795 1.00 133.03 ? 132 LEU A C   1 
ATOM   415  O  O   . LEU A 1 59  ? 162.138 184.483 -12.566 1.00 132.78 ? 132 LEU A O   1 
ATOM   416  C  CB  . LEU A 1 59  ? 164.668 182.444 -12.363 1.00 125.39 ? 132 LEU A CB  1 
ATOM   417  C  CG  . LEU A 1 59  ? 165.107 181.066 -12.852 1.00 121.99 ? 132 LEU A CG  1 
ATOM   418  C  CD1 . LEU A 1 59  ? 165.814 180.310 -11.748 1.00 125.03 ? 132 LEU A CD1 1 
ATOM   419  C  CD2 . LEU A 1 59  ? 163.896 180.287 -13.347 1.00 127.24 ? 132 LEU A CD2 1 
ATOM   420  N  N   . PHE A 1 60  ? 164.095 185.593 -12.462 1.00 127.42 ? 133 PHE A N   1 
ATOM   421  C  CA  . PHE A 1 60  ? 163.488 186.770 -11.846 1.00 142.95 ? 133 PHE A CA  1 
ATOM   422  C  C   . PHE A 1 60  ? 162.496 187.432 -12.795 1.00 159.42 ? 133 PHE A C   1 
ATOM   423  O  O   . PHE A 1 60  ? 161.367 187.758 -12.411 1.00 169.45 ? 133 PHE A O   1 
ATOM   424  C  CB  . PHE A 1 60  ? 164.578 187.755 -11.421 1.00 135.36 ? 133 PHE A CB  1 
ATOM   425  C  CG  . PHE A 1 60  ? 164.094 188.839 -10.497 1.00 157.04 ? 133 PHE A CG  1 
ATOM   426  C  CD1 . PHE A 1 60  ? 163.565 190.015 -11.002 1.00 177.03 ? 133 PHE A CD1 1 
ATOM   427  C  CD2 . PHE A 1 60  ? 164.173 188.683 -9.123  1.00 139.53 ? 133 PHE A CD2 1 
ATOM   428  C  CE1 . PHE A 1 60  ? 163.120 191.012 -10.154 1.00 178.06 ? 133 PHE A CE1 1 
ATOM   429  C  CE2 . PHE A 1 60  ? 163.730 189.678 -8.271  1.00 144.58 ? 133 PHE A CE2 1 
ATOM   430  C  CZ  . PHE A 1 60  ? 163.204 190.843 -8.787  1.00 150.65 ? 133 PHE A CZ  1 
ATOM   431  N  N   . TYR A 1 61  ? 162.910 187.643 -14.046 1.00 165.17 ? 134 TYR A N   1 
ATOM   432  C  CA  . TYR A 1 61  ? 162.051 188.299 -15.026 1.00 157.40 ? 134 TYR A CA  1 
ATOM   433  C  C   . TYR A 1 61  ? 160.904 187.393 -15.450 1.00 147.78 ? 134 TYR A C   1 
ATOM   434  O  O   . TYR A 1 61  ? 159.764 187.848 -15.585 1.00 146.16 ? 134 TYR A O   1 
ATOM   435  C  CB  . TYR A 1 61  ? 162.889 188.728 -16.232 1.00 183.92 ? 134 TYR A CB  1 
ATOM   436  C  CG  . TYR A 1 61  ? 162.105 189.260 -17.412 1.00 200.55 ? 134 TYR A CG  1 
ATOM   437  C  CD1 . TYR A 1 61  ? 161.417 190.463 -17.333 1.00 208.55 ? 134 TYR A CD1 1 
ATOM   438  C  CD2 . TYR A 1 61  ? 162.086 188.574 -18.618 1.00 199.98 ? 134 TYR A CD2 1 
ATOM   439  C  CE1 . TYR A 1 61  ? 160.711 190.955 -18.416 1.00 209.32 ? 134 TYR A CE1 1 
ATOM   440  C  CE2 . TYR A 1 61  ? 161.385 189.058 -19.707 1.00 201.71 ? 134 TYR A CE2 1 
ATOM   441  C  CZ  . TYR A 1 61  ? 160.700 190.250 -19.600 1.00 205.18 ? 134 TYR A CZ  1 
ATOM   442  O  OH  . TYR A 1 61  ? 160.001 190.737 -20.681 1.00 205.86 ? 134 TYR A OH  1 
ATOM   443  N  N   . MET A 1 62  ? 161.189 186.108 -15.675 1.00 122.92 ? 135 MET A N   1 
ATOM   444  C  CA  . MET A 1 62  ? 160.143 185.168 -16.063 1.00 124.87 ? 135 MET A CA  1 
ATOM   445  C  C   . MET A 1 62  ? 159.104 185.026 -14.957 1.00 150.76 ? 135 MET A C   1 
ATOM   446  O  O   . MET A 1 62  ? 157.903 184.909 -15.229 1.00 156.42 ? 135 MET A O   1 
ATOM   447  C  CB  . MET A 1 62  ? 160.776 183.820 -16.418 1.00 117.50 ? 135 MET A CB  1 
ATOM   448  C  CG  . MET A 1 62  ? 159.851 182.808 -17.079 1.00 116.84 ? 135 MET A CG  1 
ATOM   449  S  SD  . MET A 1 62  ? 158.973 181.758 -15.909 1.00 146.74 ? 135 MET A SD  1 
ATOM   450  C  CE  . MET A 1 62  ? 160.341 180.933 -15.097 1.00 136.66 ? 135 MET A CE  1 
ATOM   451  N  N   . GLU A 1 63  ? 159.551 185.050 -13.700 1.00 178.29 ? 136 GLU A N   1 
ATOM   452  C  CA  . GLU A 1 63  ? 158.625 184.998 -12.574 1.00 191.95 ? 136 GLU A CA  1 
ATOM   453  C  C   . GLU A 1 63  ? 157.848 186.303 -12.456 1.00 186.36 ? 136 GLU A C   1 
ATOM   454  O  O   . GLU A 1 63  ? 156.654 186.299 -12.135 1.00 188.26 ? 136 GLU A O   1 
ATOM   455  C  CB  . GLU A 1 63  ? 159.392 184.700 -11.283 1.00 184.20 ? 136 GLU A CB  1 
ATOM   456  C  CG  . GLU A 1 63  ? 158.610 184.943 -10.000 1.00 179.83 ? 136 GLU A CG  1 
ATOM   457  C  CD  . GLU A 1 63  ? 157.627 183.833 -9.683  1.00 184.66 ? 136 GLU A CD  1 
ATOM   458  O  OE1 . GLU A 1 63  ? 157.518 182.879 -10.483 1.00 190.13 ? 136 GLU A OE1 1 
ATOM   459  O  OE2 . GLU A 1 63  ? 156.962 183.914 -8.630  1.00 182.47 ? 136 GLU A OE2 1 
ATOM   460  N  N   . LEU A 1 64  ? 158.515 187.428 -12.721 1.00 164.68 ? 137 LEU A N   1 
ATOM   461  C  CA  . LEU A 1 64  ? 157.911 188.742 -12.563 1.00 156.94 ? 137 LEU A CA  1 
ATOM   462  C  C   . LEU A 1 64  ? 156.926 189.056 -13.682 1.00 143.83 ? 137 LEU A C   1 
ATOM   463  O  O   . LEU A 1 64  ? 156.056 189.915 -13.506 1.00 137.24 ? 137 LEU A O   1 
ATOM   464  C  CB  . LEU A 1 64  ? 159.012 189.805 -12.508 1.00 123.19 ? 137 LEU A CB  1 
ATOM   465  C  CG  . LEU A 1 64  ? 158.662 191.196 -11.986 1.00 126.14 ? 137 LEU A CG  1 
ATOM   466  C  CD1 . LEU A 1 64  ? 158.142 191.098 -10.566 1.00 126.08 ? 137 LEU A CD1 1 
ATOM   467  C  CD2 . LEU A 1 64  ? 159.886 192.095 -12.047 1.00 126.69 ? 137 LEU A CD2 1 
ATOM   468  N  N   . ALA A 1 65  ? 157.051 188.387 -14.827 1.00 159.60 ? 138 ALA A N   1 
ATOM   469  C  CA  . ALA A 1 65  ? 156.178 188.649 -15.965 1.00 158.02 ? 138 ALA A CA  1 
ATOM   470  C  C   . ALA A 1 65  ? 154.835 187.952 -15.787 1.00 154.53 ? 138 ALA A C   1 
ATOM   471  O  O   . ALA A 1 65  ? 153.779 188.556 -16.002 1.00 141.85 ? 138 ALA A O   1 
ATOM   472  C  CB  . ALA A 1 65  ? 156.852 188.204 -17.264 1.00 144.66 ? 138 ALA A CB  1 
ATOM   473  N  N   . LEU A 1 66  ? 154.868 186.675 -15.395 1.00 138.05 ? 139 LEU A N   1 
ATOM   474  C  CA  . LEU A 1 66  ? 153.646 185.891 -15.239 1.00 132.81 ? 139 LEU A CA  1 
ATOM   475  C  C   . LEU A 1 66  ? 152.687 186.551 -14.258 1.00 145.78 ? 139 LEU A C   1 
ATOM   476  O  O   . LEU A 1 66  ? 151.467 186.542 -14.468 1.00 173.43 ? 139 LEU A O   1 
ATOM   477  C  CB  . LEU A 1 66  ? 153.992 184.475 -14.780 1.00 129.66 ? 139 LEU A CB  1 
ATOM   478  C  CG  . LEU A 1 66  ? 154.825 183.646 -15.757 1.00 141.68 ? 139 LEU A CG  1 
ATOM   479  C  CD1 . LEU A 1 66  ? 155.203 182.309 -15.145 1.00 115.54 ? 139 LEU A CD1 1 
ATOM   480  C  CD2 . LEU A 1 66  ? 154.061 183.447 -17.056 1.00 145.75 ? 139 LEU A CD2 1 
ATOM   481  N  N   . GLY A 1 67  ? 153.218 187.117 -13.174 1.00 160.53 ? 140 GLY A N   1 
ATOM   482  C  CA  . GLY A 1 67  ? 152.362 187.774 -12.200 1.00 166.60 ? 140 GLY A CA  1 
ATOM   483  C  C   . GLY A 1 67  ? 151.647 188.977 -12.781 1.00 175.16 ? 140 GLY A C   1 
ATOM   484  O  O   . GLY A 1 67  ? 150.449 189.165 -12.557 1.00 182.45 ? 140 GLY A O   1 
ATOM   485  N  N   . GLN A 1 68  ? 152.364 189.801 -13.546 1.00 166.54 ? 141 GLN A N   1 
ATOM   486  C  CA  . GLN A 1 68  ? 151.759 191.000 -14.108 1.00 165.00 ? 141 GLN A CA  1 
ATOM   487  C  C   . GLN A 1 68  ? 150.878 190.692 -15.309 1.00 170.09 ? 141 GLN A C   1 
ATOM   488  O  O   . GLN A 1 68  ? 150.031 191.516 -15.671 1.00 169.53 ? 141 GLN A O   1 
ATOM   489  C  CB  . GLN A 1 68  ? 152.855 191.986 -14.508 1.00 163.40 ? 141 GLN A CB  1 
ATOM   490  C  CG  . GLN A 1 68  ? 152.425 193.432 -14.547 1.00 180.42 ? 141 GLN A CG  1 
ATOM   491  C  CD  . GLN A 1 68  ? 153.604 194.375 -14.433 1.00 193.89 ? 141 GLN A CD  1 
ATOM   492  O  OE1 . GLN A 1 68  ? 154.741 193.948 -14.235 1.00 213.50 ? 141 GLN A OE1 1 
ATOM   493  N  NE2 . GLN A 1 68  ? 153.339 195.664 -14.554 1.00 183.82 ? 141 GLN A NE2 1 
ATOM   494  N  N   . TYR A 1 69  ? 151.055 189.526 -15.930 1.00 169.98 ? 142 TYR A N   1 
ATOM   495  C  CA  . TYR A 1 69  ? 150.218 189.147 -17.061 1.00 179.33 ? 142 TYR A CA  1 
ATOM   496  C  C   . TYR A 1 69  ? 148.915 188.524 -16.563 1.00 187.02 ? 142 TYR A C   1 
ATOM   497  O  O   . TYR A 1 69  ? 147.823 189.009 -16.879 1.00 211.09 ? 142 TYR A O   1 
ATOM   498  C  CB  . TYR A 1 69  ? 150.981 188.195 -17.986 1.00 187.37 ? 142 TYR A CB  1 
ATOM   499  C  CG  . TYR A 1 69  ? 150.176 187.680 -19.155 1.00 194.40 ? 142 TYR A CG  1 
ATOM   500  C  CD1 . TYR A 1 69  ? 149.942 188.490 -20.260 1.00 206.71 ? 142 TYR A CD1 1 
ATOM   501  C  CD2 . TYR A 1 69  ? 149.663 186.395 -19.166 1.00 203.99 ? 142 TYR A CD2 1 
ATOM   502  C  CE1 . TYR A 1 69  ? 149.216 188.034 -21.340 1.00 218.86 ? 142 TYR A CE1 1 
ATOM   503  C  CE2 . TYR A 1 69  ? 148.932 185.928 -20.243 1.00 219.56 ? 142 TYR A CE2 1 
ATOM   504  C  CZ  . TYR A 1 69  ? 148.712 186.753 -21.327 1.00 224.82 ? 142 TYR A CZ  1 
ATOM   505  O  OH  . TYR A 1 69  ? 147.986 186.294 -22.402 1.00 232.53 ? 142 TYR A OH  1 
ATOM   506  N  N   . HIS A 1 70  ? 149.012 187.449 -15.772 1.00 166.51 ? 143 HIS A N   1 
ATOM   507  C  CA  . HIS A 1 70  ? 147.819 186.729 -15.337 1.00 165.30 ? 143 HIS A CA  1 
ATOM   508  C  C   . HIS A 1 70  ? 147.119 187.418 -14.173 1.00 164.14 ? 143 HIS A C   1 
ATOM   509  O  O   . HIS A 1 70  ? 145.914 187.214 -13.986 1.00 174.18 ? 143 HIS A O   1 
ATOM   510  C  CB  . HIS A 1 70  ? 148.154 185.293 -14.923 1.00 168.27 ? 143 HIS A CB  1 
ATOM   511  C  CG  . HIS A 1 70  ? 148.656 184.433 -16.040 1.00 183.08 ? 143 HIS A CG  1 
ATOM   512  N  ND1 . HIS A 1 70  ? 149.917 184.568 -16.581 1.00 192.36 ? 143 HIS A ND1 1 
ATOM   513  C  CD2 . HIS A 1 70  ? 148.063 183.421 -16.717 1.00 181.39 ? 143 HIS A CD2 1 
ATOM   514  C  CE1 . HIS A 1 70  ? 150.080 183.673 -17.539 1.00 186.35 ? 143 HIS A CE1 1 
ATOM   515  N  NE2 . HIS A 1 70  ? 148.968 182.968 -17.645 1.00 180.86 ? 143 HIS A NE2 1 
ATOM   516  N  N   . ARG A 1 71  ? 147.847 188.218 -13.393 1.00 179.07 ? 144 ARG A N   1 
ATOM   517  C  CA  . ARG A 1 71  ? 147.297 188.925 -12.234 1.00 180.38 ? 144 ARG A CA  1 
ATOM   518  C  C   . ARG A 1 71  ? 146.583 187.983 -11.265 1.00 180.58 ? 144 ARG A C   1 
ATOM   519  O  O   . ARG A 1 71  ? 145.515 188.294 -10.734 1.00 179.86 ? 144 ARG A O   1 
ATOM   520  C  CB  . ARG A 1 71  ? 146.371 190.057 -12.682 1.00 171.87 ? 144 ARG A CB  1 
ATOM   521  C  CG  . ARG A 1 71  ? 147.043 191.061 -13.606 1.00 175.55 ? 144 ARG A CG  1 
ATOM   522  C  CD  . ARG A 1 71  ? 146.334 192.403 -13.587 1.00 180.13 ? 144 ARG A CD  1 
ATOM   523  N  NE  . ARG A 1 71  ? 144.887 192.259 -13.715 1.00 202.04 ? 144 ARG A NE  1 
ATOM   524  C  CZ  . ARG A 1 71  ? 144.228 192.323 -14.868 1.00 207.20 ? 144 ARG A CZ  1 
ATOM   525  N  NH1 . ARG A 1 71  ? 142.909 192.183 -14.888 1.00 211.83 ? 144 ARG A NH1 1 
ATOM   526  N  NH2 . ARG A 1 71  ? 144.886 192.531 -16.001 1.00 205.17 ? 144 ARG A NH2 1 
ATOM   527  N  N   . ASN A 1 72  ? 147.175 186.814 -11.035 1.00 182.07 ? 145 ASN A N   1 
ATOM   528  C  CA  . ASN A 1 72  ? 146.618 185.832 -10.120 1.00 174.77 ? 145 ASN A CA  1 
ATOM   529  C  C   . ASN A 1 72  ? 147.639 185.505 -9.037  1.00 179.56 ? 145 ASN A C   1 
ATOM   530  O  O   . ASN A 1 72  ? 148.831 185.800 -9.165  1.00 187.62 ? 145 ASN A O   1 
ATOM   531  C  CB  . ASN A 1 72  ? 146.204 184.552 -10.858 1.00 161.14 ? 145 ASN A CB  1 
ATOM   532  N  N   . GLY A 1 73  ? 147.157 184.883 -7.966  1.00 189.71 ? 146 GLY A N   1 
ATOM   533  C  CA  . GLY A 1 73  ? 148.000 184.509 -6.852  1.00 197.53 ? 146 GLY A CA  1 
ATOM   534  C  C   . GLY A 1 73  ? 148.933 183.362 -7.199  1.00 204.22 ? 146 GLY A C   1 
ATOM   535  O  O   . GLY A 1 73  ? 149.112 182.975 -8.354  1.00 208.16 ? 146 GLY A O   1 
ATOM   536  N  N   . CYS A 1 74  ? 149.542 182.805 -6.151  1.00 211.01 ? 147 CYS A N   1 
ATOM   537  C  CA  . CYS A 1 74  ? 150.462 181.691 -6.336  1.00 211.49 ? 147 CYS A CA  1 
ATOM   538  C  C   . CYS A 1 74  ? 149.727 180.382 -6.576  1.00 201.45 ? 147 CYS A C   1 
ATOM   539  O  O   . CYS A 1 74  ? 150.341 179.414 -7.038  1.00 200.45 ? 147 CYS A O   1 
ATOM   540  C  CB  . CYS A 1 74  ? 151.365 181.541 -5.110  1.00 221.17 ? 147 CYS A CB  1 
ATOM   541  S  SG  . CYS A 1 74  ? 152.066 183.086 -4.498  1.00 237.01 ? 147 CYS A SG  1 
ATOM   542  N  N   . ILE A 1 75  ? 148.429 180.343 -6.289  1.00 187.43 ? 148 ILE A N   1 
ATOM   543  C  CA  . ILE A 1 75  ? 147.618 179.137 -6.390  1.00 169.45 ? 148 ILE A CA  1 
ATOM   544  C  C   . ILE A 1 75  ? 146.712 179.189 -7.613  1.00 150.59 ? 148 ILE A C   1 
ATOM   545  O  O   . ILE A 1 75  ? 146.672 178.251 -8.412  1.00 145.99 ? 148 ILE A O   1 
ATOM   546  C  CB  . ILE A 1 75  ? 146.793 178.911 -5.102  1.00 119.64 ? 148 ILE A CB  1 
ATOM   547  C  CG1 . ILE A 1 75  ? 147.667 179.058 -3.856  1.00 127.90 ? 148 ILE A CG1 1 
ATOM   548  C  CG2 . ILE A 1 75  ? 146.146 177.535 -5.120  1.00 118.77 ? 148 ILE A CG2 1 
ATOM   549  C  CD1 . ILE A 1 75  ? 146.884 179.023 -2.560  1.00 119.60 ? 148 ILE A CD1 1 
ATOM   550  N  N   . SER A 1 76  ? 145.981 180.295 -7.778  1.00 160.31 ? 149 SER A N   1 
ATOM   551  C  CA  . SER A 1 76  ? 144.997 180.407 -8.846  1.00 154.35 ? 149 SER A CA  1 
ATOM   552  C  C   . SER A 1 76  ? 145.647 180.536 -10.215 1.00 148.60 ? 149 SER A C   1 
ATOM   553  O  O   . SER A 1 76  ? 144.969 180.341 -11.229 1.00 155.96 ? 149 SER A O   1 
ATOM   554  C  CB  . SER A 1 76  ? 144.079 181.601 -8.583  1.00 142.70 ? 149 SER A CB  1 
ATOM   555  O  OG  . SER A 1 76  ? 144.825 182.801 -8.480  1.00 139.83 ? 149 SER A OG  1 
ATOM   556  N  N   . ILE A 1 77  ? 146.939 180.867 -10.270 1.00 155.29 ? 150 ILE A N   1 
ATOM   557  C  CA  . ILE A 1 77  ? 147.613 181.019 -11.552 1.00 138.57 ? 150 ILE A CA  1 
ATOM   558  C  C   . ILE A 1 77  ? 147.876 179.655 -12.175 1.00 147.53 ? 150 ILE A C   1 
ATOM   559  O  O   . ILE A 1 77  ? 147.996 179.546 -13.400 1.00 153.45 ? 150 ILE A O   1 
ATOM   560  C  CB  . ILE A 1 77  ? 148.914 181.833 -11.405 1.00 133.19 ? 150 ILE A CB  1 
ATOM   561  C  CG1 . ILE A 1 77  ? 149.390 182.327 -12.772 1.00 122.29 ? 150 ILE A CG1 1 
ATOM   562  C  CG2 . ILE A 1 77  ? 150.001 181.006 -10.734 1.00 136.60 ? 150 ILE A CG2 1 
ATOM   563  C  CD1 . ILE A 1 77  ? 150.647 183.159 -12.718 1.00 121.79 ? 150 ILE A CD1 1 
ATOM   564  N  N   . TRP A 1 78  ? 147.966 178.603 -11.355 1.00 160.09 ? 151 TRP A N   1 
ATOM   565  C  CA  . TRP A 1 78  ? 148.206 177.264 -11.876 1.00 155.86 ? 151 TRP A CA  1 
ATOM   566  C  C   . TRP A 1 78  ? 146.933 176.662 -12.449 1.00 156.43 ? 151 TRP A C   1 
ATOM   567  O  O   . TRP A 1 78  ? 147.000 175.811 -13.342 1.00 142.42 ? 151 TRP A O   1 
ATOM   568  C  CB  . TRP A 1 78  ? 148.767 176.362 -10.780 1.00 164.11 ? 151 TRP A CB  1 
ATOM   569  C  CG  . TRP A 1 78  ? 150.172 176.686 -10.440 1.00 146.16 ? 151 TRP A CG  1 
ATOM   570  C  CD1 . TRP A 1 78  ? 150.624 177.274 -9.297  1.00 151.65 ? 151 TRP A CD1 1 
ATOM   571  C  CD2 . TRP A 1 78  ? 151.317 176.477 -11.267 1.00 148.80 ? 151 TRP A CD2 1 
ATOM   572  N  NE1 . TRP A 1 78  ? 151.986 177.430 -9.353  1.00 163.75 ? 151 TRP A NE1 1 
ATOM   573  C  CE2 . TRP A 1 78  ? 152.437 176.948 -10.554 1.00 169.41 ? 151 TRP A CE2 1 
ATOM   574  C  CE3 . TRP A 1 78  ? 151.507 175.930 -12.538 1.00 155.43 ? 151 TRP A CE3 1 
ATOM   575  C  CZ2 . TRP A 1 78  ? 153.728 176.891 -11.071 1.00 178.14 ? 151 TRP A CZ2 1 
ATOM   576  C  CZ3 . TRP A 1 78  ? 152.789 175.873 -13.049 1.00 171.19 ? 151 TRP A CZ3 1 
ATOM   577  C  CH2 . TRP A 1 78  ? 153.883 176.349 -12.317 1.00 177.16 ? 151 TRP A CH2 1 
ATOM   578  N  N   . ARG A 1 79  ? 145.774 177.096 -11.952 1.00 174.45 ? 152 ARG A N   1 
ATOM   579  C  CA  . ARG A 1 79  ? 144.509 176.658 -12.524 1.00 187.19 ? 152 ARG A CA  1 
ATOM   580  C  C   . ARG A 1 79  ? 144.389 177.117 -13.971 1.00 183.84 ? 152 ARG A C   1 
ATOM   581  O  O   . ARG A 1 79  ? 143.706 176.476 -14.777 1.00 193.36 ? 152 ARG A O   1 
ATOM   582  C  CB  . ARG A 1 79  ? 143.348 177.195 -11.685 1.00 187.18 ? 152 ARG A CB  1 
ATOM   583  C  CG  . ARG A 1 79  ? 141.975 176.707 -12.107 1.00 185.10 ? 152 ARG A CG  1 
ATOM   584  C  CD  . ARG A 1 79  ? 140.885 177.525 -11.436 1.00 189.53 ? 152 ARG A CD  1 
ATOM   585  N  NE  . ARG A 1 79  ? 140.958 177.455 -9.979  1.00 192.13 ? 152 ARG A NE  1 
ATOM   586  C  CZ  . ARG A 1 79  ? 140.100 178.055 -9.160  1.00 200.33 ? 152 ARG A CZ  1 
ATOM   587  N  NH1 . ARG A 1 79  ? 139.100 178.773 -9.652  1.00 200.62 ? 152 ARG A NH1 1 
ATOM   588  N  NH2 . ARG A 1 79  ? 140.240 177.939 -7.847  1.00 205.89 ? 152 ARG A NH2 1 
ATOM   589  N  N   . LYS A 1 80  ? 145.064 178.213 -14.314 1.00 153.92 ? 153 LYS A N   1 
ATOM   590  C  CA  . LYS A 1 80  ? 145.046 178.806 -15.643 1.00 150.38 ? 153 LYS A CA  1 
ATOM   591  C  C   . LYS A 1 80  ? 146.246 178.389 -16.484 1.00 149.49 ? 153 LYS A C   1 
ATOM   592  O  O   . LYS A 1 80  ? 146.390 178.865 -17.614 1.00 140.17 ? 153 LYS A O   1 
ATOM   593  C  CB  . LYS A 1 80  ? 144.997 180.335 -15.542 1.00 164.23 ? 153 LYS A CB  1 
ATOM   594  C  CG  . LYS A 1 80  ? 144.010 180.875 -14.514 1.00 180.71 ? 153 LYS A CG  1 
ATOM   595  C  CD  . LYS A 1 80  ? 142.600 180.363 -14.763 1.00 181.73 ? 153 LYS A CD  1 
ATOM   596  C  CE  . LYS A 1 80  ? 141.580 181.136 -13.942 1.00 168.84 ? 153 LYS A CE  1 
ATOM   597  N  NZ  . LYS A 1 80  ? 141.982 181.245 -12.512 1.00 140.63 ? 153 LYS A NZ  1 
ATOM   598  N  N   . ILE A 1 81  ? 147.119 177.533 -15.952 1.00 147.14 ? 154 ILE A N   1 
ATOM   599  C  CA  . ILE A 1 81  ? 148.299 177.057 -16.667 1.00 150.01 ? 154 ILE A CA  1 
ATOM   600  C  C   . ILE A 1 81  ? 148.293 175.534 -16.673 1.00 148.73 ? 154 ILE A C   1 
ATOM   601  O  O   . ILE A 1 81  ? 148.041 174.908 -17.709 1.00 158.94 ? 154 ILE A O   1 
ATOM   602  C  CB  . ILE A 1 81  ? 149.599 177.601 -16.046 1.00 143.69 ? 154 ILE A CB  1 
ATOM   603  C  CG1 . ILE A 1 81  ? 149.625 179.128 -16.115 1.00 160.96 ? 154 ILE A CG1 1 
ATOM   604  C  CG2 . ILE A 1 81  ? 150.810 177.020 -16.755 1.00 123.37 ? 154 ILE A CG2 1 
ATOM   605  C  CD1 . ILE A 1 81  ? 149.575 179.672 -17.522 1.00 159.62 ? 154 ILE A CD1 1 
ATOM   606  N  N   . CYS A 1 82  ? 148.573 174.926 -15.521 1.00 155.84 ? 155 CYS A N   1 
ATOM   607  C  CA  . CYS A 1 82  ? 148.577 173.471 -15.388 1.00 161.49 ? 155 CYS A CA  1 
ATOM   608  C  C   . CYS A 1 82  ? 147.939 173.089 -14.063 1.00 161.60 ? 155 CYS A C   1 
ATOM   609  O  O   . CYS A 1 82  ? 148.609 173.041 -13.023 1.00 153.53 ? 155 CYS A O   1 
ATOM   610  C  CB  . CYS A 1 82  ? 149.991 172.899 -15.492 1.00 152.80 ? 155 CYS A CB  1 
ATOM   611  S  SG  . CYS A 1 82  ? 150.801 173.192 -17.073 1.00 149.69 ? 155 CYS A SG  1 
ATOM   612  N  N   . PRO A 1 83  ? 146.626 172.836 -14.063 1.00 167.59 ? 156 PRO A N   1 
ATOM   613  C  CA  . PRO A 1 83  ? 145.912 172.559 -12.805 1.00 177.81 ? 156 PRO A CA  1 
ATOM   614  C  C   . PRO A 1 83  ? 146.583 171.521 -11.922 1.00 177.13 ? 156 PRO A C   1 
ATOM   615  O  O   . PRO A 1 83  ? 146.564 171.671 -10.696 1.00 206.37 ? 156 PRO A O   1 
ATOM   616  C  CB  . PRO A 1 83  ? 144.525 172.099 -13.286 1.00 188.87 ? 156 PRO A CB  1 
ATOM   617  C  CG  . PRO A 1 83  ? 144.655 171.870 -14.769 1.00 177.52 ? 156 PRO A CG  1 
ATOM   618  C  CD  . PRO A 1 83  ? 145.718 172.814 -15.219 1.00 172.61 ? 156 PRO A CD  1 
ATOM   619  N  N   . ILE A 1 84  ? 147.182 170.478 -12.505 1.00 141.14 ? 157 ILE A N   1 
ATOM   620  C  CA  . ILE A 1 84  ? 147.820 169.440 -11.697 1.00 153.26 ? 157 ILE A CA  1 
ATOM   621  C  C   . ILE A 1 84  ? 148.957 170.014 -10.862 1.00 163.03 ? 157 ILE A C   1 
ATOM   622  O  O   . ILE A 1 84  ? 149.259 169.501 -9.778  1.00 148.96 ? 157 ILE A O   1 
ATOM   623  C  CB  . ILE A 1 84  ? 148.310 168.288 -12.594 1.00 143.55 ? 157 ILE A CB  1 
ATOM   624  C  CG1 . ILE A 1 84  ? 148.972 168.840 -13.859 1.00 123.68 ? 157 ILE A CG1 1 
ATOM   625  C  CG2 . ILE A 1 84  ? 147.163 167.347 -12.920 1.00 140.33 ? 157 ILE A CG2 1 
ATOM   626  C  CD1 . ILE A 1 84  ? 149.599 167.778 -14.737 1.00 124.00 ? 157 ILE A CD1 1 
ATOM   627  N  N   . PHE A 1 85  ? 149.577 171.097 -11.320 1.00 168.81 ? 158 PHE A N   1 
ATOM   628  C  CA  . PHE A 1 85  ? 150.679 171.711 -10.595 1.00 149.44 ? 158 PHE A CA  1 
ATOM   629  C  C   . PHE A 1 85  ? 150.190 172.749 -9.600  1.00 153.83 ? 158 PHE A C   1 
ATOM   630  O  O   . PHE A 1 85  ? 151.001 173.479 -9.021  1.00 183.08 ? 158 PHE A O   1 
ATOM   631  C  CB  . PHE A 1 85  ? 151.675 172.333 -11.573 1.00 148.77 ? 158 PHE A CB  1 
ATOM   632  C  CG  . PHE A 1 85  ? 152.415 171.324 -12.398 1.00 156.77 ? 158 PHE A CG  1 
ATOM   633  C  CD1 . PHE A 1 85  ? 152.644 170.048 -11.909 1.00 152.54 ? 158 PHE A CD1 1 
ATOM   634  C  CD2 . PHE A 1 85  ? 152.865 171.639 -13.667 1.00 169.51 ? 158 PHE A CD2 1 
ATOM   635  C  CE1 . PHE A 1 85  ? 153.323 169.112 -12.665 1.00 161.68 ? 158 PHE A CE1 1 
ATOM   636  C  CE2 . PHE A 1 85  ? 153.544 170.708 -14.429 1.00 170.32 ? 158 PHE A CE2 1 
ATOM   637  C  CZ  . PHE A 1 85  ? 153.772 169.443 -13.928 1.00 167.03 ? 158 PHE A CZ  1 
ATOM   638  N  N   . LYS A 1 86  ? 148.873 172.816 -9.392  1.00 133.45 ? 159 LYS A N   1 
ATOM   639  C  CA  . LYS A 1 86  ? 148.296 173.753 -8.439  1.00 118.67 ? 159 LYS A CA  1 
ATOM   640  C  C   . LYS A 1 86  ? 148.841 173.511 -7.041  1.00 118.29 ? 159 LYS A C   1 
ATOM   641  O  O   . LYS A 1 86  ? 148.914 174.444 -6.234  1.00 123.61 ? 159 LYS A O   1 
ATOM   642  C  CB  . LYS A 1 86  ? 146.774 173.641 -8.451  1.00 140.25 ? 159 LYS A CB  1 
ATOM   643  C  CG  . LYS A 1 86  ? 146.055 174.822 -7.839  1.00 152.72 ? 159 LYS A CG  1 
ATOM   644  C  CD  . LYS A 1 86  ? 144.553 174.673 -7.995  1.00 167.17 ? 159 LYS A CD  1 
ATOM   645  C  CE  . LYS A 1 86  ? 143.831 175.964 -7.662  1.00 172.32 ? 159 LYS A CE  1 
ATOM   646  N  NZ  . LYS A 1 86  ? 142.363 175.814 -7.840  1.00 170.43 ? 159 LYS A NZ  1 
ATOM   647  N  N   . GLY A 1 87  ? 149.204 172.259 -6.735  1.00 131.31 ? 160 GLY A N   1 
ATOM   648  C  CA  . GLY A 1 87  ? 149.816 171.954 -5.453  1.00 135.17 ? 160 GLY A CA  1 
ATOM   649  C  C   . GLY A 1 87  ? 151.030 172.811 -5.157  1.00 133.00 ? 160 GLY A C   1 
ATOM   650  O  O   . GLY A 1 87  ? 151.352 173.051 -3.989  1.00 135.32 ? 160 GLY A O   1 
ATOM   651  N  N   . ILE A 1 88  ? 151.744 173.249 -6.201  1.00 121.16 ? 161 ILE A N   1 
ATOM   652  C  CA  . ILE A 1 88  ? 152.848 174.191 -6.015  1.00 104.73 ? 161 ILE A CA  1 
ATOM   653  C  C   . ILE A 1 88  ? 152.382 175.375 -5.178  1.00 146.23 ? 161 ILE A C   1 
ATOM   654  O  O   . ILE A 1 88  ? 152.992 175.722 -4.157  1.00 147.13 ? 161 ILE A O   1 
ATOM   655  C  CB  . ILE A 1 88  ? 153.387 174.659 -7.379  1.00 114.42 ? 161 ILE A CB  1 
ATOM   656  C  CG1 . ILE A 1 88  ? 154.142 173.540 -8.094  1.00 102.82 ? 161 ILE A CG1 1 
ATOM   657  C  CG2 . ILE A 1 88  ? 154.251 175.902 -7.223  1.00 116.21 ? 161 ILE A CG2 1 
ATOM   658  C  CD1 . ILE A 1 88  ? 154.520 173.913 -9.505  1.00 103.17 ? 161 ILE A CD1 1 
ATOM   659  N  N   . GLY A 1 89  ? 151.274 176.003 -5.600  1.00 142.56 ? 162 GLY A N   1 
ATOM   660  C  CA  . GLY A 1 89  ? 150.726 177.131 -4.866  1.00 125.79 ? 162 GLY A CA  1 
ATOM   661  C  C   . GLY A 1 89  ? 150.461 176.805 -3.412  1.00 135.98 ? 162 GLY A C   1 
ATOM   662  O  O   . GLY A 1 89  ? 150.530 177.685 -2.550  1.00 130.37 ? 162 GLY A O   1 
ATOM   663  N  N   . TYR A 1 90  ? 150.146 175.541 -3.122  1.00 146.20 ? 163 TYR A N   1 
ATOM   664  C  CA  . TYR A 1 90  ? 149.948 175.111 -1.744  1.00 148.12 ? 163 TYR A CA  1 
ATOM   665  C  C   . TYR A 1 90  ? 151.291 174.817 -1.095  1.00 138.94 ? 163 TYR A C   1 
ATOM   666  O  O   . TYR A 1 90  ? 151.516 175.173 0.069   1.00 141.51 ? 163 TYR A O   1 
ATOM   667  C  CB  . TYR A 1 90  ? 149.045 173.879 -1.691  1.00 145.57 ? 163 TYR A CB  1 
ATOM   668  C  CG  . TYR A 1 90  ? 147.582 174.177 -1.923  1.00 134.99 ? 163 TYR A CG  1 
ATOM   669  C  CD1 . TYR A 1 90  ? 147.051 175.426 -1.628  1.00 127.91 ? 163 TYR A CD1 1 
ATOM   670  C  CD2 . TYR A 1 90  ? 146.729 173.205 -2.427  1.00 148.19 ? 163 TYR A CD2 1 
ATOM   671  C  CE1 . TYR A 1 90  ? 145.714 175.700 -1.838  1.00 150.86 ? 163 TYR A CE1 1 
ATOM   672  C  CE2 . TYR A 1 90  ? 145.391 173.469 -2.639  1.00 159.77 ? 163 TYR A CE2 1 
ATOM   673  C  CZ  . TYR A 1 90  ? 144.888 174.718 -2.343  1.00 169.73 ? 163 TYR A CZ  1 
ATOM   674  O  OH  . TYR A 1 90  ? 143.554 174.988 -2.553  1.00 199.65 ? 163 TYR A OH  1 
ATOM   675  N  N   . ALA A 1 91  ? 152.177 174.143 -1.834  1.00 142.80 ? 164 ALA A N   1 
ATOM   676  C  CA  . ALA A 1 91  ? 153.486 173.778 -1.310  1.00 138.38 ? 164 ALA A CA  1 
ATOM   677  C  C   . ALA A 1 91  ? 154.177 175.011 -0.753  1.00 125.95 ? 164 ALA A C   1 
ATOM   678  O  O   . ALA A 1 91  ? 154.596 175.038 0.411   1.00 134.29 ? 164 ALA A O   1 
ATOM   679  C  CB  . ALA A 1 91  ? 154.331 173.121 -2.403  1.00 140.71 ? 164 ALA A CB  1 
ATOM   680  N  N   . ILE A 1 92  ? 154.305 176.044 -1.593  1.00 105.83 ? 165 ILE A N   1 
ATOM   681  C  CA  . ILE A 1 92  ? 154.890 177.310 -1.160  1.00 124.00 ? 165 ILE A CA  1 
ATOM   682  C  C   . ILE A 1 92  ? 154.267 177.760 0.155   1.00 141.76 ? 165 ILE A C   1 
ATOM   683  O  O   . ILE A 1 92  ? 154.975 178.132 1.100   1.00 171.25 ? 165 ILE A O   1 
ATOM   684  C  CB  . ILE A 1 92  ? 154.718 178.376 -2.255  1.00 118.18 ? 165 ILE A CB  1 
ATOM   685  C  CG1 . ILE A 1 92  ? 155.461 177.958 -3.527  1.00 136.54 ? 165 ILE A CG1 1 
ATOM   686  C  CG2 . ILE A 1 92  ? 155.170 179.733 -1.746  1.00 115.63 ? 165 ILE A CG2 1 
ATOM   687  C  CD1 . ILE A 1 92  ? 155.367 178.969 -4.649  1.00 141.06 ? 165 ILE A CD1 1 
ATOM   688  N  N   . CYS A 1 93  ? 152.933 177.714 0.240   1.00 113.95 ? 166 CYS A N   1 
ATOM   689  C  CA  . CYS A 1 93  ? 152.250 178.066 1.481   1.00 121.95 ? 166 CYS A CA  1 
ATOM   690  C  C   . CYS A 1 93  ? 152.880 177.338 2.661   1.00 127.32 ? 166 CYS A C   1 
ATOM   691  O  O   . CYS A 1 93  ? 153.372 177.966 3.606   1.00 137.27 ? 166 CYS A O   1 
ATOM   692  C  CB  . CYS A 1 93  ? 150.753 177.763 1.376   1.00 134.13 ? 166 CYS A CB  1 
ATOM   693  S  SG  . CYS A 1 93  ? 149.833 178.918 0.325   1.00 140.94 ? 166 CYS A SG  1 
ATOM   694  N  N   . ILE A 1 94  ? 152.902 176.002 2.600   1.00 131.75 ? 167 ILE A N   1 
ATOM   695  C  CA  . ILE A 1 94  ? 153.507 175.216 3.674   1.00 136.36 ? 167 ILE A CA  1 
ATOM   696  C  C   . ILE A 1 94  ? 154.946 175.662 3.883   1.00 133.01 ? 167 ILE A C   1 
ATOM   697  O  O   . ILE A 1 94  ? 155.395 175.877 5.017   1.00 112.74 ? 167 ILE A O   1 
ATOM   698  C  CB  . ILE A 1 94  ? 153.415 173.711 3.359   1.00 132.45 ? 167 ILE A CB  1 
ATOM   699  C  CG1 . ILE A 1 94  ? 151.951 173.304 3.160   1.00 140.52 ? 167 ILE A CG1 1 
ATOM   700  C  CG2 . ILE A 1 94  ? 154.062 172.889 4.465   1.00 106.36 ? 167 ILE A CG2 1 
ATOM   701  C  CD1 . ILE A 1 94  ? 151.759 171.838 2.838   1.00 152.95 ? 167 ILE A CD1 1 
ATOM   702  N  N   . ILE A 1 95  ? 155.684 175.815 2.778   1.00 147.29 ? 168 ILE A N   1 
ATOM   703  C  CA  . ILE A 1 95  ? 157.057 176.311 2.833   1.00 130.60 ? 168 ILE A CA  1 
ATOM   704  C  C   . ILE A 1 95  ? 157.114 177.590 3.653   1.00 125.85 ? 168 ILE A C   1 
ATOM   705  O  O   . ILE A 1 95  ? 157.937 177.730 4.568   1.00 119.53 ? 168 ILE A O   1 
ATOM   706  C  CB  . ILE A 1 95  ? 157.606 176.520 1.411   1.00 101.07 ? 168 ILE A CB  1 
ATOM   707  C  CG1 . ILE A 1 95  ? 157.950 175.172 0.789   1.00 98.99  ? 168 ILE A CG1 1 
ATOM   708  C  CG2 . ILE A 1 95  ? 158.824 177.407 1.438   1.00 100.81 ? 168 ILE A CG2 1 
ATOM   709  C  CD1 . ILE A 1 95  ? 159.013 174.451 1.552   1.00 96.95  ? 168 ILE A CD1 1 
ATOM   710  N  N   . ALA A 1 96  ? 156.226 178.541 3.336   1.00 123.10 ? 169 ALA A N   1 
ATOM   711  C  CA  . ALA A 1 96  ? 156.206 179.808 4.054   1.00 107.60 ? 169 ALA A CA  1 
ATOM   712  C  C   . ALA A 1 96  ? 156.083 179.572 5.552   1.00 107.68 ? 169 ALA A C   1 
ATOM   713  O  O   . ALA A 1 96  ? 156.810 180.185 6.345   1.00 136.97 ? 169 ALA A O   1 
ATOM   714  C  CB  . ALA A 1 96  ? 155.063 180.685 3.547   1.00 110.36 ? 169 ALA A CB  1 
ATOM   715  N  N   . PHE A 1 97  ? 155.188 178.660 5.957   1.00 107.62 ? 170 PHE A N   1 
ATOM   716  C  CA  . PHE A 1 97  ? 154.981 178.422 7.383   1.00 139.57 ? 170 PHE A CA  1 
ATOM   717  C  C   . PHE A 1 97  ? 156.274 178.007 8.060   1.00 113.29 ? 170 PHE A C   1 
ATOM   718  O  O   . PHE A 1 97  ? 156.509 178.358 9.222   1.00 106.30 ? 170 PHE A O   1 
ATOM   719  C  CB  . PHE A 1 97  ? 153.906 177.358 7.602   1.00 140.03 ? 170 PHE A CB  1 
ATOM   720  C  CG  . PHE A 1 97  ? 153.824 176.873 9.021   1.00 107.85 ? 170 PHE A CG  1 
ATOM   721  C  CD1 . PHE A 1 97  ? 153.264 177.667 10.006  1.00 110.11 ? 170 PHE A CD1 1 
ATOM   722  C  CD2 . PHE A 1 97  ? 154.286 175.613 9.366   1.00 105.63 ? 170 PHE A CD2 1 
ATOM   723  C  CE1 . PHE A 1 97  ? 153.188 177.225 11.314  1.00 110.10 ? 170 PHE A CE1 1 
ATOM   724  C  CE2 . PHE A 1 97  ? 154.206 175.163 10.673  1.00 105.62 ? 170 PHE A CE2 1 
ATOM   725  C  CZ  . PHE A 1 97  ? 153.656 175.971 11.647  1.00 107.84 ? 170 PHE A CZ  1 
ATOM   726  N  N   . TYR A 1 98  ? 157.124 177.269 7.348   1.00 120.91 ? 171 TYR A N   1 
ATOM   727  C  CA  . TYR A 1 98  ? 158.414 176.884 7.904   1.00 105.62 ? 171 TYR A CA  1 
ATOM   728  C  C   . TYR A 1 98  ? 159.351 178.084 7.930   1.00 104.98 ? 171 TYR A C   1 
ATOM   729  O  O   . TYR A 1 98  ? 159.993 178.366 8.949   1.00 104.89 ? 171 TYR A O   1 
ATOM   730  C  CB  . TYR A 1 98  ? 159.008 175.729 7.100   1.00 117.45 ? 171 TYR A CB  1 
ATOM   731  C  CG  . TYR A 1 98  ? 158.213 174.443 7.198   1.00 135.91 ? 171 TYR A CG  1 
ATOM   732  C  CD1 . TYR A 1 98  ? 157.420 174.177 8.308   1.00 110.18 ? 171 TYR A CD1 1 
ATOM   733  C  CD2 . TYR A 1 98  ? 158.249 173.499 6.178   1.00 169.21 ? 171 TYR A CD2 1 
ATOM   734  C  CE1 . TYR A 1 98  ? 156.694 173.003 8.406   1.00 101.95 ? 171 TYR A CE1 1 
ATOM   735  C  CE2 . TYR A 1 98  ? 157.522 172.322 6.266   1.00 166.00 ? 171 TYR A CE2 1 
ATOM   736  C  CZ  . TYR A 1 98  ? 156.748 172.080 7.382   1.00 126.57 ? 171 TYR A CZ  1 
ATOM   737  O  OH  . TYR A 1 98  ? 156.026 170.913 7.477   1.00 115.69 ? 171 TYR A OH  1 
ATOM   738  N  N   . ILE A 1 99  ? 159.398 178.831 6.825   1.00 102.76 ? 172 ILE A N   1 
ATOM   739  C  CA  . ILE A 1 99  ? 160.309 179.968 6.713   1.00 122.67 ? 172 ILE A CA  1 
ATOM   740  C  C   . ILE A 1 99  ? 160.037 180.976 7.820   1.00 137.71 ? 172 ILE A C   1 
ATOM   741  O  O   . ILE A 1 99  ? 160.943 181.377 8.560   1.00 131.01 ? 172 ILE A O   1 
ATOM   742  C  CB  . ILE A 1 99  ? 160.183 180.616 5.323   1.00 124.53 ? 172 ILE A CB  1 
ATOM   743  C  CG1 . ILE A 1 99  ? 160.680 179.660 4.237   1.00 102.09 ? 172 ILE A CG1 1 
ATOM   744  C  CG2 . ILE A 1 99  ? 160.913 181.946 5.294   1.00 128.45 ? 172 ILE A CG2 1 
ATOM   745  C  CD1 . ILE A 1 99  ? 160.597 180.231 2.843   1.00 102.88 ? 172 ILE A CD1 1 
ATOM   746  N  N   . ALA A 1 100 ? 158.781 181.406 7.943   1.00 158.72 ? 173 ALA A N   1 
ATOM   747  C  CA  . ALA A 1 100 ? 158.393 182.371 8.963   1.00 151.72 ? 173 ALA A CA  1 
ATOM   748  C  C   . ALA A 1 100 ? 158.660 181.880 10.382  1.00 136.37 ? 173 ALA A C   1 
ATOM   749  O  O   . ALA A 1 100 ? 158.624 182.693 11.313  1.00 138.81 ? 173 ALA A O   1 
ATOM   750  C  CB  . ALA A 1 100 ? 156.914 182.723 8.801   1.00 144.54 ? 173 ALA A CB  1 
ATOM   751  N  N   . SER A 1 101 ? 158.935 180.586 10.573  1.00 124.96 ? 174 SER A N   1 
ATOM   752  C  CA  . SER A 1 101 ? 159.208 180.078 11.915  1.00 130.97 ? 174 SER A CA  1 
ATOM   753  C  C   . SER A 1 101 ? 160.550 180.547 12.466  1.00 133.52 ? 174 SER A C   1 
ATOM   754  O  O   . SER A 1 101 ? 160.711 180.607 13.690  1.00 130.96 ? 174 SER A O   1 
ATOM   755  C  CB  . SER A 1 101 ? 159.162 178.549 11.921  1.00 126.82 ? 174 SER A CB  1 
ATOM   756  O  OG  . SER A 1 101 ? 157.840 178.074 11.739  1.00 114.76 ? 174 SER A OG  1 
ATOM   757  N  N   . TYR A 1 102 ? 161.504 180.886 11.608  1.00 147.41 ? 175 TYR A N   1 
ATOM   758  C  CA  . TYR A 1 102 ? 162.828 181.308 12.051  1.00 143.13 ? 175 TYR A CA  1 
ATOM   759  C  C   . TYR A 1 102 ? 163.241 182.673 11.522  1.00 149.23 ? 175 TYR A C   1 
ATOM   760  O  O   . TYR A 1 102 ? 163.924 183.417 12.233  1.00 156.68 ? 175 TYR A O   1 
ATOM   761  C  CB  . TYR A 1 102 ? 163.881 180.249 11.669  1.00 136.29 ? 175 TYR A CB  1 
ATOM   762  C  CG  . TYR A 1 102 ? 164.139 180.080 10.185  1.00 138.03 ? 175 TYR A CG  1 
ATOM   763  C  CD1 . TYR A 1 102 ? 165.103 180.840 9.535   1.00 142.23 ? 175 TYR A CD1 1 
ATOM   764  C  CD2 . TYR A 1 102 ? 163.439 179.140 9.443   1.00 123.88 ? 175 TYR A CD2 1 
ATOM   765  C  CE1 . TYR A 1 102 ? 165.347 180.682 8.185   1.00 127.41 ? 175 TYR A CE1 1 
ATOM   766  C  CE2 . TYR A 1 102 ? 163.678 178.974 8.092   1.00 121.07 ? 175 TYR A CE2 1 
ATOM   767  C  CZ  . TYR A 1 102 ? 164.633 179.748 7.467   1.00 123.17 ? 175 TYR A CZ  1 
ATOM   768  O  OH  . TYR A 1 102 ? 164.878 179.589 6.121   1.00 125.03 ? 175 TYR A OH  1 
ATOM   769  N  N   . TYR A 1 103 ? 162.854 183.018 10.290  1.00 141.74 ? 176 TYR A N   1 
ATOM   770  C  CA  . TYR A 1 103 ? 163.309 184.260 9.668   1.00 130.57 ? 176 TYR A CA  1 
ATOM   771  C  C   . TYR A 1 103 ? 162.973 185.479 10.522  1.00 152.28 ? 176 TYR A C   1 
ATOM   772  O  O   . TYR A 1 103 ? 163.700 186.479 10.490  1.00 161.24 ? 176 TYR A O   1 
ATOM   773  C  CB  . TYR A 1 103 ? 162.695 184.401 8.273   1.00 130.44 ? 176 TYR A CB  1 
ATOM   774  C  CG  . TYR A 1 103 ? 163.225 185.574 7.477   1.00 134.77 ? 176 TYR A CG  1 
ATOM   775  C  CD1 . TYR A 1 103 ? 164.361 185.441 6.691   1.00 138.61 ? 176 TYR A CD1 1 
ATOM   776  C  CD2 . TYR A 1 103 ? 162.592 186.810 7.509   1.00 139.84 ? 176 TYR A CD2 1 
ATOM   777  C  CE1 . TYR A 1 103 ? 164.854 186.503 5.961   1.00 149.03 ? 176 TYR A CE1 1 
ATOM   778  C  CE2 . TYR A 1 103 ? 163.079 187.881 6.781   1.00 144.01 ? 176 TYR A CE2 1 
ATOM   779  C  CZ  . TYR A 1 103 ? 164.211 187.720 6.010   1.00 153.16 ? 176 TYR A CZ  1 
ATOM   780  O  OH  . TYR A 1 103 ? 164.705 188.777 5.282   1.00 164.40 ? 176 TYR A OH  1 
ATOM   781  N  N   . ASN A 1 104 ? 161.876 185.419 11.280  1.00 130.65 ? 177 ASN A N   1 
ATOM   782  C  CA  . ASN A 1 104 ? 161.498 186.526 12.154  1.00 122.88 ? 177 ASN A CA  1 
ATOM   783  C  C   . ASN A 1 104 ? 162.307 186.529 13.447  1.00 123.81 ? 177 ASN A C   1 
ATOM   784  O  O   . ASN A 1 104 ? 162.653 187.601 13.956  1.00 126.83 ? 177 ASN A O   1 
ATOM   785  C  CB  . ASN A 1 104 ? 159.999 186.478 12.451  1.00 123.27 ? 177 ASN A CB  1 
ATOM   786  C  CG  . ASN A 1 104 ? 159.156 186.770 11.224  1.00 126.65 ? 177 ASN A CG  1 
ATOM   787  O  OD1 . ASN A 1 104 ? 158.853 187.925 10.925  1.00 133.77 ? 177 ASN A OD1 1 
ATOM   788  N  ND2 . ASN A 1 104 ? 158.767 185.722 10.511  1.00 122.85 ? 177 ASN A ND2 1 
ATOM   789  N  N   . THR A 1 105 ? 162.582 185.347 14.009  1.00 135.26 ? 178 THR A N   1 
ATOM   790  C  CA  . THR A 1 105 ? 163.295 185.268 15.283  1.00 132.29 ? 178 THR A CA  1 
ATOM   791  C  C   . THR A 1 105 ? 164.627 186.006 15.218  1.00 132.22 ? 178 THR A C   1 
ATOM   792  O  O   . THR A 1 105 ? 165.059 186.606 16.210  1.00 126.88 ? 178 THR A O   1 
ATOM   793  C  CB  . THR A 1 105 ? 163.503 183.809 15.685  1.00 117.52 ? 178 THR A CB  1 
ATOM   794  O  OG1 . THR A 1 105 ? 164.278 183.140 14.683  1.00 118.85 ? 178 THR A OG1 1 
ATOM   795  C  CG2 . THR A 1 105 ? 162.162 183.117 15.838  1.00 126.36 ? 178 THR A CG2 1 
ATOM   796  N  N   . ILE A 1 106 ? 165.325 185.913 14.082  1.00 134.28 ? 179 ILE A N   1 
ATOM   797  C  CA  . ILE A 1 106 ? 166.563 186.670 13.905  1.00 110.31 ? 179 ILE A CA  1 
ATOM   798  C  C   . ILE A 1 106 ? 166.302 188.141 14.198  1.00 147.37 ? 179 ILE A C   1 
ATOM   799  O  O   . ILE A 1 106 ? 167.011 188.784 14.991  1.00 157.89 ? 179 ILE A O   1 
ATOM   800  C  CB  . ILE A 1 106 ? 167.106 186.473 12.481  1.00 108.88 ? 179 ILE A CB  1 
ATOM   801  C  CG1 . ILE A 1 106 ? 167.401 184.995 12.229  1.00 105.87 ? 179 ILE A CG1 1 
ATOM   802  C  CG2 . ILE A 1 106 ? 168.335 187.332 12.268  1.00 109.32 ? 179 ILE A CG2 1 
ATOM   803  C  CD1 . ILE A 1 106 ? 167.874 184.701 10.828  1.00 134.40 ? 179 ILE A CD1 1 
ATOM   804  N  N   . MET A 1 107 ? 165.292 188.704 13.526  1.00 134.61 ? 180 MET A N   1 
ATOM   805  C  CA  . MET A 1 107 ? 164.930 190.089 13.784  1.00 135.18 ? 180 MET A CA  1 
ATOM   806  C  C   . MET A 1 107 ? 164.634 190.289 15.263  1.00 124.58 ? 180 MET A C   1 
ATOM   807  O  O   . MET A 1 107 ? 164.953 191.341 15.823  1.00 126.29 ? 180 MET A O   1 
ATOM   808  C  CB  . MET A 1 107 ? 163.731 190.498 12.931  1.00 148.99 ? 180 MET A CB  1 
ATOM   809  C  CG  . MET A 1 107 ? 164.010 190.610 11.445  1.00 150.60 ? 180 MET A CG  1 
ATOM   810  S  SD  . MET A 1 107 ? 162.586 191.282 10.567  1.00 168.38 ? 180 MET A SD  1 
ATOM   811  C  CE  . MET A 1 107 ? 161.375 189.992 10.833  1.00 155.52 ? 180 MET A CE  1 
ATOM   812  N  N   . ALA A 1 108 ? 163.957 189.321 15.894  1.00 119.11 ? 181 ALA A N   1 
ATOM   813  C  CA  . ALA A 1 108 ? 163.698 189.417 17.327  1.00 120.38 ? 181 ALA A CA  1 
ATOM   814  C  C   . ALA A 1 108 ? 165.001 189.669 18.073  1.00 119.89 ? 181 ALA A C   1 
ATOM   815  O  O   . ALA A 1 108 ? 165.085 190.559 18.925  1.00 122.18 ? 181 ALA A O   1 
ATOM   816  C  CB  . ALA A 1 108 ? 163.004 188.153 17.837  1.00 118.92 ? 181 ALA A CB  1 
ATOM   817  N  N   . TRP A 1 109 ? 166.030 188.874 17.757  1.00 139.04 ? 182 TRP A N   1 
ATOM   818  C  CA  . TRP A 1 109 ? 167.355 189.050 18.349  1.00 122.07 ? 182 TRP A CA  1 
ATOM   819  C  C   . TRP A 1 109 ? 167.838 190.479 18.168  1.00 134.86 ? 182 TRP A C   1 
ATOM   820  O  O   . TRP A 1 109 ? 168.263 191.133 19.128  1.00 136.85 ? 182 TRP A O   1 
ATOM   821  C  CB  . TRP A 1 109 ? 168.359 188.076 17.731  1.00 113.15 ? 182 TRP A CB  1 
ATOM   822  C  CG  . TRP A 1 109 ? 168.026 186.640 17.924  1.00 112.69 ? 182 TRP A CG  1 
ATOM   823  C  CD1 . TRP A 1 109 ? 167.183 186.113 18.852  1.00 144.33 ? 182 TRP A CD1 1 
ATOM   824  C  CD2 . TRP A 1 109 ? 168.537 185.535 17.170  1.00 115.75 ? 182 TRP A CD2 1 
ATOM   825  N  NE1 . TRP A 1 109 ? 167.132 184.747 18.725  1.00 143.16 ? 182 TRP A NE1 1 
ATOM   826  C  CE2 . TRP A 1 109 ? 167.955 184.367 17.699  1.00 106.65 ? 182 TRP A CE2 1 
ATOM   827  C  CE3 . TRP A 1 109 ? 169.428 185.422 16.099  1.00 106.45 ? 182 TRP A CE3 1 
ATOM   828  C  CZ2 . TRP A 1 109 ? 168.236 183.101 17.194  1.00 103.98 ? 182 TRP A CZ2 1 
ATOM   829  C  CZ3 . TRP A 1 109 ? 169.704 184.165 15.598  1.00 103.80 ? 182 TRP A CZ3 1 
ATOM   830  C  CH2 . TRP A 1 109 ? 169.111 183.021 16.146  1.00 102.60 ? 182 TRP A CH2 1 
ATOM   831  N  N   . ALA A 1 110 ? 167.823 190.960 16.920  1.00 119.08 ? 183 ALA A N   1 
ATOM   832  C  CA  . ALA A 1 110 ? 168.238 192.334 16.650  1.00 121.50 ? 183 ALA A CA  1 
ATOM   833  C  C   . ALA A 1 110 ? 167.460 193.333 17.502  1.00 124.93 ? 183 ALA A C   1 
ATOM   834  O  O   . ALA A 1 110 ? 168.032 194.303 18.004  1.00 158.13 ? 183 ALA A O   1 
ATOM   835  C  CB  . ALA A 1 110 ? 168.076 192.650 15.164  1.00 137.73 ? 183 ALA A CB  1 
ATOM   836  N  N   . LEU A 1 111 ? 166.145 193.134 17.634  1.00 125.90 ? 184 LEU A N   1 
ATOM   837  C  CA  . LEU A 1 111 ? 165.305 194.018 18.441  1.00 166.70 ? 184 LEU A CA  1 
ATOM   838  C  C   . LEU A 1 111 ? 165.744 194.014 19.899  1.00 151.85 ? 184 LEU A C   1 
ATOM   839  O  O   . LEU A 1 111 ? 165.837 195.068 20.538  1.00 132.56 ? 184 LEU A O   1 
ATOM   840  C  CB  . LEU A 1 111 ? 163.836 193.611 18.316  1.00 167.33 ? 184 LEU A CB  1 
ATOM   841  C  CG  . LEU A 1 111 ? 162.826 194.455 19.099  1.00 162.20 ? 184 LEU A CG  1 
ATOM   842  C  CD1 . LEU A 1 111 ? 162.984 195.934 18.771  1.00 136.75 ? 184 LEU A CD1 1 
ATOM   843  C  CD2 . LEU A 1 111 ? 161.404 193.992 18.820  1.00 134.13 ? 184 LEU A CD2 1 
ATOM   844  N  N   . TYR A 1 112 ? 165.999 192.824 20.449  1.00 127.13 ? 185 TYR A N   1 
ATOM   845  C  CA  . TYR A 1 112 ? 166.461 192.724 21.827  1.00 127.37 ? 185 TYR A CA  1 
ATOM   846  C  C   . TYR A 1 112 ? 167.827 193.371 21.974  1.00 127.52 ? 185 TYR A C   1 
ATOM   847  O  O   . TYR A 1 112 ? 168.179 193.855 23.056  1.00 129.06 ? 185 TYR A O   1 
ATOM   848  C  CB  . TYR A 1 112 ? 166.506 191.261 22.264  1.00 124.41 ? 185 TYR A CB  1 
ATOM   849  C  CG  . TYR A 1 112 ? 166.732 191.063 23.746  1.00 124.84 ? 185 TYR A CG  1 
ATOM   850  C  CD1 . TYR A 1 112 ? 165.665 191.045 24.634  1.00 133.01 ? 185 TYR A CD1 1 
ATOM   851  C  CD2 . TYR A 1 112 ? 168.012 190.901 24.259  1.00 124.80 ? 185 TYR A CD2 1 
ATOM   852  C  CE1 . TYR A 1 112 ? 165.869 190.865 25.989  1.00 154.51 ? 185 TYR A CE1 1 
ATOM   853  C  CE2 . TYR A 1 112 ? 168.224 190.720 25.611  1.00 124.03 ? 185 TYR A CE2 1 
ATOM   854  C  CZ  . TYR A 1 112 ? 167.150 190.702 26.471  1.00 142.95 ? 185 TYR A CZ  1 
ATOM   855  O  OH  . TYR A 1 112 ? 167.360 190.522 27.817  1.00 126.40 ? 185 TYR A OH  1 
ATOM   856  N  N   . TYR A 1 113 ? 168.604 193.397 20.893  1.00 126.06 ? 186 TYR A N   1 
ATOM   857  C  CA  . TYR A 1 113 ? 169.894 194.066 20.919  1.00 126.40 ? 186 TYR A CA  1 
ATOM   858  C  C   . TYR A 1 113 ? 169.707 195.573 20.826  1.00 137.69 ? 186 TYR A C   1 
ATOM   859  O  O   . TYR A 1 113 ? 170.532 196.337 21.342  1.00 131.46 ? 186 TYR A O   1 
ATOM   860  C  CB  . TYR A 1 113 ? 170.751 193.567 19.754  1.00 123.76 ? 186 TYR A CB  1 
ATOM   861  C  CG  . TYR A 1 113 ? 171.777 192.527 20.122  1.00 120.82 ? 186 TYR A CG  1 
ATOM   862  C  CD1 . TYR A 1 113 ? 173.048 192.895 20.530  1.00 144.60 ? 186 TYR A CD1 1 
ATOM   863  C  CD2 . TYR A 1 113 ? 171.478 191.174 20.049  1.00 118.10 ? 186 TYR A CD2 1 
ATOM   864  C  CE1 . TYR A 1 113 ? 173.994 191.950 20.860  1.00 158.14 ? 186 TYR A CE1 1 
ATOM   865  C  CE2 . TYR A 1 113 ? 172.416 190.219 20.382  1.00 146.27 ? 186 TYR A CE2 1 
ATOM   866  C  CZ  . TYR A 1 113 ? 173.674 190.612 20.789  1.00 147.88 ? 186 TYR A CZ  1 
ATOM   867  O  OH  . TYR A 1 113 ? 174.620 189.669 21.124  1.00 113.31 ? 186 TYR A OH  1 
ATOM   868  N  N   . LEU A 1 114 ? 168.611 196.005 20.200  1.00 131.69 ? 187 LEU A N   1 
ATOM   869  C  CA  . LEU A 1 114 ? 168.329 197.418 20.004  1.00 135.30 ? 187 LEU A CA  1 
ATOM   870  C  C   . LEU A 1 114 ? 167.802 198.033 21.290  1.00 138.27 ? 187 LEU A C   1 
ATOM   871  O  O   . LEU A 1 114 ? 168.204 199.139 21.666  1.00 140.97 ? 187 LEU A O   1 
ATOM   872  C  CB  . LEU A 1 114 ? 167.322 197.598 18.867  1.00 136.03 ? 187 LEU A CB  1 
ATOM   873  C  CG  . LEU A 1 114 ? 166.853 199.014 18.537  1.00 139.91 ? 187 LEU A CG  1 
ATOM   874  C  CD1 . LEU A 1 114 ? 168.014 199.877 18.070  1.00 140.66 ? 187 LEU A CD1 1 
ATOM   875  C  CD2 . LEU A 1 114 ? 165.756 198.960 17.490  1.00 140.30 ? 187 LEU A CD2 1 
ATOM   876  N  N   . ILE A 1 115 ? 166.916 197.315 21.986  1.00 137.91 ? 188 ILE A N   1 
ATOM   877  C  CA  . ILE A 1 115 ? 166.340 197.843 23.213  1.00 140.82 ? 188 ILE A CA  1 
ATOM   878  C  C   . ILE A 1 115 ? 167.354 197.809 24.337  1.00 165.15 ? 188 ILE A C   1 
ATOM   879  O  O   . ILE A 1 115 ? 167.151 198.451 25.373  1.00 172.83 ? 188 ILE A O   1 
ATOM   880  C  CB  . ILE A 1 115 ? 165.080 197.056 23.626  1.00 140.61 ? 188 ILE A CB  1 
ATOM   881  C  CG1 . ILE A 1 115 ? 165.437 195.608 23.955  1.00 136.88 ? 188 ILE A CG1 1 
ATOM   882  C  CG2 . ILE A 1 115 ? 164.046 197.087 22.512  1.00 165.14 ? 188 ILE A CG2 1 
ATOM   883  C  CD1 . ILE A 1 115 ? 164.247 194.766 24.362  1.00 136.59 ? 188 ILE A CD1 1 
ATOM   884  N  N   . SER A 1 116 ? 168.450 197.080 24.144  1.00 164.49 ? 189 SER A N   1 
ATOM   885  C  CA  . SER A 1 116 ? 169.519 196.995 25.121  1.00 167.81 ? 189 SER A CA  1 
ATOM   886  C  C   . SER A 1 116 ? 170.647 197.947 24.773  1.00 173.96 ? 189 SER A C   1 
ATOM   887  O  O   . SER A 1 116 ? 171.649 198.001 25.493  1.00 185.75 ? 189 SER A O   1 
ATOM   888  C  CB  . SER A 1 116 ? 170.050 195.561 25.207  1.00 152.57 ? 189 SER A CB  1 
ATOM   889  O  OG  . SER A 1 116 ? 169.019 194.657 25.564  1.00 155.59 ? 189 SER A OG  1 
ATOM   890  N  N   . SER A 1 117 ? 170.494 198.701 23.687  1.00 171.52 ? 190 SER A N   1 
ATOM   891  C  CA  . SER A 1 117 ? 171.503 199.628 23.206  1.00 170.38 ? 190 SER A CA  1 
ATOM   892  C  C   . SER A 1 117 ? 171.163 201.068 23.561  1.00 182.27 ? 190 SER A C   1 
ATOM   893  O  O   . SER A 1 117 ? 171.777 201.993 23.023  1.00 198.30 ? 190 SER A O   1 
ATOM   894  C  CB  . SER A 1 117 ? 171.671 199.477 21.692  1.00 154.77 ? 190 SER A CB  1 
ATOM   895  O  OG  . SER A 1 117 ? 172.663 200.354 21.194  1.00 168.99 ? 190 SER A OG  1 
ATOM   896  N  N   . PHE A 1 118 ? 170.202 201.273 24.459  1.00 175.38 ? 191 PHE A N   1 
ATOM   897  C  CA  . PHE A 1 118 ? 169.803 202.602 24.896  1.00 170.84 ? 191 PHE A CA  1 
ATOM   898  C  C   . PHE A 1 118 ? 170.540 203.024 26.156  1.00 156.38 ? 191 PHE A C   1 
ATOM   899  O  O   . PHE A 1 118 ? 170.296 204.120 26.671  1.00 171.41 ? 191 PHE A O   1 
ATOM   900  C  CB  . PHE A 1 118 ? 168.289 202.645 25.140  1.00 168.20 ? 191 PHE A CB  1 
ATOM   901  C  CG  . PHE A 1 118 ? 167.465 202.572 23.880  1.00 171.14 ? 191 PHE A CG  1 
ATOM   902  C  CD1 . PHE A 1 118 ? 168.027 202.863 22.647  1.00 180.71 ? 191 PHE A CD1 1 
ATOM   903  C  CD2 . PHE A 1 118 ? 166.131 202.197 23.930  1.00 163.69 ? 191 PHE A CD2 1 
ATOM   904  C  CE1 . PHE A 1 118 ? 167.273 202.787 21.489  1.00 151.69 ? 191 PHE A CE1 1 
ATOM   905  C  CE2 . PHE A 1 118 ? 165.373 202.120 22.776  1.00 152.99 ? 191 PHE A CE2 1 
ATOM   906  C  CZ  . PHE A 1 118 ? 165.945 202.415 21.554  1.00 152.18 ? 191 PHE A CZ  1 
ATOM   907  N  N   . THR A 1 119 ? 171.432 202.176 26.653  1.00 168.10 ? 192 THR A N   1 
ATOM   908  C  CA  . THR A 1 119 ? 172.230 202.448 27.835  1.00 194.95 ? 192 THR A CA  1 
ATOM   909  C  C   . THR A 1 119 ? 173.499 203.202 27.457  1.00 198.70 ? 192 THR A C   1 
ATOM   910  O  O   . THR A 1 119 ? 174.049 203.026 26.365  1.00 176.92 ? 192 THR A O   1 
ATOM   911  C  CB  . THR A 1 119 ? 172.587 201.141 28.549  1.00 206.21 ? 192 THR A CB  1 
ATOM   912  O  OG1 . THR A 1 119 ? 171.421 200.312 28.639  1.00 216.11 ? 192 THR A OG1 1 
ATOM   913  C  CG2 . THR A 1 119 ? 173.102 201.415 29.955  1.00 203.57 ? 192 THR A CG2 1 
ATOM   914  N  N   . ASP A 1 120 ? 173.942 204.074 28.366  1.00 224.87 ? 193 ASP A N   1 
ATOM   915  C  CA  . ASP A 1 120 ? 175.176 204.820 28.144  1.00 231.65 ? 193 ASP A CA  1 
ATOM   916  C  C   . ASP A 1 120 ? 176.379 203.889 28.045  1.00 219.17 ? 193 ASP A C   1 
ATOM   917  O  O   . ASP A 1 120 ? 177.335 204.184 27.319  1.00 218.97 ? 193 ASP A O   1 
ATOM   918  C  CB  . ASP A 1 120 ? 175.379 205.849 29.257  1.00 243.30 ? 193 ASP A CB  1 
ATOM   919  C  CG  . ASP A 1 120 ? 175.438 205.218 30.633  1.00 251.77 ? 193 ASP A CG  1 
ATOM   920  O  OD1 . ASP A 1 120 ? 174.791 204.169 30.836  1.00 260.97 ? 193 ASP A OD1 1 
ATOM   921  O  OD2 . ASP A 1 120 ? 176.130 205.773 31.511  1.00 245.39 ? 193 ASP A OD2 1 
ATOM   922  N  N   . GLN A 1 121 ? 176.352 202.767 28.764  1.00 188.05 ? 194 GLN A N   1 
ATOM   923  C  CA  . GLN A 1 121 ? 177.392 201.745 28.690  1.00 165.10 ? 194 GLN A CA  1 
ATOM   924  C  C   . GLN A 1 121 ? 176.762 200.482 28.114  1.00 157.26 ? 194 GLN A C   1 
ATOM   925  O  O   . GLN A 1 121 ? 175.885 199.876 28.741  1.00 141.85 ? 194 GLN A O   1 
ATOM   926  C  CB  . GLN A 1 121 ? 178.001 201.480 30.066  1.00 162.79 ? 194 GLN A CB  1 
ATOM   927  C  CG  . GLN A 1 121 ? 178.794 202.646 30.639  1.00 172.86 ? 194 GLN A CG  1 
ATOM   928  C  CD  . GLN A 1 121 ? 180.008 203.000 29.802  1.00 184.03 ? 194 GLN A CD  1 
ATOM   929  O  OE1 . GLN A 1 121 ? 180.598 202.142 29.146  1.00 187.29 ? 194 GLN A OE1 1 
ATOM   930  N  NE2 . GLN A 1 121 ? 180.390 204.272 29.824  1.00 192.82 ? 194 GLN A NE2 1 
ATOM   931  N  N   . LEU A 1 122 ? 177.216 200.092 26.924  1.00 163.77 ? 195 LEU A N   1 
ATOM   932  C  CA  . LEU A 1 122 ? 176.653 198.939 26.232  1.00 161.95 ? 195 LEU A CA  1 
ATOM   933  C  C   . LEU A 1 122 ? 176.945 197.643 26.988  1.00 154.85 ? 195 LEU A C   1 
ATOM   934  O  O   . LEU A 1 122 ? 178.060 197.444 27.482  1.00 162.47 ? 195 LEU A O   1 
ATOM   935  C  CB  . LEU A 1 122 ? 177.192 198.846 24.803  1.00 152.41 ? 195 LEU A CB  1 
ATOM   936  C  CG  . LEU A 1 122 ? 177.093 200.111 23.946  1.00 144.90 ? 195 LEU A CG  1 
ATOM   937  C  CD1 . LEU A 1 122 ? 178.343 200.954 24.098  1.00 167.82 ? 195 LEU A CD1 1 
ATOM   938  C  CD2 . LEU A 1 122 ? 176.849 199.771 22.484  1.00 143.04 ? 195 LEU A CD2 1 
ATOM   939  N  N   . PRO A 1 123 ? 175.953 196.757 27.106  1.00 153.74 ? 196 PRO A N   1 
ATOM   940  C  CA  . PRO A 1 123 ? 176.125 195.531 27.904  1.00 152.42 ? 196 PRO A CA  1 
ATOM   941  C  C   . PRO A 1 123 ? 177.268 194.621 27.470  1.00 158.80 ? 196 PRO A C   1 
ATOM   942  O  O   . PRO A 1 123 ? 177.877 193.969 28.329  1.00 154.53 ? 196 PRO A O   1 
ATOM   943  C  CB  . PRO A 1 123 ? 174.770 194.827 27.740  1.00 148.84 ? 196 PRO A CB  1 
ATOM   944  C  CG  . PRO A 1 123 ? 173.808 195.926 27.443  1.00 132.36 ? 196 PRO A CG  1 
ATOM   945  C  CD  . PRO A 1 123 ? 174.577 196.899 26.600  1.00 133.43 ? 196 PRO A CD  1 
ATOM   946  N  N   . TRP A 1 124 ? 177.595 194.561 26.178  1.00 155.30 ? 197 TRP A N   1 
ATOM   947  C  CA  . TRP A 1 124 ? 178.608 193.634 25.687  1.00 135.88 ? 197 TRP A CA  1 
ATOM   948  C  C   . TRP A 1 124 ? 180.011 194.233 25.621  1.00 129.08 ? 197 TRP A C   1 
ATOM   949  O  O   . TRP A 1 124 ? 180.846 193.749 24.847  1.00 120.93 ? 197 TRP A O   1 
ATOM   950  C  CB  . TRP A 1 124 ? 178.195 193.089 24.315  1.00 121.15 ? 197 TRP A CB  1 
ATOM   951  C  CG  . TRP A 1 124 ? 178.099 194.119 23.227  1.00 122.04 ? 197 TRP A CG  1 
ATOM   952  C  CD1 . TRP A 1 124 ? 179.116 194.581 22.440  1.00 126.55 ? 197 TRP A CD1 1 
ATOM   953  C  CD2 . TRP A 1 124 ? 176.919 194.812 22.804  1.00 124.03 ? 197 TRP A CD2 1 
ATOM   954  N  NE1 . TRP A 1 124 ? 178.641 195.518 21.555  1.00 123.90 ? 197 TRP A NE1 1 
ATOM   955  C  CE2 . TRP A 1 124 ? 177.296 195.679 21.759  1.00 125.14 ? 197 TRP A CE2 1 
ATOM   956  C  CE3 . TRP A 1 124 ? 175.581 194.786 23.208  1.00 147.44 ? 197 TRP A CE3 1 
ATOM   957  C  CZ2 . TRP A 1 124 ? 176.383 196.510 21.113  1.00 127.27 ? 197 TRP A CZ2 1 
ATOM   958  C  CZ3 . TRP A 1 124 ? 174.676 195.611 22.564  1.00 127.22 ? 197 TRP A CZ3 1 
ATOM   959  C  CH2 . TRP A 1 124 ? 175.081 196.462 21.531  1.00 128.27 ? 197 TRP A CH2 1 
ATOM   960  N  N   . THR A 1 125 ? 180.296 195.255 26.424  1.00 125.76 ? 198 THR A N   1 
ATOM   961  C  CA  . THR A 1 125 ? 181.633 195.833 26.488  1.00 126.55 ? 198 THR A CA  1 
ATOM   962  C  C   . THR A 1 125 ? 182.404 195.322 27.699  1.00 141.31 ? 198 THR A C   1 
ATOM   963  O  O   . THR A 1 125 ? 183.571 194.938 27.578  1.00 143.58 ? 198 THR A O   1 
ATOM   964  C  CB  . THR A 1 125 ? 181.558 197.363 26.523  1.00 152.81 ? 198 THR A CB  1 
ATOM   965  O  OG1 . THR A 1 125 ? 180.954 197.843 25.316  1.00 130.83 ? 198 THR A OG1 1 
ATOM   966  C  CG2 . THR A 1 125 ? 182.954 197.956 26.648  1.00 155.03 ? 198 THR A CG2 1 
ATOM   967  N  N   . SER A 1 126 ? 181.768 195.310 28.865  1.00 150.70 ? 199 SER A N   1 
ATOM   968  C  CA  . SER A 1 126 ? 182.381 194.857 30.103  1.00 164.75 ? 199 SER A CA  1 
ATOM   969  C  C   . SER A 1 126 ? 182.019 193.398 30.362  1.00 139.99 ? 199 SER A C   1 
ATOM   970  O  O   . SER A 1 126 ? 181.173 192.806 29.687  1.00 131.24 ? 199 SER A O   1 
ATOM   971  C  CB  . SER A 1 126 ? 181.944 195.736 31.280  1.00 191.76 ? 199 SER A CB  1 
ATOM   972  O  OG  . SER A 1 126 ? 182.372 197.076 31.111  1.00 213.78 ? 199 SER A OG  1 
ATOM   973  N  N   . CYS A 1 127 ? 182.679 192.820 31.367  1.00 141.22 ? 200 CYS A N   1 
ATOM   974  C  CA  . CYS A 1 127 ? 182.453 191.439 31.766  1.00 122.50 ? 200 CYS A CA  1 
ATOM   975  C  C   . CYS A 1 127 ? 181.750 191.331 33.111  1.00 134.03 ? 200 CYS A C   1 
ATOM   976  O  O   . CYS A 1 127 ? 181.402 190.220 33.524  1.00 120.18 ? 200 CYS A O   1 
ATOM   977  C  CB  . CYS A 1 127 ? 183.798 190.694 31.839  1.00 119.51 ? 200 CYS A CB  1 
ATOM   978  S  SG  . CYS A 1 127 ? 184.484 190.117 30.250  1.00 142.21 ? 200 CYS A SG  1 
ATOM   979  N  N   . LYS A 1 128 ? 181.559 192.452 33.810  1.00 176.44 ? 201 LYS A N   1 
ATOM   980  C  CA  . LYS A 1 128 ? 180.920 192.488 35.127  1.00 178.45 ? 201 LYS A CA  1 
ATOM   981  C  C   . LYS A 1 128 ? 179.398 192.504 34.963  1.00 200.53 ? 201 LYS A C   1 
ATOM   982  O  O   . LYS A 1 128 ? 178.712 193.484 35.259  1.00 214.94 ? 201 LYS A O   1 
ATOM   983  C  CB  . LYS A 1 128 ? 181.412 193.687 35.925  1.00 182.81 ? 201 LYS A CB  1 
ATOM   984  N  N   . ASN A 1 129 ? 178.869 191.387 34.468  1.00 188.65 ? 202 ASN A N   1 
ATOM   985  C  CA  . ASN A 1 129 ? 177.434 191.234 34.259  1.00 168.95 ? 202 ASN A CA  1 
ATOM   986  C  C   . ASN A 1 129 ? 176.952 189.967 34.957  1.00 154.72 ? 202 ASN A C   1 
ATOM   987  O  O   . ASN A 1 129 ? 177.730 189.241 35.583  1.00 171.74 ? 202 ASN A O   1 
ATOM   988  C  CB  . ASN A 1 129 ? 177.092 191.190 32.764  1.00 150.84 ? 202 ASN A CB  1 
ATOM   989  C  CG  . ASN A 1 129 ? 177.568 192.421 32.015  1.00 138.62 ? 202 ASN A CG  1 
ATOM   990  O  OD1 . ASN A 1 129 ? 176.858 193.422 31.930  1.00 136.99 ? 202 ASN A OD1 1 
ATOM   991  N  ND2 . ASN A 1 129 ? 178.772 192.347 31.458  1.00 135.07 ? 202 ASN A ND2 1 
ATOM   992  N  N   . SER A 1 130 ? 175.651 189.697 34.841  1.00 124.55 ? 203 SER A N   1 
ATOM   993  C  CA  . SER A 1 130 ? 175.035 188.568 35.528  1.00 130.34 ? 203 SER A CA  1 
ATOM   994  C  C   . SER A 1 130 ? 175.068 187.289 34.705  1.00 142.10 ? 203 SER A C   1 
ATOM   995  O  O   . SER A 1 130 ? 174.681 186.230 35.211  1.00 127.34 ? 203 SER A O   1 
ATOM   996  C  CB  . SER A 1 130 ? 173.585 188.900 35.901  1.00 139.90 ? 203 SER A CB  1 
ATOM   997  O  OG  . SER A 1 130 ? 172.807 189.182 34.750  1.00 135.04 ? 203 SER A OG  1 
ATOM   998  N  N   . TRP A 1 131 ? 175.519 187.367 33.454  1.00 150.84 ? 204 TRP A N   1 
ATOM   999  C  CA  . TRP A 1 131 ? 175.549 186.236 32.542  1.00 154.69 ? 204 TRP A CA  1 
ATOM   1000 C  C   . TRP A 1 131 ? 176.958 185.804 32.171  1.00 134.04 ? 204 TRP A C   1 
ATOM   1001 O  O   . TRP A 1 131 ? 177.137 184.678 31.699  1.00 126.76 ? 204 TRP A O   1 
ATOM   1002 C  CB  . TRP A 1 131 ? 174.767 186.562 31.261  1.00 146.14 ? 204 TRP A CB  1 
ATOM   1003 C  CG  . TRP A 1 131 ? 175.190 187.844 30.616  1.00 129.65 ? 204 TRP A CG  1 
ATOM   1004 C  CD1 . TRP A 1 131 ? 176.202 188.020 29.717  1.00 115.24 ? 204 TRP A CD1 1 
ATOM   1005 C  CD2 . TRP A 1 131 ? 174.611 189.136 30.827  1.00 123.83 ? 204 TRP A CD2 1 
ATOM   1006 N  NE1 . TRP A 1 131 ? 176.287 189.344 29.356  1.00 118.59 ? 204 TRP A NE1 1 
ATOM   1007 C  CE2 . TRP A 1 131 ? 175.320 190.050 30.023  1.00 127.27 ? 204 TRP A CE2 1 
ATOM   1008 C  CE3 . TRP A 1 131 ? 173.561 189.609 31.620  1.00 140.81 ? 204 TRP A CE3 1 
ATOM   1009 C  CZ2 . TRP A 1 131 ? 175.013 191.409 29.988  1.00 134.98 ? 204 TRP A CZ2 1 
ATOM   1010 C  CZ3 . TRP A 1 131 ? 173.257 190.959 31.584  1.00 157.42 ? 204 TRP A CZ3 1 
ATOM   1011 C  CH2 . TRP A 1 131 ? 173.981 191.843 30.774  1.00 154.90 ? 204 TRP A CH2 1 
ATOM   1012 N  N   . ASN A 1 132 ? 177.951 186.664 32.375  1.00 134.99 ? 205 ASN A N   1 
ATOM   1013 C  CA  . ASN A 1 132 ? 179.323 186.331 32.030  1.00 112.18 ? 205 ASN A CA  1 
ATOM   1014 C  C   . ASN A 1 132 ? 179.865 185.250 32.956  1.00 110.75 ? 205 ASN A C   1 
ATOM   1015 O  O   . ASN A 1 132 ? 179.469 185.136 34.119  1.00 111.85 ? 205 ASN A O   1 
ATOM   1016 C  CB  . ASN A 1 132 ? 180.199 187.579 32.099  1.00 116.21 ? 205 ASN A CB  1 
ATOM   1017 C  CG  . ASN A 1 132 ? 179.975 188.511 30.922  1.00 142.41 ? 205 ASN A CG  1 
ATOM   1018 O  OD1 . ASN A 1 132 ? 179.133 189.408 30.974  1.00 128.72 ? 205 ASN A OD1 1 
ATOM   1019 N  ND2 . ASN A 1 132 ? 180.730 188.301 29.854  1.00 151.23 ? 205 ASN A ND2 1 
ATOM   1020 N  N   . THR A 1 133 ? 180.766 184.437 32.416  1.00 108.38 ? 206 THR A N   1 
ATOM   1021 C  CA  . THR A 1 133 ? 181.441 183.383 33.154  1.00 116.65 ? 206 THR A CA  1 
ATOM   1022 C  C   . THR A 1 133 ? 182.796 183.870 33.660  1.00 109.90 ? 206 THR A C   1 
ATOM   1023 O  O   . THR A 1 133 ? 183.138 185.053 33.561  1.00 109.52 ? 206 THR A O   1 
ATOM   1024 C  CB  . THR A 1 133 ? 181.597 182.145 32.273  1.00 118.17 ? 206 THR A CB  1 
ATOM   1025 O  OG1 . THR A 1 133 ? 182.092 182.533 30.984  1.00 109.50 ? 206 THR A OG1 1 
ATOM   1026 C  CG2 . THR A 1 133 ? 180.262 181.441 32.113  1.00 123.08 ? 206 THR A CG2 1 
ATOM   1027 N  N   . GLY A 1 134 ? 183.598 182.940 34.178  1.00 106.30 ? 207 GLY A N   1 
ATOM   1028 C  CA  . GLY A 1 134 ? 184.934 183.303 34.594  1.00 110.44 ? 207 GLY A CA  1 
ATOM   1029 C  C   . GLY A 1 134 ? 185.933 183.358 33.468  1.00 118.43 ? 207 GLY A C   1 
ATOM   1030 O  O   . GLY A 1 134 ? 187.073 183.782 33.680  1.00 136.78 ? 207 GLY A O   1 
ATOM   1031 N  N   . ASN A 1 135 ? 185.550 182.904 32.304  1.00 104.06 ? 208 ASN A N   1 
ATOM   1032 C  CA  . ASN A 1 135 ? 186.395 182.996 31.122  1.00 103.09 ? 208 ASN A CA  1 
ATOM   1033 C  C   . ASN A 1 135 ? 186.341 184.380 30.485  1.00 127.68 ? 208 ASN A C   1 
ATOM   1034 O  O   . ASN A 1 135 ? 187.171 184.707 29.637  1.00 104.69 ? 208 ASN A O   1 
ATOM   1035 C  CB  . ASN A 1 135 ? 185.981 181.954 30.084  1.00 105.89 ? 208 ASN A CB  1 
ATOM   1036 C  CG  . ASN A 1 135 ? 186.397 180.548 30.460  1.00 111.05 ? 208 ASN A CG  1 
ATOM   1037 O  OD1 . ASN A 1 135 ? 187.583 180.217 30.470  1.00 110.55 ? 208 ASN A OD1 1 
ATOM   1038 N  ND2 . ASN A 1 135 ? 185.417 179.705 30.758  1.00 126.32 ? 208 ASN A ND2 1 
ATOM   1039 N  N   . CYS A 1 136 ? 185.359 185.183 30.883  1.00 137.79 ? 209 CYS A N   1 
ATOM   1040 C  CA  . CYS A 1 136 ? 185.127 186.475 30.245  1.00 151.89 ? 209 CYS A CA  1 
ATOM   1041 C  C   . CYS A 1 136 ? 186.324 187.406 30.405  1.00 166.74 ? 209 CYS A C   1 
ATOM   1042 O  O   . CYS A 1 136 ? 186.730 187.734 31.520  1.00 174.40 ? 209 CYS A O   1 
ATOM   1043 C  CB  . CYS A 1 136 ? 183.868 187.136 30.810  1.00 156.41 ? 209 CYS A CB  1 
ATOM   1044 S  SG  . CYS A 1 136 ? 183.229 188.519 29.820  1.00 165.35 ? 209 CYS A SG  1 
ATOM   1045 N  N   . THR A 1 137 ? 186.886 187.819 29.273  1.00 142.94 ? 210 THR A N   1 
ATOM   1046 C  CA  . THR A 1 137 ? 188.000 188.759 29.249  1.00 141.04 ? 210 THR A CA  1 
ATOM   1047 C  C   . THR A 1 137 ? 187.716 189.867 28.237  1.00 148.49 ? 210 THR A C   1 
ATOM   1048 O  O   . THR A 1 137 ? 187.555 189.599 27.048  1.00 139.54 ? 210 THR A O   1 
ATOM   1049 C  CB  . THR A 1 137 ? 189.332 188.067 28.883  1.00 130.79 ? 210 THR A CB  1 
ATOM   1050 O  OG1 . THR A 1 137 ? 189.255 187.552 27.548  1.00 123.90 ? 210 THR A OG1 1 
ATOM   1051 C  CG2 . THR A 1 137 ? 189.637 186.926 29.848  1.00 111.77 ? 210 THR A CG2 1 
ATOM   1052 N  N   . ASN A 1 138 ? 187.701 191.115 28.688  1.00 166.75 ? 211 ASN A N   1 
ATOM   1053 C  CA  . ASN A 1 138 ? 187.408 192.235 27.811  1.00 162.33 ? 211 ASN A CA  1 
ATOM   1054 C  C   . ASN A 1 138 ? 188.644 193.112 27.664  1.00 168.79 ? 211 ASN A C   1 
ATOM   1055 O  O   . ASN A 1 138 ? 189.718 192.815 28.190  1.00 171.84 ? 211 ASN A O   1 
ATOM   1056 C  CB  . ASN A 1 138 ? 186.223 193.043 28.347  1.00 173.34 ? 211 ASN A CB  1 
ATOM   1057 C  CG  . ASN A 1 138 ? 186.542 193.750 29.649  1.00 203.07 ? 211 ASN A CG  1 
ATOM   1058 O  OD1 . ASN A 1 138 ? 187.328 193.258 30.462  1.00 221.42 ? 211 ASN A OD1 1 
ATOM   1059 N  ND2 . ASN A 1 138 ? 185.933 194.911 29.858  1.00 194.25 ? 211 ASN A ND2 1 
ATOM   1060 N  N   . TYR A 1 139 ? 188.481 194.211 26.931  1.00 195.05 ? 212 TYR A N   1 
ATOM   1061 C  CA  . TYR A 1 139 ? 189.535 195.195 26.771  1.00 202.55 ? 212 TYR A CA  1 
ATOM   1062 C  C   . TYR A 1 139 ? 189.282 196.375 27.707  1.00 219.27 ? 212 TYR A C   1 
ATOM   1063 O  O   . TYR A 1 139 ? 188.329 196.382 28.493  1.00 226.42 ? 212 TYR A O   1 
ATOM   1064 C  CB  . TYR A 1 139 ? 189.650 195.618 25.307  1.00 204.07 ? 212 TYR A CB  1 
ATOM   1065 C  CG  . TYR A 1 139 ? 190.392 194.597 24.473  1.00 207.22 ? 212 TYR A CG  1 
ATOM   1066 C  CD1 . TYR A 1 139 ? 189.755 193.453 24.012  1.00 214.16 ? 212 TYR A CD1 1 
ATOM   1067 C  CD2 . TYR A 1 139 ? 191.738 194.766 24.171  1.00 205.26 ? 212 TYR A CD2 1 
ATOM   1068 C  CE1 . TYR A 1 139 ? 190.433 192.512 23.260  1.00 215.62 ? 212 TYR A CE1 1 
ATOM   1069 C  CE2 . TYR A 1 139 ? 192.423 193.832 23.418  1.00 207.69 ? 212 TYR A CE2 1 
ATOM   1070 C  CZ  . TYR A 1 139 ? 191.767 192.706 22.964  1.00 211.98 ? 212 TYR A CZ  1 
ATOM   1071 O  OH  . TYR A 1 139 ? 192.445 191.771 22.215  1.00 211.41 ? 212 TYR A OH  1 
ATOM   1072 N  N   . PHE A 1 140 ? 190.155 197.380 27.624  1.00 227.48 ? 213 PHE A N   1 
ATOM   1073 C  CA  . PHE A 1 140 ? 190.319 198.381 28.681  1.00 226.49 ? 213 PHE A CA  1 
ATOM   1074 C  C   . PHE A 1 140 ? 190.681 197.703 30.001  1.00 211.24 ? 213 PHE A C   1 
ATOM   1075 O  O   . PHE A 1 140 ? 190.395 198.217 31.086  1.00 216.36 ? 213 PHE A O   1 
ATOM   1076 C  CB  . PHE A 1 140 ? 189.073 199.263 28.833  1.00 223.23 ? 213 PHE A CB  1 
ATOM   1077 C  CG  . PHE A 1 140 ? 189.323 200.544 29.581  1.00 211.44 ? 213 PHE A CG  1 
ATOM   1078 C  CD1 . PHE A 1 140 ? 190.122 201.535 29.036  1.00 210.51 ? 213 PHE A CD1 1 
ATOM   1079 C  CD2 . PHE A 1 140 ? 188.750 200.761 30.826  1.00 200.64 ? 213 PHE A CD2 1 
ATOM   1080 C  CE1 . PHE A 1 140 ? 190.354 202.713 29.719  1.00 207.12 ? 213 PHE A CE1 1 
ATOM   1081 C  CE2 . PHE A 1 140 ? 188.979 201.939 31.513  1.00 192.79 ? 213 PHE A CE2 1 
ATOM   1082 C  CZ  . PHE A 1 140 ? 189.782 202.917 30.957  1.00 200.09 ? 213 PHE A CZ  1 
ATOM   1083 N  N   . SER A 1 141 ? 191.312 196.541 29.898  1.00 205.51 ? 214 SER A N   1 
ATOM   1084 C  CA  . SER A 1 141 ? 191.753 195.719 31.013  1.00 208.06 ? 214 SER A CA  1 
ATOM   1085 C  C   . SER A 1 141 ? 193.278 195.639 30.992  1.00 239.49 ? 214 SER A C   1 
ATOM   1086 O  O   . SER A 1 141 ? 193.946 196.345 30.229  1.00 252.59 ? 214 SER A O   1 
ATOM   1087 C  CB  . SER A 1 141 ? 191.107 194.332 30.947  1.00 170.02 ? 214 SER A CB  1 
ATOM   1088 O  OG  . SER A 1 141 ? 191.552 193.509 32.011  1.00 144.93 ? 214 SER A OG  1 
ATOM   1089 N  N   . GLU A 1 142 ? 193.826 194.792 31.861  1.00 263.51 ? 215 GLU A N   1 
ATOM   1090 C  CA  . GLU A 1 142 ? 195.266 194.571 31.903  1.00 280.98 ? 215 GLU A CA  1 
ATOM   1091 C  C   . GLU A 1 142 ? 195.795 194.193 30.525  1.00 277.81 ? 215 GLU A C   1 
ATOM   1092 O  O   . GLU A 1 142 ? 195.129 193.500 29.754  1.00 266.42 ? 215 GLU A O   1 
ATOM   1093 C  CB  . GLU A 1 142 ? 195.595 193.470 32.913  1.00 287.39 ? 215 GLU A CB  1 
ATOM   1094 C  CG  . GLU A 1 142 ? 194.849 192.165 32.659  1.00 291.03 ? 215 GLU A CG  1 
ATOM   1095 C  CD  . GLU A 1 142 ? 195.222 191.071 33.637  1.00 295.27 ? 215 GLU A CD  1 
ATOM   1096 O  OE1 . GLU A 1 142 ? 196.113 191.302 34.482  1.00 299.38 ? 215 GLU A OE1 1 
ATOM   1097 O  OE2 . GLU A 1 142 ? 194.623 189.979 33.563  1.00 293.89 ? 215 GLU A OE2 1 
ATOM   1098 N  N   . ASP A 1 143 ? 196.993 194.678 30.209  1.00 287.23 ? 216 ASP A N   1 
ATOM   1099 C  CA  . ASP A 1 143 ? 197.643 194.340 28.953  1.00 283.28 ? 216 ASP A CA  1 
ATOM   1100 C  C   . ASP A 1 143 ? 198.301 192.965 29.073  1.00 277.93 ? 216 ASP A C   1 
ATOM   1101 O  O   . ASP A 1 143 ? 198.158 192.266 30.080  1.00 287.10 ? 216 ASP A O   1 
ATOM   1102 C  CB  . ASP A 1 143 ? 198.647 195.426 28.575  1.00 279.29 ? 216 ASP A CB  1 
ATOM   1103 C  CG  . ASP A 1 143 ? 199.022 195.395 27.104  1.00 274.00 ? 216 ASP A CG  1 
ATOM   1104 O  OD1 . ASP A 1 143 ? 198.394 194.628 26.345  1.00 269.18 ? 216 ASP A OD1 1 
ATOM   1105 O  OD2 . ASP A 1 143 ? 199.939 196.143 26.706  1.00 273.66 ? 216 ASP A OD2 1 
ATOM   1106 N  N   . ASN A 1 144 ? 199.016 192.557 28.021  1.00 253.87 ? 217 ASN A N   1 
ATOM   1107 C  CA  . ASN A 1 144 ? 199.770 191.311 27.928  1.00 236.48 ? 217 ASN A CA  1 
ATOM   1108 C  C   . ASN A 1 144 ? 198.867 190.079 27.867  1.00 210.58 ? 217 ASN A C   1 
ATOM   1109 O  O   . ASN A 1 144 ? 199.375 188.964 27.673  1.00 213.34 ? 217 ASN A O   1 
ATOM   1110 C  CB  . ASN A 1 144 ? 200.795 191.175 29.072  1.00 240.20 ? 217 ASN A CB  1 
ATOM   1111 C  CG  . ASN A 1 144 ? 200.525 189.989 29.990  1.00 269.96 ? 217 ASN A CG  1 
ATOM   1112 O  OD1 . ASN A 1 144 ? 199.550 189.975 30.745  1.00 269.70 ? 217 ASN A OD1 1 
ATOM   1113 N  ND2 . ASN A 1 144 ? 201.403 188.990 29.928  1.00 305.08 ? 217 ASN A ND2 1 
ATOM   1114 N  N   . ILE A 1 145 ? 197.535 190.268 28.000  1.00 181.15 ? 218 ILE A N   1 
ATOM   1115 C  CA  . ILE A 1 145 ? 196.615 189.139 28.107  1.00 162.57 ? 218 ILE A CA  1 
ATOM   1116 C  C   . ILE A 1 145 ? 196.793 188.190 26.930  1.00 144.18 ? 218 ILE A C   1 
ATOM   1117 O  O   . ILE A 1 145 ? 197.083 188.606 25.801  1.00 144.46 ? 218 ILE A O   1 
ATOM   1118 C  CB  . ILE A 1 145 ? 195.156 189.627 28.202  1.00 163.85 ? 218 ILE A CB  1 
ATOM   1119 C  CG1 . ILE A 1 145 ? 194.755 190.420 26.950  1.00 155.49 ? 218 ILE A CG1 1 
ATOM   1120 C  CG2 . ILE A 1 145 ? 194.952 190.418 29.481  1.00 180.93 ? 218 ILE A CG2 1 
ATOM   1121 C  CD1 . ILE A 1 145 ? 193.278 190.763 26.845  1.00 148.83 ? 218 ILE A CD1 1 
ATOM   1122 N  N   . THR A 1 146 ? 196.678 186.941 27.275  1.00 129.24 ? 219 THR A N   1 
ATOM   1123 C  CA  . THR A 1 146 ? 196.829 185.908 26.258  1.00 105.54 ? 219 THR A CA  1 
ATOM   1124 C  C   . THR A 1 146 ? 195.599 185.015 26.239  1.00 124.66 ? 219 THR A C   1 
ATOM   1125 O  O   . THR A 1 146 ? 195.157 184.538 27.290  1.00 103.34 ? 219 THR A O   1 
ATOM   1126 C  CB  . THR A 1 146 ? 198.086 185.070 26.498  1.00 127.35 ? 219 THR A CB  1 
ATOM   1127 O  OG1 . THR A 1 146 ? 197.950 184.342 27.722  1.00 129.94 ? 219 THR A OG1 1 
ATOM   1128 C  CG2 . THR A 1 146 ? 199.305 185.973 26.585  1.00 106.79 ? 219 THR A CG2 1 
ATOM   1129 N  N   . TRP A 1 147 ? 195.120 184.744 25.012  1.00 119.96 ? 220 TRP A N   1 
ATOM   1130 C  CA  . TRP A 1 147 ? 193.877 183.999 24.872  1.00 119.81 ? 220 TRP A CA  1 
ATOM   1131 C  C   . TRP A 1 147 ? 194.100 182.506 25.083  1.00 123.78 ? 220 TRP A C   1 
ATOM   1132 O  O   . TRP A 1 147 ? 195.126 181.947 24.685  1.00 121.37 ? 220 TRP A O   1 
ATOM   1133 C  CB  . TRP A 1 147 ? 193.272 184.236 23.493  1.00 116.13 ? 220 TRP A CB  1 
ATOM   1134 C  CG  . TRP A 1 147 ? 191.788 184.107 23.462  1.00 122.86 ? 220 TRP A CG  1 
ATOM   1135 C  CD1 . TRP A 1 147 ? 191.071 182.996 23.132  1.00 146.12 ? 220 TRP A CD1 1 
ATOM   1136 C  CD2 . TRP A 1 147 ? 190.832 185.126 23.768  1.00 135.48 ? 220 TRP A CD2 1 
ATOM   1137 N  NE1 . TRP A 1 147 ? 189.726 183.260 23.212  1.00 154.53 ? 220 TRP A NE1 1 
ATOM   1138 C  CE2 . TRP A 1 147 ? 189.553 184.562 23.601  1.00 151.86 ? 220 TRP A CE2 1 
ATOM   1139 C  CE3 . TRP A 1 147 ? 190.933 186.463 24.166  1.00 144.93 ? 220 TRP A CE3 1 
ATOM   1140 C  CZ2 . TRP A 1 147 ? 188.383 185.286 23.819  1.00 145.44 ? 220 TRP A CZ2 1 
ATOM   1141 C  CZ3 . TRP A 1 147 ? 189.771 187.179 24.382  1.00 152.07 ? 220 TRP A CZ3 1 
ATOM   1142 C  CH2 . TRP A 1 147 ? 188.514 186.590 24.209  1.00 152.16 ? 220 TRP A CH2 1 
ATOM   1143 N  N   . THR A 1 148 ? 193.122 181.864 25.712  1.00 114.16 ? 221 THR A N   1 
ATOM   1144 C  CA  . THR A 1 148 ? 193.175 180.455 26.061  1.00 107.60 ? 221 THR A CA  1 
ATOM   1145 C  C   . THR A 1 148 ? 192.067 179.721 25.313  1.00 100.94 ? 221 THR A C   1 
ATOM   1146 O  O   . THR A 1 148 ? 191.115 180.331 24.819  1.00 101.24 ? 221 THR A O   1 
ATOM   1147 C  CB  . THR A 1 148 ? 193.043 180.262 27.581  1.00 111.36 ? 221 THR A CB  1 
ATOM   1148 O  OG1 . THR A 1 148 ? 193.816 181.264 28.252  1.00 121.38 ? 221 THR A OG1 1 
ATOM   1149 C  CG2 . THR A 1 148 ? 193.551 178.902 28.011  1.00 95.01  ? 221 THR A CG2 1 
ATOM   1150 N  N   . LEU A 1 149 ? 192.215 178.396 25.214  1.00 92.56  ? 222 LEU A N   1 
ATOM   1151 C  CA  . LEU A 1 149 ? 191.232 177.574 24.512  1.00 100.24 ? 222 LEU A CA  1 
ATOM   1152 C  C   . LEU A 1 149 ? 189.832 177.715 25.096  1.00 116.23 ? 222 LEU A C   1 
ATOM   1153 O  O   . LEU A 1 149 ? 188.843 177.509 24.384  1.00 123.22 ? 222 LEU A O   1 
ATOM   1154 C  CB  . LEU A 1 149 ? 191.658 176.109 24.536  1.00 98.36  ? 222 LEU A CB  1 
ATOM   1155 C  CG  . LEU A 1 149 ? 192.689 175.705 23.489  1.00 100.33 ? 222 LEU A CG  1 
ATOM   1156 C  CD1 . LEU A 1 149 ? 193.150 174.281 23.742  1.00 114.92 ? 222 LEU A CD1 1 
ATOM   1157 C  CD2 . LEU A 1 149 ? 192.094 175.841 22.100  1.00 109.50 ? 222 LEU A CD2 1 
ATOM   1158 N  N   . HIS A 1 150 ? 189.721 178.052 26.378  1.00 106.76 ? 223 HIS A N   1 
ATOM   1159 C  CA  . HIS A 1 150 ? 188.423 178.162 27.026  1.00 99.54  ? 223 HIS A CA  1 
ATOM   1160 C  C   . HIS A 1 150 ? 187.965 179.604 27.193  1.00 120.25 ? 223 HIS A C   1 
ATOM   1161 O  O   . HIS A 1 150 ? 186.809 179.830 27.564  1.00 136.30 ? 223 HIS A O   1 
ATOM   1162 C  CB  . HIS A 1 150 ? 188.466 177.486 28.402  1.00 117.28 ? 223 HIS A CB  1 
ATOM   1163 C  CG  . HIS A 1 150 ? 188.766 176.021 28.350  1.00 134.64 ? 223 HIS A CG  1 
ATOM   1164 N  ND1 . HIS A 1 150 ? 188.011 175.131 27.616  1.00 147.43 ? 223 HIS A ND1 1 
ATOM   1165 C  CD2 . HIS A 1 150 ? 189.738 175.288 28.944  1.00 126.56 ? 223 HIS A CD2 1 
ATOM   1166 C  CE1 . HIS A 1 150 ? 188.505 173.914 27.760  1.00 135.78 ? 223 HIS A CE1 1 
ATOM   1167 N  NE2 . HIS A 1 150 ? 189.554 173.982 28.560  1.00 126.63 ? 223 HIS A NE2 1 
ATOM   1168 N  N   . SER A 1 151 ? 188.830 180.572 26.904  1.00 96.20  ? 224 SER A N   1 
ATOM   1169 C  CA  . SER A 1 151 ? 188.505 181.980 27.081  1.00 98.42  ? 224 SER A CA  1 
ATOM   1170 C  C   . SER A 1 151 ? 187.461 182.440 26.070  1.00 128.01 ? 224 SER A C   1 
ATOM   1171 O  O   . SER A 1 151 ? 187.400 181.954 24.937  1.00 122.28 ? 224 SER A O   1 
ATOM   1172 C  CB  . SER A 1 151 ? 189.764 182.838 26.957  1.00 100.07 ? 224 SER A CB  1 
ATOM   1173 O  OG  . SER A 1 151 ? 190.635 182.621 28.054  1.00 127.68 ? 224 SER A OG  1 
ATOM   1174 N  N   . THR A 1 152 ? 186.607 183.365 26.510  1.00 113.41 ? 225 THR A N   1 
ATOM   1175 C  CA  . THR A 1 152 ? 185.569 183.948 25.672  1.00 111.33 ? 225 THR A CA  1 
ATOM   1176 C  C   . THR A 1 152 ? 185.574 185.460 25.861  1.00 114.17 ? 225 THR A C   1 
ATOM   1177 O  O   . THR A 1 152 ? 186.106 185.982 26.844  1.00 115.81 ? 225 THR A O   1 
ATOM   1178 C  CB  . THR A 1 152 ? 184.183 183.380 26.003  1.00 135.17 ? 225 THR A CB  1 
ATOM   1179 O  OG1 . THR A 1 152 ? 183.947 183.486 27.413  1.00 146.91 ? 225 THR A OG1 1 
ATOM   1180 C  CG2 . THR A 1 152 ? 184.093 181.917 25.591  1.00 140.95 ? 225 THR A CG2 1 
ATOM   1181 N  N   . SER A 1 153 ? 184.966 186.178 24.878  1.00 115.00 ? 226 SER A N   1 
ATOM   1182 C  CA  . SER A 1 153 ? 184.863 187.631 24.841  1.00 114.11 ? 226 SER A CA  1 
ATOM   1183 C  C   . SER A 1 153 ? 183.499 188.107 25.333  1.00 111.88 ? 226 SER A C   1 
ATOM   1184 O  O   . SER A 1 153 ? 182.506 187.382 25.226  1.00 129.33 ? 226 SER A O   1 
ATOM   1185 C  CB  . SER A 1 153 ? 185.101 188.152 23.419  1.00 107.91 ? 226 SER A CB  1 
ATOM   1186 O  OG  . SER A 1 153 ? 184.137 187.647 22.513  1.00 130.66 ? 226 SER A OG  1 
ATOM   1187 N  N   . PRO A 1 154 ? 183.439 189.312 25.915  1.00 114.93 ? 227 PRO A N   1 
ATOM   1188 C  CA  . PRO A 1 154 ? 182.155 189.816 26.437  1.00 125.78 ? 227 PRO A CA  1 
ATOM   1189 C  C   . PRO A 1 154 ? 181.056 189.875 25.392  1.00 133.36 ? 227 PRO A C   1 
ATOM   1190 O  O   . PRO A 1 154 ? 179.876 189.752 25.742  1.00 113.50 ? 227 PRO A O   1 
ATOM   1191 C  CB  . PRO A 1 154 ? 182.509 191.218 26.954  1.00 127.37 ? 227 PRO A CB  1 
ATOM   1192 C  CG  . PRO A 1 154 ? 183.812 191.560 26.296  1.00 136.32 ? 227 PRO A CG  1 
ATOM   1193 C  CD  . PRO A 1 154 ? 184.535 190.262 26.156  1.00 134.63 ? 227 PRO A CD  1 
ATOM   1194 N  N   . ALA A 1 155 ? 181.405 190.069 24.118  1.00 126.96 ? 228 ALA A N   1 
ATOM   1195 C  CA  . ALA A 1 155 ? 180.398 190.046 23.062  1.00 125.96 ? 228 ALA A CA  1 
ATOM   1196 C  C   . ALA A 1 155 ? 179.890 188.629 22.834  1.00 132.69 ? 228 ALA A C   1 
ATOM   1197 O  O   . ALA A 1 155 ? 178.677 188.390 22.784  1.00 152.67 ? 228 ALA A O   1 
ATOM   1198 C  CB  . ALA A 1 155 ? 180.977 190.629 21.773  1.00 128.51 ? 228 ALA A CB  1 
ATOM   1199 N  N   . GLU A 1 156 ? 180.814 187.676 22.687  1.00 129.93 ? 229 GLU A N   1 
ATOM   1200 C  CA  . GLU A 1 156 ? 180.437 186.274 22.550  1.00 127.42 ? 229 GLU A CA  1 
ATOM   1201 C  C   . GLU A 1 156 ? 179.652 185.805 23.768  1.00 105.21 ? 229 GLU A C   1 
ATOM   1202 O  O   . GLU A 1 156 ? 178.694 185.033 23.644  1.00 104.20 ? 229 GLU A O   1 
ATOM   1203 C  CB  . GLU A 1 156 ? 181.692 185.424 22.346  1.00 142.99 ? 229 GLU A CB  1 
ATOM   1204 C  CG  . GLU A 1 156 ? 181.463 183.925 22.306  1.00 145.00 ? 229 GLU A CG  1 
ATOM   1205 C  CD  . GLU A 1 156 ? 182.766 183.146 22.331  1.00 147.16 ? 229 GLU A CD  1 
ATOM   1206 O  OE1 . GLU A 1 156 ? 183.837 183.785 22.418  1.00 137.08 ? 229 GLU A OE1 1 
ATOM   1207 O  OE2 . GLU A 1 156 ? 182.721 181.898 22.266  1.00 151.76 ? 229 GLU A OE2 1 
ATOM   1208 N  N   . GLU A 1 157 ? 180.050 186.261 24.957  1.00 106.20 ? 230 GLU A N   1 
ATOM   1209 C  CA  . GLU A 1 157 ? 179.323 185.912 26.173  1.00 125.05 ? 230 GLU A CA  1 
ATOM   1210 C  C   . GLU A 1 157 ? 177.924 186.516 26.165  1.00 118.81 ? 230 GLU A C   1 
ATOM   1211 O  O   . GLU A 1 157 ? 176.960 185.872 26.598  1.00 121.21 ? 230 GLU A O   1 
ATOM   1212 C  CB  . GLU A 1 157 ? 180.105 186.394 27.396  1.00 140.52 ? 230 GLU A CB  1 
ATOM   1213 C  CG  . GLU A 1 157 ? 181.381 185.617 27.708  1.00 116.36 ? 230 GLU A CG  1 
ATOM   1214 C  CD  . GLU A 1 157 ? 181.134 184.402 28.576  1.00 117.49 ? 230 GLU A CD  1 
ATOM   1215 O  OE1 . GLU A 1 157 ? 180.325 184.505 29.521  1.00 126.81 ? 230 GLU A OE1 1 
ATOM   1216 O  OE2 . GLU A 1 157 ? 181.750 183.346 28.320  1.00 115.81 ? 230 GLU A OE2 1 
ATOM   1217 N  N   . PHE A 1 158 ? 177.794 187.751 25.670  1.00 138.73 ? 231 PHE A N   1 
ATOM   1218 C  CA  . PHE A 1 158 ? 176.501 188.430 25.663  1.00 145.62 ? 231 PHE A CA  1 
ATOM   1219 C  C   . PHE A 1 158 ? 175.535 187.780 24.682  1.00 131.04 ? 231 PHE A C   1 
ATOM   1220 O  O   . PHE A 1 158 ? 174.351 187.606 24.990  1.00 111.97 ? 231 PHE A O   1 
ATOM   1221 C  CB  . PHE A 1 158 ? 176.691 189.908 25.321  1.00 161.99 ? 231 PHE A CB  1 
ATOM   1222 C  CG  . PHE A 1 158 ? 175.419 190.711 25.348  1.00 164.46 ? 231 PHE A CG  1 
ATOM   1223 C  CD1 . PHE A 1 158 ? 174.785 190.991 26.546  1.00 172.03 ? 231 PHE A CD1 1 
ATOM   1224 C  CD2 . PHE A 1 158 ? 174.862 191.192 24.174  1.00 143.64 ? 231 PHE A CD2 1 
ATOM   1225 C  CE1 . PHE A 1 158 ? 173.617 191.733 26.573  1.00 172.00 ? 231 PHE A CE1 1 
ATOM   1226 C  CE2 . PHE A 1 158 ? 173.694 191.933 24.197  1.00 155.54 ? 231 PHE A CE2 1 
ATOM   1227 C  CZ  . PHE A 1 158 ? 173.072 192.204 25.397  1.00 161.08 ? 231 PHE A CZ  1 
ATOM   1228 N  N   . TYR A 1 159 ? 176.026 187.391 23.505  1.00 132.99 ? 232 TYR A N   1 
ATOM   1229 C  CA  . TYR A 1 159 ? 175.170 186.717 22.536  1.00 122.25 ? 232 TYR A CA  1 
ATOM   1230 C  C   . TYR A 1 159 ? 174.828 185.311 23.011  1.00 124.40 ? 232 TYR A C   1 
ATOM   1231 O  O   . TYR A 1 159 ? 173.663 184.898 22.988  1.00 133.40 ? 232 TYR A O   1 
ATOM   1232 C  CB  . TYR A 1 159 ? 175.849 186.679 21.166  1.00 118.68 ? 232 TYR A CB  1 
ATOM   1233 C  CG  . TYR A 1 159 ? 175.001 186.059 20.076  1.00 128.27 ? 232 TYR A CG  1 
ATOM   1234 C  CD1 . TYR A 1 159 ? 173.618 186.180 20.092  1.00 136.26 ? 232 TYR A CD1 1 
ATOM   1235 C  CD2 . TYR A 1 159 ? 175.582 185.354 19.030  1.00 128.16 ? 232 TYR A CD2 1 
ATOM   1236 C  CE1 . TYR A 1 159 ? 172.837 185.616 19.101  1.00 126.48 ? 232 TYR A CE1 1 
ATOM   1237 C  CE2 . TYR A 1 159 ? 174.806 184.787 18.032  1.00 122.54 ? 232 TYR A CE2 1 
ATOM   1238 C  CZ  . TYR A 1 159 ? 173.436 184.922 18.075  1.00 125.25 ? 232 TYR A CZ  1 
ATOM   1239 O  OH  . TYR A 1 159 ? 172.659 184.362 17.090  1.00 141.65 ? 232 TYR A OH  1 
ATOM   1240 N  N   . THR A 1 160 ? 175.842 184.564 23.441  1.00 104.37 ? 233 THR A N   1 
ATOM   1241 C  CA  . THR A 1 160 ? 175.666 183.155 23.768  1.00 113.83 ? 233 THR A CA  1 
ATOM   1242 C  C   . THR A 1 160 ? 174.806 182.962 25.015  1.00 129.60 ? 233 THR A C   1 
ATOM   1243 O  O   . THR A 1 160 ? 173.874 182.149 25.014  1.00 135.12 ? 233 THR A O   1 
ATOM   1244 C  CB  . THR A 1 160 ? 177.037 182.503 23.948  1.00 123.95 ? 233 THR A CB  1 
ATOM   1245 O  OG1 . THR A 1 160 ? 177.750 182.542 22.706  1.00 120.14 ? 233 THR A OG1 1 
ATOM   1246 C  CG2 . THR A 1 160 ? 176.899 181.060 24.399  1.00 139.14 ? 233 THR A CG2 1 
ATOM   1247 N  N   . ARG A 1 161 ? 175.097 183.698 26.089  1.00 133.74 ? 234 ARG A N   1 
ATOM   1248 C  CA  . ARG A 1 161 ? 174.511 183.402 27.392  1.00 124.30 ? 234 ARG A CA  1 
ATOM   1249 C  C   . ARG A 1 161 ? 173.372 184.325 27.814  1.00 108.77 ? 234 ARG A C   1 
ATOM   1250 O  O   . ARG A 1 161 ? 172.704 184.026 28.809  1.00 109.58 ? 234 ARG A O   1 
ATOM   1251 C  CB  . ARG A 1 161 ? 175.601 183.451 28.470  1.00 115.30 ? 234 ARG A CB  1 
ATOM   1252 C  CG  . ARG A 1 161 ? 176.726 182.463 28.253  1.00 110.61 ? 234 ARG A CG  1 
ATOM   1253 C  CD  . ARG A 1 161 ? 177.689 182.465 29.423  1.00 122.10 ? 234 ARG A CD  1 
ATOM   1254 N  NE  . ARG A 1 161 ? 177.030 182.094 30.671  1.00 104.88 ? 234 ARG A NE  1 
ATOM   1255 C  CZ  . ARG A 1 161 ? 176.892 180.843 31.096  1.00 103.32 ? 234 ARG A CZ  1 
ATOM   1256 N  NH1 . ARG A 1 161 ? 176.279 180.595 32.246  1.00 127.51 ? 234 ARG A NH1 1 
ATOM   1257 N  NH2 . ARG A 1 161 ? 177.359 179.840 30.366  1.00 100.90 ? 234 ARG A NH2 1 
ATOM   1258 N  N   . HIS A 1 162 ? 173.130 185.431 27.114  1.00 110.38 ? 235 HIS A N   1 
ATOM   1259 C  CA  . HIS A 1 162 ? 172.090 186.375 27.518  1.00 150.23 ? 235 HIS A CA  1 
ATOM   1260 C  C   . HIS A 1 162 ? 170.905 186.356 26.562  1.00 135.92 ? 235 HIS A C   1 
ATOM   1261 O  O   . HIS A 1 162 ? 169.816 185.910 26.935  1.00 142.10 ? 235 HIS A O   1 
ATOM   1262 C  CB  . HIS A 1 162 ? 172.662 187.787 27.647  1.00 133.69 ? 235 HIS A CB  1 
ATOM   1263 C  CG  . HIS A 1 162 ? 171.691 188.772 28.217  1.00 122.82 ? 235 HIS A CG  1 
ATOM   1264 N  ND1 . HIS A 1 162 ? 171.186 188.661 29.494  1.00 126.55 ? 235 HIS A ND1 1 
ATOM   1265 C  CD2 . HIS A 1 162 ? 171.120 189.875 27.680  1.00 129.33 ? 235 HIS A CD2 1 
ATOM   1266 C  CE1 . HIS A 1 162 ? 170.353 189.660 29.723  1.00 145.77 ? 235 HIS A CE1 1 
ATOM   1267 N  NE2 . HIS A 1 162 ? 170.294 190.411 28.637  1.00 148.73 ? 235 HIS A NE2 1 
ATOM   1268 N  N   . VAL A 1 163 ? 171.080 186.837 25.330  1.00 134.88 ? 236 VAL A N   1 
ATOM   1269 C  CA  . VAL A 1 163 ? 169.955 186.939 24.406  1.00 113.77 ? 236 VAL A CA  1 
ATOM   1270 C  C   . VAL A 1 163 ? 169.578 185.564 23.865  1.00 111.14 ? 236 VAL A C   1 
ATOM   1271 O  O   . VAL A 1 163 ? 168.422 185.139 23.966  1.00 159.75 ? 236 VAL A O   1 
ATOM   1272 C  CB  . VAL A 1 163 ? 170.259 187.962 23.293  1.00 114.68 ? 236 VAL A CB  1 
ATOM   1273 C  CG1 . VAL A 1 163 ? 171.449 187.552 22.446  1.00 112.30 ? 236 VAL A CG1 1 
ATOM   1274 C  CG2 . VAL A 1 163 ? 169.038 188.133 22.406  1.00 152.64 ? 236 VAL A CG2 1 
ATOM   1275 N  N   . LEU A 1 164 ? 170.539 184.848 23.286  1.00 108.60 ? 237 LEU A N   1 
ATOM   1276 C  CA  . LEU A 1 164 ? 170.247 183.520 22.762  1.00 106.17 ? 237 LEU A CA  1 
ATOM   1277 C  C   . LEU A 1 164 ? 170.057 182.517 23.892  1.00 114.69 ? 237 LEU A C   1 
ATOM   1278 O  O   . LEU A 1 164 ? 169.164 181.664 23.827  1.00 104.74 ? 237 LEU A O   1 
ATOM   1279 C  CB  . LEU A 1 164 ? 171.357 183.073 21.814  1.00 103.90 ? 237 LEU A CB  1 
ATOM   1280 C  CG  . LEU A 1 164 ? 171.123 181.753 21.082  1.00 107.34 ? 237 LEU A CG  1 
ATOM   1281 C  CD1 . LEU A 1 164 ? 169.824 181.800 20.290  1.00 102.14 ? 237 LEU A CD1 1 
ATOM   1282 C  CD2 . LEU A 1 164 ? 172.298 181.456 20.169  1.00 107.62 ? 237 LEU A CD2 1 
ATOM   1283 N  N   . GLN A 1 165 ? 170.885 182.616 24.939  1.00 106.69 ? 238 GLN A N   1 
ATOM   1284 C  CA  . GLN A 1 165 ? 170.817 181.732 26.106  1.00 114.41 ? 238 GLN A CA  1 
ATOM   1285 C  C   . GLN A 1 165 ? 170.980 180.274 25.690  1.00 127.48 ? 238 GLN A C   1 
ATOM   1286 O  O   . GLN A 1 165 ? 170.290 179.381 26.189  1.00 120.09 ? 238 GLN A O   1 
ATOM   1287 C  CB  . GLN A 1 165 ? 169.521 181.927 26.897  1.00 127.40 ? 238 GLN A CB  1 
ATOM   1288 C  CG  . GLN A 1 165 ? 169.653 181.589 28.378  1.00 160.32 ? 238 GLN A CG  1 
ATOM   1289 C  CD  . GLN A 1 165 ? 168.479 182.079 29.203  1.00 168.57 ? 238 GLN A CD  1 
ATOM   1290 O  OE1 . GLN A 1 165 ? 167.552 182.698 28.678  1.00 169.67 ? 238 GLN A OE1 1 
ATOM   1291 N  NE2 . GLN A 1 165 ? 168.512 181.802 30.505  1.00 159.90 ? 238 GLN A NE2 1 
ATOM   1292 N  N   . ILE A 1 166 ? 171.933 180.028 24.787  1.00 120.74 ? 239 ILE A N   1 
ATOM   1293 C  CA  . ILE A 1 166 ? 172.091 178.703 24.193  1.00 99.11  ? 239 ILE A CA  1 
ATOM   1294 C  C   . ILE A 1 166 ? 172.826 177.754 25.120  1.00 120.42 ? 239 ILE A C   1 
ATOM   1295 O  O   . ILE A 1 166 ? 172.880 176.548 24.848  1.00 143.36 ? 239 ILE A O   1 
ATOM   1296 C  CB  . ILE A 1 166 ? 172.814 178.826 22.838  1.00 96.86  ? 239 ILE A CB  1 
ATOM   1297 C  CG1 . ILE A 1 166 ? 172.515 177.621 21.942  1.00 94.85  ? 239 ILE A CG1 1 
ATOM   1298 C  CG2 . ILE A 1 166 ? 174.307 179.005 23.046  1.00 136.95 ? 239 ILE A CG2 1 
ATOM   1299 C  CD1 . ILE A 1 166 ? 173.079 177.751 20.543  1.00 93.87  ? 239 ILE A CD1 1 
ATOM   1300 N  N   . HIS A 1 167 ? 173.374 178.260 26.223  1.00 101.41 ? 240 HIS A N   1 
ATOM   1301 C  CA  . HIS A 1 167 ? 174.070 177.415 27.179  1.00 110.01 ? 240 HIS A CA  1 
ATOM   1302 C  C   . HIS A 1 167 ? 173.107 176.602 28.030  1.00 97.18  ? 240 HIS A C   1 
ATOM   1303 O  O   . HIS A 1 167 ? 173.547 175.699 28.750  1.00 114.55 ? 240 HIS A O   1 
ATOM   1304 C  CB  . HIS A 1 167 ? 174.974 178.265 28.075  1.00 129.27 ? 240 HIS A CB  1 
ATOM   1305 C  CG  . HIS A 1 167 ? 174.224 179.126 29.041  1.00 100.73 ? 240 HIS A CG  1 
ATOM   1306 N  ND1 . HIS A 1 167 ? 173.640 180.319 28.673  1.00 105.75 ? 240 HIS A ND1 1 
ATOM   1307 C  CD2 . HIS A 1 167 ? 173.958 178.967 30.359  1.00 104.95 ? 240 HIS A CD2 1 
ATOM   1308 C  CE1 . HIS A 1 167 ? 173.048 180.858 29.723  1.00 127.50 ? 240 HIS A CE1 1 
ATOM   1309 N  NE2 . HIS A 1 167 ? 173.226 180.058 30.759  1.00 122.03 ? 240 HIS A NE2 1 
ATOM   1310 N  N   . ARG A 1 168 ? 171.810 176.891 27.951  1.00 99.53  ? 241 ARG A N   1 
ATOM   1311 C  CA  . ARG A 1 168 ? 170.795 176.228 28.756  1.00 107.00 ? 241 ARG A CA  1 
ATOM   1312 C  C   . ARG A 1 168 ? 170.227 174.997 28.063  1.00 121.38 ? 241 ARG A C   1 
ATOM   1313 O  O   . ARG A 1 168 ? 169.376 174.310 28.639  1.00 127.67 ? 241 ARG A O   1 
ATOM   1314 C  CB  . ARG A 1 168 ? 169.665 177.212 29.076  1.00 102.68 ? 241 ARG A CB  1 
ATOM   1315 C  CG  . ARG A 1 168 ? 168.899 176.920 30.356  1.00 110.63 ? 241 ARG A CG  1 
ATOM   1316 C  CD  . ARG A 1 168 ? 168.435 178.207 31.016  1.00 108.88 ? 241 ARG A CD  1 
ATOM   1317 N  NE  . ARG A 1 168 ? 167.552 177.951 32.149  1.00 142.59 ? 241 ARG A NE  1 
ATOM   1318 C  CZ  . ARG A 1 168 ? 167.210 178.865 33.050  1.00 164.50 ? 241 ARG A CZ  1 
ATOM   1319 N  NH1 . ARG A 1 168 ? 167.687 180.099 32.958  1.00 160.51 ? 241 ARG A NH1 1 
ATOM   1320 N  NH2 . ARG A 1 168 ? 166.398 178.544 34.048  1.00 186.10 ? 241 ARG A NH2 1 
ATOM   1321 N  N   . SER A 1 169 ? 170.692 174.699 26.853  1.00 132.61 ? 242 SER A N   1 
ATOM   1322 C  CA  . SER A 1 169 ? 170.254 173.546 26.085  1.00 122.24 ? 242 SER A CA  1 
ATOM   1323 C  C   . SER A 1 169 ? 171.464 172.702 25.710  1.00 119.52 ? 242 SER A C   1 
ATOM   1324 O  O   . SER A 1 169 ? 172.575 173.217 25.551  1.00 121.15 ? 242 SER A O   1 
ATOM   1325 C  CB  . SER A 1 169 ? 169.503 173.974 24.821  1.00 109.04 ? 242 SER A CB  1 
ATOM   1326 O  OG  . SER A 1 169 ? 170.368 174.650 23.927  1.00 109.18 ? 242 SER A OG  1 
ATOM   1327 N  N   . LYS A 1 170 ? 171.239 171.401 25.550  1.00 122.87 ? 243 LYS A N   1 
ATOM   1328 C  CA  . LYS A 1 170 ? 172.309 170.475 25.209  1.00 142.92 ? 243 LYS A CA  1 
ATOM   1329 C  C   . LYS A 1 170 ? 172.331 170.121 23.733  1.00 129.45 ? 243 LYS A C   1 
ATOM   1330 O  O   . LYS A 1 170 ? 173.163 169.309 23.316  1.00 119.78 ? 243 LYS A O   1 
ATOM   1331 C  CB  . LYS A 1 170 ? 172.178 169.191 26.036  1.00 167.72 ? 243 LYS A CB  1 
ATOM   1332 C  CG  . LYS A 1 170 ? 172.328 169.390 27.535  1.00 180.69 ? 243 LYS A CG  1 
ATOM   1333 C  CD  . LYS A 1 170 ? 172.250 168.061 28.269  1.00 174.99 ? 243 LYS A CD  1 
ATOM   1334 C  CE  . LYS A 1 170 ? 170.909 167.378 28.028  1.00 164.38 ? 243 LYS A CE  1 
ATOM   1335 N  NZ  . LYS A 1 170 ? 170.809 166.072 28.737  1.00 152.05 ? 243 LYS A NZ  1 
ATOM   1336 N  N   . GLY A 1 171 ? 171.453 170.708 22.938  1.00 149.72 ? 244 GLY A N   1 
ATOM   1337 C  CA  . GLY A 1 171 ? 171.395 170.431 21.524  1.00 149.36 ? 244 GLY A CA  1 
ATOM   1338 C  C   . GLY A 1 171 ? 169.957 170.307 21.082  1.00 148.39 ? 244 GLY A C   1 
ATOM   1339 O  O   . GLY A 1 171 ? 169.047 170.825 21.727  1.00 158.72 ? 244 GLY A O   1 
ATOM   1340 N  N   . LEU A 1 172 ? 169.759 169.597 19.971  1.00 117.78 ? 245 LEU A N   1 
ATOM   1341 C  CA  . LEU A 1 172 ? 168.407 169.399 19.466  1.00 117.09 ? 245 LEU A CA  1 
ATOM   1342 C  C   . LEU A 1 172 ? 167.597 168.495 20.387  1.00 128.07 ? 245 LEU A C   1 
ATOM   1343 O  O   . LEU A 1 172 ? 166.377 168.662 20.503  1.00 147.44 ? 245 LEU A O   1 
ATOM   1344 C  CB  . LEU A 1 172 ? 168.455 168.804 18.057  1.00 94.63  ? 245 LEU A CB  1 
ATOM   1345 C  CG  . LEU A 1 172 ? 169.058 169.647 16.931  1.00 85.86  ? 245 LEU A CG  1 
ATOM   1346 C  CD1 . LEU A 1 172 ? 169.144 168.826 15.656  1.00 84.59  ? 245 LEU A CD1 1 
ATOM   1347 C  CD2 . LEU A 1 172 ? 168.265 170.925 16.700  1.00 87.59  ? 245 LEU A CD2 1 
ATOM   1348 N  N   . GLN A 1 173 ? 168.261 167.551 21.058  1.00 127.14 ? 246 GLN A N   1 
ATOM   1349 C  CA  . GLN A 1 173 ? 167.572 166.634 21.962  1.00 141.90 ? 246 GLN A CA  1 
ATOM   1350 C  C   . GLN A 1 173 ? 166.841 167.387 23.066  1.00 170.67 ? 246 GLN A C   1 
ATOM   1351 O  O   . GLN A 1 173 ? 165.617 167.282 23.206  1.00 196.93 ? 246 GLN A O   1 
ATOM   1352 C  CB  . GLN A 1 173 ? 168.570 165.639 22.558  1.00 150.64 ? 246 GLN A CB  1 
ATOM   1353 C  CG  . GLN A 1 173 ? 169.399 164.883 21.530  1.00 157.82 ? 246 GLN A CG  1 
ATOM   1354 C  CD  . GLN A 1 173 ? 170.629 165.651 21.084  1.00 179.79 ? 246 GLN A CD  1 
ATOM   1355 O  OE1 . GLN A 1 173 ? 170.880 166.766 21.543  1.00 175.77 ? 246 GLN A OE1 1 
ATOM   1356 N  NE2 . GLN A 1 173 ? 171.405 165.056 20.185  1.00 196.80 ? 246 GLN A NE2 1 
ATOM   1357 N  N   . ASP A 1 174 ? 167.576 168.167 23.853  1.00 137.15 ? 247 ASP A N   1 
ATOM   1358 C  CA  . ASP A 1 174 ? 166.998 168.964 24.929  1.00 143.04 ? 247 ASP A CA  1 
ATOM   1359 C  C   . ASP A 1 174 ? 167.240 170.442 24.658  1.00 136.88 ? 247 ASP A C   1 
ATOM   1360 O  O   . ASP A 1 174 ? 168.380 170.913 24.729  1.00 148.80 ? 247 ASP A O   1 
ATOM   1361 C  CB  . ASP A 1 174 ? 167.581 168.555 26.281  1.00 145.72 ? 247 ASP A CB  1 
ATOM   1362 C  CG  . ASP A 1 174 ? 166.931 169.285 27.437  1.00 172.59 ? 247 ASP A CG  1 
ATOM   1363 O  OD1 . ASP A 1 174 ? 165.914 168.784 27.962  1.00 187.11 ? 247 ASP A OD1 1 
ATOM   1364 O  OD2 . ASP A 1 174 ? 167.437 170.360 27.821  1.00 168.59 ? 247 ASP A OD2 1 
ATOM   1365 N  N   . LEU A 1 175 ? 166.169 171.167 24.339  1.00 120.46 ? 248 LEU A N   1 
ATOM   1366 C  CA  . LEU A 1 175 ? 166.261 172.579 23.990  1.00 119.35 ? 248 LEU A CA  1 
ATOM   1367 C  C   . LEU A 1 175 ? 165.289 173.465 24.757  1.00 139.27 ? 248 LEU A C   1 
ATOM   1368 O  O   . LEU A 1 175 ? 165.550 174.669 24.871  1.00 136.91 ? 248 LEU A O   1 
ATOM   1369 C  CB  . LEU A 1 175 ? 166.049 172.783 22.478  1.00 94.53  ? 248 LEU A CB  1 
ATOM   1370 C  CG  . LEU A 1 175 ? 164.891 172.088 21.754  1.00 94.45  ? 248 LEU A CG  1 
ATOM   1371 C  CD1 . LEU A 1 175 ? 163.594 172.872 21.900  1.00 100.72 ? 248 LEU A CD1 1 
ATOM   1372 C  CD2 . LEU A 1 175 ? 165.225 171.882 20.282  1.00 93.02  ? 248 LEU A CD2 1 
ATOM   1373 N  N   . GLY A 1 176 ? 164.197 172.920 25.292  1.00 125.47 ? 249 GLY A N   1 
ATOM   1374 C  CA  . GLY A 1 176 ? 163.213 173.697 26.026  1.00 113.94 ? 249 GLY A CA  1 
ATOM   1375 C  C   . GLY A 1 176 ? 163.781 174.291 27.300  1.00 112.06 ? 249 GLY A C   1 
ATOM   1376 O  O   . GLY A 1 176 ? 164.801 173.818 27.797  1.00 134.07 ? 249 GLY A O   1 
ATOM   1377 N  N   . GLY A 1 177 ? 163.128 175.319 27.838  1.00 132.12 ? 250 GLY A N   1 
ATOM   1378 C  CA  . GLY A 1 177 ? 161.905 175.856 27.270  1.00 139.71 ? 250 GLY A CA  1 
ATOM   1379 C  C   . GLY A 1 177 ? 162.078 177.129 26.466  1.00 118.01 ? 250 GLY A C   1 
ATOM   1380 O  O   . GLY A 1 177 ? 163.125 177.352 25.864  1.00 111.06 ? 250 GLY A O   1 
ATOM   1381 N  N   . ILE A 1 178 ? 161.053 177.975 26.477  1.00 109.84 ? 251 ILE A N   1 
ATOM   1382 C  CA  . ILE A 1 178 ? 160.998 179.172 25.643  1.00 111.03 ? 251 ILE A CA  1 
ATOM   1383 C  C   . ILE A 1 178 ? 161.486 180.374 26.440  1.00 148.45 ? 251 ILE A C   1 
ATOM   1384 O  O   . ILE A 1 178 ? 161.216 180.490 27.643  1.00 175.58 ? 251 ILE A O   1 
ATOM   1385 C  CB  . ILE A 1 178 ? 159.567 179.395 25.113  1.00 112.80 ? 251 ILE A CB  1 
ATOM   1386 C  CG1 . ILE A 1 178 ? 159.077 178.144 24.377  1.00 110.96 ? 251 ILE A CG1 1 
ATOM   1387 C  CG2 . ILE A 1 178 ? 159.503 180.606 24.196  1.00 114.07 ? 251 ILE A CG2 1 
ATOM   1388 C  CD1 . ILE A 1 178 ? 157.676 178.262 23.823  1.00 112.62 ? 251 ILE A CD1 1 
ATOM   1389 N  N   . SER A 1 179 ? 162.237 181.254 25.777  1.00 112.91 ? 252 SER A N   1 
ATOM   1390 C  CA  . SER A 1 179 ? 162.652 182.522 26.366  1.00 115.03 ? 252 SER A CA  1 
ATOM   1391 C  C   . SER A 1 179 ? 161.564 183.567 26.147  1.00 124.73 ? 252 SER A C   1 
ATOM   1392 O  O   . SER A 1 179 ? 161.161 183.820 25.006  1.00 135.06 ? 252 SER A O   1 
ATOM   1393 C  CB  . SER A 1 179 ? 163.972 182.992 25.757  1.00 113.76 ? 252 SER A CB  1 
ATOM   1394 O  OG  . SER A 1 179 ? 165.010 182.063 26.013  1.00 173.06 ? 252 SER A OG  1 
ATOM   1395 N  N   . TRP A 1 180 ? 161.101 184.181 27.240  1.00 121.27 ? 253 TRP A N   1 
ATOM   1396 C  CA  . TRP A 1 180 ? 159.998 185.135 27.147  1.00 149.02 ? 253 TRP A CA  1 
ATOM   1397 C  C   . TRP A 1 180 ? 160.443 186.467 26.552  1.00 178.41 ? 253 TRP A C   1 
ATOM   1398 O  O   . TRP A 1 180 ? 159.625 187.181 25.956  1.00 202.76 ? 253 TRP A O   1 
ATOM   1399 C  CB  . TRP A 1 180 ? 159.350 185.342 28.516  1.00 147.52 ? 253 TRP A CB  1 
ATOM   1400 C  CG  . TRP A 1 180 ? 160.268 185.847 29.587  1.00 156.54 ? 253 TRP A CG  1 
ATOM   1401 C  CD1 . TRP A 1 180 ? 161.020 185.094 30.438  1.00 176.96 ? 253 TRP A CD1 1 
ATOM   1402 C  CD2 . TRP A 1 180 ? 160.506 187.215 29.945  1.00 157.07 ? 253 TRP A CD2 1 
ATOM   1403 N  NE1 . TRP A 1 180 ? 161.722 185.906 31.296  1.00 177.45 ? 253 TRP A NE1 1 
ATOM   1404 C  CE2 . TRP A 1 180 ? 161.422 187.213 31.015  1.00 166.41 ? 253 TRP A CE2 1 
ATOM   1405 C  CE3 . TRP A 1 180 ? 160.039 188.441 29.461  1.00 159.70 ? 253 TRP A CE3 1 
ATOM   1406 C  CZ2 . TRP A 1 180 ? 161.882 188.387 31.609  1.00 157.20 ? 253 TRP A CZ2 1 
ATOM   1407 C  CZ3 . TRP A 1 180 ? 160.496 189.606 30.053  1.00 164.09 ? 253 TRP A CZ3 1 
ATOM   1408 C  CH2 . TRP A 1 180 ? 161.410 189.570 31.115  1.00 158.92 ? 253 TRP A CH2 1 
ATOM   1409 N  N   . GLN A 1 181 ? 161.723 186.818 26.702  1.00 181.88 ? 254 GLN A N   1 
ATOM   1410 C  CA  . GLN A 1 181 ? 162.223 188.077 26.156  1.00 172.83 ? 254 GLN A CA  1 
ATOM   1411 C  C   . GLN A 1 181 ? 162.088 188.098 24.639  1.00 158.71 ? 254 GLN A C   1 
ATOM   1412 O  O   . GLN A 1 181 ? 161.462 188.997 24.064  1.00 162.24 ? 254 GLN A O   1 
ATOM   1413 C  CB  . GLN A 1 181 ? 163.685 188.279 26.556  1.00 196.02 ? 254 GLN A CB  1 
ATOM   1414 C  CG  . GLN A 1 181 ? 163.942 188.453 28.043  1.00 211.88 ? 254 GLN A CG  1 
ATOM   1415 C  CD  . GLN A 1 181 ? 164.076 187.127 28.767  1.00 215.61 ? 254 GLN A CD  1 
ATOM   1416 O  OE1 . GLN A 1 181 ? 163.975 186.062 28.159  1.00 214.52 ? 254 GLN A OE1 1 
ATOM   1417 N  NE2 . GLN A 1 181 ? 164.340 187.188 30.066  1.00 218.76 ? 254 GLN A NE2 1 
ATOM   1418 N  N   . LEU A 1 182 ? 162.673 187.102 23.972  1.00 152.21 ? 255 LEU A N   1 
ATOM   1419 C  CA  . LEU A 1 182 ? 162.584 187.036 22.520  1.00 144.18 ? 255 LEU A CA  1 
ATOM   1420 C  C   . LEU A 1 182 ? 161.158 186.782 22.059  1.00 141.84 ? 255 LEU A C   1 
ATOM   1421 O  O   . LEU A 1 182 ? 160.827 187.083 20.908  1.00 131.10 ? 255 LEU A O   1 
ATOM   1422 C  CB  . LEU A 1 182 ? 163.523 185.955 21.979  1.00 137.45 ? 255 LEU A CB  1 
ATOM   1423 C  CG  . LEU A 1 182 ? 165.004 186.329 21.852  1.00 115.71 ? 255 LEU A CG  1 
ATOM   1424 C  CD1 . LEU A 1 182 ? 165.168 187.608 21.042  1.00 121.69 ? 255 LEU A CD1 1 
ATOM   1425 C  CD2 . LEU A 1 182 ? 165.674 186.466 23.210  1.00 116.21 ? 255 LEU A CD2 1 
ATOM   1426 N  N   . ALA A 1 183 ? 160.306 186.248 22.936  1.00 128.58 ? 256 ALA A N   1 
ATOM   1427 C  CA  . ALA A 1 183 ? 158.897 186.104 22.594  1.00 145.21 ? 256 ALA A CA  1 
ATOM   1428 C  C   . ALA A 1 183 ? 158.229 187.469 22.526  1.00 143.10 ? 256 ALA A C   1 
ATOM   1429 O  O   . ALA A 1 183 ? 157.464 187.746 21.597  1.00 136.14 ? 256 ALA A O   1 
ATOM   1430 C  CB  . ALA A 1 183 ? 158.192 185.201 23.606  1.00 159.61 ? 256 ALA A CB  1 
ATOM   1431 N  N   . LEU A 1 184 ? 158.504 188.334 23.506  1.00 159.60 ? 257 LEU A N   1 
ATOM   1432 C  CA  . LEU A 1 184 ? 157.969 189.692 23.457  1.00 163.51 ? 257 LEU A CA  1 
ATOM   1433 C  C   . LEU A 1 184 ? 158.536 190.460 22.267  1.00 162.32 ? 257 LEU A C   1 
ATOM   1434 O  O   . LEU A 1 184 ? 157.812 191.213 21.602  1.00 167.60 ? 257 LEU A O   1 
ATOM   1435 C  CB  . LEU A 1 184 ? 158.265 190.425 24.763  1.00 134.98 ? 257 LEU A CB  1 
ATOM   1436 C  CG  . LEU A 1 184 ? 157.147 190.392 25.808  1.00 137.52 ? 257 LEU A CG  1 
ATOM   1437 C  CD1 . LEU A 1 184 ? 156.785 188.960 26.179  1.00 135.33 ? 257 LEU A CD1 1 
ATOM   1438 C  CD2 . LEU A 1 184 ? 157.537 191.191 27.043  1.00 181.25 ? 257 LEU A CD2 1 
ATOM   1439 N  N   . CYS A 1 185 ? 159.833 190.287 21.988  1.00 165.58 ? 258 CYS A N   1 
ATOM   1440 C  CA  . CYS A 1 185 ? 160.434 190.941 20.828  1.00 129.91 ? 258 CYS A CA  1 
ATOM   1441 C  C   . CYS A 1 185 ? 159.734 190.507 19.547  1.00 129.00 ? 258 CYS A C   1 
ATOM   1442 O  O   . CYS A 1 185 ? 159.299 191.343 18.742  1.00 134.11 ? 258 CYS A O   1 
ATOM   1443 C  CB  . CYS A 1 185 ? 161.928 190.625 20.753  1.00 127.25 ? 258 CYS A CB  1 
ATOM   1444 S  SG  . CYS A 1 185 ? 162.918 191.278 22.112  1.00 128.43 ? 258 CYS A SG  1 
ATOM   1445 N  N   . ILE A 1 186 ? 159.608 189.194 19.345  1.00 126.25 ? 259 ILE A N   1 
ATOM   1446 C  CA  . ILE A 1 186 ? 158.996 188.686 18.127  1.00 148.00 ? 259 ILE A CA  1 
ATOM   1447 C  C   . ILE A 1 186 ? 157.511 189.021 18.085  1.00 152.30 ? 259 ILE A C   1 
ATOM   1448 O  O   . ILE A 1 186 ? 156.911 189.021 17.006  1.00 135.45 ? 259 ILE A O   1 
ATOM   1449 C  CB  . ILE A 1 186 ? 159.237 187.168 18.000  1.00 121.77 ? 259 ILE A CB  1 
ATOM   1450 C  CG1 . ILE A 1 186 ? 159.106 186.719 16.546  1.00 120.19 ? 259 ILE A CG1 1 
ATOM   1451 C  CG2 . ILE A 1 186 ? 158.276 186.384 18.879  1.00 122.12 ? 259 ILE A CG2 1 
ATOM   1452 C  CD1 . ILE A 1 186 ? 159.284 185.233 16.361  1.00 117.05 ? 259 ILE A CD1 1 
ATOM   1453 N  N   . MET A 1 187 ? 156.898 189.299 19.238  1.00 149.73 ? 260 MET A N   1 
ATOM   1454 C  CA  . MET A 1 187 ? 155.517 189.771 19.246  1.00 133.26 ? 260 MET A CA  1 
ATOM   1455 C  C   . MET A 1 187 ? 155.437 191.205 18.744  1.00 157.48 ? 260 MET A C   1 
ATOM   1456 O  O   . MET A 1 187 ? 154.536 191.550 17.971  1.00 150.99 ? 260 MET A O   1 
ATOM   1457 C  CB  . MET A 1 187 ? 154.927 189.654 20.648  1.00 138.61 ? 260 MET A CB  1 
ATOM   1458 C  CG  . MET A 1 187 ? 154.333 188.292 20.946  1.00 133.28 ? 260 MET A CG  1 
ATOM   1459 S  SD  . MET A 1 187 ? 153.695 188.162 22.624  1.00 158.26 ? 260 MET A SD  1 
ATOM   1460 C  CE  . MET A 1 187 ? 152.480 189.478 22.613  1.00 175.20 ? 260 MET A CE  1 
ATOM   1461 N  N   . LEU A 1 188 ? 156.370 192.057 19.183  1.00 165.61 ? 261 LEU A N   1 
ATOM   1462 C  CA  . LEU A 1 188 ? 156.412 193.426 18.678  1.00 160.40 ? 261 LEU A CA  1 
ATOM   1463 C  C   . LEU A 1 188 ? 156.664 193.432 17.177  1.00 162.33 ? 261 LEU A C   1 
ATOM   1464 O  O   . LEU A 1 188 ? 156.096 194.250 16.443  1.00 180.32 ? 261 LEU A O   1 
ATOM   1465 C  CB  . LEU A 1 188 ? 157.485 194.235 19.406  1.00 162.72 ? 261 LEU A CB  1 
ATOM   1466 C  CG  . LEU A 1 188 ? 157.615 195.692 18.956  1.00 161.80 ? 261 LEU A CG  1 
ATOM   1467 C  CD1 . LEU A 1 188 ? 156.283 196.415 19.086  1.00 165.45 ? 261 LEU A CD1 1 
ATOM   1468 C  CD2 . LEU A 1 188 ? 158.699 196.412 19.743  1.00 173.13 ? 261 LEU A CD2 1 
ATOM   1469 N  N   . ILE A 1 189 ? 157.518 192.523 16.707  1.00 145.87 ? 262 ILE A N   1 
ATOM   1470 C  CA  . ILE A 1 189 ? 157.803 192.430 15.279  1.00 146.32 ? 262 ILE A CA  1 
ATOM   1471 C  C   . ILE A 1 189 ? 156.575 191.925 14.531  1.00 158.40 ? 262 ILE A C   1 
ATOM   1472 O  O   . ILE A 1 189 ? 156.212 192.452 13.473  1.00 150.96 ? 262 ILE A O   1 
ATOM   1473 C  CB  . ILE A 1 189 ? 159.036 191.547 15.038  1.00 129.37 ? 262 ILE A CB  1 
ATOM   1474 C  CG1 . ILE A 1 189 ? 160.250 192.224 15.665  1.00 129.62 ? 262 ILE A CG1 1 
ATOM   1475 C  CG2 . ILE A 1 189 ? 159.247 191.308 13.554  1.00 127.78 ? 262 ILE A CG2 1 
ATOM   1476 C  CD1 . ILE A 1 189 ? 161.511 191.489 15.460  1.00 126.30 ? 262 ILE A CD1 1 
ATOM   1477 N  N   . PHE A 1 190 ? 155.926 190.886 15.059  1.00 160.10 ? 263 PHE A N   1 
ATOM   1478 C  CA  . PHE A 1 190 ? 154.713 190.375 14.435  1.00 158.29 ? 263 PHE A CA  1 
ATOM   1479 C  C   . PHE A 1 190 ? 153.570 191.378 14.509  1.00 153.49 ? 263 PHE A C   1 
ATOM   1480 O  O   . PHE A 1 190 ? 152.562 191.202 13.817  1.00 137.52 ? 263 PHE A O   1 
ATOM   1481 C  CB  . PHE A 1 190 ? 154.290 189.059 15.086  1.00 167.61 ? 263 PHE A CB  1 
ATOM   1482 C  CG  . PHE A 1 190 ? 155.059 187.870 14.599  1.00 127.05 ? 263 PHE A CG  1 
ATOM   1483 C  CD1 . PHE A 1 190 ? 155.469 187.791 13.282  1.00 125.58 ? 263 PHE A CD1 1 
ATOM   1484 C  CD2 . PHE A 1 190 ? 155.359 186.824 15.451  1.00 125.01 ? 263 PHE A CD2 1 
ATOM   1485 C  CE1 . PHE A 1 190 ? 156.171 186.697 12.823  1.00 122.60 ? 263 PHE A CE1 1 
ATOM   1486 C  CE2 . PHE A 1 190 ? 156.065 185.727 14.998  1.00 138.23 ? 263 PHE A CE2 1 
ATOM   1487 C  CZ  . PHE A 1 190 ? 156.470 185.662 13.681  1.00 126.21 ? 263 PHE A CZ  1 
ATOM   1488 N  N   . THR A 1 191 ? 153.711 192.419 15.327  1.00 150.62 ? 264 THR A N   1 
ATOM   1489 C  CA  . THR A 1 191 ? 152.744 193.503 15.414  1.00 154.74 ? 264 THR A CA  1 
ATOM   1490 C  C   . THR A 1 191 ? 153.085 194.586 14.402  1.00 174.00 ? 264 THR A C   1 
ATOM   1491 O  O   . THR A 1 191 ? 152.185 195.201 13.820  1.00 204.59 ? 264 THR A O   1 
ATOM   1492 C  CB  . THR A 1 191 ? 152.711 194.083 16.829  1.00 173.26 ? 264 THR A CB  1 
ATOM   1493 O  OG1 . THR A 1 191 ? 152.503 193.025 17.772  1.00 188.19 ? 264 THR A OG1 1 
ATOM   1494 C  CG2 . THR A 1 191 ? 151.587 195.101 16.963  1.00 172.17 ? 264 THR A CG2 1 
ATOM   1495 N  N   . VAL A 1 192 ? 154.380 194.817 14.175  1.00 143.15 ? 265 VAL A N   1 
ATOM   1496 C  CA  . VAL A 1 192 ? 154.796 195.872 13.261  1.00 144.53 ? 265 VAL A CA  1 
ATOM   1497 C  C   . VAL A 1 192 ? 154.631 195.412 11.819  1.00 142.89 ? 265 VAL A C   1 
ATOM   1498 O  O   . VAL A 1 192 ? 154.604 196.246 10.905  1.00 144.51 ? 265 VAL A O   1 
ATOM   1499 C  CB  . VAL A 1 192 ? 156.239 196.320 13.551  1.00 143.61 ? 265 VAL A CB  1 
ATOM   1500 C  CG1 . VAL A 1 192 ? 157.230 195.354 12.948  1.00 139.49 ? 265 VAL A CG1 1 
ATOM   1501 C  CG2 . VAL A 1 192 ? 156.476 197.729 13.027  1.00 146.50 ? 265 VAL A CG2 1 
ATOM   1502 N  N   . ILE A 1 193 ? 154.504 194.101 11.592  1.00 149.35 ? 266 ILE A N   1 
ATOM   1503 C  CA  . ILE A 1 193 ? 154.274 193.595 10.245  1.00 162.08 ? 266 ILE A CA  1 
ATOM   1504 C  C   . ILE A 1 193 ? 152.777 193.500 9.999   1.00 169.43 ? 266 ILE A C   1 
ATOM   1505 O  O   . ILE A 1 193 ? 152.343 193.505 8.838   1.00 170.35 ? 266 ILE A O   1 
ATOM   1506 C  CB  . ILE A 1 193 ? 154.915 192.219 9.982   1.00 162.88 ? 266 ILE A CB  1 
ATOM   1507 C  CG1 . ILE A 1 193 ? 154.268 191.133 10.839  1.00 170.96 ? 266 ILE A CG1 1 
ATOM   1508 C  CG2 . ILE A 1 193 ? 156.399 192.248 10.259  1.00 156.31 ? 266 ILE A CG2 1 
ATOM   1509 C  CD1 . ILE A 1 193 ? 154.784 189.749 10.521  1.00 163.47 ? 266 ILE A CD1 1 
ATOM   1510 N  N   . TYR A 1 194 ? 151.981 193.414 11.065  1.00 167.14 ? 267 TYR A N   1 
ATOM   1511 C  CA  . TYR A 1 194 ? 150.535 193.316 10.933  1.00 180.68 ? 267 TYR A CA  1 
ATOM   1512 C  C   . TYR A 1 194 ? 149.966 194.607 10.367  1.00 179.47 ? 267 TYR A C   1 
ATOM   1513 O  O   . TYR A 1 194 ? 149.187 194.587 9.407   1.00 187.15 ? 267 TYR A O   1 
ATOM   1514 C  CB  . TYR A 1 194 ? 149.909 193.005 12.291  1.00 203.99 ? 267 TYR A CB  1 
ATOM   1515 C  CG  . TYR A 1 194 ? 148.418 192.774 12.248  1.00 227.89 ? 267 TYR A CG  1 
ATOM   1516 C  CD1 . TYR A 1 194 ? 147.804 192.255 11.116  1.00 224.41 ? 267 TYR A CD1 1 
ATOM   1517 C  CD2 . TYR A 1 194 ? 147.619 193.103 13.335  1.00 248.28 ? 267 TYR A CD2 1 
ATOM   1518 C  CE1 . TYR A 1 194 ? 146.439 192.052 11.076  1.00 245.22 ? 267 TYR A CE1 1 
ATOM   1519 C  CE2 . TYR A 1 194 ? 146.255 192.906 13.304  1.00 262.51 ? 267 TYR A CE2 1 
ATOM   1520 C  CZ  . TYR A 1 194 ? 145.669 192.382 12.172  1.00 266.39 ? 267 TYR A CZ  1 
ATOM   1521 O  OH  . TYR A 1 194 ? 144.308 192.185 12.140  1.00 283.23 ? 267 TYR A OH  1 
ATOM   1522 N  N   . PHE A 1 195 ? 150.367 195.744 10.932  1.00 187.83 ? 268 PHE A N   1 
ATOM   1523 C  CA  . PHE A 1 195 ? 149.831 197.024 10.495  1.00 213.47 ? 268 PHE A CA  1 
ATOM   1524 C  C   . PHE A 1 195 ? 150.421 197.471 9.167   1.00 221.30 ? 268 PHE A C   1 
ATOM   1525 O  O   . PHE A 1 195 ? 150.045 198.535 8.664   1.00 239.91 ? 268 PHE A O   1 
ATOM   1526 C  CB  . PHE A 1 195 ? 150.098 198.090 11.562  1.00 207.30 ? 268 PHE A CB  1 
ATOM   1527 C  CG  . PHE A 1 195 ? 149.383 197.844 12.862  1.00 201.02 ? 268 PHE A CG  1 
ATOM   1528 C  CD1 . PHE A 1 195 ? 148.223 197.088 12.903  1.00 194.90 ? 268 PHE A CD1 1 
ATOM   1529 C  CD2 . PHE A 1 195 ? 149.881 198.362 14.047  1.00 200.82 ? 268 PHE A CD2 1 
ATOM   1530 C  CE1 . PHE A 1 195 ? 147.568 196.860 14.099  1.00 198.71 ? 268 PHE A CE1 1 
ATOM   1531 C  CE2 . PHE A 1 195 ? 149.231 198.137 15.247  1.00 202.33 ? 268 PHE A CE2 1 
ATOM   1532 C  CZ  . PHE A 1 195 ? 148.074 197.385 15.273  1.00 202.52 ? 268 PHE A CZ  1 
ATOM   1533 N  N   . SER A 1 196 ? 151.334 196.688 8.594   1.00 180.71 ? 269 SER A N   1 
ATOM   1534 C  CA  . SER A 1 196 ? 151.933 196.988 7.304   1.00 170.41 ? 269 SER A CA  1 
ATOM   1535 C  C   . SER A 1 196 ? 151.413 196.080 6.198   1.00 174.30 ? 269 SER A C   1 
ATOM   1536 O  O   . SER A 1 196 ? 151.847 196.209 5.049   1.00 176.31 ? 269 SER A O   1 
ATOM   1537 C  CB  . SER A 1 196 ? 153.458 196.879 7.398   1.00 146.32 ? 269 SER A CB  1 
ATOM   1538 O  OG  . SER A 1 196 ? 153.957 197.725 8.420   1.00 148.08 ? 269 SER A OG  1 
ATOM   1539 N  N   . ILE A 1 197 ? 150.498 195.165 6.517   1.00 181.16 ? 270 ILE A N   1 
ATOM   1540 C  CA  . ILE A 1 197 ? 149.991 194.181 5.566   1.00 179.62 ? 270 ILE A CA  1 
ATOM   1541 C  C   . ILE A 1 197 ? 148.468 194.150 5.638   1.00 176.20 ? 270 ILE A C   1 
ATOM   1542 O  O   . ILE A 1 197 ? 147.792 193.959 4.620   1.00 168.05 ? 270 ILE A O   1 
ATOM   1543 C  CB  . ILE A 1 197 ? 150.598 192.789 5.827   1.00 168.75 ? 270 ILE A CB  1 
ATOM   1544 C  CG1 . ILE A 1 197 ? 152.108 192.813 5.589   1.00 161.69 ? 270 ILE A CG1 1 
ATOM   1545 C  CG2 . ILE A 1 197 ? 149.966 191.746 4.924   1.00 170.89 ? 270 ILE A CG2 1 
ATOM   1546 C  CD1 . ILE A 1 197 ? 152.493 193.123 4.155   1.00 163.96 ? 270 ILE A CD1 1 
ATOM   1547 N  N   . TRP A 1 198 ? 147.924 194.356 6.844   1.00 174.03 ? 271 TRP A N   1 
ATOM   1548 C  CA  . TRP A 1 198 ? 146.497 194.147 7.091   1.00 182.82 ? 271 TRP A CA  1 
ATOM   1549 C  C   . TRP A 1 198 ? 145.613 194.957 6.151   1.00 196.99 ? 271 TRP A C   1 
ATOM   1550 O  O   . TRP A 1 198 ? 144.501 194.526 5.823   1.00 189.00 ? 271 TRP A O   1 
ATOM   1551 C  CB  . TRP A 1 198 ? 146.159 194.488 8.544   1.00 171.25 ? 271 TRP A CB  1 
ATOM   1552 C  CG  . TRP A 1 198 ? 146.198 195.964 8.867   1.00 184.83 ? 271 TRP A CG  1 
ATOM   1553 C  CD1 . TRP A 1 198 ? 147.093 196.887 8.400   1.00 189.89 ? 271 TRP A CD1 1 
ATOM   1554 C  CD2 . TRP A 1 198 ? 145.297 196.680 9.721   1.00 182.94 ? 271 TRP A CD2 1 
ATOM   1555 N  NE1 . TRP A 1 198 ? 146.806 198.128 8.914   1.00 192.02 ? 271 TRP A NE1 1 
ATOM   1556 C  CE2 . TRP A 1 198 ? 145.708 198.029 9.727   1.00 186.56 ? 271 TRP A CE2 1 
ATOM   1557 C  CE3 . TRP A 1 198 ? 144.183 196.312 10.483  1.00 176.18 ? 271 TRP A CE3 1 
ATOM   1558 C  CZ2 . TRP A 1 198 ? 145.046 199.009 10.464  1.00 189.98 ? 271 TRP A CZ2 1 
ATOM   1559 C  CZ3 . TRP A 1 198 ? 143.527 197.286 11.213  1.00 194.13 ? 271 TRP A CZ3 1 
ATOM   1560 C  CH2 . TRP A 1 198 ? 143.960 198.618 11.199  1.00 198.45 ? 271 TRP A CH2 1 
ATOM   1561 N  N   . LYS A 1 199 ? 146.079 196.118 5.701   1.00 208.02 ? 272 LYS A N   1 
ATOM   1562 C  CA  . LYS A 1 199 ? 145.291 196.947 4.803   1.00 189.01 ? 272 LYS A CA  1 
ATOM   1563 C  C   . LYS A 1 199 ? 145.492 196.576 3.342   1.00 192.74 ? 272 LYS A C   1 
ATOM   1564 O  O   . LYS A 1 199 ? 144.795 197.118 2.478   1.00 212.80 ? 272 LYS A O   1 
ATOM   1565 C  CB  . LYS A 1 199 ? 145.624 198.428 5.019   1.00 187.47 ? 272 LYS A CB  1 
ATOM   1566 C  CG  . LYS A 1 199 ? 145.036 199.005 6.302   1.00 197.65 ? 272 LYS A CG  1 
ATOM   1567 C  CD  . LYS A 1 199 ? 145.297 200.499 6.432   1.00 204.06 ? 272 LYS A CD  1 
ATOM   1568 C  CE  . LYS A 1 199 ? 144.739 201.274 5.250   1.00 202.19 ? 272 LYS A CE  1 
ATOM   1569 N  NZ  . LYS A 1 199 ? 145.019 202.733 5.366   1.00 197.07 ? 272 LYS A NZ  1 
ATOM   1570 N  N   . GLY A 1 200 ? 146.429 195.678 3.046   1.00 175.76 ? 273 GLY A N   1 
ATOM   1571 C  CA  . GLY A 1 200 ? 146.645 195.230 1.687   1.00 169.55 ? 273 GLY A CA  1 
ATOM   1572 C  C   . GLY A 1 200 ? 147.908 195.822 1.103   1.00 178.58 ? 273 GLY A C   1 
ATOM   1573 O  O   . GLY A 1 200 ? 148.885 196.055 1.821   1.00 183.04 ? 273 GLY A O   1 
ATOM   1574 N  N   . VAL A 1 201 ? 147.898 196.071 -0.208  1.00 168.51 ? 274 VAL A N   1 
ATOM   1575 C  CA  . VAL A 1 201 ? 149.075 196.611 -0.885  1.00 177.31 ? 274 VAL A CA  1 
ATOM   1576 C  C   . VAL A 1 201 ? 149.215 198.110 -0.681  1.00 182.57 ? 274 VAL A C   1 
ATOM   1577 O  O   . VAL A 1 201 ? 150.238 198.686 -1.071  1.00 186.65 ? 274 VAL A O   1 
ATOM   1578 C  CB  . VAL A 1 201 ? 149.041 196.285 -2.389  1.00 178.50 ? 274 VAL A CB  1 
ATOM   1579 C  CG1 . VAL A 1 201 ? 149.076 194.779 -2.605  1.00 158.79 ? 274 VAL A CG1 1 
ATOM   1580 C  CG2 . VAL A 1 201 ? 147.807 196.890 -3.035  1.00 202.10 ? 274 VAL A CG2 1 
ATOM   1581 N  N   . LYS A 1 202 ? 148.203 198.759 -0.098  1.00 188.49 ? 275 LYS A N   1 
ATOM   1582 C  CA  . LYS A 1 202 ? 148.260 200.199 0.138   1.00 191.54 ? 275 LYS A CA  1 
ATOM   1583 C  C   . LYS A 1 202 ? 149.305 200.541 1.193   1.00 194.21 ? 275 LYS A C   1 
ATOM   1584 O  O   . LYS A 1 202 ? 150.094 201.478 1.019   1.00 197.38 ? 275 LYS A O   1 
ATOM   1585 C  CB  . LYS A 1 202 ? 146.884 200.718 0.552   1.00 192.90 ? 275 LYS A CB  1 
ATOM   1586 N  N   . THR A 1 203 ? 149.322 199.799 2.302   1.00 197.19 ? 276 THR A N   1 
ATOM   1587 C  CA  . THR A 1 203 ? 150.296 200.084 3.348   1.00 195.84 ? 276 THR A CA  1 
ATOM   1588 C  C   . THR A 1 203 ? 151.628 199.408 3.054   1.00 198.37 ? 276 THR A C   1 
ATOM   1589 O  O   . THR A 1 203 ? 152.688 199.969 3.349   1.00 210.98 ? 276 THR A O   1 
ATOM   1590 C  CB  . THR A 1 203 ? 149.763 199.643 4.712   1.00 199.05 ? 276 THR A CB  1 
ATOM   1591 O  OG1 . THR A 1 203 ? 149.285 198.294 4.632   1.00 199.02 ? 276 THR A OG1 1 
ATOM   1592 C  CG2 . THR A 1 203 ? 148.639 200.557 5.163   1.00 208.49 ? 276 THR A CG2 1 
ATOM   1593 N  N   . SER A 1 204 ? 151.598 198.214 2.458   1.00 176.40 ? 277 SER A N   1 
ATOM   1594 C  CA  . SER A 1 204 ? 152.841 197.515 2.163   1.00 165.40 ? 277 SER A CA  1 
ATOM   1595 C  C   . SER A 1 204 ? 153.643 198.214 1.073   1.00 182.08 ? 277 SER A C   1 
ATOM   1596 O  O   . SER A 1 204 ? 154.802 197.852 0.850   1.00 184.23 ? 277 SER A O   1 
ATOM   1597 C  CB  . SER A 1 204 ? 152.555 196.067 1.760   1.00 168.79 ? 277 SER A CB  1 
ATOM   1598 O  OG  . SER A 1 204 ? 151.982 195.999 0.467   1.00 184.76 ? 277 SER A OG  1 
ATOM   1599 N  N   . GLY A 1 205 ? 153.056 199.204 0.401   1.00 191.45 ? 278 GLY A N   1 
ATOM   1600 C  CA  . GLY A 1 205 ? 153.770 200.013 -0.564  1.00 189.06 ? 278 GLY A CA  1 
ATOM   1601 C  C   . GLY A 1 205 ? 154.190 201.328 0.057   1.00 173.85 ? 278 GLY A C   1 
ATOM   1602 O  O   . GLY A 1 205 ? 154.969 202.087 -0.528  1.00 159.23 ? 278 GLY A O   1 
ATOM   1603 N  N   . LYS A 1 206 ? 153.687 201.595 1.261   1.00 175.20 ? 279 LYS A N   1 
ATOM   1604 C  CA  . LYS A 1 206 ? 153.987 202.817 1.997   1.00 190.79 ? 279 LYS A CA  1 
ATOM   1605 C  C   . LYS A 1 206 ? 154.954 202.573 3.140   1.00 209.56 ? 279 LYS A C   1 
ATOM   1606 O  O   . LYS A 1 206 ? 155.822 203.409 3.398   1.00 214.46 ? 279 LYS A O   1 
ATOM   1607 C  CB  . LYS A 1 206 ? 152.701 203.444 2.549   1.00 190.13 ? 279 LYS A CB  1 
ATOM   1608 C  CG  . LYS A 1 206 ? 152.163 204.611 1.736   1.00 201.28 ? 279 LYS A CG  1 
ATOM   1609 C  CD  . LYS A 1 206 ? 151.854 204.219 0.306   1.00 207.30 ? 279 LYS A CD  1 
ATOM   1610 C  CE  . LYS A 1 206 ? 151.355 205.417 -0.484  1.00 228.09 ? 279 LYS A CE  1 
ATOM   1611 N  NZ  . LYS A 1 206 ? 151.070 205.073 -1.904  1.00 238.12 ? 279 LYS A NZ  1 
ATOM   1612 N  N   . VAL A 1 207 ? 154.816 201.441 3.835   1.00 194.89 ? 280 VAL A N   1 
ATOM   1613 C  CA  . VAL A 1 207 ? 155.729 201.120 4.926   1.00 184.06 ? 280 VAL A CA  1 
ATOM   1614 C  C   . VAL A 1 207 ? 157.105 200.815 4.357   1.00 163.79 ? 280 VAL A C   1 
ATOM   1615 O  O   . VAL A 1 207 ? 158.129 201.106 4.989   1.00 149.65 ? 280 VAL A O   1 
ATOM   1616 C  CB  . VAL A 1 207 ? 155.182 199.955 5.771   1.00 150.99 ? 280 VAL A CB  1 
ATOM   1617 C  CG1 . VAL A 1 207 ? 156.146 199.612 6.890   1.00 149.07 ? 280 VAL A CG1 1 
ATOM   1618 C  CG2 . VAL A 1 207 ? 153.824 200.320 6.346   1.00 160.79 ? 280 VAL A CG2 1 
ATOM   1619 N  N   . VAL A 1 208 ? 157.148 200.249 3.146   1.00 176.98 ? 281 VAL A N   1 
ATOM   1620 C  CA  . VAL A 1 208 ? 158.407 199.901 2.493   1.00 178.40 ? 281 VAL A CA  1 
ATOM   1621 C  C   . VAL A 1 208 ? 159.264 201.139 2.271   1.00 180.51 ? 281 VAL A C   1 
ATOM   1622 O  O   . VAL A 1 208 ? 160.500 201.053 2.262   1.00 189.83 ? 281 VAL A O   1 
ATOM   1623 C  CB  . VAL A 1 208 ? 158.109 199.156 1.174   1.00 178.70 ? 281 VAL A CB  1 
ATOM   1624 C  CG1 . VAL A 1 208 ? 159.382 198.874 0.386   1.00 190.51 ? 281 VAL A CG1 1 
ATOM   1625 C  CG2 . VAL A 1 208 ? 157.367 197.856 1.464   1.00 182.90 ? 281 VAL A CG2 1 
ATOM   1626 N  N   . TRP A 1 209 ? 158.633 202.305 2.103   1.00 175.48 ? 282 TRP A N   1 
ATOM   1627 C  CA  . TRP A 1 209 ? 159.380 203.546 1.917   1.00 176.23 ? 282 TRP A CA  1 
ATOM   1628 C  C   . TRP A 1 209 ? 160.456 203.705 2.983   1.00 161.52 ? 282 TRP A C   1 
ATOM   1629 O  O   . TRP A 1 209 ? 161.575 204.144 2.692   1.00 159.81 ? 282 TRP A O   1 
ATOM   1630 C  CB  . TRP A 1 209 ? 158.423 204.738 1.936   1.00 186.88 ? 282 TRP A CB  1 
ATOM   1631 C  CG  . TRP A 1 209 ? 157.880 205.092 0.586   1.00 189.53 ? 282 TRP A CG  1 
ATOM   1632 C  CD1 . TRP A 1 209 ? 156.756 204.591 -0.003  1.00 183.73 ? 282 TRP A CD1 1 
ATOM   1633 C  CD2 . TRP A 1 209 ? 158.433 206.035 -0.341  1.00 196.82 ? 282 TRP A CD2 1 
ATOM   1634 N  NE1 . TRP A 1 209 ? 156.579 205.158 -1.242  1.00 190.80 ? 282 TRP A NE1 1 
ATOM   1635 C  CE2 . TRP A 1 209 ? 157.595 206.049 -1.472  1.00 200.72 ? 282 TRP A CE2 1 
ATOM   1636 C  CE3 . TRP A 1 209 ? 159.557 206.866 -0.324  1.00 204.74 ? 282 TRP A CE3 1 
ATOM   1637 C  CZ2 . TRP A 1 209 ? 157.844 206.862 -2.576  1.00 213.50 ? 282 TRP A CZ2 1 
ATOM   1638 C  CZ3 . TRP A 1 209 ? 159.803 207.672 -1.421  1.00 213.74 ? 282 TRP A CZ3 1 
ATOM   1639 C  CH2 . TRP A 1 209 ? 158.950 207.664 -2.532  1.00 217.44 ? 282 TRP A CH2 1 
ATOM   1640 N  N   . VAL A 1 210 ? 160.136 203.348 4.224   1.00 152.96 ? 283 VAL A N   1 
ATOM   1641 C  CA  . VAL A 1 210 ? 161.082 203.462 5.329   1.00 172.96 ? 283 VAL A CA  1 
ATOM   1642 C  C   . VAL A 1 210 ? 161.981 202.232 5.419   1.00 166.95 ? 283 VAL A C   1 
ATOM   1643 O  O   . VAL A 1 210 ? 163.204 202.350 5.538   1.00 159.24 ? 283 VAL A O   1 
ATOM   1644 C  CB  . VAL A 1 210 ? 160.316 203.699 6.647   1.00 177.21 ? 283 VAL A CB  1 
ATOM   1645 C  CG1 . VAL A 1 210 ? 161.289 203.896 7.802   1.00 179.91 ? 283 VAL A CG1 1 
ATOM   1646 C  CG2 . VAL A 1 210 ? 159.372 204.888 6.511   1.00 159.00 ? 283 VAL A CG2 1 
ATOM   1647 N  N   . THR A 1 211 ? 161.382 201.036 5.385   1.00 176.86 ? 284 THR A N   1 
ATOM   1648 C  CA  . THR A 1 211 ? 162.130 199.799 5.609   1.00 165.37 ? 284 THR A CA  1 
ATOM   1649 C  C   . THR A 1 211 ? 163.180 199.550 4.531   1.00 166.48 ? 284 THR A C   1 
ATOM   1650 O  O   . THR A 1 211 ? 164.171 198.854 4.784   1.00 175.40 ? 284 THR A O   1 
ATOM   1651 C  CB  . THR A 1 211 ? 161.179 198.603 5.688   1.00 150.51 ? 284 THR A CB  1 
ATOM   1652 O  OG1 . THR A 1 211 ? 160.609 198.352 4.396   1.00 139.19 ? 284 THR A OG1 1 
ATOM   1653 C  CG2 . THR A 1 211 ? 160.065 198.874 6.686   1.00 141.79 ? 284 THR A CG2 1 
ATOM   1654 N  N   . ALA A 1 212 ? 162.985 200.094 3.329   1.00 157.67 ? 285 ALA A N   1 
ATOM   1655 C  CA  . ALA A 1 212 ? 163.889 199.826 2.218   1.00 143.52 ? 285 ALA A CA  1 
ATOM   1656 C  C   . ALA A 1 212 ? 164.943 200.904 2.012   1.00 156.87 ? 285 ALA A C   1 
ATOM   1657 O  O   . ALA A 1 212 ? 165.967 200.628 1.379   1.00 152.81 ? 285 ALA A O   1 
ATOM   1658 C  CB  . ALA A 1 212 ? 163.095 199.651 0.917   1.00 142.69 ? 285 ALA A CB  1 
ATOM   1659 N  N   . THR A 1 213 ? 164.733 202.110 2.535   1.00 187.21 ? 286 THR A N   1 
ATOM   1660 C  CA  . THR A 1 213 ? 165.676 203.203 2.332   1.00 186.18 ? 286 THR A CA  1 
ATOM   1661 C  C   . THR A 1 213 ? 166.633 203.387 3.502   1.00 175.13 ? 286 THR A C   1 
ATOM   1662 O  O   . THR A 1 213 ? 167.768 203.830 3.293   1.00 165.38 ? 286 THR A O   1 
ATOM   1663 C  CB  . THR A 1 213 ? 164.921 204.512 2.078   1.00 150.33 ? 286 THR A CB  1 
ATOM   1664 O  OG1 . THR A 1 213 ? 163.932 204.703 3.097   1.00 152.07 ? 286 THR A OG1 1 
ATOM   1665 C  CG2 . THR A 1 213 ? 164.236 204.474 0.719   1.00 150.76 ? 286 THR A CG2 1 
ATOM   1666 N  N   . PHE A 1 214 ? 166.215 203.020 4.714   1.00 170.30 ? 287 PHE A N   1 
ATOM   1667 C  CA  . PHE A 1 214 ? 167.089 203.143 5.879   1.00 164.44 ? 287 PHE A CA  1 
ATOM   1668 C  C   . PHE A 1 214 ? 168.365 202.313 5.769   1.00 168.43 ? 287 PHE A C   1 
ATOM   1669 O  O   . PHE A 1 214 ? 169.439 202.842 6.112   1.00 170.47 ? 287 PHE A O   1 
ATOM   1670 C  CB  . PHE A 1 214 ? 166.317 202.777 7.154   1.00 165.76 ? 287 PHE A CB  1 
ATOM   1671 C  CG  . PHE A 1 214 ? 167.140 202.877 8.408   1.00 167.56 ? 287 PHE A CG  1 
ATOM   1672 C  CD1 . PHE A 1 214 ? 167.402 204.109 8.983   1.00 183.89 ? 287 PHE A CD1 1 
ATOM   1673 C  CD2 . PHE A 1 214 ? 167.649 201.740 9.014   1.00 156.58 ? 287 PHE A CD2 1 
ATOM   1674 C  CE1 . PHE A 1 214 ? 168.159 204.205 10.137  1.00 188.47 ? 287 PHE A CE1 1 
ATOM   1675 C  CE2 . PHE A 1 214 ? 168.406 201.831 10.169  1.00 152.90 ? 287 PHE A CE2 1 
ATOM   1676 C  CZ  . PHE A 1 214 ? 168.661 203.064 10.730  1.00 173.51 ? 287 PHE A CZ  1 
ATOM   1677 N  N   . PRO A 1 215 ? 168.336 201.045 5.336   1.00 156.25 ? 288 PRO A N   1 
ATOM   1678 C  CA  . PRO A 1 215 ? 169.586 200.268 5.298   1.00 147.91 ? 288 PRO A CA  1 
ATOM   1679 C  C   . PRO A 1 215 ? 170.667 200.893 4.435   1.00 142.59 ? 288 PRO A C   1 
ATOM   1680 O  O   . PRO A 1 215 ? 171.849 200.689 4.721   1.00 134.41 ? 288 PRO A O   1 
ATOM   1681 C  CB  . PRO A 1 215 ? 169.134 198.910 4.748   1.00 131.99 ? 288 PRO A CB  1 
ATOM   1682 C  CG  . PRO A 1 215 ? 167.712 198.807 5.148   1.00 133.02 ? 288 PRO A CG  1 
ATOM   1683 C  CD  . PRO A 1 215 ? 167.174 200.197 5.008   1.00 137.00 ? 288 PRO A CD  1 
ATOM   1684 N  N   . TYR A 1 216 ? 170.314 201.612 3.368   1.00 140.40 ? 289 TYR A N   1 
ATOM   1685 C  CA  . TYR A 1 216 ? 171.348 202.224 2.537   1.00 140.81 ? 289 TYR A CA  1 
ATOM   1686 C  C   . TYR A 1 216 ? 172.007 203.388 3.263   1.00 143.53 ? 289 TYR A C   1 
ATOM   1687 O  O   . TYR A 1 216 ? 173.219 203.601 3.140   1.00 150.56 ? 289 TYR A O   1 
ATOM   1688 C  CB  . TYR A 1 216 ? 170.762 202.671 1.202   1.00 142.34 ? 289 TYR A CB  1 
ATOM   1689 C  CG  . TYR A 1 216 ? 170.372 201.510 0.325   1.00 155.44 ? 289 TYR A CG  1 
ATOM   1690 C  CD1 . TYR A 1 216 ? 169.141 200.882 0.472   1.00 161.57 ? 289 TYR A CD1 1 
ATOM   1691 C  CD2 . TYR A 1 216 ? 171.243 201.029 -0.641  1.00 162.29 ? 289 TYR A CD2 1 
ATOM   1692 C  CE1 . TYR A 1 216 ? 168.786 199.812 -0.328  1.00 146.13 ? 289 TYR A CE1 1 
ATOM   1693 C  CE2 . TYR A 1 216 ? 170.898 199.966 -1.444  1.00 147.77 ? 289 TYR A CE2 1 
ATOM   1694 C  CZ  . TYR A 1 216 ? 169.670 199.359 -1.285  1.00 141.80 ? 289 TYR A CZ  1 
ATOM   1695 O  OH  . TYR A 1 216 ? 169.326 198.296 -2.085  1.00 147.60 ? 289 TYR A OH  1 
ATOM   1696 N  N   . ILE A 1 217 ? 171.220 204.160 4.014   1.00 151.32 ? 290 ILE A N   1 
ATOM   1697 C  CA  . ILE A 1 217 ? 171.779 205.247 4.813   1.00 146.77 ? 290 ILE A CA  1 
ATOM   1698 C  C   . ILE A 1 217 ? 172.706 204.682 5.879   1.00 144.71 ? 290 ILE A C   1 
ATOM   1699 O  O   . ILE A 1 217 ? 173.862 205.106 6.018   1.00 145.14 ? 290 ILE A O   1 
ATOM   1700 C  CB  . ILE A 1 217 ? 170.653 206.093 5.434   1.00 156.63 ? 290 ILE A CB  1 
ATOM   1701 C  CG1 . ILE A 1 217 ? 169.792 206.721 4.333   1.00 160.93 ? 290 ILE A CG1 1 
ATOM   1702 C  CG2 . ILE A 1 217 ? 171.230 207.154 6.360   1.00 165.23 ? 290 ILE A CG2 1 
ATOM   1703 C  CD1 . ILE A 1 217 ? 168.608 207.505 4.853   1.00 155.93 ? 290 ILE A CD1 1 
ATOM   1704 N  N   . ALA A 1 218 ? 172.209 203.707 6.646   1.00 156.60 ? 291 ALA A N   1 
ATOM   1705 C  CA  . ALA A 1 218 ? 173.025 203.091 7.686   1.00 156.63 ? 291 ALA A CA  1 
ATOM   1706 C  C   . ALA A 1 218 ? 174.285 202.471 7.096   1.00 137.86 ? 291 ALA A C   1 
ATOM   1707 O  O   . ALA A 1 218 ? 175.372 202.593 7.670   1.00 137.65 ? 291 ALA A O   1 
ATOM   1708 C  CB  . ALA A 1 218 ? 172.212 202.042 8.444   1.00 138.46 ? 291 ALA A CB  1 
ATOM   1709 N  N   . LEU A 1 219 ? 174.157 201.804 5.947   1.00 135.96 ? 292 LEU A N   1 
ATOM   1710 C  CA  . LEU A 1 219 ? 175.325 201.234 5.284   1.00 151.90 ? 292 LEU A CA  1 
ATOM   1711 C  C   . LEU A 1 219 ? 176.304 202.320 4.862   1.00 155.48 ? 292 LEU A C   1 
ATOM   1712 O  O   . LEU A 1 219 ? 177.518 202.099 4.862   1.00 157.21 ? 292 LEU A O   1 
ATOM   1713 C  CB  . LEU A 1 219 ? 174.900 200.405 4.071   1.00 131.68 ? 292 LEU A CB  1 
ATOM   1714 C  CG  . LEU A 1 219 ? 174.375 198.985 4.299   1.00 128.46 ? 292 LEU A CG  1 
ATOM   1715 C  CD1 . LEU A 1 219 ? 173.858 198.400 2.995   1.00 127.24 ? 292 LEU A CD1 1 
ATOM   1716 C  CD2 . LEU A 1 219 ? 175.438 198.090 4.911   1.00 127.83 ? 292 LEU A CD2 1 
ATOM   1717 N  N   . SER A 1 220 ? 175.797 203.486 4.454   1.00 148.19 ? 293 SER A N   1 
ATOM   1718 C  CA  . SER A 1 220 ? 176.688 204.585 4.096   1.00 157.10 ? 293 SER A CA  1 
ATOM   1719 C  C   . SER A 1 220 ? 177.461 205.082 5.314   1.00 161.68 ? 293 SER A C   1 
ATOM   1720 O  O   . SER A 1 220 ? 178.683 205.275 5.253   1.00 164.16 ? 293 SER A O   1 
ATOM   1721 C  CB  . SER A 1 220 ? 175.888 205.720 3.456   1.00 172.21 ? 293 SER A CB  1 
ATOM   1722 O  OG  . SER A 1 220 ? 176.735 206.783 3.057   1.00 186.60 ? 293 SER A OG  1 
ATOM   1723 N  N   . VAL A 1 221 ? 176.759 205.289 6.434   1.00 144.02 ? 294 VAL A N   1 
ATOM   1724 C  CA  . VAL A 1 221 ? 177.414 205.747 7.659   1.00 145.21 ? 294 VAL A CA  1 
ATOM   1725 C  C   . VAL A 1 221 ? 178.462 204.737 8.109   1.00 173.75 ? 294 VAL A C   1 
ATOM   1726 O  O   . VAL A 1 221 ? 179.607 205.092 8.418   1.00 173.68 ? 294 VAL A O   1 
ATOM   1727 C  CB  . VAL A 1 221 ? 176.369 206.006 8.758   1.00 146.78 ? 294 VAL A CB  1 
ATOM   1728 C  CG1 . VAL A 1 221 ? 177.040 206.533 10.016  1.00 149.10 ? 294 VAL A CG1 1 
ATOM   1729 C  CG2 . VAL A 1 221 ? 175.313 206.979 8.263   1.00 150.09 ? 294 VAL A CG2 1 
ATOM   1730 N  N   . LEU A 1 222 ? 178.080 203.457 8.147   1.00 156.78 ? 295 LEU A N   1 
ATOM   1731 C  CA  . LEU A 1 222 ? 179.019 202.403 8.516   1.00 157.38 ? 295 LEU A CA  1 
ATOM   1732 C  C   . LEU A 1 222 ? 180.157 202.306 7.514   1.00 165.23 ? 295 LEU A C   1 
ATOM   1733 O  O   . LEU A 1 222 ? 181.250 201.846 7.858   1.00 169.84 ? 295 LEU A O   1 
ATOM   1734 C  CB  . LEU A 1 222 ? 178.291 201.066 8.635   1.00 140.76 ? 295 LEU A CB  1 
ATOM   1735 C  CG  . LEU A 1 222 ? 177.227 201.006 9.731   1.00 138.39 ? 295 LEU A CG  1 
ATOM   1736 C  CD1 . LEU A 1 222 ? 176.472 199.689 9.679   1.00 142.39 ? 295 LEU A CD1 1 
ATOM   1737 C  CD2 . LEU A 1 222 ? 177.867 201.211 11.095  1.00 138.11 ? 295 LEU A CD2 1 
ATOM   1738 N  N   . LEU A 1 223 ? 179.907 202.698 6.265   1.00 161.49 ? 296 LEU A N   1 
ATOM   1739 C  CA  . LEU A 1 223 ? 180.939 202.622 5.239   1.00 139.24 ? 296 LEU A CA  1 
ATOM   1740 C  C   . LEU A 1 223 ? 182.002 203.682 5.475   1.00 149.27 ? 296 LEU A C   1 
ATOM   1741 O  O   . LEU A 1 223 ? 183.196 203.373 5.520   1.00 148.26 ? 296 LEU A O   1 
ATOM   1742 C  CB  . LEU A 1 223 ? 180.323 202.775 3.850   1.00 135.39 ? 296 LEU A CB  1 
ATOM   1743 C  CG  . LEU A 1 223 ? 181.318 202.635 2.695   1.00 134.71 ? 296 LEU A CG  1 
ATOM   1744 C  CD1 . LEU A 1 223 ? 181.876 201.223 2.633   1.00 130.95 ? 296 LEU A CD1 1 
ATOM   1745 C  CD2 . LEU A 1 223 ? 180.678 203.024 1.371   1.00 135.93 ? 296 LEU A CD2 1 
ATOM   1746 N  N   . VAL A 1 224 ? 181.591 204.947 5.601   1.00 140.98 ? 297 VAL A N   1 
ATOM   1747 C  CA  . VAL A 1 224 ? 182.573 205.996 5.849   1.00 143.65 ? 297 VAL A CA  1 
ATOM   1748 C  C   . VAL A 1 224 ? 183.192 205.839 7.234   1.00 154.16 ? 297 VAL A C   1 
ATOM   1749 O  O   . VAL A 1 224 ? 184.367 206.190 7.438   1.00 165.98 ? 297 VAL A O   1 
ATOM   1750 C  CB  . VAL A 1 224 ? 181.912 207.376 5.681   1.00 147.74 ? 297 VAL A CB  1 
ATOM   1751 C  CG1 . VAL A 1 224 ? 182.877 208.494 6.051   1.00 150.78 ? 297 VAL A CG1 1 
ATOM   1752 C  CG2 . VAL A 1 224 ? 181.410 207.546 4.257   1.00 151.43 ? 297 VAL A CG2 1 
ATOM   1753 N  N   . ARG A 1 225 ? 182.505 205.126 8.127   1.00 141.57 ? 298 ARG A N   1 
ATOM   1754 C  CA  . ARG A 1 225 ? 183.072 204.849 9.438   1.00 140.91 ? 298 ARG A CA  1 
ATOM   1755 C  C   . ARG A 1 225 ? 184.172 203.811 9.311   1.00 137.80 ? 298 ARG A C   1 
ATOM   1756 O  O   . ARG A 1 225 ? 185.299 204.030 9.767   1.00 138.28 ? 298 ARG A O   1 
ATOM   1757 C  CB  . ARG A 1 225 ? 181.974 204.364 10.387  1.00 167.42 ? 298 ARG A CB  1 
ATOM   1758 C  CG  . ARG A 1 225 ? 182.456 203.868 11.742  1.00 174.65 ? 298 ARG A CG  1 
ATOM   1759 C  CD  . ARG A 1 225 ? 183.093 204.982 12.568  1.00 187.45 ? 298 ARG A CD  1 
ATOM   1760 N  NE  . ARG A 1 225 ? 184.529 205.133 12.353  1.00 185.18 ? 298 ARG A NE  1 
ATOM   1761 C  CZ  . ARG A 1 225 ? 185.275 206.049 12.963  1.00 189.39 ? 298 ARG A CZ  1 
ATOM   1762 N  NH1 . ARG A 1 225 ? 184.719 206.893 13.822  1.00 189.29 ? 298 ARG A NH1 1 
ATOM   1763 N  NH2 . ARG A 1 225 ? 186.575 206.125 12.715  1.00 192.12 ? 298 ARG A NH2 1 
ATOM   1764 N  N   . GLY A 1 226 ? 183.868 202.673 8.686   1.00 134.72 ? 299 GLY A N   1 
ATOM   1765 C  CA  . GLY A 1 226 ? 184.878 201.646 8.573   1.00 154.59 ? 299 GLY A CA  1 
ATOM   1766 C  C   . GLY A 1 226 ? 186.011 202.069 7.665   1.00 149.39 ? 299 GLY A C   1 
ATOM   1767 O  O   . GLY A 1 226 ? 187.129 201.563 7.804   1.00 131.34 ? 299 GLY A O   1 
ATOM   1768 N  N   . ALA A 1 227 ? 185.740 202.994 6.737   1.00 139.38 ? 300 ALA A N   1 
ATOM   1769 C  CA  . ALA A 1 227 ? 186.791 203.496 5.865   1.00 145.07 ? 300 ALA A CA  1 
ATOM   1770 C  C   . ALA A 1 227 ? 187.717 204.420 6.636   1.00 159.96 ? 300 ALA A C   1 
ATOM   1771 O  O   . ALA A 1 227 ? 188.899 204.541 6.295   1.00 158.26 ? 300 ALA A O   1 
ATOM   1772 C  CB  . ALA A 1 227 ? 186.185 204.215 4.661   1.00 138.10 ? 300 ALA A CB  1 
ATOM   1773 N  N   . THR A 1 228 ? 187.198 205.077 7.679   1.00 192.76 ? 301 THR A N   1 
ATOM   1774 C  CA  . THR A 1 228 ? 188.025 205.973 8.478   1.00 215.71 ? 301 THR A CA  1 
ATOM   1775 C  C   . THR A 1 228 ? 188.803 205.223 9.555   1.00 206.74 ? 301 THR A C   1 
ATOM   1776 O  O   . THR A 1 228 ? 189.731 205.792 10.139  1.00 211.53 ? 301 THR A O   1 
ATOM   1777 C  CB  . THR A 1 228 ? 187.178 207.075 9.122   1.00 232.32 ? 301 THR A CB  1 
ATOM   1778 O  OG1 . THR A 1 228 ? 186.043 206.496 9.779   1.00 245.92 ? 301 THR A OG1 1 
ATOM   1779 C  CG2 . THR A 1 228 ? 186.726 208.093 8.081   1.00 235.38 ? 301 THR A CG2 1 
ATOM   1780 N  N   . LEU A 1 229 ? 188.446 203.967 9.818   1.00 190.53 ? 302 LEU A N   1 
ATOM   1781 C  CA  . LEU A 1 229 ? 189.127 203.171 10.830  1.00 175.30 ? 302 LEU A CA  1 
ATOM   1782 C  C   . LEU A 1 229 ? 190.529 202.773 10.370  1.00 171.41 ? 302 LEU A C   1 
ATOM   1783 O  O   . LEU A 1 229 ? 190.721 202.389 9.211   1.00 176.72 ? 302 LEU A O   1 
ATOM   1784 C  CB  . LEU A 1 229 ? 188.325 201.912 11.156  1.00 162.43 ? 302 LEU A CB  1 
ATOM   1785 C  CG  . LEU A 1 229 ? 186.910 202.090 11.701  1.00 164.07 ? 302 LEU A CG  1 
ATOM   1786 C  CD1 . LEU A 1 229 ? 186.249 200.739 11.920  1.00 164.42 ? 302 LEU A CD1 1 
ATOM   1787 C  CD2 . LEU A 1 229 ? 186.945 202.881 12.993  1.00 178.91 ? 302 LEU A CD2 1 
ATOM   1788 N  N   . PRO A 1 230 ? 191.521 202.852 11.255  1.00 165.27 ? 303 PRO A N   1 
ATOM   1789 C  CA  . PRO A 1 230 ? 192.894 202.504 10.870  1.00 162.45 ? 303 PRO A CA  1 
ATOM   1790 C  C   . PRO A 1 230 ? 193.039 201.012 10.615  1.00 158.42 ? 303 PRO A C   1 
ATOM   1791 O  O   . PRO A 1 230 ? 192.462 200.181 11.320  1.00 140.29 ? 303 PRO A O   1 
ATOM   1792 C  CB  . PRO A 1 230 ? 193.723 202.944 12.081  1.00 172.46 ? 303 PRO A CB  1 
ATOM   1793 C  CG  . PRO A 1 230 ? 192.769 202.862 13.225  1.00 170.78 ? 303 PRO A CG  1 
ATOM   1794 C  CD  . PRO A 1 230 ? 191.429 203.258 12.668  1.00 167.10 ? 303 PRO A CD  1 
ATOM   1795 N  N   . GLY A 1 231 ? 193.824 200.681 9.594   1.00 180.08 ? 304 GLY A N   1 
ATOM   1796 C  CA  . GLY A 1 231 ? 194.041 199.291 9.251   1.00 177.76 ? 304 GLY A CA  1 
ATOM   1797 C  C   . GLY A 1 231 ? 192.857 198.607 8.615   1.00 172.04 ? 304 GLY A C   1 
ATOM   1798 O  O   . GLY A 1 231 ? 192.750 197.380 8.684   1.00 160.60 ? 304 GLY A O   1 
ATOM   1799 N  N   . ALA A 1 232 ? 191.957 199.370 7.995   1.00 169.98 ? 305 ALA A N   1 
ATOM   1800 C  CA  . ALA A 1 232 ? 190.784 198.798 7.353   1.00 164.93 ? 305 ALA A CA  1 
ATOM   1801 C  C   . ALA A 1 232 ? 191.100 198.247 5.973   1.00 158.39 ? 305 ALA A C   1 
ATOM   1802 O  O   . ALA A 1 232 ? 190.257 197.563 5.384   1.00 163.26 ? 305 ALA A O   1 
ATOM   1803 C  CB  . ALA A 1 232 ? 189.673 199.843 7.245   1.00 165.51 ? 305 ALA A CB  1 
ATOM   1804 N  N   . TRP A 1 233 ? 192.293 198.533 5.449   1.00 157.77 ? 306 TRP A N   1 
ATOM   1805 C  CA  . TRP A 1 233 ? 192.667 198.058 4.126   1.00 163.16 ? 306 TRP A CA  1 
ATOM   1806 C  C   . TRP A 1 233 ? 192.884 196.553 4.110   1.00 156.23 ? 306 TRP A C   1 
ATOM   1807 O  O   . TRP A 1 233 ? 192.831 195.948 3.037   1.00 150.93 ? 306 TRP A O   1 
ATOM   1808 C  CB  . TRP A 1 233 ? 193.925 198.772 3.629   1.00 171.11 ? 306 TRP A CB  1 
ATOM   1809 C  CG  . TRP A 1 233 ? 195.116 198.571 4.499   1.00 154.25 ? 306 TRP A CG  1 
ATOM   1810 C  CD1 . TRP A 1 233 ? 195.532 199.373 5.519   1.00 173.07 ? 306 TRP A CD1 1 
ATOM   1811 C  CD2 . TRP A 1 233 ? 196.051 197.488 4.431   1.00 157.49 ? 306 TRP A CD2 1 
ATOM   1812 N  NE1 . TRP A 1 233 ? 196.671 198.858 6.091   1.00 182.27 ? 306 TRP A NE1 1 
ATOM   1813 C  CE2 . TRP A 1 233 ? 197.010 197.700 5.441   1.00 176.54 ? 306 TRP A CE2 1 
ATOM   1814 C  CE3 . TRP A 1 233 ? 196.170 196.360 3.613   1.00 157.20 ? 306 TRP A CE3 1 
ATOM   1815 C  CZ2 . TRP A 1 233 ? 198.073 196.826 5.656   1.00 172.29 ? 306 TRP A CZ2 1 
ATOM   1816 C  CZ3 . TRP A 1 233 ? 197.225 195.495 3.826   1.00 155.74 ? 306 TRP A CZ3 1 
ATOM   1817 C  CH2 . TRP A 1 233 ? 198.164 195.732 4.840   1.00 170.33 ? 306 TRP A CH2 1 
ATOM   1818 N  N   . ARG A 1 234 ? 193.161 195.943 5.266   1.00 154.13 ? 307 ARG A N   1 
ATOM   1819 C  CA  . ARG A 1 234 ? 193.409 194.506 5.305   1.00 150.11 ? 307 ARG A CA  1 
ATOM   1820 C  C   . ARG A 1 234 ? 192.150 193.725 4.956   1.00 152.36 ? 307 ARG A C   1 
ATOM   1821 O  O   . ARG A 1 234 ? 192.211 192.733 4.219   1.00 153.93 ? 307 ARG A O   1 
ATOM   1822 C  CB  . ARG A 1 234 ? 193.928 194.094 6.681   1.00 144.78 ? 307 ARG A CB  1 
ATOM   1823 C  CG  . ARG A 1 234 ? 195.187 194.819 7.103   1.00 154.79 ? 307 ARG A CG  1 
ATOM   1824 C  CD  . ARG A 1 234 ? 195.680 194.312 8.441   1.00 159.08 ? 307 ARG A CD  1 
ATOM   1825 N  NE  . ARG A 1 234 ? 196.836 195.067 8.912   1.00 180.60 ? 307 ARG A NE  1 
ATOM   1826 C  CZ  . ARG A 1 234 ? 198.095 194.773 8.608   1.00 189.68 ? 307 ARG A CZ  1 
ATOM   1827 N  NH1 . ARG A 1 234 ? 198.366 193.734 7.829   1.00 188.44 ? 307 ARG A NH1 1 
ATOM   1828 N  NH2 . ARG A 1 234 ? 199.085 195.516 9.084   1.00 196.25 ? 307 ARG A NH2 1 
ATOM   1829 N  N   . GLY A 1 235 ? 191.002 194.146 5.487   1.00 153.76 ? 308 GLY A N   1 
ATOM   1830 C  CA  . GLY A 1 235 ? 189.762 193.459 5.170   1.00 161.53 ? 308 GLY A CA  1 
ATOM   1831 C  C   . GLY A 1 235 ? 189.375 193.622 3.713   1.00 151.72 ? 308 GLY A C   1 
ATOM   1832 O  O   . GLY A 1 235 ? 188.849 192.693 3.094   1.00 140.67 ? 308 GLY A O   1 
ATOM   1833 N  N   . VAL A 1 236 ? 189.629 194.803 3.146   1.00 146.62 ? 309 VAL A N   1 
ATOM   1834 C  CA  . VAL A 1 236 ? 189.338 195.026 1.733   1.00 142.66 ? 309 VAL A CA  1 
ATOM   1835 C  C   . VAL A 1 236 ? 190.285 194.205 0.868   1.00 142.14 ? 309 VAL A C   1 
ATOM   1836 O  O   . VAL A 1 236 ? 189.888 193.662 -0.168  1.00 164.81 ? 309 VAL A O   1 
ATOM   1837 C  CB  . VAL A 1 236 ? 189.416 196.525 1.398   1.00 119.70 ? 309 VAL A CB  1 
ATOM   1838 C  CG1 . VAL A 1 236 ? 189.064 196.761 -0.063  1.00 120.43 ? 309 VAL A CG1 1 
ATOM   1839 C  CG2 . VAL A 1 236 ? 188.495 197.320 2.311   1.00 141.59 ? 309 VAL A CG2 1 
ATOM   1840 N  N   . LEU A 1 237 ? 191.556 194.128 1.266   1.00 129.05 ? 310 LEU A N   1 
ATOM   1841 C  CA  . LEU A 1 237 ? 192.530 193.324 0.535   1.00 131.01 ? 310 LEU A CA  1 
ATOM   1842 C  C   . LEU A 1 237 ? 192.120 191.859 0.542   1.00 139.33 ? 310 LEU A C   1 
ATOM   1843 O  O   . LEU A 1 237 ? 192.135 191.190 -0.497  1.00 144.82 ? 310 LEU A O   1 
ATOM   1844 C  CB  . LEU A 1 237 ? 193.922 193.500 1.140   1.00 151.45 ? 310 LEU A CB  1 
ATOM   1845 C  CG  . LEU A 1 237 ? 195.031 192.671 0.488   1.00 158.80 ? 310 LEU A CG  1 
ATOM   1846 C  CD1 . LEU A 1 237 ? 195.204 193.053 -0.976  1.00 149.40 ? 310 LEU A CD1 1 
ATOM   1847 C  CD2 . LEU A 1 237 ? 196.339 192.818 1.249   1.00 167.18 ? 310 LEU A CD2 1 
ATOM   1848 N  N   . PHE A 1 238 ? 191.739 191.345 1.715   1.00 145.10 ? 311 PHE A N   1 
ATOM   1849 C  CA  . PHE A 1 238 ? 191.292 189.963 1.821   1.00 140.34 ? 311 PHE A CA  1 
ATOM   1850 C  C   . PHE A 1 238 ? 189.965 189.765 1.103   1.00 113.20 ? 311 PHE A C   1 
ATOM   1851 O  O   . PHE A 1 238 ? 189.635 188.637 0.721   1.00 109.36 ? 311 PHE A O   1 
ATOM   1852 C  CB  . PHE A 1 238 ? 191.172 189.581 3.300   1.00 132.48 ? 311 PHE A CB  1 
ATOM   1853 C  CG  . PHE A 1 238 ? 190.640 188.197 3.539   1.00 131.06 ? 311 PHE A CG  1 
ATOM   1854 C  CD1 . PHE A 1 238 ? 191.431 187.084 3.308   1.00 138.30 ? 311 PHE A CD1 1 
ATOM   1855 C  CD2 . PHE A 1 238 ? 189.349 188.012 4.007   1.00 122.38 ? 311 PHE A CD2 1 
ATOM   1856 C  CE1 . PHE A 1 238 ? 190.941 185.809 3.536   1.00 156.65 ? 311 PHE A CE1 1 
ATOM   1857 C  CE2 . PHE A 1 238 ? 188.853 186.742 4.235   1.00 143.11 ? 311 PHE A CE2 1 
ATOM   1858 C  CZ  . PHE A 1 238 ? 189.649 185.638 3.999   1.00 156.76 ? 311 PHE A CZ  1 
ATOM   1859 N  N   . TYR A 1 239 ? 189.212 190.848 0.910   1.00 108.14 ? 312 TYR A N   1 
ATOM   1860 C  CA  . TYR A 1 239 ? 187.912 190.811 0.253   1.00 108.00 ? 312 TYR A CA  1 
ATOM   1861 C  C   . TYR A 1 239 ? 188.047 190.781 -1.264  1.00 132.61 ? 312 TYR A C   1 
ATOM   1862 O  O   . TYR A 1 239 ? 187.201 190.195 -1.950  1.00 107.30 ? 312 TYR A O   1 
ATOM   1863 C  CB  . TYR A 1 239 ? 187.098 192.029 0.691   1.00 117.26 ? 312 TYR A CB  1 
ATOM   1864 C  CG  . TYR A 1 239 ? 185.694 192.112 0.146   1.00 110.34 ? 312 TYR A CG  1 
ATOM   1865 C  CD1 . TYR A 1 239 ? 184.911 190.979 -0.021  1.00 108.16 ? 312 TYR A CD1 1 
ATOM   1866 C  CD2 . TYR A 1 239 ? 185.153 193.343 -0.210  1.00 112.87 ? 312 TYR A CD2 1 
ATOM   1867 C  CE1 . TYR A 1 239 ? 183.625 191.075 -0.527  1.00 110.80 ? 312 TYR A CE1 1 
ATOM   1868 C  CE2 . TYR A 1 239 ? 183.876 193.448 -0.712  1.00 113.22 ? 312 TYR A CE2 1 
ATOM   1869 C  CZ  . TYR A 1 239 ? 183.115 192.314 -0.871  1.00 112.15 ? 312 TYR A CZ  1 
ATOM   1870 O  OH  . TYR A 1 239 ? 181.839 192.428 -1.370  1.00 111.47 ? 312 TYR A OH  1 
ATOM   1871 N  N   . LEU A 1 240 ? 189.081 191.432 -1.800  1.00 143.18 ? 313 LEU A N   1 
ATOM   1872 C  CA  . LEU A 1 240 ? 189.257 191.607 -3.233  1.00 110.71 ? 313 LEU A CA  1 
ATOM   1873 C  C   . LEU A 1 240 ? 190.490 190.913 -3.799  1.00 117.65 ? 313 LEU A C   1 
ATOM   1874 O  O   . LEU A 1 240 ? 190.702 190.974 -5.015  1.00 110.59 ? 313 LEU A O   1 
ATOM   1875 C  CB  . LEU A 1 240 ? 189.327 193.101 -3.574  1.00 113.75 ? 313 LEU A CB  1 
ATOM   1876 C  CG  . LEU A 1 240 ? 188.123 193.928 -3.131  1.00 115.04 ? 313 LEU A CG  1 
ATOM   1877 C  CD1 . LEU A 1 240 ? 188.282 195.368 -3.581  1.00 124.97 ? 313 LEU A CD1 1 
ATOM   1878 C  CD2 . LEU A 1 240 ? 186.837 193.325 -3.673  1.00 113.81 ? 313 LEU A CD2 1 
ATOM   1879 N  N   . LYS A 1 241 ? 191.301 190.260 -2.970  1.00 118.83 ? 314 LYS A N   1 
ATOM   1880 C  CA  . LYS A 1 241 ? 192.510 189.603 -3.457  1.00 122.42 ? 314 LYS A CA  1 
ATOM   1881 C  C   . LYS A 1 241 ? 192.135 188.481 -4.416  1.00 139.01 ? 314 LYS A C   1 
ATOM   1882 O  O   . LYS A 1 241 ? 191.485 187.511 -3.999  1.00 153.52 ? 314 LYS A O   1 
ATOM   1883 C  CB  . LYS A 1 241 ? 193.328 189.047 -2.296  1.00 128.69 ? 314 LYS A CB  1 
ATOM   1884 C  CG  . LYS A 1 241 ? 194.671 188.457 -2.687  1.00 138.99 ? 314 LYS A CG  1 
ATOM   1885 C  CD  . LYS A 1 241 ? 195.422 187.965 -1.455  1.00 149.26 ? 314 LYS A CD  1 
ATOM   1886 C  CE  . LYS A 1 241 ? 196.766 187.357 -1.814  1.00 137.19 ? 314 LYS A CE  1 
ATOM   1887 N  NZ  . LYS A 1 241 ? 197.481 186.874 -0.603  1.00 132.48 ? 314 LYS A NZ  1 
ATOM   1888 N  N   . PRO A 1 242 ? 192.521 188.565 -5.688  1.00 129.91 ? 315 PRO A N   1 
ATOM   1889 C  CA  . PRO A 1 242 ? 192.116 187.536 -6.655  1.00 126.52 ? 315 PRO A CA  1 
ATOM   1890 C  C   . PRO A 1 242 ? 192.818 186.212 -6.395  1.00 144.61 ? 315 PRO A C   1 
ATOM   1891 O  O   . PRO A 1 242 ? 194.047 186.143 -6.339  1.00 161.45 ? 315 PRO A O   1 
ATOM   1892 C  CB  . PRO A 1 242 ? 192.531 188.133 -8.007  1.00 130.96 ? 315 PRO A CB  1 
ATOM   1893 C  CG  . PRO A 1 242 ? 192.789 189.594 -7.737  1.00 152.26 ? 315 PRO A CG  1 
ATOM   1894 C  CD  . PRO A 1 242 ? 193.282 189.648 -6.328  1.00 157.05 ? 315 PRO A CD  1 
ATOM   1895 N  N   . ASN A 1 243 ? 192.023 185.155 -6.248  1.00 133.85 ? 316 ASN A N   1 
ATOM   1896 C  CA  . ASN A 1 243 ? 192.522 183.787 -6.137  1.00 122.63 ? 316 ASN A CA  1 
ATOM   1897 C  C   . ASN A 1 243 ? 191.865 182.999 -7.264  1.00 124.91 ? 316 ASN A C   1 
ATOM   1898 O  O   . ASN A 1 243 ? 190.873 182.298 -7.056  1.00 136.31 ? 316 ASN A O   1 
ATOM   1899 C  CB  . ASN A 1 243 ? 192.213 183.190 -4.756  1.00 121.80 ? 316 ASN A CB  1 
ATOM   1900 C  CG  . ASN A 1 243 ? 192.973 181.906 -4.489  1.00 130.30 ? 316 ASN A CG  1 
ATOM   1901 O  OD1 . ASN A 1 243 ? 193.335 181.179 -5.415  1.00 126.77 ? 316 ASN A OD1 1 
ATOM   1902 N  ND2 . ASN A 1 243 ? 193.221 181.620 -3.216  1.00 147.88 ? 316 ASN A ND2 1 
ATOM   1903 N  N   . TRP A 1 244 ? 192.439 183.106 -8.464  1.00 126.12 ? 317 TRP A N   1 
ATOM   1904 C  CA  . TRP A 1 244 ? 191.825 182.514 -9.646  1.00 138.42 ? 317 TRP A CA  1 
ATOM   1905 C  C   . TRP A 1 244 ? 191.832 180.991 -9.618  1.00 151.71 ? 317 TRP A C   1 
ATOM   1906 O  O   . TRP A 1 244 ? 191.021 180.374 -10.324 1.00 162.15 ? 317 TRP A O   1 
ATOM   1907 C  CB  . TRP A 1 244 ? 192.553 183.008 -10.898 1.00 149.13 ? 317 TRP A CB  1 
ATOM   1908 C  CG  . TRP A 1 244 ? 192.619 184.507 -11.018 1.00 157.48 ? 317 TRP A CG  1 
ATOM   1909 C  CD1 . TRP A 1 244 ? 193.674 185.307 -10.685 1.00 165.75 ? 317 TRP A CD1 1 
ATOM   1910 C  CD2 . TRP A 1 244 ? 191.602 185.381 -11.529 1.00 154.88 ? 317 TRP A CD2 1 
ATOM   1911 N  NE1 . TRP A 1 244 ? 193.373 186.622 -10.943 1.00 163.19 ? 317 TRP A NE1 1 
ATOM   1912 C  CE2 . TRP A 1 244 ? 192.108 186.695 -11.462 1.00 152.80 ? 317 TRP A CE2 1 
ATOM   1913 C  CE3 . TRP A 1 244 ? 190.312 185.180 -12.030 1.00 146.96 ? 317 TRP A CE3 1 
ATOM   1914 C  CZ2 . TRP A 1 244 ? 191.369 187.802 -11.877 1.00 145.89 ? 317 TRP A CZ2 1 
ATOM   1915 C  CZ3 . TRP A 1 244 ? 189.581 186.282 -12.442 1.00 137.39 ? 317 TRP A CZ3 1 
ATOM   1916 C  CH2 . TRP A 1 244 ? 190.111 187.575 -12.363 1.00 142.55 ? 317 TRP A CH2 1 
ATOM   1917 N  N   . GLN A 1 245 ? 192.574 180.382 -8.691  1.00 162.50 ? 318 GLN A N   1 
ATOM   1918 C  CA  . GLN A 1 245 ? 192.599 178.929 -8.604  1.00 168.49 ? 318 GLN A CA  1 
ATOM   1919 C  C   . GLN A 1 245 ? 191.305 178.398 -8.026  1.00 180.17 ? 318 GLN A C   1 
ATOM   1920 O  O   . GLN A 1 245 ? 190.937 177.247 -8.302  1.00 186.63 ? 318 GLN A O   1 
ATOM   1921 C  CB  . GLN A 1 245 ? 193.780 178.482 -7.739  1.00 190.58 ? 318 GLN A CB  1 
ATOM   1922 C  CG  . GLN A 1 245 ? 195.150 178.843 -8.301  1.00 207.99 ? 318 GLN A CG  1 
ATOM   1923 C  CD  . GLN A 1 245 ? 195.490 178.097 -9.573  1.00 217.69 ? 318 GLN A CD  1 
ATOM   1924 O  OE1 . GLN A 1 245 ? 194.932 177.036 -9.852  1.00 214.84 ? 318 GLN A OE1 1 
ATOM   1925 N  NE2 . GLN A 1 245 ? 196.407 178.653 -10.358 1.00 225.40 ? 318 GLN A NE2 1 
ATOM   1926 N  N   . LYS A 1 246 ? 190.507 179.285 -7.436  1.00 158.51 ? 319 LYS A N   1 
ATOM   1927 C  CA  . LYS A 1 246 ? 189.240 178.869 -6.869  1.00 146.45 ? 319 LYS A CA  1 
ATOM   1928 C  C   . LYS A 1 246 ? 188.277 178.598 -8.002  1.00 129.77 ? 319 LYS A C   1 
ATOM   1929 O  O   . LYS A 1 246 ? 187.394 177.741 -7.877  1.00 143.70 ? 319 LYS A O   1 
ATOM   1930 C  CB  . LYS A 1 246 ? 188.695 179.951 -5.938  1.00 125.11 ? 319 LYS A CB  1 
ATOM   1931 C  CG  . LYS A 1 246 ? 189.278 179.942 -4.532  1.00 117.87 ? 319 LYS A CG  1 
ATOM   1932 C  CD  . LYS A 1 246 ? 188.924 178.684 -3.764  1.00 116.94 ? 319 LYS A CD  1 
ATOM   1933 C  CE  . LYS A 1 246 ? 189.465 178.754 -2.342  1.00 122.01 ? 319 LYS A CE  1 
ATOM   1934 N  NZ  . LYS A 1 246 ? 189.102 177.557 -1.536  1.00 133.75 ? 319 LYS A NZ  1 
ATOM   1935 N  N   . LEU A 1 247 ? 188.441 179.315 -9.118  1.00 103.47 ? 320 LEU A N   1 
ATOM   1936 C  CA  . LEU A 1 247 ? 187.553 179.096 -10.247 1.00 101.87 ? 320 LEU A CA  1 
ATOM   1937 C  C   . LEU A 1 247 ? 187.728 177.691 -10.808 1.00 122.42 ? 320 LEU A C   1 
ATOM   1938 O  O   . LEU A 1 247 ? 186.815 177.186 -11.473 1.00 123.14 ? 320 LEU A O   1 
ATOM   1939 C  CB  . LEU A 1 247 ? 187.784 180.150 -11.329 1.00 109.47 ? 320 LEU A CB  1 
ATOM   1940 C  CG  . LEU A 1 247 ? 187.451 181.584 -10.912 1.00 127.10 ? 320 LEU A CG  1 
ATOM   1941 C  CD1 . LEU A 1 247 ? 187.724 182.556 -12.046 1.00 149.53 ? 320 LEU A CD1 1 
ATOM   1942 C  CD2 . LEU A 1 247 ? 185.996 181.668 -10.482 1.00 97.35  ? 320 LEU A CD2 1 
ATOM   1943 N  N   . LEU A 1 248 ? 188.881 177.047 -10.565 1.00 131.98 ? 321 LEU A N   1 
ATOM   1944 C  CA  . LEU A 1 248 ? 189.051 175.679 -11.052 1.00 143.53 ? 321 LEU A CA  1 
ATOM   1945 C  C   . LEU A 1 248 ? 188.188 174.686 -10.281 1.00 165.61 ? 321 LEU A C   1 
ATOM   1946 O  O   . LEU A 1 248 ? 187.816 173.640 -10.826 1.00 181.55 ? 321 LEU A O   1 
ATOM   1947 C  CB  . LEU A 1 248 ? 190.517 175.258 -10.995 1.00 136.34 ? 321 LEU A CB  1 
ATOM   1948 C  CG  . LEU A 1 248 ? 191.463 176.057 -11.889 1.00 142.85 ? 321 LEU A CG  1 
ATOM   1949 C  CD1 . LEU A 1 248 ? 192.879 175.518 -11.769 1.00 167.83 ? 321 LEU A CD1 1 
ATOM   1950 C  CD2 . LEU A 1 248 ? 190.985 176.013 -13.332 1.00 142.76 ? 321 LEU A CD2 1 
ATOM   1951 N  N   . GLU A 1 249 ? 187.874 174.980 -9.023  1.00 139.64 ? 322 GLU A N   1 
ATOM   1952 C  CA  . GLU A 1 249 ? 187.014 174.105 -8.238  1.00 127.14 ? 322 GLU A CA  1 
ATOM   1953 C  C   . GLU A 1 249 ? 185.564 174.241 -8.687  1.00 126.98 ? 322 GLU A C   1 
ATOM   1954 O  O   . GLU A 1 249 ? 185.033 175.351 -8.789  1.00 123.71 ? 322 GLU A O   1 
ATOM   1955 C  CB  . GLU A 1 249 ? 187.131 174.430 -6.752  1.00 148.64 ? 322 GLU A CB  1 
ATOM   1956 C  CG  . GLU A 1 249 ? 188.538 174.349 -6.202  1.00 159.58 ? 322 GLU A CG  1 
ATOM   1957 C  CD  . GLU A 1 249 ? 188.597 174.705 -4.731  1.00 169.92 ? 322 GLU A CD  1 
ATOM   1958 O  OE1 . GLU A 1 249 ? 187.523 174.920 -4.128  1.00 161.70 ? 322 GLU A OE1 1 
ATOM   1959 O  OE2 . GLU A 1 249 ? 189.715 174.771 -4.177  1.00 186.17 ? 322 GLU A OE2 1 
ATOM   1960 N  N   . THR A 1 250 ? 184.910 173.103 -8.919  1.00 155.03 ? 323 THR A N   1 
ATOM   1961 C  CA  . THR A 1 250 ? 183.536 173.110 -9.402  1.00 162.25 ? 323 THR A CA  1 
ATOM   1962 C  C   . THR A 1 250 ? 182.546 173.497 -8.317  1.00 154.94 ? 323 THR A C   1 
ATOM   1963 O  O   . THR A 1 250 ? 181.354 173.644 -8.609  1.00 161.16 ? 323 THR A O   1 
ATOM   1964 C  CB  . THR A 1 250 ? 183.172 171.735 -9.967  1.00 179.78 ? 323 THR A CB  1 
ATOM   1965 O  OG1 . THR A 1 250 ? 181.809 171.738 -10.410 1.00 190.88 ? 323 THR A OG1 1 
ATOM   1966 C  CG2 . THR A 1 250 ? 183.356 170.656 -8.907  1.00 173.91 ? 323 THR A CG2 1 
ATOM   1967 N  N   . GLY A 1 251 ? 183.015 173.676 -7.086  1.00 157.07 ? 324 GLY A N   1 
ATOM   1968 C  CA  . GLY A 1 251 ? 182.168 174.006 -5.960  1.00 157.87 ? 324 GLY A CA  1 
ATOM   1969 C  C   . GLY A 1 251 ? 181.766 175.467 -5.913  1.00 133.94 ? 324 GLY A C   1 
ATOM   1970 O  O   . GLY A 1 251 ? 180.602 175.781 -5.646  1.00 141.55 ? 324 GLY A O   1 
ATOM   1971 N  N   . VAL A 1 252 ? 182.715 176.370 -6.180  1.00 112.75 ? 325 VAL A N   1 
ATOM   1972 C  CA  . VAL A 1 252 ? 182.438 177.800 -6.050  1.00 110.19 ? 325 VAL A CA  1 
ATOM   1973 C  C   . VAL A 1 252 ? 181.409 178.261 -7.076  1.00 116.15 ? 325 VAL A C   1 
ATOM   1974 O  O   . VAL A 1 252 ? 180.695 179.245 -6.844  1.00 116.23 ? 325 VAL A O   1 
ATOM   1975 C  CB  . VAL A 1 252 ? 183.741 178.613 -6.160  1.00 108.31 ? 325 VAL A CB  1 
ATOM   1976 C  CG1 . VAL A 1 252 ? 184.741 178.156 -5.107  1.00 114.28 ? 325 VAL A CG1 1 
ATOM   1977 C  CG2 . VAL A 1 252 ? 184.328 178.503 -7.556  1.00 109.92 ? 325 VAL A CG2 1 
ATOM   1978 N  N   . TRP A 1 253 ? 181.303 177.570 -8.214  1.00 124.37 ? 326 TRP A N   1 
ATOM   1979 C  CA  . TRP A 1 253 ? 180.287 177.932 -9.197  1.00 150.22 ? 326 TRP A CA  1 
ATOM   1980 C  C   . TRP A 1 253 ? 178.898 177.606 -8.668  1.00 152.06 ? 326 TRP A C   1 
ATOM   1981 O  O   . TRP A 1 253 ? 177.953 178.386 -8.847  1.00 142.72 ? 326 TRP A O   1 
ATOM   1982 C  CB  . TRP A 1 253 ? 180.549 177.218 -10.523 1.00 146.40 ? 326 TRP A CB  1 
ATOM   1983 C  CG  . TRP A 1 253 ? 181.749 177.737 -11.251 1.00 130.92 ? 326 TRP A CG  1 
ATOM   1984 C  CD1 . TRP A 1 253 ? 183.049 177.349 -11.085 1.00 121.63 ? 326 TRP A CD1 1 
ATOM   1985 C  CD2 . TRP A 1 253 ? 181.759 178.753 -12.259 1.00 119.35 ? 326 TRP A CD2 1 
ATOM   1986 N  NE1 . TRP A 1 253 ? 183.866 178.059 -11.933 1.00 105.19 ? 326 TRP A NE1 1 
ATOM   1987 C  CE2 . TRP A 1 253 ? 183.098 178.928 -12.663 1.00 114.72 ? 326 TRP A CE2 1 
ATOM   1988 C  CE3 . TRP A 1 253 ? 180.764 179.531 -12.860 1.00 111.90 ? 326 TRP A CE3 1 
ATOM   1989 C  CZ2 . TRP A 1 253 ? 183.466 179.850 -13.641 1.00 136.73 ? 326 TRP A CZ2 1 
ATOM   1990 C  CZ3 . TRP A 1 253 ? 181.131 180.443 -13.830 1.00 131.52 ? 326 TRP A CZ3 1 
ATOM   1991 C  CH2 . TRP A 1 253 ? 182.470 180.596 -14.211 1.00 141.26 ? 326 TRP A CH2 1 
ATOM   1992 N  N   . ILE A 1 254 ? 178.763 176.454 -8.012  1.00 154.96 ? 327 ILE A N   1 
ATOM   1993 C  CA  . ILE A 1 254 ? 177.496 176.075 -7.405  1.00 144.18 ? 327 ILE A CA  1 
ATOM   1994 C  C   . ILE A 1 254 ? 177.170 177.015 -6.251  1.00 134.06 ? 327 ILE A C   1 
ATOM   1995 O  O   . ILE A 1 254 ? 176.012 177.406 -6.055  1.00 141.85 ? 327 ILE A O   1 
ATOM   1996 C  CB  . ILE A 1 254 ? 177.567 174.606 -6.955  1.00 134.71 ? 327 ILE A CB  1 
ATOM   1997 C  CG1 . ILE A 1 254 ? 177.906 173.721 -8.158  1.00 133.06 ? 327 ILE A CG1 1 
ATOM   1998 C  CG2 . ILE A 1 254 ? 176.260 174.181 -6.309  1.00 145.25 ? 327 ILE A CG2 1 
ATOM   1999 C  CD1 . ILE A 1 254 ? 178.157 172.277 -7.814  1.00 143.36 ? 327 ILE A CD1 1 
ATOM   2000 N  N   . ASP A 1 255 ? 178.190 177.402 -5.478  1.00 124.67 ? 328 ASP A N   1 
ATOM   2001 C  CA  . ASP A 1 255 ? 177.989 178.352 -4.388  1.00 110.71 ? 328 ASP A CA  1 
ATOM   2002 C  C   . ASP A 1 255 ? 177.472 179.683 -4.920  1.00 118.04 ? 328 ASP A C   1 
ATOM   2003 O  O   . ASP A 1 255 ? 176.552 180.279 -4.344  1.00 131.73 ? 328 ASP A O   1 
ATOM   2004 C  CB  . ASP A 1 255 ? 179.297 178.554 -3.621  1.00 123.74 ? 328 ASP A CB  1 
ATOM   2005 C  CG  . ASP A 1 255 ? 179.687 177.341 -2.792  1.00 136.19 ? 328 ASP A CG  1 
ATOM   2006 O  OD1 . ASP A 1 255 ? 179.232 176.223 -3.114  1.00 158.96 ? 328 ASP A OD1 1 
ATOM   2007 O  OD2 . ASP A 1 255 ? 180.462 177.505 -1.825  1.00 113.16 ? 328 ASP A OD2 1 
ATOM   2008 N  N   . ALA A 1 256 ? 178.060 180.166 -6.018  1.00 114.77 ? 329 ALA A N   1 
ATOM   2009 C  CA  . ALA A 1 256 ? 177.615 181.420 -6.619  1.00 125.71 ? 329 ALA A CA  1 
ATOM   2010 C  C   . ALA A 1 256 ? 176.190 181.299 -7.145  1.00 123.02 ? 329 ALA A C   1 
ATOM   2011 O  O   . ALA A 1 256 ? 175.367 182.203 -6.947  1.00 118.62 ? 329 ALA A O   1 
ATOM   2012 C  CB  . ALA A 1 256 ? 178.568 181.837 -7.738  1.00 120.18 ? 329 ALA A CB  1 
ATOM   2013 N  N   . ALA A 1 257 ? 175.882 180.185 -7.817  1.00 124.14 ? 330 ALA A N   1 
ATOM   2014 C  CA  . ALA A 1 257 ? 174.534 179.968 -8.337  1.00 122.04 ? 330 ALA A CA  1 
ATOM   2015 C  C   . ALA A 1 257 ? 173.506 180.008 -7.215  1.00 94.65  ? 330 ALA A C   1 
ATOM   2016 O  O   . ALA A 1 257 ? 172.512 180.742 -7.289  1.00 100.18 ? 330 ALA A O   1 
ATOM   2017 C  CB  . ALA A 1 257 ? 174.473 178.636 -9.082  1.00 111.25 ? 330 ALA A CB  1 
ATOM   2018 N  N   . ALA A 1 258 ? 173.730 179.221 -6.162  1.00 93.14  ? 331 ALA A N   1 
ATOM   2019 C  CA  . ALA A 1 258 ? 172.807 179.212 -5.033  1.00 93.13  ? 331 ALA A CA  1 
ATOM   2020 C  C   . ALA A 1 258 ? 172.682 180.603 -4.425  1.00 127.34 ? 331 ALA A C   1 
ATOM   2021 O  O   . ALA A 1 258 ? 171.568 181.069 -4.144  1.00 114.92 ? 331 ALA A O   1 
ATOM   2022 C  CB  . ALA A 1 258 ? 173.266 178.202 -3.983  1.00 91.42  ? 331 ALA A CB  1 
ATOM   2023 N  N   . GLN A 1 259 ? 173.813 181.292 -4.238  1.00 100.34 ? 332 GLN A N   1 
ATOM   2024 C  CA  . GLN A 1 259 ? 173.777 182.616 -3.625  1.00 112.05 ? 332 GLN A CA  1 
ATOM   2025 C  C   . GLN A 1 259 ? 172.918 183.579 -4.438  1.00 113.79 ? 332 GLN A C   1 
ATOM   2026 O  O   . GLN A 1 259 ? 172.074 184.295 -3.881  1.00 121.21 ? 332 GLN A O   1 
ATOM   2027 C  CB  . GLN A 1 259 ? 175.205 183.157 -3.503  1.00 111.13 ? 332 GLN A CB  1 
ATOM   2028 C  CG  . GLN A 1 259 ? 175.337 184.577 -2.951  1.00 112.96 ? 332 GLN A CG  1 
ATOM   2029 C  CD  . GLN A 1 259 ? 174.868 184.723 -1.517  1.00 109.50 ? 332 GLN A CD  1 
ATOM   2030 O  OE1 . GLN A 1 259 ? 174.797 183.749 -0.770  1.00 113.28 ? 332 GLN A OE1 1 
ATOM   2031 N  NE2 . GLN A 1 259 ? 174.547 185.951 -1.125  1.00 102.27 ? 332 GLN A NE2 1 
ATOM   2032 N  N   . ILE A 1 260 ? 173.093 183.593 -5.763  1.00 106.25 ? 333 ILE A N   1 
ATOM   2033 C  CA  . ILE A 1 260 ? 172.310 184.538 -6.547  1.00 117.83 ? 333 ILE A CA  1 
ATOM   2034 C  C   . ILE A 1 260 ? 170.858 184.088 -6.670  1.00 122.03 ? 333 ILE A C   1 
ATOM   2035 O  O   . ILE A 1 260 ? 169.962 184.928 -6.834  1.00 124.43 ? 333 ILE A O   1 
ATOM   2036 C  CB  . ILE A 1 260 ? 172.953 184.736 -7.937  1.00 102.05 ? 333 ILE A CB  1 
ATOM   2037 C  CG1 . ILE A 1 260 ? 172.456 186.025 -8.593  1.00 130.07 ? 333 ILE A CG1 1 
ATOM   2038 C  CG2 . ILE A 1 260 ? 172.663 183.554 -8.845  1.00 100.69 ? 333 ILE A CG2 1 
ATOM   2039 C  CD1 . ILE A 1 260 ? 172.741 187.273 -7.792  1.00 140.30 ? 333 ILE A CD1 1 
ATOM   2040 N  N   . PHE A 1 261 ? 170.582 182.795 -6.472  1.00 99.70  ? 334 PHE A N   1 
ATOM   2041 C  CA  . PHE A 1 261 ? 169.198 182.338 -6.504  1.00 110.54 ? 334 PHE A CA  1 
ATOM   2042 C  C   . PHE A 1 261 ? 168.436 182.768 -5.261  1.00 127.41 ? 334 PHE A C   1 
ATOM   2043 O  O   . PHE A 1 261 ? 167.380 183.406 -5.355  1.00 102.34 ? 334 PHE A O   1 
ATOM   2044 C  CB  . PHE A 1 261 ? 169.138 180.817 -6.642  1.00 97.71  ? 334 PHE A CB  1 
ATOM   2045 C  CG  . PHE A 1 261 ? 167.752 180.256 -6.483  1.00 97.75  ? 334 PHE A CG  1 
ATOM   2046 C  CD1 . PHE A 1 261 ? 166.821 180.377 -7.499  1.00 126.93 ? 334 PHE A CD1 1 
ATOM   2047 C  CD2 . PHE A 1 261 ? 167.371 179.634 -5.305  1.00 96.82  ? 334 PHE A CD2 1 
ATOM   2048 C  CE1 . PHE A 1 261 ? 165.542 179.874 -7.350  1.00 125.12 ? 334 PHE A CE1 1 
ATOM   2049 C  CE2 . PHE A 1 261 ? 166.093 179.131 -5.150  1.00 97.02  ? 334 PHE A CE2 1 
ATOM   2050 C  CZ  . PHE A 1 261 ? 165.179 179.249 -6.174  1.00 116.94 ? 334 PHE A CZ  1 
ATOM   2051 N  N   . PHE A 1 262 ? 168.963 182.430 -4.082  1.00 120.34 ? 335 PHE A N   1 
ATOM   2052 C  CA  . PHE A 1 262 ? 168.298 182.823 -2.846  1.00 116.03 ? 335 PHE A CA  1 
ATOM   2053 C  C   . PHE A 1 262 ? 168.282 184.334 -2.651  1.00 136.81 ? 335 PHE A C   1 
ATOM   2054 O  O   . PHE A 1 262 ? 167.312 184.875 -2.106  1.00 104.16 ? 335 PHE A O   1 
ATOM   2055 C  CB  . PHE A 1 262 ? 168.950 182.131 -1.653  1.00 113.52 ? 335 PHE A CB  1 
ATOM   2056 C  CG  . PHE A 1 262 ? 168.684 180.654 -1.596  1.00 104.80 ? 335 PHE A CG  1 
ATOM   2057 C  CD1 . PHE A 1 262 ? 169.491 179.765 -2.283  1.00 105.12 ? 335 PHE A CD1 1 
ATOM   2058 C  CD2 . PHE A 1 262 ? 167.615 180.157 -0.871  1.00 110.12 ? 335 PHE A CD2 1 
ATOM   2059 C  CE1 . PHE A 1 262 ? 169.248 178.407 -2.235  1.00 100.80 ? 335 PHE A CE1 1 
ATOM   2060 C  CE2 . PHE A 1 262 ? 167.367 178.800 -0.824  1.00 98.76  ? 335 PHE A CE2 1 
ATOM   2061 C  CZ  . PHE A 1 262 ? 168.183 177.924 -1.505  1.00 97.79  ? 335 PHE A CZ  1 
ATOM   2062 N  N   . SER A 1 263 ? 169.349 185.036 -3.045  1.00 122.58 ? 336 SER A N   1 
ATOM   2063 C  CA  . SER A 1 263 ? 169.290 186.491 -2.936  1.00 129.10 ? 336 SER A CA  1 
ATOM   2064 C  C   . SER A 1 263 ? 168.232 187.075 -3.866  1.00 140.17 ? 336 SER A C   1 
ATOM   2065 O  O   . SER A 1 263 ? 167.492 187.986 -3.477  1.00 150.05 ? 336 SER A O   1 
ATOM   2066 C  CB  . SER A 1 263 ? 170.661 187.098 -3.233  1.00 126.57 ? 336 SER A CB  1 
ATOM   2067 O  OG  . SER A 1 263 ? 170.634 188.503 -3.059  1.00 130.50 ? 336 SER A OG  1 
ATOM   2068 N  N   . LEU A 1 264 ? 168.150 186.567 -5.101  1.00 141.17 ? 337 LEU A N   1 
ATOM   2069 C  CA  . LEU A 1 264 ? 167.127 187.036 -6.036  1.00 135.03 ? 337 LEU A CA  1 
ATOM   2070 C  C   . LEU A 1 264 ? 165.729 186.551 -5.654  1.00 136.26 ? 337 LEU A C   1 
ATOM   2071 O  O   . LEU A 1 264 ? 164.747 187.287 -5.805  1.00 111.03 ? 337 LEU A O   1 
ATOM   2072 C  CB  . LEU A 1 264 ? 167.495 186.655 -7.467  1.00 137.42 ? 337 LEU A CB  1 
ATOM   2073 C  CG  . LEU A 1 264 ? 168.708 187.455 -7.964  1.00 127.04 ? 337 LEU A CG  1 
ATOM   2074 C  CD1 . LEU A 1 264 ? 168.973 187.205 -9.433  1.00 123.31 ? 337 LEU A CD1 1 
ATOM   2075 C  CD2 . LEU A 1 264 ? 168.531 188.948 -7.702  1.00 111.69 ? 337 LEU A CD2 1 
ATOM   2076 N  N   . GLY A 1 265 ? 165.623 185.321 -5.146  1.00 138.85 ? 338 GLY A N   1 
ATOM   2077 C  CA  . GLY A 1 265 ? 164.366 184.776 -4.675  1.00 137.89 ? 338 GLY A CA  1 
ATOM   2078 C  C   . GLY A 1 265 ? 163.225 184.516 -5.662  1.00 139.53 ? 338 GLY A C   1 
ATOM   2079 O  O   . GLY A 1 265 ? 162.059 184.753 -5.328  1.00 142.38 ? 338 GLY A O   1 
ATOM   2080 N  N   . PRO A 1 266 ? 163.508 184.044 -6.885  1.00 136.17 ? 339 PRO A N   1 
ATOM   2081 C  CA  . PRO A 1 266 ? 162.414 183.700 -7.804  1.00 148.27 ? 339 PRO A CA  1 
ATOM   2082 C  C   . PRO A 1 266 ? 161.724 182.414 -7.372  1.00 148.14 ? 339 PRO A C   1 
ATOM   2083 O  O   . PRO A 1 266 ? 162.213 181.649 -6.538  1.00 132.48 ? 339 PRO A O   1 
ATOM   2084 C  CB  . PRO A 1 266 ? 163.107 183.475 -9.154  1.00 147.93 ? 339 PRO A CB  1 
ATOM   2085 C  CG  . PRO A 1 266 ? 164.550 183.573 -8.890  1.00 137.42 ? 339 PRO A CG  1 
ATOM   2086 C  CD  . PRO A 1 266 ? 164.706 184.375 -7.674  1.00 133.18 ? 339 PRO A CD  1 
ATOM   2087 N  N   . GLY A 1 267 ? 160.555 182.184 -7.966  1.00 155.24 ? 340 GLY A N   1 
ATOM   2088 C  CA  . GLY A 1 267 ? 159.914 180.887 -7.887  1.00 146.53 ? 340 GLY A CA  1 
ATOM   2089 C  C   . GLY A 1 267 ? 159.078 180.662 -6.652  1.00 134.10 ? 340 GLY A C   1 
ATOM   2090 O  O   . GLY A 1 267 ? 158.683 179.521 -6.386  1.00 132.84 ? 340 GLY A O   1 
ATOM   2091 N  N   . PHE A 1 268 ? 158.816 181.712 -5.879  1.00 117.27 ? 341 PHE A N   1 
ATOM   2092 C  CA  . PHE A 1 268 ? 158.180 181.615 -4.577  1.00 129.19 ? 341 PHE A CA  1 
ATOM   2093 C  C   . PHE A 1 268 ? 156.805 182.264 -4.577  1.00 134.45 ? 341 PHE A C   1 
ATOM   2094 O  O   . PHE A 1 268 ? 156.026 182.043 -3.645  1.00 139.61 ? 341 PHE A O   1 
ATOM   2095 C  CB  . PHE A 1 268 ? 159.054 182.259 -3.489  1.00 136.30 ? 341 PHE A CB  1 
ATOM   2096 C  CG  . PHE A 1 268 ? 158.620 181.922 -2.087  1.00 140.75 ? 341 PHE A CG  1 
ATOM   2097 C  CD1 . PHE A 1 268 ? 159.002 180.725 -1.502  1.00 122.67 ? 341 PHE A CD1 1 
ATOM   2098 C  CD2 . PHE A 1 268 ? 157.824 182.792 -1.358  1.00 147.85 ? 341 PHE A CD2 1 
ATOM   2099 C  CE1 . PHE A 1 268 ? 158.605 180.406 -0.219  1.00 105.25 ? 341 PHE A CE1 1 
ATOM   2100 C  CE2 . PHE A 1 268 ? 157.420 182.474 -0.073  1.00 141.80 ? 341 PHE A CE2 1 
ATOM   2101 C  CZ  . PHE A 1 268 ? 157.813 181.280 0.497   1.00 126.61 ? 341 PHE A CZ  1 
ATOM   2102 N  N   . GLY A 1 269 ? 156.498 183.064 -5.592  1.00 129.28 ? 342 GLY A N   1 
ATOM   2103 C  CA  . GLY A 1 269 ? 155.211 183.696 -5.731  1.00 138.02 ? 342 GLY A CA  1 
ATOM   2104 C  C   . GLY A 1 269 ? 155.154 185.091 -5.162  1.00 159.40 ? 342 GLY A C   1 
ATOM   2105 O  O   . GLY A 1 269 ? 154.114 185.754 -5.285  1.00 163.60 ? 342 GLY A O   1 
ATOM   2106 N  N   . VAL A 1 270 ? 156.229 185.549 -4.523  1.00 143.85 ? 343 VAL A N   1 
ATOM   2107 C  CA  . VAL A 1 270 ? 156.263 186.915 -4.021  1.00 138.46 ? 343 VAL A CA  1 
ATOM   2108 C  C   . VAL A 1 270 ? 156.302 187.888 -5.191  1.00 131.44 ? 343 VAL A C   1 
ATOM   2109 O  O   . VAL A 1 270 ? 155.513 188.838 -5.259  1.00 123.75 ? 343 VAL A O   1 
ATOM   2110 C  CB  . VAL A 1 270 ? 157.454 187.111 -3.071  1.00 130.59 ? 343 VAL A CB  1 
ATOM   2111 C  CG1 . VAL A 1 270 ? 157.704 188.587 -2.857  1.00 125.81 ? 343 VAL A CG1 1 
ATOM   2112 C  CG2 . VAL A 1 270 ? 157.182 186.414 -1.744  1.00 116.88 ? 343 VAL A CG2 1 
ATOM   2113 N  N   . LEU A 1 271 ? 157.231 187.666 -6.127  1.00 127.50 ? 344 LEU A N   1 
ATOM   2114 C  CA  . LEU A 1 271 ? 157.298 188.511 -7.313  1.00 142.75 ? 344 LEU A CA  1 
ATOM   2115 C  C   . LEU A 1 271 ? 156.028 188.383 -8.137  1.00 167.24 ? 344 LEU A C   1 
ATOM   2116 O  O   . LEU A 1 271 ? 155.606 189.343 -8.794  1.00 178.46 ? 344 LEU A O   1 
ATOM   2117 C  CB  . LEU A 1 271 ? 158.503 188.118 -8.164  1.00 119.64 ? 344 LEU A CB  1 
ATOM   2118 C  CG  . LEU A 1 271 ? 159.822 187.909 -7.423  1.00 117.64 ? 344 LEU A CG  1 
ATOM   2119 C  CD1 . LEU A 1 271 ? 160.873 187.374 -8.377  1.00 126.61 ? 344 LEU A CD1 1 
ATOM   2120 C  CD2 . LEU A 1 271 ? 160.288 189.189 -6.759  1.00 119.43 ? 344 LEU A CD2 1 
ATOM   2121 N  N   . LEU A 1 272 ? 155.408 187.203 -8.108  1.00 179.02 ? 345 LEU A N   1 
ATOM   2122 C  CA  . LEU A 1 272 ? 154.149 186.990 -8.812  1.00 157.33 ? 345 LEU A CA  1 
ATOM   2123 C  C   . LEU A 1 272 ? 153.054 187.879 -8.238  1.00 152.79 ? 345 LEU A C   1 
ATOM   2124 O  O   . LEU A 1 272 ? 152.335 188.563 -8.977  1.00 163.82 ? 345 LEU A O   1 
ATOM   2125 C  CB  . LEU A 1 272 ? 153.757 185.517 -8.707  1.00 154.55 ? 345 LEU A CB  1 
ATOM   2126 C  CG  . LEU A 1 272 ? 152.805 184.906 -9.727  1.00 148.00 ? 345 LEU A CG  1 
ATOM   2127 C  CD1 . LEU A 1 272 ? 153.556 184.630 -11.013 1.00 154.44 ? 345 LEU A CD1 1 
ATOM   2128 C  CD2 . LEU A 1 272 ? 152.198 183.630 -9.173  1.00 145.36 ? 345 LEU A CD2 1 
ATOM   2129 N  N   . ALA A 1 273 ? 152.929 187.890 -6.910  1.00 164.12 ? 346 ALA A N   1 
ATOM   2130 C  CA  . ALA A 1 273 ? 151.910 188.698 -6.249  1.00 164.63 ? 346 ALA A CA  1 
ATOM   2131 C  C   . ALA A 1 273 ? 152.186 190.187 -6.414  1.00 165.04 ? 346 ALA A C   1 
ATOM   2132 O  O   . ALA A 1 273 ? 151.263 190.967 -6.676  1.00 178.71 ? 346 ALA A O   1 
ATOM   2133 C  CB  . ALA A 1 273 ? 151.827 188.328 -4.770  1.00 166.51 ? 346 ALA A CB  1 
ATOM   2134 N  N   . PHE A 1 274 ? 153.447 190.601 -6.254  1.00 150.09 ? 347 PHE A N   1 
ATOM   2135 C  CA  . PHE A 1 274 ? 153.789 192.011 -6.409  1.00 154.09 ? 347 PHE A CA  1 
ATOM   2136 C  C   . PHE A 1 274 ? 153.544 192.482 -7.836  1.00 174.54 ? 347 PHE A C   1 
ATOM   2137 O  O   . PHE A 1 274 ? 153.157 193.634 -8.059  1.00 179.08 ? 347 PHE A O   1 
ATOM   2138 C  CB  . PHE A 1 274 ? 155.247 192.238 -6.020  1.00 157.79 ? 347 PHE A CB  1 
ATOM   2139 C  CG  . PHE A 1 274 ? 155.451 192.464 -4.552  1.00 156.42 ? 347 PHE A CG  1 
ATOM   2140 C  CD1 . PHE A 1 274 ? 154.368 192.627 -3.707  1.00 173.49 ? 347 PHE A CD1 1 
ATOM   2141 C  CD2 . PHE A 1 274 ? 156.726 192.516 -4.018  1.00 135.54 ? 347 PHE A CD2 1 
ATOM   2142 C  CE1 . PHE A 1 274 ? 154.550 192.832 -2.355  1.00 168.26 ? 347 PHE A CE1 1 
ATOM   2143 C  CE2 . PHE A 1 274 ? 156.916 192.724 -2.670  1.00 136.59 ? 347 PHE A CE2 1 
ATOM   2144 C  CZ  . PHE A 1 274 ? 155.824 192.880 -1.835  1.00 152.10 ? 347 PHE A CZ  1 
ATOM   2145 N  N   . ALA A 1 275 ? 153.778 191.608 -8.817  1.00 172.55 ? 348 ALA A N   1 
ATOM   2146 C  CA  . ALA A 1 275 ? 153.553 191.967 -10.212 1.00 186.45 ? 348 ALA A CA  1 
ATOM   2147 C  C   . ALA A 1 275 ? 152.072 191.959 -10.558 1.00 187.56 ? 348 ALA A C   1 
ATOM   2148 O  O   . ALA A 1 275 ? 151.641 192.711 -11.437 1.00 191.91 ? 348 ALA A O   1 
ATOM   2149 C  CB  . ALA A 1 275 ? 154.315 191.014 -11.128 1.00 193.52 ? 348 ALA A CB  1 
ATOM   2150 N  N   . SER A 1 276 ? 151.289 191.126 -9.864  1.00 179.97 ? 349 SER A N   1 
ATOM   2151 C  CA  . SER A 1 276 ? 149.851 191.041 -10.103 1.00 157.96 ? 349 SER A CA  1 
ATOM   2152 C  C   . SER A 1 276 ? 149.174 192.400 -9.979  1.00 180.83 ? 349 SER A C   1 
ATOM   2153 O  O   . SER A 1 276 ? 148.367 192.784 -10.833 1.00 202.32 ? 349 SER A O   1 
ATOM   2154 C  CB  . SER A 1 276 ? 149.228 190.043 -9.125  1.00 151.10 ? 349 SER A CB  1 
ATOM   2155 O  OG  . SER A 1 276 ? 147.822 189.977 -9.274  1.00 145.78 ? 349 SER A OG  1 
ATOM   2156 N  N   . TYR A 1 277 ? 149.493 193.144 -8.922  1.00 166.65 ? 350 TYR A N   1 
ATOM   2157 C  CA  . TYR A 1 277 ? 148.951 194.489 -8.732  1.00 178.31 ? 350 TYR A CA  1 
ATOM   2158 C  C   . TYR A 1 277 ? 149.819 195.497 -9.484  1.00 163.93 ? 350 TYR A C   1 
ATOM   2159 O  O   . TYR A 1 277 ? 150.698 196.152 -8.921  1.00 148.44 ? 350 TYR A O   1 
ATOM   2160 C  CB  . TYR A 1 277 ? 148.874 194.818 -7.246  1.00 185.74 ? 350 TYR A CB  1 
ATOM   2161 C  CG  . TYR A 1 277 ? 148.149 193.787 -6.407  1.00 183.18 ? 350 TYR A CG  1 
ATOM   2162 C  CD1 . TYR A 1 277 ? 146.777 193.856 -6.215  1.00 203.79 ? 350 TYR A CD1 1 
ATOM   2163 C  CD2 . TYR A 1 277 ? 148.845 192.753 -5.793  1.00 145.73 ? 350 TYR A CD2 1 
ATOM   2164 C  CE1 . TYR A 1 277 ? 146.115 192.917 -5.442  1.00 196.26 ? 350 TYR A CE1 1 
ATOM   2165 C  CE2 . TYR A 1 277 ? 148.193 191.811 -5.019  1.00 145.54 ? 350 TYR A CE2 1 
ATOM   2166 C  CZ  . TYR A 1 277 ? 146.828 191.897 -4.846  1.00 168.92 ? 350 TYR A CZ  1 
ATOM   2167 O  OH  . TYR A 1 277 ? 146.174 190.961 -4.077  1.00 150.18 ? 350 TYR A OH  1 
ATOM   2168 N  N   . ASN A 1 278 ? 149.559 195.629 -10.784 1.00 166.44 ? 351 ASN A N   1 
ATOM   2169 C  CA  . ASN A 1 278 ? 150.318 196.572 -11.599 1.00 174.99 ? 351 ASN A CA  1 
ATOM   2170 C  C   . ASN A 1 278 ? 149.602 196.789 -12.927 1.00 192.78 ? 351 ASN A C   1 
ATOM   2171 O  O   . ASN A 1 278 ? 148.665 196.068 -13.281 1.00 172.60 ? 351 ASN A O   1 
ATOM   2172 C  CB  . ASN A 1 278 ? 151.750 196.081 -11.827 1.00 178.37 ? 351 ASN A CB  1 
ATOM   2173 C  CG  . ASN A 1 278 ? 152.714 197.215 -12.117 1.00 195.56 ? 351 ASN A CG  1 
ATOM   2174 O  OD1 . ASN A 1 278 ? 153.101 197.439 -13.263 1.00 218.78 ? 351 ASN A OD1 1 
ATOM   2175 N  ND2 . ASN A 1 278 ? 153.107 197.938 -11.074 1.00 173.14 ? 351 ASN A ND2 1 
ATOM   2176 N  N   . LYS A 1 279 ? 150.078 197.791 -13.663 1.00 212.16 ? 352 LYS A N   1 
ATOM   2177 C  CA  . LYS A 1 279 ? 149.530 198.118 -14.973 1.00 219.04 ? 352 LYS A CA  1 
ATOM   2178 C  C   . LYS A 1 279 ? 149.818 197.014 -15.983 1.00 216.70 ? 352 LYS A C   1 
ATOM   2179 O  O   . LYS A 1 279 ? 150.878 196.382 -15.955 1.00 213.16 ? 352 LYS A O   1 
ATOM   2180 C  CB  . LYS A 1 279 ? 150.113 199.440 -15.476 1.00 223.61 ? 352 LYS A CB  1 
ATOM   2181 C  CG  . LYS A 1 279 ? 150.153 200.554 -14.441 1.00 221.14 ? 352 LYS A CG  1 
ATOM   2182 C  CD  . LYS A 1 279 ? 150.773 201.818 -15.023 1.00 221.30 ? 352 LYS A CD  1 
ATOM   2183 C  CE  . LYS A 1 279 ? 149.892 202.432 -16.101 1.00 220.10 ? 352 LYS A CE  1 
ATOM   2184 N  NZ  . LYS A 1 279 ? 148.559 202.837 -15.578 1.00 215.01 ? 352 LYS A NZ  1 
ATOM   2185 N  N   . PHE A 1 280 ? 148.855 196.778 -16.879 1.00 215.11 ? 353 PHE A N   1 
ATOM   2186 C  CA  . PHE A 1 280 ? 149.014 195.715 -17.865 1.00 205.64 ? 353 PHE A CA  1 
ATOM   2187 C  C   . PHE A 1 280 ? 150.053 196.087 -18.916 1.00 196.31 ? 353 PHE A C   1 
ATOM   2188 O  O   . PHE A 1 280 ? 150.830 195.233 -19.356 1.00 178.34 ? 353 PHE A O   1 
ATOM   2189 C  CB  . PHE A 1 280 ? 147.676 195.397 -18.529 1.00 208.80 ? 353 PHE A CB  1 
ATOM   2190 C  CG  . PHE A 1 280 ? 147.682 194.109 -19.297 1.00 203.69 ? 353 PHE A CG  1 
ATOM   2191 C  CD1 . PHE A 1 280 ? 147.369 192.913 -18.674 1.00 198.98 ? 353 PHE A CD1 1 
ATOM   2192 C  CD2 . PHE A 1 280 ? 148.015 194.091 -20.642 1.00 205.54 ? 353 PHE A CD2 1 
ATOM   2193 C  CE1 . PHE A 1 280 ? 147.380 191.724 -19.380 1.00 193.13 ? 353 PHE A CE1 1 
ATOM   2194 C  CE2 . PHE A 1 280 ? 148.028 192.908 -21.353 1.00 198.84 ? 353 PHE A CE2 1 
ATOM   2195 C  CZ  . PHE A 1 280 ? 147.710 191.722 -20.722 1.00 190.86 ? 353 PHE A CZ  1 
ATOM   2196 N  N   . ASN A 1 281 ? 150.079 197.347 -19.337 1.00 186.50 ? 354 ASN A N   1 
ATOM   2197 C  CA  . ASN A 1 281 ? 151.025 197.800 -20.345 1.00 181.12 ? 354 ASN A CA  1 
ATOM   2198 C  C   . ASN A 1 281 ? 152.356 198.207 -19.733 1.00 172.28 ? 354 ASN A C   1 
ATOM   2199 O  O   . ASN A 1 281 ? 153.252 198.651 -20.461 1.00 159.36 ? 354 ASN A O   1 
ATOM   2200 C  CB  . ASN A 1 281 ? 150.443 198.983 -21.128 1.00 186.17 ? 354 ASN A CB  1 
ATOM   2201 C  CG  . ASN A 1 281 ? 150.030 198.609 -22.539 1.00 181.87 ? 354 ASN A CG  1 
ATOM   2202 O  OD1 . ASN A 1 281 ? 148.905 198.167 -22.772 1.00 174.18 ? 354 ASN A OD1 1 
ATOM   2203 N  ND2 . ASN A 1 281 ? 150.942 198.785 -23.489 1.00 187.17 ? 354 ASN A ND2 1 
ATOM   2204 N  N   . ASN A 1 282 ? 152.495 198.062 -18.418 1.00 174.92 ? 355 ASN A N   1 
ATOM   2205 C  CA  . ASN A 1 282 ? 153.721 198.441 -17.733 1.00 174.48 ? 355 ASN A CA  1 
ATOM   2206 C  C   . ASN A 1 282 ? 154.888 197.545 -18.133 1.00 156.29 ? 355 ASN A C   1 
ATOM   2207 O  O   . ASN A 1 282 ? 154.726 196.344 -18.372 1.00 153.80 ? 355 ASN A O   1 
ATOM   2208 C  CB  . ASN A 1 282 ? 153.539 198.410 -16.220 1.00 181.05 ? 355 ASN A CB  1 
ATOM   2209 C  CG  . ASN A 1 282 ? 154.828 198.675 -15.478 1.00 184.07 ? 355 ASN A CG  1 
ATOM   2210 O  OD1 . ASN A 1 282 ? 155.502 197.752 -15.020 1.00 197.00 ? 355 ASN A OD1 1 
ATOM   2211 N  ND2 . ASN A 1 282 ? 155.184 199.950 -15.363 1.00 182.35 ? 355 ASN A ND2 1 
ATOM   2212 N  N   . ASN A 1 283 ? 156.073 198.147 -18.196 1.00 158.38 ? 356 ASN A N   1 
ATOM   2213 C  CA  . ASN A 1 283 ? 157.279 197.429 -18.582 1.00 161.80 ? 356 ASN A CA  1 
ATOM   2214 C  C   . ASN A 1 283 ? 157.745 196.490 -17.475 1.00 181.76 ? 356 ASN A C   1 
ATOM   2215 O  O   . ASN A 1 283 ? 157.721 196.839 -16.291 1.00 200.63 ? 356 ASN A O   1 
ATOM   2216 C  CB  . ASN A 1 283 ? 158.390 198.422 -18.930 1.00 156.97 ? 356 ASN A CB  1 
ATOM   2217 C  CG  . ASN A 1 283 ? 159.616 197.751 -19.511 1.00 163.65 ? 356 ASN A CG  1 
ATOM   2218 O  OD1 . ASN A 1 283 ? 160.467 197.250 -18.777 1.00 159.11 ? 356 ASN A OD1 1 
ATOM   2219 N  ND2 . ASN A 1 283 ? 159.716 197.742 -20.836 1.00 172.66 ? 356 ASN A ND2 1 
ATOM   2220 N  N   . CYS A 1 284 ? 158.174 195.290 -17.869 1.00 191.07 ? 357 CYS A N   1 
ATOM   2221 C  CA  . CYS A 1 284 ? 158.684 194.287 -16.942 1.00 164.40 ? 357 CYS A CA  1 
ATOM   2222 C  C   . CYS A 1 284 ? 160.190 194.129 -17.031 1.00 173.38 ? 357 CYS A C   1 
ATOM   2223 O  O   . CYS A 1 284 ? 160.828 193.809 -16.028 1.00 198.08 ? 357 CYS A O   1 
ATOM   2224 C  CB  . CYS A 1 284 ? 158.025 192.926 -17.197 1.00 163.83 ? 357 CYS A CB  1 
ATOM   2225 S  SG  . CYS A 1 284 ? 156.228 192.970 -17.345 1.00 200.56 ? 357 CYS A SG  1 
ATOM   2226 N  N   . TYR A 1 285 ? 160.753 194.333 -18.223 1.00 174.00 ? 358 TYR A N   1 
ATOM   2227 C  CA  . TYR A 1 285 ? 162.185 194.177 -18.455 1.00 192.30 ? 358 TYR A CA  1 
ATOM   2228 C  C   . TYR A 1 285 ? 162.987 195.099 -17.543 1.00 205.27 ? 358 TYR A C   1 
ATOM   2229 O  O   . TYR A 1 285 ? 163.814 194.650 -16.737 1.00 219.29 ? 358 TYR A O   1 
ATOM   2230 C  CB  . TYR A 1 285 ? 162.482 194.470 -19.928 1.00 189.66 ? 358 TYR A CB  1 
ATOM   2231 C  CG  . TYR A 1 285 ? 163.827 194.007 -20.427 1.00 181.86 ? 358 TYR A CG  1 
ATOM   2232 C  CD1 . TYR A 1 285 ? 164.033 192.690 -20.809 1.00 174.09 ? 358 TYR A CD1 1 
ATOM   2233 C  CD2 . TYR A 1 285 ? 164.888 194.896 -20.536 1.00 184.63 ? 358 TYR A CD2 1 
ATOM   2234 C  CE1 . TYR A 1 285 ? 165.261 192.270 -21.275 1.00 171.88 ? 358 TYR A CE1 1 
ATOM   2235 C  CE2 . TYR A 1 285 ? 166.120 194.485 -21.000 1.00 178.69 ? 358 TYR A CE2 1 
ATOM   2236 C  CZ  . TYR A 1 285 ? 166.302 193.171 -21.368 1.00 183.55 ? 358 TYR A CZ  1 
ATOM   2237 O  OH  . TYR A 1 285 ? 167.530 192.759 -21.833 1.00 189.76 ? 358 TYR A OH  1 
ATOM   2238 N  N   . GLN A 1 286 ? 162.743 196.406 -17.665 1.00 215.29 ? 359 GLN A N   1 
ATOM   2239 C  CA  . GLN A 1 286 ? 163.475 197.398 -16.887 1.00 225.01 ? 359 GLN A CA  1 
ATOM   2240 C  C   . GLN A 1 286 ? 163.299 197.173 -15.391 1.00 225.59 ? 359 GLN A C   1 
ATOM   2241 O  O   . GLN A 1 286 ? 164.260 197.300 -14.625 1.00 227.84 ? 359 GLN A O   1 
ATOM   2242 C  CB  . GLN A 1 286 ? 163.021 198.806 -17.277 1.00 243.78 ? 359 GLN A CB  1 
ATOM   2243 C  CG  . GLN A 1 286 ? 163.810 199.928 -16.617 1.00 255.33 ? 359 GLN A CG  1 
ATOM   2244 C  CD  . GLN A 1 286 ? 163.366 201.303 -17.084 1.00 275.79 ? 359 GLN A CD  1 
ATOM   2245 O  OE1 . GLN A 1 286 ? 162.398 201.433 -17.834 1.00 292.36 ? 359 GLN A OE1 1 
ATOM   2246 N  NE2 . GLN A 1 286 ? 164.074 202.337 -16.643 1.00 269.95 ? 359 GLN A NE2 1 
ATOM   2247 N  N   . ASP A 1 287 ? 162.076 196.866 -14.950 1.00 206.84 ? 360 ASP A N   1 
ATOM   2248 C  CA  . ASP A 1 287 ? 161.835 196.628 -13.529 1.00 189.80 ? 360 ASP A CA  1 
ATOM   2249 C  C   . ASP A 1 287 ? 162.738 195.524 -12.988 1.00 175.23 ? 360 ASP A C   1 
ATOM   2250 O  O   . ASP A 1 287 ? 163.555 195.756 -12.089 1.00 179.80 ? 360 ASP A O   1 
ATOM   2251 C  CB  . ASP A 1 287 ? 160.370 196.253 -13.308 1.00 158.75 ? 360 ASP A CB  1 
ATOM   2252 C  CG  . ASP A 1 287 ? 159.424 197.368 -13.664 1.00 169.29 ? 360 ASP A CG  1 
ATOM   2253 O  OD1 . ASP A 1 287 ? 159.781 198.205 -14.520 1.00 171.09 ? 360 ASP A OD1 1 
ATOM   2254 O  OD2 . ASP A 1 287 ? 158.315 197.400 -13.093 1.00 179.39 ? 360 ASP A OD2 1 
ATOM   2255 N  N   . ALA A 1 288 ? 162.651 194.329 -13.578 1.00 147.97 ? 361 ALA A N   1 
ATOM   2256 C  CA  . ALA A 1 288 ? 163.471 193.209 -13.127 1.00 125.98 ? 361 ALA A CA  1 
ATOM   2257 C  C   . ALA A 1 288 ? 164.951 193.560 -13.176 1.00 184.80 ? 361 ALA A C   1 
ATOM   2258 O  O   . ALA A 1 288 ? 165.686 193.353 -12.198 1.00 188.34 ? 361 ALA A O   1 
ATOM   2259 C  CB  . ALA A 1 288 ? 163.177 191.973 -13.978 1.00 124.04 ? 361 ALA A CB  1 
ATOM   2260 N  N   . LEU A 1 289 ? 165.398 194.118 -14.303 1.00 191.77 ? 362 LEU A N   1 
ATOM   2261 C  CA  . LEU A 1 289 ? 166.800 194.485 -14.458 1.00 203.42 ? 362 LEU A CA  1 
ATOM   2262 C  C   . LEU A 1 289 ? 167.260 195.393 -13.321 1.00 207.75 ? 362 LEU A C   1 
ATOM   2263 O  O   . LEU A 1 289 ? 168.124 195.015 -12.521 1.00 223.28 ? 362 LEU A O   1 
ATOM   2264 C  CB  . LEU A 1 289 ? 167.015 195.153 -15.820 1.00 208.32 ? 362 LEU A CB  1 
ATOM   2265 C  CG  . LEU A 1 289 ? 168.461 195.370 -16.277 1.00 214.43 ? 362 LEU A CG  1 
ATOM   2266 C  CD1 . LEU A 1 289 ? 168.568 195.175 -17.779 1.00 229.80 ? 362 LEU A CD1 1 
ATOM   2267 C  CD2 . LEU A 1 289 ? 168.966 196.752 -15.888 1.00 213.06 ? 362 LEU A CD2 1 
ATOM   2268 N  N   . VAL A 1 290 ? 166.625 196.563 -13.184 1.00 199.67 ? 363 VAL A N   1 
ATOM   2269 C  CA  . VAL A 1 290 ? 167.023 197.514 -12.146 1.00 188.21 ? 363 VAL A CA  1 
ATOM   2270 C  C   . VAL A 1 290 ? 167.036 196.842 -10.780 1.00 184.18 ? 363 VAL A C   1 
ATOM   2271 O  O   . VAL A 1 290 ? 168.030 196.931 -10.043 1.00 161.63 ? 363 VAL A O   1 
ATOM   2272 C  CB  . VAL A 1 290 ? 166.096 198.743 -12.159 1.00 176.41 ? 363 VAL A CB  1 
ATOM   2273 C  CG1 . VAL A 1 290 ? 166.375 199.629 -10.958 1.00 183.97 ? 363 VAL A CG1 1 
ATOM   2274 C  CG2 . VAL A 1 290 ? 166.280 199.526 -13.447 1.00 193.27 ? 363 VAL A CG2 1 
ATOM   2275 N  N   . THR A 1 291 ? 165.941 196.163 -10.411 1.00 179.75 ? 364 THR A N   1 
ATOM   2276 C  CA  . THR A 1 291 ? 165.866 195.675 -9.037  1.00 176.24 ? 364 THR A CA  1 
ATOM   2277 C  C   . THR A 1 291 ? 167.011 194.711 -8.767  1.00 147.93 ? 364 THR A C   1 
ATOM   2278 O  O   . THR A 1 291 ? 167.693 194.817 -7.738  1.00 137.66 ? 364 THR A O   1 
ATOM   2279 C  CB  . THR A 1 291 ? 164.518 195.012 -8.738  1.00 127.47 ? 364 THR A CB  1 
ATOM   2280 O  OG1 . THR A 1 291 ? 164.455 193.718 -9.354  1.00 124.87 ? 364 THR A OG1 1 
ATOM   2281 C  CG2 . THR A 1 291 ? 163.345 195.893 -9.152  1.00 130.62 ? 364 THR A CG2 1 
ATOM   2282 N  N   . SER A 1 292 ? 167.240 193.753 -9.677  1.00 126.30 ? 365 SER A N   1 
ATOM   2283 C  CA  . SER A 1 292 ? 168.269 192.763 -9.382  1.00 126.32 ? 365 SER A CA  1 
ATOM   2284 C  C   . SER A 1 292 ? 169.634 193.438 -9.300  1.00 134.94 ? 365 SER A C   1 
ATOM   2285 O  O   . SER A 1 292 ? 170.425 193.151 -8.393  1.00 152.88 ? 365 SER A O   1 
ATOM   2286 C  CB  . SER A 1 292 ? 168.261 191.661 -10.439 1.00 120.01 ? 365 SER A CB  1 
ATOM   2287 O  OG  . SER A 1 292 ? 166.939 191.214 -10.692 1.00 120.14 ? 365 SER A OG  1 
ATOM   2288 N  N   . VAL A 1 293 ? 169.928 194.334 -10.252 1.00 132.47 ? 366 VAL A N   1 
ATOM   2289 C  CA  . VAL A 1 293 ? 171.257 194.945 -10.314 1.00 147.14 ? 366 VAL A CA  1 
ATOM   2290 C  C   . VAL A 1 293 ? 171.538 195.750 -9.052  1.00 144.27 ? 366 VAL A C   1 
ATOM   2291 O  O   . VAL A 1 293 ? 172.672 195.787 -8.560  1.00 126.24 ? 366 VAL A O   1 
ATOM   2292 C  CB  . VAL A 1 293 ? 171.451 195.788 -11.588 1.00 161.10 ? 366 VAL A CB  1 
ATOM   2293 C  CG1 . VAL A 1 293 ? 172.932 196.065 -11.786 1.00 156.36 ? 366 VAL A CG1 1 
ATOM   2294 C  CG2 . VAL A 1 293 ? 170.995 195.013 -12.795 1.00 165.54 ? 366 VAL A CG2 1 
ATOM   2295 N  N   . VAL A 1 294 ? 170.513 196.417 -8.513  1.00 157.80 ? 367 VAL A N   1 
ATOM   2296 C  CA  . VAL A 1 294 ? 170.648 197.034 -7.194  1.00 156.13 ? 367 VAL A CA  1 
ATOM   2297 C  C   . VAL A 1 294 ? 170.901 195.989 -6.113  1.00 155.83 ? 367 VAL A C   1 
ATOM   2298 O  O   . VAL A 1 294 ? 171.776 196.166 -5.268  1.00 153.88 ? 367 VAL A O   1 
ATOM   2299 C  CB  . VAL A 1 294 ? 169.402 197.881 -6.871  1.00 144.91 ? 367 VAL A CB  1 
ATOM   2300 C  CG1 . VAL A 1 294 ? 169.478 198.429 -5.448  1.00 137.41 ? 367 VAL A CG1 1 
ATOM   2301 C  CG2 . VAL A 1 294 ? 169.254 199.015 -7.875  1.00 142.17 ? 367 VAL A CG2 1 
ATOM   2302 N  N   . ASN A 1 295 ? 170.101 194.925 -6.072  1.00 146.33 ? 368 ASN A N   1 
ATOM   2303 C  CA  . ASN A 1 295 ? 170.315 193.871 -5.075  1.00 141.45 ? 368 ASN A CA  1 
ATOM   2304 C  C   . ASN A 1 295 ? 171.757 193.344 -5.033  1.00 154.10 ? 368 ASN A C   1 
ATOM   2305 O  O   . ASN A 1 295 ? 172.382 193.280 -3.957  1.00 176.52 ? 368 ASN A O   1 
ATOM   2306 C  CB  . ASN A 1 295 ? 169.336 192.723 -5.338  1.00 147.23 ? 368 ASN A CB  1 
ATOM   2307 C  CG  . ASN A 1 295 ? 169.614 191.508 -4.477  1.00 154.15 ? 368 ASN A CG  1 
ATOM   2308 O  OD1 . ASN A 1 295 ? 169.212 191.450 -3.313  1.00 158.45 ? 368 ASN A OD1 1 
ATOM   2309 N  ND2 . ASN A 1 295 ? 170.290 190.520 -5.053  1.00 154.89 ? 368 ASN A ND2 1 
ATOM   2310 N  N   . CYS A 1 296 ? 172.351 193.116 -6.209  1.00 117.18 ? 369 CYS A N   1 
ATOM   2311 C  CA  . CYS A 1 296 ? 173.777 192.798 -6.296  1.00 129.49 ? 369 CYS A CA  1 
ATOM   2312 C  C   . CYS A 1 296 ? 174.670 193.957 -5.875  1.00 144.65 ? 369 CYS A C   1 
ATOM   2313 O  O   . CYS A 1 296 ? 175.652 193.747 -5.153  1.00 157.08 ? 369 CYS A O   1 
ATOM   2314 C  CB  . CYS A 1 296 ? 174.104 192.327 -7.709  1.00 129.05 ? 369 CYS A CB  1 
ATOM   2315 S  SG  . CYS A 1 296 ? 172.908 191.106 -8.300  1.00 113.50 ? 369 CYS A SG  1 
ATOM   2316 N  N   . MET A 1 297 ? 174.394 195.176 -6.338  1.00 168.99 ? 370 MET A N   1 
ATOM   2317 C  CA  . MET A 1 297 ? 175.314 196.260 -6.014  1.00 184.22 ? 370 MET A CA  1 
ATOM   2318 C  C   . MET A 1 297 ? 175.326 196.456 -4.505  1.00 179.67 ? 370 MET A C   1 
ATOM   2319 O  O   . MET A 1 297 ? 176.375 196.704 -3.900  1.00 168.68 ? 370 MET A O   1 
ATOM   2320 C  CB  . MET A 1 297 ? 174.925 197.540 -6.749  1.00 199.03 ? 370 MET A CB  1 
ATOM   2321 C  CG  . MET A 1 297 ? 175.424 197.563 -8.184  1.00 203.94 ? 370 MET A CG  1 
ATOM   2322 S  SD  . MET A 1 297 ? 177.086 196.870 -8.326  1.00 195.66 ? 370 MET A SD  1 
ATOM   2323 C  CE  . MET A 1 297 ? 178.018 198.311 -8.838  1.00 206.77 ? 370 MET A CE  1 
ATOM   2324 N  N   . THR A 1 298 ? 174.146 196.355 -3.894  1.00 164.87 ? 371 THR A N   1 
ATOM   2325 C  CA  . THR A 1 298 ? 173.984 196.539 -2.463  1.00 142.97 ? 371 THR A CA  1 
ATOM   2326 C  C   . THR A 1 298 ? 174.802 195.496 -1.722  1.00 137.74 ? 371 THR A C   1 
ATOM   2327 O  O   . THR A 1 298 ? 175.467 195.806 -0.727  1.00 140.61 ? 371 THR A O   1 
ATOM   2328 C  CB  . THR A 1 298 ? 172.506 196.423 -2.090  1.00 125.86 ? 371 THR A CB  1 
ATOM   2329 O  OG1 . THR A 1 298 ? 171.761 197.439 -2.769  1.00 128.74 ? 371 THR A OG1 1 
ATOM   2330 C  CG2 . THR A 1 298 ? 172.317 196.581 -0.591  1.00 133.93 ? 371 THR A CG2 1 
ATOM   2331 N  N   . SER A 1 299 ? 174.742 194.238 -2.183  1.00 129.86 ? 372 SER A N   1 
ATOM   2332 C  CA  . SER A 1 299 ? 175.651 193.235 -1.633  1.00 114.90 ? 372 SER A CA  1 
ATOM   2333 C  C   . SER A 1 299 ? 177.106 193.678 -1.773  1.00 132.72 ? 372 SER A C   1 
ATOM   2334 O  O   . SER A 1 299 ? 177.905 193.522 -0.841  1.00 130.65 ? 372 SER A O   1 
ATOM   2335 C  CB  . SER A 1 299 ? 175.438 191.889 -2.326  1.00 112.34 ? 372 SER A CB  1 
ATOM   2336 O  OG  . SER A 1 299 ? 174.117 191.420 -2.145  1.00 111.97 ? 372 SER A OG  1 
ATOM   2337 N  N   . PHE A 1 300 ? 177.468 194.215 -2.943  1.00 132.14 ? 373 PHE A N   1 
ATOM   2338 C  CA  . PHE A 1 300 ? 178.853 194.600 -3.213  1.00 135.33 ? 373 PHE A CA  1 
ATOM   2339 C  C   . PHE A 1 300 ? 179.356 195.661 -2.240  1.00 141.50 ? 373 PHE A C   1 
ATOM   2340 O  O   . PHE A 1 300 ? 180.468 195.552 -1.710  1.00 141.56 ? 373 PHE A O   1 
ATOM   2341 C  CB  . PHE A 1 300 ? 178.998 195.080 -4.655  1.00 150.00 ? 373 PHE A CB  1 
ATOM   2342 C  CG  . PHE A 1 300 ? 180.421 195.303 -5.071  1.00 159.19 ? 373 PHE A CG  1 
ATOM   2343 C  CD1 . PHE A 1 300 ? 181.249 194.231 -5.353  1.00 159.48 ? 373 PHE A CD1 1 
ATOM   2344 C  CD2 . PHE A 1 300 ? 180.927 196.586 -5.195  1.00 164.60 ? 373 PHE A CD2 1 
ATOM   2345 C  CE1 . PHE A 1 300 ? 182.560 194.433 -5.734  1.00 161.19 ? 373 PHE A CE1 1 
ATOM   2346 C  CE2 . PHE A 1 300 ? 182.236 196.793 -5.584  1.00 168.67 ? 373 PHE A CE2 1 
ATOM   2347 C  CZ  . PHE A 1 300 ? 183.054 195.715 -5.852  1.00 163.08 ? 373 PHE A CZ  1 
ATOM   2348 N  N   . VAL A 1 301 ? 178.557 196.703 -1.995  1.00 142.83 ? 374 VAL A N   1 
ATOM   2349 C  CA  . VAL A 1 301 ? 178.999 197.740 -1.068  1.00 139.55 ? 374 VAL A CA  1 
ATOM   2350 C  C   . VAL A 1 301 ? 178.913 197.238 0.364   1.00 136.16 ? 374 VAL A C   1 
ATOM   2351 O  O   . VAL A 1 301 ? 179.708 197.644 1.222   1.00 122.89 ? 374 VAL A O   1 
ATOM   2352 C  CB  . VAL A 1 301 ? 178.182 199.029 -1.267  1.00 126.89 ? 374 VAL A CB  1 
ATOM   2353 C  CG1 . VAL A 1 301 ? 178.474 199.632 -2.631  1.00 154.60 ? 374 VAL A CG1 1 
ATOM   2354 C  CG2 . VAL A 1 301 ? 176.695 198.752 -1.111  1.00 126.78 ? 374 VAL A CG2 1 
ATOM   2355 N  N   . SER A 1 302 ? 177.942 196.367 0.651   1.00 137.73 ? 375 SER A N   1 
ATOM   2356 C  CA  . SER A 1 302 ? 177.860 195.750 1.968   1.00 134.71 ? 375 SER A CA  1 
ATOM   2357 C  C   . SER A 1 302 ? 179.146 194.999 2.281   1.00 125.33 ? 375 SER A C   1 
ATOM   2358 O  O   . SER A 1 302 ? 179.593 194.965 3.433   1.00 116.79 ? 375 SER A O   1 
ATOM   2359 C  CB  . SER A 1 302 ? 176.655 194.815 2.035   1.00 117.55 ? 375 SER A CB  1 
ATOM   2360 O  OG  . SER A 1 302 ? 175.454 195.528 1.805   1.00 119.68 ? 375 SER A OG  1 
ATOM   2361 N  N   . GLY A 1 303 ? 179.738 194.368 1.261   1.00 116.21 ? 376 GLY A N   1 
ATOM   2362 C  CA  . GLY A 1 303 ? 181.035 193.737 1.440   1.00 122.80 ? 376 GLY A CA  1 
ATOM   2363 C  C   . GLY A 1 303 ? 182.058 194.687 2.024   1.00 140.59 ? 376 GLY A C   1 
ATOM   2364 O  O   . GLY A 1 303 ? 182.790 194.339 2.951   1.00 155.67 ? 376 GLY A O   1 
ATOM   2365 N  N   . PHE A 1 304 ? 182.132 195.901 1.477   1.00 158.75 ? 377 PHE A N   1 
ATOM   2366 C  CA  . PHE A 1 304 ? 183.037 196.902 2.030   1.00 165.61 ? 377 PHE A CA  1 
ATOM   2367 C  C   . PHE A 1 304 ? 182.615 197.299 3.438   1.00 149.10 ? 377 PHE A C   1 
ATOM   2368 O  O   . PHE A 1 304 ? 183.461 197.444 4.326   1.00 157.47 ? 377 PHE A O   1 
ATOM   2369 C  CB  . PHE A 1 304 ? 183.105 198.118 1.109   1.00 168.63 ? 377 PHE A CB  1 
ATOM   2370 C  CG  . PHE A 1 304 ? 183.740 197.825 -0.216  1.00 148.12 ? 377 PHE A CG  1 
ATOM   2371 C  CD1 . PHE A 1 304 ? 185.118 197.823 -0.350  1.00 138.30 ? 377 PHE A CD1 1 
ATOM   2372 C  CD2 . PHE A 1 304 ? 182.964 197.523 -1.320  1.00 141.49 ? 377 PHE A CD2 1 
ATOM   2373 C  CE1 . PHE A 1 304 ? 185.710 197.542 -1.564  1.00 144.52 ? 377 PHE A CE1 1 
ATOM   2374 C  CE2 . PHE A 1 304 ? 183.549 197.241 -2.536  1.00 150.57 ? 377 PHE A CE2 1 
ATOM   2375 C  CZ  . PHE A 1 304 ? 184.924 197.251 -2.659  1.00 147.78 ? 377 PHE A CZ  1 
ATOM   2376 N  N   . VAL A 1 305 ? 181.315 197.515 3.649   1.00 144.74 ? 378 VAL A N   1 
ATOM   2377 C  CA  . VAL A 1 305 ? 180.815 197.896 4.969   1.00 123.14 ? 378 VAL A CA  1 
ATOM   2378 C  C   . VAL A 1 305 ? 181.272 196.900 6.029   1.00 120.76 ? 378 VAL A C   1 
ATOM   2379 O  O   . VAL A 1 305 ? 181.649 197.284 7.144   1.00 121.66 ? 378 VAL A O   1 
ATOM   2380 C  CB  . VAL A 1 305 ? 179.281 198.029 4.938   1.00 123.93 ? 378 VAL A CB  1 
ATOM   2381 C  CG1 . VAL A 1 305 ? 178.742 198.310 6.326   1.00 124.93 ? 378 VAL A CG1 1 
ATOM   2382 C  CG2 . VAL A 1 305 ? 178.874 199.136 3.979   1.00 129.42 ? 378 VAL A CG2 1 
ATOM   2383 N  N   . ILE A 1 306 ? 181.284 195.611 5.687   1.00 126.85 ? 379 ILE A N   1 
ATOM   2384 C  CA  . ILE A 1 306 ? 181.709 194.588 6.638   1.00 128.22 ? 379 ILE A CA  1 
ATOM   2385 C  C   . ILE A 1 306 ? 183.226 194.522 6.729   1.00 115.09 ? 379 ILE A C   1 
ATOM   2386 O  O   . ILE A 1 306 ? 183.792 194.526 7.826   1.00 115.10 ? 379 ILE A O   1 
ATOM   2387 C  CB  . ILE A 1 306 ? 181.116 193.219 6.254   1.00 112.71 ? 379 ILE A CB  1 
ATOM   2388 C  CG1 . ILE A 1 306 ? 179.591 193.256 6.321   1.00 122.74 ? 379 ILE A CG1 1 
ATOM   2389 C  CG2 . ILE A 1 306 ? 181.658 192.132 7.160   1.00 110.40 ? 379 ILE A CG2 1 
ATOM   2390 C  CD1 . ILE A 1 306 ? 179.064 193.556 7.701   1.00 117.37 ? 379 ILE A CD1 1 
ATOM   2391 N  N   . PHE A 1 307 ? 183.910 194.449 5.587   1.00 128.87 ? 380 PHE A N   1 
ATOM   2392 C  CA  . PHE A 1 307 ? 185.339 194.163 5.594   1.00 126.35 ? 380 PHE A CA  1 
ATOM   2393 C  C   . PHE A 1 307 ? 186.195 195.353 5.997   1.00 140.69 ? 380 PHE A C   1 
ATOM   2394 O  O   . PHE A 1 307 ? 187.372 195.164 6.306   1.00 129.23 ? 380 PHE A O   1 
ATOM   2395 C  CB  . PHE A 1 307 ? 185.782 193.598 4.248   1.00 113.83 ? 380 PHE A CB  1 
ATOM   2396 C  CG  . PHE A 1 307 ? 185.583 192.122 4.150   1.00 109.89 ? 380 PHE A CG  1 
ATOM   2397 C  CD1 . PHE A 1 307 ? 186.500 191.262 4.731   1.00 113.68 ? 380 PHE A CD1 1 
ATOM   2398 C  CD2 . PHE A 1 307 ? 184.470 191.591 3.530   1.00 108.91 ? 380 PHE A CD2 1 
ATOM   2399 C  CE1 . PHE A 1 307 ? 186.325 189.900 4.671   1.00 120.27 ? 380 PHE A CE1 1 
ATOM   2400 C  CE2 . PHE A 1 307 ? 184.291 190.227 3.464   1.00 120.61 ? 380 PHE A CE2 1 
ATOM   2401 C  CZ  . PHE A 1 307 ? 185.216 189.383 4.041   1.00 134.38 ? 380 PHE A CZ  1 
ATOM   2402 N  N   . THR A 1 308 ? 185.671 196.574 5.937   1.00 153.57 ? 381 THR A N   1 
ATOM   2403 C  CA  . THR A 1 308 ? 186.428 197.685 6.497   1.00 144.60 ? 381 THR A CA  1 
ATOM   2404 C  C   . THR A 1 308 ? 186.479 197.550 8.012   1.00 152.54 ? 381 THR A C   1 
ATOM   2405 O  O   . THR A 1 308 ? 187.539 197.711 8.631   1.00 143.33 ? 381 THR A O   1 
ATOM   2406 C  CB  . THR A 1 308 ? 185.812 199.020 6.080   1.00 156.26 ? 381 THR A CB  1 
ATOM   2407 O  OG1 . THR A 1 308 ? 184.405 199.013 6.360   1.00 155.38 ? 381 THR A OG1 1 
ATOM   2408 C  CG2 . THR A 1 308 ? 186.038 199.274 4.594   1.00 161.93 ? 381 THR A CG2 1 
ATOM   2409 N  N   . VAL A 1 309 ? 185.337 197.213 8.616   1.00 149.94 ? 382 VAL A N   1 
ATOM   2410 C  CA  . VAL A 1 309 ? 185.256 197.062 10.063  1.00 130.51 ? 382 VAL A CA  1 
ATOM   2411 C  C   . VAL A 1 309 ? 186.030 195.825 10.502  1.00 118.07 ? 382 VAL A C   1 
ATOM   2412 O  O   . VAL A 1 309 ? 186.741 195.850 11.511  1.00 140.01 ? 382 VAL A O   1 
ATOM   2413 C  CB  . VAL A 1 309 ? 183.782 197.008 10.505  1.00 121.06 ? 382 VAL A CB  1 
ATOM   2414 C  CG1 . VAL A 1 309 ? 183.679 196.887 12.009  1.00 121.14 ? 382 VAL A CG1 1 
ATOM   2415 C  CG2 . VAL A 1 309 ? 183.043 198.245 10.017  1.00 124.03 ? 382 VAL A CG2 1 
ATOM   2416 N  N   . LEU A 1 310 ? 185.905 194.725 9.752   1.00 115.54 ? 383 LEU A N   1 
ATOM   2417 C  CA  . LEU A 1 310 ? 186.641 193.501 10.061  1.00 112.93 ? 383 LEU A CA  1 
ATOM   2418 C  C   . LEU A 1 310 ? 188.128 193.677 9.798   1.00 113.27 ? 383 LEU A C   1 
ATOM   2419 O  O   . LEU A 1 310 ? 188.953 192.994 10.415  1.00 111.97 ? 383 LEU A O   1 
ATOM   2420 C  CB  . LEU A 1 310 ? 186.094 192.324 9.255   1.00 110.41 ? 383 LEU A CB  1 
ATOM   2421 C  CG  . LEU A 1 310 ? 185.071 191.447 9.977   1.00 108.80 ? 383 LEU A CG  1 
ATOM   2422 C  CD1 . LEU A 1 310 ? 183.840 192.246 10.363  1.00 127.70 ? 383 LEU A CD1 1 
ATOM   2423 C  CD2 . LEU A 1 310 ? 184.694 190.260 9.106   1.00 106.40 ? 383 LEU A CD2 1 
ATOM   2424 N  N   . GLY A 1 311 ? 188.480 194.537 8.844   1.00 126.42 ? 384 GLY A N   1 
ATOM   2425 C  CA  . GLY A 1 311 ? 189.879 194.850 8.620   1.00 131.34 ? 384 GLY A CA  1 
ATOM   2426 C  C   . GLY A 1 311 ? 190.436 195.611 9.803   1.00 138.91 ? 384 GLY A C   1 
ATOM   2427 O  O   . GLY A 1 311 ? 191.553 195.351 10.257  1.00 117.28 ? 384 GLY A O   1 
ATOM   2428 N  N   . TYR A 1 312 ? 189.663 196.575 10.307  1.00 151.46 ? 385 TYR A N   1 
ATOM   2429 C  CA  . TYR A 1 312 ? 190.049 197.285 11.520  1.00 172.89 ? 385 TYR A CA  1 
ATOM   2430 C  C   . TYR A 1 312 ? 190.163 196.314 12.687  1.00 161.27 ? 385 TYR A C   1 
ATOM   2431 O  O   . TYR A 1 312 ? 191.034 196.464 13.550  1.00 162.03 ? 385 TYR A O   1 
ATOM   2432 C  CB  . TYR A 1 312 ? 189.032 198.385 11.824  1.00 184.94 ? 385 TYR A CB  1 
ATOM   2433 C  CG  . TYR A 1 312 ? 188.977 198.791 13.277  1.00 181.31 ? 385 TYR A CG  1 
ATOM   2434 C  CD1 . TYR A 1 312 ? 189.941 199.627 13.822  1.00 183.53 ? 385 TYR A CD1 1 
ATOM   2435 C  CD2 . TYR A 1 312 ? 187.956 198.341 14.104  1.00 176.43 ? 385 TYR A CD2 1 
ATOM   2436 C  CE1 . TYR A 1 312 ? 189.894 200.000 15.150  1.00 190.98 ? 385 TYR A CE1 1 
ATOM   2437 C  CE2 . TYR A 1 312 ? 187.900 198.708 15.432  1.00 185.49 ? 385 TYR A CE2 1 
ATOM   2438 C  CZ  . TYR A 1 312 ? 188.872 199.538 15.951  1.00 194.30 ? 385 TYR A CZ  1 
ATOM   2439 O  OH  . TYR A 1 312 ? 188.819 199.907 17.276  1.00 204.26 ? 385 TYR A OH  1 
ATOM   2440 N  N   . MET A 1 313 ? 189.274 195.317 12.734  1.00 170.32 ? 386 MET A N   1 
ATOM   2441 C  CA  . MET A 1 313 ? 189.293 194.332 13.809  1.00 152.75 ? 386 MET A CA  1 
ATOM   2442 C  C   . MET A 1 313 ? 190.529 193.450 13.705  1.00 150.43 ? 386 MET A C   1 
ATOM   2443 O  O   . MET A 1 313 ? 191.103 193.050 14.724  1.00 163.63 ? 386 MET A O   1 
ATOM   2444 C  CB  . MET A 1 313 ? 188.028 193.476 13.741  1.00 137.10 ? 386 MET A CB  1 
ATOM   2445 C  CG  . MET A 1 313 ? 187.681 192.735 15.010  1.00 136.06 ? 386 MET A CG  1 
ATOM   2446 S  SD  . MET A 1 313 ? 187.155 193.853 16.315  1.00 166.41 ? 386 MET A SD  1 
ATOM   2447 C  CE  . MET A 1 313 ? 186.776 192.687 17.620  1.00 193.69 ? 386 MET A CE  1 
ATOM   2448 N  N   . ALA A 1 314 ? 190.956 193.141 12.478  1.00 138.00 ? 387 ALA A N   1 
ATOM   2449 C  CA  . ALA A 1 314 ? 192.164 192.349 12.288  1.00 137.36 ? 387 ALA A CA  1 
ATOM   2450 C  C   . ALA A 1 314 ? 193.401 193.180 12.596  1.00 136.45 ? 387 ALA A C   1 
ATOM   2451 O  O   . ALA A 1 314 ? 194.428 192.637 13.018  1.00 112.89 ? 387 ALA A O   1 
ATOM   2452 C  CB  . ALA A 1 314 ? 192.217 191.796 10.863  1.00 150.40 ? 387 ALA A CB  1 
ATOM   2453 N  N   . GLU A 1 315 ? 193.319 194.497 12.381  1.00 157.70 ? 388 GLU A N   1 
ATOM   2454 C  CA  . GLU A 1 315 ? 194.428 195.383 12.715  1.00 172.42 ? 388 GLU A CA  1 
ATOM   2455 C  C   . GLU A 1 315 ? 194.566 195.500 14.226  1.00 171.77 ? 388 GLU A C   1 
ATOM   2456 O  O   . GLU A 1 315 ? 195.678 195.462 14.764  1.00 167.86 ? 388 GLU A O   1 
ATOM   2457 C  CB  . GLU A 1 315 ? 194.202 196.759 12.084  1.00 174.75 ? 388 GLU A CB  1 
ATOM   2458 C  CG  . GLU A 1 315 ? 195.291 197.791 12.355  1.00 169.50 ? 388 GLU A CG  1 
ATOM   2459 C  CD  . GLU A 1 315 ? 196.523 197.589 11.491  1.00 161.43 ? 388 GLU A CD  1 
ATOM   2460 O  OE1 . GLU A 1 315 ? 197.531 198.290 11.719  1.00 165.43 ? 388 GLU A OE1 1 
ATOM   2461 O  OE2 . GLU A 1 315 ? 196.476 196.752 10.566  1.00 156.20 ? 388 GLU A OE2 1 
ATOM   2462 N  N   . MET A 1 316 ? 193.434 195.648 14.920  1.00 183.57 ? 389 MET A N   1 
ATOM   2463 C  CA  . MET A 1 316 ? 193.437 195.734 16.376  1.00 194.97 ? 389 MET A CA  1 
ATOM   2464 C  C   . MET A 1 316 ? 193.929 194.426 16.983  1.00 182.38 ? 389 MET A C   1 
ATOM   2465 O  O   . MET A 1 316 ? 194.693 194.428 17.955  1.00 182.06 ? 389 MET A O   1 
ATOM   2466 C  CB  . MET A 1 316 ? 192.036 196.092 16.876  1.00 204.02 ? 389 MET A CB  1 
ATOM   2467 C  CG  . MET A 1 316 ? 191.966 196.481 18.343  1.00 202.07 ? 389 MET A CG  1 
ATOM   2468 S  SD  . MET A 1 316 ? 190.396 197.264 18.764  1.00 188.03 ? 389 MET A SD  1 
ATOM   2469 C  CE  . MET A 1 316 ? 189.243 195.952 18.377  1.00 181.83 ? 389 MET A CE  1 
ATOM   2470 N  N   . ARG A 1 317 ? 193.502 193.298 16.413  1.00 169.44 ? 390 ARG A N   1 
ATOM   2471 C  CA  . ARG A 1 317 ? 194.040 191.986 16.754  1.00 147.67 ? 390 ARG A CA  1 
ATOM   2472 C  C   . ARG A 1 317 ? 195.272 191.803 15.876  1.00 164.14 ? 390 ARG A C   1 
ATOM   2473 O  O   . ARG A 1 317 ? 196.001 192.774 15.646  1.00 163.79 ? 390 ARG A O   1 
ATOM   2474 C  CB  . ARG A 1 317 ? 193.024 190.875 16.480  1.00 145.11 ? 390 ARG A CB  1 
ATOM   2475 N  N   . ASN A 1 318 ? 195.557 190.589 15.398  1.00 158.93 ? 391 ASN A N   1 
ATOM   2476 C  CA  . ASN A 1 318 ? 196.729 190.384 14.546  1.00 152.21 ? 391 ASN A CA  1 
ATOM   2477 C  C   . ASN A 1 318 ? 196.402 189.684 13.222  1.00 167.43 ? 391 ASN A C   1 
ATOM   2478 O  O   . ASN A 1 318 ? 196.725 188.512 13.021  1.00 162.19 ? 391 ASN A O   1 
ATOM   2479 C  CB  . ASN A 1 318 ? 197.761 189.596 15.346  1.00 119.36 ? 391 ASN A CB  1 
ATOM   2480 C  CG  . ASN A 1 318 ? 198.725 190.496 16.080  1.00 132.59 ? 391 ASN A CG  1 
ATOM   2481 O  OD1 . ASN A 1 318 ? 198.925 191.650 15.700  1.00 112.99 ? 391 ASN A OD1 1 
ATOM   2482 N  ND2 . ASN A 1 318 ? 199.325 189.975 17.145  1.00 156.96 ? 391 ASN A ND2 1 
ATOM   2483 N  N   . GLU A 1 319 ? 195.749 190.420 12.320  1.00 178.79 ? 392 GLU A N   1 
ATOM   2484 C  CA  . GLU A 1 319 ? 195.743 190.099 10.896  1.00 180.32 ? 392 GLU A CA  1 
ATOM   2485 C  C   . GLU A 1 319 ? 195.074 188.774 10.552  1.00 176.48 ? 392 GLU A C   1 
ATOM   2486 O  O   . GLU A 1 319 ? 194.424 188.150 11.398  1.00 164.09 ? 392 GLU A O   1 
ATOM   2487 C  CB  . GLU A 1 319 ? 197.162 190.116 10.334  1.00 186.63 ? 392 GLU A CB  1 
ATOM   2488 C  CG  . GLU A 1 319 ? 197.227 190.796 8.981   1.00 221.11 ? 392 GLU A CG  1 
ATOM   2489 C  CD  . GLU A 1 319 ? 198.546 190.592 8.289   1.00 244.29 ? 392 GLU A CD  1 
ATOM   2490 O  OE1 . GLU A 1 319 ? 199.562 190.429 8.995   1.00 244.74 ? 392 GLU A OE1 1 
ATOM   2491 O  OE2 . GLU A 1 319 ? 198.561 190.581 7.040   1.00 261.52 ? 392 GLU A OE2 1 
ATOM   2492 N  N   . ASP A 1 320 ? 195.243 188.352 9.296   1.00 177.36 ? 393 ASP A N   1 
ATOM   2493 C  CA  . ASP A 1 320 ? 194.555 187.204 8.719   1.00 160.99 ? 393 ASP A CA  1 
ATOM   2494 C  C   . ASP A 1 320 ? 193.058 187.309 8.950   1.00 147.10 ? 393 ASP A C   1 
ATOM   2495 O  O   . ASP A 1 320 ? 192.514 186.658 9.848   1.00 132.98 ? 393 ASP A O   1 
ATOM   2496 C  CB  . ASP A 1 320 ? 195.100 185.895 9.294   1.00 152.51 ? 393 ASP A CB  1 
ATOM   2497 N  N   . VAL A 1 321 ? 192.392 188.136 8.139   1.00 153.44 ? 394 VAL A N   1 
ATOM   2498 C  CA  . VAL A 1 321 ? 190.976 188.432 8.341   1.00 144.60 ? 394 VAL A CA  1 
ATOM   2499 C  C   . VAL A 1 321 ? 190.165 187.148 8.403   1.00 138.59 ? 394 VAL A C   1 
ATOM   2500 O  O   . VAL A 1 321 ? 189.084 187.114 9.002   1.00 138.58 ? 394 VAL A O   1 
ATOM   2501 C  CB  . VAL A 1 321 ? 190.465 189.375 7.232   1.00 153.20 ? 394 VAL A CB  1 
ATOM   2502 C  CG1 . VAL A 1 321 ? 188.962 189.590 7.364   1.00 157.36 ? 394 VAL A CG1 1 
ATOM   2503 C  CG2 . VAL A 1 321 ? 191.207 190.704 7.289   1.00 157.39 ? 394 VAL A CG2 1 
ATOM   2504 N  N   . SER A 1 322 ? 190.664 186.075 7.782   1.00 139.53 ? 395 SER A N   1 
ATOM   2505 C  CA  . SER A 1 322 ? 189.996 184.786 7.907   1.00 143.71 ? 395 SER A CA  1 
ATOM   2506 C  C   . SER A 1 322 ? 189.900 184.351 9.361   1.00 156.38 ? 395 SER A C   1 
ATOM   2507 O  O   . SER A 1 322 ? 188.908 183.731 9.759   1.00 161.43 ? 395 SER A O   1 
ATOM   2508 C  CB  . SER A 1 322 ? 190.744 183.730 7.095   1.00 147.93 ? 395 SER A CB  1 
ATOM   2509 O  OG  . SER A 1 322 ? 190.227 182.435 7.351   1.00 168.55 ? 395 SER A OG  1 
ATOM   2510 N  N   . GLU A 1 323 ? 190.916 184.671 10.167  1.00 152.26 ? 396 GLU A N   1 
ATOM   2511 C  CA  . GLU A 1 323 ? 190.889 184.297 11.577  1.00 158.95 ? 396 GLU A CA  1 
ATOM   2512 C  C   . GLU A 1 323 ? 189.776 185.028 12.317  1.00 140.98 ? 396 GLU A C   1 
ATOM   2513 O  O   . GLU A 1 323 ? 189.073 184.434 13.143  1.00 147.89 ? 396 GLU A O   1 
ATOM   2514 C  CB  . GLU A 1 323 ? 192.245 184.580 12.220  1.00 170.59 ? 396 GLU A CB  1 
ATOM   2515 C  CG  . GLU A 1 323 ? 193.374 183.816 11.569  1.00 180.68 ? 396 GLU A CG  1 
ATOM   2516 C  CD  . GLU A 1 323 ? 193.211 182.320 11.715  1.00 191.17 ? 396 GLU A CD  1 
ATOM   2517 O  OE1 . GLU A 1 323 ? 192.974 181.856 12.848  1.00 189.91 ? 396 GLU A OE1 1 
ATOM   2518 O  OE2 . GLU A 1 323 ? 193.303 181.612 10.689  1.00 195.38 ? 396 GLU A OE2 1 
ATOM   2519 N  N   . VAL A 1 324 ? 189.594 186.318 12.024  1.00 111.91 ? 397 VAL A N   1 
ATOM   2520 C  CA  . VAL A 1 324 ? 188.555 187.105 12.683  1.00 112.07 ? 397 VAL A CA  1 
ATOM   2521 C  C   . VAL A 1 324 ? 187.196 186.890 12.040  1.00 135.46 ? 397 VAL A C   1 
ATOM   2522 O  O   . VAL A 1 324 ? 186.171 187.242 12.637  1.00 145.64 ? 397 VAL A O   1 
ATOM   2523 C  CB  . VAL A 1 324 ? 188.923 188.602 12.673  1.00 120.02 ? 397 VAL A CB  1 
ATOM   2524 C  CG1 . VAL A 1 324 ? 188.611 189.231 11.323  1.00 104.70 ? 397 VAL A CG1 1 
ATOM   2525 C  CG2 . VAL A 1 324 ? 188.190 189.338 13.778  1.00 143.31 ? 397 VAL A CG2 1 
ATOM   2526 N  N   . ALA A 1 325 ? 187.161 186.278 10.862  1.00 149.49 ? 398 ALA A N   1 
ATOM   2527 C  CA  . ALA A 1 325 ? 185.936 186.008 10.122  1.00 154.08 ? 398 ALA A CA  1 
ATOM   2528 C  C   . ALA A 1 325 ? 185.775 184.510 9.910   1.00 151.10 ? 398 ALA A C   1 
ATOM   2529 O  O   . ALA A 1 325 ? 185.304 184.054 8.867   1.00 144.74 ? 398 ALA A O   1 
ATOM   2530 C  CB  . ALA A 1 325 ? 185.919 186.750 8.787   1.00 156.69 ? 398 ALA A CB  1 
ATOM   2531 N  N   . LYS A 1 326 ? 186.189 183.726 10.907  1.00 142.10 ? 399 LYS A N   1 
ATOM   2532 C  CA  . LYS A 1 326 ? 186.046 182.278 10.812  1.00 161.77 ? 399 LYS A CA  1 
ATOM   2533 C  C   . LYS A 1 326 ? 184.578 181.878 10.828  1.00 173.23 ? 399 LYS A C   1 
ATOM   2534 O  O   . LYS A 1 326 ? 184.119 181.127 9.960   1.00 157.93 ? 399 LYS A O   1 
ATOM   2535 C  CB  . LYS A 1 326 ? 186.790 181.593 11.959  1.00 165.06 ? 399 LYS A CB  1 
ATOM   2536 C  CG  . LYS A 1 326 ? 188.255 181.312 11.695  1.00 172.07 ? 399 LYS A CG  1 
ATOM   2537 C  CD  . LYS A 1 326 ? 188.858 180.546 12.859  1.00 158.38 ? 399 LYS A CD  1 
ATOM   2538 C  CE  . LYS A 1 326 ? 190.285 180.133 12.577  1.00 143.53 ? 399 LYS A CE  1 
ATOM   2539 N  NZ  . LYS A 1 326 ? 190.866 179.424 13.746  1.00 125.82 ? 399 LYS A NZ  1 
ATOM   2540 N  N   . ASP A 1 327 ? 183.825 182.375 11.805  1.00 201.74 ? 400 ASP A N   1 
ATOM   2541 C  CA  . ASP A 1 327 ? 182.418 182.018 11.923  1.00 214.02 ? 400 ASP A CA  1 
ATOM   2542 C  C   . ASP A 1 327 ? 181.626 182.690 10.806  1.00 211.82 ? 400 ASP A C   1 
ATOM   2543 O  O   . ASP A 1 327 ? 181.665 183.916 10.659  1.00 223.39 ? 400 ASP A O   1 
ATOM   2544 C  CB  . ASP A 1 327 ? 181.895 182.440 13.294  1.00 225.04 ? 400 ASP A CB  1 
ATOM   2545 C  CG  . ASP A 1 327 ? 180.633 181.704 13.694  1.00 237.05 ? 400 ASP A CG  1 
ATOM   2546 O  OD1 . ASP A 1 327 ? 179.857 181.307 12.801  1.00 239.25 ? 400 ASP A OD1 1 
ATOM   2547 O  OD2 . ASP A 1 327 ? 180.420 181.521 14.911  1.00 243.00 ? 400 ASP A OD2 1 
ATOM   2548 N  N   . ALA A 1 328 ? 180.912 181.889 10.018  1.00 189.64 ? 401 ALA A N   1 
ATOM   2549 C  CA  . ALA A 1 328 ? 180.095 182.381 8.911   1.00 163.29 ? 401 ALA A CA  1 
ATOM   2550 C  C   . ALA A 1 328 ? 178.624 182.284 9.302   1.00 136.86 ? 401 ALA A C   1 
ATOM   2551 O  O   . ALA A 1 328 ? 177.922 181.345 8.928   1.00 115.29 ? 401 ALA A O   1 
ATOM   2552 C  CB  . ALA A 1 328 ? 180.382 181.600 7.644   1.00 160.33 ? 401 ALA A CB  1 
ATOM   2553 N  N   . GLY A 1 329 ? 178.155 183.266 10.058  1.00 154.24 ? 402 GLY A N   1 
ATOM   2554 C  CA  . GLY A 1 329 ? 176.777 183.280 10.476  1.00 155.56 ? 402 GLY A CA  1 
ATOM   2555 C  C   . GLY A 1 329 ? 176.401 184.592 11.122  1.00 160.60 ? 402 GLY A C   1 
ATOM   2556 O  O   . GLY A 1 329 ? 177.072 185.614 10.948  1.00 183.32 ? 402 GLY A O   1 
ATOM   2557 N  N   . PRO A 1 330 ? 175.310 184.584 11.890  1.00 143.62 ? 403 PRO A N   1 
ATOM   2558 C  CA  . PRO A 1 330 ? 174.910 185.807 12.597  1.00 152.11 ? 403 PRO A CA  1 
ATOM   2559 C  C   . PRO A 1 330 ? 175.977 186.289 13.558  1.00 149.20 ? 403 PRO A C   1 
ATOM   2560 O  O   . PRO A 1 330 ? 176.003 187.480 13.894  1.00 156.42 ? 403 PRO A O   1 
ATOM   2561 C  CB  . PRO A 1 330 ? 173.626 185.389 13.327  1.00 156.02 ? 403 PRO A CB  1 
ATOM   2562 C  CG  . PRO A 1 330 ? 173.114 184.219 12.545  1.00 135.19 ? 403 PRO A CG  1 
ATOM   2563 C  CD  . PRO A 1 330 ? 174.337 183.495 12.071  1.00 133.58 ? 403 PRO A CD  1 
ATOM   2564 N  N   . SER A 1 331 ? 176.863 185.395 14.003  1.00 105.20 ? 404 SER A N   1 
ATOM   2565 C  CA  . SER A 1 331 ? 177.926 185.775 14.922  1.00 120.87 ? 404 SER A CA  1 
ATOM   2566 C  C   . SER A 1 331 ? 178.864 186.793 14.296  1.00 125.54 ? 404 SER A C   1 
ATOM   2567 O  O   . SER A 1 331 ? 179.518 187.550 15.022  1.00 142.94 ? 404 SER A O   1 
ATOM   2568 C  CB  . SER A 1 331 ? 178.704 184.537 15.362  1.00 135.20 ? 404 SER A CB  1 
ATOM   2569 O  OG  . SER A 1 331 ? 177.827 183.580 15.927  1.00 143.12 ? 404 SER A OG  1 
ATOM   2570 N  N   . LEU A 1 332 ? 178.943 186.828 12.965  1.00 119.09 ? 405 LEU A N   1 
ATOM   2571 C  CA  . LEU A 1 332 ? 179.782 187.823 12.314  1.00 113.19 ? 405 LEU A CA  1 
ATOM   2572 C  C   . LEU A 1 332 ? 179.223 189.219 12.542  1.00 117.74 ? 405 LEU A C   1 
ATOM   2573 O  O   . LEU A 1 332 ? 179.980 190.195 12.554  1.00 145.52 ? 405 LEU A O   1 
ATOM   2574 C  CB  . LEU A 1 332 ? 179.909 187.503 10.824  1.00 104.25 ? 405 LEU A CB  1 
ATOM   2575 C  CG  . LEU A 1 332 ? 181.056 188.150 10.047  1.00 103.19 ? 405 LEU A CG  1 
ATOM   2576 C  CD1 . LEU A 1 332 ? 181.480 187.236 8.913   1.00 101.62 ? 405 LEU A CD1 1 
ATOM   2577 C  CD2 . LEU A 1 332 ? 180.648 189.507 9.501   1.00 105.75 ? 405 LEU A CD2 1 
ATOM   2578 N  N   . LEU A 1 333 ? 177.911 189.328 12.738  1.00 114.88 ? 406 LEU A N   1 
ATOM   2579 C  CA  . LEU A 1 333 ? 177.252 190.603 12.981  1.00 138.11 ? 406 LEU A CA  1 
ATOM   2580 C  C   . LEU A 1 333 ? 176.973 190.831 14.459  1.00 157.93 ? 406 LEU A C   1 
ATOM   2581 O  O   . LEU A 1 333 ? 177.184 191.939 14.961  1.00 173.90 ? 406 LEU A O   1 
ATOM   2582 C  CB  . LEU A 1 333 ? 175.938 190.688 12.199  1.00 129.64 ? 406 LEU A CB  1 
ATOM   2583 C  CG  . LEU A 1 333 ? 176.055 190.650 10.677  1.00 134.93 ? 406 LEU A CG  1 
ATOM   2584 C  CD1 . LEU A 1 333 ? 174.675 190.699 10.058  1.00 117.40 ? 406 LEU A CD1 1 
ATOM   2585 C  CD2 . LEU A 1 333 ? 176.924 191.792 10.172  1.00 155.08 ? 406 LEU A CD2 1 
ATOM   2586 N  N   . PHE A 1 334 ? 176.497 189.803 15.165  1.00 146.33 ? 407 PHE A N   1 
ATOM   2587 C  CA  . PHE A 1 334 ? 176.081 189.969 16.551  1.00 110.65 ? 407 PHE A CA  1 
ATOM   2588 C  C   . PHE A 1 334 ? 177.248 189.909 17.525  1.00 130.08 ? 407 PHE A C   1 
ATOM   2589 O  O   . PHE A 1 334 ? 177.114 190.386 18.657  1.00 140.09 ? 407 PHE A O   1 
ATOM   2590 C  CB  . PHE A 1 334 ? 175.057 188.899 16.932  1.00 109.29 ? 407 PHE A CB  1 
ATOM   2591 C  CG  . PHE A 1 334 ? 173.699 189.114 16.328  1.00 126.56 ? 407 PHE A CG  1 
ATOM   2592 C  CD1 . PHE A 1 334 ? 172.819 190.033 16.873  1.00 132.72 ? 407 PHE A CD1 1 
ATOM   2593 C  CD2 . PHE A 1 334 ? 173.297 188.385 15.222  1.00 114.55 ? 407 PHE A CD2 1 
ATOM   2594 C  CE1 . PHE A 1 334 ? 171.569 190.228 16.319  1.00 138.94 ? 407 PHE A CE1 1 
ATOM   2595 C  CE2 . PHE A 1 334 ? 172.049 188.573 14.666  1.00 109.67 ? 407 PHE A CE2 1 
ATOM   2596 C  CZ  . PHE A 1 334 ? 171.184 189.496 15.214  1.00 120.39 ? 407 PHE A CZ  1 
ATOM   2597 N  N   . ILE A 1 335 ? 178.378 189.327 17.123  1.00 108.46 ? 408 ILE A N   1 
ATOM   2598 C  CA  . ILE A 1 335 ? 179.531 189.223 18.010  1.00 121.21 ? 408 ILE A CA  1 
ATOM   2599 C  C   . ILE A 1 335 ? 180.695 190.029 17.452  1.00 135.53 ? 408 ILE A C   1 
ATOM   2600 O  O   . ILE A 1 335 ? 181.097 191.039 18.038  1.00 172.24 ? 408 ILE A O   1 
ATOM   2601 C  CB  . ILE A 1 335 ? 179.939 187.755 18.234  1.00 106.76 ? 408 ILE A CB  1 
ATOM   2602 C  CG1 . ILE A 1 335 ? 178.804 186.978 18.901  1.00 104.63 ? 408 ILE A CG1 1 
ATOM   2603 C  CG2 . ILE A 1 335 ? 181.202 187.678 19.079  1.00 105.08 ? 408 ILE A CG2 1 
ATOM   2604 C  CD1 . ILE A 1 335 ? 179.142 185.531 19.176  1.00 109.50 ? 408 ILE A CD1 1 
ATOM   2605 N  N   . THR A 1 336 ? 181.239 189.591 16.314  1.00 120.60 ? 409 THR A N   1 
ATOM   2606 C  CA  . THR A 1 336 ? 182.417 190.240 15.745  1.00 121.89 ? 409 THR A CA  1 
ATOM   2607 C  C   . THR A 1 336 ? 182.150 191.710 15.448  1.00 123.74 ? 409 THR A C   1 
ATOM   2608 O  O   . THR A 1 336 ? 182.806 192.603 16.000  1.00 149.40 ? 409 THR A O   1 
ATOM   2609 C  CB  . THR A 1 336 ? 182.864 189.506 14.478  1.00 120.13 ? 409 THR A CB  1 
ATOM   2610 O  OG1 . THR A 1 336 ? 183.168 188.142 14.794  1.00 136.19 ? 409 THR A OG1 1 
ATOM   2611 C  CG2 . THR A 1 336 ? 184.097 190.171 13.884  1.00 115.74 ? 409 THR A CG2 1 
ATOM   2612 N  N   . TYR A 1 337 ? 181.194 191.978 14.555  1.00 111.75 ? 410 TYR A N   1 
ATOM   2613 C  CA  . TYR A 1 337 ? 180.901 193.354 14.167  1.00 131.44 ? 410 TYR A CA  1 
ATOM   2614 C  C   . TYR A 1 337 ? 180.443 194.180 15.365  1.00 152.19 ? 410 TYR A C   1 
ATOM   2615 O  O   . TYR A 1 337 ? 180.820 195.350 15.502  1.00 151.57 ? 410 TYR A O   1 
ATOM   2616 C  CB  . TYR A 1 337 ? 179.847 193.358 13.062  1.00 114.65 ? 410 TYR A CB  1 
ATOM   2617 C  CG  . TYR A 1 337 ? 179.831 194.601 12.206  1.00 117.12 ? 410 TYR A CG  1 
ATOM   2618 C  CD1 . TYR A 1 337 ? 179.214 195.764 12.639  1.00 120.11 ? 410 TYR A CD1 1 
ATOM   2619 C  CD2 . TYR A 1 337 ? 180.430 194.604 10.952  1.00 116.59 ? 410 TYR A CD2 1 
ATOM   2620 C  CE1 . TYR A 1 337 ? 179.199 196.898 11.850  1.00 130.59 ? 410 TYR A CE1 1 
ATOM   2621 C  CE2 . TYR A 1 337 ? 180.420 195.730 10.158  1.00 118.94 ? 410 TYR A CE2 1 
ATOM   2622 C  CZ  . TYR A 1 337 ? 179.804 196.876 10.610  1.00 124.09 ? 410 TYR A CZ  1 
ATOM   2623 O  OH  . TYR A 1 337 ? 179.791 198.002 9.821   1.00 124.38 ? 410 TYR A OH  1 
ATOM   2624 N  N   . ALA A 1 338 ? 179.630 193.585 16.247  1.00 144.95 ? 411 ALA A N   1 
ATOM   2625 C  CA  . ALA A 1 338 ? 179.164 194.304 17.430  1.00 135.66 ? 411 ALA A CA  1 
ATOM   2626 C  C   . ALA A 1 338 ? 180.320 194.640 18.364  1.00 119.37 ? 411 ALA A C   1 
ATOM   2627 O  O   . ALA A 1 338 ? 180.410 195.762 18.875  1.00 126.51 ? 411 ALA A O   1 
ATOM   2628 C  CB  . ALA A 1 338 ? 178.103 193.484 18.161  1.00 117.71 ? 411 ALA A CB  1 
ATOM   2629 N  N   . GLU A 1 339 ? 181.213 193.676 18.604  1.00 126.58 ? 412 GLU A N   1 
ATOM   2630 C  CA  . GLU A 1 339 ? 182.375 193.940 19.447  1.00 133.00 ? 412 GLU A CA  1 
ATOM   2631 C  C   . GLU A 1 339 ? 183.261 195.010 18.830  1.00 142.84 ? 412 GLU A C   1 
ATOM   2632 O  O   . GLU A 1 339 ? 183.893 195.789 19.553  1.00 154.93 ? 412 GLU A O   1 
ATOM   2633 C  CB  . GLU A 1 339 ? 183.167 192.655 19.685  1.00 138.23 ? 412 GLU A CB  1 
ATOM   2634 C  CG  . GLU A 1 339 ? 184.246 192.780 20.742  1.00 147.38 ? 412 GLU A CG  1 
ATOM   2635 C  CD  . GLU A 1 339 ? 184.979 191.478 20.968  1.00 155.74 ? 412 GLU A CD  1 
ATOM   2636 O  OE1 . GLU A 1 339 ? 185.412 191.230 22.112  1.00 155.97 ? 412 GLU A OE1 1 
ATOM   2637 O  OE2 . GLU A 1 339 ? 185.116 190.701 20.001  1.00 167.24 ? 412 GLU A OE2 1 
ATOM   2638 N  N   . ALA A 1 340 ? 183.319 195.064 17.498  1.00 143.04 ? 413 ALA A N   1 
ATOM   2639 C  CA  . ALA A 1 340 ? 184.076 196.125 16.846  1.00 120.88 ? 413 ALA A CA  1 
ATOM   2640 C  C   . ALA A 1 340 ? 183.388 197.469 17.045  1.00 137.31 ? 413 ALA A C   1 
ATOM   2641 O  O   . ALA A 1 340 ? 184.057 198.498 17.198  1.00 151.15 ? 413 ALA A O   1 
ATOM   2642 C  CB  . ALA A 1 340 ? 184.252 195.814 15.363  1.00 119.57 ? 413 ALA A CB  1 
ATOM   2643 N  N   . ILE A 1 341 ? 182.052 197.476 17.057  1.00 136.46 ? 414 ILE A N   1 
ATOM   2644 C  CA  . ILE A 1 341 ? 181.309 198.717 17.261  1.00 157.42 ? 414 ILE A CA  1 
ATOM   2645 C  C   . ILE A 1 341 ? 181.513 199.232 18.681  1.00 174.14 ? 414 ILE A C   1 
ATOM   2646 O  O   . ILE A 1 341 ? 181.646 200.442 18.904  1.00 191.39 ? 414 ILE A O   1 
ATOM   2647 C  CB  . ILE A 1 341 ? 179.815 198.516 16.942  1.00 157.80 ? 414 ILE A CB  1 
ATOM   2648 C  CG1 . ILE A 1 341 ? 179.607 198.249 15.452  1.00 165.55 ? 414 ILE A CG1 1 
ATOM   2649 C  CG2 . ILE A 1 341 ? 178.997 199.723 17.383  1.00 152.36 ? 414 ILE A CG2 1 
ATOM   2650 C  CD1 . ILE A 1 341 ? 178.158 198.010 15.082  1.00 165.11 ? 414 ILE A CD1 1 
ATOM   2651 N  N   . ALA A 1 342 ? 181.544 198.326 19.663  1.00 167.85 ? 415 ALA A N   1 
ATOM   2652 C  CA  . ALA A 1 342 ? 181.659 198.742 21.059  1.00 172.58 ? 415 ALA A CA  1 
ATOM   2653 C  C   . ALA A 1 342 ? 182.952 199.506 21.318  1.00 179.39 ? 415 ALA A C   1 
ATOM   2654 O  O   . ALA A 1 342 ? 183.006 200.339 22.230  1.00 200.10 ? 415 ALA A O   1 
ATOM   2655 C  CB  . ALA A 1 342 ? 181.566 197.526 21.980  1.00 169.71 ? 415 ALA A CB  1 
ATOM   2656 N  N   . ASN A 1 343 ? 183.999 199.242 20.535  1.00 167.16 ? 416 ASN A N   1 
ATOM   2657 C  CA  . ASN A 1 343 ? 185.300 199.865 20.732  1.00 164.16 ? 416 ASN A CA  1 
ATOM   2658 C  C   . ASN A 1 343 ? 185.480 201.118 19.880  1.00 191.59 ? 416 ASN A C   1 
ATOM   2659 O  O   . ASN A 1 343 ? 186.619 201.511 19.605  1.00 196.25 ? 416 ASN A O   1 
ATOM   2660 C  CB  . ASN A 1 343 ? 186.420 198.868 20.427  1.00 157.52 ? 416 ASN A CB  1 
ATOM   2661 C  CG  . ASN A 1 343 ? 186.424 197.687 21.375  1.00 175.06 ? 416 ASN A CG  1 
ATOM   2662 O  OD1 . ASN A 1 343 ? 186.341 196.535 20.948  1.00 174.63 ? 416 ASN A OD1 1 
ATOM   2663 N  ND2 . ASN A 1 343 ? 186.519 197.966 22.670  1.00 179.33 ? 416 ASN A ND2 1 
ATOM   2664 N  N   . MET A 1 344 ? 184.384 201.749 19.458  1.00 176.45 ? 417 MET A N   1 
ATOM   2665 C  CA  . MET A 1 344 ? 184.423 202.947 18.638  1.00 173.96 ? 417 MET A CA  1 
ATOM   2666 C  C   . MET A 1 344 ? 183.680 204.093 19.317  1.00 178.57 ? 417 MET A C   1 
ATOM   2667 O  O   . MET A 1 344 ? 182.758 203.861 20.105  1.00 177.63 ? 417 MET A O   1 
ATOM   2668 C  CB  . MET A 1 344 ? 183.807 202.698 17.254  1.00 170.38 ? 417 MET A CB  1 
ATOM   2669 C  CG  . MET A 1 344 ? 184.522 201.642 16.429  1.00 167.14 ? 417 MET A CG  1 
ATOM   2670 S  SD  . MET A 1 344 ? 183.945 201.601 14.719  1.00 173.62 ? 417 MET A SD  1 
ATOM   2671 C  CE  . MET A 1 344 ? 182.179 201.407 14.948  1.00 162.71 ? 417 MET A CE  1 
ATOM   2672 N  N   . PRO A 1 345 ? 184.074 205.339 19.046  1.00 187.99 ? 418 PRO A N   1 
ATOM   2673 C  CA  . PRO A 1 345 ? 183.332 206.485 19.586  1.00 184.96 ? 418 PRO A CA  1 
ATOM   2674 C  C   . PRO A 1 345 ? 181.895 206.505 19.088  1.00 172.92 ? 418 PRO A C   1 
ATOM   2675 O  O   . PRO A 1 345 ? 181.592 206.058 17.979  1.00 158.61 ? 418 PRO A O   1 
ATOM   2676 C  CB  . PRO A 1 345 ? 184.121 207.696 19.071  1.00 191.59 ? 418 PRO A CB  1 
ATOM   2677 C  CG  . PRO A 1 345 ? 184.894 207.180 17.898  1.00 191.61 ? 418 PRO A CG  1 
ATOM   2678 C  CD  . PRO A 1 345 ? 185.234 205.764 18.244  1.00 189.23 ? 418 PRO A CD  1 
ATOM   2679 N  N   . ALA A 1 346 ? 181.009 207.040 19.929  1.00 176.53 ? 419 ALA A N   1 
ATOM   2680 C  CA  . ALA A 1 346 ? 179.568 207.034 19.675  1.00 182.17 ? 419 ALA A CA  1 
ATOM   2681 C  C   . ALA A 1 346 ? 179.071 205.613 19.421  1.00 172.08 ? 419 ALA A C   1 
ATOM   2682 O  O   . ALA A 1 346 ? 178.307 205.345 18.491  1.00 167.28 ? 419 ALA A O   1 
ATOM   2683 C  CB  . ALA A 1 346 ? 179.205 207.965 18.516  1.00 191.59 ? 419 ALA A CB  1 
ATOM   2684 N  N   . SER A 1 347 ? 179.529 204.691 20.274  1.00 174.62 ? 420 SER A N   1 
ATOM   2685 C  CA  . SER A 1 347 ? 179.194 203.280 20.112  1.00 163.75 ? 420 SER A CA  1 
ATOM   2686 C  C   . SER A 1 347 ? 177.690 203.058 20.205  1.00 152.01 ? 420 SER A C   1 
ATOM   2687 O  O   . SER A 1 347 ? 177.137 202.207 19.498  1.00 156.96 ? 420 SER A O   1 
ATOM   2688 C  CB  . SER A 1 347 ? 179.934 202.451 21.161  1.00 164.18 ? 420 SER A CB  1 
ATOM   2689 O  OG  . SER A 1 347 ? 179.842 203.064 22.434  1.00 171.79 ? 420 SER A OG  1 
ATOM   2690 N  N   . THR A 1 348 ? 177.019 203.784 21.101  1.00 153.99 ? 421 THR A N   1 
ATOM   2691 C  CA  . THR A 1 348 ? 175.567 203.679 21.210  1.00 158.43 ? 421 THR A CA  1 
ATOM   2692 C  C   . THR A 1 348 ? 174.904 203.989 19.871  1.00 170.53 ? 421 THR A C   1 
ATOM   2693 O  O   . THR A 1 348 ? 174.006 203.266 19.424  1.00 166.10 ? 421 THR A O   1 
ATOM   2694 C  CB  . THR A 1 348 ? 175.051 204.614 22.306  1.00 154.95 ? 421 THR A CB  1 
ATOM   2695 O  OG1 . THR A 1 348 ? 175.606 204.227 23.569  1.00 154.29 ? 421 THR A OG1 1 
ATOM   2696 C  CG2 . THR A 1 348 ? 173.533 204.570 22.384  1.00 161.79 ? 421 THR A CG2 1 
ATOM   2697 N  N   . PHE A 1 349 ? 175.336 205.074 19.224  1.00 164.48 ? 422 PHE A N   1 
ATOM   2698 C  CA  . PHE A 1 349 ? 174.806 205.456 17.917  1.00 168.03 ? 422 PHE A CA  1 
ATOM   2699 C  C   . PHE A 1 349 ? 174.986 204.338 16.894  1.00 148.75 ? 422 PHE A C   1 
ATOM   2700 O  O   . PHE A 1 349 ? 174.009 203.820 16.336  1.00 147.70 ? 422 PHE A O   1 
ATOM   2701 C  CB  . PHE A 1 349 ? 175.494 206.741 17.450  1.00 174.86 ? 422 PHE A CB  1 
ATOM   2702 C  CG  . PHE A 1 349 ? 175.176 207.128 16.032  1.00 178.55 ? 422 PHE A CG  1 
ATOM   2703 C  CD1 . PHE A 1 349 ? 174.008 207.809 15.732  1.00 181.36 ? 422 PHE A CD1 1 
ATOM   2704 C  CD2 . PHE A 1 349 ? 176.058 206.834 15.004  1.00 176.56 ? 422 PHE A CD2 1 
ATOM   2705 C  CE1 . PHE A 1 349 ? 173.716 208.172 14.430  1.00 179.17 ? 422 PHE A CE1 1 
ATOM   2706 C  CE2 . PHE A 1 349 ? 175.772 207.195 13.701  1.00 173.37 ? 422 PHE A CE2 1 
ATOM   2707 C  CZ  . PHE A 1 349 ? 174.600 207.865 13.414  1.00 175.78 ? 422 PHE A CZ  1 
ATOM   2708 N  N   . PHE A 1 350 ? 176.239 203.935 16.653  1.00 153.62 ? 423 PHE A N   1 
ATOM   2709 C  CA  . PHE A 1 350 ? 176.529 202.922 15.643  1.00 159.46 ? 423 PHE A CA  1 
ATOM   2710 C  C   . PHE A 1 350 ? 175.938 201.563 15.993  1.00 166.82 ? 423 PHE A C   1 
ATOM   2711 O  O   . PHE A 1 350 ? 175.868 200.690 15.122  1.00 158.02 ? 423 PHE A O   1 
ATOM   2712 C  CB  . PHE A 1 350 ? 178.040 202.797 15.436  1.00 158.10 ? 423 PHE A CB  1 
ATOM   2713 C  CG  . PHE A 1 350 ? 178.661 203.981 14.748  1.00 154.84 ? 423 PHE A CG  1 
ATOM   2714 C  CD1 . PHE A 1 350 ? 178.535 204.150 13.379  1.00 151.73 ? 423 PHE A CD1 1 
ATOM   2715 C  CD2 . PHE A 1 350 ? 179.373 204.923 15.471  1.00 173.82 ? 423 PHE A CD2 1 
ATOM   2716 C  CE1 . PHE A 1 350 ? 179.106 205.238 12.743  1.00 152.09 ? 423 PHE A CE1 1 
ATOM   2717 C  CE2 . PHE A 1 350 ? 179.946 206.013 14.842  1.00 185.52 ? 423 PHE A CE2 1 
ATOM   2718 C  CZ  . PHE A 1 350 ? 179.812 206.172 13.476  1.00 177.70 ? 423 PHE A CZ  1 
ATOM   2719 N  N   . ALA A 1 351 ? 175.525 201.358 17.243  1.00 172.17 ? 424 ALA A N   1 
ATOM   2720 C  CA  . ALA A 1 351 ? 174.839 200.125 17.609  1.00 162.91 ? 424 ALA A CA  1 
ATOM   2721 C  C   . ALA A 1 351 ? 173.356 200.234 17.276  1.00 168.06 ? 424 ALA A C   1 
ATOM   2722 O  O   . ALA A 1 351 ? 172.774 199.325 16.672  1.00 178.30 ? 424 ALA A O   1 
ATOM   2723 C  CB  . ALA A 1 351 ? 175.048 199.821 19.093  1.00 157.52 ? 424 ALA A CB  1 
ATOM   2724 N  N   . ILE A 1 352 ? 172.736 201.350 17.670  1.00 147.70 ? 425 ILE A N   1 
ATOM   2725 C  CA  . ILE A 1 352 ? 171.315 201.570 17.409  1.00 157.11 ? 425 ILE A CA  1 
ATOM   2726 C  C   . ILE A 1 352 ? 171.042 201.512 15.911  1.00 159.37 ? 425 ILE A C   1 
ATOM   2727 O  O   . ILE A 1 352 ? 170.118 200.827 15.458  1.00 159.18 ? 425 ILE A O   1 
ATOM   2728 C  CB  . ILE A 1 352 ? 170.856 202.907 18.019  1.00 159.72 ? 425 ILE A CB  1 
ATOM   2729 C  CG1 . ILE A 1 352 ? 170.805 202.806 19.544  1.00 153.10 ? 425 ILE A CG1 1 
ATOM   2730 C  CG2 . ILE A 1 352 ? 169.494 203.306 17.468  1.00 148.14 ? 425 ILE A CG2 1 
ATOM   2731 C  CD1 . ILE A 1 352 ? 170.410 204.094 20.228  1.00 151.29 ? 425 ILE A CD1 1 
ATOM   2732 N  N   . ILE A 1 353 ? 171.828 202.249 15.118  1.00 175.50 ? 426 ILE A N   1 
ATOM   2733 C  CA  . ILE A 1 353 ? 171.568 202.286 13.683  1.00 165.19 ? 426 ILE A CA  1 
ATOM   2734 C  C   . ILE A 1 353 ? 171.887 200.942 13.040  1.00 157.35 ? 426 ILE A C   1 
ATOM   2735 O  O   . ILE A 1 353 ? 171.337 200.616 11.983  1.00 158.58 ? 426 ILE A O   1 
ATOM   2736 C  CB  . ILE A 1 353 ? 172.356 203.418 12.996  1.00 172.56 ? 426 ILE A CB  1 
ATOM   2737 C  CG1 . ILE A 1 353 ? 173.847 203.083 12.936  1.00 170.59 ? 426 ILE A CG1 1 
ATOM   2738 C  CG2 . ILE A 1 353 ? 172.129 204.737 13.717  1.00 190.14 ? 426 ILE A CG2 1 
ATOM   2739 C  CD1 . ILE A 1 353 ? 174.647 204.041 12.081  1.00 172.88 ? 426 ILE A CD1 1 
ATOM   2740 N  N   . PHE A 1 354 ? 172.771 200.153 13.653  1.00 164.05 ? 427 PHE A N   1 
ATOM   2741 C  CA  . PHE A 1 354 ? 173.122 198.851 13.097  1.00 164.77 ? 427 PHE A CA  1 
ATOM   2742 C  C   . PHE A 1 354 ? 171.987 197.858 13.306  1.00 154.15 ? 427 PHE A C   1 
ATOM   2743 O  O   . PHE A 1 354 ? 171.514 197.227 12.354  1.00 150.20 ? 427 PHE A O   1 
ATOM   2744 C  CB  . PHE A 1 354 ? 174.412 198.339 13.745  1.00 155.44 ? 427 PHE A CB  1 
ATOM   2745 C  CG  . PHE A 1 354 ? 174.880 197.009 13.220  1.00 125.47 ? 427 PHE A CG  1 
ATOM   2746 C  CD1 . PHE A 1 354 ? 175.544 196.918 12.009  1.00 141.32 ? 427 PHE A CD1 1 
ATOM   2747 C  CD2 . PHE A 1 354 ? 174.669 195.852 13.949  1.00 123.15 ? 427 PHE A CD2 1 
ATOM   2748 C  CE1 . PHE A 1 354 ? 175.979 195.693 11.530  1.00 132.17 ? 427 PHE A CE1 1 
ATOM   2749 C  CE2 . PHE A 1 354 ? 175.101 194.625 13.478  1.00 132.45 ? 427 PHE A CE2 1 
ATOM   2750 C  CZ  . PHE A 1 354 ? 175.758 194.546 12.267  1.00 118.92 ? 427 PHE A CZ  1 
ATOM   2751 N  N   . PHE A 1 355 ? 171.526 197.720 14.551  1.00 168.37 ? 428 PHE A N   1 
ATOM   2752 C  CA  . PHE A 1 355 ? 170.440 196.787 14.832  1.00 164.20 ? 428 PHE A CA  1 
ATOM   2753 C  C   . PHE A 1 355 ? 169.152 197.240 14.157  1.00 130.79 ? 428 PHE A C   1 
ATOM   2754 O  O   . PHE A 1 355 ? 168.393 196.417 13.628  1.00 129.25 ? 428 PHE A O   1 
ATOM   2755 C  CB  . PHE A 1 355 ? 170.267 196.677 16.344  1.00 181.75 ? 428 PHE A CB  1 
ATOM   2756 C  CG  . PHE A 1 355 ? 171.478 196.133 17.040  1.00 127.56 ? 428 PHE A CG  1 
ATOM   2757 C  CD1 . PHE A 1 355 ? 172.344 195.275 16.382  1.00 124.52 ? 428 PHE A CD1 1 
ATOM   2758 C  CD2 . PHE A 1 355 ? 171.801 196.551 18.317  1.00 175.19 ? 428 PHE A CD2 1 
ATOM   2759 C  CE1 . PHE A 1 355 ? 173.474 194.793 17.008  1.00 122.88 ? 428 PHE A CE1 1 
ATOM   2760 C  CE2 . PHE A 1 355 ? 172.934 196.079 18.947  1.00 174.99 ? 428 PHE A CE2 1 
ATOM   2761 C  CZ  . PHE A 1 355 ? 173.773 195.198 18.290  1.00 164.02 ? 428 PHE A CZ  1 
ATOM   2762 N  N   . LEU A 1 356 ? 168.900 198.551 14.156  1.00 134.27 ? 429 LEU A N   1 
ATOM   2763 C  CA  . LEU A 1 356 ? 167.759 199.091 13.426  1.00 163.68 ? 429 LEU A CA  1 
ATOM   2764 C  C   . LEU A 1 356 ? 167.885 198.774 11.945  1.00 162.72 ? 429 LEU A C   1 
ATOM   2765 O  O   . LEU A 1 356 ? 166.890 198.477 11.275  1.00 151.26 ? 429 LEU A O   1 
ATOM   2766 C  CB  . LEU A 1 356 ? 167.642 200.597 13.651  1.00 145.35 ? 429 LEU A CB  1 
ATOM   2767 C  CG  . LEU A 1 356 ? 166.264 201.192 13.368  1.00 143.35 ? 429 LEU A CG  1 
ATOM   2768 C  CD1 . LEU A 1 356 ? 165.195 200.536 14.228  1.00 143.19 ? 429 LEU A CD1 1 
ATOM   2769 C  CD2 . LEU A 1 356 ? 166.291 202.692 13.592  1.00 171.46 ? 429 LEU A CD2 1 
ATOM   2770 N  N   . MET A 1 357 ? 169.112 198.835 11.421  1.00 148.58 ? 430 MET A N   1 
ATOM   2771 C  CA  . MET A 1 357 ? 169.344 198.467 10.031  1.00 132.01 ? 430 MET A CA  1 
ATOM   2772 C  C   . MET A 1 357 ? 168.958 197.017 9.795   1.00 128.72 ? 430 MET A C   1 
ATOM   2773 O  O   . MET A 1 357 ? 168.287 196.699 8.812   1.00 135.65 ? 430 MET A O   1 
ATOM   2774 C  CB  . MET A 1 357 ? 170.808 198.694 9.656   1.00 131.25 ? 430 MET A CB  1 
ATOM   2775 C  CG  . MET A 1 357 ? 171.128 198.279 8.230   1.00 129.58 ? 430 MET A CG  1 
ATOM   2776 S  SD  . MET A 1 357 ? 172.888 198.240 7.852   1.00 135.47 ? 430 MET A SD  1 
ATOM   2777 C  CE  . MET A 1 357 ? 173.443 196.968 8.979   1.00 124.97 ? 430 MET A CE  1 
ATOM   2778 N  N   . LEU A 1 358 ? 169.410 196.119 10.670  1.00 126.47 ? 431 LEU A N   1 
ATOM   2779 C  CA  . LEU A 1 358 ? 169.051 194.706 10.574  1.00 127.28 ? 431 LEU A CA  1 
ATOM   2780 C  C   . LEU A 1 358 ? 167.535 194.507 10.551  1.00 127.81 ? 431 LEU A C   1 
ATOM   2781 O  O   . LEU A 1 358 ? 166.996 193.798 9.688   1.00 128.70 ? 431 LEU A O   1 
ATOM   2782 C  CB  . LEU A 1 358 ? 169.674 193.942 11.744  1.00 133.15 ? 431 LEU A CB  1 
ATOM   2783 C  CG  . LEU A 1 358 ? 170.976 193.182 11.488  1.00 126.67 ? 431 LEU A CG  1 
ATOM   2784 C  CD1 . LEU A 1 358 ? 172.005 194.071 10.808  1.00 120.21 ? 431 LEU A CD1 1 
ATOM   2785 C  CD2 . LEU A 1 358 ? 171.527 192.629 12.793  1.00 117.65 ? 431 LEU A CD2 1 
ATOM   2786 N  N   . ILE A 1 359 ? 166.836 195.111 11.516  1.00 126.76 ? 432 ILE A N   1 
ATOM   2787 C  CA  . ILE A 1 359 ? 165.379 195.005 11.592  1.00 155.24 ? 432 ILE A CA  1 
ATOM   2788 C  C   . ILE A 1 359 ? 164.709 195.513 10.315  1.00 167.66 ? 432 ILE A C   1 
ATOM   2789 O  O   . ILE A 1 359 ? 163.801 194.867 9.776   1.00 171.60 ? 432 ILE A O   1 
ATOM   2790 C  CB  . ILE A 1 359 ? 164.864 195.749 12.836  1.00 143.44 ? 432 ILE A CB  1 
ATOM   2791 C  CG1 . ILE A 1 359 ? 165.492 195.145 14.092  1.00 129.32 ? 432 ILE A CG1 1 
ATOM   2792 C  CG2 . ILE A 1 359 ? 163.349 195.671 12.913  1.00 144.18 ? 432 ILE A CG2 1 
ATOM   2793 C  CD1 . ILE A 1 359 ? 165.099 195.838 15.367  1.00 132.03 ? 432 ILE A CD1 1 
ATOM   2794 N  N   . THR A 1 360 ? 165.136 196.677 9.810   1.00 151.66 ? 433 THR A N   1 
ATOM   2795 C  CA  . THR A 1 360 ? 164.541 197.193 8.577   1.00 143.89 ? 433 THR A CA  1 
ATOM   2796 C  C   . THR A 1 360 ? 164.955 196.393 7.348   1.00 147.23 ? 433 THR A C   1 
ATOM   2797 O  O   . THR A 1 360 ? 164.290 196.479 6.313   1.00 130.91 ? 433 THR A O   1 
ATOM   2798 C  CB  . THR A 1 360 ? 164.912 198.663 8.378   1.00 139.63 ? 433 THR A CB  1 
ATOM   2799 O  OG1 . THR A 1 360 ? 166.338 198.804 8.375   1.00 135.10 ? 433 THR A OG1 1 
ATOM   2800 C  CG2 . THR A 1 360 ? 164.319 199.516 9.489   1.00 158.72 ? 433 THR A CG2 1 
ATOM   2801 N  N   . LEU A 1 361 ? 166.066 195.665 7.433   1.00 149.87 ? 434 LEU A N   1 
ATOM   2802 C  CA  . LEU A 1 361 ? 166.494 194.754 6.377   1.00 138.26 ? 434 LEU A CA  1 
ATOM   2803 C  C   . LEU A 1 361 ? 165.582 193.539 6.303   1.00 130.67 ? 434 LEU A C   1 
ATOM   2804 O  O   . LEU A 1 361 ? 165.255 193.057 5.212   1.00 132.39 ? 434 LEU A O   1 
ATOM   2805 C  CB  . LEU A 1 361 ? 167.940 194.339 6.627   1.00 140.74 ? 434 LEU A CB  1 
ATOM   2806 C  CG  . LEU A 1 361 ? 168.979 195.329 6.111   1.00 143.85 ? 434 LEU A CG  1 
ATOM   2807 C  CD1 . LEU A 1 361 ? 170.342 194.932 6.605   1.00 129.84 ? 434 LEU A CD1 1 
ATOM   2808 C  CD2 . LEU A 1 361 ? 168.952 195.335 4.596   1.00 153.53 ? 434 LEU A CD2 1 
ATOM   2809 N  N   . GLY A 1 362 ? 165.165 193.040 7.460   1.00 122.42 ? 435 GLY A N   1 
ATOM   2810 C  CA  . GLY A 1 362 ? 164.315 191.873 7.589   1.00 128.79 ? 435 GLY A CA  1 
ATOM   2811 C  C   . GLY A 1 362 ? 162.849 192.145 7.318   1.00 122.85 ? 435 GLY A C   1 
ATOM   2812 O  O   . GLY A 1 362 ? 162.142 191.313 6.725   1.00 121.70 ? 435 GLY A O   1 
ATOM   2813 N  N   . LEU A 1 363 ? 162.382 193.321 7.745   1.00 126.07 ? 436 LEU A N   1 
ATOM   2814 C  CA  . LEU A 1 363 ? 160.949 193.589 7.740   1.00 149.50 ? 436 LEU A CA  1 
ATOM   2815 C  C   . LEU A 1 363 ? 160.389 193.550 6.325   1.00 150.98 ? 436 LEU A C   1 
ATOM   2816 O  O   . LEU A 1 363 ? 159.314 192.991 6.101   1.00 168.79 ? 436 LEU A O   1 
ATOM   2817 C  CB  . LEU A 1 363 ? 160.694 194.951 8.380   1.00 131.97 ? 436 LEU A CB  1 
ATOM   2818 C  CG  . LEU A 1 363 ? 160.509 194.930 9.894   1.00 132.70 ? 436 LEU A CG  1 
ATOM   2819 C  CD1 . LEU A 1 363 ? 160.555 196.340 10.451  1.00 140.46 ? 436 LEU A CD1 1 
ATOM   2820 C  CD2 . LEU A 1 363 ? 159.220 194.243 10.257  1.00 132.89 ? 436 LEU A CD2 1 
ATOM   2821 N  N   . ASP A 1 364 ? 161.065 194.187 5.364   1.00 165.03 ? 437 ASP A N   1 
ATOM   2822 C  CA  . ASP A 1 364 ? 160.478 194.306 4.029   1.00 155.18 ? 437 ASP A CA  1 
ATOM   2823 C  C   . ASP A 1 364 ? 160.321 192.922 3.406   1.00 159.96 ? 437 ASP A C   1 
ATOM   2824 O  O   . ASP A 1 364 ? 159.294 192.607 2.782   1.00 171.45 ? 437 ASP A O   1 
ATOM   2825 C  CB  . ASP A 1 364 ? 161.338 195.197 3.134   1.00 156.30 ? 437 ASP A CB  1 
ATOM   2826 C  CG  . ASP A 1 364 ? 162.656 195.567 3.774   1.00 162.94 ? 437 ASP A CG  1 
ATOM   2827 O  OD1 . ASP A 1 364 ? 163.067 194.860 4.715   1.00 175.73 ? 437 ASP A OD1 1 
ATOM   2828 O  OD2 . ASP A 1 364 ? 163.280 196.558 3.341   1.00 150.23 ? 437 ASP A OD2 1 
ATOM   2829 N  N   . SER A 1 365 ? 161.329 192.065 3.615   1.00 146.73 ? 438 SER A N   1 
ATOM   2830 C  CA  . SER A 1 365 ? 161.299 190.698 3.113   1.00 143.42 ? 438 SER A CA  1 
ATOM   2831 C  C   . SER A 1 365 ? 160.244 189.868 3.823   1.00 137.78 ? 438 SER A C   1 
ATOM   2832 O  O   . SER A 1 365 ? 159.733 188.902 3.244   1.00 143.65 ? 438 SER A O   1 
ATOM   2833 C  CB  . SER A 1 365 ? 162.674 190.047 3.259   1.00 129.49 ? 438 SER A CB  1 
ATOM   2834 O  OG  . SER A 1 365 ? 163.623 190.656 2.403   1.00 122.64 ? 438 SER A OG  1 
ATOM   2835 N  N   . SER A 1 366 ? 159.885 190.220 5.058   1.00 147.66 ? 439 SER A N   1 
ATOM   2836 C  CA  . SER A 1 366 ? 158.838 189.427 5.688   1.00 158.20 ? 439 SER A CA  1 
ATOM   2837 C  C   . SER A 1 366 ? 157.474 189.956 5.275   1.00 181.17 ? 439 SER A C   1 
ATOM   2838 O  O   . SER A 1 366 ? 156.507 189.181 5.182   1.00 183.36 ? 439 SER A O   1 
ATOM   2839 C  CB  . SER A 1 366 ? 158.981 189.445 7.211   1.00 173.27 ? 439 SER A CB  1 
ATOM   2840 O  OG  . SER A 1 366 ? 158.038 188.579 7.820   1.00 179.29 ? 439 SER A OG  1 
ATOM   2841 N  N   . PHE A 1 367 ? 157.418 191.249 4.940   1.00 182.25 ? 440 PHE A N   1 
ATOM   2842 C  CA  . PHE A 1 367 ? 156.201 191.838 4.405   1.00 129.65 ? 440 PHE A CA  1 
ATOM   2843 C  C   . PHE A 1 367 ? 155.837 191.102 3.136   1.00 128.31 ? 440 PHE A C   1 
ATOM   2844 O  O   . PHE A 1 367 ? 154.728 190.580 2.992   1.00 163.30 ? 440 PHE A O   1 
ATOM   2845 C  CB  . PHE A 1 367 ? 156.401 193.323 4.091   1.00 132.58 ? 440 PHE A CB  1 
ATOM   2846 C  CG  . PHE A 1 367 ? 156.552 194.198 5.291   1.00 134.67 ? 440 PHE A CG  1 
ATOM   2847 C  CD1 . PHE A 1 367 ? 156.151 193.769 6.541   1.00 134.61 ? 440 PHE A CD1 1 
ATOM   2848 C  CD2 . PHE A 1 367 ? 157.097 195.465 5.162   1.00 136.85 ? 440 PHE A CD2 1 
ATOM   2849 C  CE1 . PHE A 1 367 ? 156.292 194.590 7.640   1.00 162.63 ? 440 PHE A CE1 1 
ATOM   2850 C  CE2 . PHE A 1 367 ? 157.242 196.286 6.257   1.00 138.93 ? 440 PHE A CE2 1 
ATOM   2851 C  CZ  . PHE A 1 367 ? 156.839 195.849 7.499   1.00 164.42 ? 440 PHE A CZ  1 
ATOM   2852 N  N   . ALA A 1 368 ? 156.781 191.059 2.194   1.00 141.52 ? 441 ALA A N   1 
ATOM   2853 C  CA  . ALA A 1 368 ? 156.522 190.386 0.930   1.00 141.78 ? 441 ALA A CA  1 
ATOM   2854 C  C   . ALA A 1 368 ? 156.327 188.894 1.153   1.00 132.43 ? 441 ALA A C   1 
ATOM   2855 O  O   . ALA A 1 368 ? 155.413 188.284 0.581   1.00 136.22 ? 441 ALA A O   1 
ATOM   2856 C  CB  . ALA A 1 368 ? 157.672 190.643 -0.032  1.00 139.91 ? 441 ALA A CB  1 
ATOM   2857 N  N   . GLY A 1 369 ? 157.218 188.283 1.938   1.00 120.56 ? 442 GLY A N   1 
ATOM   2858 C  CA  . GLY A 1 369 ? 157.166 186.870 2.264   1.00 128.57 ? 442 GLY A CA  1 
ATOM   2859 C  C   . GLY A 1 369 ? 155.764 186.419 2.603   1.00 119.01 ? 442 GLY A C   1 
ATOM   2860 O  O   . GLY A 1 369 ? 155.302 185.374 2.135   1.00 117.66 ? 442 GLY A O   1 
ATOM   2861 N  N   . LEU A 1 370 ? 155.051 187.181 3.413   1.00 121.55 ? 443 LEU A N   1 
ATOM   2862 C  CA  . LEU A 1 370 ? 153.670 186.897 3.777   1.00 132.91 ? 443 LEU A CA  1 
ATOM   2863 C  C   . LEU A 1 370 ? 152.725 187.351 2.672   1.00 130.00 ? 443 LEU A C   1 
ATOM   2864 O  O   . LEU A 1 370 ? 151.714 186.704 2.401   1.00 125.31 ? 443 LEU A O   1 
ATOM   2865 C  CB  . LEU A 1 370 ? 153.302 187.581 5.093   1.00 141.16 ? 443 LEU A CB  1 
ATOM   2866 C  CG  . LEU A 1 370 ? 153.952 187.029 6.360   1.00 150.52 ? 443 LEU A CG  1 
ATOM   2867 C  CD1 . LEU A 1 370 ? 153.496 187.821 7.574   1.00 156.64 ? 443 LEU A CD1 1 
ATOM   2868 C  CD2 . LEU A 1 370 ? 153.629 185.552 6.527   1.00 121.27 ? 443 LEU A CD2 1 
ATOM   2869 N  N   . GLU A 1 371 ? 153.061 188.456 2.066   1.00 141.17 ? 444 GLU A N   1 
ATOM   2870 C  CA  . GLU A 1 371 ? 152.193 189.109 1.091   1.00 148.04 ? 444 GLU A CA  1 
ATOM   2871 C  C   . GLU A 1 371 ? 151.851 188.184 -0.072  1.00 146.10 ? 444 GLU A C   1 
ATOM   2872 O  O   . GLU A 1 371 ? 150.713 188.165 -0.545  1.00 129.26 ? 444 GLU A O   1 
ATOM   2873 C  CB  . GLU A 1 371 ? 152.851 190.387 0.565   1.00 130.65 ? 444 GLU A CB  1 
ATOM   2874 C  CG  . GLU A 1 371 ? 151.932 191.266 -0.263  1.00 133.78 ? 444 GLU A CG  1 
ATOM   2875 C  CD  . GLU A 1 371 ? 150.821 191.887 0.563   1.00 156.25 ? 444 GLU A CD  1 
ATOM   2876 O  OE1 . GLU A 1 371 ? 149.743 191.266 0.673   1.00 140.52 ? 444 GLU A OE1 1 
ATOM   2877 O  OE2 . GLU A 1 371 ? 151.028 192.994 1.101   1.00 165.09 ? 444 GLU A OE2 1 
ATOM   2878 N  N   . GLY A 1 372 ? 152.839 187.421 -0.528  1.00 163.80 ? 445 GLY A N   1 
ATOM   2879 C  CA  . GLY A 1 372 ? 152.629 186.480 -1.613  1.00 167.60 ? 445 GLY A CA  1 
ATOM   2880 C  C   . GLY A 1 372 ? 151.627 185.393 -1.271  1.00 161.77 ? 445 GLY A C   1 
ATOM   2881 O  O   . GLY A 1 372 ? 150.737 185.077 -2.063  1.00 163.11 ? 445 GLY A O   1 
ATOM   2882 N  N   . VAL A 1 373 ? 151.772 184.826 -0.078  1.00 154.03 ? 446 VAL A N   1 
ATOM   2883 C  CA  . VAL A 1 373 ? 150.896 183.755 0.378   1.00 155.65 ? 446 VAL A CA  1 
ATOM   2884 C  C   . VAL A 1 373 ? 149.481 184.275 0.598   1.00 158.00 ? 446 VAL A C   1 
ATOM   2885 O  O   . VAL A 1 373 ? 148.506 183.645 0.181   1.00 179.31 ? 446 VAL A O   1 
ATOM   2886 C  CB  . VAL A 1 373 ? 151.442 183.108 1.661   1.00 119.16 ? 446 VAL A CB  1 
ATOM   2887 C  CG1 . VAL A 1 373 ? 150.530 181.980 2.117   1.00 118.75 ? 446 VAL A CG1 1 
ATOM   2888 C  CG2 . VAL A 1 373 ? 152.854 182.600 1.432   1.00 132.57 ? 446 VAL A CG2 1 
ATOM   2889 N  N   . ILE A 1 374 ? 149.375 185.428 1.253   1.00 156.21 ? 447 ILE A N   1 
ATOM   2890 C  CA  . ILE A 1 374 ? 148.081 186.047 1.519   1.00 154.54 ? 447 ILE A CA  1 
ATOM   2891 C  C   . ILE A 1 374 ? 147.361 186.347 0.209   1.00 164.25 ? 447 ILE A C   1 
ATOM   2892 O  O   . ILE A 1 374 ? 146.176 186.044 0.058   1.00 161.21 ? 447 ILE A O   1 
ATOM   2893 C  CB  . ILE A 1 374 ? 148.242 187.321 2.367   1.00 148.64 ? 447 ILE A CB  1 
ATOM   2894 C  CG1 . ILE A 1 374 ? 148.761 186.963 3.761   1.00 161.58 ? 447 ILE A CG1 1 
ATOM   2895 C  CG2 . ILE A 1 374 ? 146.923 188.073 2.461   1.00 147.74 ? 447 ILE A CG2 1 
ATOM   2896 C  CD1 . ILE A 1 374 ? 149.172 188.159 4.588   1.00 165.57 ? 447 ILE A CD1 1 
ATOM   2897 N  N   . THR A 1 375 ? 148.088 186.933 -0.737  1.00 149.64 ? 448 THR A N   1 
ATOM   2898 C  CA  . THR A 1 375 ? 147.545 187.221 -2.060  1.00 139.43 ? 448 THR A CA  1 
ATOM   2899 C  C   . THR A 1 375 ? 147.078 185.936 -2.742  1.00 130.74 ? 448 THR A C   1 
ATOM   2900 O  O   . THR A 1 375 ? 146.014 185.902 -3.362  1.00 132.46 ? 448 THR A O   1 
ATOM   2901 C  CB  . THR A 1 375 ? 148.584 187.929 -2.953  1.00 146.79 ? 448 THR A CB  1 
ATOM   2902 O  OG1 . THR A 1 375 ? 148.938 189.190 -2.371  1.00 141.32 ? 448 THR A OG1 1 
ATOM   2903 C  CG2 . THR A 1 375 ? 148.029 188.159 -4.349  1.00 151.71 ? 448 THR A CG2 1 
ATOM   2904 N  N   . ALA A 1 376 ? 147.879 184.897 -2.715  1.00 127.51 ? 449 ALA A N   1 
ATOM   2905 C  CA  . ALA A 1 376 ? 147.432 183.713 -3.404  1.00 126.15 ? 449 ALA A CA  1 
ATOM   2906 C  C   . ALA A 1 376 ? 146.190 183.133 -2.770  1.00 149.40 ? 449 ALA A C   1 
ATOM   2907 O  O   . ALA A 1 376 ? 145.256 182.774 -3.454  1.00 164.77 ? 449 ALA A O   1 
ATOM   2908 C  CB  . ALA A 1 376 ? 148.534 182.679 -3.446  1.00 135.13 ? 449 ALA A CB  1 
ATOM   2909 N  N   . VAL A 1 377 ? 146.170 183.046 -1.455  1.00 140.59 ? 450 VAL A N   1 
ATOM   2910 C  CA  . VAL A 1 377 ? 145.091 182.340 -0.784  1.00 145.22 ? 450 VAL A CA  1 
ATOM   2911 C  C   . VAL A 1 377 ? 143.749 183.026 -1.002  1.00 131.56 ? 450 VAL A C   1 
ATOM   2912 O  O   . VAL A 1 377 ? 142.724 182.393 -1.225  1.00 132.36 ? 450 VAL A O   1 
ATOM   2913 C  CB  . VAL A 1 377 ? 145.394 182.167 0.709   1.00 145.71 ? 450 VAL A CB  1 
ATOM   2914 C  CG1 . VAL A 1 377 ? 144.189 181.608 1.436   1.00 157.71 ? 450 VAL A CG1 1 
ATOM   2915 C  CG2 . VAL A 1 377 ? 146.615 181.292 0.906   1.00 123.84 ? 450 VAL A CG2 1 
ATOM   2916 N  N   . LEU A 1 378 ? 143.790 184.341 -0.936  1.00 142.06 ? 451 LEU A N   1 
ATOM   2917 C  CA  . LEU A 1 378 ? 142.652 185.216 -1.197  1.00 161.67 ? 451 LEU A CA  1 
ATOM   2918 C  C   . LEU A 1 378 ? 142.192 185.117 -2.650  1.00 174.17 ? 451 LEU A C   1 
ATOM   2919 O  O   . LEU A 1 378 ? 140.999 185.230 -2.941  1.00 182.97 ? 451 LEU A O   1 
ATOM   2920 C  CB  . LEU A 1 378 ? 142.993 186.667 -0.851  1.00 162.39 ? 451 LEU A CB  1 
ATOM   2921 C  CG  . LEU A 1 378 ? 143.096 186.997 0.640   1.00 156.82 ? 451 LEU A CG  1 
ATOM   2922 C  CD1 . LEU A 1 378 ? 143.349 188.483 0.847   1.00 143.06 ? 451 LEU A CD1 1 
ATOM   2923 C  CD2 . LEU A 1 378 ? 141.841 186.553 1.378   1.00 142.26 ? 451 LEU A CD2 1 
ATOM   2924 N  N   . ASP A 1 379 ? 143.138 184.898 -3.559  1.00 165.68 ? 452 ASP A N   1 
ATOM   2925 C  CA  . ASP A 1 379 ? 142.815 184.754 -4.974  1.00 162.69 ? 452 ASP A CA  1 
ATOM   2926 C  C   . ASP A 1 379 ? 142.302 183.351 -5.291  1.00 152.64 ? 452 ASP A C   1 
ATOM   2927 O  O   . ASP A 1 379 ? 141.724 183.118 -6.353  1.00 143.87 ? 452 ASP A O   1 
ATOM   2928 C  CB  . ASP A 1 379 ? 144.034 185.070 -5.843  1.00 166.02 ? 452 ASP A CB  1 
ATOM   2929 C  CG  . ASP A 1 379 ? 144.344 186.554 -5.895  1.00 163.40 ? 452 ASP A CG  1 
ATOM   2930 O  OD1 . ASP A 1 379 ? 144.034 187.261 -4.913  1.00 162.30 ? 452 ASP A OD1 1 
ATOM   2931 O  OD2 . ASP A 1 379 ? 144.896 187.012 -6.919  1.00 156.58 ? 452 ASP A OD2 1 
ATOM   2932 N  N   . GLU A 1 380 ? 142.673 182.378 -4.479  1.00 156.89 ? 453 GLU A N   1 
ATOM   2933 C  CA  . GLU A 1 380 ? 142.212 181.009 -4.666  1.00 157.09 ? 453 GLU A CA  1 
ATOM   2934 C  C   . GLU A 1 380 ? 140.846 180.764 -4.044  1.00 164.77 ? 453 GLU A C   1 
ATOM   2935 O  O   . GLU A 1 380 ? 140.048 180.000 -4.598  1.00 171.01 ? 453 GLU A O   1 
ATOM   2936 C  CB  . GLU A 1 380 ? 143.225 180.026 -4.074  1.00 158.36 ? 453 GLU A CB  1 
ATOM   2937 C  CG  . GLU A 1 380 ? 142.816 178.568 -4.171  1.00 158.19 ? 453 GLU A CG  1 
ATOM   2938 C  CD  . GLU A 1 380 ? 142.454 178.158 -5.583  1.00 170.25 ? 453 GLU A CD  1 
ATOM   2939 O  OE1 . GLU A 1 380 ? 141.517 177.349 -5.750  1.00 189.14 ? 453 GLU A OE1 1 
ATOM   2940 O  OE2 . GLU A 1 380 ? 143.108 178.646 -6.529  1.00 149.99 ? 453 GLU A OE2 1 
ATOM   2941 N  N   . PHE A 1 381 ? 140.669 181.462 -2.925  1.00 183.86 ? 454 PHE A N   1 
ATOM   2942 C  CA  . PHE A 1 381 ? 139.366 181.343 -2.276  1.00 198.58 ? 454 PHE A CA  1 
ATOM   2943 C  C   . PHE A 1 381 ? 138.704 182.717 -2.232  1.00 217.87 ? 454 PHE A C   1 
ATOM   2944 O  O   . PHE A 1 381 ? 138.517 183.295 -1.153  1.00 229.55 ? 454 PHE A O   1 
ATOM   2945 C  CB  . PHE A 1 381 ? 139.505 180.762 -0.869  1.00 193.47 ? 454 PHE A CB  1 
ATOM   2946 C  CG  . PHE A 1 381 ? 139.752 179.276 -0.838  1.00 195.41 ? 454 PHE A CG  1 
ATOM   2947 C  CD1 . PHE A 1 381 ? 140.917 178.739 -1.357  1.00 193.43 ? 454 PHE A CD1 1 
ATOM   2948 C  CD2 . PHE A 1 381 ? 138.822 178.418 -0.269  1.00 201.53 ? 454 PHE A CD2 1 
ATOM   2949 C  CE1 . PHE A 1 381 ? 141.147 177.374 -1.325  1.00 190.48 ? 454 PHE A CE1 1 
ATOM   2950 C  CE2 . PHE A 1 381 ? 139.047 177.053 -0.231  1.00 200.75 ? 454 PHE A CE2 1 
ATOM   2951 C  CZ  . PHE A 1 381 ? 140.212 176.531 -0.759  1.00 196.16 ? 454 PHE A CZ  1 
ATOM   2952 N  N   . PRO A 1 382 ? 138.335 183.273 -3.373  1.00 216.34 ? 455 PRO A N   1 
ATOM   2953 C  CA  . PRO A 1 382 ? 137.884 184.659 -3.361  1.00 210.01 ? 455 PRO A CA  1 
ATOM   2954 C  C   . PRO A 1 382 ? 136.494 184.760 -2.810  1.00 205.18 ? 455 PRO A C   1 
ATOM   2955 O  O   . PRO A 1 382 ? 135.579 184.129 -3.317  1.00 192.12 ? 455 PRO A O   1 
ATOM   2956 C  CB  . PRO A 1 382 ? 137.793 184.970 -4.838  1.00 208.21 ? 455 PRO A CB  1 
ATOM   2957 C  CG  . PRO A 1 382 ? 137.252 183.694 -5.398  1.00 211.40 ? 455 PRO A CG  1 
ATOM   2958 C  CD  . PRO A 1 382 ? 137.810 182.569 -4.552  1.00 215.27 ? 455 PRO A CD  1 
ATOM   2959 N  N   . HIS A 1 383 ? 136.353 185.522 -1.744  1.00 230.62 ? 456 HIS A N   1 
ATOM   2960 C  CA  . HIS A 1 383 ? 135.079 186.064 -1.317  1.00 246.98 ? 456 HIS A CA  1 
ATOM   2961 C  C   . HIS A 1 383 ? 134.170 184.984 -0.768  1.00 244.29 ? 456 HIS A C   1 
ATOM   2962 O  O   . HIS A 1 383 ? 133.006 185.214 -0.462  1.00 241.52 ? 456 HIS A O   1 
ATOM   2963 C  CB  . HIS A 1 383 ? 134.418 186.856 -2.436  1.00 250.88 ? 456 HIS A CB  1 
ATOM   2964 C  CG  . HIS A 1 383 ? 134.717 188.321 -2.383  1.00 242.94 ? 456 HIS A CG  1 
ATOM   2965 N  ND1 . HIS A 1 383 ? 135.350 188.989 -3.408  1.00 236.01 ? 456 HIS A ND1 1 
ATOM   2966 C  CD2 . HIS A 1 383 ? 134.477 189.244 -1.423  1.00 238.12 ? 456 HIS A CD2 1 
ATOM   2967 C  CE1 . HIS A 1 383 ? 135.482 190.262 -3.084  1.00 234.58 ? 456 HIS A CE1 1 
ATOM   2968 N  NE2 . HIS A 1 383 ? 134.961 190.444 -1.885  1.00 233.66 ? 456 HIS A NE2 1 
ATOM   2969 N  N   . VAL A 1 384 ? 134.710 183.781 -0.725  1.00 249.40 ? 457 VAL A N   1 
ATOM   2970 C  CA  . VAL A 1 384 ? 134.823 182.928 0.406   1.00 241.44 ? 457 VAL A CA  1 
ATOM   2971 C  C   . VAL A 1 384 ? 135.770 183.654 1.350   1.00 225.61 ? 457 VAL A C   1 
ATOM   2972 O  O   . VAL A 1 384 ? 135.601 183.632 2.557   1.00 223.53 ? 457 VAL A O   1 
ATOM   2973 C  CB  . VAL A 1 384 ? 135.412 181.581 0.014   1.00 227.08 ? 457 VAL A CB  1 
ATOM   2974 C  CG1 . VAL A 1 384 ? 136.798 181.784 -0.568  1.00 229.56 ? 457 VAL A CG1 1 
ATOM   2975 C  CG2 . VAL A 1 384 ? 135.433 180.654 1.215   1.00 214.70 ? 457 VAL A CG2 1 
ATOM   2976 N  N   . TRP A 1 385 ? 136.773 184.300 0.765   1.00 218.85 ? 458 TRP A N   1 
ATOM   2977 C  CA  . TRP A 1 385 ? 137.788 185.027 1.506   1.00 221.95 ? 458 TRP A CA  1 
ATOM   2978 C  C   . TRP A 1 385 ? 137.838 186.462 1.039   1.00 235.80 ? 458 TRP A C   1 
ATOM   2979 O  O   . TRP A 1 385 ? 137.340 186.798 -0.028  1.00 240.05 ? 458 TRP A O   1 
ATOM   2980 C  CB  . TRP A 1 385 ? 139.164 184.385 1.338   1.00 207.75 ? 458 TRP A CB  1 
ATOM   2981 C  CG  . TRP A 1 385 ? 139.501 183.501 2.463   1.00 193.68 ? 458 TRP A CG  1 
ATOM   2982 C  CD1 . TRP A 1 385 ? 139.657 182.155 2.426   1.00 187.79 ? 458 TRP A CD1 1 
ATOM   2983 C  CD2 . TRP A 1 385 ? 139.688 183.889 3.814   1.00 189.36 ? 458 TRP A CD2 1 
ATOM   2984 N  NE1 . TRP A 1 385 ? 139.936 181.679 3.672   1.00 176.37 ? 458 TRP A NE1 1 
ATOM   2985 C  CE2 . TRP A 1 385 ? 139.961 182.730 4.546   1.00 186.70 ? 458 TRP A CE2 1 
ATOM   2986 C  CE3 . TRP A 1 385 ? 139.653 185.109 4.476   1.00 187.06 ? 458 TRP A CE3 1 
ATOM   2987 C  CZ2 . TRP A 1 385 ? 140.199 182.752 5.906   1.00 186.13 ? 458 TRP A CZ2 1 
ATOM   2988 C  CZ3 . TRP A 1 385 ? 139.892 185.130 5.823   1.00 186.83 ? 458 TRP A CZ3 1 
ATOM   2989 C  CH2 . TRP A 1 385 ? 140.161 183.962 6.527   1.00 185.57 ? 458 TRP A CH2 1 
ATOM   2990 N  N   . ALA A 1 386 ? 138.525 187.310 1.780   1.00 252.43 ? 459 ALA A N   1 
ATOM   2991 C  CA  . ALA A 1 386 ? 138.588 188.699 1.373   1.00 266.20 ? 459 ALA A CA  1 
ATOM   2992 C  C   . ALA A 1 386 ? 137.404 189.450 1.929   1.00 270.60 ? 459 ALA A C   1 
ATOM   2993 O  O   . ALA A 1 386 ? 137.196 190.617 1.613   1.00 272.09 ? 459 ALA A O   1 
ATOM   2994 C  CB  . ALA A 1 386 ? 138.597 188.795 -0.144  1.00 263.80 ? 459 ALA A CB  1 
ATOM   2995 N  N   . LYS A 1 387 ? 136.628 188.786 2.775   1.00 276.71 ? 460 LYS A N   1 
ATOM   2996 C  CA  . LYS A 1 387 ? 135.507 189.443 3.411   1.00 268.67 ? 460 LYS A CA  1 
ATOM   2997 C  C   . LYS A 1 387 ? 136.109 190.572 4.211   1.00 266.07 ? 460 LYS A C   1 
ATOM   2998 O  O   . LYS A 1 387 ? 135.594 191.683 4.237   1.00 261.76 ? 460 LYS A O   1 
ATOM   2999 C  CB  . LYS A 1 387 ? 134.804 188.473 4.345   1.00 259.96 ? 460 LYS A CB  1 
ATOM   3000 C  CG  . LYS A 1 387 ? 135.691 187.986 5.471   1.00 238.86 ? 460 LYS A CG  1 
ATOM   3001 C  CD  . LYS A 1 387 ? 134.934 187.024 6.362   1.00 233.44 ? 460 LYS A CD  1 
ATOM   3002 C  CE  . LYS A 1 387 ? 134.623 185.727 5.636   1.00 231.94 ? 460 LYS A CE  1 
ATOM   3003 N  NZ  . LYS A 1 387 ? 133.877 184.762 6.488   1.00 241.59 ? 460 LYS A NZ  1 
ATOM   3004 N  N   . ARG A 1 388 ? 137.210 190.347 4.969   1.00 261.64 ? 461 ARG A N   1 
ATOM   3005 C  CA  . ARG A 1 388 ? 138.069 191.331 5.611   1.00 263.75 ? 461 ARG A CA  1 
ATOM   3006 C  C   . ARG A 1 388 ? 139.494 190.800 5.481   1.00 251.89 ? 461 ARG A C   1 
ATOM   3007 O  O   . ARG A 1 388 ? 139.717 189.593 5.582   1.00 245.00 ? 461 ARG A O   1 
ATOM   3008 C  CB  . ARG A 1 388 ? 137.697 191.540 7.083   1.00 264.68 ? 461 ARG A CB  1 
ATOM   3009 C  CG  . ARG A 1 388 ? 136.281 192.043 7.326   1.00 268.93 ? 461 ARG A CG  1 
ATOM   3010 C  CD  . ARG A 1 388 ? 136.077 193.443 6.770   1.00 271.39 ? 461 ARG A CD  1 
ATOM   3011 N  NE  . ARG A 1 388 ? 134.701 193.897 6.945   1.00 277.31 ? 461 ARG A NE  1 
ATOM   3012 C  CZ  . ARG A 1 388 ? 134.196 194.990 6.384   1.00 285.63 ? 461 ARG A CZ  1 
ATOM   3013 N  NH1 . ARG A 1 388 ? 134.952 195.747 5.601   1.00 287.49 ? 461 ARG A NH1 1 
ATOM   3014 N  NH2 . ARG A 1 388 ? 132.931 195.324 6.600   1.00 292.19 ? 461 ARG A NH2 1 
ATOM   3015 N  N   . ARG A 1 389 ? 140.431 191.713 5.153   1.00 239.71 ? 462 ARG A N   1 
ATOM   3016 C  CA  . ARG A 1 389 ? 141.808 191.278 4.952   1.00 220.81 ? 462 ARG A CA  1 
ATOM   3017 C  C   . ARG A 1 389 ? 142.559 191.149 6.278   1.00 217.23 ? 462 ARG A C   1 
ATOM   3018 O  O   . ARG A 1 389 ? 143.344 190.214 6.466   1.00 209.71 ? 462 ARG A O   1 
ATOM   3019 C  CB  . ARG A 1 389 ? 142.543 192.239 4.019   1.00 194.51 ? 462 ARG A CB  1 
ATOM   3020 C  CG  . ARG A 1 389 ? 143.990 191.855 3.779   1.00 155.52 ? 462 ARG A CG  1 
ATOM   3021 C  CD  . ARG A 1 389 ? 144.508 192.410 2.469   1.00 158.61 ? 462 ARG A CD  1 
ATOM   3022 N  NE  . ARG A 1 389 ? 145.841 191.905 2.164   1.00 170.11 ? 462 ARG A NE  1 
ATOM   3023 C  CZ  . ARG A 1 389 ? 146.412 191.986 0.968   1.00 184.12 ? 462 ARG A CZ  1 
ATOM   3024 N  NH1 . ARG A 1 389 ? 145.764 192.552 -0.040  1.00 146.92 ? 462 ARG A NH1 1 
ATOM   3025 N  NH2 . ARG A 1 389 ? 147.630 191.501 0.780   1.00 177.57 ? 462 ARG A NH2 1 
ATOM   3026 N  N   . GLU A 1 390 ? 142.292 192.113 7.159   1.00 245.88 ? 463 GLU A N   1 
ATOM   3027 C  CA  . GLU A 1 390 ? 142.944 192.114 8.463   1.00 261.90 ? 463 GLU A CA  1 
ATOM   3028 C  C   . GLU A 1 390 ? 142.709 190.800 9.194   1.00 277.38 ? 463 GLU A C   1 
ATOM   3029 O  O   . GLU A 1 390 ? 143.579 190.341 9.942   1.00 291.03 ? 463 GLU A O   1 
ATOM   3030 C  CB  . GLU A 1 390 ? 142.444 193.291 9.300   1.00 271.20 ? 463 GLU A CB  1 
ATOM   3031 N  N   . ARG A 1 391 ? 141.537 190.190 8.998   1.00 228.79 ? 464 ARG A N   1 
ATOM   3032 C  CA  . ARG A 1 391 ? 141.237 188.919 9.648   1.00 201.05 ? 464 ARG A CA  1 
ATOM   3033 C  C   . ARG A 1 391 ? 142.182 187.822 9.172   1.00 213.59 ? 464 ARG A C   1 
ATOM   3034 O  O   . ARG A 1 391 ? 142.781 187.108 9.985   1.00 233.68 ? 464 ARG A O   1 
ATOM   3035 C  CB  . ARG A 1 391 ? 139.783 188.529 9.384   1.00 173.32 ? 464 ARG A CB  1 
ATOM   3036 N  N   . PHE A 1 392 ? 142.329 187.670 7.854   1.00 198.07 ? 465 PHE A N   1 
ATOM   3037 C  CA  . PHE A 1 392 ? 143.209 186.630 7.329   1.00 181.99 ? 465 PHE A CA  1 
ATOM   3038 C  C   . PHE A 1 392 ? 144.668 186.911 7.670   1.00 184.37 ? 465 PHE A C   1 
ATOM   3039 O  O   . PHE A 1 392 ? 145.401 186.006 8.088   1.00 176.79 ? 465 PHE A O   1 
ATOM   3040 C  CB  . PHE A 1 392 ? 143.023 186.477 5.821   1.00 170.15 ? 465 PHE A CB  1 
ATOM   3041 C  CG  . PHE A 1 392 ? 143.922 185.442 5.214   1.00 160.20 ? 465 PHE A CG  1 
ATOM   3042 C  CD1 . PHE A 1 392 ? 143.615 184.096 5.319   1.00 135.16 ? 465 PHE A CD1 1 
ATOM   3043 C  CD2 . PHE A 1 392 ? 145.068 185.812 4.529   1.00 143.85 ? 465 PHE A CD2 1 
ATOM   3044 C  CE1 . PHE A 1 392 ? 144.439 183.138 4.768   1.00 131.72 ? 465 PHE A CE1 1 
ATOM   3045 C  CE2 . PHE A 1 392 ? 145.893 184.857 3.971   1.00 152.84 ? 465 PHE A CE2 1 
ATOM   3046 C  CZ  . PHE A 1 392 ? 145.579 183.519 4.091   1.00 130.10 ? 465 PHE A CZ  1 
ATOM   3047 N  N   . VAL A 1 393 ? 145.112 188.158 7.486   1.00 204.03 ? 466 VAL A N   1 
ATOM   3048 C  CA  . VAL A 1 393 ? 146.499 188.502 7.796   1.00 192.67 ? 466 VAL A CA  1 
ATOM   3049 C  C   . VAL A 1 393 ? 146.798 188.230 9.266   1.00 215.29 ? 466 VAL A C   1 
ATOM   3050 O  O   . VAL A 1 393 ? 147.863 187.702 9.612   1.00 228.17 ? 466 VAL A O   1 
ATOM   3051 C  CB  . VAL A 1 393 ? 146.782 189.968 7.418   1.00 189.14 ? 466 VAL A CB  1 
ATOM   3052 C  CG1 . VAL A 1 393 ? 148.188 190.365 7.832   1.00 172.41 ? 466 VAL A CG1 1 
ATOM   3053 C  CG2 . VAL A 1 393 ? 146.591 190.170 5.924   1.00 204.41 ? 466 VAL A CG2 1 
ATOM   3054 N  N   . LEU A 1 394 ? 145.862 188.579 10.152  1.00 198.23 ? 467 LEU A N   1 
ATOM   3055 C  CA  . LEU A 1 394 ? 146.030 188.278 11.572  1.00 191.01 ? 467 LEU A CA  1 
ATOM   3056 C  C   . LEU A 1 394 ? 146.098 186.773 11.807  1.00 186.65 ? 467 LEU A C   1 
ATOM   3057 O  O   . LEU A 1 394 ? 146.944 186.290 12.571  1.00 193.92 ? 467 LEU A O   1 
ATOM   3058 C  CB  . LEU A 1 394 ? 144.894 188.913 12.375  1.00 173.42 ? 467 LEU A CB  1 
ATOM   3059 C  CG  . LEU A 1 394 ? 144.915 188.769 13.898  1.00 168.01 ? 467 LEU A CG  1 
ATOM   3060 C  CD1 . LEU A 1 394 ? 144.415 190.042 14.553  1.00 178.53 ? 467 LEU A CD1 1 
ATOM   3061 C  CD2 . LEU A 1 394 ? 144.053 187.593 14.327  1.00 166.87 ? 467 LEU A CD2 1 
ATOM   3062 N  N   . ALA A 1 395 ? 145.208 186.017 11.156  1.00 182.85 ? 468 ALA A N   1 
ATOM   3063 C  CA  . ALA A 1 395 ? 145.186 184.566 11.312  1.00 168.76 ? 468 ALA A CA  1 
ATOM   3064 C  C   . ALA A 1 395 ? 146.484 183.934 10.831  1.00 160.90 ? 468 ALA A C   1 
ATOM   3065 O  O   . ALA A 1 395 ? 146.844 182.839 11.278  1.00 160.72 ? 468 ALA A O   1 
ATOM   3066 C  CB  . ALA A 1 395 ? 143.993 183.972 10.562  1.00 177.39 ? 468 ALA A CB  1 
ATOM   3067 N  N   . VAL A 1 396 ? 147.188 184.597 9.914   1.00 169.08 ? 469 VAL A N   1 
ATOM   3068 C  CA  . VAL A 1 396 ? 148.477 184.093 9.452   1.00 163.92 ? 469 VAL A CA  1 
ATOM   3069 C  C   . VAL A 1 396 ? 149.577 184.469 10.438  1.00 160.80 ? 469 VAL A C   1 
ATOM   3070 O  O   . VAL A 1 396 ? 150.394 183.628 10.833  1.00 162.17 ? 469 VAL A O   1 
ATOM   3071 C  CB  . VAL A 1 396 ? 148.778 184.617 8.035   1.00 157.82 ? 469 VAL A CB  1 
ATOM   3072 C  CG1 . VAL A 1 396 ? 150.208 184.290 7.636   1.00 156.13 ? 469 VAL A CG1 1 
ATOM   3073 C  CG2 . VAL A 1 396 ? 147.798 184.023 7.032   1.00 153.21 ? 469 VAL A CG2 1 
ATOM   3074 N  N   . VAL A 1 397 ? 149.609 185.740 10.850  1.00 129.65 ? 470 VAL A N   1 
ATOM   3075 C  CA  . VAL A 1 397 ? 150.654 186.224 11.751  1.00 129.26 ? 470 VAL A CA  1 
ATOM   3076 C  C   . VAL A 1 397 ? 150.650 185.437 13.061  1.00 143.29 ? 470 VAL A C   1 
ATOM   3077 O  O   . VAL A 1 397 ? 151.707 185.029 13.561  1.00 137.79 ? 470 VAL A O   1 
ATOM   3078 C  CB  . VAL A 1 397 ? 150.491 187.737 11.989  1.00 132.63 ? 470 VAL A CB  1 
ATOM   3079 C  CG1 . VAL A 1 397 ? 151.335 188.190 13.167  1.00 171.27 ? 470 VAL A CG1 1 
ATOM   3080 C  CG2 . VAL A 1 397 ? 150.875 188.511 10.733  1.00 132.94 ? 470 VAL A CG2 1 
ATOM   3081 N  N   . ILE A 1 398 ? 149.465 185.215 13.640  1.00 133.69 ? 471 ILE A N   1 
ATOM   3082 C  CA  . ILE A 1 398 ? 149.383 184.465 14.895  1.00 132.71 ? 471 ILE A CA  1 
ATOM   3083 C  C   . ILE A 1 398 ? 149.894 183.040 14.704  1.00 129.13 ? 471 ILE A C   1 
ATOM   3084 O  O   . ILE A 1 398 ? 150.637 182.509 15.543  1.00 131.46 ? 471 ILE A O   1 
ATOM   3085 C  CB  . ILE A 1 398 ? 147.945 184.487 15.445  1.00 144.87 ? 471 ILE A CB  1 
ATOM   3086 C  CG1 . ILE A 1 398 ? 147.583 185.895 15.921  1.00 159.01 ? 471 ILE A CG1 1 
ATOM   3087 C  CG2 . ILE A 1 398 ? 147.785 183.482 16.578  1.00 137.55 ? 471 ILE A CG2 1 
ATOM   3088 C  CD1 . ILE A 1 398 ? 146.283 185.969 16.693  1.00 167.80 ? 471 ILE A CD1 1 
ATOM   3089 N  N   . THR A 1 399 ? 149.503 182.398 13.598  1.00 125.17 ? 472 THR A N   1 
ATOM   3090 C  CA  . THR A 1 399 ? 149.972 181.045 13.316  1.00 121.95 ? 472 THR A CA  1 
ATOM   3091 C  C   . THR A 1 399 ? 151.491 181.009 13.215  1.00 145.76 ? 472 THR A C   1 
ATOM   3092 O  O   . THR A 1 399 ? 152.133 180.076 13.712  1.00 145.25 ? 472 THR A O   1 
ATOM   3093 C  CB  . THR A 1 399 ? 149.338 180.521 12.028  1.00 136.17 ? 472 THR A CB  1 
ATOM   3094 O  OG1 . THR A 1 399 ? 147.911 180.622 12.119  1.00 158.61 ? 472 THR A OG1 1 
ATOM   3095 C  CG2 . THR A 1 399 ? 149.723 179.066 11.799  1.00 118.46 ? 472 THR A CG2 1 
ATOM   3096 N  N   . CYS A 1 400 ? 152.082 182.016 12.568  1.00 142.12 ? 473 CYS A N   1 
ATOM   3097 C  CA  . CYS A 1 400 ? 153.536 182.086 12.490  1.00 128.25 ? 473 CYS A CA  1 
ATOM   3098 C  C   . CYS A 1 400 ? 154.151 182.298 13.868  1.00 137.96 ? 473 CYS A C   1 
ATOM   3099 O  O   . CYS A 1 400 ? 155.252 181.802 14.133  1.00 149.42 ? 473 CYS A O   1 
ATOM   3100 C  CB  . CYS A 1 400 ? 153.962 183.203 11.539  1.00 130.53 ? 473 CYS A CB  1 
ATOM   3101 S  SG  . CYS A 1 400 ? 153.570 182.892 9.803   1.00 138.27 ? 473 CYS A SG  1 
ATOM   3102 N  N   . PHE A 1 401 ? 153.472 183.042 14.748  1.00 143.02 ? 474 PHE A N   1 
ATOM   3103 C  CA  . PHE A 1 401 ? 153.994 183.237 16.098  1.00 135.96 ? 474 PHE A CA  1 
ATOM   3104 C  C   . PHE A 1 401 ? 154.043 181.912 16.845  1.00 140.54 ? 474 PHE A C   1 
ATOM   3105 O  O   . PHE A 1 401 ? 155.060 181.566 17.458  1.00 157.02 ? 474 PHE A O   1 
ATOM   3106 C  CB  . PHE A 1 401 ? 153.156 184.256 16.868  1.00 132.47 ? 474 PHE A CB  1 
ATOM   3107 C  CG  . PHE A 1 401 ? 153.512 184.341 18.326  1.00 128.56 ? 474 PHE A CG  1 
ATOM   3108 C  CD1 . PHE A 1 401 ? 154.676 184.975 18.728  1.00 132.78 ? 474 PHE A CD1 1 
ATOM   3109 C  CD2 . PHE A 1 401 ? 152.695 183.779 19.292  1.00 129.52 ? 474 PHE A CD2 1 
ATOM   3110 C  CE1 . PHE A 1 401 ? 155.018 185.050 20.067  1.00 128.76 ? 474 PHE A CE1 1 
ATOM   3111 C  CE2 . PHE A 1 401 ? 153.032 183.852 20.633  1.00 130.09 ? 474 PHE A CE2 1 
ATOM   3112 C  CZ  . PHE A 1 401 ? 154.194 184.490 21.020  1.00 129.70 ? 474 PHE A CZ  1 
ATOM   3113 N  N   . PHE A 1 402 ? 152.942 181.153 16.810  1.00 140.85 ? 475 PHE A N   1 
ATOM   3114 C  CA  . PHE A 1 402 ? 152.946 179.842 17.453  1.00 135.94 ? 475 PHE A CA  1 
ATOM   3115 C  C   . PHE A 1 402 ? 153.912 178.895 16.753  1.00 130.19 ? 475 PHE A C   1 
ATOM   3116 O  O   . PHE A 1 402 ? 154.438 177.968 17.380  1.00 125.55 ? 475 PHE A O   1 
ATOM   3117 C  CB  . PHE A 1 402 ? 151.537 179.254 17.487  1.00 150.32 ? 475 PHE A CB  1 
ATOM   3118 C  CG  . PHE A 1 402 ? 150.661 179.844 18.554  1.00 167.85 ? 475 PHE A CG  1 
ATOM   3119 C  CD1 . PHE A 1 402 ? 150.923 179.598 19.893  1.00 161.15 ? 475 PHE A CD1 1 
ATOM   3120 C  CD2 . PHE A 1 402 ? 149.578 180.642 18.224  1.00 183.83 ? 475 PHE A CD2 1 
ATOM   3121 C  CE1 . PHE A 1 402 ? 150.122 180.136 20.882  1.00 184.90 ? 475 PHE A CE1 1 
ATOM   3122 C  CE2 . PHE A 1 402 ? 148.772 181.184 19.209  1.00 194.63 ? 475 PHE A CE2 1 
ATOM   3123 C  CZ  . PHE A 1 402 ? 149.045 180.931 20.540  1.00 195.98 ? 475 PHE A CZ  1 
ATOM   3124 N  N   . GLY A 1 403 ? 154.172 179.126 15.467  1.00 140.76 ? 476 GLY A N   1 
ATOM   3125 C  CA  . GLY A 1 403 ? 155.120 178.325 14.720  1.00 134.31 ? 476 GLY A CA  1 
ATOM   3126 C  C   . GLY A 1 403 ? 156.562 178.680 14.989  1.00 120.25 ? 476 GLY A C   1 
ATOM   3127 O  O   . GLY A 1 403 ? 157.461 177.928 14.603  1.00 122.51 ? 476 GLY A O   1 
ATOM   3128 N  N   . SER A 1 404 ? 156.794 179.808 15.656  1.00 110.81 ? 477 SER A N   1 
ATOM   3129 C  CA  . SER A 1 404 ? 158.128 180.288 15.980  1.00 109.93 ? 477 SER A CA  1 
ATOM   3130 C  C   . SER A 1 404 ? 158.507 179.981 17.419  1.00 130.48 ? 477 SER A C   1 
ATOM   3131 O  O   . SER A 1 404 ? 159.626 180.301 17.833  1.00 122.65 ? 477 SER A O   1 
ATOM   3132 C  CB  . SER A 1 404 ? 158.237 181.796 15.728  1.00 129.96 ? 477 SER A CB  1 
ATOM   3133 O  OG  . SER A 1 404 ? 157.998 182.110 14.368  1.00 138.19 ? 477 SER A OG  1 
ATOM   3134 N  N   . LEU A 1 405 ? 157.600 179.378 18.192  1.00 118.26 ? 478 LEU A N   1 
ATOM   3135 C  CA  . LEU A 1 405 ? 157.910 179.080 19.584  1.00 124.94 ? 478 LEU A CA  1 
ATOM   3136 C  C   . LEU A 1 405 ? 158.994 178.018 19.676  1.00 134.94 ? 478 LEU A C   1 
ATOM   3137 O  O   . LEU A 1 405 ? 159.723 177.961 20.673  1.00 132.24 ? 478 LEU A O   1 
ATOM   3138 C  CB  . LEU A 1 405 ? 156.654 178.633 20.331  1.00 123.33 ? 478 LEU A CB  1 
ATOM   3139 C  CG  . LEU A 1 405 ? 155.565 179.690 20.521  1.00 147.20 ? 478 LEU A CG  1 
ATOM   3140 C  CD1 . LEU A 1 405 ? 154.403 179.101 21.299  1.00 162.98 ? 478 LEU A CD1 1 
ATOM   3141 C  CD2 . LEU A 1 405 ? 156.115 180.928 21.220  1.00 155.80 ? 478 LEU A CD2 1 
ATOM   3142 N  N   . VAL A 1 406 ? 159.108 177.166 18.652  1.00 148.47 ? 479 VAL A N   1 
ATOM   3143 C  CA  . VAL A 1 406 ? 160.168 176.165 18.638  1.00 141.41 ? 479 VAL A CA  1 
ATOM   3144 C  C   . VAL A 1 406 ? 161.510 176.857 18.469  1.00 129.31 ? 479 VAL A C   1 
ATOM   3145 O  O   . VAL A 1 406 ? 162.540 176.374 18.957  1.00 113.20 ? 479 VAL A O   1 
ATOM   3146 C  CB  . VAL A 1 406 ? 159.919 175.134 17.522  1.00 135.84 ? 479 VAL A CB  1 
ATOM   3147 C  CG1 . VAL A 1 406 ? 160.927 173.999 17.597  1.00 129.90 ? 479 VAL A CG1 1 
ATOM   3148 C  CG2 . VAL A 1 406 ? 158.501 174.595 17.606  1.00 163.42 ? 479 VAL A CG2 1 
ATOM   3149 N  N   . THR A 1 407 ? 161.515 178.005 17.793  1.00 127.78 ? 480 THR A N   1 
ATOM   3150 C  CA  . THR A 1 407 ? 162.732 178.753 17.529  1.00 130.40 ? 480 THR A CA  1 
ATOM   3151 C  C   . THR A 1 407 ? 163.080 179.694 18.671  1.00 138.10 ? 480 THR A C   1 
ATOM   3152 O  O   . THR A 1 407 ? 164.246 180.082 18.810  1.00 160.96 ? 480 THR A O   1 
ATOM   3153 C  CB  . THR A 1 407 ? 162.579 179.557 16.237  1.00 152.97 ? 480 THR A CB  1 
ATOM   3154 O  OG1 . THR A 1 407 ? 162.006 178.724 15.221  1.00 179.14 ? 480 THR A OG1 1 
ATOM   3155 C  CG2 . THR A 1 407 ? 163.916 180.059 15.765  1.00 141.75 ? 480 THR A CG2 1 
ATOM   3156 N  N   . LEU A 1 408 ? 162.098 180.059 19.493  1.00 121.64 ? 481 LEU A N   1 
ATOM   3157 C  CA  . LEU A 1 408 ? 162.322 180.960 20.612  1.00 113.86 ? 481 LEU A CA  1 
ATOM   3158 C  C   . LEU A 1 408 ? 162.891 180.232 21.821  1.00 107.50 ? 481 LEU A C   1 
ATOM   3159 O  O   . LEU A 1 408 ? 163.110 180.860 22.862  1.00 108.97 ? 481 LEU A O   1 
ATOM   3160 C  CB  . LEU A 1 408 ? 161.019 181.669 20.989  1.00 135.93 ? 481 LEU A CB  1 
ATOM   3161 C  CG  . LEU A 1 408 ? 160.439 182.646 19.961  1.00 113.18 ? 481 LEU A CG  1 
ATOM   3162 C  CD1 . LEU A 1 408 ? 159.071 183.142 20.399  1.00 116.11 ? 481 LEU A CD1 1 
ATOM   3163 C  CD2 . LEU A 1 408 ? 161.386 183.815 19.729  1.00 113.88 ? 481 LEU A CD2 1 
ATOM   3164 N  N   . THR A 1 409 ? 163.134 178.928 21.707  1.00 105.15 ? 482 THR A N   1 
ATOM   3165 C  CA  . THR A 1 409 ? 163.685 178.151 22.805  1.00 105.93 ? 482 THR A CA  1 
ATOM   3166 C  C   . THR A 1 409 ? 165.160 178.490 23.006  1.00 118.22 ? 482 THR A C   1 
ATOM   3167 O  O   . THR A 1 409 ? 165.765 179.264 22.256  1.00 122.92 ? 482 THR A O   1 
ATOM   3168 C  CB  . THR A 1 409 ? 163.494 176.656 22.550  1.00 102.07 ? 482 THR A CB  1 
ATOM   3169 O  OG1 . THR A 1 409 ? 164.153 176.275 21.336  1.00 100.04 ? 482 THR A OG1 1 
ATOM   3170 C  CG2 . THR A 1 409 ? 162.013 176.303 22.471  1.00 112.58 ? 482 THR A CG2 1 
ATOM   3171 N  N   . PHE A 1 410 ? 165.740 177.911 24.058  1.00 116.07 ? 483 PHE A N   1 
ATOM   3172 C  CA  . PHE A 1 410 ? 167.147 178.157 24.352  1.00 101.63 ? 483 PHE A CA  1 
ATOM   3173 C  C   . PHE A 1 410 ? 168.035 177.597 23.248  1.00 139.88 ? 483 PHE A C   1 
ATOM   3174 O  O   . PHE A 1 410 ? 169.024 178.227 22.856  1.00 137.80 ? 483 PHE A O   1 
ATOM   3175 C  CB  . PHE A 1 410 ? 167.504 177.560 25.712  1.00 104.14 ? 483 PHE A CB  1 
ATOM   3176 C  CG  . PHE A 1 410 ? 166.667 178.095 26.840  1.00 116.10 ? 483 PHE A CG  1 
ATOM   3177 C  CD1 . PHE A 1 410 ? 166.719 179.436 27.187  1.00 125.19 ? 483 PHE A CD1 1 
ATOM   3178 C  CD2 . PHE A 1 410 ? 165.813 177.260 27.541  1.00 129.43 ? 483 PHE A CD2 1 
ATOM   3179 C  CE1 . PHE A 1 410 ? 165.939 179.931 28.220  1.00 133.52 ? 483 PHE A CE1 1 
ATOM   3180 C  CE2 . PHE A 1 410 ? 165.034 177.749 28.575  1.00 139.08 ? 483 PHE A CE2 1 
ATOM   3181 C  CZ  . PHE A 1 410 ? 165.096 179.085 28.913  1.00 143.82 ? 483 PHE A CZ  1 
ATOM   3182 N  N   . GLY A 1 411 ? 167.677 176.434 22.714  1.00 130.70 ? 484 GLY A N   1 
ATOM   3183 C  CA  . GLY A 1 411 ? 168.394 175.844 21.603  1.00 122.34 ? 484 GLY A CA  1 
ATOM   3184 C  C   . GLY A 1 411 ? 167.720 176.159 20.285  1.00 124.87 ? 484 GLY A C   1 
ATOM   3185 O  O   . GLY A 1 411 ? 167.541 175.279 19.438  1.00 122.51 ? 484 GLY A O   1 
ATOM   3186 N  N   . GLY A 1 412 ? 167.330 177.418 20.107  1.00 157.87 ? 485 GLY A N   1 
ATOM   3187 C  CA  . GLY A 1 412 ? 166.610 177.826 18.919  1.00 183.62 ? 485 GLY A CA  1 
ATOM   3188 C  C   . GLY A 1 412 ? 167.486 177.988 17.695  1.00 182.70 ? 485 GLY A C   1 
ATOM   3189 O  O   . GLY A 1 412 ? 167.056 177.661 16.585  1.00 189.90 ? 485 GLY A O   1 
ATOM   3190 N  N   . ALA A 1 413 ? 168.716 178.478 17.878  1.00 96.78  ? 486 ALA A N   1 
ATOM   3191 C  CA  . ALA A 1 413 ? 169.598 178.701 16.736  1.00 95.85  ? 486 ALA A CA  1 
ATOM   3192 C  C   . ALA A 1 413 ? 169.876 177.400 15.992  1.00 132.54 ? 486 ALA A C   1 
ATOM   3193 O  O   . ALA A 1 413 ? 169.992 177.391 14.758  1.00 165.21 ? 486 ALA A O   1 
ATOM   3194 C  CB  . ALA A 1 413 ? 170.904 179.344 17.202  1.00 95.98  ? 486 ALA A CB  1 
ATOM   3195 N  N   . TYR A 1 414 ? 169.980 176.292 16.728  1.00 113.40 ? 487 TYR A N   1 
ATOM   3196 C  CA  . TYR A 1 414 ? 170.163 174.986 16.102  1.00 101.57 ? 487 TYR A CA  1 
ATOM   3197 C  C   . TYR A 1 414 ? 169.029 174.692 15.128  1.00 124.61 ? 487 TYR A C   1 
ATOM   3198 O  O   . TYR A 1 414 ? 169.259 174.263 13.989  1.00 135.91 ? 487 TYR A O   1 
ATOM   3199 C  CB  . TYR A 1 414 ? 170.246 173.909 17.180  1.00 94.57  ? 487 TYR A CB  1 
ATOM   3200 C  CG  . TYR A 1 414 ? 171.422 174.096 18.111  1.00 115.40 ? 487 TYR A CG  1 
ATOM   3201 C  CD1 . TYR A 1 414 ? 172.642 174.561 17.636  1.00 116.98 ? 487 TYR A CD1 1 
ATOM   3202 C  CD2 . TYR A 1 414 ? 171.305 173.840 19.470  1.00 118.32 ? 487 TYR A CD2 1 
ATOM   3203 C  CE1 . TYR A 1 414 ? 173.716 174.745 18.484  1.00 88.68  ? 487 TYR A CE1 1 
ATOM   3204 C  CE2 . TYR A 1 414 ? 172.374 174.024 20.323  1.00 89.55  ? 487 TYR A CE2 1 
ATOM   3205 C  CZ  . TYR A 1 414 ? 173.574 174.475 19.824  1.00 89.06  ? 487 TYR A CZ  1 
ATOM   3206 O  OH  . TYR A 1 414 ? 174.638 174.657 20.672  1.00 115.64 ? 487 TYR A OH  1 
ATOM   3207 N  N   . VAL A 1 415 ? 167.790 174.923 15.570  1.00 120.06 ? 488 VAL A N   1 
ATOM   3208 C  CA  . VAL A 1 415 ? 166.629 174.717 14.713  1.00 92.30  ? 488 VAL A CA  1 
ATOM   3209 C  C   . VAL A 1 415 ? 166.667 175.670 13.526  1.00 93.00  ? 488 VAL A C   1 
ATOM   3210 O  O   . VAL A 1 415 ? 166.242 175.311 12.423  1.00 139.41 ? 488 VAL A O   1 
ATOM   3211 C  CB  . VAL A 1 415 ? 165.336 174.861 15.536  1.00 93.99  ? 488 VAL A CB  1 
ATOM   3212 C  CG1 . VAL A 1 415 ? 164.122 174.503 14.698  1.00 94.39  ? 488 VAL A CG1 1 
ATOM   3213 C  CG2 . VAL A 1 415 ? 165.413 173.977 16.774  1.00 100.38 ? 488 VAL A CG2 1 
ATOM   3214 N  N   . VAL A 1 416 ? 167.173 176.890 13.724  1.00 94.18  ? 489 VAL A N   1 
ATOM   3215 C  CA  . VAL A 1 416 ? 167.290 177.845 12.620  1.00 94.98  ? 489 VAL A CA  1 
ATOM   3216 C  C   . VAL A 1 416 ? 168.193 177.279 11.534  1.00 93.16  ? 489 VAL A C   1 
ATOM   3217 O  O   . VAL A 1 416 ? 167.843 177.276 10.348  1.00 117.84 ? 489 VAL A O   1 
ATOM   3218 C  CB  . VAL A 1 416 ? 167.814 179.203 13.120  1.00 96.60  ? 489 VAL A CB  1 
ATOM   3219 C  CG1 . VAL A 1 416 ? 167.932 180.182 11.960  1.00 97.55  ? 489 VAL A CG1 1 
ATOM   3220 C  CG2 . VAL A 1 416 ? 166.915 179.759 14.183  1.00 98.57  ? 489 VAL A CG2 1 
ATOM   3221 N  N   . LYS A 1 417 ? 169.394 176.844 11.919  1.00 91.78  ? 490 LYS A N   1 
ATOM   3222 C  CA  . LYS A 1 417 ? 170.303 176.233 10.954  1.00 90.12  ? 490 LYS A CA  1 
ATOM   3223 C  C   . LYS A 1 417 ? 169.648 175.036 10.269  1.00 88.99  ? 490 LYS A C   1 
ATOM   3224 O  O   . LYS A 1 417 ? 169.643 174.937 9.036   1.00 106.45 ? 490 LYS A O   1 
ATOM   3225 C  CB  . LYS A 1 417 ? 171.584 175.800 11.671  1.00 88.92  ? 490 LYS A CB  1 
ATOM   3226 C  CG  . LYS A 1 417 ? 172.795 176.703 11.487  1.00 108.05 ? 490 LYS A CG  1 
ATOM   3227 C  CD  . LYS A 1 417 ? 173.551 176.432 10.202  1.00 117.89 ? 490 LYS A CD  1 
ATOM   3228 C  CE  . LYS A 1 417 ? 174.845 177.237 10.175  1.00 126.43 ? 490 LYS A CE  1 
ATOM   3229 N  NZ  . LYS A 1 417 ? 175.652 176.985 8.951   1.00 146.93 ? 490 LYS A NZ  1 
ATOM   3230 N  N   . LEU A 1 418 ? 169.081 174.118 11.061  1.00 88.52  ? 491 LEU A N   1 
ATOM   3231 C  CA  . LEU A 1 418 ? 168.499 172.895 10.506  1.00 87.49  ? 491 LEU A CA  1 
ATOM   3232 C  C   . LEU A 1 418 ? 167.399 173.193 9.491   1.00 88.44  ? 491 LEU A C   1 
ATOM   3233 O  O   . LEU A 1 418 ? 167.379 172.624 8.394   1.00 112.43 ? 491 LEU A O   1 
ATOM   3234 C  CB  . LEU A 1 418 ? 167.964 172.011 11.633  1.00 87.24  ? 491 LEU A CB  1 
ATOM   3235 C  CG  . LEU A 1 418 ? 167.404 170.654 11.198  1.00 86.24  ? 491 LEU A CG  1 
ATOM   3236 C  CD1 . LEU A 1 418 ? 168.504 169.758 10.661  1.00 84.48  ? 491 LEU A CD1 1 
ATOM   3237 C  CD2 . LEU A 1 418 ? 166.682 169.977 12.352  1.00 127.18 ? 491 LEU A CD2 1 
ATOM   3238 N  N   . LEU A 1 419 ? 166.477 174.089 9.837   1.00 115.30 ? 492 LEU A N   1 
ATOM   3239 C  CA  . LEU A 1 419 ? 165.364 174.402 8.944   1.00 120.46 ? 492 LEU A CA  1 
ATOM   3240 C  C   . LEU A 1 419 ? 165.824 175.203 7.736   1.00 131.79 ? 492 LEU A C   1 
ATOM   3241 O  O   . LEU A 1 419 ? 165.305 175.020 6.628   1.00 157.91 ? 492 LEU A O   1 
ATOM   3242 C  CB  . LEU A 1 419 ? 164.277 175.159 9.707   1.00 93.43  ? 492 LEU A CB  1 
ATOM   3243 C  CG  . LEU A 1 419 ? 163.130 174.339 10.296  1.00 93.72  ? 492 LEU A CG  1 
ATOM   3244 C  CD1 . LEU A 1 419 ? 163.634 173.199 11.163  1.00 92.16  ? 492 LEU A CD1 1 
ATOM   3245 C  CD2 . LEU A 1 419 ? 162.229 175.255 11.098  1.00 95.97  ? 492 LEU A CD2 1 
ATOM   3246 N  N   . GLU A 1 420 ? 166.798 176.089 7.925   1.00 119.55 ? 493 GLU A N   1 
ATOM   3247 C  CA  . GLU A 1 420 ? 167.220 176.961 6.839   1.00 120.07 ? 493 GLU A CA  1 
ATOM   3248 C  C   . GLU A 1 420 ? 168.082 176.226 5.823   1.00 102.23 ? 493 GLU A C   1 
ATOM   3249 O  O   . GLU A 1 420 ? 168.100 176.606 4.647   1.00 102.74 ? 493 GLU A O   1 
ATOM   3250 C  CB  . GLU A 1 420 ? 167.974 178.168 7.394   1.00 149.05 ? 493 GLU A CB  1 
ATOM   3251 C  CG  . GLU A 1 420 ? 168.258 179.248 6.365   1.00 163.24 ? 493 GLU A CG  1 
ATOM   3252 C  CD  . GLU A 1 420 ? 168.992 180.432 6.959   1.00 182.81 ? 493 GLU A CD  1 
ATOM   3253 O  OE1 . GLU A 1 420 ? 169.156 181.448 6.251   1.00 172.29 ? 493 GLU A OE1 1 
ATOM   3254 O  OE2 . GLU A 1 420 ? 169.408 180.344 8.134   1.00 199.10 ? 493 GLU A OE2 1 
ATOM   3255 N  N   . GLU A 1 421 ? 168.809 175.192 6.245   1.00 89.18  ? 494 GLU A N   1 
ATOM   3256 C  CA  . GLU A 1 421 ? 169.751 174.529 5.356   1.00 87.74  ? 494 GLU A CA  1 
ATOM   3257 C  C   . GLU A 1 421 ? 169.329 173.129 4.935   1.00 86.50  ? 494 GLU A C   1 
ATOM   3258 O  O   . GLU A 1 421 ? 169.635 172.725 3.812   1.00 85.89  ? 494 GLU A O   1 
ATOM   3259 C  CB  . GLU A 1 421 ? 171.136 174.476 6.010   1.00 109.53 ? 494 GLU A CB  1 
ATOM   3260 C  CG  . GLU A 1 421 ? 172.267 174.192 5.044   1.00 139.22 ? 494 GLU A CG  1 
ATOM   3261 C  CD  . GLU A 1 421 ? 173.575 174.812 5.499   1.00 151.42 ? 494 GLU A CD  1 
ATOM   3262 O  OE1 . GLU A 1 421 ? 173.605 175.387 6.610   1.00 135.53 ? 494 GLU A OE1 1 
ATOM   3263 O  OE2 . GLU A 1 421 ? 174.569 174.734 4.743   1.00 163.27 ? 494 GLU A OE2 1 
ATOM   3264 N  N   . TYR A 1 422 ? 168.661 172.370 5.803   1.00 86.21  ? 495 TYR A N   1 
ATOM   3265 C  CA  . TYR A 1 422 ? 168.280 171.000 5.480   1.00 85.14  ? 495 TYR A CA  1 
ATOM   3266 C  C   . TYR A 1 422 ? 166.822 170.861 5.063   1.00 112.43 ? 495 TYR A C   1 
ATOM   3267 O  O   . TYR A 1 422 ? 166.463 169.858 4.437   1.00 127.48 ? 495 TYR A O   1 
ATOM   3268 C  CB  . TYR A 1 422 ? 168.537 170.066 6.667   1.00 84.18  ? 495 TYR A CB  1 
ATOM   3269 C  CG  . TYR A 1 422 ? 169.956 169.562 6.781   1.00 82.83  ? 495 TYR A CG  1 
ATOM   3270 C  CD1 . TYR A 1 422 ? 170.914 169.886 5.831   1.00 82.50  ? 495 TYR A CD1 1 
ATOM   3271 C  CD2 . TYR A 1 422 ? 170.327 168.736 7.831   1.00 118.47 ? 495 TYR A CD2 1 
ATOM   3272 C  CE1 . TYR A 1 422 ? 172.212 169.416 5.940   1.00 85.72  ? 495 TYR A CE1 1 
ATOM   3273 C  CE2 . TYR A 1 422 ? 171.614 168.258 7.946   1.00 120.27 ? 495 TYR A CE2 1 
ATOM   3274 C  CZ  . TYR A 1 422 ? 172.554 168.600 7.001   1.00 95.69  ? 495 TYR A CZ  1 
ATOM   3275 O  OH  . TYR A 1 422 ? 173.838 168.120 7.128   1.00 79.67  ? 495 TYR A OH  1 
ATOM   3276 N  N   . ALA A 1 423 ? 165.981 171.837 5.391   1.00 87.65  ? 496 ALA A N   1 
ATOM   3277 C  CA  . ALA A 1 423 ? 164.546 171.738 5.164   1.00 88.74  ? 496 ALA A CA  1 
ATOM   3278 C  C   . ALA A 1 423 ? 164.088 172.684 4.063   1.00 101.52 ? 496 ALA A C   1 
ATOM   3279 O  O   . ALA A 1 423 ? 163.814 172.259 2.937   1.00 120.71 ? 496 ALA A O   1 
ATOM   3280 C  CB  . ALA A 1 423 ? 163.782 172.023 6.455   1.00 89.82  ? 496 ALA A CB  1 
ATOM   3281 N  N   . THR A 1 424 ? 164.005 173.973 4.394   1.00 91.51  ? 497 THR A N   1 
ATOM   3282 C  CA  . THR A 1 424 ? 163.412 174.958 3.494   1.00 112.17 ? 497 THR A CA  1 
ATOM   3283 C  C   . THR A 1 424 ? 164.171 175.054 2.175   1.00 119.04 ? 497 THR A C   1 
ATOM   3284 O  O   . THR A 1 424 ? 163.560 175.057 1.102   1.00 148.60 ? 497 THR A O   1 
ATOM   3285 C  CB  . THR A 1 424 ? 163.355 176.324 4.176   1.00 105.53 ? 497 THR A CB  1 
ATOM   3286 O  OG1 . THR A 1 424 ? 164.677 176.731 4.544   1.00 104.86 ? 497 THR A OG1 1 
ATOM   3287 C  CG2 . THR A 1 424 ? 162.491 176.251 5.421   1.00 105.17 ? 497 THR A CG2 1 
ATOM   3288 N  N   . GLY A 1 425 ? 165.496 175.163 2.233   1.00 91.54  ? 498 GLY A N   1 
ATOM   3289 C  CA  . GLY A 1 425 ? 166.305 175.346 1.049   1.00 91.16  ? 498 GLY A CA  1 
ATOM   3290 C  C   . GLY A 1 425 ? 166.014 174.393 -0.098  1.00 116.87 ? 498 GLY A C   1 
ATOM   3291 O  O   . GLY A 1 425 ? 165.524 174.805 -1.159  1.00 113.99 ? 498 GLY A O   1 
ATOM   3292 N  N   . PRO A 1 426 ? 166.272 173.094 0.099   1.00 120.41 ? 499 PRO A N   1 
ATOM   3293 C  CA  . PRO A 1 426 ? 166.046 172.138 -0.999  1.00 129.85 ? 499 PRO A CA  1 
ATOM   3294 C  C   . PRO A 1 426 ? 164.607 172.085 -1.469  1.00 126.00 ? 499 PRO A C   1 
ATOM   3295 O  O   . PRO A 1 426 ? 164.350 171.724 -2.625  1.00 135.37 ? 499 PRO A O   1 
ATOM   3296 C  CB  . PRO A 1 426 ? 166.472 170.795 -0.386  1.00 128.51 ? 499 PRO A CB  1 
ATOM   3297 C  CG  . PRO A 1 426 ? 166.360 171.002 1.094   1.00 114.50 ? 499 PRO A CG  1 
ATOM   3298 C  CD  . PRO A 1 426 ? 166.761 172.426 1.315   1.00 113.07 ? 499 PRO A CD  1 
ATOM   3299 N  N   . ALA A 1 427 ? 163.658 172.438 -0.606  1.00 112.77 ? 500 ALA A N   1 
ATOM   3300 C  CA  . ALA A 1 427 ? 162.264 172.438 -1.019  1.00 113.59 ? 500 ALA A CA  1 
ATOM   3301 C  C   . ALA A 1 427 ? 161.934 173.653 -1.878  1.00 118.31 ? 500 ALA A C   1 
ATOM   3302 O  O   . ALA A 1 427 ? 161.185 173.533 -2.852  1.00 135.19 ? 500 ALA A O   1 
ATOM   3303 C  CB  . ALA A 1 427 ? 161.359 172.369 0.208   1.00 127.37 ? 500 ALA A CB  1 
ATOM   3304 N  N   . VAL A 1 428 ? 162.462 174.830 -1.527  1.00 94.05  ? 501 VAL A N   1 
ATOM   3305 C  CA  . VAL A 1 428 ? 162.243 176.007 -2.362  1.00 119.17 ? 501 VAL A CA  1 
ATOM   3306 C  C   . VAL A 1 428 ? 162.916 175.831 -3.716  1.00 119.41 ? 501 VAL A C   1 
ATOM   3307 O  O   . VAL A 1 428 ? 162.344 176.177 -4.756  1.00 152.43 ? 501 VAL A O   1 
ATOM   3308 C  CB  . VAL A 1 428 ? 162.731 177.277 -1.645  1.00 96.76  ? 501 VAL A CB  1 
ATOM   3309 C  CG1 . VAL A 1 428 ? 162.656 178.482 -2.579  1.00 98.52  ? 501 VAL A CG1 1 
ATOM   3310 C  CG2 . VAL A 1 428 ? 161.919 177.513 -0.387  1.00 97.73  ? 501 VAL A CG2 1 
ATOM   3311 N  N   . LEU A 1 429 ? 164.150 175.315 -3.728  1.00 93.49  ? 502 LEU A N   1 
ATOM   3312 C  CA  . LEU A 1 429 ? 164.791 175.014 -5.006  1.00 92.93  ? 502 LEU A CA  1 
ATOM   3313 C  C   . LEU A 1 429 ? 163.993 173.981 -5.787  1.00 92.65  ? 502 LEU A C   1 
ATOM   3314 O  O   . LEU A 1 429 ? 163.883 174.071 -7.014  1.00 125.69 ? 502 LEU A O   1 
ATOM   3315 C  CB  . LEU A 1 429 ? 166.237 174.571 -4.809  1.00 96.29  ? 502 LEU A CB  1 
ATOM   3316 C  CG  . LEU A 1 429 ? 167.204 175.752 -4.785  1.00 103.68 ? 502 LEU A CG  1 
ATOM   3317 C  CD1 . LEU A 1 429 ? 168.508 175.389 -4.121  1.00 114.84 ? 502 LEU A CD1 1 
ATOM   3318 C  CD2 . LEU A 1 429 ? 167.459 176.175 -6.220  1.00 92.68  ? 502 LEU A CD2 1 
ATOM   3319 N  N   . THR A 1 430 ? 163.450 172.976 -5.098  1.00 91.87  ? 503 THR A N   1 
ATOM   3320 C  CA  . THR A 1 430 ? 162.680 171.944 -5.784  1.00 93.73  ? 503 THR A CA  1 
ATOM   3321 C  C   . THR A 1 430 ? 161.434 172.538 -6.434  1.00 95.72  ? 503 THR A C   1 
ATOM   3322 O  O   . THR A 1 430 ? 161.207 172.359 -7.635  1.00 93.93  ? 503 THR A O   1 
ATOM   3323 C  CB  . THR A 1 430 ? 162.308 170.824 -4.809  1.00 119.10 ? 503 THR A CB  1 
ATOM   3324 O  OG1 . THR A 1 430 ? 163.498 170.283 -4.223  1.00 89.10  ? 503 THR A OG1 1 
ATOM   3325 C  CG2 . THR A 1 430 ? 161.547 169.716 -5.526  1.00 90.62  ? 503 THR A CG2 1 
ATOM   3326 N  N   . VAL A 1 431 ? 160.618 173.261 -5.660  1.00 111.44 ? 504 VAL A N   1 
ATOM   3327 C  CA  . VAL A 1 431 ? 159.387 173.819 -6.216  1.00 130.07 ? 504 VAL A CA  1 
ATOM   3328 C  C   . VAL A 1 431 ? 159.703 174.878 -7.270  1.00 129.96 ? 504 VAL A C   1 
ATOM   3329 O  O   . VAL A 1 431 ? 158.939 175.060 -8.228  1.00 115.08 ? 504 VAL A O   1 
ATOM   3330 C  CB  . VAL A 1 431 ? 158.495 174.370 -5.085  1.00 138.22 ? 504 VAL A CB  1 
ATOM   3331 C  CG1 . VAL A 1 431 ? 159.153 175.552 -4.389  1.00 133.91 ? 504 VAL A CG1 1 
ATOM   3332 C  CG2 . VAL A 1 431 ? 157.132 174.753 -5.617  1.00 152.27 ? 504 VAL A CG2 1 
ATOM   3333 N  N   . ALA A 1 432 ? 160.830 175.581 -7.124  1.00 97.56  ? 505 ALA A N   1 
ATOM   3334 C  CA  . ALA A 1 432 ? 161.258 176.528 -8.149  1.00 126.29 ? 505 ALA A CA  1 
ATOM   3335 C  C   . ALA A 1 432 ? 161.602 175.795 -9.438  1.00 97.85  ? 505 ALA A C   1 
ATOM   3336 O  O   . ALA A 1 432 ? 161.331 176.291 -10.536 1.00 99.09  ? 505 ALA A O   1 
ATOM   3337 C  CB  . ALA A 1 432 ? 162.447 177.349 -7.652  1.00 133.58 ? 505 ALA A CB  1 
ATOM   3338 N  N   . LEU A 1 433 ? 162.241 174.628 -9.313  1.00 95.94  ? 506 LEU A N   1 
ATOM   3339 C  CA  . LEU A 1 433 ? 162.544 173.797 -10.472 1.00 95.27  ? 506 LEU A CA  1 
ATOM   3340 C  C   . LEU A 1 433 ? 161.252 173.326 -11.123 1.00 119.02 ? 506 LEU A C   1 
ATOM   3341 O  O   . LEU A 1 433 ? 161.146 173.278 -12.354 1.00 104.74 ? 506 LEU A O   1 
ATOM   3342 C  CB  . LEU A 1 433 ? 163.417 172.610 -10.054 1.00 93.22  ? 506 LEU A CB  1 
ATOM   3343 C  CG  . LEU A 1 433 ? 164.102 171.715 -11.099 1.00 92.33  ? 506 LEU A CG  1 
ATOM   3344 C  CD1 . LEU A 1 433 ? 163.197 170.591 -11.603 1.00 92.27  ? 506 LEU A CD1 1 
ATOM   3345 C  CD2 . LEU A 1 433 ? 164.645 172.540 -12.258 1.00 93.27  ? 506 LEU A CD2 1 
ATOM   3346 N  N   . ILE A 1 434 ? 160.269 172.946 -10.302 1.00 137.01 ? 507 ILE A N   1 
ATOM   3347 C  CA  . ILE A 1 434 ? 158.987 172.485 -10.823 1.00 121.28 ? 507 ILE A CA  1 
ATOM   3348 C  C   . ILE A 1 434 ? 158.321 173.603 -11.612 1.00 112.65 ? 507 ILE A C   1 
ATOM   3349 O  O   . ILE A 1 434 ? 157.783 173.378 -12.700 1.00 100.20 ? 507 ILE A O   1 
ATOM   3350 C  CB  . ILE A 1 434 ? 158.082 172.001 -9.674  1.00 116.52 ? 507 ILE A CB  1 
ATOM   3351 C  CG1 . ILE A 1 434 ? 158.754 170.886 -8.883  1.00 95.30  ? 507 ILE A CG1 1 
ATOM   3352 C  CG2 . ILE A 1 434 ? 156.790 171.450 -10.232 1.00 110.74 ? 507 ILE A CG2 1 
ATOM   3353 C  CD1 . ILE A 1 434 ? 159.008 169.663 -9.689  1.00 94.30  ? 507 ILE A CD1 1 
ATOM   3354 N  N   . GLU A 1 435 ? 158.360 174.828 -11.082 1.00 128.32 ? 508 GLU A N   1 
ATOM   3355 C  CA  . GLU A 1 435 ? 157.778 175.966 -11.789 1.00 147.31 ? 508 GLU A CA  1 
ATOM   3356 C  C   . GLU A 1 435 ? 158.530 176.244 -13.086 1.00 140.13 ? 508 GLU A C   1 
ATOM   3357 O  O   . GLU A 1 435 ? 157.918 176.464 -14.137 1.00 139.84 ? 508 GLU A O   1 
ATOM   3358 C  CB  . GLU A 1 435 ? 157.788 177.201 -10.888 1.00 169.63 ? 508 GLU A CB  1 
ATOM   3359 C  CG  . GLU A 1 435 ? 156.898 177.087 -9.666  1.00 177.79 ? 508 GLU A CG  1 
ATOM   3360 C  CD  . GLU A 1 435 ? 156.872 178.363 -8.855  1.00 195.57 ? 508 GLU A CD  1 
ATOM   3361 O  OE1 . GLU A 1 435 ? 157.267 179.418 -9.395  1.00 200.58 ? 508 GLU A OE1 1 
ATOM   3362 O  OE2 . GLU A 1 435 ? 156.461 178.312 -7.678  1.00 208.99 ? 508 GLU A OE2 1 
ATOM   3363 N  N   . ALA A 1 436 ? 159.863 176.257 -13.024 1.00 155.77 ? 509 ALA A N   1 
ATOM   3364 C  CA  . ALA A 1 436 ? 160.666 176.524 -14.213 1.00 164.93 ? 509 ALA A CA  1 
ATOM   3365 C  C   . ALA A 1 436 ? 160.390 175.494 -15.300 1.00 160.60 ? 509 ALA A C   1 
ATOM   3366 O  O   . ALA A 1 436 ? 160.395 175.820 -16.492 1.00 165.05 ? 509 ALA A O   1 
ATOM   3367 C  CB  . ALA A 1 436 ? 162.152 176.543 -13.853 1.00 168.37 ? 509 ALA A CB  1 
ATOM   3368 N  N   . VAL A 1 437 ? 160.154 174.241 -14.907 1.00 150.85 ? 510 VAL A N   1 
ATOM   3369 C  CA  . VAL A 1 437 ? 159.835 173.206 -15.884 1.00 141.54 ? 510 VAL A CA  1 
ATOM   3370 C  C   . VAL A 1 437 ? 158.415 173.382 -16.410 1.00 138.58 ? 510 VAL A C   1 
ATOM   3371 O  O   . VAL A 1 437 ? 158.162 173.228 -17.609 1.00 151.77 ? 510 VAL A O   1 
ATOM   3372 C  CB  . VAL A 1 437 ? 160.053 171.813 -15.265 1.00 134.07 ? 510 VAL A CB  1 
ATOM   3373 C  CG1 . VAL A 1 437 ? 159.439 170.730 -16.139 1.00 125.24 ? 510 VAL A CG1 1 
ATOM   3374 C  CG2 . VAL A 1 437 ? 161.540 171.557 -15.069 1.00 126.97 ? 510 VAL A CG2 1 
ATOM   3375 N  N   . ALA A 1 438 ? 157.466 173.700 -15.529 1.00 131.22 ? 511 ALA A N   1 
ATOM   3376 C  CA  . ALA A 1 438 ? 156.066 173.790 -15.937 1.00 125.73 ? 511 ALA A CA  1 
ATOM   3377 C  C   . ALA A 1 438 ? 155.847 174.939 -16.914 1.00 140.14 ? 511 ALA A C   1 
ATOM   3378 O  O   . ALA A 1 438 ? 155.183 174.775 -17.943 1.00 144.82 ? 511 ALA A O   1 
ATOM   3379 C  CB  . ALA A 1 438 ? 155.167 173.949 -14.714 1.00 107.70 ? 511 ALA A CB  1 
ATOM   3380 N  N   . VAL A 1 439 ? 156.377 176.122 -16.597 1.00 136.63 ? 512 VAL A N   1 
ATOM   3381 C  CA  . VAL A 1 439 ? 156.139 177.276 -17.458 1.00 108.75 ? 512 VAL A CA  1 
ATOM   3382 C  C   . VAL A 1 439 ? 156.842 177.113 -18.802 1.00 159.02 ? 512 VAL A C   1 
ATOM   3383 O  O   . VAL A 1 439 ? 156.323 177.549 -19.837 1.00 168.58 ? 512 VAL A O   1 
ATOM   3384 C  CB  . VAL A 1 439 ? 156.569 178.568 -16.742 1.00 109.52 ? 512 VAL A CB  1 
ATOM   3385 C  CG1 . VAL A 1 439 ? 156.292 179.780 -17.615 1.00 123.39 ? 512 VAL A CG1 1 
ATOM   3386 C  CG2 . VAL A 1 439 ? 155.839 178.695 -15.416 1.00 122.45 ? 512 VAL A CG2 1 
ATOM   3387 N  N   . SER A 1 440 ? 158.015 176.480 -18.822 1.00 152.20 ? 513 SER A N   1 
ATOM   3388 C  CA  . SER A 1 440 ? 158.798 176.415 -20.051 1.00 168.44 ? 513 SER A CA  1 
ATOM   3389 C  C   . SER A 1 440 ? 158.417 175.227 -20.929 1.00 175.41 ? 513 SER A C   1 
ATOM   3390 O  O   . SER A 1 440 ? 158.436 175.338 -22.159 1.00 188.50 ? 513 SER A O   1 
ATOM   3391 C  CB  . SER A 1 440 ? 160.292 176.352 -19.721 1.00 163.77 ? 513 SER A CB  1 
ATOM   3392 O  OG  . SER A 1 440 ? 161.072 176.273 -20.901 1.00 160.24 ? 513 SER A OG  1 
ATOM   3393 N  N   . TRP A 1 441 ? 158.071 174.092 -20.322 1.00 166.74 ? 514 TRP A N   1 
ATOM   3394 C  CA  . TRP A 1 441 ? 157.877 172.848 -21.052 1.00 177.60 ? 514 TRP A CA  1 
ATOM   3395 C  C   . TRP A 1 441 ? 156.432 172.367 -21.086 1.00 185.96 ? 514 TRP A C   1 
ATOM   3396 O  O   . TRP A 1 441 ? 156.136 171.411 -21.809 1.00 206.79 ? 514 TRP A O   1 
ATOM   3397 C  CB  . TRP A 1 441 ? 158.762 171.744 -20.458 1.00 174.53 ? 514 TRP A CB  1 
ATOM   3398 C  CG  . TRP A 1 441 ? 160.227 172.004 -20.627 1.00 169.67 ? 514 TRP A CG  1 
ATOM   3399 C  CD1 . TRP A 1 441 ? 160.806 173.004 -21.355 1.00 163.73 ? 514 TRP A CD1 1 
ATOM   3400 C  CD2 . TRP A 1 441 ? 161.302 171.239 -20.072 1.00 168.96 ? 514 TRP A CD2 1 
ATOM   3401 N  NE1 . TRP A 1 441 ? 162.174 172.915 -21.277 1.00 171.85 ? 514 TRP A NE1 1 
ATOM   3402 C  CE2 . TRP A 1 441 ? 162.504 171.838 -20.497 1.00 177.16 ? 514 TRP A CE2 1 
ATOM   3403 C  CE3 . TRP A 1 441 ? 161.364 170.107 -19.253 1.00 157.79 ? 514 TRP A CE3 1 
ATOM   3404 C  CZ2 . TRP A 1 441 ? 163.754 171.344 -20.131 1.00 181.98 ? 514 TRP A CZ2 1 
ATOM   3405 C  CZ3 . TRP A 1 441 ? 162.604 169.619 -18.891 1.00 169.35 ? 514 TRP A CZ3 1 
ATOM   3406 C  CH2 . TRP A 1 441 ? 163.783 170.237 -19.330 1.00 179.99 ? 514 TRP A CH2 1 
ATOM   3407 N  N   . PHE A 1 442 ? 155.534 172.986 -20.322 1.00 173.16 ? 515 PHE A N   1 
ATOM   3408 C  CA  . PHE A 1 442 ? 154.121 172.629 -20.322 1.00 165.95 ? 515 PHE A CA  1 
ATOM   3409 C  C   . PHE A 1 442 ? 153.284 173.751 -20.922 1.00 181.38 ? 515 PHE A C   1 
ATOM   3410 O  O   . PHE A 1 442 ? 152.570 173.539 -21.906 1.00 200.60 ? 515 PHE A O   1 
ATOM   3411 C  CB  . PHE A 1 442 ? 153.645 172.294 -18.903 1.00 152.23 ? 515 PHE A CB  1 
ATOM   3412 C  CG  . PHE A 1 442 ? 153.747 170.841 -18.560 1.00 152.49 ? 515 PHE A CG  1 
ATOM   3413 C  CD1 . PHE A 1 442 ? 154.938 170.304 -18.106 1.00 161.80 ? 515 PHE A CD1 1 
ATOM   3414 C  CD2 . PHE A 1 442 ? 152.641 170.014 -18.668 1.00 145.74 ? 515 PHE A CD2 1 
ATOM   3415 C  CE1 . PHE A 1 442 ? 155.032 168.964 -17.786 1.00 170.57 ? 515 PHE A CE1 1 
ATOM   3416 C  CE2 . PHE A 1 442 ? 152.726 168.674 -18.347 1.00 158.51 ? 515 PHE A CE2 1 
ATOM   3417 C  CZ  . PHE A 1 442 ? 153.924 168.148 -17.905 1.00 166.90 ? 515 PHE A CZ  1 
ATOM   3418 N  N   . TYR A 1 443 ? 153.357 174.949 -20.340 1.00 176.87 ? 516 TYR A N   1 
ATOM   3419 C  CA  . TYR A 1 443 ? 152.607 176.077 -20.875 1.00 170.41 ? 516 TYR A CA  1 
ATOM   3420 C  C   . TYR A 1 443 ? 153.161 176.492 -22.230 1.00 169.44 ? 516 TYR A C   1 
ATOM   3421 O  O   . TYR A 1 443 ? 152.426 177.023 -23.070 1.00 189.08 ? 516 TYR A O   1 
ATOM   3422 C  CB  . TYR A 1 443 ? 152.642 177.247 -19.894 1.00 159.46 ? 516 TYR A CB  1 
ATOM   3423 C  CG  . TYR A 1 443 ? 152.040 178.525 -20.431 1.00 163.05 ? 516 TYR A CG  1 
ATOM   3424 C  CD1 . TYR A 1 443 ? 150.673 178.630 -20.651 1.00 174.20 ? 516 TYR A CD1 1 
ATOM   3425 C  CD2 . TYR A 1 443 ? 152.836 179.629 -20.711 1.00 154.20 ? 516 TYR A CD2 1 
ATOM   3426 C  CE1 . TYR A 1 443 ? 150.115 179.796 -21.137 1.00 180.12 ? 516 TYR A CE1 1 
ATOM   3427 C  CE2 . TYR A 1 443 ? 152.286 180.801 -21.197 1.00 166.02 ? 516 TYR A CE2 1 
ATOM   3428 C  CZ  . TYR A 1 443 ? 150.925 180.877 -21.409 1.00 179.57 ? 516 TYR A CZ  1 
ATOM   3429 O  OH  . TYR A 1 443 ? 150.370 182.038 -21.894 1.00 191.15 ? 516 TYR A OH  1 
ATOM   3430 N  N   . GLY A 1 444 ? 154.450 176.252 -22.455 1.00 153.84 ? 517 GLY A N   1 
ATOM   3431 C  CA  . GLY A 1 444 ? 155.095 176.610 -23.699 1.00 161.06 ? 517 GLY A CA  1 
ATOM   3432 C  C   . GLY A 1 444 ? 155.838 177.925 -23.630 1.00 153.38 ? 517 GLY A C   1 
ATOM   3433 O  O   . GLY A 1 444 ? 155.277 178.946 -23.221 1.00 144.85 ? 517 GLY A O   1 
ATOM   3434 N  N   . ILE A 1 445 ? 157.110 177.907 -24.027 1.00 155.94 ? 518 ILE A N   1 
ATOM   3435 C  CA  . ILE A 1 445 ? 157.911 179.120 -23.959 1.00 143.15 ? 518 ILE A CA  1 
ATOM   3436 C  C   . ILE A 1 445 ? 157.520 180.065 -25.082 1.00 136.72 ? 518 ILE A C   1 
ATOM   3437 O  O   . ILE A 1 445 ? 157.650 181.289 -24.948 1.00 132.86 ? 518 ILE A O   1 
ATOM   3438 C  CB  . ILE A 1 445 ? 159.409 178.774 -24.004 1.00 140.95 ? 518 ILE A CB  1 
ATOM   3439 C  CG1 . ILE A 1 445 ? 160.240 180.027 -23.736 1.00 137.36 ? 518 ILE A CG1 1 
ATOM   3440 C  CG2 . ILE A 1 445 ? 159.768 178.145 -25.344 1.00 137.52 ? 518 ILE A CG2 1 
ATOM   3441 C  CD1 . ILE A 1 445 ? 159.884 180.699 -22.435 1.00 147.88 ? 518 ILE A CD1 1 
ATOM   3442 N  N   . THR A 1 446 ? 157.036 179.516 -26.198 1.00 135.41 ? 519 THR A N   1 
ATOM   3443 C  CA  . THR A 1 446 ? 156.626 180.350 -27.320 1.00 143.20 ? 519 THR A CA  1 
ATOM   3444 C  C   . THR A 1 446 ? 155.415 181.190 -26.938 1.00 147.29 ? 519 THR A C   1 
ATOM   3445 O  O   . THR A 1 446 ? 155.365 182.396 -27.218 1.00 143.74 ? 519 THR A O   1 
ATOM   3446 C  CB  . THR A 1 446 ? 156.328 179.471 -28.533 1.00 152.65 ? 519 THR A CB  1 
ATOM   3447 O  OG1 . THR A 1 446 ? 155.270 178.561 -28.206 1.00 170.36 ? 519 THR A OG1 1 
ATOM   3448 C  CG2 . THR A 1 446 ? 157.565 178.678 -28.923 1.00 125.10 ? 519 THR A CG2 1 
ATOM   3449 N  N   . GLN A 1 447 ? 154.429 180.565 -26.288 1.00 138.14 ? 520 GLN A N   1 
ATOM   3450 C  CA  . GLN A 1 447 ? 153.250 181.300 -25.849 1.00 150.26 ? 520 GLN A CA  1 
ATOM   3451 C  C   . GLN A 1 447 ? 153.620 182.325 -24.786 1.00 157.55 ? 520 GLN A C   1 
ATOM   3452 O  O   . GLN A 1 447 ? 152.994 183.386 -24.705 1.00 152.38 ? 520 GLN A O   1 
ATOM   3453 C  CB  . GLN A 1 447 ? 152.184 180.336 -25.328 1.00 138.40 ? 520 GLN A CB  1 
ATOM   3454 C  CG  . GLN A 1 447 ? 150.873 181.008 -24.954 1.00 153.00 ? 520 GLN A CG  1 
ATOM   3455 C  CD  . GLN A 1 447 ? 150.208 181.695 -26.138 1.00 183.64 ? 520 GLN A CD  1 
ATOM   3456 O  OE1 . GLN A 1 447 ? 150.352 181.264 -27.283 1.00 196.68 ? 520 GLN A OE1 1 
ATOM   3457 N  NE2 . GLN A 1 447 ? 149.481 182.773 -25.865 1.00 190.29 ? 520 GLN A NE2 1 
ATOM   3458 N  N   . PHE A 1 448 ? 154.624 182.016 -23.960 1.00 187.17 ? 521 PHE A N   1 
ATOM   3459 C  CA  . PHE A 1 448 ? 155.098 182.975 -22.967 1.00 172.07 ? 521 PHE A CA  1 
ATOM   3460 C  C   . PHE A 1 448 ? 155.704 184.192 -23.654 1.00 169.86 ? 521 PHE A C   1 
ATOM   3461 O  O   . PHE A 1 448 ? 155.428 185.339 -23.279 1.00 154.03 ? 521 PHE A O   1 
ATOM   3462 C  CB  . PHE A 1 448 ? 156.111 182.310 -22.036 1.00 153.36 ? 521 PHE A CB  1 
ATOM   3463 C  CG  . PHE A 1 448 ? 156.790 183.267 -21.101 1.00 155.77 ? 521 PHE A CG  1 
ATOM   3464 C  CD1 . PHE A 1 448 ? 156.130 183.749 -19.984 1.00 143.90 ? 521 PHE A CD1 1 
ATOM   3465 C  CD2 . PHE A 1 448 ? 158.090 183.681 -21.336 1.00 166.76 ? 521 PHE A CD2 1 
ATOM   3466 C  CE1 . PHE A 1 448 ? 156.752 184.630 -19.120 1.00 144.31 ? 521 PHE A CE1 1 
ATOM   3467 C  CE2 . PHE A 1 448 ? 158.718 184.561 -20.475 1.00 162.23 ? 521 PHE A CE2 1 
ATOM   3468 C  CZ  . PHE A 1 448 ? 158.047 185.037 -19.366 1.00 148.27 ? 521 PHE A CZ  1 
ATOM   3469 N  N   . CYS A 1 449 ? 156.535 183.956 -24.673 1.00 187.29 ? 522 CYS A N   1 
ATOM   3470 C  CA  . CYS A 1 449 ? 157.104 185.064 -25.430 1.00 196.91 ? 522 CYS A CA  1 
ATOM   3471 C  C   . CYS A 1 449 ? 156.011 185.828 -26.160 1.00 209.09 ? 522 CYS A C   1 
ATOM   3472 O  O   . CYS A 1 449 ? 156.166 187.021 -26.446 1.00 226.03 ? 522 CYS A O   1 
ATOM   3473 C  CB  . CYS A 1 449 ? 158.157 184.550 -26.411 1.00 190.52 ? 522 CYS A CB  1 
ATOM   3474 S  SG  . CYS A 1 449 ? 159.586 183.773 -25.619 1.00 173.49 ? 522 CYS A SG  1 
ATOM   3475 N  N   . ARG A 1 450 ? 154.897 185.159 -26.464 1.00 207.31 ? 523 ARG A N   1 
ATOM   3476 C  CA  . ARG A 1 450 ? 153.776 185.840 -27.098 1.00 210.02 ? 523 ARG A CA  1 
ATOM   3477 C  C   . ARG A 1 450 ? 153.050 186.718 -26.087 1.00 218.43 ? 523 ARG A C   1 
ATOM   3478 O  O   . ARG A 1 450 ? 152.576 187.809 -26.427 1.00 229.65 ? 523 ARG A O   1 
ATOM   3479 C  CB  . ARG A 1 450 ? 152.823 184.815 -27.718 1.00 207.33 ? 523 ARG A CB  1 
ATOM   3480 C  CG  . ARG A 1 450 ? 151.801 185.400 -28.683 1.00 209.76 ? 523 ARG A CG  1 
ATOM   3481 C  CD  . ARG A 1 450 ? 150.500 185.743 -27.971 1.00 210.96 ? 523 ARG A CD  1 
ATOM   3482 N  NE  . ARG A 1 450 ? 149.510 186.319 -28.876 1.00 222.33 ? 523 ARG A NE  1 
ATOM   3483 C  CZ  . ARG A 1 450 ? 148.288 186.687 -28.506 1.00 227.75 ? 523 ARG A CZ  1 
ATOM   3484 N  NH1 . ARG A 1 450 ? 147.903 186.538 -27.245 1.00 230.29 ? 523 ARG A NH1 1 
ATOM   3485 N  NH2 . ARG A 1 450 ? 147.451 187.204 -29.395 1.00 229.05 ? 523 ARG A NH2 1 
ATOM   3486 N  N   . ASP A 1 451 ? 152.951 186.254 -24.838 1.00 196.24 ? 524 ASP A N   1 
ATOM   3487 C  CA  . ASP A 1 451 ? 152.330 187.052 -23.787 1.00 185.64 ? 524 ASP A CA  1 
ATOM   3488 C  C   . ASP A 1 451 ? 153.172 188.281 -23.477 1.00 190.36 ? 524 ASP A C   1 
ATOM   3489 O  O   . ASP A 1 451 ? 152.638 189.386 -23.307 1.00 199.96 ? 524 ASP A O   1 
ATOM   3490 C  CB  . ASP A 1 451 ? 152.138 186.200 -22.535 1.00 167.89 ? 524 ASP A CB  1 
ATOM   3491 C  CG  . ASP A 1 451 ? 151.230 185.013 -22.775 1.00 174.35 ? 524 ASP A CG  1 
ATOM   3492 O  OD1 . ASP A 1 451 ? 150.337 185.112 -23.642 1.00 178.01 ? 524 ASP A OD1 1 
ATOM   3493 O  OD2 . ASP A 1 451 ? 151.418 183.977 -22.104 1.00 173.64 ? 524 ASP A OD2 1 
ATOM   3494 N  N   . VAL A 1 452 ? 154.494 188.106 -23.409 1.00 194.80 ? 525 VAL A N   1 
ATOM   3495 C  CA  . VAL A 1 452 ? 155.381 189.251 -23.239 1.00 198.62 ? 525 VAL A CA  1 
ATOM   3496 C  C   . VAL A 1 452 ? 155.250 190.174 -24.441 1.00 203.88 ? 525 VAL A C   1 
ATOM   3497 O  O   . VAL A 1 452 ? 155.301 191.404 -24.314 1.00 218.10 ? 525 VAL A O   1 
ATOM   3498 C  CB  . VAL A 1 452 ? 156.833 188.781 -23.033 1.00 191.41 ? 525 VAL A CB  1 
ATOM   3499 C  CG1 . VAL A 1 452 ? 157.770 189.973 -22.907 1.00 188.28 ? 525 VAL A CG1 1 
ATOM   3500 C  CG2 . VAL A 1 452 ? 156.932 187.880 -21.811 1.00 185.82 ? 525 VAL A CG2 1 
ATOM   3501 N  N   . LYS A 1 453 ? 155.067 189.589 -25.626 1.00 177.21 ? 526 LYS A N   1 
ATOM   3502 C  CA  . LYS A 1 453 ? 154.870 190.382 -26.832 1.00 175.26 ? 526 LYS A CA  1 
ATOM   3503 C  C   . LYS A 1 453 ? 153.563 191.162 -26.763 1.00 169.58 ? 526 LYS A C   1 
ATOM   3504 O  O   . LYS A 1 453 ? 153.441 192.224 -27.382 1.00 177.51 ? 526 LYS A O   1 
ATOM   3505 C  CB  . LYS A 1 453 ? 154.895 189.468 -28.058 1.00 182.88 ? 526 LYS A CB  1 
ATOM   3506 C  CG  . LYS A 1 453 ? 154.871 190.186 -29.397 1.00 202.30 ? 526 LYS A CG  1 
ATOM   3507 C  CD  . LYS A 1 453 ? 154.963 189.196 -30.549 1.00 208.97 ? 526 LYS A CD  1 
ATOM   3508 C  CE  . LYS A 1 453 ? 153.791 188.226 -30.540 1.00 214.84 ? 526 LYS A CE  1 
ATOM   3509 N  NZ  . LYS A 1 453 ? 153.860 187.250 -31.664 1.00 214.44 ? 526 LYS A NZ  1 
ATOM   3510 N  N   . GLU A 1 454 ? 152.593 190.669 -25.989 1.00 166.04 ? 527 GLU A N   1 
ATOM   3511 C  CA  . GLU A 1 454 ? 151.329 191.375 -25.805 1.00 171.55 ? 527 GLU A CA  1 
ATOM   3512 C  C   . GLU A 1 454 ? 151.461 192.509 -24.797 1.00 170.25 ? 527 GLU A C   1 
ATOM   3513 O  O   . GLU A 1 454 ? 150.956 193.613 -25.033 1.00 182.73 ? 527 GLU A O   1 
ATOM   3514 C  CB  . GLU A 1 454 ? 150.239 190.394 -25.364 1.00 166.44 ? 527 GLU A CB  1 
ATOM   3515 C  CG  . GLU A 1 454 ? 148.966 191.057 -24.852 1.00 172.34 ? 527 GLU A CG  1 
ATOM   3516 C  CD  . GLU A 1 454 ? 148.320 191.969 -25.877 1.00 200.75 ? 527 GLU A CD  1 
ATOM   3517 O  OE1 . GLU A 1 454 ? 147.742 193.001 -25.474 1.00 195.97 ? 527 GLU A OE1 1 
ATOM   3518 O  OE2 . GLU A 1 454 ? 148.382 191.654 -27.084 1.00 219.60 ? 527 GLU A OE2 1 
ATOM   3519 N  N   . MET A 1 455 ? 152.137 192.265 -23.674 1.00 159.69 ? 528 MET A N   1 
ATOM   3520 C  CA  . MET A 1 455 ? 152.262 193.301 -22.652 1.00 172.89 ? 528 MET A CA  1 
ATOM   3521 C  C   . MET A 1 455 ? 153.198 194.412 -23.112 1.00 181.57 ? 528 MET A C   1 
ATOM   3522 O  O   . MET A 1 455 ? 152.804 195.580 -23.200 1.00 164.53 ? 528 MET A O   1 
ATOM   3523 C  CB  . MET A 1 455 ? 152.759 192.693 -21.340 1.00 172.60 ? 528 MET A CB  1 
ATOM   3524 C  CG  . MET A 1 455 ? 151.800 191.719 -20.689 1.00 179.59 ? 528 MET A CG  1 
ATOM   3525 S  SD  . MET A 1 455 ? 152.415 191.193 -19.079 1.00 192.96 ? 528 MET A SD  1 
ATOM   3526 C  CE  . MET A 1 455 ? 152.485 192.753 -18.206 1.00 183.04 ? 528 MET A CE  1 
ATOM   3527 N  N   . LEU A 1 456 ? 154.446 194.061 -23.415 1.00 187.54 ? 529 LEU A N   1 
ATOM   3528 C  CA  . LEU A 1 456 ? 155.467 195.037 -23.773 1.00 191.11 ? 529 LEU A CA  1 
ATOM   3529 C  C   . LEU A 1 456 ? 155.368 195.510 -25.215 1.00 200.73 ? 529 LEU A C   1 
ATOM   3530 O  O   . LEU A 1 456 ? 156.005 196.510 -25.563 1.00 208.91 ? 529 LEU A O   1 
ATOM   3531 C  CB  . LEU A 1 456 ? 156.864 194.457 -23.534 1.00 177.11 ? 529 LEU A CB  1 
ATOM   3532 C  CG  . LEU A 1 456 ? 157.431 194.508 -22.115 1.00 139.40 ? 529 LEU A CG  1 
ATOM   3533 C  CD1 . LEU A 1 456 ? 156.641 193.621 -21.165 1.00 137.77 ? 529 LEU A CD1 1 
ATOM   3534 C  CD2 . LEU A 1 456 ? 158.897 194.112 -22.130 1.00 138.69 ? 529 LEU A CD2 1 
ATOM   3535 N  N   . GLY A 1 457 ? 154.609 194.818 -26.063 1.00 230.19 ? 530 GLY A N   1 
ATOM   3536 C  CA  . GLY A 1 457 ? 154.483 195.199 -27.451 1.00 243.47 ? 530 GLY A CA  1 
ATOM   3537 C  C   . GLY A 1 457 ? 155.479 194.544 -28.381 1.00 245.24 ? 530 GLY A C   1 
ATOM   3538 O  O   . GLY A 1 457 ? 155.340 194.674 -29.604 1.00 258.50 ? 530 GLY A O   1 
ATOM   3539 N  N   . PHE A 1 458 ? 156.479 193.849 -27.845 1.00 217.59 ? 531 PHE A N   1 
ATOM   3540 C  CA  . PHE A 1 458 ? 157.491 193.178 -28.644 1.00 199.72 ? 531 PHE A CA  1 
ATOM   3541 C  C   . PHE A 1 458 ? 157.852 191.856 -27.982 1.00 191.39 ? 531 PHE A C   1 
ATOM   3542 O  O   . PHE A 1 458 ? 157.844 191.736 -26.754 1.00 195.03 ? 531 PHE A O   1 
ATOM   3543 C  CB  . PHE A 1 458 ? 158.733 194.065 -28.830 1.00 200.77 ? 531 PHE A CB  1 
ATOM   3544 C  CG  . PHE A 1 458 ? 159.377 194.490 -27.540 1.00 200.27 ? 531 PHE A CG  1 
ATOM   3545 C  CD1 . PHE A 1 458 ? 158.957 195.643 -26.893 1.00 203.53 ? 531 PHE A CD1 1 
ATOM   3546 C  CD2 . PHE A 1 458 ? 160.400 193.747 -26.976 1.00 197.70 ? 531 PHE A CD2 1 
ATOM   3547 C  CE1 . PHE A 1 458 ? 159.543 196.044 -25.707 1.00 203.40 ? 531 PHE A CE1 1 
ATOM   3548 C  CE2 . PHE A 1 458 ? 160.989 194.142 -25.789 1.00 199.03 ? 531 PHE A CE2 1 
ATOM   3549 C  CZ  . PHE A 1 458 ? 160.560 195.292 -25.154 1.00 200.30 ? 531 PHE A CZ  1 
ATOM   3550 N  N   . SER A 1 459 ? 158.173 190.868 -28.811 1.00 183.02 ? 532 SER A N   1 
ATOM   3551 C  CA  . SER A 1 459 ? 158.553 189.560 -28.297 1.00 189.72 ? 532 SER A CA  1 
ATOM   3552 C  C   . SER A 1 459 ? 159.937 189.620 -27.654 1.00 196.83 ? 532 SER A C   1 
ATOM   3553 O  O   . SER A 1 459 ? 160.830 190.306 -28.163 1.00 200.08 ? 532 SER A O   1 
ATOM   3554 C  CB  . SER A 1 459 ? 158.541 188.523 -29.421 1.00 192.84 ? 532 SER A CB  1 
ATOM   3555 O  OG  . SER A 1 459 ? 158.881 187.235 -28.936 1.00 193.55 ? 532 SER A OG  1 
ATOM   3556 N  N   . PRO A 1 460 ? 160.140 188.930 -26.530 1.00 199.45 ? 533 PRO A N   1 
ATOM   3557 C  CA  . PRO A 1 460 ? 161.457 188.947 -25.883 1.00 180.76 ? 533 PRO A CA  1 
ATOM   3558 C  C   . PRO A 1 460 ? 162.525 188.345 -26.782 1.00 179.05 ? 533 PRO A C   1 
ATOM   3559 O  O   . PRO A 1 460 ? 162.259 187.460 -27.599 1.00 169.47 ? 533 PRO A O   1 
ATOM   3560 C  CB  . PRO A 1 460 ? 161.245 188.105 -24.620 1.00 156.25 ? 533 PRO A CB  1 
ATOM   3561 C  CG  . PRO A 1 460 ? 160.061 187.254 -24.928 1.00 155.10 ? 533 PRO A CG  1 
ATOM   3562 C  CD  . PRO A 1 460 ? 159.178 188.095 -25.792 1.00 186.83 ? 533 PRO A CD  1 
ATOM   3563 N  N   . GLY A 1 461 ? 163.748 188.829 -26.607 1.00 169.33 ? 534 GLY A N   1 
ATOM   3564 C  CA  . GLY A 1 461 ? 164.855 188.405 -27.441 1.00 177.11 ? 534 GLY A CA  1 
ATOM   3565 C  C   . GLY A 1 461 ? 165.175 186.929 -27.297 1.00 161.20 ? 534 GLY A C   1 
ATOM   3566 O  O   . GLY A 1 461 ? 164.713 186.225 -26.399 1.00 128.00 ? 534 GLY A O   1 
ATOM   3567 N  N   . TRP A 1 462 ? 165.988 186.453 -28.244 1.00 202.04 ? 535 TRP A N   1 
ATOM   3568 C  CA  . TRP A 1 462 ? 166.427 185.062 -28.232 1.00 211.00 ? 535 TRP A CA  1 
ATOM   3569 C  C   . TRP A 1 462 ? 167.310 184.771 -27.027 1.00 207.03 ? 535 TRP A C   1 
ATOM   3570 O  O   . TRP A 1 462 ? 167.342 183.634 -26.541 1.00 188.98 ? 535 TRP A O   1 
ATOM   3571 C  CB  . TRP A 1 462 ? 167.172 184.741 -29.527 1.00 225.74 ? 535 TRP A CB  1 
ATOM   3572 C  CG  . TRP A 1 462 ? 168.266 185.722 -29.832 1.00 237.33 ? 535 TRP A CG  1 
ATOM   3573 C  CD1 . TRP A 1 462 ? 168.149 186.880 -30.543 1.00 246.72 ? 535 TRP A CD1 1 
ATOM   3574 C  CD2 . TRP A 1 462 ? 169.634 185.646 -29.412 1.00 232.79 ? 535 TRP A CD2 1 
ATOM   3575 N  NE1 . TRP A 1 462 ? 169.361 187.523 -30.605 1.00 246.73 ? 535 TRP A NE1 1 
ATOM   3576 C  CE2 . TRP A 1 462 ? 170.289 186.787 -29.917 1.00 236.87 ? 535 TRP A CE2 1 
ATOM   3577 C  CE3 . TRP A 1 462 ? 170.370 184.722 -28.663 1.00 216.32 ? 535 TRP A CE3 1 
ATOM   3578 C  CZ2 . TRP A 1 462 ? 171.644 187.028 -29.699 1.00 227.41 ? 535 TRP A CZ2 1 
ATOM   3579 C  CZ3 . TRP A 1 462 ? 171.715 184.964 -28.448 1.00 214.78 ? 535 TRP A CZ3 1 
ATOM   3580 C  CH2 . TRP A 1 462 ? 172.338 186.107 -28.964 1.00 215.86 ? 535 TRP A CH2 1 
ATOM   3581 N  N   . PHE A 1 463 ? 168.033 185.784 -26.542 1.00 191.81 ? 536 PHE A N   1 
ATOM   3582 C  CA  . PHE A 1 463 ? 168.905 185.608 -25.386 1.00 161.75 ? 536 PHE A CA  1 
ATOM   3583 C  C   . PHE A 1 463 ? 168.119 185.159 -24.162 1.00 123.15 ? 536 PHE A C   1 
ATOM   3584 O  O   . PHE A 1 463 ? 168.606 184.352 -23.363 1.00 115.52 ? 536 PHE A O   1 
ATOM   3585 C  CB  . PHE A 1 463 ? 169.652 186.909 -25.094 1.00 163.11 ? 536 PHE A CB  1 
ATOM   3586 C  CG  . PHE A 1 463 ? 170.205 186.987 -23.701 1.00 150.89 ? 536 PHE A CG  1 
ATOM   3587 C  CD1 . PHE A 1 463 ? 171.317 186.246 -23.339 1.00 142.91 ? 536 PHE A CD1 1 
ATOM   3588 C  CD2 . PHE A 1 463 ? 169.609 187.801 -22.751 1.00 151.50 ? 536 PHE A CD2 1 
ATOM   3589 C  CE1 . PHE A 1 463 ? 171.825 186.317 -22.058 1.00 143.59 ? 536 PHE A CE1 1 
ATOM   3590 C  CE2 . PHE A 1 463 ? 170.111 187.875 -21.468 1.00 146.00 ? 536 PHE A CE2 1 
ATOM   3591 C  CZ  . PHE A 1 463 ? 171.220 187.132 -21.122 1.00 145.42 ? 536 PHE A CZ  1 
ATOM   3592 N  N   . TRP A 1 464 ? 166.894 185.655 -24.009 1.00 144.26 ? 537 TRP A N   1 
ATOM   3593 C  CA  . TRP A 1 464 ? 166.082 185.301 -22.854 1.00 146.43 ? 537 TRP A CA  1 
ATOM   3594 C  C   . TRP A 1 464 ? 165.306 184.016 -23.098 1.00 145.87 ? 537 TRP A C   1 
ATOM   3595 O  O   . TRP A 1 464 ? 165.127 183.214 -22.174 1.00 144.81 ? 537 TRP A O   1 
ATOM   3596 C  CB  . TRP A 1 464 ? 165.112 186.439 -22.532 1.00 158.15 ? 537 TRP A CB  1 
ATOM   3597 C  CG  . TRP A 1 464 ? 165.806 187.718 -22.231 1.00 181.84 ? 537 TRP A CG  1 
ATOM   3598 C  CD1 . TRP A 1 464 ? 166.064 188.731 -23.106 1.00 204.48 ? 537 TRP A CD1 1 
ATOM   3599 C  CD2 . TRP A 1 464 ? 166.371 188.115 -20.979 1.00 197.58 ? 537 TRP A CD2 1 
ATOM   3600 N  NE1 . TRP A 1 464 ? 166.740 189.743 -22.472 1.00 213.67 ? 537 TRP A NE1 1 
ATOM   3601 C  CE2 . TRP A 1 464 ? 166.942 189.388 -21.164 1.00 210.07 ? 537 TRP A CE2 1 
ATOM   3602 C  CE3 . TRP A 1 464 ? 166.445 187.520 -19.716 1.00 197.08 ? 537 TRP A CE3 1 
ATOM   3603 C  CZ2 . TRP A 1 464 ? 167.577 190.078 -20.136 1.00 210.65 ? 537 TRP A CZ2 1 
ATOM   3604 C  CZ3 . TRP A 1 464 ? 167.075 188.207 -18.697 1.00 198.68 ? 537 TRP A CZ3 1 
ATOM   3605 C  CH2 . TRP A 1 464 ? 167.633 189.473 -18.913 1.00 205.43 ? 537 TRP A CH2 1 
ATOM   3606 N  N   . ARG A 1 465 ? 164.847 183.809 -24.334 1.00 161.21 ? 538 ARG A N   1 
ATOM   3607 C  CA  . ARG A 1 465 ? 164.134 182.581 -24.664 1.00 160.19 ? 538 ARG A CA  1 
ATOM   3608 C  C   . ARG A 1 465 ? 165.036 181.374 -24.447 1.00 128.52 ? 538 ARG A C   1 
ATOM   3609 O  O   . ARG A 1 465 ? 164.641 180.394 -23.803 1.00 119.27 ? 538 ARG A O   1 
ATOM   3610 C  CB  . ARG A 1 465 ? 163.633 182.633 -26.108 1.00 175.99 ? 538 ARG A CB  1 
ATOM   3611 N  N   . ILE A 1 466 ? 166.266 181.439 -24.966 1.00 111.71 ? 539 ILE A N   1 
ATOM   3612 C  CA  . ILE A 1 466 ? 167.194 180.330 -24.810 1.00 125.58 ? 539 ILE A CA  1 
ATOM   3613 C  C   . ILE A 1 466 ? 167.563 180.129 -23.347 1.00 128.03 ? 539 ILE A C   1 
ATOM   3614 O  O   . ILE A 1 466 ? 167.982 179.033 -22.957 1.00 112.24 ? 539 ILE A O   1 
ATOM   3615 C  CB  . ILE A 1 466 ? 168.439 180.565 -25.684 1.00 126.00 ? 539 ILE A CB  1 
ATOM   3616 C  CG1 . ILE A 1 466 ? 169.189 179.253 -25.911 1.00 149.56 ? 539 ILE A CG1 1 
ATOM   3617 C  CG2 . ILE A 1 466 ? 169.351 181.613 -25.057 1.00 139.02 ? 539 ILE A CG2 1 
ATOM   3618 C  CD1 . ILE A 1 466 ? 170.363 179.380 -26.848 1.00 158.75 ? 539 ILE A CD1 1 
ATOM   3619 N  N   . CYS A 1 467 ? 167.384 181.155 -22.515 1.00 140.15 ? 540 CYS A N   1 
ATOM   3620 C  CA  . CYS A 1 467 ? 167.644 181.016 -21.087 1.00 131.56 ? 540 CYS A CA  1 
ATOM   3621 C  C   . CYS A 1 467 ? 166.489 180.302 -20.400 1.00 117.42 ? 540 CYS A C   1 
ATOM   3622 O  O   . CYS A 1 467 ? 166.703 179.383 -19.604 1.00 126.02 ? 540 CYS A O   1 
ATOM   3623 C  CB  . CYS A 1 467 ? 167.899 182.382 -20.444 1.00 140.58 ? 540 CYS A CB  1 
ATOM   3624 S  SG  . CYS A 1 467 ? 169.602 182.991 -20.593 1.00 138.21 ? 540 CYS A SG  1 
ATOM   3625 N  N   . TRP A 1 468 ? 165.255 180.702 -20.710 1.00 120.45 ? 541 TRP A N   1 
ATOM   3626 C  CA  . TRP A 1 468 ? 164.104 180.053 -20.094 1.00 121.06 ? 541 TRP A CA  1 
ATOM   3627 C  C   . TRP A 1 468 ? 163.967 178.609 -20.554 1.00 136.74 ? 541 TRP A C   1 
ATOM   3628 O  O   . TRP A 1 468 ? 163.528 177.754 -19.777 1.00 142.56 ? 541 TRP A O   1 
ATOM   3629 C  CB  . TRP A 1 468 ? 162.822 180.820 -20.410 1.00 122.10 ? 541 TRP A CB  1 
ATOM   3630 C  CG  . TRP A 1 468 ? 162.855 182.254 -20.003 1.00 134.71 ? 541 TRP A CG  1 
ATOM   3631 C  CD1 . TRP A 1 468 ? 163.274 182.757 -18.808 1.00 146.78 ? 541 TRP A CD1 1 
ATOM   3632 C  CD2 . TRP A 1 468 ? 162.425 183.375 -20.783 1.00 135.93 ? 541 TRP A CD2 1 
ATOM   3633 N  NE1 . TRP A 1 468 ? 163.146 184.125 -18.801 1.00 148.99 ? 541 TRP A NE1 1 
ATOM   3634 C  CE2 . TRP A 1 468 ? 162.625 184.528 -20.002 1.00 139.02 ? 541 TRP A CE2 1 
ATOM   3635 C  CE3 . TRP A 1 468 ? 161.897 183.515 -22.069 1.00 146.19 ? 541 TRP A CE3 1 
ATOM   3636 C  CZ2 . TRP A 1 468 ? 162.317 185.803 -20.464 1.00 130.06 ? 541 TRP A CZ2 1 
ATOM   3637 C  CZ3 . TRP A 1 468 ? 161.591 184.781 -22.526 1.00 149.16 ? 541 TRP A CZ3 1 
ATOM   3638 C  CH2 . TRP A 1 468 ? 161.801 185.909 -21.725 1.00 140.55 ? 541 TRP A CH2 1 
ATOM   3639 N  N   . VAL A 1 469 ? 164.314 178.321 -21.808 1.00 132.74 ? 542 VAL A N   1 
ATOM   3640 C  CA  . VAL A 1 469 ? 164.122 176.976 -22.340 1.00 132.87 ? 542 VAL A CA  1 
ATOM   3641 C  C   . VAL A 1 469 ? 165.076 175.991 -21.672 1.00 139.02 ? 542 VAL A C   1 
ATOM   3642 O  O   . VAL A 1 469 ? 164.662 174.925 -21.201 1.00 141.35 ? 542 VAL A O   1 
ATOM   3643 C  CB  . VAL A 1 469 ? 164.304 176.973 -23.868 1.00 123.04 ? 542 VAL A CB  1 
ATOM   3644 C  CG1 . VAL A 1 469 ? 164.425 175.544 -24.385 1.00 119.26 ? 542 VAL A CG1 1 
ATOM   3645 C  CG2 . VAL A 1 469 ? 163.159 177.696 -24.542 1.00 119.75 ? 542 VAL A CG2 1 
ATOM   3646 N  N   . ALA A 1 470 ? 166.363 176.326 -21.624 1.00 150.24 ? 543 ALA A N   1 
ATOM   3647 C  CA  . ALA A 1 470 ? 167.384 175.378 -21.189 1.00 157.68 ? 543 ALA A CA  1 
ATOM   3648 C  C   . ALA A 1 470 ? 168.239 175.865 -20.030 1.00 156.12 ? 543 ALA A C   1 
ATOM   3649 O  O   . ALA A 1 470 ? 168.523 175.086 -19.117 1.00 164.55 ? 543 ALA A O   1 
ATOM   3650 C  CB  . ALA A 1 470 ? 168.296 175.017 -22.370 1.00 164.20 ? 543 ALA A CB  1 
ATOM   3651 N  N   . ILE A 1 471 ? 168.665 177.131 -20.043 1.00 144.70 ? 544 ILE A N   1 
ATOM   3652 C  CA  . ILE A 1 471 ? 169.682 177.589 -19.098 1.00 119.37 ? 544 ILE A CA  1 
ATOM   3653 C  C   . ILE A 1 471 ? 169.146 177.593 -17.670 1.00 125.16 ? 544 ILE A C   1 
ATOM   3654 O  O   . ILE A 1 471 ? 169.837 177.170 -16.738 1.00 134.11 ? 544 ILE A O   1 
ATOM   3655 C  CB  . ILE A 1 471 ? 170.211 178.974 -19.509 1.00 101.72 ? 544 ILE A CB  1 
ATOM   3656 C  CG1 . ILE A 1 471 ? 170.679 178.946 -20.961 1.00 121.57 ? 544 ILE A CG1 1 
ATOM   3657 C  CG2 . ILE A 1 471 ? 171.366 179.376 -18.623 1.00 101.09 ? 544 ILE A CG2 1 
ATOM   3658 C  CD1 . ILE A 1 471 ? 171.812 177.978 -21.203 1.00 136.96 ? 544 ILE A CD1 1 
ATOM   3659 N  N   . SER A 1 472 ? 167.926 178.101 -17.467 1.00 122.54 ? 545 SER A N   1 
ATOM   3660 C  CA  . SER A 1 472 ? 167.402 178.223 -16.106 1.00 105.82 ? 545 SER A CA  1 
ATOM   3661 C  C   . SER A 1 472 ? 167.062 176.874 -15.480 1.00 112.00 ? 545 SER A C   1 
ATOM   3662 O  O   . SER A 1 472 ? 167.452 176.642 -14.320 1.00 125.32 ? 545 SER A O   1 
ATOM   3663 C  CB  . SER A 1 472 ? 166.205 179.177 -16.095 1.00 125.16 ? 545 SER A CB  1 
ATOM   3664 O  OG  . SER A 1 472 ? 166.565 180.446 -16.613 1.00 149.85 ? 545 SER A OG  1 
ATOM   3665 N  N   . PRO A 1 473 ? 166.344 175.957 -16.148 1.00 111.11 ? 546 PRO A N   1 
ATOM   3666 C  CA  . PRO A 1 473 ? 166.072 174.664 -15.495 1.00 125.86 ? 546 PRO A CA  1 
ATOM   3667 C  C   . PRO A 1 473 ? 167.335 173.888 -15.171 1.00 131.88 ? 546 PRO A C   1 
ATOM   3668 O  O   . PRO A 1 473 ? 167.394 173.218 -14.133 1.00 136.61 ? 546 PRO A O   1 
ATOM   3669 C  CB  . PRO A 1 473 ? 165.196 173.932 -16.522 1.00 134.09 ? 546 PRO A CB  1 
ATOM   3670 C  CG  . PRO A 1 473 ? 164.579 175.015 -17.333 1.00 138.11 ? 546 PRO A CG  1 
ATOM   3671 C  CD  . PRO A 1 473 ? 165.637 176.068 -17.437 1.00 116.69 ? 546 PRO A CD  1 
ATOM   3672 N  N   . LEU A 1 474 ? 168.353 173.960 -16.032 1.00 141.08 ? 547 LEU A N   1 
ATOM   3673 C  CA  . LEU A 1 474 ? 169.624 173.321 -15.711 1.00 133.27 ? 547 LEU A CA  1 
ATOM   3674 C  C   . LEU A 1 474 ? 170.333 174.077 -14.599 1.00 125.26 ? 547 LEU A C   1 
ATOM   3675 O  O   . LEU A 1 474 ? 171.097 173.486 -13.828 1.00 143.72 ? 547 LEU A O   1 
ATOM   3676 C  CB  . LEU A 1 474 ? 170.506 173.234 -16.955 1.00 146.81 ? 547 LEU A CB  1 
ATOM   3677 C  CG  . LEU A 1 474 ? 170.036 172.260 -18.037 1.00 172.73 ? 547 LEU A CG  1 
ATOM   3678 C  CD1 . LEU A 1 474 ? 170.938 172.342 -19.257 1.00 184.14 ? 547 LEU A CD1 1 
ATOM   3679 C  CD2 . LEU A 1 474 ? 169.987 170.837 -17.498 1.00 165.15 ? 547 LEU A CD2 1 
ATOM   3680 N  N   . PHE A 1 475 ? 170.086 175.386 -14.512 1.00 94.24  ? 548 PHE A N   1 
ATOM   3681 C  CA  . PHE A 1 475 ? 170.678 176.208 -13.464 1.00 109.65 ? 548 PHE A CA  1 
ATOM   3682 C  C   . PHE A 1 475 ? 170.176 175.781 -12.092 1.00 93.22  ? 548 PHE A C   1 
ATOM   3683 O  O   . PHE A 1 475 ? 170.958 175.680 -11.141 1.00 92.25  ? 548 PHE A O   1 
ATOM   3684 C  CB  . PHE A 1 475 ? 170.348 177.678 -13.731 1.00 116.80 ? 548 PHE A CB  1 
ATOM   3685 C  CG  . PHE A 1 475 ? 170.714 178.606 -12.610 1.00 114.24 ? 548 PHE A CG  1 
ATOM   3686 C  CD1 . PHE A 1 475 ? 172.005 179.088 -12.486 1.00 125.97 ? 548 PHE A CD1 1 
ATOM   3687 C  CD2 . PHE A 1 475 ? 169.761 179.005 -11.686 1.00 97.00  ? 548 PHE A CD2 1 
ATOM   3688 C  CE1 . PHE A 1 475 ? 172.338 179.949 -11.461 1.00 120.01 ? 548 PHE A CE1 1 
ATOM   3689 C  CE2 . PHE A 1 475 ? 170.089 179.863 -10.658 1.00 97.45  ? 548 PHE A CE2 1 
ATOM   3690 C  CZ  . PHE A 1 475 ? 171.380 180.335 -10.545 1.00 122.94 ? 548 PHE A CZ  1 
ATOM   3691 N  N   . LEU A 1 476 ? 168.872 175.526 -11.971 1.00 93.53  ? 549 LEU A N   1 
ATOM   3692 C  CA  . LEU A 1 476 ? 168.340 175.044 -10.700 1.00 92.67  ? 549 LEU A CA  1 
ATOM   3693 C  C   . LEU A 1 476 ? 168.707 173.580 -10.486 1.00 90.87  ? 549 LEU A C   1 
ATOM   3694 O  O   . LEU A 1 476 ? 169.020 173.161 -9.361  1.00 89.77  ? 549 LEU A O   1 
ATOM   3695 C  CB  . LEU A 1 476 ? 166.824 175.233 -10.665 1.00 102.53 ? 549 LEU A CB  1 
ATOM   3696 C  CG  . LEU A 1 476 ? 166.333 176.679 -10.759 1.00 95.74  ? 549 LEU A CG  1 
ATOM   3697 C  CD1 . LEU A 1 476 ? 164.812 176.728 -10.710 1.00 103.95 ? 549 LEU A CD1 1 
ATOM   3698 C  CD2 . LEU A 1 476 ? 166.949 177.548 -9.672  1.00 95.90  ? 549 LEU A CD2 1 
ATOM   3699 N  N   . LEU A 1 477 ? 168.657 172.791 -11.562 1.00 109.68 ? 550 LEU A N   1 
ATOM   3700 C  CA  . LEU A 1 477 ? 168.961 171.367 -11.485 1.00 110.86 ? 550 LEU A CA  1 
ATOM   3701 C  C   . LEU A 1 477 ? 170.367 171.135 -10.946 1.00 119.76 ? 550 LEU A C   1 
ATOM   3702 O  O   . LEU A 1 477 ? 170.596 170.206 -10.162 1.00 111.57 ? 550 LEU A O   1 
ATOM   3703 C  CB  . LEU A 1 477 ? 168.797 170.734 -12.867 1.00 107.21 ? 550 LEU A CB  1 
ATOM   3704 C  CG  . LEU A 1 477 ? 168.686 169.214 -12.964 1.00 116.03 ? 550 LEU A CG  1 
ATOM   3705 C  CD1 . LEU A 1 477 ? 167.279 168.769 -12.612 1.00 127.98 ? 550 LEU A CD1 1 
ATOM   3706 C  CD2 . LEU A 1 477 ? 169.058 168.758 -14.364 1.00 119.20 ? 550 LEU A CD2 1 
ATOM   3707 N  N   . PHE A 1 478 ? 171.324 171.967 -11.367 1.00 123.05 ? 551 PHE A N   1 
ATOM   3708 C  CA  . PHE A 1 478 ? 172.698 171.820 -10.901 1.00 124.39 ? 551 PHE A CA  1 
ATOM   3709 C  C   . PHE A 1 478 ? 172.793 172.010 -9.391  1.00 117.55 ? 551 PHE A C   1 
ATOM   3710 O  O   . PHE A 1 478 ? 173.488 171.251 -8.707  1.00 132.35 ? 551 PHE A O   1 
ATOM   3711 C  CB  . PHE A 1 478 ? 173.602 172.818 -11.625 1.00 133.07 ? 551 PHE A CB  1 
ATOM   3712 C  CG  . PHE A 1 478 ? 175.060 172.456 -11.591 1.00 159.26 ? 551 PHE A CG  1 
ATOM   3713 C  CD1 . PHE A 1 478 ? 175.469 171.204 -11.160 1.00 156.08 ? 551 PHE A CD1 1 
ATOM   3714 C  CD2 . PHE A 1 478 ? 176.023 173.371 -11.985 1.00 172.00 ? 551 PHE A CD2 1 
ATOM   3715 C  CE1 . PHE A 1 478 ? 176.807 170.869 -11.128 1.00 156.84 ? 551 PHE A CE1 1 
ATOM   3716 C  CE2 . PHE A 1 478 ? 177.364 173.042 -11.954 1.00 177.96 ? 551 PHE A CE2 1 
ATOM   3717 C  CZ  . PHE A 1 478 ? 177.756 171.789 -11.525 1.00 171.38 ? 551 PHE A CZ  1 
ATOM   3718 N  N   . ILE A 1 479 ? 172.114 173.027 -8.855  1.00 110.55 ? 552 ILE A N   1 
ATOM   3719 C  CA  . ILE A 1 479 ? 172.183 173.295 -7.421  1.00 87.58  ? 552 ILE A CA  1 
ATOM   3720 C  C   . ILE A 1 479 ? 171.506 172.180 -6.632  1.00 113.61 ? 552 ILE A C   1 
ATOM   3721 O  O   . ILE A 1 479 ? 172.071 171.652 -5.664  1.00 85.44  ? 552 ILE A O   1 
ATOM   3722 C  CB  . ILE A 1 479 ? 171.559 174.664 -7.096  1.00 89.08  ? 552 ILE A CB  1 
ATOM   3723 C  CG1 . ILE A 1 479 ? 172.152 175.759 -7.981  1.00 90.36  ? 552 ILE A CG1 1 
ATOM   3724 C  CG2 . ILE A 1 479 ? 171.751 175.004 -5.628  1.00 97.66  ? 552 ILE A CG2 1 
ATOM   3725 C  CD1 . ILE A 1 479 ? 171.501 177.105 -7.774  1.00 92.08  ? 552 ILE A CD1 1 
ATOM   3726 N  N   . ILE A 1 480 ? 170.290 171.798 -7.040  1.00 141.88 ? 553 ILE A N   1 
ATOM   3727 C  CA  . ILE A 1 480 ? 169.573 170.722 -6.353  1.00 118.41 ? 553 ILE A CA  1 
ATOM   3728 C  C   . ILE A 1 480 ? 170.406 169.446 -6.348  1.00 95.32  ? 553 ILE A C   1 
ATOM   3729 O  O   . ILE A 1 480 ? 170.557 168.784 -5.314  1.00 91.19  ? 553 ILE A O   1 
ATOM   3730 C  CB  . ILE A 1 480 ? 168.192 170.495 -6.995  1.00 119.23 ? 553 ILE A CB  1 
ATOM   3731 C  CG1 . ILE A 1 480 ? 167.178 171.485 -6.431  1.00 103.89 ? 553 ILE A CG1 1 
ATOM   3732 C  CG2 . ILE A 1 480 ? 167.699 169.091 -6.707  1.00 127.92 ? 553 ILE A CG2 1 
ATOM   3733 C  CD1 . ILE A 1 480 ? 166.748 171.153 -5.018  1.00 117.16 ? 553 ILE A CD1 1 
ATOM   3734 N  N   . ALA A 1 481 ? 170.921 169.061 -7.518  1.00 105.31 ? 554 ALA A N   1 
ATOM   3735 C  CA  . ALA A 1 481 ? 171.739 167.857 -7.619  1.00 83.47  ? 554 ALA A CA  1 
ATOM   3736 C  C   . ALA A 1 481 ? 172.990 167.961 -6.757  1.00 100.30 ? 554 ALA A C   1 
ATOM   3737 O  O   . ALA A 1 481 ? 173.399 166.983 -6.118  1.00 100.98 ? 554 ALA A O   1 
ATOM   3738 C  CB  . ALA A 1 481 ? 172.119 167.609 -9.077  1.00 83.86  ? 554 ALA A CB  1 
ATOM   3739 N  N   . SER A 1 482 ? 173.627 169.133 -6.750  1.00 83.30  ? 555 SER A N   1 
ATOM   3740 C  CA  . SER A 1 482 ? 174.834 169.325 -5.953  1.00 82.74  ? 555 SER A CA  1 
ATOM   3741 C  C   . SER A 1 482 ? 174.556 169.140 -4.467  1.00 82.11  ? 555 SER A C   1 
ATOM   3742 O  O   . SER A 1 482 ? 175.346 168.512 -3.753  1.00 106.37 ? 555 SER A O   1 
ATOM   3743 C  CB  . SER A 1 482 ? 175.413 170.710 -6.219  1.00 101.68 ? 555 SER A CB  1 
ATOM   3744 O  OG  . SER A 1 482 ? 176.529 170.962 -5.386  1.00 116.97 ? 555 SER A OG  1 
ATOM   3745 N  N   . PHE A 1 483 ? 173.430 169.668 -3.986  1.00 82.71  ? 556 PHE A N   1 
ATOM   3746 C  CA  . PHE A 1 483 ? 173.076 169.502 -2.579  1.00 87.19  ? 556 PHE A CA  1 
ATOM   3747 C  C   . PHE A 1 483 ? 172.728 168.053 -2.269  1.00 103.39 ? 556 PHE A C   1 
ATOM   3748 O  O   . PHE A 1 483 ? 173.261 167.466 -1.321  1.00 123.82 ? 556 PHE A O   1 
ATOM   3749 C  CB  . PHE A 1 483 ? 171.914 170.419 -2.211  1.00 117.15 ? 556 PHE A CB  1 
ATOM   3750 C  CG  . PHE A 1 483 ? 171.409 170.221 -0.809  1.00 120.24 ? 556 PHE A CG  1 
ATOM   3751 C  CD1 . PHE A 1 483 ? 172.135 170.684 0.276   1.00 128.20 ? 556 PHE A CD1 1 
ATOM   3752 C  CD2 . PHE A 1 483 ? 170.212 169.564 -0.578  1.00 113.18 ? 556 PHE A CD2 1 
ATOM   3753 C  CE1 . PHE A 1 483 ? 171.673 170.499 1.566   1.00 116.28 ? 556 PHE A CE1 1 
ATOM   3754 C  CE2 . PHE A 1 483 ? 169.746 169.376 0.709   1.00 105.10 ? 556 PHE A CE2 1 
ATOM   3755 C  CZ  . PHE A 1 483 ? 170.478 169.844 1.782   1.00 109.28 ? 556 PHE A CZ  1 
ATOM   3756 N  N   . LEU A 1 484 ? 171.822 167.464 -3.051  1.00 110.75 ? 557 LEU A N   1 
ATOM   3757 C  CA  . LEU A 1 484 ? 171.363 166.108 -2.772  1.00 112.96 ? 557 LEU A CA  1 
ATOM   3758 C  C   . LEU A 1 484 ? 172.510 165.108 -2.847  1.00 136.11 ? 557 LEU A C   1 
ATOM   3759 O  O   . LEU A 1 484 ? 172.501 164.096 -2.136  1.00 132.87 ? 557 LEU A O   1 
ATOM   3760 C  CB  . LEU A 1 484 ? 170.255 165.725 -3.753  1.00 113.39 ? 557 LEU A CB  1 
ATOM   3761 C  CG  . LEU A 1 484 ? 168.932 166.488 -3.639  1.00 114.41 ? 557 LEU A CG  1 
ATOM   3762 C  CD1 . LEU A 1 484 ? 167.927 165.964 -4.652  1.00 136.15 ? 557 LEU A CD1 1 
ATOM   3763 C  CD2 . LEU A 1 484 ? 168.365 166.406 -2.230  1.00 114.15 ? 557 LEU A CD2 1 
ATOM   3764 N  N   . MET A 1 485 ? 173.507 165.375 -3.697  1.00 136.16 ? 558 MET A N   1 
ATOM   3765 C  CA  . MET A 1 485 ? 174.643 164.469 -3.833  1.00 114.83 ? 558 MET A CA  1 
ATOM   3766 C  C   . MET A 1 485 ? 175.581 164.542 -2.634  1.00 110.58 ? 558 MET A C   1 
ATOM   3767 O  O   . MET A 1 485 ? 176.268 163.560 -2.330  1.00 114.53 ? 558 MET A O   1 
ATOM   3768 C  CB  . MET A 1 485 ? 175.414 164.777 -5.118  1.00 113.77 ? 558 MET A CB  1 
ATOM   3769 C  CG  . MET A 1 485 ? 174.870 164.099 -6.362  1.00 110.51 ? 558 MET A CG  1 
ATOM   3770 S  SD  . MET A 1 485 ? 174.689 162.318 -6.155  1.00 94.47  ? 558 MET A SD  1 
ATOM   3771 C  CE  . MET A 1 485 ? 174.378 161.821 -7.850  1.00 106.71 ? 558 MET A CE  1 
ATOM   3772 N  N   . SER A 1 486 ? 175.646 165.693 -1.955  1.00 142.31 ? 559 SER A N   1 
ATOM   3773 C  CA  . SER A 1 486 ? 176.518 165.860 -0.796  1.00 151.01 ? 559 SER A CA  1 
ATOM   3774 C  C   . SER A 1 486 ? 176.032 166.993 0.102   1.00 146.55 ? 559 SER A C   1 
ATOM   3775 O  O   . SER A 1 486 ? 176.508 168.129 -0.019  1.00 137.48 ? 559 SER A O   1 
ATOM   3776 C  CB  . SER A 1 486 ? 177.961 166.123 -1.233  1.00 162.33 ? 559 SER A CB  1 
ATOM   3777 O  OG  . SER A 1 486 ? 178.508 165.002 -1.906  1.00 174.57 ? 559 SER A OG  1 
ATOM   3778 N  N   . PRO A 1 487 ? 175.084 166.728 0.999   1.00 147.65 ? 560 PRO A N   1 
ATOM   3779 C  CA  . PRO A 1 487 ? 174.643 167.755 1.954   1.00 111.47 ? 560 PRO A CA  1 
ATOM   3780 C  C   . PRO A 1 487 ? 175.770 168.162 2.886   1.00 99.63  ? 560 PRO A C   1 
ATOM   3781 O  O   . PRO A 1 487 ? 176.501 167.308 3.411   1.00 104.47 ? 560 PRO A O   1 
ATOM   3782 C  CB  . PRO A 1 487 ? 173.506 167.062 2.721   1.00 112.13 ? 560 PRO A CB  1 
ATOM   3783 C  CG  . PRO A 1 487 ? 173.065 165.949 1.832   1.00 132.74 ? 560 PRO A CG  1 
ATOM   3784 C  CD  . PRO A 1 487 ? 174.302 165.488 1.127   1.00 141.84 ? 560 PRO A CD  1 
ATOM   3785 N  N   . PRO A 1 488 ? 175.942 169.464 3.110   1.00 80.10  ? 561 PRO A N   1 
ATOM   3786 C  CA  . PRO A 1 488 ? 177.048 169.942 3.951   1.00 103.93 ? 561 PRO A CA  1 
ATOM   3787 C  C   . PRO A 1 488 ? 176.902 169.554 5.417   1.00 112.72 ? 561 PRO A C   1 
ATOM   3788 O  O   . PRO A 1 488 ? 175.802 169.542 5.974   1.00 111.94 ? 561 PRO A O   1 
ATOM   3789 C  CB  . PRO A 1 488 ? 176.990 171.463 3.776   1.00 111.90 ? 561 PRO A CB  1 
ATOM   3790 C  CG  . PRO A 1 488 ? 175.562 171.740 3.424   1.00 103.41 ? 561 PRO A CG  1 
ATOM   3791 C  CD  . PRO A 1 488 ? 175.106 170.567 2.607   1.00 97.11  ? 561 PRO A CD  1 
ATOM   3792 N  N   . GLN A 1 489 ? 178.038 169.227 6.032   1.00 137.89 ? 562 GLN A N   1 
ATOM   3793 C  CA  . GLN A 1 489 ? 178.093 168.899 7.454   1.00 138.85 ? 562 GLN A CA  1 
ATOM   3794 C  C   . GLN A 1 489 ? 177.858 170.155 8.290   1.00 129.95 ? 562 GLN A C   1 
ATOM   3795 O  O   . GLN A 1 489 ? 178.635 171.113 8.212   1.00 149.95 ? 562 GLN A O   1 
ATOM   3796 C  CB  . GLN A 1 489 ? 179.452 168.284 7.789   1.00 155.95 ? 562 GLN A CB  1 
ATOM   3797 C  CG  . GLN A 1 489 ? 179.603 167.754 9.211   1.00 163.90 ? 562 GLN A CG  1 
ATOM   3798 C  CD  . GLN A 1 489 ? 178.678 166.595 9.515   1.00 171.29 ? 562 GLN A CD  1 
ATOM   3799 O  OE1 . GLN A 1 489 ? 178.738 165.552 8.865   1.00 169.23 ? 562 GLN A OE1 1 
ATOM   3800 N  NE2 . GLN A 1 489 ? 177.817 166.770 10.511  1.00 181.37 ? 562 GLN A NE2 1 
ATOM   3801 N  N   . LEU A 1 490 ? 176.780 170.164 9.074   1.00 109.13 ? 563 LEU A N   1 
ATOM   3802 C  CA  . LEU A 1 490 ? 176.375 171.359 9.805   1.00 99.75  ? 563 LEU A CA  1 
ATOM   3803 C  C   . LEU A 1 490 ? 177.140 171.488 11.120  1.00 117.13 ? 563 LEU A C   1 
ATOM   3804 O  O   . LEU A 1 490 ? 177.354 170.502 11.832  1.00 134.23 ? 563 LEU A O   1 
ATOM   3805 C  CB  . LEU A 1 490 ? 174.870 171.349 10.077  1.00 96.00  ? 563 LEU A CB  1 
ATOM   3806 C  CG  . LEU A 1 490 ? 173.907 171.158 8.904   1.00 98.34  ? 563 LEU A CG  1 
ATOM   3807 C  CD1 . LEU A 1 490 ? 172.470 171.301 9.369   1.00 83.16  ? 563 LEU A CD1 1 
ATOM   3808 C  CD2 . LEU A 1 490 ? 174.207 172.153 7.796   1.00 97.87  ? 563 LEU A CD2 1 
ATOM   3809 N  N   . ARG A 1 491 ? 177.548 172.717 11.438  1.00 112.19 ? 564 ARG A N   1 
ATOM   3810 C  CA  . ARG A 1 491 ? 178.246 173.025 12.680  1.00 82.92  ? 564 ARG A CA  1 
ATOM   3811 C  C   . ARG A 1 491 ? 177.878 174.434 13.122  1.00 84.62  ? 564 ARG A C   1 
ATOM   3812 O  O   . ARG A 1 491 ? 177.816 175.350 12.297  1.00 102.84 ? 564 ARG A O   1 
ATOM   3813 C  CB  . ARG A 1 491 ? 179.768 172.916 12.517  1.00 119.80 ? 564 ARG A CB  1 
ATOM   3814 C  CG  . ARG A 1 491 ? 180.553 173.346 13.751  1.00 126.93 ? 564 ARG A CG  1 
ATOM   3815 C  CD  . ARG A 1 491 ? 182.045 173.320 13.504  1.00 126.85 ? 564 ARG A CD  1 
ATOM   3816 N  NE  . ARG A 1 491 ? 182.798 173.798 14.660  1.00 146.78 ? 564 ARG A NE  1 
ATOM   3817 C  CZ  . ARG A 1 491 ? 183.184 173.028 15.672  1.00 163.86 ? 564 ARG A CZ  1 
ATOM   3818 N  NH1 . ARG A 1 491 ? 183.868 173.549 16.681  1.00 180.76 ? 564 ARG A NH1 1 
ATOM   3819 N  NH2 . ARG A 1 491 ? 182.892 171.734 15.672  1.00 164.79 ? 564 ARG A NH2 1 
ATOM   3820 N  N   . LEU A 1 492 ? 177.623 174.600 14.421  1.00 97.04  ? 565 LEU A N   1 
ATOM   3821 C  CA  . LEU A 1 492 ? 177.254 175.901 14.977  1.00 87.01  ? 565 LEU A CA  1 
ATOM   3822 C  C   . LEU A 1 492 ? 177.663 175.953 16.442  1.00 87.37  ? 565 LEU A C   1 
ATOM   3823 O  O   . LEU A 1 492 ? 177.222 175.119 17.238  1.00 90.79  ? 565 LEU A O   1 
ATOM   3824 C  CB  . LEU A 1 492 ? 175.753 176.171 14.821  1.00 87.94  ? 565 LEU A CB  1 
ATOM   3825 C  CG  . LEU A 1 492 ? 175.192 177.447 15.463  1.00 90.03  ? 565 LEU A CG  1 
ATOM   3826 C  CD1 . LEU A 1 492 ? 175.757 178.689 14.793  1.00 91.18  ? 565 LEU A CD1 1 
ATOM   3827 C  CD2 . LEU A 1 492 ? 173.670 177.465 15.408  1.00 90.86  ? 565 LEU A CD2 1 
ATOM   3828 N  N   . PHE A 1 493 ? 178.504 176.931 16.786  1.00 106.58 ? 566 PHE A N   1 
ATOM   3829 C  CA  . PHE A 1 493 ? 178.941 177.194 18.161  1.00 141.65 ? 566 PHE A CA  1 
ATOM   3830 C  C   . PHE A 1 493 ? 179.568 175.968 18.830  1.00 150.13 ? 566 PHE A C   1 
ATOM   3831 O  O   . PHE A 1 493 ? 179.099 175.485 19.863  1.00 171.57 ? 566 PHE A O   1 
ATOM   3832 C  CB  . PHE A 1 493 ? 177.778 177.718 19.011  1.00 129.50 ? 566 PHE A CB  1 
ATOM   3833 C  CG  . PHE A 1 493 ? 177.426 179.148 18.752  1.00 138.57 ? 566 PHE A CG  1 
ATOM   3834 C  CD1 . PHE A 1 493 ? 178.389 180.045 18.322  1.00 145.16 ? 566 PHE A CD1 1 
ATOM   3835 C  CD2 . PHE A 1 493 ? 176.132 179.600 18.948  1.00 143.75 ? 566 PHE A CD2 1 
ATOM   3836 C  CE1 . PHE A 1 493 ? 178.067 181.366 18.090  1.00 163.99 ? 566 PHE A CE1 1 
ATOM   3837 C  CE2 . PHE A 1 493 ? 175.802 180.918 18.715  1.00 163.01 ? 566 PHE A CE2 1 
ATOM   3838 C  CZ  . PHE A 1 493 ? 176.770 181.804 18.285  1.00 171.92 ? 566 PHE A CZ  1 
ATOM   3839 N  N   . GLN A 1 494 ? 180.657 175.483 18.230  1.00 149.17 ? 567 GLN A N   1 
ATOM   3840 C  CA  . GLN A 1 494 ? 181.406 174.347 18.776  1.00 157.20 ? 567 GLN A CA  1 
ATOM   3841 C  C   . GLN A 1 494 ? 180.506 173.136 19.017  1.00 156.63 ? 567 GLN A C   1 
ATOM   3842 O  O   . GLN A 1 494 ? 180.711 172.371 19.963  1.00 165.71 ? 567 GLN A O   1 
ATOM   3843 C  CB  . GLN A 1 494 ? 182.133 174.739 20.068  1.00 166.19 ? 567 GLN A CB  1 
ATOM   3844 C  CG  . GLN A 1 494 ? 182.754 176.136 20.059  1.00 180.80 ? 567 GLN A CG  1 
ATOM   3845 C  CD  . GLN A 1 494 ? 183.767 176.334 18.947  1.00 193.45 ? 567 GLN A CD  1 
ATOM   3846 O  OE1 . GLN A 1 494 ? 184.449 175.395 18.538  1.00 213.36 ? 567 GLN A OE1 1 
ATOM   3847 N  NE2 . GLN A 1 494 ? 183.871 177.563 18.453  1.00 188.50 ? 567 GLN A NE2 1 
ATOM   3848 N  N   . TYR A 1 495 ? 179.497 172.952 18.166  1.00 137.92 ? 568 TYR A N   1 
ATOM   3849 C  CA  . TYR A 1 495 ? 178.550 171.848 18.308  1.00 117.66 ? 568 TYR A CA  1 
ATOM   3850 C  C   . TYR A 1 495 ? 178.275 171.247 16.938  1.00 117.52 ? 568 TYR A C   1 
ATOM   3851 O  O   . TYR A 1 495 ? 177.667 171.897 16.083  1.00 121.65 ? 568 TYR A O   1 
ATOM   3852 C  CB  . TYR A 1 495 ? 177.249 172.319 18.959  1.00 110.48 ? 568 TYR A CB  1 
ATOM   3853 C  CG  . TYR A 1 495 ? 176.110 171.325 18.863  1.00 102.56 ? 568 TYR A CG  1 
ATOM   3854 C  CD1 . TYR A 1 495 ? 176.067 170.208 19.686  1.00 137.56 ? 568 TYR A CD1 1 
ATOM   3855 C  CD2 . TYR A 1 495 ? 175.066 171.517 17.966  1.00 103.61 ? 568 TYR A CD2 1 
ATOM   3856 C  CE1 . TYR A 1 495 ? 175.026 169.299 19.608  1.00 135.83 ? 568 TYR A CE1 1 
ATOM   3857 C  CE2 . TYR A 1 495 ? 174.019 170.613 17.881  1.00 101.74 ? 568 TYR A CE2 1 
ATOM   3858 C  CZ  . TYR A 1 495 ? 174.005 169.507 18.705  1.00 114.46 ? 568 TYR A CZ  1 
ATOM   3859 O  OH  . TYR A 1 495 ? 172.970 168.603 18.632  1.00 116.59 ? 568 TYR A OH  1 
ATOM   3860 N  N   . ASN A 1 496 ? 178.706 170.004 16.741  1.00 124.05 ? 569 ASN A N   1 
ATOM   3861 C  CA  . ASN A 1 496 ? 178.490 169.301 15.486  1.00 116.64 ? 569 ASN A CA  1 
ATOM   3862 C  C   . ASN A 1 496 ? 177.118 168.642 15.517  1.00 108.48 ? 569 ASN A C   1 
ATOM   3863 O  O   . ASN A 1 496 ? 176.749 168.005 16.509  1.00 112.75 ? 569 ASN A O   1 
ATOM   3864 C  CB  . ASN A 1 496 ? 179.584 168.259 15.249  1.00 124.88 ? 569 ASN A CB  1 
ATOM   3865 C  CG  . ASN A 1 496 ? 180.970 168.871 15.220  1.00 141.12 ? 569 ASN A CG  1 
ATOM   3866 O  OD1 . ASN A 1 496 ? 181.401 169.414 14.203  1.00 131.17 ? 569 ASN A OD1 1 
ATOM   3867 N  ND2 . ASN A 1 496 ? 181.677 168.786 16.341  1.00 159.46 ? 569 ASN A ND2 1 
ATOM   3868 N  N   . TYR A 1 497 ? 176.367 168.808 14.437  1.00 117.83 ? 570 TYR A N   1 
ATOM   3869 C  CA  . TYR A 1 497 ? 175.023 168.258 14.369  1.00 94.32  ? 570 TYR A CA  1 
ATOM   3870 C  C   . TYR A 1 497 ? 175.048 166.733 14.302  1.00 81.86  ? 570 TYR A C   1 
ATOM   3871 O  O   . TYR A 1 497 ? 175.951 166.149 13.694  1.00 97.04  ? 570 TYR A O   1 
ATOM   3872 C  CB  . TYR A 1 497 ? 174.274 168.828 13.171  1.00 80.77  ? 570 TYR A CB  1 
ATOM   3873 C  CG  . TYR A 1 497 ? 173.775 170.228 13.414  1.00 82.26  ? 570 TYR A CG  1 
ATOM   3874 C  CD1 . TYR A 1 497 ? 174.657 171.279 13.609  1.00 82.83  ? 570 TYR A CD1 1 
ATOM   3875 C  CD2 . TYR A 1 497 ? 172.415 170.495 13.457  1.00 103.15 ? 570 TYR A CD2 1 
ATOM   3876 C  CE1 . TYR A 1 497 ? 174.197 172.556 13.838  1.00 84.37  ? 570 TYR A CE1 1 
ATOM   3877 C  CE2 . TYR A 1 497 ? 171.947 171.769 13.684  1.00 84.79  ? 570 TYR A CE2 1 
ATOM   3878 C  CZ  . TYR A 1 497 ? 172.842 172.794 13.872  1.00 85.36  ? 570 TYR A CZ  1 
ATOM   3879 O  OH  . TYR A 1 497 ? 172.381 174.065 14.100  1.00 87.07  ? 570 TYR A OH  1 
ATOM   3880 N  N   . PRO A 1 498 ? 174.083 166.070 14.938  1.00 82.86  ? 571 PRO A N   1 
ATOM   3881 C  CA  . PRO A 1 498 ? 173.988 164.610 14.853  1.00 84.80  ? 571 PRO A CA  1 
ATOM   3882 C  C   . PRO A 1 498 ? 173.863 164.135 13.413  1.00 104.21 ? 571 PRO A C   1 
ATOM   3883 O  O   . PRO A 1 498 ? 173.457 164.875 12.513  1.00 119.78 ? 571 PRO A O   1 
ATOM   3884 C  CB  . PRO A 1 498 ? 172.720 164.292 15.652  1.00 90.17  ? 571 PRO A CB  1 
ATOM   3885 C  CG  . PRO A 1 498 ? 172.583 165.434 16.600  1.00 93.97  ? 571 PRO A CG  1 
ATOM   3886 C  CD  . PRO A 1 498 ? 173.066 166.636 15.840  1.00 100.82 ? 571 PRO A CD  1 
ATOM   3887 N  N   . TYR A 1 499 ? 174.203 162.862 13.208  1.00 99.23  ? 572 TYR A N   1 
ATOM   3888 C  CA  . TYR A 1 499 ? 174.171 162.288 11.870  1.00 108.70 ? 572 TYR A CA  1 
ATOM   3889 C  C   . TYR A 1 499 ? 172.758 162.195 11.311  1.00 98.34  ? 572 TYR A C   1 
ATOM   3890 O  O   . TYR A 1 499 ? 172.594 162.179 10.088  1.00 102.77 ? 572 TYR A O   1 
ATOM   3891 C  CB  . TYR A 1 499 ? 174.801 160.893 11.886  1.00 134.82 ? 572 TYR A CB  1 
ATOM   3892 C  CG  . TYR A 1 499 ? 174.117 159.932 12.837  1.00 152.15 ? 572 TYR A CG  1 
ATOM   3893 C  CD1 . TYR A 1 499 ? 174.420 159.929 14.194  1.00 160.49 ? 572 TYR A CD1 1 
ATOM   3894 C  CD2 . TYR A 1 499 ? 173.160 159.035 12.380  1.00 145.35 ? 572 TYR A CD2 1 
ATOM   3895 C  CE1 . TYR A 1 499 ? 173.793 159.057 15.064  1.00 162.30 ? 572 TYR A CE1 1 
ATOM   3896 C  CE2 . TYR A 1 499 ? 172.529 158.160 13.241  1.00 151.63 ? 572 TYR A CE2 1 
ATOM   3897 C  CZ  . TYR A 1 499 ? 172.848 158.175 14.582  1.00 149.35 ? 572 TYR A CZ  1 
ATOM   3898 O  OH  . TYR A 1 499 ? 172.226 157.307 15.448  1.00 153.38 ? 572 TYR A OH  1 
ATOM   3899 N  N   . TRP A 1 500 ? 171.741 162.163 12.170  1.00 97.17  ? 573 TRP A N   1 
ATOM   3900 C  CA  . TRP A 1 500 ? 170.356 162.029 11.739  1.00 78.35  ? 573 TRP A CA  1 
ATOM   3901 C  C   . TRP A 1 500 ? 169.683 163.361 11.430  1.00 79.35  ? 573 TRP A C   1 
ATOM   3902 O  O   . TRP A 1 500 ? 168.495 163.370 11.084  1.00 92.16  ? 573 TRP A O   1 
ATOM   3903 C  CB  . TRP A 1 500 ? 169.546 161.282 12.802  1.00 78.75  ? 573 TRP A CB  1 
ATOM   3904 C  CG  . TRP A 1 500 ? 169.664 161.865 14.182  1.00 109.48 ? 573 TRP A CG  1 
ATOM   3905 C  CD1 . TRP A 1 500 ? 170.489 161.435 15.179  1.00 114.58 ? 573 TRP A CD1 1 
ATOM   3906 C  CD2 . TRP A 1 500 ? 168.942 162.987 14.717  1.00 104.34 ? 573 TRP A CD2 1 
ATOM   3907 N  NE1 . TRP A 1 500 ? 170.322 162.209 16.301  1.00 116.07 ? 573 TRP A NE1 1 
ATOM   3908 C  CE2 . TRP A 1 500 ? 169.381 163.170 16.043  1.00 100.55 ? 573 TRP A CE2 1 
ATOM   3909 C  CE3 . TRP A 1 500 ? 167.965 163.848 14.205  1.00 115.65 ? 573 TRP A CE3 1 
ATOM   3910 C  CZ2 . TRP A 1 500 ? 168.882 164.181 16.863  1.00 88.74  ? 573 TRP A CZ2 1 
ATOM   3911 C  CZ3 . TRP A 1 500 ? 167.471 164.851 15.022  1.00 112.60 ? 573 TRP A CZ3 1 
ATOM   3912 C  CH2 . TRP A 1 500 ? 167.931 165.009 16.335  1.00 109.58 ? 573 TRP A CH2 1 
ATOM   3913 N  N   . SER A 1 501 ? 170.413 164.475 11.510  1.00 100.78 ? 574 SER A N   1 
ATOM   3914 C  CA  . SER A 1 501 ? 169.805 165.775 11.246  1.00 80.65  ? 574 SER A CA  1 
ATOM   3915 C  C   . SER A 1 501 ? 169.274 165.843 9.821   1.00 91.24  ? 574 SER A C   1 
ATOM   3916 O  O   . SER A 1 501 ? 168.157 166.326 9.588   1.00 102.56 ? 574 SER A O   1 
ATOM   3917 C  CB  . SER A 1 501 ? 170.817 166.890 11.502  1.00 80.82  ? 574 SER A CB  1 
ATOM   3918 O  OG  . SER A 1 501 ? 171.329 166.812 12.820  1.00 80.74  ? 574 SER A OG  1 
ATOM   3919 N  N   . ILE A 1 502 ? 169.995 165.232 8.879   1.00 79.85  ? 575 ILE A N   1 
ATOM   3920 C  CA  . ILE A 1 502 ? 169.578 165.262 7.483   1.00 103.51 ? 575 ILE A CA  1 
ATOM   3921 C  C   . ILE A 1 502 ? 168.283 164.486 7.328   1.00 106.43 ? 575 ILE A C   1 
ATOM   3922 O  O   . ILE A 1 502 ? 167.463 164.794 6.453   1.00 121.16 ? 575 ILE A O   1 
ATOM   3923 C  CB  . ILE A 1 502 ? 170.694 164.705 6.578   1.00 79.00  ? 575 ILE A CB  1 
ATOM   3924 C  CG1 . ILE A 1 502 ? 170.312 164.828 5.102   1.00 79.29  ? 575 ILE A CG1 1 
ATOM   3925 C  CG2 . ILE A 1 502 ? 170.993 163.251 6.923   1.00 78.09  ? 575 ILE A CG2 1 
ATOM   3926 C  CD1 . ILE A 1 502 ? 170.105 166.251 4.640   1.00 80.27  ? 575 ILE A CD1 1 
ATOM   3927 N  N   . ILE A 1 503 ? 168.059 163.492 8.186   1.00 108.95 ? 576 ILE A N   1 
ATOM   3928 C  CA  . ILE A 1 503 ? 166.832 162.717 8.101   1.00 94.07  ? 576 ILE A CA  1 
ATOM   3929 C  C   . ILE A 1 503 ? 165.659 163.581 8.536   1.00 94.05  ? 576 ILE A C   1 
ATOM   3930 O  O   . ILE A 1 503 ? 164.577 163.535 7.938   1.00 108.42 ? 576 ILE A O   1 
ATOM   3931 C  CB  . ILE A 1 503 ? 166.942 161.450 8.965   1.00 84.25  ? 576 ILE A CB  1 
ATOM   3932 C  CG1 . ILE A 1 503 ? 168.233 160.702 8.647   1.00 110.43 ? 576 ILE A CG1 1 
ATOM   3933 C  CG2 . ILE A 1 503 ? 165.746 160.545 8.724   1.00 80.83  ? 576 ILE A CG2 1 
ATOM   3934 C  CD1 . ILE A 1 503 ? 168.524 159.576 9.612   1.00 113.74 ? 576 ILE A CD1 1 
ATOM   3935 N  N   . LEU A 1 504 ? 165.861 164.396 9.575   1.00 82.74  ? 577 LEU A N   1 
ATOM   3936 C  CA  . LEU A 1 504 ? 164.797 165.276 10.043  1.00 100.52 ? 577 LEU A CA  1 
ATOM   3937 C  C   . LEU A 1 504 ? 164.523 166.389 9.039   1.00 104.72 ? 577 LEU A C   1 
ATOM   3938 O  O   . LEU A 1 504 ? 163.366 166.638 8.675   1.00 99.80  ? 577 LEU A O   1 
ATOM   3939 C  CB  . LEU A 1 504 ? 165.168 165.854 11.410  1.00 84.23  ? 577 LEU A CB  1 
ATOM   3940 C  CG  . LEU A 1 504 ? 164.176 166.820 12.055  1.00 85.97  ? 577 LEU A CG  1 
ATOM   3941 C  CD1 . LEU A 1 504 ? 162.778 166.228 12.056  1.00 101.77 ? 577 LEU A CD1 1 
ATOM   3942 C  CD2 . LEU A 1 504 ? 164.618 167.147 13.470  1.00 86.23  ? 577 LEU A CD2 1 
ATOM   3943 N  N   . GLY A 1 505 ? 165.582 167.019 8.531   1.00 84.16  ? 578 GLY A N   1 
ATOM   3944 C  CA  . GLY A 1 505 ? 165.405 168.062 7.534   1.00 84.97  ? 578 GLY A CA  1 
ATOM   3945 C  C   . GLY A 1 505 ? 164.679 167.574 6.297   1.00 85.08  ? 578 GLY A C   1 
ATOM   3946 O  O   . GLY A 1 505 ? 163.673 168.161 5.885   1.00 86.37  ? 578 GLY A O   1 
ATOM   3947 N  N   . TYR A 1 506 ? 165.085 166.411 5.778   1.00 118.78 ? 579 TYR A N   1 
ATOM   3948 C  CA  . TYR A 1 506 ? 164.394 165.885 4.610   1.00 118.72 ? 579 TYR A CA  1 
ATOM   3949 C  C   . TYR A 1 506 ? 162.968 165.526 4.969   1.00 119.88 ? 579 TYR A C   1 
ATOM   3950 O  O   . TYR A 1 506 ? 162.051 165.779 4.177   1.00 125.55 ? 579 TYR A O   1 
ATOM   3951 C  CB  . TYR A 1 506 ? 165.105 164.640 4.079   1.00 101.00 ? 579 TYR A CB  1 
ATOM   3952 C  CG  . TYR A 1 506 ? 166.272 164.905 3.159   1.00 102.40 ? 579 TYR A CG  1 
ATOM   3953 C  CD1 . TYR A 1 506 ? 166.533 166.178 2.675   1.00 118.62 ? 579 TYR A CD1 1 
ATOM   3954 C  CD2 . TYR A 1 506 ? 167.118 163.872 2.778   1.00 92.76  ? 579 TYR A CD2 1 
ATOM   3955 C  CE1 . TYR A 1 506 ? 167.609 166.415 1.838   1.00 109.16 ? 579 TYR A CE1 1 
ATOM   3956 C  CE2 . TYR A 1 506 ? 168.190 164.098 1.944   1.00 85.20  ? 579 TYR A CE2 1 
ATOM   3957 C  CZ  . TYR A 1 506 ? 168.433 165.370 1.476   1.00 90.58  ? 579 TYR A CZ  1 
ATOM   3958 O  OH  . TYR A 1 506 ? 169.506 165.593 0.644   1.00 82.68  ? 579 TYR A OH  1 
ATOM   3959 N  N   . ALA A 1 507 ? 162.746 165.116 6.219   1.00 129.93 ? 580 ALA A N   1 
ATOM   3960 C  CA  . ALA A 1 507 ? 161.392 164.790 6.631   1.00 126.08 ? 580 ALA A CA  1 
ATOM   3961 C  C   . ALA A 1 507 ? 160.552 166.050 6.587   1.00 107.76 ? 580 ALA A C   1 
ATOM   3962 O  O   . ALA A 1 507 ? 159.420 166.036 6.091   1.00 124.11 ? 580 ALA A O   1 
ATOM   3963 C  CB  . ALA A 1 507 ? 161.389 164.169 8.028   1.00 107.46 ? 580 ALA A CB  1 
ATOM   3964 N  N   . ILE A 1 508 ? 161.098 167.152 7.098   1.00 88.18  ? 581 ILE A N   1 
ATOM   3965 C  CA  . ILE A 1 508 ? 160.371 168.409 7.033   1.00 102.07 ? 581 ILE A CA  1 
ATOM   3966 C  C   . ILE A 1 508 ? 160.280 168.882 5.588   1.00 110.26 ? 581 ILE A C   1 
ATOM   3967 O  O   . ILE A 1 508 ? 159.260 169.441 5.167   1.00 91.77  ? 581 ILE A O   1 
ATOM   3968 C  CB  . ILE A 1 508 ? 161.041 169.461 7.935   1.00 90.70  ? 581 ILE A CB  1 
ATOM   3969 C  CG1 . ILE A 1 508 ? 161.114 168.959 9.377   1.00 102.94 ? 581 ILE A CG1 1 
ATOM   3970 C  CG2 . ILE A 1 508 ? 160.283 170.779 7.874   1.00 92.31  ? 581 ILE A CG2 1 
ATOM   3971 C  CD1 . ILE A 1 508 ? 161.772 169.932 10.329  1.00 90.47  ? 581 ILE A CD1 1 
ATOM   3972 N  N   . GLY A 1 509 ? 161.340 168.664 4.805   1.00 115.16 ? 582 GLY A N   1 
ATOM   3973 C  CA  . GLY A 1 509 ? 161.318 169.120 3.424   1.00 111.58 ? 582 GLY A CA  1 
ATOM   3974 C  C   . GLY A 1 509 ? 160.280 168.414 2.573   1.00 118.46 ? 582 GLY A C   1 
ATOM   3975 O  O   . GLY A 1 509 ? 159.446 169.058 1.929   1.00 129.45 ? 582 GLY A O   1 
ATOM   3976 N  N   . THR A 1 510 ? 160.250 167.082 2.637   1.00 115.28 ? 583 THR A N   1 
ATOM   3977 C  CA  . THR A 1 510 ? 159.303 166.353 1.805   1.00 111.84 ? 583 THR A CA  1 
ATOM   3978 C  C   . THR A 1 510 ? 157.878 166.610 2.259   1.00 125.11 ? 583 THR A C   1 
ATOM   3979 O  O   . THR A 1 510 ? 156.984 166.805 1.420   1.00 128.09 ? 583 THR A O   1 
ATOM   3980 C  CB  . THR A 1 510 ? 159.622 164.863 1.850   1.00 106.52 ? 583 THR A CB  1 
ATOM   3981 O  OG1 . THR A 1 510 ? 159.732 164.440 3.214   1.00 127.31 ? 583 THR A OG1 1 
ATOM   3982 C  CG2 . THR A 1 510 ? 160.952 164.623 1.184   1.00 86.41  ? 583 THR A CG2 1 
ATOM   3983 N  N   . SER A 1 511 ? 157.689 166.804 3.566   1.00 123.97 ? 584 SER A N   1 
ATOM   3984 C  CA  . SER A 1 511 ? 156.356 167.031 4.092   1.00 104.62 ? 584 SER A CA  1 
ATOM   3985 C  C   . SER A 1 511 ? 155.813 168.358 3.606   1.00 104.16 ? 584 SER A C   1 
ATOM   3986 O  O   . SER A 1 511 ? 154.627 168.642 3.801   1.00 115.86 ? 584 SER A O   1 
ATOM   3987 C  CB  . SER A 1 511 ? 156.362 166.987 5.621   1.00 116.41 ? 584 SER A CB  1 
ATOM   3988 O  OG  . SER A 1 511 ? 157.084 168.081 6.160   1.00 123.04 ? 584 SER A OG  1 
ATOM   3989 N  N   . SER A 1 512 ? 156.667 169.183 2.999   1.00 122.10 ? 585 SER A N   1 
ATOM   3990 C  CA  . SER A 1 512 ? 156.196 170.459 2.498   1.00 126.59 ? 585 SER A CA  1 
ATOM   3991 C  C   . SER A 1 512 ? 155.508 170.271 1.154   1.00 138.90 ? 585 SER A C   1 
ATOM   3992 O  O   . SER A 1 512 ? 154.441 170.849 0.917   1.00 133.05 ? 585 SER A O   1 
ATOM   3993 C  CB  . SER A 1 512 ? 157.352 171.450 2.378   1.00 134.42 ? 585 SER A CB  1 
ATOM   3994 O  OG  . SER A 1 512 ? 158.337 170.984 1.473   1.00 134.57 ? 585 SER A OG  1 
ATOM   3995 N  N   . PHE A 1 513 ? 156.095 169.477 0.254   1.00 160.98 ? 586 PHE A N   1 
ATOM   3996 C  CA  . PHE A 1 513 ? 155.500 169.292 -1.066  1.00 162.02 ? 586 PHE A CA  1 
ATOM   3997 C  C   . PHE A 1 513 ? 154.839 167.925 -1.218  1.00 177.00 ? 586 PHE A C   1 
ATOM   3998 O  O   . PHE A 1 513 ? 154.614 167.464 -2.342  1.00 183.93 ? 586 PHE A O   1 
ATOM   3999 C  CB  . PHE A 1 513 ? 156.541 169.501 -2.163  1.00 125.85 ? 586 PHE A CB  1 
ATOM   4000 C  CG  . PHE A 1 513 ? 157.786 168.690 -1.977  1.00 121.41 ? 586 PHE A CG  1 
ATOM   4001 C  CD1 . PHE A 1 513 ? 157.879 167.413 -2.504  1.00 119.09 ? 586 PHE A CD1 1 
ATOM   4002 C  CD2 . PHE A 1 513 ? 158.861 169.200 -1.269  1.00 124.79 ? 586 PHE A CD2 1 
ATOM   4003 C  CE1 . PHE A 1 513 ? 159.024 166.662 -2.331  1.00 148.21 ? 586 PHE A CE1 1 
ATOM   4004 C  CE2 . PHE A 1 513 ? 160.008 168.453 -1.091  1.00 135.55 ? 586 PHE A CE2 1 
ATOM   4005 C  CZ  . PHE A 1 513 ? 160.089 167.183 -1.620  1.00 144.53 ? 586 PHE A CZ  1 
ATOM   4006 N  N   . ILE A 1 514 ? 154.234 167.425 -0.139  1.00 182.74 ? 587 ILE A N   1 
ATOM   4007 C  CA  . ILE A 1 514 ? 153.470 166.190 -0.256  1.00 189.54 ? 587 ILE A CA  1 
ATOM   4008 C  C   . ILE A 1 514 ? 152.190 166.480 -0.993  1.00 206.02 ? 587 ILE A C   1 
ATOM   4009 O  O   . ILE A 1 514 ? 151.498 165.565 -1.449  1.00 222.69 ? 587 ILE A O   1 
ATOM   4010 C  CB  . ILE A 1 514 ? 153.174 165.563 1.121   1.00 200.29 ? 587 ILE A CB  1 
ATOM   4011 C  CG1 . ILE A 1 514 ? 152.524 166.595 2.048   1.00 200.84 ? 587 ILE A CG1 1 
ATOM   4012 C  CG2 . ILE A 1 514 ? 154.435 164.960 1.723   1.00 207.49 ? 587 ILE A CG2 1 
ATOM   4013 C  CD1 . ILE A 1 514 ? 152.125 166.043 3.401   1.00 202.91 ? 587 ILE A CD1 1 
ATOM   4014 N  N   . CYS A 1 515 ? 151.889 167.762 -1.113  1.00 194.20 ? 588 CYS A N   1 
ATOM   4015 C  CA  . CYS A 1 515 ? 150.652 168.236 -1.679  1.00 194.57 ? 588 CYS A CA  1 
ATOM   4016 C  C   . CYS A 1 515 ? 150.749 168.252 -3.196  1.00 174.83 ? 588 CYS A C   1 
ATOM   4017 O  O   . CYS A 1 515 ? 149.729 168.081 -3.871  1.00 190.08 ? 588 CYS A O   1 
ATOM   4018 C  CB  . CYS A 1 515 ? 150.318 169.624 -1.136  1.00 209.17 ? 588 CYS A CB  1 
ATOM   4019 S  SG  . CYS A 1 515 ? 151.617 170.838 -1.406  1.00 221.76 ? 588 CYS A SG  1 
ATOM   4020 N  N   . ILE A 1 516 ? 151.946 168.457 -3.758  1.00 125.64 ? 589 ILE A N   1 
ATOM   4021 C  CA  . ILE A 1 516 ? 151.965 168.565 -5.221  1.00 119.34 ? 589 ILE A CA  1 
ATOM   4022 C  C   . ILE A 1 516 ? 151.713 167.226 -5.919  1.00 118.20 ? 589 ILE A C   1 
ATOM   4023 O  O   . ILE A 1 516 ? 150.925 167.208 -6.877  1.00 125.55 ? 589 ILE A O   1 
ATOM   4024 C  CB  . ILE A 1 516 ? 153.243 169.255 -5.743  1.00 121.81 ? 589 ILE A CB  1 
ATOM   4025 C  CG1 . ILE A 1 516 ? 153.394 169.038 -7.249  1.00 112.46 ? 589 ILE A CG1 1 
ATOM   4026 C  CG2 . ILE A 1 516 ? 154.490 168.833 -5.008  1.00 125.62 ? 589 ILE A CG2 1 
ATOM   4027 C  CD1 . ILE A 1 516 ? 154.515 169.833 -7.858  1.00 127.67 ? 589 ILE A CD1 1 
ATOM   4028 N  N   . PRO A 1 517 ? 152.315 166.092 -5.533  1.00 131.96 ? 590 PRO A N   1 
ATOM   4029 C  CA  . PRO A 1 517 ? 152.003 164.867 -6.282  1.00 136.58 ? 590 PRO A CA  1 
ATOM   4030 C  C   . PRO A 1 517 ? 150.626 164.325 -5.946  1.00 141.75 ? 590 PRO A C   1 
ATOM   4031 O  O   . PRO A 1 517 ? 149.906 163.892 -6.857  1.00 170.14 ? 590 PRO A O   1 
ATOM   4032 C  CB  . PRO A 1 517 ? 153.115 163.889 -5.864  1.00 161.64 ? 590 PRO A CB  1 
ATOM   4033 C  CG  . PRO A 1 517 ? 154.042 164.670 -4.970  1.00 169.90 ? 590 PRO A CG  1 
ATOM   4034 C  CD  . PRO A 1 517 ? 153.227 165.789 -4.421  1.00 161.05 ? 590 PRO A CD  1 
ATOM   4035 N  N   . THR A 1 518 ? 150.169 164.517 -4.703  1.00 142.18 ? 591 THR A N   1 
ATOM   4036 C  CA  . THR A 1 518 ? 148.857 164.025 -4.300  1.00 154.03 ? 591 THR A CA  1 
ATOM   4037 C  C   . THR A 1 518 ? 147.751 164.849 -4.922  1.00 152.34 ? 591 THR A C   1 
ATOM   4038 O  O   . THR A 1 518 ? 146.623 164.362 -5.054  1.00 156.16 ? 591 THR A O   1 
ATOM   4039 C  CB  . THR A 1 518 ? 148.710 164.040 -2.777  1.00 162.38 ? 591 THR A CB  1 
ATOM   4040 O  OG1 . THR A 1 518 ? 148.984 165.356 -2.282  1.00 151.99 ? 591 THR A OG1 1 
ATOM   4041 C  CG2 . THR A 1 518 ? 149.661 163.045 -2.135  1.00 171.91 ? 591 THR A CG2 1 
ATOM   4042 N  N   . TYR A 1 519 ? 148.050 166.083 -5.310  1.00 151.00 ? 592 TYR A N   1 
ATOM   4043 C  CA  . TYR A 1 519 ? 147.055 166.871 -6.013  1.00 147.55 ? 592 TYR A CA  1 
ATOM   4044 C  C   . TYR A 1 519 ? 147.044 166.451 -7.475  1.00 147.68 ? 592 TYR A C   1 
ATOM   4045 O  O   . TYR A 1 519 ? 145.978 166.379 -8.098  1.00 142.85 ? 592 TYR A O   1 
ATOM   4046 C  CB  . TYR A 1 519 ? 147.338 168.364 -5.874  1.00 151.60 ? 592 TYR A CB  1 
ATOM   4047 C  CG  . TYR A 1 519 ? 146.260 169.221 -6.489  1.00 165.28 ? 592 TYR A CG  1 
ATOM   4048 C  CD1 . TYR A 1 519 ? 145.094 169.501 -5.787  1.00 182.36 ? 592 TYR A CD1 1 
ATOM   4049 C  CD2 . TYR A 1 519 ? 146.387 169.727 -7.772  1.00 154.92 ? 592 TYR A CD2 1 
ATOM   4050 C  CE1 . TYR A 1 519 ? 144.094 170.276 -6.338  1.00 181.78 ? 592 TYR A CE1 1 
ATOM   4051 C  CE2 . TYR A 1 519 ? 145.389 170.499 -8.329  1.00 153.30 ? 592 TYR A CE2 1 
ATOM   4052 C  CZ  . TYR A 1 519 ? 144.248 170.773 -7.610  1.00 166.12 ? 592 TYR A CZ  1 
ATOM   4053 O  OH  . TYR A 1 519 ? 143.259 171.547 -8.169  1.00 169.69 ? 592 TYR A OH  1 
ATOM   4054 N  N   . ILE A 1 520 ? 148.225 166.129 -8.021  1.00 144.35 ? 593 ILE A N   1 
ATOM   4055 C  CA  . ILE A 1 520 ? 148.284 165.573 -9.369  1.00 132.90 ? 593 ILE A CA  1 
ATOM   4056 C  C   . ILE A 1 520 ? 147.469 164.293 -9.420  1.00 140.63 ? 593 ILE A C   1 
ATOM   4057 O  O   . ILE A 1 520 ? 146.680 164.073 -10.347 1.00 148.44 ? 593 ILE A O   1 
ATOM   4058 C  CB  . ILE A 1 520 ? 149.747 165.332 -9.788  1.00 114.62 ? 593 ILE A CB  1 
ATOM   4059 C  CG1 . ILE A 1 520 ? 150.442 166.658 -10.096 1.00 116.36 ? 593 ILE A CG1 1 
ATOM   4060 C  CG2 . ILE A 1 520 ? 149.817 164.397 -10.984 1.00 110.55 ? 593 ILE A CG2 1 
ATOM   4061 C  CD1 . ILE A 1 520 ? 151.883 166.510 -10.520 1.00 110.40 ? 593 ILE A CD1 1 
ATOM   4062 N  N   . ALA A 1 521 ? 147.627 163.443 -8.405  1.00 139.24 ? 594 ALA A N   1 
ATOM   4063 C  CA  . ALA A 1 521 ? 146.837 162.224 -8.326  1.00 143.86 ? 594 ALA A CA  1 
ATOM   4064 C  C   . ALA A 1 521 ? 145.368 162.556 -8.122  1.00 159.03 ? 594 ALA A C   1 
ATOM   4065 O  O   . ALA A 1 521 ? 144.494 161.817 -8.587  1.00 181.99 ? 594 ALA A O   1 
ATOM   4066 C  CB  . ALA A 1 521 ? 147.350 161.330 -7.198  1.00 132.88 ? 594 ALA A CB  1 
ATOM   4067 N  N   . TYR A 1 522 ? 145.083 163.659 -7.423  1.00 168.19 ? 595 TYR A N   1 
ATOM   4068 C  CA  . TYR A 1 522 ? 143.701 164.068 -7.195  1.00 193.58 ? 595 TYR A CA  1 
ATOM   4069 C  C   . TYR A 1 522 ? 143.004 164.392 -8.510  1.00 202.65 ? 595 TYR A C   1 
ATOM   4070 O  O   . TYR A 1 522 ? 141.981 163.783 -8.850  1.00 210.12 ? 595 TYR A O   1 
ATOM   4071 C  CB  . TYR A 1 522 ? 143.669 165.270 -6.248  1.00 191.48 ? 595 TYR A CB  1 
ATOM   4072 C  CG  . TYR A 1 522 ? 142.299 165.883 -6.056  1.00 209.86 ? 595 TYR A CG  1 
ATOM   4073 C  CD1 . TYR A 1 522 ? 141.389 165.332 -5.162  1.00 205.91 ? 595 TYR A CD1 1 
ATOM   4074 C  CD2 . TYR A 1 522 ? 141.921 167.021 -6.759  1.00 220.81 ? 595 TYR A CD2 1 
ATOM   4075 C  CE1 . TYR A 1 522 ? 140.138 165.893 -4.980  1.00 206.50 ? 595 TYR A CE1 1 
ATOM   4076 C  CE2 . TYR A 1 522 ? 140.673 167.588 -6.584  1.00 223.28 ? 595 TYR A CE2 1 
ATOM   4077 C  CZ  . TYR A 1 522 ? 139.786 167.020 -5.693  1.00 214.49 ? 595 TYR A CZ  1 
ATOM   4078 O  OH  . TYR A 1 522 ? 138.543 167.584 -5.517  1.00 211.38 ? 595 TYR A OH  1 
ATOM   4079 N  N   . ARG A 1 523 ? 143.598 165.281 -9.313  1.00 207.09 ? 596 ARG A N   1 
ATOM   4080 C  CA  . ARG A 1 523 ? 142.973 165.633 -10.582 1.00 208.15 ? 596 ARG A CA  1 
ATOM   4081 C  C   . ARG A 1 523 ? 142.978 164.445 -11.529 1.00 221.18 ? 596 ARG A C   1 
ATOM   4082 O  O   . ARG A 1 523 ? 141.985 164.210 -12.231 1.00 234.13 ? 596 ARG A O   1 
ATOM   4083 C  CB  . ARG A 1 523 ? 143.693 166.822 -11.216 1.00 195.66 ? 596 ARG A CB  1 
ATOM   4084 C  CG  . ARG A 1 523 ? 142.956 167.418 -12.399 1.00 191.46 ? 596 ARG A CG  1 
ATOM   4085 C  CD  . ARG A 1 523 ? 141.637 168.017 -11.952 1.00 187.88 ? 596 ARG A CD  1 
ATOM   4086 N  NE  . ARG A 1 523 ? 141.843 169.223 -11.157 1.00 184.33 ? 596 ARG A NE  1 
ATOM   4087 C  CZ  . ARG A 1 523 ? 141.862 170.450 -11.664 1.00 193.83 ? 596 ARG A CZ  1 
ATOM   4088 N  NH1 . ARG A 1 523 ? 142.060 171.495 -10.871 1.00 185.68 ? 596 ARG A NH1 1 
ATOM   4089 N  NH2 . ARG A 1 523 ? 141.674 170.633 -12.963 1.00 203.26 ? 596 ARG A NH2 1 
ATOM   4090 N  N   . LEU A 1 524 ? 144.014 163.610 -11.452 1.00 216.07 ? 597 LEU A N   1 
ATOM   4091 C  CA  . LEU A 1 524 ? 144.095 162.438 -12.310 1.00 203.02 ? 597 LEU A CA  1 
ATOM   4092 C  C   . LEU A 1 524 ? 143.016 161.443 -11.927 1.00 200.16 ? 597 LEU A C   1 
ATOM   4093 O  O   . LEU A 1 524 ? 142.613 160.621 -12.757 1.00 217.28 ? 597 LEU A O   1 
ATOM   4094 C  CB  . LEU A 1 524 ? 145.480 161.795 -12.220 1.00 186.62 ? 597 LEU A CB  1 
ATOM   4095 N  N   . ILE A 1 525 ? 142.547 161.507 -10.678 1.00 180.09 ? 598 ILE A N   1 
ATOM   4096 C  CA  . ILE A 1 525 ? 141.497 160.622 -10.194 1.00 164.83 ? 598 ILE A CA  1 
ATOM   4097 C  C   . ILE A 1 525 ? 140.133 161.282 -10.306 1.00 157.76 ? 598 ILE A C   1 
ATOM   4098 O  O   . ILE A 1 525 ? 139.110 160.598 -10.140 1.00 168.23 ? 598 ILE A O   1 
ATOM   4099 C  CB  . ILE A 1 525 ? 141.749 160.180 -8.737  1.00 130.08 ? 598 ILE A CB  1 
ATOM   4100 N  N   . ILE A 1 526 ? 140.083 162.586 -10.578 1.00 164.53 ? 599 ILE A N   1 
ATOM   4101 C  CA  . ILE A 1 526 ? 138.810 163.298 -10.633 1.00 166.89 ? 599 ILE A CA  1 
ATOM   4102 C  C   . ILE A 1 526 ? 138.271 163.382 -12.057 1.00 169.37 ? 599 ILE A C   1 
ATOM   4103 O  O   . ILE A 1 526 ? 137.072 163.196 -12.280 1.00 172.36 ? 599 ILE A O   1 
ATOM   4104 C  CB  . ILE A 1 526 ? 138.965 164.698 -10.006 1.00 119.03 ? 599 ILE A CB  1 
ATOM   4105 N  N   . THR A 1 527 ? 139.125 163.653 -13.035 1.00 206.54 ? 600 THR A N   1 
ATOM   4106 C  CA  . THR A 1 527 ? 138.665 163.816 -14.413 1.00 222.51 ? 600 THR A CA  1 
ATOM   4107 C  C   . THR A 1 527 ? 138.254 162.487 -15.040 1.00 240.62 ? 600 THR A C   1 
ATOM   4108 O  O   . THR A 1 527 ? 139.082 161.572 -15.141 1.00 227.87 ? 600 THR A O   1 
ATOM   4109 C  CB  . THR A 1 527 ? 139.758 164.472 -15.252 1.00 210.94 ? 600 THR A CB  1 
ATOM   4110 N  N   . PRO A 1 528 ? 136.991 162.337 -15.464 1.00 267.04 ? 601 PRO A N   1 
ATOM   4111 C  CA  . PRO A 1 528 ? 136.527 161.083 -16.079 1.00 276.40 ? 601 PRO A CA  1 
ATOM   4112 C  C   . PRO A 1 528 ? 137.194 160.778 -17.413 1.00 272.86 ? 601 PRO A C   1 
ATOM   4113 O  O   . PRO A 1 528 ? 138.019 161.556 -17.903 1.00 276.06 ? 601 PRO A O   1 
ATOM   4114 C  CB  . PRO A 1 528 ? 135.019 161.314 -16.256 1.00 283.26 ? 601 PRO A CB  1 
ATOM   4115 C  CG  . PRO A 1 528 ? 134.682 162.428 -15.319 1.00 283.95 ? 601 PRO A CG  1 
ATOM   4116 C  CD  . PRO A 1 528 ? 135.894 163.305 -15.304 1.00 277.61 ? 601 PRO A CD  1 
ATOM   4117 N  N   . GLY A 1 529 ? 136.832 159.644 -18.011 1.00 236.42 ? 602 GLY A N   1 
ATOM   4118 C  CA  . GLY A 1 529 ? 137.390 159.251 -19.290 1.00 227.21 ? 602 GLY A CA  1 
ATOM   4119 C  C   . GLY A 1 529 ? 138.782 158.651 -19.197 1.00 197.83 ? 602 GLY A C   1 
ATOM   4120 O  O   . GLY A 1 529 ? 139.257 158.239 -18.134 1.00 202.01 ? 602 GLY A O   1 
ATOM   4121 N  N   . THR A 1 530 ? 139.438 158.597 -20.353 1.00 207.71 ? 603 THR A N   1 
ATOM   4122 C  CA  . THR A 1 530 ? 140.785 158.057 -20.443 1.00 211.52 ? 603 THR A CA  1 
ATOM   4123 C  C   . THR A 1 530 ? 141.798 158.975 -19.765 1.00 217.68 ? 603 THR A C   1 
ATOM   4124 O  O   . THR A 1 530 ? 141.571 160.174 -19.573 1.00 219.61 ? 603 THR A O   1 
ATOM   4125 C  CB  . THR A 1 530 ? 141.182 157.844 -21.905 1.00 202.80 ? 603 THR A CB  1 
ATOM   4126 N  N   . PHE A 1 531 ? 142.942 158.384 -19.408 1.00 210.53 ? 604 PHE A N   1 
ATOM   4127 C  CA  . PHE A 1 531 ? 144.013 159.142 -18.771 1.00 198.09 ? 604 PHE A CA  1 
ATOM   4128 C  C   . PHE A 1 531 ? 144.600 160.181 -19.714 1.00 189.99 ? 604 PHE A C   1 
ATOM   4129 O  O   . PHE A 1 531 ? 145.139 161.195 -19.257 1.00 202.41 ? 604 PHE A O   1 
ATOM   4130 C  CB  . PHE A 1 531 ? 145.105 158.195 -18.275 1.00 191.79 ? 604 PHE A CB  1 
ATOM   4131 N  N   . LYS A 1 532 ? 144.505 159.953 -21.025 1.00 162.28 ? 605 LYS A N   1 
ATOM   4132 C  CA  . LYS A 1 532 ? 145.007 160.943 -21.968 1.00 158.35 ? 605 LYS A CA  1 
ATOM   4133 C  C   . LYS A 1 532 ? 144.092 162.159 -21.993 1.00 159.04 ? 605 LYS A C   1 
ATOM   4134 O  O   . LYS A 1 532 ? 144.557 163.294 -22.149 1.00 160.41 ? 605 LYS A O   1 
ATOM   4135 C  CB  . LYS A 1 532 ? 145.138 160.329 -23.361 1.00 154.52 ? 605 LYS A CB  1 
ATOM   4136 N  N   . GLU A 1 533 ? 142.784 161.939 -21.844 1.00 182.29 ? 606 GLU A N   1 
ATOM   4137 C  CA  . GLU A 1 533 ? 141.856 163.061 -21.796 1.00 192.58 ? 606 GLU A CA  1 
ATOM   4138 C  C   . GLU A 1 533 ? 141.962 163.801 -20.470 1.00 202.35 ? 606 GLU A C   1 
ATOM   4139 O  O   . GLU A 1 533 ? 141.793 165.025 -20.430 1.00 208.88 ? 606 GLU A O   1 
ATOM   4140 C  CB  . GLU A 1 533 ? 140.425 162.573 -22.025 1.00 195.33 ? 606 GLU A CB  1 
ATOM   4141 N  N   . ARG A 1 534 ? 142.229 163.079 -19.377 1.00 186.15 ? 607 ARG A N   1 
ATOM   4142 C  CA  . ARG A 1 534 ? 142.408 163.737 -18.087 1.00 181.61 ? 607 ARG A CA  1 
ATOM   4143 C  C   . ARG A 1 534 ? 143.699 164.546 -18.054 1.00 197.57 ? 607 ARG A C   1 
ATOM   4144 O  O   . ARG A 1 534 ? 143.722 165.671 -17.539 1.00 214.74 ? 607 ARG A O   1 
ATOM   4145 C  CB  . ARG A 1 534 ? 142.395 162.699 -16.965 1.00 176.93 ? 607 ARG A CB  1 
ATOM   4146 N  N   . ILE A 1 535 ? 144.783 163.999 -18.613 1.00 176.18 ? 608 ILE A N   1 
ATOM   4147 C  CA  . ILE A 1 535 ? 146.035 164.742 -18.658 1.00 166.71 ? 608 ILE A CA  1 
ATOM   4148 C  C   . ILE A 1 535 ? 145.964 165.830 -19.716 1.00 174.35 ? 608 ILE A C   1 
ATOM   4149 O  O   . ILE A 1 535 ? 146.770 166.769 -19.698 1.00 160.57 ? 608 ILE A O   1 
ATOM   4150 C  CB  . ILE A 1 535 ? 147.223 163.797 -18.913 1.00 108.85 ? 608 ILE A CB  1 
ATOM   4151 N  N   . ILE A 1 536 ? 144.997 165.729 -20.630 1.00 176.73 ? 609 ILE A N   1 
ATOM   4152 C  CA  . ILE A 1 536 ? 144.790 166.763 -21.635 1.00 164.26 ? 609 ILE A CA  1 
ATOM   4153 C  C   . ILE A 1 536 ? 144.016 167.921 -21.029 1.00 158.13 ? 609 ILE A C   1 
ATOM   4154 O  O   . ILE A 1 536 ? 144.273 169.088 -21.342 1.00 154.26 ? 609 ILE A O   1 
ATOM   4155 C  CB  . ILE A 1 536 ? 144.076 166.179 -22.867 1.00 150.88 ? 609 ILE A CB  1 
ATOM   4156 N  N   . LYS A 1 537 ? 143.046 167.616 -20.168 1.00 151.54 ? 610 LYS A N   1 
ATOM   4157 C  CA  . LYS A 1 537 ? 142.350 168.664 -19.441 1.00 160.88 ? 610 LYS A CA  1 
ATOM   4158 C  C   . LYS A 1 537 ? 143.193 169.189 -18.292 1.00 173.68 ? 610 LYS A C   1 
ATOM   4159 O  O   . LYS A 1 537 ? 142.848 170.220 -17.705 1.00 198.44 ? 610 LYS A O   1 
ATOM   4160 C  CB  . LYS A 1 537 ? 141.010 168.147 -18.913 1.00 157.24 ? 610 LYS A CB  1 
ATOM   4161 N  N   . SER A 1 538 ? 144.292 168.503 -17.968 1.00 162.30 ? 611 SER A N   1 
ATOM   4162 C  CA  . SER A 1 538 ? 145.187 168.931 -16.906 1.00 156.67 ? 611 SER A CA  1 
ATOM   4163 C  C   . SER A 1 538 ? 146.387 169.694 -17.438 1.00 173.41 ? 611 SER A C   1 
ATOM   4164 O  O   . SER A 1 538 ? 147.020 170.435 -16.679 1.00 191.14 ? 611 SER A O   1 
ATOM   4165 C  CB  . SER A 1 538 ? 145.675 167.720 -16.102 1.00 130.69 ? 611 SER A CB  1 
ATOM   4166 N  N   . ILE A 1 539 ? 146.725 169.507 -18.711 1.00 181.75 ? 612 ILE A N   1 
ATOM   4167 C  CA  . ILE A 1 539 ? 147.842 170.217 -19.321 1.00 191.06 ? 612 ILE A CA  1 
ATOM   4168 C  C   . ILE A 1 539 ? 147.364 171.486 -20.016 1.00 206.65 ? 612 ILE A C   1 
ATOM   4169 O  O   . ILE A 1 539 ? 148.004 172.536 -19.919 1.00 218.19 ? 612 ILE A O   1 
ATOM   4170 C  CB  . ILE A 1 539 ? 148.594 169.289 -20.295 1.00 193.07 ? 612 ILE A CB  1 
ATOM   4171 N  N   . THR A 1 540 ? 146.236 171.397 -20.714 1.00 190.53 ? 613 THR A N   1 
ATOM   4172 C  CA  . THR A 1 540 ? 145.647 172.540 -21.400 1.00 172.55 ? 613 THR A CA  1 
ATOM   4173 C  C   . THR A 1 540 ? 144.959 173.464 -20.401 1.00 153.56 ? 613 THR A C   1 
ATOM   4174 O  O   . THR A 1 540 ? 144.251 172.986 -19.509 1.00 134.63 ? 613 THR A O   1 
ATOM   4175 C  CB  . THR A 1 540 ? 144.645 172.080 -22.456 1.00 177.73 ? 613 THR A CB  1 
ATOM   4176 N  N   . PRO A 1 541 ? 145.177 174.776 -20.494 1.00 154.62 ? 614 PRO A N   1 
ATOM   4177 C  CA  . PRO A 1 541 ? 144.535 175.712 -19.564 1.00 157.63 ? 614 PRO A CA  1 
ATOM   4178 C  C   . PRO A 1 541 ? 143.017 175.604 -19.605 1.00 187.50 ? 614 PRO A C   1 
ATOM   4179 O  O   . PRO A 1 541 ? 142.428 175.050 -20.538 1.00 215.34 ? 614 PRO A O   1 
ATOM   4180 C  CB  . PRO A 1 541 ? 145.005 177.083 -20.064 1.00 154.62 ? 614 PRO A CB  1 
ATOM   4181 C  CG  . PRO A 1 541 ? 146.296 176.800 -20.762 1.00 159.05 ? 614 PRO A CG  1 
ATOM   4182 C  CD  . PRO A 1 541 ? 146.097 175.462 -21.418 1.00 155.87 ? 614 PRO A CD  1 
ATOM   4183 N  N   . GLU A 1 542 ? 142.383 176.137 -18.561 1.00 187.17 ? 615 GLU A N   1 
ATOM   4184 C  CA  . GLU A 1 542 ? 140.928 176.112 -18.467 1.00 189.85 ? 615 GLU A CA  1 
ATOM   4185 C  C   . GLU A 1 542 ? 140.293 176.809 -19.666 1.00 200.03 ? 615 GLU A C   1 
ATOM   4186 O  O   . GLU A 1 542 ? 140.709 177.905 -20.056 1.00 207.89 ? 615 GLU A O   1 
ATOM   4187 C  CB  . GLU A 1 542 ? 140.477 176.779 -17.167 1.00 180.05 ? 615 GLU A CB  1 
ATOM   4188 N  N   . THR A 1 543 ? 139.282 176.169 -20.247 1.00 181.38 ? 616 THR A N   1 
ATOM   4189 C  CA  . THR A 1 543 ? 138.608 176.693 -21.431 1.00 168.42 ? 616 THR A CA  1 
ATOM   4190 C  C   . THR A 1 543 ? 137.899 178.011 -21.138 1.00 177.22 ? 616 THR A C   1 
ATOM   4191 O  O   . THR A 1 543 ? 138.348 179.075 -21.566 1.00 178.45 ? 616 THR A O   1 
ATOM   4192 C  CB  . THR A 1 543 ? 137.581 175.687 -21.986 1.00 156.65 ? 616 THR A CB  1 
ATOM   4193 N  N   . GLU B 2 1   ? 181.826 174.798 33.886  1.00 130.69 ? 20  GLU B N   1 
ATOM   4194 C  CA  . GLU B 2 1   ? 181.260 173.483 34.166  1.00 129.71 ? 20  GLU B CA  1 
ATOM   4195 C  C   . GLU B 2 1   ? 181.939 172.857 35.378  1.00 111.07 ? 20  GLU B C   1 
ATOM   4196 O  O   . GLU B 2 1   ? 182.163 171.646 35.422  1.00 124.73 ? 20  GLU B O   1 
ATOM   4197 C  CB  . GLU B 2 1   ? 181.401 172.566 32.949  1.00 122.70 ? 20  GLU B CB  1 
ATOM   4198 N  N   . VAL B 2 2   ? 182.265 173.692 36.363  1.00 155.10 ? 21  VAL B N   1 
ATOM   4199 C  CA  . VAL B 2 2   ? 182.772 173.215 37.644  1.00 137.88 ? 21  VAL B CA  1 
ATOM   4200 C  C   . VAL B 2 2   ? 181.717 172.381 38.356  1.00 117.24 ? 21  VAL B C   1 
ATOM   4201 O  O   . VAL B 2 2   ? 180.704 172.911 38.825  1.00 130.90 ? 21  VAL B O   1 
ATOM   4202 C  CB  . VAL B 2 2   ? 183.219 174.392 38.531  1.00 133.21 ? 21  VAL B CB  1 
ATOM   4203 C  CG1 . VAL B 2 2   ? 183.742 173.879 39.863  1.00 133.83 ? 21  VAL B CG1 1 
ATOM   4204 C  CG2 . VAL B 2 2   ? 184.274 175.225 37.818  1.00 139.86 ? 21  VAL B CG2 1 
ATOM   4205 N  N   . GLN B 2 3   ? 181.946 171.072 38.447  1.00 110.73 ? 22  GLN B N   1 
ATOM   4206 C  CA  . GLN B 2 3   ? 181.015 170.161 39.094  1.00 110.37 ? 22  GLN B CA  1 
ATOM   4207 C  C   . GLN B 2 3   ? 181.742 169.368 40.169  1.00 108.28 ? 22  GLN B C   1 
ATOM   4208 O  O   . GLN B 2 3   ? 182.852 168.871 39.944  1.00 103.22 ? 22  GLN B O   1 
ATOM   4209 C  CB  . GLN B 2 3   ? 180.361 169.205 38.088  1.00 127.28 ? 22  GLN B CB  1 
ATOM   4210 C  CG  . GLN B 2 3   ? 179.552 169.895 37.002  1.00 147.20 ? 22  GLN B CG  1 
ATOM   4211 C  CD  . GLN B 2 3   ? 178.863 168.910 36.076  1.00 156.16 ? 22  GLN B CD  1 
ATOM   4212 O  OE1 . GLN B 2 3   ? 178.797 167.713 36.363  1.00 154.39 ? 22  GLN B OE1 1 
ATOM   4213 N  NE2 . GLN B 2 3   ? 178.338 169.410 34.962  1.00 167.43 ? 22  GLN B NE2 1 
ATOM   4214 N  N   . LEU B 2 4   ? 181.102 169.242 41.329  1.00 112.60 ? 23  LEU B N   1 
ATOM   4215 C  CA  . LEU B 2 4   ? 181.608 168.448 42.447  1.00 112.30 ? 23  LEU B CA  1 
ATOM   4216 C  C   . LEU B 2 4   ? 180.561 167.382 42.755  1.00 105.96 ? 23  LEU B C   1 
ATOM   4217 O  O   . LEU B 2 4   ? 179.526 167.681 43.360  1.00 104.49 ? 23  LEU B O   1 
ATOM   4218 C  CB  . LEU B 2 4   ? 181.875 169.336 43.661  1.00 118.03 ? 23  LEU B CB  1 
ATOM   4219 C  CG  . LEU B 2 4   ? 182.809 170.530 43.446  1.00 118.34 ? 23  LEU B CG  1 
ATOM   4220 C  CD1 . LEU B 2 4   ? 183.059 171.279 44.746  1.00 85.18  ? 23  LEU B CD1 1 
ATOM   4221 C  CD2 . LEU B 2 4   ? 184.119 170.083 42.823  1.00 133.64 ? 23  LEU B CD2 1 
ATOM   4222 N  N   . GLN B 2 5   ? 180.825 166.142 42.356  1.00 113.34 ? 24  GLN B N   1 
ATOM   4223 C  CA  . GLN B 2 5   ? 179.874 165.051 42.530  1.00 117.16 ? 24  GLN B CA  1 
ATOM   4224 C  C   . GLN B 2 5   ? 180.310 164.192 43.712  1.00 116.41 ? 24  GLN B C   1 
ATOM   4225 O  O   . GLN B 2 5   ? 181.372 163.565 43.669  1.00 109.73 ? 24  GLN B O   1 
ATOM   4226 C  CB  . GLN B 2 5   ? 179.773 164.216 41.253  1.00 134.12 ? 24  GLN B CB  1 
ATOM   4227 C  CG  . GLN B 2 5   ? 178.739 163.100 41.307  1.00 156.46 ? 24  GLN B CG  1 
ATOM   4228 C  CD  . GLN B 2 5   ? 177.309 163.617 41.326  1.00 152.30 ? 24  GLN B CD  1 
ATOM   4229 O  OE1 . GLN B 2 5   ? 177.046 164.769 40.979  1.00 140.92 ? 24  GLN B OE1 1 
ATOM   4230 N  NE2 . GLN B 2 5   ? 176.377 162.760 41.731  1.00 152.62 ? 24  GLN B NE2 1 
ATOM   4231 N  N   . GLN B 2 6   ? 179.483 164.149 44.753  1.00 106.00 ? 25  GLN B N   1 
ATOM   4232 C  CA  . GLN B 2 6   ? 179.785 163.373 45.945  1.00 95.87  ? 25  GLN B CA  1 
ATOM   4233 C  C   . GLN B 2 6   ? 179.181 161.974 45.827  1.00 97.50  ? 25  GLN B C   1 
ATOM   4234 O  O   . GLN B 2 6   ? 178.592 161.607 44.806  1.00 104.36 ? 25  GLN B O   1 
ATOM   4235 C  CB  . GLN B 2 6   ? 179.259 164.089 47.186  1.00 90.26  ? 25  GLN B CB  1 
ATOM   4236 C  CG  . GLN B 2 6   ? 179.421 165.596 47.140  1.00 82.86  ? 25  GLN B CG  1 
ATOM   4237 C  CD  . GLN B 2 6   ? 179.139 166.242 48.474  1.00 100.51 ? 25  GLN B CD  1 
ATOM   4238 O  OE1 . GLN B 2 6   ? 179.144 167.466 48.597  1.00 105.42 ? 25  GLN B OE1 1 
ATOM   4239 N  NE2 . GLN B 2 6   ? 178.918 165.419 49.492  1.00 108.25 ? 25  GLN B NE2 1 
ATOM   4240 N  N   . SER B 2 7   ? 179.323 161.180 46.885  1.00 93.43  ? 26  SER B N   1 
ATOM   4241 C  CA  . SER B 2 7   ? 178.749 159.844 46.911  1.00 121.14 ? 26  SER B CA  1 
ATOM   4242 C  C   . SER B 2 7   ? 177.304 159.899 47.407  1.00 149.54 ? 26  SER B C   1 
ATOM   4243 O  O   . SER B 2 7   ? 176.808 160.933 47.860  1.00 145.77 ? 26  SER B O   1 
ATOM   4244 C  CB  . SER B 2 7   ? 179.585 158.904 47.785  1.00 112.98 ? 26  SER B CB  1 
ATOM   4245 O  OG  . SER B 2 7   ? 179.670 159.368 49.121  1.00 115.58 ? 26  SER B OG  1 
ATOM   4246 N  N   . GLY B 2 8   ? 176.616 158.767 47.290  1.00 172.75 ? 27  GLY B N   1 
ATOM   4247 C  CA  . GLY B 2 8   ? 175.238 158.668 47.708  1.00 177.16 ? 27  GLY B CA  1 
ATOM   4248 C  C   . GLY B 2 8   ? 175.057 158.610 49.212  1.00 150.85 ? 27  GLY B C   1 
ATOM   4249 O  O   . GLY B 2 8   ? 176.007 158.740 49.990  1.00 151.66 ? 27  GLY B O   1 
ATOM   4250 N  N   . PRO B 2 9   ? 173.816 158.401 49.644  1.00 129.43 ? 28  PRO B N   1 
ATOM   4251 C  CA  . PRO B 2 9   ? 173.533 158.324 51.080  1.00 135.39 ? 28  PRO B CA  1 
ATOM   4252 C  C   . PRO B 2 9   ? 174.156 157.086 51.704  1.00 145.05 ? 28  PRO B C   1 
ATOM   4253 O  O   . PRO B 2 9   ? 174.395 156.077 51.036  1.00 140.13 ? 28  PRO B O   1 
ATOM   4254 C  CB  . PRO B 2 9   ? 172.002 158.266 51.136  1.00 140.70 ? 28  PRO B CB  1 
ATOM   4255 C  CG  . PRO B 2 9   ? 171.613 157.661 49.829  1.00 151.21 ? 28  PRO B CG  1 
ATOM   4256 C  CD  . PRO B 2 9   ? 172.610 158.180 48.829  1.00 148.31 ? 28  PRO B CD  1 
ATOM   4257 N  N   . GLU B 2 10  ? 174.439 157.180 53.002  1.00 157.18 ? 29  GLU B N   1 
ATOM   4258 C  CA  . GLU B 2 10  ? 175.061 156.089 53.739  1.00 163.84 ? 29  GLU B CA  1 
ATOM   4259 C  C   . GLU B 2 10  ? 174.302 155.852 55.036  1.00 170.71 ? 29  GLU B C   1 
ATOM   4260 O  O   . GLU B 2 10  ? 174.062 156.791 55.801  1.00 176.77 ? 29  GLU B O   1 
ATOM   4261 C  CB  . GLU B 2 10  ? 176.532 156.396 54.037  1.00 177.11 ? 29  GLU B CB  1 
ATOM   4262 C  CG  . GLU B 2 10  ? 177.408 156.501 52.798  1.00 186.81 ? 29  GLU B CG  1 
ATOM   4263 C  CD  . GLU B 2 10  ? 177.632 155.162 52.122  1.00 201.89 ? 29  GLU B CD  1 
ATOM   4264 O  OE1 . GLU B 2 10  ? 177.450 154.118 52.784  1.00 210.69 ? 29  GLU B OE1 1 
ATOM   4265 O  OE2 . GLU B 2 10  ? 177.990 155.154 50.926  1.00 206.59 ? 29  GLU B OE2 1 
ATOM   4266 N  N   . LEU B 2 11  ? 173.930 154.597 55.276  1.00 182.13 ? 30  LEU B N   1 
ATOM   4267 C  CA  . LEU B 2 11  ? 173.285 154.159 56.511  1.00 171.49 ? 30  LEU B CA  1 
ATOM   4268 C  C   . LEU B 2 11  ? 174.245 153.223 57.233  1.00 160.46 ? 30  LEU B C   1 
ATOM   4269 O  O   . LEU B 2 11  ? 174.531 152.125 56.744  1.00 148.31 ? 30  LEU B O   1 
ATOM   4270 C  CB  . LEU B 2 11  ? 171.955 153.463 56.237  1.00 174.17 ? 30  LEU B CB  1 
ATOM   4271 C  CG  . LEU B 2 11  ? 171.328 152.840 57.489  1.00 179.45 ? 30  LEU B CG  1 
ATOM   4272 C  CD1 . LEU B 2 11  ? 171.022 153.902 58.534  1.00 169.49 ? 30  LEU B CD1 1 
ATOM   4273 C  CD2 . LEU B 2 11  ? 170.083 152.039 57.150  1.00 182.72 ? 30  LEU B CD2 1 
ATOM   4274 N  N   . VAL B 2 12  ? 174.752 153.657 58.382  1.00 146.80 ? 31  VAL B N   1 
ATOM   4275 C  CA  . VAL B 2 12  ? 175.761 152.893 59.100  1.00 143.41 ? 31  VAL B CA  1 
ATOM   4276 C  C   . VAL B 2 12  ? 175.390 152.801 60.572  1.00 135.22 ? 31  VAL B C   1 
ATOM   4277 O  O   . VAL B 2 12  ? 174.816 153.728 61.151  1.00 129.40 ? 31  VAL B O   1 
ATOM   4278 C  CB  . VAL B 2 12  ? 177.158 153.520 58.930  1.00 139.80 ? 31  VAL B CB  1 
ATOM   4279 C  CG1 . VAL B 2 12  ? 177.732 153.159 57.573  1.00 147.43 ? 31  VAL B CG1 1 
ATOM   4280 C  CG2 . VAL B 2 12  ? 177.053 155.021 59.067  1.00 124.24 ? 31  VAL B CG2 1 
ATOM   4281 N  N   . LYS B 2 13  ? 175.742 151.672 61.181  1.00 146.32 ? 32  LYS B N   1 
ATOM   4282 C  CA  . LYS B 2 13  ? 175.478 151.475 62.594  1.00 146.80 ? 32  LYS B CA  1 
ATOM   4283 C  C   . LYS B 2 13  ? 176.444 152.306 63.436  1.00 164.35 ? 32  LYS B C   1 
ATOM   4284 O  O   . LYS B 2 13  ? 177.596 152.518 63.045  1.00 171.04 ? 32  LYS B O   1 
ATOM   4285 C  CB  . LYS B 2 13  ? 175.599 150.002 62.972  1.00 140.54 ? 32  LYS B CB  1 
ATOM   4286 C  CG  . LYS B 2 13  ? 174.514 149.116 62.385  1.00 141.49 ? 32  LYS B CG  1 
ATOM   4287 C  CD  . LYS B 2 13  ? 174.616 147.699 62.925  1.00 147.92 ? 32  LYS B CD  1 
ATOM   4288 C  CE  . LYS B 2 13  ? 173.490 146.823 62.402  1.00 146.58 ? 32  LYS B CE  1 
ATOM   4289 N  NZ  . LYS B 2 13  ? 173.560 145.447 62.965  1.00 150.01 ? 32  LYS B NZ  1 
ATOM   4290 N  N   . PRO B 2 14  ? 175.988 152.805 64.585  1.00 172.44 ? 33  PRO B N   1 
ATOM   4291 C  CA  . PRO B 2 14  ? 176.874 153.586 65.455  1.00 182.04 ? 33  PRO B CA  1 
ATOM   4292 C  C   . PRO B 2 14  ? 178.116 152.796 65.831  1.00 181.90 ? 33  PRO B C   1 
ATOM   4293 O  O   . PRO B 2 14  ? 178.059 151.590 66.082  1.00 176.97 ? 33  PRO B O   1 
ATOM   4294 C  CB  . PRO B 2 14  ? 175.997 153.884 66.677  1.00 186.54 ? 33  PRO B CB  1 
ATOM   4295 C  CG  . PRO B 2 14  ? 174.602 153.840 66.144  1.00 181.79 ? 33  PRO B CG  1 
ATOM   4296 C  CD  . PRO B 2 14  ? 174.607 152.765 65.095  1.00 179.96 ? 33  PRO B CD  1 
ATOM   4297 N  N   . GLY B 2 15  ? 179.253 153.489 65.841  1.00 199.83 ? 34  GLY B N   1 
ATOM   4298 C  CA  . GLY B 2 15  ? 180.526 152.895 66.162  1.00 205.58 ? 34  GLY B CA  1 
ATOM   4299 C  C   . GLY B 2 15  ? 181.342 152.503 64.949  1.00 200.40 ? 34  GLY B C   1 
ATOM   4300 O  O   . GLY B 2 15  ? 182.551 152.274 65.078  1.00 194.59 ? 34  GLY B O   1 
ATOM   4301 N  N   . ALA B 2 16  ? 180.712 152.421 63.780  1.00 192.67 ? 35  ALA B N   1 
ATOM   4302 C  CA  . ALA B 2 16  ? 181.390 152.063 62.546  1.00 191.17 ? 35  ALA B CA  1 
ATOM   4303 C  C   . ALA B 2 16  ? 182.012 153.309 61.915  1.00 178.85 ? 35  ALA B C   1 
ATOM   4304 O  O   . ALA B 2 16  ? 182.077 154.379 62.525  1.00 132.94 ? 35  ALA B O   1 
ATOM   4305 C  CB  . ALA B 2 16  ? 180.418 151.369 61.594  1.00 183.22 ? 35  ALA B CB  1 
ATOM   4306 N  N   . SER B 2 17  ? 182.477 153.174 60.676  1.00 193.68 ? 36  SER B N   1 
ATOM   4307 C  CA  . SER B 2 17  ? 183.091 154.263 59.933  1.00 197.37 ? 36  SER B CA  1 
ATOM   4308 C  C   . SER B 2 17  ? 182.402 154.407 58.584  1.00 194.14 ? 36  SER B C   1 
ATOM   4309 O  O   . SER B 2 17  ? 181.743 153.483 58.098  1.00 197.70 ? 36  SER B O   1 
ATOM   4310 C  CB  . SER B 2 17  ? 184.596 154.026 59.739  1.00 199.87 ? 36  SER B CB  1 
ATOM   4311 O  OG  . SER B 2 17  ? 185.248 153.853 60.985  1.00 199.75 ? 36  SER B OG  1 
ATOM   4312 N  N   . VAL B 2 18  ? 182.555 155.583 57.980  1.00 153.78 ? 37  VAL B N   1 
ATOM   4313 C  CA  . VAL B 2 18  ? 181.968 155.850 56.669  1.00 146.41 ? 37  VAL B CA  1 
ATOM   4314 C  C   . VAL B 2 18  ? 182.886 156.795 55.903  1.00 161.80 ? 37  VAL B C   1 
ATOM   4315 O  O   . VAL B 2 18  ? 183.437 157.743 56.469  1.00 175.23 ? 37  VAL B O   1 
ATOM   4316 C  CB  . VAL B 2 18  ? 180.535 156.417 56.801  1.00 131.50 ? 37  VAL B CB  1 
ATOM   4317 C  CG1 . VAL B 2 18  ? 180.535 157.727 57.575  1.00 114.90 ? 37  VAL B CG1 1 
ATOM   4318 C  CG2 . VAL B 2 18  ? 179.908 156.606 55.430  1.00 121.46 ? 37  VAL B CG2 1 
ATOM   4319 N  N   . LYS B 2 19  ? 183.063 156.516 54.611  1.00 174.30 ? 38  LYS B N   1 
ATOM   4320 C  CA  . LYS B 2 19  ? 183.895 157.322 53.725  1.00 168.88 ? 38  LYS B CA  1 
ATOM   4321 C  C   . LYS B 2 19  ? 183.038 157.960 52.641  1.00 159.46 ? 38  LYS B C   1 
ATOM   4322 O  O   . LYS B 2 19  ? 182.216 157.283 52.016  1.00 179.43 ? 38  LYS B O   1 
ATOM   4323 C  CB  . LYS B 2 19  ? 184.997 156.469 53.087  1.00 179.21 ? 38  LYS B CB  1 
ATOM   4324 C  CG  . LYS B 2 19  ? 185.895 157.235 52.128  1.00 193.45 ? 38  LYS B CG  1 
ATOM   4325 C  CD  . LYS B 2 19  ? 186.926 156.328 51.472  1.00 206.08 ? 38  LYS B CD  1 
ATOM   4326 C  CE  . LYS B 2 19  ? 187.868 155.721 52.499  1.00 209.56 ? 38  LYS B CE  1 
ATOM   4327 N  NZ  . LYS B 2 19  ? 188.899 154.856 51.860  1.00 207.91 ? 38  LYS B NZ  1 
ATOM   4328 N  N   . ILE B 2 20  ? 183.232 159.261 52.421  1.00 134.80 ? 39  ILE B N   1 
ATOM   4329 C  CA  . ILE B 2 20  ? 182.501 160.020 51.411  1.00 122.37 ? 39  ILE B CA  1 
ATOM   4330 C  C   . ILE B 2 20  ? 183.492 160.533 50.374  1.00 137.98 ? 39  ILE B C   1 
ATOM   4331 O  O   . ILE B 2 20  ? 184.557 161.052 50.732  1.00 150.98 ? 39  ILE B O   1 
ATOM   4332 C  CB  . ILE B 2 20  ? 181.716 161.187 52.036  1.00 84.93  ? 39  ILE B CB  1 
ATOM   4333 C  CG1 . ILE B 2 20  ? 180.766 160.672 53.116  1.00 103.73 ? 39  ILE B CG1 1 
ATOM   4334 C  CG2 . ILE B 2 20  ? 180.938 161.943 50.969  1.00 89.56  ? 39  ILE B CG2 1 
ATOM   4335 C  CD1 . ILE B 2 20  ? 179.969 161.767 53.785  1.00 120.32 ? 39  ILE B CD1 1 
ATOM   4336 N  N   . SER B 2 21  ? 183.142 160.388 49.097  1.00 134.20 ? 40  SER B N   1 
ATOM   4337 C  CA  . SER B 2 21  ? 183.982 160.816 47.987  1.00 124.83 ? 40  SER B CA  1 
ATOM   4338 C  C   . SER B 2 21  ? 183.554 162.194 47.483  1.00 117.17 ? 40  SER B C   1 
ATOM   4339 O  O   . SER B 2 21  ? 182.558 162.771 47.929  1.00 93.71  ? 40  SER B O   1 
ATOM   4340 C  CB  . SER B 2 21  ? 183.940 159.788 46.851  1.00 122.33 ? 40  SER B CB  1 
ATOM   4341 O  OG  . SER B 2 21  ? 182.617 159.579 46.389  1.00 127.35 ? 40  SER B OG  1 
ATOM   4342 N  N   . CYS B 2 22  ? 184.334 162.718 46.533  1.00 109.89 ? 41  CYS B N   1 
ATOM   4343 C  CA  . CYS B 2 22  ? 184.086 164.053 45.980  1.00 94.55  ? 41  CYS B CA  1 
ATOM   4344 C  C   . CYS B 2 22  ? 184.881 164.171 44.672  1.00 112.09 ? 41  CYS B C   1 
ATOM   4345 O  O   . CYS B 2 22  ? 186.052 164.548 44.683  1.00 125.61 ? 41  CYS B O   1 
ATOM   4346 C  CB  . CYS B 2 22  ? 184.477 165.138 46.965  1.00 96.01  ? 41  CYS B CB  1 
ATOM   4347 S  SG  . CYS B 2 22  ? 184.023 166.832 46.504  1.00 117.10 ? 41  CYS B SG  1 
ATOM   4348 N  N   . LYS B 2 23  ? 184.226 163.846 43.561  1.00 113.32 ? 42  LYS B N   1 
ATOM   4349 C  CA  . LYS B 2 23  ? 184.838 163.922 42.239  1.00 109.62 ? 42  LYS B CA  1 
ATOM   4350 C  C   . LYS B 2 23  ? 184.704 165.339 41.696  1.00 107.67 ? 42  LYS B C   1 
ATOM   4351 O  O   . LYS B 2 23  ? 183.588 165.852 41.556  1.00 88.79  ? 42  LYS B O   1 
ATOM   4352 C  CB  . LYS B 2 23  ? 184.196 162.917 41.284  1.00 120.78 ? 42  LYS B CB  1 
ATOM   4353 C  CG  . LYS B 2 23  ? 184.632 163.081 39.837  1.00 135.92 ? 42  LYS B CG  1 
ATOM   4354 C  CD  . LYS B 2 23  ? 186.110 162.795 39.647  1.00 156.50 ? 42  LYS B CD  1 
ATOM   4355 C  CE  . LYS B 2 23  ? 186.496 162.909 38.180  1.00 179.82 ? 42  LYS B CE  1 
ATOM   4356 N  NZ  . LYS B 2 23  ? 187.937 162.618 37.948  1.00 199.89 ? 42  LYS B NZ  1 
ATOM   4357 N  N   . ALA B 2 24  ? 185.835 165.963 41.380  1.00 119.78 ? 43  ALA B N   1 
ATOM   4358 C  CA  . ALA B 2 24  ? 185.860 167.340 40.915  1.00 109.17 ? 43  ALA B CA  1 
ATOM   4359 C  C   . ALA B 2 24  ? 186.099 167.386 39.412  1.00 119.66 ? 43  ALA B C   1 
ATOM   4360 O  O   . ALA B 2 24  ? 186.811 166.550 38.848  1.00 120.58 ? 43  ALA B O   1 
ATOM   4361 C  CB  . ALA B 2 24  ? 186.943 168.143 41.638  1.00 91.62  ? 43  ALA B CB  1 
ATOM   4362 N  N   . SER B 2 25  ? 185.481 168.371 38.765  1.00 133.60 ? 44  SER B N   1 
ATOM   4363 C  CA  . SER B 2 25  ? 185.681 168.585 37.339  1.00 120.29 ? 44  SER B CA  1 
ATOM   4364 C  C   . SER B 2 25  ? 185.383 170.039 37.005  1.00 98.86  ? 44  SER B C   1 
ATOM   4365 O  O   . SER B 2 25  ? 184.733 170.750 37.776  1.00 106.07 ? 44  SER B O   1 
ATOM   4366 C  CB  . SER B 2 25  ? 184.804 167.640 36.511  1.00 125.42 ? 44  SER B CB  1 
ATOM   4367 O  OG  . SER B 2 25  ? 183.433 167.830 36.814  1.00 113.29 ? 44  SER B OG  1 
ATOM   4368 N  N   . GLY B 2 26  ? 185.898 170.483 35.860  1.00 75.69  ? 45  GLY B N   1 
ATOM   4369 C  CA  . GLY B 2 26  ? 185.636 171.820 35.371  1.00 108.24 ? 45  GLY B CA  1 
ATOM   4370 C  C   . GLY B 2 26  ? 186.642 172.872 35.782  1.00 114.08 ? 45  GLY B C   1 
ATOM   4371 O  O   . GLY B 2 26  ? 186.452 174.051 35.450  1.00 99.40  ? 45  GLY B O   1 
ATOM   4372 N  N   . TYR B 2 27  ? 187.709 172.490 36.475  1.00 135.41 ? 46  TYR B N   1 
ATOM   4373 C  CA  . TYR B 2 27  ? 188.729 173.437 36.902  1.00 120.34 ? 46  TYR B CA  1 
ATOM   4374 C  C   . TYR B 2 27  ? 190.020 172.674 37.163  1.00 113.86 ? 46  TYR B C   1 
ATOM   4375 O  O   . TYR B 2 27  ? 190.035 171.443 37.242  1.00 97.52  ? 46  TYR B O   1 
ATOM   4376 C  CB  . TYR B 2 27  ? 188.279 174.208 38.146  1.00 98.24  ? 46  TYR B CB  1 
ATOM   4377 C  CG  . TYR B 2 27  ? 188.283 173.373 39.408  1.00 111.70 ? 46  TYR B CG  1 
ATOM   4378 C  CD1 . TYR B 2 27  ? 187.217 172.536 39.715  1.00 120.67 ? 46  TYR B CD1 1 
ATOM   4379 C  CD2 . TYR B 2 27  ? 189.349 173.425 40.295  1.00 103.83 ? 46  TYR B CD2 1 
ATOM   4380 C  CE1 . TYR B 2 27  ? 187.217 171.773 40.868  1.00 109.25 ? 46  TYR B CE1 1 
ATOM   4381 C  CE2 . TYR B 2 27  ? 189.360 172.665 41.448  1.00 87.18  ? 46  TYR B CE2 1 
ATOM   4382 C  CZ  . TYR B 2 27  ? 188.291 171.843 41.730  1.00 98.51  ? 46  TYR B CZ  1 
ATOM   4383 O  OH  . TYR B 2 27  ? 188.300 171.088 42.878  1.00 98.26  ? 46  TYR B OH  1 
ATOM   4384 N  N   . THR B 2 28  ? 191.105 173.430 37.314  1.00 112.64 ? 47  THR B N   1 
ATOM   4385 C  CA  . THR B 2 28  ? 192.402 172.846 37.640  1.00 104.24 ? 47  THR B CA  1 
ATOM   4386 C  C   . THR B 2 28  ? 192.361 172.344 39.077  1.00 108.90 ? 47  THR B C   1 
ATOM   4387 O  O   . THR B 2 28  ? 192.401 173.137 40.024  1.00 98.43  ? 47  THR B O   1 
ATOM   4388 C  CB  . THR B 2 28  ? 193.513 173.873 37.452  1.00 105.36 ? 47  THR B CB  1 
ATOM   4389 O  OG1 . THR B 2 28  ? 193.510 174.346 36.098  1.00 117.82 ? 47  THR B OG1 1 
ATOM   4390 C  CG2 . THR B 2 28  ? 194.867 173.248 37.757  1.00 120.87 ? 47  THR B CG2 1 
ATOM   4391 N  N   . PHE B 2 29  ? 192.309 171.019 39.236  1.00 121.38 ? 48  PHE B N   1 
ATOM   4392 C  CA  . PHE B 2 29  ? 192.116 170.412 40.551  1.00 94.00  ? 48  PHE B CA  1 
ATOM   4393 C  C   . PHE B 2 29  ? 193.238 170.755 41.520  1.00 78.38  ? 48  PHE B C   1 
ATOM   4394 O  O   . PHE B 2 29  ? 193.013 170.802 42.734  1.00 74.95  ? 48  PHE B O   1 
ATOM   4395 C  CB  . PHE B 2 29  ? 191.997 168.896 40.406  1.00 105.89 ? 48  PHE B CB  1 
ATOM   4396 C  CG  . PHE B 2 29  ? 191.741 168.182 41.700  1.00 98.48  ? 48  PHE B CG  1 
ATOM   4397 C  CD1 . PHE B 2 29  ? 190.467 168.142 42.241  1.00 98.16  ? 48  PHE B CD1 1 
ATOM   4398 C  CD2 . PHE B 2 29  ? 192.773 167.554 42.377  1.00 91.82  ? 48  PHE B CD2 1 
ATOM   4399 C  CE1 . PHE B 2 29  ? 190.227 167.488 43.431  1.00 101.17 ? 48  PHE B CE1 1 
ATOM   4400 C  CE2 . PHE B 2 29  ? 192.538 166.900 43.568  1.00 74.21  ? 48  PHE B CE2 1 
ATOM   4401 C  CZ  . PHE B 2 29  ? 191.263 166.867 44.095  1.00 85.32  ? 48  PHE B CZ  1 
ATOM   4402 N  N   . THR B 2 30  ? 194.441 171.001 41.015  1.00 115.93 ? 49  THR B N   1 
ATOM   4403 C  CA  . THR B 2 30  ? 195.597 171.273 41.855  1.00 130.34 ? 49  THR B CA  1 
ATOM   4404 C  C   . THR B 2 30  ? 195.716 172.746 42.231  1.00 127.49 ? 49  THR B C   1 
ATOM   4405 O  O   . THR B 2 30  ? 196.720 173.143 42.830  1.00 116.29 ? 49  THR B O   1 
ATOM   4406 C  CB  . THR B 2 30  ? 196.875 170.807 41.153  1.00 149.71 ? 49  THR B CB  1 
ATOM   4407 O  OG1 . THR B 2 30  ? 197.068 171.568 39.953  1.00 184.79 ? 49  THR B OG1 1 
ATOM   4408 C  CG2 . THR B 2 30  ? 196.776 169.329 40.800  1.00 117.67 ? 49  THR B CG2 1 
ATOM   4409 N  N   . ASP B 2 31  ? 194.721 173.562 41.884  1.00 130.26 ? 50  ASP B N   1 
ATOM   4410 C  CA  . ASP B 2 31  ? 194.756 174.999 42.124  1.00 130.99 ? 50  ASP B CA  1 
ATOM   4411 C  C   . ASP B 2 31  ? 194.016 175.439 43.382  1.00 125.45 ? 50  ASP B C   1 
ATOM   4412 O  O   . ASP B 2 31  ? 194.334 176.502 43.926  1.00 123.02 ? 50  ASP B O   1 
ATOM   4413 C  CB  . ASP B 2 31  ? 194.165 175.749 40.923  1.00 144.34 ? 50  ASP B CB  1 
ATOM   4414 C  CG  . ASP B 2 31  ? 195.221 176.184 39.928  1.00 161.98 ? 50  ASP B CG  1 
ATOM   4415 O  OD1 . ASP B 2 31  ? 196.411 176.218 40.299  1.00 153.69 ? 50  ASP B OD1 1 
ATOM   4416 O  OD2 . ASP B 2 31  ? 194.859 176.503 38.775  1.00 180.14 ? 50  ASP B OD2 1 
ATOM   4417 N  N   . TYR B 2 32  ? 193.031 174.679 43.854  1.00 120.85 ? 51  TYR B N   1 
ATOM   4418 C  CA  . TYR B 2 32  ? 192.180 175.128 44.947  1.00 91.63  ? 51  TYR B CA  1 
ATOM   4419 C  C   . TYR B 2 32  ? 192.154 174.153 46.120  1.00 91.28  ? 51  TYR B C   1 
ATOM   4420 O  O   . TYR B 2 32  ? 192.242 172.934 45.949  1.00 71.43  ? 51  TYR B O   1 
ATOM   4421 C  CB  . TYR B 2 32  ? 190.758 175.366 44.451  1.00 81.91  ? 51  TYR B CB  1 
ATOM   4422 C  CG  . TYR B 2 32  ? 190.674 176.427 43.383  1.00 89.11  ? 51  TYR B CG  1 
ATOM   4423 C  CD1 . TYR B 2 32  ? 190.702 177.772 43.715  1.00 92.22  ? 51  TYR B CD1 1 
ATOM   4424 C  CD2 . TYR B 2 32  ? 190.573 176.086 42.044  1.00 121.42 ? 51  TYR B CD2 1 
ATOM   4425 C  CE1 . TYR B 2 32  ? 190.627 178.748 42.746  1.00 87.11  ? 51  TYR B CE1 1 
ATOM   4426 C  CE2 . TYR B 2 32  ? 190.498 177.059 41.064  1.00 129.85 ? 51  TYR B CE2 1 
ATOM   4427 C  CZ  . TYR B 2 32  ? 190.525 178.388 41.423  1.00 96.64  ? 51  TYR B CZ  1 
ATOM   4428 O  OH  . TYR B 2 32  ? 190.447 179.360 40.455  1.00 108.34 ? 51  TYR B OH  1 
ATOM   4429 N  N   . TYR B 2 33  ? 192.046 174.727 47.319  1.00 101.42 ? 52  TYR B N   1 
ATOM   4430 C  CA  . TYR B 2 33  ? 191.799 173.961 48.535  1.00 97.64  ? 52  TYR B CA  1 
ATOM   4431 C  C   . TYR B 2 33  ? 190.463 173.235 48.442  1.00 80.23  ? 52  TYR B C   1 
ATOM   4432 O  O   . TYR B 2 33  ? 189.467 173.792 47.966  1.00 66.67  ? 52  TYR B O   1 
ATOM   4433 C  CB  . TYR B 2 33  ? 191.791 174.905 49.739  1.00 82.63  ? 52  TYR B CB  1 
ATOM   4434 C  CG  . TYR B 2 33  ? 193.133 175.142 50.394  1.00 95.82  ? 52  TYR B CG  1 
ATOM   4435 C  CD1 . TYR B 2 33  ? 194.086 174.135 50.478  1.00 114.99 ? 52  TYR B CD1 1 
ATOM   4436 C  CD2 . TYR B 2 33  ? 193.465 176.400 50.885  1.00 106.54 ? 52  TYR B CD2 1 
ATOM   4437 C  CE1 . TYR B 2 33  ? 195.318 174.367 51.070  1.00 136.62 ? 52  TYR B CE1 1 
ATOM   4438 C  CE2 . TYR B 2 33  ? 194.692 176.643 51.470  1.00 117.00 ? 52  TYR B CE2 1 
ATOM   4439 C  CZ  . TYR B 2 33  ? 195.616 175.625 51.560  1.00 129.42 ? 52  TYR B CZ  1 
ATOM   4440 O  OH  . TYR B 2 33  ? 196.837 175.870 52.146  1.00 120.32 ? 52  TYR B OH  1 
ATOM   4441 N  N   . MET B 2 34  ? 190.431 171.993 48.924  1.00 80.63  ? 53  MET B N   1 
ATOM   4442 C  CA  . MET B 2 34  ? 189.188 171.231 49.001  1.00 96.35  ? 53  MET B CA  1 
ATOM   4443 C  C   . MET B 2 34  ? 188.708 171.170 50.446  1.00 110.93 ? 53  MET B C   1 
ATOM   4444 O  O   . MET B 2 34  ? 189.454 170.743 51.332  1.00 122.92 ? 53  MET B O   1 
ATOM   4445 C  CB  . MET B 2 34  ? 189.367 169.822 48.433  1.00 109.29 ? 53  MET B CB  1 
ATOM   4446 C  CG  . MET B 2 34  ? 188.081 169.017 48.414  1.00 116.59 ? 53  MET B CG  1 
ATOM   4447 S  SD  . MET B 2 34  ? 186.825 169.768 47.356  1.00 108.16 ? 53  MET B SD  1 
ATOM   4448 C  CE  . MET B 2 34  ? 187.681 169.815 45.785  1.00 106.97 ? 53  MET B CE  1 
ATOM   4449 N  N   . ASN B 2 35  ? 187.465 171.585 50.681  1.00 116.40 ? 54  ASN B N   1 
ATOM   4450 C  CA  . ASN B 2 35  ? 186.914 171.706 52.025  1.00 102.02 ? 54  ASN B CA  1 
ATOM   4451 C  C   . ASN B 2 35  ? 185.752 170.741 52.232  1.00 100.72 ? 54  ASN B C   1 
ATOM   4452 O  O   . ASN B 2 35  ? 185.180 170.198 51.281  1.00 100.35 ? 54  ASN B O   1 
ATOM   4453 C  CB  . ASN B 2 35  ? 186.427 173.139 52.277  1.00 81.07  ? 54  ASN B CB  1 
ATOM   4454 C  CG  . ASN B 2 35  ? 187.536 174.160 52.169  1.00 92.28  ? 54  ASN B CG  1 
ATOM   4455 O  OD1 . ASN B 2 35  ? 188.022 174.674 53.175  1.00 101.95 ? 54  ASN B OD1 1 
ATOM   4456 N  ND2 . ASN B 2 35  ? 187.961 174.443 50.943  1.00 69.84  ? 54  ASN B ND2 1 
ATOM   4457 N  N   . TRP B 2 36  ? 185.388 170.557 53.502  1.00 113.87 ? 55  TRP B N   1 
ATOM   4458 C  CA  . TRP B 2 36  ? 184.236 169.735 53.874  1.00 117.29 ? 55  TRP B CA  1 
ATOM   4459 C  C   . TRP B 2 36  ? 183.426 170.453 54.944  1.00 119.49 ? 55  TRP B C   1 
ATOM   4460 O  O   . TRP B 2 36  ? 183.955 170.783 56.007  1.00 103.03 ? 55  TRP B O   1 
ATOM   4461 C  CB  . TRP B 2 36  ? 184.666 168.344 54.354  1.00 99.95  ? 55  TRP B CB  1 
ATOM   4462 C  CG  . TRP B 2 36  ? 185.125 167.450 53.240  1.00 114.50 ? 55  TRP B CG  1 
ATOM   4463 C  CD1 . TRP B 2 36  ? 186.391 167.335 52.747  1.00 122.21 ? 55  TRP B CD1 1 
ATOM   4464 C  CD2 . TRP B 2 36  ? 184.313 166.547 52.475  1.00 124.40 ? 55  TRP B CD2 1 
ATOM   4465 N  NE1 . TRP B 2 36  ? 186.420 166.414 51.726  1.00 137.18 ? 55  TRP B NE1 1 
ATOM   4466 C  CE2 . TRP B 2 36  ? 185.157 165.918 51.540  1.00 138.45 ? 55  TRP B CE2 1 
ATOM   4467 C  CE3 . TRP B 2 36  ? 182.955 166.211 52.492  1.00 121.29 ? 55  TRP B CE3 1 
ATOM   4468 C  CZ2 . TRP B 2 36  ? 184.687 164.971 50.630  1.00 146.35 ? 55  TRP B CZ2 1 
ATOM   4469 C  CZ3 . TRP B 2 36  ? 182.491 165.272 51.590  1.00 122.94 ? 55  TRP B CZ3 1 
ATOM   4470 C  CH2 . TRP B 2 36  ? 183.354 164.663 50.672  1.00 136.74 ? 55  TRP B CH2 1 
ATOM   4471 N  N   . VAL B 2 37  ? 182.151 170.711 54.658  1.00 132.88 ? 56  VAL B N   1 
ATOM   4472 C  CA  . VAL B 2 37  ? 181.256 171.430 55.561  1.00 120.95 ? 56  VAL B CA  1 
ATOM   4473 C  C   . VAL B 2 37  ? 180.156 170.487 56.028  1.00 115.11 ? 56  VAL B C   1 
ATOM   4474 O  O   . VAL B 2 37  ? 179.482 169.854 55.207  1.00 111.81 ? 56  VAL B O   1 
ATOM   4475 C  CB  . VAL B 2 37  ? 180.652 172.673 54.885  1.00 118.06 ? 56  VAL B CB  1 
ATOM   4476 C  CG1 . VAL B 2 37  ? 179.716 173.397 55.842  1.00 117.28 ? 56  VAL B CG1 1 
ATOM   4477 C  CG2 . VAL B 2 37  ? 181.753 173.604 54.402  1.00 115.16 ? 56  VAL B CG2 1 
ATOM   4478 N  N   . LYS B 2 38  ? 179.973 170.400 57.343  1.00 109.22 ? 57  LYS B N   1 
ATOM   4479 C  CA  . LYS B 2 38  ? 178.936 169.582 57.960  1.00 105.74 ? 57  LYS B CA  1 
ATOM   4480 C  C   . LYS B 2 38  ? 177.714 170.441 58.259  1.00 113.22 ? 57  LYS B C   1 
ATOM   4481 O  O   . LYS B 2 38  ? 177.837 171.518 58.851  1.00 114.29 ? 57  LYS B O   1 
ATOM   4482 C  CB  . LYS B 2 38  ? 179.443 168.933 59.248  1.00 95.10  ? 57  LYS B CB  1 
ATOM   4483 C  CG  . LYS B 2 38  ? 178.354 168.287 60.095  1.00 111.40 ? 57  LYS B CG  1 
ATOM   4484 C  CD  . LYS B 2 38  ? 178.924 167.751 61.403  1.00 123.95 ? 57  LYS B CD  1 
ATOM   4485 C  CE  . LYS B 2 38  ? 177.834 167.184 62.300  1.00 131.56 ? 57  LYS B CE  1 
ATOM   4486 N  NZ  . LYS B 2 38  ? 178.376 166.692 63.598  1.00 131.28 ? 57  LYS B NZ  1 
ATOM   4487 N  N   . GLN B 2 39  ? 176.542 169.981 57.825  1.00 125.60 ? 58  GLN B N   1 
ATOM   4488 C  CA  . GLN B 2 39  ? 175.289 170.679 58.093  1.00 128.91 ? 58  GLN B CA  1 
ATOM   4489 C  C   . GLN B 2 39  ? 174.310 169.714 58.749  1.00 142.05 ? 58  GLN B C   1 
ATOM   4490 O  O   . GLN B 2 39  ? 173.875 168.741 58.121  1.00 123.79 ? 58  GLN B O   1 
ATOM   4491 C  CB  . GLN B 2 39  ? 174.694 171.266 56.816  1.00 107.70 ? 58  GLN B CB  1 
ATOM   4492 C  CG  . GLN B 2 39  ? 173.456 172.094 57.078  1.00 118.72 ? 58  GLN B CG  1 
ATOM   4493 C  CD  . GLN B 2 39  ? 172.869 172.678 55.818  1.00 139.07 ? 58  GLN B CD  1 
ATOM   4494 O  OE1 . GLN B 2 39  ? 173.233 172.283 54.710  1.00 136.47 ? 58  GLN B OE1 1 
ATOM   4495 N  NE2 . GLN B 2 39  ? 171.967 173.641 55.977  1.00 138.97 ? 58  GLN B NE2 1 
ATOM   4496 N  N   . SER B 2 40  ? 173.975 169.977 60.011  1.00 156.03 ? 59  SER B N   1 
ATOM   4497 C  CA  . SER B 2 40  ? 173.033 169.153 60.750  1.00 160.30 ? 59  SER B CA  1 
ATOM   4498 C  C   . SER B 2 40  ? 171.600 169.486 60.344  1.00 177.98 ? 59  SER B C   1 
ATOM   4499 O  O   . SER B 2 40  ? 171.321 170.535 59.757  1.00 186.01 ? 59  SER B O   1 
ATOM   4500 C  CB  . SER B 2 40  ? 173.206 169.347 62.257  1.00 146.85 ? 59  SER B CB  1 
ATOM   4501 O  OG  . SER B 2 40  ? 174.535 169.075 62.664  1.00 156.30 ? 59  SER B OG  1 
ATOM   4502 N  N   . HIS B 2 41  ? 170.684 168.577 60.674  1.00 191.08 ? 60  HIS B N   1 
ATOM   4503 C  CA  . HIS B 2 41  ? 169.280 168.754 60.317  1.00 196.38 ? 60  HIS B CA  1 
ATOM   4504 C  C   . HIS B 2 41  ? 168.710 169.940 61.082  1.00 204.67 ? 60  HIS B C   1 
ATOM   4505 O  O   . HIS B 2 41  ? 168.539 169.878 62.304  1.00 199.52 ? 60  HIS B O   1 
ATOM   4506 C  CB  . HIS B 2 41  ? 168.488 167.486 60.619  1.00 195.31 ? 60  HIS B CB  1 
ATOM   4507 C  CG  . HIS B 2 41  ? 167.036 167.586 60.269  1.00 202.49 ? 60  HIS B CG  1 
ATOM   4508 N  ND1 . HIS B 2 41  ? 166.595 167.886 58.998  1.00 209.62 ? 60  HIS B ND1 1 
ATOM   4509 C  CD2 . HIS B 2 41  ? 165.924 167.440 61.028  1.00 205.49 ? 60  HIS B CD2 1 
ATOM   4510 C  CE1 . HIS B 2 41  ? 165.274 167.914 58.987  1.00 206.23 ? 60  HIS B CE1 1 
ATOM   4511 N  NE2 . HIS B 2 41  ? 164.842 167.647 60.207  1.00 202.67 ? 60  HIS B NE2 1 
ATOM   4512 N  N   . GLY B 2 42  ? 168.416 171.022 60.366  1.00 209.85 ? 61  GLY B N   1 
ATOM   4513 C  CA  . GLY B 2 42  ? 167.849 172.204 60.972  1.00 202.80 ? 61  GLY B CA  1 
ATOM   4514 C  C   . GLY B 2 42  ? 168.856 173.122 61.625  1.00 205.58 ? 61  GLY B C   1 
ATOM   4515 O  O   . GLY B 2 42  ? 168.457 174.145 62.196  1.00 198.24 ? 61  GLY B O   1 
ATOM   4516 N  N   . LYS B 2 43  ? 170.143 172.800 61.549  1.00 203.84 ? 62  LYS B N   1 
ATOM   4517 C  CA  . LYS B 2 43  ? 171.194 173.604 62.143  1.00 194.85 ? 62  LYS B CA  1 
ATOM   4518 C  C   . LYS B 2 43  ? 171.930 174.388 61.061  1.00 172.02 ? 62  LYS B C   1 
ATOM   4519 O  O   . LYS B 2 43  ? 171.546 174.393 59.887  1.00 166.32 ? 62  LYS B O   1 
ATOM   4520 C  CB  . LYS B 2 43  ? 172.148 172.715 62.944  1.00 186.48 ? 62  LYS B CB  1 
ATOM   4521 C  CG  . LYS B 2 43  ? 171.499 172.023 64.129  1.00 187.35 ? 62  LYS B CG  1 
ATOM   4522 C  CD  . LYS B 2 43  ? 170.945 173.043 65.109  1.00 196.34 ? 62  LYS B CD  1 
ATOM   4523 C  CE  . LYS B 2 43  ? 170.291 172.370 66.304  1.00 202.35 ? 62  LYS B CE  1 
ATOM   4524 N  NZ  . LYS B 2 43  ? 169.731 173.369 67.257  1.00 214.66 ? 62  LYS B NZ  1 
ATOM   4525 N  N   . SER B 2 44  ? 173.007 175.053 61.460  1.00 158.22 ? 63  SER B N   1 
ATOM   4526 C  CA  . SER B 2 44  ? 173.783 175.896 60.570  1.00 147.50 ? 63  SER B CA  1 
ATOM   4527 C  C   . SER B 2 44  ? 174.953 175.106 59.985  1.00 148.78 ? 63  SER B C   1 
ATOM   4528 O  O   . SER B 2 44  ? 175.177 173.936 60.307  1.00 147.69 ? 63  SER B O   1 
ATOM   4529 C  CB  . SER B 2 44  ? 174.261 177.142 61.314  1.00 128.63 ? 63  SER B CB  1 
ATOM   4530 O  OG  . SER B 2 44  ? 175.039 177.978 60.476  1.00 107.36 ? 63  SER B OG  1 
ATOM   4531 N  N   . LEU B 2 45  ? 175.708 175.758 59.107  1.00 131.30 ? 64  LEU B N   1 
ATOM   4532 C  CA  . LEU B 2 45  ? 176.868 175.144 58.484  1.00 103.17 ? 64  LEU B CA  1 
ATOM   4533 C  C   . LEU B 2 45  ? 178.024 175.093 59.473  1.00 115.81 ? 64  LEU B C   1 
ATOM   4534 O  O   . LEU B 2 45  ? 178.148 175.943 60.359  1.00 126.97 ? 64  LEU B O   1 
ATOM   4535 C  CB  . LEU B 2 45  ? 177.275 175.925 57.237  1.00 112.91 ? 64  LEU B CB  1 
ATOM   4536 C  CG  . LEU B 2 45  ? 176.183 176.004 56.170  1.00 107.13 ? 64  LEU B CG  1 
ATOM   4537 C  CD1 . LEU B 2 45  ? 176.618 176.889 55.017  1.00 102.55 ? 64  LEU B CD1 1 
ATOM   4538 C  CD2 . LEU B 2 45  ? 175.822 174.610 55.685  1.00 108.00 ? 64  LEU B CD2 1 
ATOM   4539 N  N   . GLU B 2 46  ? 178.892 174.098 59.301  1.00 124.09 ? 65  GLU B N   1 
ATOM   4540 C  CA  . GLU B 2 46  ? 179.983 173.876 60.248  1.00 130.92 ? 65  GLU B CA  1 
ATOM   4541 C  C   . GLU B 2 46  ? 181.202 173.377 59.486  1.00 160.47 ? 65  GLU B C   1 
ATOM   4542 O  O   . GLU B 2 46  ? 181.253 172.212 59.079  1.00 174.43 ? 65  GLU B O   1 
ATOM   4543 C  CB  . GLU B 2 46  ? 179.566 172.872 61.319  1.00 128.15 ? 65  GLU B CB  1 
ATOM   4544 C  CG  . GLU B 2 46  ? 180.404 172.907 62.580  1.00 140.78 ? 65  GLU B CG  1 
ATOM   4545 C  CD  . GLU B 2 46  ? 179.780 172.109 63.709  1.00 155.88 ? 65  GLU B CD  1 
ATOM   4546 O  OE1 . GLU B 2 46  ? 178.978 171.195 63.420  1.00 155.81 ? 65  GLU B OE1 1 
ATOM   4547 O  OE2 . GLU B 2 46  ? 180.088 172.395 64.883  1.00 150.62 ? 65  GLU B OE2 1 
ATOM   4548 N  N   . TRP B 2 47  ? 182.183 174.260 59.320  1.00 149.39 ? 66  TRP B N   1 
ATOM   4549 C  CA  . TRP B 2 47  ? 183.383 173.960 58.548  1.00 128.96 ? 66  TRP B CA  1 
ATOM   4550 C  C   . TRP B 2 47  ? 184.224 172.896 59.245  1.00 110.89 ? 66  TRP B C   1 
ATOM   4551 O  O   . TRP B 2 47  ? 184.674 173.092 60.378  1.00 114.19 ? 66  TRP B O   1 
ATOM   4552 C  CB  . TRP B 2 47  ? 184.194 175.239 58.357  1.00 129.64 ? 66  TRP B CB  1 
ATOM   4553 C  CG  . TRP B 2 47  ? 185.441 175.066 57.558  1.00 128.53 ? 66  TRP B CG  1 
ATOM   4554 C  CD1 . TRP B 2 47  ? 185.541 174.883 56.210  1.00 128.32 ? 66  TRP B CD1 1 
ATOM   4555 C  CD2 . TRP B 2 47  ? 186.780 175.045 58.068  1.00 115.63 ? 66  TRP B CD2 1 
ATOM   4556 N  NE1 . TRP B 2 47  ? 186.862 174.758 55.848  1.00 124.31 ? 66  TRP B NE1 1 
ATOM   4557 C  CE2 . TRP B 2 47  ? 187.641 174.852 56.971  1.00 116.27 ? 66  TRP B CE2 1 
ATOM   4558 C  CE3 . TRP B 2 47  ? 187.332 175.172 59.346  1.00 105.53 ? 66  TRP B CE3 1 
ATOM   4559 C  CZ2 . TRP B 2 47  ? 189.024 174.786 57.114  1.00 113.93 ? 66  TRP B CZ2 1 
ATOM   4560 C  CZ3 . TRP B 2 47  ? 188.704 175.105 59.486  1.00 100.63 ? 66  TRP B CZ3 1 
ATOM   4561 C  CH2 . TRP B 2 47  ? 189.535 174.915 58.377  1.00 107.18 ? 66  TRP B CH2 1 
ATOM   4562 N  N   . ILE B 2 48  ? 184.433 171.768 58.564  1.00 102.77 ? 67  ILE B N   1 
ATOM   4563 C  CA  . ILE B 2 48  ? 185.200 170.666 59.141  1.00 98.29  ? 67  ILE B CA  1 
ATOM   4564 C  C   . ILE B 2 48  ? 186.695 170.882 58.941  1.00 96.48  ? 67  ILE B C   1 
ATOM   4565 O  O   . ILE B 2 48  ? 187.478 170.842 59.896  1.00 78.00  ? 67  ILE B O   1 
ATOM   4566 C  CB  . ILE B 2 48  ? 184.749 169.318 58.547  1.00 93.41  ? 67  ILE B CB  1 
ATOM   4567 C  CG1 . ILE B 2 48  ? 183.275 169.056 58.845  1.00 105.38 ? 67  ILE B CG1 1 
ATOM   4568 C  CG2 . ILE B 2 48  ? 185.601 168.184 59.088  1.00 68.84  ? 67  ILE B CG2 1 
ATOM   4569 C  CD1 . ILE B 2 48  ? 182.788 167.746 58.277  1.00 116.88 ? 67  ILE B CD1 1 
ATOM   4570 N  N   . GLY B 2 49  ? 187.114 171.086 57.697  1.00 121.88 ? 68  GLY B N   1 
ATOM   4571 C  CA  . GLY B 2 49  ? 188.522 171.273 57.402  1.00 128.40 ? 68  GLY B CA  1 
ATOM   4572 C  C   . GLY B 2 49  ? 188.771 171.233 55.912  1.00 118.53 ? 68  GLY B C   1 
ATOM   4573 O  O   . GLY B 2 49  ? 187.899 170.857 55.111  1.00 129.16 ? 68  GLY B O   1 
ATOM   4574 N  N   . ASN B 2 50  ? 189.975 171.670 55.542  1.00 120.83 ? 69  ASN B N   1 
ATOM   4575 C  CA  . ASN B 2 50  ? 190.385 171.698 54.143  1.00 112.89 ? 69  ASN B CA  1 
ATOM   4576 C  C   . ASN B 2 50  ? 191.578 170.770 53.933  1.00 115.62 ? 69  ASN B C   1 
ATOM   4577 O  O   . ASN B 2 50  ? 192.106 170.162 54.870  1.00 74.97  ? 69  ASN B O   1 
ATOM   4578 C  CB  . ASN B 2 50  ? 190.731 173.117 53.676  1.00 104.79 ? 69  ASN B CB  1 
ATOM   4579 C  CG  . ASN B 2 50  ? 191.930 173.713 54.401  1.00 102.34 ? 69  ASN B CG  1 
ATOM   4580 O  OD1 . ASN B 2 50  ? 191.785 174.366 55.430  1.00 103.85 ? 69  ASN B OD1 1 
ATOM   4581 N  ND2 . ASN B 2 50  ? 193.119 173.516 53.842  1.00 78.28  ? 69  ASN B ND2 1 
ATOM   4582 N  N   . ILE B 2 51  ? 191.994 170.672 52.673  1.00 118.97 ? 70  ILE B N   1 
ATOM   4583 C  CA  . ILE B 2 51  ? 193.132 169.855 52.275  1.00 109.76 ? 70  ILE B CA  1 
ATOM   4584 C  C   . ILE B 2 51  ? 193.722 170.443 51.001  1.00 106.98 ? 70  ILE B C   1 
ATOM   4585 O  O   . ILE B 2 51  ? 192.993 170.897 50.107  1.00 82.59  ? 70  ILE B O   1 
ATOM   4586 C  CB  . ILE B 2 51  ? 192.742 168.372 52.098  1.00 72.95  ? 70  ILE B CB  1 
ATOM   4587 C  CG1 . ILE B 2 51  ? 193.929 167.562 51.584  1.00 76.13  ? 70  ILE B CG1 1 
ATOM   4588 C  CG2 . ILE B 2 51  ? 191.570 168.232 51.143  1.00 73.52  ? 70  ILE B CG2 1 
ATOM   4589 C  CD1 . ILE B 2 51  ? 193.634 166.091 51.461  1.00 75.73  ? 70  ILE B CD1 1 
ATOM   4590 N  N   . ASN B 2 52  ? 195.056 170.525 50.980  1.00 140.20 ? 71  ASN B N   1 
ATOM   4591 C  CA  . ASN B 2 52  ? 195.802 170.982 49.817  1.00 125.40 ? 71  ASN B CA  1 
ATOM   4592 C  C   . ASN B 2 52  ? 196.025 169.802 48.880  1.00 117.27 ? 71  ASN B C   1 
ATOM   4593 O  O   . ASN B 2 52  ? 196.742 168.859 49.253  1.00 119.99 ? 71  ASN B O   1 
ATOM   4594 C  CB  . ASN B 2 52  ? 197.140 171.569 50.239  1.00 107.91 ? 71  ASN B CB  1 
ATOM   4595 C  CG  . ASN B 2 52  ? 197.783 172.400 49.150  1.00 102.54 ? 71  ASN B CG  1 
ATOM   4596 O  OD1 . ASN B 2 52  ? 197.565 172.162 47.960  1.00 96.60  ? 71  ASN B OD1 1 
ATOM   4597 N  ND2 . ASN B 2 52  ? 198.589 173.375 49.549  1.00 121.90 ? 71  ASN B ND2 1 
ATOM   4598 N  N   . PRO B 2 53  ? 195.452 169.814 47.673  1.00 99.09  ? 72  PRO B N   1 
ATOM   4599 C  CA  . PRO B 2 53  ? 195.599 168.673 46.753  1.00 99.37  ? 72  PRO B CA  1 
ATOM   4600 C  C   . PRO B 2 53  ? 197.022 168.429 46.282  1.00 115.35 ? 72  PRO B C   1 
ATOM   4601 O  O   . PRO B 2 53  ? 197.342 167.300 45.891  1.00 145.64 ? 72  PRO B O   1 
ATOM   4602 C  CB  . PRO B 2 53  ? 194.688 169.055 45.576  1.00 111.16 ? 72  PRO B CB  1 
ATOM   4603 C  CG  . PRO B 2 53  ? 193.754 170.093 46.120  1.00 105.40 ? 72  PRO B CG  1 
ATOM   4604 C  CD  . PRO B 2 53  ? 194.557 170.848 47.131  1.00 97.28  ? 72  PRO B CD  1 
ATOM   4605 N  N   . ASN B 2 54  ? 197.887 169.442 46.334  1.00 99.32  ? 73  ASN B N   1 
ATOM   4606 C  CA  . ASN B 2 54  ? 199.243 169.311 45.813  1.00 109.48 ? 73  ASN B CA  1 
ATOM   4607 C  C   . ASN B 2 54  ? 200.078 168.360 46.658  1.00 132.21 ? 73  ASN B C   1 
ATOM   4608 O  O   . ASN B 2 54  ? 200.911 167.616 46.127  1.00 150.61 ? 73  ASN B O   1 
ATOM   4609 C  CB  . ASN B 2 54  ? 199.896 170.687 45.741  1.00 130.36 ? 73  ASN B CB  1 
ATOM   4610 C  CG  . ASN B 2 54  ? 199.107 171.648 44.883  1.00 143.33 ? 73  ASN B CG  1 
ATOM   4611 O  OD1 . ASN B 2 54  ? 198.456 171.242 43.920  1.00 140.71 ? 73  ASN B OD1 1 
ATOM   4612 N  ND2 . ASN B 2 54  ? 199.145 172.928 45.234  1.00 157.68 ? 73  ASN B ND2 1 
ATOM   4613 N  N   . ASN B 2 55  ? 199.888 168.387 47.969  1.00 134.01 ? 74  ASN B N   1 
ATOM   4614 C  CA  . ASN B 2 55  ? 200.674 167.573 48.880  1.00 146.61 ? 74  ASN B CA  1 
ATOM   4615 C  C   . ASN B 2 55  ? 199.806 166.936 49.948  1.00 156.50 ? 74  ASN B C   1 
ATOM   4616 O  O   . ASN B 2 55  ? 200.336 166.226 50.808  1.00 170.09 ? 74  ASN B O   1 
ATOM   4617 C  CB  . ASN B 2 55  ? 201.754 168.418 49.566  1.00 150.45 ? 74  ASN B CB  1 
ATOM   4618 C  CG  . ASN B 2 55  ? 201.166 169.570 50.354  1.00 145.63 ? 74  ASN B CG  1 
ATOM   4619 O  OD1 . ASN B 2 55  ? 200.081 170.062 50.041  1.00 123.28 ? 74  ASN B OD1 1 
ATOM   4620 N  ND2 . ASN B 2 55  ? 201.879 170.005 51.386  1.00 162.63 ? 74  ASN B ND2 1 
ATOM   4621 N  N   . GLY B 2 56  ? 198.500 167.170 49.925  1.00 180.97 ? 75  GLY B N   1 
ATOM   4622 C  CA  . GLY B 2 56  ? 197.626 166.664 50.959  1.00 175.13 ? 75  GLY B CA  1 
ATOM   4623 C  C   . GLY B 2 56  ? 197.706 167.519 52.199  1.00 153.89 ? 75  GLY B C   1 
ATOM   4624 O  O   . GLY B 2 56  ? 197.645 166.998 53.319  1.00 98.43  ? 75  GLY B O   1 
ATOM   4625 N  N   . GLY B 2 57  ? 197.857 168.830 52.025  1.00 200.66 ? 76  GLY B N   1 
ATOM   4626 C  CA  . GLY B 2 57  ? 198.040 169.720 53.154  1.00 206.56 ? 76  GLY B CA  1 
ATOM   4627 C  C   . GLY B 2 57  ? 196.762 169.944 53.934  1.00 204.74 ? 76  GLY B C   1 
ATOM   4628 O  O   . GLY B 2 57  ? 196.028 170.901 53.672  1.00 211.75 ? 76  GLY B O   1 
ATOM   4629 N  N   . THR B 2 58  ? 196.494 169.080 54.907  1.00 155.83 ? 77  THR B N   1 
ATOM   4630 C  CA  . THR B 2 58  ? 195.234 169.138 55.626  1.00 129.27 ? 77  THR B CA  1 
ATOM   4631 C  C   . THR B 2 58  ? 195.252 170.266 56.650  1.00 122.44 ? 77  THR B C   1 
ATOM   4632 O  O   . THR B 2 58  ? 196.305 170.652 57.167  1.00 133.64 ? 77  THR B O   1 
ATOM   4633 C  CB  . THR B 2 58  ? 194.948 167.808 56.322  1.00 121.00 ? 77  THR B CB  1 
ATOM   4634 O  OG1 . THR B 2 58  ? 195.983 167.531 57.273  1.00 132.91 ? 77  THR B OG1 1 
ATOM   4635 C  CG2 . THR B 2 58  ? 194.892 166.679 55.304  1.00 133.05 ? 77  THR B CG2 1 
ATOM   4636 N  N   . SER B 2 59  ? 194.063 170.794 56.939  1.00 124.67 ? 78  SER B N   1 
ATOM   4637 C  CA  . SER B 2 59  ? 193.896 171.798 57.988  1.00 131.20 ? 78  SER B CA  1 
ATOM   4638 C  C   . SER B 2 59  ? 192.517 171.579 58.607  1.00 145.96 ? 78  SER B C   1 
ATOM   4639 O  O   . SER B 2 59  ? 191.504 171.991 58.031  1.00 143.61 ? 78  SER B O   1 
ATOM   4640 C  CB  . SER B 2 59  ? 194.051 173.210 57.438  1.00 111.66 ? 78  SER B CB  1 
ATOM   4641 O  OG  . SER B 2 59  ? 193.785 174.181 58.437  1.00 107.02 ? 78  SER B OG  1 
ATOM   4642 N  N   . TYR B 2 60  ? 192.487 170.887 59.744  1.00 134.34 ? 79  TYR B N   1 
ATOM   4643 C  CA  . TYR B 2 60  ? 191.245 170.530 60.412  1.00 131.43 ? 79  TYR B CA  1 
ATOM   4644 C  C   . TYR B 2 60  ? 190.827 171.609 61.411  1.00 143.46 ? 79  TYR B C   1 
ATOM   4645 O  O   . TYR B 2 60  ? 191.578 172.534 61.726  1.00 167.58 ? 79  TYR B O   1 
ATOM   4646 C  CB  . TYR B 2 60  ? 191.388 169.187 61.130  1.00 121.16 ? 79  TYR B CB  1 
ATOM   4647 C  CG  . TYR B 2 60  ? 191.961 168.073 60.284  1.00 125.64 ? 79  TYR B CG  1 
ATOM   4648 C  CD1 . TYR B 2 60  ? 191.142 167.303 59.466  1.00 122.05 ? 79  TYR B CD1 1 
ATOM   4649 C  CD2 . TYR B 2 60  ? 193.321 167.790 60.303  1.00 133.05 ? 79  TYR B CD2 1 
ATOM   4650 C  CE1 . TYR B 2 60  ? 191.662 166.279 58.693  1.00 139.93 ? 79  TYR B CE1 1 
ATOM   4651 C  CE2 . TYR B 2 60  ? 193.849 166.771 59.534  1.00 154.53 ? 79  TYR B CE2 1 
ATOM   4652 C  CZ  . TYR B 2 60  ? 193.017 166.020 58.730  1.00 156.23 ? 79  TYR B CZ  1 
ATOM   4653 O  OH  . TYR B 2 60  ? 193.545 165.005 57.966  1.00 170.18 ? 79  TYR B OH  1 
ATOM   4654 N  N   . ASN B 2 61  ? 189.598 171.480 61.902  1.00 130.63 ? 80  ASN B N   1 
ATOM   4655 C  CA  . ASN B 2 61  ? 189.072 172.334 62.956  1.00 149.14 ? 80  ASN B CA  1 
ATOM   4656 C  C   . ASN B 2 61  ? 189.326 171.712 64.323  1.00 176.76 ? 80  ASN B C   1 
ATOM   4657 O  O   . ASN B 2 61  ? 189.363 170.488 64.470  1.00 196.04 ? 80  ASN B O   1 
ATOM   4658 C  CB  . ASN B 2 61  ? 187.570 172.558 62.761  1.00 134.49 ? 80  ASN B CB  1 
ATOM   4659 C  CG  . ASN B 2 61  ? 187.014 173.661 63.647  1.00 113.52 ? 80  ASN B CG  1 
ATOM   4660 O  OD1 . ASN B 2 61  ? 187.595 174.008 64.676  1.00 124.06 ? 80  ASN B OD1 1 
ATOM   4661 N  ND2 . ASN B 2 61  ? 185.871 174.210 63.252  1.00 113.64 ? 80  ASN B ND2 1 
ATOM   4662 N  N   . GLN B 2 62  ? 189.494 172.574 65.331  1.00 194.35 ? 81  GLN B N   1 
ATOM   4663 C  CA  . GLN B 2 62  ? 189.739 172.082 66.684  1.00 208.74 ? 81  GLN B CA  1 
ATOM   4664 C  C   . GLN B 2 62  ? 188.572 171.239 67.179  1.00 212.47 ? 81  GLN B C   1 
ATOM   4665 O  O   . GLN B 2 62  ? 188.763 170.315 67.979  1.00 230.06 ? 81  GLN B O   1 
ATOM   4666 C  CB  . GLN B 2 62  ? 189.991 173.252 67.637  1.00 218.88 ? 81  GLN B CB  1 
ATOM   4667 C  CG  . GLN B 2 62  ? 190.397 172.829 69.043  1.00 233.14 ? 81  GLN B CG  1 
ATOM   4668 C  CD  . GLN B 2 62  ? 190.599 174.007 69.976  1.00 249.58 ? 81  GLN B CD  1 
ATOM   4669 O  OE1 . GLN B 2 62  ? 190.364 175.156 69.603  1.00 254.55 ? 81  GLN B OE1 1 
ATOM   4670 N  NE2 . GLN B 2 62  ? 191.035 173.726 71.199  1.00 258.13 ? 81  GLN B NE2 1 
ATOM   4671 N  N   . LYS B 2 63  ? 187.362 171.530 66.696  1.00 178.63 ? 82  LYS B N   1 
ATOM   4672 C  CA  . LYS B 2 63  ? 186.166 170.796 67.083  1.00 157.84 ? 82  LYS B CA  1 
ATOM   4673 C  C   . LYS B 2 63  ? 186.077 169.437 66.401  1.00 158.16 ? 82  LYS B C   1 
ATOM   4674 O  O   . LYS B 2 63  ? 185.330 168.569 66.864  1.00 165.97 ? 82  LYS B O   1 
ATOM   4675 C  CB  . LYS B 2 63  ? 184.924 171.632 66.759  1.00 153.75 ? 82  LYS B CB  1 
ATOM   4676 C  CG  . LYS B 2 63  ? 183.628 171.115 67.358  1.00 174.69 ? 82  LYS B CG  1 
ATOM   4677 C  CD  . LYS B 2 63  ? 182.469 172.052 67.057  1.00 178.89 ? 82  LYS B CD  1 
ATOM   4678 C  CE  . LYS B 2 63  ? 181.175 171.535 67.667  1.00 193.57 ? 82  LYS B CE  1 
ATOM   4679 N  NZ  . LYS B 2 63  ? 180.026 172.439 67.379  1.00 195.60 ? 82  LYS B NZ  1 
ATOM   4680 N  N   . PHE B 2 64  ? 186.821 169.238 65.313  1.00 148.02 ? 83  PHE B N   1 
ATOM   4681 C  CA  . PHE B 2 64  ? 186.798 167.999 64.546  1.00 152.98 ? 83  PHE B CA  1 
ATOM   4682 C  C   . PHE B 2 64  ? 188.137 167.271 64.575  1.00 154.79 ? 83  PHE B C   1 
ATOM   4683 O  O   . PHE B 2 64  ? 188.311 166.288 63.844  1.00 157.65 ? 83  PHE B O   1 
ATOM   4684 C  CB  . PHE B 2 64  ? 186.380 168.278 63.099  1.00 149.24 ? 83  PHE B CB  1 
ATOM   4685 C  CG  . PHE B 2 64  ? 184.978 168.802 62.963  1.00 142.96 ? 83  PHE B CG  1 
ATOM   4686 C  CD1 . PHE B 2 64  ? 183.908 167.932 62.844  1.00 132.60 ? 83  PHE B CD1 1 
ATOM   4687 C  CD2 . PHE B 2 64  ? 184.730 170.166 62.956  1.00 141.29 ? 83  PHE B CD2 1 
ATOM   4688 C  CE1 . PHE B 2 64  ? 182.616 168.410 62.719  1.00 134.36 ? 83  PHE B CE1 1 
ATOM   4689 C  CE2 . PHE B 2 64  ? 183.441 170.650 62.832  1.00 144.35 ? 83  PHE B CE2 1 
ATOM   4690 C  CZ  . PHE B 2 64  ? 182.383 169.771 62.714  1.00 141.54 ? 83  PHE B CZ  1 
ATOM   4691 N  N   . LYS B 2 65  ? 189.071 167.707 65.417  1.00 140.20 ? 84  LYS B N   1 
ATOM   4692 C  CA  . LYS B 2 65  ? 190.368 167.050 65.529  1.00 150.88 ? 84  LYS B CA  1 
ATOM   4693 C  C   . LYS B 2 65  ? 190.201 165.635 66.061  1.00 151.38 ? 84  LYS B C   1 
ATOM   4694 O  O   . LYS B 2 65  ? 189.711 165.431 67.175  1.00 168.79 ? 84  LYS B O   1 
ATOM   4695 C  CB  . LYS B 2 65  ? 191.295 167.855 66.441  1.00 164.34 ? 84  LYS B CB  1 
ATOM   4696 C  CG  . LYS B 2 65  ? 191.888 169.100 65.797  1.00 177.05 ? 84  LYS B CG  1 
ATOM   4697 C  CD  . LYS B 2 65  ? 192.803 169.843 66.759  1.00 192.83 ? 84  LYS B CD  1 
ATOM   4698 C  CE  . LYS B 2 65  ? 193.358 171.110 66.126  1.00 191.82 ? 84  LYS B CE  1 
ATOM   4699 N  NZ  . LYS B 2 65  ? 194.240 171.862 67.061  1.00 196.44 ? 84  LYS B NZ  1 
ATOM   4700 N  N   . GLY B 2 66  ? 190.591 164.657 65.245  1.00 149.39 ? 85  GLY B N   1 
ATOM   4701 C  CA  . GLY B 2 66  ? 190.440 163.260 65.584  1.00 167.65 ? 85  GLY B CA  1 
ATOM   4702 C  C   . GLY B 2 66  ? 189.110 162.653 65.201  1.00 163.69 ? 85  GLY B C   1 
ATOM   4703 O  O   . GLY B 2 66  ? 188.894 161.462 65.457  1.00 168.62 ? 85  GLY B O   1 
ATOM   4704 N  N   . LYS B 2 67  ? 188.207 163.434 64.610  1.00 175.26 ? 86  LYS B N   1 
ATOM   4705 C  CA  . LYS B 2 67  ? 186.892 162.963 64.197  1.00 182.80 ? 86  LYS B CA  1 
ATOM   4706 C  C   . LYS B 2 67  ? 186.814 162.674 62.702  1.00 159.92 ? 86  LYS B C   1 
ATOM   4707 O  O   . LYS B 2 67  ? 186.245 161.653 62.302  1.00 176.59 ? 86  LYS B O   1 
ATOM   4708 C  CB  . LYS B 2 67  ? 185.821 163.990 64.577  1.00 183.75 ? 86  LYS B CB  1 
ATOM   4709 C  CG  . LYS B 2 67  ? 184.409 163.604 64.166  1.00 175.28 ? 86  LYS B CG  1 
ATOM   4710 C  CD  . LYS B 2 67  ? 184.014 162.269 64.784  1.00 160.82 ? 86  LYS B CD  1 
ATOM   4711 C  CE  . LYS B 2 67  ? 182.649 161.811 64.308  1.00 157.66 ? 86  LYS B CE  1 
ATOM   4712 N  NZ  . LYS B 2 67  ? 182.267 160.505 64.912  1.00 161.35 ? 86  LYS B NZ  1 
ATOM   4713 N  N   . ALA B 2 68  ? 187.379 163.547 61.870  1.00 124.76 ? 87  ALA B N   1 
ATOM   4714 C  CA  . ALA B 2 68  ? 187.349 163.413 60.420  1.00 107.99 ? 87  ALA B CA  1 
ATOM   4715 C  C   . ALA B 2 68  ? 188.767 163.324 59.869  1.00 159.68 ? 87  ALA B C   1 
ATOM   4716 O  O   . ALA B 2 68  ? 189.690 163.961 60.387  1.00 179.18 ? 87  ALA B O   1 
ATOM   4717 C  CB  . ALA B 2 68  ? 186.617 164.593 59.773  1.00 98.30  ? 87  ALA B CB  1 
ATOM   4718 N  N   . THR B 2 69  ? 188.936 162.533 58.807  1.00 137.07 ? 88  THR B N   1 
ATOM   4719 C  CA  . THR B 2 69  ? 190.225 162.410 58.128  1.00 122.65 ? 88  THR B CA  1 
ATOM   4720 C  C   . THR B 2 69  ? 190.051 162.671 56.639  1.00 97.02  ? 88  THR B C   1 
ATOM   4721 O  O   . THR B 2 69  ? 189.323 161.939 55.959  1.00 106.34 ? 88  THR B O   1 
ATOM   4722 C  CB  . THR B 2 69  ? 190.839 161.024 58.348  1.00 127.12 ? 88  THR B CB  1 
ATOM   4723 O  OG1 . THR B 2 69  ? 191.008 160.787 59.751  1.00 140.32 ? 88  THR B OG1 1 
ATOM   4724 C  CG2 . THR B 2 69  ? 192.193 160.929 57.658  1.00 109.08 ? 88  THR B CG2 1 
ATOM   4725 N  N   . LEU B 2 70  ? 190.734 163.700 56.136  1.00 104.64 ? 89  LEU B N   1 
ATOM   4726 C  CA  . LEU B 2 70  ? 190.626 164.123 54.745  1.00 100.02 ? 89  LEU B CA  1 
ATOM   4727 C  C   . LEU B 2 70  ? 191.785 163.559 53.932  1.00 137.53 ? 89  LEU B C   1 
ATOM   4728 O  O   . LEU B 2 70  ? 192.945 163.652 54.348  1.00 169.41 ? 89  LEU B O   1 
ATOM   4729 C  CB  . LEU B 2 70  ? 190.627 165.649 54.641  1.00 85.19  ? 89  LEU B CB  1 
ATOM   4730 C  CG  . LEU B 2 70  ? 189.580 166.413 55.450  1.00 108.30 ? 89  LEU B CG  1 
ATOM   4731 C  CD1 . LEU B 2 70  ? 189.615 167.895 55.109  1.00 97.19  ? 89  LEU B CD1 1 
ATOM   4732 C  CD2 . LEU B 2 70  ? 188.202 165.835 55.204  1.00 124.76 ? 89  LEU B CD2 1 
ATOM   4733 N  N   . THR B 2 71  ? 191.470 162.992 52.770  1.00 131.04 ? 90  THR B N   1 
ATOM   4734 C  CA  . THR B 2 71  ? 192.468 162.509 51.826  1.00 127.47 ? 90  THR B CA  1 
ATOM   4735 C  C   . THR B 2 71  ? 192.140 163.042 50.437  1.00 124.09 ? 90  THR B C   1 
ATOM   4736 O  O   . THR B 2 71  ? 191.069 163.608 50.203  1.00 140.98 ? 90  THR B O   1 
ATOM   4737 C  CB  . THR B 2 71  ? 192.542 160.975 51.811  1.00 143.54 ? 90  THR B CB  1 
ATOM   4738 O  OG1 . THR B 2 71  ? 191.235 160.431 51.594  1.00 149.51 ? 90  THR B OG1 1 
ATOM   4739 C  CG2 . THR B 2 71  ? 193.099 160.451 53.128  1.00 140.45 ? 90  THR B CG2 1 
ATOM   4740 N  N   . VAL B 2 72  ? 193.073 162.854 49.503  1.00 114.44 ? 91  VAL B N   1 
ATOM   4741 C  CA  . VAL B 2 72  ? 192.913 163.373 48.150  1.00 112.62 ? 91  VAL B CA  1 
ATOM   4742 C  C   . VAL B 2 72  ? 193.671 162.471 47.186  1.00 121.80 ? 91  VAL B C   1 
ATOM   4743 O  O   . VAL B 2 72  ? 194.686 161.863 47.540  1.00 94.18  ? 91  VAL B O   1 
ATOM   4744 C  CB  . VAL B 2 72  ? 193.396 164.842 48.049  1.00 113.16 ? 91  VAL B CB  1 
ATOM   4745 C  CG1 . VAL B 2 72  ? 194.903 164.940 48.264  1.00 131.89 ? 91  VAL B CG1 1 
ATOM   4746 C  CG2 . VAL B 2 72  ? 192.988 165.461 46.724  1.00 81.64  ? 91  VAL B CG2 1 
ATOM   4747 N  N   . ASP B 2 73  ? 193.148 162.363 45.964  1.00 130.44 ? 92  ASP B N   1 
ATOM   4748 C  CA  . ASP B 2 73  ? 193.772 161.595 44.893  1.00 126.20 ? 92  ASP B CA  1 
ATOM   4749 C  C   . ASP B 2 73  ? 193.852 162.456 43.643  1.00 118.65 ? 92  ASP B C   1 
ATOM   4750 O  O   . ASP B 2 73  ? 192.816 162.852 43.092  1.00 113.55 ? 92  ASP B O   1 
ATOM   4751 C  CB  . ASP B 2 73  ? 192.990 160.310 44.601  1.00 118.32 ? 92  ASP B CB  1 
ATOM   4752 C  CG  . ASP B 2 73  ? 193.609 159.492 43.482  1.00 123.39 ? 92  ASP B CG  1 
ATOM   4753 O  OD1 . ASP B 2 73  ? 194.850 159.502 43.345  1.00 140.19 ? 92  ASP B OD1 1 
ATOM   4754 O  OD2 . ASP B 2 73  ? 192.848 158.844 42.731  1.00 114.48 ? 92  ASP B OD2 1 
ATOM   4755 N  N   . LYS B 2 74  ? 195.080 162.740 43.199  1.00 136.36 ? 93  LYS B N   1 
ATOM   4756 C  CA  . LYS B 2 74  ? 195.293 163.572 42.023  1.00 134.39 ? 93  LYS B CA  1 
ATOM   4757 C  C   . LYS B 2 74  ? 195.112 162.787 40.734  1.00 149.33 ? 93  LYS B C   1 
ATOM   4758 O  O   . LYS B 2 74  ? 194.831 163.385 39.689  1.00 162.64 ? 93  LYS B O   1 
ATOM   4759 C  CB  . LYS B 2 74  ? 196.692 164.191 42.047  1.00 135.65 ? 93  LYS B CB  1 
ATOM   4760 C  CG  . LYS B 2 74  ? 196.955 165.111 43.223  1.00 120.94 ? 93  LYS B CG  1 
ATOM   4761 C  CD  . LYS B 2 74  ? 198.323 165.761 43.100  1.00 130.65 ? 93  LYS B CD  1 
ATOM   4762 C  CE  . LYS B 2 74  ? 199.441 164.733 43.099  1.00 134.18 ? 93  LYS B CE  1 
ATOM   4763 N  NZ  . LYS B 2 74  ? 200.778 165.384 42.991  1.00 139.32 ? 93  LYS B NZ  1 
ATOM   4764 N  N   . SER B 2 75  ? 195.270 161.462 40.793  1.00 160.43 ? 94  SER B N   1 
ATOM   4765 C  CA  . SER B 2 75  ? 195.155 160.636 39.597  1.00 181.44 ? 94  SER B CA  1 
ATOM   4766 C  C   . SER B 2 75  ? 193.745 160.687 39.033  1.00 174.77 ? 94  SER B C   1 
ATOM   4767 O  O   . SER B 2 75  ? 193.554 160.561 37.818  1.00 187.39 ? 94  SER B O   1 
ATOM   4768 C  CB  . SER B 2 75  ? 195.559 159.195 39.912  1.00 200.63 ? 94  SER B CB  1 
ATOM   4769 O  OG  . SER B 2 75  ? 196.907 159.127 40.347  1.00 211.88 ? 94  SER B OG  1 
ATOM   4770 N  N   . SER B 2 76  ? 192.747 160.881 39.898  1.00 144.11 ? 95  SER B N   1 
ATOM   4771 C  CA  . SER B 2 76  ? 191.355 160.937 39.480  1.00 126.61 ? 95  SER B CA  1 
ATOM   4772 C  C   . SER B 2 76  ? 190.670 162.215 39.949  1.00 104.71 ? 95  SER B C   1 
ATOM   4773 O  O   . SER B 2 76  ? 189.455 162.352 39.769  1.00 98.36  ? 95  SER B O   1 
ATOM   4774 C  CB  . SER B 2 76  ? 190.586 159.716 39.996  1.00 127.59 ? 95  SER B CB  1 
ATOM   4775 O  OG  . SER B 2 76  ? 189.225 159.774 39.610  1.00 132.63 ? 95  SER B OG  1 
ATOM   4776 N  N   . THR B 2 77  ? 191.419 163.145 40.540  1.00 108.15 ? 96  THR B N   1 
ATOM   4777 C  CA  . THR B 2 77  ? 190.897 164.412 41.053  1.00 111.69 ? 96  THR B CA  1 
ATOM   4778 C  C   . THR B 2 77  ? 189.687 164.195 41.961  1.00 122.08 ? 96  THR B C   1 
ATOM   4779 O  O   . THR B 2 77  ? 188.584 164.685 41.709  1.00 67.60  ? 96  THR B O   1 
ATOM   4780 C  CB  . THR B 2 77  ? 190.556 165.365 39.904  1.00 98.46  ? 96  THR B CB  1 
ATOM   4781 O  OG1 . THR B 2 77  ? 189.468 164.831 39.139  1.00 73.87  ? 96  THR B OG1 1 
ATOM   4782 C  CG2 . THR B 2 77  ? 191.761 165.554 38.996  1.00 101.97 ? 96  THR B CG2 1 
ATOM   4783 N  N   . THR B 2 78  ? 189.906 163.432 43.029  1.00 150.45 ? 97  THR B N   1 
ATOM   4784 C  CA  . THR B 2 78  ? 188.805 163.078 43.916  1.00 135.65 ? 97  THR B CA  1 
ATOM   4785 C  C   . THR B 2 78  ? 189.242 163.199 45.367  1.00 136.95 ? 97  THR B C   1 
ATOM   4786 O  O   . THR B 2 78  ? 190.297 162.682 45.743  1.00 127.67 ? 97  THR B O   1 
ATOM   4787 C  CB  . THR B 2 78  ? 188.305 161.656 43.627  1.00 128.80 ? 97  THR B CB  1 
ATOM   4788 O  OG1 . THR B 2 78  ? 187.944 161.547 42.244  1.00 138.67 ? 97  THR B OG1 1 
ATOM   4789 C  CG2 . THR B 2 78  ? 187.095 161.323 44.486  1.00 121.11 ? 97  THR B CG2 1 
ATOM   4790 N  N   . ALA B 2 79  ? 188.434 163.881 46.173  1.00 148.60 ? 98  ALA B N   1 
ATOM   4791 C  CA  . ALA B 2 79  ? 188.708 164.069 47.590  1.00 130.31 ? 98  ALA B CA  1 
ATOM   4792 C  C   . ALA B 2 79  ? 187.875 163.087 48.405  1.00 110.66 ? 98  ALA B C   1 
ATOM   4793 O  O   . ALA B 2 79  ? 186.812 162.637 47.977  1.00 108.17 ? 98  ALA B O   1 
ATOM   4794 C  CB  . ALA B 2 79  ? 188.406 165.504 48.021  1.00 116.84 ? 98  ALA B CB  1 
ATOM   4795 N  N   . TYR B 2 80  ? 188.357 162.771 49.604  1.00 108.03 ? 99  TYR B N   1 
ATOM   4796 C  CA  . TYR B 2 80  ? 187.653 161.832 50.463  1.00 123.74 ? 99  TYR B CA  1 
ATOM   4797 C  C   . TYR B 2 80  ? 187.658 162.326 51.902  1.00 128.80 ? 99  TYR B C   1 
ATOM   4798 O  O   . TYR B 2 80  ? 188.587 163.013 52.337  1.00 113.23 ? 99  TYR B O   1 
ATOM   4799 C  CB  . TYR B 2 80  ? 188.277 160.426 50.389  1.00 124.27 ? 99  TYR B CB  1 
ATOM   4800 C  CG  . TYR B 2 80  ? 188.350 159.847 48.990  1.00 110.91 ? 99  TYR B CG  1 
ATOM   4801 C  CD1 . TYR B 2 80  ? 187.299 159.102 48.468  1.00 134.18 ? 99  TYR B CD1 1 
ATOM   4802 C  CD2 . TYR B 2 80  ? 189.472 160.043 48.195  1.00 120.81 ? 99  TYR B CD2 1 
ATOM   4803 C  CE1 . TYR B 2 80  ? 187.363 158.572 47.189  1.00 146.90 ? 99  TYR B CE1 1 
ATOM   4804 C  CE2 . TYR B 2 80  ? 189.546 159.518 46.916  1.00 126.12 ? 99  TYR B CE2 1 
ATOM   4805 C  CZ  . TYR B 2 80  ? 188.490 158.782 46.418  1.00 141.71 ? 99  TYR B CZ  1 
ATOM   4806 O  OH  . TYR B 2 80  ? 188.561 158.259 45.145  1.00 135.11 ? 99  TYR B OH  1 
ATOM   4807 N  N   . MET B 2 81  ? 186.590 161.991 52.628  1.00 141.27 ? 100 MET B N   1 
ATOM   4808 C  CA  . MET B 2 81  ? 186.481 162.286 54.053  1.00 144.95 ? 100 MET B CA  1 
ATOM   4809 C  C   . MET B 2 81  ? 185.985 161.042 54.772  1.00 141.76 ? 100 MET B C   1 
ATOM   4810 O  O   . MET B 2 81  ? 184.926 160.506 54.426  1.00 147.40 ? 100 MET B O   1 
ATOM   4811 C  CB  . MET B 2 81  ? 185.529 163.454 54.322  1.00 130.31 ? 100 MET B CB  1 
ATOM   4812 C  CG  . MET B 2 81  ? 185.302 163.697 55.809  1.00 132.14 ? 100 MET B CG  1 
ATOM   4813 S  SD  . MET B 2 81  ? 184.113 165.002 56.172  1.00 152.69 ? 100 MET B SD  1 
ATOM   4814 C  CE  . MET B 2 81  ? 182.597 164.271 55.557  1.00 161.65 ? 100 MET B CE  1 
ATOM   4815 N  N   . GLU B 2 82  ? 186.734 160.593 55.775  1.00 137.57 ? 101 GLU B N   1 
ATOM   4816 C  CA  . GLU B 2 82  ? 186.365 159.419 56.552  1.00 125.27 ? 101 GLU B CA  1 
ATOM   4817 C  C   . GLU B 2 82  ? 185.989 159.822 57.973  1.00 141.21 ? 101 GLU B C   1 
ATOM   4818 O  O   . GLU B 2 82  ? 186.676 160.638 58.601  1.00 140.30 ? 101 GLU B O   1 
ATOM   4819 C  CB  . GLU B 2 82  ? 187.504 158.396 56.572  1.00 125.04 ? 101 GLU B CB  1 
ATOM   4820 C  CG  . GLU B 2 82  ? 187.141 157.072 57.223  1.00 147.01 ? 101 GLU B CG  1 
ATOM   4821 C  CD  . GLU B 2 82  ? 188.221 156.022 57.051  1.00 166.35 ? 101 GLU B CD  1 
ATOM   4822 O  OE1 . GLU B 2 82  ? 188.064 154.909 57.599  1.00 170.96 ? 101 GLU B OE1 1 
ATOM   4823 O  OE2 . GLU B 2 82  ? 189.223 156.307 56.364  1.00 178.15 ? 101 GLU B OE2 1 
ATOM   4824 N  N   . LEU B 2 83  ? 184.898 159.238 58.472  1.00 123.16 ? 102 LEU B N   1 
ATOM   4825 C  CA  . LEU B 2 83  ? 184.391 159.481 59.819  1.00 118.37 ? 102 LEU B CA  1 
ATOM   4826 C  C   . LEU B 2 83  ? 184.354 158.166 60.587  1.00 142.45 ? 102 LEU B C   1 
ATOM   4827 O  O   . LEU B 2 83  ? 183.748 157.191 60.122  1.00 142.31 ? 102 LEU B O   1 
ATOM   4828 C  CB  . LEU B 2 83  ? 182.994 160.111 59.783  1.00 90.71  ? 102 LEU B CB  1 
ATOM   4829 C  CG  . LEU B 2 83  ? 182.801 161.407 58.989  1.00 105.00 ? 102 LEU B CG  1 
ATOM   4830 C  CD1 . LEU B 2 83  ? 181.333 161.851 58.958  1.00 82.62  ? 102 LEU B CD1 1 
ATOM   4831 C  CD2 . LEU B 2 83  ? 183.673 162.495 59.573  1.00 103.17 ? 102 LEU B CD2 1 
ATOM   4832 N  N   . ARG B 2 84  ? 185.009 158.136 61.748  1.00 156.12 ? 103 ARG B N   1 
ATOM   4833 C  CA  . ARG B 2 84  ? 185.012 156.978 62.633  1.00 160.83 ? 103 ARG B CA  1 
ATOM   4834 C  C   . ARG B 2 84  ? 184.273 157.315 63.924  1.00 160.20 ? 103 ARG B C   1 
ATOM   4835 O  O   . ARG B 2 84  ? 184.039 158.484 64.245  1.00 151.12 ? 103 ARG B O   1 
ATOM   4836 C  CB  . ARG B 2 84  ? 186.442 156.516 62.946  1.00 173.73 ? 103 ARG B CB  1 
ATOM   4837 C  CG  . ARG B 2 84  ? 187.176 157.369 63.977  1.00 188.21 ? 103 ARG B CG  1 
ATOM   4838 C  CD  . ARG B 2 84  ? 188.478 156.701 64.418  1.00 194.30 ? 103 ARG B CD  1 
ATOM   4839 N  NE  . ARG B 2 84  ? 189.090 157.363 65.569  1.00 193.80 ? 103 ARG B NE  1 
ATOM   4840 C  CZ  . ARG B 2 84  ? 190.042 158.288 65.486  1.00 189.33 ? 103 ARG B CZ  1 
ATOM   4841 N  NH1 . ARG B 2 84  ? 190.501 158.668 64.302  1.00 184.70 ? 103 ARG B NH1 1 
ATOM   4842 N  NH2 . ARG B 2 84  ? 190.538 158.833 66.589  1.00 193.39 ? 103 ARG B NH2 1 
ATOM   4843 N  N   . SER B 2 85  ? 183.936 156.270 64.681  1.00 172.94 ? 104 SER B N   1 
ATOM   4844 C  CA  . SER B 2 85  ? 183.192 156.396 65.937  1.00 183.62 ? 104 SER B CA  1 
ATOM   4845 C  C   . SER B 2 85  ? 181.898 157.185 65.726  1.00 170.90 ? 104 SER B C   1 
ATOM   4846 O  O   . SER B 2 85  ? 181.672 158.244 66.314  1.00 181.43 ? 104 SER B O   1 
ATOM   4847 C  CB  . SER B 2 85  ? 184.056 157.032 67.030  1.00 203.95 ? 104 SER B CB  1 
ATOM   4848 O  OG  . SER B 2 85  ? 185.214 156.257 67.285  1.00 215.69 ? 104 SER B OG  1 
ATOM   4849 N  N   . LEU B 2 86  ? 181.046 156.641 64.863  1.00 157.43 ? 105 LEU B N   1 
ATOM   4850 C  CA  . LEU B 2 86  ? 179.823 157.324 64.463  1.00 139.50 ? 105 LEU B CA  1 
ATOM   4851 C  C   . LEU B 2 86  ? 178.761 157.245 65.552  1.00 137.62 ? 105 LEU B C   1 
ATOM   4852 O  O   . LEU B 2 86  ? 178.521 156.180 66.127  1.00 141.76 ? 105 LEU B O   1 
ATOM   4853 C  CB  . LEU B 2 86  ? 179.298 156.726 63.162  1.00 117.41 ? 105 LEU B CB  1 
ATOM   4854 C  CG  . LEU B 2 86  ? 180.223 156.982 61.976  1.00 122.48 ? 105 LEU B CG  1 
ATOM   4855 C  CD1 . LEU B 2 86  ? 179.868 156.083 60.818  1.00 129.77 ? 105 LEU B CD1 1 
ATOM   4856 C  CD2 . LEU B 2 86  ? 180.131 158.443 61.568  1.00 96.30  ? 105 LEU B CD2 1 
ATOM   4857 N  N   . THR B 2 87  ? 178.122 158.382 65.825  1.00 141.93 ? 106 THR B N   1 
ATOM   4858 C  CA  . THR B 2 87  ? 177.047 158.471 66.805  1.00 157.47 ? 106 THR B CA  1 
ATOM   4859 C  C   . THR B 2 87  ? 175.814 159.106 66.178  1.00 168.75 ? 106 THR B C   1 
ATOM   4860 O  O   . THR B 2 87  ? 175.784 159.359 64.970  1.00 171.25 ? 106 THR B O   1 
ATOM   4861 C  CB  . THR B 2 87  ? 177.486 159.282 68.026  1.00 155.37 ? 106 THR B CB  1 
ATOM   4862 O  OG1 . THR B 2 87  ? 177.838 160.609 67.617  1.00 152.06 ? 106 THR B OG1 1 
ATOM   4863 C  CG2 . THR B 2 87  ? 178.684 158.631 68.700  1.00 152.41 ? 106 THR B CG2 1 
ATOM   4864 N  N   . SER B 2 88  ? 174.799 159.385 66.998  1.00 190.41 ? 107 SER B N   1 
ATOM   4865 C  CA  . SER B 2 88  ? 173.571 159.976 66.478  1.00 187.44 ? 107 SER B CA  1 
ATOM   4866 C  C   . SER B 2 88  ? 173.802 161.406 66.008  1.00 177.80 ? 107 SER B C   1 
ATOM   4867 O  O   . SER B 2 88  ? 173.091 161.885 65.118  1.00 179.89 ? 107 SER B O   1 
ATOM   4868 C  CB  . SER B 2 88  ? 172.476 159.938 67.543  1.00 198.00 ? 107 SER B CB  1 
ATOM   4869 O  OG  . SER B 2 88  ? 172.869 160.658 68.698  1.00 202.95 ? 107 SER B OG  1 
ATOM   4870 N  N   . GLU B 2 89  ? 174.788 162.095 66.587  1.00 175.57 ? 108 GLU B N   1 
ATOM   4871 C  CA  . GLU B 2 89  ? 175.070 163.474 66.208  1.00 182.88 ? 108 GLU B CA  1 
ATOM   4872 C  C   . GLU B 2 89  ? 175.666 163.577 64.810  1.00 176.33 ? 108 GLU B C   1 
ATOM   4873 O  O   . GLU B 2 89  ? 175.551 164.631 64.176  1.00 167.85 ? 108 GLU B O   1 
ATOM   4874 C  CB  . GLU B 2 89  ? 176.022 164.111 67.222  1.00 180.23 ? 108 GLU B CB  1 
ATOM   4875 C  CG  . GLU B 2 89  ? 175.441 164.263 68.619  1.00 192.64 ? 108 GLU B CG  1 
ATOM   4876 C  CD  . GLU B 2 89  ? 174.328 165.291 68.687  1.00 211.76 ? 108 GLU B CD  1 
ATOM   4877 O  OE1 . GLU B 2 89  ? 174.289 166.188 67.818  1.00 223.04 ? 108 GLU B OE1 1 
ATOM   4878 O  OE2 . GLU B 2 89  ? 173.491 165.201 69.610  1.00 206.07 ? 108 GLU B OE2 1 
ATOM   4879 N  N   . ASP B 2 90  ? 176.300 162.513 64.321  1.00 156.93 ? 109 ASP B N   1 
ATOM   4880 C  CA  . ASP B 2 90  ? 176.927 162.525 63.006  1.00 141.41 ? 109 ASP B CA  1 
ATOM   4881 C  C   . ASP B 2 90  ? 175.926 162.372 61.871  1.00 145.84 ? 109 ASP B C   1 
ATOM   4882 O  O   . ASP B 2 90  ? 176.282 162.623 60.714  1.00 135.88 ? 109 ASP B O   1 
ATOM   4883 C  CB  . ASP B 2 90  ? 177.978 161.420 62.918  1.00 121.52 ? 109 ASP B CB  1 
ATOM   4884 C  CG  . ASP B 2 90  ? 179.061 161.573 63.960  1.00 115.36 ? 109 ASP B CG  1 
ATOM   4885 O  OD1 . ASP B 2 90  ? 179.354 162.727 64.341  1.00 117.23 ? 109 ASP B OD1 1 
ATOM   4886 O  OD2 . ASP B 2 90  ? 179.622 160.546 64.396  1.00 106.26 ? 109 ASP B OD2 1 
ATOM   4887 N  N   . SER B 2 91  ? 174.690 161.981 62.171  1.00 160.24 ? 110 SER B N   1 
ATOM   4888 C  CA  . SER B 2 91  ? 173.654 161.854 61.155  1.00 155.64 ? 110 SER B CA  1 
ATOM   4889 C  C   . SER B 2 91  ? 173.263 163.225 60.618  1.00 141.15 ? 110 SER B C   1 
ATOM   4890 O  O   . SER B 2 91  ? 172.368 163.881 61.161  1.00 145.50 ? 110 SER B O   1 
ATOM   4891 C  CB  . SER B 2 91  ? 172.431 161.130 61.724  1.00 159.14 ? 110 SER B CB  1 
ATOM   4892 O  OG  . SER B 2 91  ? 172.767 159.822 62.154  1.00 143.42 ? 110 SER B OG  1 
ATOM   4893 N  N   . ALA B 2 92  ? 173.935 163.667 59.556  1.00 123.93 ? 111 ALA B N   1 
ATOM   4894 C  CA  . ALA B 2 92  ? 173.693 164.981 58.980  1.00 110.58 ? 111 ALA B CA  1 
ATOM   4895 C  C   . ALA B 2 92  ? 174.096 164.963 57.510  1.00 106.58 ? 111 ALA B C   1 
ATOM   4896 O  O   . ALA B 2 92  ? 174.531 163.940 56.976  1.00 95.75  ? 111 ALA B O   1 
ATOM   4897 C  CB  . ALA B 2 92  ? 174.455 166.059 59.755  1.00 99.82  ? 111 ALA B CB  1 
ATOM   4898 N  N   . VAL B 2 93  ? 173.930 166.108 56.851  1.00 121.32 ? 112 VAL B N   1 
ATOM   4899 C  CA  . VAL B 2 93  ? 174.254 166.264 55.436  1.00 121.26 ? 112 VAL B CA  1 
ATOM   4900 C  C   . VAL B 2 93  ? 175.633 166.900 55.314  1.00 115.69 ? 112 VAL B C   1 
ATOM   4901 O  O   . VAL B 2 93  ? 175.870 167.993 55.842  1.00 99.99  ? 112 VAL B O   1 
ATOM   4902 C  CB  . VAL B 2 93  ? 173.195 167.101 54.704  1.00 134.01 ? 112 VAL B CB  1 
ATOM   4903 C  CG1 . VAL B 2 93  ? 173.582 167.284 53.243  1.00 118.79 ? 112 VAL B CG1 1 
ATOM   4904 C  CG2 . VAL B 2 93  ? 171.827 166.448 54.823  1.00 148.82 ? 112 VAL B CG2 1 
ATOM   4905 N  N   . TYR B 2 94  ? 176.542 166.215 54.625  1.00 133.20 ? 113 TYR B N   1 
ATOM   4906 C  CA  . TYR B 2 94  ? 177.922 166.653 54.468  1.00 108.75 ? 113 TYR B CA  1 
ATOM   4907 C  C   . TYR B 2 94  ? 178.170 167.122 53.041  1.00 120.55 ? 113 TYR B C   1 
ATOM   4908 O  O   . TYR B 2 94  ? 177.727 166.485 52.081  1.00 121.58 ? 113 TYR B O   1 
ATOM   4909 C  CB  . TYR B 2 94  ? 178.893 165.529 54.826  1.00 95.47  ? 113 TYR B CB  1 
ATOM   4910 C  CG  . TYR B 2 94  ? 178.781 165.096 56.265  1.00 107.43 ? 113 TYR B CG  1 
ATOM   4911 C  CD1 . TYR B 2 94  ? 177.879 164.112 56.645  1.00 114.38 ? 113 TYR B CD1 1 
ATOM   4912 C  CD2 . TYR B 2 94  ? 179.568 165.679 57.247  1.00 118.19 ? 113 TYR B CD2 1 
ATOM   4913 C  CE1 . TYR B 2 94  ? 177.768 163.717 57.963  1.00 127.10 ? 113 TYR B CE1 1 
ATOM   4914 C  CE2 . TYR B 2 94  ? 179.467 165.291 58.565  1.00 133.58 ? 113 TYR B CE2 1 
ATOM   4915 C  CZ  . TYR B 2 94  ? 178.566 164.311 58.919  1.00 134.84 ? 113 TYR B CZ  1 
ATOM   4916 O  OH  . TYR B 2 94  ? 178.463 163.923 60.234  1.00 140.80 ? 113 TYR B OH  1 
ATOM   4917 N  N   . TYR B 2 95  ? 178.862 168.251 52.911  1.00 113.77 ? 114 TYR B N   1 
ATOM   4918 C  CA  . TYR B 2 95  ? 179.228 168.828 51.628  1.00 89.48  ? 114 TYR B CA  1 
ATOM   4919 C  C   . TYR B 2 95  ? 180.744 168.881 51.480  1.00 95.86  ? 114 TYR B C   1 
ATOM   4920 O  O   . TYR B 2 95  ? 181.479 168.956 52.468  1.00 92.12  ? 114 TYR B O   1 
ATOM   4921 C  CB  . TYR B 2 95  ? 178.655 170.240 51.473  1.00 74.02  ? 114 TYR B CB  1 
ATOM   4922 C  CG  . TYR B 2 95  ? 177.145 170.310 51.487  1.00 106.89 ? 114 TYR B CG  1 
ATOM   4923 C  CD1 . TYR B 2 95  ? 176.412 170.115 50.326  1.00 125.66 ? 114 TYR B CD1 1 
ATOM   4924 C  CD2 . TYR B 2 95  ? 176.453 170.582 52.659  1.00 115.26 ? 114 TYR B CD2 1 
ATOM   4925 C  CE1 . TYR B 2 95  ? 175.031 170.181 50.332  1.00 123.43 ? 114 TYR B CE1 1 
ATOM   4926 C  CE2 . TYR B 2 95  ? 175.069 170.652 52.674  1.00 119.13 ? 114 TYR B CE2 1 
ATOM   4927 C  CZ  . TYR B 2 95  ? 174.365 170.452 51.505  1.00 122.48 ? 114 TYR B CZ  1 
ATOM   4928 O  OH  . TYR B 2 95  ? 172.992 170.518 51.509  1.00 130.44 ? 114 TYR B OH  1 
ATOM   4929 N  N   . CYS B 2 96  ? 181.207 168.835 50.234  1.00 113.80 ? 115 CYS B N   1 
ATOM   4930 C  CA  . CYS B 2 96  ? 182.598 169.115 49.894  1.00 87.56  ? 115 CYS B CA  1 
ATOM   4931 C  C   . CYS B 2 96  ? 182.603 170.320 48.968  1.00 98.45  ? 115 CYS B C   1 
ATOM   4932 O  O   . CYS B 2 96  ? 181.907 170.321 47.946  1.00 105.87 ? 115 CYS B O   1 
ATOM   4933 C  CB  . CYS B 2 96  ? 183.282 167.917 49.231  1.00 107.80 ? 115 CYS B CB  1 
ATOM   4934 S  SG  . CYS B 2 96  ? 182.476 167.268 47.746  1.00 173.23 ? 115 CYS B SG  1 
ATOM   4935 N  N   . THR B 2 97  ? 183.329 171.366 49.350  1.00 83.04  ? 116 THR B N   1 
ATOM   4936 C  CA  . THR B 2 97  ? 183.259 172.622 48.621  1.00 84.31  ? 116 THR B CA  1 
ATOM   4937 C  C   . THR B 2 97  ? 184.647 173.144 48.267  1.00 79.86  ? 116 THR B C   1 
ATOM   4938 O  O   . THR B 2 97  ? 185.579 173.069 49.071  1.00 71.53  ? 116 THR B O   1 
ATOM   4939 C  CB  . THR B 2 97  ? 182.491 173.669 49.430  1.00 86.38  ? 116 THR B CB  1 
ATOM   4940 O  OG1 . THR B 2 97  ? 182.585 174.942 48.780  1.00 116.73 ? 116 THR B OG1 1 
ATOM   4941 C  CG2 . THR B 2 97  ? 183.039 173.763 50.846  1.00 94.77  ? 116 THR B CG2 1 
ATOM   4942 N  N   . ARG B 2 98  ? 184.771 173.661 47.047  1.00 113.76 ? 117 ARG B N   1 
ATOM   4943 C  CA  . ARG B 2 98  ? 186.019 174.234 46.560  1.00 118.65 ? 117 ARG B CA  1 
ATOM   4944 C  C   . ARG B 2 98  ? 186.263 175.597 47.207  1.00 114.32 ? 117 ARG B C   1 
ATOM   4945 O  O   . ARG B 2 98  ? 185.322 176.339 47.504  1.00 90.30  ? 117 ARG B O   1 
ATOM   4946 C  CB  . ARG B 2 98  ? 185.990 174.351 45.037  1.00 130.84 ? 117 ARG B CB  1 
ATOM   4947 C  CG  . ARG B 2 98  ? 187.358 174.520 44.406  1.00 125.83 ? 117 ARG B CG  1 
ATOM   4948 C  CD  . ARG B 2 98  ? 187.264 174.936 42.951  1.00 111.70 ? 117 ARG B CD  1 
ATOM   4949 N  NE  . ARG B 2 98  ? 186.996 176.358 42.787  1.00 113.38 ? 117 ARG B NE  1 
ATOM   4950 C  CZ  . ARG B 2 98  ? 187.044 176.990 41.620  1.00 131.47 ? 117 ARG B CZ  1 
ATOM   4951 N  NH1 . ARG B 2 98  ? 187.349 176.322 40.516  1.00 128.66 ? 117 ARG B NH1 1 
ATOM   4952 N  NH2 . ARG B 2 98  ? 186.794 178.291 41.556  1.00 145.28 ? 117 ARG B NH2 1 
ATOM   4953 N  N   . SER B 2 99  ? 187.543 175.939 47.412  1.00 110.98 ? 118 SER B N   1 
ATOM   4954 C  CA  . SER B 2 99  ? 187.829 177.257 47.973  1.00 84.60  ? 118 SER B CA  1 
ATOM   4955 C  C   . SER B 2 99  ? 189.241 177.713 47.650  1.00 71.38  ? 118 SER B C   1 
ATOM   4956 O  O   . SER B 2 99  ? 190.177 176.908 47.743  1.00 82.62  ? 118 SER B O   1 
ATOM   4957 C  CB  . SER B 2 99  ? 187.635 177.257 49.491  1.00 98.05  ? 118 SER B CB  1 
ATOM   4958 O  OG  . SER B 2 99  ? 188.627 176.466 50.119  1.00 116.56 ? 118 SER B OG  1 
ATOM   4959 N  N   . PRO B 2 100 ? 189.432 178.982 47.270  1.00 74.14  ? 119 PRO B N   1 
ATOM   4960 C  CA  . PRO B 2 100 ? 190.788 179.508 47.058  1.00 126.65 ? 119 PRO B CA  1 
ATOM   4961 C  C   . PRO B 2 100 ? 191.522 179.752 48.366  1.00 123.72 ? 119 PRO B C   1 
ATOM   4962 O  O   . PRO B 2 100 ? 190.995 179.461 49.445  1.00 143.19 ? 119 PRO B O   1 
ATOM   4963 C  CB  . PRO B 2 100 ? 190.539 180.826 46.314  1.00 80.07  ? 119 PRO B CB  1 
ATOM   4964 C  CG  . PRO B 2 100 ? 189.193 181.255 46.785  1.00 79.00  ? 119 PRO B CG  1 
ATOM   4965 C  CD  . PRO B 2 100 ? 188.399 179.991 46.981  1.00 74.91  ? 119 PRO B CD  1 
ATOM   4966 N  N   . VAL B 2 101 ? 192.753 180.258 48.282  1.00 130.44 ? 120 VAL B N   1 
ATOM   4967 C  CA  . VAL B 2 101 ? 193.500 180.556 49.499  1.00 105.10 ? 120 VAL B CA  1 
ATOM   4968 C  C   . VAL B 2 101 ? 193.075 181.902 50.070  1.00 107.31 ? 120 VAL B C   1 
ATOM   4969 O  O   . VAL B 2 101 ? 192.950 182.058 51.290  1.00 123.05 ? 120 VAL B O   1 
ATOM   4970 C  CB  . VAL B 2 101 ? 195.010 180.513 49.214  1.00 124.15 ? 120 VAL B CB  1 
ATOM   4971 C  CG1 . VAL B 2 101 ? 195.798 180.742 50.493  1.00 146.75 ? 120 VAL B CG1 1 
ATOM   4972 C  CG2 . VAL B 2 101 ? 195.388 179.186 48.586  1.00 130.49 ? 120 VAL B CG2 1 
ATOM   4973 N  N   . ARG B 2 102 ? 192.850 182.890 49.210  1.00 107.39 ? 121 ARG B N   1 
ATOM   4974 C  CA  . ARG B 2 102 ? 192.453 184.220 49.658  1.00 119.59 ? 121 ARG B CA  1 
ATOM   4975 C  C   . ARG B 2 102 ? 191.786 184.994 48.519  1.00 138.55 ? 121 ARG B C   1 
ATOM   4976 O  O   . ARG B 2 102 ? 192.338 185.075 47.420  1.00 164.17 ? 121 ARG B O   1 
ATOM   4977 C  CB  . ARG B 2 102 ? 193.658 184.983 50.219  1.00 153.55 ? 121 ARG B CB  1 
ATOM   4978 C  CG  . ARG B 2 102 ? 193.379 186.447 50.529  1.00 171.70 ? 121 ARG B CG  1 
ATOM   4979 C  CD  . ARG B 2 102 ? 194.521 187.115 51.294  1.00 181.72 ? 121 ARG B CD  1 
ATOM   4980 N  NE  . ARG B 2 102 ? 195.807 187.058 50.604  1.00 185.07 ? 121 ARG B NE  1 
ATOM   4981 C  CZ  . ARG B 2 102 ? 196.783 186.209 50.912  1.00 187.24 ? 121 ARG B CZ  1 
ATOM   4982 N  NH1 . ARG B 2 102 ? 196.622 185.339 51.901  1.00 187.45 ? 121 ARG B NH1 1 
ATOM   4983 N  NH2 . ARG B 2 102 ? 197.923 186.230 50.234  1.00 186.35 ? 121 ARG B NH2 1 
ATOM   4984 N  N   . PRO B 2 103 ? 190.583 185.546 48.762  1.00 127.37 ? 122 PRO B N   1 
ATOM   4985 C  CA  . PRO B 2 103 ? 189.801 185.413 49.996  1.00 103.90 ? 122 PRO B CA  1 
ATOM   4986 C  C   . PRO B 2 103 ? 189.111 184.056 50.084  1.00 102.21 ? 122 PRO B C   1 
ATOM   4987 O  O   . PRO B 2 103 ? 188.641 183.522 49.080  1.00 111.90 ? 122 PRO B O   1 
ATOM   4988 C  CB  . PRO B 2 103 ? 188.782 186.548 49.888  1.00 122.27 ? 122 PRO B CB  1 
ATOM   4989 C  CG  . PRO B 2 103 ? 188.617 186.757 48.432  1.00 126.15 ? 122 PRO B CG  1 
ATOM   4990 C  CD  . PRO B 2 103 ? 189.949 186.472 47.808  1.00 132.80 ? 122 PRO B CD  1 
ATOM   4991 N  N   . TYR B 2 104 ? 189.081 183.505 51.295  1.00 93.36  ? 123 TYR B N   1 
ATOM   4992 C  CA  . TYR B 2 104 ? 188.650 182.130 51.546  1.00 105.02 ? 123 TYR B CA  1 
ATOM   4993 C  C   . TYR B 2 104 ? 187.124 182.005 51.507  1.00 128.35 ? 123 TYR B C   1 
ATOM   4994 O  O   . TYR B 2 104 ? 186.452 181.872 52.533  1.00 136.36 ? 123 TYR B O   1 
ATOM   4995 C  CB  . TYR B 2 104 ? 189.211 181.657 52.879  1.00 100.18 ? 123 TYR B CB  1 
ATOM   4996 C  CG  . TYR B 2 104 ? 189.415 180.167 52.968  1.00 106.80 ? 123 TYR B CG  1 
ATOM   4997 C  CD1 . TYR B 2 104 ? 188.400 179.329 53.398  1.00 107.15 ? 123 TYR B CD1 1 
ATOM   4998 C  CD2 . TYR B 2 104 ? 190.640 179.602 52.642  1.00 80.54  ? 123 TYR B CD2 1 
ATOM   4999 C  CE1 . TYR B 2 104 ? 188.592 177.970 53.488  1.00 101.39 ? 123 TYR B CE1 1 
ATOM   5000 C  CE2 . TYR B 2 104 ? 190.843 178.248 52.729  1.00 105.55 ? 123 TYR B CE2 1 
ATOM   5001 C  CZ  . TYR B 2 104 ? 189.818 177.436 53.154  1.00 104.10 ? 123 TYR B CZ  1 
ATOM   5002 O  OH  . TYR B 2 104 ? 190.022 176.080 53.240  1.00 94.57  ? 123 TYR B OH  1 
ATOM   5003 N  N   . TYR B 2 105 ? 186.564 182.031 50.298  1.00 129.46 ? 124 TYR B N   1 
ATOM   5004 C  CA  . TYR B 2 105 ? 185.134 181.813 50.115  1.00 105.00 ? 124 TYR B CA  1 
ATOM   5005 C  C   . TYR B 2 105 ? 184.897 180.437 49.500  1.00 101.16 ? 124 TYR B C   1 
ATOM   5006 O  O   . TYR B 2 105 ? 185.795 179.842 48.900  1.00 111.94 ? 124 TYR B O   1 
ATOM   5007 C  CB  . TYR B 2 105 ? 184.511 182.913 49.244  1.00 82.73  ? 124 TYR B CB  1 
ATOM   5008 C  CG  . TYR B 2 105 ? 185.217 183.146 47.928  1.00 80.52  ? 124 TYR B CG  1 
ATOM   5009 C  CD1 . TYR B 2 105 ? 185.127 182.225 46.891  1.00 125.14 ? 124 TYR B CD1 1 
ATOM   5010 C  CD2 . TYR B 2 105 ? 185.956 184.301 47.714  1.00 84.53  ? 124 TYR B CD2 1 
ATOM   5011 C  CE1 . TYR B 2 105 ? 185.768 182.437 45.686  1.00 111.25 ? 124 TYR B CE1 1 
ATOM   5012 C  CE2 . TYR B 2 105 ? 186.601 184.523 46.510  1.00 104.56 ? 124 TYR B CE2 1 
ATOM   5013 C  CZ  . TYR B 2 105 ? 186.503 183.586 45.500  1.00 99.53  ? 124 TYR B CZ  1 
ATOM   5014 O  OH  . TYR B 2 105 ? 187.138 183.795 44.299  1.00 94.52  ? 124 TYR B OH  1 
ATOM   5015 N  N   . PHE B 2 106 ? 183.669 179.934 49.644  1.00 106.35 ? 125 PHE B N   1 
ATOM   5016 C  CA  . PHE B 2 106 ? 183.282 178.635 49.082  1.00 116.20 ? 125 PHE B CA  1 
ATOM   5017 C  C   . PHE B 2 106 ? 182.490 178.844 47.794  1.00 130.48 ? 125 PHE B C   1 
ATOM   5018 O  O   . PHE B 2 106 ? 181.264 178.954 47.806  1.00 124.93 ? 125 PHE B O   1 
ATOM   5019 C  CB  . PHE B 2 106 ? 182.488 177.833 50.106  1.00 104.24 ? 125 PHE B CB  1 
ATOM   5020 C  CG  . PHE B 2 106 ? 183.237 177.578 51.383  1.00 107.69 ? 125 PHE B CG  1 
ATOM   5021 C  CD1 . PHE B 2 106 ? 184.612 177.411 51.372  1.00 94.38  ? 125 PHE B CD1 1 
ATOM   5022 C  CD2 . PHE B 2 106 ? 182.570 177.514 52.594  1.00 121.05 ? 125 PHE B CD2 1 
ATOM   5023 C  CE1 . PHE B 2 106 ? 185.307 177.184 52.542  1.00 90.06  ? 125 PHE B CE1 1 
ATOM   5024 C  CE2 . PHE B 2 106 ? 183.259 177.284 53.768  1.00 119.42 ? 125 PHE B CE2 1 
ATOM   5025 C  CZ  . PHE B 2 106 ? 184.631 177.119 53.741  1.00 110.92 ? 125 PHE B CZ  1 
ATOM   5026 N  N   . ASP B 2 107 ? 183.207 178.899 46.669  1.00 131.21 ? 126 ASP B N   1 
ATOM   5027 C  CA  . ASP B 2 107 ? 182.565 179.243 45.403  1.00 125.52 ? 126 ASP B CA  1 
ATOM   5028 C  C   . ASP B 2 107 ? 181.660 178.126 44.886  1.00 104.67 ? 126 ASP B C   1 
ATOM   5029 O  O   . ASP B 2 107 ? 180.537 178.392 44.443  1.00 118.21 ? 126 ASP B O   1 
ATOM   5030 C  CB  . ASP B 2 107 ? 183.622 179.609 44.358  1.00 127.07 ? 126 ASP B CB  1 
ATOM   5031 C  CG  . ASP B 2 107 ? 184.809 178.671 44.369  1.00 124.64 ? 126 ASP B CG  1 
ATOM   5032 O  OD1 . ASP B 2 107 ? 184.659 177.517 44.825  1.00 126.03 ? 126 ASP B OD1 1 
ATOM   5033 O  OD2 . ASP B 2 107 ? 185.893 179.090 43.911  1.00 116.94 ? 126 ASP B OD2 1 
ATOM   5034 N  N   . TYR B 2 108 ? 182.113 176.873 44.943  1.00 77.65  ? 127 TYR B N   1 
ATOM   5035 C  CA  . TYR B 2 108 ? 181.337 175.753 44.418  1.00 91.30  ? 127 TYR B CA  1 
ATOM   5036 C  C   . TYR B 2 108 ? 181.204 174.656 45.462  1.00 96.37  ? 127 TYR B C   1 
ATOM   5037 O  O   . TYR B 2 108 ? 182.194 174.269 46.091  1.00 115.52 ? 127 TYR B O   1 
ATOM   5038 C  CB  . TYR B 2 108 ? 181.992 175.184 43.155  1.00 111.46 ? 127 TYR B CB  1 
ATOM   5039 C  CG  . TYR B 2 108 ? 182.144 176.198 42.046  1.00 117.87 ? 127 TYR B CG  1 
ATOM   5040 C  CD1 . TYR B 2 108 ? 181.086 176.508 41.204  1.00 104.10 ? 127 TYR B CD1 1 
ATOM   5041 C  CD2 . TYR B 2 108 ? 183.350 176.853 41.850  1.00 130.72 ? 127 TYR B CD2 1 
ATOM   5042 C  CE1 . TYR B 2 108 ? 181.230 177.442 40.194  1.00 110.11 ? 127 TYR B CE1 1 
ATOM   5043 C  CE2 . TYR B 2 108 ? 183.504 177.784 40.845  1.00 130.89 ? 127 TYR B CE2 1 
ATOM   5044 C  CZ  . TYR B 2 108 ? 182.442 178.076 40.020  1.00 112.98 ? 127 TYR B CZ  1 
ATOM   5045 O  OH  . TYR B 2 108 ? 182.601 179.006 39.019  1.00 91.53  ? 127 TYR B OH  1 
ATOM   5046 N  N   . TRP B 2 109 ? 179.989 174.139 45.619  1.00 92.70  ? 128 TRP B N   1 
ATOM   5047 C  CA  . TRP B 2 109 ? 179.680 173.107 46.595  1.00 114.38 ? 128 TRP B CA  1 
ATOM   5048 C  C   . TRP B 2 109 ? 179.286 171.803 45.908  1.00 115.46 ? 128 TRP B C   1 
ATOM   5049 O  O   . TRP B 2 109 ? 178.937 171.776 44.725  1.00 117.06 ? 128 TRP B O   1 
ATOM   5050 C  CB  . TRP B 2 109 ? 178.544 173.557 47.521  1.00 121.46 ? 128 TRP B CB  1 
ATOM   5051 C  CG  . TRP B 2 109 ? 178.870 174.730 48.405  1.00 102.58 ? 128 TRP B CG  1 
ATOM   5052 C  CD1 . TRP B 2 109 ? 179.140 176.019 48.020  1.00 77.88  ? 128 TRP B CD1 1 
ATOM   5053 C  CD2 . TRP B 2 109 ? 178.946 174.715 49.833  1.00 99.73  ? 128 TRP B CD2 1 
ATOM   5054 N  NE1 . TRP B 2 109 ? 179.383 176.801 49.127  1.00 69.57  ? 128 TRP B NE1 1 
ATOM   5055 C  CE2 . TRP B 2 109 ? 179.269 176.023 50.251  1.00 98.65  ? 128 TRP B CE2 1 
ATOM   5056 C  CE3 . TRP B 2 109 ? 178.772 173.717 50.800  1.00 76.49  ? 128 TRP B CE3 1 
ATOM   5057 C  CZ2 . TRP B 2 109 ? 179.423 176.356 51.593  1.00 120.82 ? 128 TRP B CZ2 1 
ATOM   5058 C  CZ3 . TRP B 2 109 ? 178.926 174.047 52.126  1.00 83.97  ? 128 TRP B CZ3 1 
ATOM   5059 C  CH2 . TRP B 2 109 ? 179.249 175.356 52.514  1.00 112.93 ? 128 TRP B CH2 1 
ATOM   5060 N  N   . GLY B 2 110 ? 179.328 170.709 46.685  1.00 115.24 ? 129 GLY B N   1 
ATOM   5061 C  CA  . GLY B 2 110 ? 178.820 169.436 46.219  1.00 108.26 ? 129 GLY B CA  1 
ATOM   5062 C  C   . GLY B 2 110 ? 177.334 169.299 46.492  1.00 121.58 ? 129 GLY B C   1 
ATOM   5063 O  O   . GLY B 2 110 ? 176.732 170.116 47.180  1.00 133.98 ? 129 GLY B O   1 
ATOM   5064 N  N   . GLN B 2 111 ? 176.734 168.244 45.934  1.00 123.31 ? 130 GLN B N   1 
ATOM   5065 C  CA  . GLN B 2 111 ? 175.294 168.075 46.105  1.00 122.99 ? 130 GLN B CA  1 
ATOM   5066 C  C   . GLN B 2 111 ? 174.916 167.646 47.519  1.00 120.76 ? 130 GLN B C   1 
ATOM   5067 O  O   . GLN B 2 111 ? 173.749 167.784 47.901  1.00 122.17 ? 130 GLN B O   1 
ATOM   5068 C  CB  . GLN B 2 111 ? 174.744 167.059 45.102  1.00 125.52 ? 130 GLN B CB  1 
ATOM   5069 C  CG  . GLN B 2 111 ? 174.988 165.599 45.457  1.00 124.83 ? 130 GLN B CG  1 
ATOM   5070 C  CD  . GLN B 2 111 ? 176.382 165.120 45.123  1.00 122.92 ? 130 GLN B CD  1 
ATOM   5071 O  OE1 . GLN B 2 111 ? 177.248 165.899 44.723  1.00 119.23 ? 130 GLN B OE1 1 
ATOM   5072 N  NE2 . GLN B 2 111 ? 176.599 163.819 45.262  1.00 123.25 ? 130 GLN B NE2 1 
ATOM   5073 N  N   . GLY B 2 112 ? 175.864 167.137 48.297  1.00 91.07  ? 131 GLY B N   1 
ATOM   5074 C  CA  . GLY B 2 112 ? 175.631 166.731 49.666  1.00 55.28  ? 131 GLY B CA  1 
ATOM   5075 C  C   . GLY B 2 112 ? 175.540 165.219 49.806  1.00 77.52  ? 131 GLY B C   1 
ATOM   5076 O  O   . GLY B 2 112 ? 175.328 164.481 48.839  1.00 87.40  ? 131 GLY B O   1 
ATOM   5077 N  N   . THR B 2 113 ? 175.700 164.750 51.042  1.00 81.74  ? 132 THR B N   1 
ATOM   5078 C  CA  . THR B 2 113 ? 175.647 163.320 51.339  1.00 110.42 ? 132 THR B CA  1 
ATOM   5079 C  C   . THR B 2 113 ? 174.861 163.110 52.626  1.00 124.41 ? 132 THR B C   1 
ATOM   5080 O  O   . THR B 2 113 ? 175.317 163.508 53.703  1.00 130.21 ? 132 THR B O   1 
ATOM   5081 C  CB  . THR B 2 113 ? 177.053 162.730 51.467  1.00 97.65  ? 132 THR B CB  1 
ATOM   5082 O  OG1 . THR B 2 113 ? 177.779 162.943 50.250  1.00 94.44  ? 132 THR B OG1 1 
ATOM   5083 C  CG2 . THR B 2 113 ? 176.981 161.241 51.759  1.00 103.30 ? 132 THR B CG2 1 
ATOM   5084 N  N   . THR B 2 114 ? 173.692 162.481 52.521  1.00 130.15 ? 133 THR B N   1 
ATOM   5085 C  CA  . THR B 2 114 ? 172.847 162.240 53.687  1.00 128.84 ? 133 THR B CA  1 
ATOM   5086 C  C   . THR B 2 114 ? 173.379 161.031 54.448  1.00 128.96 ? 133 THR B C   1 
ATOM   5087 O  O   . THR B 2 114 ? 173.299 159.896 53.965  1.00 106.94 ? 133 THR B O   1 
ATOM   5088 C  CB  . THR B 2 114 ? 171.396 162.030 53.265  1.00 141.30 ? 133 THR B CB  1 
ATOM   5089 O  OG1 . THR B 2 114 ? 170.919 163.202 52.590  1.00 143.25 ? 133 THR B OG1 1 
ATOM   5090 C  CG2 . THR B 2 114 ? 170.524 161.759 54.484  1.00 137.82 ? 133 THR B CG2 1 
ATOM   5091 N  N   . LEU B 2 115 ? 173.909 161.268 55.642  1.00 125.10 ? 134 LEU B N   1 
ATOM   5092 C  CA  . LEU B 2 115 ? 174.439 160.213 56.495  1.00 119.95 ? 134 LEU B CA  1 
ATOM   5093 C  C   . LEU B 2 115 ? 173.462 159.919 57.624  1.00 130.79 ? 134 LEU B C   1 
ATOM   5094 O  O   . LEU B 2 115 ? 172.999 160.840 58.303  1.00 132.88 ? 134 LEU B O   1 
ATOM   5095 C  CB  . LEU B 2 115 ? 175.800 160.600 57.072  1.00 104.92 ? 134 LEU B CB  1 
ATOM   5096 C  CG  . LEU B 2 115 ? 176.365 159.594 58.077  1.00 115.45 ? 134 LEU B CG  1 
ATOM   5097 C  CD1 . LEU B 2 115 ? 176.561 158.239 57.419  1.00 121.95 ? 134 LEU B CD1 1 
ATOM   5098 C  CD2 . LEU B 2 115 ? 177.669 160.092 58.683  1.00 110.12 ? 134 LEU B CD2 1 
ATOM   5099 N  N   . THR B 2 116 ? 173.138 158.643 57.810  1.00 144.20 ? 135 THR B N   1 
ATOM   5100 C  CA  . THR B 2 116 ? 172.266 158.206 58.893  1.00 138.38 ? 135 THR B CA  1 
ATOM   5101 C  C   . THR B 2 116 ? 173.010 157.166 59.717  1.00 134.39 ? 135 THR B C   1 
ATOM   5102 O  O   . THR B 2 116 ? 173.326 156.079 59.218  1.00 116.47 ? 135 THR B O   1 
ATOM   5103 C  CB  . THR B 2 116 ? 170.951 157.631 58.367  1.00 135.72 ? 135 THR B CB  1 
ATOM   5104 O  OG1 . THR B 2 116 ? 170.306 158.597 57.527  1.00 123.49 ? 135 THR B OG1 1 
ATOM   5105 C  CG2 . THR B 2 116 ? 170.035 157.292 59.533  1.00 132.94 ? 135 THR B CG2 1 
ATOM   5106 N  N   . VAL B 2 117 ? 173.285 157.502 60.971  1.00 136.05 ? 136 VAL B N   1 
ATOM   5107 C  CA  . VAL B 2 117 ? 173.982 156.618 61.895  1.00 141.26 ? 136 VAL B CA  1 
ATOM   5108 C  C   . VAL B 2 117 ? 172.936 156.042 62.841  1.00 147.60 ? 136 VAL B C   1 
ATOM   5109 O  O   . VAL B 2 117 ? 172.508 156.701 63.792  1.00 148.40 ? 136 VAL B O   1 
ATOM   5110 C  CB  . VAL B 2 117 ? 175.091 157.347 62.652  1.00 130.38 ? 136 VAL B CB  1 
ATOM   5111 C  CG1 . VAL B 2 117 ? 175.805 156.385 63.575  1.00 107.73 ? 136 VAL B CG1 1 
ATOM   5112 C  CG2 . VAL B 2 117 ? 176.068 157.989 61.677  1.00 131.70 ? 136 VAL B CG2 1 
ATOM   5113 N  N   . SER B 2 118 ? 172.513 154.810 62.571  1.00 134.48 ? 137 SER B N   1 
ATOM   5114 C  CA  . SER B 2 118 ? 171.518 154.144 63.397  1.00 145.76 ? 137 SER B CA  1 
ATOM   5115 C  C   . SER B 2 118 ? 171.639 152.642 63.201  1.00 152.24 ? 137 SER B C   1 
ATOM   5116 O  O   . SER B 2 118 ? 172.101 152.175 62.157  1.00 154.66 ? 137 SER B O   1 
ATOM   5117 C  CB  . SER B 2 118 ? 170.099 154.609 63.056  1.00 149.51 ? 137 SER B CB  1 
ATOM   5118 O  OG  . SER B 2 118 ? 169.138 153.928 63.844  1.00 159.66 ? 137 SER B OG  1 
ATOM   5119 N  N   . SER B 2 119 ? 171.208 151.892 64.212  1.00 170.43 ? 138 SER B N   1 
ATOM   5120 C  CA  . SER B 2 119 ? 171.252 150.439 64.153  1.00 166.66 ? 138 SER B CA  1 
ATOM   5121 C  C   . SER B 2 119 ? 169.958 149.855 63.611  1.00 172.03 ? 138 SER B C   1 
ATOM   5122 O  O   . SER B 2 119 ? 169.810 148.629 63.576  1.00 198.39 ? 138 SER B O   1 
ATOM   5123 C  CB  . SER B 2 119 ? 171.538 149.855 65.541  1.00 165.77 ? 138 SER B CB  1 
ATOM   5124 O  OG  . SER B 2 119 ? 172.785 150.300 66.043  1.00 168.10 ? 138 SER B OG  1 
ATOM   5125 N  N   . ALA B 2 120 ? 169.028 150.707 63.188  1.00 238.62 ? 139 ALA B N   1 
ATOM   5126 C  CA  . ALA B 2 120 ? 167.746 150.249 62.675  1.00 208.89 ? 139 ALA B CA  1 
ATOM   5127 C  C   . ALA B 2 120 ? 167.924 149.539 61.338  1.00 197.28 ? 139 ALA B C   1 
ATOM   5128 O  O   . ALA B 2 120 ? 168.740 149.941 60.504  1.00 172.75 ? 139 ALA B O   1 
ATOM   5129 C  CB  . ALA B 2 120 ? 166.782 151.425 62.526  1.00 195.63 ? 139 ALA B CB  1 
ATOM   5130 N  N   . LYS B 2 121 ? 167.152 148.475 61.143  1.00 216.43 ? 140 LYS B N   1 
ATOM   5131 C  CA  . LYS B 2 121 ? 167.246 147.683 59.925  1.00 215.45 ? 140 LYS B CA  1 
ATOM   5132 C  C   . LYS B 2 121 ? 166.717 148.466 58.729  1.00 203.46 ? 140 LYS B C   1 
ATOM   5133 O  O   . LYS B 2 121 ? 165.727 149.197 58.830  1.00 202.70 ? 140 LYS B O   1 
ATOM   5134 C  CB  . LYS B 2 121 ? 166.471 146.375 60.086  1.00 217.78 ? 140 LYS B CB  1 
ATOM   5135 C  CG  . LYS B 2 121 ? 166.555 145.440 58.887  1.00 224.21 ? 140 LYS B CG  1 
ATOM   5136 C  CD  . LYS B 2 121 ? 167.990 145.019 58.609  1.00 224.30 ? 140 LYS B CD  1 
ATOM   5137 C  CE  . LYS B 2 121 ? 168.069 144.060 57.430  1.00 220.04 ? 140 LYS B CE  1 
ATOM   5138 N  NZ  . LYS B 2 121 ? 169.467 143.619 57.169  1.00 216.89 ? 140 LYS B NZ  1 
ATOM   5139 N  N   . THR B 2 122 ? 167.394 148.314 57.592  1.00 197.73 ? 141 THR B N   1 
ATOM   5140 C  CA  . THR B 2 122 ? 166.978 148.957 56.350  1.00 184.67 ? 141 THR B CA  1 
ATOM   5141 C  C   . THR B 2 122 ? 165.641 148.373 55.912  1.00 171.49 ? 141 THR B C   1 
ATOM   5142 O  O   . THR B 2 122 ? 165.579 147.243 55.418  1.00 167.12 ? 141 THR B O   1 
ATOM   5143 C  CB  . THR B 2 122 ? 168.039 148.760 55.271  1.00 188.33 ? 141 THR B CB  1 
ATOM   5144 O  OG1 . THR B 2 122 ? 169.310 149.207 55.759  1.00 188.43 ? 141 THR B OG1 1 
ATOM   5145 C  CG2 . THR B 2 122 ? 167.681 149.556 54.027  1.00 167.51 ? 141 THR B CG2 1 
ATOM   5146 N  N   . THR B 2 123 ? 164.564 149.145 56.092  1.00 178.17 ? 142 THR B N   1 
ATOM   5147 C  CA  . THR B 2 123 ? 163.211 148.689 55.795  1.00 189.93 ? 142 THR B CA  1 
ATOM   5148 C  C   . THR B 2 123 ? 162.771 149.181 54.427  1.00 193.73 ? 142 THR B C   1 
ATOM   5149 O  O   . THR B 2 123 ? 162.830 150.389 54.157  1.00 188.98 ? 142 THR B O   1 
ATOM   5150 C  CB  . THR B 2 123 ? 162.239 149.187 56.860  1.00 203.41 ? 142 THR B CB  1 
ATOM   5151 O  OG1 . THR B 2 123 ? 162.660 148.720 58.148  1.00 205.73 ? 142 THR B OG1 1 
ATOM   5152 C  CG2 . THR B 2 123 ? 160.831 148.686 56.579  1.00 212.16 ? 142 THR B CG2 1 
ATOM   5153 N  N   . PRO B 2 124 ? 162.323 148.280 53.557  1.00 208.78 ? 143 PRO B N   1 
ATOM   5154 C  CA  . PRO B 2 124 ? 161.814 148.685 52.240  1.00 218.33 ? 143 PRO B CA  1 
ATOM   5155 C  C   . PRO B 2 124 ? 160.492 149.424 52.341  1.00 221.40 ? 143 PRO B C   1 
ATOM   5156 O  O   . PRO B 2 124 ? 159.612 149.052 53.133  1.00 221.27 ? 143 PRO B O   1 
ATOM   5157 C  CB  . PRO B 2 124 ? 161.651 147.347 51.502  1.00 218.95 ? 143 PRO B CB  1 
ATOM   5158 C  CG  . PRO B 2 124 ? 161.445 146.349 52.589  1.00 221.20 ? 143 PRO B CG  1 
ATOM   5159 C  CD  . PRO B 2 124 ? 162.296 146.818 53.736  1.00 219.12 ? 143 PRO B CD  1 
ATOM   5160 N  N   . PRO B 2 125 ? 160.323 150.487 51.555  1.00 223.11 ? 144 PRO B N   1 
ATOM   5161 C  CA  . PRO B 2 125 ? 159.095 151.290 51.627  1.00 222.88 ? 144 PRO B CA  1 
ATOM   5162 C  C   . PRO B 2 125 ? 157.901 150.575 51.008  1.00 225.83 ? 144 PRO B C   1 
ATOM   5163 O  O   . PRO B 2 125 ? 158.026 149.871 50.003  1.00 225.67 ? 144 PRO B O   1 
ATOM   5164 C  CB  . PRO B 2 125 ? 159.458 152.553 50.839  1.00 224.79 ? 144 PRO B CB  1 
ATOM   5165 C  CG  . PRO B 2 125 ? 160.475 152.081 49.855  1.00 231.52 ? 144 PRO B CG  1 
ATOM   5166 C  CD  . PRO B 2 125 ? 161.279 151.027 50.573  1.00 232.04 ? 144 PRO B CD  1 
ATOM   5167 N  N   . SER B 2 126 ? 156.735 150.762 51.625  1.00 232.65 ? 145 SER B N   1 
ATOM   5168 C  CA  . SER B 2 126 ? 155.475 150.230 51.118  1.00 222.79 ? 145 SER B CA  1 
ATOM   5169 C  C   . SER B 2 126 ? 154.777 151.312 50.299  1.00 231.88 ? 145 SER B C   1 
ATOM   5170 O  O   . SER B 2 126 ? 154.393 152.355 50.840  1.00 241.05 ? 145 SER B O   1 
ATOM   5171 C  CB  . SER B 2 126 ? 154.581 149.765 52.267  1.00 202.86 ? 145 SER B CB  1 
ATOM   5172 O  OG  . SER B 2 126 ? 155.165 148.679 52.962  1.00 207.75 ? 145 SER B OG  1 
ATOM   5173 N  N   . VAL B 2 127 ? 154.617 151.059 49.002  1.00 245.73 ? 146 VAL B N   1 
ATOM   5174 C  CA  . VAL B 2 127 ? 154.052 152.020 48.059  1.00 254.13 ? 146 VAL B CA  1 
ATOM   5175 C  C   . VAL B 2 127 ? 152.585 151.684 47.822  1.00 245.82 ? 146 VAL B C   1 
ATOM   5176 O  O   . VAL B 2 127 ? 152.263 150.642 47.240  1.00 229.05 ? 146 VAL B O   1 
ATOM   5177 C  CB  . VAL B 2 127 ? 154.832 152.022 46.738  1.00 268.71 ? 146 VAL B CB  1 
ATOM   5178 C  CG1 . VAL B 2 127 ? 154.302 153.104 45.809  1.00 272.67 ? 146 VAL B CG1 1 
ATOM   5179 C  CG2 . VAL B 2 127 ? 156.316 152.194 47.004  1.00 279.47 ? 146 VAL B CG2 1 
ATOM   5180 N  N   . TYR B 2 128 ? 151.690 152.570 48.262  1.00 240.37 ? 147 TYR B N   1 
ATOM   5181 C  CA  . TYR B 2 128 ? 150.260 152.395 48.069  1.00 236.71 ? 147 TYR B CA  1 
ATOM   5182 C  C   . TYR B 2 128 ? 149.664 153.553 47.274  1.00 226.41 ? 147 TYR B C   1 
ATOM   5183 O  O   . TYR B 2 128 ? 149.846 154.723 47.648  1.00 220.49 ? 147 TYR B O   1 
ATOM   5184 C  CB  . TYR B 2 128 ? 149.553 152.259 49.427  1.00 236.41 ? 147 TYR B CB  1 
ATOM   5185 C  CG  . TYR B 2 128 ? 150.033 151.062 50.219  1.00 239.29 ? 147 TYR B CG  1 
ATOM   5186 C  CD1 . TYR B 2 128 ? 150.380 149.879 49.576  1.00 253.49 ? 147 TYR B CD1 1 
ATOM   5187 C  CD2 . TYR B 2 128 ? 150.161 151.117 51.601  1.00 229.28 ? 147 TYR B CD2 1 
ATOM   5188 C  CE1 . TYR B 2 128 ? 150.824 148.782 50.284  1.00 253.35 ? 147 TYR B CE1 1 
ATOM   5189 C  CE2 . TYR B 2 128 ? 150.606 150.021 52.320  1.00 229.27 ? 147 TYR B CE2 1 
ATOM   5190 C  CZ  . TYR B 2 128 ? 150.936 148.857 51.655  1.00 240.61 ? 147 TYR B CZ  1 
ATOM   5191 O  OH  . TYR B 2 128 ? 151.380 147.762 52.359  1.00 247.57 ? 147 TYR B OH  1 
ATOM   5192 N  N   . PRO B 2 129 ? 148.982 153.304 46.191  1.00 235.73 ? 148 PRO B N   1 
ATOM   5193 C  CA  . PRO B 2 129 ? 148.401 154.348 45.336  1.00 244.82 ? 148 PRO B CA  1 
ATOM   5194 C  C   . PRO B 2 129 ? 147.247 155.108 45.987  1.00 263.62 ? 148 PRO B C   1 
ATOM   5195 O  O   . PRO B 2 129 ? 146.492 154.532 46.763  1.00 238.65 ? 148 PRO B O   1 
ATOM   5196 C  CB  . PRO B 2 129 ? 147.906 153.562 44.118  1.00 233.14 ? 148 PRO B CB  1 
ATOM   5197 C  CG  . PRO B 2 129 ? 147.643 152.194 44.641  1.00 225.59 ? 148 PRO B CG  1 
ATOM   5198 C  CD  . PRO B 2 129 ? 148.693 151.951 45.684  1.00 227.09 ? 148 PRO B CD  1 
ATOM   5199 N  N   . LEU B 2 130 ? 147.135 156.399 45.692  1.00 301.90 ? 149 LEU B N   1 
ATOM   5200 C  CA  . LEU B 2 130 ? 146.046 157.215 46.219  1.00 325.82 ? 149 LEU B CA  1 
ATOM   5201 C  C   . LEU B 2 130 ? 145.213 157.783 45.073  1.00 350.71 ? 149 LEU B C   1 
ATOM   5202 O  O   . LEU B 2 130 ? 145.435 158.914 44.641  1.00 350.98 ? 149 LEU B O   1 
ATOM   5203 C  CB  . LEU B 2 130 ? 146.581 158.342 47.103  1.00 319.70 ? 149 LEU B CB  1 
ATOM   5204 C  CG  . LEU B 2 130 ? 147.306 157.904 48.376  1.00 322.06 ? 149 LEU B CG  1 
ATOM   5205 C  CD1 . LEU B 2 130 ? 147.731 159.114 49.192  1.00 323.81 ? 149 LEU B CD1 1 
ATOM   5206 C  CD2 . LEU B 2 130 ? 146.429 156.973 49.201  1.00 320.54 ? 149 LEU B CD2 1 
ATOM   5207 N  N   . ALA B 2 131 ? 144.255 157.003 44.583  1.00 385.43 ? 150 ALA B N   1 
ATOM   5208 C  CA  . ALA B 2 131 ? 143.429 157.437 43.461  1.00 408.54 ? 150 ALA B CA  1 
ATOM   5209 C  C   . ALA B 2 131 ? 142.128 158.080 43.930  1.00 413.78 ? 150 ALA B C   1 
ATOM   5210 O  O   . ALA B 2 131 ? 141.494 157.595 44.868  1.00 417.48 ? 150 ALA B O   1 
ATOM   5211 C  CB  . ALA B 2 131 ? 143.136 156.261 42.541  1.00 416.31 ? 150 ALA B CB  1 
ATOM   5212 N  N   . PRO B 2 132 ? 141.764 159.155 43.213  1.00 415.30 ? 151 PRO B N   1 
ATOM   5213 C  CA  . PRO B 2 132 ? 140.489 159.815 43.528  1.00 406.89 ? 151 PRO B CA  1 
ATOM   5214 C  C   . PRO B 2 132 ? 139.286 158.909 43.301  1.00 393.12 ? 151 PRO B C   1 
ATOM   5215 O  O   . PRO B 2 132 ? 139.276 158.060 42.407  1.00 398.03 ? 151 PRO B O   1 
ATOM   5216 C  CB  . PRO B 2 132 ? 140.466 161.013 42.571  1.00 410.25 ? 151 PRO B CB  1 
ATOM   5217 C  CG  . PRO B 2 132 ? 141.898 161.252 42.221  1.00 414.91 ? 151 PRO B CG  1 
ATOM   5218 C  CD  . PRO B 2 132 ? 142.535 159.894 42.200  1.00 418.43 ? 151 PRO B CD  1 
ATOM   5219 N  N   . GLY B 2 133 ? 138.263 159.105 44.132  1.00 348.07 ? 152 GLY B N   1 
ATOM   5220 C  CA  . GLY B 2 133 ? 137.051 158.316 44.019  1.00 358.97 ? 152 GLY B CA  1 
ATOM   5221 C  C   . GLY B 2 133 ? 136.312 158.557 42.715  1.00 330.20 ? 152 GLY B C   1 
ATOM   5222 O  O   . GLY B 2 133 ? 136.509 159.557 42.021  1.00 327.80 ? 152 GLY B O   1 
ATOM   5223 N  N   . CYS B 2 134 ? 135.439 157.606 42.382  1.00 361.70 ? 153 CYS B N   1 
ATOM   5224 C  CA  . CYS B 2 134 ? 134.614 157.664 41.181  1.00 361.71 ? 153 CYS B CA  1 
ATOM   5225 C  C   . CYS B 2 134 ? 133.359 158.513 41.356  1.00 349.76 ? 153 CYS B C   1 
ATOM   5226 O  O   . CYS B 2 134 ? 132.596 158.663 40.396  1.00 357.92 ? 153 CYS B O   1 
ATOM   5227 C  CB  . CYS B 2 134 ? 134.214 156.253 40.744  1.00 368.35 ? 153 CYS B CB  1 
ATOM   5228 S  SG  . CYS B 2 134 ? 133.229 155.319 41.944  1.00 373.44 ? 153 CYS B SG  1 
ATOM   5229 N  N   . GLY B 2 135 ? 133.130 159.068 42.543  1.00 300.77 ? 154 GLY B N   1 
ATOM   5230 C  CA  . GLY B 2 135 ? 131.969 159.901 42.796  1.00 276.89 ? 154 GLY B CA  1 
ATOM   5231 C  C   . GLY B 2 135 ? 132.278 161.379 42.902  1.00 230.36 ? 154 GLY B C   1 
ATOM   5232 O  O   . GLY B 2 135 ? 131.379 162.195 43.127  1.00 211.35 ? 154 GLY B O   1 
ATOM   5233 N  N   . ASP B 2 136 ? 133.548 161.734 42.742  1.00 239.70 ? 155 ASP B N   1 
ATOM   5234 C  CA  . ASP B 2 136 ? 133.960 163.124 42.827  1.00 251.77 ? 155 ASP B CA  1 
ATOM   5235 C  C   . ASP B 2 136 ? 133.497 163.896 41.593  1.00 259.52 ? 155 ASP B C   1 
ATOM   5236 O  O   . ASP B 2 136 ? 133.177 163.324 40.547  1.00 256.01 ? 155 ASP B O   1 
ATOM   5237 C  CB  . ASP B 2 136 ? 135.479 163.222 42.966  1.00 251.35 ? 155 ASP B CB  1 
ATOM   5238 C  CG  . ASP B 2 136 ? 135.998 162.515 44.203  1.00 248.68 ? 155 ASP B CG  1 
ATOM   5239 O  OD1 . ASP B 2 136 ? 135.372 161.521 44.628  1.00 256.00 ? 155 ASP B OD1 1 
ATOM   5240 O  OD2 . ASP B 2 136 ? 137.034 162.950 44.748  1.00 241.06 ? 155 ASP B OD2 1 
ATOM   5241 N  N   . THR B 2 137 ? 133.467 165.220 41.729  1.00 268.11 ? 156 THR B N   1 
ATOM   5242 C  CA  . THR B 2 137 ? 133.038 166.106 40.652  1.00 279.34 ? 156 THR B CA  1 
ATOM   5243 C  C   . THR B 2 137 ? 134.275 166.528 39.870  1.00 287.08 ? 156 THR B C   1 
ATOM   5244 O  O   . THR B 2 137 ? 135.118 167.275 40.378  1.00 282.73 ? 156 THR B O   1 
ATOM   5245 C  CB  . THR B 2 137 ? 132.302 167.324 41.207  1.00 274.97 ? 156 THR B CB  1 
ATOM   5246 O  OG1 . THR B 2 137 ? 131.156 166.896 41.953  1.00 274.89 ? 156 THR B OG1 1 
ATOM   5247 C  CG2 . THR B 2 137 ? 131.855 168.240 40.075  1.00 277.89 ? 156 THR B CG2 1 
ATOM   5248 N  N   . THR B 2 138 ? 134.379 166.054 38.631  1.00 275.49 ? 157 THR B N   1 
ATOM   5249 C  CA  . THR B 2 138 ? 135.518 166.379 37.777  1.00 257.63 ? 157 THR B CA  1 
ATOM   5250 C  C   . THR B 2 138 ? 135.393 167.821 37.307  1.00 242.75 ? 157 THR B C   1 
ATOM   5251 O  O   . THR B 2 138 ? 134.603 168.135 36.415  1.00 241.12 ? 157 THR B O   1 
ATOM   5252 C  CB  . THR B 2 138 ? 135.586 165.423 36.592  1.00 246.23 ? 157 THR B CB  1 
ATOM   5253 O  OG1 . THR B 2 138 ? 135.672 164.073 37.066  1.00 239.67 ? 157 THR B OG1 1 
ATOM   5254 C  CG2 . THR B 2 138 ? 136.803 165.729 35.731  1.00 242.80 ? 157 THR B CG2 1 
ATOM   5255 N  N   . GLY B 2 139 ? 136.177 168.704 37.916  1.00 220.48 ? 158 GLY B N   1 
ATOM   5256 C  CA  . GLY B 2 139 ? 136.159 170.108 37.565  1.00 223.10 ? 158 GLY B CA  1 
ATOM   5257 C  C   . GLY B 2 139 ? 137.210 170.405 36.519  1.00 213.55 ? 158 GLY B C   1 
ATOM   5258 O  O   . GLY B 2 139 ? 137.459 169.582 35.633  1.00 214.22 ? 158 GLY B O   1 
ATOM   5259 N  N   . SER B 2 140 ? 137.834 171.579 36.602  1.00 228.17 ? 159 SER B N   1 
ATOM   5260 C  CA  . SER B 2 140 ? 138.873 171.930 35.645  1.00 233.89 ? 159 SER B CA  1 
ATOM   5261 C  C   . SER B 2 140 ? 140.186 171.207 35.913  1.00 240.28 ? 159 SER B C   1 
ATOM   5262 O  O   . SER B 2 140 ? 141.032 171.139 35.014  1.00 245.04 ? 159 SER B O   1 
ATOM   5263 C  CB  . SER B 2 140 ? 139.105 173.443 35.652  1.00 233.25 ? 159 SER B CB  1 
ATOM   5264 O  OG  . SER B 2 140 ? 139.524 173.887 36.930  1.00 237.03 ? 159 SER B OG  1 
ATOM   5265 N  N   . SER B 2 141 ? 140.379 170.668 37.117  1.00 247.22 ? 160 SER B N   1 
ATOM   5266 C  CA  . SER B 2 141 ? 141.610 169.966 37.452  1.00 241.03 ? 160 SER B CA  1 
ATOM   5267 C  C   . SER B 2 141 ? 141.342 168.915 38.523  1.00 235.31 ? 160 SER B C   1 
ATOM   5268 O  O   . SER B 2 141 ? 140.618 169.171 39.489  1.00 228.21 ? 160 SER B O   1 
ATOM   5269 C  CB  . SER B 2 141 ? 142.692 170.942 37.928  1.00 231.39 ? 160 SER B CB  1 
ATOM   5270 O  OG  . SER B 2 141 ? 142.297 171.606 39.115  1.00 212.84 ? 160 SER B OG  1 
ATOM   5271 N  N   . VAL B 2 142 ? 141.929 167.734 38.335  1.00 246.50 ? 161 VAL B N   1 
ATOM   5272 C  CA  . VAL B 2 142 ? 141.868 166.632 39.290  1.00 237.34 ? 161 VAL B CA  1 
ATOM   5273 C  C   . VAL B 2 142 ? 143.219 166.519 39.987  1.00 243.02 ? 161 VAL B C   1 
ATOM   5274 O  O   . VAL B 2 142 ? 144.270 166.703 39.359  1.00 253.24 ? 161 VAL B O   1 
ATOM   5275 C  CB  . VAL B 2 142 ? 141.491 165.308 38.596  1.00 223.37 ? 161 VAL B CB  1 
ATOM   5276 C  CG1 . VAL B 2 142 ? 141.195 164.228 39.625  1.00 216.99 ? 161 VAL B CG1 1 
ATOM   5277 C  CG2 . VAL B 2 142 ? 140.299 165.514 37.672  1.00 227.62 ? 161 VAL B CG2 1 
ATOM   5278 N  N   . THR B 2 143 ? 143.191 166.226 41.287  1.00 225.47 ? 162 THR B N   1 
ATOM   5279 C  CA  . THR B 2 143 ? 144.393 166.065 42.100  1.00 218.60 ? 162 THR B CA  1 
ATOM   5280 C  C   . THR B 2 143 ? 144.630 164.593 42.427  1.00 248.82 ? 162 THR B C   1 
ATOM   5281 O  O   . THR B 2 143 ? 143.808 163.962 43.100  1.00 228.66 ? 162 THR B O   1 
ATOM   5282 C  CB  . THR B 2 143 ? 144.294 166.888 43.384  1.00 170.47 ? 162 THR B CB  1 
ATOM   5283 O  OG1 . THR B 2 143 ? 144.167 168.276 43.050  1.00 162.03 ? 162 THR B OG1 1 
ATOM   5284 C  CG2 . THR B 2 143 ? 145.535 166.689 44.238  1.00 167.79 ? 162 THR B CG2 1 
ATOM   5285 N  N   . LEU B 2 144 ? 145.748 164.054 41.943  1.00 300.37 ? 163 LEU B N   1 
ATOM   5286 C  CA  . LEU B 2 144 ? 146.174 162.680 42.168  1.00 308.12 ? 163 LEU B CA  1 
ATOM   5287 C  C   . LEU B 2 144 ? 147.262 162.639 43.247  1.00 304.03 ? 163 LEU B C   1 
ATOM   5288 O  O   . LEU B 2 144 ? 147.674 163.668 43.787  1.00 308.47 ? 163 LEU B O   1 
ATOM   5289 C  CB  . LEU B 2 144 ? 146.670 162.062 40.859  1.00 319.02 ? 163 LEU B CB  1 
ATOM   5290 C  CG  . LEU B 2 144 ? 145.987 162.507 39.561  1.00 325.29 ? 163 LEU B CG  1 
ATOM   5291 C  CD1 . LEU B 2 144 ? 146.610 161.802 38.365  1.00 334.92 ? 163 LEU B CD1 1 
ATOM   5292 C  CD2 . LEU B 2 144 ? 144.483 162.254 39.603  1.00 323.48 ? 163 LEU B CD2 1 
ATOM   5293 N  N   . GLY B 2 145 ? 147.733 161.430 43.566  1.00 288.90 ? 164 GLY B N   1 
ATOM   5294 C  CA  . GLY B 2 145 ? 148.774 161.271 44.571  1.00 273.49 ? 164 GLY B CA  1 
ATOM   5295 C  C   . GLY B 2 145 ? 149.136 159.840 44.930  1.00 254.71 ? 164 GLY B C   1 
ATOM   5296 O  O   . GLY B 2 145 ? 148.379 158.911 44.634  1.00 240.51 ? 164 GLY B O   1 
ATOM   5297 N  N   . CYS B 2 146 ? 150.308 159.646 45.546  1.00 241.24 ? 165 CYS B N   1 
ATOM   5298 C  CA  . CYS B 2 146 ? 150.785 158.333 45.970  1.00 232.13 ? 165 CYS B CA  1 
ATOM   5299 C  C   . CYS B 2 146 ? 151.307 158.400 47.403  1.00 218.96 ? 165 CYS B C   1 
ATOM   5300 O  O   . CYS B 2 146 ? 151.761 159.452 47.867  1.00 208.01 ? 165 CYS B O   1 
ATOM   5301 C  CB  . CYS B 2 146 ? 151.885 157.783 45.035  1.00 231.91 ? 165 CYS B CB  1 
ATOM   5302 S  SG  . CYS B 2 146 ? 151.289 157.232 43.409  1.00 230.11 ? 165 CYS B SG  1 
ATOM   5303 N  N   . LEU B 2 147 ? 151.229 157.265 48.105  1.00 201.79 ? 166 LEU B N   1 
ATOM   5304 C  CA  . LEU B 2 147 ? 151.554 157.174 49.526  1.00 201.80 ? 166 LEU B CA  1 
ATOM   5305 C  C   . LEU B 2 147 ? 152.704 156.201 49.765  1.00 215.67 ? 166 LEU B C   1 
ATOM   5306 O  O   . LEU B 2 147 ? 152.725 155.102 49.203  1.00 222.26 ? 166 LEU B O   1 
ATOM   5307 C  CB  . LEU B 2 147 ? 150.334 156.724 50.337  1.00 197.97 ? 166 LEU B CB  1 
ATOM   5308 C  CG  . LEU B 2 147 ? 150.578 156.391 51.811  1.00 196.56 ? 166 LEU B CG  1 
ATOM   5309 C  CD1 . LEU B 2 147 ? 150.989 157.634 52.591  1.00 193.54 ? 166 LEU B CD1 1 
ATOM   5310 C  CD2 . LEU B 2 147 ? 149.349 155.741 52.429  1.00 191.60 ? 166 LEU B CD2 1 
ATOM   5311 N  N   . VAL B 2 148 ? 153.655 156.605 50.610  1.00 208.41 ? 167 VAL B N   1 
ATOM   5312 C  CA  . VAL B 2 148 ? 154.808 155.781 50.974  1.00 202.31 ? 167 VAL B CA  1 
ATOM   5313 C  C   . VAL B 2 148 ? 154.800 155.593 52.486  1.00 202.34 ? 167 VAL B C   1 
ATOM   5314 O  O   . VAL B 2 148 ? 154.847 156.575 53.238  1.00 195.47 ? 167 VAL B O   1 
ATOM   5315 C  CB  . VAL B 2 148 ? 156.133 156.405 50.510  1.00 192.65 ? 167 VAL B CB  1 
ATOM   5316 C  CG1 . VAL B 2 148 ? 157.311 155.583 51.014  1.00 186.26 ? 167 VAL B CG1 1 
ATOM   5317 C  CG2 . VAL B 2 148 ? 156.166 156.515 48.996  1.00 189.99 ? 167 VAL B CG2 1 
ATOM   5318 N  N   . LYS B 2 149 ? 154.748 154.337 52.933  1.00 203.87 ? 168 LYS B N   1 
ATOM   5319 C  CA  . LYS B 2 149 ? 154.652 154.016 54.352  1.00 189.70 ? 168 LYS B CA  1 
ATOM   5320 C  C   . LYS B 2 149 ? 155.722 153.018 54.770  1.00 172.95 ? 168 LYS B C   1 
ATOM   5321 O  O   . LYS B 2 149 ? 155.895 151.979 54.124  1.00 169.94 ? 168 LYS B O   1 
ATOM   5322 C  CB  . LYS B 2 149 ? 153.266 153.450 54.681  1.00 200.12 ? 168 LYS B CB  1 
ATOM   5323 C  CG  . LYS B 2 149 ? 153.090 153.034 56.129  1.00 213.55 ? 168 LYS B CG  1 
ATOM   5324 C  CD  . LYS B 2 149 ? 152.973 151.520 56.238  1.00 228.52 ? 168 LYS B CD  1 
ATOM   5325 C  CE  . LYS B 2 149 ? 152.746 151.077 57.673  1.00 227.15 ? 168 LYS B CE  1 
ATOM   5326 N  NZ  . LYS B 2 149 ? 152.558 149.603 57.771  1.00 220.50 ? 168 LYS B NZ  1 
ATOM   5327 N  N   . GLY B 2 150 ? 156.414 153.322 55.870  1.00 160.90 ? 169 GLY B N   1 
ATOM   5328 C  CA  . GLY B 2 150 ? 157.355 152.400 56.480  1.00 163.58 ? 169 GLY B CA  1 
ATOM   5329 C  C   . GLY B 2 150 ? 158.664 152.165 55.753  1.00 193.08 ? 169 GLY B C   1 
ATOM   5330 O  O   . GLY B 2 150 ? 158.763 151.238 54.944  1.00 216.55 ? 169 GLY B O   1 
ATOM   5331 N  N   . TYR B 2 151 ? 159.680 152.979 56.036  1.00 172.16 ? 170 TYR B N   1 
ATOM   5332 C  CA  . TYR B 2 151 ? 160.992 152.787 55.430  1.00 175.10 ? 170 TYR B CA  1 
ATOM   5333 C  C   . TYR B 2 151 ? 162.040 153.479 56.287  1.00 177.19 ? 170 TYR B C   1 
ATOM   5334 O  O   . TYR B 2 151 ? 161.729 154.362 57.091  1.00 179.75 ? 170 TYR B O   1 
ATOM   5335 C  CB  . TYR B 2 151 ? 161.046 153.317 53.991  1.00 171.24 ? 170 TYR B CB  1 
ATOM   5336 C  CG  . TYR B 2 151 ? 160.912 154.818 53.875  1.00 171.05 ? 170 TYR B CG  1 
ATOM   5337 C  CD1 . TYR B 2 151 ? 159.667 155.429 53.909  1.00 166.09 ? 170 TYR B CD1 1 
ATOM   5338 C  CD2 . TYR B 2 151 ? 162.034 155.623 53.727  1.00 171.53 ? 170 TYR B CD2 1 
ATOM   5339 C  CE1 . TYR B 2 151 ? 159.543 156.801 53.803  1.00 174.35 ? 170 TYR B CE1 1 
ATOM   5340 C  CE2 . TYR B 2 151 ? 161.921 156.995 53.620  1.00 171.94 ? 170 TYR B CE2 1 
ATOM   5341 C  CZ  . TYR B 2 151 ? 160.673 157.579 53.658  1.00 174.55 ? 170 TYR B CZ  1 
ATOM   5342 O  OH  . TYR B 2 151 ? 160.553 158.945 53.553  1.00 163.47 ? 170 TYR B OH  1 
ATOM   5343 N  N   . PHE B 2 152 ? 163.289 153.060 56.106  1.00 175.16 ? 171 PHE B N   1 
ATOM   5344 C  CA  . PHE B 2 152 ? 164.403 153.611 56.867  1.00 164.48 ? 171 PHE B CA  1 
ATOM   5345 C  C   . PHE B 2 152 ? 165.702 153.456 56.079  1.00 177.08 ? 171 PHE B C   1 
ATOM   5346 O  O   . PHE B 2 152 ? 165.939 152.412 55.470  1.00 175.97 ? 171 PHE B O   1 
ATOM   5347 C  CB  . PHE B 2 152 ? 164.518 152.914 58.228  1.00 150.23 ? 171 PHE B CB  1 
ATOM   5348 C  CG  . PHE B 2 152 ? 165.511 153.552 59.162  1.00 157.43 ? 171 PHE B CG  1 
ATOM   5349 C  CD1 . PHE B 2 152 ? 165.128 154.580 60.008  1.00 157.53 ? 171 PHE B CD1 1 
ATOM   5350 C  CD2 . PHE B 2 152 ? 166.829 153.125 59.190  1.00 164.65 ? 171 PHE B CD2 1 
ATOM   5351 C  CE1 . PHE B 2 152 ? 166.040 155.166 60.867  1.00 163.45 ? 171 PHE B CE1 1 
ATOM   5352 C  CE2 . PHE B 2 152 ? 167.745 153.709 60.043  1.00 166.82 ? 171 PHE B CE2 1 
ATOM   5353 C  CZ  . PHE B 2 152 ? 167.350 154.731 60.883  1.00 167.48 ? 171 PHE B CZ  1 
ATOM   5354 N  N   . PRO B 2 153 ? 166.548 154.499 56.082  1.00 199.12 ? 172 PRO B N   1 
ATOM   5355 C  CA  . PRO B 2 153 ? 166.307 155.796 56.719  1.00 212.17 ? 172 PRO B CA  1 
ATOM   5356 C  C   . PRO B 2 153 ? 165.650 156.791 55.769  1.00 204.61 ? 172 PRO B C   1 
ATOM   5357 O  O   . PRO B 2 153 ? 164.981 156.387 54.818  1.00 192.10 ? 172 PRO B O   1 
ATOM   5358 C  CB  . PRO B 2 153 ? 167.712 156.255 57.094  1.00 212.29 ? 172 PRO B CB  1 
ATOM   5359 C  CG  . PRO B 2 153 ? 168.562 155.705 56.003  1.00 211.40 ? 172 PRO B CG  1 
ATOM   5360 C  CD  . PRO B 2 153 ? 167.929 154.396 55.580  1.00 203.32 ? 172 PRO B CD  1 
ATOM   5361 N  N   . GLU B 2 154 ? 165.845 158.083 56.030  1.00 219.41 ? 173 GLU B N   1 
ATOM   5362 C  CA  . GLU B 2 154 ? 165.303 159.126 55.169  1.00 224.50 ? 173 GLU B CA  1 
ATOM   5363 C  C   . GLU B 2 154 ? 166.056 159.189 53.843  1.00 221.10 ? 173 GLU B C   1 
ATOM   5364 O  O   . GLU B 2 154 ? 166.862 160.096 53.610  1.00 223.88 ? 173 GLU B O   1 
ATOM   5365 C  CB  . GLU B 2 154 ? 165.356 160.471 55.904  1.00 232.99 ? 173 GLU B CB  1 
ATOM   5366 C  CG  . GLU B 2 154 ? 166.704 160.762 56.571  1.00 245.07 ? 173 GLU B CG  1 
ATOM   5367 C  CD  . GLU B 2 154 ? 166.869 162.215 56.970  1.00 240.33 ? 173 GLU B CD  1 
ATOM   5368 O  OE1 . GLU B 2 154 ? 165.863 162.843 57.363  1.00 243.76 ? 173 GLU B OE1 1 
ATOM   5369 O  OE2 . GLU B 2 154 ? 168.007 162.727 56.899  1.00 230.50 ? 173 GLU B OE2 1 
ATOM   5370 N  N   . SER B 2 155 ? 165.793 158.220 52.963  1.00 189.57 ? 174 SER B N   1 
ATOM   5371 C  CA  . SER B 2 155 ? 166.405 158.183 51.633  1.00 191.26 ? 174 SER B CA  1 
ATOM   5372 C  C   . SER B 2 155 ? 165.381 157.606 50.651  1.00 206.12 ? 174 SER B C   1 
ATOM   5373 O  O   . SER B 2 155 ? 165.317 156.391 50.455  1.00 217.30 ? 174 SER B O   1 
ATOM   5374 C  CB  . SER B 2 155 ? 167.697 157.379 51.640  1.00 188.84 ? 174 SER B CB  1 
ATOM   5375 O  OG  . SER B 2 155 ? 168.660 157.970 52.496  1.00 188.85 ? 174 SER B OG  1 
ATOM   5376 N  N   . VAL B 2 156 ? 164.568 158.483 50.060  1.00 207.60 ? 175 VAL B N   1 
ATOM   5377 C  CA  . VAL B 2 156 ? 163.509 158.052 49.152  1.00 205.30 ? 175 VAL B CA  1 
ATOM   5378 C  C   . VAL B 2 156 ? 163.293 159.139 48.106  1.00 225.19 ? 175 VAL B C   1 
ATOM   5379 O  O   . VAL B 2 156 ? 163.483 160.329 48.375  1.00 235.82 ? 175 VAL B O   1 
ATOM   5380 C  CB  . VAL B 2 156 ? 162.202 157.739 49.924  1.00 170.31 ? 175 VAL B CB  1 
ATOM   5381 C  CG1 . VAL B 2 156 ? 161.608 159.010 50.513  1.00 146.80 ? 175 VAL B CG1 1 
ATOM   5382 C  CG2 . VAL B 2 156 ? 161.197 157.028 49.030  1.00 165.98 ? 175 VAL B CG2 1 
ATOM   5383 N  N   . THR B 2 157 ? 162.899 158.722 46.900  1.00 243.89 ? 176 THR B N   1 
ATOM   5384 C  CA  . THR B 2 157 ? 162.672 159.646 45.790  1.00 255.98 ? 176 THR B CA  1 
ATOM   5385 C  C   . THR B 2 157 ? 161.442 159.215 45.003  1.00 255.17 ? 176 THR B C   1 
ATOM   5386 O  O   . THR B 2 157 ? 161.426 158.121 44.433  1.00 272.78 ? 176 THR B O   1 
ATOM   5387 C  CB  . THR B 2 157 ? 163.898 159.707 44.871  1.00 266.06 ? 176 THR B CB  1 
ATOM   5388 O  OG1 . THR B 2 157 ? 165.038 160.152 45.618  1.00 269.98 ? 176 THR B OG1 1 
ATOM   5389 C  CG2 . THR B 2 157 ? 163.651 160.662 43.715  1.00 264.30 ? 176 THR B CG2 1 
ATOM   5390 N  N   . VAL B 2 158 ? 160.422 160.071 44.959  1.00 241.09 ? 177 VAL B N   1 
ATOM   5391 C  CA  . VAL B 2 158 ? 159.169 159.793 44.256  1.00 227.21 ? 177 VAL B CA  1 
ATOM   5392 C  C   . VAL B 2 158 ? 159.083 160.689 43.021  1.00 220.13 ? 177 VAL B C   1 
ATOM   5393 O  O   . VAL B 2 158 ? 158.898 161.906 43.143  1.00 205.37 ? 177 VAL B O   1 
ATOM   5394 C  CB  . VAL B 2 158 ? 157.951 159.992 45.167  1.00 205.13 ? 177 VAL B CB  1 
ATOM   5395 C  CG1 . VAL B 2 158 ? 156.669 159.662 44.417  1.00 190.60 ? 177 VAL B CG1 1 
ATOM   5396 C  CG2 . VAL B 2 158 ? 158.078 159.132 46.416  1.00 201.67 ? 177 VAL B CG2 1 
ATOM   5397 N  N   . THR B 2 159 ? 159.213 160.100 41.832  1.00 232.32 ? 178 THR B N   1 
ATOM   5398 C  CA  . THR B 2 159 ? 159.126 160.830 40.571  1.00 253.22 ? 178 THR B CA  1 
ATOM   5399 C  C   . THR B 2 159 ? 157.791 160.547 39.884  1.00 283.29 ? 178 THR B C   1 
ATOM   5400 O  O   . THR B 2 159 ? 157.076 159.602 40.230  1.00 272.49 ? 178 THR B O   1 
ATOM   5401 C  CB  . THR B 2 159 ? 160.289 160.456 39.644  1.00 246.50 ? 178 THR B CB  1 
ATOM   5402 O  OG1 . THR B 2 159 ? 160.212 159.063 39.315  1.00 241.88 ? 178 THR B OG1 1 
ATOM   5403 C  CG2 . THR B 2 159 ? 161.623 160.737 40.320  1.00 241.58 ? 178 THR B CG2 1 
ATOM   5404 N  N   . TRP B 2 160 ? 157.458 161.376 38.887  1.00 307.88 ? 179 TRP B N   1 
ATOM   5405 C  CA  . TRP B 2 160 ? 156.204 161.244 38.144  1.00 324.29 ? 179 TRP B CA  1 
ATOM   5406 C  C   . TRP B 2 160 ? 156.425 161.242 36.634  1.00 341.20 ? 179 TRP B C   1 
ATOM   5407 O  O   . TRP B 2 160 ? 156.724 162.287 36.046  1.00 336.05 ? 179 TRP B O   1 
ATOM   5408 C  CB  . TRP B 2 160 ? 155.231 162.362 38.523  1.00 314.19 ? 179 TRP B CB  1 
ATOM   5409 C  CG  . TRP B 2 160 ? 154.679 162.250 39.905  1.00 308.90 ? 179 TRP B CG  1 
ATOM   5410 C  CD1 . TRP B 2 160 ? 155.232 162.733 41.054  1.00 308.59 ? 179 TRP B CD1 1 
ATOM   5411 C  CD2 . TRP B 2 160 ? 153.448 161.623 40.284  1.00 306.01 ? 179 TRP B CD2 1 
ATOM   5412 N  NE1 . TRP B 2 160 ? 154.425 162.439 42.127  1.00 304.03 ? 179 TRP B NE1 1 
ATOM   5413 C  CE2 . TRP B 2 160 ? 153.323 161.758 41.680  1.00 301.38 ? 179 TRP B CE2 1 
ATOM   5414 C  CE3 . TRP B 2 160 ? 152.441 160.958 39.578  1.00 308.48 ? 179 TRP B CE3 1 
ATOM   5415 C  CZ2 . TRP B 2 160 ? 152.232 161.253 42.384  1.00 298.04 ? 179 TRP B CZ2 1 
ATOM   5416 C  CZ3 . TRP B 2 160 ? 151.360 160.457 40.278  1.00 306.54 ? 179 TRP B CZ3 1 
ATOM   5417 C  CH2 . TRP B 2 160 ? 151.263 160.607 41.666  1.00 299.82 ? 179 TRP B CH2 1 
ATOM   5418 N  N   . ASN B 2 161 ? 156.265 160.072 36.015  1.00 349.49 ? 180 ASN B N   1 
ATOM   5419 C  CA  . ASN B 2 161 ? 156.364 159.885 34.563  1.00 352.10 ? 180 ASN B CA  1 
ATOM   5420 C  C   . ASN B 2 161 ? 157.683 160.403 33.991  1.00 351.12 ? 180 ASN B C   1 
ATOM   5421 O  O   . ASN B 2 161 ? 157.708 161.164 33.021  1.00 357.47 ? 180 ASN B O   1 
ATOM   5422 C  CB  . ASN B 2 161 ? 155.178 160.543 33.853  1.00 346.02 ? 180 ASN B CB  1 
ATOM   5423 C  CG  . ASN B 2 161 ? 153.842 160.035 34.354  1.00 337.64 ? 180 ASN B CG  1 
ATOM   5424 O  OD1 . ASN B 2 161 ? 153.714 158.878 34.755  1.00 335.21 ? 180 ASN B OD1 1 
ATOM   5425 N  ND2 . ASN B 2 161 ? 152.835 160.901 34.333  1.00 334.00 ? 180 ASN B ND2 1 
ATOM   5426 N  N   . SER B 2 162 ? 158.791 159.974 34.596  1.00 347.44 ? 181 SER B N   1 
ATOM   5427 C  CA  . SER B 2 162 ? 160.132 160.362 34.148  1.00 339.99 ? 181 SER B CA  1 
ATOM   5428 C  C   . SER B 2 162 ? 160.289 161.882 34.114  1.00 329.56 ? 181 SER B C   1 
ATOM   5429 O  O   . SER B 2 162 ? 160.953 162.436 33.236  1.00 341.16 ? 181 SER B O   1 
ATOM   5430 C  CB  . SER B 2 162 ? 160.461 159.746 32.785  1.00 337.87 ? 181 SER B CB  1 
ATOM   5431 O  OG  . SER B 2 162 ? 161.768 160.097 32.367  1.00 339.32 ? 181 SER B OG  1 
ATOM   5432 N  N   . GLY B 2 163 ? 159.674 162.562 35.078  1.00 291.22 ? 182 GLY B N   1 
ATOM   5433 C  CA  . GLY B 2 163 ? 159.797 164.005 35.179  1.00 285.68 ? 182 GLY B CA  1 
ATOM   5434 C  C   . GLY B 2 163 ? 159.068 164.803 34.117  1.00 252.38 ? 182 GLY B C   1 
ATOM   5435 O  O   . GLY B 2 163 ? 159.550 165.868 33.718  1.00 250.85 ? 182 GLY B O   1 
ATOM   5436 N  N   . SER B 2 164 ? 157.918 164.323 33.648  1.00 274.74 ? 183 SER B N   1 
ATOM   5437 C  CA  . SER B 2 164 ? 157.137 165.046 32.642  1.00 273.10 ? 183 SER B CA  1 
ATOM   5438 C  C   . SER B 2 164 ? 155.676 164.595 32.642  1.00 264.26 ? 183 SER B C   1 
ATOM   5439 O  O   . SER B 2 164 ? 155.375 163.469 32.246  1.00 264.43 ? 183 SER B O   1 
ATOM   5440 C  CB  . SER B 2 164 ? 157.740 164.855 31.248  1.00 274.87 ? 183 SER B CB  1 
ATOM   5441 O  OG  . SER B 2 164 ? 157.736 163.489 30.870  1.00 279.73 ? 183 SER B OG  1 
ATOM   5442 N  N   . LEU B 2 165 ? 154.770 165.467 33.081  1.00 265.04 ? 184 LEU B N   1 
ATOM   5443 C  CA  . LEU B 2 165 ? 155.118 166.804 33.553  1.00 262.39 ? 184 LEU B CA  1 
ATOM   5444 C  C   . LEU B 2 165 ? 154.925 166.892 35.066  1.00 252.80 ? 184 LEU B C   1 
ATOM   5445 O  O   . LEU B 2 165 ? 154.212 166.081 35.656  1.00 250.60 ? 184 LEU B O   1 
ATOM   5446 C  CB  . LEU B 2 165 ? 154.291 167.869 32.823  1.00 261.99 ? 184 LEU B CB  1 
ATOM   5447 C  CG  . LEU B 2 165 ? 152.781 167.664 32.664  1.00 254.83 ? 184 LEU B CG  1 
ATOM   5448 C  CD1 . LEU B 2 165 ? 152.011 168.108 33.903  1.00 246.75 ? 184 LEU B CD1 1 
ATOM   5449 C  CD2 . LEU B 2 165 ? 152.275 168.391 31.425  1.00 249.46 ? 184 LEU B CD2 1 
ATOM   5450 N  N   . SER B 2 166 ? 155.563 167.887 35.685  1.00 257.83 ? 185 SER B N   1 
ATOM   5451 C  CA  . SER B 2 166 ? 155.513 168.081 37.133  1.00 250.90 ? 185 SER B CA  1 
ATOM   5452 C  C   . SER B 2 166 ? 155.428 169.568 37.487  1.00 248.93 ? 185 SER B C   1 
ATOM   5453 O  O   . SER B 2 166 ? 156.244 170.109 38.227  1.00 252.31 ? 185 SER B O   1 
ATOM   5454 C  CB  . SER B 2 166 ? 156.726 167.433 37.797  1.00 252.93 ? 185 SER B CB  1 
ATOM   5455 O  OG  . SER B 2 166 ? 157.932 167.962 37.276  1.00 258.80 ? 185 SER B OG  1 
ATOM   5456 N  N   . SER B 2 167 ? 154.423 170.257 36.949  1.00 239.45 ? 186 SER B N   1 
ATOM   5457 C  CA  . SER B 2 167 ? 154.255 171.685 37.184  1.00 241.12 ? 186 SER B CA  1 
ATOM   5458 C  C   . SER B 2 167 ? 153.273 171.985 38.312  1.00 246.00 ? 186 SER B C   1 
ATOM   5459 O  O   . SER B 2 167 ? 152.932 173.152 38.530  1.00 236.13 ? 186 SER B O   1 
ATOM   5460 C  CB  . SER B 2 167 ? 153.798 172.378 35.900  1.00 233.74 ? 186 SER B CB  1 
ATOM   5461 O  OG  . SER B 2 167 ? 152.551 171.866 35.459  1.00 223.32 ? 186 SER B OG  1 
ATOM   5462 N  N   . SER B 2 168 ? 152.803 170.953 39.027  1.00 252.48 ? 187 SER B N   1 
ATOM   5463 C  CA  . SER B 2 168 ? 151.845 171.152 40.111  1.00 256.51 ? 187 SER B CA  1 
ATOM   5464 C  C   . SER B 2 168 ? 151.979 170.091 41.202  1.00 251.37 ? 187 SER B C   1 
ATOM   5465 O  O   . SER B 2 168 ? 151.012 169.858 41.938  1.00 244.48 ? 187 SER B O   1 
ATOM   5466 C  CB  . SER B 2 168 ? 150.410 171.156 39.573  1.00 258.90 ? 187 SER B CB  1 
ATOM   5467 O  OG  . SER B 2 168 ? 150.204 172.220 38.660  1.00 266.13 ? 187 SER B OG  1 
ATOM   5468 N  N   . VAL B 2 169 ? 153.133 169.441 41.317  1.00 248.09 ? 188 VAL B N   1 
ATOM   5469 C  CA  . VAL B 2 169 ? 153.339 168.375 42.292  1.00 243.43 ? 188 VAL B CA  1 
ATOM   5470 C  C   . VAL B 2 169 ? 153.708 168.959 43.652  1.00 233.27 ? 188 VAL B C   1 
ATOM   5471 O  O   . VAL B 2 169 ? 154.640 169.763 43.766  1.00 241.93 ? 188 VAL B O   1 
ATOM   5472 C  CB  . VAL B 2 169 ? 154.431 167.411 41.802  1.00 234.97 ? 188 VAL B CB  1 
ATOM   5473 C  CG1 . VAL B 2 169 ? 154.754 166.372 42.866  1.00 242.71 ? 188 VAL B CG1 1 
ATOM   5474 C  CG2 . VAL B 2 169 ? 154.019 166.753 40.493  1.00 217.56 ? 188 VAL B CG2 1 
ATOM   5475 N  N   . HIS B 2 170 ? 152.933 168.549 44.660  1.00 213.52 ? 189 HIS B N   1 
ATOM   5476 C  CA  . HIS B 2 170 ? 153.225 168.916 46.045  1.00 212.33 ? 189 HIS B CA  1 
ATOM   5477 C  C   . HIS B 2 170 ? 153.744 167.710 46.825  1.00 223.65 ? 189 HIS B C   1 
ATOM   5478 O  O   . HIS B 2 170 ? 153.052 166.700 46.948  1.00 213.60 ? 189 HIS B O   1 
ATOM   5479 C  CB  . HIS B 2 170 ? 151.983 169.489 46.734  1.00 201.32 ? 189 HIS B CB  1 
ATOM   5480 C  CG  . HIS B 2 170 ? 151.461 170.742 46.102  1.00 193.29 ? 189 HIS B CG  1 
ATOM   5481 N  ND1 . HIS B 2 170 ? 151.808 171.999 46.548  1.00 174.79 ? 189 HIS B ND1 1 
ATOM   5482 C  CD2 . HIS B 2 170 ? 150.614 170.933 45.062  1.00 204.44 ? 189 HIS B CD2 1 
ATOM   5483 C  CE1 . HIS B 2 170 ? 151.201 172.910 45.809  1.00 188.20 ? 189 HIS B CE1 1 
ATOM   5484 N  NE2 . HIS B 2 170 ? 150.470 172.290 44.900  1.00 205.82 ? 189 HIS B NE2 1 
ATOM   5485 N  N   . THR B 2 171 ? 154.959 167.820 47.354  1.00 251.12 ? 190 THR B N   1 
ATOM   5486 C  CA  . THR B 2 171 ? 155.560 166.730 48.118  1.00 254.43 ? 190 THR B CA  1 
ATOM   5487 C  C   . THR B 2 171 ? 155.614 167.045 49.612  1.00 250.91 ? 190 THR B C   1 
ATOM   5488 O  O   . THR B 2 171 ? 156.110 168.097 50.016  1.00 241.86 ? 190 THR B O   1 
ATOM   5489 C  CB  . THR B 2 171 ? 156.984 166.416 47.619  1.00 274.42 ? 190 THR B CB  1 
ATOM   5490 O  OG1 . THR B 2 171 ? 156.937 166.044 46.236  1.00 281.52 ? 190 THR B OG1 1 
ATOM   5491 C  CG2 . THR B 2 171 ? 157.594 165.275 48.421  1.00 284.06 ? 190 THR B CG2 1 
ATOM   5492 N  N   . PHE B 2 172 ? 155.095 166.131 50.427  1.00 235.96 ? 191 PHE B N   1 
ATOM   5493 C  CA  . PHE B 2 172 ? 155.024 166.344 51.869  1.00 216.77 ? 191 PHE B CA  1 
ATOM   5494 C  C   . PHE B 2 172 ? 156.196 165.673 52.585  1.00 196.91 ? 191 PHE B C   1 
ATOM   5495 O  O   . PHE B 2 172 ? 156.535 164.527 52.284  1.00 179.71 ? 191 PHE B O   1 
ATOM   5496 C  CB  . PHE B 2 172 ? 153.696 165.825 52.421  1.00 203.38 ? 191 PHE B CB  1 
ATOM   5497 C  CG  . PHE B 2 172 ? 152.493 166.410 51.741  1.00 193.48 ? 191 PHE B CG  1 
ATOM   5498 C  CD1 . PHE B 2 172 ? 151.995 167.643 52.126  1.00 193.10 ? 191 PHE B CD1 1 
ATOM   5499 C  CD2 . PHE B 2 172 ? 151.857 165.726 50.719  1.00 186.50 ? 191 PHE B CD2 1 
ATOM   5500 C  CE1 . PHE B 2 172 ? 150.888 168.185 51.502  1.00 196.28 ? 191 PHE B CE1 1 
ATOM   5501 C  CE2 . PHE B 2 172 ? 150.750 166.263 50.091  1.00 195.82 ? 191 PHE B CE2 1 
ATOM   5502 C  CZ  . PHE B 2 172 ? 150.264 167.493 50.484  1.00 199.15 ? 191 PHE B CZ  1 
ATOM   5503 N  N   . PRO B 2 173 ? 156.791 166.390 53.540  1.00 171.23 ? 192 PRO B N   1 
ATOM   5504 C  CA  . PRO B 2 173 ? 157.945 165.874 54.289  1.00 177.88 ? 192 PRO B CA  1 
ATOM   5505 C  C   . PRO B 2 173 ? 157.634 164.582 55.033  1.00 181.00 ? 192 PRO B C   1 
ATOM   5506 O  O   . PRO B 2 173 ? 156.541 164.395 55.571  1.00 191.65 ? 192 PRO B O   1 
ATOM   5507 C  CB  . PRO B 2 173 ? 158.268 167.012 55.263  1.00 159.31 ? 192 PRO B CB  1 
ATOM   5508 C  CG  . PRO B 2 173 ? 157.724 168.233 54.608  1.00 128.68 ? 192 PRO B CG  1 
ATOM   5509 C  CD  . PRO B 2 173 ? 156.481 167.783 53.902  1.00 153.11 ? 192 PRO B CD  1 
ATOM   5510 N  N   . ALA B 2 174 ? 158.627 163.698 55.071  1.00 210.67 ? 193 ALA B N   1 
ATOM   5511 C  CA  . ALA B 2 174 ? 158.482 162.413 55.737  1.00 224.61 ? 193 ALA B CA  1 
ATOM   5512 C  C   . ALA B 2 174 ? 158.420 162.596 57.249  1.00 216.59 ? 193 ALA B C   1 
ATOM   5513 O  O   . ALA B 2 174 ? 159.043 163.498 57.816  1.00 223.79 ? 193 ALA B O   1 
ATOM   5514 C  CB  . ALA B 2 174 ? 159.639 161.486 55.369  1.00 230.72 ? 193 ALA B CB  1 
ATOM   5515 N  N   . LEU B 2 175 ? 157.650 161.731 57.901  1.00 176.70 ? 194 LEU B N   1 
ATOM   5516 C  CA  . LEU B 2 175 ? 157.516 161.736 59.350  1.00 184.75 ? 194 LEU B CA  1 
ATOM   5517 C  C   . LEU B 2 175 ? 158.031 160.421 59.915  1.00 194.20 ? 194 LEU B C   1 
ATOM   5518 O  O   . LEU B 2 175 ? 157.674 159.345 59.423  1.00 168.30 ? 194 LEU B O   1 
ATOM   5519 C  CB  . LEU B 2 175 ? 156.058 161.954 59.762  1.00 173.77 ? 194 LEU B CB  1 
ATOM   5520 C  CG  . LEU B 2 175 ? 155.428 163.270 59.305  1.00 169.71 ? 194 LEU B CG  1 
ATOM   5521 C  CD1 . LEU B 2 175 ? 153.985 163.363 59.780  1.00 184.24 ? 194 LEU B CD1 1 
ATOM   5522 C  CD2 . LEU B 2 175 ? 156.239 164.459 59.794  1.00 171.92 ? 194 LEU B CD2 1 
ATOM   5523 N  N   . LEU B 2 176 ? 158.877 160.515 60.939  1.00 237.25 ? 195 LEU B N   1 
ATOM   5524 C  CA  . LEU B 2 176 ? 159.495 159.348 61.553  1.00 257.97 ? 195 LEU B CA  1 
ATOM   5525 C  C   . LEU B 2 176 ? 158.642 158.879 62.725  1.00 272.59 ? 195 LEU B C   1 
ATOM   5526 O  O   . LEU B 2 176 ? 158.227 159.686 63.563  1.00 266.88 ? 195 LEU B O   1 
ATOM   5527 C  CB  . LEU B 2 176 ? 160.915 159.669 62.022  1.00 259.51 ? 195 LEU B CB  1 
ATOM   5528 C  CG  . LEU B 2 176 ? 161.697 158.530 62.681  1.00 264.43 ? 195 LEU B CG  1 
ATOM   5529 C  CD1 . LEU B 2 176 ? 161.834 157.348 61.735  1.00 267.28 ? 195 LEU B CD1 1 
ATOM   5530 C  CD2 . LEU B 2 176 ? 163.065 159.012 63.145  1.00 261.97 ? 195 LEU B CD2 1 
ATOM   5531 N  N   . GLN B 2 177 ? 158.380 157.575 62.776  1.00 282.92 ? 196 GLN B N   1 
ATOM   5532 C  CA  . GLN B 2 177 ? 157.587 156.990 63.849  1.00 284.82 ? 196 GLN B CA  1 
ATOM   5533 C  C   . GLN B 2 177 ? 157.925 155.510 63.959  1.00 273.43 ? 196 GLN B C   1 
ATOM   5534 O  O   . GLN B 2 177 ? 157.988 154.811 62.942  1.00 283.78 ? 196 GLN B O   1 
ATOM   5535 C  CB  . GLN B 2 177 ? 156.090 157.196 63.588  1.00 289.44 ? 196 GLN B CB  1 
ATOM   5536 C  CG  . GLN B 2 177 ? 155.640 156.764 62.199  1.00 293.50 ? 196 GLN B CG  1 
ATOM   5537 C  CD  . GLN B 2 177 ? 154.162 156.992 61.965  1.00 295.26 ? 196 GLN B CD  1 
ATOM   5538 O  OE1 . GLN B 2 177 ? 153.447 157.464 62.849  1.00 299.56 ? 196 GLN B OE1 1 
ATOM   5539 N  NE2 . GLN B 2 177 ? 153.695 156.661 60.767  1.00 289.04 ? 196 GLN B NE2 1 
ATOM   5540 N  N   . SER B 2 178 ? 158.153 155.047 65.190  1.00 258.82 ? 197 SER B N   1 
ATOM   5541 C  CA  . SER B 2 178 ? 158.507 153.651 65.467  1.00 247.87 ? 197 SER B CA  1 
ATOM   5542 C  C   . SER B 2 178 ? 159.708 153.202 64.639  1.00 242.63 ? 197 SER B C   1 
ATOM   5543 O  O   . SER B 2 178 ? 159.808 152.039 64.237  1.00 244.37 ? 197 SER B O   1 
ATOM   5544 C  CB  . SER B 2 178 ? 157.314 152.719 65.237  1.00 232.35 ? 197 SER B CB  1 
ATOM   5545 O  OG  . SER B 2 178 ? 156.976 152.643 63.863  1.00 223.73 ? 197 SER B OG  1 
ATOM   5546 N  N   . GLY B 2 179 ? 160.629 154.126 64.374  1.00 252.76 ? 198 GLY B N   1 
ATOM   5547 C  CA  . GLY B 2 179 ? 161.827 153.820 63.626  1.00 242.88 ? 198 GLY B CA  1 
ATOM   5548 C  C   . GLY B 2 179 ? 161.652 153.757 62.125  1.00 229.12 ? 198 GLY B C   1 
ATOM   5549 O  O   . GLY B 2 179 ? 162.614 153.423 61.423  1.00 240.33 ? 198 GLY B O   1 
ATOM   5550 N  N   . LEU B 2 180 ? 160.462 154.060 61.608  1.00 197.07 ? 199 LEU B N   1 
ATOM   5551 C  CA  . LEU B 2 180 ? 160.198 154.010 60.177  1.00 190.63 ? 199 LEU B CA  1 
ATOM   5552 C  C   . LEU B 2 180 ? 159.605 155.332 59.713  1.00 172.33 ? 199 LEU B C   1 
ATOM   5553 O  O   . LEU B 2 180 ? 158.823 155.957 60.434  1.00 139.84 ? 199 LEU B O   1 
ATOM   5554 C  CB  . LEU B 2 180 ? 159.247 152.858 59.826  1.00 170.62 ? 199 LEU B CB  1 
ATOM   5555 C  CG  . LEU B 2 180 ? 159.755 151.454 60.162  1.00 144.22 ? 199 LEU B CG  1 
ATOM   5556 C  CD1 . LEU B 2 180 ? 158.760 150.388 59.721  1.00 145.21 ? 199 LEU B CD1 1 
ATOM   5557 C  CD2 . LEU B 2 180 ? 161.122 151.215 59.551  1.00 156.25 ? 199 LEU B CD2 1 
ATOM   5558 N  N   . TYR B 2 181 ? 159.979 155.753 58.509  1.00 176.42 ? 200 TYR B N   1 
ATOM   5559 C  CA  . TYR B 2 181 ? 159.495 157.005 57.949  1.00 175.81 ? 200 TYR B CA  1 
ATOM   5560 C  C   . TYR B 2 181 ? 158.219 156.767 57.140  1.00 195.61 ? 200 TYR B C   1 
ATOM   5561 O  O   . TYR B 2 181 ? 157.939 155.654 56.688  1.00 176.64 ? 200 TYR B O   1 
ATOM   5562 C  CB  . TYR B 2 181 ? 160.574 157.646 57.075  1.00 181.19 ? 200 TYR B CB  1 
ATOM   5563 C  CG  . TYR B 2 181 ? 161.791 158.113 57.846  1.00 177.49 ? 200 TYR B CG  1 
ATOM   5564 C  CD1 . TYR B 2 181 ? 162.853 157.250 58.088  1.00 193.31 ? 200 TYR B CD1 1 
ATOM   5565 C  CD2 . TYR B 2 181 ? 161.882 159.412 58.328  1.00 180.23 ? 200 TYR B CD2 1 
ATOM   5566 C  CE1 . TYR B 2 181 ? 163.970 157.667 58.790  1.00 198.05 ? 200 TYR B CE1 1 
ATOM   5567 C  CE2 . TYR B 2 181 ? 162.996 159.838 59.031  1.00 188.34 ? 200 TYR B CE2 1 
ATOM   5568 C  CZ  . TYR B 2 181 ? 164.037 158.961 59.259  1.00 190.66 ? 200 TYR B CZ  1 
ATOM   5569 O  OH  . TYR B 2 181 ? 165.148 159.377 59.958  1.00 180.44 ? 200 TYR B OH  1 
ATOM   5570 N  N   . THR B 2 182 ? 157.445 157.838 56.955  1.00 187.34 ? 201 THR B N   1 
ATOM   5571 C  CA  . THR B 2 182 ? 156.208 157.774 56.176  1.00 182.00 ? 201 THR B CA  1 
ATOM   5572 C  C   . THR B 2 182 ? 155.930 159.129 55.541  1.00 167.43 ? 201 THR B C   1 
ATOM   5573 O  O   . THR B 2 182 ? 155.869 160.139 56.248  1.00 149.25 ? 201 THR B O   1 
ATOM   5574 C  CB  . THR B 2 182 ? 155.027 157.344 57.050  1.00 161.55 ? 201 THR B CB  1 
ATOM   5575 O  OG1 . THR B 2 182 ? 155.272 156.036 57.583  1.00 175.73 ? 201 THR B OG1 1 
ATOM   5576 C  CG2 . THR B 2 182 ? 153.742 157.323 56.235  1.00 148.04 ? 201 THR B CG2 1 
ATOM   5577 N  N   . MET B 2 183 ? 155.767 159.152 54.216  1.00 181.90 ? 202 MET B N   1 
ATOM   5578 C  CA  . MET B 2 183 ? 155.539 160.391 53.482  1.00 187.35 ? 202 MET B CA  1 
ATOM   5579 C  C   . MET B 2 183 ? 154.480 160.173 52.405  1.00 196.42 ? 202 MET B C   1 
ATOM   5580 O  O   . MET B 2 183 ? 154.017 159.051 52.173  1.00 195.80 ? 202 MET B O   1 
ATOM   5581 C  CB  . MET B 2 183 ? 156.843 160.917 52.866  1.00 187.83 ? 202 MET B CB  1 
ATOM   5582 C  CG  . MET B 2 183 ? 157.528 159.946 51.913  1.00 186.22 ? 202 MET B CG  1 
ATOM   5583 S  SD  . MET B 2 183 ? 156.905 160.027 50.224  1.00 176.35 ? 202 MET B SD  1 
ATOM   5584 C  CE  . MET B 2 183 ? 157.186 161.756 49.853  1.00 178.71 ? 202 MET B CE  1 
ATOM   5585 N  N   . SER B 2 184 ? 154.105 161.266 51.736  1.00 225.29 ? 203 SER B N   1 
ATOM   5586 C  CA  . SER B 2 184 ? 153.085 161.228 50.694  1.00 262.11 ? 203 SER B CA  1 
ATOM   5587 C  C   . SER B 2 184 ? 153.343 162.327 49.667  1.00 298.69 ? 203 SER B C   1 
ATOM   5588 O  O   . SER B 2 184 ? 154.012 163.327 49.952  1.00 292.21 ? 203 SER B O   1 
ATOM   5589 C  CB  . SER B 2 184 ? 151.681 161.373 51.290  1.00 255.39 ? 203 SER B CB  1 
ATOM   5590 O  OG  . SER B 2 184 ? 151.559 162.587 52.013  1.00 248.28 ? 203 SER B OG  1 
ATOM   5591 N  N   . SER B 2 185 ? 152.792 162.132 48.463  1.00 337.64 ? 204 SER B N   1 
ATOM   5592 C  CA  . SER B 2 185 ? 152.944 163.084 47.367  1.00 345.91 ? 204 SER B CA  1 
ATOM   5593 C  C   . SER B 2 185 ? 151.630 163.244 46.607  1.00 333.53 ? 204 SER B C   1 
ATOM   5594 O  O   . SER B 2 185 ? 150.802 162.329 46.570  1.00 341.88 ? 204 SER B O   1 
ATOM   5595 C  CB  . SER B 2 185 ? 154.053 162.649 46.399  1.00 359.89 ? 204 SER B CB  1 
ATOM   5596 O  OG  . SER B 2 185 ? 154.149 163.540 45.301  1.00 366.35 ? 204 SER B OG  1 
ATOM   5597 N  N   . SER B 2 186 ? 151.457 164.414 45.984  1.00 266.84 ? 205 SER B N   1 
ATOM   5598 C  CA  . SER B 2 186 ? 150.253 164.737 45.223  1.00 236.89 ? 205 SER B CA  1 
ATOM   5599 C  C   . SER B 2 186 ? 150.634 165.518 43.970  1.00 219.24 ? 205 SER B C   1 
ATOM   5600 O  O   . SER B 2 186 ? 151.733 166.068 43.871  1.00 225.86 ? 205 SER B O   1 
ATOM   5601 C  CB  . SER B 2 186 ? 149.256 165.554 46.054  1.00 193.03 ? 205 SER B CB  1 
ATOM   5602 O  OG  . SER B 2 186 ? 149.828 166.786 46.460  1.00 169.59 ? 205 SER B OG  1 
ATOM   5603 N  N   . VAL B 2 187 ? 149.705 165.579 43.015  1.00 236.36 ? 206 VAL B N   1 
ATOM   5604 C  CA  . VAL B 2 187 ? 149.933 166.288 41.755  1.00 244.63 ? 206 VAL B CA  1 
ATOM   5605 C  C   . VAL B 2 187 ? 148.599 166.772 41.195  1.00 234.57 ? 206 VAL B C   1 
ATOM   5606 O  O   . VAL B 2 187 ? 147.652 165.993 41.063  1.00 227.34 ? 206 VAL B O   1 
ATOM   5607 C  CB  . VAL B 2 187 ? 150.671 165.398 40.733  1.00 253.14 ? 206 VAL B CB  1 
ATOM   5608 C  CG1 . VAL B 2 187 ? 150.017 164.023 40.639  1.00 245.58 ? 206 VAL B CG1 1 
ATOM   5609 C  CG2 . VAL B 2 187 ? 150.710 166.073 39.369  1.00 262.09 ? 206 VAL B CG2 1 
ATOM   5610 N  N   . THR B 2 188 ? 148.526 168.061 40.863  1.00 238.89 ? 207 THR B N   1 
ATOM   5611 C  CA  . THR B 2 188 ? 147.311 168.687 40.334  1.00 245.75 ? 207 THR B CA  1 
ATOM   5612 C  C   . THR B 2 188 ? 147.389 168.743 38.808  1.00 264.80 ? 207 THR B C   1 
ATOM   5613 O  O   . THR B 2 188 ? 148.082 169.592 38.244  1.00 269.95 ? 207 THR B O   1 
ATOM   5614 C  CB  . THR B 2 188 ? 147.121 170.079 40.928  1.00 238.10 ? 207 THR B CB  1 
ATOM   5615 O  OG1 . THR B 2 188 ? 147.109 169.993 42.359  1.00 229.57 ? 207 THR B OG1 1 
ATOM   5616 C  CG2 . THR B 2 188 ? 145.809 170.688 40.451  1.00 238.34 ? 207 THR B CG2 1 
ATOM   5617 N  N   . VAL B 2 189 ? 146.672 167.845 38.136  1.00 282.30 ? 208 VAL B N   1 
ATOM   5618 C  CA  . VAL B 2 189 ? 146.692 167.808 36.673  1.00 292.97 ? 208 VAL B CA  1 
ATOM   5619 C  C   . VAL B 2 189 ? 145.317 168.171 36.121  1.00 288.51 ? 208 VAL B C   1 
ATOM   5620 O  O   . VAL B 2 189 ? 144.298 167.840 36.740  1.00 286.50 ? 208 VAL B O   1 
ATOM   5621 C  CB  . VAL B 2 189 ? 147.144 166.433 36.153  1.00 300.76 ? 208 VAL B CB  1 
ATOM   5622 C  CG1 . VAL B 2 189 ? 148.616 166.212 36.449  1.00 302.94 ? 208 VAL B CG1 1 
ATOM   5623 C  CG2 . VAL B 2 189 ? 146.300 165.327 36.767  1.00 300.10 ? 208 VAL B CG2 1 
ATOM   5624 N  N   . PRO B 2 190 ? 145.239 168.845 34.973  1.00 280.63 ? 209 PRO B N   1 
ATOM   5625 C  CA  . PRO B 2 190 ? 143.934 169.220 34.407  1.00 266.08 ? 209 PRO B CA  1 
ATOM   5626 C  C   . PRO B 2 190 ? 143.086 167.999 34.079  1.00 236.55 ? 209 PRO B C   1 
ATOM   5627 O  O   . PRO B 2 190 ? 143.551 166.858 34.067  1.00 240.22 ? 209 PRO B O   1 
ATOM   5628 C  CB  . PRO B 2 190 ? 144.304 170.004 33.143  1.00 267.90 ? 209 PRO B CB  1 
ATOM   5629 C  CG  . PRO B 2 190 ? 145.691 169.555 32.808  1.00 277.07 ? 209 PRO B CG  1 
ATOM   5630 C  CD  . PRO B 2 190 ? 146.355 169.302 34.128  1.00 284.47 ? 209 PRO B CD  1 
ATOM   5631 N  N   . SER B 2 191 ? 141.806 168.255 33.806  1.00 213.14 ? 210 SER B N   1 
ATOM   5632 C  CA  . SER B 2 191 ? 140.866 167.178 33.518  1.00 215.67 ? 210 SER B CA  1 
ATOM   5633 C  C   . SER B 2 191 ? 140.910 166.733 32.063  1.00 220.32 ? 210 SER B C   1 
ATOM   5634 O  O   . SER B 2 191 ? 140.102 165.886 31.664  1.00 201.36 ? 210 SER B O   1 
ATOM   5635 C  CB  . SER B 2 191 ? 139.441 167.608 33.879  1.00 179.73 ? 210 SER B CB  1 
ATOM   5636 O  OG  . SER B 2 191 ? 139.342 167.965 35.246  1.00 161.27 ? 210 SER B OG  1 
ATOM   5637 N  N   . SER B 2 192 ? 141.826 167.282 31.268  1.00 272.18 ? 211 SER B N   1 
ATOM   5638 C  CA  . SER B 2 192 ? 141.977 166.942 29.861  1.00 298.30 ? 211 SER B CA  1 
ATOM   5639 C  C   . SER B 2 192 ? 143.161 166.012 29.631  1.00 303.93 ? 211 SER B C   1 
ATOM   5640 O  O   . SER B 2 192 ? 143.592 165.834 28.488  1.00 307.84 ? 211 SER B O   1 
ATOM   5641 C  CB  . SER B 2 192 ? 142.131 168.211 29.022  1.00 305.56 ? 211 SER B CB  1 
ATOM   5642 O  OG  . SER B 2 192 ? 143.262 168.959 29.432  1.00 305.51 ? 211 SER B OG  1 
ATOM   5643 N  N   . THR B 2 193 ? 143.691 165.419 30.704  1.00 308.43 ? 212 THR B N   1 
ATOM   5644 C  CA  . THR B 2 193 ? 144.823 164.506 30.631  1.00 307.97 ? 212 THR B CA  1 
ATOM   5645 C  C   . THR B 2 193 ? 144.633 163.303 31.548  1.00 307.43 ? 212 THR B C   1 
ATOM   5646 O  O   . THR B 2 193 ? 145.555 162.487 31.675  1.00 305.45 ? 212 THR B O   1 
ATOM   5647 C  CB  . THR B 2 193 ? 146.134 165.226 30.979  1.00 300.25 ? 212 THR B CB  1 
ATOM   5648 O  OG1 . THR B 2 193 ? 147.237 164.326 30.810  1.00 303.94 ? 212 THR B OG1 1 
ATOM   5649 C  CG2 . THR B 2 193 ? 146.107 165.718 32.418  1.00 291.55 ? 212 THR B CG2 1 
ATOM   5650 N  N   . TRP B 2 194 ? 143.474 163.172 32.186  1.00 300.87 ? 213 TRP B N   1 
ATOM   5651 C  CA  . TRP B 2 194 ? 143.183 162.075 33.101  1.00 281.71 ? 213 TRP B CA  1 
ATOM   5652 C  C   . TRP B 2 194 ? 141.723 161.652 32.995  1.00 249.93 ? 213 TRP B C   1 
ATOM   5653 O  O   . TRP B 2 194 ? 140.828 162.497 32.953  1.00 240.71 ? 213 TRP B O   1 
ATOM   5654 C  CB  . TRP B 2 194 ? 143.498 162.489 34.541  1.00 273.70 ? 213 TRP B CB  1 
ATOM   5655 C  CG  . TRP B 2 194 ? 143.302 161.395 35.543  1.00 262.08 ? 213 TRP B CG  1 
ATOM   5656 C  CD1 . TRP B 2 194 ? 144.216 160.461 35.933  1.00 253.13 ? 213 TRP B CD1 1 
ATOM   5657 C  CD2 . TRP B 2 194 ? 142.105 161.120 36.280  1.00 255.88 ? 213 TRP B CD2 1 
ATOM   5658 N  NE1 . TRP B 2 194 ? 143.662 159.622 36.871  1.00 244.09 ? 213 TRP B NE1 1 
ATOM   5659 C  CE2 . TRP B 2 194 ? 142.367 160.006 37.101  1.00 244.13 ? 213 TRP B CE2 1 
ATOM   5660 C  CE3 . TRP B 2 194 ? 140.836 161.709 36.326  1.00 257.85 ? 213 TRP B CE3 1 
ATOM   5661 C  CZ2 . TRP B 2 194 ? 141.409 159.471 37.959  1.00 239.54 ? 213 TRP B CZ2 1 
ATOM   5662 C  CZ3 . TRP B 2 194 ? 139.887 161.175 37.177  1.00 250.29 ? 213 TRP B CZ3 1 
ATOM   5663 C  CH2 . TRP B 2 194 ? 140.178 160.067 37.981  1.00 240.75 ? 213 TRP B CH2 1 
ATOM   5664 N  N   . PRO B 2 195 ? 141.478 160.332 32.951  1.00 226.34 ? 214 PRO B N   1 
ATOM   5665 C  CA  . PRO B 2 195 ? 142.486 159.264 32.965  1.00 220.24 ? 214 PRO B CA  1 
ATOM   5666 C  C   . PRO B 2 195 ? 142.915 158.829 31.565  1.00 236.82 ? 214 PRO B C   1 
ATOM   5667 O  O   . PRO B 2 195 ? 143.197 157.652 31.340  1.00 231.02 ? 214 PRO B O   1 
ATOM   5668 C  CB  . PRO B 2 195 ? 141.761 158.130 33.684  1.00 208.24 ? 214 PRO B CB  1 
ATOM   5669 C  CG  . PRO B 2 195 ? 140.342 158.294 33.243  1.00 208.22 ? 214 PRO B CG  1 
ATOM   5670 C  CD  . PRO B 2 195 ? 140.113 159.783 33.057  1.00 210.46 ? 214 PRO B CD  1 
ATOM   5671 N  N   . SER B 2 196 ? 142.951 159.789 30.639  1.00 237.89 ? 215 SER B N   1 
ATOM   5672 C  CA  . SER B 2 196 ? 143.279 159.496 29.247  1.00 257.70 ? 215 SER B CA  1 
ATOM   5673 C  C   . SER B 2 196 ? 144.685 158.919 29.099  1.00 278.48 ? 215 SER B C   1 
ATOM   5674 O  O   . SER B 2 196 ? 144.857 157.784 28.638  1.00 283.19 ? 215 SER B O   1 
ATOM   5675 C  CB  . SER B 2 196 ? 143.124 160.762 28.401  1.00 250.95 ? 215 SER B CB  1 
ATOM   5676 O  OG  . SER B 2 196 ? 143.972 161.796 28.869  1.00 240.83 ? 215 SER B OG  1 
ATOM   5677 N  N   . GLN B 2 197 ? 145.706 159.681 29.486  1.00 301.16 ? 216 GLN B N   1 
ATOM   5678 C  CA  . GLN B 2 197 ? 147.084 159.224 29.339  1.00 316.02 ? 216 GLN B CA  1 
ATOM   5679 C  C   . GLN B 2 197 ? 147.504 158.332 30.509  1.00 317.80 ? 216 GLN B C   1 
ATOM   5680 O  O   . GLN B 2 197 ? 146.697 157.936 31.354  1.00 316.45 ? 216 GLN B O   1 
ATOM   5681 C  CB  . GLN B 2 197 ? 148.020 160.420 29.186  1.00 316.49 ? 216 GLN B CB  1 
ATOM   5682 C  CG  . GLN B 2 197 ? 147.752 161.272 27.954  1.00 316.06 ? 216 GLN B CG  1 
ATOM   5683 C  CD  . GLN B 2 197 ? 148.735 162.418 27.811  1.00 310.53 ? 216 GLN B CD  1 
ATOM   5684 O  OE1 . GLN B 2 197 ? 149.636 162.586 28.634  1.00 305.18 ? 216 GLN B OE1 1 
ATOM   5685 N  NE2 . GLN B 2 197 ? 148.568 163.214 26.761  1.00 312.00 ? 216 GLN B NE2 1 
ATOM   5686 N  N   . THR B 2 198 ? 148.798 158.006 30.554  1.00 326.00 ? 217 THR B N   1 
ATOM   5687 C  CA  . THR B 2 198 ? 149.377 157.131 31.569  1.00 316.26 ? 217 THR B CA  1 
ATOM   5688 C  C   . THR B 2 198 ? 150.153 157.964 32.584  1.00 307.01 ? 217 THR B C   1 
ATOM   5689 O  O   . THR B 2 198 ? 151.161 158.591 32.241  1.00 312.97 ? 217 THR B O   1 
ATOM   5690 C  CB  . THR B 2 198 ? 150.286 156.091 30.915  1.00 311.11 ? 217 THR B CB  1 
ATOM   5691 O  OG1 . THR B 2 198 ? 149.513 155.248 30.050  1.00 313.33 ? 217 THR B OG1 1 
ATOM   5692 C  CG2 . THR B 2 198 ? 150.994 155.247 31.966  1.00 309.12 ? 217 THR B CG2 1 
ATOM   5693 N  N   . VAL B 2 199 ? 149.683 157.972 33.828  1.00 308.44 ? 218 VAL B N   1 
ATOM   5694 C  CA  . VAL B 2 199 ? 150.340 158.672 34.927  1.00 323.89 ? 218 VAL B CA  1 
ATOM   5695 C  C   . VAL B 2 199 ? 150.761 157.631 35.956  1.00 367.34 ? 218 VAL B C   1 
ATOM   5696 O  O   . VAL B 2 199 ? 149.906 157.007 36.598  1.00 361.66 ? 218 VAL B O   1 
ATOM   5697 C  CB  . VAL B 2 199 ? 149.433 159.736 35.557  1.00 270.28 ? 218 VAL B CB  1 
ATOM   5698 C  CG1 . VAL B 2 199 ? 150.159 160.447 36.686  1.00 239.81 ? 218 VAL B CG1 1 
ATOM   5699 C  CG2 . VAL B 2 199 ? 148.973 160.730 34.503  1.00 258.25 ? 218 VAL B CG2 1 
ATOM   5700 N  N   . THR B 2 200 ? 152.070 157.440 36.120  1.00 455.20 ? 219 THR B N   1 
ATOM   5701 C  CA  . THR B 2 200 ? 152.600 156.422 37.019  1.00 465.83 ? 219 THR B CA  1 
ATOM   5702 C  C   . THR B 2 200 ? 153.620 157.048 37.960  1.00 456.42 ? 219 THR B C   1 
ATOM   5703 O  O   . THR B 2 200 ? 154.547 157.728 37.507  1.00 462.15 ? 219 THR B O   1 
ATOM   5704 C  CB  . THR B 2 200 ? 153.249 155.278 36.229  1.00 485.36 ? 219 THR B CB  1 
ATOM   5705 O  OG1 . THR B 2 200 ? 152.276 154.677 35.365  1.00 495.65 ? 219 THR B OG1 1 
ATOM   5706 C  CG2 . THR B 2 200 ? 153.806 154.223 37.171  1.00 493.08 ? 219 THR B CG2 1 
ATOM   5707 N  N   . CYS B 2 201 ? 153.447 156.824 39.263  1.00 395.99 ? 220 CYS B N   1 
ATOM   5708 C  CA  . CYS B 2 201 ? 154.382 157.326 40.263  1.00 327.31 ? 220 CYS B CA  1 
ATOM   5709 C  C   . CYS B 2 201 ? 155.460 156.287 40.560  1.00 279.83 ? 220 CYS B C   1 
ATOM   5710 O  O   . CYS B 2 201 ? 155.170 155.094 40.703  1.00 276.82 ? 220 CYS B O   1 
ATOM   5711 C  CB  . CYS B 2 201 ? 153.649 157.724 41.548  1.00 290.88 ? 220 CYS B CB  1 
ATOM   5712 S  SG  . CYS B 2 201 ? 152.899 156.380 42.501  1.00 276.41 ? 220 CYS B SG  1 
ATOM   5713 N  N   . SER B 2 202 ? 156.707 156.749 40.636  1.00 241.09 ? 221 SER B N   1 
ATOM   5714 C  CA  . SER B 2 202 ? 157.863 155.904 40.917  1.00 215.98 ? 221 SER B CA  1 
ATOM   5715 C  C   . SER B 2 202 ? 158.414 156.217 42.303  1.00 200.16 ? 221 SER B C   1 
ATOM   5716 O  O   . SER B 2 202 ? 158.648 157.385 42.630  1.00 199.13 ? 221 SER B O   1 
ATOM   5717 C  CB  . SER B 2 202 ? 158.956 156.099 39.865  1.00 204.98 ? 221 SER B CB  1 
ATOM   5718 O  OG  . SER B 2 202 ? 160.145 155.422 40.237  1.00 191.32 ? 221 SER B OG  1 
ATOM   5719 N  N   . VAL B 2 203 ? 158.606 155.182 43.118  1.00 211.33 ? 222 VAL B N   1 
ATOM   5720 C  CA  . VAL B 2 203 ? 159.155 155.329 44.463  1.00 202.04 ? 222 VAL B CA  1 
ATOM   5721 C  C   . VAL B 2 203 ? 160.463 154.550 44.537  1.00 211.43 ? 222 VAL B C   1 
ATOM   5722 O  O   . VAL B 2 203 ? 160.468 153.316 44.433  1.00 216.48 ? 222 VAL B O   1 
ATOM   5723 C  CB  . VAL B 2 203 ? 158.173 154.859 45.541  1.00 191.43 ? 222 VAL B CB  1 
ATOM   5724 C  CG1 . VAL B 2 203 ? 158.805 154.978 46.918  1.00 188.97 ? 222 VAL B CG1 1 
ATOM   5725 C  CG2 . VAL B 2 203 ? 156.890 155.670 45.469  1.00 182.97 ? 222 VAL B CG2 1 
ATOM   5726 N  N   . ALA B 2 204 ? 161.568 155.265 44.726  1.00 221.76 ? 223 ALA B N   1 
ATOM   5727 C  CA  . ALA B 2 204 ? 162.901 154.685 44.797  1.00 218.99 ? 223 ALA B CA  1 
ATOM   5728 C  C   . ALA B 2 204 ? 163.439 154.793 46.218  1.00 219.71 ? 223 ALA B C   1 
ATOM   5729 O  O   . ALA B 2 204 ? 163.247 155.813 46.890  1.00 207.04 ? 223 ALA B O   1 
ATOM   5730 C  CB  . ALA B 2 204 ? 163.858 155.376 43.822  1.00 219.61 ? 223 ALA B CB  1 
ATOM   5731 N  N   . HIS B 2 205 ? 164.121 153.738 46.667  1.00 213.20 ? 224 HIS B N   1 
ATOM   5732 C  CA  . HIS B 2 205 ? 164.734 153.689 47.993  1.00 204.17 ? 224 HIS B CA  1 
ATOM   5733 C  C   . HIS B 2 205 ? 166.194 153.283 47.846  1.00 209.55 ? 224 HIS B C   1 
ATOM   5734 O  O   . HIS B 2 205 ? 166.513 152.088 47.728  1.00 210.87 ? 224 HIS B O   1 
ATOM   5735 C  CB  . HIS B 2 205 ? 163.982 152.732 48.916  1.00 185.15 ? 224 HIS B CB  1 
ATOM   5736 C  CG  . HIS B 2 205 ? 164.223 152.981 50.373  1.00 188.71 ? 224 HIS B CG  1 
ATOM   5737 N  ND1 . HIS B 2 205 ? 165.210 152.334 51.087  1.00 202.05 ? 224 HIS B ND1 1 
ATOM   5738 C  CD2 . HIS B 2 205 ? 163.606 153.807 51.250  1.00 178.13 ? 224 HIS B CD2 1 
ATOM   5739 C  CE1 . HIS B 2 205 ? 165.188 152.749 52.341  1.00 196.84 ? 224 HIS B CE1 1 
ATOM   5740 N  NE2 . HIS B 2 205 ? 164.224 153.644 52.466  1.00 180.05 ? 224 HIS B NE2 1 
ATOM   5741 N  N   . PRO B 2 206 ? 167.103 154.264 47.776  1.00 212.53 ? 225 PRO B N   1 
ATOM   5742 C  CA  . PRO B 2 206 ? 168.529 153.950 47.576  1.00 218.47 ? 225 PRO B CA  1 
ATOM   5743 C  C   . PRO B 2 206 ? 169.152 153.178 48.725  1.00 218.14 ? 225 PRO B C   1 
ATOM   5744 O  O   . PRO B 2 206 ? 170.112 152.428 48.504  1.00 232.84 ? 225 PRO B O   1 
ATOM   5745 C  CB  . PRO B 2 206 ? 169.172 155.336 47.419  1.00 214.11 ? 225 PRO B CB  1 
ATOM   5746 C  CG  . PRO B 2 206 ? 168.227 156.271 48.103  1.00 201.58 ? 225 PRO B CG  1 
ATOM   5747 C  CD  . PRO B 2 206 ? 166.862 155.715 47.832  1.00 205.00 ? 225 PRO B CD  1 
ATOM   5748 N  N   . ALA B 2 207 ? 168.641 153.344 49.948  1.00 206.83 ? 226 ALA B N   1 
ATOM   5749 C  CA  . ALA B 2 207 ? 169.200 152.622 51.087  1.00 205.82 ? 226 ALA B CA  1 
ATOM   5750 C  C   . ALA B 2 207 ? 168.937 151.130 50.961  1.00 202.88 ? 226 ALA B C   1 
ATOM   5751 O  O   . ALA B 2 207 ? 169.805 150.310 51.280  1.00 208.75 ? 226 ALA B O   1 
ATOM   5752 C  CB  . ALA B 2 207 ? 168.624 153.167 52.391  1.00 206.79 ? 226 ALA B CB  1 
ATOM   5753 N  N   . SER B 2 208 ? 167.742 150.760 50.512  1.00 193.00 ? 227 SER B N   1 
ATOM   5754 C  CA  . SER B 2 208 ? 167.394 149.366 50.296  1.00 192.25 ? 227 SER B CA  1 
ATOM   5755 C  C   . SER B 2 208 ? 167.483 148.996 48.824  1.00 201.88 ? 227 SER B C   1 
ATOM   5756 O  O   . SER B 2 208 ? 167.289 147.826 48.477  1.00 199.57 ? 227 SER B O   1 
ATOM   5757 C  CB  . SER B 2 208 ? 165.989 149.074 50.836  1.00 181.24 ? 227 SER B CB  1 
ATOM   5758 O  OG  . SER B 2 208 ? 165.012 149.872 50.193  1.00 172.42 ? 227 SER B OG  1 
ATOM   5759 N  N   . SER B 2 209 ? 167.785 149.971 47.961  1.00 207.76 ? 228 SER B N   1 
ATOM   5760 C  CA  . SER B 2 209 ? 167.892 149.772 46.515  1.00 221.77 ? 228 SER B CA  1 
ATOM   5761 C  C   . SER B 2 209 ? 166.626 149.151 45.931  1.00 211.96 ? 228 SER B C   1 
ATOM   5762 O  O   . SER B 2 209 ? 166.683 148.225 45.119  1.00 212.98 ? 228 SER B O   1 
ATOM   5763 C  CB  . SER B 2 209 ? 169.121 148.928 46.169  1.00 240.57 ? 228 SER B CB  1 
ATOM   5764 O  OG  . SER B 2 209 ? 170.313 149.542 46.631  1.00 247.45 ? 228 SER B OG  1 
ATOM   5765 N  N   . THR B 2 210 ? 165.466 149.658 46.343  1.00 208.62 ? 229 THR B N   1 
ATOM   5766 C  CA  . THR B 2 210 ? 164.196 149.102 45.884  1.00 219.56 ? 229 THR B CA  1 
ATOM   5767 C  C   . THR B 2 210 ? 163.373 150.183 45.200  1.00 222.66 ? 229 THR B C   1 
ATOM   5768 O  O   . THR B 2 210 ? 163.044 151.201 45.817  1.00 206.97 ? 229 THR B O   1 
ATOM   5769 C  CB  . THR B 2 210 ? 163.407 148.493 47.046  1.00 226.29 ? 229 THR B CB  1 
ATOM   5770 O  OG1 . THR B 2 210 ? 163.168 149.495 48.044  1.00 220.15 ? 229 THR B OG1 1 
ATOM   5771 C  CG2 . THR B 2 210 ? 164.172 147.333 47.666  1.00 236.18 ? 229 THR B CG2 1 
ATOM   5772 N  N   . THR B 2 211 ? 163.027 149.950 43.933  1.00 240.63 ? 230 THR B N   1 
ATOM   5773 C  CA  . THR B 2 211 ? 162.249 150.891 43.131  1.00 245.98 ? 230 THR B CA  1 
ATOM   5774 C  C   . THR B 2 211 ? 160.921 150.246 42.752  1.00 255.82 ? 230 THR B C   1 
ATOM   5775 O  O   . THR B 2 211 ? 160.883 149.346 41.905  1.00 257.24 ? 230 THR B O   1 
ATOM   5776 C  CB  . THR B 2 211 ? 163.021 151.313 41.880  1.00 251.94 ? 230 THR B CB  1 
ATOM   5777 O  OG1 . THR B 2 211 ? 164.276 151.891 42.262  1.00 256.53 ? 230 THR B OG1 1 
ATOM   5778 C  CG2 . THR B 2 211 ? 162.222 152.331 41.081  1.00 247.34 ? 230 THR B CG2 1 
ATOM   5779 N  N   . VAL B 2 212 ? 159.835 150.706 43.371  1.00 243.92 ? 231 VAL B N   1 
ATOM   5780 C  CA  . VAL B 2 212 ? 158.489 150.213 43.096  1.00 232.29 ? 231 VAL B CA  1 
ATOM   5781 C  C   . VAL B 2 212 ? 157.720 151.298 42.356  1.00 235.44 ? 231 VAL B C   1 
ATOM   5782 O  O   . VAL B 2 212 ? 157.662 152.447 42.813  1.00 217.33 ? 231 VAL B O   1 
ATOM   5783 C  CB  . VAL B 2 212 ? 157.761 149.806 44.389  1.00 198.97 ? 231 VAL B CB  1 
ATOM   5784 C  CG1 . VAL B 2 212 ? 156.359 149.311 44.074  1.00 186.66 ? 231 VAL B CG1 1 
ATOM   5785 C  CG2 . VAL B 2 212 ? 158.552 148.738 45.127  1.00 195.00 ? 231 VAL B CG2 1 
ATOM   5786 N  N   . ASP B 2 213 ? 157.133 150.939 41.217  1.00 251.64 ? 232 ASP B N   1 
ATOM   5787 C  CA  . ASP B 2 213 ? 156.357 151.867 40.404  1.00 259.20 ? 232 ASP B CA  1 
ATOM   5788 C  C   . ASP B 2 213 ? 154.890 151.456 40.429  1.00 282.27 ? 232 ASP B C   1 
ATOM   5789 O  O   . ASP B 2 213 ? 154.569 150.283 40.210  1.00 286.03 ? 232 ASP B O   1 
ATOM   5790 C  CB  . ASP B 2 213 ? 156.875 151.892 38.964  1.00 246.22 ? 232 ASP B CB  1 
ATOM   5791 C  CG  . ASP B 2 213 ? 158.363 152.182 38.885  1.00 232.22 ? 232 ASP B CG  1 
ATOM   5792 O  OD1 . ASP B 2 213 ? 158.893 152.836 39.807  1.00 226.75 ? 232 ASP B OD1 1 
ATOM   5793 O  OD2 . ASP B 2 213 ? 159.002 151.752 37.901  1.00 233.53 ? 232 ASP B OD2 1 
ATOM   5794 N  N   . LYS B 2 214 ? 154.004 152.416 40.695  1.00 307.44 ? 233 LYS B N   1 
ATOM   5795 C  CA  . LYS B 2 214 ? 152.570 152.153 40.747  1.00 321.04 ? 233 LYS B CA  1 
ATOM   5796 C  C   . LYS B 2 214 ? 151.830 153.157 39.874  1.00 328.01 ? 233 LYS B C   1 
ATOM   5797 O  O   . LYS B 2 214 ? 152.076 154.364 39.970  1.00 327.55 ? 233 LYS B O   1 
ATOM   5798 C  CB  . LYS B 2 214 ? 152.051 152.216 42.188  1.00 305.72 ? 233 LYS B CB  1 
ATOM   5799 C  CG  . LYS B 2 214 ? 152.604 151.122 43.090  1.00 300.07 ? 233 LYS B CG  1 
ATOM   5800 C  CD  . LYS B 2 214 ? 152.229 149.737 42.590  1.00 304.01 ? 233 LYS B CD  1 
ATOM   5801 C  CE  . LYS B 2 214 ? 152.767 148.656 43.515  1.00 306.28 ? 233 LYS B CE  1 
ATOM   5802 N  NZ  . LYS B 2 214 ? 152.430 147.288 43.034  1.00 313.40 ? 233 LYS B NZ  1 
ATOM   5803 N  N   . LYS B 2 215 ? 150.923 152.664 39.031  1.00 333.04 ? 234 LYS B N   1 
ATOM   5804 C  CA  . LYS B 2 215 ? 150.123 153.519 38.163  1.00 317.76 ? 234 LYS B CA  1 
ATOM   5805 C  C   . LYS B 2 215 ? 148.769 153.799 38.802  1.00 292.68 ? 234 LYS B C   1 
ATOM   5806 O  O   . LYS B 2 215 ? 148.166 152.915 39.419  1.00 297.35 ? 234 LYS B O   1 
ATOM   5807 C  CB  . LYS B 2 215 ? 149.921 152.875 36.788  1.00 319.49 ? 234 LYS B CB  1 
ATOM   5808 C  CG  . LYS B 2 215 ? 149.126 153.737 35.812  1.00 314.82 ? 234 LYS B CG  1 
ATOM   5809 C  CD  . LYS B 2 215 ? 148.960 153.067 34.456  1.00 313.72 ? 234 LYS B CD  1 
ATOM   5810 C  CE  . LYS B 2 215 ? 148.131 153.934 33.518  1.00 305.30 ? 234 LYS B CE  1 
ATOM   5811 N  NZ  . LYS B 2 215 ? 147.988 153.328 32.164  1.00 303.85 ? 234 LYS B NZ  1 
ATOM   5812 N  N   . LEU B 2 216 ? 148.298 155.036 38.659  1.00 251.25 ? 235 LEU B N   1 
ATOM   5813 C  CA  . LEU B 2 216 ? 147.028 155.439 39.247  1.00 233.20 ? 235 LEU B CA  1 
ATOM   5814 C  C   . LEU B 2 216 ? 145.860 154.949 38.398  1.00 235.45 ? 235 LEU B C   1 
ATOM   5815 O  O   . LEU B 2 216 ? 145.873 155.087 37.171  1.00 247.75 ? 235 LEU B O   1 
ATOM   5816 C  CB  . LEU B 2 216 ? 146.964 156.956 39.401  1.00 187.66 ? 235 LEU B CB  1 
ATOM   5817 C  CG  . LEU B 2 216 ? 145.998 157.408 40.494  1.00 171.36 ? 235 LEU B CG  1 
ATOM   5818 C  CD1 . LEU B 2 216 ? 146.694 157.410 41.846  1.00 147.16 ? 235 LEU B CD1 1 
ATOM   5819 C  CD2 . LEU B 2 216 ? 145.416 158.771 40.176  1.00 171.62 ? 235 LEU B CD2 1 
ATOM   5820 N  N   . GLU B 2 217 ? 144.849 154.381 39.054  1.00 267.91 ? 236 GLU B N   1 
ATOM   5821 C  CA  . GLU B 2 217 ? 143.652 153.891 38.377  1.00 289.62 ? 236 GLU B CA  1 
ATOM   5822 C  C   . GLU B 2 217 ? 142.404 154.324 39.138  1.00 278.12 ? 236 GLU B C   1 
ATOM   5823 O  O   . GLU B 2 217 ? 142.253 153.990 40.320  1.00 265.23 ? 236 GLU B O   1 
ATOM   5824 C  CB  . GLU B 2 217 ? 143.690 152.369 38.223  1.00 299.00 ? 236 GLU B CB  1 
ATOM   5825 C  CG  . GLU B 2 217 ? 144.853 151.853 37.387  1.00 309.44 ? 236 GLU B CG  1 
ATOM   5826 C  CD  . GLU B 2 217 ? 144.784 152.315 35.941  1.00 313.75 ? 236 GLU B CD  1 
ATOM   5827 O  OE1 . GLU B 2 217 ? 143.666 152.566 35.444  1.00 313.77 ? 236 GLU B OE1 1 
ATOM   5828 O  OE2 . GLU B 2 217 ? 145.849 152.425 35.299  1.00 316.43 ? 236 GLU B OE2 1 
ATOM   5829 N  N   . PRO B 2 218 ? 141.481 155.061 38.499  1.00 270.93 ? 237 PRO B N   1 
ATOM   5830 C  CA  . PRO B 2 218 ? 140.249 155.518 39.154  1.00 245.94 ? 237 PRO B CA  1 
ATOM   5831 C  C   . PRO B 2 218 ? 139.271 154.386 39.454  1.00 221.82 ? 237 PRO B C   1 
ATOM   5832 O  O   . PRO B 2 218 ? 138.634 154.418 40.507  1.00 191.78 ? 237 PRO B O   1 
ATOM   5833 C  CB  . PRO B 2 218 ? 139.652 156.489 38.132  1.00 247.17 ? 237 PRO B CB  1 
ATOM   5834 C  CG  . PRO B 2 218 ? 140.167 156.008 36.821  1.00 259.18 ? 237 PRO B CG  1 
ATOM   5835 C  CD  . PRO B 2 218 ? 141.555 155.502 37.094  1.00 272.28 ? 237 PRO B CD  1 
ATOM   5836 N  N   . ASP C 3 1   ? 188.148 181.512 68.862  1.00 168.09 ? 21  ASP C N   1 
ATOM   5837 C  CA  . ASP C 3 1   ? 187.328 181.412 67.660  1.00 140.75 ? 21  ASP C CA  1 
ATOM   5838 C  C   . ASP C 3 1   ? 186.399 182.611 67.520  1.00 119.26 ? 21  ASP C C   1 
ATOM   5839 O  O   . ASP C 3 1   ? 186.405 183.522 68.350  1.00 115.47 ? 21  ASP C O   1 
ATOM   5840 C  CB  . ASP C 3 1   ? 186.519 180.113 67.666  1.00 138.64 ? 21  ASP C CB  1 
ATOM   5841 C  CG  . ASP C 3 1   ? 187.396 178.877 67.572  1.00 136.27 ? 21  ASP C CG  1 
ATOM   5842 O  OD1 . ASP C 3 1   ? 188.575 178.946 67.982  1.00 150.93 ? 21  ASP C OD1 1 
ATOM   5843 O  OD2 . ASP C 3 1   ? 186.905 177.836 67.086  1.00 142.30 ? 21  ASP C OD2 1 
ATOM   5844 N  N   . ILE C 3 2   ? 185.601 182.608 66.456  1.00 216.95 ? 22  ILE C N   1 
ATOM   5845 C  CA  . ILE C 3 2   ? 184.725 183.721 66.120  1.00 195.60 ? 22  ILE C CA  1 
ATOM   5846 C  C   . ILE C 3 2   ? 183.282 183.239 66.181  1.00 165.80 ? 22  ILE C C   1 
ATOM   5847 O  O   . ILE C 3 2   ? 182.963 182.144 65.706  1.00 139.12 ? 22  ILE C O   1 
ATOM   5848 C  CB  . ILE C 3 2   ? 185.072 184.299 64.732  1.00 119.47 ? 22  ILE C CB  1 
ATOM   5849 C  CG1 . ILE C 3 2   ? 186.553 184.680 64.699  1.00 119.78 ? 22  ILE C CG1 1 
ATOM   5850 C  CG2 . ILE C 3 2   ? 184.204 185.497 64.405  1.00 120.67 ? 22  ILE C CG2 1 
ATOM   5851 C  CD1 . ILE C 3 2   ? 186.962 185.622 65.811  1.00 124.40 ? 22  ILE C CD1 1 
ATOM   5852 N  N   . VAL C 3 3   ? 182.413 184.056 66.767  1.00 183.16 ? 23  VAL C N   1 
ATOM   5853 C  CA  . VAL C 3 3   ? 180.997 183.735 66.907  1.00 166.62 ? 23  VAL C CA  1 
ATOM   5854 C  C   . VAL C 3 3   ? 180.215 184.687 66.014  1.00 159.50 ? 23  VAL C C   1 
ATOM   5855 O  O   . VAL C 3 3   ? 180.091 185.882 66.316  1.00 141.47 ? 23  VAL C O   1 
ATOM   5856 C  CB  . VAL C 3 3   ? 180.534 183.835 68.367  1.00 171.65 ? 23  VAL C CB  1 
ATOM   5857 C  CG1 . VAL C 3 3   ? 179.056 183.500 68.480  1.00 181.59 ? 23  VAL C CG1 1 
ATOM   5858 C  CG2 . VAL C 3 3   ? 181.361 182.913 69.253  1.00 166.14 ? 23  VAL C CG2 1 
ATOM   5859 N  N   . MET C 3 4   ? 179.708 184.161 64.899  1.00 147.68 ? 24  MET C N   1 
ATOM   5860 C  CA  . MET C 3 4   ? 178.852 184.913 63.986  1.00 153.35 ? 24  MET C CA  1 
ATOM   5861 C  C   . MET C 3 4   ? 177.403 184.776 64.444  1.00 156.47 ? 24  MET C C   1 
ATOM   5862 O  O   . MET C 3 4   ? 176.800 183.705 64.308  1.00 125.10 ? 24  MET C O   1 
ATOM   5863 C  CB  . MET C 3 4   ? 179.033 184.423 62.553  1.00 118.73 ? 24  MET C CB  1 
ATOM   5864 C  CG  . MET C 3 4   ? 180.475 184.446 62.073  1.00 115.87 ? 24  MET C CG  1 
ATOM   5865 S  SD  . MET C 3 4   ? 181.220 186.091 62.124  1.00 118.11 ? 24  MET C SD  1 
ATOM   5866 C  CE  . MET C 3 4   ? 180.346 186.921 60.804  1.00 131.04 ? 24  MET C CE  1 
ATOM   5867 N  N   . THR C 3 5   ? 176.845 185.855 64.986  1.00 149.73 ? 25  THR C N   1 
ATOM   5868 C  CA  . THR C 3 5   ? 175.528 185.840 65.608  1.00 154.99 ? 25  THR C CA  1 
ATOM   5869 C  C   . THR C 3 5   ? 174.510 186.513 64.694  1.00 158.55 ? 25  THR C C   1 
ATOM   5870 O  O   . THR C 3 5   ? 174.649 187.699 64.377  1.00 167.03 ? 25  THR C O   1 
ATOM   5871 C  CB  . THR C 3 5   ? 175.572 186.547 66.963  1.00 151.90 ? 25  THR C CB  1 
ATOM   5872 O  OG1 . THR C 3 5   ? 176.530 185.901 67.810  1.00 150.05 ? 25  THR C OG1 1 
ATOM   5873 C  CG2 . THR C 3 5   ? 174.208 186.510 67.634  1.00 169.22 ? 25  THR C CG2 1 
ATOM   5874 N  N   . GLN C 3 6   ? 173.504 185.753 64.255  1.00 154.14 ? 26  GLN C N   1 
ATOM   5875 C  CA  . GLN C 3 6   ? 172.367 186.295 63.508  1.00 155.28 ? 26  GLN C CA  1 
ATOM   5876 C  C   . GLN C 3 6   ? 171.170 186.350 64.453  1.00 182.22 ? 26  GLN C C   1 
ATOM   5877 O  O   . GLN C 3 6   ? 170.549 185.324 64.744  1.00 194.01 ? 26  GLN C O   1 
ATOM   5878 C  CB  . GLN C 3 6   ? 172.063 185.463 62.270  1.00 134.67 ? 26  GLN C CB  1 
ATOM   5879 C  CG  . GLN C 3 6   ? 173.224 185.332 61.314  1.00 138.67 ? 26  GLN C CG  1 
ATOM   5880 C  CD  . GLN C 3 6   ? 172.829 184.617 60.044  1.00 137.94 ? 26  GLN C CD  1 
ATOM   5881 O  OE1 . GLN C 3 6   ? 173.647 183.950 59.412  1.00 153.82 ? 26  GLN C OE1 1 
ATOM   5882 N  NE2 . GLN C 3 6   ? 171.566 184.756 59.657  1.00 133.42 ? 26  GLN C NE2 1 
ATOM   5883 N  N   . SER C 3 7   ? 170.851 187.553 64.932  1.00 220.85 ? 27  SER C N   1 
ATOM   5884 C  CA  . SER C 3 7   ? 169.782 187.713 65.915  1.00 236.11 ? 27  SER C CA  1 
ATOM   5885 C  C   . SER C 3 7   ? 168.425 187.275 65.367  1.00 238.64 ? 27  SER C C   1 
ATOM   5886 O  O   . SER C 3 7   ? 167.674 186.560 66.041  1.00 250.33 ? 27  SER C O   1 
ATOM   5887 C  CB  . SER C 3 7   ? 169.728 189.166 66.390  1.00 253.15 ? 27  SER C CB  1 
ATOM   5888 O  OG  . SER C 3 7   ? 169.478 190.049 65.310  1.00 260.89 ? 27  SER C OG  1 
ATOM   5889 N  N   . HIS C 3 8   ? 168.093 187.690 64.145  1.00 203.36 ? 28  HIS C N   1 
ATOM   5890 C  CA  . HIS C 3 8   ? 166.805 187.361 63.527  1.00 162.10 ? 28  HIS C CA  1 
ATOM   5891 C  C   . HIS C 3 8   ? 166.876 186.008 62.827  1.00 171.61 ? 28  HIS C C   1 
ATOM   5892 O  O   . HIS C 3 8   ? 167.450 185.883 61.743  1.00 166.07 ? 28  HIS C O   1 
ATOM   5893 C  CB  . HIS C 3 8   ? 166.391 188.459 62.555  1.00 161.60 ? 28  HIS C CB  1 
ATOM   5894 C  CG  . HIS C 3 8   ? 166.228 189.802 63.196  1.00 199.42 ? 28  HIS C CG  1 
ATOM   5895 N  ND1 . HIS C 3 8   ? 165.059 190.196 63.811  1.00 201.09 ? 28  HIS C ND1 1 
ATOM   5896 C  CD2 . HIS C 3 8   ? 167.089 190.839 63.326  1.00 192.36 ? 28  HIS C CD2 1 
ATOM   5897 C  CE1 . HIS C 3 8   ? 165.205 191.419 64.287  1.00 206.96 ? 28  HIS C CE1 1 
ATOM   5898 N  NE2 . HIS C 3 8   ? 166.428 191.832 64.006  1.00 202.88 ? 28  HIS C NE2 1 
ATOM   5899 N  N   . LYS C 3 9   ? 166.276 184.989 63.449  1.00 175.89 ? 29  LYS C N   1 
ATOM   5900 C  CA  . LYS C 3 9   ? 166.246 183.658 62.849  1.00 174.65 ? 29  LYS C CA  1 
ATOM   5901 C  C   . LYS C 3 9   ? 165.277 183.586 61.672  1.00 175.28 ? 29  LYS C C   1 
ATOM   5902 O  O   . LYS C 3 9   ? 165.489 182.794 60.746  1.00 168.61 ? 29  LYS C O   1 
ATOM   5903 C  CB  . LYS C 3 9   ? 165.862 182.617 63.902  1.00 176.62 ? 29  LYS C CB  1 
ATOM   5904 C  CG  . LYS C 3 9   ? 166.758 182.598 65.132  1.00 168.07 ? 29  LYS C CG  1 
ATOM   5905 C  CD  . LYS C 3 9   ? 168.174 182.181 64.784  1.00 160.94 ? 29  LYS C CD  1 
ATOM   5906 C  CE  . LYS C 3 9   ? 168.203 180.760 64.245  1.00 172.33 ? 29  LYS C CE  1 
ATOM   5907 N  NZ  . LYS C 3 9   ? 169.587 180.310 63.934  1.00 172.66 ? 29  LYS C NZ  1 
ATOM   5908 N  N   . PHE C 3 10  ? 164.215 184.390 61.693  1.00 168.32 ? 30  PHE C N   1 
ATOM   5909 C  CA  . PHE C 3 10  ? 163.219 184.422 60.631  1.00 158.74 ? 30  PHE C CA  1 
ATOM   5910 C  C   . PHE C 3 10  ? 162.881 185.865 60.291  1.00 189.17 ? 30  PHE C C   1 
ATOM   5911 O  O   . PHE C 3 10  ? 162.805 186.715 61.183  1.00 207.60 ? 30  PHE C O   1 
ATOM   5912 C  CB  . PHE C 3 10  ? 161.941 183.673 61.036  1.00 162.88 ? 30  PHE C CB  1 
ATOM   5913 C  CG  . PHE C 3 10  ? 162.167 182.233 61.397  1.00 158.77 ? 30  PHE C CG  1 
ATOM   5914 C  CD1 . PHE C 3 10  ? 162.142 181.248 60.424  1.00 166.61 ? 30  PHE C CD1 1 
ATOM   5915 C  CD2 . PHE C 3 10  ? 162.410 181.865 62.709  1.00 167.10 ? 30  PHE C CD2 1 
ATOM   5916 C  CE1 . PHE C 3 10  ? 162.350 179.922 60.754  1.00 155.81 ? 30  PHE C CE1 1 
ATOM   5917 C  CE2 . PHE C 3 10  ? 162.621 180.541 63.045  1.00 169.84 ? 30  PHE C CE2 1 
ATOM   5918 C  CZ  . PHE C 3 10  ? 162.590 179.568 62.066  1.00 152.09 ? 30  PHE C CZ  1 
ATOM   5919 N  N   . MET C 3 11  ? 162.688 186.142 59.003  1.00 167.66 ? 31  MET C N   1 
ATOM   5920 C  CA  . MET C 3 11  ? 162.272 187.467 58.565  1.00 186.45 ? 31  MET C CA  1 
ATOM   5921 C  C   . MET C 3 11  ? 161.199 187.347 57.495  1.00 199.22 ? 31  MET C C   1 
ATOM   5922 O  O   . MET C 3 11  ? 161.294 186.510 56.592  1.00 205.77 ? 31  MET C O   1 
ATOM   5923 C  CB  . MET C 3 11  ? 163.446 188.295 58.026  1.00 181.60 ? 31  MET C CB  1 
ATOM   5924 C  CG  . MET C 3 11  ? 164.392 188.807 59.097  1.00 184.61 ? 31  MET C CG  1 
ATOM   5925 S  SD  . MET C 3 11  ? 165.536 190.043 58.453  1.00 185.47 ? 31  MET C SD  1 
ATOM   5926 C  CE  . MET C 3 11  ? 164.392 191.290 57.864  1.00 174.22 ? 31  MET C CE  1 
ATOM   5927 N  N   . SER C 3 12  ? 160.176 188.190 57.612  1.00 200.65 ? 32  SER C N   1 
ATOM   5928 C  CA  . SER C 3 12  ? 159.048 188.210 56.693  1.00 192.45 ? 32  SER C CA  1 
ATOM   5929 C  C   . SER C 3 12  ? 159.172 189.397 55.748  1.00 202.98 ? 32  SER C C   1 
ATOM   5930 O  O   . SER C 3 12  ? 159.549 190.498 56.161  1.00 214.54 ? 32  SER C O   1 
ATOM   5931 C  CB  . SER C 3 12  ? 157.720 188.286 57.451  1.00 202.73 ? 32  SER C CB  1 
ATOM   5932 O  OG  . SER C 3 12  ? 157.565 187.186 58.330  1.00 197.28 ? 32  SER C OG  1 
ATOM   5933 N  N   . THR C 3 13  ? 158.849 189.167 54.479  1.00 221.54 ? 33  THR C N   1 
ATOM   5934 C  CA  . THR C 3 13  ? 158.877 190.217 53.473  1.00 230.20 ? 33  THR C CA  1 
ATOM   5935 C  C   . THR C 3 13  ? 157.878 189.868 52.382  1.00 242.94 ? 33  THR C C   1 
ATOM   5936 O  O   . THR C 3 13  ? 157.355 188.753 52.323  1.00 260.89 ? 33  THR C O   1 
ATOM   5937 C  CB  . THR C 3 13  ? 160.280 190.400 52.883  1.00 216.92 ? 33  THR C CB  1 
ATOM   5938 O  OG1 . THR C 3 13  ? 160.285 191.531 52.004  1.00 221.62 ? 33  THR C OG1 1 
ATOM   5939 C  CG2 . THR C 3 13  ? 160.688 189.162 52.102  1.00 206.07 ? 33  THR C CG2 1 
ATOM   5940 N  N   . SER C 3 14  ? 157.617 190.837 51.512  1.00 238.69 ? 34  SER C N   1 
ATOM   5941 C  CA  . SER C 3 14  ? 156.678 190.672 50.414  1.00 231.79 ? 34  SER C CA  1 
ATOM   5942 C  C   . SER C 3 14  ? 157.418 190.763 49.085  1.00 225.66 ? 34  SER C C   1 
ATOM   5943 O  O   . SER C 3 14  ? 158.566 191.209 49.012  1.00 221.39 ? 34  SER C O   1 
ATOM   5944 C  CB  . SER C 3 14  ? 155.561 191.721 50.484  1.00 213.99 ? 34  SER C CB  1 
ATOM   5945 O  OG  . SER C 3 14  ? 154.841 191.613 51.700  1.00 218.52 ? 34  SER C OG  1 
ATOM   5946 N  N   . VAL C 3 15  ? 156.741 190.325 48.025  1.00 232.65 ? 35  VAL C N   1 
ATOM   5947 C  CA  . VAL C 3 15  ? 157.314 190.349 46.682  1.00 234.94 ? 35  VAL C CA  1 
ATOM   5948 C  C   . VAL C 3 15  ? 157.435 191.805 46.240  1.00 245.12 ? 35  VAL C C   1 
ATOM   5949 O  O   . VAL C 3 15  ? 156.427 192.480 46.012  1.00 277.96 ? 35  VAL C O   1 
ATOM   5950 C  CB  . VAL C 3 15  ? 156.468 189.536 45.696  1.00 237.53 ? 35  VAL C CB  1 
ATOM   5951 C  CG1 . VAL C 3 15  ? 157.051 189.625 44.294  1.00 240.23 ? 35  VAL C CG1 1 
ATOM   5952 C  CG2 . VAL C 3 15  ? 156.373 188.086 46.147  1.00 228.17 ? 35  VAL C CG2 1 
ATOM   5953 N  N   . GLY C 3 16  ? 158.669 192.292 46.119  1.00 208.42 ? 36  GLY C N   1 
ATOM   5954 C  CA  . GLY C 3 16  ? 158.932 193.658 45.711  1.00 201.48 ? 36  GLY C CA  1 
ATOM   5955 C  C   . GLY C 3 16  ? 159.437 194.563 46.813  1.00 209.50 ? 36  GLY C C   1 
ATOM   5956 O  O   . GLY C 3 16  ? 159.863 195.687 46.517  1.00 204.59 ? 36  GLY C O   1 
ATOM   5957 N  N   . ASP C 3 17  ? 159.404 194.120 48.067  1.00 219.92 ? 37  ASP C N   1 
ATOM   5958 C  CA  . ASP C 3 17  ? 159.881 194.928 49.177  1.00 226.17 ? 37  ASP C CA  1 
ATOM   5959 C  C   . ASP C 3 17  ? 161.401 194.839 49.302  1.00 216.73 ? 37  ASP C C   1 
ATOM   5960 O  O   . ASP C 3 17  ? 162.055 193.963 48.730  1.00 195.78 ? 37  ASP C O   1 
ATOM   5961 C  CB  . ASP C 3 17  ? 159.224 194.490 50.486  1.00 225.77 ? 37  ASP C CB  1 
ATOM   5962 C  CG  . ASP C 3 17  ? 157.720 194.665 50.474  1.00 232.49 ? 37  ASP C CG  1 
ATOM   5963 O  OD1 . ASP C 3 17  ? 157.116 194.575 49.385  1.00 243.07 ? 37  ASP C OD1 1 
ATOM   5964 O  OD2 . ASP C 3 17  ? 157.141 194.887 51.558  1.00 238.25 ? 37  ASP C OD2 1 
ATOM   5965 N  N   . ARG C 3 18  ? 161.958 195.758 50.082  1.00 218.45 ? 38  ARG C N   1 
ATOM   5966 C  CA  . ARG C 3 18  ? 163.389 195.823 50.337  1.00 208.62 ? 38  ARG C CA  1 
ATOM   5967 C  C   . ARG C 3 18  ? 163.668 195.115 51.655  1.00 212.68 ? 38  ARG C C   1 
ATOM   5968 O  O   . ARG C 3 18  ? 163.157 195.528 52.702  1.00 214.86 ? 38  ARG C O   1 
ATOM   5969 C  CB  . ARG C 3 18  ? 163.853 197.278 50.399  1.00 221.70 ? 38  ARG C CB  1 
ATOM   5970 C  CG  . ARG C 3 18  ? 165.317 197.474 50.743  1.00 225.20 ? 38  ARG C CG  1 
ATOM   5971 C  CD  . ARG C 3 18  ? 165.626 198.954 50.914  1.00 245.26 ? 38  ARG C CD  1 
ATOM   5972 N  NE  . ARG C 3 18  ? 167.048 199.208 51.127  1.00 247.75 ? 38  ARG C NE  1 
ATOM   5973 C  CZ  . ARG C 3 18  ? 167.924 199.415 50.151  1.00 248.49 ? 38  ARG C CZ  1 
ATOM   5974 N  NH1 . ARG C 3 18  ? 167.527 199.402 48.886  1.00 257.63 ? 38  ARG C NH1 1 
ATOM   5975 N  NH2 . ARG C 3 18  ? 169.199 199.640 50.439  1.00 238.16 ? 38  ARG C NH2 1 
ATOM   5976 N  N   . VAL C 3 19  ? 164.469 194.052 51.607  1.00 209.57 ? 39  VAL C N   1 
ATOM   5977 C  CA  . VAL C 3 19  ? 164.758 193.256 52.794  1.00 198.73 ? 39  VAL C CA  1 
ATOM   5978 C  C   . VAL C 3 19  ? 166.256 193.283 53.061  1.00 190.96 ? 39  VAL C C   1 
ATOM   5979 O  O   . VAL C 3 19  ? 167.063 193.252 52.127  1.00 203.56 ? 39  VAL C O   1 
ATOM   5980 C  CB  . VAL C 3 19  ? 164.239 191.807 52.651  1.00 188.39 ? 39  VAL C CB  1 
ATOM   5981 C  CG1 . VAL C 3 19  ? 164.938 191.082 51.512  1.00 181.76 ? 39  VAL C CG1 1 
ATOM   5982 C  CG2 . VAL C 3 19  ? 164.400 191.045 53.960  1.00 192.16 ? 39  VAL C CG2 1 
ATOM   5983 N  N   . SER C 3 20  ? 166.627 193.380 54.336  1.00 182.51 ? 40  SER C N   1 
ATOM   5984 C  CA  . SER C 3 20  ? 168.028 193.436 54.730  1.00 159.30 ? 40  SER C CA  1 
ATOM   5985 C  C   . SER C 3 20  ? 168.243 192.521 55.924  1.00 160.61 ? 40  SER C C   1 
ATOM   5986 O  O   . SER C 3 20  ? 167.488 192.586 56.900  1.00 172.85 ? 40  SER C O   1 
ATOM   5987 C  CB  . SER C 3 20  ? 168.457 194.869 55.064  1.00 163.38 ? 40  SER C CB  1 
ATOM   5988 O  OG  . SER C 3 20  ? 168.303 195.719 53.940  1.00 166.05 ? 40  SER C OG  1 
ATOM   5989 N  N   . ILE C 3 21  ? 169.263 191.669 55.844  1.00 149.66 ? 41  ILE C N   1 
ATOM   5990 C  CA  . ILE C 3 21  ? 169.606 190.738 56.915  1.00 152.93 ? 41  ILE C CA  1 
ATOM   5991 C  C   . ILE C 3 21  ? 170.890 191.211 57.584  1.00 169.35 ? 41  ILE C C   1 
ATOM   5992 O  O   . ILE C 3 21  ? 171.854 191.581 56.901  1.00 178.54 ? 41  ILE C O   1 
ATOM   5993 C  CB  . ILE C 3 21  ? 169.751 189.302 56.387  1.00 141.11 ? 41  ILE C CB  1 
ATOM   5994 C  CG1 . ILE C 3 21  ? 168.475 188.880 55.657  1.00 143.44 ? 41  ILE C CG1 1 
ATOM   5995 C  CG2 . ILE C 3 21  ? 170.038 188.341 57.529  1.00 138.99 ? 41  ILE C CG2 1 
ATOM   5996 C  CD1 . ILE C 3 21  ? 168.515 187.464 55.133  1.00 153.93 ? 41  ILE C CD1 1 
ATOM   5997 N  N   . THR C 3 22  ? 170.899 191.203 58.915  1.00 199.35 ? 42  THR C N   1 
ATOM   5998 C  CA  . THR C 3 22  ? 172.044 191.633 59.702  1.00 204.33 ? 42  THR C CA  1 
ATOM   5999 C  C   . THR C 3 22  ? 172.860 190.436 60.180  1.00 184.25 ? 42  THR C C   1 
ATOM   6000 O  O   . THR C 3 22  ? 172.333 189.341 60.395  1.00 187.34 ? 42  THR C O   1 
ATOM   6001 C  CB  . THR C 3 22  ? 171.603 192.466 60.908  1.00 217.35 ? 42  THR C CB  1 
ATOM   6002 O  OG1 . THR C 3 22  ? 170.805 191.661 61.785  1.00 228.31 ? 42  THR C OG1 1 
ATOM   6003 C  CG2 . THR C 3 22  ? 170.796 193.675 60.457  1.00 226.34 ? 42  THR C CG2 1 
ATOM   6004 N  N   . CYS C 3 23  ? 174.161 190.664 60.343  1.00 154.91 ? 43  CYS C N   1 
ATOM   6005 C  CA  . CYS C 3 23  ? 175.099 189.655 60.823  1.00 134.16 ? 43  CYS C CA  1 
ATOM   6006 C  C   . CYS C 3 23  ? 176.025 190.297 61.842  1.00 163.19 ? 43  CYS C C   1 
ATOM   6007 O  O   . CYS C 3 23  ? 176.689 191.292 61.537  1.00 151.34 ? 43  CYS C O   1 
ATOM   6008 C  CB  . CYS C 3 23  ? 175.906 189.058 59.667  1.00 163.94 ? 43  CYS C CB  1 
ATOM   6009 S  SG  . CYS C 3 23  ? 176.946 187.636 60.090  1.00 161.34 ? 43  CYS C SG  1 
ATOM   6010 N  N   . LYS C 3 24  ? 176.059 189.735 63.046  1.00 167.77 ? 44  LYS C N   1 
ATOM   6011 C  CA  . LYS C 3 24  ? 176.890 190.233 64.131  1.00 170.60 ? 44  LYS C CA  1 
ATOM   6012 C  C   . LYS C 3 24  ? 178.011 189.236 64.385  1.00 171.48 ? 44  LYS C C   1 
ATOM   6013 O  O   . LYS C 3 24  ? 177.757 188.036 64.528  1.00 151.81 ? 44  LYS C O   1 
ATOM   6014 C  CB  . LYS C 3 24  ? 176.069 190.450 65.405  1.00 163.89 ? 44  LYS C CB  1 
ATOM   6015 C  CG  . LYS C 3 24  ? 176.891 190.866 66.617  1.00 166.81 ? 44  LYS C CG  1 
ATOM   6016 C  CD  . LYS C 3 24  ? 176.037 190.912 67.874  1.00 193.90 ? 44  LYS C CD  1 
ATOM   6017 C  CE  . LYS C 3 24  ? 174.911 191.927 67.743  1.00 217.09 ? 44  LYS C CE  1 
ATOM   6018 N  NZ  . LYS C 3 24  ? 174.068 191.994 68.971  1.00 224.37 ? 44  LYS C NZ  1 
ATOM   6019 N  N   . ALA C 3 25  ? 179.242 189.730 64.433  1.00 168.35 ? 45  ALA C N   1 
ATOM   6020 C  CA  . ALA C 3 25  ? 180.414 188.900 64.654  1.00 163.44 ? 45  ALA C CA  1 
ATOM   6021 C  C   . ALA C 3 25  ? 180.928 189.096 66.074  1.00 192.14 ? 45  ALA C C   1 
ATOM   6022 O  O   . ALA C 3 25  ? 180.491 189.989 66.804  1.00 207.63 ? 45  ALA C O   1 
ATOM   6023 C  CB  . ALA C 3 25  ? 181.512 189.230 63.637  1.00 155.08 ? 45  ALA C CB  1 
ATOM   6024 N  N   . SER C 3 26  ? 181.873 188.241 66.465  1.00 133.55 ? 46  SER C N   1 
ATOM   6025 C  CA  . SER C 3 26  ? 182.440 188.339 67.805  1.00 146.34 ? 46  SER C CA  1 
ATOM   6026 C  C   . SER C 3 26  ? 183.375 189.540 67.906  1.00 161.34 ? 46  SER C C   1 
ATOM   6027 O  O   . SER C 3 26  ? 183.140 190.464 68.693  1.00 183.63 ? 46  SER C O   1 
ATOM   6028 C  CB  . SER C 3 26  ? 183.171 187.046 68.169  1.00 158.30 ? 46  SER C CB  1 
ATOM   6029 O  OG  . SER C 3 26  ? 184.277 186.819 67.314  1.00 167.68 ? 46  SER C OG  1 
ATOM   6030 N  N   . GLN C 3 27  ? 184.447 189.536 67.120  1.00 168.87 ? 47  GLN C N   1 
ATOM   6031 C  CA  . GLN C 3 27  ? 185.419 190.619 67.082  1.00 159.10 ? 47  GLN C CA  1 
ATOM   6032 C  C   . GLN C 3 27  ? 185.320 191.377 65.758  1.00 167.85 ? 47  GLN C C   1 
ATOM   6033 O  O   . GLN C 3 27  ? 184.453 191.114 64.920  1.00 133.41 ? 47  GLN C O   1 
ATOM   6034 C  CB  . GLN C 3 27  ? 186.831 190.069 67.305  1.00 157.40 ? 47  GLN C CB  1 
ATOM   6035 C  CG  . GLN C 3 27  ? 187.330 189.166 66.191  1.00 131.73 ? 47  GLN C CG  1 
ATOM   6036 C  CD  . GLN C 3 27  ? 188.687 188.559 66.493  1.00 140.25 ? 47  GLN C CD  1 
ATOM   6037 O  OE1 . GLN C 3 27  ? 188.973 188.193 67.632  1.00 158.71 ? 47  GLN C OE1 1 
ATOM   6038 N  NE2 . GLN C 3 27  ? 189.526 188.441 65.472  1.00 128.44 ? 47  GLN C NE2 1 
ATOM   6039 N  N   . ASP C 3 28  ? 186.207 192.356 65.596  1.00 164.84 ? 48  ASP C N   1 
ATOM   6040 C  CA  . ASP C 3 28  ? 186.270 193.144 64.371  1.00 159.93 ? 48  ASP C CA  1 
ATOM   6041 C  C   . ASP C 3 28  ? 186.759 192.294 63.205  1.00 171.30 ? 48  ASP C C   1 
ATOM   6042 O  O   . ASP C 3 28  ? 187.704 191.514 63.340  1.00 186.15 ? 48  ASP C O   1 
ATOM   6043 C  CB  . ASP C 3 28  ? 187.184 194.355 64.550  1.00 162.49 ? 48  ASP C CB  1 
ATOM   6044 C  CG  . ASP C 3 28  ? 187.085 195.334 63.393  1.00 160.13 ? 48  ASP C CG  1 
ATOM   6045 O  OD1 . ASP C 3 28  ? 187.806 195.150 62.392  1.00 144.73 ? 48  ASP C OD1 1 
ATOM   6046 O  OD2 . ASP C 3 28  ? 186.281 196.285 63.481  1.00 171.93 ? 48  ASP C OD2 1 
ATOM   6047 N  N   . VAL C 3 29  ? 186.106 192.447 62.055  1.00 169.96 ? 49  VAL C N   1 
ATOM   6048 C  CA  . VAL C 3 29  ? 186.330 191.579 60.903  1.00 147.25 ? 49  VAL C CA  1 
ATOM   6049 C  C   . VAL C 3 29  ? 186.884 192.334 59.701  1.00 139.94 ? 49  VAL C C   1 
ATOM   6050 O  O   . VAL C 3 29  ? 187.386 191.694 58.763  1.00 117.52 ? 49  VAL C O   1 
ATOM   6051 C  CB  . VAL C 3 29  ? 185.024 190.841 60.516  1.00 146.68 ? 49  VAL C CB  1 
ATOM   6052 C  CG1 . VAL C 3 29  ? 185.220 189.868 59.364  1.00 155.82 ? 49  VAL C CG1 1 
ATOM   6053 C  CG2 . VAL C 3 29  ? 184.455 190.103 61.716  1.00 122.45 ? 49  VAL C CG2 1 
ATOM   6054 N  N   . SER C 3 30  ? 186.890 193.668 59.734  1.00 174.29 ? 50  SER C N   1 
ATOM   6055 C  CA  . SER C 3 30  ? 187.236 194.516 58.596  1.00 177.09 ? 50  SER C CA  1 
ATOM   6056 C  C   . SER C 3 30  ? 186.261 194.271 57.451  1.00 184.46 ? 50  SER C C   1 
ATOM   6057 O  O   . SER C 3 30  ? 185.105 194.703 57.516  1.00 200.76 ? 50  SER C O   1 
ATOM   6058 C  CB  . SER C 3 30  ? 188.681 194.289 58.142  1.00 168.17 ? 50  SER C CB  1 
ATOM   6059 O  OG  . SER C 3 30  ? 188.977 195.072 56.999  1.00 163.72 ? 50  SER C OG  1 
ATOM   6060 N  N   . THR C 3 31  ? 186.710 193.597 56.392  1.00 160.78 ? 51  THR C N   1 
ATOM   6061 C  CA  . THR C 3 31  ? 185.858 193.304 55.241  1.00 142.09 ? 51  THR C CA  1 
ATOM   6062 C  C   . THR C 3 31  ? 185.968 191.840 54.836  1.00 120.13 ? 51  THR C C   1 
ATOM   6063 O  O   . THR C 3 31  ? 186.132 191.512 53.660  1.00 136.66 ? 51  THR C O   1 
ATOM   6064 C  CB  . THR C 3 31  ? 186.220 194.184 54.048  1.00 150.44 ? 51  THR C CB  1 
ATOM   6065 O  OG1 . THR C 3 31  ? 187.602 193.987 53.712  1.00 153.21 ? 51  THR C OG1 1 
ATOM   6066 C  CG2 . THR C 3 31  ? 185.962 195.652 54.353  1.00 154.95 ? 51  THR C CG2 1 
ATOM   6067 N  N   . ALA C 3 32  ? 185.828 190.931 55.795  1.00 139.25 ? 52  ALA C N   1 
ATOM   6068 C  CA  . ALA C 3 32  ? 185.950 189.499 55.539  1.00 161.94 ? 52  ALA C CA  1 
ATOM   6069 C  C   . ALA C 3 32  ? 184.626 188.813 55.865  1.00 158.74 ? 52  ALA C C   1 
ATOM   6070 O  O   . ALA C 3 32  ? 184.544 188.024 56.806  1.00 154.99 ? 52  ALA C O   1 
ATOM   6071 C  CB  . ALA C 3 32  ? 187.116 188.905 56.337  1.00 170.33 ? 52  ALA C CB  1 
ATOM   6072 N  N   . VAL C 3 33  ? 183.583 189.125 55.101  1.00 165.14 ? 53  VAL C N   1 
ATOM   6073 C  CA  . VAL C 3 33  ? 182.273 188.526 55.329  1.00 147.52 ? 53  VAL C CA  1 
ATOM   6074 C  C   . VAL C 3 33  ? 181.715 188.035 54.003  1.00 149.57 ? 53  VAL C C   1 
ATOM   6075 O  O   . VAL C 3 33  ? 181.721 188.772 53.012  1.00 166.95 ? 53  VAL C O   1 
ATOM   6076 C  CB  . VAL C 3 33  ? 181.294 189.505 56.003  1.00 167.30 ? 53  VAL C CB  1 
ATOM   6077 C  CG1 . VAL C 3 33  ? 179.873 188.946 55.962  1.00 170.37 ? 53  VAL C CG1 1 
ATOM   6078 C  CG2 . VAL C 3 33  ? 181.714 189.777 57.429  1.00 169.88 ? 53  VAL C CG2 1 
ATOM   6079 N  N   . ALA C 3 34  ? 181.221 186.800 53.993  1.00 157.28 ? 54  ALA C N   1 
ATOM   6080 C  CA  . ALA C 3 34  ? 180.622 186.182 52.818  1.00 170.23 ? 54  ALA C CA  1 
ATOM   6081 C  C   . ALA C 3 34  ? 179.161 185.849 53.092  1.00 207.20 ? 54  ALA C C   1 
ATOM   6082 O  O   . ALA C 3 34  ? 178.813 185.412 54.195  1.00 224.20 ? 54  ALA C O   1 
ATOM   6083 C  CB  . ALA C 3 34  ? 181.381 184.914 52.411  1.00 166.86 ? 54  ALA C CB  1 
ATOM   6084 N  N   . TRP C 3 35  ? 178.309 186.047 52.087  1.00 183.06 ? 55  TRP C N   1 
ATOM   6085 C  CA  . TRP C 3 35  ? 176.883 185.756 52.190  1.00 159.19 ? 55  TRP C CA  1 
ATOM   6086 C  C   . TRP C 3 35  ? 176.543 184.624 51.229  1.00 132.71 ? 55  TRP C C   1 
ATOM   6087 O  O   . TRP C 3 35  ? 176.779 184.741 50.019  1.00 155.00 ? 55  TRP C O   1 
ATOM   6088 C  CB  . TRP C 3 35  ? 176.037 186.993 51.888  1.00 147.04 ? 55  TRP C CB  1 
ATOM   6089 C  CG  . TRP C 3 35  ? 176.209 188.121 52.868  1.00 147.02 ? 55  TRP C CG  1 
ATOM   6090 C  CD1 . TRP C 3 35  ? 177.096 189.157 52.782  1.00 164.84 ? 55  TRP C CD1 1 
ATOM   6091 C  CD2 . TRP C 3 35  ? 175.476 188.321 54.083  1.00 147.70 ? 55  TRP C CD2 1 
ATOM   6092 N  NE1 . TRP C 3 35  ? 176.954 189.994 53.865  1.00 168.76 ? 55  TRP C NE1 1 
ATOM   6093 C  CE2 . TRP C 3 35  ? 175.967 189.502 54.679  1.00 166.56 ? 55  TRP C CE2 1 
ATOM   6094 C  CE3 . TRP C 3 35  ? 174.450 187.619 54.723  1.00 148.88 ? 55  TRP C CE3 1 
ATOM   6095 C  CZ2 . TRP C 3 35  ? 175.468 189.993 55.883  1.00 174.25 ? 55  TRP C CZ2 1 
ATOM   6096 C  CZ3 . TRP C 3 35  ? 173.956 188.109 55.918  1.00 171.65 ? 55  TRP C CZ3 1 
ATOM   6097 C  CH2 . TRP C 3 35  ? 174.465 189.285 56.485  1.00 178.99 ? 55  TRP C CH2 1 
ATOM   6098 N  N   . TYR C 3 36  ? 175.984 183.544 51.771  1.00 114.13 ? 56  TYR C N   1 
ATOM   6099 C  CA  . TYR C 3 36  ? 175.612 182.349 51.032  1.00 103.38 ? 56  TYR C CA  1 
ATOM   6100 C  C   . TYR C 3 36  ? 174.099 182.169 51.030  1.00 106.46 ? 56  TYR C C   1 
ATOM   6101 O  O   . TYR C 3 36  ? 173.415 182.490 52.008  1.00 109.38 ? 56  TYR C O   1 
ATOM   6102 C  CB  . TYR C 3 36  ? 176.261 181.097 51.636  1.00 120.01 ? 56  TYR C CB  1 
ATOM   6103 C  CG  . TYR C 3 36  ? 177.770 181.064 51.571  1.00 120.21 ? 56  TYR C CG  1 
ATOM   6104 C  CD1 . TYR C 3 36  ? 178.537 181.684 52.547  1.00 120.26 ? 56  TYR C CD1 1 
ATOM   6105 C  CD2 . TYR C 3 36  ? 178.426 180.380 50.557  1.00 128.45 ? 56  TYR C CD2 1 
ATOM   6106 C  CE1 . TYR C 3 36  ? 179.917 181.647 52.502  1.00 129.49 ? 56  TYR C CE1 1 
ATOM   6107 C  CE2 . TYR C 3 36  ? 179.808 180.336 50.503  1.00 137.67 ? 56  TYR C CE2 1 
ATOM   6108 C  CZ  . TYR C 3 36  ? 180.549 180.972 51.479  1.00 138.90 ? 56  TYR C CZ  1 
ATOM   6109 O  OH  . TYR C 3 36  ? 181.924 180.933 51.431  1.00 144.90 ? 56  TYR C OH  1 
ATOM   6110 N  N   . GLN C 3 37  ? 173.587 181.626 49.928  1.00 106.17 ? 57  GLN C N   1 
ATOM   6111 C  CA  . GLN C 3 37  ? 172.170 181.321 49.774  1.00 109.25 ? 57  GLN C CA  1 
ATOM   6112 C  C   . GLN C 3 37  ? 172.001 179.815 49.649  1.00 107.38 ? 57  GLN C C   1 
ATOM   6113 O  O   . GLN C 3 37  ? 172.617 179.190 48.780  1.00 140.72 ? 57  GLN C O   1 
ATOM   6114 C  CB  . GLN C 3 37  ? 171.588 182.019 48.546  1.00 111.57 ? 57  GLN C CB  1 
ATOM   6115 C  CG  . GLN C 3 37  ? 170.192 181.559 48.184  1.00 119.61 ? 57  GLN C CG  1 
ATOM   6116 C  CD  . GLN C 3 37  ? 169.766 182.015 46.807  1.00 134.73 ? 57  GLN C CD  1 
ATOM   6117 O  OE1 . GLN C 3 37  ? 170.594 182.408 45.988  1.00 127.94 ? 57  GLN C OE1 1 
ATOM   6118 N  NE2 . GLN C 3 37  ? 168.467 181.967 46.544  1.00 139.75 ? 57  GLN C NE2 1 
ATOM   6119 N  N   . GLN C 3 38  ? 171.170 179.237 50.511  1.00 109.18 ? 58  GLN C N   1 
ATOM   6120 C  CA  . GLN C 3 38  ? 170.889 177.802 50.505  1.00 108.10 ? 58  GLN C CA  1 
ATOM   6121 C  C   . GLN C 3 38  ? 169.387 177.606 50.337  1.00 111.99 ? 58  GLN C C   1 
ATOM   6122 O  O   . GLN C 3 38  ? 168.614 177.836 51.275  1.00 143.82 ? 58  GLN C O   1 
ATOM   6123 C  CB  . GLN C 3 38  ? 171.392 177.113 51.770  1.00 116.95 ? 58  GLN C CB  1 
ATOM   6124 C  CG  . GLN C 3 38  ? 171.228 175.596 51.710  1.00 105.64 ? 58  GLN C CG  1 
ATOM   6125 C  CD  . GLN C 3 38  ? 171.742 174.888 52.948  1.00 104.74 ? 58  GLN C CD  1 
ATOM   6126 O  OE1 . GLN C 3 38  ? 172.137 175.526 53.924  1.00 105.19 ? 58  GLN C OE1 1 
ATOM   6127 N  NE2 . GLN C 3 38  ? 171.743 173.560 52.910  1.00 103.85 ? 58  GLN C NE2 1 
ATOM   6128 N  N   . LYS C 3 39  ? 168.973 177.211 49.139  1.00 133.15 ? 59  LYS C N   1 
ATOM   6129 C  CA  . LYS C 3 39  ? 167.571 176.915 48.912  1.00 153.36 ? 59  LYS C CA  1 
ATOM   6130 C  C   . LYS C 3 39  ? 167.205 175.572 49.543  1.00 145.83 ? 59  LYS C C   1 
ATOM   6131 O  O   . LYS C 3 39  ? 168.036 174.663 49.614  1.00 140.21 ? 59  LYS C O   1 
ATOM   6132 C  CB  . LYS C 3 39  ? 167.253 176.899 47.420  1.00 162.93 ? 59  LYS C CB  1 
ATOM   6133 C  CG  . LYS C 3 39  ? 167.461 178.238 46.737  1.00 156.12 ? 59  LYS C CG  1 
ATOM   6134 C  CD  . LYS C 3 39  ? 167.058 178.182 45.276  1.00 147.07 ? 59  LYS C CD  1 
ATOM   6135 C  CE  . LYS C 3 39  ? 167.257 179.525 44.603  1.00 149.79 ? 59  LYS C CE  1 
ATOM   6136 N  NZ  . LYS C 3 39  ? 166.850 179.486 43.173  1.00 166.73 ? 59  LYS C NZ  1 
ATOM   6137 N  N   . PRO C 3 40  ? 165.972 175.444 50.052  1.00 149.51 ? 60  PRO C N   1 
ATOM   6138 C  CA  . PRO C 3 40  ? 165.542 174.187 50.684  1.00 144.27 ? 60  PRO C CA  1 
ATOM   6139 C  C   . PRO C 3 40  ? 165.725 172.971 49.790  1.00 131.70 ? 60  PRO C C   1 
ATOM   6140 O  O   . PRO C 3 40  ? 165.016 172.817 48.791  1.00 132.59 ? 60  PRO C O   1 
ATOM   6141 C  CB  . PRO C 3 40  ? 164.060 174.441 50.983  1.00 158.12 ? 60  PRO C CB  1 
ATOM   6142 C  CG  . PRO C 3 40  ? 163.964 175.921 51.136  1.00 170.24 ? 60  PRO C CG  1 
ATOM   6143 C  CD  . PRO C 3 40  ? 164.939 176.490 50.141  1.00 159.50 ? 60  PRO C CD  1 
ATOM   6144 N  N   . GLY C 3 41  ? 166.680 172.108 50.136  1.00 136.84 ? 61  GLY C N   1 
ATOM   6145 C  CA  . GLY C 3 41  ? 166.947 170.902 49.380  1.00 137.20 ? 61  GLY C CA  1 
ATOM   6146 C  C   . GLY C 3 41  ? 168.150 170.974 48.468  1.00 129.34 ? 61  GLY C C   1 
ATOM   6147 O  O   . GLY C 3 41  ? 168.438 169.993 47.771  1.00 116.04 ? 61  GLY C O   1 
ATOM   6148 N  N   . GLN C 3 42  ? 168.866 172.092 48.460  1.00 149.70 ? 62  GLN C N   1 
ATOM   6149 C  CA  . GLN C 3 42  ? 170.035 172.292 47.621  1.00 150.26 ? 62  GLN C CA  1 
ATOM   6150 C  C   . GLN C 3 42  ? 171.242 172.634 48.483  1.00 152.69 ? 62  GLN C C   1 
ATOM   6151 O  O   . GLN C 3 42  ? 171.133 172.902 49.682  1.00 147.93 ? 62  GLN C O   1 
ATOM   6152 C  CB  . GLN C 3 42  ? 169.795 173.403 46.593  1.00 132.44 ? 62  GLN C CB  1 
ATOM   6153 C  CG  . GLN C 3 42  ? 168.698 173.108 45.592  1.00 134.52 ? 62  GLN C CG  1 
ATOM   6154 C  CD  . GLN C 3 42  ? 168.523 174.231 44.596  1.00 149.61 ? 62  GLN C CD  1 
ATOM   6155 O  OE1 . GLN C 3 42  ? 169.189 175.263 44.688  1.00 141.62 ? 62  GLN C OE1 1 
ATOM   6156 N  NE2 . GLN C 3 42  ? 167.624 174.041 43.639  1.00 167.56 ? 62  GLN C NE2 1 
ATOM   6157 N  N   . SER C 3 43  ? 172.400 172.635 47.845  1.00 154.38 ? 63  SER C N   1 
ATOM   6158 C  CA  . SER C 3 43  ? 173.630 173.013 48.511  1.00 137.38 ? 63  SER C CA  1 
ATOM   6159 C  C   . SER C 3 43  ? 173.746 174.533 48.589  1.00 122.86 ? 63  SER C C   1 
ATOM   6160 O  O   . SER C 3 43  ? 173.166 175.251 47.771  1.00 119.55 ? 63  SER C O   1 
ATOM   6161 C  CB  . SER C 3 43  ? 174.833 172.442 47.767  1.00 159.82 ? 63  SER C CB  1 
ATOM   6162 O  OG  . SER C 3 43  ? 174.884 172.905 46.429  1.00 179.29 ? 63  SER C OG  1 
ATOM   6163 N  N   . PRO C 3 44  ? 174.467 175.041 49.588  1.00 119.38 ? 64  PRO C N   1 
ATOM   6164 C  CA  . PRO C 3 44  ? 174.682 176.489 49.686  1.00 124.04 ? 64  PRO C CA  1 
ATOM   6165 C  C   . PRO C 3 44  ? 175.290 177.056 48.412  1.00 113.77 ? 64  PRO C C   1 
ATOM   6166 O  O   . PRO C 3 44  ? 176.062 176.395 47.715  1.00 124.72 ? 64  PRO C O   1 
ATOM   6167 C  CB  . PRO C 3 44  ? 175.646 176.622 50.871  1.00 118.61 ? 64  PRO C CB  1 
ATOM   6168 C  CG  . PRO C 3 44  ? 175.369 175.417 51.706  1.00 107.93 ? 64  PRO C CG  1 
ATOM   6169 C  CD  . PRO C 3 44  ? 175.045 174.315 50.734  1.00 104.36 ? 64  PRO C CD  1 
ATOM   6170 N  N   . LYS C 3 45  ? 174.915 178.294 48.104  1.00 102.15 ? 65  LYS C N   1 
ATOM   6171 C  CA  . LYS C 3 45  ? 175.420 178.992 46.930  1.00 109.96 ? 65  LYS C CA  1 
ATOM   6172 C  C   . LYS C 3 45  ? 175.987 180.337 47.351  1.00 114.75 ? 65  LYS C C   1 
ATOM   6173 O  O   . LYS C 3 45  ? 175.297 181.134 47.994  1.00 132.51 ? 65  LYS C O   1 
ATOM   6174 C  CB  . LYS C 3 45  ? 174.316 179.197 45.889  1.00 133.26 ? 65  LYS C CB  1 
ATOM   6175 C  CG  . LYS C 3 45  ? 174.759 179.999 44.676  1.00 149.29 ? 65  LYS C CG  1 
ATOM   6176 C  CD  . LYS C 3 45  ? 173.617 180.188 43.694  1.00 152.54 ? 65  LYS C CD  1 
ATOM   6177 C  CE  . LYS C 3 45  ? 174.055 180.995 42.484  1.00 149.99 ? 65  LYS C CE  1 
ATOM   6178 N  NZ  . LYS C 3 45  ? 172.942 181.158 41.511  1.00 144.75 ? 65  LYS C NZ  1 
ATOM   6179 N  N   . LEU C 3 46  ? 177.243 180.578 46.989  1.00 108.27 ? 66  LEU C N   1 
ATOM   6180 C  CA  . LEU C 3 46  ? 177.907 181.829 47.325  1.00 105.13 ? 66  LEU C CA  1 
ATOM   6181 C  C   . LEU C 3 46  ? 177.286 182.998 46.572  1.00 99.01  ? 66  LEU C C   1 
ATOM   6182 O  O   . LEU C 3 46  ? 177.135 182.951 45.348  1.00 99.14  ? 66  LEU C O   1 
ATOM   6183 C  CB  . LEU C 3 46  ? 179.397 181.736 47.006  1.00 116.96 ? 66  LEU C CB  1 
ATOM   6184 C  CG  . LEU C 3 46  ? 180.192 183.024 47.218  1.00 104.54 ? 66  LEU C CG  1 
ATOM   6185 C  CD1 . LEU C 3 46  ? 180.176 183.445 48.679  1.00 105.04 ? 66  LEU C CD1 1 
ATOM   6186 C  CD2 . LEU C 3 46  ? 181.614 182.851 46.720  1.00 101.85 ? 66  LEU C CD2 1 
ATOM   6187 N  N   . LEU C 3 47  ? 176.916 184.047 47.305  1.00 101.57 ? 67  LEU C N   1 
ATOM   6188 C  CA  . LEU C 3 47  ? 176.362 185.250 46.698  1.00 123.30 ? 67  LEU C CA  1 
ATOM   6189 C  C   . LEU C 3 47  ? 177.275 186.455 46.854  1.00 105.11 ? 67  LEU C C   1 
ATOM   6190 O  O   . LEU C 3 47  ? 177.615 187.104 45.860  1.00 105.50 ? 67  LEU C O   1 
ATOM   6191 C  CB  . LEU C 3 47  ? 174.983 185.582 47.290  1.00 128.64 ? 67  LEU C CB  1 
ATOM   6192 C  CG  . LEU C 3 47  ? 173.824 184.615 47.064  1.00 143.81 ? 67  LEU C CG  1 
ATOM   6193 C  CD1 . LEU C 3 47  ? 172.523 185.265 47.515  1.00 114.88 ? 67  LEU C CD1 1 
ATOM   6194 C  CD2 . LEU C 3 47  ? 173.746 184.188 45.606  1.00 130.05 ? 67  LEU C CD2 1 
ATOM   6195 N  N   . ILE C 3 48  ? 177.695 186.769 48.077  1.00 129.37 ? 68  ILE C N   1 
ATOM   6196 C  CA  . ILE C 3 48  ? 178.523 187.939 48.343  1.00 147.88 ? 68  ILE C CA  1 
ATOM   6197 C  C   . ILE C 3 48  ? 179.839 187.486 48.959  1.00 152.70 ? 68  ILE C C   1 
ATOM   6198 O  O   . ILE C 3 48  ? 179.877 186.516 49.723  1.00 152.24 ? 68  ILE C O   1 
ATOM   6199 C  CB  . ILE C 3 48  ? 177.799 188.940 49.271  1.00 110.40 ? 68  ILE C CB  1 
ATOM   6200 C  CG1 . ILE C 3 48  ? 176.493 189.413 48.635  1.00 114.21 ? 68  ILE C CG1 1 
ATOM   6201 C  CG2 . ILE C 3 48  ? 178.675 190.143 49.575  1.00 111.64 ? 68  ILE C CG2 1 
ATOM   6202 C  CD1 . ILE C 3 48  ? 176.687 190.148 47.328  1.00 115.61 ? 68  ILE C CD1 1 
ATOM   6203 N  N   . TYR C 3 49  ? 180.922 188.178 48.611  1.00 150.82 ? 69  TYR C N   1 
ATOM   6204 C  CA  . TYR C 3 49  ? 182.217 187.943 49.226  1.00 138.81 ? 69  TYR C CA  1 
ATOM   6205 C  C   . TYR C 3 49  ? 182.879 189.288 49.483  1.00 135.62 ? 69  TYR C C   1 
ATOM   6206 O  O   . TYR C 3 49  ? 182.703 190.238 48.716  1.00 138.49 ? 69  TYR C O   1 
ATOM   6207 C  CB  . TYR C 3 49  ? 183.110 187.047 48.350  1.00 130.55 ? 69  TYR C CB  1 
ATOM   6208 C  CG  . TYR C 3 49  ? 183.702 187.738 47.141  1.00 132.86 ? 69  TYR C CG  1 
ATOM   6209 C  CD1 . TYR C 3 49  ? 182.954 187.920 45.986  1.00 161.85 ? 69  TYR C CD1 1 
ATOM   6210 C  CD2 . TYR C 3 49  ? 185.013 188.194 47.149  1.00 134.52 ? 69  TYR C CD2 1 
ATOM   6211 C  CE1 . TYR C 3 49  ? 183.491 188.548 44.878  1.00 175.37 ? 69  TYR C CE1 1 
ATOM   6212 C  CE2 . TYR C 3 49  ? 185.558 188.823 46.046  1.00 158.51 ? 69  TYR C CE2 1 
ATOM   6213 C  CZ  . TYR C 3 49  ? 184.793 188.997 44.913  1.00 176.51 ? 69  TYR C CZ  1 
ATOM   6214 O  OH  . TYR C 3 49  ? 185.331 189.622 43.812  1.00 187.41 ? 69  TYR C OH  1 
ATOM   6215 N  N   . SER C 3 50  ? 183.627 189.362 50.585  1.00 130.73 ? 70  SER C N   1 
ATOM   6216 C  CA  . SER C 3 50  ? 184.296 190.588 51.020  1.00 135.73 ? 70  SER C CA  1 
ATOM   6217 C  C   . SER C 3 50  ? 183.298 191.741 51.159  1.00 135.19 ? 70  SER C C   1 
ATOM   6218 O  O   . SER C 3 50  ? 183.358 192.745 50.446  1.00 148.54 ? 70  SER C O   1 
ATOM   6219 C  CB  . SER C 3 50  ? 185.447 190.954 50.077  1.00 137.93 ? 70  SER C CB  1 
ATOM   6220 O  OG  . SER C 3 50  ? 186.432 189.934 50.067  1.00 100.89 ? 70  SER C OG  1 
ATOM   6221 N  N   . ALA C 3 51  ? 182.355 191.559 52.085  1.00 132.69 ? 71  ALA C N   1 
ATOM   6222 C  CA  . ALA C 3 51  ? 181.373 192.578 52.448  1.00 158.89 ? 71  ALA C CA  1 
ATOM   6223 C  C   . ALA C 3 51  ? 180.454 192.970 51.295  1.00 165.10 ? 71  ALA C C   1 
ATOM   6224 O  O   . ALA C 3 51  ? 179.246 192.718 51.348  1.00 150.51 ? 71  ALA C O   1 
ATOM   6225 C  CB  . ALA C 3 51  ? 182.076 193.823 53.000  1.00 174.40 ? 71  ALA C CB  1 
ATOM   6226 N  N   . SER C 3 52  ? 181.009 193.600 50.257  1.00 165.38 ? 72  SER C N   1 
ATOM   6227 C  CA  . SER C 3 52  ? 180.211 194.217 49.203  1.00 164.46 ? 72  SER C CA  1 
ATOM   6228 C  C   . SER C 3 52  ? 180.361 193.573 47.832  1.00 153.13 ? 72  SER C C   1 
ATOM   6229 O  O   . SER C 3 52  ? 179.428 193.648 47.030  1.00 156.41 ? 72  SER C O   1 
ATOM   6230 C  CB  . SER C 3 52  ? 180.554 195.708 49.083  1.00 159.49 ? 72  SER C CB  1 
ATOM   6231 O  OG  . SER C 3 52  ? 181.922 195.895 48.764  1.00 146.46 ? 72  SER C OG  1 
ATOM   6232 N  N   . TYR C 3 53  ? 181.503 192.957 47.536  1.00 135.40 ? 73  TYR C N   1 
ATOM   6233 C  CA  . TYR C 3 53  ? 181.742 192.431 46.198  1.00 119.66 ? 73  TYR C CA  1 
ATOM   6234 C  C   . TYR C 3 53  ? 180.814 191.266 45.875  1.00 108.65 ? 73  TYR C C   1 
ATOM   6235 O  O   . TYR C 3 53  ? 180.579 190.383 46.703  1.00 107.21 ? 73  TYR C O   1 
ATOM   6236 C  CB  . TYR C 3 53  ? 183.200 191.994 46.042  1.00 115.34 ? 73  TYR C CB  1 
ATOM   6237 C  CG  . TYR C 3 53  ? 184.193 193.133 46.095  1.00 149.85 ? 73  TYR C CG  1 
ATOM   6238 C  CD1 . TYR C 3 53  ? 184.491 193.868 44.955  1.00 168.93 ? 73  TYR C CD1 1 
ATOM   6239 C  CD2 . TYR C 3 53  ? 184.838 193.470 47.278  1.00 148.10 ? 73  TYR C CD2 1 
ATOM   6240 C  CE1 . TYR C 3 53  ? 185.396 194.910 44.990  1.00 176.03 ? 73  TYR C CE1 1 
ATOM   6241 C  CE2 . TYR C 3 53  ? 185.748 194.511 47.323  1.00 159.27 ? 73  TYR C CE2 1 
ATOM   6242 C  CZ  . TYR C 3 53  ? 186.022 195.227 46.175  1.00 174.91 ? 73  TYR C CZ  1 
ATOM   6243 O  OH  . TYR C 3 53  ? 186.925 196.264 46.210  1.00 186.98 ? 73  TYR C OH  1 
ATOM   6244 N  N   . ARG C 3 54  ? 180.265 191.290 44.664  1.00 117.06 ? 74  ARG C N   1 
ATOM   6245 C  CA  . ARG C 3 54  ? 179.412 190.224 44.164  1.00 116.20 ? 74  ARG C CA  1 
ATOM   6246 C  C   . ARG C 3 54  ? 180.251 189.195 43.421  1.00 117.59 ? 74  ARG C C   1 
ATOM   6247 O  O   . ARG C 3 54  ? 181.277 189.520 42.818  1.00 135.12 ? 74  ARG C O   1 
ATOM   6248 C  CB  . ARG C 3 54  ? 178.336 190.775 43.225  1.00 122.03 ? 74  ARG C CB  1 
ATOM   6249 C  CG  . ARG C 3 54  ? 177.524 191.927 43.786  1.00 154.50 ? 74  ARG C CG  1 
ATOM   6250 C  CD  . ARG C 3 54  ? 176.449 192.356 42.798  1.00 169.45 ? 74  ARG C CD  1 
ATOM   6251 N  NE  . ARG C 3 54  ? 175.722 193.536 43.255  1.00 182.16 ? 74  ARG C NE  1 
ATOM   6252 C  CZ  . ARG C 3 54  ? 176.015 194.780 42.892  1.00 195.68 ? 74  ARG C CZ  1 
ATOM   6253 N  NH1 . ARG C 3 54  ? 177.023 195.010 42.062  1.00 204.21 ? 74  ARG C NH1 1 
ATOM   6254 N  NH2 . ARG C 3 54  ? 175.299 195.794 43.358  1.00 200.83 ? 74  ARG C NH2 1 
ATOM   6255 N  N   . TYR C 3 55  ? 179.807 187.945 43.470  1.00 102.77 ? 75  TYR C N   1 
ATOM   6256 C  CA  . TYR C 3 55  ? 180.483 186.875 42.756  1.00 121.10 ? 75  TYR C CA  1 
ATOM   6257 C  C   . TYR C 3 55  ? 179.931 186.776 41.336  1.00 148.66 ? 75  TYR C C   1 
ATOM   6258 O  O   . TYR C 3 55  ? 178.845 187.274 41.030  1.00 162.61 ? 75  TYR C O   1 
ATOM   6259 C  CB  . TYR C 3 55  ? 180.319 185.553 43.507  1.00 97.63  ? 75  TYR C CB  1 
ATOM   6260 C  CG  . TYR C 3 55  ? 181.199 184.431 43.009  1.00 95.73  ? 75  TYR C CG  1 
ATOM   6261 C  CD1 . TYR C 3 55  ? 182.555 184.410 43.304  1.00 97.21  ? 75  TYR C CD1 1 
ATOM   6262 C  CD2 . TYR C 3 55  ? 180.674 183.380 42.269  1.00 114.31 ? 75  TYR C CD2 1 
ATOM   6263 C  CE1 . TYR C 3 55  ? 183.368 183.384 42.863  1.00 94.27  ? 75  TYR C CE1 1 
ATOM   6264 C  CE2 . TYR C 3 55  ? 181.481 182.347 41.823  1.00 124.92 ? 75  TYR C CE2 1 
ATOM   6265 C  CZ  . TYR C 3 55  ? 182.827 182.355 42.125  1.00 121.11 ? 75  TYR C CZ  1 
ATOM   6266 O  OH  . TYR C 3 55  ? 183.635 181.335 41.685  1.00 125.73 ? 75  TYR C OH  1 
ATOM   6267 N  N   . THR C 3 56  ? 180.700 186.130 40.461  1.00 170.39 ? 76  THR C N   1 
ATOM   6268 C  CA  . THR C 3 56  ? 180.288 185.988 39.070  1.00 176.20 ? 76  THR C CA  1 
ATOM   6269 C  C   . THR C 3 56  ? 179.046 185.111 38.975  1.00 164.88 ? 76  THR C C   1 
ATOM   6270 O  O   . THR C 3 56  ? 178.965 184.058 39.616  1.00 157.08 ? 76  THR C O   1 
ATOM   6271 C  CB  . THR C 3 56  ? 181.415 185.388 38.231  1.00 190.27 ? 76  THR C CB  1 
ATOM   6272 O  OG1 . THR C 3 56  ? 181.788 184.112 38.768  1.00 187.51 ? 76  THR C OG1 1 
ATOM   6273 C  CG2 . THR C 3 56  ? 182.628 186.306 38.228  1.00 200.37 ? 76  THR C CG2 1 
ATOM   6274 N  N   . GLY C 3 57  ? 178.076 185.550 38.179  1.00 170.35 ? 77  GLY C N   1 
ATOM   6275 C  CA  . GLY C 3 57  ? 176.842 184.805 38.038  1.00 173.33 ? 77  GLY C CA  1 
ATOM   6276 C  C   . GLY C 3 57  ? 175.817 185.100 39.105  1.00 165.61 ? 77  GLY C C   1 
ATOM   6277 O  O   . GLY C 3 57  ? 175.023 184.219 39.452  1.00 168.77 ? 77  GLY C O   1 
ATOM   6278 N  N   . VAL C 3 58  ? 175.812 186.314 39.644  1.00 147.56 ? 78  VAL C N   1 
ATOM   6279 C  CA  . VAL C 3 58  ? 174.872 186.724 40.679  1.00 150.76 ? 78  VAL C CA  1 
ATOM   6280 C  C   . VAL C 3 58  ? 174.114 187.943 40.181  1.00 140.30 ? 78  VAL C C   1 
ATOM   6281 O  O   . VAL C 3 58  ? 174.738 188.907 39.731  1.00 142.03 ? 78  VAL C O   1 
ATOM   6282 C  CB  . VAL C 3 58  ? 175.573 187.041 42.014  1.00 167.75 ? 78  VAL C CB  1 
ATOM   6283 C  CG1 . VAL C 3 58  ? 174.582 187.614 43.016  1.00 176.29 ? 78  VAL C CG1 1 
ATOM   6284 C  CG2 . VAL C 3 58  ? 176.240 185.792 42.570  1.00 173.80 ? 78  VAL C CG2 1 
ATOM   6285 N  N   . PRO C 3 59  ? 172.780 187.936 40.217  1.00 128.78 ? 79  PRO C N   1 
ATOM   6286 C  CA  . PRO C 3 59  ? 172.004 189.095 39.761  1.00 153.84 ? 79  PRO C CA  1 
ATOM   6287 C  C   . PRO C 3 59  ? 172.394 190.373 40.492  1.00 149.59 ? 79  PRO C C   1 
ATOM   6288 O  O   . PRO C 3 59  ? 172.970 190.353 41.583  1.00 150.52 ? 79  PRO C O   1 
ATOM   6289 C  CB  . PRO C 3 59  ? 170.557 188.697 40.072  1.00 166.21 ? 79  PRO C CB  1 
ATOM   6290 C  CG  . PRO C 3 59  ? 170.575 187.203 40.036  1.00 161.32 ? 79  PRO C CG  1 
ATOM   6291 C  CD  . PRO C 3 59  ? 171.914 186.807 40.598  1.00 135.41 ? 79  PRO C CD  1 
ATOM   6292 N  N   . ASP C 3 60  ? 172.053 191.503 39.875  1.00 178.30 ? 80  ASP C N   1 
ATOM   6293 C  CA  . ASP C 3 60  ? 172.412 192.809 40.411  1.00 191.55 ? 80  ASP C CA  1 
ATOM   6294 C  C   . ASP C 3 60  ? 171.545 193.211 41.596  1.00 192.37 ? 80  ASP C C   1 
ATOM   6295 O  O   . ASP C 3 60  ? 171.890 194.165 42.302  1.00 181.65 ? 80  ASP C O   1 
ATOM   6296 C  CB  . ASP C 3 60  ? 172.301 193.874 39.316  1.00 211.03 ? 80  ASP C CB  1 
ATOM   6297 C  CG  . ASP C 3 60  ? 173.171 193.567 38.114  1.00 216.26 ? 80  ASP C CG  1 
ATOM   6298 O  OD1 . ASP C 3 60  ? 174.343 194.001 38.098  1.00 217.92 ? 80  ASP C OD1 1 
ATOM   6299 O  OD2 . ASP C 3 60  ? 172.678 192.894 37.184  1.00 210.83 ? 80  ASP C OD2 1 
ATOM   6300 N  N   . ARG C 3 61  ? 170.432 192.511 41.821  1.00 188.06 ? 81  ARG C N   1 
ATOM   6301 C  CA  . ARG C 3 61  ? 169.504 192.854 42.891  1.00 182.39 ? 81  ARG C CA  1 
ATOM   6302 C  C   . ARG C 3 61  ? 170.039 192.491 44.273  1.00 179.34 ? 81  ARG C C   1 
ATOM   6303 O  O   . ARG C 3 61  ? 169.519 192.998 45.273  1.00 180.81 ? 81  ARG C O   1 
ATOM   6304 C  CB  . ARG C 3 61  ? 168.156 192.173 42.639  1.00 166.29 ? 81  ARG C CB  1 
ATOM   6305 C  CG  . ARG C 3 61  ? 168.222 190.654 42.598  1.00 159.19 ? 81  ARG C CG  1 
ATOM   6306 C  CD  . ARG C 3 61  ? 166.842 190.037 42.436  1.00 160.41 ? 81  ARG C CD  1 
ATOM   6307 N  NE  . ARG C 3 61  ? 166.903 188.578 42.400  1.00 152.26 ? 81  ARG C NE  1 
ATOM   6308 C  CZ  . ARG C 3 61  ? 167.011 187.862 41.285  1.00 168.90 ? 81  ARG C CZ  1 
ATOM   6309 N  NH1 . ARG C 3 61  ? 167.070 188.470 40.108  1.00 192.55 ? 81  ARG C NH1 1 
ATOM   6310 N  NH2 . ARG C 3 61  ? 167.059 186.537 41.344  1.00 141.22 ? 81  ARG C NH2 1 
ATOM   6311 N  N   . PHE C 3 62  ? 171.052 191.627 44.355  1.00 171.78 ? 82  PHE C N   1 
ATOM   6312 C  CA  . PHE C 3 62  ? 171.660 191.251 45.628  1.00 132.89 ? 82  PHE C CA  1 
ATOM   6313 C  C   . PHE C 3 62  ? 172.863 192.145 45.907  1.00 131.53 ? 82  PHE C C   1 
ATOM   6314 O  O   . PHE C 3 62  ? 173.819 192.164 45.124  1.00 128.44 ? 82  PHE C O   1 
ATOM   6315 C  CB  . PHE C 3 62  ? 172.111 189.792 45.607  1.00 127.11 ? 82  PHE C CB  1 
ATOM   6316 C  CG  . PHE C 3 62  ? 171.020 188.821 45.290  1.00 128.16 ? 82  PHE C CG  1 
ATOM   6317 C  CD1 . PHE C 3 62  ? 170.135 188.407 46.268  1.00 161.89 ? 82  PHE C CD1 1 
ATOM   6318 C  CD2 . PHE C 3 62  ? 170.887 188.312 44.010  1.00 152.35 ? 82  PHE C CD2 1 
ATOM   6319 C  CE1 . PHE C 3 62  ? 169.132 187.505 45.975  1.00 162.34 ? 82  PHE C CE1 1 
ATOM   6320 C  CE2 . PHE C 3 62  ? 169.887 187.411 43.710  1.00 163.84 ? 82  PHE C CE2 1 
ATOM   6321 C  CZ  . PHE C 3 62  ? 169.008 187.007 44.693  1.00 171.22 ? 82  PHE C CZ  1 
ATOM   6322 N  N   . THR C 3 63  ? 172.816 192.889 47.011  1.00 143.98 ? 83  THR C N   1 
ATOM   6323 C  CA  . THR C 3 63  ? 173.920 193.748 47.413  1.00 152.84 ? 83  THR C CA  1 
ATOM   6324 C  C   . THR C 3 63  ? 174.402 193.388 48.816  1.00 139.76 ? 83  THR C C   1 
ATOM   6325 O  O   . THR C 3 63  ? 173.763 192.627 49.555  1.00 131.37 ? 83  THR C O   1 
ATOM   6326 C  CB  . THR C 3 63  ? 173.521 195.229 47.358  1.00 167.62 ? 83  THR C CB  1 
ATOM   6327 O  OG1 . THR C 3 63  ? 172.423 195.465 48.248  1.00 185.55 ? 83  THR C OG1 1 
ATOM   6328 C  CG2 . THR C 3 63  ? 173.120 195.624 45.944  1.00 187.85 ? 83  THR C CG2 1 
ATOM   6329 N  N   . GLY C 3 64  ? 175.511 194.021 49.197  1.00 148.83 ? 84  GLY C N   1 
ATOM   6330 C  CA  . GLY C 3 64  ? 176.131 193.842 50.496  1.00 168.26 ? 84  GLY C CA  1 
ATOM   6331 C  C   . GLY C 3 64  ? 176.826 195.083 51.021  1.00 166.02 ? 84  GLY C C   1 
ATOM   6332 O  O   . GLY C 3 64  ? 177.418 195.842 50.247  1.00 140.30 ? 84  GLY C O   1 
ATOM   6333 N  N   . SER C 3 65  ? 176.749 195.310 52.331  1.00 192.15 ? 85  SER C N   1 
ATOM   6334 C  CA  . SER C 3 65  ? 177.370 196.473 52.949  1.00 205.14 ? 85  SER C CA  1 
ATOM   6335 C  C   . SER C 3 65  ? 177.764 196.119 54.377  1.00 205.73 ? 85  SER C C   1 
ATOM   6336 O  O   . SER C 3 65  ? 177.332 195.105 54.931  1.00 211.01 ? 85  SER C O   1 
ATOM   6337 C  CB  . SER C 3 65  ? 176.438 197.690 52.922  1.00 220.08 ? 85  SER C CB  1 
ATOM   6338 O  OG  . SER C 3 65  ? 175.218 197.416 53.590  1.00 230.72 ? 85  SER C OG  1 
ATOM   6339 N  N   . GLY C 3 66  ? 178.597 196.973 54.971  1.00 173.85 ? 86  GLY C N   1 
ATOM   6340 C  CA  . GLY C 3 66  ? 179.068 196.778 56.331  1.00 168.33 ? 86  GLY C CA  1 
ATOM   6341 C  C   . GLY C 3 66  ? 180.582 196.724 56.411  1.00 155.40 ? 86  GLY C C   1 
ATOM   6342 O  O   . GLY C 3 66  ? 181.234 196.271 55.466  1.00 138.31 ? 86  GLY C O   1 
ATOM   6343 N  N   . SER C 3 67  ? 181.159 197.170 57.533  1.00 179.64 ? 87  SER C N   1 
ATOM   6344 C  CA  . SER C 3 67  ? 182.616 197.155 57.689  1.00 176.85 ? 87  SER C CA  1 
ATOM   6345 C  C   . SER C 3 67  ? 182.967 197.161 59.178  1.00 158.78 ? 87  SER C C   1 
ATOM   6346 O  O   . SER C 3 67  ? 183.022 198.228 59.795  1.00 160.82 ? 87  SER C O   1 
ATOM   6347 C  CB  . SER C 3 67  ? 183.250 198.335 56.972  1.00 197.41 ? 87  SER C CB  1 
ATOM   6348 O  OG  . SER C 3 67  ? 184.659 198.315 57.118  1.00 207.79 ? 87  SER C OG  1 
ATOM   6349 N  N   . GLY C 3 68  ? 183.221 195.977 59.731  1.00 147.84 ? 88  GLY C N   1 
ATOM   6350 C  CA  . GLY C 3 68  ? 183.566 195.848 61.136  1.00 162.15 ? 88  GLY C CA  1 
ATOM   6351 C  C   . GLY C 3 68  ? 182.999 194.605 61.790  1.00 167.61 ? 88  GLY C C   1 
ATOM   6352 O  O   . GLY C 3 68  ? 183.569 193.519 61.654  1.00 175.00 ? 88  GLY C O   1 
ATOM   6353 N  N   . THR C 3 69  ? 181.883 194.742 62.500  1.00 177.48 ? 89  THR C N   1 
ATOM   6354 C  CA  . THR C 3 69  ? 181.255 193.614 63.173  1.00 185.26 ? 89  THR C CA  1 
ATOM   6355 C  C   . THR C 3 69  ? 179.818 193.389 62.742  1.00 193.92 ? 89  THR C C   1 
ATOM   6356 O  O   . THR C 3 69  ? 179.368 192.241 62.712  1.00 198.95 ? 89  THR C O   1 
ATOM   6357 C  CB  . THR C 3 69  ? 181.285 193.800 64.698  1.00 189.68 ? 89  THR C CB  1 
ATOM   6358 O  OG1 . THR C 3 69  ? 180.611 195.015 65.047  1.00 197.78 ? 89  THR C OG1 1 
ATOM   6359 C  CG2 . THR C 3 69  ? 182.718 193.857 65.201  1.00 188.80 ? 89  THR C CG2 1 
ATOM   6360 N  N   . ASP C 3 70  ? 179.088 194.451 62.419  1.00 175.30 ? 90  ASP C N   1 
ATOM   6361 C  CA  . ASP C 3 70  ? 177.709 194.363 61.967  1.00 170.44 ? 90  ASP C CA  1 
ATOM   6362 C  C   . ASP C 3 70  ? 177.708 194.509 60.452  1.00 141.97 ? 90  ASP C C   1 
ATOM   6363 O  O   . ASP C 3 70  ? 178.269 195.472 59.919  1.00 149.80 ? 90  ASP C O   1 
ATOM   6364 C  CB  . ASP C 3 70  ? 176.844 195.439 62.625  1.00 174.77 ? 90  ASP C CB  1 
ATOM   6365 C  CG  . ASP C 3 70  ? 176.878 195.365 64.142  1.00 178.60 ? 90  ASP C CG  1 
ATOM   6366 O  OD1 . ASP C 3 70  ? 177.006 194.246 64.685  1.00 183.15 ? 90  ASP C OD1 1 
ATOM   6367 O  OD2 . ASP C 3 70  ? 176.780 196.427 64.792  1.00 165.51 ? 90  ASP C OD2 1 
ATOM   6368 N  N   . PHE C 3 71  ? 177.093 193.553 59.764  1.00 146.20 ? 91  PHE C N   1 
ATOM   6369 C  CA  . PHE C 3 71  ? 177.057 193.546 58.311  1.00 172.16 ? 91  PHE C CA  1 
ATOM   6370 C  C   . PHE C 3 71  ? 175.624 193.364 57.836  1.00 200.99 ? 91  PHE C C   1 
ATOM   6371 O  O   . PHE C 3 71  ? 174.776 192.821 58.547  1.00 224.36 ? 91  PHE C O   1 
ATOM   6372 C  CB  . PHE C 3 71  ? 177.968 192.452 57.742  1.00 164.95 ? 91  PHE C CB  1 
ATOM   6373 C  CG  . PHE C 3 71  ? 179.426 192.694 58.007  1.00 175.98 ? 91  PHE C CG  1 
ATOM   6374 C  CD1 . PHE C 3 71  ? 179.997 192.320 59.213  1.00 185.48 ? 91  PHE C CD1 1 
ATOM   6375 C  CD2 . PHE C 3 71  ? 180.222 193.311 57.058  1.00 174.21 ? 91  PHE C CD2 1 
ATOM   6376 C  CE1 . PHE C 3 71  ? 181.337 192.552 59.463  1.00 189.67 ? 91  PHE C CE1 1 
ATOM   6377 C  CE2 . PHE C 3 71  ? 181.563 193.542 57.301  1.00 178.73 ? 91  PHE C CE2 1 
ATOM   6378 C  CZ  . PHE C 3 71  ? 182.120 193.162 58.505  1.00 179.39 ? 91  PHE C CZ  1 
ATOM   6379 N  N   . THR C 3 72  ? 175.356 193.834 56.619  1.00 210.67 ? 92  THR C N   1 
ATOM   6380 C  CA  . THR C 3 72  ? 174.004 193.839 56.079  1.00 209.02 ? 92  THR C CA  1 
ATOM   6381 C  C   . THR C 3 72  ? 173.998 193.321 54.648  1.00 189.05 ? 92  THR C C   1 
ATOM   6382 O  O   . THR C 3 72  ? 174.782 193.779 53.810  1.00 190.25 ? 92  THR C O   1 
ATOM   6383 C  CB  . THR C 3 72  ? 173.411 195.252 56.126  1.00 215.53 ? 92  THR C CB  1 
ATOM   6384 O  OG1 . THR C 3 72  ? 173.461 195.751 57.469  1.00 215.55 ? 92  THR C OG1 1 
ATOM   6385 C  CG2 . THR C 3 72  ? 171.971 195.244 55.648  1.00 226.32 ? 92  THR C CG2 1 
ATOM   6386 N  N   . PHE C 3 73  ? 173.116 192.359 54.387  1.00 178.19 ? 93  PHE C N   1 
ATOM   6387 C  CA  . PHE C 3 73  ? 172.856 191.814 53.058  1.00 168.03 ? 93  PHE C CA  1 
ATOM   6388 C  C   . PHE C 3 73  ? 171.510 192.342 52.585  1.00 162.42 ? 93  PHE C C   1 
ATOM   6389 O  O   . PHE C 3 73  ? 170.484 192.084 53.226  1.00 159.91 ? 93  PHE C O   1 
ATOM   6390 C  CB  . PHE C 3 73  ? 172.861 190.287 53.076  1.00 149.08 ? 93  PHE C CB  1 
ATOM   6391 C  CG  . PHE C 3 73  ? 172.508 189.665 51.757  1.00 141.70 ? 93  PHE C CG  1 
ATOM   6392 C  CD1 . PHE C 3 73  ? 173.441 189.586 50.738  1.00 124.18 ? 93  PHE C CD1 1 
ATOM   6393 C  CD2 . PHE C 3 73  ? 171.244 189.141 51.543  1.00 130.40 ? 93  PHE C CD2 1 
ATOM   6394 C  CE1 . PHE C 3 73  ? 173.114 189.010 49.525  1.00 122.84 ? 93  PHE C CE1 1 
ATOM   6395 C  CE2 . PHE C 3 73  ? 170.913 188.561 50.335  1.00 129.07 ? 93  PHE C CE2 1 
ATOM   6396 C  CZ  . PHE C 3 73  ? 171.849 188.496 49.324  1.00 125.30 ? 93  PHE C CZ  1 
ATOM   6397 N  N   . THR C 3 74  ? 171.502 193.070 51.469  1.00 157.34 ? 94  THR C N   1 
ATOM   6398 C  CA  . THR C 3 74  ? 170.296 193.766 51.037  1.00 163.10 ? 94  THR C CA  1 
ATOM   6399 C  C   . THR C 3 74  ? 169.780 193.212 49.716  1.00 147.29 ? 94  THR C C   1 
ATOM   6400 O  O   . THR C 3 74  ? 170.555 193.004 48.778  1.00 143.19 ? 94  THR C O   1 
ATOM   6401 C  CB  . THR C 3 74  ? 170.563 195.270 50.900  1.00 154.24 ? 94  THR C CB  1 
ATOM   6402 O  OG1 . THR C 3 74  ? 171.140 195.768 52.114  1.00 153.19 ? 94  THR C OG1 1 
ATOM   6403 C  CG2 . THR C 3 74  ? 169.270 196.024 50.619  1.00 174.43 ? 94  THR C CG2 1 
ATOM   6404 N  N   . ILE C 3 75  ? 168.475 192.952 49.661  1.00 167.77 ? 95  ILE C N   1 
ATOM   6405 C  CA  . ILE C 3 75  ? 167.771 192.570 48.441  1.00 164.07 ? 95  ILE C CA  1 
ATOM   6406 C  C   . ILE C 3 75  ? 166.756 193.665 48.142  1.00 184.76 ? 95  ILE C C   1 
ATOM   6407 O  O   . ILE C 3 75  ? 165.915 193.994 48.994  1.00 211.56 ? 95  ILE C O   1 
ATOM   6408 C  CB  . ILE C 3 75  ? 167.077 191.204 48.560  1.00 150.91 ? 95  ILE C CB  1 
ATOM   6409 C  CG1 . ILE C 3 75  ? 168.085 190.105 48.883  1.00 143.30 ? 95  ILE C CG1 1 
ATOM   6410 C  CG2 . ILE C 3 75  ? 166.352 190.866 47.266  1.00 152.66 ? 95  ILE C CG2 1 
ATOM   6411 C  CD1 . ILE C 3 75  ? 167.451 188.738 49.022  1.00 141.71 ? 95  ILE C CD1 1 
ATOM   6412 N  N   . SER C 3 76  ? 166.837 194.226 46.934  1.00 186.92 ? 96  SER C N   1 
ATOM   6413 C  CA  . SER C 3 76  ? 165.959 195.319 46.530  1.00 187.62 ? 96  SER C CA  1 
ATOM   6414 C  C   . SER C 3 76  ? 164.580 194.816 46.112  1.00 187.73 ? 96  SER C C   1 
ATOM   6415 O  O   . SER C 3 76  ? 163.567 195.174 46.721  1.00 181.97 ? 96  SER C O   1 
ATOM   6416 C  CB  . SER C 3 76  ? 166.609 196.115 45.394  1.00 196.08 ? 96  SER C CB  1 
ATOM   6417 O  OG  . SER C 3 76  ? 166.887 195.280 44.283  1.00 203.44 ? 96  SER C OG  1 
ATOM   6418 N  N   . SER C 3 77  ? 164.524 193.977 45.078  1.00 207.61 ? 97  SER C N   1 
ATOM   6419 C  CA  . SER C 3 77  ? 163.268 193.427 44.567  1.00 215.69 ? 97  SER C CA  1 
ATOM   6420 C  C   . SER C 3 77  ? 163.208 191.929 44.852  1.00 210.52 ? 97  SER C C   1 
ATOM   6421 O  O   . SER C 3 77  ? 163.858 191.128 44.173  1.00 202.54 ? 97  SER C O   1 
ATOM   6422 C  CB  . SER C 3 77  ? 163.136 193.704 43.071  1.00 222.77 ? 97  SER C CB  1 
ATOM   6423 O  OG  . SER C 3 77  ? 161.908 193.213 42.564  1.00 234.21 ? 97  SER C OG  1 
ATOM   6424 N  N   . VAL C 3 78  ? 162.411 191.558 45.849  1.00 198.65 ? 98  VAL C N   1 
ATOM   6425 C  CA  . VAL C 3 78  ? 162.264 190.163 46.248  1.00 193.54 ? 98  VAL C CA  1 
ATOM   6426 C  C   . VAL C 3 78  ? 161.402 189.436 45.226  1.00 202.14 ? 98  VAL C C   1 
ATOM   6427 O  O   . VAL C 3 78  ? 160.285 189.869 44.917  1.00 225.17 ? 98  VAL C O   1 
ATOM   6428 C  CB  . VAL C 3 78  ? 161.657 190.059 47.656  1.00 197.20 ? 98  VAL C CB  1 
ATOM   6429 C  CG1 . VAL C 3 78  ? 161.528 188.602 48.070  1.00 194.01 ? 98  VAL C CG1 1 
ATOM   6430 C  CG2 . VAL C 3 78  ? 162.508 190.819 48.657  1.00 194.97 ? 98  VAL C CG2 1 
ATOM   6431 N  N   . GLN C 3 79  ? 161.916 188.333 44.696  1.00 187.64 ? 99  GLN C N   1 
ATOM   6432 C  CA  . GLN C 3 79  ? 161.177 187.508 43.753  1.00 167.33 ? 99  GLN C CA  1 
ATOM   6433 C  C   . GLN C 3 79  ? 160.675 186.243 44.444  1.00 165.71 ? 99  GLN C C   1 
ATOM   6434 O  O   . GLN C 3 79  ? 161.081 185.903 45.558  1.00 162.19 ? 99  GLN C O   1 
ATOM   6435 C  CB  . GLN C 3 79  ? 162.044 187.157 42.539  1.00 162.58 ? 99  GLN C CB  1 
ATOM   6436 C  CG  . GLN C 3 79  ? 162.474 188.365 41.718  1.00 164.73 ? 99  GLN C CG  1 
ATOM   6437 C  CD  . GLN C 3 79  ? 163.327 187.987 40.520  1.00 160.35 ? 99  GLN C CD  1 
ATOM   6438 O  OE1 . GLN C 3 79  ? 163.696 186.824 40.346  1.00 159.25 ? 99  GLN C OE1 1 
ATOM   6439 N  NE2 . GLN C 3 79  ? 163.653 188.974 39.691  1.00 162.58 ? 99  GLN C NE2 1 
ATOM   6440 N  N   . ALA C 3 80  ? 159.786 185.531 43.748  1.00 170.58 ? 100 ALA C N   1 
ATOM   6441 C  CA  . ALA C 3 80  ? 159.220 184.304 44.299  1.00 167.81 ? 100 ALA C CA  1 
ATOM   6442 C  C   . ALA C 3 80  ? 160.276 183.219 44.441  1.00 159.36 ? 100 ALA C C   1 
ATOM   6443 O  O   . ALA C 3 80  ? 160.160 182.351 45.313  1.00 157.35 ? 100 ALA C O   1 
ATOM   6444 C  CB  . ALA C 3 80  ? 158.069 183.814 43.423  1.00 195.70 ? 100 ALA C CB  1 
ATOM   6445 N  N   . GLU C 3 81  ? 161.303 183.251 43.598  1.00 155.87 ? 101 GLU C N   1 
ATOM   6446 C  CA  . GLU C 3 81  ? 162.376 182.269 43.615  1.00 179.68 ? 101 GLU C CA  1 
ATOM   6447 C  C   . GLU C 3 81  ? 163.507 182.656 44.560  1.00 178.68 ? 101 GLU C C   1 
ATOM   6448 O  O   . GLU C 3 81  ? 164.500 181.926 44.651  1.00 140.54 ? 101 GLU C O   1 
ATOM   6449 C  CB  . GLU C 3 81  ? 162.917 182.072 42.195  1.00 181.72 ? 101 GLU C CB  1 
ATOM   6450 C  CG  . GLU C 3 81  ? 163.377 183.357 41.524  1.00 181.34 ? 101 GLU C CG  1 
ATOM   6451 C  CD  . GLU C 3 81  ? 163.867 183.131 40.107  1.00 180.08 ? 101 GLU C CD  1 
ATOM   6452 O  OE1 . GLU C 3 81  ? 163.983 181.957 39.698  1.00 184.36 ? 101 GLU C OE1 1 
ATOM   6453 O  OE2 . GLU C 3 81  ? 164.133 184.127 39.401  1.00 179.21 ? 101 GLU C OE2 1 
ATOM   6454 N  N   . ASP C 3 82  ? 163.378 183.782 45.261  1.00 182.78 ? 102 ASP C N   1 
ATOM   6455 C  CA  . ASP C 3 82  ? 164.356 184.220 46.249  1.00 157.25 ? 102 ASP C CA  1 
ATOM   6456 C  C   . ASP C 3 82  ? 164.140 183.572 47.611  1.00 145.71 ? 102 ASP C C   1 
ATOM   6457 O  O   . ASP C 3 82  ? 164.852 183.907 48.563  1.00 139.19 ? 102 ASP C O   1 
ATOM   6458 C  CB  . ASP C 3 82  ? 164.304 185.743 46.393  1.00 146.25 ? 102 ASP C CB  1 
ATOM   6459 C  CG  . ASP C 3 82  ? 164.889 186.461 45.195  1.00 145.87 ? 102 ASP C CG  1 
ATOM   6460 O  OD1 . ASP C 3 82  ? 165.793 185.900 44.543  1.00 140.66 ? 102 ASP C OD1 1 
ATOM   6461 O  OD2 . ASP C 3 82  ? 164.444 187.590 44.905  1.00 168.79 ? 102 ASP C OD2 1 
ATOM   6462 N  N   . LEU C 3 83  ? 163.173 182.666 47.718  1.00 146.82 ? 103 LEU C N   1 
ATOM   6463 C  CA  . LEU C 3 83  ? 162.870 181.964 48.961  1.00 144.62 ? 103 LEU C CA  1 
ATOM   6464 C  C   . LEU C 3 83  ? 163.981 180.975 49.296  1.00 144.66 ? 103 LEU C C   1 
ATOM   6465 O  O   . LEU C 3 83  ? 164.091 179.918 48.665  1.00 159.05 ? 103 LEU C O   1 
ATOM   6466 C  CB  . LEU C 3 83  ? 161.529 181.251 48.826  1.00 154.34 ? 103 LEU C CB  1 
ATOM   6467 C  CG  . LEU C 3 83  ? 161.089 180.341 49.969  1.00 168.45 ? 103 LEU C CG  1 
ATOM   6468 C  CD1 . LEU C 3 83  ? 160.615 181.155 51.159  1.00 186.39 ? 103 LEU C CD1 1 
ATOM   6469 C  CD2 . LEU C 3 83  ? 159.999 179.412 49.486  1.00 175.31 ? 103 LEU C CD2 1 
ATOM   6470 N  N   . ALA C 3 84  ? 164.801 181.307 50.292  1.00 145.55 ? 104 ALA C N   1 
ATOM   6471 C  CA  . ALA C 3 84  ? 165.905 180.445 50.695  1.00 153.23 ? 104 ALA C CA  1 
ATOM   6472 C  C   . ALA C 3 84  ? 166.390 180.880 52.070  1.00 159.87 ? 104 ALA C C   1 
ATOM   6473 O  O   . ALA C 3 84  ? 165.953 181.897 52.613  1.00 171.36 ? 104 ALA C O   1 
ATOM   6474 C  CB  . ALA C 3 84  ? 167.048 180.484 49.676  1.00 157.63 ? 104 ALA C CB  1 
ATOM   6475 N  N   . VAL C 3 85  ? 167.309 180.094 52.627  1.00 146.80 ? 105 VAL C N   1 
ATOM   6476 C  CA  . VAL C 3 85  ? 167.952 180.407 53.900  1.00 150.16 ? 105 VAL C CA  1 
ATOM   6477 C  C   . VAL C 3 85  ? 169.303 181.055 53.638  1.00 148.43 ? 105 VAL C C   1 
ATOM   6478 O  O   . VAL C 3 85  ? 170.129 180.509 52.896  1.00 167.99 ? 105 VAL C O   1 
ATOM   6479 C  CB  . VAL C 3 85  ? 168.111 179.146 54.765  1.00 161.67 ? 105 VAL C CB  1 
ATOM   6480 C  CG1 . VAL C 3 85  ? 168.720 179.502 56.112  1.00 166.86 ? 105 VAL C CG1 1 
ATOM   6481 C  CG2 . VAL C 3 85  ? 166.770 178.448 54.937  1.00 175.43 ? 105 VAL C CG2 1 
ATOM   6482 N  N   . TYR C 3 86  ? 169.533 182.215 54.245  1.00 145.07 ? 106 TYR C N   1 
ATOM   6483 C  CA  . TYR C 3 86  ? 170.743 182.990 54.009  1.00 149.98 ? 106 TYR C CA  1 
ATOM   6484 C  C   . TYR C 3 86  ? 171.690 182.851 55.195  1.00 157.73 ? 106 TYR C C   1 
ATOM   6485 O  O   . TYR C 3 86  ? 171.268 182.931 56.353  1.00 160.20 ? 106 TYR C O   1 
ATOM   6486 C  CB  . TYR C 3 86  ? 170.399 184.461 53.761  1.00 134.49 ? 106 TYR C CB  1 
ATOM   6487 C  CG  . TYR C 3 86  ? 169.652 184.672 52.465  1.00 129.67 ? 106 TYR C CG  1 
ATOM   6488 C  CD1 . TYR C 3 86  ? 168.292 184.406 52.377  1.00 136.48 ? 106 TYR C CD1 1 
ATOM   6489 C  CD2 . TYR C 3 86  ? 170.305 185.126 51.328  1.00 127.06 ? 106 TYR C CD2 1 
ATOM   6490 C  CE1 . TYR C 3 86  ? 167.602 184.588 51.196  1.00 141.08 ? 106 TYR C CE1 1 
ATOM   6491 C  CE2 . TYR C 3 86  ? 169.622 185.313 50.139  1.00 148.36 ? 106 TYR C CE2 1 
ATOM   6492 C  CZ  . TYR C 3 86  ? 168.270 185.042 50.081  1.00 157.43 ? 106 TYR C CZ  1 
ATOM   6493 O  OH  . TYR C 3 86  ? 167.580 185.225 48.904  1.00 158.38 ? 106 TYR C OH  1 
ATOM   6494 N  N   . TYR C 3 87  ? 172.972 182.636 54.899  1.00 154.24 ? 107 TYR C N   1 
ATOM   6495 C  CA  . TYR C 3 87  ? 173.997 182.452 55.917  1.00 112.10 ? 107 TYR C CA  1 
ATOM   6496 C  C   . TYR C 3 87  ? 175.116 183.466 55.714  1.00 144.40 ? 107 TYR C C   1 
ATOM   6497 O  O   . TYR C 3 87  ? 175.467 183.788 54.578  1.00 132.33 ? 107 TYR C O   1 
ATOM   6498 C  CB  . TYR C 3 87  ? 174.587 181.039 55.855  1.00 117.89 ? 107 TYR C CB  1 
ATOM   6499 C  CG  . TYR C 3 87  ? 173.620 179.932 56.207  1.00 119.80 ? 107 TYR C CG  1 
ATOM   6500 C  CD1 . TYR C 3 87  ? 173.419 179.542 57.525  1.00 147.87 ? 107 TYR C CD1 1 
ATOM   6501 C  CD2 . TYR C 3 87  ? 172.915 179.267 55.212  1.00 121.94 ? 107 TYR C CD2 1 
ATOM   6502 C  CE1 . TYR C 3 87  ? 172.535 178.524 57.838  1.00 160.30 ? 107 TYR C CE1 1 
ATOM   6503 C  CE2 . TYR C 3 87  ? 172.032 178.253 55.514  1.00 116.46 ? 107 TYR C CE2 1 
ATOM   6504 C  CZ  . TYR C 3 87  ? 171.845 177.884 56.827  1.00 155.87 ? 107 TYR C CZ  1 
ATOM   6505 O  OH  . TYR C 3 87  ? 170.965 176.870 57.126  1.00 158.47 ? 107 TYR C OH  1 
ATOM   6506 N  N   . CYS C 3 88  ? 175.658 183.988 56.810  1.00 159.78 ? 108 CYS C N   1 
ATOM   6507 C  CA  . CYS C 3 88  ? 176.858 184.814 56.769  1.00 168.02 ? 108 CYS C CA  1 
ATOM   6508 C  C   . CYS C 3 88  ? 178.032 184.057 57.381  1.00 160.52 ? 108 CYS C C   1 
ATOM   6509 O  O   . CYS C 3 88  ? 177.860 183.258 58.305  1.00 176.56 ? 108 CYS C O   1 
ATOM   6510 C  CB  . CYS C 3 88  ? 176.642 186.153 57.479  1.00 174.56 ? 108 CYS C CB  1 
ATOM   6511 S  SG  . CYS C 3 88  ? 176.051 186.061 59.177  1.00 188.72 ? 108 CYS C SG  1 
ATOM   6512 N  N   . GLN C 3 89  ? 179.231 184.310 56.855  1.00 149.17 ? 109 GLN C N   1 
ATOM   6513 C  CA  . GLN C 3 89  ? 180.406 183.554 57.275  1.00 149.53 ? 109 GLN C CA  1 
ATOM   6514 C  C   . GLN C 3 89  ? 181.658 184.422 57.224  1.00 147.87 ? 109 GLN C C   1 
ATOM   6515 O  O   . GLN C 3 89  ? 181.885 185.122 56.234  1.00 166.93 ? 109 GLN C O   1 
ATOM   6516 C  CB  . GLN C 3 89  ? 180.575 182.312 56.389  1.00 131.16 ? 109 GLN C CB  1 
ATOM   6517 C  CG  . GLN C 3 89  ? 181.907 181.582 56.519  1.00 140.25 ? 109 GLN C CG  1 
ATOM   6518 C  CD  . GLN C 3 89  ? 182.822 181.798 55.324  1.00 145.79 ? 109 GLN C CD  1 
ATOM   6519 O  OE1 . GLN C 3 89  ? 183.344 182.892 55.116  1.00 175.98 ? 109 GLN C OE1 1 
ATOM   6520 N  NE2 . GLN C 3 89  ? 183.014 180.752 54.528  1.00 135.33 ? 109 GLN C NE2 1 
ATOM   6521 N  N   . GLN C 3 90  ? 182.451 184.394 58.296  1.00 121.97 ? 110 GLN C N   1 
ATOM   6522 C  CA  . GLN C 3 90  ? 183.714 185.124 58.333  1.00 109.11 ? 110 GLN C CA  1 
ATOM   6523 C  C   . GLN C 3 90  ? 184.813 184.302 57.672  1.00 160.42 ? 110 GLN C C   1 
ATOM   6524 O  O   . GLN C 3 90  ? 184.852 183.075 57.808  1.00 155.52 ? 110 GLN C O   1 
ATOM   6525 C  CB  . GLN C 3 90  ? 184.102 185.455 59.775  1.00 131.31 ? 110 GLN C CB  1 
ATOM   6526 C  CG  . GLN C 3 90  ? 184.255 184.232 60.683  1.00 144.77 ? 110 GLN C CG  1 
ATOM   6527 C  CD  . GLN C 3 90  ? 185.688 183.735 60.803  1.00 137.38 ? 110 GLN C CD  1 
ATOM   6528 O  OE1 . GLN C 3 90  ? 186.580 184.184 60.085  1.00 136.40 ? 110 GLN C OE1 1 
ATOM   6529 N  NE2 . GLN C 3 90  ? 185.911 182.800 61.719  1.00 109.64 ? 110 GLN C NE2 1 
ATOM   6530 N  N   . HIS C 3 91  ? 185.722 184.976 56.966  1.00 174.64 ? 111 HIS C N   1 
ATOM   6531 C  CA  . HIS C 3 91  ? 186.812 184.280 56.284  1.00 193.03 ? 111 HIS C CA  1 
ATOM   6532 C  C   . HIS C 3 91  ? 188.164 184.937 56.557  1.00 200.05 ? 111 HIS C C   1 
ATOM   6533 O  O   . HIS C 3 91  ? 188.958 185.172 55.643  1.00 207.90 ? 111 HIS C O   1 
ATOM   6534 C  CB  . HIS C 3 91  ? 186.538 184.179 54.783  1.00 191.11 ? 111 HIS C CB  1 
ATOM   6535 C  CG  . HIS C 3 91  ? 186.451 185.499 54.080  1.00 180.34 ? 111 HIS C CG  1 
ATOM   6536 N  ND1 . HIS C 3 91  ? 187.561 186.264 53.791  1.00 173.36 ? 111 HIS C ND1 1 
ATOM   6537 C  CD2 . HIS C 3 91  ? 185.389 186.178 53.586  1.00 172.69 ? 111 HIS C CD2 1 
ATOM   6538 C  CE1 . HIS C 3 91  ? 187.185 187.361 53.159  1.00 170.04 ? 111 HIS C CE1 1 
ATOM   6539 N  NE2 . HIS C 3 91  ? 185.872 187.334 53.023  1.00 171.84 ? 111 HIS C NE2 1 
ATOM   6540 N  N   . TYR C 3 92  ? 188.466 185.232 57.822  1.00 209.68 ? 112 TYR C N   1 
ATOM   6541 C  CA  . TYR C 3 92  ? 189.780 185.774 58.156  1.00 200.59 ? 112 TYR C CA  1 
ATOM   6542 C  C   . TYR C 3 92  ? 190.540 184.860 59.107  1.00 185.22 ? 112 TYR C C   1 
ATOM   6543 O  O   . TYR C 3 92  ? 191.658 184.444 58.787  1.00 207.63 ? 112 TYR C O   1 
ATOM   6544 C  CB  . TYR C 3 92  ? 189.657 187.189 58.740  1.00 203.10 ? 112 TYR C CB  1 
ATOM   6545 C  CG  . TYR C 3 92  ? 188.855 187.297 60.013  1.00 217.72 ? 112 TYR C CG  1 
ATOM   6546 C  CD1 . TYR C 3 92  ? 187.471 187.331 59.982  1.00 229.79 ? 112 TYR C CD1 1 
ATOM   6547 C  CD2 . TYR C 3 92  ? 189.485 187.399 61.247  1.00 232.87 ? 112 TYR C CD2 1 
ATOM   6548 C  CE1 . TYR C 3 92  ? 186.735 187.438 61.141  1.00 242.29 ? 112 TYR C CE1 1 
ATOM   6549 C  CE2 . TYR C 3 92  ? 188.755 187.509 62.414  1.00 249.55 ? 112 TYR C CE2 1 
ATOM   6550 C  CZ  . TYR C 3 92  ? 187.379 187.531 62.351  1.00 252.73 ? 112 TYR C CZ  1 
ATOM   6551 O  OH  . TYR C 3 92  ? 186.631 187.643 63.496  1.00 257.78 ? 112 TYR C OH  1 
ATOM   6552 N  N   . SER C 3 93  ? 189.979 184.539 60.267  1.00 161.48 ? 113 SER C N   1 
ATOM   6553 C  CA  . SER C 3 93  ? 190.686 183.779 61.284  1.00 150.47 ? 113 SER C CA  1 
ATOM   6554 C  C   . SER C 3 93  ? 190.304 182.309 61.188  1.00 129.48 ? 113 SER C C   1 
ATOM   6555 O  O   . SER C 3 93  ? 189.179 181.963 60.819  1.00 107.60 ? 113 SER C O   1 
ATOM   6556 C  CB  . SER C 3 93  ? 190.383 184.312 62.686  1.00 154.28 ? 113 SER C CB  1 
ATOM   6557 O  OG  . SER C 3 93  ? 191.110 183.595 63.668  1.00 160.68 ? 113 SER C OG  1 
ATOM   6558 N  N   . ILE C 3 94  ? 191.249 181.447 61.538  1.00 131.50 ? 114 ILE C N   1 
ATOM   6559 C  CA  . ILE C 3 94  ? 190.992 180.018 61.607  1.00 141.19 ? 114 ILE C CA  1 
ATOM   6560 C  C   . ILE C 3 94  ? 190.472 179.667 62.995  1.00 165.25 ? 114 ILE C C   1 
ATOM   6561 O  O   . ILE C 3 94  ? 191.067 180.065 63.997  1.00 186.83 ? 114 ILE C O   1 
ATOM   6562 C  CB  . ILE C 3 94  ? 192.255 179.210 61.257  1.00 163.09 ? 114 ILE C CB  1 
ATOM   6563 C  CG1 . ILE C 3 94  ? 192.697 179.514 59.824  1.00 168.72 ? 114 ILE C CG1 1 
ATOM   6564 C  CG2 . ILE C 3 94  ? 192.021 177.717 61.446  1.00 167.95 ? 114 ILE C CG2 1 
ATOM   6565 C  CD1 . ILE C 3 94  ? 193.964 178.800 59.412  1.00 182.15 ? 114 ILE C CD1 1 
ATOM   6566 N  N   . PRO C 3 95  ? 189.349 178.929 63.066  1.00 161.77 ? 115 PRO C N   1 
ATOM   6567 C  CA  . PRO C 3 95  ? 188.568 178.412 61.938  1.00 108.01 ? 115 PRO C CA  1 
ATOM   6568 C  C   . PRO C 3 95  ? 187.488 179.357 61.413  1.00 164.33 ? 115 PRO C C   1 
ATOM   6569 O  O   . PRO C 3 95  ? 187.126 180.336 62.066  1.00 166.78 ? 115 PRO C O   1 
ATOM   6570 C  CB  . PRO C 3 95  ? 187.929 177.155 62.524  1.00 113.57 ? 115 PRO C CB  1 
ATOM   6571 C  CG  . PRO C 3 95  ? 187.696 177.517 63.946  1.00 149.07 ? 115 PRO C CG  1 
ATOM   6572 C  CD  . PRO C 3 95  ? 188.845 178.413 64.352  1.00 161.15 ? 115 PRO C CD  1 
ATOM   6573 N  N   . ARG C 3 96  ? 187.000 179.051 60.214  1.00 148.63 ? 116 ARG C N   1 
ATOM   6574 C  CA  . ARG C 3 96  ? 185.916 179.796 59.583  1.00 140.12 ? 116 ARG C CA  1 
ATOM   6575 C  C   . ARG C 3 96  ? 184.573 179.368 60.170  1.00 128.05 ? 116 ARG C C   1 
ATOM   6576 O  O   . ARG C 3 96  ? 184.208 178.190 60.098  1.00 124.84 ? 116 ARG C O   1 
ATOM   6577 C  CB  . ARG C 3 96  ? 185.936 179.587 58.068  1.00 127.91 ? 116 ARG C CB  1 
ATOM   6578 C  CG  . ARG C 3 96  ? 187.074 180.301 57.330  1.00 153.67 ? 116 ARG C CG  1 
ATOM   6579 C  CD  . ARG C 3 96  ? 188.419 179.596 57.495  1.00 166.70 ? 116 ARG C CD  1 
ATOM   6580 N  NE  . ARG C 3 96  ? 189.413 180.045 56.522  1.00 176.63 ? 116 ARG C NE  1 
ATOM   6581 C  CZ  . ARG C 3 96  ? 190.143 181.149 56.653  1.00 178.43 ? 116 ARG C CZ  1 
ATOM   6582 N  NH1 . ARG C 3 96  ? 189.991 181.927 57.716  1.00 191.06 ? 116 ARG C NH1 1 
ATOM   6583 N  NH2 . ARG C 3 96  ? 191.026 181.479 55.719  1.00 164.69 ? 116 ARG C NH2 1 
ATOM   6584 N  N   . THR C 3 97  ? 183.840 180.313 60.754  1.00 109.59 ? 117 THR C N   1 
ATOM   6585 C  CA  . THR C 3 97  ? 182.555 180.016 61.371  1.00 150.64 ? 117 THR C CA  1 
ATOM   6586 C  C   . THR C 3 97  ? 181.423 180.631 60.554  1.00 158.94 ? 117 THR C C   1 
ATOM   6587 O  O   . THR C 3 97  ? 181.639 181.513 59.719  1.00 105.48 ? 117 THR C O   1 
ATOM   6588 C  CB  . THR C 3 97  ? 182.508 180.523 62.818  1.00 164.25 ? 117 THR C CB  1 
ATOM   6589 O  OG1 . THR C 3 97  ? 182.687 181.946 62.839  1.00 158.23 ? 117 THR C OG1 1 
ATOM   6590 C  CG2 . THR C 3 97  ? 183.595 179.856 63.650  1.00 167.10 ? 117 THR C CG2 1 
ATOM   6591 N  N   . PHE C 3 98  ? 180.204 180.158 60.814  1.00 163.09 ? 118 PHE C N   1 
ATOM   6592 C  CA  . PHE C 3 98  ? 179.006 180.608 60.116  1.00 145.10 ? 118 PHE C CA  1 
ATOM   6593 C  C   . PHE C 3 98  ? 177.985 181.204 61.078  1.00 147.21 ? 118 PHE C C   1 
ATOM   6594 O  O   . PHE C 3 98  ? 178.107 181.109 62.303  1.00 133.27 ? 118 PHE C O   1 
ATOM   6595 C  CB  . PHE C 3 98  ? 178.347 179.450 59.355  1.00 105.77 ? 118 PHE C CB  1 
ATOM   6596 C  CG  . PHE C 3 98  ? 179.175 178.903 58.239  1.00 102.27 ? 118 PHE C CG  1 
ATOM   6597 C  CD1 . PHE C 3 98  ? 180.151 177.956 58.484  1.00 127.64 ? 118 PHE C CD1 1 
ATOM   6598 C  CD2 . PHE C 3 98  ? 178.960 179.318 56.938  1.00 100.77 ? 118 PHE C CD2 1 
ATOM   6599 C  CE1 . PHE C 3 98  ? 180.911 177.444 57.452  1.00 135.86 ? 118 PHE C CE1 1 
ATOM   6600 C  CE2 . PHE C 3 98  ? 179.714 178.811 55.900  1.00 100.13 ? 118 PHE C CE2 1 
ATOM   6601 C  CZ  . PHE C 3 98  ? 180.691 177.872 56.156  1.00 130.21 ? 118 PHE C CZ  1 
ATOM   6602 N  N   . GLY C 3 99  ? 176.965 181.849 60.486  1.00 138.93 ? 119 GLY C N   1 
ATOM   6603 C  CA  . GLY C 3 99  ? 175.861 182.400 61.242  1.00 140.93 ? 119 GLY C CA  1 
ATOM   6604 C  C   . GLY C 3 99  ? 174.748 181.383 61.483  1.00 158.59 ? 119 GLY C C   1 
ATOM   6605 O  O   . GLY C 3 99  ? 174.749 180.277 60.945  1.00 115.49 ? 119 GLY C O   1 
ATOM   6606 N  N   . GLY C 3 100 ? 173.780 181.787 62.310  1.00 191.24 ? 120 GLY C N   1 
ATOM   6607 C  CA  . GLY C 3 100 ? 172.663 180.908 62.620  1.00 196.98 ? 120 GLY C CA  1 
ATOM   6608 C  C   . GLY C 3 100 ? 171.785 180.586 61.425  1.00 171.31 ? 120 GLY C C   1 
ATOM   6609 O  O   . GLY C 3 100 ? 171.264 179.473 61.315  1.00 163.77 ? 120 GLY C O   1 
ATOM   6610 N  N   . GLY C 3 101 ? 171.617 181.543 60.514  1.00 146.80 ? 121 GLY C N   1 
ATOM   6611 C  CA  . GLY C 3 101 ? 170.780 181.367 59.342  1.00 123.39 ? 121 GLY C CA  1 
ATOM   6612 C  C   . GLY C 3 101 ? 169.466 182.112 59.480  1.00 165.37 ? 121 GLY C C   1 
ATOM   6613 O  O   . GLY C 3 101 ? 168.808 182.021 60.521  1.00 176.00 ? 121 GLY C O   1 
ATOM   6614 N  N   . THR C 3 102 ? 169.065 182.842 58.439  1.00 157.47 ? 122 THR C N   1 
ATOM   6615 C  CA  . THR C 3 102 ? 167.819 183.613 58.436  1.00 169.60 ? 122 THR C CA  1 
ATOM   6616 C  C   . THR C 3 102 ? 166.896 183.112 57.328  1.00 186.21 ? 122 THR C C   1 
ATOM   6617 O  O   . THR C 3 102 ? 167.087 183.448 56.155  1.00 208.09 ? 122 THR C O   1 
ATOM   6618 C  CB  . THR C 3 102 ? 168.108 185.104 58.268  1.00 158.59 ? 122 THR C CB  1 
ATOM   6619 O  OG1 . THR C 3 102 ? 168.995 185.540 59.305  1.00 154.98 ? 122 THR C OG1 1 
ATOM   6620 C  CG2 . THR C 3 102 ? 166.818 185.909 58.342  1.00 169.10 ? 122 THR C CG2 1 
ATOM   6621 N  N   . LYS C 3 103 ? 165.897 182.310 57.694  1.00 172.95 ? 123 LYS C N   1 
ATOM   6622 C  CA  . LYS C 3 103 ? 164.939 181.786 56.723  1.00 150.39 ? 123 LYS C CA  1 
ATOM   6623 C  C   . LYS C 3 103 ? 163.996 182.906 56.293  1.00 168.25 ? 123 LYS C C   1 
ATOM   6624 O  O   . LYS C 3 103 ? 163.163 183.362 57.082  1.00 196.75 ? 123 LYS C O   1 
ATOM   6625 C  CB  . LYS C 3 103 ? 164.168 180.617 57.328  1.00 144.73 ? 123 LYS C CB  1 
ATOM   6626 C  CG  . LYS C 3 103 ? 163.215 179.932 56.373  1.00 142.96 ? 123 LYS C CG  1 
ATOM   6627 C  CD  . LYS C 3 103 ? 162.552 178.740 57.038  1.00 142.97 ? 123 LYS C CD  1 
ATOM   6628 C  CE  . LYS C 3 103 ? 161.631 178.016 56.070  1.00 167.62 ? 123 LYS C CE  1 
ATOM   6629 N  NZ  . LYS C 3 103 ? 160.993 176.825 56.694  1.00 167.57 ? 123 LYS C NZ  1 
ATOM   6630 N  N   . LEU C 3 104 ? 164.126 183.358 55.047  1.00 144.55 ? 124 LEU C N   1 
ATOM   6631 C  CA  . LEU C 3 104 ? 163.340 184.482 54.535  1.00 161.68 ? 124 LEU C CA  1 
ATOM   6632 C  C   . LEU C 3 104 ? 161.999 183.978 54.013  1.00 186.58 ? 124 LEU C C   1 
ATOM   6633 O  O   . LEU C 3 104 ? 161.922 183.399 52.928  1.00 186.44 ? 124 LEU C O   1 
ATOM   6634 C  CB  . LEU C 3 104 ? 164.109 185.221 53.445  1.00 148.03 ? 124 LEU C CB  1 
ATOM   6635 C  CG  . LEU C 3 104 ? 163.451 186.502 52.932  1.00 154.16 ? 124 LEU C CG  1 
ATOM   6636 C  CD1 . LEU C 3 104 ? 163.315 187.499 54.071  1.00 159.65 ? 124 LEU C CD1 1 
ATOM   6637 C  CD2 . LEU C 3 104 ? 164.235 187.105 51.775  1.00 151.68 ? 124 LEU C CD2 1 
ATOM   6638 N  N   . GLU C 3 105 ? 160.934 184.204 54.781  1.00 186.39 ? 125 GLU C N   1 
ATOM   6639 C  CA  . GLU C 3 105 ? 159.590 183.822 54.368  1.00 198.80 ? 125 GLU C CA  1 
ATOM   6640 C  C   . GLU C 3 105 ? 158.921 184.982 53.639  1.00 196.00 ? 125 GLU C C   1 
ATOM   6641 O  O   . GLU C 3 105 ? 159.088 186.146 54.014  1.00 190.86 ? 125 GLU C O   1 
ATOM   6642 C  CB  . GLU C 3 105 ? 158.752 183.391 55.573  1.00 205.43 ? 125 GLU C CB  1 
ATOM   6643 C  CG  . GLU C 3 105 ? 158.746 184.380 56.724  1.00 213.30 ? 125 GLU C CG  1 
ATOM   6644 C  CD  . GLU C 3 105 ? 158.000 183.854 57.932  1.00 233.12 ? 125 GLU C CD  1 
ATOM   6645 O  OE1 . GLU C 3 105 ? 157.378 182.776 57.824  1.00 242.01 ? 125 GLU C OE1 1 
ATOM   6646 O  OE2 . GLU C 3 105 ? 158.037 184.514 58.991  1.00 236.08 ? 125 GLU C OE2 1 
ATOM   6647 N  N   . ILE C 3 106 ? 158.156 184.655 52.599  1.00 197.71 ? 126 ILE C N   1 
ATOM   6648 C  CA  . ILE C 3 106 ? 157.511 185.649 51.746  1.00 173.70 ? 126 ILE C CA  1 
ATOM   6649 C  C   . ILE C 3 106 ? 156.063 185.840 52.181  1.00 177.31 ? 126 ILE C C   1 
ATOM   6650 O  O   . ILE C 3 106 ? 155.322 184.864 52.360  1.00 175.25 ? 126 ILE C O   1 
ATOM   6651 C  CB  . ILE C 3 106 ? 157.595 185.243 50.264  1.00 152.44 ? 126 ILE C CB  1 
ATOM   6652 C  CG1 . ILE C 3 106 ? 159.049 184.978 49.872  1.00 115.13 ? 126 ILE C CG1 1 
ATOM   6653 C  CG2 . ILE C 3 106 ? 157.006 186.329 49.379  1.00 145.31 ? 126 ILE C CG2 1 
ATOM   6654 C  CD1 . ILE C 3 106 ? 159.223 184.524 48.442  1.00 129.69 ? 126 ILE C CD1 1 
ATOM   6655 N  N   . LYS C 3 107 ? 155.665 187.099 52.355  1.00 178.79 ? 127 LYS C N   1 
ATOM   6656 C  CA  . LYS C 3 107 ? 154.317 187.478 52.764  1.00 175.83 ? 127 LYS C CA  1 
ATOM   6657 C  C   . LYS C 3 107 ? 153.488 187.855 51.542  1.00 201.64 ? 127 LYS C C   1 
ATOM   6658 O  O   . LYS C 3 107 ? 153.953 188.612 50.683  1.00 189.49 ? 127 LYS C O   1 
ATOM   6659 C  CB  . LYS C 3 107 ? 154.359 188.646 53.751  1.00 170.12 ? 127 LYS C CB  1 
ATOM   6660 C  CG  . LYS C 3 107 ? 152.993 189.131 54.217  1.00 179.12 ? 127 LYS C CG  1 
ATOM   6661 C  CD  . LYS C 3 107 ? 152.248 188.055 54.986  1.00 190.27 ? 127 LYS C CD  1 
ATOM   6662 C  CE  . LYS C 3 107 ? 150.891 188.552 55.467  1.00 204.53 ? 127 LYS C CE  1 
ATOM   6663 N  NZ  . LYS C 3 107 ? 151.012 189.720 56.384  1.00 206.89 ? 127 LYS C NZ  1 
ATOM   6664 N  N   . ARG C 3 108 ? 152.268 187.330 51.464  1.00 216.09 ? 128 ARG C N   1 
ATOM   6665 C  CA  . ARG C 3 108 ? 151.373 187.638 50.354  1.00 213.58 ? 128 ARG C CA  1 
ATOM   6666 C  C   . ARG C 3 108 ? 149.935 187.650 50.859  1.00 220.32 ? 128 ARG C C   1 
ATOM   6667 O  O   . ARG C 3 108 ? 149.676 187.575 52.065  1.00 225.19 ? 128 ARG C O   1 
ATOM   6668 C  CB  . ARG C 3 108 ? 151.521 186.627 49.211  1.00 190.59 ? 128 ARG C CB  1 
ATOM   6669 C  CG  . ARG C 3 108 ? 151.196 185.203 49.624  1.00 187.44 ? 128 ARG C CG  1 
ATOM   6670 C  CD  . ARG C 3 108 ? 150.698 184.392 48.444  1.00 207.83 ? 128 ARG C CD  1 
ATOM   6671 N  NE  . ARG C 3 108 ? 149.442 184.937 47.931  1.00 220.70 ? 128 ARG C NE  1 
ATOM   6672 C  CZ  . ARG C 3 108 ? 148.755 184.419 46.918  1.00 216.25 ? 128 ARG C CZ  1 
ATOM   6673 N  NH1 . ARG C 3 108 ? 149.197 183.334 46.298  1.00 220.23 ? 128 ARG C NH1 1 
ATOM   6674 N  NH2 . ARG C 3 108 ? 147.622 184.987 46.526  1.00 197.94 ? 128 ARG C NH2 1 
ATOM   6675 N  N   . ALA C 3 109 ? 148.998 187.749 49.920  1.00 224.43 ? 129 ALA C N   1 
ATOM   6676 C  CA  . ALA C 3 109 ? 147.578 187.750 50.227  1.00 220.98 ? 129 ALA C CA  1 
ATOM   6677 C  C   . ALA C 3 109 ? 147.111 186.348 50.610  1.00 212.73 ? 129 ALA C C   1 
ATOM   6678 O  O   . ALA C 3 109 ? 147.784 185.346 50.355  1.00 210.46 ? 129 ALA C O   1 
ATOM   6679 C  CB  . ALA C 3 109 ? 146.770 188.266 49.036  1.00 227.58 ? 129 ALA C CB  1 
ATOM   6680 N  N   . ASP C 3 110 ? 145.937 186.290 51.232  1.00 205.55 ? 130 ASP C N   1 
ATOM   6681 C  CA  . ASP C 3 110 ? 145.388 185.019 51.675  1.00 203.57 ? 130 ASP C CA  1 
ATOM   6682 C  C   . ASP C 3 110 ? 144.961 184.167 50.481  1.00 220.76 ? 130 ASP C C   1 
ATOM   6683 O  O   . ASP C 3 110 ? 144.669 184.670 49.392  1.00 220.55 ? 130 ASP C O   1 
ATOM   6684 C  CB  . ASP C 3 110 ? 144.202 185.248 52.610  1.00 215.74 ? 130 ASP C CB  1 
ATOM   6685 C  CG  . ASP C 3 110 ? 144.581 186.038 53.846  1.00 222.48 ? 130 ASP C CG  1 
ATOM   6686 O  OD1 . ASP C 3 110 ? 145.742 185.919 54.294  1.00 216.48 ? 130 ASP C OD1 1 
ATOM   6687 O  OD2 . ASP C 3 110 ? 143.719 186.773 54.373  1.00 234.52 ? 130 ASP C OD2 1 
ATOM   6688 N  N   . ALA C 3 111 ? 144.921 182.854 50.705  1.00 210.33 ? 131 ALA C N   1 
ATOM   6689 C  CA  . ALA C 3 111 ? 144.533 181.890 49.684  1.00 209.64 ? 131 ALA C CA  1 
ATOM   6690 C  C   . ALA C 3 111 ? 143.660 180.810 50.304  1.00 211.96 ? 131 ALA C C   1 
ATOM   6691 O  O   . ALA C 3 111 ? 143.898 180.381 51.436  1.00 204.25 ? 131 ALA C O   1 
ATOM   6692 C  CB  . ALA C 3 111 ? 145.761 181.257 49.016  1.00 207.64 ? 131 ALA C CB  1 
ATOM   6693 N  N   . ALA C 3 112 ? 142.649 180.378 49.556  1.00 224.03 ? 132 ALA C N   1 
ATOM   6694 C  CA  . ALA C 3 112 ? 141.719 179.360 50.036  1.00 233.28 ? 132 ALA C CA  1 
ATOM   6695 C  C   . ALA C 3 112 ? 142.324 177.966 49.909  1.00 221.45 ? 132 ALA C C   1 
ATOM   6696 O  O   . ALA C 3 112 ? 142.669 177.551 48.797  1.00 204.88 ? 132 ALA C O   1 
ATOM   6697 C  CB  . ALA C 3 112 ? 140.410 179.432 49.262  1.00 263.19 ? 132 ALA C CB  1 
ATOM   6698 N  N   . PRO C 3 113 ? 142.460 177.214 51.008  1.00 213.07 ? 133 PRO C N   1 
ATOM   6699 C  CA  . PRO C 3 113 ? 143.053 175.869 50.933  1.00 212.13 ? 133 PRO C CA  1 
ATOM   6700 C  C   . PRO C 3 113 ? 142.170 174.841 50.240  1.00 218.46 ? 133 PRO C C   1 
ATOM   6701 O  O   . PRO C 3 113 ? 141.146 174.423 50.789  1.00 229.47 ? 133 PRO C O   1 
ATOM   6702 C  CB  . PRO C 3 113 ? 143.265 175.502 52.408  1.00 213.71 ? 133 PRO C CB  1 
ATOM   6703 C  CG  . PRO C 3 113 ? 142.256 176.315 53.147  1.00 214.90 ? 133 PRO C CG  1 
ATOM   6704 C  CD  . PRO C 3 113 ? 142.132 177.604 52.390  1.00 213.05 ? 133 PRO C CD  1 
ATOM   6705 N  N   . THR C 3 114 ? 142.555 174.429 49.033  1.00 202.74 ? 134 THR C N   1 
ATOM   6706 C  CA  . THR C 3 114 ? 141.875 173.341 48.333  1.00 209.78 ? 134 THR C CA  1 
ATOM   6707 C  C   . THR C 3 114 ? 142.074 172.031 49.090  1.00 212.30 ? 134 THR C C   1 
ATOM   6708 O  O   . THR C 3 114 ? 143.191 171.506 49.155  1.00 217.79 ? 134 THR C O   1 
ATOM   6709 C  CB  . THR C 3 114 ? 142.400 173.227 46.905  1.00 207.90 ? 134 THR C CB  1 
ATOM   6710 O  OG1 . THR C 3 114 ? 142.241 174.483 46.233  1.00 205.76 ? 134 THR C OG1 1 
ATOM   6711 C  CG2 . THR C 3 114 ? 141.651 172.143 46.142  1.00 215.92 ? 134 THR C CG2 1 
ATOM   6712 N  N   . VAL C 3 115 ? 140.993 171.504 49.667  1.00 226.16 ? 135 VAL C N   1 
ATOM   6713 C  CA  . VAL C 3 115 ? 141.018 170.275 50.457  1.00 223.96 ? 135 VAL C CA  1 
ATOM   6714 C  C   . VAL C 3 115 ? 140.557 169.115 49.583  1.00 231.08 ? 135 VAL C C   1 
ATOM   6715 O  O   . VAL C 3 115 ? 139.525 169.214 48.908  1.00 255.17 ? 135 VAL C O   1 
ATOM   6716 C  CB  . VAL C 3 115 ? 140.131 170.405 51.708  1.00 228.77 ? 135 VAL C CB  1 
ATOM   6717 C  CG1 . VAL C 3 115 ? 140.180 169.131 52.526  1.00 233.21 ? 135 VAL C CG1 1 
ATOM   6718 C  CG2 . VAL C 3 115 ? 140.563 171.601 52.545  1.00 222.29 ? 135 VAL C CG2 1 
ATOM   6719 N  N   . SER C 3 116 ? 141.310 168.012 49.597  1.00 230.82 ? 136 SER C N   1 
ATOM   6720 C  CA  . SER C 3 116 ? 140.970 166.836 48.796  1.00 240.89 ? 136 SER C CA  1 
ATOM   6721 C  C   . SER C 3 116 ? 141.174 165.573 49.621  1.00 249.49 ? 136 SER C C   1 
ATOM   6722 O  O   . SER C 3 116 ? 142.294 165.291 50.056  1.00 246.20 ? 136 SER C O   1 
ATOM   6723 C  CB  . SER C 3 116 ? 141.815 166.779 47.518  1.00 235.96 ? 136 SER C CB  1 
ATOM   6724 O  OG  . SER C 3 116 ? 141.574 167.904 46.692  1.00 238.47 ? 136 SER C OG  1 
ATOM   6725 N  N   . ILE C 3 117 ? 140.096 164.806 49.824  1.00 255.85 ? 137 ILE C N   1 
ATOM   6726 C  CA  . ILE C 3 117 ? 140.125 163.578 50.613  1.00 257.87 ? 137 ILE C CA  1 
ATOM   6727 C  C   . ILE C 3 117 ? 140.240 162.371 49.687  1.00 268.45 ? 137 ILE C C   1 
ATOM   6728 O  O   . ILE C 3 117 ? 139.719 162.369 48.565  1.00 277.28 ? 137 ILE C O   1 
ATOM   6729 C  CB  . ILE C 3 117 ? 138.879 163.480 51.523  1.00 268.53 ? 137 ILE C CB  1 
ATOM   6730 C  CG1 . ILE C 3 117 ? 139.063 162.392 52.583  1.00 280.28 ? 137 ILE C CG1 1 
ATOM   6731 C  CG2 . ILE C 3 117 ? 137.619 163.235 50.701  1.00 282.11 ? 137 ILE C CG2 1 
ATOM   6732 C  CD1 . ILE C 3 117 ? 138.000 162.411 53.662  1.00 290.85 ? 137 ILE C CD1 1 
ATOM   6733 N  N   . PHE C 3 118 ? 140.937 161.327 50.159  1.00 286.81 ? 138 PHE C N   1 
ATOM   6734 C  CA  . PHE C 3 118 ? 141.225 160.143 49.351  1.00 311.24 ? 138 PHE C CA  1 
ATOM   6735 C  C   . PHE C 3 118 ? 141.028 158.855 50.148  1.00 354.03 ? 138 PHE C C   1 
ATOM   6736 O  O   . PHE C 3 118 ? 141.553 158.732 51.283  1.00 344.09 ? 138 PHE C O   1 
ATOM   6737 C  CB  . PHE C 3 118 ? 142.647 160.202 48.783  1.00 289.54 ? 138 PHE C CB  1 
ATOM   6738 C  CG  . PHE C 3 118 ? 142.880 161.357 47.849  1.00 264.57 ? 138 PHE C CG  1 
ATOM   6739 C  CD1 . PHE C 3 118 ? 142.643 161.222 46.491  1.00 264.23 ? 138 PHE C CD1 1 
ATOM   6740 C  CD2 . PHE C 3 118 ? 143.339 162.574 48.326  1.00 245.73 ? 138 PHE C CD2 1 
ATOM   6741 C  CE1 . PHE C 3 118 ? 142.856 162.279 45.625  1.00 255.17 ? 138 PHE C CE1 1 
ATOM   6742 C  CE2 . PHE C 3 118 ? 143.552 163.635 47.465  1.00 237.39 ? 138 PHE C CE2 1 
ATOM   6743 C  CZ  . PHE C 3 118 ? 143.310 163.487 46.114  1.00 240.57 ? 138 PHE C CZ  1 
ATOM   6744 N  N   . PRO C 3 119 ? 140.273 157.907 49.587  1.00 405.76 ? 139 PRO C N   1 
ATOM   6745 C  CA  . PRO C 3 119 ? 140.045 156.597 50.222  1.00 412.74 ? 139 PRO C CA  1 
ATOM   6746 C  C   . PRO C 3 119 ? 141.217 155.646 50.047  1.00 407.89 ? 139 PRO C C   1 
ATOM   6747 O  O   . PRO C 3 119 ? 141.943 155.710 49.043  1.00 411.85 ? 139 PRO C O   1 
ATOM   6748 C  CB  . PRO C 3 119 ? 138.802 156.074 49.490  1.00 433.29 ? 139 PRO C CB  1 
ATOM   6749 C  CG  . PRO C 3 119 ? 138.920 156.668 48.129  1.00 430.47 ? 139 PRO C CG  1 
ATOM   6750 C  CD  . PRO C 3 119 ? 139.515 158.044 48.330  1.00 415.89 ? 139 PRO C CD  1 
ATOM   6751 N  N   . PRO C 3 120 ? 141.433 154.754 51.013  1.00 364.64 ? 140 PRO C N   1 
ATOM   6752 C  CA  . PRO C 3 120 ? 142.507 153.753 50.902  1.00 331.77 ? 140 PRO C CA  1 
ATOM   6753 C  C   . PRO C 3 120 ? 142.342 152.845 49.687  1.00 363.61 ? 140 PRO C C   1 
ATOM   6754 O  O   . PRO C 3 120 ? 141.263 152.308 49.430  1.00 327.35 ? 140 PRO C O   1 
ATOM   6755 C  CB  . PRO C 3 120 ? 142.382 152.964 52.210  1.00 304.95 ? 140 PRO C CB  1 
ATOM   6756 C  CG  . PRO C 3 120 ? 141.724 153.913 53.155  1.00 302.94 ? 140 PRO C CG  1 
ATOM   6757 C  CD  . PRO C 3 120 ? 140.761 154.699 52.322  1.00 304.13 ? 140 PRO C CD  1 
ATOM   6758 N  N   . SER C 3 121 ? 143.433 152.676 48.940  1.00 422.76 ? 141 SER C N   1 
ATOM   6759 C  CA  . SER C 3 121 ? 143.459 151.852 47.738  1.00 435.93 ? 141 SER C CA  1 
ATOM   6760 C  C   . SER C 3 121 ? 143.403 150.362 48.082  1.00 441.23 ? 141 SER C C   1 
ATOM   6761 O  O   . SER C 3 121 ? 143.568 149.947 49.233  1.00 443.02 ? 141 SER C O   1 
ATOM   6762 C  CB  . SER C 3 121 ? 144.707 152.134 46.909  1.00 436.05 ? 141 SER C CB  1 
ATOM   6763 O  OG  . SER C 3 121 ? 145.885 151.885 47.658  1.00 433.12 ? 141 SER C OG  1 
ATOM   6764 N  N   . SER C 3 122 ? 143.168 149.551 47.045  1.00 419.04 ? 142 SER C N   1 
ATOM   6765 C  CA  . SER C 3 122 ? 143.079 148.104 47.219  1.00 402.49 ? 142 SER C CA  1 
ATOM   6766 C  C   . SER C 3 122 ? 144.442 147.478 47.499  1.00 378.19 ? 142 SER C C   1 
ATOM   6767 O  O   . SER C 3 122 ? 144.515 146.448 48.181  1.00 387.42 ? 142 SER C O   1 
ATOM   6768 C  CB  . SER C 3 122 ? 142.450 147.466 45.980  1.00 390.58 ? 142 SER C CB  1 
ATOM   6769 O  OG  . SER C 3 122 ? 143.195 147.774 44.815  1.00 369.60 ? 142 SER C OG  1 
ATOM   6770 N  N   . GLU C 3 123 ? 145.526 148.072 46.988  1.00 358.79 ? 143 GLU C N   1 
ATOM   6771 C  CA  . GLU C 3 123 ? 146.851 147.517 47.250  1.00 353.71 ? 143 GLU C CA  1 
ATOM   6772 C  C   . GLU C 3 123 ? 147.171 147.574 48.735  1.00 339.02 ? 143 GLU C C   1 
ATOM   6773 O  O   . GLU C 3 123 ? 147.882 146.706 49.256  1.00 340.65 ? 143 GLU C O   1 
ATOM   6774 C  CB  . GLU C 3 123 ? 147.922 148.257 46.448  1.00 335.85 ? 143 GLU C CB  1 
ATOM   6775 C  CG  . GLU C 3 123 ? 147.770 148.150 44.943  1.00 341.47 ? 143 GLU C CG  1 
ATOM   6776 C  CD  . GLU C 3 123 ? 148.947 148.754 44.206  1.00 327.88 ? 143 GLU C CD  1 
ATOM   6777 O  OE1 . GLU C 3 123 ? 148.876 148.883 42.966  1.00 328.11 ? 143 GLU C OE1 1 
ATOM   6778 O  OE2 . GLU C 3 123 ? 149.948 149.096 44.871  1.00 316.57 ? 143 GLU C OE2 1 
ATOM   6779 N  N   . GLN C 3 124 ? 146.657 148.590 49.428  1.00 323.85 ? 144 GLN C N   1 
ATOM   6780 C  CA  . GLN C 3 124 ? 146.859 148.703 50.864  1.00 318.02 ? 144 GLN C CA  1 
ATOM   6781 C  C   . GLN C 3 124 ? 145.910 147.779 51.611  1.00 319.41 ? 144 GLN C C   1 
ATOM   6782 O  O   . GLN C 3 124 ? 146.265 147.253 52.672  1.00 326.01 ? 144 GLN C O   1 
ATOM   6783 C  CB  . GLN C 3 124 ? 146.662 150.151 51.316  1.00 302.91 ? 144 GLN C CB  1 
ATOM   6784 C  CG  . GLN C 3 124 ? 146.960 150.390 52.786  1.00 298.08 ? 144 GLN C CG  1 
ATOM   6785 C  CD  . GLN C 3 124 ? 146.831 151.848 53.177  1.00 288.62 ? 144 GLN C CD  1 
ATOM   6786 O  OE1 . GLN C 3 124 ? 146.539 152.703 52.341  1.00 289.16 ? 144 GLN C OE1 1 
ATOM   6787 N  NE2 . GLN C 3 124 ? 147.043 152.138 54.455  1.00 280.50 ? 144 GLN C NE2 1 
ATOM   6788 N  N   . LEU C 3 125 ? 144.708 147.565 51.067  1.00 329.76 ? 145 LEU C N   1 
ATOM   6789 C  CA  . LEU C 3 125 ? 143.762 146.651 51.693  1.00 350.84 ? 145 LEU C CA  1 
ATOM   6790 C  C   . LEU C 3 125 ? 144.256 145.213 51.612  1.00 358.67 ? 145 LEU C C   1 
ATOM   6791 O  O   . LEU C 3 125 ? 143.913 144.392 52.471  1.00 360.78 ? 145 LEU C O   1 
ATOM   6792 C  CB  . LEU C 3 125 ? 142.389 146.781 51.034  1.00 362.84 ? 145 LEU C CB  1 
ATOM   6793 C  CG  . LEU C 3 125 ? 141.674 148.122 51.210  1.00 357.30 ? 145 LEU C CG  1 
ATOM   6794 C  CD1 . LEU C 3 125 ? 140.345 148.123 50.472  1.00 369.12 ? 145 LEU C CD1 1 
ATOM   6795 C  CD2 . LEU C 3 125 ? 141.473 148.436 52.684  1.00 353.00 ? 145 LEU C CD2 1 
ATOM   6796 N  N   . THR C 3 126 ? 145.057 144.890 50.592  1.00 362.95 ? 146 THR C N   1 
ATOM   6797 C  CA  . THR C 3 126 ? 145.603 143.540 50.489  1.00 367.87 ? 146 THR C CA  1 
ATOM   6798 C  C   . THR C 3 126 ? 146.570 143.270 51.634  1.00 360.58 ? 146 THR C C   1 
ATOM   6799 O  O   . THR C 3 126 ? 146.568 142.178 52.215  1.00 365.85 ? 146 THR C O   1 
ATOM   6800 C  CB  . THR C 3 126 ? 146.301 143.349 49.141  1.00 358.65 ? 146 THR C CB  1 
ATOM   6801 O  OG1 . THR C 3 126 ? 145.386 143.642 48.077  1.00 360.74 ? 146 THR C OG1 1 
ATOM   6802 C  CG2 . THR C 3 126 ? 146.802 141.918 48.992  1.00 363.26 ? 146 THR C CG2 1 
ATOM   6803 N  N   . SER C 3 127 ? 147.400 144.260 51.972  1.00 355.74 ? 147 SER C N   1 
ATOM   6804 C  CA  . SER C 3 127 ? 148.361 144.099 53.057  1.00 343.49 ? 147 SER C CA  1 
ATOM   6805 C  C   . SER C 3 127 ? 147.669 144.091 54.415  1.00 342.05 ? 147 SER C C   1 
ATOM   6806 O  O   . SER C 3 127 ? 148.199 143.519 55.375  1.00 340.90 ? 147 SER C O   1 
ATOM   6807 C  CB  . SER C 3 127 ? 149.413 145.206 52.998  1.00 324.15 ? 147 SER C CB  1 
ATOM   6808 O  OG  . SER C 3 127 ? 150.131 145.165 51.776  1.00 312.59 ? 147 SER C OG  1 
ATOM   6809 N  N   . GLY C 3 128 ? 146.493 144.710 54.516  1.00 339.96 ? 148 GLY C N   1 
ATOM   6810 C  CA  . GLY C 3 128 ? 145.747 144.725 55.760  1.00 345.21 ? 148 GLY C CA  1 
ATOM   6811 C  C   . GLY C 3 128 ? 145.736 146.040 56.515  1.00 352.97 ? 148 GLY C C   1 
ATOM   6812 O  O   . GLY C 3 128 ? 145.837 146.051 57.746  1.00 334.81 ? 148 GLY C O   1 
ATOM   6813 N  N   . GLY C 3 129 ? 145.612 147.158 55.796  1.00 351.09 ? 149 GLY C N   1 
ATOM   6814 C  CA  . GLY C 3 129 ? 145.525 148.460 56.428  1.00 345.95 ? 149 GLY C CA  1 
ATOM   6815 C  C   . GLY C 3 129 ? 144.726 149.411 55.563  1.00 354.52 ? 149 GLY C C   1 
ATOM   6816 O  O   . GLY C 3 129 ? 144.443 149.130 54.396  1.00 357.77 ? 149 GLY C O   1 
ATOM   6817 N  N   . ALA C 3 130 ? 144.354 150.550 56.150  1.00 345.29 ? 150 ALA C N   1 
ATOM   6818 C  CA  . ALA C 3 130 ? 143.563 151.534 55.411  1.00 342.74 ? 150 ALA C CA  1 
ATOM   6819 C  C   . ALA C 3 130 ? 143.751 152.912 56.023  1.00 330.00 ? 150 ALA C C   1 
ATOM   6820 O  O   . ALA C 3 130 ? 143.432 153.115 57.199  1.00 331.49 ? 150 ALA C O   1 
ATOM   6821 C  CB  . ALA C 3 130 ? 142.088 151.141 55.408  1.00 354.98 ? 150 ALA C CB  1 
ATOM   6822 N  N   . SER C 3 131 ? 144.248 153.861 55.232  1.00 312.23 ? 151 SER C N   1 
ATOM   6823 C  CA  . SER C 3 131 ? 144.514 155.216 55.701  1.00 307.63 ? 151 SER C CA  1 
ATOM   6824 C  C   . SER C 3 131 ? 143.767 156.225 54.838  1.00 311.59 ? 151 SER C C   1 
ATOM   6825 O  O   . SER C 3 131 ? 144.030 156.332 53.635  1.00 326.27 ? 151 SER C O   1 
ATOM   6826 C  CB  . SER C 3 131 ? 146.015 155.509 55.689  1.00 299.08 ? 151 SER C CB  1 
ATOM   6827 O  OG  . SER C 3 131 ? 146.720 154.582 56.496  1.00 302.62 ? 151 SER C OG  1 
ATOM   6828 N  N   . VAL C 3 132 ? 142.841 156.959 55.451  1.00 314.74 ? 152 VAL C N   1 
ATOM   6829 C  CA  . VAL C 3 132 ? 142.122 158.032 54.769  1.00 322.04 ? 152 VAL C CA  1 
ATOM   6830 C  C   . VAL C 3 132 ? 143.011 159.269 54.764  1.00 319.01 ? 152 VAL C C   1 
ATOM   6831 O  O   . VAL C 3 132 ? 143.583 159.638 55.800  1.00 309.95 ? 152 VAL C O   1 
ATOM   6832 C  CB  . VAL C 3 132 ? 140.775 158.311 55.454  1.00 325.47 ? 152 VAL C CB  1 
ATOM   6833 C  CG1 . VAL C 3 132 ? 140.066 159.473 54.777  1.00 323.58 ? 152 VAL C CG1 1 
ATOM   6834 C  CG2 . VAL C 3 132 ? 139.905 157.064 55.434  1.00 343.81 ? 152 VAL C CG2 1 
ATOM   6835 N  N   . VAL C 3 133 ? 143.143 159.913 53.603  1.00 309.49 ? 153 VAL C N   1 
ATOM   6836 C  CA  . VAL C 3 133 ? 144.068 161.036 53.454  1.00 291.13 ? 153 VAL C CA  1 
ATOM   6837 C  C   . VAL C 3 133 ? 143.307 162.329 53.185  1.00 276.29 ? 153 VAL C C   1 
ATOM   6838 O  O   . VAL C 3 133 ? 142.342 162.343 52.416  1.00 299.31 ? 153 VAL C O   1 
ATOM   6839 C  CB  . VAL C 3 133 ? 145.083 160.757 52.329  1.00 286.73 ? 153 VAL C CB  1 
ATOM   6840 C  CG1 . VAL C 3 133 ? 146.148 161.835 52.299  1.00 278.75 ? 153 VAL C CG1 1 
ATOM   6841 C  CG2 . VAL C 3 133 ? 145.709 159.380 52.509  1.00 291.77 ? 153 VAL C CG2 1 
ATOM   6842 N  N   . CYS C 3 134 ? 143.729 163.415 53.839  1.00 257.15 ? 154 CYS C N   1 
ATOM   6843 C  CA  . CYS C 3 134 ? 143.124 164.733 53.642  1.00 251.41 ? 154 CYS C CA  1 
ATOM   6844 C  C   . CYS C 3 134 ? 144.215 165.734 53.275  1.00 222.80 ? 154 CYS C C   1 
ATOM   6845 O  O   . CYS C 3 134 ? 145.021 166.118 54.129  1.00 216.74 ? 154 CYS C O   1 
ATOM   6846 C  CB  . CYS C 3 134 ? 142.373 165.188 54.896  1.00 253.93 ? 154 CYS C CB  1 
ATOM   6847 S  SG  . CYS C 3 134 ? 141.198 166.548 54.644  1.00 255.71 ? 154 CYS C SG  1 
ATOM   6848 N  N   . PHE C 3 135 ? 144.237 166.158 52.011  1.00 227.66 ? 155 PHE C N   1 
ATOM   6849 C  CA  . PHE C 3 135 ? 145.231 167.102 51.508  1.00 224.57 ? 155 PHE C CA  1 
ATOM   6850 C  C   . PHE C 3 135 ? 144.723 168.538 51.575  1.00 234.17 ? 155 PHE C C   1 
ATOM   6851 O  O   . PHE C 3 135 ? 143.553 168.810 51.287  1.00 260.46 ? 155 PHE C O   1 
ATOM   6852 C  CB  . PHE C 3 135 ? 145.617 166.768 50.066  1.00 228.19 ? 155 PHE C CB  1 
ATOM   6853 C  CG  . PHE C 3 135 ? 146.559 165.606 49.943  1.00 232.89 ? 155 PHE C CG  1 
ATOM   6854 C  CD1 . PHE C 3 135 ? 147.361 165.232 51.007  1.00 236.28 ? 155 PHE C CD1 1 
ATOM   6855 C  CD2 . PHE C 3 135 ? 146.641 164.889 48.762  1.00 229.99 ? 155 PHE C CD2 1 
ATOM   6856 C  CE1 . PHE C 3 135 ? 148.230 164.164 50.894  1.00 236.04 ? 155 PHE C CE1 1 
ATOM   6857 C  CE2 . PHE C 3 135 ? 147.506 163.818 48.644  1.00 231.43 ? 155 PHE C CE2 1 
ATOM   6858 C  CZ  . PHE C 3 135 ? 148.301 163.455 49.712  1.00 234.11 ? 155 PHE C CZ  1 
ATOM   6859 N  N   . LEU C 3 136 ? 145.613 169.457 51.955  1.00 200.40 ? 156 LEU C N   1 
ATOM   6860 C  CA  . LEU C 3 136 ? 145.310 170.886 52.002  1.00 197.38 ? 156 LEU C CA  1 
ATOM   6861 C  C   . LEU C 3 136 ? 146.343 171.622 51.155  1.00 197.16 ? 156 LEU C C   1 
ATOM   6862 O  O   . LEU C 3 136 ? 147.499 171.767 51.568  1.00 206.68 ? 156 LEU C O   1 
ATOM   6863 C  CB  . LEU C 3 136 ? 145.306 171.405 53.440  1.00 196.06 ? 156 LEU C CB  1 
ATOM   6864 C  CG  . LEU C 3 136 ? 144.322 170.795 54.443  1.00 203.81 ? 156 LEU C CG  1 
ATOM   6865 C  CD1 . LEU C 3 136 ? 144.821 169.478 55.023  1.00 205.63 ? 156 LEU C CD1 1 
ATOM   6866 C  CD2 . LEU C 3 136 ? 144.057 171.790 55.551  1.00 202.81 ? 156 LEU C CD2 1 
ATOM   6867 N  N   . ASN C 3 137 ? 145.927 172.094 49.981  1.00 190.52 ? 157 ASN C N   1 
ATOM   6868 C  CA  . ASN C 3 137 ? 146.831 172.678 48.997  1.00 192.95 ? 157 ASN C CA  1 
ATOM   6869 C  C   . ASN C 3 137 ? 146.576 174.170 48.813  1.00 206.19 ? 157 ASN C C   1 
ATOM   6870 O  O   . ASN C 3 137 ? 145.432 174.628 48.889  1.00 229.60 ? 157 ASN C O   1 
ATOM   6871 C  CB  . ASN C 3 137 ? 146.712 171.962 47.648  1.00 188.24 ? 157 ASN C CB  1 
ATOM   6872 C  CG  . ASN C 3 137 ? 146.963 170.469 47.755  1.00 203.88 ? 157 ASN C CG  1 
ATOM   6873 O  OD1 . ASN C 3 137 ? 147.698 170.014 48.631  1.00 207.70 ? 157 ASN C OD1 1 
ATOM   6874 N  ND2 . ASN C 3 137 ? 146.355 169.700 46.859  1.00 212.82 ? 157 ASN C ND2 1 
ATOM   6875 N  N   . ASN C 3 138 ? 147.657 174.920 48.582  1.00 194.25 ? 158 ASN C N   1 
ATOM   6876 C  CA  . ASN C 3 138 ? 147.603 176.334 48.213  1.00 188.13 ? 158 ASN C CA  1 
ATOM   6877 C  C   . ASN C 3 138 ? 146.825 177.203 49.193  1.00 184.99 ? 158 ASN C C   1 
ATOM   6878 O  O   . ASN C 3 138 ? 145.681 177.584 48.923  1.00 195.00 ? 158 ASN C O   1 
ATOM   6879 C  CB  . ASN C 3 138 ? 147.005 176.487 46.813  1.00 196.85 ? 158 ASN C CB  1 
ATOM   6880 C  CG  . ASN C 3 138 ? 147.756 175.688 45.774  1.00 209.50 ? 158 ASN C CG  1 
ATOM   6881 O  OD1 . ASN C 3 138 ? 147.441 174.525 45.522  1.00 210.42 ? 158 ASN C OD1 1 
ATOM   6882 N  ND2 . ASN C 3 138 ? 148.761 176.307 45.164  1.00 214.58 ? 158 ASN C ND2 1 
ATOM   6883 N  N   . PHE C 3 139 ? 147.440 177.527 50.326  1.00 183.64 ? 159 PHE C N   1 
ATOM   6884 C  CA  . PHE C 3 139 ? 146.842 178.434 51.293  1.00 193.49 ? 159 PHE C CA  1 
ATOM   6885 C  C   . PHE C 3 139 ? 147.943 179.248 51.955  1.00 179.07 ? 159 PHE C C   1 
ATOM   6886 O  O   . PHE C 3 139 ? 149.134 178.961 51.809  1.00 159.47 ? 159 PHE C O   1 
ATOM   6887 C  CB  . PHE C 3 139 ? 146.006 177.676 52.329  1.00 204.60 ? 159 PHE C CB  1 
ATOM   6888 C  CG  . PHE C 3 139 ? 146.794 176.695 53.146  1.00 190.47 ? 159 PHE C CG  1 
ATOM   6889 C  CD1 . PHE C 3 139 ? 146.950 175.388 52.717  1.00 180.26 ? 159 PHE C CD1 1 
ATOM   6890 C  CD2 . PHE C 3 139 ? 147.371 177.075 54.345  1.00 189.00 ? 159 PHE C CD2 1 
ATOM   6891 C  CE1 . PHE C 3 139 ? 147.671 174.479 53.465  1.00 184.48 ? 159 PHE C CE1 1 
ATOM   6892 C  CE2 . PHE C 3 139 ? 148.097 176.172 55.096  1.00 192.70 ? 159 PHE C CE2 1 
ATOM   6893 C  CZ  . PHE C 3 139 ? 148.245 174.872 54.656  1.00 193.76 ? 159 PHE C CZ  1 
ATOM   6894 N  N   . TYR C 3 140 ? 147.527 180.279 52.683  1.00 204.47 ? 160 TYR C N   1 
ATOM   6895 C  CA  . TYR C 3 140 ? 148.458 181.166 53.367  1.00 219.86 ? 160 TYR C CA  1 
ATOM   6896 C  C   . TYR C 3 140 ? 147.720 181.942 54.451  1.00 232.26 ? 160 TYR C C   1 
ATOM   6897 O  O   . TYR C 3 140 ? 146.626 182.454 54.213  1.00 233.06 ? 160 TYR C O   1 
ATOM   6898 C  CB  . TYR C 3 140 ? 149.118 182.128 52.376  1.00 224.48 ? 160 TYR C CB  1 
ATOM   6899 C  CG  . TYR C 3 140 ? 150.267 182.905 52.968  1.00 225.71 ? 160 TYR C CG  1 
ATOM   6900 C  CD1 . TYR C 3 140 ? 151.552 182.379 52.977  1.00 217.45 ? 160 TYR C CD1 1 
ATOM   6901 C  CD2 . TYR C 3 140 ? 150.067 184.156 53.536  1.00 229.26 ? 160 TYR C CD2 1 
ATOM   6902 C  CE1 . TYR C 3 140 ? 152.606 183.080 53.525  1.00 210.13 ? 160 TYR C CE1 1 
ATOM   6903 C  CE2 . TYR C 3 140 ? 151.115 184.864 54.087  1.00 219.56 ? 160 TYR C CE2 1 
ATOM   6904 C  CZ  . TYR C 3 140 ? 152.383 184.322 54.078  1.00 209.68 ? 160 TYR C CZ  1 
ATOM   6905 O  OH  . TYR C 3 140 ? 153.432 185.022 54.625  1.00 199.66 ? 160 TYR C OH  1 
ATOM   6906 N  N   . PRO C 3 141 ? 148.327 182.055 55.644  1.00 250.17 ? 161 PRO C N   1 
ATOM   6907 C  CA  . PRO C 3 141 ? 149.656 181.544 55.994  1.00 247.06 ? 161 PRO C CA  1 
ATOM   6908 C  C   . PRO C 3 141 ? 149.666 180.088 56.456  1.00 248.88 ? 161 PRO C C   1 
ATOM   6909 O  O   . PRO C 3 141 ? 148.750 179.324 56.152  1.00 266.91 ? 161 PRO C O   1 
ATOM   6910 C  CB  . PRO C 3 141 ? 150.083 182.467 57.133  1.00 247.91 ? 161 PRO C CB  1 
ATOM   6911 C  CG  . PRO C 3 141 ? 148.805 182.787 57.821  1.00 258.16 ? 161 PRO C CG  1 
ATOM   6912 C  CD  . PRO C 3 141 ? 147.744 182.844 56.744  1.00 260.97 ? 161 PRO C CD  1 
ATOM   6913 N  N   . LYS C 3 142 ? 150.714 179.724 57.197  1.00 231.72 ? 162 LYS C N   1 
ATOM   6914 C  CA  . LYS C 3 142 ? 150.891 178.342 57.631  1.00 225.62 ? 162 LYS C CA  1 
ATOM   6915 C  C   . LYS C 3 142 ? 149.857 177.942 58.678  1.00 220.54 ? 162 LYS C C   1 
ATOM   6916 O  O   . LYS C 3 142 ? 149.379 176.801 58.679  1.00 228.69 ? 162 LYS C O   1 
ATOM   6917 C  CB  . LYS C 3 142 ? 152.306 178.152 58.181  1.00 223.76 ? 162 LYS C CB  1 
ATOM   6918 C  CG  . LYS C 3 142 ? 152.605 176.753 58.695  1.00 229.08 ? 162 LYS C CG  1 
ATOM   6919 C  CD  . LYS C 3 142 ? 154.015 176.666 59.260  1.00 220.48 ? 162 LYS C CD  1 
ATOM   6920 C  CE  . LYS C 3 142 ? 154.311 175.276 59.802  1.00 220.42 ? 162 LYS C CE  1 
ATOM   6921 N  NZ  . LYS C 3 142 ? 155.693 175.172 60.347  1.00 211.85 ? 162 LYS C NZ  1 
ATOM   6922 N  N   . ASP C 3 143 ? 149.496 178.863 59.569  1.00 207.32 ? 163 ASP C N   1 
ATOM   6923 C  CA  . ASP C 3 143 ? 148.553 178.568 60.642  1.00 221.35 ? 163 ASP C CA  1 
ATOM   6924 C  C   . ASP C 3 143 ? 147.176 178.189 60.111  1.00 230.23 ? 163 ASP C C   1 
ATOM   6925 O  O   . ASP C 3 143 ? 146.486 179.013 59.503  1.00 233.93 ? 163 ASP C O   1 
ATOM   6926 C  CB  . ASP C 3 143 ? 148.439 179.765 61.587  1.00 229.15 ? 163 ASP C CB  1 
ATOM   6927 C  CG  . ASP C 3 143 ? 149.734 180.052 62.316  1.00 237.71 ? 163 ASP C CG  1 
ATOM   6928 O  OD1 . ASP C 3 143 ? 150.550 179.118 62.465  1.00 242.66 ? 163 ASP C OD1 1 
ATOM   6929 O  OD2 . ASP C 3 143 ? 149.937 181.209 62.739  1.00 243.84 ? 163 ASP C OD2 1 
ATOM   6930 N  N   . ILE C 3 144 ? 146.778 176.939 60.334  1.00 249.88 ? 164 ILE C N   1 
ATOM   6931 C  CA  . ILE C 3 144 ? 145.480 176.442 59.891  1.00 260.58 ? 164 ILE C CA  1 
ATOM   6932 C  C   . ILE C 3 144 ? 145.125 175.226 60.735  1.00 254.01 ? 164 ILE C C   1 
ATOM   6933 O  O   . ILE C 3 144 ? 145.981 174.389 61.035  1.00 253.99 ? 164 ILE C O   1 
ATOM   6934 C  CB  . ILE C 3 144 ? 145.493 176.114 58.378  1.00 265.29 ? 164 ILE C CB  1 
ATOM   6935 C  CG1 . ILE C 3 144 ? 144.143 175.550 57.932  1.00 279.97 ? 164 ILE C CG1 1 
ATOM   6936 C  CG2 . ILE C 3 144 ? 146.617 175.147 58.049  1.00 256.54 ? 164 ILE C CG2 1 
ATOM   6937 C  CD1 . ILE C 3 144 ? 144.058 175.285 56.447  1.00 278.92 ? 164 ILE C CD1 1 
ATOM   6938 N  N   . ASN C 3 145 ? 143.858 175.144 61.132  1.00 242.63 ? 165 ASN C N   1 
ATOM   6939 C  CA  . ASN C 3 145 ? 143.373 174.040 61.948  1.00 232.63 ? 165 ASN C CA  1 
ATOM   6940 C  C   . ASN C 3 145 ? 142.800 172.942 61.061  1.00 230.53 ? 165 ASN C C   1 
ATOM   6941 O  O   . ASN C 3 145 ? 142.177 173.220 60.033  1.00 229.08 ? 165 ASN C O   1 
ATOM   6942 C  CB  . ASN C 3 145 ? 142.312 174.526 62.937  1.00 235.42 ? 165 ASN C CB  1 
ATOM   6943 C  CG  . ASN C 3 145 ? 141.762 173.406 63.800  1.00 249.74 ? 165 ASN C CG  1 
ATOM   6944 O  OD1 . ASN C 3 145 ? 140.708 172.841 63.506  1.00 252.51 ? 165 ASN C OD1 1 
ATOM   6945 N  ND2 . ASN C 3 145 ? 142.479 173.075 64.868  1.00 261.04 ? 165 ASN C ND2 1 
ATOM   6946 N  N   . VAL C 3 146 ? 143.036 171.691 61.451  1.00 228.58 ? 166 VAL C N   1 
ATOM   6947 C  CA  . VAL C 3 146 ? 142.523 170.531 60.731  1.00 230.87 ? 166 VAL C CA  1 
ATOM   6948 C  C   . VAL C 3 146 ? 141.781 169.640 61.717  1.00 244.39 ? 166 VAL C C   1 
ATOM   6949 O  O   . VAL C 3 146 ? 142.367 169.182 62.706  1.00 247.88 ? 166 VAL C O   1 
ATOM   6950 C  CB  . VAL C 3 146 ? 143.641 169.743 60.031  1.00 217.33 ? 166 VAL C CB  1 
ATOM   6951 C  CG1 . VAL C 3 146 ? 143.072 168.495 59.378  1.00 229.32 ? 166 VAL C CG1 1 
ATOM   6952 C  CG2 . VAL C 3 146 ? 144.338 170.616 59.004  1.00 207.86 ? 166 VAL C CG2 1 
ATOM   6953 N  N   . LYS C 3 147 ? 140.501 169.393 61.450  1.00 237.95 ? 167 LYS C N   1 
ATOM   6954 C  CA  . LYS C 3 147 ? 139.662 168.557 62.298  1.00 247.58 ? 167 LYS C CA  1 
ATOM   6955 C  C   . LYS C 3 147 ? 139.141 167.377 61.490  1.00 254.22 ? 167 LYS C C   1 
ATOM   6956 O  O   . LYS C 3 147 ? 138.678 167.550 60.356  1.00 254.83 ? 167 LYS C O   1 
ATOM   6957 C  CB  . LYS C 3 147 ? 138.495 169.357 62.880  1.00 252.93 ? 167 LYS C CB  1 
ATOM   6958 C  CG  . LYS C 3 147 ? 137.653 168.576 63.875  1.00 273.93 ? 167 LYS C CG  1 
ATOM   6959 C  CD  . LYS C 3 147 ? 136.567 169.444 64.491  1.00 275.75 ? 167 LYS C CD  1 
ATOM   6960 C  CE  . LYS C 3 147 ? 137.156 170.624 65.245  1.00 269.96 ? 167 LYS C CE  1 
ATOM   6961 N  NZ  . LYS C 3 147 ? 136.091 171.465 65.858  1.00 266.89 ? 167 LYS C NZ  1 
ATOM   6962 N  N   . TRP C 3 148 ? 139.227 166.183 62.073  1.00 259.56 ? 168 TRP C N   1 
ATOM   6963 C  CA  . TRP C 3 148 ? 138.778 164.953 61.437  1.00 269.13 ? 168 TRP C CA  1 
ATOM   6964 C  C   . TRP C 3 148 ? 137.423 164.512 61.976  1.00 284.46 ? 168 TRP C C   1 
ATOM   6965 O  O   . TRP C 3 148 ? 137.063 164.798 63.120  1.00 294.36 ? 168 TRP C O   1 
ATOM   6966 C  CB  . TRP C 3 148 ? 139.798 163.833 61.640  1.00 267.20 ? 168 TRP C CB  1 
ATOM   6967 C  CG  . TRP C 3 148 ? 140.939 163.896 60.692  1.00 256.84 ? 168 TRP C CG  1 
ATOM   6968 C  CD1 . TRP C 3 148 ? 142.101 164.585 60.852  1.00 246.60 ? 168 TRP C CD1 1 
ATOM   6969 C  CD2 . TRP C 3 148 ? 141.036 163.228 59.430  1.00 257.82 ? 168 TRP C CD2 1 
ATOM   6970 N  NE1 . TRP C 3 148 ? 142.917 164.394 59.764  1.00 242.86 ? 168 TRP C NE1 1 
ATOM   6971 C  CE2 . TRP C 3 148 ? 142.285 163.564 58.876  1.00 247.74 ? 168 TRP C CE2 1 
ATOM   6972 C  CE3 . TRP C 3 148 ? 140.186 162.382 58.713  1.00 270.97 ? 168 TRP C CE3 1 
ATOM   6973 C  CZ2 . TRP C 3 148 ? 142.706 163.081 57.640  1.00 254.47 ? 168 TRP C CZ2 1 
ATOM   6974 C  CZ3 . TRP C 3 148 ? 140.605 161.904 57.486  1.00 265.20 ? 168 TRP C CZ3 1 
ATOM   6975 C  CH2 . TRP C 3 148 ? 141.853 162.256 56.961  1.00 255.04 ? 168 TRP C CH2 1 
ATOM   6976 N  N   . LYS C 3 149 ? 136.678 163.799 61.131  1.00 288.43 ? 169 LYS C N   1 
ATOM   6977 C  CA  . LYS C 3 149 ? 135.353 163.290 61.480  1.00 309.38 ? 169 LYS C CA  1 
ATOM   6978 C  C   . LYS C 3 149 ? 135.152 161.954 60.775  1.00 317.66 ? 169 LYS C C   1 
ATOM   6979 O  O   . LYS C 3 149 ? 134.953 161.922 59.554  1.00 311.58 ? 169 LYS C O   1 
ATOM   6980 C  CB  . LYS C 3 149 ? 134.260 164.282 61.084  1.00 310.11 ? 169 LYS C CB  1 
ATOM   6981 C  CG  . LYS C 3 149 ? 134.238 165.569 61.893  1.00 306.14 ? 169 LYS C CG  1 
ATOM   6982 C  CD  . LYS C 3 149 ? 133.160 166.516 61.395  1.00 307.24 ? 169 LYS C CD  1 
ATOM   6983 C  CE  . LYS C 3 149 ? 133.143 167.803 62.202  1.00 303.73 ? 169 LYS C CE  1 
ATOM   6984 N  NZ  . LYS C 3 149 ? 132.098 168.748 61.719  1.00 307.14 ? 169 LYS C NZ  1 
ATOM   6985 N  N   . ILE C 3 150 ? 135.207 160.857 61.532  1.00 338.01 ? 170 ILE C N   1 
ATOM   6986 C  CA  . ILE C 3 150 ? 135.001 159.537 60.937  1.00 353.48 ? 170 ILE C CA  1 
ATOM   6987 C  C   . ILE C 3 150 ? 133.540 159.354 60.544  1.00 365.97 ? 170 ILE C C   1 
ATOM   6988 O  O   . ILE C 3 150 ? 133.218 159.090 59.380  1.00 382.20 ? 170 ILE C O   1 
ATOM   6989 C  CB  . ILE C 3 150 ? 135.463 158.428 61.898  1.00 362.16 ? 170 ILE C CB  1 
ATOM   6990 C  CG1 . ILE C 3 150 ? 136.972 158.506 62.132  1.00 345.79 ? 170 ILE C CG1 1 
ATOM   6991 C  CG2 . ILE C 3 150 ? 135.082 157.060 61.353  1.00 379.24 ? 170 ILE C CG2 1 
ATOM   6992 C  CD1 . ILE C 3 150 ? 137.508 157.377 62.988  1.00 347.62 ? 170 ILE C CD1 1 
ATOM   6993 N  N   . ASP C 3 151 ? 132.637 159.492 61.512  1.00 376.73 ? 171 ASP C N   1 
ATOM   6994 C  CA  . ASP C 3 151 ? 131.198 159.405 61.278  1.00 349.02 ? 171 ASP C CA  1 
ATOM   6995 C  C   . ASP C 3 151 ? 130.479 160.462 62.110  1.00 349.41 ? 171 ASP C C   1 
ATOM   6996 O  O   . ASP C 3 151 ? 129.522 160.178 62.831  1.00 362.18 ? 171 ASP C O   1 
ATOM   6997 C  CB  . ASP C 3 151 ? 130.677 158.007 61.601  1.00 362.08 ? 171 ASP C CB  1 
ATOM   6998 C  CG  . ASP C 3 151 ? 131.027 156.992 60.532  1.00 364.40 ? 171 ASP C CG  1 
ATOM   6999 O  OD1 . ASP C 3 151 ? 131.024 157.353 59.336  1.00 360.53 ? 171 ASP C OD1 1 
ATOM   7000 O  OD2 . ASP C 3 151 ? 131.299 155.829 60.891  1.00 370.56 ? 171 ASP C OD2 1 
ATOM   7001 N  N   . GLY C 3 152 ? 130.945 161.705 62.012  1.00 338.67 ? 172 GLY C N   1 
ATOM   7002 C  CA  . GLY C 3 152 ? 130.401 162.802 62.777  1.00 337.97 ? 172 GLY C CA  1 
ATOM   7003 C  C   . GLY C 3 152 ? 131.125 163.084 64.076  1.00 336.95 ? 172 GLY C C   1 
ATOM   7004 O  O   . GLY C 3 152 ? 131.033 164.205 64.592  1.00 329.49 ? 172 GLY C O   1 
ATOM   7005 N  N   . SER C 3 153 ? 131.836 162.101 64.620  1.00 341.59 ? 173 SER C N   1 
ATOM   7006 C  CA  . SER C 3 153 ? 132.603 162.270 65.846  1.00 336.08 ? 173 SER C CA  1 
ATOM   7007 C  C   . SER C 3 153 ? 133.997 162.790 65.520  1.00 318.93 ? 173 SER C C   1 
ATOM   7008 O  O   . SER C 3 153 ? 134.650 162.304 64.592  1.00 313.41 ? 173 SER C O   1 
ATOM   7009 C  CB  . SER C 3 153 ? 132.701 160.948 66.611  1.00 343.64 ? 173 SER C CB  1 
ATOM   7010 O  OG  . SER C 3 153 ? 133.491 161.095 67.779  1.00 338.22 ? 173 SER C OG  1 
ATOM   7011 N  N   . GLU C 3 154 ? 134.447 163.782 66.285  1.00 310.88 ? 174 GLU C N   1 
ATOM   7012 C  CA  . GLU C 3 154 ? 135.760 164.375 66.056  1.00 298.37 ? 174 GLU C CA  1 
ATOM   7013 C  C   . GLU C 3 154 ? 136.838 163.342 66.353  1.00 319.80 ? 174 GLU C C   1 
ATOM   7014 O  O   . GLU C 3 154 ? 137.085 163.001 67.513  1.00 316.79 ? 174 GLU C O   1 
ATOM   7015 C  CB  . GLU C 3 154 ? 135.950 165.622 66.914  1.00 294.41 ? 174 GLU C CB  1 
ATOM   7016 C  CG  . GLU C 3 154 ? 137.332 166.249 66.768  1.00 282.60 ? 174 GLU C CG  1 
ATOM   7017 C  CD  . GLU C 3 154 ? 137.531 167.461 67.658  1.00 276.58 ? 174 GLU C CD  1 
ATOM   7018 O  OE1 . GLU C 3 154 ? 136.558 167.892 68.311  1.00 291.36 ? 174 GLU C OE1 1 
ATOM   7019 O  OE2 . GLU C 3 154 ? 138.667 167.979 67.711  1.00 267.26 ? 174 GLU C OE2 1 
ATOM   7020 N  N   . ARG C 3 155 ? 137.480 162.842 65.303  1.00 324.69 ? 175 ARG C N   1 
ATOM   7021 C  CA  . ARG C 3 155 ? 138.569 161.884 65.440  1.00 332.23 ? 175 ARG C CA  1 
ATOM   7022 C  C   . ARG C 3 155 ? 139.884 162.616 65.674  1.00 336.07 ? 175 ARG C C   1 
ATOM   7023 O  O   . ARG C 3 155 ? 140.201 163.582 64.975  1.00 319.33 ? 175 ARG C O   1 
ATOM   7024 C  CB  . ARG C 3 155 ? 138.679 160.993 64.204  1.00 334.96 ? 175 ARG C CB  1 
ATOM   7025 C  CG  . ARG C 3 155 ? 139.723 159.898 64.352  1.00 325.82 ? 175 ARG C CG  1 
ATOM   7026 C  CD  . ARG C 3 155 ? 139.462 159.061 65.595  1.00 329.84 ? 175 ARG C CD  1 
ATOM   7027 N  NE  . ARG C 3 155 ? 140.431 157.983 65.756  1.00 328.48 ? 175 ARG C NE  1 
ATOM   7028 C  CZ  . ARG C 3 155 ? 140.422 157.120 66.766  1.00 336.95 ? 175 ARG C CZ  1 
ATOM   7029 N  NH1 . ARG C 3 155 ? 139.492 157.210 67.706  1.00 343.10 ? 175 ARG C NH1 1 
ATOM   7030 N  NH2 . ARG C 3 155 ? 141.344 156.171 66.841  1.00 338.62 ? 175 ARG C NH2 1 
ATOM   7031 N  N   . GLN C 3 156 ? 140.641 162.150 66.663  1.00 362.09 ? 176 GLN C N   1 
ATOM   7032 C  CA  . GLN C 3 156 ? 141.892 162.783 67.054  1.00 361.29 ? 176 GLN C CA  1 
ATOM   7033 C  C   . GLN C 3 156 ? 143.072 161.826 67.114  1.00 354.36 ? 176 GLN C C   1 
ATOM   7034 O  O   . GLN C 3 156 ? 144.215 162.287 67.010  1.00 343.99 ? 176 GLN C O   1 
ATOM   7035 C  CB  . GLN C 3 156 ? 141.738 163.467 68.421  1.00 371.62 ? 176 GLN C CB  1 
ATOM   7036 C  CG  . GLN C 3 156 ? 142.736 164.576 68.667  1.00 370.32 ? 176 GLN C CG  1 
ATOM   7037 C  CD  . GLN C 3 156 ? 142.436 165.818 67.850  1.00 369.48 ? 176 GLN C CD  1 
ATOM   7038 O  OE1 . GLN C 3 156 ? 141.343 165.968 67.303  1.00 375.42 ? 176 GLN C OE1 1 
ATOM   7039 N  NE2 . GLN C 3 156 ? 143.408 166.717 67.766  1.00 361.42 ? 176 GLN C NE2 1 
ATOM   7040 N  N   . ASN C 3 157 ? 142.847 160.525 67.275  1.00 356.94 ? 177 ASN C N   1 
ATOM   7041 C  CA  . ASN C 3 157 ? 143.928 159.551 67.323  1.00 342.70 ? 177 ASN C CA  1 
ATOM   7042 C  C   . ASN C 3 157 ? 144.259 159.077 65.914  1.00 334.23 ? 177 ASN C C   1 
ATOM   7043 O  O   . ASN C 3 157 ? 143.364 158.828 65.101  1.00 343.46 ? 177 ASN C O   1 
ATOM   7044 C  CB  . ASN C 3 157 ? 143.543 158.356 68.195  1.00 347.13 ? 177 ASN C CB  1 
ATOM   7045 C  CG  . ASN C 3 157 ? 143.510 158.698 69.667  1.00 347.09 ? 177 ASN C CG  1 
ATOM   7046 O  OD1 . ASN C 3 157 ? 143.602 159.864 70.043  1.00 341.69 ? 177 ASN C OD1 1 
ATOM   7047 N  ND2 . ASN C 3 157 ? 143.374 157.682 70.511  1.00 359.22 ? 177 ASN C ND2 1 
ATOM   7048 N  N   . GLY C 3 158 ? 145.554 158.958 65.633  1.00 322.67 ? 178 GLY C N   1 
ATOM   7049 C  CA  . GLY C 3 158 ? 146.000 158.528 64.325  1.00 299.64 ? 178 GLY C CA  1 
ATOM   7050 C  C   . GLY C 3 158 ? 146.034 159.616 63.281  1.00 275.55 ? 178 GLY C C   1 
ATOM   7051 O  O   . GLY C 3 158 ? 146.033 159.311 62.085  1.00 275.33 ? 178 GLY C O   1 
ATOM   7052 N  N   . VAL C 3 159 ? 146.065 160.880 63.694  1.00 251.72 ? 179 VAL C N   1 
ATOM   7053 C  CA  . VAL C 3 159 ? 146.088 162.021 62.787  1.00 236.88 ? 179 VAL C CA  1 
ATOM   7054 C  C   . VAL C 3 159 ? 147.493 162.603 62.785  1.00 249.25 ? 179 VAL C C   1 
ATOM   7055 O  O   . VAL C 3 159 ? 148.030 162.943 63.847  1.00 226.61 ? 179 VAL C O   1 
ATOM   7056 C  CB  . VAL C 3 159 ? 145.057 163.087 63.197  1.00 238.78 ? 179 VAL C CB  1 
ATOM   7057 C  CG1 . VAL C 3 159 ? 145.176 164.311 62.303  1.00 241.98 ? 179 VAL C CG1 1 
ATOM   7058 C  CG2 . VAL C 3 159 ? 143.650 162.513 63.147  1.00 250.03 ? 179 VAL C CG2 1 
ATOM   7059 N  N   . LEU C 3 160 ? 148.090 162.718 61.600  1.00 252.22 ? 180 LEU C N   1 
ATOM   7060 C  CA  . LEU C 3 160 ? 149.419 163.305 61.460  1.00 236.83 ? 180 LEU C CA  1 
ATOM   7061 C  C   . LEU C 3 160 ? 149.361 164.476 60.489  1.00 223.46 ? 180 LEU C C   1 
ATOM   7062 O  O   . LEU C 3 160 ? 148.977 164.306 59.328  1.00 224.41 ? 180 LEU C O   1 
ATOM   7063 C  CB  . LEU C 3 160 ? 150.434 162.264 60.979  1.00 233.98 ? 180 LEU C CB  1 
ATOM   7064 C  CG  . LEU C 3 160 ? 150.844 161.190 61.989  1.00 233.66 ? 180 LEU C CG  1 
ATOM   7065 C  CD1 . LEU C 3 160 ? 151.922 160.284 61.407  1.00 228.12 ? 180 LEU C CD1 1 
ATOM   7066 C  CD2 . LEU C 3 160 ? 151.310 161.821 63.292  1.00 227.52 ? 180 LEU C CD2 1 
ATOM   7067 N  N   . ASN C 3 161 ? 149.742 165.658 60.967  1.00 216.64 ? 181 ASN C N   1 
ATOM   7068 C  CA  . ASN C 3 161 ? 149.768 166.869 60.157  1.00 191.80 ? 181 ASN C CA  1 
ATOM   7069 C  C   . ASN C 3 161 ? 151.193 167.124 59.681  1.00 198.31 ? 181 ASN C C   1 
ATOM   7070 O  O   . ASN C 3 161 ? 152.122 167.161 60.495  1.00 178.66 ? 181 ASN C O   1 
ATOM   7071 C  CB  . ASN C 3 161 ? 149.249 168.068 60.952  1.00 191.37 ? 181 ASN C CB  1 
ATOM   7072 C  CG  . ASN C 3 161 ? 147.773 167.953 61.285  1.00 207.78 ? 181 ASN C CG  1 
ATOM   7073 O  OD1 . ASN C 3 161 ? 147.001 167.348 60.540  1.00 208.80 ? 181 ASN C OD1 1 
ATOM   7074 N  ND2 . ASN C 3 161 ? 147.372 168.538 62.409  1.00 202.19 ? 181 ASN C ND2 1 
ATOM   7075 N  N   . SER C 3 162 ? 151.365 167.297 58.371  1.00 208.84 ? 182 SER C N   1 
ATOM   7076 C  CA  . SER C 3 162 ? 152.677 167.555 57.782  1.00 195.44 ? 182 SER C CA  1 
ATOM   7077 C  C   . SER C 3 162 ? 152.635 168.854 56.984  1.00 192.87 ? 182 SER C C   1 
ATOM   7078 O  O   . SER C 3 162 ? 152.003 168.916 55.923  1.00 196.31 ? 182 SER C O   1 
ATOM   7079 C  CB  . SER C 3 162 ? 153.118 166.390 56.896  1.00 187.29 ? 182 SER C CB  1 
ATOM   7080 O  OG  . SER C 3 162 ? 154.405 166.626 56.351  1.00 165.24 ? 182 SER C OG  1 
ATOM   7081 N  N   . TRP C 3 163 ? 153.307 169.884 57.495  1.00 164.03 ? 183 TRP C N   1 
ATOM   7082 C  CA  . TRP C 3 163 ? 153.413 171.167 56.812  1.00 156.43 ? 183 TRP C CA  1 
ATOM   7083 C  C   . TRP C 3 163 ? 154.672 171.196 55.953  1.00 164.09 ? 183 TRP C C   1 
ATOM   7084 O  O   . TRP C 3 163 ? 155.765 170.876 56.431  1.00 145.79 ? 183 TRP C O   1 
ATOM   7085 C  CB  . TRP C 3 163 ? 153.431 172.321 57.816  1.00 154.20 ? 183 TRP C CB  1 
ATOM   7086 C  CG  . TRP C 3 163 ? 152.110 172.571 58.472  1.00 160.60 ? 183 TRP C CG  1 
ATOM   7087 C  CD1 . TRP C 3 163 ? 151.007 173.124 57.895  1.00 164.19 ? 183 TRP C CD1 1 
ATOM   7088 C  CD2 . TRP C 3 163 ? 151.748 172.273 59.825  1.00 185.86 ? 183 TRP C CD2 1 
ATOM   7089 N  NE1 . TRP C 3 163 ? 149.979 173.192 58.802  1.00 177.94 ? 183 TRP C NE1 1 
ATOM   7090 C  CE2 . TRP C 3 163 ? 150.408 172.676 59.996  1.00 187.60 ? 183 TRP C CE2 1 
ATOM   7091 C  CE3 . TRP C 3 163 ? 152.425 171.707 60.908  1.00 195.27 ? 183 TRP C CE3 1 
ATOM   7092 C  CZ2 . TRP C 3 163 ? 149.734 172.532 61.206  1.00 203.36 ? 183 TRP C CZ2 1 
ATOM   7093 C  CZ3 . TRP C 3 163 ? 151.753 171.565 62.110  1.00 200.98 ? 183 TRP C CZ3 1 
ATOM   7094 C  CH2 . TRP C 3 163 ? 150.421 171.975 62.248  1.00 208.03 ? 183 TRP C CH2 1 
ATOM   7095 N  N   . THR C 3 164 ? 154.516 171.583 54.691  1.00 180.39 ? 184 THR C N   1 
ATOM   7096 C  CA  . THR C 3 164 ? 155.651 171.730 53.795  1.00 187.01 ? 184 THR C CA  1 
ATOM   7097 C  C   . THR C 3 164 ? 156.253 173.124 53.939  1.00 211.50 ? 184 THR C C   1 
ATOM   7098 O  O   . THR C 3 164 ? 155.701 174.006 54.600  1.00 212.37 ? 184 THR C O   1 
ATOM   7099 C  CB  . THR C 3 164 ? 155.238 171.492 52.340  1.00 165.95 ? 184 THR C CB  1 
ATOM   7100 O  OG1 . THR C 3 164 ? 154.346 172.530 51.918  1.00 176.42 ? 184 THR C OG1 1 
ATOM   7101 C  CG2 . THR C 3 164 ? 154.532 170.157 52.194  1.00 155.63 ? 184 THR C CG2 1 
ATOM   7102 N  N   . ASP C 3 165 ? 157.410 173.315 53.313  1.00 232.05 ? 185 ASP C N   1 
ATOM   7103 C  CA  . ASP C 3 165 ? 158.009 174.637 53.265  1.00 240.29 ? 185 ASP C CA  1 
ATOM   7104 C  C   . ASP C 3 165 ? 157.261 175.511 52.264  1.00 222.97 ? 185 ASP C C   1 
ATOM   7105 O  O   . ASP C 3 165 ? 156.505 175.024 51.418  1.00 226.20 ? 185 ASP C O   1 
ATOM   7106 C  CB  . ASP C 3 165 ? 159.488 174.553 52.891  1.00 243.03 ? 185 ASP C CB  1 
ATOM   7107 C  CG  . ASP C 3 165 ? 160.323 173.890 53.967  1.00 256.74 ? 185 ASP C CG  1 
ATOM   7108 O  OD1 . ASP C 3 165 ? 159.895 173.896 55.141  1.00 262.01 ? 185 ASP C OD1 1 
ATOM   7109 O  OD2 . ASP C 3 165 ? 161.405 173.359 53.640  1.00 253.58 ? 185 ASP C OD2 1 
ATOM   7110 N  N   . GLN C 3 166 ? 157.470 176.820 52.378  1.00 198.34 ? 186 GLN C N   1 
ATOM   7111 C  CA  . GLN C 3 166 ? 156.797 177.764 51.500  1.00 181.00 ? 186 GLN C CA  1 
ATOM   7112 C  C   . GLN C 3 166 ? 157.146 177.485 50.040  1.00 181.42 ? 186 GLN C C   1 
ATOM   7113 O  O   . GLN C 3 166 ? 158.169 176.873 49.719  1.00 171.51 ? 186 GLN C O   1 
ATOM   7114 C  CB  . GLN C 3 166 ? 157.173 179.197 51.878  1.00 154.87 ? 186 GLN C CB  1 
ATOM   7115 C  CG  . GLN C 3 166 ? 156.262 180.266 51.297  1.00 130.03 ? 186 GLN C CG  1 
ATOM   7116 C  CD  . GLN C 3 166 ? 156.504 181.628 51.913  1.00 146.31 ? 186 GLN C CD  1 
ATOM   7117 O  OE1 . GLN C 3 166 ? 157.306 181.771 52.836  1.00 155.98 ? 186 GLN C OE1 1 
ATOM   7118 N  NE2 . GLN C 3 166 ? 155.812 182.638 51.403  1.00 146.82 ? 186 GLN C NE2 1 
ATOM   7119 N  N   . ASP C 3 167 ? 156.263 177.925 49.150  1.00 204.10 ? 187 ASP C N   1 
ATOM   7120 C  CA  . ASP C 3 167 ? 156.422 177.699 47.723  1.00 211.19 ? 187 ASP C CA  1 
ATOM   7121 C  C   . ASP C 3 167 ? 157.275 178.802 47.107  1.00 207.77 ? 187 ASP C C   1 
ATOM   7122 O  O   . ASP C 3 167 ? 157.324 179.928 47.609  1.00 220.33 ? 187 ASP C O   1 
ATOM   7123 C  CB  . ASP C 3 167 ? 155.060 177.641 47.031  1.00 222.86 ? 187 ASP C CB  1 
ATOM   7124 C  CG  . ASP C 3 167 ? 155.141 177.061 45.638  1.00 235.30 ? 187 ASP C CG  1 
ATOM   7125 O  OD1 . ASP C 3 167 ? 155.409 177.827 44.691  1.00 237.49 ? 187 ASP C OD1 1 
ATOM   7126 O  OD2 . ASP C 3 167 ? 154.935 175.838 45.489  1.00 245.60 ? 187 ASP C OD2 1 
ATOM   7127 N  N   . SER C 3 168 ? 157.947 178.469 46.005  1.00 189.58 ? 188 SER C N   1 
ATOM   7128 C  CA  . SER C 3 168 ? 158.854 179.399 45.345  1.00 190.04 ? 188 SER C CA  1 
ATOM   7129 C  C   . SER C 3 168 ? 158.275 179.959 44.053  1.00 194.19 ? 188 SER C C   1 
ATOM   7130 O  O   . SER C 3 168 ? 159.009 180.566 43.266  1.00 185.72 ? 188 SER C O   1 
ATOM   7131 C  CB  . SER C 3 168 ? 160.197 178.721 45.067  1.00 198.80 ? 188 SER C CB  1 
ATOM   7132 O  OG  . SER C 3 168 ? 160.036 177.615 44.196  1.00 212.79 ? 188 SER C OG  1 
ATOM   7133 N  N   . LYS C 3 169 ? 156.976 179.779 43.823  1.00 201.60 ? 189 LYS C N   1 
ATOM   7134 C  CA  . LYS C 3 169 ? 156.296 180.272 42.632  1.00 215.66 ? 189 LYS C CA  1 
ATOM   7135 C  C   . LYS C 3 169 ? 155.180 181.241 42.984  1.00 225.53 ? 189 LYS C C   1 
ATOM   7136 O  O   . LYS C 3 169 ? 155.114 182.341 42.422  1.00 225.06 ? 189 LYS C O   1 
ATOM   7137 C  CB  . LYS C 3 169 ? 155.743 179.097 41.809  1.00 224.78 ? 189 LYS C CB  1 
ATOM   7138 C  CG  . LYS C 3 169 ? 154.993 179.521 40.553  1.00 236.68 ? 189 LYS C CG  1 
ATOM   7139 C  CD  . LYS C 3 169 ? 155.887 180.274 39.573  1.00 244.09 ? 189 LYS C CD  1 
ATOM   7140 C  CE  . LYS C 3 169 ? 155.187 180.551 38.243  1.00 255.16 ? 189 LYS C CE  1 
ATOM   7141 N  NZ  . LYS C 3 169 ? 155.945 181.464 37.339  1.00 257.13 ? 189 LYS C NZ  1 
ATOM   7142 N  N   . ASP C 3 170 ? 154.291 180.854 43.900  1.00 237.00 ? 190 ASP C N   1 
ATOM   7143 C  CA  . ASP C 3 170 ? 153.171 181.683 44.314  1.00 234.35 ? 190 ASP C CA  1 
ATOM   7144 C  C   . ASP C 3 170 ? 153.158 181.910 45.818  1.00 226.07 ? 190 ASP C C   1 
ATOM   7145 O  O   . ASP C 3 170 ? 152.257 182.593 46.320  1.00 236.09 ? 190 ASP C O   1 
ATOM   7146 C  CB  . ASP C 3 170 ? 151.840 181.059 43.870  1.00 239.67 ? 190 ASP C CB  1 
ATOM   7147 C  CG  . ASP C 3 170 ? 151.633 179.663 44.427  1.00 237.92 ? 190 ASP C CG  1 
ATOM   7148 O  OD1 . ASP C 3 170 ? 152.638 178.973 44.699  1.00 236.64 ? 190 ASP C OD1 1 
ATOM   7149 O  OD2 . ASP C 3 170 ? 150.464 179.256 44.593  1.00 235.61 ? 190 ASP C OD2 1 
ATOM   7150 N  N   . SER C 3 171 ? 154.134 181.360 46.543  1.00 203.93 ? 191 SER C N   1 
ATOM   7151 C  CA  . SER C 3 171 ? 154.276 181.520 47.991  1.00 199.65 ? 191 SER C CA  1 
ATOM   7152 C  C   . SER C 3 171 ? 153.022 181.068 48.745  1.00 204.25 ? 191 SER C C   1 
ATOM   7153 O  O   . SER C 3 171 ? 152.393 181.835 49.478  1.00 216.08 ? 191 SER C O   1 
ATOM   7154 C  CB  . SER C 3 171 ? 154.638 182.968 48.340  1.00 193.23 ? 191 SER C CB  1 
ATOM   7155 O  OG  . SER C 3 171 ? 155.866 183.346 47.741  1.00 184.52 ? 191 SER C OG  1 
ATOM   7156 N  N   . THR C 3 172 ? 152.663 179.797 48.558  1.00 214.48 ? 192 THR C N   1 
ATOM   7157 C  CA  . THR C 3 172 ? 151.513 179.220 49.242  1.00 199.70 ? 192 THR C CA  1 
ATOM   7158 C  C   . THR C 3 172 ? 151.922 177.923 49.923  1.00 178.18 ? 192 THR C C   1 
ATOM   7159 O  O   . THR C 3 172 ? 152.492 177.033 49.284  1.00 171.70 ? 192 THR C O   1 
ATOM   7160 C  CB  . THR C 3 172 ? 150.356 178.954 48.270  1.00 209.28 ? 192 THR C CB  1 
ATOM   7161 O  OG1 . THR C 3 172 ? 150.809 178.114 47.201  1.00 180.60 ? 192 THR C OG1 1 
ATOM   7162 C  CG2 . THR C 3 172 ? 149.821 180.259 47.698  1.00 228.85 ? 192 THR C CG2 1 
ATOM   7163 N  N   . TYR C 3 173 ? 151.611 177.815 51.212  1.00 174.18 ? 193 TYR C N   1 
ATOM   7164 C  CA  . TYR C 3 173 ? 151.909 176.620 51.988  1.00 177.64 ? 193 TYR C CA  1 
ATOM   7165 C  C   . TYR C 3 173 ? 150.955 175.482 51.630  1.00 206.89 ? 193 TYR C C   1 
ATOM   7166 O  O   . TYR C 3 173 ? 149.898 175.683 51.024  1.00 229.13 ? 193 TYR C O   1 
ATOM   7167 C  CB  . TYR C 3 173 ? 151.843 176.919 53.486  1.00 179.72 ? 193 TYR C CB  1 
ATOM   7168 C  CG  . TYR C 3 173 ? 152.969 177.802 53.976  1.00 171.82 ? 193 TYR C CG  1 
ATOM   7169 C  CD1 . TYR C 3 173 ? 152.863 179.185 53.932  1.00 188.31 ? 193 TYR C CD1 1 
ATOM   7170 C  CD2 . TYR C 3 173 ? 154.140 177.250 54.479  1.00 164.57 ? 193 TYR C CD2 1 
ATOM   7171 C  CE1 . TYR C 3 173 ? 153.890 179.994 54.376  1.00 191.05 ? 193 TYR C CE1 1 
ATOM   7172 C  CE2 . TYR C 3 173 ? 155.172 178.051 54.926  1.00 181.60 ? 193 TYR C CE2 1 
ATOM   7173 C  CZ  . TYR C 3 173 ? 155.042 179.423 54.872  1.00 190.98 ? 193 TYR C CZ  1 
ATOM   7174 O  OH  . TYR C 3 173 ? 156.068 180.227 55.316  1.00 195.95 ? 193 TYR C OH  1 
ATOM   7175 N  N   . SER C 3 174 ? 151.349 174.267 52.008  1.00 188.20 ? 194 SER C N   1 
ATOM   7176 C  CA  . SER C 3 174 ? 150.529 173.084 51.790  1.00 171.11 ? 194 SER C CA  1 
ATOM   7177 C  C   . SER C 3 174 ? 150.813 172.083 52.900  1.00 190.88 ? 194 SER C C   1 
ATOM   7178 O  O   . SER C 3 174 ? 151.958 171.948 53.339  1.00 207.22 ? 194 SER C O   1 
ATOM   7179 C  CB  . SER C 3 174 ? 150.813 172.454 50.422  1.00 169.61 ? 194 SER C CB  1 
ATOM   7180 O  OG  . SER C 3 174 ? 150.552 173.371 49.374  1.00 174.40 ? 194 SER C OG  1 
ATOM   7181 N  N   . MET C 3 175 ? 149.772 171.385 53.351  1.00 187.26 ? 195 MET C N   1 
ATOM   7182 C  CA  . MET C 3 175 ? 149.915 170.419 54.432  1.00 185.41 ? 195 MET C CA  1 
ATOM   7183 C  C   . MET C 3 175 ? 149.095 169.174 54.129  1.00 205.76 ? 195 MET C C   1 
ATOM   7184 O  O   . MET C 3 175 ? 148.178 169.194 53.304  1.00 229.39 ? 195 MET C O   1 
ATOM   7185 C  CB  . MET C 3 175 ? 149.496 171.021 55.779  1.00 188.78 ? 195 MET C CB  1 
ATOM   7186 C  CG  . MET C 3 175 ? 148.021 171.347 55.889  1.00 196.90 ? 195 MET C CG  1 
ATOM   7187 S  SD  . MET C 3 175 ? 147.542 171.716 57.585  1.00 204.38 ? 195 MET C SD  1 
ATOM   7188 C  CE  . MET C 3 175 ? 147.943 170.169 58.386  1.00 212.18 ? 195 MET C CE  1 
ATOM   7189 N  N   . SER C 3 176 ? 149.438 168.081 54.811  1.00 184.99 ? 196 SER C N   1 
ATOM   7190 C  CA  . SER C 3 176 ? 148.757 166.802 54.639  1.00 193.22 ? 196 SER C CA  1 
ATOM   7191 C  C   . SER C 3 176 ? 148.367 166.238 55.996  1.00 217.95 ? 196 SER C C   1 
ATOM   7192 O  O   . SER C 3 176 ? 149.230 166.033 56.856  1.00 196.31 ? 196 SER C O   1 
ATOM   7193 C  CB  . SER C 3 176 ? 149.642 165.800 53.894  1.00 192.04 ? 196 SER C CB  1 
ATOM   7194 O  OG  . SER C 3 176 ? 150.818 165.519 54.634  1.00 187.05 ? 196 SER C OG  1 
ATOM   7195 N  N   . SER C 3 177 ? 147.072 165.998 56.189  1.00 227.05 ? 197 SER C N   1 
ATOM   7196 C  CA  . SER C 3 177 ? 146.557 165.357 57.392  1.00 226.15 ? 197 SER C CA  1 
ATOM   7197 C  C   . SER C 3 177 ? 146.262 163.896 57.065  1.00 227.11 ? 197 SER C C   1 
ATOM   7198 O  O   . SER C 3 177 ? 145.435 163.609 56.191  1.00 234.21 ? 197 SER C O   1 
ATOM   7199 C  CB  . SER C 3 177 ? 145.305 166.068 57.902  1.00 217.63 ? 197 SER C CB  1 
ATOM   7200 O  OG  . SER C 3 177 ? 144.868 165.509 59.127  1.00 223.71 ? 197 SER C OG  1 
ATOM   7201 N  N   . THR C 3 178 ? 146.940 162.981 57.753  1.00 221.30 ? 198 THR C N   1 
ATOM   7202 C  CA  . THR C 3 178 ? 146.823 161.550 57.495  1.00 228.55 ? 198 THR C CA  1 
ATOM   7203 C  C   . THR C 3 178 ? 146.106 160.854 58.644  1.00 240.20 ? 198 THR C C   1 
ATOM   7204 O  O   . THR C 3 178 ? 146.486 161.023 59.809  1.00 235.34 ? 198 THR C O   1 
ATOM   7205 C  CB  . THR C 3 178 ? 148.203 160.919 57.295  1.00 226.62 ? 198 THR C CB  1 
ATOM   7206 O  OG1 . THR C 3 178 ? 148.885 161.582 56.222  1.00 233.90 ? 198 THR C OG1 1 
ATOM   7207 C  CG2 . THR C 3 178 ? 148.071 159.439 56.972  1.00 231.48 ? 198 THR C CG2 1 
ATOM   7208 N  N   . LEU C 3 179 ? 145.066 160.080 58.312  1.00 261.06 ? 199 LEU C N   1 
ATOM   7209 C  CA  . LEU C 3 179 ? 144.339 159.261 59.283  1.00 280.98 ? 199 LEU C CA  1 
ATOM   7210 C  C   . LEU C 3 179 ? 144.616 157.789 58.981  1.00 293.34 ? 199 LEU C C   1 
ATOM   7211 O  O   . LEU C 3 179 ? 143.996 157.204 58.089  1.00 284.21 ? 199 LEU C O   1 
ATOM   7212 C  CB  . LEU C 3 179 ? 142.844 159.564 59.243  1.00 264.88 ? 199 LEU C CB  1 
ATOM   7213 C  CG  . LEU C 3 179 ? 141.997 158.823 60.279  1.00 283.21 ? 199 LEU C CG  1 
ATOM   7214 C  CD1 . LEU C 3 179 ? 142.444 159.177 61.690  1.00 280.68 ? 199 LEU C CD1 1 
ATOM   7215 C  CD2 . LEU C 3 179 ? 140.519 159.121 60.088  1.00 283.43 ? 199 LEU C CD2 1 
ATOM   7216 N  N   . THR C 3 180 ? 145.539 157.190 59.729  1.00 307.33 ? 200 THR C N   1 
ATOM   7217 C  CA  . THR C 3 180 ? 145.939 155.802 59.513  1.00 323.83 ? 200 THR C CA  1 
ATOM   7218 C  C   . THR C 3 180 ? 145.127 154.878 60.416  1.00 324.63 ? 200 THR C C   1 
ATOM   7219 O  O   . THR C 3 180 ? 145.165 155.019 61.644  1.00 325.05 ? 200 THR C O   1 
ATOM   7220 C  CB  . THR C 3 180 ? 147.434 155.625 59.774  1.00 333.42 ? 200 THR C CB  1 
ATOM   7221 O  OG1 . THR C 3 180 ? 148.181 156.457 58.877  1.00 335.78 ? 200 THR C OG1 1 
ATOM   7222 C  CG2 . THR C 3 180 ? 147.842 154.173 59.573  1.00 344.42 ? 200 THR C CG2 1 
ATOM   7223 N  N   . LEU C 3 181 ? 144.399 153.935 59.816  1.00 331.86 ? 201 LEU C N   1 
ATOM   7224 C  CA  . LEU C 3 181 ? 143.566 153.013 60.578  1.00 325.50 ? 201 LEU C CA  1 
ATOM   7225 C  C   . LEU C 3 181 ? 143.722 151.593 60.044  1.00 322.71 ? 201 LEU C C   1 
ATOM   7226 O  O   . LEU C 3 181 ? 144.314 151.355 58.985  1.00 313.53 ? 201 LEU C O   1 
ATOM   7227 C  CB  . LEU C 3 181 ? 142.089 153.432 60.548  1.00 321.89 ? 201 LEU C CB  1 
ATOM   7228 C  CG  . LEU C 3 181 ? 141.717 154.766 61.201  1.00 305.67 ? 201 LEU C CG  1 
ATOM   7229 C  CD1 . LEU C 3 181 ? 140.235 155.055 61.025  1.00 311.14 ? 201 LEU C CD1 1 
ATOM   7230 C  CD2 . LEU C 3 181 ? 142.088 154.762 62.677  1.00 302.78 ? 201 LEU C CD2 1 
ATOM   7231 N  N   . THR C 3 182 ? 143.172 150.645 60.799  1.00 343.75 ? 202 THR C N   1 
ATOM   7232 C  CA  . THR C 3 182 ? 143.209 149.237 60.440  1.00 376.88 ? 202 THR C CA  1 
ATOM   7233 C  C   . THR C 3 182 ? 142.102 148.895 59.444  1.00 452.28 ? 202 THR C C   1 
ATOM   7234 O  O   . THR C 3 182 ? 141.141 149.646 59.257  1.00 447.26 ? 202 THR C O   1 
ATOM   7235 C  CB  . THR C 3 182 ? 143.072 148.358 61.685  1.00 365.49 ? 202 THR C CB  1 
ATOM   7236 O  OG1 . THR C 3 182 ? 141.802 148.598 62.304  1.00 355.86 ? 202 THR C OG1 1 
ATOM   7237 C  CG2 . THR C 3 182 ? 144.180 148.669 62.679  1.00 330.99 ? 202 THR C CG2 1 
ATOM   7238 N  N   . LYS C 3 183 ? 142.253 147.734 58.802  1.00 549.38 ? 203 LYS C N   1 
ATOM   7239 C  CA  . LYS C 3 183 ? 141.262 147.285 57.829  1.00 572.07 ? 203 LYS C CA  1 
ATOM   7240 C  C   . LYS C 3 183 ? 139.947 146.914 58.507  1.00 579.78 ? 203 LYS C C   1 
ATOM   7241 O  O   . LYS C 3 183 ? 138.867 147.261 58.013  1.00 589.23 ? 203 LYS C O   1 
ATOM   7242 C  CB  . LYS C 3 183 ? 141.813 146.105 57.028  1.00 594.52 ? 203 LYS C CB  1 
ATOM   7243 C  CG  . LYS C 3 183 ? 140.864 145.571 55.967  1.00 619.26 ? 203 LYS C CG  1 
ATOM   7244 C  CD  . LYS C 3 183 ? 141.493 144.422 55.195  1.00 631.57 ? 203 LYS C CD  1 
ATOM   7245 C  CE  . LYS C 3 183 ? 141.899 143.286 56.118  1.00 644.44 ? 203 LYS C CE  1 
ATOM   7246 N  NZ  . LYS C 3 183 ? 142.554 142.176 55.372  1.00 651.94 ? 203 LYS C NZ  1 
ATOM   7247 N  N   . ASP C 3 184 ? 140.021 146.202 59.638  1.00 530.87 ? 204 ASP C N   1 
ATOM   7248 C  CA  . ASP C 3 184 ? 138.813 145.790 60.348  1.00 500.11 ? 204 ASP C CA  1 
ATOM   7249 C  C   . ASP C 3 184 ? 137.973 146.994 60.756  1.00 467.85 ? 204 ASP C C   1 
ATOM   7250 O  O   . ASP C 3 184 ? 136.741 146.964 60.656  1.00 470.41 ? 204 ASP C O   1 
ATOM   7251 C  CB  . ASP C 3 184 ? 139.186 144.956 61.574  1.00 477.91 ? 204 ASP C CB  1 
ATOM   7252 C  CG  . ASP C 3 184 ? 139.976 143.714 61.214  1.00 464.76 ? 204 ASP C CG  1 
ATOM   7253 O  OD1 . ASP C 3 184 ? 139.762 143.170 60.111  1.00 468.24 ? 204 ASP C OD1 1 
ATOM   7254 O  OD2 . ASP C 3 184 ? 140.812 143.282 62.036  1.00 457.36 ? 204 ASP C OD2 1 
ATOM   7255 N  N   . GLU C 3 185 ? 138.622 148.063 61.220  1.00 443.18 ? 205 GLU C N   1 
ATOM   7256 C  CA  . GLU C 3 185 ? 137.895 149.263 61.612  1.00 435.80 ? 205 GLU C CA  1 
ATOM   7257 C  C   . GLU C 3 185 ? 137.444 150.051 60.389  1.00 452.57 ? 205 GLU C C   1 
ATOM   7258 O  O   . GLU C 3 185 ? 136.414 150.733 60.435  1.00 455.41 ? 205 GLU C O   1 
ATOM   7259 C  CB  . GLU C 3 185 ? 138.759 150.127 62.533  1.00 406.00 ? 205 GLU C CB  1 
ATOM   7260 C  CG  . GLU C 3 185 ? 138.035 151.322 63.133  1.00 390.14 ? 205 GLU C CG  1 
ATOM   7261 C  CD  . GLU C 3 185 ? 138.893 152.091 64.118  1.00 370.30 ? 205 GLU C CD  1 
ATOM   7262 O  OE1 . GLU C 3 185 ? 140.067 151.712 64.310  1.00 366.94 ? 205 GLU C OE1 1 
ATOM   7263 O  OE2 . GLU C 3 185 ? 138.391 153.073 64.705  1.00 360.74 ? 205 GLU C OE2 1 
ATOM   7264 N  N   . TYR C 3 186 ? 138.199 149.957 59.292  1.00 474.55 ? 206 TYR C N   1 
ATOM   7265 C  CA  . TYR C 3 186 ? 137.842 150.656 58.062  1.00 499.20 ? 206 TYR C CA  1 
ATOM   7266 C  C   . TYR C 3 186 ? 136.584 150.067 57.439  1.00 571.01 ? 206 TYR C C   1 
ATOM   7267 O  O   . TYR C 3 186 ? 135.771 150.797 56.859  1.00 572.66 ? 206 TYR C O   1 
ATOM   7268 C  CB  . TYR C 3 186 ? 138.999 150.604 57.067  1.00 462.05 ? 206 TYR C CB  1 
ATOM   7269 C  CG  . TYR C 3 186 ? 138.653 151.156 55.702  1.00 433.08 ? 206 TYR C CG  1 
ATOM   7270 C  CD1 . TYR C 3 186 ? 138.510 152.523 55.499  1.00 411.49 ? 206 TYR C CD1 1 
ATOM   7271 C  CD2 . TYR C 3 186 ? 138.472 150.311 54.615  1.00 430.17 ? 206 TYR C CD2 1 
ATOM   7272 C  CE1 . TYR C 3 186 ? 138.193 153.031 54.253  1.00 402.68 ? 206 TYR C CE1 1 
ATOM   7273 C  CE2 . TYR C 3 186 ? 138.156 150.810 53.365  1.00 421.64 ? 206 TYR C CE2 1 
ATOM   7274 C  CZ  . TYR C 3 186 ? 138.018 152.170 53.190  1.00 408.15 ? 206 TYR C CZ  1 
ATOM   7275 O  OH  . TYR C 3 186 ? 137.705 152.672 51.947  1.00 403.34 ? 206 TYR C OH  1 
ATOM   7276 N  N   . GLU C 3 187 ? 136.402 148.752 57.550  1.00 648.30 ? 207 GLU C N   1 
ATOM   7277 C  CA  . GLU C 3 187 ? 135.246 148.092 56.961  1.00 676.05 ? 207 GLU C CA  1 
ATOM   7278 C  C   . GLU C 3 187 ? 134.022 148.134 57.866  1.00 677.99 ? 207 GLU C C   1 
ATOM   7279 O  O   . GLU C 3 187 ? 133.069 147.377 57.644  1.00 697.63 ? 207 GLU C O   1 
ATOM   7280 C  CB  . GLU C 3 187 ? 135.587 146.640 56.612  1.00 703.11 ? 207 GLU C CB  1 
ATOM   7281 C  CG  . GLU C 3 187 ? 136.636 146.490 55.524  1.00 712.11 ? 207 GLU C CG  1 
ATOM   7282 C  CD  . GLU C 3 187 ? 136.824 145.049 55.095  1.00 733.18 ? 207 GLU C CD  1 
ATOM   7283 O  OE1 . GLU C 3 187 ? 136.122 144.170 55.637  1.00 749.83 ? 207 GLU C OE1 1 
ATOM   7284 O  OE2 . GLU C 3 187 ? 137.675 144.795 54.216  1.00 732.39 ? 207 GLU C OE2 1 
ATOM   7285 N  N   . ARG C 3 188 ? 134.031 149.002 58.878  1.00 572.78 ? 208 ARG C N   1 
ATOM   7286 C  CA  . ARG C 3 188 ? 132.886 149.195 59.758  1.00 497.59 ? 208 ARG C CA  1 
ATOM   7287 C  C   . ARG C 3 188 ? 132.359 150.625 59.704  1.00 436.53 ? 208 ARG C C   1 
ATOM   7288 O  O   . ARG C 3 188 ? 131.475 150.979 60.494  1.00 428.26 ? 208 ARG C O   1 
ATOM   7289 C  CB  . ARG C 3 188 ? 133.245 148.818 61.199  1.00 454.85 ? 208 ARG C CB  1 
ATOM   7290 C  CG  . ARG C 3 188 ? 133.455 147.327 61.418  1.00 435.02 ? 208 ARG C CG  1 
ATOM   7291 C  CD  . ARG C 3 188 ? 133.514 146.985 62.899  1.00 434.19 ? 208 ARG C CD  1 
ATOM   7292 N  NE  . ARG C 3 188 ? 134.682 147.565 63.554  1.00 410.44 ? 208 ARG C NE  1 
ATOM   7293 C  CZ  . ARG C 3 188 ? 135.830 146.921 63.740  1.00 407.39 ? 208 ARG C CZ  1 
ATOM   7294 N  NH1 . ARG C 3 188 ? 135.965 145.670 63.319  1.00 417.33 ? 208 ARG C NH1 1 
ATOM   7295 N  NH2 . ARG C 3 188 ? 136.842 147.525 64.347  1.00 397.46 ? 208 ARG C NH2 1 
ATOM   7296 N  N   . HIS C 3 189 ? 132.881 151.455 58.800  1.00 408.35 ? 209 HIS C N   1 
ATOM   7297 C  CA  . HIS C 3 189 ? 132.415 152.822 58.619  1.00 393.09 ? 209 HIS C CA  1 
ATOM   7298 C  C   . HIS C 3 189 ? 132.396 153.139 57.129  1.00 395.93 ? 209 HIS C C   1 
ATOM   7299 O  O   . HIS C 3 189 ? 133.190 152.593 56.358  1.00 383.87 ? 209 HIS C O   1 
ATOM   7300 C  CB  . HIS C 3 189 ? 133.302 153.815 59.380  1.00 367.38 ? 209 HIS C CB  1 
ATOM   7301 C  CG  . HIS C 3 189 ? 133.365 153.557 60.854  1.00 370.58 ? 209 HIS C CG  1 
ATOM   7302 N  ND1 . HIS C 3 189 ? 132.357 153.925 61.719  1.00 376.86 ? 209 HIS C ND1 1 
ATOM   7303 C  CD2 . HIS C 3 189 ? 134.312 152.957 61.615  1.00 371.58 ? 209 HIS C CD2 1 
ATOM   7304 C  CE1 . HIS C 3 189 ? 132.682 153.569 62.949  1.00 378.86 ? 209 HIS C CE1 1 
ATOM   7305 N  NE2 . HIS C 3 189 ? 133.863 152.979 62.913  1.00 374.04 ? 209 HIS C NE2 1 
ATOM   7306 N  N   . ASN C 3 190 ? 131.484 154.026 56.724  1.00 415.50 ? 210 ASN C N   1 
ATOM   7307 C  CA  . ASN C 3 190 ? 131.223 154.275 55.308  1.00 414.41 ? 210 ASN C CA  1 
ATOM   7308 C  C   . ASN C 3 190 ? 131.693 155.650 54.845  1.00 393.15 ? 210 ASN C C   1 
ATOM   7309 O  O   . ASN C 3 190 ? 132.617 155.743 54.034  1.00 390.14 ? 210 ASN C O   1 
ATOM   7310 C  CB  . ASN C 3 190 ? 129.731 154.086 55.018  1.00 428.08 ? 210 ASN C CB  1 
ATOM   7311 C  CG  . ASN C 3 190 ? 129.409 154.179 53.537  1.00 427.83 ? 210 ASN C CG  1 
ATOM   7312 O  OD1 . ASN C 3 190 ? 130.254 153.902 52.686  1.00 423.59 ? 210 ASN C OD1 1 
ATOM   7313 N  ND2 . ASN C 3 190 ? 128.178 154.568 53.224  1.00 430.81 ? 210 ASN C ND2 1 
ATOM   7314 N  N   . SER C 3 191 ? 131.075 156.728 55.330  1.00 376.32 ? 211 SER C N   1 
ATOM   7315 C  CA  . SER C 3 191 ? 131.325 158.081 54.834  1.00 349.69 ? 211 SER C CA  1 
ATOM   7316 C  C   . SER C 3 191 ? 132.284 158.831 55.753  1.00 347.97 ? 211 SER C C   1 
ATOM   7317 O  O   . SER C 3 191 ? 131.916 159.206 56.870  1.00 339.72 ? 211 SER C O   1 
ATOM   7318 C  CB  . SER C 3 191 ? 130.011 158.847 54.694  1.00 354.59 ? 211 SER C CB  1 
ATOM   7319 O  OG  . SER C 3 191 ? 129.354 158.962 55.944  1.00 360.61 ? 211 SER C OG  1 
ATOM   7320 N  N   . TYR C 3 192 ? 133.511 159.050 55.282  1.00 341.47 ? 212 TYR C N   1 
ATOM   7321 C  CA  . TYR C 3 192 ? 134.500 159.811 56.032  1.00 316.84 ? 212 TYR C CA  1 
ATOM   7322 C  C   . TYR C 3 192 ? 134.410 161.293 55.679  1.00 326.79 ? 212 TYR C C   1 
ATOM   7323 O  O   . TYR C 3 192 ? 133.988 161.664 54.578  1.00 309.04 ? 212 TYR C O   1 
ATOM   7324 C  CB  . TYR C 3 192 ? 135.914 159.297 55.756  1.00 309.74 ? 212 TYR C CB  1 
ATOM   7325 C  CG  . TYR C 3 192 ? 136.199 157.925 56.324  1.00 316.37 ? 212 TYR C CG  1 
ATOM   7326 C  CD1 . TYR C 3 192 ? 136.627 157.772 57.636  1.00 315.34 ? 212 TYR C CD1 1 
ATOM   7327 C  CD2 . TYR C 3 192 ? 136.054 156.785 55.545  1.00 324.03 ? 212 TYR C CD2 1 
ATOM   7328 C  CE1 . TYR C 3 192 ? 136.894 156.522 58.160  1.00 321.75 ? 212 TYR C CE1 1 
ATOM   7329 C  CE2 . TYR C 3 192 ? 136.320 155.529 56.060  1.00 330.61 ? 212 TYR C CE2 1 
ATOM   7330 C  CZ  . TYR C 3 192 ? 136.739 155.404 57.368  1.00 329.40 ? 212 TYR C CZ  1 
ATOM   7331 O  OH  . TYR C 3 192 ? 137.005 154.158 57.887  1.00 336.31 ? 212 TYR C OH  1 
ATOM   7332 N  N   . THR C 3 193 ? 134.829 162.141 56.621  1.00 326.86 ? 213 THR C N   1 
ATOM   7333 C  CA  . THR C 3 193 ? 134.712 163.588 56.449  1.00 352.57 ? 213 THR C CA  1 
ATOM   7334 C  C   . THR C 3 193 ? 135.849 164.289 57.174  1.00 369.34 ? 213 THR C C   1 
ATOM   7335 O  O   . THR C 3 193 ? 135.986 164.140 58.388  1.00 352.00 ? 213 THR C O   1 
ATOM   7336 C  CB  . THR C 3 193 ? 133.368 164.085 56.989  1.00 358.07 ? 213 THR C CB  1 
ATOM   7337 O  OG1 . THR C 3 193 ? 132.297 163.549 56.202  1.00 368.09 ? 213 THR C OG1 1 
ATOM   7338 C  CG2 . THR C 3 193 ? 133.314 165.600 56.971  1.00 348.05 ? 213 THR C CG2 1 
ATOM   7339 N  N   . CYS C 3 194 ? 136.649 165.065 56.445  1.00 410.35 ? 214 CYS C N   1 
ATOM   7340 C  CA  . CYS C 3 194 ? 137.665 165.920 57.045  1.00 405.35 ? 214 CYS C CA  1 
ATOM   7341 C  C   . CYS C 3 194 ? 137.354 167.381 56.745  1.00 396.42 ? 214 CYS C C   1 
ATOM   7342 O  O   . CYS C 3 194 ? 136.953 167.723 55.626  1.00 400.49 ? 214 CYS C O   1 
ATOM   7343 C  CB  . CYS C 3 194 ? 139.077 165.561 56.554  1.00 405.43 ? 214 CYS C CB  1 
ATOM   7344 S  SG  . CYS C 3 194 ? 139.370 165.672 54.774  1.00 401.64 ? 214 CYS C SG  1 
ATOM   7345 N  N   . GLU C 3 195 ? 137.513 168.240 57.755  1.00 338.96 ? 215 GLU C N   1 
ATOM   7346 C  CA  . GLU C 3 195 ? 137.239 169.663 57.610  1.00 295.20 ? 215 GLU C CA  1 
ATOM   7347 C  C   . GLU C 3 195 ? 138.444 170.473 58.072  1.00 251.35 ? 215 GLU C C   1 
ATOM   7348 O  O   . GLU C 3 195 ? 139.198 170.048 58.951  1.00 240.27 ? 215 GLU C O   1 
ATOM   7349 C  CB  . GLU C 3 195 ? 135.985 170.079 58.395  1.00 280.04 ? 215 GLU C CB  1 
ATOM   7350 C  CG  . GLU C 3 195 ? 136.099 169.928 59.899  1.00 276.69 ? 215 GLU C CG  1 
ATOM   7351 C  CD  . GLU C 3 195 ? 134.878 170.458 60.624  1.00 290.36 ? 215 GLU C CD  1 
ATOM   7352 O  OE1 . GLU C 3 195 ? 134.898 170.501 61.872  1.00 294.40 ? 215 GLU C OE1 1 
ATOM   7353 O  OE2 . GLU C 3 195 ? 133.896 170.828 59.945  1.00 272.72 ? 215 GLU C OE2 1 
ATOM   7354 N  N   . ALA C 3 196 ? 138.619 171.646 57.463  1.00 236.78 ? 216 ALA C N   1 
ATOM   7355 C  CA  . ALA C 3 196 ? 139.748 172.525 57.746  1.00 237.25 ? 216 ALA C CA  1 
ATOM   7356 C  C   . ALA C 3 196 ? 139.257 173.934 58.046  1.00 234.74 ? 216 ALA C C   1 
ATOM   7357 O  O   . ALA C 3 196 ? 138.438 174.481 57.301  1.00 236.61 ? 216 ALA C O   1 
ATOM   7358 C  CB  . ALA C 3 196 ? 140.728 172.553 56.571  1.00 232.09 ? 216 ALA C CB  1 
ATOM   7359 N  N   . THR C 3 197 ? 139.760 174.516 59.133  1.00 238.51 ? 217 THR C N   1 
ATOM   7360 C  CA  . THR C 3 197 ? 139.430 175.879 59.533  1.00 237.76 ? 217 THR C CA  1 
ATOM   7361 C  C   . THR C 3 197 ? 140.618 176.794 59.251  1.00 234.41 ? 217 THR C C   1 
ATOM   7362 O  O   . THR C 3 197 ? 141.703 176.595 59.810  1.00 207.96 ? 217 THR C O   1 
ATOM   7363 C  CB  . THR C 3 197 ? 139.055 175.938 61.014  1.00 226.50 ? 217 THR C CB  1 
ATOM   7364 O  OG1 . THR C 3 197 ? 137.959 175.050 61.267  1.00 235.68 ? 217 THR C OG1 1 
ATOM   7365 C  CG2 . THR C 3 197 ? 138.653 177.352 61.405  1.00 226.33 ? 217 THR C CG2 1 
ATOM   7366 N  N   . HIS C 3 198 ? 140.412 177.784 58.384  1.00 237.42 ? 218 HIS C N   1 
ATOM   7367 C  CA  . HIS C 3 198 ? 141.432 178.753 57.998  1.00 240.70 ? 218 HIS C CA  1 
ATOM   7368 C  C   . HIS C 3 198 ? 140.888 180.161 58.225  1.00 255.51 ? 218 HIS C C   1 
ATOM   7369 O  O   . HIS C 3 198 ? 139.724 180.347 58.592  1.00 259.88 ? 218 HIS C O   1 
ATOM   7370 C  CB  . HIS C 3 198 ? 141.859 178.557 56.536  1.00 243.07 ? 218 HIS C CB  1 
ATOM   7371 C  CG  . HIS C 3 198 ? 143.191 179.157 56.205  1.00 239.95 ? 218 HIS C CG  1 
ATOM   7372 N  ND1 . HIS C 3 198 ? 143.321 180.399 55.620  1.00 239.34 ? 218 HIS C ND1 1 
ATOM   7373 C  CD2 . HIS C 3 198 ? 144.450 178.689 56.373  1.00 230.83 ? 218 HIS C CD2 1 
ATOM   7374 C  CE1 . HIS C 3 198 ? 144.601 180.669 55.444  1.00 224.11 ? 218 HIS C CE1 1 
ATOM   7375 N  NE2 . HIS C 3 198 ? 145.308 179.647 55.893  1.00 216.28 ? 218 HIS C NE2 1 
ATOM   7376 N  N   . LYS C 3 199 ? 141.738 181.166 58.003  1.00 236.14 ? 219 LYS C N   1 
ATOM   7377 C  CA  . LYS C 3 199 ? 141.342 182.550 58.224  1.00 230.31 ? 219 LYS C CA  1 
ATOM   7378 C  C   . LYS C 3 199 ? 140.725 183.190 56.990  1.00 222.62 ? 219 LYS C C   1 
ATOM   7379 O  O   . LYS C 3 199 ? 140.224 184.317 57.079  1.00 218.51 ? 219 LYS C O   1 
ATOM   7380 C  CB  . LYS C 3 199 ? 142.540 183.393 58.670  1.00 218.35 ? 219 LYS C CB  1 
ATOM   7381 C  CG  . LYS C 3 199 ? 143.644 183.487 57.634  1.00 205.92 ? 219 LYS C CG  1 
ATOM   7382 C  CD  . LYS C 3 199 ? 144.770 184.380 58.120  1.00 202.14 ? 219 LYS C CD  1 
ATOM   7383 C  CE  . LYS C 3 199 ? 144.252 185.772 58.441  1.00 202.38 ? 219 LYS C CE  1 
ATOM   7384 N  NZ  . LYS C 3 199 ? 143.624 186.412 57.250  1.00 200.27 ? 219 LYS C NZ  1 
ATOM   7385 N  N   . THR C 3 200 ? 140.762 182.510 55.842  1.00 228.61 ? 220 THR C N   1 
ATOM   7386 C  CA  . THR C 3 200 ? 140.162 183.059 54.632  1.00 240.08 ? 220 THR C CA  1 
ATOM   7387 C  C   . THR C 3 200 ? 138.645 183.105 54.742  1.00 238.16 ? 220 THR C C   1 
ATOM   7388 O  O   . THR C 3 200 ? 138.012 184.029 54.218  1.00 240.44 ? 220 THR C O   1 
ATOM   7389 C  CB  . THR C 3 200 ? 140.578 182.241 53.410  1.00 240.62 ? 220 THR C CB  1 
ATOM   7390 O  OG1 . THR C 3 200 ? 140.274 180.858 53.630  1.00 247.50 ? 220 THR C OG1 1 
ATOM   7391 C  CG2 . THR C 3 200 ? 142.068 182.392 53.158  1.00 235.59 ? 220 THR C CG2 1 
ATOM   7392 N  N   . SER C 3 201 ? 138.052 182.121 55.413  1.00 232.60 ? 221 SER C N   1 
ATOM   7393 C  CA  . SER C 3 201 ? 136.611 182.069 55.593  1.00 223.05 ? 221 SER C CA  1 
ATOM   7394 C  C   . SER C 3 201 ? 136.298 181.477 56.959  1.00 241.51 ? 221 SER C C   1 
ATOM   7395 O  O   . SER C 3 201 ? 137.053 180.657 57.490  1.00 224.35 ? 221 SER C O   1 
ATOM   7396 C  CB  . SER C 3 201 ? 135.937 181.247 54.488  1.00 227.33 ? 221 SER C CB  1 
ATOM   7397 O  OG  . SER C 3 201 ? 134.530 181.233 54.650  1.00 244.90 ? 221 SER C OG  1 
ATOM   7398 N  N   . THR C 3 202 ? 135.174 181.920 57.523  1.00 242.39 ? 222 THR C N   1 
ATOM   7399 C  CA  . THR C 3 202 ? 134.741 181.463 58.840  1.00 249.55 ? 222 THR C CA  1 
ATOM   7400 C  C   . THR C 3 202 ? 134.203 180.037 58.813  1.00 254.63 ? 222 THR C C   1 
ATOM   7401 O  O   . THR C 3 202 ? 134.303 179.322 59.817  1.00 251.78 ? 222 THR C O   1 
ATOM   7402 C  CB  . THR C 3 202 ? 133.682 182.409 59.403  1.00 250.49 ? 222 THR C CB  1 
ATOM   7403 O  OG1 . THR C 3 202 ? 132.553 182.441 58.522  1.00 251.93 ? 222 THR C OG1 1 
ATOM   7404 C  CG2 . THR C 3 202 ? 134.247 183.813 59.549  1.00 242.47 ? 222 THR C CG2 1 
ATOM   7405 N  N   . SER C 3 203 ? 133.633 179.604 57.690  1.00 262.38 ? 223 SER C N   1 
ATOM   7406 C  CA  . SER C 3 203 ? 133.078 178.260 57.588  1.00 281.19 ? 223 SER C CA  1 
ATOM   7407 C  C   . SER C 3 203 ? 134.153 177.259 57.184  1.00 263.67 ? 223 SER C C   1 
ATOM   7408 O  O   . SER C 3 203 ? 134.712 177.374 56.085  1.00 258.86 ? 223 SER C O   1 
ATOM   7409 C  CB  . SER C 3 203 ? 131.941 178.227 56.581  1.00 296.44 ? 223 SER C CB  1 
ATOM   7410 O  OG  . SER C 3 203 ? 130.891 179.097 56.967  1.00 307.85 ? 223 SER C OG  1 
ATOM   7411 N  N   . PRO C 3 204 ? 134.474 176.286 58.037  1.00 267.25 ? 224 PRO C N   1 
ATOM   7412 C  CA  . PRO C 3 204 ? 135.499 175.291 57.696  1.00 258.89 ? 224 PRO C CA  1 
ATOM   7413 C  C   . PRO C 3 204 ? 135.120 174.482 56.464  1.00 255.42 ? 224 PRO C C   1 
ATOM   7414 O  O   . PRO C 3 204 ? 133.973 174.059 56.301  1.00 257.25 ? 224 PRO C O   1 
ATOM   7415 C  CB  . PRO C 3 204 ? 135.564 174.408 58.948  1.00 260.24 ? 224 PRO C CB  1 
ATOM   7416 C  CG  . PRO C 3 204 ? 135.010 175.261 60.046  1.00 251.54 ? 224 PRO C CG  1 
ATOM   7417 C  CD  . PRO C 3 204 ? 133.949 176.094 59.399  1.00 255.14 ? 224 PRO C CD  1 
ATOM   7418 N  N   . ILE C 3 205 ? 136.103 174.273 55.589  1.00 254.25 ? 225 ILE C N   1 
ATOM   7419 C  CA  . ILE C 3 205 ? 135.879 173.493 54.378  1.00 270.30 ? 225 ILE C CA  1 
ATOM   7420 C  C   . ILE C 3 205 ? 135.700 172.028 54.755  1.00 287.98 ? 225 ILE C C   1 
ATOM   7421 O  O   . ILE C 3 205 ? 136.539 171.439 55.449  1.00 276.76 ? 225 ILE C O   1 
ATOM   7422 C  CB  . ILE C 3 205 ? 137.046 173.683 53.397  1.00 266.73 ? 225 ILE C CB  1 
ATOM   7423 C  CG1 . ILE C 3 205 ? 137.192 175.160 53.021  1.00 248.91 ? 225 ILE C CG1 1 
ATOM   7424 C  CG2 . ILE C 3 205 ? 136.845 172.831 52.154  1.00 271.76 ? 225 ILE C CG2 1 
ATOM   7425 C  CD1 . ILE C 3 205 ? 138.279 175.433 52.004  1.00 228.74 ? 225 ILE C CD1 1 
ATOM   7426 N  N   . VAL C 3 206 ? 134.594 171.439 54.308  1.00 314.28 ? 226 VAL C N   1 
ATOM   7427 C  CA  . VAL C 3 206 ? 134.200 170.081 54.671  1.00 329.94 ? 226 VAL C CA  1 
ATOM   7428 C  C   . VAL C 3 206 ? 134.233 169.205 53.425  1.00 334.93 ? 226 VAL C C   1 
ATOM   7429 O  O   . VAL C 3 206 ? 133.583 169.518 52.419  1.00 339.35 ? 226 VAL C O   1 
ATOM   7430 C  CB  . VAL C 3 206 ? 132.806 170.062 55.316  1.00 344.81 ? 226 VAL C CB  1 
ATOM   7431 C  CG1 . VAL C 3 206 ? 132.325 168.638 55.510  1.00 358.05 ? 226 VAL C CG1 1 
ATOM   7432 C  CG2 . VAL C 3 206 ? 132.822 170.810 56.641  1.00 342.70 ? 226 VAL C CG2 1 
ATOM   7433 N  N   . LYS C 3 207 ? 134.988 168.108 53.491  1.00 318.80 ? 227 LYS C N   1 
ATOM   7434 C  CA  . LYS C 3 207 ? 135.039 167.114 52.426  1.00 324.15 ? 227 LYS C CA  1 
ATOM   7435 C  C   . LYS C 3 207 ? 134.626 165.750 52.965  1.00 326.63 ? 227 LYS C C   1 
ATOM   7436 O  O   . LYS C 3 207 ? 135.012 165.367 54.074  1.00 312.58 ? 227 LYS C O   1 
ATOM   7437 C  CB  . LYS C 3 207 ? 136.436 167.033 51.800  1.00 303.67 ? 227 LYS C CB  1 
ATOM   7438 C  CG  . LYS C 3 207 ? 136.783 168.208 50.896  1.00 280.18 ? 227 LYS C CG  1 
ATOM   7439 C  CD  . LYS C 3 207 ? 135.803 168.303 49.733  1.00 276.02 ? 227 LYS C CD  1 
ATOM   7440 C  CE  . LYS C 3 207 ? 136.127 169.471 48.814  1.00 263.88 ? 227 LYS C CE  1 
ATOM   7441 N  NZ  . LYS C 3 207 ? 136.080 170.777 49.523  1.00 263.88 ? 227 LYS C NZ  1 
ATOM   7442 N  N   . SER C 3 208 ? 133.836 165.022 52.175  1.00 363.91 ? 228 SER C N   1 
ATOM   7443 C  CA  . SER C 3 208 ? 133.292 163.738 52.591  1.00 382.01 ? 228 SER C CA  1 
ATOM   7444 C  C   . SER C 3 208 ? 133.279 162.778 51.411  1.00 388.76 ? 228 SER C C   1 
ATOM   7445 O  O   . SER C 3 208 ? 133.186 163.196 50.254  1.00 392.88 ? 228 SER C O   1 
ATOM   7446 C  CB  . SER C 3 208 ? 131.867 163.885 53.140  1.00 395.14 ? 228 SER C CB  1 
ATOM   7447 O  OG  . SER C 3 208 ? 131.815 164.843 54.182  1.00 393.73 ? 228 SER C OG  1 
ATOM   7448 N  N   . PHE C 3 209 ? 133.370 161.483 51.713  1.00 386.42 ? 229 PHE C N   1 
ATOM   7449 C  CA  . PHE C 3 209 ? 133.226 160.459 50.686  1.00 384.28 ? 229 PHE C CA  1 
ATOM   7450 C  C   . PHE C 3 209 ? 132.594 159.219 51.304  1.00 380.01 ? 229 PHE C C   1 
ATOM   7451 O  O   . PHE C 3 209 ? 132.540 159.066 52.528  1.00 385.51 ? 229 PHE C O   1 
ATOM   7452 C  CB  . PHE C 3 209 ? 134.568 160.120 50.020  1.00 373.54 ? 229 PHE C CB  1 
ATOM   7453 C  CG  . PHE C 3 209 ? 135.482 159.283 50.871  1.00 371.03 ? 229 PHE C CG  1 
ATOM   7454 C  CD1 . PHE C 3 209 ? 136.371 159.878 51.748  1.00 359.62 ? 229 PHE C CD1 1 
ATOM   7455 C  CD2 . PHE C 3 209 ? 135.460 157.899 50.783  1.00 379.30 ? 229 PHE C CD2 1 
ATOM   7456 C  CE1 . PHE C 3 209 ? 137.216 159.110 52.526  1.00 356.66 ? 229 PHE C CE1 1 
ATOM   7457 C  CE2 . PHE C 3 209 ? 136.297 157.128 51.563  1.00 376.85 ? 229 PHE C CE2 1 
ATOM   7458 C  CZ  . PHE C 3 209 ? 137.178 157.734 52.433  1.00 365.16 ? 229 PHE C CZ  1 
ATOM   7459 N  N   . ASN C 3 210 ? 132.121 158.327 50.436  1.00 371.60 ? 230 ASN C N   1 
ATOM   7460 C  CA  . ASN C 3 210 ? 131.505 157.074 50.848  1.00 383.65 ? 230 ASN C CA  1 
ATOM   7461 C  C   . ASN C 3 210 ? 132.418 155.903 50.509  1.00 382.00 ? 230 ASN C C   1 
ATOM   7462 O  O   . ASN C 3 210 ? 133.108 155.917 49.484  1.00 368.50 ? 230 ASN C O   1 
ATOM   7463 C  CB  . ASN C 3 210 ? 130.147 156.882 50.165  1.00 386.43 ? 230 ASN C CB  1 
ATOM   7464 C  CG  . ASN C 3 210 ? 129.172 158.000 50.479  1.00 378.22 ? 230 ASN C CG  1 
ATOM   7465 O  OD1 . ASN C 3 210 ? 129.229 158.609 51.547  1.00 373.41 ? 230 ASN C OD1 1 
ATOM   7466 N  ND2 . ASN C 3 210 ? 128.267 158.274 49.546  1.00 379.86 ? 230 ASN C ND2 1 
ATOM   7467 N  N   . ARG C 3 211 ? 132.417 154.890 51.379  1.00 404.49 ? 231 ARG C N   1 
ATOM   7468 C  CA  . ARG C 3 211 ? 133.230 153.699 51.156  1.00 414.82 ? 231 ARG C CA  1 
ATOM   7469 C  C   . ARG C 3 211 ? 132.606 152.767 50.122  1.00 418.51 ? 231 ARG C C   1 
ATOM   7470 O  O   . ARG C 3 211 ? 133.325 152.006 49.463  1.00 420.78 ? 231 ARG C O   1 
ATOM   7471 C  CB  . ARG C 3 211 ? 133.447 152.949 52.472  1.00 428.17 ? 231 ARG C CB  1 
ATOM   7472 C  CG  . ARG C 3 211 ? 134.389 151.757 52.359  1.00 438.40 ? 231 ARG C CG  1 
ATOM   7473 C  CD  . ARG C 3 211 ? 134.332 150.871 53.590  1.00 451.51 ? 231 ARG C CD  1 
ATOM   7474 N  NE  . ARG C 3 211 ? 132.995 150.328 53.804  1.00 470.07 ? 231 ARG C NE  1 
ATOM   7475 C  CZ  . ARG C 3 211 ? 132.546 149.213 53.236  1.00 484.44 ? 231 ARG C CZ  1 
ATOM   7476 N  NH1 . ARG C 3 211 ? 133.327 148.522 52.418  1.00 483.97 ? 231 ARG C NH1 1 
ATOM   7477 N  NH2 . ARG C 3 211 ? 131.314 148.790 53.485  1.00 499.54 ? 231 ARG C NH2 1 
ATOM   7478 N  N   . ASN C 3 212 ? 131.285 152.826 49.954  1.00 420.09 ? 232 ASN C N   1 
ATOM   7479 C  CA  . ASN C 3 212 ? 130.570 151.941 49.043  1.00 398.08 ? 232 ASN C CA  1 
ATOM   7480 C  C   . ASN C 3 212 ? 130.932 152.214 47.589  1.00 400.11 ? 232 ASN C C   1 
ATOM   7481 O  O   . ASN C 3 212 ? 130.113 152.735 46.825  1.00 396.75 ? 232 ASN C O   1 
ATOM   7482 C  CB  . ASN C 3 212 ? 129.059 152.082 49.243  1.00 408.70 ? 232 ASN C CB  1 
ATOM   7483 N  N   . GLU C 3 213 ? 132.151 151.828 47.205  1.00 395.60 ? 233 GLU C N   1 
ATOM   7484 C  CA  . GLU C 3 213 ? 132.641 151.920 45.830  1.00 398.60 ? 233 GLU C CA  1 
ATOM   7485 C  C   . GLU C 3 213 ? 132.358 153.293 45.222  1.00 398.71 ? 233 GLU C C   1 
ATOM   7486 O  O   . GLU C 3 213 ? 131.826 153.413 44.116  1.00 401.12 ? 233 GLU C O   1 
ATOM   7487 C  CB  . GLU C 3 213 ? 132.044 150.806 44.968  1.00 411.84 ? 233 GLU C CB  1 
ATOM   7488 C  CG  . GLU C 3 213 ? 132.937 150.358 43.821  1.00 410.32 ? 233 GLU C CG  1 
ATOM   7489 C  CD  . GLU C 3 213 ? 134.201 149.670 44.299  1.00 402.47 ? 233 GLU C CD  1 
ATOM   7490 O  OE1 . GLU C 3 213 ? 134.187 149.097 45.408  1.00 406.97 ? 233 GLU C OE1 1 
ATOM   7491 O  OE2 . GLU C 3 213 ? 135.211 149.703 43.564  1.00 390.58 ? 233 GLU C OE2 1 
ATOM   7492 N  N   . CYS C 3 214 ? 132.741 154.332 45.966  1.00 377.58 ? 234 CYS C N   1 
ATOM   7493 C  CA  . CYS C 3 214 ? 132.585 155.743 45.585  1.00 367.46 ? 234 CYS C CA  1 
ATOM   7494 C  C   . CYS C 3 214 ? 131.314 156.042 44.792  1.00 377.87 ? 234 CYS C C   1 
ATOM   7495 O  O   . CYS C 3 214 ? 130.648 157.051 45.026  1.00 379.44 ? 234 CYS C O   1 
ATOM   7496 C  CB  . CYS C 3 214 ? 133.811 156.221 44.791  1.00 346.08 ? 234 CYS C CB  1 
ATOM   7497 S  SG  . CYS C 3 214 ? 134.457 155.074 43.541  1.00 352.46 ? 234 CYS C SG  1 
HETATM 7498 C  C10 . 68P D 4 .   ? 160.520 184.571 2.886   1.00 115.44 ? 701 68P A C10 1 
HETATM 7499 C  C13 . 68P D 4 .   ? 163.297 182.662 3.015   1.00 132.05 ? 701 68P A C13 1 
HETATM 7500 C  C15 . 68P D 4 .   ? 159.329 183.675 2.526   1.00 141.01 ? 701 68P A C15 1 
HETATM 7501 C  C17 . 68P D 4 .   ? 163.939 181.315 2.717   1.00 135.45 ? 701 68P A C17 1 
HETATM 7502 C  C20 . 68P D 4 .   ? 159.307 185.226 5.148   1.00 124.72 ? 701 68P A C20 1 
HETATM 7503 C  C21 . 68P D 4 .   ? 158.120 184.329 4.782   1.00 151.80 ? 701 68P A C21 1 
HETATM 7504 C  C22 . 68P D 4 .   ? 165.815 187.523 -0.412  1.00 134.43 ? 701 68P A C22 1 
HETATM 7505 C  C24 . 68P D 4 .   ? 164.400 179.326 1.092   1.00 137.94 ? 701 68P A C24 1 
HETATM 7506 F  F01 . 68P D 4 .   ? 157.071 184.228 5.616   1.00 171.33 ? 701 68P A F01 1 
HETATM 7507 O  O02 . 68P D 4 .   ? 161.227 184.923 0.630   1.00 128.37 ? 701 68P A O02 1 
HETATM 7508 N  N03 . 68P D 4 .   ? 164.385 187.179 -0.607  1.00 140.27 ? 701 68P A N03 1 
HETATM 7509 N  N04 . 68P D 4 .   ? 164.899 178.297 0.889   1.00 135.12 ? 701 68P A N04 1 
HETATM 7510 C  C05 . 68P D 4 .   ? 161.690 184.684 1.955   1.00 112.35 ? 701 68P A C05 1 
HETATM 7511 C  C06 . 68P D 4 .   ? 162.626 185.818 2.422   1.00 109.55 ? 701 68P A C06 1 
HETATM 7512 C  C07 . 68P D 4 .   ? 162.444 183.375 1.942   1.00 113.73 ? 701 68P A C07 1 
HETATM 7513 C  C08 . 68P D 4 .   ? 162.248 182.753 0.620   1.00 135.14 ? 701 68P A C08 1 
HETATM 7514 C  C09 . 68P D 4 .   ? 163.803 185.929 1.432   1.00 108.42 ? 701 68P A C09 1 
HETATM 7515 C  C11 . 68P D 4 .   ? 161.407 183.670 -0.164  1.00 135.80 ? 701 68P A C11 1 
HETATM 7516 C  C12 . 68P D 4 .   ? 163.676 187.238 0.654   1.00 120.39 ? 701 68P A C12 1 
HETATM 7517 C  C14 . 68P D 4 .   ? 162.904 181.382 0.310   1.00 139.08 ? 701 68P A C14 1 
HETATM 7518 C  C16 . 68P D 4 .   ? 160.509 185.343 4.194   1.00 115.91 ? 701 68P A C16 1 
HETATM 7519 C  C18 . 68P D 4 .   ? 163.745 180.681 1.374   1.00 138.85 ? 701 68P A C18 1 
HETATM 7520 C  C19 . 68P D 4 .   ? 158.126 183.555 3.476   1.00 148.66 ? 701 68P A C19 1 
HETATM 7521 C  C23 . 68P D 4 .   ? 164.266 185.878 -1.220  1.00 158.73 ? 701 68P A C23 1 
HETATM 7522 C  C1  . NAG E 5 .   ? 185.667 178.374 31.097  1.00 82.98  ? 702 NAG A C1  1 
HETATM 7523 C  C2  . NAG E 5 .   ? 185.142 177.936 32.464  1.00 100.97 ? 702 NAG A C2  1 
HETATM 7524 C  C3  . NAG E 5 .   ? 185.388 176.440 32.676  1.00 105.62 ? 702 NAG A C3  1 
HETATM 7525 C  C4  . NAG E 5 .   ? 184.850 175.630 31.503  1.00 104.69 ? 702 NAG A C4  1 
HETATM 7526 C  C5  . NAG E 5 .   ? 185.415 176.172 30.195  1.00 96.36  ? 702 NAG A C5  1 
HETATM 7527 C  C6  . NAG E 5 .   ? 184.851 175.490 28.970  1.00 95.78  ? 702 NAG A C6  1 
HETATM 7528 C  C7  . NAG E 5 .   ? 185.126 179.087 34.633  1.00 156.03 ? 702 NAG A C7  1 
HETATM 7529 C  C8  . NAG E 5 .   ? 185.931 179.877 35.619  1.00 180.46 ? 702 NAG A C8  1 
HETATM 7530 N  N2  . NAG E 5 .   ? 185.768 178.709 33.524  1.00 115.24 ? 702 NAG A N2  1 
HETATM 7531 O  O3  . NAG E 5 .   ? 184.761 176.018 33.881  1.00 103.98 ? 702 NAG A O3  1 
HETATM 7532 O  O4  . NAG E 5 .   ? 185.224 174.264 31.639  1.00 101.57 ? 702 NAG A O4  1 
HETATM 7533 O  O5  . NAG E 5 .   ? 185.091 177.563 30.078  1.00 97.93  ? 702 NAG A O5  1 
HETATM 7534 O  O6  . NAG E 5 .   ? 185.074 176.267 27.801  1.00 89.92  ? 702 NAG A O6  1 
HETATM 7535 O  O7  . NAG E 5 .   ? 183.948 178.806 34.831  1.00 167.18 ? 702 NAG A O7  1 
HETATM 7536 C  C1  . CLR F 6 .   ? 167.174 159.429 16.769  1.00 173.26 ? 703 CLR A C1  1 
HETATM 7537 C  C2  . CLR F 6 .   ? 167.639 159.077 18.174  1.00 182.92 ? 703 CLR A C2  1 
HETATM 7538 C  C3  . CLR F 6 .   ? 167.952 160.366 18.916  1.00 200.90 ? 703 CLR A C3  1 
HETATM 7539 C  C4  . CLR F 6 .   ? 166.715 161.246 19.001  1.00 180.61 ? 703 CLR A C4  1 
HETATM 7540 C  C5  . CLR F 6 .   ? 166.022 161.370 17.669  1.00 174.31 ? 703 CLR A C5  1 
HETATM 7541 C  C6  . CLR F 6 .   ? 165.550 162.560 17.290  1.00 180.28 ? 703 CLR A C6  1 
HETATM 7542 C  C7  . CLR F 6 .   ? 165.136 162.843 15.869  1.00 173.27 ? 703 CLR A C7  1 
HETATM 7543 C  C8  . CLR F 6 .   ? 164.410 161.632 15.336  1.00 164.40 ? 703 CLR A C8  1 
HETATM 7544 C  C9  . CLR F 6 .   ? 165.355 160.445 15.379  1.00 163.83 ? 703 CLR A C9  1 
HETATM 7545 C  C10 . CLR F 6 .   ? 165.840 160.145 16.807  1.00 168.03 ? 703 CLR A C10 1 
HETATM 7546 C  C11 . CLR F 6 .   ? 164.727 159.224 14.691  1.00 160.06 ? 703 CLR A C11 1 
HETATM 7547 C  C12 . CLR F 6 .   ? 164.073 159.529 13.336  1.00 156.58 ? 703 CLR A C12 1 
HETATM 7548 C  C13 . CLR F 6 .   ? 163.086 160.665 13.476  1.00 166.37 ? 703 CLR A C13 1 
HETATM 7549 C  C14 . CLR F 6 .   ? 163.905 161.847 13.929  1.00 168.38 ? 703 CLR A C14 1 
HETATM 7550 C  C15 . CLR F 6 .   ? 163.022 163.056 13.716  1.00 172.00 ? 703 CLR A C15 1 
HETATM 7551 C  C16 . CLR F 6 .   ? 162.218 162.694 12.476  1.00 163.17 ? 703 CLR A C16 1 
HETATM 7552 C  C17 . CLR F 6 .   ? 162.404 161.205 12.222  1.00 162.91 ? 703 CLR A C17 1 
HETATM 7553 C  C18 . CLR F 6 .   ? 162.051 160.258 14.517  1.00 172.12 ? 703 CLR A C18 1 
HETATM 7554 C  C19 . CLR F 6 .   ? 164.860 159.253 17.540  1.00 172.90 ? 703 CLR A C19 1 
HETATM 7555 C  C20 . CLR F 6 .   ? 161.058 160.588 11.865  1.00 160.06 ? 703 CLR A C20 1 
HETATM 7556 C  C21 . CLR F 6 .   ? 161.220 159.132 11.467  1.00 154.00 ? 703 CLR A C21 1 
HETATM 7557 C  C22 . CLR F 6 .   ? 160.347 161.377 10.774  1.00 164.23 ? 703 CLR A C22 1 
HETATM 7558 C  C23 . CLR F 6 .   ? 159.196 162.187 11.366  1.00 179.07 ? 703 CLR A C23 1 
HETATM 7559 C  C24 . CLR F 6 .   ? 158.982 163.513 10.637  1.00 179.19 ? 703 CLR A C24 1 
HETATM 7560 C  C25 . CLR F 6 .   ? 157.527 163.971 10.681  1.00 168.99 ? 703 CLR A C25 1 
HETATM 7561 C  C26 . CLR F 6 .   ? 157.430 165.491 10.639  1.00 163.11 ? 703 CLR A C26 1 
HETATM 7562 C  C27 . CLR F 6 .   ? 156.718 163.356 9.549   1.00 171.75 ? 703 CLR A C27 1 
HETATM 7563 O  O1  . CLR F 6 .   ? 168.383 160.050 20.241  1.00 199.73 ? 703 CLR A O1  1 
HETATM 7564 C  C01 . C14 G 7 .   ? 161.799 165.903 -5.611  0.50 72.82  ? 704 C14 A C01 1 
HETATM 7565 C  C02 . C14 G 7 .   ? 163.087 165.915 -4.790  0.50 75.65  ? 704 C14 A C02 1 
HETATM 7566 C  C03 . C14 G 7 .   ? 162.744 165.753 -3.311  0.50 77.61  ? 704 C14 A C03 1 
HETATM 7567 C  C04 . C14 G 7 .   ? 163.968 166.069 -2.453  0.50 75.23  ? 704 C14 A C04 1 
HETATM 7568 C  C05 . C14 G 7 .   ? 163.537 166.225 -0.995  0.50 79.95  ? 704 C14 A C05 1 
HETATM 7569 C  C06 . C14 G 7 .   ? 164.365 165.302 -0.102  0.50 72.35  ? 704 C14 A C06 1 
HETATM 7570 C  C07 . C14 G 7 .   ? 164.257 163.861 -0.600  0.50 71.36  ? 704 C14 A C07 1 
HETATM 7571 C  C08 . C14 G 7 .   ? 164.231 162.902 0.587   0.50 71.10  ? 704 C14 A C08 1 
HETATM 7572 C  C09 . C14 G 7 .   ? 164.350 161.460 0.095   0.50 71.82  ? 704 C14 A C09 1 
HETATM 7573 C  C10 . C14 G 7 .   ? 163.530 160.534 0.993   0.50 69.01  ? 704 C14 A C10 1 
HETATM 7574 C  C11 . C14 G 7 .   ? 163.970 160.690 2.449   0.50 75.00  ? 704 C14 A C11 1 
HETATM 7575 C  C12 . C14 G 7 .   ? 162.755 161.031 3.311   0.50 77.61  ? 704 C14 A C12 1 
HETATM 7576 C  C13 . C14 G 7 .   ? 163.092 160.841 4.787   0.50 75.02  ? 704 C14 A C13 1 
HETATM 7577 C  C14 . C14 G 7 .   ? 161.806 160.900 5.609   0.50 72.86  ? 704 C14 A C14 1 
HETATM 7578 C  C05 . 69D H 8 .   ? 172.058 176.927 1.641   1.00 151.93 ? 705 69D A C05 1 
HETATM 7579 C  C07 . 69D H 8 .   ? 171.888 178.191 1.318   1.00 151.84 ? 705 69D A C07 1 
HETATM 7580 C  C08 . 69D H 8 .   ? 171.041 179.082 1.876   1.00 151.50 ? 705 69D A C08 1 
HETATM 7581 C  C10 . 69D H 8 .   ? 171.425 175.892 0.645   1.00 167.28 ? 705 69D A C10 1 
HETATM 7582 C  C11 . 69D H 8 .   ? 170.339 178.159 2.958   1.00 147.96 ? 705 69D A C11 1 
HETATM 7583 C  C13 . 69D H 8 .   ? 172.615 178.802 0.345   1.00 159.54 ? 705 69D A C13 1 
HETATM 7584 C  C14 . 69D H 8 .   ? 171.067 180.558 1.300   1.00 161.54 ? 705 69D A C14 1 
HETATM 7585 C  C15 . 69D H 8 .   ? 172.093 175.504 -0.507  1.00 164.49 ? 705 69D A C15 1 
HETATM 7586 C  C16 . 69D H 8 .   ? 170.191 175.338 0.948   1.00 176.05 ? 705 69D A C16 1 
HETATM 7587 C  C17 . 69D H 8 .   ? 172.581 179.918 -0.036  1.00 167.26 ? 705 69D A C17 1 
HETATM 7588 C  C18 . 69D H 8 .   ? 171.933 180.793 0.312   1.00 170.47 ? 705 69D A C18 1 
HETATM 7589 C  C19 . 69D H 8 .   ? 171.514 174.576 -1.361  1.00 164.91 ? 705 69D A C19 1 
HETATM 7590 C  C20 . 69D H 8 .   ? 169.615 174.414 0.098   1.00 175.77 ? 705 69D A C20 1 
HETATM 7591 C  C21 . 69D H 8 .   ? 170.275 174.033 -1.056  1.00 175.38 ? 705 69D A C21 1 
HETATM 7592 C  C24 . 69D H 8 .   ? 172.026 182.184 -0.306  1.00 193.12 ? 705 69D A C24 1 
HETATM 7593 BR BR  . 69D H 8 .   ? 169.446 172.733 -2.229  1.00 195.79 ? 705 69D A BR  1 
HETATM 7594 O  O02 . 69D H 8 .   ? 171.357 176.807 2.972   1.00 147.91 ? 705 69D A O02 1 
HETATM 7595 N  N04 . 69D H 8 .   ? 172.075 183.224 -0.750  1.00 198.51 ? 705 69D A N04 1 
HETATM 7596 C  C1  . NAG I 5 .   ? 201.325 187.780 30.712  1.00 221.09 ? 706 NAG A C1  1 
HETATM 7597 C  C2  . NAG I 5 .   ? 201.441 187.989 32.221  1.00 235.73 ? 706 NAG A C2  1 
HETATM 7598 C  C3  . NAG I 5 .   ? 201.472 186.640 32.937  1.00 235.63 ? 706 NAG A C3  1 
HETATM 7599 C  C4  . NAG I 5 .   ? 200.282 185.787 32.521  1.00 240.98 ? 706 NAG A C4  1 
HETATM 7600 C  C5  . NAG I 5 .   ? 200.207 185.682 31.000  1.00 243.23 ? 706 NAG A C5  1 
HETATM 7601 C  C6  . NAG I 5 .   ? 198.974 184.954 30.517  1.00 249.07 ? 706 NAG A C6  1 
HETATM 7602 C  C7  . NAG I 5 .   ? 202.699 189.547 33.642  1.00 233.76 ? 706 NAG A C7  1 
HETATM 7603 C  C8  . NAG I 5 .   ? 203.990 190.287 33.829  1.00 230.08 ? 706 NAG A C8  1 
HETATM 7604 N  N2  . NAG I 5 .   ? 202.620 188.771 32.555  1.00 236.23 ? 706 NAG A N2  1 
HETATM 7605 O  O3  . NAG I 5 .   ? 201.452 186.849 34.344  1.00 232.11 ? 706 NAG A O3  1 
HETATM 7606 O  O4  . NAG I 5 .   ? 200.402 184.482 33.074  1.00 240.27 ? 706 NAG A O4  1 
HETATM 7607 O  O5  . NAG I 5 .   ? 200.167 186.996 30.421  1.00 240.35 ? 706 NAG A O5  1 
HETATM 7608 O  O6  . NAG I 5 .   ? 199.019 183.575 30.857  1.00 244.91 ? 706 NAG A O6  1 
HETATM 7609 O  O7  . NAG I 5 .   ? 201.771 189.644 34.438  1.00 242.27 ? 706 NAG A O7  1 
HETATM 7610 NA NA  . NA  J 9 .   ? 163.955 193.125 3.240   1.00 98.83  ? 707 NA  A NA  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLY A 4   ? 2.5486 3.6795 2.8120  1.0393  -0.5676 -0.1325 77  GLY A N   
2    C CA  . GLY A 4   ? 2.5090 3.6099 2.7682  1.0237  -0.5836 -0.1050 77  GLY A CA  
3    C C   . GLY A 4   ? 2.4335 3.4662 2.6769  0.9995  -0.5877 -0.0884 77  GLY A C   
4    O O   . GLY A 4   ? 2.5035 3.5508 2.7469  0.9658  -0.5784 -0.0725 77  GLY A O   
5    N N   . GLU A 5   ? 2.3725 3.3305 2.6013  1.0167  -0.6020 -0.0921 78  GLU A N   
6    C CA  . GLU A 5   ? 2.2256 3.1106 2.4376  0.9972  -0.6103 -0.0749 78  GLU A CA  
7    C C   . GLU A 5   ? 2.4724 3.3239 2.6760  1.0013  -0.6021 -0.0916 78  GLU A C   
8    O O   . GLU A 5   ? 2.6221 3.4898 2.8288  1.0264  -0.5971 -0.1164 78  GLU A O   
9    C CB  . GLU A 5   ? 2.2022 3.0172 2.4010  1.0104  -0.6400 -0.0578 78  GLU A CB  
10   C CG  . GLU A 5   ? 2.2870 3.0748 2.4828  1.0521  -0.6561 -0.0748 78  GLU A CG  
11   C CD  . GLU A 5   ? 2.3771 3.1031 2.5615  1.0636  -0.6855 -0.0560 78  GLU A CD  
12   O OE1 . GLU A 5   ? 2.4616 3.1644 2.6391  1.0381  -0.6935 -0.0291 78  GLU A OE1 
13   O OE2 . GLU A 5   ? 2.3365 3.0369 2.5176  1.0981  -0.7009 -0.0679 78  GLU A OE2 
14   N N   . ARG A 6   ? 2.2948 3.1005 2.4870  0.9761  -0.6009 -0.0777 79  ARG A N   
15   C CA  . ARG A 6   ? 2.2585 3.0286 2.4419  0.9761  -0.5942 -0.0903 79  ARG A CA  
16   C C   . ARG A 6   ? 2.4952 3.1756 2.6593  0.9951  -0.6190 -0.0883 79  ARG A C   
17   O O   . ARG A 6   ? 2.5820 3.2264 2.7392  1.0055  -0.6408 -0.0750 79  ARG A O   
18   C CB  . ARG A 6   ? 1.8745 2.6468 2.0569  0.9385  -0.5785 -0.0771 79  ARG A CB  
19   N N   . GLU A 7   ? 2.6494 3.2925 2.8038  0.9986  -0.6162 -0.1010 80  GLU A N   
20   C CA  . GLU A 7   ? 2.7069 3.2639 2.8411  1.0159  -0.6390 -0.1017 80  GLU A CA  
21   C C   . GLU A 7   ? 2.4305 2.9227 2.5498  0.9889  -0.6509 -0.0730 80  GLU A C   
22   O O   . GLU A 7   ? 2.3512 2.8662 2.4757  0.9584  -0.6408 -0.0540 80  GLU A O   
23   C CB  . GLU A 7   ? 2.8593 3.4036 2.9877  1.0301  -0.6319 -0.1274 80  GLU A CB  
24   C CG  . GLU A 7   ? 2.9853 3.5797 3.1228  1.0628  -0.6257 -0.1570 80  GLU A CG  
25   C CD  . GLU A 7   ? 3.1269 3.6882 3.2568  1.0975  -0.6495 -0.1624 80  GLU A CD  
26   O OE1 . GLU A 7   ? 3.1225 3.7374 3.2640  1.1214  -0.6456 -0.1788 80  GLU A OE1 
27   O OE2 . GLU A 7   ? 3.2331 3.7147 3.3450  1.1005  -0.6724 -0.1499 80  GLU A OE2 
28   N N   . THR A 8   ? 2.2226 2.6328 2.3218  1.0001  -0.6730 -0.0698 81  THR A N   
29   C CA  . THR A 8   ? 2.1434 2.4862 2.2256  0.9759  -0.6865 -0.0425 81  THR A CA  
30   C C   . THR A 8   ? 2.3245 2.5969 2.3881  0.9809  -0.6954 -0.0512 81  THR A C   
31   O O   . THR A 8   ? 2.0449 2.3288 2.1102  0.9985  -0.6873 -0.0775 81  THR A O   
32   C CB  . THR A 8   ? 2.1002 2.4102 2.1745  0.9808  -0.7101 -0.0219 81  THR A CB  
33   O OG1 . THR A 8   ? 2.3403 2.5831 2.3959  0.9563  -0.7235 0.0049  81  THR A OG1 
34   C CG2 . THR A 8   ? 1.9826 2.2593 2.0495  1.0194  -0.7295 -0.0385 81  THR A CG2 
35   N N   . TRP A 9   ? 2.2973 2.4970 2.3418  0.9641  -0.7123 -0.0285 82  TRP A N   
36   C CA  . TRP A 9   ? 2.1907 2.3173 2.2151  0.9649  -0.7233 -0.0330 82  TRP A CA  
37   C C   . TRP A 9   ? 2.2562 2.3229 2.2638  0.9958  -0.7493 -0.0427 82  TRP A C   
38   O O   . TRP A 9   ? 2.4831 2.5440 2.4899  1.0077  -0.7639 -0.0338 82  TRP A O   
39   C CB  . TRP A 9   ? 1.9597 2.0370 1.9706  0.9294  -0.7286 -0.0031 82  TRP A CB  
40   N N   . GLY A 10  ? 2.2538 2.2749 2.2471  1.0088  -0.7555 -0.0612 83  GLY A N   
41   C CA  . GLY A 10  ? 2.2168 2.1730 2.1905  1.0372  -0.7813 -0.0716 83  GLY A CA  
42   C C   . GLY A 10  ? 2.3996 2.2691 2.3496  1.0198  -0.8056 -0.0448 83  GLY A C   
43   O O   . GLY A 10  ? 2.5586 2.3775 2.4939  1.0387  -0.8294 -0.0439 83  GLY A O   
44   N N   . LYS A 11  ? 2.1604 2.0120 2.1059  0.9834  -0.8000 -0.0226 84  LYS A N   
45   C CA  . LYS A 11  ? 2.3146 2.0891 2.2377  0.9605  -0.8204 0.0057  84  LYS A CA  
46   C C   . LYS A 11  ? 2.4877 2.2803 2.4164  0.9198  -0.8047 0.0299  84  LYS A C   
47   O O   . LYS A 11  ? 2.8076 2.6452 2.7499  0.9110  -0.7824 0.0200  84  LYS A O   
48   C CB  . LYS A 11  ? 2.2611 1.9513 2.1580  0.9690  -0.8403 -0.0047 84  LYS A CB  
49   C CG  . LYS A 11  ? 2.3002 1.9097 2.1727  0.9414  -0.8609 0.0251  84  LYS A CG  
50   C CD  . LYS A 11  ? 2.3874 1.9106 2.2322  0.9590  -0.8886 0.0146  84  LYS A CD  
51   C CE  . LYS A 11  ? 2.8537 2.3682 2.6960  0.9924  -0.9059 0.0061  84  LYS A CE  
52   N NZ  . LYS A 11  ? 3.0056 2.4302 2.8185  1.0077  -0.9351 -0.0020 84  LYS A NZ  
53   N N   . LYS A 12  ? 2.4122 2.1712 2.3300  0.8954  -0.8166 0.0619  85  LYS A N   
54   C CA  . LYS A 12  ? 2.6405 2.4094 2.5598  0.8562  -0.8042 0.0872  85  LYS A CA  
55   C C   . LYS A 12  ? 2.7471 2.4869 2.6590  0.8410  -0.7981 0.0825  85  LYS A C   
56   O O   . LYS A 12  ? 2.8421 2.6238 2.7669  0.8211  -0.7767 0.0859  85  LYS A O   
57   C CB  . LYS A 12  ? 2.6036 2.3272 2.5062  0.8338  -0.8219 0.1214  85  LYS A CB  
58   C CG  . LYS A 12  ? 2.4997 2.2276 2.4006  0.7934  -0.8104 0.1473  85  LYS A CG  
59   C CD  . LYS A 12  ? 2.2535 2.0638 2.1764  0.7841  -0.7883 0.1519  85  LYS A CD  
60   C CE  . LYS A 12  ? 2.1800 1.9897 2.0980  0.7448  -0.7796 0.1796  85  LYS A CE  
61   N NZ  . LYS A 12  ? 2.1034 1.9891 2.0395  0.7356  -0.7605 0.1846  85  LYS A NZ  
62   N N   . VAL A 13  ? 2.5698 2.2375 2.4605  0.8500  -0.8174 0.0748  86  VAL A N   
63   C CA  . VAL A 13  ? 2.2370 1.8695 2.1180  0.8344  -0.8153 0.0723  86  VAL A CA  
64   C C   . VAL A 13  ? 2.2106 1.9006 2.1103  0.8471  -0.7924 0.0445  86  VAL A C   
65   O O   . VAL A 13  ? 2.0441 1.7362 1.9457  0.8272  -0.7808 0.0471  86  VAL A O   
66   C CB  . VAL A 13  ? 2.5268 2.0693 2.3795  0.8440  -0.8432 0.0676  86  VAL A CB  
67   C CG1 . VAL A 13  ? 2.2117 1.7125 2.0521  0.8222  -0.8435 0.0704  86  VAL A CG1 
68   C CG2 . VAL A 13  ? 2.6937 2.1844 2.5289  0.8341  -0.8661 0.0936  86  VAL A CG2 
69   N N   . ASP A 14  ? 2.7517 2.4900 2.6653  0.8796  -0.7855 0.0182  87  ASP A N   
70   C CA  . ASP A 14  ? 2.8414 2.6359 2.7717  0.8920  -0.7639 -0.0091 87  ASP A CA  
71   C C   . ASP A 14  ? 2.7726 2.6317 2.7238  0.8651  -0.7372 0.0025  87  ASP A C   
72   O O   . ASP A 14  ? 2.9055 2.7738 2.8605  0.8531  -0.7242 -0.0028 87  ASP A O   
73   C CB  . ASP A 14  ? 2.8795 2.7207 2.8216  0.9294  -0.7606 -0.0365 87  ASP A CB  
74   C CG  . ASP A 14  ? 3.1065 2.8877 3.0282  0.9604  -0.7846 -0.0551 87  ASP A CG  
75   O OD1 . ASP A 14  ? 3.2589 2.9602 3.1569  0.9523  -0.8081 -0.0403 87  ASP A OD1 
76   O OD2 . ASP A 14  ? 3.1010 2.9155 3.0295  0.9926  -0.7801 -0.0845 87  ASP A OD2 
77   N N   . PHE A 15  ? 2.5745 2.4781 2.5386  0.8553  -0.7293 0.0184  88  PHE A N   
78   C CA  . PHE A 15  ? 2.3674 2.3297 2.3493  0.8295  -0.7050 0.0296  88  PHE A CA  
79   C C   . PHE A 15  ? 2.2380 2.1573 2.2079  0.7940  -0.7087 0.0593  88  PHE A C   
80   O O   . PHE A 15  ? 2.5227 2.4716 2.5025  0.7733  -0.6902 0.0641  88  PHE A O   
81   C CB  . PHE A 15  ? 2.2879 2.3151 2.2868  0.8310  -0.6952 0.0347  88  PHE A CB  
82   C CG  . PHE A 15  ? 2.2946 2.3944 2.3140  0.8546  -0.6782 0.0064  88  PHE A CG  
83   C CD1 . PHE A 15  ? 2.3643 2.4728 2.3866  0.8705  -0.6703 -0.0205 88  PHE A CD1 
84   C CD2 . PHE A 15  ? 2.1897 2.3512 2.2248  0.8590  -0.6699 0.0071  88  PHE A CD2 
85   C CE1 . PHE A 15  ? 2.1769 2.3546 2.2172  0.8904  -0.6540 -0.0459 88  PHE A CE1 
86   C CE2 . PHE A 15  ? 2.1204 2.3505 2.1740  0.8783  -0.6539 -0.0180 88  PHE A CE2 
87   C CZ  . PHE A 15  ? 2.0691 2.3078 2.1252  0.8938  -0.6455 -0.0443 88  PHE A CZ  
88   N N   . LEU A 16  ? 1.9099 1.7604 1.8583  0.7862  -0.7321 0.0793  89  LEU A N   
89   C CA  . LEU A 16  ? 2.1383 1.9447 2.0733  0.7516  -0.7367 0.1079  89  LEU A CA  
90   C C   . LEU A 16  ? 2.2827 2.0637 2.2134  0.7434  -0.7328 0.1000  89  LEU A C   
91   O O   . LEU A 16  ? 2.2850 2.0629 2.2157  0.7139  -0.7244 0.1184  89  LEU A O   
92   C CB  . LEU A 16  ? 1.9563 1.6907 1.8673  0.7465  -0.7640 0.1281  89  LEU A CB  
93   C CG  . LEU A 16  ? 2.1191 1.8072 2.0142  0.7087  -0.7705 0.1610  89  LEU A CG  
94   C CD1 . LEU A 16  ? 2.1897 1.9306 2.0971  0.6840  -0.7524 0.1813  89  LEU A CD1 
95   C CD2 . LEU A 16  ? 2.1515 1.7700 2.0225  0.7065  -0.7981 0.1779  89  LEU A CD2 
96   N N   . LEU A 17  ? 2.2292 1.9937 2.1561  0.7694  -0.7386 0.0726  90  LEU A N   
97   C CA  . LEU A 17  ? 2.1728 1.9185 2.0963  0.7647  -0.7349 0.0619  90  LEU A CA  
98   C C   . LEU A 17  ? 1.8356 1.6574 1.7832  0.7728  -0.7082 0.0405  90  LEU A C   
99   O O   . LEU A 17  ? 1.9849 1.8062 1.9345  0.7621  -0.6997 0.0366  90  LEU A O   
100  C CB  . LEU A 17  ? 1.9706 1.6524 1.8733  0.7875  -0.7573 0.0432  90  LEU A CB  
101  C CG  . LEU A 17  ? 2.1260 1.7178 2.0010  0.7683  -0.7817 0.0630  90  LEU A CG  
102  C CD1 . LEU A 17  ? 2.3324 1.8967 2.1976  0.7539  -0.7951 0.0913  90  LEU A CD1 
103  C CD2 . LEU A 17  ? 2.0956 1.6300 1.9505  0.7937  -0.8023 0.0393  90  LEU A CD2 
104  N N   . SER A 18  ? 2.0179 1.9056 1.9836  0.7903  -0.6952 0.0273  91  SER A N   
105  C CA  . SER A 18  ? 2.1820 2.1463 2.1708  0.7962  -0.6690 0.0076  91  SER A CA  
106  C C   . SER A 18  ? 2.1264 2.1284 2.1285  0.7645  -0.6492 0.0272  91  SER A C   
107  O O   . SER A 18  ? 2.1491 2.1788 2.1615  0.7565  -0.6327 0.0196  91  SER A O   
108  C CB  . SER A 18  ? 2.2830 2.3064 2.2863  0.8217  -0.6617 -0.0104 91  SER A CB  
109  O OG  . SER A 18  ? 2.3276 2.4215 2.3508  0.8289  -0.6378 -0.0323 91  SER A OG  
110  N N   . VAL A 19  ? 1.8898 1.8932 1.8911  0.7463  -0.6509 0.0526  92  VAL A N   
111  C CA  . VAL A 19  ? 1.9684 2.0051 1.9799  0.7169  -0.6333 0.0715  92  VAL A CA  
112  C C   . VAL A 19  ? 2.0674 2.0543 2.0678  0.6940  -0.6375 0.0864  92  VAL A C   
113  O O   . VAL A 19  ? 2.1151 2.1329 2.1271  0.6775  -0.6195 0.0896  92  VAL A O   
114  C CB  . VAL A 19  ? 1.6158 1.6616 1.6253  0.7040  -0.6365 0.0948  92  VAL A CB  
115  C CG1 . VAL A 19  ? 1.6800 1.6495 1.6655  0.6997  -0.6638 0.1142  92  VAL A CG1 
116  C CG2 . VAL A 19  ? 1.5599 1.6376 1.5772  0.6748  -0.6190 0.1135  92  VAL A CG2 
117  N N   . ILE A 20  ? 2.1181 2.0278 2.0961  0.6922  -0.6615 0.0959  93  ILE A N   
118  C CA  . ILE A 20  ? 1.9620 1.8213 1.9283  0.6693  -0.6675 0.1106  93  ILE A CA  
119  C C   . ILE A 20  ? 1.6680 1.5398 1.6415  0.6792  -0.6586 0.0875  93  ILE A C   
120  O O   . ILE A 20  ? 1.9488 1.8267 1.9280  0.6589  -0.6478 0.0956  93  ILE A O   
121  C CB  . ILE A 20  ? 1.7584 1.5326 1.6978  0.6653  -0.6962 0.1243  93  ILE A CB  
122  C CG1 . ILE A 20  ? 1.9962 1.7571 1.9274  0.6483  -0.7040 0.1525  93  ILE A CG1 
123  C CG2 . ILE A 20  ? 1.7712 1.4932 1.6982  0.6440  -0.7034 0.1350  93  ILE A CG2 
124  C CD1 . ILE A 20  ? 1.8558 1.5355 1.7605  0.6420  -0.7315 0.1676  93  ILE A CD1 
125  N N   . GLY A 21  ? 1.7544 1.6315 1.7277  0.7105  -0.6628 0.0585  94  GLY A N   
126  C CA  . GLY A 21  ? 1.8865 1.7806 1.8660  0.7223  -0.6541 0.0342  94  GLY A CA  
127  C C   . GLY A 21  ? 1.8179 1.7913 1.8232  0.7145  -0.6248 0.0288  94  GLY A C   
128  O O   . GLY A 21  ? 1.7322 1.7128 1.7424  0.7054  -0.6154 0.0246  94  GLY A O   
129  N N   . TYR A 22  ? 1.5680 1.6020 1.5894  0.7164  -0.6097 0.0291  95  TYR A N   
130  C CA  . TYR A 22  ? 1.4974 1.6039 1.5418  0.7024  -0.5803 0.0277  95  TYR A CA  
131  C C   . TYR A 22  ? 1.6780 1.7707 1.7230  0.6569  -0.5639 0.0550  95  TYR A C   
132  O O   . TYR A 22  ? 1.6868 1.8085 1.7442  0.6375  -0.5400 0.0529  95  TYR A O   
133  C CB  . TYR A 22  ? 1.4713 1.6413 1.5304  0.7109  -0.5689 0.0239  95  TYR A CB  
134  C CG  . TYR A 22  ? 1.4080 1.6331 1.4840  0.6788  -0.5381 0.0367  95  TYR A CG  
135  C CD1 . TYR A 22  ? 1.3573 1.6483 1.4531  0.6751  -0.5111 0.0212  95  TYR A CD1 
136  C CD2 . TYR A 22  ? 1.4016 1.6125 1.4727  0.6509  -0.5352 0.0639  95  TYR A CD2 
137  C CE1 . TYR A 22  ? 1.3038 1.6409 1.4135  0.6448  -0.4828 0.0323  95  TYR A CE1 
138  C CE2 . TYR A 22  ? 1.6608 1.9191 1.7456  0.6214  -0.5061 0.0740  95  TYR A CE2 
139  C CZ  . TYR A 22  ? 1.2997 1.6193 1.4037  0.6187  -0.4803 0.0581  95  TYR A CZ  
140  O OH  . TYR A 22  ? 1.2501 1.6128 1.3662  0.5897  -0.4523 0.0678  95  TYR A OH  
141  N N   . ALA A 23  ? 1.5569 1.6067 1.5887  0.6397  -0.5764 0.0811  96  ALA A N   
142  C CA  . ALA A 23  ? 1.5552 1.5955 1.5880  0.5974  -0.5603 0.1075  96  ALA A CA  
143  C C   . ALA A 23  ? 1.7417 1.7405 1.7679  0.5819  -0.5622 0.1112  96  ALA A C   
144  O O   . ALA A 23  ? 1.7888 1.8050 1.8253  0.5517  -0.5393 0.1225  96  ALA A O   
145  C CB  . ALA A 23  ? 1.7165 1.7199 1.7347  0.5837  -0.5751 0.1343  96  ALA A CB  
146  N N   . VAL A 24  ? 1.8469 1.7903 1.8557  0.6021  -0.5897 0.1021  97  VAL A N   
147  C CA  . VAL A 24  ? 1.9114 1.8094 1.9107  0.5873  -0.5956 0.1062  97  VAL A CA  
148  C C   . VAL A 24  ? 1.8184 1.7483 1.8282  0.6018  -0.5836 0.0788  97  VAL A C   
149  O O   . VAL A 24  ? 1.6677 1.6113 1.6770  0.6372  -0.5923 0.0525  97  VAL A O   
150  C CB  . VAL A 24  ? 1.6677 1.4823 1.6393  0.5983  -0.6335 0.1122  97  VAL A CB  
151  C CG1 . VAL A 24  ? 1.6476 1.4186 1.6087  0.5891  -0.6415 0.1098  97  VAL A CG1 
152  C CG2 . VAL A 24  ? 1.8110 1.5914 1.7714  0.5748  -0.6437 0.1445  97  VAL A CG2 
153  N N   . ASP A 25  ? 1.9876 1.9302 2.0068  0.5748  -0.5639 0.0853  98  ASP A N   
154  C CA  . ASP A 25  ? 1.9203 1.8973 1.9499  0.5840  -0.5502 0.0618  98  ASP A CA  
155  C C   . ASP A 25  ? 1.6147 1.5649 1.6420  0.5552  -0.5456 0.0741  98  ASP A C   
156  O O   . ASP A 25  ? 1.6561 1.5507 1.6693  0.5359  -0.5604 0.0962  98  ASP A O   
157  C CB  . ASP A 25  ? 1.9072 1.9681 1.9620  0.5846  -0.5194 0.0514  98  ASP A CB  
158  C CG  . ASP A 25  ? 1.9229 2.0121 1.9925  0.5471  -0.4929 0.0751  98  ASP A CG  
159  O OD1 . ASP A 25  ? 2.1036 2.1540 2.1667  0.5199  -0.4952 0.0989  98  ASP A OD1 
160  O OD2 . ASP A 25  ? 1.6943 1.8461 1.7820  0.5450  -0.4693 0.0696  98  ASP A OD2 
161  N N   . LEU A 26  ? 1.7142 1.7064 1.7557  0.5518  -0.5251 0.0605  99  LEU A N   
162  C CA  . LEU A 26  ? 1.7715 1.7481 1.8140  0.5253  -0.5183 0.0707  99  LEU A CA  
163  C C   . LEU A 26  ? 1.5130 1.4901 1.5643  0.4870  -0.5032 0.1029  99  LEU A C   
164  O O   . LEU A 26  ? 1.5786 1.5124 1.6213  0.4646  -0.5118 0.1217  99  LEU A O   
165  C CB  . LEU A 26  ? 1.8643 1.8954 1.9224  0.5297  -0.4970 0.0502  99  LEU A CB  
166  C CG  . LEU A 26  ? 2.0999 2.1303 2.1480  0.5667  -0.5115 0.0175  99  LEU A CG  
167  C CD1 . LEU A 26  ? 2.0580 2.1510 2.1228  0.5694  -0.4883 -0.0015 99  LEU A CD1 
168  C CD2 . LEU A 26  ? 2.1847 2.1412 2.2073  0.5716  -0.5406 0.0155  99  LEU A CD2 
169  N N   . GLY A 27  ? 1.3313 1.3589 1.3999  0.4790  -0.4804 0.1092  100 GLY A N   
170  C CA  . GLY A 27  ? 1.2987 1.3343 1.3774  0.4441  -0.4623 0.1369  100 GLY A CA  
171  C C   . GLY A 27  ? 1.3373 1.3156 1.3993  0.4296  -0.4819 0.1622  100 GLY A C   
172  O O   . GLY A 27  ? 1.7236 1.6875 1.7879  0.4000  -0.4755 0.1855  100 GLY A O   
173  N N   . ASN A 28  ? 1.5568 1.5040 1.6022  0.4498  -0.5057 0.1591  101 ASN A N   
174  C CA  . ASN A 28  ? 1.6795 1.5659 1.7056  0.4369  -0.5287 0.1826  101 ASN A CA  
175  C C   . ASN A 28  ? 1.8275 1.6630 1.8414  0.4237  -0.5441 0.1899  101 ASN A C   
176  O O   . ASN A 28  ? 2.0169 1.8196 2.0240  0.3964  -0.5498 0.2167  101 ASN A O   
177  C CB  . ASN A 28  ? 1.6866 1.5425 1.6951  0.4662  -0.5560 0.1735  101 ASN A CB  
178  C CG  . ASN A 28  ? 1.8402 1.7270 1.8543  0.4672  -0.5476 0.1812  101 ASN A CG  
179  O OD1 . ASN A 28  ? 1.7735 1.7124 1.8009  0.4850  -0.5338 0.1633  101 ASN A OD1 
180  N ND2 . ASN A 28  ? 2.0783 1.9344 2.0818  0.4474  -0.5564 0.2081  101 ASN A ND2 
181  N N   . VAL A 29  ? 1.7790 1.6092 1.7897  0.4419  -0.5507 0.1664  102 VAL A N   
182  C CA  . VAL A 29  ? 1.6964 1.4753 1.6927  0.4313  -0.5682 0.1707  102 VAL A CA  
183  C C   . VAL A 29  ? 1.6120 1.4131 1.6242  0.3978  -0.5462 0.1874  102 VAL A C   
184  O O   . VAL A 29  ? 1.7489 1.5099 1.7522  0.3732  -0.5569 0.2091  102 VAL A O   
185  C CB  . VAL A 29  ? 1.7825 1.5489 1.7684  0.4627  -0.5826 0.1387  102 VAL A CB  
186  C CG1 . VAL A 29  ? 1.7085 1.4086 1.6725  0.4540  -0.6076 0.1431  102 VAL A CG1 
187  C CG2 . VAL A 29  ? 2.0815 1.8395 2.0570  0.4985  -0.5993 0.1210  102 VAL A CG2 
188  N N   . TRP A 30  ? 1.4036 1.2685 1.4396  0.3959  -0.5160 0.1781  103 TRP A N   
189  C CA  . TRP A 30  ? 1.3739 1.2576 1.4245  0.3685  -0.4975 0.1901  103 TRP A CA  
190  C C   . TRP A 30  ? 1.6677 1.6020 1.7419  0.3464  -0.4659 0.2071  103 TRP A C   
191  O O   . TRP A 30  ? 1.9277 1.8626 2.0107  0.3185  -0.4556 0.2279  103 TRP A O   
192  C CB  . TRP A 30  ? 1.4330 1.3413 1.4895  0.3816  -0.4907 0.1650  103 TRP A CB  
193  C CG  . TRP A 30  ? 1.6691 1.6396 1.7418  0.4011  -0.4698 0.1428  103 TRP A CG  
194  C CD1 . TRP A 30  ? 1.8997 1.8800 1.9660  0.4347  -0.4785 0.1157  103 TRP A CD1 
195  C CD2 . TRP A 30  ? 1.4193 1.4518 1.5174  0.3875  -0.4370 0.1459  103 TRP A CD2 
196  N NE1 . TRP A 30  ? 1.9131 1.9601 1.9996  0.4414  -0.4530 0.1026  103 TRP A NE1 
197  C CE2 . TRP A 30  ? 1.4612 1.5389 1.5665  0.4124  -0.4277 0.1208  103 TRP A CE2 
198  C CE3 . TRP A 30  ? 1.3555 1.4093 1.4709  0.3572  -0.4150 0.1678  103 TRP A CE3 
199  C CZ2 . TRP A 30  ? 1.3092 1.4499 1.4369  0.4059  -0.3981 0.1175  103 TRP A CZ2 
200  C CZ3 . TRP A 30  ? 1.4159 1.5300 1.5534  0.3528  -0.3856 0.1636  103 TRP A CZ3 
201  C CH2 . TRP A 30  ? 1.4162 1.5718 1.5589  0.3760  -0.3778 0.1389  103 TRP A CH2 
202  N N   . ARG A 31  ? 1.5477 1.5241 1.6321  0.3583  -0.4506 0.1986  104 ARG A N   
203  C CA  . ARG A 31  ? 1.6210 1.6420 1.7253  0.3383  -0.4214 0.2135  104 ARG A CA  
204  C C   . ARG A 31  ? 1.5754 1.5702 1.6739  0.3153  -0.4250 0.2433  104 ARG A C   
205  O O   . ARG A 31  ? 1.5399 1.5513 1.6517  0.2896  -0.4060 0.2628  104 ARG A O   
206  C CB  . ARG A 31  ? 1.8112 1.8804 1.9247  0.3566  -0.4069 0.1963  104 ARG A CB  
207  C CG  . ARG A 31  ? 1.8951 2.0233 2.0325  0.3444  -0.3733 0.1951  104 ARG A CG  
208  C CD  . ARG A 31  ? 2.0751 2.2491 2.2203  0.3677  -0.3644 0.1676  104 ARG A CD  
209  N NE  . ARG A 31  ? 2.1851 2.4116 2.3517  0.3548  -0.3341 0.1665  104 ARG A NE  
210  C CZ  . ARG A 31  ? 2.3315 2.6048 2.5080  0.3685  -0.3218 0.1453  104 ARG A CZ  
211  N NH1 . ARG A 31  ? 2.3695 2.6854 2.5641  0.3540  -0.2954 0.1469  104 ARG A NH1 
212  N NH2 . ARG A 31  ? 2.3599 2.6376 2.5282  0.3967  -0.3363 0.1230  104 ARG A NH2 
213  N N   . PHE A 32  ? 1.5417 1.4962 1.6204  0.3242  -0.4492 0.2479  105 PHE A N   
214  C CA  . PHE A 32  ? 1.5089 1.4388 1.5804  0.3015  -0.4539 0.2770  105 PHE A CA  
215  C C   . PHE A 32  ? 1.5230 1.4187 1.5906  0.2752  -0.4616 0.2993  105 PHE A C   
216  O O   . PHE A 32  ? 1.4307 1.3362 1.5060  0.2491  -0.4481 0.3237  105 PHE A O   
217  C CB  . PHE A 32  ? 1.3540 1.2453 1.4034  0.3174  -0.4809 0.2771  105 PHE A CB  
218  C CG  . PHE A 32  ? 1.4238 1.2843 1.4619  0.2941  -0.4901 0.3076  105 PHE A CG  
219  C CD1 . PHE A 32  ? 1.5605 1.4539 1.6077  0.2785  -0.4695 0.3227  105 PHE A CD1 
220  C CD2 . PHE A 32  ? 1.5285 1.3267 1.5455  0.2871  -0.5199 0.3210  105 PHE A CD2 
221  C CE1 . PHE A 32  ? 1.6253 1.4934 1.6614  0.2566  -0.4773 0.3508  105 PHE A CE1 
222  C CE2 . PHE A 32  ? 1.6718 1.4437 1.6779  0.2641  -0.5287 0.3502  105 PHE A CE2 
223  C CZ  . PHE A 32  ? 1.6978 1.5063 1.7138  0.2489  -0.5070 0.3652  105 PHE A CZ  
224  N N   . PRO A 33  ? 1.4765 1.3332 1.5322  0.2801  -0.4828 0.2924  106 PRO A N   
225  C CA  . PRO A 33  ? 1.3686 1.1968 1.4217  0.2520  -0.4893 0.3155  106 PRO A CA  
226  C C   . PRO A 33  ? 1.5144 1.3879 1.5930  0.2305  -0.4594 0.3252  106 PRO A C   
227  O O   . PRO A 33  ? 1.5563 1.4267 1.6398  0.2030  -0.4541 0.3522  106 PRO A O   
228  C CB  . PRO A 33  ? 1.4131 1.1962 1.4485  0.2657  -0.5163 0.2997  106 PRO A CB  
229  C CG  . PRO A 33  ? 1.4423 1.2105 1.4631  0.2987  -0.5327 0.2772  106 PRO A CG  
230  C CD  . PRO A 33  ? 1.4551 1.2841 1.4949  0.3103  -0.5059 0.2663  106 PRO A CD  
231  N N   . TYR A 34  ? 1.3396 1.2561 1.4348  0.2423  -0.4399 0.3047  107 TYR A N   
232  C CA  . TYR A 34  ? 1.3582 1.3162 1.4777  0.2230  -0.4122 0.3140  107 TYR A CA  
233  C C   . TYR A 34  ? 1.4746 1.4670 1.6087  0.2083  -0.3874 0.3311  107 TYR A C   
234  O O   . TYR A 34  ? 1.7316 1.7296 1.8758  0.1832  -0.3768 0.3550  107 TYR A O   
235  C CB  . TYR A 34  ? 1.5656 1.5615 1.6980  0.2391  -0.3978 0.2883  107 TYR A CB  
236  C CG  . TYR A 34  ? 1.8368 1.8766 1.9947  0.2209  -0.3689 0.2974  107 TYR A CG  
237  C CD1 . TYR A 34  ? 2.1374 2.1688 2.3007  0.2044  -0.3708 0.3076  107 TYR A CD1 
238  C CD2 . TYR A 34  ? 1.9899 2.0782 2.1659  0.2202  -0.3405 0.2961  107 TYR A CD2 
239  C CE1 . TYR A 34  ? 2.3263 2.3971 2.5134  0.1889  -0.3454 0.3168  107 TYR A CE1 
240  C CE2 . TYR A 34  ? 2.0286 2.1534 2.2272  0.2046  -0.3150 0.3046  107 TYR A CE2 
241  C CZ  . TYR A 34  ? 2.3848 2.5011 2.5895  0.1897  -0.3176 0.3151  107 TYR A CZ  
242  O OH  . TYR A 34  ? 2.5464 2.6988 2.7742  0.1753  -0.2932 0.3242  107 TYR A OH  
243  N N   . ILE A 35  ? 1.4146 1.4305 1.5494  0.2237  -0.3785 0.3190  108 ILE A N   
244  C CA  . ILE A 35  ? 1.2667 1.3162 1.4136  0.2111  -0.3542 0.3320  108 ILE A CA  
245  C C   . ILE A 35  ? 1.5190 1.5391 1.6546  0.1922  -0.3644 0.3593  108 ILE A C   
246  O O   . ILE A 35  ? 1.6401 1.6832 1.7863  0.1739  -0.3443 0.3768  108 ILE A O   
247  C CB  . ILE A 35  ? 1.2850 1.3637 1.4323  0.2315  -0.3453 0.3127  108 ILE A CB  
248  C CG1 . ILE A 35  ? 1.2928 1.4135 1.4555  0.2180  -0.3150 0.3219  108 ILE A CG1 
249  C CG2 . ILE A 35  ? 1.3035 1.3479 1.4284  0.2452  -0.3707 0.3111  108 ILE A CG2 
250  C CD1 . ILE A 35  ? 1.5094 1.6592 1.6715  0.2344  -0.3064 0.3052  108 ILE A CD1 
251  N N   . CYS A 36  ? 1.5043 1.4732 1.6177  0.1957  -0.3956 0.3635  109 CYS A N   
252  C CA  . CYS A 36  ? 1.4540 1.3925 1.5548  0.1759  -0.4080 0.3909  109 CYS A CA  
253  C C   . CYS A 36  ? 1.5135 1.4436 1.6216  0.1491  -0.4066 0.4132  109 CYS A C   
254  O O   . CYS A 36  ? 1.5155 1.4471 1.6251  0.1262  -0.4010 0.4390  109 CYS A O   
255  C CB  . CYS A 36  ? 1.3144 1.1984 1.3877  0.1893  -0.4435 0.3876  109 CYS A CB  
256  S SG  . CYS A 36  ? 1.6854 1.5254 1.7396  0.1637  -0.4639 0.4223  109 CYS A SG  
257  N N   . ALA A 37  ? 1.5346 1.4586 1.6475  0.1515  -0.4112 0.4037  110 ALA A N   
258  C CA  . ALA A 37  ? 1.4559 1.3723 1.5757  0.1266  -0.4119 0.4242  110 ALA A CA  
259  C C   . ALA A 37  ? 1.4020 1.3715 1.5502  0.1117  -0.3775 0.4345  110 ALA A C   
260  O O   . ALA A 37  ? 1.4757 1.4485 1.6315  0.0870  -0.3723 0.4602  110 ALA A O   
261  C CB  . ALA A 37  ? 1.4742 1.3665 1.5882  0.1343  -0.4289 0.4098  110 ALA A CB  
262  N N   . GLN A 38  ? 1.1881 1.1994 1.3520  0.1263  -0.3542 0.4151  111 GLN A N   
263  C CA  . GLN A 38  ? 1.2154 1.2735 1.4058  0.1139  -0.3227 0.4229  111 GLN A CA  
264  C C   . GLN A 38  ? 1.3019 1.3881 1.4990  0.1080  -0.3007 0.4325  111 GLN A C   
265  O O   . GLN A 38  ? 1.5635 1.6871 1.7817  0.0984  -0.2737 0.4394  111 GLN A O   
266  C CB  . GLN A 38  ? 1.3554 1.4447 1.5600  0.1296  -0.3079 0.3988  111 GLN A CB  
267  C CG  . GLN A 38  ? 1.6042 1.7168 1.8078  0.1505  -0.2972 0.3766  111 GLN A CG  
268  C CD  . GLN A 38  ? 1.7256 1.8788 1.9476  0.1593  -0.2761 0.3587  111 GLN A CD  
269  O OE1 . GLN A 38  ? 1.6638 1.8253 1.8981  0.1515  -0.2712 0.3616  111 GLN A OE1 
270  N NE2 . GLN A 38  ? 1.7416 1.9212 1.9653  0.1743  -0.2639 0.3410  111 GLN A NE2 
271  N N   . ASN A 39  ? 1.3557 1.4245 1.5349  0.1137  -0.3117 0.4329  112 ASN A N   
272  C CA  . ASN A 39  ? 1.6074 1.7019 1.7900  0.1079  -0.2919 0.4410  112 ASN A CA  
273  C C   . ASN A 39  ? 1.7242 1.7913 1.8906  0.0918  -0.3067 0.4653  112 ASN A C   
274  O O   . ASN A 39  ? 1.8382 1.8951 1.9888  0.0985  -0.3146 0.4635  112 ASN A O   
275  C CB  . ASN A 39  ? 1.6891 1.7997 1.8670  0.1300  -0.2864 0.4172  112 ASN A CB  
276  C CG  . ASN A 39  ? 1.6825 1.8312 1.8791  0.1411  -0.2647 0.3968  112 ASN A CG  
277  O OD1 . ASN A 39  ? 1.8965 2.0690 2.1125  0.1297  -0.2450 0.4036  112 ASN A OD1 
278  N ND2 . ASN A 39  ? 1.2685 1.4245 1.4598  0.1631  -0.2684 0.3724  112 ASN A ND2 
279  N N   . GLY A 40  ? 1.5449 1.6017 1.7152  0.0697  -0.3108 0.4891  113 GLY A N   
280  C CA  . GLY A 40  ? 1.9783 2.0144 2.1352  0.0504  -0.3226 0.5153  113 GLY A CA  
281  C C   . GLY A 40  ? 1.8884 1.8692 2.0226  0.0468  -0.3595 0.5229  113 GLY A C   
282  O O   . GLY A 40  ? 1.7118 1.6727 1.8339  0.0277  -0.3718 0.5473  113 GLY A O   
283  N N   . GLY A 41  ? 2.3909 2.3460 2.5177  0.0643  -0.3778 0.5029  114 GLY A N   
284  C CA  . GLY A 41  ? 2.4743 2.3718 2.5770  0.0627  -0.4144 0.5081  114 GLY A CA  
285  C C   . GLY A 41  ? 2.4823 2.3520 2.5615  0.0701  -0.4322 0.5097  114 GLY A C   
286  O O   . GLY A 41  ? 2.5500 2.4340 2.6275  0.0913  -0.4257 0.4908  114 GLY A O   
287  N N   . GLY A 42  ? 2.1081 1.9392 2.1691  0.0512  -0.4550 0.5339  115 GLY A N   
288  C CA  . GLY A 42  ? 1.4188 1.2216 1.4566  0.0555  -0.4735 0.5393  115 GLY A CA  
289  C C   . GLY A 42  ? 1.7626 1.6076 1.8076  0.0550  -0.4487 0.5423  115 GLY A C   
290  O O   . GLY A 42  ? 1.8535 1.6881 1.8839  0.0693  -0.4579 0.5350  115 GLY A O   
291  N N   . ALA A 43  ? 1.6235 1.5167 1.6907  0.0396  -0.4170 0.5523  116 ALA A N   
292  C CA  . ALA A 43  ? 1.6605 1.5942 1.7338  0.0387  -0.3918 0.5538  116 ALA A CA  
293  C C   . ALA A 43  ? 1.5086 1.4655 1.5871  0.0667  -0.3794 0.5234  116 ALA A C   
294  O O   . ALA A 43  ? 1.3529 1.3313 1.4282  0.0698  -0.3672 0.5217  116 ALA A O   
295  C CB  . ALA A 43  ? 1.5795 1.5586 1.6761  0.0184  -0.3603 0.5689  116 ALA A CB  
296  N N   . PHE A 44  ? 1.5185 1.4664 1.6007  0.0874  -0.3869 0.4997  117 PHE A N   
297  C CA  . PHE A 44  ? 1.6173 1.5886 1.7037  0.1135  -0.3769 0.4715  117 PHE A CA  
298  C C   . PHE A 44  ? 1.6995 1.6431 1.7630  0.1287  -0.4001 0.4660  117 PHE A C   
299  O O   . PHE A 44  ? 1.8881 1.8540 1.9529  0.1477  -0.3922 0.4469  117 PHE A O   
300  C CB  . PHE A 44  ? 1.6889 1.6625 1.7859  0.1306  -0.3775 0.4482  117 PHE A CB  
301  C CG  . PHE A 44  ? 1.6280 1.6315 1.7317  0.1557  -0.3654 0.4197  117 PHE A CG  
302  C CD1 . PHE A 44  ? 1.4540 1.5081 1.5770  0.1537  -0.3326 0.4136  117 PHE A CD1 
303  C CD2 . PHE A 44  ? 1.5984 1.5798 1.6890  0.1814  -0.3872 0.3990  117 PHE A CD2 
304  C CE1 . PHE A 44  ? 1.4678 1.5504 1.5964  0.1745  -0.3222 0.3884  117 PHE A CE1 
305  C CE2 . PHE A 44  ? 1.4831 1.4964 1.5808  0.2036  -0.3761 0.3736  117 PHE A CE2 
306  C CZ  . PHE A 44  ? 1.4744 1.5386 1.5909  0.1991  -0.3438 0.3688  117 PHE A CZ  
307  N N   . LEU A 45  ? 1.3492 1.2447 1.3918  0.1198  -0.4291 0.4835  118 LEU A N   
308  C CA  . LEU A 45  ? 1.3905 1.2551 1.4102  0.1332  -0.4539 0.4815  118 LEU A CA  
309  C C   . LEU A 45  ? 1.7132 1.6075 1.7309  0.1259  -0.4380 0.4906  118 LEU A C   
310  O O   . LEU A 45  ? 1.7832 1.6726 1.7887  0.1425  -0.4485 0.4816  118 LEU A O   
311  C CB  . LEU A 45  ? 1.4502 1.2544 1.4474  0.1213  -0.4883 0.5015  118 LEU A CB  
312  C CG  . LEU A 45  ? 1.4749 1.2397 1.4673  0.1322  -0.5103 0.4894  118 LEU A CG  
313  C CD1 . LEU A 45  ? 1.6896 1.3916 1.6571  0.1182  -0.5454 0.5107  118 LEU A CD1 
314  C CD2 . LEU A 45  ? 1.4759 1.2386 1.4664  0.1685  -0.5181 0.4565  118 LEU A CD2 
315  N N   . LEU A 46  ? 1.6085 1.5356 1.6382  0.1018  -0.4123 0.5080  119 LEU A N   
316  C CA  . LEU A 46  ? 1.5716 1.5254 1.5968  0.0934  -0.3974 0.5171  119 LEU A CA  
317  C C   . LEU A 46  ? 1.5885 1.5844 1.6245  0.1124  -0.3752 0.4921  119 LEU A C   
318  O O   . LEU A 46  ? 1.3163 1.3127 1.3393  0.1228  -0.3825 0.4870  119 LEU A O   
319  C CB  . LEU A 46  ? 1.5536 1.5295 1.5871  0.0632  -0.3769 0.5424  119 LEU A CB  
320  C CG  . LEU A 46  ? 1.3214 1.3255 1.3493  0.0499  -0.3596 0.5550  119 LEU A CG  
321  C CD1 . LEU A 46  ? 1.3468 1.3399 1.3665  0.0200  -0.3646 0.5881  119 LEU A CD1 
322  C CD2 . LEU A 46  ? 1.2675 1.3256 1.3167  0.0513  -0.3209 0.5423  119 LEU A CD2 
323  N N   . PRO A 47  ? 1.6504 1.6821 1.7091  0.1173  -0.3496 0.4764  120 PRO A N   
324  C CA  . PRO A 47  ? 1.5208 1.5910 1.5876  0.1338  -0.3304 0.4534  120 PRO A CA  
325  C C   . PRO A 47  ? 1.6873 1.7454 1.7491  0.1627  -0.3491 0.4290  120 PRO A C   
326  O O   . PRO A 47  ? 1.7257 1.8108 1.7888  0.1768  -0.3404 0.4124  120 PRO A O   
327  C CB  . PRO A 47  ? 1.2646 1.3714 1.3564  0.1279  -0.2996 0.4471  120 PRO A CB  
328  C CG  . PRO A 47  ? 1.2746 1.3559 1.3718  0.1215  -0.3114 0.4552  120 PRO A CG  
329  C CD  . PRO A 47  ? 1.4350 1.4759 1.5128  0.1069  -0.3362 0.4799  120 PRO A CD  
330  N N   . TYR A 48  ? 1.4738 1.4926 1.5293  0.1720  -0.3750 0.4264  121 TYR A N   
331  C CA  . TYR A 48  ? 1.4300 1.4369 1.4805  0.2016  -0.3934 0.4023  121 TYR A CA  
332  C C   . TYR A 48  ? 1.6700 1.6617 1.7012  0.2129  -0.4128 0.4032  121 TYR A C   
333  O O   . TYR A 48  ? 1.9247 1.9319 1.9564  0.2368  -0.4157 0.3820  121 TYR A O   
334  C CB  . TYR A 48  ? 1.3250 1.2893 1.3707  0.2077  -0.4172 0.4000  121 TYR A CB  
335  C CG  . TYR A 48  ? 1.5898 1.5388 1.6290  0.2397  -0.4374 0.3747  121 TYR A CG  
336  C CD1 . TYR A 48  ? 1.7369 1.7207 1.7921  0.2581  -0.4230 0.3483  121 TYR A CD1 
337  C CD2 . TYR A 48  ? 1.6128 1.5126 1.6297  0.2518  -0.4715 0.3773  121 TYR A CD2 
338  C CE1 . TYR A 48  ? 1.6870 1.6607 1.7368  0.2882  -0.4408 0.3247  121 TYR A CE1 
339  C CE2 . TYR A 48  ? 1.5468 1.4331 1.5581  0.2833  -0.4899 0.3533  121 TYR A CE2 
340  C CZ  . TYR A 48  ? 1.5391 1.4642 1.5672  0.3016  -0.4739 0.3267  121 TYR A CZ  
341  O OH  . TYR A 48  ? 1.5904 1.5059 1.6133  0.3337  -0.4914 0.3024  121 TYR A OH  
342  N N   . THR A 49  ? 1.3445 1.3087 1.3590  0.1954  -0.4260 0.4284  122 THR A N   
343  C CA  . THR A 49  ? 1.5274 1.4748 1.5222  0.2039  -0.4460 0.4327  122 THR A CA  
344  C C   . THR A 49  ? 1.6289 1.6224 1.6271  0.1987  -0.4226 0.4320  122 THR A C   
345  O O   . THR A 49  ? 1.6697 1.6718 1.6610  0.2161  -0.4304 0.4210  122 THR A O   
346  C CB  . THR A 49  ? 1.5954 1.4940 1.5695  0.1855  -0.4707 0.4612  122 THR A CB  
347  O OG1 . THR A 49  ? 1.8230 1.7384 1.8024  0.1541  -0.4504 0.4839  122 THR A OG1 
348  C CG2 . THR A 49  ? 1.4646 1.3129 1.4321  0.1923  -0.4972 0.4598  122 THR A CG2 
349  N N   . ILE A 50  ? 1.6370 1.6606 1.6456  0.1754  -0.3939 0.4431  123 ILE A N   
350  C CA  . ILE A 50  ? 1.5817 1.6474 1.5920  0.1686  -0.3703 0.4422  123 ILE A CA  
351  C C   . ILE A 50  ? 1.5966 1.6984 1.6189  0.1908  -0.3579 0.4133  123 ILE A C   
352  O O   . ILE A 50  ? 1.7121 1.8338 1.7276  0.1977  -0.3564 0.4069  123 ILE A O   
353  C CB  . ILE A 50  ? 1.3948 1.4852 1.4157  0.1419  -0.3407 0.4568  123 ILE A CB  
354  C CG1 . ILE A 50  ? 1.5090 1.5688 1.5168  0.1185  -0.3534 0.4873  123 ILE A CG1 
355  C CG2 . ILE A 50  ? 1.6285 1.7623 1.6509  0.1363  -0.3143 0.4522  123 ILE A CG2 
356  C CD1 . ILE A 50  ? 1.5448 1.6306 1.5634  0.0931  -0.3251 0.5029  123 ILE A CD1 
357  N N   . MET A 51  ? 1.4267 1.5382 1.4664  0.2018  -0.3502 0.3959  124 MET A N   
358  C CA  . MET A 51  ? 1.3162 1.4634 1.3677  0.2221  -0.3393 0.3688  124 MET A CA  
359  C C   . MET A 51  ? 1.3331 1.4658 1.3746  0.2494  -0.3664 0.3548  124 MET A C   
360  O O   . MET A 51  ? 1.3221 1.4880 1.3703  0.2659  -0.3596 0.3346  124 MET A O   
361  C CB  . MET A 51  ? 1.1744 1.3357 1.2463  0.2254  -0.3247 0.3554  124 MET A CB  
362  C CG  . MET A 51  ? 1.1381 1.3252 1.2243  0.2032  -0.2934 0.3638  124 MET A CG  
363  S SD  . MET A 51  ? 1.1103 1.3440 1.1976  0.1962  -0.2659 0.3586  124 MET A SD  
364  C CE  . MET A 51  ? 1.7603 2.0151 1.8650  0.1730  -0.2321 0.3683  124 MET A CE  
365  N N   . ALA A 52  ? 1.2829 1.3668 1.3085  0.2546  -0.3972 0.3652  125 ALA A N   
366  C CA  . ALA A 52  ? 1.3159 1.3824 1.3309  0.2821  -0.4247 0.3531  125 ALA A CA  
367  C C   . ALA A 52  ? 1.4702 1.5405 1.4701  0.2802  -0.4324 0.3632  125 ALA A C   
368  O O   . ALA A 52  ? 1.3292 1.4278 1.3309  0.2978  -0.4323 0.3478  125 ALA A O   
369  C CB  . ALA A 52  ? 1.3618 1.3699 1.3649  0.2897  -0.4558 0.3587  125 ALA A CB  
370  N N   . ILE A 53  ? 1.7192 1.7634 1.7040  0.2578  -0.4393 0.3899  126 ILE A N   
371  C CA  . ILE A 53  ? 1.7689 1.8122 1.7365  0.2537  -0.4492 0.4027  126 ILE A CA  
372  C C   . ILE A 53  ? 1.7431 1.8423 1.7183  0.2503  -0.4224 0.3930  126 ILE A C   
373  O O   . ILE A 53  ? 1.8838 1.9960 1.8510  0.2618  -0.4313 0.3884  126 ILE A O   
374  C CB  . ILE A 53  ? 1.6334 1.6456 1.5852  0.2252  -0.4558 0.4343  126 ILE A CB  
375  C CG1 . ILE A 53  ? 1.7139 1.6669 1.6554  0.2278  -0.4858 0.4443  126 ILE A CG1 
376  C CG2 . ILE A 53  ? 1.8709 1.8852 1.8039  0.2181  -0.4642 0.4487  126 ILE A CG2 
377  C CD1 . ILE A 53  ? 1.7617 1.6840 1.6877  0.1983  -0.4940 0.4766  126 ILE A CD1 
378  N N   . PHE A 54  ? 1.4235 1.5561 1.4140  0.2350  -0.3901 0.3894  127 PHE A N   
379  C CA  . PHE A 54  ? 1.4010 1.5828 1.3967  0.2285  -0.3638 0.3813  127 PHE A CA  
380  C C   . PHE A 54  ? 1.3369 1.5562 1.3502  0.2480  -0.3516 0.3530  127 PHE A C   
381  O O   . PHE A 54  ? 1.2197 1.4762 1.2336  0.2497  -0.3398 0.3433  127 PHE A O   
382  C CB  . PHE A 54  ? 1.5206 1.7178 1.5213  0.2000  -0.3345 0.3940  127 PHE A CB  
383  C CG  . PHE A 54  ? 1.2754 1.4467 1.2587  0.1777  -0.3419 0.4225  127 PHE A CG  
384  C CD1 . PHE A 54  ? 1.3186 1.4655 1.2808  0.1802  -0.3684 0.4350  127 PHE A CD1 
385  C CD2 . PHE A 54  ? 1.2617 1.4350 1.2501  0.1540  -0.3224 0.4374  127 PHE A CD2 
386  C CE1 . PHE A 54  ? 1.3479 1.4724 1.2934  0.1579  -0.3755 0.4623  127 PHE A CE1 
387  C CE2 . PHE A 54  ? 1.2897 1.4435 1.2627  0.1326  -0.3286 0.4640  127 PHE A CE2 
388  C CZ  . PHE A 54  ? 1.3330 1.4622 1.2839  0.1337  -0.3551 0.4767  127 PHE A CZ  
389  N N   . GLY A 55  ? 1.3880 1.5994 1.4146  0.2618  -0.3548 0.3399  128 GLY A N   
390  C CA  . GLY A 55  ? 1.1975 1.4463 1.2415  0.2782  -0.3421 0.3141  128 GLY A CA  
391  C C   . GLY A 55  ? 1.2174 1.4562 1.2621  0.3094  -0.3669 0.2971  128 GLY A C   
392  O O   . GLY A 55  ? 1.2109 1.4810 1.2589  0.3265  -0.3682 0.2809  128 GLY A O   
393  N N   . GLY A 56  ? 1.2378 1.4344 1.2796  0.3170  -0.3862 0.3001  129 GLY A N   
394  C CA  . GLY A 56  ? 1.2598 1.4420 1.3018  0.3476  -0.4095 0.2828  129 GLY A CA  
395  C C   . GLY A 56  ? 1.7637 1.9317 1.7908  0.3669  -0.4365 0.2832  129 GLY A C   
396  O O   . GLY A 56  ? 1.2974 1.4923 1.3303  0.3917  -0.4416 0.2635  129 GLY A O   
397  N N   . ILE A 57  ? 1.6924 1.8185 1.7006  0.3560  -0.4549 0.3062  130 ILE A N   
398  C CA  . ILE A 57  ? 1.5661 1.6728 1.5587  0.3740  -0.4835 0.3092  130 ILE A CA  
399  C C   . ILE A 57  ? 1.6023 1.7587 1.5979  0.3787  -0.4736 0.3020  130 ILE A C   
400  O O   . ILE A 57  ? 1.7145 1.8780 1.7092  0.4060  -0.4914 0.2894  130 ILE A O   
401  C CB  . ILE A 57  ? 1.4278 1.4809 1.3988  0.3570  -0.5039 0.3378  130 ILE A CB  
402  C CG1 . ILE A 57  ? 1.4393 1.4493 1.4088  0.3457  -0.5090 0.3466  130 ILE A CG1 
403  C CG2 . ILE A 57  ? 1.5930 1.6139 1.5477  0.3801  -0.5391 0.3397  130 ILE A CG2 
404  C CD1 . ILE A 57  ? 1.4622 1.4432 1.4329  0.3739  -0.5299 0.3287  130 ILE A CD1 
405  N N   . PRO A 58  ? 1.5727 1.7641 1.5710  0.3540  -0.4471 0.3092  131 PRO A N   
406  C CA  . PRO A 58  ? 1.5320 1.7700 1.5317  0.3590  -0.4398 0.3011  131 PRO A CA  
407  C C   . PRO A 58  ? 1.4342 1.7162 1.4524  0.3825  -0.4322 0.2729  131 PRO A C   
408  O O   . PRO A 58  ? 1.5593 1.8666 1.5773  0.4004  -0.4421 0.2637  131 PRO A O   
409  C CB  . PRO A 58  ? 1.3918 1.6539 1.3906  0.3261  -0.4103 0.3128  131 PRO A CB  
410  C CG  . PRO A 58  ? 1.3054 1.5239 1.2952  0.3051  -0.4125 0.3349  131 PRO A CG  
411  C CD  . PRO A 58  ? 1.3914 1.5788 1.3885  0.3206  -0.4257 0.3272  131 PRO A CD  
412  N N   . LEU A 59  ? 1.5455 1.8411 1.5801  0.3816  -0.4142 0.2597  132 LEU A N   
413  C CA  . LEU A 59  ? 1.6002 1.9384 1.6520  0.4034  -0.4077 0.2334  132 LEU A CA  
414  C C   . LEU A 59  ? 1.5621 1.8799 1.6124  0.4383  -0.4370 0.2210  132 LEU A C   
415  O O   . LEU A 59  ? 1.5440 1.8984 1.6026  0.4614  -0.4411 0.2030  132 LEU A O   
416  C CB  . LEU A 59  ? 1.4470 1.8021 1.5153  0.3927  -0.3824 0.2241  132 LEU A CB  
417  C CG  . LEU A 59  ? 1.3917 1.7782 1.4651  0.3634  -0.3504 0.2298  132 LEU A CG  
418  C CD1 . LEU A 59  ? 1.4223 1.8170 1.5112  0.3540  -0.3290 0.2231  132 LEU A CD1 
419  C CD2 . LEU A 59  ? 1.4390 1.8788 1.5166  0.3668  -0.3406 0.2179  132 LEU A CD2 
420  N N   . PHE A 60  ? 1.5135 1.7740 1.5537  0.4426  -0.4574 0.2299  133 PHE A N   
421  C CA  . PHE A 60  ? 1.7205 1.9542 1.7568  0.4765  -0.4864 0.2178  133 PHE A CA  
422  C C   . PHE A 60  ? 1.9324 2.1663 1.9584  0.4945  -0.5090 0.2208  133 PHE A C   
423  O O   . PHE A 60  ? 2.0503 2.3051 2.0827  0.5258  -0.5208 0.2021  133 PHE A O   
424  C CB  . PHE A 60  ? 1.6508 1.8176 1.6748  0.4729  -0.5043 0.2294  133 PHE A CB  
425  C CG  . PHE A 60  ? 1.9362 2.0735 1.9572  0.5072  -0.5304 0.2129  133 PHE A CG  
426  C CD1 . PHE A 60  ? 2.2066 2.3078 2.2122  0.5289  -0.5626 0.2167  133 PHE A CD1 
427  C CD2 . PHE A 60  ? 1.7080 1.8526 1.7407  0.5180  -0.5228 0.1934  133 PHE A CD2 
428  C CE1 . PHE A 60  ? 2.2306 2.3024 2.2325  0.5621  -0.5867 0.2002  133 PHE A CE1 
429  C CE2 . PHE A 60  ? 1.7826 1.8998 1.8110  0.5502  -0.5463 0.1767  133 PHE A CE2 
430  C CZ  . PHE A 60  ? 1.8771 1.9571 1.8900  0.5729  -0.5781 0.1796  133 PHE A CZ  
431  N N   . TYR A 61  ? 2.0178 2.2298 2.0278  0.4751  -0.5155 0.2448  134 TYR A N   
432  C CA  . TYR A 61  ? 1.9243 2.1332 1.9228  0.4896  -0.5384 0.2510  134 TYR A CA  
433  C C   . TYR A 61  ? 1.7760 2.0529 1.7860  0.4939  -0.5233 0.2392  134 TYR A C   
434  O O   . TYR A 61  ? 1.7494 2.0429 1.7611  0.5212  -0.5405 0.2295  134 TYR A O   
435  C CB  . TYR A 61  ? 2.2810 2.4490 2.2582  0.4641  -0.5482 0.2814  134 TYR A CB  
436  C CG  . TYR A 61  ? 2.4962 2.6637 2.4600  0.4723  -0.5690 0.2920  134 TYR A CG  
437  C CD1 . TYR A 61  ? 2.6102 2.7471 2.5666  0.5042  -0.6028 0.2886  134 TYR A CD1 
438  C CD2 . TYR A 61  ? 2.4817 2.6775 2.4393  0.4480  -0.5554 0.3060  134 TYR A CD2 
439  C CE1 . TYR A 61  ? 2.6242 2.7604 2.5687  0.5119  -0.6228 0.2997  134 TYR A CE1 
440  C CE2 . TYR A 61  ? 2.5077 2.7039 2.4524  0.4541  -0.5749 0.3168  134 TYR A CE2 
441  C CZ  . TYR A 61  ? 2.5635 2.7303 2.5023  0.4861  -0.6088 0.3142  134 TYR A CZ  
442  O OH  . TYR A 61  ? 2.5760 2.7433 2.5024  0.4927  -0.6292 0.3260  134 TYR A OH  
443  N N   . MET A 62  ? 1.4453 1.7618 1.4631  0.4670  -0.4918 0.2402  135 MET A N   
444  C CA  . MET A 62  ? 1.4452 1.8261 1.4730  0.4674  -0.4765 0.2292  135 MET A CA  
445  C C   . MET A 62  ? 1.7535 2.1744 1.8005  0.4966  -0.4754 0.2016  135 MET A C   
446  O O   . MET A 62  ? 1.8088 2.2725 1.8618  0.5127  -0.4799 0.1916  135 MET A O   
447  C CB  . MET A 62  ? 1.3420 1.7498 1.3728  0.4321  -0.4428 0.2349  135 MET A CB  
448  C CG  . MET A 62  ? 1.3123 1.7796 1.3475  0.4245  -0.4270 0.2284  135 MET A CG  
449  S SD  . MET A 62  ? 1.6614 2.1923 1.7218  0.4356  -0.4056 0.1996  135 MET A SD  
450  C CE  . MET A 62  ? 1.5361 2.0523 1.6040  0.4108  -0.3776 0.2009  135 MET A CE  
451  N N   . GLU A 63  ? 2.1026 2.5122 2.1595  0.5035  -0.4697 0.1896  136 GLU A N   
452  C CA  . GLU A 63  ? 2.2579 2.7036 2.3318  0.5320  -0.4695 0.1633  136 GLU A CA  
453  C C   . GLU A 63  ? 2.1957 2.6204 2.2648  0.5699  -0.5025 0.1561  136 GLU A C   
454  O O   . GLU A 63  ? 2.2011 2.6697 2.2820  0.5960  -0.5066 0.1378  136 GLU A O   
455  C CB  . GLU A 63  ? 2.1597 2.5959 2.2432  0.5274  -0.4552 0.1537  136 GLU A CB  
456  C CG  . GLU A 63  ? 2.0919 2.5516 2.1892  0.5592  -0.4599 0.1275  136 GLU A CG  
457  C CD  . GLU A 63  ? 2.1216 2.6573 2.2375  0.5606  -0.4385 0.1101  136 GLU A CD  
458  O OE1 . GLU A 63  ? 2.1797 2.7475 2.2969  0.5370  -0.4210 0.1180  136 GLU A OE1 
459  O OE2 . GLU A 63  ? 2.0805 2.6439 2.2089  0.5846  -0.4394 0.0884  136 GLU A OE2 
460  N N   . LEU A 64  ? 1.9493 2.3070 2.0009  0.5732  -0.5266 0.1708  137 LEU A N   
461  C CA  . LEU A 64  ? 1.8641 2.1903 1.9087  0.6095  -0.5598 0.1647  137 LEU A CA  
462  C C   . LEU A 64  ? 1.6938 2.0379 1.7333  0.6216  -0.5762 0.1713  137 LEU A C   
463  O O   . LEU A 64  ? 1.6115 1.9514 1.6515  0.6569  -0.5997 0.1607  137 LEU A O   
464  C CB  . LEU A 64  ? 1.4700 1.7150 1.4956  0.6052  -0.5806 0.1802  137 LEU A CB  
465  C CG  . LEU A 64  ? 1.5260 1.7239 1.5429  0.6423  -0.6143 0.1711  137 LEU A CG  
466  C CD1 . LEU A 64  ? 1.5109 1.7350 1.5445  0.6659  -0.6053 0.1410  137 LEU A CD1 
467  C CD2 . LEU A 64  ? 1.5668 1.6839 1.5630  0.6289  -0.6323 0.1902  137 LEU A CD2 
468  N N   . ALA A 65  ? 1.8890 2.2522 1.9230  0.5931  -0.5642 0.1884  138 ALA A N   
469  C CA  . ALA A 65  ? 1.8655 2.2457 1.8930  0.6008  -0.5795 0.1971  138 ALA A CA  
470  C C   . ALA A 65  ? 1.7890 2.2464 1.8360  0.6169  -0.5689 0.1770  138 ALA A C   
471  O O   . ALA A 65  ? 1.6225 2.0953 1.6720  0.6465  -0.5896 0.1710  138 ALA A O   
472  C CB  . ALA A 65  ? 1.7044 2.0756 1.7167  0.5628  -0.5706 0.2229  138 ALA A CB  
473  N N   . LEU A 66  ? 1.5592 2.0658 1.6201  0.5974  -0.5371 0.1672  139 LEU A N   
474  C CA  . LEU A 66  ? 1.4614 2.0445 1.5404  0.6070  -0.5247 0.1497  139 LEU A CA  
475  C C   . LEU A 66  ? 1.6148 2.2165 1.7078  0.6502  -0.5401 0.1269  139 LEU A C   
476  O O   . LEU A 66  ? 1.9470 2.5923 2.0500  0.6633  -0.5420 0.1173  139 LEU A O   
477  C CB  . LEU A 66  ? 1.4046 2.0269 1.4950  0.5788  -0.4890 0.1425  139 LEU A CB  
478  C CG  . LEU A 66  ? 1.5635 2.1779 1.6419  0.5370  -0.4701 0.1620  139 LEU A CG  
479  C CD1 . LEU A 66  ? 1.2176 1.8644 1.3079  0.5131  -0.4364 0.1532  139 LEU A CD1 
480  C CD2 . LEU A 66  ? 1.6076 2.2518 1.6784  0.5300  -0.4752 0.1715  139 LEU A CD2 
481  N N   . GLY A 67  ? 1.8142 2.3771 1.9082  0.6634  -0.5442 0.1171  140 GLY A N   
482  C CA  . GLY A 67  ? 1.8858 2.4526 1.9914  0.6908  -0.5479 0.0937  140 GLY A CA  
483  C C   . GLY A 67  ? 2.0064 2.5440 2.1047  0.7106  -0.5723 0.0970  140 GLY A C   
484  O O   . GLY A 67  ? 2.0829 2.6563 2.1932  0.7303  -0.5724 0.0810  140 GLY A O   
485  N N   . GLN A 68  ? 1.9255 2.3988 2.0037  0.7050  -0.5933 0.1187  141 GLN A N   
486  C CA  . GLN A 68  ? 1.9195 2.3599 1.9898  0.7230  -0.6177 0.1239  141 GLN A CA  
487  C C   . GLN A 68  ? 1.9692 2.4521 2.0414  0.7186  -0.6207 0.1340  141 GLN A C   
488  O O   . GLN A 68  ? 1.9641 2.4407 2.0365  0.7373  -0.6371 0.1332  141 GLN A O   
489  C CB  . GLN A 68  ? 1.9351 2.2913 1.9822  0.7155  -0.6391 0.1451  141 GLN A CB  
490  C CG  . GLN A 68  ? 2.1700 2.4764 2.2088  0.7390  -0.6639 0.1442  141 GLN A CG  
491  C CD  . GLN A 68  ? 2.3757 2.5975 2.3936  0.7325  -0.6808 0.1579  141 GLN A CD  
492  O OE1 . GLN A 68  ? 2.6330 2.8347 2.6441  0.7113  -0.6733 0.1669  141 GLN A OE1 
493  N NE2 . GLN A 68  ? 2.2684 2.4404 2.2756  0.7503  -0.7036 0.1597  141 GLN A NE2 
494  N N   . TYR A 69  ? 1.9530 2.4794 2.0260  0.6945  -0.6053 0.1432  142 TYR A N   
495  C CA  . TYR A 69  ? 2.0564 2.6271 2.1301  0.6881  -0.6071 0.1521  142 TYR A CA  
496  C C   . TYR A 69  ? 2.1210 2.7669 2.2179  0.7000  -0.5916 0.1291  142 TYR A C   
497  O O   . TYR A 69  ? 2.4175 3.0820 2.5208  0.7168  -0.6021 0.1249  142 TYR A O   
498  C CB  . TYR A 69  ? 2.1583 2.7420 2.2191  0.6567  -0.5978 0.1720  142 TYR A CB  
499  C CG  . TYR A 69  ? 2.2313 2.8643 2.2906  0.6466  -0.5978 0.1809  142 TYR A CG  
500  C CD1 . TYR A 69  ? 2.4015 3.0064 2.4462  0.6482  -0.6212 0.1995  142 TYR A CD1 
501  C CD2 . TYR A 69  ? 2.3242 3.0308 2.3956  0.6339  -0.5749 0.1718  142 TYR A CD2 
502  C CE1 . TYR A 69  ? 2.5413 3.1911 2.5834  0.6380  -0.6220 0.2082  142 TYR A CE1 
503  C CE2 . TYR A 69  ? 2.5076 3.2587 2.5760  0.6229  -0.5752 0.1800  142 TYR A CE2 
504  C CZ  . TYR A 69  ? 2.5885 3.3114 2.6421  0.6254  -0.5990 0.1981  142 TYR A CZ  
505  O OH  . TYR A 69  ? 2.6726 3.4401 2.7224  0.6135  -0.5999 0.2065  142 TYR A OH  
506  N N   . HIS A 70  ? 1.8422 2.5325 1.9520  0.6909  -0.5665 0.1148  143 HIS A N   
507  C CA  . HIS A 70  ? 1.7949 2.5604 1.9254  0.6969  -0.5499 0.0949  143 HIS A CA  
508  C C   . HIS A 70  ? 1.7756 2.5417 1.9192  0.7269  -0.5516 0.0712  143 HIS A C   
509  O O   . HIS A 70  ? 1.8797 2.7006 2.0380  0.7384  -0.5456 0.0569  143 HIS A O   
510  C CB  . HIS A 70  ? 1.8133 2.6277 1.9523  0.6741  -0.5220 0.0892  143 HIS A CB  
511  C CG  . HIS A 70  ? 1.9997 2.8292 2.1272  0.6449  -0.5161 0.1091  143 HIS A CG  
512  N ND1 . HIS A 70  ? 2.1410 2.9186 2.2492  0.6289  -0.5216 0.1295  143 HIS A ND1 
513  C CD2 . HIS A 70  ? 1.9567 2.8474 2.0877  0.6270  -0.5040 0.1116  143 HIS A CD2 
514  C CE1 . HIS A 70  ? 2.0616 2.8572 2.1615  0.5943  -0.5059 0.1421  143 HIS A CE1 
515  N NE2 . HIS A 70  ? 1.9641 2.8308 2.0771  0.5957  -0.4978 0.1318  143 HIS A NE2 
516  N N   . ARG A 71  ? 1.9864 2.6940 2.1234  0.7392  -0.5596 0.0669  144 ARG A N   
517  C CA  . ARG A 71  ? 2.0018 2.7045 2.1473  0.7683  -0.5616 0.0436  144 ARG A CA  
518  C C   . ARG A 71  ? 1.9740 2.7482 2.1390  0.7698  -0.5368 0.0206  144 ARG A C   
519  O O   . ARG A 71  ? 1.9510 2.7561 2.1267  0.7925  -0.5362 0.0022  144 ARG A O   
520  C CB  . ARG A 71  ? 1.8994 2.5875 2.0434  0.7941  -0.5834 0.0431  144 ARG A CB  
521  C CG  . ARG A 71  ? 1.9770 2.5921 2.1008  0.7926  -0.6091 0.0665  144 ARG A CG  
522  C CD  . ARG A 71  ? 2.0463 2.6302 2.1676  0.8239  -0.6311 0.0609  144 ARG A CD  
523  N NE  . ARG A 71  ? 2.2972 2.9443 2.4350  0.8401  -0.6280 0.0490  144 ARG A NE  
524  C CZ  . ARG A 71  ? 2.3560 3.0226 2.4942  0.8377  -0.6385 0.0634  144 ARG A CZ  
525  N NH1 . ARG A 71  ? 2.3894 3.1155 2.5437  0.8528  -0.6349 0.0516  144 ARG A NH1 
526  N NH2 . ARG A 71  ? 2.3486 2.9763 2.4707  0.8197  -0.6528 0.0902  144 ARG A NH2 
527  N N   . ASN A 72  ? 1.9824 2.7839 2.1516  0.7450  -0.5160 0.0222  145 ASN A N   
528  C CA  . ASN A 72  ? 1.8622 2.7296 2.0485  0.7414  -0.4916 0.0029  145 ASN A CA  
529  C C   . ASN A 72  ? 1.9295 2.7772 2.1159  0.7340  -0.4792 -0.0036 145 ASN A C   
530  O O   . ASN A 72  ? 2.0548 2.8453 2.2286  0.7257  -0.4869 0.0097  145 ASN A O   
531  C CB  . ASN A 72  ? 1.6659 2.5974 1.8594  0.7160  -0.4758 0.0102  145 ASN A CB  
532  N N   . GLY A 73  ? 2.0371 2.9338 2.2373  0.7361  -0.4601 -0.0235 146 GLY A N   
533  C CA  . GLY A 73  ? 2.1389 3.0254 2.3411  0.7293  -0.4470 -0.0313 146 GLY A CA  
534  C C   . GLY A 73  ? 2.2202 3.1164 2.4227  0.6970  -0.4321 -0.0163 146 GLY A C   
535  O O   . GLY A 73  ? 2.2708 3.1700 2.4681  0.6801  -0.4342 0.0018  146 GLY A O   
536  N N   . CYS A 74  ? 2.3023 3.2044 2.5106  0.6887  -0.4165 -0.0242 147 CYS A N   
537  C CA  . CYS A 74  ? 2.3044 3.2168 2.5145  0.6594  -0.4009 -0.0113 147 CYS A CA  
538  C C   . CYS A 74  ? 2.1480 3.1354 2.3707  0.6400  -0.3803 -0.0136 147 CYS A C   
539  O O   . CYS A 74  ? 2.1311 3.1312 2.3540  0.6142  -0.3682 -0.0006 147 CYS A O   
540  C CB  . CYS A 74  ? 2.4323 3.3260 2.6452  0.6570  -0.3917 -0.0182 147 CYS A CB  
541  S SG  . CYS A 74  ? 2.6651 3.4764 2.8639  0.6814  -0.4147 -0.0216 147 CYS A SG  
542  N N   . ILE A 75  ? 1.9512 2.9872 2.1830  0.6511  -0.3763 -0.0293 148 ILE A N   
543  C CA  . ILE A 75  ? 1.6954 2.8043 1.9387  0.6328  -0.3572 -0.0333 148 ILE A CA  
544  C C   . ILE A 75  ? 1.4491 2.5824 1.6901  0.6325  -0.3659 -0.0259 148 ILE A C   
545  O O   . ILE A 75  ? 1.3803 2.5451 1.6215  0.6085  -0.3574 -0.0151 148 ILE A O   
546  C CB  . ILE A 75  ? 1.0456 2.1995 1.3008  0.6420  -0.3439 -0.0560 148 ILE A CB  
547  C CG1 . ILE A 75  ? 1.1598 2.2845 1.4153  0.6460  -0.3387 -0.0640 148 ILE A CG1 
548  C CG2 . ILE A 75  ? 1.0072 2.2326 1.2729  0.6173  -0.3227 -0.0579 148 ILE A CG2 
549  C CD1 . ILE A 75  ? 1.0391 2.2023 1.3028  0.6582  -0.3283 -0.0866 148 ILE A CD1 
550  N N   . SER A 76  ? 1.5780 2.6968 1.8163  0.6590  -0.3836 -0.0315 149 SER A N   
551  C CA  . SER A 76  ? 1.4937 2.6394 1.7315  0.6613  -0.3925 -0.0259 149 SER A CA  
552  C C   . SER A 76  ? 1.4373 2.5477 1.6613  0.6489  -0.4056 -0.0026 149 SER A C   
553  O O   . SER A 76  ? 1.5216 2.6599 1.7441  0.6423  -0.4100 0.0054  149 SER A O   
554  C CB  . SER A 76  ? 1.3483 2.4862 1.5877  0.6950  -0.4081 -0.0382 149 SER A CB  
555  O OG  . SER A 76  ? 1.3401 2.4046 1.5683  0.7139  -0.4271 -0.0348 149 SER A OG  
556  N N   . ILE A 77  ? 1.5455 2.5963 1.7584  0.6451  -0.4120 0.0090  150 ILE A N   
557  C CA  . ILE A 77  ? 1.3506 2.3666 1.5478  0.6330  -0.4245 0.0322  150 ILE A CA  
558  C C   . ILE A 77  ? 1.4506 2.5075 1.6474  0.6008  -0.4072 0.0425  150 ILE A C   
559  O O   . ILE A 77  ? 1.5335 2.5797 1.7170  0.5841  -0.4116 0.0593  150 ILE A O   
560  C CB  . ILE A 77  ? 1.3126 2.2515 1.4964  0.6386  -0.4373 0.0422  150 ILE A CB  
561  C CG1 . ILE A 77  ? 1.1943 2.0927 1.3593  0.6323  -0.4557 0.0660  150 ILE A CG1 
562  C CG2 . ILE A 77  ? 1.3573 2.2898 1.5431  0.6179  -0.4176 0.0432  150 ILE A CG2 
563  C CD1 . ILE A 77  ? 1.2199 2.0383 1.3694  0.6332  -0.4682 0.0780  150 ILE A CD1 
564  N N   . TRP A 78  ? 1.5938 2.6867 1.8021  0.5849  -0.3835 0.0325  151 TRP A N   
565  C CA  . TRP A 78  ? 1.5351 2.6475 1.7391  0.5440  -0.3595 0.0402  151 TRP A CA  
566  C C   . TRP A 78  ? 1.5164 2.6999 1.7272  0.5396  -0.3580 0.0368  151 TRP A C   
567  O O   . TRP A 78  ? 1.3393 2.5315 1.5404  0.5083  -0.3463 0.0470  151 TRP A O   
568  C CB  . TRP A 78  ? 1.6345 2.7540 1.8470  0.5270  -0.3349 0.0316  151 TRP A CB  
569  C CG  . TRP A 78  ? 1.4336 2.4831 1.6369  0.5202  -0.3322 0.0394  151 TRP A CG  
570  C CD1 . TRP A 78  ? 1.5093 2.5341 1.7185  0.5391  -0.3361 0.0303  151 TRP A CD1 
571  C CD2 . TRP A 78  ? 1.4904 2.4867 1.6766  0.4928  -0.3256 0.0584  151 TRP A CD2 
572  N NE1 . TRP A 78  ? 1.6882 2.6479 1.8856  0.5239  -0.3327 0.0431  151 TRP A NE1 
573  C CE2 . TRP A 78  ? 1.7702 2.7125 1.9540  0.4958  -0.3259 0.0606  151 TRP A CE2 
574  C CE3 . TRP A 78  ? 1.5811 2.5715 1.7532  0.4657  -0.3192 0.0734  151 TRP A CE3 
575  C CZ2 . TRP A 78  ? 1.9044 2.7902 2.0740  0.4729  -0.3200 0.0780  151 TRP A CZ2 
576  C CZ3 . TRP A 78  ? 1.8045 2.7382 1.9617  0.4439  -0.3126 0.0896  151 TRP A CZ3 
577  C CH2 . TRP A 78  ? 1.8969 2.7805 2.0539  0.4477  -0.3129 0.0922  151 TRP A CH2 
578  N N   . ARG A 79  ? 1.7266 2.9507 1.9511  0.5653  -0.3660 0.0219  152 ARG A N   
579  C CA  . ARG A 79  ? 1.8671 3.1491 2.0961  0.5589  -0.3641 0.0191  152 ARG A CA  
580  C C   . ARG A 79  ? 1.8348 3.1007 2.0496  0.5577  -0.3822 0.0361  152 ARG A C   
581  O O   . ARG A 79  ? 1.9411 3.2512 2.1544  0.5409  -0.3793 0.0407  152 ARG A O   
582  C CB  . ARG A 79  ? 1.8540 3.1624 2.0958  0.5835  -0.3655 0.0001  152 ARG A CB  
583  C CG  . ARG A 79  ? 1.8033 3.1774 2.0520  0.5773  -0.3617 -0.0042 152 ARG A CG  
584  C CD  . ARG A 79  ? 1.8504 3.2415 2.1094  0.6074  -0.3679 -0.0203 152 ARG A CD  
585  N NE  . ARG A 79  ? 1.8783 3.2757 2.1461  0.6163  -0.3549 -0.0377 152 ARG A NE  
586  C CZ  . ARG A 79  ? 1.9734 3.3888 2.2494  0.6416  -0.3564 -0.0544 152 ARG A CZ  
587  N NH1 . ARG A 79  ? 1.9719 3.4008 2.2501  0.6614  -0.3702 -0.0559 152 ARG A NH1 
588  N NH2 . ARG A 79  ? 2.0401 3.4613 2.3217  0.6472  -0.3442 -0.0695 152 ARG A NH2 
589  N N   . LYS A 80  ? 1.4810 2.6832 1.6842  0.5736  -0.4013 0.0461  153 LYS A N   
590  C CA  . LYS A 80  ? 1.4494 2.6273 1.6372  0.5742  -0.4209 0.0637  153 LYS A CA  
591  C C   . LYS A 80  ? 1.4589 2.5946 1.6264  0.5439  -0.4148 0.0831  153 LYS A C   
592  O O   . LYS A 80  ? 1.3558 2.4629 1.5069  0.5395  -0.4291 0.0995  153 LYS A O   
593  C CB  . LYS A 80  ? 1.6442 2.7673 1.8286  0.6058  -0.4443 0.0636  153 LYS A CB  
594  C CG  . LYS A 80  ? 1.8412 2.9830 2.0422  0.6328  -0.4447 0.0422  153 LYS A CG  
595  C CD  . LYS A 80  ? 1.8266 3.0392 2.0390  0.6304  -0.4387 0.0345  153 LYS A CD  
596  C CE  . LYS A 80  ? 1.6543 2.8808 1.8801  0.6615  -0.4436 0.0161  153 LYS A CE  
597  N NZ  . LYS A 80  ? 1.2993 2.5122 1.5319  0.6731  -0.4332 -0.0006 153 LYS A NZ  
598  N N   . ILE A 81  ? 1.4345 2.5550 1.6010  0.5185  -0.3902 0.0811  154 ILE A N   
599  C CA  . ILE A 81  ? 1.4936 2.5653 1.6406  0.4842  -0.3770 0.0972  154 ILE A CA  
600  C C   . ILE A 81  ? 1.4650 2.5729 1.6131  0.4494  -0.3482 0.0933  154 ILE A C   
601  O O   . ILE A 81  ? 1.5925 2.7176 1.7289  0.4259  -0.3428 0.1012  154 ILE A O   
602  C CB  . ILE A 81  ? 1.4376 2.4419 1.5800  0.4873  -0.3765 0.1011  154 ILE A CB  
603  C CG1 . ILE A 81  ? 1.6718 2.6340 1.8097  0.5199  -0.4067 0.1061  154 ILE A CG1 
604  C CG2 . ILE A 81  ? 1.2006 2.1620 1.3249  0.4514  -0.3604 0.1173  154 ILE A CG2 
605  C CD1 . ILE A 81  ? 1.6685 2.6084 1.7879  0.5155  -0.4244 0.1249  154 ILE A CD1 
606  N N   . CYS A 82  ? 1.5474 2.6657 1.7083  0.4454  -0.3302 0.0812  155 CYS A N   
607  C CA  . CYS A 82  ? 1.6077 2.7578 1.7704  0.4135  -0.3034 0.0768  155 CYS A CA  
608  C C   . CYS A 82  ? 1.5852 2.7850 1.7700  0.4252  -0.2953 0.0582  155 CYS A C   
609  O O   . CYS A 82  ? 1.4873 2.6668 1.6794  0.4281  -0.2861 0.0523  155 CYS A O   
610  C CB  . CYS A 82  ? 1.5194 2.6166 1.6696  0.3856  -0.2844 0.0865  155 CYS A CB  
611  S SG  . CYS A 82  ? 1.5069 2.5508 1.6298  0.3670  -0.2899 0.1087  155 CYS A SG  
612  N N   . PRO A 83  ? 1.6346 2.9023 1.8306  0.4321  -0.2992 0.0490  156 PRO A N   
613  C CA  . PRO A 83  ? 1.7387 3.0606 1.9564  0.4454  -0.2933 0.0312  156 PRO A CA  
614  C C   . PRO A 83  ? 1.7303 3.0483 1.9517  0.4220  -0.2681 0.0264  156 PRO A C   
615  O O   . PRO A 83  ? 2.0916 3.4219 2.3276  0.4378  -0.2654 0.0144  156 PRO A O   
616  C CB  . PRO A 83  ? 1.8520 3.2481 2.0762  0.4420  -0.2964 0.0271  156 PRO A CB  
617  C CG  . PRO A 83  ? 1.7214 3.0985 1.9250  0.4191  -0.2988 0.0427  156 PRO A CG  
618  C CD  . PRO A 83  ? 1.6894 2.9905 1.8787  0.4280  -0.3099 0.0550  156 PRO A CD  
619  N N   . ILE A 84  ? 1.2848 2.5851 1.4929  0.3854  -0.2498 0.0353  157 ILE A N   
620  C CA  . ILE A 84  ? 1.4388 2.7343 1.6503  0.3628  -0.2262 0.0317  157 ILE A CA  
621  C C   . ILE A 84  ? 1.5797 2.8213 1.7936  0.3749  -0.2254 0.0323  157 ILE A C   
622  O O   . ILE A 84  ? 1.3958 2.6441 1.6198  0.3700  -0.2117 0.0250  157 ILE A O   
623  C CB  . ILE A 84  ? 1.3270 2.6061 1.5213  0.3234  -0.2083 0.0416  157 ILE A CB  
624  C CG1 . ILE A 84  ? 1.0994 2.3263 1.2737  0.3196  -0.2170 0.0569  157 ILE A CG1 
625  C CG2 . ILE A 84  ? 1.2645 2.6072 1.4601  0.3055  -0.2026 0.0365  157 ILE A CG2 
626  C CD1 . ILE A 84  ? 1.1173 2.3214 1.2729  0.2830  -0.1988 0.0660  157 ILE A CD1 
627  N N   . PHE A 85  ? 1.6734 2.8626 1.8782  0.3905  -0.2410 0.0412  158 PHE A N   
628  C CA  . PHE A 85  ? 1.4457 2.5812 1.6512  0.4009  -0.2423 0.0431  158 PHE A CA  
629  C C   . PHE A 85  ? 1.4926 2.6404 1.7119  0.4383  -0.2590 0.0301  158 PHE A C   
630  O O   . PHE A 85  ? 1.8786 2.9804 2.0971  0.4516  -0.2651 0.0308  158 PHE A O   
631  C CB  . PHE A 85  ? 1.4650 2.5352 1.6523  0.3960  -0.2504 0.0604  158 PHE A CB  
632  C CG  . PHE A 85  ? 1.5777 2.6277 1.7510  0.3599  -0.2313 0.0724  158 PHE A CG  
633  C CD1 . PHE A 85  ? 1.5170 2.5839 1.6949  0.3358  -0.2071 0.0681  158 PHE A CD1 
634  C CD2 . PHE A 85  ? 1.7571 2.7717 1.9119  0.3503  -0.2376 0.0878  158 PHE A CD2 
635  C CE1 . PHE A 85  ? 1.6440 2.6907 1.8083  0.3045  -0.1894 0.0778  158 PHE A CE1 
636  C CE2 . PHE A 85  ? 1.7777 2.7750 1.9187  0.3184  -0.2193 0.0975  158 PHE A CE2 
637  C CZ  . PHE A 85  ? 1.7293 2.7419 1.8752  0.2963  -0.1951 0.0919  158 PHE A CZ  
638  N N   . LYS A 86  ? 1.2097 2.4197 1.4410  0.4553  -0.2663 0.0178  159 LYS A N   
639  C CA  . LYS A 86  ? 1.0118 2.2405 1.2567  0.4928  -0.2813 0.0032  159 LYS A CA  
640  C C   . LYS A 86  ? 1.0054 2.2295 1.2597  0.4935  -0.2688 -0.0067 159 LYS A C   
641  O O   . LYS A 86  ? 1.0760 2.2851 1.3353  0.5224  -0.2810 -0.0159 159 LYS A O   
642  C CB  . LYS A 86  ? 1.2547 2.5613 1.5127  0.5066  -0.2870 -0.0082 159 LYS A CB  
643  C CG  . LYS A 86  ? 1.4109 2.7171 1.6746  0.5435  -0.3025 -0.0220 159 LYS A CG  
644  C CD  . LYS A 86  ? 1.5729 2.9363 1.8425  0.5467  -0.3013 -0.0314 159 LYS A CD  
645  C CE  . LYS A 86  ? 1.6426 2.9918 1.9128  0.5815  -0.3168 -0.0428 159 LYS A CE  
646  N NZ  . LYS A 86  ? 1.5969 3.0049 1.8737  0.5851  -0.3154 -0.0508 159 LYS A NZ  
647  N N   . GLY A 87  ? 1.1654 2.4023 1.4214  0.4621  -0.2452 -0.0052 160 GLY A N   
648  C CA  . GLY A 87  ? 1.2141 2.4438 1.4778  0.4591  -0.2326 -0.0121 160 GLY A CA  
649  C C   . GLY A 87  ? 1.2129 2.3714 1.4692  0.4690  -0.2402 -0.0063 160 GLY A C   
650  O O   . GLY A 87  ? 1.2419 2.3945 1.5053  0.4802  -0.2388 -0.0153 160 GLY A O   
651  N N   . ILE A 88  ? 1.0860 2.1902 1.3272  0.4627  -0.2479 0.0094  161 ILE A N   
652  C CA  . ILE A 88  ? 0.9034 1.9396 1.1364  0.4727  -0.2585 0.0164  161 ILE A CA  
653  C C   . ILE A 88  ? 1.4264 2.4639 1.6657  0.5113  -0.2784 0.0020  161 ILE A C   
654  O O   . ILE A 88  ? 1.4451 2.4582 1.6869  0.5196  -0.2786 -0.0036 161 ILE A O   
655  C CB  . ILE A 88  ? 1.0480 2.0359 1.2637  0.4650  -0.2686 0.0347  161 ILE A CB  
656  C CG1 . ILE A 88  ? 0.9081 1.8829 1.1157  0.4270  -0.2474 0.0488  161 ILE A CG1 
657  C CG2 . ILE A 88  ? 1.0950 2.0182 1.3024  0.4818  -0.2865 0.0408  161 ILE A CG2 
658  C CD1 . ILE A 88  ? 0.9306 1.8687 1.1208  0.4181  -0.2561 0.0660  161 ILE A CD1 
659  N N   . GLY A 89  ? 1.3694 2.4363 1.6109  0.5358  -0.2956 -0.0046 162 GLY A N   
660  C CA  . GLY A 89  ? 1.1538 2.2246 1.4010  0.5755  -0.3151 -0.0197 162 GLY A CA  
661  C C   . GLY A 89  ? 1.2652 2.3745 1.5268  0.5839  -0.3043 -0.0381 162 GLY A C   
662  O O   . GLY A 89  ? 1.2042 2.2858 1.4634  0.6054  -0.3129 -0.0497 162 GLY A O   
663  N N   . TYR A 90  ? 1.3742 2.5354 1.6454  0.5601  -0.2822 -0.0410 163 TYR A N   
664  C CA  . TYR A 90  ? 1.3840 2.5780 1.6660  0.5605  -0.2686 -0.0564 163 TYR A CA  
665  C C   . TYR A 90  ? 1.2830 2.4339 1.5622  0.5441  -0.2582 -0.0499 163 TYR A C   
666  O O   . TYR A 90  ? 1.3155 2.4623 1.5989  0.5581  -0.2593 -0.0612 163 TYR A O   
667  C CB  . TYR A 90  ? 1.3252 2.5891 1.6166  0.5394  -0.2498 -0.0609 163 TYR A CB  
668  C CG  . TYR A 90  ? 1.1781 2.4812 1.4696  0.5523  -0.2544 -0.0718 163 TYR A CG  
669  C CD1 . TYR A 90  ? 1.0963 2.3805 1.3833  0.5841  -0.2697 -0.0837 163 TYR A CD1 
670  C CD2 . TYR A 90  ? 1.3249 2.6845 1.6211  0.5326  -0.2436 -0.0701 163 TYR A CD2 
671  C CE1 . TYR A 90  ? 1.3737 2.6960 1.6621  0.5970  -0.2736 -0.0932 163 TYR A CE1 
672  C CE2 . TYR A 90  ? 1.4586 2.8563 1.7555  0.5440  -0.2478 -0.0791 163 TYR A CE2 
673  C CZ  . TYR A 90  ? 1.5918 2.9716 1.8855  0.5768  -0.2625 -0.0905 163 TYR A CZ  
674  O OH  . TYR A 90  ? 1.9569 3.3767 2.2524  0.5893  -0.2665 -0.0990 163 TYR A OH  
675  N N   . ALA A 91  ? 1.3462 2.4628 1.6169  0.5121  -0.2465 -0.0318 164 ALA A N   
676  C CA  . ALA A 91  ? 1.3059 2.3786 1.5732  0.4920  -0.2342 -0.0234 164 ALA A CA  
677  C C   . ALA A 91  ? 1.1684 2.1874 1.4297  0.5147  -0.2511 -0.0257 164 ALA A C   
678  O O   . ALA A 91  ? 1.2741 2.2885 1.5399  0.5179  -0.2468 -0.0334 164 ALA A O   
679  C CB  . ALA A 91  ? 1.3505 2.3881 1.6076  0.4603  -0.2234 -0.0031 164 ALA A CB  
680  N N   . ILE A 92  ? 0.9315 1.9082 1.1814  0.5294  -0.2713 -0.0185 165 ILE A N   
681  C CA  . ILE A 92  ? 1.1826 2.1045 1.4244  0.5518  -0.2907 -0.0204 165 ILE A CA  
682  C C   . ILE A 92  ? 1.3948 2.3460 1.6453  0.5801  -0.2963 -0.0431 165 ILE A C   
683  O O   . ILE A 92  ? 1.7793 2.7000 2.0275  0.5846  -0.2982 -0.0474 165 ILE A O   
684  C CB  . ILE A 92  ? 1.1248 2.0112 1.3543  0.5685  -0.3143 -0.0124 165 ILE A CB  
685  C CG1 . ILE A 92  ? 1.3716 2.2259 1.5905  0.5388  -0.3082 0.0108  165 ILE A CG1 
686  C CG2 . ILE A 92  ? 1.1138 1.9453 1.3342  0.5944  -0.3369 -0.0166 165 ILE A CG2 
687  C CD1 . ILE A 92  ? 1.4455 2.2633 1.6508  0.5516  -0.3312 0.0213  165 ILE A CD1 
688  N N   . CYS A 93  ? 1.0185 2.0319 1.2791  0.5991  -0.2988 -0.0581 166 CYS A N   
689  C CA  . CYS A 93  ? 1.1098 2.1487 1.3750  0.6197  -0.2984 -0.0807 166 CYS A CA  
690  C C   . CYS A 93  ? 1.1704 2.2238 1.4435  0.6056  -0.2821 -0.0846 166 CYS A C   
691  O O   . CYS A 93  ? 1.3078 2.3313 1.5765  0.6184  -0.2882 -0.0929 166 CYS A O   
692  C CB  . CYS A 93  ? 1.2420 2.3415 1.5129  0.6237  -0.2915 -0.0931 166 CYS A CB  
693  S SG  . CYS A 93  ? 1.3369 2.4193 1.5988  0.6492  -0.3136 -0.0942 166 CYS A SG  
694  N N   . ILE A 94  ? 1.2098 2.3038 1.4925  0.5765  -0.2607 -0.0777 167 ILE A N   
695  C CA  . ILE A 94  ? 1.2636 2.3657 1.5517  0.5569  -0.2426 -0.0790 167 ILE A CA  
696  C C   . ILE A 94  ? 1.2495 2.2773 1.5269  0.5489  -0.2463 -0.0678 167 ILE A C   
697  O O   . ILE A 94  ? 0.9961 2.0137 1.2739  0.5541  -0.2458 -0.0757 167 ILE A O   
698  C CB  . ILE A 94  ? 1.1991 2.3392 1.4943  0.5214  -0.2191 -0.0695 167 ILE A CB  
699  C CG1 . ILE A 94  ? 1.2726 2.4886 1.5781  0.5283  -0.2168 -0.0803 167 ILE A CG1 
700  C CG2 . ILE A 94  ? 0.8647 2.0109 1.1654  0.5010  -0.2013 -0.0694 167 ILE A CG2 
701  C CD1 . ILE A 94  ? 1.4155 2.6696 1.7263  0.4934  -0.1955 -0.0719 167 ILE A CD1 
702  N N   . ILE A 95  ? 1.4508 2.4276 1.7181  0.5356  -0.2505 -0.0489 168 ILE A N   
703  C CA  . ILE A 95  ? 1.2664 2.1725 1.5234  0.5275  -0.2558 -0.0361 168 ILE A CA  
704  C C   . ILE A 95  ? 1.2180 2.0952 1.4687  0.5581  -0.2762 -0.0493 168 ILE A C   
705  O O   . ILE A 95  ? 1.1475 1.9980 1.3961  0.5542  -0.2748 -0.0501 168 ILE A O   
706  C CB  . ILE A 95  ? 0.9110 1.7722 1.1570  0.5153  -0.2618 -0.0157 168 ILE A CB  
707  C CG1 . ILE A 95  ? 0.8782 1.7548 1.1281  0.4800  -0.2385 -0.0015 168 ILE A CG1 
708  C CG2 . ILE A 95  ? 0.9360 1.7246 1.1698  0.5156  -0.2746 -0.0046 168 ILE A CG2 
709  C CD1 . ILE A 95  ? 0.8557 1.7181 1.1098  0.4572  -0.2215 0.0053  168 ILE A CD1 
710  N N   . ALA A 96  ? 1.1828 2.0646 1.4299  0.5895  -0.2959 -0.0602 169 ALA A N   
711  C CA  . ALA A 96  ? 0.9993 1.8506 1.2384  0.6215  -0.3170 -0.0744 169 ALA A CA  
712  C C   . ALA A 96  ? 0.9872 1.8705 1.2335  0.6279  -0.3081 -0.0926 169 ALA A C   
713  O O   . ALA A 96  ? 1.3748 2.2167 1.6129  0.6339  -0.3160 -0.0964 169 ALA A O   
714  C CB  . ALA A 96  ? 1.0300 1.8956 1.2674  0.6561  -0.3369 -0.0859 169 ALA A CB  
715  N N   . PHE A 97  ? 0.9569 1.9143 1.2179  0.6246  -0.2915 -0.1032 170 PHE A N   
716  C CA  . PHE A 97  ? 1.3475 2.3407 1.6148  0.6300  -0.2826 -0.1207 170 PHE A CA  
717  C C   . PHE A 97  ? 1.0270 1.9859 1.2916  0.6048  -0.2723 -0.1103 170 PHE A C   
718  O O   . PHE A 97  ? 0.9409 1.8951 1.2028  0.6148  -0.2748 -0.1227 170 PHE A O   
719  C CB  . PHE A 97  ? 1.3248 2.3926 1.6033  0.6170  -0.2616 -0.1284 170 PHE A CB  
720  C CG  . PHE A 97  ? 0.9036 2.0072 1.1870  0.6121  -0.2478 -0.1415 170 PHE A CG  
721  C CD1 . PHE A 97  ? 0.9333 2.0414 1.2088  0.6367  -0.2543 -0.1637 170 PHE A CD1 
722  C CD2 . PHE A 97  ? 0.8616 1.9952 1.1566  0.5827  -0.2284 -0.1317 170 PHE A CD2 
723  C CE1 . PHE A 97  ? 0.9206 2.0636 1.1992  0.6319  -0.2419 -0.1756 170 PHE A CE1 
724  C CE2 . PHE A 97  ? 0.8493 2.0158 1.1479  0.5769  -0.2163 -0.1425 170 PHE A CE2 
725  C CZ  . PHE A 97  ? 0.8784 2.0506 1.1684  0.6013  -0.2231 -0.1644 170 PHE A CZ  
726  N N   . TYR A 98  ? 1.1316 2.0661 1.3962  0.5721  -0.2606 -0.0877 171 TYR A N   
727  C CA  . TYR A 98  ? 0.9503 1.8498 1.2131  0.5476  -0.2511 -0.0756 171 TYR A CA  
728  C C   . TYR A 98  ? 0.9720 1.7972 1.2196  0.5579  -0.2711 -0.0708 171 TYR A C   
729  O O   . TYR A 98  ? 0.9792 1.7833 1.2229  0.5583  -0.2733 -0.0752 171 TYR A O   
730  C CB  . TYR A 98  ? 1.0990 1.9966 1.3668  0.5117  -0.2324 -0.0537 171 TYR A CB  
731  C CG  . TYR A 98  ? 1.3056 2.2717 1.5867  0.4967  -0.2118 -0.0573 171 TYR A CG  
732  C CD1 . TYR A 98  ? 0.9581 1.9804 1.2477  0.5065  -0.2062 -0.0756 171 TYR A CD1 
733  C CD2 . TYR A 98  ? 1.7235 2.6981 2.0077  0.4722  -0.1984 -0.0424 171 TYR A CD2 
734  C CE1 . TYR A 98  ? 0.8292 1.9141 1.1302  0.4907  -0.1883 -0.0777 171 TYR A CE1 
735  C CE2 . TYR A 98  ? 1.6595 2.6936 1.9541  0.4570  -0.1808 -0.0454 171 TYR A CE2 
736  C CZ  . TYR A 98  ? 1.1389 2.2279 1.4421  0.4657  -0.1762 -0.0624 171 TYR A CZ  
737  O OH  . TYR A 98  ? 0.9782 2.1264 1.2911  0.4487  -0.1596 -0.0643 171 TYR A OH  
738  N N   . ILE A 99  ? 0.9602 1.7459 1.1982  0.5663  -0.2870 -0.0621 172 ILE A N   
739  C CA  . ILE A 99  ? 1.2423 1.9541 1.4646  0.5730  -0.3073 -0.0546 172 ILE A CA  
740  C C   . ILE A 99  ? 1.4388 2.1400 1.6535  0.6032  -0.3239 -0.0764 172 ILE A C   
741  O O   . ILE A 99  ? 1.3700 2.0310 1.5766  0.5989  -0.3292 -0.0751 172 ILE A O   
742  C CB  . ILE A 99  ? 1.2799 1.9587 1.4929  0.5795  -0.3229 -0.0431 172 ILE A CB  
743  C CG1 . ILE A 99  ? 0.9939 1.6738 1.2111  0.5469  -0.3065 -0.0201 172 ILE A CG1 
744  C CG2 . ILE A 99  ? 1.3602 1.9649 1.5553  0.5916  -0.3479 -0.0387 172 ILE A CG2 
745  C CD1 . ILE A 99  ? 1.0173 1.6670 1.2246  0.5501  -0.3207 -0.0072 172 ILE A CD1 
746  N N   . ALA A 100 ? 1.6921 2.4297 1.9087  0.6346  -0.3325 -0.0971 173 ALA A N   
747  C CA  . ALA A 100 ? 1.6081 2.3397 1.8170  0.6672  -0.3480 -0.1208 173 ALA A CA  
748  C C   . ALA A 100 ? 1.4035 2.1608 1.6170  0.6596  -0.3345 -0.1319 173 ALA A C   
749  O O   . ALA A 100 ? 1.4431 2.1841 1.6468  0.6821  -0.3471 -0.1498 173 ALA A O   
750  C CB  . ALA A 100 ? 1.4994 2.2788 1.7136  0.7013  -0.3557 -0.1407 173 ALA A CB  
751  N N   . SER A 101 ? 1.2421 2.0368 1.4688  0.6287  -0.3100 -0.1218 174 SER A N   
752  C CA  . SER A 101 ? 1.3086 2.1284 1.5395  0.6195  -0.2973 -0.1304 174 SER A CA  
753  C C   . SER A 101 ? 1.3661 2.1223 1.5849  0.6080  -0.3047 -0.1217 174 SER A C   
754  O O   . SER A 101 ? 1.3315 2.0964 1.5478  0.6113  -0.3031 -0.1342 174 SER A O   
755  C CB  . SER A 101 ? 1.2325 2.1057 1.4803  0.5885  -0.2701 -0.1201 174 SER A CB  
756  O OG  . SER A 101 ? 1.0531 1.9952 1.3122  0.5990  -0.2625 -0.1319 174 SER A OG  
757  N N   . TYR A 102 ? 1.5650 2.2601 1.7758  0.5941  -0.3131 -0.1005 175 TYR A N   
758  C CA  . TYR A 102 ? 1.5341 2.1699 1.7342  0.5801  -0.3204 -0.0894 175 TYR A CA  
759  C C   . TYR A 102 ? 1.6418 2.2053 1.8228  0.5951  -0.3476 -0.0858 175 TYR A C   
760  O O   . TYR A 102 ? 1.7556 2.2744 1.9231  0.5985  -0.3611 -0.0892 175 TYR A O   
761  C CB  . TYR A 102 ? 1.4459 2.0765 1.6559  0.5407  -0.3014 -0.0628 175 TYR A CB  
762  C CG  . TYR A 102 ? 1.4746 2.0840 1.6857  0.5272  -0.3005 -0.0415 175 TYR A CG  
763  C CD1 . TYR A 102 ? 1.5541 2.0972 1.7527  0.5204  -0.3155 -0.0243 175 TYR A CD1 
764  C CD2 . TYR A 102 ? 1.2756 1.9322 1.4991  0.5193  -0.2844 -0.0381 175 TYR A CD2 
765  C CE1 . TYR A 102 ? 1.3721 1.8983 1.5708  0.5074  -0.3141 -0.0047 175 TYR A CE1 
766  C CE2 . TYR A 102 ? 1.2464 1.8844 1.4693  0.5065  -0.2831 -0.0194 175 TYR A CE2 
767  C CZ  . TYR A 102 ? 1.2986 1.8721 1.5091  0.5009  -0.2977 -0.0028 175 TYR A CZ  
768  O OH  . TYR A 102 ? 1.3283 1.8853 1.5372  0.4876  -0.2961 0.0159  175 TYR A OH  
769  N N   . TYR A 103 ? 1.5524 2.1021 1.7308  0.6029  -0.3568 -0.0784 176 TYR A N   
770  C CA  . TYR A 103 ? 1.4411 1.9191 1.6009  0.6132  -0.3829 -0.0709 176 TYR A CA  
771  C C   . TYR A 103 ? 1.7307 2.1808 1.8744  0.6463  -0.4057 -0.0943 176 TYR A C   
772  O O   . TYR A 103 ? 1.8730 2.2547 1.9985  0.6487  -0.4268 -0.0886 176 TYR A O   
773  C CB  . TYR A 103 ? 1.4388 1.9181 1.5994  0.6202  -0.3889 -0.0627 176 TYR A CB  
774  C CG  . TYR A 103 ? 1.5246 1.9298 1.6662  0.6256  -0.4148 -0.0500 176 TYR A CG  
775  C CD1 . TYR A 103 ? 1.5880 1.9526 1.7259  0.5955  -0.4133 -0.0218 176 TYR A CD1 
776  C CD2 . TYR A 103 ? 1.6033 1.9794 1.7304  0.6608  -0.4410 -0.0658 176 TYR A CD2 
777  C CE1 . TYR A 103 ? 1.7480 2.0463 1.8681  0.5980  -0.4373 -0.0087 176 TYR A CE1 
778  C CE2 . TYR A 103 ? 1.6857 1.9916 1.7944  0.6644  -0.4659 -0.0530 176 TYR A CE2 
779  C CZ  . TYR A 103 ? 1.8156 2.0833 1.9206  0.6318  -0.4640 -0.0239 176 TYR A CZ  
780  O OH  . TYR A 103 ? 1.9871 2.1863 2.0732  0.6332  -0.4891 -0.0097 176 TYR A OH  
781  N N   . ASN A 104 ? 1.4376 1.9396 1.5869  0.6720  -0.4021 -0.1208 177 ASN A N   
782  C CA  . ASN A 104 ? 1.3517 1.8318 1.4855  0.7057  -0.4221 -0.1461 177 ASN A CA  
783  C C   . ASN A 104 ? 1.3709 1.8356 1.4978  0.6948  -0.4194 -0.1517 177 ASN A C   
784  O O   . ASN A 104 ? 1.4340 1.8444 1.5407  0.7100  -0.4407 -0.1614 177 ASN A O   
785  C CB  . ASN A 104 ? 1.3317 1.8772 1.4747  0.7387  -0.4189 -0.1727 177 ASN A CB  
786  C CG  . ASN A 104 ? 1.3713 1.9233 1.5174  0.7561  -0.4281 -0.1697 177 ASN A CG  
787  O OD1 . ASN A 104 ? 1.4802 1.9903 1.6120  0.7851  -0.4529 -0.1778 177 ASN A OD1 
788  N ND2 . ASN A 104 ? 1.2999 1.9037 1.4641  0.7385  -0.4090 -0.1580 177 ASN A ND2 
789  N N   . THR A 105 ? 1.4951 2.0068 1.6373  0.6691  -0.3944 -0.1464 178 THR A N   
790  C CA  . THR A 105 ? 1.4618 1.9663 1.5986  0.6580  -0.3907 -0.1517 178 THR A CA  
791  C C   . THR A 105 ? 1.4936 1.9171 1.6132  0.6429  -0.4076 -0.1352 178 THR A C   
792  O O   . THR A 105 ? 1.4407 1.8348 1.5454  0.6481  -0.4185 -0.1463 178 THR A O   
793  C CB  . THR A 105 ? 1.2486 1.8108 1.4056  0.6280  -0.3615 -0.1421 178 THR A CB  
794  O OG1 . THR A 105 ? 1.2673 1.8146 1.4336  0.5966  -0.3514 -0.1122 178 THR A OG1 
795  C CG2 . THR A 105 ? 1.3285 1.9717 1.5009  0.6421  -0.3461 -0.1591 178 THR A CG2 
796  N N   . ILE A 106 ? 1.5304 1.9198 1.6518  0.6215  -0.4089 -0.1079 179 ILE A N   
797  C CA  . ILE A 106 ? 1.2577 1.5709 1.3627  0.6067  -0.4265 -0.0904 179 ILE A CA  
798  C C   . ILE A 106 ? 1.7534 2.0125 1.8335  0.6380  -0.4567 -0.1089 179 ILE A C   
799  O O   . ILE A 106 ? 1.9070 2.1217 1.9705  0.6357  -0.4701 -0.1126 179 ILE A O   
800  C CB  . ILE A 106 ? 1.2461 1.5353 1.3556  0.5854  -0.4253 -0.0610 179 ILE A CB  
801  C CG1 . ILE A 106 ? 1.1833 1.5231 1.3161  0.5550  -0.3951 -0.0441 179 ILE A CG1 
802  C CG2 . ILE A 106 ? 1.2832 1.4951 1.3751  0.5707  -0.4450 -0.0427 179 ILE A CG2 
803  C CD1 . ILE A 106 ? 1.5484 1.8718 1.6862  0.5346  -0.3910 -0.0170 179 ILE A CD1 
804  N N   . MET A 107 ? 1.5927 1.8527 1.6692  0.6676  -0.4687 -0.1200 180 MET A N   
805  C CA  . MET A 107 ? 1.6244 1.8342 1.6775  0.7013  -0.4978 -0.1394 180 MET A CA  
806  C C   . MET A 107 ? 1.4869 1.7138 1.5326  0.7194  -0.4979 -0.1684 180 MET A C   
807  O O   . MET A 107 ? 1.5354 1.7053 1.5576  0.7330  -0.5203 -0.1797 180 MET A O   
808  C CB  . MET A 107 ? 1.7943 2.0177 1.8490  0.7330  -0.5072 -0.1493 180 MET A CB  
809  C CG  . MET A 107 ? 1.8249 2.0174 1.8799  0.7197  -0.5142 -0.1224 180 MET A CG  
810  S SD  . MET A 107 ? 2.0473 2.2493 2.1009  0.7611  -0.5303 -0.1360 180 MET A SD  
811  C CE  . MET A 107 ? 1.8380 2.1505 1.9205  0.7678  -0.4996 -0.1515 180 MET A CE  
812  N N   . ALA A 108 ? 1.3852 1.6908 1.4494  0.7211  -0.4740 -0.1818 181 ALA A N   
813  C CA  . ALA A 108 ? 1.3960 1.7244 1.4537  0.7355  -0.4717 -0.2084 181 ALA A CA  
814  C C   . ALA A 108 ? 1.4117 1.6892 1.4546  0.7118  -0.4783 -0.1995 181 ALA A C   
815  O O   . ALA A 108 ? 1.4600 1.7013 1.4811  0.7293  -0.4955 -0.2188 181 ALA A O   
816  C CB  . ALA A 108 ? 1.3385 1.7599 1.4200  0.7299  -0.4424 -0.2164 181 ALA A CB  
817  N N   . TRP A 109 ? 1.6510 1.9262 1.7055  0.6718  -0.4646 -0.1702 182 TRP A N   
818  C CA  . TRP A 109 ? 1.4554 1.6842 1.4986  0.6454  -0.4704 -0.1570 182 TRP A CA  
819  C C   . TRP A 109 ? 1.6560 1.7973 1.6707  0.6565  -0.5028 -0.1576 182 TRP A C   
820  O O   . TRP A 109 ? 1.6998 1.8054 1.6945  0.6601  -0.5166 -0.1698 182 TRP A O   
821  C CB  . TRP A 109 ? 1.3345 1.5693 1.3955  0.6038  -0.4531 -0.1225 182 TRP A CB  
822  C CG  . TRP A 109 ? 1.2938 1.6068 1.3811  0.5890  -0.4221 -0.1194 182 TRP A CG  
823  C CD1 . TRP A 109 ? 1.6711 2.0467 1.7661  0.6019  -0.4081 -0.1419 182 TRP A CD1 
824  C CD2 . TRP A 109 ? 1.3178 1.6540 1.4262  0.5579  -0.4015 -0.0919 182 TRP A CD2 
825  N NE1 . TRP A 109 ? 1.6286 2.0632 1.7478  0.5796  -0.3809 -0.1293 182 TRP A NE1 
826  C CE2 . TRP A 109 ? 1.1714 1.5817 1.2990  0.5532  -0.3763 -0.0993 182 TRP A CE2 
827  C CE3 . TRP A 109 ? 1.2102 1.5119 1.3224  0.5337  -0.4018 -0.0621 182 TRP A CE3 
828  C CZ2 . TRP A 109 ? 1.1183 1.5648 1.2676  0.5259  -0.3525 -0.0785 182 TRP A CZ2 
829  C CZ3 . TRP A 109 ? 1.1563 1.4967 1.2907  0.5079  -0.3771 -0.0424 182 TRP A CZ3 
830  C CH2 . TRP A 109 ? 1.1120 1.5220 1.2643  0.5044  -0.3531 -0.0509 182 TRP A CH2 
831  N N   . ALA A 110 ? 1.4697 1.5737 1.4811  0.6596  -0.5158 -0.1429 183 ALA A N   
832  C CA  . ALA A 110 ? 1.5383 1.5564 1.5218  0.6697  -0.5483 -0.1417 183 ALA A CA  
833  C C   . ALA A 110 ? 1.5952 1.5947 1.5570  0.7100  -0.5673 -0.1774 183 ALA A C   
834  O O   . ALA A 110 ? 2.0462 1.9800 1.9819  0.7127  -0.5903 -0.1828 183 ALA A O   
835  C CB  . ALA A 110 ? 1.7522 1.7442 1.7368  0.6718  -0.5583 -0.1236 183 ALA A CB  
836  N N   . LEU A 111 ? 1.5853 1.6411 1.5570  0.7422  -0.5588 -0.2019 184 LEU A N   
837  C CA  . LEU A 111 ? 2.1112 2.1583 2.0644  0.7842  -0.5744 -0.2381 184 LEU A CA  
838  C C   . LEU A 111 ? 1.9263 1.9752 1.8679  0.7787  -0.5716 -0.2543 184 LEU A C   
839  O O   . LEU A 111 ? 1.7094 1.7041 1.6231  0.7978  -0.5943 -0.2733 184 LEU A O   
840  C CB  . LEU A 111 ? 2.0882 2.2102 2.0594  0.8158  -0.5611 -0.2588 184 LEU A CB  
841  C CG  . LEU A 111 ? 2.0274 2.1523 1.9832  0.8634  -0.5746 -0.2979 184 LEU A CG  
842  C CD1 . LEU A 111 ? 1.7462 1.7779 1.6718  0.8864  -0.6103 -0.3033 184 LEU A CD1 
843  C CD2 . LEU A 111 ? 1.6384 1.8423 1.6155  0.8915  -0.5606 -0.3137 184 LEU A CD2 
844  N N   . TYR A 112 ? 1.5860 1.6966 1.5477  0.7527  -0.5442 -0.2474 185 TYR A N   
845  C CA  . TYR A 112 ? 1.5903 1.7070 1.5422  0.7438  -0.5401 -0.2600 185 TYR A CA  
846  C C   . TYR A 112 ? 1.6262 1.6623 1.5566  0.7188  -0.5592 -0.2431 185 TYR A C   
847  O O   . TYR A 112 ? 1.6610 1.6721 1.5707  0.7211  -0.5691 -0.2587 185 TYR A O   
848  C CB  . TYR A 112 ? 1.5167 1.7142 1.4959  0.7179  -0.5072 -0.2513 185 TYR A CB  
849  C CG  . TYR A 112 ? 1.5175 1.7371 1.4888  0.7129  -0.5005 -0.2678 185 TYR A CG  
850  C CD1 . TYR A 112 ? 1.6039 1.8763 1.5735  0.7426  -0.4938 -0.3011 185 TYR A CD1 
851  C CD2 . TYR A 112 ? 1.5289 1.7186 1.4943  0.6784  -0.5010 -0.2499 185 TYR A CD2 
852  C CE1 . TYR A 112 ? 1.8720 2.1659 1.8329  0.7372  -0.4876 -0.3161 185 TYR A CE1 
853  C CE2 . TYR A 112 ? 1.5150 1.7253 1.4724  0.6729  -0.4955 -0.2642 185 TYR A CE2 
854  C CZ  . TYR A 112 ? 1.7383 2.0002 1.6928  0.7021  -0.4888 -0.2974 185 TYR A CZ  
855  O OH  . TYR A 112 ? 1.5245 1.8082 1.4698  0.6958  -0.4833 -0.3115 185 TYR A OH  
856  N N   . TYR A 113 ? 1.6198 1.6159 1.5541  0.6944  -0.5649 -0.2111 186 TYR A N   
857  C CA  . TYR A 113 ? 1.6564 1.5755 1.5705  0.6699  -0.5848 -0.1928 186 TYR A CA  
858  C C   . TYR A 113 ? 1.8369 1.6766 1.7180  0.6981  -0.6195 -0.2085 186 TYR A C   
859  O O   . TYR A 113 ? 1.7878 1.5637 1.6435  0.6881  -0.6398 -0.2077 186 TYR A O   
860  C CB  . TYR A 113 ? 1.6213 1.5295 1.5516  0.6348  -0.5782 -0.1531 186 TYR A CB  
861  C CG  . TYR A 113 ? 1.5681 1.5062 1.5161  0.5938  -0.5571 -0.1302 186 TYR A CG  
862  C CD1 . TYR A 113 ? 1.8907 1.7786 1.8248  0.5664  -0.5692 -0.1145 186 TYR A CD1 
863  C CD2 . TYR A 113 ? 1.4975 1.5134 1.4761  0.5822  -0.5257 -0.1236 186 TYR A CD2 
864  C CE1 . TYR A 113 ? 2.0468 1.9632 1.9984  0.5302  -0.5505 -0.0928 186 TYR A CE1 
865  C CE2 . TYR A 113 ? 1.8404 1.8817 1.8353  0.5462  -0.5070 -0.1024 186 TYR A CE2 
866  C CZ  . TYR A 113 ? 1.8815 1.8739 1.8636  0.5211  -0.5193 -0.0871 186 TYR A CZ  
867  O OH  . TYR A 113 ? 1.4289 1.4478 1.4284  0.4865  -0.5013 -0.0654 186 TYR A OH  
868  N N   . LEU A 114 ? 1.7601 1.6031 1.6406  0.7337  -0.6271 -0.2232 187 LEU A N   
869  C CA  . LEU A 114 ? 1.8409 1.6087 1.6913  0.7639  -0.6605 -0.2379 187 LEU A CA  
870  C C   . LEU A 114 ? 1.8877 1.6499 1.7162  0.7957  -0.6699 -0.2770 187 LEU A C   
871  O O   . LEU A 114 ? 1.9583 1.6437 1.7543  0.8037  -0.6976 -0.2865 187 LEU A O   
872  C CB  . LEU A 114 ? 1.8434 1.6220 1.7032  0.7912  -0.6644 -0.2388 187 LEU A CB  
873  C CG  . LEU A 114 ? 1.9261 1.6322 1.7577  0.8274  -0.6986 -0.2541 187 LEU A CG  
874  C CD1 . LEU A 114 ? 1.9758 1.5859 1.7829  0.8035  -0.7258 -0.2298 187 LEU A CD1 
875  C CD2 . LEU A 114 ? 1.9156 1.6523 1.7628  0.8540  -0.6968 -0.2553 187 LEU A CD2 
876  N N   . ILE A 115 ? 1.8504 1.6940 1.6954  0.8129  -0.6470 -0.3000 188 ILE A N   
877  C CA  . ILE A 115 ? 1.8926 1.7399 1.7179  0.8448  -0.6535 -0.3388 188 ILE A CA  
878  C C   . ILE A 115 ? 2.2128 2.0395 2.0225  0.8179  -0.6539 -0.3387 188 ILE A C   
879  O O   . ILE A 115 ? 2.3246 2.1324 2.1096  0.8395  -0.6652 -0.3687 188 ILE A O   
880  C CB  . ILE A 115 ? 1.8492 1.7958 1.6975  0.8695  -0.6279 -0.3624 188 ILE A CB  
881  C CG1 . ILE A 115 ? 1.7674 1.7895 1.6441  0.8329  -0.5950 -0.3453 188 ILE A CG1 
882  C CG2 . ILE A 115 ? 2.1466 2.1169 2.0110  0.8961  -0.6279 -0.3624 188 ILE A CG2 
883  C CD1 . ILE A 115 ? 1.7229 1.8447 1.6224  0.8520  -0.5695 -0.3655 188 ILE A CD1 
884  N N   . SER A 116 ? 2.1988 2.0290 2.0222  0.7717  -0.6423 -0.3054 189 SER A N   
885  C CA  . SER A 116 ? 2.2511 2.0625 2.0623  0.7417  -0.6429 -0.2999 189 SER A CA  
886  C C   . SER A 116 ? 2.3701 2.0839 2.1556  0.7218  -0.6718 -0.2807 189 SER A C   
887  O O   . SER A 116 ? 2.5322 2.2200 2.3052  0.6944  -0.6766 -0.2730 189 SER A O   
888  C CB  . SER A 116 ? 2.0248 1.9042 1.8681  0.7030  -0.6117 -0.2751 189 SER A CB  
889  O OG  . SER A 116 ? 2.0255 1.9950 1.8913  0.7187  -0.5854 -0.2920 189 SER A OG  
890  N N   . SER A 117 ? 2.3598 2.0202 2.1371  0.7344  -0.6919 -0.2722 190 SER A N   
891  C CA  . SER A 117 ? 2.3844 1.9516 2.1377  0.7152  -0.7206 -0.2515 190 SER A CA  
892  C C   . SER A 117 ? 2.5744 2.0635 2.2876  0.7490  -0.7545 -0.2794 190 SER A C   
893  O O   . SER A 117 ? 2.8129 2.2183 2.5034  0.7404  -0.7826 -0.2650 190 SER A O   
894  C CB  . SER A 117 ? 2.1846 1.7416 1.9546  0.7016  -0.7208 -0.2190 190 SER A CB  
895  O OG  . SER A 117 ? 2.4013 1.8709 2.1486  0.6806  -0.7484 -0.1967 190 SER A OG  
896  N N   . PHE A 118 ? 2.4818 1.9966 2.1854  0.7870  -0.7527 -0.3190 191 PHE A N   
897  C CA  . PHE A 118 ? 2.4605 1.9050 2.1256  0.8233  -0.7833 -0.3500 191 PHE A CA  
898  C C   . PHE A 118 ? 2.3002 1.7060 1.9355  0.8104  -0.7946 -0.3635 191 PHE A C   
899  O O   . PHE A 118 ? 2.5231 1.8671 2.1226  0.8385  -0.8201 -0.3915 191 PHE A O   
900  C CB  . PHE A 118 ? 2.4085 1.9034 2.0791  0.8759  -0.7755 -0.3876 191 PHE A CB  
901  C CG  . PHE A 118 ? 2.4323 1.9466 2.1237  0.8965  -0.7735 -0.3790 191 PHE A CG  
902  C CD1 . PHE A 118 ? 2.5706 2.0328 2.2626  0.8767  -0.7880 -0.3457 191 PHE A CD1 
903  C CD2 . PHE A 118 ? 2.3071 1.8949 2.0173  0.9343  -0.7570 -0.4036 191 PHE A CD2 
904  C CE1 . PHE A 118 ? 2.1907 1.6718 1.9009  0.8945  -0.7864 -0.3373 191 PHE A CE1 
905  C CE2 . PHE A 118 ? 2.1587 1.7663 1.8880  0.9522  -0.7556 -0.3951 191 PHE A CE2 
906  C CZ  . PHE A 118 ? 2.1667 1.7201 1.8955  0.9323  -0.7704 -0.3620 191 PHE A CZ  
907  N N   . THR A 119 ? 2.4326 1.8729 2.0814  0.7690  -0.7766 -0.3443 192 THR A N   
908  C CA  . THR A 119 ? 2.7911 2.2016 2.4146  0.7504  -0.7853 -0.3526 192 THR A CA  
909  C C   . THR A 119 ? 2.8771 2.1952 2.4775  0.7172  -0.8132 -0.3252 192 THR A C   
910  O O   . THR A 119 ? 2.6008 1.9047 2.2167  0.6922  -0.8141 -0.2896 192 THR A O   
911  C CB  . THR A 119 ? 2.8965 2.3913 2.5471  0.7210  -0.7528 -0.3432 192 THR A CB  
912  O OG1 . THR A 119 ? 2.9825 2.5685 2.6604  0.7465  -0.7250 -0.3608 192 THR A OG1 
913  C CG2 . THR A 119 ? 2.8779 2.3554 2.5013  0.7117  -0.7599 -0.3613 192 THR A CG2 
914  N N   . ASP A 120 ? 3.2426 2.4972 2.8041  0.7172  -0.8367 -0.3428 193 ASP A N   
915  C CA  . ASP A 120 ? 3.3663 2.5327 2.9028  0.6834  -0.8646 -0.3181 193 ASP A CA  
916  C C   . ASP A 120 ? 3.1886 2.3883 2.7504  0.6291  -0.8475 -0.2778 193 ASP A C   
917  O O   . ASP A 120 ? 3.2039 2.3535 2.7626  0.5972  -0.8623 -0.2442 193 ASP A O   
918  C CB  . ASP A 120 ? 3.5523 2.6504 3.0416  0.6935  -0.8913 -0.3473 193 ASP A CB  
919  C CG  . ASP A 120 ? 3.6400 2.7957 3.1304  0.6870  -0.8720 -0.3664 193 ASP A CG  
920  O OD1 . ASP A 120 ? 3.7143 2.9644 3.2371  0.6961  -0.8396 -0.3730 193 ASP A OD1 
921  O OD2 . ASP A 120 ? 3.5866 2.6927 3.0444  0.6718  -0.8899 -0.3742 193 ASP A OD2 
922  N N   . GLN A 121 ? 2.7580 2.0422 2.3449  0.6180  -0.8168 -0.2800 194 GLN A N   
923  C CA  . GLN A 121 ? 2.4436 1.7704 2.0592  0.5703  -0.7968 -0.2431 194 GLN A CA  
924  C C   . GLN A 121 ? 2.2982 1.7177 1.9591  0.5744  -0.7615 -0.2335 194 GLN A C   
925  O O   . GLN A 121 ? 2.0765 1.5636 1.7497  0.5965  -0.7404 -0.2582 194 GLN A O   
926  C CB  . GLN A 121 ? 2.4122 1.7558 2.0174  0.5498  -0.7924 -0.2511 194 GLN A CB  
927  C CG  . GLN A 121 ? 2.5849 1.8372 2.1456  0.5377  -0.8270 -0.2560 194 GLN A CG  
928  C CD  . GLN A 121 ? 2.7466 1.9406 2.3052  0.4983  -0.8449 -0.2150 194 GLN A CD  
929  O OE1 . GLN A 121 ? 2.7629 1.9975 2.3557  0.4682  -0.8265 -0.1795 194 GLN A OE1 
930  N NE2 . GLN A 121 ? 2.9036 2.0017 2.4211  0.4981  -0.8812 -0.2199 194 GLN A NE2 
931  N N   . LEU A 122 ? 2.3718 1.7943 2.0565  0.5522  -0.7555 -0.1978 195 LEU A N   
932  C CA  . LEU A 122 ? 2.3085 1.8108 2.0342  0.5546  -0.7241 -0.1867 195 LEU A CA  
933  C C   . LEU A 122 ? 2.1828 1.7654 1.9356  0.5320  -0.6930 -0.1800 195 LEU A C   
934  O O   . LEU A 122 ? 2.2826 1.8563 2.0342  0.4967  -0.6938 -0.1612 195 LEU A O   
935  C CB  . LEU A 122 ? 2.1889 1.6714 1.9306  0.5330  -0.7258 -0.1490 195 LEU A CB  
936  C CG  . LEU A 122 ? 2.1307 1.5288 1.8461  0.5477  -0.7583 -0.1477 195 LEU A CG  
937  C CD1 . LEU A 122 ? 2.4569 1.7750 2.1446  0.5173  -0.7861 -0.1296 195 LEU A CD1 
938  C CD2 . LEU A 122 ? 2.0942 1.5075 1.8331  0.5466  -0.7499 -0.1243 195 LEU A CD2 
939  N N   . PRO A 123 ? 2.1342 1.7957 1.9113  0.5513  -0.6663 -0.1948 196 PRO A N   
940  C CA  . PRO A 123 ? 2.0841 1.8222 1.8850  0.5323  -0.6375 -0.1910 196 PRO A CA  
941  C C   . PRO A 123 ? 2.1492 1.9073 1.9772  0.4876  -0.6223 -0.1495 196 PRO A C   
942  O O   . PRO A 123 ? 2.0818 1.8720 1.9177  0.4638  -0.6101 -0.1425 196 PRO A O   
943  C CB  . PRO A 123 ? 2.0067 1.8190 1.8297  0.5620  -0.6142 -0.2101 196 PRO A CB  
944  C CG  . PRO A 123 ? 1.8193 1.5908 1.6192  0.6045  -0.6351 -0.2379 196 PRO A CG  
945  C CD  . PRO A 123 ? 1.8683 1.5516 1.6497  0.5932  -0.6631 -0.2178 196 PRO A CD  
946  N N   . TRP A 124 ? 2.1060 1.8467 1.9481  0.4756  -0.6229 -0.1217 197 TRP A N   
947  C CA  . TRP A 124 ? 1.8423 1.6079 1.7125  0.4363  -0.6060 -0.0833 197 TRP A CA  
948  C C   . TRP A 124 ? 1.7817 1.4850 1.6377  0.4031  -0.6265 -0.0570 197 TRP A C   
949  O O   . TRP A 124 ? 1.6702 1.3782 1.5465  0.3742  -0.6184 -0.0227 197 TRP A O   
950  C CB  . TRP A 124 ? 1.6387 1.4298 1.5346  0.4396  -0.5914 -0.0668 197 TRP A CB  
951  C CG  . TRP A 124 ? 1.6770 1.4037 1.5562  0.4509  -0.6152 -0.0615 197 TRP A CG  
952  C CD1 . TRP A 124 ? 1.7535 1.4274 1.6275  0.4254  -0.6303 -0.0314 197 TRP A CD1 
953  C CD2 . TRP A 124 ? 1.7123 1.4220 1.5782  0.4903  -0.6270 -0.0861 197 TRP A CD2 
954  N NE1 . TRP A 124 ? 1.7424 1.3657 1.5994  0.4456  -0.6512 -0.0353 197 TRP A NE1 
955  C CE2 . TRP A 124 ? 1.7532 1.3964 1.6053  0.4862  -0.6498 -0.0687 197 TRP A CE2 
956  C CE3 . TRP A 124 ? 1.9971 1.7431 1.8619  0.5288  -0.6206 -0.1206 197 TRP A CE3 
957  C CZ2 . TRP A 124 ? 1.7961 1.4061 1.6333  0.5196  -0.6670 -0.0844 197 TRP A CZ2 
958  C CZ3 . TRP A 124 ? 1.7557 1.4710 1.6069  0.5628  -0.6371 -0.1366 197 TRP A CZ3 
959  C CH2 . TRP A 124 ? 1.7966 1.4433 1.6340  0.5583  -0.6604 -0.1185 197 TRP A CH2 
960  N N   . THR A 125 ? 1.7700 1.4169 1.5915  0.4060  -0.6524 -0.0723 198 THR A N   
961  C CA  . THR A 125 ? 1.8041 1.3936 1.6104  0.3726  -0.6730 -0.0483 198 THR A CA  
962  C C   . THR A 125 ? 1.9813 1.5977 1.7902  0.3472  -0.6653 -0.0444 198 THR A C   
963  O O   . THR A 125 ? 2.0046 1.6234 1.8274  0.3103  -0.6619 -0.0119 198 THR A O   
964  C CB  . THR A 125 ? 2.1809 1.6811 1.9442  0.3882  -0.7102 -0.0647 198 THR A CB  
965  O OG1 . THR A 125 ? 1.9124 1.3845 1.6741  0.4085  -0.7190 -0.0633 198 THR A OG1 
966  C CG2 . THR A 125 ? 2.2341 1.6760 1.9804  0.3509  -0.7324 -0.0394 198 THR A CG2 
967  N N   . SER A 126 ? 2.0971 1.7359 1.8931  0.3665  -0.6624 -0.0767 199 SER A N   
968  C CA  . SER A 126 ? 2.2660 1.9320 2.0617  0.3453  -0.6559 -0.0766 199 SER A CA  
969  C C   . SER A 126 ? 1.9094 1.6676 1.7417  0.3425  -0.6200 -0.0733 199 SER A C   
970  O O   . SER A 126 ? 1.7775 1.5774 1.6317  0.3604  -0.6013 -0.0766 199 SER A O   
971  C CB  . SER A 126 ? 2.6317 2.2659 2.3884  0.3664  -0.6749 -0.1142 199 SER A CB  
972  O OG  . SER A 126 ? 2.9527 2.4967 2.6732  0.3658  -0.7096 -0.1162 199 SER A OG  
973  N N   . CYS A 127 ? 1.9129 1.7019 1.7508  0.3187  -0.6115 -0.0661 200 CYS A N   
974  C CA  . CYS A 127 ? 1.6372 1.5100 1.5072  0.3122  -0.5796 -0.0615 200 CYS A CA  
975  C C   . CYS A 127 ? 1.7764 1.6838 1.6321  0.3289  -0.5747 -0.0947 200 CYS A C   
976  O O   . CYS A 127 ? 1.5695 1.5479 1.4487  0.3266  -0.5490 -0.0949 200 CYS A O   
977  C CB  . CYS A 127 ? 1.5861 1.4760 1.4788  0.2698  -0.5708 -0.0233 200 CYS A CB  
978  S SG  . CYS A 127 ? 1.8612 1.7539 1.7884  0.2489  -0.5591 0.0192  200 CYS A SG  
979  N N   . LYS A 128 ? 2.3431 2.2013 2.1596  0.3446  -0.5989 -0.1223 201 LYS A N   
980  C CA  . LYS A 128 ? 2.3656 2.2514 2.1634  0.3613  -0.5967 -0.1563 201 LYS A CA  
981  C C   . LYS A 128 ? 2.6349 2.5518 2.4327  0.4042  -0.5871 -0.1892 201 LYS A C   
982  O O   . LYS A 128 ? 2.8394 2.7212 2.6062  0.4350  -0.6042 -0.2221 201 LYS A O   
983  C CB  . LYS A 128 ? 2.4581 2.2755 2.2126  0.3592  -0.6272 -0.1718 201 LYS A CB  
984  N N   . ASN A 129 ? 2.4501 2.4344 2.2835  0.4060  -0.5593 -0.1796 202 ASN A N   
985  C CA  . ASN A 129 ? 2.1850 2.2104 2.0242  0.4431  -0.5471 -0.2067 202 ASN A CA  
986  C C   . ASN A 129 ? 1.9669 2.0823 1.8295  0.4387  -0.5176 -0.2101 202 ASN A C   
987  O O   . ASN A 129 ? 2.1699 2.3119 2.0435  0.4080  -0.5077 -0.1916 202 ASN A O   
988  C CB  . ASN A 129 ? 1.9523 1.9683 1.8105  0.4528  -0.5439 -0.1925 202 ASN A CB  
989  C CG  . ASN A 129 ? 1.8347 1.7621 1.6702  0.4556  -0.5734 -0.1865 202 ASN A CG  
990  O OD1 . ASN A 129 ? 1.8353 1.7237 1.6459  0.4880  -0.5914 -0.2132 202 ASN A OD1 
991  N ND2 . ASN A 129 ? 1.7974 1.6932 1.6416  0.4216  -0.5786 -0.1508 202 ASN A ND2 
992  N N   . SER A 130 ? 1.5661 1.7296 1.4368  0.4691  -0.5040 -0.2331 203 SER A N   
993  C CA  . SER A 130 ? 1.6041 1.8541 1.4940  0.4678  -0.4773 -0.2398 203 SER A CA  
994  C C   . SER A 130 ? 1.7231 2.0229 1.6533  0.4495  -0.4523 -0.2106 203 SER A C   
995  O O   . SER A 130 ? 1.5065 1.8768 1.4551  0.4425  -0.4296 -0.2103 203 SER A O   
996  C CB  . SER A 130 ? 1.7181 2.0012 1.5961  0.5094  -0.4747 -0.2803 203 SER A CB  
997  O OG  . SER A 130 ? 1.6567 1.9312 1.5431  0.5350  -0.4762 -0.2849 203 SER A OG  
998  N N   . TRP A 131 ? 1.8415 2.1053 1.7844  0.4412  -0.4562 -0.1862 204 TRP A N   
999  C CA  . TRP A 131 ? 1.8651 2.1685 1.8438  0.4258  -0.4340 -0.1595 204 TRP A CA  
1000 C C   . TRP A 131 ? 1.6062 1.8868 1.5998  0.3876  -0.4327 -0.1204 204 TRP A C   
1001 O O   . TRP A 131 ? 1.4906 1.8113 1.5143  0.3698  -0.4115 -0.0974 204 TRP A O   
1002 C CB  . TRP A 131 ? 1.7591 2.0500 1.7435  0.4500  -0.4361 -0.1638 204 TRP A CB  
1003 C CG  . TRP A 131 ? 1.5852 1.7935 1.5473  0.4580  -0.4638 -0.1625 204 TRP A CG  
1004 C CD1 . TRP A 131 ? 1.4170 1.5775 1.3842  0.4359  -0.4722 -0.1320 204 TRP A CD1 
1005 C CD2 . TRP A 131 ? 1.5371 1.7003 1.4673  0.4902  -0.4872 -0.1930 204 TRP A CD2 
1006 N NE1 . TRP A 131 ? 1.4927 1.5806 1.4327  0.4507  -0.5001 -0.1406 204 TRP A NE1 
1007 C CE2 . TRP A 131 ? 1.6110 1.6970 1.5277  0.4847  -0.5101 -0.1782 204 TRP A CE2 
1008 C CE3 . TRP A 131 ? 1.7526 1.9336 1.6641  0.5238  -0.4910 -0.2316 204 TRP A CE3 
1009 C CZ2 . TRP A 131 ? 1.7405 1.7631 1.6250  0.5113  -0.5376 -0.2002 204 TRP A CZ2 
1010 C CZ3 . TRP A 131 ? 1.9939 2.1131 1.8741  0.5520  -0.5175 -0.2547 204 TRP A CZ3 
1011 C CH2 . TRP A 131 ? 1.9934 2.0323 1.8600  0.5455  -0.5410 -0.2387 204 TRP A CH2 
1012 N N   . ASN A 132 ? 1.6458 1.8641 1.6191  0.3747  -0.4550 -0.1126 205 ASN A N   
1013 C CA  . ASN A 132 ? 1.3592 1.5564 1.3465  0.3388  -0.4553 -0.0752 205 ASN A CA  
1014 C C   . ASN A 132 ? 1.3187 1.5667 1.3227  0.3127  -0.4379 -0.0614 205 ASN A C   
1015 O O   . ASN A 132 ? 1.3260 1.6045 1.3191  0.3182  -0.4351 -0.0817 205 ASN A O   
1016 C CB  . ASN A 132 ? 1.4458 1.5650 1.4047  0.3314  -0.4852 -0.0719 205 ASN A CB  
1017 C CG  . ASN A 132 ? 1.7999 1.8631 1.7480  0.3481  -0.5021 -0.0729 205 ASN A CG  
1018 O OD1 . ASN A 132 ? 1.6432 1.6803 1.5674  0.3790  -0.5167 -0.1021 205 ASN A OD1 
1019 N ND2 . ASN A 132 ? 1.9117 1.9571 1.8774  0.3280  -0.5003 -0.0406 205 ASN A ND2 
1020 N N   . THR A 133 ? 1.2763 1.5345 1.3073  0.2847  -0.4259 -0.0264 206 THR A N   
1021 C CA  . THR A 133 ? 1.3605 1.6613 1.4103  0.2574  -0.4105 -0.0073 206 THR A CA  
1022 C C   . THR A 133 ? 1.2922 1.5524 1.3312  0.2312  -0.4279 0.0109  206 THR A C   
1023 O O   . THR A 133 ? 1.3161 1.5156 1.3297  0.2345  -0.4526 0.0055  206 THR A O   
1024 C CB  . THR A 133 ? 1.3550 1.6933 1.4417  0.2440  -0.3861 0.0195  206 THR A CB  
1025 O OG1 . THR A 133 ? 1.2574 1.5532 1.3499  0.2403  -0.3930 0.0384  206 THR A OG1 
1026 C CG2 . THR A 133 ? 1.3953 1.7877 1.4934  0.2647  -0.3665 0.0014  206 THR A CG2 
1027 N N   . GLY A 134 ? 1.2289 1.5221 1.2877  0.2039  -0.4156 0.0343  207 GLY A N   
1028 C CA  . GLY A 134 ? 1.2944 1.5549 1.3471  0.1767  -0.4307 0.0554  207 GLY A CA  
1029 C C   . GLY A 134 ? 1.4006 1.6294 1.4696  0.1588  -0.4339 0.0882  207 GLY A C   
1030 O O   . GLY A 134 ? 1.6454 1.8427 1.7089  0.1361  -0.4488 0.1071  207 GLY A O   
1031 N N   . ASN A 135 ? 1.2083 1.4481 1.2975  0.1671  -0.4198 0.0961  208 ASN A N   
1032 C CA  . ASN A 135 ? 1.2009 1.4117 1.3043  0.1529  -0.4221 0.1253  208 ASN A CA  
1033 C C   . ASN A 135 ? 1.5434 1.6879 1.6199  0.1643  -0.4475 0.1164  208 ASN A C   
1034 O O   . ASN A 135 ? 1.2617 1.3731 1.3431  0.1496  -0.4555 0.1405  208 ASN A O   
1035 C CB  . ASN A 135 ? 1.2139 1.4618 1.3477  0.1573  -0.3968 0.1365  208 ASN A CB  
1036 C CG  . ASN A 135 ? 1.2507 1.5538 1.4150  0.1390  -0.3730 0.1561  208 ASN A CG  
1037 O OD1 . ASN A 135 ? 1.2395 1.5416 1.4193  0.1140  -0.3718 0.1850  208 ASN A OD1 
1038 N ND2 . ASN A 135 ? 1.4247 1.7769 1.5982  0.1515  -0.3541 0.1411  208 ASN A ND2 
1039 N N   . CYS A 136 ? 1.6871 1.8131 1.7353  0.1908  -0.4602 0.0822  209 CYS A N   
1040 C CA  . CYS A 136 ? 1.8955 1.9583 1.9175  0.2064  -0.4841 0.0708  209 CYS A CA  
1041 C C   . CYS A 136 ? 2.1094 2.1136 2.1125  0.1840  -0.5100 0.0868  209 CYS A C   
1042 O O   . CYS A 136 ? 2.2155 2.2099 2.2010  0.1744  -0.5219 0.0799  209 CYS A O   
1043 C CB  . CYS A 136 ? 1.9639 2.0205 1.9585  0.2404  -0.4930 0.0294  209 CYS A CB  
1044 S SG  . CYS A 136 ? 2.1086 2.0975 2.0765  0.2684  -0.5172 0.0126  209 CYS A SG  
1045 N N   . THR A 137 ? 1.8193 1.7858 1.8259  0.1745  -0.5187 0.1087  210 THR A N   
1046 C CA  . THR A 137 ? 1.8207 1.7289 1.8093  0.1523  -0.5445 0.1260  210 THR A CA  
1047 C C   . THR A 137 ? 1.9424 1.7892 1.9102  0.1659  -0.5652 0.1216  210 THR A C   
1048 O O   . THR A 137 ? 1.8215 1.6739 1.8064  0.1694  -0.5554 0.1348  210 THR A O   
1049 C CB  . THR A 137 ? 1.6749 1.6019 1.6927  0.1168  -0.5345 0.1676  210 THR A CB  
1050 O OG1 . THR A 137 ? 1.5745 1.5163 1.6171  0.1183  -0.5187 0.1852  210 THR A OG1 
1051 C CG2 . THR A 137 ? 1.4064 1.3940 1.4465  0.1033  -0.5142 0.1742  210 THR A CG2 
1052 N N   . ASN A 138 ? 2.2066 1.9925 2.1367  0.1723  -0.5947 0.1045  211 ASN A N   
1053 C CA  . ASN A 138 ? 2.1795 1.9019 2.0865  0.1862  -0.6173 0.0992  211 ASN A CA  
1054 C C   . ASN A 138 ? 2.2872 1.9490 2.1770  0.1567  -0.6438 0.1231  211 ASN A C   
1055 O O   . ASN A 138 ? 2.3192 1.9923 2.2175  0.1259  -0.6434 0.1445  211 ASN A O   
1056 C CB  . ASN A 138 ? 2.3385 2.0342 2.2133  0.2230  -0.6314 0.0567  211 ASN A CB  
1057 C CG  . ASN A 138 ? 2.7367 2.3998 2.5792  0.2182  -0.6522 0.0395  211 ASN A CG  
1058 O OD1 . ASN A 138 ? 2.9581 2.6463 2.8086  0.1929  -0.6465 0.0519  211 ASN A OD1 
1059 N ND2 . ASN A 138 ? 2.6564 2.2626 2.4616  0.2428  -0.6769 0.0107  211 ASN A ND2 
1060 N N   . TYR A 139 ? 2.6496 2.2466 2.5149  0.1659  -0.6679 0.1202  212 TYR A N   
1061 C CA  . TYR A 139 ? 2.7736 2.3053 2.6170  0.1396  -0.6970 0.1402  212 TYR A CA  
1062 C C   . TYR A 139 ? 3.0211 2.4912 2.8191  0.1518  -0.7273 0.1108  212 TYR A C   
1063 O O   . TYR A 139 ? 3.1115 2.5943 2.8971  0.1805  -0.7239 0.0755  212 TYR A O   
1064 C CB  . TYR A 139 ? 2.8031 2.3016 2.6489  0.1369  -0.7048 0.1609  212 TYR A CB  
1065 C CG  . TYR A 139 ? 2.8129 2.3613 2.6992  0.1121  -0.6805 0.1980  212 TYR A CG  
1066 C CD1 . TYR A 139 ? 2.8683 2.4815 2.7874  0.1263  -0.6482 0.1967  212 TYR A CD1 
1067 C CD2 . TYR A 139 ? 2.7919 2.3238 2.6832  0.0742  -0.6898 0.2339  212 TYR A CD2 
1068 C CE1 . TYR A 139 ? 2.8603 2.5173 2.8150  0.1050  -0.6259 0.2289  212 TYR A CE1 
1069 C CE2 . TYR A 139 ? 2.7945 2.3737 2.7229  0.0534  -0.6670 0.2668  212 TYR A CE2 
1070 C CZ  . TYR A 139 ? 2.8181 2.4584 2.7776  0.0695  -0.6349 0.2635  212 TYR A CZ  
1071 O OH  . TYR A 139 ? 2.7841 2.4694 2.7791  0.0501  -0.6121 0.2947  212 TYR A OH  
1072 N N   . PHE A 140 ? 3.1559 2.5589 2.9283  0.1292  -0.7573 0.1256  213 PHE A N   
1073 C CA  . PHE A 140 ? 3.1763 2.5225 2.9068  0.1280  -0.7862 0.1052  213 PHE A CA  
1074 C C   . PHE A 140 ? 2.9649 2.3584 2.7028  0.1147  -0.7738 0.1001  213 PHE A C   
1075 O O   . PHE A 140 ? 3.0476 2.4181 2.7549  0.1253  -0.7875 0.0714  213 PHE A O   
1076 C CB  . PHE A 140 ? 3.1614 2.4625 2.8579  0.1706  -0.8022 0.0635  213 PHE A CB  
1077 C CG  . PHE A 140 ? 3.0551 2.2761 2.7027  0.1684  -0.8386 0.0463  213 PHE A CG  
1078 C CD1 . PHE A 140 ? 3.0758 2.2222 2.7004  0.1455  -0.8691 0.0672  213 PHE A CD1 
1079 C CD2 . PHE A 140 ? 2.9269 2.1465 2.5500  0.1890  -0.8426 0.0088  213 PHE A CD2 
1080 C CE1 . PHE A 140 ? 3.0742 2.1433 2.6520  0.1426  -0.9036 0.0513  213 PHE A CE1 
1081 C CE2 . PHE A 140 ? 2.8686 2.0119 2.4447  0.1873  -0.8763 -0.0084 213 PHE A CE2 
1082 C CZ  . PHE A 140 ? 2.9944 2.0606 2.5474  0.1640  -0.9073 0.0128  213 PHE A CZ  
1083 N N   . SER A 141 ? 2.8569 2.3164 2.6350  0.0919  -0.7478 0.1281  214 SER A N   
1084 C CA  . SER A 141 ? 2.8666 2.3796 2.6592  0.0757  -0.7327 0.1307  214 SER A CA  
1085 C C   . SER A 141 ? 3.2616 2.7721 3.0657  0.0304  -0.7397 0.1709  214 SER A C   
1086 O O   . SER A 141 ? 3.4467 2.9087 3.2419  0.0123  -0.7591 0.1929  214 SER A O   
1087 C CB  . SER A 141 ? 2.3436 1.9410 2.1754  0.0904  -0.6947 0.1281  214 SER A CB  
1088 O OG  . SER A 141 ? 2.0038 1.6529 1.8502  0.0738  -0.6806 0.1326  214 SER A OG  
1089 N N   . GLU A 142 ? 3.5417 3.1052 3.3651  0.0119  -0.7248 0.1807  215 GLU A N   
1090 C CA  . GLU A 142 ? 3.7544 3.3276 3.5941  -0.0302 -0.7282 0.2197  215 GLU A CA  
1091 C C   . GLU A 142 ? 3.6991 3.2860 3.5706  -0.0436 -0.7169 0.2551  215 GLU A C   
1092 O O   . GLU A 142 ? 3.5347 3.1571 3.4309  -0.0239 -0.6932 0.2535  215 GLU A O   
1093 C CB  . GLU A 142 ? 3.8044 3.4464 3.6685  -0.0422 -0.7071 0.2251  215 GLU A CB  
1094 C CG  . GLU A 142 ? 3.8141 3.5286 3.7153  -0.0220 -0.6704 0.2211  215 GLU A CG  
1095 C CD  . GLU A 142 ? 3.8379 3.6178 3.7631  -0.0356 -0.6509 0.2292  215 GLU A CD  
1096 O OE1 . GLU A 142 ? 3.8959 3.6680 3.8111  -0.0618 -0.6652 0.2400  215 GLU A OE1 
1097 O OE2 . GLU A 142 ? 3.7915 3.6301 3.7448  -0.0210 -0.6220 0.2254  215 GLU A OE2 
1098 N N   . ASP A 143 ? 3.8286 3.3869 3.6980  -0.0777 -0.7345 0.2867  216 ASP A N   
1099 C CA  . ASP A 143 ? 3.7636 3.3373 3.6626  -0.0944 -0.7245 0.3228  216 ASP A CA  
1100 C C   . ASP A 143 ? 3.6537 3.3071 3.5994  -0.1108 -0.6942 0.3486  216 ASP A C   
1101 O O   . ASP A 143 ? 3.7526 3.4482 3.7076  -0.1074 -0.6808 0.3378  216 ASP A O   
1102 C CB  . ASP A 143 ? 3.7404 3.2537 3.6178  -0.1249 -0.7559 0.3466  216 ASP A CB  
1103 C CG  . ASP A 143 ? 3.6669 3.1797 3.5640  -0.1345 -0.7507 0.3764  216 ASP A CG  
1104 O OD1 . ASP A 143 ? 3.5843 3.1360 3.5073  -0.1141 -0.7246 0.3745  216 ASP A OD1 
1105 O OD2 . ASP A 143 ? 3.6796 3.1533 3.5650  -0.1633 -0.7731 0.4016  216 ASP A OD2 
1106 N N   . ASN A 144 ? 3.3318 3.0068 3.3072  -0.1281 -0.6829 0.3830  217 ASN A N   
1107 C CA  . ASN A 144 ? 3.0729 2.8184 3.0939  -0.1447 -0.6555 0.4120  217 ASN A CA  
1108 C C   . ASN A 144 ? 2.7159 2.5204 2.7648  -0.1179 -0.6212 0.3974  217 ASN A C   
1109 O O   . ASN A 144 ? 2.7186 2.5811 2.8064  -0.1274 -0.5961 0.4198  217 ASN A O   
1110 C CB  . ASN A 144 ? 3.1130 2.8762 3.1373  -0.1735 -0.6631 0.4267  217 ASN A CB  
1111 C CG  . ASN A 144 ? 3.4609 3.2877 3.5086  -0.1647 -0.6381 0.4178  217 ASN A CG  
1112 O OD1 . ASN A 144 ? 3.4639 3.2895 3.4940  -0.1414 -0.6366 0.3841  217 ASN A OD1 
1113 N ND2 . ASN A 144 ? 3.8737 3.7569 3.9612  -0.1834 -0.6186 0.4486  217 ASN A ND2 
1114 N N   . ILE A 145 ? 2.3544 2.1446 2.3838  -0.0843 -0.6201 0.3606  218 ILE A N   
1115 C CA  . ILE A 145 ? 2.0931 1.9388 2.1451  -0.0599 -0.5897 0.3441  218 ILE A CA  
1116 C C   . ILE A 145 ? 1.8336 1.7207 1.9240  -0.0612 -0.5630 0.3678  218 ILE A C   
1117 O O   . ILE A 145 ? 1.8450 1.7077 1.9362  -0.0671 -0.5686 0.3843  218 ILE A O   
1118 C CB  . ILE A 145 ? 2.1267 1.9473 2.1514  -0.0235 -0.5947 0.3031  218 ILE A CB  
1119 C CG1 . ILE A 145 ? 2.0411 1.8148 2.0518  -0.0115 -0.6063 0.3019  218 ILE A CG1 
1120 C CG2 . ILE A 145 ? 2.3663 2.1537 2.3545  -0.0201 -0.6174 0.2772  218 ILE A CG2 
1121 C CD1 . ILE A 145 ? 1.9689 1.7261 1.9597  0.0269  -0.6074 0.2644  218 ILE A CD1 
1122 N N   . THR A 146 ? 1.6142 1.5622 1.7343  -0.0577 -0.5357 0.3698  219 THR A N   
1123 C CA  . THR A 146 ? 1.2873 1.2782 1.4445  -0.0580 -0.5081 0.3902  219 THR A CA  
1124 C C   . THR A 146 ? 1.5133 1.5418 1.6815  -0.0296 -0.4835 0.3666  219 THR A C   
1125 O O   . THR A 146 ? 1.2344 1.2897 1.4023  -0.0219 -0.4765 0.3495  219 THR A O   
1126 C CB  . THR A 146 ? 1.5383 1.5722 1.7284  -0.0852 -0.4955 0.4238  219 THR A CB  
1127 O OG1 . THR A 146 ? 1.5558 1.6274 1.7538  -0.0838 -0.4857 0.4143  219 THR A OG1 
1128 C CG2 . THR A 146 ? 1.2928 1.2928 1.4718  -0.1150 -0.5210 0.4475  219 THR A CG2 
1129 N N   . TRP A 147 ? 1.4485 1.4817 1.6278  -0.0167 -0.4700 0.3684  220 TRP A N   
1130 C CA  . TRP A 147 ? 1.4337 1.4980 1.6206  0.0103  -0.4489 0.3453  220 TRP A CA  
1131 C C   . TRP A 147 ? 1.4507 1.5782 1.6739  0.0048  -0.4189 0.3580  220 TRP A C   
1132 O O   . TRP A 147 ? 1.4049 1.5527 1.6539  -0.0149 -0.4085 0.3884  220 TRP A O   
1133 C CB  . TRP A 147 ? 1.3936 1.4405 1.5783  0.0252  -0.4458 0.3427  220 TRP A CB  
1134 C CG  . TRP A 147 ? 1.4792 1.5343 1.6545  0.0566  -0.4383 0.3100  220 TRP A CG  
1135 C CD1 . TRP A 147 ? 1.7511 1.8528 1.9481  0.0700  -0.4112 0.3038  220 TRP A CD1 
1136 C CD2 . TRP A 147 ? 1.6631 1.6798 1.8049  0.0787  -0.4585 0.2791  220 TRP A CD2 
1137 N NE1 . TRP A 147 ? 1.8646 1.9623 2.0446  0.0981  -0.4131 0.2718  220 TRP A NE1 
1138 C CE2 . TRP A 147 ? 1.8589 1.9054 2.0056  0.1052  -0.4416 0.2558  220 TRP A CE2 
1139 C CE3 . TRP A 147 ? 1.8134 1.7723 1.9209  0.0790  -0.4897 0.2687  220 TRP A CE3 
1140 C CZ2 . TRP A 147 ? 1.7937 1.8182 1.9142  0.1329  -0.4541 0.2228  220 TRP A CZ2 
1141 C CZ3 . TRP A 147 ? 1.9215 1.8547 2.0018  0.1075  -0.5022 0.2350  220 TRP A CZ3 
1142 C CH2 . TRP A 147 ? 1.9085 1.8763 1.9964  0.1347  -0.4842 0.2125  220 TRP A CH2 
1143 N N   . THR A 148 ? 1.3181 1.4767 1.5428  0.0228  -0.4053 0.3346  221 THR A N   
1144 C CA  . THR A 148 ? 1.2058 1.4217 1.4608  0.0195  -0.3786 0.3426  221 THR A CA  
1145 C C   . THR A 148 ? 1.1096 1.3505 1.3750  0.0411  -0.3569 0.3287  221 THR A C   
1146 O O   . THR A 148 ? 1.1274 1.3454 1.3739  0.0611  -0.3639 0.3075  221 THR A O   
1147 C CB  . THR A 148 ? 1.2494 1.4846 1.4971  0.0177  -0.3816 0.3292  221 THR A CB  
1148 O OG1 . THR A 148 ? 1.3951 1.5947 1.6222  0.0019  -0.4077 0.3339  221 THR A OG1 
1149 C CG2 . THR A 148 ? 1.0139 1.3021 1.2942  0.0052  -0.3591 0.3479  221 THR A CG2 
1150 N N   . LEU A 149 ? 0.9779 1.2653 1.2736  0.0366  -0.3310 0.3417  222 LEU A N   
1151 C CA  . LEU A 149 ? 1.0626 1.3764 1.3697  0.0539  -0.3092 0.3308  222 LEU A CA  
1152 C C   . LEU A 149 ? 1.2690 1.5900 1.5572  0.0768  -0.3108 0.2960  222 LEU A C   
1153 O O   . LEU A 149 ? 1.3553 1.6837 1.6429  0.0946  -0.3012 0.2817  222 LEU A O   
1154 C CB  . LEU A 149 ? 1.0121 1.3728 1.3525  0.0441  -0.2830 0.3494  222 LEU A CB  
1155 C CG  . LEU A 149 ? 1.0285 1.3912 1.3924  0.0301  -0.2726 0.3802  222 LEU A CG  
1156 C CD1 . LEU A 149 ? 1.1880 1.5952 1.5833  0.0213  -0.2489 0.3970  222 LEU A CD1 
1157 C CD2 . LEU A 149 ? 1.1501 1.4995 1.5109  0.0429  -0.2666 0.3751  222 LEU A CD2 
1158 N N   . HIS A 150 ? 1.1541 1.4756 1.4269  0.0765  -0.3225 0.2820  223 HIS A N   
1159 C CA  . HIS A 150 ? 1.0643 1.3980 1.3198  0.0981  -0.3232 0.2487  223 HIS A CA  
1160 C C   . HIS A 150 ? 1.3536 1.6409 1.5745  0.1124  -0.3494 0.2258  223 HIS A C   
1161 O O   . HIS A 150 ? 1.5598 1.8541 1.7649  0.1343  -0.3510 0.1962  223 HIS A O   
1162 C CB  . HIS A 150 ? 1.2749 1.6460 1.5353  0.0904  -0.3166 0.2453  223 HIS A CB  
1163 C CG  . HIS A 150 ? 1.4686 1.8858 1.7614  0.0790  -0.2911 0.2648  223 HIS A CG  
1164 N ND1 . HIS A 150 ? 1.6164 2.0610 1.9244  0.0895  -0.2699 0.2614  223 HIS A ND1 
1165 C CD2 . HIS A 150 ? 1.3524 1.7918 1.6646  0.0581  -0.2842 0.2880  223 HIS A CD2 
1166 C CE1 . HIS A 150 ? 1.4485 1.9276 1.7829  0.0759  -0.2512 0.2810  223 HIS A CE1 
1167 N NE2 . HIS A 150 ? 1.3320 1.8091 1.6701  0.0574  -0.2593 0.2976  223 HIS A NE2 
1168 N N   . SER A 151 ? 1.0687 1.3091 1.2775  0.1009  -0.3699 0.2389  224 SER A N   
1169 C CA  . SER A 151 ? 1.1254 1.3147 1.2995  0.1128  -0.3972 0.2188  224 SER A CA  
1170 C C   . SER A 151 ? 1.5096 1.6807 1.6734  0.1378  -0.3992 0.2016  224 SER A C   
1171 O O   . SER A 151 ? 1.4278 1.6090 1.6094  0.1384  -0.3854 0.2145  224 SER A O   
1172 C CB  . SER A 151 ? 1.1646 1.3080 1.3295  0.0907  -0.4187 0.2409  224 SER A CB  
1173 O OG  . SER A 151 ? 1.5089 1.6650 1.6774  0.0696  -0.4219 0.2522  224 SER A OG  
1174 N N   . THR A 152 ? 1.3430 1.4885 1.4775  0.1596  -0.4162 0.1713  225 THR A N   
1175 C CA  . THR A 152 ? 1.3278 1.4528 1.4493  0.1858  -0.4220 0.1525  225 THR A CA  
1176 C C   . THR A 152 ? 1.3971 1.4578 1.4829  0.1946  -0.4539 0.1383  225 THR A C   
1177 O O   . THR A 152 ? 1.4306 1.4702 1.4993  0.1849  -0.4696 0.1349  225 THR A O   
1178 C CB  . THR A 152 ? 1.6139 1.7839 1.7382  0.2111  -0.4064 0.1243  225 THR A CB  
1179 O OG1 . THR A 152 ? 1.7628 1.9461 1.8731  0.2153  -0.4111 0.1041  225 THR A OG1 
1180 C CG2 . THR A 152 ? 1.6568 1.8839 1.8148  0.2033  -0.3759 0.1388  225 THR A CG2 
1181 N N   . SER A 153 ? 1.4230 1.4502 1.4964  0.2132  -0.4645 0.1300  226 SER A N   
1182 C CA  . SER A 153 ? 1.4452 1.4060 1.4844  0.2247  -0.4954 0.1167  226 SER A CA  
1183 C C   . SER A 153 ? 1.4238 1.3846 1.4424  0.2604  -0.5016 0.0771  226 SER A C   
1184 O O   . SER A 153 ? 1.6238 1.6332 1.6568  0.2785  -0.4818 0.0631  226 SER A O   
1185 C CB  . SER A 153 ? 1.3801 1.3019 1.4182  0.2219  -0.5047 0.1348  226 SER A CB  
1186 O OG  . SER A 153 ? 1.6540 1.6046 1.7060  0.2412  -0.4884 0.1283  226 SER A OG  
1187 N N   . PRO A 154 ? 1.4914 1.3994 1.4760  0.2708  -0.5289 0.0584  227 PRO A N   
1188 C CA  . PRO A 154 ? 1.6358 1.5436 1.5997  0.3070  -0.5354 0.0190  227 PRO A CA  
1189 C C   . PRO A 154 ? 1.7282 1.6420 1.6969  0.3348  -0.5308 0.0082  227 PRO A C   
1190 O O   . PRO A 154 ? 1.4669 1.4123 1.4334  0.3635  -0.5236 -0.0206 227 PRO A O   
1191 C CB  . PRO A 154 ? 1.6933 1.5279 1.6185  0.3097  -0.5691 0.0072  227 PRO A CB  
1192 C CG  . PRO A 154 ? 1.8210 1.6117 1.7470  0.2778  -0.5820 0.0423  227 PRO A CG  
1193 C CD  . PRO A 154 ? 1.7687 1.6154 1.7314  0.2499  -0.5553 0.0716  227 PRO A CD  
1194 N N   . ALA A 155 ? 1.6542 1.5406 1.6291  0.3267  -0.5352 0.0308  228 ALA A N   
1195 C CA  . ALA A 155 ? 1.6362 1.5320 1.6176  0.3506  -0.5298 0.0235  228 ALA A CA  
1196 C C   . ALA A 155 ? 1.6848 1.6574 1.6996  0.3499  -0.4963 0.0271  228 ALA A C   
1197 O O   . ALA A 155 ? 1.9252 1.9320 1.9436  0.3767  -0.4869 0.0046  228 ALA A O   
1198 C CB  . ALA A 155 ? 1.6865 1.5322 1.6642  0.3391  -0.5439 0.0485  228 ALA A CB  
1199 N N   . GLU A 156 ? 1.6325 1.6326 1.6718  0.3194  -0.4784 0.0557  229 GLU A N   
1200 C CA  . GLU A 156 ? 1.5672 1.6370 1.6372  0.3158  -0.4469 0.0604  229 GLU A CA  
1201 C C   . GLU A 156 ? 1.2701 1.3872 1.3402  0.3298  -0.4362 0.0340  229 GLU A C   
1202 O O   . GLU A 156 ? 1.2352 1.4039 1.3202  0.3433  -0.4170 0.0226  229 GLU A O   
1203 C CB  . GLU A 156 ? 1.7516 1.8364 1.8450  0.2807  -0.4325 0.0950  229 GLU A CB  
1204 C CG  . GLU A 156 ? 1.7443 1.8966 1.8686  0.2736  -0.4006 0.1020  229 GLU A CG  
1205 C CD  . GLU A 156 ? 1.7603 1.9252 1.9059  0.2407  -0.3884 0.1339  229 GLU A CD  
1206 O OE1 . GLU A 156 ? 1.6490 1.7736 1.7858  0.2230  -0.4047 0.1504  229 GLU A OE1 
1207 O OE2 . GLU A 156 ? 1.7935 2.0083 1.9644  0.2326  -0.3630 0.1427  229 GLU A OE2 
1208 N N   . GLU A 157 ? 1.2936 1.3948 1.3466  0.3255  -0.4486 0.0243  230 GLU A N   
1209 C CA  . GLU A 157 ? 1.5190 1.6635 1.5688  0.3387  -0.4401 -0.0017 230 GLU A CA  
1210 C C   . GLU A 157 ? 1.4445 1.5911 1.4784  0.3771  -0.4471 -0.0361 230 GLU A C   
1211 O O   . GLU A 157 ? 1.4530 1.6562 1.4960  0.3918  -0.4304 -0.0545 230 GLU A O   
1212 C CB  . GLU A 157 ? 1.7292 1.8497 1.7603  0.3254  -0.4547 -0.0045 230 GLU A CB  
1213 C CG  . GLU A 157 ? 1.4120 1.5474 1.4618  0.2887  -0.4445 0.0264  230 GLU A CG  
1214 C CD  . GLU A 157 ? 1.3971 1.6011 1.4659  0.2821  -0.4204 0.0236  230 GLU A CD  
1215 O OE1 . GLU A 157 ? 1.5120 1.7387 1.5676  0.2998  -0.4205 -0.0047 230 GLU A OE1 
1216 O OE2 . GLU A 157 ? 1.3563 1.5914 1.4526  0.2595  -0.4017 0.0498  230 GLU A OE2 
1217 N N   . PHE A 158 ? 1.7249 1.8109 1.7352  0.3936  -0.4719 -0.0446 231 PHE A N   
1218 C CA  . PHE A 158 ? 1.8186 1.9016 1.8127  0.4325  -0.4811 -0.0775 231 PHE A CA  
1219 C C   . PHE A 158 ? 1.6123 1.7386 1.6279  0.4469  -0.4635 -0.0780 231 PHE A C   
1220 O O   . PHE A 158 ? 1.3562 1.5248 1.3732  0.4730  -0.4554 -0.1038 231 PHE A O   
1221 C CB  . PHE A 158 ? 2.0633 2.0649 2.0266  0.4450  -0.5136 -0.0834 231 PHE A CB  
1222 C CG  . PHE A 158 ? 2.1040 2.0959 2.0487  0.4872  -0.5259 -0.1178 231 PHE A CG  
1223 C CD1 . PHE A 158 ? 2.2001 2.2079 2.1284  0.5087  -0.5289 -0.1507 231 PHE A CD1 
1224 C CD2 . PHE A 158 ? 1.8486 1.8168 1.7923  0.5057  -0.5347 -0.1170 231 PHE A CD2 
1225 C CE1 . PHE A 158 ? 2.2074 2.2083 2.1195  0.5496  -0.5398 -0.1829 231 PHE A CE1 
1226 C CE2 . PHE A 158 ? 2.0073 1.9676 1.9351  0.5461  -0.5465 -0.1482 231 PHE A CE2 
1227 C CZ  . PHE A 158 ? 2.0770 2.0539 1.9894  0.5687  -0.5488 -0.1815 231 PHE A CZ  
1228 N N   . TYR A 159 ? 1.6338 1.7531 1.6663  0.4293  -0.4569 -0.0495 232 TYR A N   
1229 C CA  . TYR A 159 ? 1.4773 1.6376 1.5299  0.4397  -0.4397 -0.0482 232 TYR A CA  
1230 C C   . TYR A 159 ? 1.4705 1.7076 1.5484  0.4305  -0.4099 -0.0481 232 TYR A C   
1231 O O   . TYR A 159 ? 1.5660 1.8509 1.6518  0.4505  -0.3980 -0.0663 232 TYR A O   
1232 C CB  . TYR A 159 ? 1.4387 1.5699 1.5007  0.4218  -0.4407 -0.0176 232 TYR A CB  
1233 C CG  . TYR A 159 ? 1.5421 1.7096 1.6220  0.4316  -0.4251 -0.0155 232 TYR A CG  
1234 C CD1 . TYR A 159 ? 1.6346 1.8310 1.7118  0.4638  -0.4241 -0.0427 232 TYR A CD1 
1235 C CD2 . TYR A 159 ? 1.5321 1.7062 1.6311  0.4088  -0.4115 0.0134  232 TYR A CD2 
1236 C CE1 . TYR A 159 ? 1.4939 1.7246 1.5870  0.4715  -0.4107 -0.0404 232 TYR A CE1 
1237 C CE2 . TYR A 159 ? 1.4455 1.6516 1.5587  0.4167  -0.3978 0.0148  232 TYR A CE2 
1238 C CZ  . TYR A 159 ? 1.4716 1.7057 1.5818  0.4474  -0.3978 -0.0118 232 TYR A CZ  
1239 O OH  . TYR A 159 ? 1.6637 1.9307 1.7877  0.4541  -0.3850 -0.0101 232 TYR A OH  
1240 N N   . THR A 160 ? 1.2083 1.4580 1.2992  0.3997  -0.3983 -0.0270 233 THR A N   
1241 C CA  . THR A 160 ? 1.2973 1.6144 1.4135  0.3866  -0.3701 -0.0213 233 THR A CA  
1242 C C   . THR A 160 ? 1.4837 1.8460 1.5946  0.4022  -0.3645 -0.0495 233 THR A C   
1243 O O   . THR A 160 ? 1.5295 1.9495 1.6548  0.4104  -0.3460 -0.0590 233 THR A O   
1244 C CB  . THR A 160 ? 1.4219 1.7357 1.5520  0.3511  -0.3618 0.0089  233 THR A CB  
1245 O OG1 . THR A 160 ? 1.3815 1.6638 1.5196  0.3369  -0.3632 0.0354  233 THR A OG1 
1246 C CG2 . THR A 160 ? 1.5844 1.9637 1.7387  0.3374  -0.3345 0.0148  233 THR A CG2 
1247 N N   . ARG A 161 ? 1.5513 1.8894 1.6407  0.4057  -0.3802 -0.0633 234 ARG A N   
1248 C CA  . ARG A 161 ? 1.4180 1.8018 1.5030  0.4140  -0.3729 -0.0862 234 ARG A CA  
1249 C C   . ARG A 161 ? 1.2293 1.6114 1.2921  0.4512  -0.3861 -0.1232 234 ARG A C   
1250 O O   . ARG A 161 ? 1.2246 1.6539 1.2851  0.4611  -0.3776 -0.1443 234 ARG A O   
1251 C CB  . ARG A 161 ? 1.3121 1.6800 1.3887  0.3910  -0.3788 -0.0776 234 ARG A CB  
1252 C CG  . ARG A 161 ? 1.2416 1.6194 1.3417  0.3551  -0.3645 -0.0423 234 ARG A CG  
1253 C CD  . ARG A 161 ? 1.3921 1.7626 1.4847  0.3340  -0.3698 -0.0355 234 ARG A CD  
1254 N NE  . ARG A 161 ? 1.1591 1.5787 1.2470  0.3412  -0.3615 -0.0575 234 ARG A NE  
1255 C CZ  . ARG A 161 ? 1.1123 1.5923 1.2213  0.3276  -0.3387 -0.0497 234 ARG A CZ  
1256 N NH1 . ARG A 161 ? 1.4064 1.9299 1.5085  0.3341  -0.3329 -0.0701 234 ARG A NH1 
1257 N NH2 . ARG A 161 ? 1.0670 1.5635 1.2031  0.3074  -0.3219 -0.0217 234 ARG A NH2 
1258 N N   . HIS A 162 ? 1.2726 1.6028 1.3187  0.4724  -0.4065 -0.1317 235 HIS A N   
1259 C CA  . HIS A 162 ? 1.7867 2.1105 1.8107  0.5102  -0.4207 -0.1674 235 HIS A CA  
1260 C C   . HIS A 162 ? 1.5943 1.9419 1.6280  0.5366  -0.4160 -0.1776 235 HIS A C   
1261 O O   . HIS A 162 ? 1.6498 2.0584 1.6911  0.5546  -0.4026 -0.1979 235 HIS A O   
1262 C CB  . HIS A 162 ? 1.6150 1.8569 1.6075  0.5180  -0.4514 -0.1739 235 HIS A CB  
1263 C CG  . HIS A 162 ? 1.4894 1.7206 1.4567  0.5570  -0.4668 -0.2121 235 HIS A CG  
1264 N ND1 . HIS A 162 ? 1.5262 1.7975 1.4848  0.5686  -0.4610 -0.2384 235 HIS A ND1 
1265 C CD2 . HIS A 162 ? 1.5929 1.7792 1.5420  0.5881  -0.4875 -0.2287 235 HIS A CD2 
1266 C CE1 . HIS A 162 ? 1.7836 2.0354 1.7195  0.6060  -0.4770 -0.2705 235 HIS A CE1 
1267 N NE2 . HIS A 162 ? 1.8407 2.0399 1.7707  0.6191  -0.4936 -0.2652 235 HIS A NE2 
1268 N N   . VAL A 163 ? 1.5963 1.8991 1.6296  0.5389  -0.4272 -0.1636 236 VAL A N   
1269 C CA  . VAL A 163 ? 1.3207 1.6414 1.3607  0.5653  -0.4259 -0.1736 236 VAL A CA  
1270 C C   . VAL A 163 ? 1.2547 1.6423 1.3257  0.5510  -0.3978 -0.1593 236 VAL A C   
1271 O O   . VAL A 163 ? 1.8477 2.2938 1.9284  0.5695  -0.3856 -0.1770 236 VAL A O   
1272 C CB  . VAL A 163 ? 1.3608 1.6091 1.3875  0.5725  -0.4490 -0.1634 236 VAL A CB  
1273 C CG1 . VAL A 163 ? 1.3359 1.5568 1.3743  0.5366  -0.4453 -0.1257 236 VAL A CG1 
1274 C CG2 . VAL A 163 ? 1.8333 2.1009 1.8655  0.6023  -0.4495 -0.1756 236 VAL A CG2 
1275 N N   . LEU A 164 ? 1.2195 1.6003 1.3063  0.5178  -0.3873 -0.1273 237 LEU A N   
1276 C CA  . LEU A 164 ? 1.1602 1.5991 1.2746  0.5027  -0.3611 -0.1132 237 LEU A CA  
1277 C C   . LEU A 164 ? 1.2433 1.7451 1.3691  0.4921  -0.3410 -0.1198 237 LEU A C   
1278 O O   . LEU A 164 ? 1.0915 1.6550 1.2332  0.4960  -0.3227 -0.1260 237 LEU A O   
1279 C CB  . LEU A 164 ? 1.1366 1.5478 1.2634  0.4720  -0.3559 -0.0782 237 LEU A CB  
1280 C CG  . LEU A 164 ? 1.1548 1.6157 1.3081  0.4564  -0.3304 -0.0622 237 LEU A CG  
1281 C CD1 . LEU A 164 ? 1.0789 1.5665 1.2356  0.4812  -0.3286 -0.0764 237 LEU A CD1 
1282 C CD2 . LEU A 164 ? 1.1665 1.5939 1.3288  0.4285  -0.3274 -0.0292 237 LEU A CD2 
1283 N N   . GLN A 165 ? 1.1500 1.6369 1.2669  0.4775  -0.3451 -0.1178 238 GLN A N   
1284 C CA  . GLN A 165 ? 1.2267 1.7686 1.3516  0.4654  -0.3283 -0.1226 238 GLN A CA  
1285 C C   . GLN A 165 ? 1.3678 1.9548 1.5208  0.4394  -0.3028 -0.0994 238 GLN A C   
1286 O O   . GLN A 165 ? 1.2494 1.8993 1.4142  0.4380  -0.2851 -0.1069 238 GLN A O   
1287 C CB  . GLN A 165 ? 1.3784 1.9669 1.4952  0.4946  -0.3270 -0.1569 238 GLN A CB  
1288 C CG  . GLN A 165 ? 1.7861 2.4076 1.8977  0.4860  -0.3208 -0.1670 238 GLN A CG  
1289 C CD  . GLN A 165 ? 1.8836 2.5401 1.9812  0.5180  -0.3243 -0.2036 238 GLN A CD  
1290 O OE1 . GLN A 165 ? 1.8996 2.5551 1.9919  0.5484  -0.3319 -0.2219 238 GLN A OE1 
1291 N NE2 . GLN A 165 ? 1.7650 2.4542 1.8564  0.5116  -0.3186 -0.2142 238 GLN A NE2 
1292 N N   . ILE A 166 ? 1.2902 1.8440 1.4532  0.4179  -0.3013 -0.0706 239 ILE A N   
1293 C CA  . ILE A 166 ? 0.9962 1.5849 1.1846  0.3956  -0.2782 -0.0485 239 ILE A CA  
1294 C C   . ILE A 166 ? 1.2539 1.8682 1.4534  0.3688  -0.2644 -0.0347 239 ILE A C   
1295 O O   . ILE A 166 ? 1.5259 2.1750 1.7460  0.3509  -0.2441 -0.0191 239 ILE A O   
1296 C CB  . ILE A 166 ? 0.9805 1.5251 1.1745  0.3846  -0.2815 -0.0240 239 ILE A CB  
1297 C CG1 . ILE A 166 ? 0.9351 1.5171 1.1517  0.3730  -0.2592 -0.0099 239 ILE A CG1 
1298 C CG2 . ILE A 166 ? 1.5034 2.0045 1.6957  0.3606  -0.2884 -0.0012 239 ILE A CG2 
1299 C CD1 . ILE A 166 ? 0.9341 1.4776 1.1549  0.3649  -0.2615 0.0114  239 ILE A CD1 
1300 N N   . HIS A 167 ? 1.0233 1.6209 1.2089  0.3656  -0.2755 -0.0403 240 HIS A N   
1301 C CA  . HIS A 167 ? 1.1210 1.7430 1.3160  0.3407  -0.2642 -0.0274 240 HIS A CA  
1302 C C   . HIS A 167 ? 0.9337 1.6240 1.1346  0.3443  -0.2485 -0.0431 240 HIS A C   
1303 O O   . HIS A 167 ? 1.1406 1.8595 1.3522  0.3226  -0.2361 -0.0309 240 HIS A O   
1304 C CB  . HIS A 167 ? 1.3846 1.9660 1.5610  0.3352  -0.2826 -0.0281 240 HIS A CB  
1305 C CG  . HIS A 167 ? 1.0297 1.6152 1.1823  0.3592  -0.2956 -0.0608 240 HIS A CG  
1306 N ND1 . HIS A 167 ? 1.1112 1.6626 1.2442  0.3876  -0.3138 -0.0819 240 HIS A ND1 
1307 C CD2 . HIS A 167 ? 1.0743 1.6943 1.2191  0.3597  -0.2929 -0.0764 240 HIS A CD2 
1308 C CE1 . HIS A 167 ? 1.3888 1.9530 1.5028  0.4059  -0.3215 -0.1101 240 HIS A CE1 
1309 N NE2 . HIS A 167 ? 1.3031 1.9099 1.4235  0.3890  -0.3088 -0.1075 240 HIS A NE2 
1310 N N   . ARG A 168 ? 0.9562 1.6744 1.1510  0.3705  -0.2488 -0.0687 241 ARG A N   
1311 C CA  . ARG A 168 ? 1.0269 1.8131 1.2257  0.3758  -0.2352 -0.0857 241 ARG A CA  
1312 C C   . ARG A 168 ? 1.1860 2.0183 1.4075  0.3659  -0.2138 -0.0748 241 ARG A C   
1313 O O   . ARG A 168 ? 1.2437 2.1363 1.4709  0.3665  -0.2009 -0.0855 241 ARG A O   
1314 C CB  . ARG A 168 ? 0.9749 1.7711 1.1554  0.4108  -0.2470 -0.1202 241 ARG A CB  
1315 C CG  . ARG A 168 ? 1.0573 1.9133 1.2328  0.4170  -0.2396 -0.1416 241 ARG A CG  
1316 C CD  . ARG A 168 ? 1.0493 1.8889 1.1989  0.4473  -0.2580 -0.1730 241 ARG A CD  
1317 N NE  . ARG A 168 ? 1.4565 2.3598 1.6014  0.4567  -0.2498 -0.1961 241 ARG A NE  
1318 C CZ  . ARG A 168 ? 1.7427 2.6431 1.8646  0.4790  -0.2622 -0.2241 241 ARG A CZ  
1319 N NH1 . ARG A 168 ? 1.7215 2.5547 1.8223  0.4937  -0.2844 -0.2325 241 ARG A NH1 
1320 N NH2 . ARG A 168 ? 1.9957 2.9603 2.1148  0.4860  -0.2526 -0.2438 241 ARG A NH2 
1321 N N   . SER A 169 ? 1.3331 2.1387 1.5667  0.3556  -0.2099 -0.0535 242 SER A N   
1322 C CA  . SER A 169 ? 1.1834 2.0244 1.4368  0.3447  -0.1906 -0.0418 242 SER A CA  
1323 C C   . SER A 169 ? 1.1506 1.9713 1.4193  0.3148  -0.1806 -0.0099 242 SER A C   
1324 O O   . SER A 169 ? 1.1893 1.9599 1.4542  0.3071  -0.1909 0.0043  242 SER A O   
1325 C CB  . SER A 169 ? 1.0195 1.8511 1.2724  0.3640  -0.1946 -0.0489 242 SER A CB  
1326 O OG  . SER A 169 ? 1.0435 1.8127 1.2921  0.3627  -0.2066 -0.0346 242 SER A OG  
1327 N N   . LYS A 170 ? 1.1743 2.0342 1.4602  0.2981  -0.1607 0.0014  243 LYS A N   
1328 C CA  . LYS A 170 ? 1.4277 2.2733 1.7294  0.2713  -0.1492 0.0307  243 LYS A CA  
1329 C C   . LYS A 170 ? 1.2592 2.0887 1.5708  0.2685  -0.1420 0.0436  243 LYS A C   
1330 O O   . LYS A 170 ? 1.1357 1.9543 1.4610  0.2481  -0.1310 0.0671  243 LYS A O   
1331 C CB  . LYS A 170 ? 1.7216 2.6159 2.0351  0.2522  -0.1322 0.0372  243 LYS A CB  
1332 C CG  . LYS A 170 ? 1.8831 2.7945 2.1879  0.2497  -0.1377 0.0289  243 LYS A CG  
1333 C CD  . LYS A 170 ? 1.7913 2.7490 2.1085  0.2284  -0.1210 0.0389  243 LYS A CD  
1334 C CE  . LYS A 170 ? 1.6381 2.6480 1.9598  0.2330  -0.1086 0.0267  243 LYS A CE  
1335 N NZ  . LYS A 170 ? 1.4638 2.5173 1.7961  0.2107  -0.0932 0.0373  243 LYS A NZ  
1336 N N   . GLY A 171 ? 1.5186 2.3466 1.8233  0.2888  -0.1479 0.0289  244 GLY A N   
1337 C CA  . GLY A 171 ? 1.5164 2.3305 1.8282  0.2870  -0.1420 0.0395  244 GLY A CA  
1338 C C   . GLY A 171 ? 1.4913 2.3446 1.8023  0.3026  -0.1380 0.0213  244 GLY A C   
1339 O O   . GLY A 171 ? 1.6163 2.4961 1.9184  0.3213  -0.1450 -0.0016 244 GLY A O   
1340 N N   . LEU A 172 ? 1.0989 1.9570 1.4191  0.2947  -0.1265 0.0316  245 LEU A N   
1341 C CA  . LEU A 172 ? 1.0770 1.9742 1.3976  0.3069  -0.1222 0.0165  245 LEU A CA  
1342 C C   . LEU A 172 ? 1.1936 2.1522 1.5202  0.3003  -0.1097 0.0073  245 LEU A C   
1343 O O   . LEU A 172 ? 1.4264 2.4256 1.7501  0.3161  -0.1111 -0.0122 245 LEU A O   
1344 C CB  . LEU A 172 ? 0.7939 1.6800 1.1214  0.2972  -0.1127 0.0307  245 LEU A CB  
1345 C CG  . LEU A 172 ? 0.7030 1.5352 1.0242  0.3037  -0.1240 0.0397  245 LEU A CG  
1346 C CD1 . LEU A 172 ? 0.6857 1.5141 1.0144  0.2899  -0.1109 0.0546  245 LEU A CD1 
1347 C CD2 . LEU A 172 ? 0.7320 1.5563 1.0398  0.3324  -0.1427 0.0201  245 LEU A CD2 
1348 N N   . GLN A 173 ? 1.1761 2.1433 1.5114  0.2772  -0.0980 0.0218  246 GLN A N   
1349 C CA  . GLN A 173 ? 1.3422 2.3664 1.6829  0.2674  -0.0863 0.0160  246 GLN A CA  
1350 C C   . GLN A 173 ? 1.6997 2.7547 2.0302  0.2863  -0.0960 -0.0080 246 GLN A C   
1351 O O   . GLN A 173 ? 2.0161 3.1204 2.3458  0.2965  -0.0932 -0.0249 246 GLN A O   
1352 C CB  . GLN A 173 ? 1.4512 2.4708 1.8015  0.2405  -0.0752 0.0371  246 GLN A CB  
1353 C CG  . GLN A 173 ? 1.5494 2.5369 1.9100  0.2229  -0.0651 0.0607  246 GLN A CG  
1354 C CD  . GLN A 173 ? 1.8480 2.7769 2.2065  0.2250  -0.0749 0.0732  246 GLN A CD  
1355 O OE1 . GLN A 173 ? 1.8072 2.7157 2.1557  0.2386  -0.0904 0.0647  246 GLN A OE1 
1356 N NE2 . GLN A 173 ? 2.0695 2.9711 2.4369  0.2111  -0.0660 0.0934  246 GLN A NE2 
1357 N N   . ASP A 174 ? 1.2873 2.3146 1.6092  0.2912  -0.1077 -0.0100 247 ASP A N   
1358 C CA  . ASP A 174 ? 1.3584 2.4085 1.6679  0.3101  -0.1179 -0.0337 247 ASP A CA  
1359 C C   . ASP A 174 ? 1.3015 2.3029 1.5964  0.3342  -0.1382 -0.0447 247 ASP A C   
1360 O O   . ASP A 174 ? 1.4707 2.4218 1.7611  0.3281  -0.1471 -0.0330 247 ASP A O   
1361 C CB  . ASP A 174 ? 1.3878 2.4518 1.6971  0.2938  -0.1144 -0.0285 247 ASP A CB  
1362 C CG  . ASP A 174 ? 1.7230 2.8163 2.0185  0.3122  -0.1231 -0.0541 247 ASP A CG  
1363 O OD1 . ASP A 174 ? 1.8859 3.0399 2.1835  0.3135  -0.1144 -0.0665 247 ASP A OD1 
1364 O OD2 . ASP A 174 ? 1.6893 2.7452 1.9711  0.3251  -0.1388 -0.0621 247 ASP A OD2 
1365 N N   . LEU A 175 ? 1.0910 2.1073 1.3787  0.3611  -0.1462 -0.0666 248 LEU A N   
1366 C CA  . LEU A 175 ? 1.0975 2.0669 1.3704  0.3862  -0.1666 -0.0782 248 LEU A CA  
1367 C C   . LEU A 175 ? 1.3457 2.3407 1.6053  0.4160  -0.1773 -0.1090 248 LEU A C   
1368 O O   . LEU A 175 ? 1.3355 2.2871 1.5793  0.4351  -0.1959 -0.1197 248 LEU A O   
1369 C CB  . LEU A 175 ? 0.7902 1.7351 1.0664  0.3934  -0.1694 -0.0717 248 LEU A CB  
1370 C CG  . LEU A 175 ? 0.7694 1.7631 1.0561  0.3961  -0.1576 -0.0760 248 LEU A CG  
1371 C CD1 . LEU A 175 ? 0.8407 1.8663 1.1199  0.4285  -0.1670 -0.1041 248 LEU A CD1 
1372 C CD2 . LEU A 175 ? 0.7603 1.7215 1.0527  0.3877  -0.1555 -0.0579 248 LEU A CD2 
1373 N N   . GLY A 176 ? 1.1465 2.2096 1.4112  0.4205  -0.1667 -0.1236 249 GLY A N   
1374 C CA  . GLY A 176 ? 0.9936 2.0887 1.2470  0.4499  -0.1749 -0.1538 249 GLY A CA  
1375 C C   . GLY A 176 ? 0.9802 2.0592 1.2184  0.4529  -0.1840 -0.1637 249 GLY A C   
1376 O O   . GLY A 176 ? 1.2643 2.3258 1.5041  0.4275  -0.1797 -0.1462 249 GLY A O   
1377 N N   . GLY A 177 ? 1.2373 2.3223 1.4602  0.4840  -0.1965 -0.1919 250 GLY A N   
1378 C CA  . GLY A 177 ? 1.3256 2.4347 1.5481  0.5154  -0.2015 -0.2124 250 GLY A CA  
1379 C C   . GLY A 177 ? 1.0767 2.1204 1.2867  0.5403  -0.2226 -0.2182 250 GLY A C   
1380 O O   . GLY A 177 ? 1.0107 1.9910 1.2181  0.5272  -0.2300 -0.1986 250 GLY A O   
1381 N N   . ILE A 178 ? 0.9707 2.0304 1.1726  0.5764  -0.2326 -0.2449 251 ILE A N   
1382 C CA  . ILE A 178 ? 1.0082 2.0116 1.1988  0.6035  -0.2532 -0.2520 251 ILE A CA  
1383 C C   . ILE A 178 ? 1.5073 2.4596 1.6734  0.6215  -0.2729 -0.2686 251 ILE A C   
1384 O O   . ILE A 178 ? 1.8437 2.8267 2.0008  0.6300  -0.2713 -0.2884 251 ILE A O   
1385 C CB  . ILE A 178 ? 1.0131 2.0628 1.2101  0.6341  -0.2537 -0.2707 251 ILE A CB  
1386 C CG1 . ILE A 178 ? 0.9644 2.0670 1.1846  0.6132  -0.2340 -0.2542 251 ILE A CG1 
1387 C CG2 . ILE A 178 ? 1.0528 2.0429 1.2386  0.6619  -0.2757 -0.2761 251 ILE A CG2 
1388 C CD1 . ILE A 178 ? 0.9657 2.1193 1.1942  0.6396  -0.2336 -0.2700 251 ILE A CD1 
1389 N N   . SER A 179 ? 1.0875 1.9610 1.2415  0.6256  -0.2915 -0.2599 252 SER A N   
1390 C CA  . SER A 179 ? 1.1422 1.9581 1.2704  0.6448  -0.3137 -0.2761 252 SER A CA  
1391 C C   . SER A 179 ? 1.2688 2.0841 1.3863  0.6896  -0.3288 -0.3044 252 SER A C   
1392 O O   . SER A 179 ? 1.4022 2.2040 1.5256  0.7019  -0.3347 -0.2994 252 SER A O   
1393 C CB  . SER A 179 ? 1.1573 1.8885 1.2768  0.6267  -0.3279 -0.2524 252 SER A CB  
1394 O OG  . SER A 179 ? 1.9045 2.6367 2.0342  0.5873  -0.3145 -0.2268 252 SER A OG  
1395 N N   . TRP A 180 ? 1.2256 2.0552 1.3270  0.7145  -0.3352 -0.3343 253 TRP A N   
1396 C CA  . TRP A 180 ? 1.5780 2.4141 1.6700  0.7602  -0.3483 -0.3640 253 TRP A CA  
1397 C C   . TRP A 180 ? 1.9878 2.7323 2.0587  0.7796  -0.3763 -0.3658 253 TRP A C   
1398 O O   . TRP A 180 ? 2.2993 3.0373 2.3675  0.8137  -0.3884 -0.3802 253 TRP A O   
1399 C CB  . TRP A 180 ? 1.5469 2.4303 1.6279  0.7816  -0.3451 -0.3964 253 TRP A CB  
1400 C CG  . TRP A 180 ? 1.6843 2.5224 1.7413  0.7739  -0.3550 -0.4030 253 TRP A CG  
1401 C CD1 . TRP A 180 ? 1.9371 2.7912 1.9953  0.7401  -0.3426 -0.3910 253 TRP A CD1 
1402 C CD2 . TRP A 180 ? 1.7238 2.4935 1.7507  0.8006  -0.3801 -0.4237 253 TRP A CD2 
1403 N NE1 . TRP A 180 ? 1.9698 2.7716 2.0010  0.7431  -0.3582 -0.4025 253 TRP A NE1 
1404 C CE2 . TRP A 180 ? 1.8546 2.6029 1.8655  0.7797  -0.3814 -0.4230 253 TRP A CE2 
1405 C CE3 . TRP A 180 ? 1.7779 2.5007 1.7892  0.8399  -0.4025 -0.4423 253 TRP A CE3 
1406 C CZ2 . TRP A 180 ? 1.7709 2.4523 1.7498  0.7957  -0.4041 -0.4409 253 TRP A CZ2 
1407 C CZ3 . TRP A 180 ? 1.8671 2.5212 1.8464  0.8566  -0.4252 -0.4600 253 TRP A CZ3 
1408 C CH2 . TRP A 180 ? 1.8138 2.4477 1.7769  0.8340  -0.4257 -0.4595 253 TRP A CH2 
1409 N N   . GLN A 181 ? 2.0603 2.7342 2.1162  0.7580  -0.3877 -0.3508 254 GLN A N   
1410 C CA  . GLN A 181 ? 1.9831 2.5663 2.0173  0.7723  -0.4155 -0.3503 254 GLN A CA  
1411 C C   . GLN A 181 ? 1.8071 2.3698 1.8536  0.7725  -0.4197 -0.3307 254 GLN A C   
1412 O O   . GLN A 181 ? 1.8633 2.3999 1.9011  0.8054  -0.4369 -0.3436 254 GLN A O   
1413 C CB  . GLN A 181 ? 2.3033 2.8221 2.3224  0.7420  -0.4244 -0.3329 254 GLN A CB  
1414 C CG  . GLN A 181 ? 2.5080 3.0327 2.5095  0.7419  -0.4252 -0.3522 254 GLN A CG  
1415 C CD  . GLN A 181 ? 2.5254 3.1210 2.5457  0.7123  -0.3984 -0.3427 254 GLN A CD  
1416 O OE1 . GLN A 181 ? 2.4885 3.1273 2.5349  0.6920  -0.3792 -0.3221 254 GLN A OE1 
1417 N NE2 . GLN A 181 ? 2.5672 3.1719 2.5729  0.7085  -0.3979 -0.3570 254 GLN A NE2 
1418 N N   . LEU A 182 ? 1.7143 2.2885 1.7806  0.7362  -0.4041 -0.2993 255 LEU A N   
1419 C CA  . LEU A 182 ? 1.6142 2.1721 1.6919  0.7332  -0.4063 -0.2795 255 LEU A CA  
1420 C C   . LEU A 182 ? 1.5581 2.1801 1.6510  0.7592  -0.3982 -0.2939 255 LEU A C   
1421 O O   . LEU A 182 ? 1.4269 2.0310 1.5234  0.7695  -0.4065 -0.2862 255 LEU A O   
1422 C CB  . LEU A 182 ? 1.5223 2.0828 1.6176  0.6887  -0.3895 -0.2445 255 LEU A CB  
1423 C CG  . LEU A 182 ? 1.2762 1.7609 1.3593  0.6625  -0.4014 -0.2216 255 LEU A CG  
1424 C CD1 . LEU A 182 ? 1.3836 1.7922 1.4478  0.6804  -0.4291 -0.2205 255 LEU A CD1 
1425 C CD2 . LEU A 182 ? 1.2908 1.7644 1.3604  0.6531  -0.4036 -0.2298 255 LEU A CD2 
1426 N N   . ALA A 183 ? 1.3622 2.0598 1.4637  0.7694  -0.3827 -0.3143 256 ALA A N   
1427 C CA  . ALA A 183 ? 1.5468 2.3086 1.6618  0.7968  -0.3766 -0.3304 256 ALA A CA  
1428 C C   . ALA A 183 ? 1.5369 2.2661 1.6343  0.8435  -0.4008 -0.3562 256 ALA A C   
1429 O O   . ALA A 183 ? 1.4439 2.1804 1.5483  0.8647  -0.4072 -0.3577 256 ALA A O   
1430 C CB  . ALA A 183 ? 1.6947 2.5471 1.8227  0.7942  -0.3542 -0.3450 256 ALA A CB  
1431 N N   . LEU A 184 ? 1.7660 2.4582 1.8399  0.8604  -0.4149 -0.3768 257 LEU A N   
1432 C CA  . LEU A 184 ? 1.8360 2.4864 1.8902  0.9053  -0.4400 -0.4013 257 LEU A CA  
1433 C C   . LEU A 184 ? 1.8526 2.4181 1.8968  0.9047  -0.4623 -0.3822 257 LEU A C   
1434 O O   . LEU A 184 ? 1.9257 2.4758 1.9665  0.9380  -0.4780 -0.3920 257 LEU A O   
1435 C CB  . LEU A 184 ? 1.4929 2.1148 1.5211  0.9197  -0.4507 -0.4264 257 LEU A CB  
1436 C CG  . LEU A 184 ? 1.4999 2.1962 1.5292  0.9508  -0.4411 -0.4615 257 LEU A CG  
1437 C CD1 . LEU A 184 ? 1.4311 2.2242 1.4866  0.9254  -0.4100 -0.4542 257 LEU A CD1 
1438 C CD2 . LEU A 184 ? 2.0762 2.7345 2.0761  0.9641  -0.4536 -0.4859 257 LEU A CD2 
1439 N N   . CYS A 185 ? 1.9137 2.4245 1.9532  0.8671  -0.4642 -0.3541 258 CYS A N   
1440 C CA  . CYS A 185 ? 1.4906 1.9243 1.5213  0.8617  -0.4840 -0.3326 258 CYS A CA  
1441 C C   . CYS A 185 ? 1.4609 1.9278 1.5125  0.8645  -0.4774 -0.3193 258 CYS A C   
1442 O O   . CYS A 185 ? 1.5398 1.9719 1.5840  0.8901  -0.4968 -0.3220 258 CYS A O   
1443 C CB  . CYS A 185 ? 1.4741 1.8595 1.5012  0.8170  -0.4824 -0.3027 258 CYS A CB  
1444 S SG  . CYS A 185 ? 1.5165 1.8478 1.5156  0.8102  -0.4952 -0.3138 258 CYS A SG  
1445 N N   . ILE A 186 ? 1.3953 1.9292 1.4723  0.8380  -0.4506 -0.3048 259 ILE A N   
1446 C CA  . ILE A 186 ? 1.6535 2.2203 1.7497  0.8361  -0.4430 -0.2908 259 ILE A CA  
1447 C C   . ILE A 186 ? 1.6891 2.3065 1.7912  0.8787  -0.4464 -0.3169 259 ILE A C   
1448 O O   . ILE A 186 ? 1.4724 2.0941 1.5800  0.8790  -0.4449 -0.3080 259 ILE A O   
1449 C CB  . ILE A 186 ? 1.2941 1.9186 1.4140  0.7966  -0.4135 -0.2703 259 ILE A CB  
1450 C CG1 . ILE A 186 ? 1.2681 1.8968 1.4018  0.7834  -0.4092 -0.2469 259 ILE A CG1 
1451 C CG2 . ILE A 186 ? 1.2629 1.9791 1.3979  0.8042  -0.3929 -0.2901 259 ILE A CG2 
1452 C CD1 . ILE A 186 ? 1.2030 1.8857 1.3587  0.7466  -0.3810 -0.2281 259 ILE A CD1 
1453 N N   . MET A 187 ? 1.6486 2.2969 1.7436  0.9023  -0.4443 -0.3469 260 MET A N   
1454 C CA  . MET A 187 ? 1.4317 2.1101 1.5216  0.9309  -0.4424 -0.3707 260 MET A CA  
1455 C C   . MET A 187 ? 1.7724 2.3723 1.8388  0.9589  -0.4706 -0.3781 260 MET A C   
1456 O O   . MET A 187 ? 1.6886 2.2934 1.7549  0.9722  -0.4726 -0.3803 260 MET A O   
1457 C CB  . MET A 187 ? 1.4817 2.2160 1.5689  0.9469  -0.4316 -0.4004 260 MET A CB  
1458 C CG  . MET A 187 ? 1.3746 2.2046 1.4848  0.9249  -0.4007 -0.3975 260 MET A CG  
1459 S SD  . MET A 187 ? 1.6705 2.5670 1.7758  0.9412  -0.3884 -0.4310 260 MET A SD  
1460 C CE  . MET A 187 ? 1.8969 2.7787 1.9812  0.9876  -0.4035 -0.4617 260 MET A CE  
1461 N N   . LEU A 188 ? 1.9069 2.4329 1.9525  0.9674  -0.4935 -0.3816 261 LEU A N   
1462 C CA  . LEU A 188 ? 1.8770 2.3192 1.8981  0.9902  -0.5221 -0.3859 261 LEU A CA  
1463 C C   . LEU A 188 ? 1.9114 2.3185 1.9380  0.9725  -0.5281 -0.3554 261 LEU A C   
1464 O O   . LEU A 188 ? 2.1535 2.5280 2.1698  0.9902  -0.5417 -0.3578 261 LEU A O   
1465 C CB  . LEU A 188 ? 1.9398 2.3060 1.9367  0.9966  -0.5459 -0.3917 261 LEU A CB  
1466 C CG  . LEU A 188 ? 1.9696 2.2406 1.9375  1.0180  -0.5776 -0.3958 261 LEU A CG  
1467 C CD1 . LEU A 188 ? 2.0136 2.3010 1.9717  1.0553  -0.5802 -0.4251 261 LEU A CD1 
1468 C CD2 . LEU A 188 ? 2.1462 2.3429 2.0890  1.0212  -0.6009 -0.4013 261 LEU A CD2 
1469 N N   . ILE A 189 ? 1.6952 2.1094 1.7376  0.9374  -0.5181 -0.3266 262 ILE A N   
1470 C CA  . ILE A 189 ? 1.7083 2.0946 1.7565  0.9184  -0.5219 -0.2969 262 ILE A CA  
1471 C C   . ILE A 189 ? 1.8346 2.2838 1.8999  0.9209  -0.5049 -0.2973 262 ILE A C   
1472 O O   . ILE A 189 ? 1.7513 2.1723 1.8122  0.9270  -0.5156 -0.2884 262 ILE A O   
1473 C CB  . ILE A 189 ? 1.4911 1.8730 1.5514  0.8810  -0.5146 -0.2674 262 ILE A CB  
1474 C CG1 . ILE A 189 ? 1.5280 1.8325 1.5645  0.8687  -0.5300 -0.2639 262 ILE A CG1 
1475 C CG2 . ILE A 189 ? 1.4740 1.8392 1.5419  0.8607  -0.5148 -0.2377 262 ILE A CG2 
1476 C CD1 . ILE A 189 ? 1.4897 1.7776 1.5314  0.8205  -0.5173 -0.2335 262 ILE A CD1 
1477 N N   . PHE A 190 ? 1.8211 2.3563 1.9058  0.9147  -0.4787 -0.3063 263 PHE A N   
1478 C CA  . PHE A 190 ? 1.7722 2.3703 1.8721  0.9162  -0.4627 -0.3076 263 PHE A CA  
1479 C C   . PHE A 190 ? 1.7165 2.3118 1.8036  0.9531  -0.4738 -0.3322 263 PHE A C   
1480 O O   . PHE A 190 ? 1.4982 2.1321 1.5947  0.9576  -0.4666 -0.3316 263 PHE A O   
1481 C CB  . PHE A 190 ? 1.8532 2.5414 1.9739  0.8996  -0.4332 -0.3121 263 PHE A CB  
1482 C CG  . PHE A 190 ? 1.3273 2.0338 1.4661  0.8614  -0.4179 -0.2842 263 PHE A CG  
1483 C CD1 . PHE A 190 ? 1.3183 1.9925 1.4605  0.8454  -0.4234 -0.2581 263 PHE A CD1 
1484 C CD2 . PHE A 190 ? 1.2803 2.0375 1.4322  0.8416  -0.3979 -0.2841 263 PHE A CD2 
1485 C CE1 . PHE A 190 ? 1.2697 1.9611 1.4276  0.8117  -0.4092 -0.2335 263 PHE A CE1 
1486 C CE2 . PHE A 190 ? 1.4370 2.2098 1.6051  0.8071  -0.3840 -0.2588 263 PHE A CE2 
1487 C CZ  . PHE A 190 ? 1.2948 2.0348 1.4658  0.7929  -0.3894 -0.2340 263 PHE A CZ  
1488 N N   . THR A 191 ? 1.7024 2.2526 1.7677  0.9795  -0.4918 -0.3536 264 THR A N   
1489 C CA  . THR A 191 ? 1.7646 2.3006 1.8144  1.0166  -0.5057 -0.3774 264 THR A CA  
1490 C C   . THR A 191 ? 2.0426 2.4927 2.0760  1.0245  -0.5326 -0.3645 264 THR A C   
1491 O O   . THR A 191 ? 2.4322 2.8796 2.4619  1.0453  -0.5406 -0.3707 264 THR A O   
1492 C CB  . THR A 191 ? 2.0069 2.5368 2.0394  1.0419  -0.5119 -0.4086 264 THR A CB  
1493 O OG1 . THR A 191 ? 2.1644 2.7740 2.2121  1.0306  -0.4867 -0.4177 264 THR A OG1 
1494 C CG2 . THR A 191 ? 1.9991 2.5257 2.0170  1.0814  -0.5233 -0.4351 264 THR A CG2 
1495 N N   . VAL A 192 ? 1.6781 2.0591 1.7019  1.0067  -0.5468 -0.3452 265 VAL A N   
1496 C CA  . VAL A 192 ? 1.7304 2.0252 1.7360  1.0110  -0.5735 -0.3314 265 VAL A CA  
1497 C C   . VAL A 192 ? 1.7002 2.0078 1.7213  0.9912  -0.5679 -0.3036 265 VAL A C   
1498 O O   . VAL A 192 ? 1.7428 1.9959 1.7522  0.9977  -0.5873 -0.2932 265 VAL A O   
1499 C CB  . VAL A 192 ? 1.7513 1.9665 1.7389  0.9975  -0.5921 -0.3201 265 VAL A CB  
1500 C CG1 . VAL A 192 ? 1.6921 1.9125 1.6953  0.9576  -0.5815 -0.2871 265 VAL A CG1 
1501 C CG2 . VAL A 192 ? 1.8285 1.9493 1.7887  1.0122  -0.6238 -0.3177 265 VAL A CG2 
1502 N N   . ILE A 193 ? 1.7500 2.1284 1.7963  0.9671  -0.5422 -0.2914 266 ILE A N   
1503 C CA  . ILE A 193 ? 1.9003 2.2968 1.9611  0.9491  -0.5358 -0.2670 266 ILE A CA  
1504 C C   . ILE A 193 ? 1.9693 2.4277 2.0406  0.9681  -0.5260 -0.2814 266 ILE A C   
1505 O O   . ILE A 193 ? 1.9779 2.4393 2.0552  0.9645  -0.5284 -0.2666 266 ILE A O   
1506 C CB  . ILE A 193 ? 1.8901 2.3273 1.9714  0.9119  -0.5143 -0.2446 266 ILE A CB  
1507 C CG1 . ILE A 193 ? 1.9562 2.4831 2.0563  0.9083  -0.4868 -0.2599 266 ILE A CG1 
1508 C CG2 . ILE A 193 ? 1.8282 2.2101 1.9008  0.8923  -0.5230 -0.2295 266 ILE A CG2 
1509 C CD1 . ILE A 193 ? 1.8404 2.4096 1.9609  0.8722  -0.4652 -0.2383 266 ILE A CD1 
1510 N N   . TYR A 194 ? 1.9228 2.4317 1.9960  0.9878  -0.5155 -0.3095 267 TYR A N   
1511 C CA  . TYR A 194 ? 2.0701 2.6421 2.1529  1.0059  -0.5058 -0.3240 267 TYR A CA  
1512 C C   . TYR A 194 ? 2.0758 2.5999 2.1433  1.0357  -0.5295 -0.3306 267 TYR A C   
1513 O O   . TYR A 194 ? 2.1629 2.7087 2.2392  1.0385  -0.5292 -0.3224 267 TYR A O   
1514 C CB  . TYR A 194 ? 2.3442 2.9769 2.4294  1.0200  -0.4907 -0.3526 267 TYR A CB  
1515 C CG  . TYR A 194 ? 2.6186 3.3254 2.7147  1.0354  -0.4783 -0.3669 267 TYR A CG  
1516 C CD1 . TYR A 194 ? 2.5578 3.2991 2.6697  1.0232  -0.4707 -0.3499 267 TYR A CD1 
1517 C CD2 . TYR A 194 ? 2.8673 3.6094 2.9568  1.0627  -0.4751 -0.3975 267 TYR A CD2 
1518 C CE1 . TYR A 194 ? 2.7955 3.6046 2.9170  1.0367  -0.4604 -0.3622 267 TYR A CE1 
1519 C CE2 . TYR A 194 ? 3.0215 3.8325 3.1204  1.0765  -0.4644 -0.4098 267 TYR A CE2 
1520 C CZ  . TYR A 194 ? 3.0541 3.8981 3.1693  1.0632  -0.4573 -0.3917 267 TYR A CZ  
1521 O OH  . TYR A 194 ? 3.2412 4.1545 3.3657  1.0763  -0.4474 -0.4031 267 TYR A OH  
1522 N N   . PHE A 195 ? 2.2121 2.6688 2.2559  1.0576  -0.5511 -0.3447 268 PHE A N   
1523 C CA  . PHE A 195 ? 2.5586 2.9664 2.5859  1.0876  -0.5747 -0.3529 268 PHE A CA  
1524 C C   . PHE A 195 ? 2.6813 3.0239 2.7030  1.0736  -0.5925 -0.3238 268 PHE A C   
1525 O O   . PHE A 195 ? 2.9368 3.2336 2.9449  1.0952  -0.6135 -0.3262 268 PHE A O   
1526 C CB  . PHE A 195 ? 2.5073 2.8606 2.5085  1.1148  -0.5928 -0.3782 268 PHE A CB  
1527 C CG  . PHE A 195 ? 2.4064 2.8219 2.4094  1.1344  -0.5782 -0.4099 268 PHE A CG  
1528 C CD1 . PHE A 195 ? 2.2913 2.7992 2.3147  1.1376  -0.5561 -0.4179 268 PHE A CD1 
1529 C CD2 . PHE A 195 ? 2.4215 2.8036 2.4050  1.1485  -0.5870 -0.4312 268 PHE A CD2 
1530 C CE1 . PHE A 195 ? 2.3196 2.8868 2.3437  1.1540  -0.5426 -0.4460 268 PHE A CE1 
1531 C CE2 . PHE A 195 ? 2.4208 2.8620 2.4050  1.1662  -0.5735 -0.4603 268 PHE A CE2 
1532 C CZ  . PHE A 195 ? 2.3852 2.9199 2.3898  1.1686  -0.5511 -0.4673 268 PHE A CZ  
1533 N N   . SER A 196 ? 2.1656 2.5037 2.1970  1.0380  -0.5849 -0.2962 269 SER A N   
1534 C CA  . SER A 196 ? 2.0548 2.3383 2.0818  1.0207  -0.5996 -0.2663 269 SER A CA  
1535 C C   . SER A 196 ? 2.0777 2.4179 2.1271  1.0023  -0.5841 -0.2469 269 SER A C   
1536 O O   . SER A 196 ? 2.1158 2.4202 2.1631  0.9863  -0.5941 -0.2209 269 SER A O   
1537 C CB  . SER A 196 ? 1.7713 1.9989 1.7892  0.9935  -0.6056 -0.2475 269 SER A CB  
1538 O OG  . SER A 196 ? 1.8192 1.9921 1.8150  1.0095  -0.6214 -0.2653 269 SER A OG  
1539 N N   . ILE A 197 ? 2.1288 2.5563 2.1981  1.0033  -0.5605 -0.2585 270 ILE A N   
1540 C CA  . ILE A 197 ? 2.0824 2.5693 2.1729  0.9839  -0.5442 -0.2417 270 ILE A CA  
1541 C C   . ILE A 197 ? 2.0137 2.5663 2.1146  1.0070  -0.5361 -0.2604 270 ILE A C   
1542 O O   . ILE A 197 ? 1.8983 2.4774 2.0094  1.0042  -0.5350 -0.2488 270 ILE A O   
1543 C CB  . ILE A 197 ? 1.9244 2.4566 2.0309  0.9506  -0.5200 -0.2311 270 ILE A CB  
1544 C CG1 . ILE A 197 ? 1.8594 2.3274 1.9568  0.9267  -0.5288 -0.2090 270 ILE A CG1 
1545 C CG2 . ILE A 197 ? 1.9230 2.5202 2.0500  0.9321  -0.5026 -0.2172 270 ILE A CG2 
1546 C CD1 . ILE A 197 ? 1.9046 2.3279 1.9972  0.9138  -0.5432 -0.1811 270 ILE A CD1 
1547 N N   . TRP A 198 ? 1.9785 2.5579 2.0759  1.0300  -0.5310 -0.2893 271 TRP A N   
1548 C CA  . TRP A 198 ? 2.0612 2.7151 2.1699  1.0489  -0.5192 -0.3081 271 TRP A CA  
1549 C C   . TRP A 198 ? 2.2452 2.8875 2.3520  1.0709  -0.5352 -0.3061 271 TRP A C   
1550 O O   . TRP A 198 ? 2.1171 2.8253 2.2388  1.0752  -0.5243 -0.3090 271 TRP A O   
1551 C CB  . TRP A 198 ? 1.9120 2.5827 2.0119  1.0738  -0.5162 -0.3400 271 TRP A CB  
1552 C CG  . TRP A 198 ? 2.1154 2.7160 2.1915  1.1079  -0.5422 -0.3564 271 TRP A CG  
1553 C CD1 . TRP A 198 ? 2.2162 2.7248 2.2741  1.1090  -0.5666 -0.3445 271 TRP A CD1 
1554 C CD2 . TRP A 198 ? 2.0892 2.7058 2.1558  1.1451  -0.5469 -0.3875 271 TRP A CD2 
1555 N NE1 . TRP A 198 ? 2.2649 2.7288 2.3021  1.1443  -0.5865 -0.3666 271 TRP A NE1 
1556 C CE2 . TRP A 198 ? 2.1722 2.7015 2.2146  1.1679  -0.5748 -0.3937 271 TRP A CE2 
1557 C CE3 . TRP A 198 ? 1.9740 2.6706 2.0493  1.1607  -0.5305 -0.4104 271 TRP A CE3 
1558 C CZ2 . TRP A 198 ? 2.2243 2.7429 2.2510  1.2070  -0.5866 -0.4229 271 TRP A CZ2 
1559 C CZ3 . TRP A 198 ? 2.2090 2.8977 2.2693  1.1996  -0.5418 -0.4389 271 TRP A CZ3 
1560 C CH2 . TRP A 198 ? 2.3013 2.9012 2.3376  1.2230  -0.5696 -0.4455 271 TRP A CH2 
1561 N N   . LYS A 199 ? 2.4184 2.9783 2.5070  1.0840  -0.5613 -0.3003 272 LYS A N   
1562 C CA  . LYS A 199 ? 2.1839 2.7276 2.2700  1.1051  -0.5783 -0.2972 272 LYS A CA  
1563 C C   . LYS A 199 ? 2.2301 2.7678 2.3253  1.0804  -0.5807 -0.2654 272 LYS A C   
1564 O O   . LYS A 199 ? 2.4853 3.0185 2.5816  1.0943  -0.5931 -0.2595 272 LYS A O   
1565 C CB  . LYS A 199 ? 2.2020 2.6586 2.2624  1.1320  -0.6067 -0.3068 272 LYS A CB  
1566 C CG  . LYS A 199 ? 2.3306 2.7982 2.3808  1.1665  -0.6079 -0.3419 272 LYS A CG  
1567 C CD  . LYS A 199 ? 2.4504 2.8295 2.4737  1.1940  -0.6376 -0.3515 272 LYS A CD  
1568 C CE  . LYS A 199 ? 2.4365 2.7874 2.4583  1.2074  -0.6565 -0.3390 272 LYS A CE  
1569 N NZ  . LYS A 199 ? 2.4109 2.6717 2.4052  1.2327  -0.6863 -0.3475 272 LYS A NZ  
1570 N N   . GLY A 200 ? 2.0129 2.5508 2.1143  1.0448  -0.5698 -0.2449 273 GLY A N   
1571 C CA  . GLY A 200 ? 1.9318 2.4690 2.0412  1.0199  -0.5705 -0.2153 273 GLY A CA  
1572 C C   . GLY A 200 ? 2.0810 2.5309 2.1733  1.0058  -0.5899 -0.1933 273 GLY A C   
1573 O O   . GLY A 200 ? 2.1569 2.5609 2.2367  1.0012  -0.5941 -0.1964 273 GLY A O   
1574 N N   . VAL A 201 ? 1.9615 2.3886 2.0527  0.9978  -0.6023 -0.1702 274 VAL A N   
1575 C CA  . VAL A 201 ? 2.1053 2.4521 2.1797  0.9813  -0.6209 -0.1461 274 VAL A CA  
1576 C C   . VAL A 201 ? 2.2059 2.4737 2.2571  1.0067  -0.6484 -0.1537 274 VAL A C   
1577 O O   . VAL A 201 ? 2.2879 2.4820 2.3218  0.9939  -0.6655 -0.1359 274 VAL A O   
1578 C CB  . VAL A 201 ? 2.1161 2.4696 2.1964  0.9612  -0.6238 -0.1173 274 VAL A CB  
1579 C CG1 . VAL A 201 ? 1.8367 2.2599 1.9366  0.9329  -0.5977 -0.1085 274 VAL A CG1 
1580 C CG2 . VAL A 201 ? 2.4084 2.7784 2.4922  0.9856  -0.6349 -0.1210 274 VAL A CG2 
1581 N N   . LYS A 202 ? 2.2769 2.5582 2.3266  1.0418  -0.6533 -0.1795 275 LYS A N   
1582 C CA  . LYS A 202 ? 2.3481 2.5547 2.3748  1.0685  -0.6799 -0.1895 275 LYS A CA  
1583 C C   . LYS A 202 ? 2.4061 2.5585 2.4146  1.0664  -0.6852 -0.1996 275 LYS A C   
1584 O O   . LYS A 202 ? 2.4817 2.5501 2.4678  1.0650  -0.7081 -0.1904 275 LYS A O   
1585 C CB  . LYS A 202 ? 2.3524 2.5941 2.3829  1.1076  -0.6819 -0.2162 275 LYS A CB  
1586 N N   . THR A 203 ? 2.4253 2.6245 2.4424  1.0652  -0.6650 -0.2180 276 THR A N   
1587 C CA  . THR A 203 ? 2.4295 2.5813 2.4301  1.0633  -0.6699 -0.2281 276 THR A CA  
1588 C C   . THR A 203 ? 2.4686 2.5986 2.4701  1.0240  -0.6644 -0.2020 276 THR A C   
1589 O O   . THR A 203 ? 2.6583 2.7175 2.6403  1.0162  -0.6794 -0.1967 276 THR A O   
1590 C CB  . THR A 203 ? 2.4486 2.6582 2.4563  1.0798  -0.6520 -0.2594 276 THR A CB  
1591 O OG1 . THR A 203 ? 2.4093 2.7091 2.4436  1.0631  -0.6236 -0.2562 276 THR A OG1 
1592 C CG2 . THR A 203 ? 2.5694 2.7830 2.5693  1.1217  -0.6622 -0.2875 276 THR A CG2 
1593 N N   . SER A 204 ? 2.1636 2.3524 2.1866  0.9986  -0.6438 -0.1853 277 SER A N   
1594 C CA  . SER A 204 ? 2.0290 2.2017 2.0537  0.9620  -0.6375 -0.1606 277 SER A CA  
1595 C C   . SER A 204 ? 2.2708 2.3681 2.2792  0.9469  -0.6597 -0.1322 277 SER A C   
1596 O O   . SER A 204 ? 2.3084 2.3782 2.3132  0.9177  -0.6589 -0.1111 277 SER A O   
1597 C CB  . SER A 204 ? 2.0360 2.2905 2.0866  0.9398  -0.6105 -0.1507 277 SER A CB  
1598 O OG  . SER A 204 ? 2.2307 2.5012 2.2882  0.9357  -0.6133 -0.1339 277 SER A OG  
1599 N N   . GLY A 205 ? 2.4039 2.4683 2.4021  0.9656  -0.6795 -0.1307 278 GLY A N   
1600 C CA  . GLY A 205 ? 2.4050 2.3935 2.3847  0.9531  -0.7029 -0.1052 278 GLY A CA  
1601 C C   . GLY A 205 ? 2.2491 2.1548 2.2016  0.9702  -0.7279 -0.1165 278 GLY A C   
1602 O O   . GLY A 205 ? 2.0951 1.9271 2.0279  0.9576  -0.7490 -0.0966 278 GLY A O   
1603 N N   . LYS A 206 ? 2.2631 2.1807 2.2130  0.9979  -0.7258 -0.1487 279 LYS A N   
1604 C CA  . LYS A 206 ? 2.4943 2.3375 2.4173  1.0178  -0.7490 -0.1648 279 LYS A CA  
1605 C C   . LYS A 206 ? 2.7407 2.5657 2.6560  1.0071  -0.7445 -0.1736 279 LYS A C   
1606 O O   . LYS A 206 ? 2.8375 2.5831 2.7280  1.0029  -0.7654 -0.1703 279 LYS A O   
1607 C CB  . LYS A 206 ? 2.4796 2.3431 2.4012  1.0606  -0.7532 -0.1969 279 LYS A CB  
1608 C CG  . LYS A 206 ? 2.6414 2.4569 2.5493  1.0799  -0.7780 -0.1925 279 LYS A CG  
1609 C CD  . LYS A 206 ? 2.7036 2.5459 2.6267  1.0637  -0.7748 -0.1645 279 LYS A CD  
1610 C CE  . LYS A 206 ? 2.9884 2.7805 2.8974  1.0828  -0.8009 -0.1592 279 LYS A CE  
1611 N NZ  . LYS A 206 ? 3.1030 2.9194 3.0253  1.0667  -0.7994 -0.1310 279 LYS A NZ  
1612 N N   . VAL A 207 ? 2.5239 2.4214 2.4596  1.0018  -0.7180 -0.1843 280 VAL A N   
1613 C CA  . VAL A 207 ? 2.3922 2.2786 2.3227  0.9908  -0.7126 -0.1916 280 VAL A CA  
1614 C C   . VAL A 207 ? 2.1501 1.9963 2.0768  0.9516  -0.7158 -0.1586 280 VAL A C   
1615 O O   . VAL A 207 ? 1.9933 1.7883 1.9042  0.9411  -0.7256 -0.1571 280 VAL A O   
1616 C CB  . VAL A 207 ? 1.9347 1.9132 1.8891  0.9941  -0.6829 -0.2101 280 VAL A CB  
1617 C CG1 . VAL A 207 ? 1.9154 1.8834 1.8650  0.9822  -0.6778 -0.2163 280 VAL A CG1 
1618 C CG2 . VAL A 207 ? 2.0450 2.0630 2.0013  1.0326  -0.6804 -0.2425 280 VAL A CG2 
1619 N N   . VAL A 208 ? 2.3055 2.1736 2.2454  0.9296  -0.7085 -0.1316 281 VAL A N   
1620 C CA  . VAL A 208 ? 2.3349 2.1714 2.2722  0.8917  -0.7100 -0.0987 281 VAL A CA  
1621 C C   . VAL A 208 ? 2.4048 2.1417 2.3121  0.8858  -0.7400 -0.0861 281 VAL A C   
1622 O O   . VAL A 208 ? 2.5387 2.2365 2.4376  0.8574  -0.7444 -0.0663 281 VAL A O   
1623 C CB  . VAL A 208 ? 2.3182 2.1985 2.2730  0.8741  -0.6981 -0.0751 281 VAL A CB  
1624 C CG1 . VAL A 208 ? 2.4809 2.3269 2.4309  0.8360  -0.7010 -0.0402 281 VAL A CG1 
1625 C CG2 . VAL A 208 ? 2.3296 2.3070 2.3129  0.8755  -0.6681 -0.0869 281 VAL A CG2 
1626 N N   . TRP A 209 ? 2.3606 2.0555 2.2514  0.9114  -0.7611 -0.0970 282 TRP A N   
1627 C CA  . TRP A 209 ? 2.4125 2.0105 2.2730  0.9064  -0.7909 -0.0865 282 TRP A CA  
1628 C C   . TRP A 209 ? 2.2460 1.8001 2.0911  0.8958  -0.7972 -0.0918 282 TRP A C   
1629 O O   . TRP A 209 ? 2.2518 1.7410 2.0792  0.8699  -0.8128 -0.0694 282 TRP A O   
1630 C CB  . TRP A 209 ? 2.5633 2.1288 2.4084  0.9427  -0.8111 -0.1066 282 TRP A CB  
1631 C CG  . TRP A 209 ? 2.5977 2.1589 2.4446  0.9429  -0.8197 -0.0880 282 TRP A CG  
1632 C CD1 . TRP A 209 ? 2.4943 2.1234 2.3630  0.9561  -0.8060 -0.0907 282 TRP A CD1 
1633 C CD2 . TRP A 209 ? 2.7224 2.2080 2.5477  0.9287  -0.8448 -0.0635 282 TRP A CD2 
1634 N NE1 . TRP A 209 ? 2.5956 2.1959 2.4580  0.9518  -0.8213 -0.0692 282 TRP A NE1 
1635 C CE2 . TRP A 209 ? 2.7593 2.2721 2.5951  0.9350  -0.8449 -0.0522 282 TRP A CE2 
1636 C CE3 . TRP A 209 ? 2.8609 2.2595 2.6588  0.9098  -0.8674 -0.0493 282 TRP A CE3 
1637 C CZ2 . TRP A 209 ? 2.9452 2.4018 2.7650  0.9238  -0.8665 -0.0275 282 TRP A CZ2 
1638 C CZ3 . TRP A 209 ? 2.9987 2.3419 2.7807  0.8975  -0.8884 -0.0248 282 TRP A CZ3 
1639 C CH2 . TRP A 209 ? 3.0321 2.4047 2.8251  0.9049  -0.8877 -0.0141 282 TRP A CH2 
1640 N N   . VAL A 210 ? 2.1233 1.7136 1.9748  0.9144  -0.7854 -0.1207 283 VAL A N   
1641 C CA  . VAL A 210 ? 2.3934 1.9474 2.2310  0.9068  -0.7911 -0.1283 283 VAL A CA  
1642 C C   . VAL A 210 ? 2.2981 1.8909 2.1542  0.8733  -0.7703 -0.1094 283 VAL A C   
1643 O O   . VAL A 210 ? 2.2210 1.7649 2.0647  0.8470  -0.7797 -0.0915 283 VAL A O   
1644 C CB  . VAL A 210 ? 2.4417 2.0158 2.2756  0.9438  -0.7892 -0.1691 283 VAL A CB  
1645 C CG1 . VAL A 210 ? 2.4957 2.0276 2.3125  0.9372  -0.7979 -0.1777 283 VAL A CG1 
1646 C CG2 . VAL A 210 ? 2.2284 1.7679 2.0451  0.9785  -0.8090 -0.1880 283 VAL A CG2 
1647 N N   . THR A 211 ? 2.3844 2.0658 2.2698  0.8736  -0.7420 -0.1131 284 THR A N   
1648 C CA  . THR A 211 ? 2.2179 1.9431 2.1222  0.8457  -0.7205 -0.0995 284 THR A CA  
1649 C C   . THR A 211 ? 2.2414 1.9390 2.1453  0.8075  -0.7232 -0.0605 284 THR A C   
1650 O O   . THR A 211 ? 2.3502 2.0538 2.2604  0.7811  -0.7142 -0.0458 284 THR A O   
1651 C CB  . THR A 211 ? 1.9862 1.8115 1.9210  0.8534  -0.6905 -0.1112 284 THR A CB  
1652 O OG1 . THR A 211 ? 1.8303 1.6817 1.7764  0.8482  -0.6852 -0.0950 284 THR A OG1 
1653 C CG2 . THR A 211 ? 1.8649 1.7223 1.8002  0.8908  -0.6871 -0.1491 284 THR A CG2 
1654 N N   . ALA A 212 ? 2.1417 1.8110 2.0382  0.8037  -0.7352 -0.0431 285 ALA A N   
1655 C CA  . ALA A 212 ? 1.9689 1.6190 1.8652  0.7680  -0.7362 -0.0061 285 ALA A CA  
1656 C C   . ALA A 212 ? 2.1784 1.7360 2.0461  0.7503  -0.7631 0.0123  285 ALA A C   
1657 O O   . ALA A 212 ? 2.1331 1.6732 1.9996  0.7160  -0.7629 0.0429  285 ALA A O   
1658 C CB  . ALA A 212 ? 1.9446 1.6258 1.8510  0.7698  -0.7315 0.0058  285 ALA A CB  
1659 N N   . THR A 213 ? 2.5900 2.0889 2.4343  0.7717  -0.7862 -0.0053 286 THR A N   
1660 C CA  . THR A 213 ? 2.6167 2.0252 2.4320  0.7545  -0.8135 0.0113  286 THR A CA  
1661 C C   . THR A 213 ? 2.4941 1.8641 2.2959  0.7455  -0.8214 0.0050  286 THR A C   
1662 O O   . THR A 213 ? 2.3958 1.7072 2.1805  0.7161  -0.8362 0.0282  286 THR A O   
1663 C CB  . THR A 213 ? 2.1866 1.5444 1.9807  0.7813  -0.8377 -0.0015 286 THR A CB  
1664 O OG1 . THR A 213 ? 2.2013 1.5804 1.9965  0.8211  -0.8360 -0.0400 286 THR A OG1 
1665 C CG2 . THR A 213 ? 2.1814 1.5621 1.9847  0.7819  -0.8352 0.0140  286 THR A CG2 
1666 N N   . PHE A 214 ? 2.4188 1.8237 2.2282  0.7682  -0.8112 -0.0249 287 PHE A N   
1667 C CA  . PHE A 214 ? 2.3595 1.7319 2.1565  0.7607  -0.8186 -0.0321 287 PHE A CA  
1668 C C   . PHE A 214 ? 2.4037 1.7851 2.2108  0.7195  -0.8081 -0.0024 287 PHE A C   
1669 O O   . PHE A 214 ? 2.4565 1.7767 2.2439  0.6987  -0.8253 0.0096  287 PHE A O   
1670 C CB  . PHE A 214 ? 2.3572 1.7776 2.1633  0.7934  -0.8065 -0.0697 287 PHE A CB  
1671 C CG  . PHE A 214 ? 2.3940 1.7852 2.1874  0.7884  -0.8142 -0.0793 287 PHE A CG  
1672 C CD1 . PHE A 214 ? 2.6387 1.9493 2.3989  0.7990  -0.8429 -0.0920 287 PHE A CD1 
1673 C CD2 . PHE A 214 ? 2.2308 1.6742 2.0444  0.7729  -0.7937 -0.0755 287 PHE A CD2 
1674 C CE1 . PHE A 214 ? 2.7105 1.9930 2.4575  0.7940  -0.8513 -0.1007 287 PHE A CE1 
1675 C CE2 . PHE A 214 ? 2.1968 1.6141 1.9986  0.7681  -0.8019 -0.0834 287 PHE A CE2 
1676 C CZ  . PHE A 214 ? 2.4959 1.8327 2.2641  0.7786  -0.8308 -0.0960 287 PHE A CZ  
1677 N N   . PRO A 215 ? 2.2158 1.6691 2.0519  0.7059  -0.7813 0.0103  288 PRO A N   
1678 C CA  . PRO A 215 ? 2.1047 1.5652 1.9499  0.6678  -0.7718 0.0377  288 PRO A CA  
1679 C C   . PRO A 215 ? 2.0649 1.4607 1.8923  0.6334  -0.7890 0.0721  288 PRO A C   
1680 O O   . PRO A 215 ? 1.9684 1.3452 1.7934  0.6035  -0.7902 0.0908  288 PRO A O   
1681 C CB  . PRO A 215 ? 1.8633 1.4110 1.7408  0.6624  -0.7401 0.0435  288 PRO A CB  
1682 C CG  . PRO A 215 ? 1.8572 1.4525 1.7446  0.7024  -0.7323 0.0104  288 PRO A CG  
1683 C CD  . PRO A 215 ? 1.9362 1.4709 1.7984  0.7249  -0.7576 -0.0019 288 PRO A CD  
1684 N N   . TYR A 216 ? 2.0510 1.4164 1.8670  0.6346  -0.8013 0.0825  289 TYR A N   
1685 C CA  . TYR A 216 ? 2.0817 1.3881 1.8803  0.6001  -0.8173 0.1158  289 TYR A CA  
1686 C C   . TYR A 216 ? 2.1534 1.3783 1.9217  0.5960  -0.8450 0.1114  289 TYR A C   
1687 O O   . TYR A 216 ? 2.2592 1.4448 2.0168  0.5608  -0.8537 0.1371  289 TYR A O   
1688 C CB  . TYR A 216 ? 2.1051 1.4035 1.8995  0.6028  -0.8232 0.1278  289 TYR A CB  
1689 C CG  . TYR A 216 ? 2.2376 1.6095 2.0589  0.5971  -0.7977 0.1397  289 TYR A CG  
1690 C CD1 . TYR A 216 ? 2.2871 1.7236 2.1282  0.6277  -0.7810 0.1158  289 TYR A CD1 
1691 C CD2 . TYR A 216 ? 2.3207 1.6987 2.1471  0.5603  -0.7903 0.1746  289 TYR A CD2 
1692 C CE1 . TYR A 216 ? 2.0620 1.5642 1.9261  0.6214  -0.7588 0.1263  289 TYR A CE1 
1693 C CE2 . TYR A 216 ? 2.1079 1.5501 1.9565  0.5554  -0.7683 0.1846  289 TYR A CE2 
1694 C CZ  . TYR A 216 ? 2.0060 1.5088 1.8729  0.5858  -0.7532 0.1603  289 TYR A CZ  
1695 O OH  . TYR A 216 ? 2.0518 1.6171 1.9392  0.5799  -0.7324 0.1699  289 TYR A OH  
1696 N N   . ILE A 217 ? 2.2657 1.4646 2.0192  0.6314  -0.8593 0.0791  290 ILE A N   
1697 C CA  . ILE A 217 ? 2.2444 1.3651 1.9671  0.6307  -0.8865 0.0707  290 ILE A CA  
1698 C C   . ILE A 217 ? 2.2145 1.3426 1.9412  0.6138  -0.8806 0.0716  290 ILE A C   
1699 O O   . ILE A 217 ? 2.2429 1.3188 1.9529  0.5829  -0.8954 0.0911  290 ILE A O   
1700 C CB  . ILE A 217 ? 2.3818 1.4803 2.0892  0.6761  -0.9007 0.0326  290 ILE A CB  
1701 C CG1 . ILE A 217 ? 2.4416 1.5287 2.1443  0.6909  -0.9088 0.0348  290 ILE A CG1 
1702 C CG2 . ILE A 217 ? 2.5287 1.5466 2.2028  0.6767  -0.9288 0.0211  290 ILE A CG2 
1703 C CD1 . ILE A 217 ? 2.3873 1.4595 2.0777  0.7368  -0.9209 -0.0020 290 ILE A CD1 
1704 N N   . ALA A 218 ? 2.3351 1.5304 2.0844  0.6327  -0.8589 0.0511  291 ALA A N   
1705 C CA  . ALA A 218 ? 2.3289 1.5382 2.0842  0.6182  -0.8521 0.0513  291 ALA A CA  
1706 C C   . ALA A 218 ? 2.0834 1.3042 1.8507  0.5669  -0.8378 0.0899  291 ALA A C   
1707 O O   . ALA A 218 ? 2.0928 1.2859 1.8514  0.5382  -0.8418 0.1009  291 ALA A O   
1708 C CB  . ALA A 218 ? 2.0606 1.3572 1.8430  0.6382  -0.8197 0.0237  291 ALA A CB  
1709 N N   . LEU A 219 ? 2.0388 1.3014 1.8258  0.5550  -0.8209 0.1107  292 LEU A N   
1710 C CA  . LEU A 219 ? 2.2329 1.5074 2.0311  0.5082  -0.8072 0.1475  292 LEU A CA  
1711 C C   . LEU A 219 ? 2.3160 1.5061 2.0855  0.4840  -0.8396 0.1736  292 LEU A C   
1712 O O   . LEU A 219 ? 2.3390 1.5236 2.1108  0.4444  -0.8343 0.1988  292 LEU A O   
1713 C CB  . LEU A 219 ? 1.9505 1.2812 1.7715  0.5036  -0.7855 0.1625  292 LEU A CB  
1714 C CG  . LEU A 219 ? 1.8672 1.2915 1.7221  0.5078  -0.7457 0.1499  292 LEU A CG  
1715 C CD1 . LEU A 219 ? 1.8329 1.2984 1.7031  0.5064  -0.7315 0.1636  292 LEU A CD1 
1716 C CD2 . LEU A 219 ? 1.8426 1.2999 1.7144  0.4738  -0.7210 0.1611  292 LEU A CD2 
1717 N N   . SER A 220 ? 2.2503 1.3846 1.9955  0.4996  -0.8633 0.1665  293 SER A N   
1718 C CA  . SER A 220 ? 2.3980 1.4559 2.1154  0.4718  -0.8885 0.1875  293 SER A CA  
1719 C C   . SER A 220 ? 2.4784 1.4879 2.1766  0.4633  -0.9061 0.1803  293 SER A C   
1720 O O   . SER A 220 ? 2.5226 1.5021 2.2126  0.4243  -0.9137 0.2070  293 SER A O   
1721 C CB  . SER A 220 ? 2.6120 1.6232 2.3081  0.4922  -0.9089 0.1782  293 SER A CB  
1722 O OG  . SER A 220 ? 2.8275 1.7659 2.4967  0.4639  -0.9336 0.1990  293 SER A OG  
1723 N N   . VAL A 221 ? 2.2592 1.2630 1.9500  0.4992  -0.9126 0.1443  294 VAL A N   
1724 C CA  . VAL A 221 ? 2.2962 1.2543 1.9670  0.4944  -0.9302 0.1344  294 VAL A CA  
1725 C C   . VAL A 221 ? 2.6358 1.6383 2.3275  0.4596  -0.9084 0.1526  294 VAL A C   
1726 O O   . VAL A 221 ? 2.6527 1.6154 2.3308  0.4264  -0.9207 0.1708  294 VAL A O   
1727 C CB  . VAL A 221 ? 2.3193 1.2763 1.9814  0.5422  -0.9361 0.0899  294 VAL A CB  
1728 C CG1 . VAL A 221 ? 2.3737 1.2797 2.0117  0.5370  -0.9554 0.0785  294 VAL A CG1 
1729 C CG2 . VAL A 221 ? 2.3782 1.3012 2.0234  0.5735  -0.9509 0.0710  294 VAL A CG2 
1730 N N   . LEU A 222 ? 2.3793 1.4714 2.1061  0.4626  -0.8703 0.1465  295 LEU A N   
1731 C CA  . LEU A 222 ? 2.3608 1.5067 2.1122  0.4275  -0.8413 0.1620  295 LEU A CA  
1732 C C   . LEU A 222 ? 2.4621 1.5982 2.2176  0.3837  -0.8411 0.2051  295 LEU A C   
1733 O O   . LEU A 222 ? 2.5118 1.6640 2.2774  0.3491  -0.8294 0.2232  295 LEU A O   
1734 C CB  . LEU A 222 ? 2.1070 1.3474 1.8938  0.4411  -0.8022 0.1475  295 LEU A CB  
1735 C CG  . LEU A 222 ? 2.0693 1.3329 1.8559  0.4810  -0.7976 0.1055  295 LEU A CG  
1736 C CD1 . LEU A 222 ? 2.0773 1.4343 1.8987  0.4920  -0.7602 0.0949  295 LEU A CD1 
1737 C CD2 . LEU A 222 ? 2.0764 1.3200 1.8510  0.4719  -0.8032 0.0935  295 LEU A CD2 
1738 N N   . LEU A 223 ? 2.4241 1.5385 2.1731  0.3847  -0.8529 0.2222  296 LEU A N   
1739 C CA  . LEU A 223 ? 2.1434 1.2514 1.8956  0.3438  -0.8525 0.2633  296 LEU A CA  
1740 C C   . LEU A 223 ? 2.3065 1.3361 2.0291  0.3171  -0.8848 0.2815  296 LEU A C   
1741 O O   . LEU A 223 ? 2.2879 1.3271 2.0182  0.2778  -0.8770 0.3070  296 LEU A O   
1742 C CB  . LEU A 223 ? 2.0953 1.2023 1.8467  0.3527  -0.8567 0.2756  296 LEU A CB  
1743 C CG  . LEU A 223 ? 2.0833 1.1952 1.8400  0.3095  -0.8497 0.3160  296 LEU A CG  
1744 C CD1 . LEU A 223 ? 1.9985 1.1877 1.7895  0.2876  -0.8130 0.3302  296 LEU A CD1 
1745 C CD2 . LEU A 223 ? 2.1025 1.2089 1.8535  0.3156  -0.8520 0.3227  296 LEU A CD2 
1746 N N   . VAL A 224 ? 2.2356 1.1947 1.9262  0.3339  -0.9147 0.2661  297 VAL A N   
1747 C CA  . VAL A 224 ? 2.3030 1.1902 1.9648  0.3052  -0.9415 0.2793  297 VAL A CA  
1748 C C   . VAL A 224 ? 2.4404 1.3188 2.0982  0.2992  -0.9471 0.2712  297 VAL A C   
1749 O O   . VAL A 224 ? 2.6043 1.4513 2.2511  0.2618  -0.9585 0.2930  297 VAL A O   
1750 C CB  . VAL A 224 ? 2.3902 1.2047 2.0186  0.3263  -0.9710 0.2615  297 VAL A CB  
1751 C CG1 . VAL A 224 ? 2.4656 1.2018 2.0615  0.2982  -1.0013 0.2716  297 VAL A CG1 
1752 C CG2 . VAL A 224 ? 2.4327 1.2559 2.0650  0.3273  -0.9667 0.2741  297 VAL A CG2 
1753 N N   . ARG A 225 ? 2.2593 1.1863 1.9333  0.3276  -0.9276 0.2410  298 ARG A N   
1754 C CA  . ARG A 225 ? 2.2462 1.1853 1.9223  0.3167  -0.9201 0.2292  298 ARG A CA  
1755 C C   . ARG A 225 ? 2.1771 1.1754 1.8831  0.2751  -0.8916 0.2586  298 ARG A C   
1756 O O   . ARG A 225 ? 2.1934 1.1688 1.8917  0.2419  -0.9006 0.2757  298 ARG A O   
1757 C CB  . ARG A 225 ? 2.5640 1.5466 2.2504  0.3572  -0.9029 0.1873  298 ARG A CB  
1758 C CG  . ARG A 225 ? 2.6440 1.6546 2.3374  0.3474  -0.8891 0.1741  298 ARG A CG  
1759 C CD  . ARG A 225 ? 2.8452 1.7753 2.5016  0.3373  -0.9232 0.1697  298 ARG A CD  
1760 N NE  . ARG A 225 ? 2.8257 1.7319 2.4784  0.2881  -0.9318 0.2069  298 ARG A NE  
1761 C CZ  . ARG A 225 ? 2.9123 1.7498 2.5339  0.2700  -0.9614 0.2102  298 ARG A CZ  
1762 N NH1 . ARG A 225 ? 2.9396 1.7227 2.5297  0.2981  -0.9849 0.1775  298 ARG A NH1 
1763 N NH2 . ARG A 225 ? 2.9517 1.7752 2.5730  0.2239  -0.9676 0.2460  298 ARG A NH2 
1764 N N   . GLY A 226 ? 2.1013 1.1759 1.8414  0.2762  -0.8576 0.2649  299 GLY A N   
1765 C CA  . GLY A 226 ? 2.3241 1.4561 2.0934  0.2399  -0.8295 0.2910  299 GLY A CA  
1766 C C   . GLY A 226 ? 2.2712 1.3715 2.0333  0.1998  -0.8430 0.3321  299 GLY A C   
1767 O O   . GLY A 226 ? 2.0286 1.1556 1.8061  0.1648  -0.8300 0.3555  299 GLY A O   
1768 N N   . ALA A 227 ? 2.1707 1.2156 1.9095  0.2043  -0.8694 0.3420  300 ALA A N   
1769 C CA  . ALA A 227 ? 2.2576 1.2684 1.9859  0.1655  -0.8852 0.3817  300 ALA A CA  
1770 C C   . ALA A 227 ? 2.4767 1.4230 2.1781  0.1421  -0.9148 0.3891  300 ALA A C   
1771 O O   . ALA A 227 ? 2.4554 1.3993 2.1583  0.0996  -0.9149 0.4198  300 ALA A O   
1772 C CB  . ALA A 227 ? 2.1846 1.1648 1.8979  0.1745  -0.8970 0.3850  300 ALA A CB  
1773 N N   . THR A 228 ? 2.9151 1.8160 2.5930  0.1676  -0.9349 0.3577  301 THR A N   
1774 C CA  . THR A 228 ? 3.2370 2.0729 2.8862  0.1466  -0.9645 0.3618  301 THR A CA  
1775 C C   . THR A 228 ? 3.1017 1.9835 2.7701  0.1266  -0.9441 0.3609  301 THR A C   
1776 O O   . THR A 228 ? 3.1821 2.0226 2.8323  0.0993  -0.9643 0.3721  301 THR A O   
1777 C CB  . THR A 228 ? 3.4837 2.2471 3.0964  0.1812  -0.9951 0.3271  301 THR A CB  
1778 O OG1 . THR A 228 ? 3.6377 2.4426 3.2635  0.2244  -0.9767 0.2891  301 THR A OG1 
1779 C CG2 . THR A 228 ? 3.5451 2.2609 3.1372  0.1858  -1.0113 0.3276  301 THR A CG2 
1780 N N   . LEU A 229 ? 2.8565 1.8220 2.5606  0.1388  -0.9056 0.3488  302 LEU A N   
1781 C CA  . LEU A 229 ? 2.6407 1.6545 2.3652  0.1217  -0.8846 0.3480  302 LEU A CA  
1782 C C   . LEU A 229 ? 2.5770 1.6163 2.3194  0.0737  -0.8752 0.3902  302 LEU A C   
1783 O O   . LEU A 229 ? 2.6296 1.6966 2.3886  0.0611  -0.8623 0.4150  302 LEU A O   
1784 C CB  . LEU A 229 ? 2.4393 1.5352 2.1970  0.1476  -0.8462 0.3252  302 LEU A CB  
1785 C CG  . LEU A 229 ? 2.4656 1.5556 2.2128  0.1958  -0.8486 0.2822  302 LEU A CG  
1786 C CD1 . LEU A 229 ? 2.4286 1.6069 2.2117  0.2140  -0.8086 0.2661  302 LEU A CD1 
1787 C CD2 . LEU A 229 ? 2.6805 1.7190 2.3981  0.2038  -0.8727 0.2583  302 LEU A CD2 
1788 N N   . PRO A 230 ? 2.5024 1.5351 2.2418  0.0466  -0.8814 0.3989  303 PRO A N   
1789 C CA  . PRO A 230 ? 2.4521 1.5111 2.2092  0.0009  -0.8734 0.4395  303 PRO A CA  
1790 C C   . PRO A 230 ? 2.3540 1.5080 2.1572  -0.0026 -0.8291 0.4483  303 PRO A C   
1791 O O   . PRO A 230 ? 2.1023 1.3040 1.9241  0.0197  -0.8054 0.4235  303 PRO A O   
1792 C CB  . PRO A 230 ? 2.5938 1.6235 2.3353  -0.0205 -0.8912 0.4392  303 PRO A CB  
1793 C CG  . PRO A 230 ? 2.5753 1.6046 2.3091  0.0160  -0.8887 0.3960  303 PRO A CG  
1794 C CD  . PRO A 230 ? 2.5421 1.5452 2.2617  0.0567  -0.8957 0.3716  303 PRO A CD  
1795 N N   . GLY A 231 ? 2.6135 1.7944 2.4342  -0.0312 -0.8184 0.4840  304 GLY A N   
1796 C CA  . GLY A 231 ? 2.5413 1.8083 2.4044  -0.0360 -0.7773 0.4945  304 GLY A CA  
1797 C C   . GLY A 231 ? 2.4516 1.7557 2.3294  -0.0027 -0.7542 0.4759  304 GLY A C   
1798 O O   . GLY A 231 ? 2.2725 1.6465 2.1830  0.0030  -0.7194 0.4722  304 GLY A O   
1799 N N   . ALA A 232 ? 2.4488 1.7070 2.3026  0.0192  -0.7734 0.4645  305 ALA A N   
1800 C CA  . ALA A 232 ? 2.3699 1.6610 2.2356  0.0508  -0.7541 0.4471  305 ALA A CA  
1801 C C   . ALA A 232 ? 2.2686 1.5965 2.1530  0.0345  -0.7356 0.4754  305 ALA A C   
1802 O O   . ALA A 232 ? 2.3123 1.6793 2.2116  0.0557  -0.7142 0.4646  305 ALA A O   
1803 C CB  . ALA A 232 ? 2.4088 1.6376 2.2421  0.0826  -0.7827 0.4235  305 ALA A CB  
1804 N N   . TRP A 233 ? 2.2646 1.5821 2.1478  -0.0033 -0.7434 0.5112  306 TRP A N   
1805 C CA  . TRP A 233 ? 2.3160 1.6682 2.2150  -0.0206 -0.7264 0.5392  306 TRP A CA  
1806 C C   . TRP A 233 ? 2.1865 1.6237 2.1260  -0.0227 -0.6833 0.5413  306 TRP A C   
1807 O O   . TRP A 233 ? 2.1018 1.5764 2.0565  -0.0258 -0.6630 0.5541  306 TRP A O   
1808 C CB  . TRP A 233 ? 2.4308 1.7525 2.3180  -0.0617 -0.7463 0.5774  306 TRP A CB  
1809 C CG  . TRP A 233 ? 2.2080 1.5456 2.1071  -0.0900 -0.7434 0.5917  306 TRP A CG  
1810 C CD1 . TRP A 233 ? 2.4695 1.7585 2.3477  -0.0997 -0.7704 0.5878  306 TRP A CD1 
1811 C CD2 . TRP A 233 ? 2.2138 1.6216 2.1486  -0.1121 -0.7119 0.6122  306 TRP A CD2 
1812 N NE1 . TRP A 233 ? 2.5667 1.8929 2.4659  -0.1275 -0.7580 0.6056  306 TRP A NE1 
1813 C CE2 . TRP A 233 ? 2.4578 1.8575 2.3926  -0.1347 -0.7221 0.6209  306 TRP A CE2 
1814 C CE3 . TRP A 233 ? 2.1771 1.6528 2.1430  -0.1143 -0.6764 0.6236  306 TRP A CE3 
1815 C CZ2 . TRP A 233 ? 2.3735 1.8326 2.3402  -0.1585 -0.6981 0.6413  306 TRP A CZ2 
1816 C CZ3 . TRP A 233 ? 2.1295 1.6618 2.1261  -0.1369 -0.6524 0.6428  306 TRP A CZ3 
1817 C CH2 . TRP A 233 ? 2.3165 1.8412 2.3142  -0.1584 -0.6634 0.6519  306 TRP A CH2 
1818 N N   . ARG A 234 ? 2.1443 1.6113 2.1006  -0.0223 -0.6695 0.5299  307 ARG A N   
1819 C CA  . ARG A 234 ? 2.0548 1.5996 2.0492  -0.0246 -0.6297 0.5326  307 ARG A CA  
1820 C C   . ARG A 234 ? 2.0677 1.6477 2.0736  0.0081  -0.6070 0.5079  307 ARG A C   
1821 O O   . ARG A 234 ? 2.0620 1.6947 2.0920  0.0050  -0.5778 0.5172  307 ARG A O   
1822 C CB  . ARG A 234 ? 1.9764 1.5408 1.9837  -0.0304 -0.6231 0.5253  307 ARG A CB  
1823 C CG  . ARG A 234 ? 2.1171 1.6503 2.1141  -0.0640 -0.6452 0.5496  307 ARG A CG  
1824 C CD  . ARG A 234 ? 2.1578 1.7168 2.1696  -0.0695 -0.6365 0.5427  307 ARG A CD  
1825 N NE  . ARG A 234 ? 2.4452 1.9720 2.4449  -0.1015 -0.6602 0.5644  307 ARG A NE  
1826 C CZ  . ARG A 234 ? 2.5441 2.1003 2.5626  -0.1349 -0.6520 0.5983  307 ARG A CZ  
1827 N NH1 . ARG A 234 ? 2.4977 2.1147 2.5476  -0.1392 -0.6201 0.6134  307 ARG A NH1 
1828 N NH2 . ARG A 234 ? 2.6419 2.1672 2.6475  -0.1640 -0.6759 0.6169  307 ARG A NH2 
1829 N N   . GLY A 235 ? 2.1002 1.6531 2.0890  0.0396  -0.6199 0.4759  308 GLY A N   
1830 C CA  . GLY A 235 ? 2.1839 1.7707 2.1828  0.0704  -0.6003 0.4523  308 GLY A CA  
1831 C C   . GLY A 235 ? 2.0634 1.6451 2.0563  0.0723  -0.6011 0.4640  308 GLY A C   
1832 O O   . GLY A 235 ? 1.9014 1.5308 1.9127  0.0823  -0.5748 0.4597  308 GLY A O   
1833 N N   . VAL A 236 ? 2.0274 1.5503 1.9933  0.0617  -0.6319 0.4794  309 VAL A N   
1834 C CA  . VAL A 236 ? 1.9822 1.4980 1.9403  0.0604  -0.6349 0.4937  309 VAL A CA  
1835 C C   . VAL A 236 ? 1.9520 1.5159 1.9328  0.0316  -0.6094 0.5239  309 VAL A C   
1836 O O   . VAL A 236 ? 2.2260 1.8205 2.2154  0.0358  -0.5921 0.5280  309 VAL A O   
1837 C CB  . VAL A 236 ? 1.7294 1.1670 1.6516  0.0548  -0.6762 0.5040  309 VAL A CB  
1838 C CG1 . VAL A 236 ? 1.7439 1.1746 1.6572  0.0540  -0.6802 0.5189  309 VAL A CG1 
1839 C CG2 . VAL A 236 ? 2.0303 1.4197 1.9299  0.0857  -0.7009 0.4720  309 VAL A CG2 
1840 N N   . LEU A 237 ? 1.7807 1.3519 1.7709  0.0018  -0.6074 0.5456  310 LEU A N   
1841 C CA  . LEU A 237 ? 1.7812 1.4017 1.7950  -0.0248 -0.5821 0.5739  310 LEU A CA  
1842 C C   . LEU A 237 ? 1.8533 1.5426 1.8980  -0.0104 -0.5424 0.5600  310 LEU A C   
1843 O O   . LEU A 237 ? 1.9065 1.6324 1.9636  -0.0148 -0.5209 0.5708  310 LEU A O   
1844 C CB  . LEU A 237 ? 2.0387 1.6573 2.0586  -0.0566 -0.5877 0.5970  310 LEU A CB  
1845 C CG  . LEU A 237 ? 2.1048 1.7776 2.1511  -0.0841 -0.5613 0.6267  310 LEU A CG  
1846 C CD1 . LEU A 237 ? 1.9921 1.6570 2.0273  -0.0988 -0.5662 0.6507  310 LEU A CD1 
1847 C CD2 . LEU A 237 ? 2.2076 1.8823 2.2622  -0.1127 -0.5671 0.6469  310 LEU A CD2 
1848 N N   . PHE A 238 ? 1.9167 1.6236 1.9729  0.0066  -0.5328 0.5356  311 PHE A N   
1849 C CA  . PHE A 238 ? 1.8266 1.5952 1.9105  0.0207  -0.4971 0.5210  311 PHE A CA  
1850 C C   . PHE A 238 ? 1.4826 1.2578 1.5606  0.0473  -0.4911 0.5015  311 PHE A C   
1851 O O   . PHE A 238 ? 1.4104 1.2359 1.5088  0.0540  -0.4613 0.4961  311 PHE A O   
1852 C CB  . PHE A 238 ? 1.7196 1.5006 1.8136  0.0316  -0.4922 0.5000  311 PHE A CB  
1853 C CG  . PHE A 238 ? 1.6729 1.5132 1.7934  0.0467  -0.4581 0.4834  311 PHE A CG  
1854 C CD1 . PHE A 238 ? 1.7383 1.6293 1.8870  0.0306  -0.4286 0.5000  311 PHE A CD1 
1855 C CD2 . PHE A 238 ? 1.5627 1.4079 1.6794  0.0771  -0.4560 0.4512  311 PHE A CD2 
1856 C CE1 . PHE A 238 ? 1.9464 1.8879 2.1177  0.0439  -0.3985 0.4850  311 PHE A CE1 
1857 C CE2 . PHE A 238 ? 1.7997 1.6984 1.9394  0.0890  -0.4257 0.4369  311 PHE A CE2 
1858 C CZ  . PHE A 238 ? 1.9483 1.8932 2.1147  0.0721  -0.3974 0.4538  311 PHE A CZ  
1859 N N   . TYR A 239 ? 1.4447 1.1692 1.4950  0.0622  -0.5198 0.4914  312 TYR A N   
1860 C CA  . TYR A 239 ? 1.4446 1.1714 1.4873  0.0885  -0.5187 0.4731  312 TYR A CA  
1861 C C   . TYR A 239 ? 1.7553 1.4885 1.7948  0.0759  -0.5140 0.4950  312 TYR A C   
1862 O O   . TYR A 239 ? 1.4234 1.1851 1.4683  0.0908  -0.4983 0.4848  312 TYR A O   
1863 C CB  . TYR A 239 ? 1.5909 1.2592 1.6051  0.1106  -0.5529 0.4541  312 TYR A CB  
1864 C CG  . TYR A 239 ? 1.5062 1.1744 1.5118  0.1408  -0.5556 0.4333  312 TYR A CG  
1865 C CD1 . TYR A 239 ? 1.4531 1.1775 1.4789  0.1565  -0.5265 0.4174  312 TYR A CD1 
1866 C CD2 . TYR A 239 ? 1.5671 1.1776 1.5439  0.1533  -0.5886 0.4304  312 TYR A CD2 
1867 C CE1 . TYR A 239 ? 1.4885 1.2148 1.5067  0.1832  -0.5300 0.3994  312 TYR A CE1 
1868 C CE2 . TYR A 239 ? 1.5735 1.1850 1.5433  0.1816  -0.5922 0.4124  312 TYR A CE2 
1869 C CZ  . TYR A 239 ? 1.5330 1.2041 1.5240  0.1962  -0.5627 0.3971  312 TYR A CZ  
1870 O OH  . TYR A 239 ? 1.5254 1.2000 1.5099  0.2236  -0.5670 0.3799  312 TYR A OH  
1871 N N   . LEU A 240 ? 1.9012 1.6082 1.9307  0.0478  -0.5283 0.5250  313 LEU A N   
1872 C CA  . LEU A 240 ? 1.4930 1.1990 1.5145  0.0338  -0.5289 0.5477  313 LEU A CA  
1873 C C   . LEU A 240 ? 1.5611 1.3073 1.6017  0.0030  -0.5059 0.5765  313 LEU A C   
1874 O O   . LEU A 240 ? 1.4717 1.2233 1.5068  -0.0105 -0.5034 0.5963  313 LEU A O   
1875 C CB  . LEU A 240 ? 1.5654 1.2023 1.5542  0.0271  -0.5688 0.5603  313 LEU A CB  
1876 C CG  . LEU A 240 ? 1.6044 1.1951 1.5713  0.0588  -0.5950 0.5333  313 LEU A CG  
1877 C CD1 . LEU A 240 ? 1.7646 1.2851 1.6987  0.0499  -0.6343 0.5491  313 LEU A CD1 
1878 C CD2 . LEU A 240 ? 1.5767 1.1983 1.5493  0.0867  -0.5795 0.5124  313 LEU A CD2 
1879 N N   . LYS A 241 ? 1.5588 1.3347 1.6216  -0.0081 -0.4892 0.5798  314 LYS A N   
1880 C CA  . LYS A 241 ? 1.5843 1.4004 1.6669  -0.0358 -0.4673 0.6070  314 LYS A CA  
1881 C C   . LYS A 241 ? 1.7722 1.6393 1.8703  -0.0294 -0.4349 0.6045  314 LYS A C   
1882 O O   . LYS A 241 ? 1.9394 1.8400 2.0537  -0.0098 -0.4126 0.5817  314 LYS A O   
1883 C CB  . LYS A 241 ? 1.6480 1.4884 1.7533  -0.0444 -0.4551 0.6078  314 LYS A CB  
1884 C CG  . LYS A 241 ? 1.7578 1.6385 1.8846  -0.0728 -0.4350 0.6371  314 LYS A CG  
1885 C CD  . LYS A 241 ? 1.8734 1.7757 2.0220  -0.0794 -0.4258 0.6371  314 LYS A CD  
1886 C CE  . LYS A 241 ? 1.6983 1.6439 1.8706  -0.1057 -0.4055 0.6662  314 LYS A CE  
1887 N NZ  . LYS A 241 ? 1.6239 1.5914 1.8183  -0.1114 -0.3974 0.6668  314 LYS A NZ  
1888 N N   . PRO A 242 ? 1.6564 1.5308 1.7488  -0.0462 -0.4313 0.6270  315 PRO A N   
1889 C CA  . PRO A 242 ? 1.5948 1.5145 1.6981  -0.0399 -0.4016 0.6232  315 PRO A CA  
1890 C C   . PRO A 242 ? 1.7942 1.7710 1.9295  -0.0463 -0.3658 0.6258  315 PRO A C   
1891 O O   . PRO A 242 ? 1.9985 1.9900 2.1458  -0.0695 -0.3603 0.6491  315 PRO A O   
1892 C CB  . PRO A 242 ? 1.6604 1.5687 1.7468  -0.0603 -0.4110 0.6502  315 PRO A CB  
1893 C CG  . PRO A 242 ? 1.9587 1.8060 2.0204  -0.0708 -0.4507 0.6624  315 PRO A CG  
1894 C CD  . PRO A 242 ? 2.0183 1.8577 2.0911  -0.0717 -0.4560 0.6564  315 PRO A CD  
1895 N N   . ASN A 243 ? 1.6425 1.6519 1.7914  -0.0256 -0.3418 0.6023  316 ASN A N   
1896 C CA  . ASN A 243 ? 1.4728 1.5359 1.6506  -0.0283 -0.3061 0.6023  316 ASN A CA  
1897 C C   . ASN A 243 ? 1.4925 1.5839 1.6698  -0.0202 -0.2840 0.5951  316 ASN A C   
1898 O O   . ASN A 243 ? 1.6303 1.7369 1.8121  0.0006  -0.2714 0.5704  316 ASN A O   
1899 C CB  . ASN A 243 ? 1.4529 1.5274 1.6474  -0.0125 -0.2983 0.5803  316 ASN A CB  
1900 C CG  . ASN A 243 ? 1.5341 1.6578 1.7588  -0.0189 -0.2658 0.5852  316 ASN A CG  
1901 O OD1 . ASN A 243 ? 1.4757 1.6313 1.7096  -0.0263 -0.2426 0.5955  316 ASN A OD1 
1902 N ND2 . ASN A 243 ? 1.7497 1.8795 1.9896  -0.0156 -0.2640 0.5778  316 ASN A ND2 
1903 N N   . TRP A 244 ? 1.5070 1.6070 1.6781  -0.0379 -0.2793 0.6174  317 TRP A N   
1904 C CA  . TRP A 244 ? 1.6573 1.7792 1.8228  -0.0324 -0.2620 0.6122  317 TRP A CA  
1905 C C   . TRP A 244 ? 1.8015 1.9724 1.9906  -0.0254 -0.2246 0.6006  317 TRP A C   
1906 O O   . TRP A 244 ? 1.9298 2.1170 2.1142  -0.0147 -0.2102 0.5871  317 TRP A O   
1907 C CB  . TRP A 244 ? 1.7974 1.9184 1.9503  -0.0554 -0.2657 0.6406  317 TRP A CB  
1908 C CG  . TRP A 244 ? 1.9282 1.9988 2.0563  -0.0653 -0.3032 0.6552  317 TRP A CG  
1909 C CD1 . TRP A 244 ? 2.0401 2.0910 2.1666  -0.0865 -0.3208 0.6786  317 TRP A CD1 
1910 C CD2 . TRP A 244 ? 1.9171 1.9498 2.0178  -0.0550 -0.3283 0.6485  317 TRP A CD2 
1911 N NE1 . TRP A 244 ? 2.0340 2.0340 2.1326  -0.0905 -0.3558 0.6863  317 TRP A NE1 
1912 C CE2 . TRP A 244 ? 1.9117 1.8995 1.9946  -0.0705 -0.3610 0.6682  317 TRP A CE2 
1913 C CE3 . TRP A 244 ? 1.8205 1.8530 1.9102  -0.0344 -0.3270 0.6281  317 TRP A CE3 
1914 C CZ2 . TRP A 244 ? 1.8494 1.7901 1.9037  -0.0647 -0.3923 0.6679  317 TRP A CZ2 
1915 C CZ3 . TRP A 244 ? 1.7227 1.7120 1.7856  -0.0284 -0.3577 0.6282  317 TRP A CZ3 
1916 C CH2 . TRP A 244 ? 1.8093 1.7522 1.8547  -0.0428 -0.3900 0.6478  317 TRP A CH2 
1917 N N   . GLN A 245 ? 1.9233 2.1146 2.1366  -0.0284 -0.2109 0.6021  318 GLN A N   
1918 C CA  . GLN A 245 ? 1.9773 2.2116 2.2129  -0.0212 -0.1766 0.5914  318 GLN A CA  
1919 C C   . GLN A 245 ? 2.1250 2.3601 2.3608  0.0027  -0.1727 0.5604  318 GLN A C   
1920 O O   . GLN A 245 ? 2.1935 2.4586 2.4389  0.0107  -0.1467 0.5481  318 GLN A O   
1921 C CB  . GLN A 245 ? 2.2416 2.4961 2.5033  -0.0312 -0.1653 0.6034  318 GLN A CB  
1922 C CG  . GLN A 245 ? 2.4576 2.7215 2.7237  -0.0558 -0.1648 0.6351  318 GLN A CG  
1923 C CD  . GLN A 245 ? 2.5682 2.8660 2.8372  -0.0623 -0.1385 0.6441  318 GLN A CD  
1924 O OE1 . GLN A 245 ? 2.5225 2.8430 2.7975  -0.0491 -0.1147 0.6270  318 GLN A OE1 
1925 N NE2 . GLN A 245 ? 2.6663 2.9677 2.9302  -0.0834 -0.1428 0.6708  318 GLN A NE2 
1926 N N   . LYS A 246 ? 1.8669 2.0679 2.0880  0.0143  -0.1994 0.5478  319 LYS A N   
1927 C CA  . LYS A 246 ? 1.7133 1.9171 1.9341  0.0372  -0.1975 0.5186  319 LYS A CA  
1928 C C   . LYS A 246 ? 1.5039 1.7156 1.7110  0.0452  -0.1907 0.5089  319 LYS A C   
1929 O O   . LYS A 246 ? 1.6717 1.9041 1.8840  0.0597  -0.1757 0.4878  319 LYS A O   
1930 C CB  . LYS A 246 ? 1.4597 1.6257 1.6682  0.0482  -0.2284 0.5078  319 LYS A CB  
1931 C CG  . LYS A 246 ? 1.3637 1.5277 1.5871  0.0467  -0.2316 0.5068  319 LYS A CG  
1932 C CD  . LYS A 246 ? 1.3334 1.5322 1.5776  0.0581  -0.2074 0.4885  319 LYS A CD  
1933 C CE  . LYS A 246 ? 1.3944 1.5898 1.6515  0.0564  -0.2131 0.4877  319 LYS A CE  
1934 N NZ  . LYS A 246 ? 1.5258 1.7538 1.8022  0.0669  -0.1912 0.4706  319 LYS A NZ  
1935 N N   . LEU A 247 ? 1.1821 1.3783 1.3709  0.0347  -0.2021 0.5250  320 LEU A N   
1936 C CA  . LEU A 247 ? 1.1642 1.3680 1.3384  0.0408  -0.1968 0.5174  320 LEU A CA  
1937 C C   . LEU A 247 ? 1.4060 1.6519 1.5936  0.0375  -0.1614 0.5145  320 LEU A C   
1938 O O   . LEU A 247 ? 1.4135 1.6722 1.5930  0.0461  -0.1520 0.5008  320 LEU A O   
1939 C CB  . LEU A 247 ? 1.2762 1.4552 1.4278  0.0280  -0.2164 0.5377  320 LEU A CB  
1940 C CG  . LEU A 247 ? 1.5214 1.6527 1.6552  0.0332  -0.2540 0.5391  320 LEU A CG  
1941 C CD1 . LEU A 247 ? 1.8210 1.9283 1.9322  0.0184  -0.2726 0.5614  320 LEU A CD1 
1942 C CD2 . LEU A 247 ? 1.1498 1.2723 1.2768  0.0594  -0.2642 0.5111  320 LEU A CD2 
1943 N N   . LEU A 248 ? 1.5133 1.7806 1.7207  0.0254  -0.1418 0.5272  321 LEU A N   
1944 C CA  . LEU A 248 ? 1.6430 1.9477 1.8629  0.0243  -0.1080 0.5229  321 LEU A CA  
1945 C C   . LEU A 248 ? 1.9136 2.2339 2.1450  0.0415  -0.0942 0.4968  321 LEU A C   
1946 O O   . LEU A 248 ? 2.1071 2.4509 2.3402  0.0448  -0.0712 0.4865  321 LEU A O   
1947 C CB  . LEU A 248 ? 1.5389 1.8634 1.7780  0.0087  -0.0910 0.5435  321 LEU A CB  
1948 C CG  . LEU A 248 ? 1.6266 1.9450 1.8559  -0.0113 -0.0995 0.5712  321 LEU A CG  
1949 C CD1 . LEU A 248 ? 1.9265 2.2718 2.1784  -0.0248 -0.0800 0.5899  321 LEU A CD1 
1950 C CD2 . LEU A 248 ? 1.6306 1.9542 1.8394  -0.0142 -0.0940 0.5718  321 LEU A CD2 
1951 N N   . GLU A 249 ? 1.5866 1.8944 1.8249  0.0515  -0.1077 0.4861  322 GLU A N   
1952 C CA  . GLU A 249 ? 1.4197 1.7430 1.6679  0.0669  -0.0966 0.4620  322 GLU A CA  
1953 C C   . GLU A 249 ? 1.4250 1.7442 1.6555  0.0808  -0.1048 0.4426  322 GLU A C   
1954 O O   . GLU A 249 ? 1.3977 1.6911 1.6115  0.0863  -0.1307 0.4416  322 GLU A O   
1955 C CB  . GLU A 249 ? 1.6917 2.0046 1.9514  0.0727  -0.1093 0.4569  322 GLU A CB  
1956 C CG  . GLU A 249 ? 1.8226 2.1400 2.1006  0.0590  -0.1037 0.4762  322 GLU A CG  
1957 C CD  . GLU A 249 ? 1.9543 2.2606 2.2411  0.0643  -0.1176 0.4704  322 GLU A CD  
1958 O OE1 . GLU A 249 ? 1.8555 2.1533 2.1350  0.0797  -0.1291 0.4497  322 GLU A OE1 
1959 O OE2 . GLU A 249 ? 2.1550 2.4628 2.4558  0.0530  -0.1171 0.4864  322 GLU A OE2 
1960 N N   . THR A 250 ? 1.7706 2.1150 2.0050  0.0867  -0.0835 0.4271  323 THR A N   
1961 C CA  . THR A 250 ? 1.8664 2.2129 2.0853  0.0985  -0.0890 0.4092  323 THR A CA  
1962 C C   . THR A 250 ? 1.7759 2.1158 1.9954  0.1157  -0.1058 0.3900  323 THR A C   
1963 O O   . THR A 250 ? 1.8579 2.2000 2.0655  0.1273  -0.1138 0.3750  323 THR A O   
1964 C CB  . THR A 250 ? 2.0778 2.4533 2.2998  0.0975  -0.0609 0.3987  323 THR A CB  
1965 O OG1 . THR A 250 ? 2.2217 2.6017 2.4291  0.1080  -0.0670 0.3816  323 THR A OG1 
1966 C CG2 . THR A 250 ? 1.9900 2.3841 2.2338  0.1003  -0.0425 0.3896  323 THR A CG2 
1967 N N   . GLY A 251 ? 1.8004 2.1341 2.0333  0.1175  -0.1113 0.3903  324 GLY A N   
1968 C CA  . GLY A 251 ? 1.8114 2.1411 2.0457  0.1336  -0.1257 0.3718  324 GLY A CA  
1969 C C   . GLY A 251 ? 1.5249 1.8219 1.7421  0.1425  -0.1576 0.3715  324 GLY A C   
1970 O O   . GLY A 251 ? 1.6240 1.9206 1.8336  0.1595  -0.1698 0.3530  324 GLY A O   
1971 N N   . VAL A 252 ? 1.2679 1.5374 1.4787  0.1311  -0.1718 0.3921  325 VAL A N   
1972 C CA  . VAL A 252 ? 1.2536 1.4857 1.4472  0.1387  -0.2041 0.3931  325 VAL A CA  
1973 C C   . VAL A 252 ? 1.3380 1.5631 1.5122  0.1481  -0.2157 0.3872  325 VAL A C   
1974 O O   . VAL A 252 ? 1.3514 1.5523 1.5125  0.1629  -0.2409 0.3784  325 VAL A O   
1975 C CB  . VAL A 252 ? 1.2401 1.4445 1.4306  0.1211  -0.2164 0.4187  325 VAL A CB  
1976 C CG1 . VAL A 252 ? 1.3059 1.5197 1.5166  0.1121  -0.2058 0.4246  325 VAL A CG1 
1977 C CG2 . VAL A 252 ? 1.2613 1.4700 1.4452  0.1042  -0.2073 0.4390  325 VAL A CG2 
1978 N N   . TRP A 253 ? 1.4360 1.6819 1.6077  0.1405  -0.1981 0.3915  326 TRP A N   
1979 C CA  . TRP A 253 ? 1.7704 2.0134 1.9240  0.1489  -0.2083 0.3859  326 TRP A CA  
1980 C C   . TRP A 253 ? 1.7867 2.0482 1.9425  0.1702  -0.2089 0.3590  326 TRP A C   
1981 O O   . TRP A 253 ? 1.6773 1.9258 1.8197  0.1855  -0.2298 0.3503  326 TRP A O   
1982 C CB  . TRP A 253 ? 1.7169 1.9792 1.8662  0.1342  -0.1882 0.3967  326 TRP A CB  
1983 C CG  . TRP A 253 ? 1.5290 1.7736 1.6716  0.1144  -0.1916 0.4237  326 TRP A CG  
1984 C CD1 . TRP A 253 ? 1.4049 1.6558 1.5608  0.0978  -0.1767 0.4397  326 TRP A CD1 
1985 C CD2 . TRP A 253 ? 1.3979 1.6175 1.5191  0.1086  -0.2118 0.4389  326 TRP A CD2 
1986 N NE1 . TRP A 253 ? 1.2063 1.4398 1.3505  0.0814  -0.1858 0.4639  326 TRP A NE1 
1987 C CE2 . TRP A 253 ? 1.3413 1.5543 1.4635  0.0870  -0.2076 0.4641  326 TRP A CE2 
1988 C CE3 . TRP A 253 ? 1.3157 1.5189 1.4173  0.1194  -0.2335 0.4343  326 TRP A CE3 
1989 C CZ2 . TRP A 253 ? 1.6339 1.8243 1.7370  0.0747  -0.2243 0.4850  326 TRP A CZ2 
1990 C CZ3 . TRP A 253 ? 1.5787 1.7571 1.6613  0.1080  -0.2506 0.4551  326 TRP A CZ3 
1991 C CH2 . TRP A 253 ? 1.7041 1.8761 1.7870  0.0851  -0.2459 0.4803  326 TRP A CH2 
1992 N N   . ILE A 254 ? 1.8072 2.1003 1.9803  0.1714  -0.1862 0.3464  327 ILE A N   
1993 C CA  . ILE A 254 ? 1.6619 1.9772 1.8390  0.1896  -0.1853 0.3215  327 ILE A CA  
1994 C C   . ILE A 254 ? 1.5404 1.8361 1.7170  0.2063  -0.2085 0.3110  327 ILE A C   
1995 O O   . ILE A 254 ? 1.6399 1.9395 1.8104  0.2257  -0.2218 0.2937  327 ILE A O   
1996 C CB  . ILE A 254 ? 1.5241 1.8750 1.7192  0.1837  -0.1558 0.3134  327 ILE A CB  
1997 C CG1 . ILE A 254 ? 1.4990 1.8650 1.6918  0.1681  -0.1337 0.3230  327 ILE A CG1 
1998 C CG2 . ILE A 254 ? 1.6474 2.0246 1.8468  0.2003  -0.1545 0.2887  327 ILE A CG2 
1999 C CD1 . ILE A 254 ? 1.6145 2.0091 1.8236  0.1605  -0.1047 0.3179  327 ILE A CD1 
2000 N N   . ASP A 255 ? 1.4264 1.7015 1.6090  0.1994  -0.2139 0.3211  328 ASP A N   
2001 C CA  . ASP A 255 ? 1.2583 1.5102 1.4378  0.2139  -0.2368 0.3117  328 ASP A CA  
2002 C C   . ASP A 255 ? 1.3697 1.5871 1.5281  0.2258  -0.2665 0.3124  328 ASP A C   
2003 O O   . ASP A 255 ? 1.5471 1.7581 1.6999  0.2474  -0.2835 0.2945  328 ASP A O   
2004 C CB  . ASP A 255 ? 1.4269 1.6605 1.6144  0.2003  -0.2380 0.3258  328 ASP A CB  
2005 C CG  . ASP A 255 ? 1.5665 1.8324 1.7758  0.1935  -0.2128 0.3218  328 ASP A CG  
2006 O OD1 . ASP A 255 ? 1.8407 2.1407 2.0582  0.1927  -0.1905 0.3144  328 ASP A OD1 
2007 O OD2 . ASP A 255 ? 1.2755 1.5315 1.4927  0.1883  -0.2160 0.3266  328 ASP A OD2 
2008 N N   . ALA A 256 ? 1.3397 1.5349 1.4861  0.2122  -0.2732 0.3334  329 ALA A N   
2009 C CA  . ALA A 256 ? 1.4971 1.6570 1.6224  0.2217  -0.3021 0.3370  329 ALA A CA  
2010 C C   . ALA A 256 ? 1.4582 1.6384 1.5775  0.2402  -0.3043 0.3200  329 ALA A C   
2011 O O   . ALA A 256 ? 1.4125 1.5737 1.5209  0.2611  -0.3280 0.3087  329 ALA A O   
2012 C CB  . ALA A 256 ? 1.4383 1.5755 1.5523  0.2001  -0.3064 0.3648  329 ALA A CB  
2013 N N   . ALA A 257 ? 1.4573 1.6760 1.5834  0.2332  -0.2799 0.3179  330 ALA A N   
2014 C CA  . ALA A 257 ? 1.4242 1.6671 1.5456  0.2484  -0.2804 0.3024  330 ALA A CA  
2015 C C   . ALA A 257 ? 1.0695 1.3282 1.1984  0.2727  -0.2863 0.2767  330 ALA A C   
2016 O O   . ALA A 257 ? 1.1448 1.3970 1.2644  0.2936  -0.3063 0.2656  330 ALA A O   
2017 C CB  . ALA A 257 ? 1.2723 1.5544 1.4005  0.2343  -0.2509 0.3033  330 ALA A CB  
2018 N N   . ALA A 258 ? 1.0375 1.3182 1.1833  0.2707  -0.2692 0.2672  331 ALA A N   
2019 C CA  . ALA A 258 ? 1.0286 1.3280 1.1820  0.2922  -0.2732 0.2431  331 ALA A CA  
2020 C C   . ALA A 258 ? 1.4785 1.7389 1.6209  0.3107  -0.3036 0.2381  331 ALA A C   
2021 O O   . ALA A 258 ? 1.3203 1.5875 1.4588  0.3350  -0.3174 0.2197  331 ALA A O   
2022 C CB  . ALA A 258 ? 0.9924 1.3167 1.1644  0.2835  -0.2511 0.2377  331 ALA A CB  
2023 N N   . GLN A 259 ? 1.1523 1.3713 1.2889  0.2996  -0.3149 0.2542  332 GLN A N   
2024 C CA  . GLN A 259 ? 1.3189 1.4954 1.4430  0.3156  -0.3445 0.2496  332 GLN A CA  
2025 C C   . GLN A 259 ? 1.3539 1.5093 1.4604  0.3331  -0.3686 0.2475  332 GLN A C   
2026 O O   . GLN A 259 ? 1.4529 1.5991 1.5536  0.3592  -0.3874 0.2295  332 GLN A O   
2027 C CB  . GLN A 259 ? 1.3228 1.4578 1.4420  0.2957  -0.3525 0.2714  332 GLN A CB  
2028 C CG  . GLN A 259 ? 1.3690 1.4512 1.4718  0.3078  -0.3849 0.2700  332 GLN A CG  
2029 C CD  . GLN A 259 ? 1.3220 1.4089 1.4295  0.3277  -0.3900 0.2459  332 GLN A CD  
2030 O OE1 . GLN A 259 ? 1.3509 1.4774 1.4756  0.3260  -0.3683 0.2352  332 GLN A OE1 
2031 N NE2 . GLN A 259 ? 1.2498 1.2954 1.3408  0.3467  -0.4192 0.2372  332 GLN A NE2 
2032 N N   . ILE A 260 ? 1.2633 1.4127 1.3612  0.3200  -0.3683 0.2654  333 ILE A N   
2033 C CA  . ILE A 260 ? 1.4230 1.5506 1.5036  0.3361  -0.3928 0.2654  333 ILE A CA  
2034 C C   . ILE A 260 ? 1.4598 1.6307 1.5461  0.3573  -0.3875 0.2442  333 ILE A C   
2035 O O   . ILE A 260 ? 1.4979 1.6558 1.5740  0.3807  -0.4100 0.2352  333 ILE A O   
2036 C CB  . ILE A 260 ? 1.2338 1.3419 1.3019  0.3144  -0.3953 0.2922  333 ILE A CB  
2037 C CG1 . ILE A 260 ? 1.6092 1.6770 1.6560  0.3286  -0.4279 0.2974  333 ILE A CG1 
2038 C CG2 . ILE A 260 ? 1.1987 1.3531 1.2741  0.3021  -0.3689 0.2944  333 ILE A CG2 
2039 C CD1 . ILE A 260 ? 1.7602 1.7747 1.7958  0.3407  -0.4567 0.2958  333 ILE A CD1 
2040 N N   . PHE A 261 ? 1.1543 1.3765 1.2575  0.3509  -0.3591 0.2347  334 PHE A N   
2041 C CA  . PHE A 261 ? 1.2746 1.5414 1.3841  0.3694  -0.3540 0.2145  334 PHE A CA  
2042 C C   . PHE A 261 ? 1.4844 1.7578 1.5989  0.3973  -0.3652 0.1903  334 PHE A C   
2043 O O   . PHE A 261 ? 1.1679 1.4439 1.2767  0.4227  -0.3829 0.1776  334 PHE A O   
2044 C CB  . PHE A 261 ? 1.0902 1.4076 1.2146  0.3527  -0.3212 0.2119  334 PHE A CB  
2045 C CG  . PHE A 261 ? 1.0714 1.4385 1.2041  0.3693  -0.3144 0.1904  334 PHE A CG  
2046 C CD1 . PHE A 261 ? 1.4387 1.8206 1.5637  0.3770  -0.3215 0.1895  334 PHE A CD1 
2047 C CD2 . PHE A 261 ? 1.0434 1.4440 1.1914  0.3767  -0.3020 0.1718  334 PHE A CD2 
2048 C CE1 . PHE A 261 ? 1.3968 1.8273 1.5300  0.3914  -0.3160 0.1705  334 PHE A CE1 
2049 C CE2 . PHE A 261 ? 1.0271 1.4763 1.1829  0.3907  -0.2963 0.1530  334 PHE A CE2 
2050 C CZ  . PHE A 261 ? 1.2766 1.7413 1.4254  0.3980  -0.3032 0.1523  334 PHE A CZ  
2051 N N   . PHE A 262 ? 1.3900 1.6674 1.5152  0.3935  -0.3552 0.1836  335 PHE A N   
2052 C CA  . PHE A 262 ? 1.3315 1.6164 1.4605  0.4190  -0.3648 0.1601  335 PHE A CA  
2053 C C   . PHE A 262 ? 1.6183 1.8497 1.7301  0.4392  -0.3979 0.1581  335 PHE A C   
2054 O O   . PHE A 262 ? 1.2031 1.4412 1.3133  0.4685  -0.4117 0.1373  335 PHE A O   
2055 C CB  . PHE A 262 ? 1.2906 1.5895 1.4332  0.4079  -0.3472 0.1554  335 PHE A CB  
2056 C CG  . PHE A 262 ? 1.1557 1.5108 1.3156  0.3950  -0.3167 0.1509  335 PHE A CG  
2057 C CD1 . PHE A 262 ? 1.1561 1.5169 1.3210  0.3670  -0.2962 0.1693  335 PHE A CD1 
2058 C CD2 . PHE A 262 ? 1.2038 1.6061 1.3743  0.4108  -0.3089 0.1282  335 PHE A CD2 
2059 C CE1 . PHE A 262 ? 1.0809 1.4889 1.2601  0.3553  -0.2693 0.1648  335 PHE A CE1 
2060 C CE2 . PHE A 262 ? 1.0386 1.4900 1.2237  0.3972  -0.2822 0.1250  335 PHE A CE2 
2061 C CZ  . PHE A 262 ? 1.0249 1.4769 1.2137  0.3696  -0.2627 0.1431  335 PHE A CZ  
2062 N N   . SER A 263 ? 1.4602 1.6383 1.5589  0.4244  -0.4112 0.1792  336 SER A N   
2063 C CA  . SER A 263 ? 1.5673 1.6906 1.6474  0.4431  -0.4446 0.1779  336 SER A CA  
2064 C C   . SER A 263 ? 1.7114 1.8328 1.7815  0.4636  -0.4620 0.1749  336 SER A C   
2065 O O   . SER A 263 ? 1.8453 1.9488 1.9071  0.4934  -0.4846 0.1592  336 SER A O   
2066 C CB  . SER A 263 ? 1.5580 1.6256 1.6254  0.4198  -0.4557 0.2034  336 SER A CB  
2067 O OG  . SER A 263 ? 1.6335 1.6436 1.6813  0.4366  -0.4890 0.2020  336 SER A OG  
2068 N N   . LEU A 264 ? 1.7179 1.8577 1.7882  0.4486  -0.4520 0.1897  337 LEU A N   
2069 C CA  . LEU A 264 ? 1.6419 1.7850 1.7036  0.4664  -0.4675 0.1881  337 LEU A CA  
2070 C C   . LEU A 264 ? 1.6342 1.8338 1.7092  0.4914  -0.4598 0.1623  337 LEU A C   
2071 O O   . LEU A 264 ? 1.3178 1.5142 1.3868  0.5197  -0.4801 0.1514  337 LEU A O   
2072 C CB  . LEU A 264 ? 1.6732 1.8187 1.7293  0.4413  -0.4596 0.2120  337 LEU A CB  
2073 C CG  . LEU A 264 ? 1.5676 1.6526 1.6067  0.4217  -0.4752 0.2381  337 LEU A CG  
2074 C CD1 . LEU A 264 ? 1.5223 1.6097 1.5532  0.3996  -0.4701 0.2611  337 LEU A CD1 
2075 C CD2 . LEU A 264 ? 1.3981 1.4260 1.4195  0.4443  -0.5116 0.2357  337 LEU A CD2 
2076 N N   . GLY A 265 ? 1.6435 1.8955 1.7368  0.4814  -0.4310 0.1527  338 GLY A N   
2077 C CA  . GLY A 265 ? 1.6074 1.9173 1.7146  0.5015  -0.4217 0.1289  338 GLY A CA  
2078 C C   . GLY A 265 ? 1.6149 1.9630 1.7234  0.5102  -0.4216 0.1264  338 GLY A C   
2079 O O   . GLY A 265 ? 1.6397 2.0168 1.7533  0.5384  -0.4298 0.1068  338 GLY A O   
2080 N N   . PRO A 266 ? 1.5730 1.9240 1.6770  0.4870  -0.4128 0.1454  339 PRO A N   
2081 C CA  . PRO A 266 ? 1.7123 2.1038 1.8176  0.4928  -0.4112 0.1427  339 PRO A CA  
2082 C C   . PRO A 266 ? 1.6819 2.1412 1.8056  0.4889  -0.3850 0.1270  339 PRO A C   
2083 O O   . PRO A 266 ? 1.4750 1.9491 1.6097  0.4763  -0.3650 0.1221  339 PRO A O   
2084 C CB  . PRO A 266 ? 1.7179 2.0910 1.8117  0.4645  -0.4064 0.1682  339 PRO A CB  
2085 C CG  . PRO A 266 ? 1.6005 1.9308 1.6899  0.4433  -0.4022 0.1834  339 PRO A CG  
2086 C CD  . PRO A 266 ? 1.5560 1.8580 1.6461  0.4628  -0.4174 0.1717  339 PRO A CD  
2087 N N   . GLY A 267 ? 1.7568 2.2580 1.8835  0.4993  -0.3860 0.1200  340 GLY A N   
2088 C CA  . GLY A 267 ? 1.6206 2.1855 1.7615  0.4889  -0.3612 0.1100  340 GLY A CA  
2089 C C   . GLY A 267 ? 1.4432 2.0521 1.6000  0.5094  -0.3567 0.0855  340 GLY A C   
2090 O O   . GLY A 267 ? 1.4060 2.0659 1.5753  0.4976  -0.3346 0.0775  340 GLY A O   
2091 N N   . PHE A 268 ? 1.2368 1.8264 1.3924  0.5391  -0.3772 0.0732  341 PHE A N   
2092 C CA  . PHE A 268 ? 1.3713 1.9971 1.5404  0.5594  -0.3736 0.0496  341 PHE A CA  
2093 C C   . PHE A 268 ? 1.4266 2.0828 1.5990  0.5948  -0.3914 0.0331  341 PHE A C   
2094 O O   . PHE A 268 ? 1.4723 2.1748 1.6576  0.6120  -0.3862 0.0124  341 PHE A O   
2095 C CB  . PHE A 268 ? 1.4777 2.0583 1.6430  0.5658  -0.3809 0.0459  341 PHE A CB  
2096 C CG  . PHE A 268 ? 1.5164 2.1361 1.6954  0.5786  -0.3713 0.0234  341 PHE A CG  
2097 C CD1 . PHE A 268 ? 1.2732 1.9238 1.4639  0.5546  -0.3446 0.0229  341 PHE A CD1 
2098 C CD2 . PHE A 268 ? 1.6040 2.2301 1.7835  0.6149  -0.3889 0.0028  341 PHE A CD2 
2099 C CE1 . PHE A 268 ? 1.0363 1.7242 1.2386  0.5648  -0.3360 0.0034  341 PHE A CE1 
2100 C CE2 . PHE A 268 ? 1.5104 2.1757 1.7016  0.6262  -0.3793 -0.0180 341 PHE A CE2 
2101 C CZ  . PHE A 268 ? 1.3038 2.0004 1.5062  0.6001  -0.3529 -0.0172 341 PHE A CZ  
2102 N N   . GLY A 269 ? 1.3729 2.0053 1.5340  0.6064  -0.4125 0.0423  342 GLY A N   
2103 C CA  . GLY A 269 ? 1.4732 2.1333 1.6375  0.6403  -0.4305 0.0291  342 GLY A CA  
2104 C C   . GLY A 269 ? 1.7616 2.3774 1.9177  0.6752  -0.4581 0.0193  342 GLY A C   
2105 O O   . GLY A 269 ? 1.8119 2.4361 1.9682  0.6978  -0.4696 0.0085  342 GLY A O   
2106 N N   . VAL A 270 ? 1.5860 2.1463 1.7332  0.6702  -0.4622 0.0225  343 VAL A N   
2107 C CA  . VAL A 270 ? 1.5395 2.0465 1.6749  0.6986  -0.4881 0.0141  343 VAL A CA  
2108 C C   . VAL A 270 ? 1.4735 1.9290 1.5918  0.7022  -0.5121 0.0313  343 VAL A C   
2109 O O   . VAL A 270 ? 1.3830 1.8227 1.4962  0.7245  -0.5274 0.0221  343 VAL A O   
2110 C CB  . VAL A 270 ? 1.4570 1.9187 1.5862  0.6903  -0.4877 0.0147  343 VAL A CB  
2111 C CG1 . VAL A 270 ? 1.4266 1.8163 1.5374  0.7109  -0.5162 0.0127  343 VAL A CG1 
2112 C CG2 . VAL A 270 ? 1.2616 1.7726 1.4066  0.6944  -0.4680 -0.0071 343 VAL A CG2 
2113 N N   . LEU A 271 ? 1.4366 1.8629 1.5449  0.6754  -0.5124 0.0570  344 LEU A N   
2114 C CA  . LEU A 271 ? 1.6503 2.0320 1.7415  0.6774  -0.5362 0.0760  344 LEU A CA  
2115 C C   . LEU A 271 ? 1.9428 2.3710 2.0404  0.6883  -0.5378 0.0731  344 LEU A C   
2116 O O   . LEU A 271 ? 2.0991 2.4957 2.1861  0.6999  -0.5580 0.0788  344 LEU A O   
2117 C CB  . LEU A 271 ? 1.3718 1.7214 1.4524  0.6363  -0.5263 0.1038  344 LEU A CB  
2118 C CG  . LEU A 271 ? 1.3582 1.6745 1.4370  0.6134  -0.5145 0.1093  344 LEU A CG  
2119 C CD1 . LEU A 271 ? 1.4801 1.7790 1.5516  0.5735  -0.5015 0.1362  344 LEU A CD1 
2120 C CD2 . LEU A 271 ? 1.4076 1.6579 1.4725  0.6321  -0.5408 0.1063  344 LEU A CD2 
2121 N N   . LEU A 272 ? 2.0617 2.5638 2.1765  0.6815  -0.5153 0.0648  345 LEU A N   
2122 C CA  . LEU A 272 ? 1.7680 2.3196 1.8902  0.6880  -0.5136 0.0608  345 LEU A CA  
2123 C C   . LEU A 272 ? 1.7084 2.2618 1.8351  0.7181  -0.5234 0.0399  345 LEU A C   
2124 O O   . LEU A 272 ? 1.8523 2.3980 1.9742  0.7305  -0.5390 0.0435  345 LEU A O   
2125 C CB  . LEU A 272 ? 1.7010 2.3306 1.8406  0.6727  -0.4864 0.0544  345 LEU A CB  
2126 C CG  . LEU A 272 ? 1.5981 2.2823 1.7429  0.6659  -0.4811 0.0587  345 LEU A CG  
2127 C CD1 . LEU A 272 ? 1.6943 2.3499 1.8238  0.6336  -0.4785 0.0849  345 LEU A CD1 
2128 C CD2 . LEU A 272 ? 1.5327 2.2936 1.6968  0.6566  -0.4546 0.0441  345 LEU A CD2 
2129 N N   . ALA A 273 ? 1.8456 2.4096 1.9807  0.7307  -0.5145 0.0180  346 ALA A N   
2130 C CA  . ALA A 273 ? 1.8493 2.4183 1.9876  0.7610  -0.5219 -0.0042 346 ALA A CA  
2131 C C   . ALA A 273 ? 1.8863 2.3782 2.0062  0.7785  -0.5497 0.0005  346 ALA A C   
2132 O O   . ALA A 273 ? 2.0608 2.5504 2.1791  0.8006  -0.5629 -0.0062 346 ALA A O   
2133 C CB  . ALA A 273 ? 1.8603 2.4574 2.0090  0.7683  -0.5056 -0.0278 346 ALA A CB  
2134 N N   . PHE A 274 ? 1.7231 2.1511 1.8285  0.7685  -0.5592 0.0122  347 PHE A N   
2135 C CA  . PHE A 274 ? 1.8062 2.1566 1.8920  0.7817  -0.5861 0.0180  347 PHE A CA  
2136 C C   . PHE A 274 ? 2.0748 2.4056 2.1515  0.7783  -0.6028 0.0392  347 PHE A C   
2137 O O   . PHE A 274 ? 2.1492 2.4397 2.2153  0.7975  -0.6238 0.0383  347 PHE A O   
2138 C CB  . PHE A 274 ? 1.8780 2.1673 1.9500  0.7661  -0.5918 0.0292  347 PHE A CB  
2139 C CG  . PHE A 274 ? 1.8638 2.1428 1.9365  0.7794  -0.5880 0.0068  347 PHE A CG  
2140 C CD1 . PHE A 274 ? 2.0649 2.3801 2.1468  0.8063  -0.5828 -0.0214 347 PHE A CD1 
2141 C CD2 . PHE A 274 ? 1.6175 1.8517 1.6809  0.7648  -0.5901 0.0141  347 PHE A CD2 
2142 C CE1 . PHE A 274 ? 2.0018 2.3089 2.0824  0.8188  -0.5796 -0.0426 347 PHE A CE1 
2143 C CE2 . PHE A 274 ? 1.6339 1.8591 1.6968  0.7768  -0.5876 -0.0064 347 PHE A CE2 
2144 C CZ  . PHE A 274 ? 1.8154 2.0772 1.8864  0.8040  -0.5824 -0.0352 347 PHE A CZ  
2145 N N   . ALA A 275 ? 2.0395 2.3978 2.1190  0.7539  -0.5943 0.0585  348 ALA A N   
2146 C CA  . ALA A 275 ? 2.2232 2.5677 2.2933  0.7484  -0.6094 0.0797  348 ALA A CA  
2147 C C   . ALA A 275 ? 2.2156 2.6128 2.2981  0.7667  -0.6089 0.0684  348 ALA A C   
2148 O O   . ALA A 275 ? 2.2805 2.6563 2.3549  0.7745  -0.6275 0.0794  348 ALA A O   
2149 C CB  . ALA A 275 ? 2.3096 2.6671 2.3760  0.7166  -0.6003 0.1030  348 ALA A CB  
2150 N N   . SER A 276 ? 2.0899 2.5561 2.1920  0.7730  -0.5879 0.0474  349 SER A N   
2151 C CA  . SER A 276 ? 1.7879 2.3105 1.9033  0.7893  -0.5854 0.0357  349 SER A CA  
2152 C C   . SER A 276 ? 2.0910 2.5789 2.2007  0.8208  -0.6068 0.0267  349 SER A C   
2153 O O   . SER A 276 ? 2.3596 2.8577 2.4699  0.8298  -0.6185 0.0332  349 SER A O   
2154 C CB  . SER A 276 ? 1.6704 2.2651 1.8057  0.7913  -0.5597 0.0126  349 SER A CB  
2155 O OG  . SER A 276 ? 1.5801 2.2308 1.7282  0.8070  -0.5570 0.0006  349 SER A OG  
2156 N N   . TYR A 277 ? 1.9273 2.3740 2.0307  0.8381  -0.6127 0.0116  350 TYR A N   
2157 C CA  . TYR A 277 ? 2.0911 2.4978 2.1862  0.8691  -0.6338 0.0017  350 TYR A CA  
2158 C C   . TYR A 277 ? 1.9444 2.2672 2.0170  0.8628  -0.6590 0.0248  350 TYR A C   
2159 O O   . TYR A 277 ? 1.7739 2.0343 1.8317  0.8637  -0.6687 0.0242  350 TYR A O   
2160 C CB  . TYR A 277 ? 2.1866 2.5881 2.2827  0.8907  -0.6289 -0.0265 350 TYR A CB  
2161 C CG  . TYR A 277 ? 2.1203 2.6029 2.2367  0.8934  -0.6027 -0.0483 350 TYR A CG  
2162 C CD1 . TYR A 277 ? 2.3596 2.8952 2.4884  0.9171  -0.5990 -0.0664 350 TYR A CD1 
2163 C CD2 . TYR A 277 ? 1.6361 2.1423 1.7588  0.8718  -0.5820 -0.0501 350 TYR A CD2 
2164 C CE1 . TYR A 277 ? 2.2335 2.8439 2.3795  0.9174  -0.5751 -0.0853 350 TYR A CE1 
2165 C CE2 . TYR A 277 ? 1.6034 2.1830 1.7436  0.8722  -0.5583 -0.0688 350 TYR A CE2 
2166 C CZ  . TYR A 277 ? 1.8785 2.5099 2.0297  0.8943  -0.5549 -0.0863 350 TYR A CZ  
2167 O OH  . TYR A 277 ? 1.6112 2.3162 1.7785  0.8928  -0.5314 -0.1038 350 TYR A OH  
2168 N N   . ASN A 278 ? 1.9776 2.2995 2.0469  0.8550  -0.6702 0.0461  351 ASN A N   
2169 C CA  . ASN A 278 ? 2.1184 2.3646 2.1658  0.8468  -0.6942 0.0704  351 ASN A CA  
2170 C C   . ASN A 278 ? 2.3392 2.5990 2.3865  0.8470  -0.7066 0.0878  351 ASN A C   
2171 O O   . ASN A 278 ? 2.0553 2.3837 2.1191  0.8483  -0.6953 0.0835  351 ASN A O   
2172 C CB  . ASN A 278 ? 2.1752 2.3905 2.2114  0.8132  -0.6896 0.0908  351 ASN A CB  
2173 C CG  . ASN A 278 ? 2.4311 2.5569 2.4425  0.8075  -0.7132 0.1086  351 ASN A CG  
2174 O OD1 . ASN A 278 ? 2.7382 2.8376 2.7369  0.7900  -0.7254 0.1354  351 ASN A OD1 
2175 N ND2 . ASN A 278 ? 2.1656 2.2445 2.1685  0.8211  -0.7200 0.0939  351 ASN A ND2 
2176 N N   . LYS A 279 ? 2.6134 2.8066 2.6410  0.8440  -0.7304 0.1083  352 LYS A N   
2177 C CA  . LYS A 279 ? 2.7005 2.8971 2.7247  0.8425  -0.7453 0.1283  352 LYS A CA  
2178 C C   . LYS A 279 ? 2.6571 2.8933 2.6832  0.8105  -0.7341 0.1493  352 LYS A C   
2179 O O   . LYS A 279 ? 2.6179 2.8440 2.6373  0.7846  -0.7239 0.1592  352 LYS A O   
2180 C CB  . LYS A 279 ? 2.7948 2.9063 2.7950  0.8433  -0.7729 0.1467  352 LYS A CB  
2181 C CG  . LYS A 279 ? 2.7846 2.8414 2.7764  0.8700  -0.7853 0.1274  352 LYS A CG  
2182 C CD  . LYS A 279 ? 2.8235 2.7951 2.7898  0.8668  -0.8128 0.1477  352 LYS A CD  
2183 C CE  . LYS A 279 ? 2.8077 2.7820 2.7732  0.8786  -0.8306 0.1608  352 LYS A CE  
2184 N NZ  . LYS A 279 ? 2.7282 2.7326 2.7085  0.9177  -0.8332 0.1351  352 LYS A NZ  
2185 N N   . PHE A 280 ? 2.6188 2.9010 2.6533  0.8129  -0.7364 0.1557  353 PHE A N   
2186 C CA  . PHE A 280 ? 2.4851 2.8087 2.5197  0.7839  -0.7263 0.1736  353 PHE A CA  
2187 C C   . PHE A 280 ? 2.3936 2.6614 2.4037  0.7589  -0.7416 0.2058  353 PHE A C   
2188 O O   . PHE A 280 ? 2.1652 2.4429 2.1683  0.7303  -0.7308 0.2196  353 PHE A O   
2189 C CB  . PHE A 280 ? 2.4990 2.8866 2.5480  0.7928  -0.7259 0.1714  353 PHE A CB  
2190 C CG  . PHE A 280 ? 2.4146 2.8584 2.4664  0.7653  -0.7107 0.1817  353 PHE A CG  
2191 C CD1 . PHE A 280 ? 2.3274 2.8363 2.3964  0.7603  -0.6847 0.1632  353 PHE A CD1 
2192 C CD2 . PHE A 280 ? 2.4478 2.8788 2.4831  0.7436  -0.7222 0.2099  353 PHE A CD2 
2193 C CE1 . PHE A 280 ? 2.2365 2.7957 2.3060  0.7348  -0.6705 0.1718  353 PHE A CE1 
2194 C CE2 . PHE A 280 ? 2.3462 2.8279 2.3810  0.7187  -0.7084 0.2181  353 PHE A CE2 
2195 C CZ  . PHE A 280 ? 2.2182 2.7635 2.2699  0.7145  -0.6824 0.1986  353 PHE A CZ  
2196 N N   . ASN A 281 ? 2.2934 2.5034 2.2893  0.7689  -0.7663 0.2182  354 ASN A N   
2197 C CA  . ASN A 281 ? 2.2516 2.4075 2.2228  0.7449  -0.7817 0.2497  354 ASN A CA  
2198 C C   . ASN A 281 ? 2.1671 2.2566 2.1224  0.7334  -0.7836 0.2537  354 ASN A C   
2199 O O   . ASN A 281 ? 2.0275 2.0667 1.9609  0.7120  -0.7960 0.2796  354 ASN A O   
2200 C CB  . ASN A 281 ? 2.3293 2.4532 2.2913  0.7592  -0.8077 0.2630  354 ASN A CB  
2201 C CG  . ASN A 281 ? 2.2646 2.4227 2.2228  0.7433  -0.8128 0.2856  354 ASN A CG  
2202 O OD1 . ASN A 281 ? 2.1412 2.3604 2.1166  0.7546  -0.8083 0.2769  354 ASN A OD1 
2203 N ND2 . ASN A 281 ? 2.3524 2.4723 2.2871  0.7160  -0.8223 0.3148  354 ASN A ND2 
2204 N N   . ASN A 282 ? 2.1968 2.2869 2.1624  0.7460  -0.7717 0.2292  355 ASN A N   
2205 C CA  . ASN A 282 ? 2.2161 2.2454 2.1680  0.7358  -0.7735 0.2310  355 ASN A CA  
2206 C C   . ASN A 282 ? 1.9879 2.0189 1.9315  0.6997  -0.7612 0.2501  355 ASN A C   
2207 O O   . ASN A 282 ? 1.9326 2.0237 1.8873  0.6879  -0.7427 0.2490  355 ASN A O   
2208 C CB  . ASN A 282 ? 2.2924 2.3289 2.2576  0.7577  -0.7627 0.1993  355 ASN A CB  
2209 C CG  . ASN A 282 ? 2.3542 2.3335 2.3061  0.7449  -0.7633 0.2009  355 ASN A CG  
2210 O OD1 . ASN A 282 ? 2.5092 2.5089 2.4668  0.7281  -0.7449 0.1988  355 ASN A OD1 
2211 N ND2 . ASN A 282 ? 2.3627 2.2692 2.2963  0.7524  -0.7852 0.2052  355 ASN A ND2 
2212 N N   . ASN A 283 ? 2.0436 2.0076 1.9666  0.6819  -0.7718 0.2674  356 ASN A N   
2213 C CA  . ASN A 283 ? 2.0923 2.0501 2.0052  0.6471  -0.7621 0.2875  356 ASN A CA  
2214 C C   . ASN A 283 ? 2.3318 2.3158 2.2586  0.6440  -0.7398 0.2699  356 ASN A C   
2215 O O   . ASN A 283 ? 2.5736 2.5420 2.5072  0.6618  -0.7384 0.2486  356 ASN A O   
2216 C CB  . ASN A 283 ? 2.0662 1.9447 1.9534  0.6284  -0.7801 0.3110  356 ASN A CB  
2217 C CG  . ASN A 283 ? 2.1569 2.0291 2.0320  0.5904  -0.7716 0.3356  356 ASN A CG  
2218 O OD1 . ASN A 283 ? 2.0998 1.9673 1.9782  0.5786  -0.7590 0.3316  356 ASN A OD1 
2219 N ND2 . ASN A 283 ? 2.2757 2.1483 2.1364  0.5708  -0.7785 0.3614  356 ASN A ND2 
2220 N N   . CYS A 284 ? 2.4355 2.4592 2.3652  0.6215  -0.7225 0.2786  357 CYS A N   
2221 C CA  . CYS A 284 ? 2.0843 2.1357 2.0265  0.6156  -0.7003 0.2651  357 CYS A CA  
2222 C C   . CYS A 284 ? 2.2166 2.2269 2.1441  0.5852  -0.6989 0.2860  357 CYS A C   
2223 O O   . CYS A 284 ? 2.5290 2.5338 2.4633  0.5827  -0.6879 0.2760  357 CYS A O   
2224 C CB  . CYS A 284 ? 2.0448 2.1774 2.0027  0.6141  -0.6789 0.2562  357 CYS A CB  
2225 S SG  . CYS A 284 ? 2.4846 2.6754 2.4603  0.6428  -0.6795 0.2367  357 CYS A SG  
2226 N N   . TYR A 285 ? 2.2397 2.2237 2.1476  0.5610  -0.7094 0.3153  358 TYR A N   
2227 C CA  . TYR A 285 ? 2.4862 2.4376 2.3826  0.5231  -0.7002 0.3373  358 TYR A CA  
2228 C C   . TYR A 285 ? 2.6753 2.5608 2.5633  0.5281  -0.7171 0.3374  358 TYR A C   
2229 O O   . TYR A 285 ? 2.8508 2.7348 2.7465  0.5141  -0.6993 0.3325  358 TYR A O   
2230 C CB  . TYR A 285 ? 2.4661 2.3987 2.3415  0.4993  -0.7119 0.3684  358 TYR A CB  
2231 C CG  . TYR A 285 ? 2.3737 2.2958 2.2404  0.4551  -0.6936 0.3915  358 TYR A CG  
2232 C CD1 . TYR A 285 ? 2.2532 2.2311 2.1303  0.4295  -0.6579 0.3913  358 TYR A CD1 
2233 C CD2 . TYR A 285 ? 2.4370 2.2933 2.2846  0.4391  -0.7127 0.4139  358 TYR A CD2 
2234 C CE1 . TYR A 285 ? 2.2303 2.2005 2.1000  0.3912  -0.6407 0.4118  358 TYR A CE1 
2235 C CE2 . TYR A 285 ? 2.3660 2.2168 2.2067  0.3991  -0.6959 0.4356  358 TYR A CE2 
2236 C CZ  . TYR A 285 ? 2.4043 2.3130 2.2566  0.3763  -0.6595 0.4341  358 TYR A CZ  
2237 O OH  . TYR A 285 ? 2.4862 2.3914 2.3323  0.3385  -0.6421 0.4550  358 TYR A OH  
2238 N N   . GLN A 286 ? 2.8224 2.6592 2.6983  0.5391  -0.7384 0.3401  359 GLN A N   
2239 C CA  . GLN A 286 ? 2.9703 2.7426 2.8363  0.5386  -0.7503 0.3392  359 GLN A CA  
2240 C C   . GLN A 286 ? 2.9681 2.7526 2.8508  0.5600  -0.7403 0.3091  359 GLN A C   
2241 O O   . GLN A 286 ? 3.0087 2.7603 2.8878  0.5488  -0.7391 0.3097  359 GLN A O   
2242 C CB  . GLN A 286 ? 3.2297 2.9527 3.0802  0.5520  -0.7755 0.3431  359 GLN A CB  
2243 C CG  . GLN A 286 ? 3.4057 3.0550 3.2407  0.5488  -0.7913 0.3444  359 GLN A CG  
2244 C CD  . GLN A 286 ? 3.6873 3.2862 3.5053  0.5612  -0.8172 0.3492  359 GLN A CD  
2245 O OE1 . GLN A 286 ? 3.8891 3.5101 3.7090  0.5751  -0.8232 0.3502  359 GLN A OE1 
2246 N NE2 . GLN A 286 ? 3.6419 3.1722 3.4429  0.5557  -0.8336 0.3524  359 GLN A NE2 
2247 N N   . ASP A 287 ? 2.7087 2.5411 2.6093  0.5899  -0.7332 0.2829  360 ASP A N   
2248 C CA  . ASP A 287 ? 2.4820 2.3315 2.3983  0.6104  -0.7224 0.2533  360 ASP A CA  
2249 C C   . ASP A 287 ? 2.2865 2.1593 2.2120  0.5909  -0.7020 0.2545  360 ASP A C   
2250 O O   . ASP A 287 ? 2.3568 2.1955 2.2792  0.5856  -0.7026 0.2511  360 ASP A O   
2251 C CB  . ASP A 287 ? 2.0616 1.9728 1.9975  0.6402  -0.7137 0.2280  360 ASP A CB  
2252 C CG  . ASP A 287 ? 2.2046 2.0938 2.1340  0.6637  -0.7338 0.2236  360 ASP A CG  
2253 O OD1 . ASP A 287 ? 2.2504 2.0900 2.1604  0.6528  -0.7529 0.2459  360 ASP A OD1 
2254 O OD2 . ASP A 287 ? 2.3162 2.2395 2.2602  0.6929  -0.7302 0.1981  360 ASP A OD2 
2255 N N   . ALA A 288 ? 1.9197 1.8478 1.8547  0.5787  -0.6849 0.2607  361 ALA A N   
2256 C CA  . ALA A 288 ? 1.6265 1.5852 1.5748  0.5496  -0.6507 0.2602  361 ALA A CA  
2257 C C   . ALA A 288 ? 2.3945 2.2983 2.3287  0.5189  -0.6543 0.2833  361 ALA A C   
2258 O O   . ALA A 288 ? 2.4403 2.3353 2.3807  0.5108  -0.6432 0.2769  361 ALA A O   
2259 C CB  . ALA A 288 ? 1.5770 1.5999 1.5362  0.5292  -0.6225 0.2652  361 ALA A CB  
2260 N N   . LEU A 289 ? 2.5016 2.3687 2.4162  0.5012  -0.6706 0.3109  362 LEU A N   
2261 C CA  . LEU A 289 ? 2.6704 2.4878 2.5708  0.4700  -0.6751 0.3356  362 LEU A CA  
2262 C C   . LEU A 289 ? 2.7463 2.5074 2.6397  0.4829  -0.6951 0.3276  362 LEU A C   
2263 O O   . LEU A 289 ? 2.9410 2.7009 2.8419  0.4672  -0.6796 0.3255  362 LEU A O   
2264 C CB  . LEU A 289 ? 2.7513 2.5347 2.6293  0.4548  -0.6960 0.3652  362 LEU A CB  
2265 C CG  . LEU A 289 ? 2.8464 2.5911 2.7099  0.4158  -0.6968 0.3957  362 LEU A CG  
2266 C CD1 . LEU A 289 ? 3.0406 2.7981 2.8927  0.3918  -0.6944 0.4213  362 LEU A CD1 
2267 C CD2 . LEU A 289 ? 2.8614 2.5286 2.7053  0.4200  -0.7294 0.4038  362 LEU A CD2 
2268 N N   . VAL A 290 ? 2.6612 2.3824 2.5429  0.5088  -0.7214 0.3190  363 VAL A N   
2269 C CA  . VAL A 290 ? 2.5367 2.2041 2.4102  0.5165  -0.7342 0.3084  363 VAL A CA  
2270 C C   . VAL A 290 ? 2.4704 2.1660 2.3617  0.5293  -0.7189 0.2837  363 VAL A C   
2271 O O   . VAL A 290 ? 2.1956 1.8619 2.0837  0.5150  -0.7189 0.2872  363 VAL A O   
2272 C CB  . VAL A 290 ? 2.4020 2.0361 2.2648  0.5442  -0.7553 0.2953  363 VAL A CB  
2273 C CG1 . VAL A 290 ? 2.5174 2.1006 2.3720  0.5566  -0.7678 0.2786  363 VAL A CG1 
2274 C CG2 . VAL A 290 ? 2.6348 2.2313 2.4773  0.5280  -0.7726 0.3223  363 VAL A CG2 
2275 N N   . THR A 291 ? 2.3883 2.1427 2.2986  0.5552  -0.7054 0.2590  364 THR A N   
2276 C CA  . THR A 291 ? 2.3306 2.1095 2.2562  0.5698  -0.6924 0.2333  364 THR A CA  
2277 C C   . THR A 291 ? 1.9624 1.7600 1.8980  0.5347  -0.6657 0.2443  364 THR A C   
2278 O O   . THR A 291 ? 1.8393 1.6159 1.7754  0.5303  -0.6641 0.2379  364 THR A O   
2279 C CB  . THR A 291 ? 1.6832 1.5308 1.6292  0.5983  -0.6777 0.2062  364 THR A CB  
2280 O OG1 . THR A 291 ? 1.6240 1.5348 1.5857  0.5778  -0.6489 0.2131  364 THR A OG1 
2281 C CG2 . THR A 291 ? 1.7272 1.5679 1.6680  0.6238  -0.6925 0.1964  364 THR A CG2 
2282 N N   . SER A 292 ? 1.6720 1.5108 1.6160  0.5076  -0.6420 0.2601  365 SER A N   
2283 C CA  . SER A 292 ? 1.6602 1.5227 1.6166  0.4752  -0.6121 0.2679  365 SER A CA  
2284 C C   . SER A 292 ? 1.7947 1.5964 1.7358  0.4509  -0.6253 0.2900  365 SER A C   
2285 O O   . SER A 292 ? 2.0203 1.8195 1.9687  0.4388  -0.6138 0.2872  365 SER A O   
2286 C CB  . SER A 292 ? 1.5602 1.4737 1.5258  0.4519  -0.5856 0.2806  365 SER A CB  
2287 O OG  . SER A 292 ? 1.5420 1.5052 1.5175  0.4738  -0.5794 0.2634  365 SER A OG  
2288 N N   . VAL A 293 ? 1.7868 1.5402 1.7064  0.4423  -0.6501 0.3132  366 VAL A N   
2289 C CA  . VAL A 293 ? 1.9958 1.6945 1.9002  0.4147  -0.6625 0.3379  366 VAL A CA  
2290 C C   . VAL A 293 ? 1.9777 1.6289 1.8750  0.4287  -0.6816 0.3247  366 VAL A C   
2291 O O   . VAL A 293 ? 1.7573 1.3862 1.6530  0.4055  -0.6787 0.3356  366 VAL A O   
2292 C CB  . VAL A 293 ? 2.1947 1.8507 2.0759  0.4027  -0.6873 0.3658  366 VAL A CB  
2293 C CG1 . VAL A 293 ? 2.1506 1.7695 2.0210  0.3653  -0.6903 0.3947  366 VAL A CG1 
2294 C CG2 . VAL A 293 ? 2.2324 1.9380 2.1195  0.3934  -0.6695 0.3747  366 VAL A CG2 
2295 N N   . VAL A 294 ? 2.1560 1.7912 2.0483  0.4671  -0.7017 0.3010  367 VAL A N   
2296 C CA  . VAL A 294 ? 2.1487 1.7476 2.0357  0.4840  -0.7157 0.2824  367 VAL A CA  
2297 C C   . VAL A 294 ? 2.1211 1.7691 2.0309  0.4785  -0.6844 0.2655  367 VAL A C   
2298 O O   . VAL A 294 ? 2.1061 1.7277 2.0130  0.4661  -0.6859 0.2665  367 VAL A O   
2299 C CB  . VAL A 294 ? 2.0130 1.5991 1.8937  0.5226  -0.7305 0.2553  367 VAL A CB  
2300 C CG1 . VAL A 294 ? 1.9294 1.4860 1.8057  0.5393  -0.7386 0.2316  367 VAL A CG1 
2301 C CG2 . VAL A 294 ? 2.0018 1.5391 1.8609  0.5196  -0.7523 0.2703  367 VAL A CG2 
2302 N N   . ASN A 295 ? 1.9698 1.6884 1.9017  0.4886  -0.6575 0.2492  368 ASN A N   
2303 C CA  . ASN A 295 ? 1.8845 1.6516 1.8382  0.4822  -0.6273 0.2344  368 ASN A CA  
2304 C C   . ASN A 295 ? 2.0441 1.8083 2.0025  0.4422  -0.6104 0.2566  368 ASN A C   
2305 O O   . ASN A 295 ? 2.3296 2.0856 2.2919  0.4364  -0.6060 0.2501  368 ASN A O   
2306 C CB  . ASN A 295 ? 1.9252 1.7687 1.9003  0.4911  -0.6002 0.2207  368 ASN A CB  
2307 C CG  . ASN A 295 ? 1.9879 1.8836 1.9856  0.4793  -0.5672 0.2100  368 ASN A CG  
2308 O OD1 . ASN A 295 ? 2.0353 1.9451 2.0402  0.4986  -0.5646 0.1859  368 ASN A OD1 
2309 N ND2 . ASN A 295 ? 1.9839 1.9091 1.9923  0.4480  -0.5416 0.2278  368 ASN A ND2 
2310 N N   . CYS A 296 ? 1.5776 1.3418 1.5329  0.4144  -0.6045 0.2842  369 CYS A N   
2311 C CA  . CYS A 296 ? 1.7357 1.4911 1.6930  0.3769  -0.5927 0.3085  369 CYS A CA  
2312 C C   . CYS A 296 ? 1.9577 1.6429 1.8952  0.3682  -0.6210 0.3206  369 CYS A C   
2313 O O   . CYS A 296 ? 2.1149 1.7955 2.0580  0.3493  -0.6126 0.3259  369 CYS A O   
2314 C CB  . CYS A 296 ? 1.7240 1.4980 1.6812  0.3520  -0.5806 0.3338  369 CYS A CB  
2315 S SG  . CYS A 296 ? 1.4959 1.3451 1.4712  0.3640  -0.5528 0.3186  369 CYS A SG  
2316 N N   . MET A 297 ? 2.2927 1.9218 2.2063  0.3797  -0.6549 0.3268  370 MET A N   
2317 C CA  . MET A 297 ? 2.5158 2.0752 2.4085  0.3671  -0.6824 0.3409  370 MET A CA  
2318 C C   . MET A 297 ? 2.4618 2.0083 2.3565  0.3829  -0.6863 0.3168  370 MET A C   
2319 O O   . MET A 297 ? 2.3337 1.8516 2.2236  0.3625  -0.6909 0.3265  370 MET A O   
2320 C CB  . MET A 297 ? 2.7327 2.2314 2.5982  0.3790  -0.7197 0.3504  370 MET A CB  
2321 C CG  . MET A 297 ? 2.7989 2.2935 2.6563  0.3507  -0.7209 0.3837  370 MET A CG  
2322 S SD  . MET A 297 ? 2.6850 2.1970 2.5524  0.3011  -0.6972 0.4130  370 MET A SD  
2323 C CE  . MET A 297 ? 2.8632 2.2940 2.6990  0.2769  -0.7326 0.4429  370 MET A CE  
2324 N N   . THR A 298 ? 2.2646 1.8339 2.1658  0.4191  -0.6849 0.2854  371 THR A N   
2325 C CA  . THR A 298 ? 1.9895 1.5511 1.8917  0.4383  -0.6884 0.2589  371 THR A CA  
2326 C C   . THR A 298 ? 1.9025 1.5055 1.8254  0.4148  -0.6583 0.2601  371 THR A C   
2327 O O   . THR A 298 ? 1.9495 1.5258 1.8672  0.4085  -0.6650 0.2564  371 THR A O   
2328 C CB  . THR A 298 ? 1.7593 1.3539 1.6689  0.4801  -0.6865 0.2261  371 THR A CB  
2329 O OG1 . THR A 298 ? 1.8157 1.3698 1.7062  0.5035  -0.7162 0.2256  371 THR A OG1 
2330 C CG2 . THR A 298 ? 1.8624 1.4535 1.7727  0.5003  -0.6886 0.1976  371 THR A CG2 
2331 N N   . SER A 299 ? 1.7733 1.4416 1.7193  0.4021  -0.6253 0.2648  372 SER A N   
2332 C CA  . SER A 299 ? 1.5654 1.2695 1.5308  0.3764  -0.5972 0.2711  372 SER A CA  
2333 C C   . SER A 299 ? 1.8086 1.4703 1.7640  0.3424  -0.6068 0.3001  372 SER A C   
2334 O O   . SER A 299 ? 1.7815 1.4404 1.7422  0.3291  -0.6015 0.3005  372 SER A O   
2335 C CB  . SER A 299 ? 1.5028 1.2748 1.4909  0.3656  -0.5630 0.2758  372 SER A CB  
2336 O OG  . SER A 299 ? 1.4802 1.2954 1.4786  0.3943  -0.5533 0.2496  372 SER A OG  
2337 N N   . PHE A 300 ? 1.8161 1.4472 1.7573  0.3270  -0.6208 0.3256  373 PHE A N   
2338 C CA  . PHE A 300 ? 1.8710 1.4675 1.8035  0.2920  -0.6290 0.3561  373 PHE A CA  
2339 C C   . PHE A 300 ? 1.9758 1.5110 1.8897  0.2927  -0.6572 0.3530  373 PHE A C   
2340 O O   . PHE A 300 ? 1.9771 1.5066 1.8950  0.2676  -0.6528 0.3658  373 PHE A O   
2341 C CB  . PHE A 300 ? 2.0693 1.6431 1.9871  0.2780  -0.6418 0.3824  373 PHE A CB  
2342 C CG  . PHE A 300 ? 2.1950 1.7464 2.1071  0.2390  -0.6451 0.4162  373 PHE A CG  
2343 C CD1 . PHE A 300 ? 2.1752 1.7758 2.1084  0.2119  -0.6136 0.4320  373 PHE A CD1 
2344 C CD2 . PHE A 300 ? 2.2957 1.7772 2.1812  0.2294  -0.6801 0.4324  373 PHE A CD2 
2345 C CE1 . PHE A 300 ? 2.2035 1.7883 2.1329  0.1765  -0.6161 0.4632  373 PHE A CE1 
2346 C CE2 . PHE A 300 ? 2.3546 1.8190 2.2352  0.1918  -0.6833 0.4646  373 PHE A CE2 
2347 C CZ  . PHE A 300 ? 2.2583 1.7765 2.1616  0.1656  -0.6508 0.4800  373 PHE A CZ  
2348 N N   . VAL A 301 ? 2.0153 1.5034 1.9082  0.3215  -0.6869 0.3361  374 VAL A N   
2349 C CA  . VAL A 301 ? 2.0016 1.4269 1.8737  0.3232  -0.7150 0.3313  374 VAL A CA  
2350 C C   . VAL A 301 ? 1.9454 1.3974 1.8307  0.3347  -0.7007 0.3053  374 VAL A C   
2351 O O   . VAL A 301 ? 1.7909 1.2108 1.6677  0.3220  -0.7114 0.3072  374 VAL A O   
2352 C CB  . VAL A 301 ? 1.8715 1.2343 1.7156  0.3516  -0.7522 0.3209  374 VAL A CB  
2353 C CG1 . VAL A 301 ? 2.2392 1.5679 2.0672  0.3339  -0.7691 0.3510  374 VAL A CG1 
2354 C CG2 . VAL A 301 ? 1.8556 1.2530 1.7084  0.3934  -0.7454 0.2891  374 VAL A CG2 
2355 N N   . SER A 302 ? 1.9390 1.4499 1.8442  0.3581  -0.6773 0.2810  375 SER A N   
2356 C CA  . SER A 302 ? 1.8845 1.4295 1.8043  0.3665  -0.6602 0.2580  375 SER A CA  
2357 C C   . SER A 302 ? 1.7527 1.3210 1.6883  0.3302  -0.6396 0.2777  375 SER A C   
2358 O O   . SER A 302 ? 1.6451 1.2103 1.5822  0.3265  -0.6387 0.2686  375 SER A O   
2359 C CB  . SER A 302 ? 1.6382 1.2496 1.5786  0.3920  -0.6359 0.2340  375 SER A CB  
2360 O OG  . SER A 302 ? 1.6758 1.2686 1.6028  0.4273  -0.6554 0.2151  375 SER A OG  
2361 N N   . GLY A 303 ? 1.6243 1.2187 1.5724  0.3038  -0.6223 0.3043  376 GLY A N   
2362 C CA  . GLY A 303 ? 1.6967 1.3101 1.6593  0.2690  -0.6047 0.3261  376 GLY A CA  
2363 C C   . GLY A 303 ? 1.9472 1.5029 1.8916  0.2510  -0.6298 0.3385  376 GLY A C   
2364 O O   . GLY A 303 ? 2.1312 1.6984 2.0852  0.2371  -0.6210 0.3391  376 GLY A O   
2365 N N   . PHE A 304 ? 2.2076 1.6995 2.1248  0.2499  -0.6623 0.3496  377 PHE A N   
2366 C CA  . PHE A 304 ? 2.3220 1.7525 2.2180  0.2332  -0.6900 0.3605  377 PHE A CA  
2367 C C   . PHE A 304 ? 2.1230 1.5327 2.0095  0.2563  -0.7018 0.3298  377 PHE A C   
2368 O O   . PHE A 304 ? 2.2350 1.6293 2.1187  0.2394  -0.7066 0.3332  377 PHE A O   
2369 C CB  . PHE A 304 ? 2.3919 1.7564 2.2589  0.2283  -0.7235 0.3783  377 PHE A CB  
2370 C CG  . PHE A 304 ? 2.1245 1.5055 1.9979  0.1994  -0.7140 0.4122  377 PHE A CG  
2371 C CD1 . PHE A 304 ? 2.0010 1.3770 1.8767  0.1602  -0.7129 0.4429  377 PHE A CD1 
2372 C CD2 . PHE A 304 ? 2.0310 1.4362 1.9086  0.2111  -0.7053 0.4135  377 PHE A CD2 
2373 C CE1 . PHE A 304 ? 2.0716 1.4664 1.9532  0.1339  -0.7030 0.4736  377 PHE A CE1 
2374 C CE2 . PHE A 304 ? 2.1390 1.5608 2.0211  0.1844  -0.6959 0.4439  377 PHE A CE2 
2375 C CZ  . PHE A 304 ? 2.1046 1.5216 1.9887  0.1461  -0.6944 0.4737  377 PHE A CZ  
2376 N N   . VAL A 305 ? 2.0701 1.4788 1.9504  0.2950  -0.7077 0.2998  378 VAL A N   
2377 C CA  . VAL A 305 ? 1.8055 1.1974 1.6759  0.3203  -0.7183 0.2679  378 VAL A CA  
2378 C C   . VAL A 305 ? 1.7507 1.1939 1.6437  0.3094  -0.6915 0.2607  378 VAL A C   
2379 O O   . VAL A 305 ? 1.7739 1.1922 1.6563  0.3080  -0.7025 0.2503  378 VAL A O   
2380 C CB  . VAL A 305 ? 1.8130 1.2153 1.6806  0.3644  -0.7212 0.2370  378 VAL A CB  
2381 C CG1 . VAL A 305 ? 1.8308 1.2254 1.6904  0.3915  -0.7280 0.2025  378 VAL A CG1 
2382 C CG2 . VAL A 305 ? 1.9103 1.2540 1.7531  0.3760  -0.7520 0.2444  378 VAL A CG2 
2383 N N   . ILE A 306 ? 1.7944 1.3077 1.7177  0.3001  -0.6567 0.2673  379 ILE A N   
2384 C CA  . ILE A 306 ? 1.7872 1.3513 1.7333  0.2894  -0.6304 0.2623  379 ILE A CA  
2385 C C   . ILE A 306 ? 1.6230 1.1768 1.5730  0.2498  -0.6295 0.2921  379 ILE A C   
2386 O O   . ILE A 306 ? 1.6246 1.1743 1.5743  0.2410  -0.6311 0.2877  379 ILE A O   
2387 C CB  . ILE A 306 ? 1.5553 1.1959 1.5313  0.2954  -0.5943 0.2574  379 ILE A CB  
2388 C CG1 . ILE A 306 ? 1.6777 1.3345 1.6512  0.3347  -0.5949 0.2262  379 ILE A CG1 
2389 C CG2 . ILE A 306 ? 1.5014 1.1922 1.5013  0.2811  -0.5675 0.2565  379 ILE A CG2 
2390 C CD1 . ILE A 306 ? 1.6141 1.2657 1.5797  0.3583  -0.6026 0.1950  379 ILE A CD1 
2391 N N   . PHE A 307 ? 1.7968 1.3491 1.7508  0.2250  -0.6266 0.3231  380 PHE A N   
2392 C CA  . PHE A 307 ? 1.7592 1.3180 1.7236  0.1870  -0.6193 0.3527  380 PHE A CA  
2393 C C   . PHE A 307 ? 1.9716 1.4635 1.9104  0.1694  -0.6522 0.3650  380 PHE A C   
2394 O O   . PHE A 307 ? 1.8218 1.3195 1.7687  0.1394  -0.6481 0.3857  380 PHE A O   
2395 C CB  . PHE A 307 ? 1.5864 1.1734 1.5652  0.1666  -0.6022 0.3809  380 PHE A CB  
2396 C CG  . PHE A 307 ? 1.5009 1.1624 1.5119  0.1680  -0.5632 0.3771  380 PHE A CG  
2397 C CD1 . PHE A 307 ? 1.5288 1.2280 1.5624  0.1474  -0.5418 0.3875  380 PHE A CD1 
2398 C CD2 . PHE A 307 ? 1.4757 1.1686 1.4938  0.1902  -0.5488 0.3625  380 PHE A CD2 
2399 C CE1 . PHE A 307 ? 1.5814 1.3451 1.6433  0.1490  -0.5070 0.3838  380 PHE A CE1 
2400 C CE2 . PHE A 307 ? 1.5928 1.3510 1.6386  0.1903  -0.5139 0.3588  380 PHE A CE2 
2401 C CZ  . PHE A 307 ? 1.7489 1.5409 1.8162  0.1701  -0.4932 0.3691  380 PHE A CZ  
2402 N N   . THR A 308 ? 2.1664 1.5943 2.0742  0.1859  -0.6851 0.3548  381 THR A N   
2403 C CA  . THR A 308 ? 2.0836 1.4455 1.9650  0.1705  -0.7171 0.3624  381 THR A CA  
2404 C C   . THR A 308 ? 2.1821 1.5497 2.0642  0.1776  -0.7154 0.3399  381 THR A C   
2405 O O   . THR A 308 ? 2.0707 1.4247 1.9503  0.1511  -0.7220 0.3536  381 THR A O   
2406 C CB  . THR A 308 ? 2.2674 1.5558 2.1140  0.1884  -0.7536 0.3555  381 THR A CB  
2407 O OG1 . THR A 308 ? 2.2546 1.5507 2.0984  0.2313  -0.7524 0.3203  381 THR A OG1 
2408 C CG2 . THR A 308 ? 2.3448 1.6203 2.1874  0.1725  -0.7595 0.3849  381 THR A CG2 
2409 N N   . VAL A 309 ? 2.1394 1.5319 2.0258  0.2124  -0.7055 0.3057  382 VAL A N   
2410 C CA  . VAL A 309 ? 1.8903 1.2921 1.7764  0.2219  -0.7030 0.2816  382 VAL A CA  
2411 C C   . VAL A 309 ? 1.7006 1.1668 1.6187  0.1986  -0.6714 0.2940  382 VAL A C   
2412 O O   . VAL A 309 ? 1.9806 1.4422 1.8970  0.1837  -0.6748 0.2946  382 VAL A O   
2413 C CB  . VAL A 309 ? 1.7667 1.1833 1.6499  0.2657  -0.6997 0.2426  382 VAL A CB  
2414 C CG1 . VAL A 309 ? 1.7651 1.1919 1.6459  0.2756  -0.6975 0.2170  382 VAL A CG1 
2415 C CG2 . VAL A 309 ? 1.8361 1.1880 1.6886  0.2900  -0.7316 0.2317  382 VAL A CG2 
2416 N N   . LEU A 310 ? 1.6389 1.1651 1.5858  0.1953  -0.6410 0.3042  383 LEU A N   
2417 C CA  . LEU A 310 ? 1.5752 1.1621 1.5535  0.1741  -0.6103 0.3176  383 LEU A CA  
2418 C C   . LEU A 310 ? 1.5837 1.1557 1.5643  0.1346  -0.6160 0.3533  383 LEU A C   
2419 O O   . LEU A 310 ? 1.5498 1.1552 1.5495  0.1150  -0.6006 0.3638  383 LEU A O   
2420 C CB  . LEU A 310 ? 1.5135 1.1626 1.5191  0.1815  -0.5780 0.3186  383 LEU A CB  
2421 C CG  . LEU A 310 ? 1.4712 1.1711 1.4918  0.2073  -0.5562 0.2887  383 LEU A CG  
2422 C CD1 . LEU A 310 ? 1.7279 1.3984 1.7258  0.2427  -0.5757 0.2563  383 LEU A CD1 
2423 C CD2 . LEU A 310 ? 1.4125 1.1709 1.4594  0.2086  -0.5248 0.2943  383 LEU A CD2 
2424 N N   . GLY A 311 ? 1.7714 1.2976 1.7344  0.1221  -0.6371 0.3736  384 GLY A N   
2425 C CA  . GLY A 311 ? 1.8400 1.3483 1.8020  0.0840  -0.6463 0.4077  384 GLY A CA  
2426 C C   . GLY A 311 ? 1.9566 1.4223 1.8992  0.0743  -0.6704 0.4030  384 GLY A C   
2427 O O   . GLY A 311 ? 1.6740 1.1543 1.6279  0.0459  -0.6660 0.4222  384 GLY A O   
2428 N N   . TYR A 312 ? 2.1433 1.5556 2.0558  0.0981  -0.6968 0.3771  385 TYR A N   
2429 C CA  . TYR A 312 ? 2.4358 1.8065 2.3269  0.0929  -0.7195 0.3669  385 TYR A CA  
2430 C C   . TYR A 312 ? 2.2630 1.6882 2.1763  0.0940  -0.6958 0.3538  385 TYR A C   
2431 O O   . TYR A 312 ? 2.2769 1.6929 2.1867  0.0728  -0.7038 0.3612  385 TYR A O   
2432 C CB  . TYR A 312 ? 2.6208 1.9292 2.4769  0.1247  -0.7485 0.3369  385 TYR A CB  
2433 C CG  . TYR A 312 ? 2.5888 1.8731 2.4271  0.1333  -0.7623 0.3118  385 TYR A CG  
2434 C CD1 . TYR A 312 ? 2.6422 1.8738 2.4575  0.1076  -0.7890 0.3238  385 TYR A CD1 
2435 C CD2 . TYR A 312 ? 2.5150 1.8302 2.3582  0.1662  -0.7487 0.2761  385 TYR A CD2 
2436 C CE1 . TYR A 312 ? 2.7501 1.9589 2.5472  0.1149  -0.8017 0.3002  385 TYR A CE1 
2437 C CE2 . TYR A 312 ? 2.6424 1.9374 2.4681  0.1741  -0.7607 0.2526  385 TYR A CE2 
2438 C CZ  . TYR A 312 ? 2.7798 2.0208 2.5820  0.1487  -0.7872 0.2643  385 TYR A CZ  
2439 O OH  . TYR A 312 ? 2.9194 2.1394 2.7021  0.1560  -0.7993 0.2401  385 TYR A OH  
2440 N N   . MET A 313 ? 2.3513 1.8334 2.2867  0.1180  -0.6675 0.3348  386 MET A N   
2441 C CA  . MET A 313 ? 2.1035 1.6399 2.0604  0.1200  -0.6441 0.3223  386 MET A CA  
2442 C C   . MET A 313 ? 2.0495 1.6304 2.0357  0.0860  -0.6233 0.3540  386 MET A C   
2443 O O   . MET A 313 ? 2.2064 1.8086 2.2020  0.0737  -0.6170 0.3546  386 MET A O   
2444 C CB  . MET A 313 ? 1.8832 1.4695 1.8564  0.1519  -0.6192 0.2970  386 MET A CB  
2445 C CG  . MET A 313 ? 1.8518 1.4812 1.8368  0.1632  -0.6025 0.2743  386 MET A CG  
2446 S SD  . MET A 313 ? 2.2657 1.8427 2.2143  0.1842  -0.6322 0.2404  386 MET A SD  
2447 C CE  . MET A 313 ? 2.5812 2.2271 2.5511  0.1937  -0.6045 0.2189  386 MET A CE  
2448 N N   . ALA A 314 ? 1.8821 1.4783 1.8829  0.0708  -0.6126 0.3808  387 ALA A N   
2449 C CA  . ALA A 314 ? 1.8508 1.4886 1.8796  0.0395  -0.5934 0.4120  387 ALA A CA  
2450 C C   . ALA A 314 ? 1.8573 1.4551 1.8720  0.0076  -0.6180 0.4354  387 ALA A C   
2451 O O   . ALA A 314 ? 1.5418 1.1712 1.5765  -0.0167 -0.6070 0.4546  387 ALA A O   
2452 C CB  . ALA A 314 ? 2.0005 1.6668 2.0472  0.0342  -0.5746 0.4319  387 ALA A CB  
2453 N N   . GLU A 315 ? 2.1611 1.6892 2.1414  0.0071  -0.6521 0.4346  388 GLU A N   
2454 C CA  . GLU A 315 ? 2.3683 1.8521 2.3307  -0.0236 -0.6791 0.4552  388 GLU A CA  
2455 C C   . GLU A 315 ? 2.3654 1.8416 2.3193  -0.0230 -0.6876 0.4374  388 GLU A C   
2456 O O   . GLU A 315 ? 2.3116 1.7945 2.2717  -0.0522 -0.6910 0.4571  388 GLU A O   
2457 C CB  . GLU A 315 ? 2.4357 1.8428 2.3611  -0.0225 -0.7143 0.4572  388 GLU A CB  
2458 C CG  . GLU A 315 ? 2.3951 1.7479 2.2972  -0.0553 -0.7462 0.4786  388 GLU A CG  
2459 C CD  . GLU A 315 ? 2.2796 1.6546 2.1993  -0.0935 -0.7400 0.5215  388 GLU A CD  
2460 O OE1 . GLU A 315 ? 2.3460 1.6879 2.2518  -0.1248 -0.7627 0.5430  388 GLU A OE1 
2461 O OE2 . GLU A 315 ? 2.1878 1.6131 2.1341  -0.0924 -0.7130 0.5337  388 GLU A OE2 
2462 N N   . MET A 316 ? 2.5239 1.9878 2.4631  0.0102  -0.6912 0.4003  389 MET A N   
2463 C CA  . MET A 316 ? 2.6732 2.1322 2.6024  0.0140  -0.6980 0.3797  389 MET A CA  
2464 C C   . MET A 316 ? 2.4771 2.0098 2.4426  0.0031  -0.6666 0.3871  389 MET A C   
2465 O O   . MET A 316 ? 2.4724 2.0076 2.4376  -0.0158 -0.6722 0.3925  389 MET A O   
2466 C CB  . MET A 316 ? 2.8018 2.2399 2.7101  0.0547  -0.7050 0.3377  389 MET A CB  
2467 C CG  . MET A 316 ? 2.7907 2.2083 2.6786  0.0605  -0.7191 0.3134  389 MET A CG  
2468 S SD  . MET A 316 ? 2.6378 2.0137 2.4928  0.1080  -0.7358 0.2659  389 MET A SD  
2469 C CE  . MET A 316 ? 2.5214 1.9765 2.4108  0.1378  -0.6965 0.2501  389 MET A CE  
2470 N N   . ARG A 317 ? 2.2832 1.8753 2.2796  0.0146  -0.6342 0.3878  390 ARG A N   
2471 C CA  . ARG A 317 ? 1.9717 1.6338 2.0052  0.0026  -0.6032 0.4000  390 ARG A CA  
2472 C C   . ARG A 317 ? 2.1699 1.8450 2.2217  -0.0301 -0.5980 0.4405  390 ARG A C   
2473 O O   . ARG A 317 ? 2.1873 1.8159 2.2199  -0.0517 -0.6238 0.4586  390 ARG A O   
2474 C CB  . ARG A 317 ? 1.9137 1.6297 1.9700  0.0288  -0.5718 0.3828  390 ARG A CB  
2475 N N   . ASN A 318 ? 2.0712 1.8083 2.1591  -0.0352 -0.5659 0.4557  391 ASN A N   
2476 C CA  . ASN A 318 ? 1.9742 1.7283 2.0807  -0.0647 -0.5593 0.4936  391 ASN A CA  
2477 C C   . ASN A 318 ? 2.1498 1.9362 2.2754  -0.0568 -0.5351 0.5018  391 ASN A C   
2478 O O   . ASN A 318 ? 2.0535 1.8971 2.2117  -0.0606 -0.5053 0.5127  391 ASN A O   
2479 C CB  . ASN A 318 ? 1.5341 1.3334 1.6675  -0.0856 -0.5450 0.5104  391 ASN A CB  
2480 C CG  . ASN A 318 ? 1.7194 1.4828 1.8355  -0.1119 -0.5732 0.5238  391 ASN A CG  
2481 O OD1 . ASN A 318 ? 1.4989 1.2067 1.5875  -0.1226 -0.6014 0.5311  391 ASN A OD1 
2482 N ND2 . ASN A 318 ? 2.0130 1.8067 2.1442  -0.1232 -0.5666 0.5276  391 ASN A ND2 
2483 N N   . GLU A 319 ? 2.3138 2.0614 2.4178  -0.0455 -0.5490 0.4962  392 GLU A N   
2484 C CA  . GLU A 319 ? 2.3239 2.0886 2.4390  -0.0478 -0.5348 0.5127  392 GLU A CA  
2485 C C   . GLU A 319 ? 2.2468 2.0696 2.3889  -0.0288 -0.4992 0.5016  392 GLU A C   
2486 O O   . GLU A 319 ? 2.0793 1.9263 2.2293  -0.0103 -0.4867 0.4780  392 GLU A O   
2487 C CB  . GLU A 319 ? 2.3955 2.1717 2.5238  -0.0831 -0.5340 0.5519  392 GLU A CB  
2488 C CG  . GLU A 319 ? 2.8466 2.5943 2.9604  -0.0916 -0.5456 0.5692  392 GLU A CG  
2489 C CD  . GLU A 319 ? 3.1255 2.8990 3.2574  -0.1242 -0.5377 0.6076  392 GLU A CD  
2490 O OE1 . GLU A 319 ? 3.1209 2.9118 3.2663  -0.1454 -0.5374 0.6233  392 GLU A OE1 
2491 O OE2 . GLU A 319 ? 3.3415 3.1206 3.4746  -0.1285 -0.5314 0.6221  392 GLU A OE2 
2492 N N   . ASP A 320 ? 2.2464 2.0911 2.4014  -0.0346 -0.4832 0.5190  393 ASP A N   
2493 C CA  . ASP A 320 ? 2.0164 1.9082 2.1921  -0.0173 -0.4520 0.5094  393 ASP A CA  
2494 C C   . ASP A 320 ? 1.8496 1.7292 2.0104  0.0156  -0.4552 0.4744  393 ASP A C   
2495 O O   . ASP A 320 ? 1.6589 1.5644 1.8292  0.0309  -0.4428 0.4533  393 ASP A O   
2496 C CB  . ASP A 320 ? 1.8783 1.8286 2.0879  -0.0234 -0.4227 0.5151  393 ASP A CB  
2497 N N   . VAL A 321 ? 1.9503 1.7917 2.0878  0.0262  -0.4723 0.4690  394 VAL A N   
2498 C CA  . VAL A 321 ? 1.8496 1.6742 1.9702  0.0582  -0.4801 0.4363  394 VAL A CA  
2499 C C   . VAL A 321 ? 1.7475 1.6279 1.8905  0.0768  -0.4487 0.4186  394 VAL A C   
2500 O O   . VAL A 321 ? 1.7488 1.6315 1.8853  0.1021  -0.4497 0.3894  394 VAL A O   
2501 C CB  . VAL A 321 ? 1.9808 1.7626 2.0774  0.0651  -0.5000 0.4384  394 VAL A CB  
2502 C CG1 . VAL A 321 ? 2.0416 1.8132 2.1243  0.1002  -0.5056 0.4050  394 VAL A CG1 
2503 C CG2 . VAL A 321 ? 2.0627 1.7836 2.1339  0.0468  -0.5341 0.4542  394 VAL A CG2 
2504 N N   . SER A 322 ? 1.7354 1.6617 1.9046  0.0647  -0.4207 0.4357  395 SER A N   
2505 C CA  . SER A 322 ? 1.7637 1.7421 1.9544  0.0792  -0.3908 0.4205  395 SER A CA  
2506 C C   . SER A 322 ? 1.9152 1.9122 2.1142  0.0851  -0.3860 0.4043  395 SER A C   
2507 O O   . SER A 322 ? 1.9687 1.9918 2.1730  0.1053  -0.3732 0.3807  395 SER A O   
2508 C CB  . SER A 322 ? 1.7947 1.8149 2.0113  0.0627  -0.3628 0.4434  395 SER A CB  
2509 O OG  . SER A 322 ? 2.0327 2.1011 2.2704  0.0739  -0.3344 0.4302  395 SER A OG  
2510 N N   . GLU A 323 ? 1.8667 1.8520 2.0667  0.0667  -0.3965 0.4173  396 GLU A N   
2511 C CA  . GLU A 323 ? 1.9435 1.9459 2.1500  0.0703  -0.3934 0.4034  396 GLU A CA  
2512 C C   . GLU A 323 ? 1.7333 1.7082 1.9152  0.0946  -0.4122 0.3715  396 GLU A C   
2513 O O   . GLU A 323 ? 1.8093 1.8122 1.9975  0.1099  -0.4010 0.3498  396 GLU A O   
2514 C CB  . GLU A 323 ? 2.0926 2.0858 2.3033  0.0439  -0.4032 0.4255  396 GLU A CB  
2515 C CG  . GLU A 323 ? 2.2005 2.2265 2.4379  0.0213  -0.3835 0.4567  396 GLU A CG  
2516 C CD  . GLU A 323 ? 2.3045 2.3877 2.5714  0.0271  -0.3501 0.4534  396 GLU A CD  
2517 O OE1 . GLU A 323 ? 2.2803 2.3820 2.5535  0.0334  -0.3450 0.4393  396 GLU A OE1 
2518 O OE2 . GLU A 323 ? 2.3443 2.4528 2.6267  0.0252  -0.3295 0.4645  396 GLU A OE2 
2519 N N   . VAL A 324 ? 1.3927 1.3131 1.5464  0.0989  -0.4409 0.3684  397 VAL A N   
2520 C CA  . VAL A 324 ? 1.4132 1.3033 1.5418  0.1240  -0.4606 0.3377  397 VAL A CA  
2521 C C   . VAL A 324 ? 1.7056 1.6091 1.8323  0.1517  -0.4524 0.3168  397 VAL A C   
2522 O O   . VAL A 324 ? 1.8418 1.7374 1.9544  0.1768  -0.4612 0.2880  397 VAL A O   
2523 C CB  . VAL A 324 ? 1.5470 1.3686 1.6446  0.1179  -0.4966 0.3423  397 VAL A CB  
2524 C CG1 . VAL A 324 ? 1.3676 1.1587 1.4520  0.1222  -0.5077 0.3503  397 VAL A CG1 
2525 C CG2 . VAL A 324 ? 1.8598 1.6521 1.9334  0.1392  -0.5165 0.3116  397 VAL A CG2 
2526 N N   . ALA A 325 ? 1.8706 1.7976 2.0116  0.1478  -0.4347 0.3303  398 ALA A N   
2527 C CA  . ALA A 325 ? 1.9236 1.8665 2.0641  0.1708  -0.4259 0.3140  398 ALA A CA  
2528 C C   . ALA A 325 ? 1.8557 1.8605 2.0251  0.1691  -0.3910 0.3155  398 ALA A C   
2529 O O   . ALA A 325 ? 1.7671 1.7898 1.9427  0.1739  -0.3778 0.3177  398 ALA A O   
2530 C CB  . ALA A 325 ? 1.9730 1.8815 2.0992  0.1689  -0.4398 0.3275  398 ALA A CB  
2531 N N   . LYS A 326 ? 1.7254 1.7619 1.9118  0.1612  -0.3763 0.3150  399 LYS A N   
2532 C CA  . LYS A 326 ? 1.9470 2.0394 2.1599  0.1595  -0.3441 0.3159  399 LYS A CA  
2533 C C   . LYS A 326 ? 2.0844 2.2017 2.2959  0.1854  -0.3354 0.2882  399 LYS A C   
2534 O O   . LYS A 326 ? 1.8779 2.0225 2.1001  0.1886  -0.3170 0.2891  399 LYS A O   
2535 C CB  . LYS A 326 ? 1.9746 2.0925 2.2045  0.1461  -0.3332 0.3214  399 LYS A CB  
2536 C CG  . LYS A 326 ? 2.0573 2.1780 2.3027  0.1184  -0.3266 0.3533  399 LYS A CG  
2537 C CD  . LYS A 326 ? 1.8679 2.0183 2.1315  0.1080  -0.3148 0.3570  399 LYS A CD  
2538 C CE  . LYS A 326 ? 1.6697 1.8308 1.9529  0.0822  -0.3054 0.3889  399 LYS A CE  
2539 N NZ  . LYS A 326 ? 1.4302 1.6193 1.7311  0.0728  -0.2958 0.3930  399 LYS A NZ  
2540 N N   . ASP A 327 ? 2.4525 2.5622 2.6506  0.2037  -0.3485 0.2632  400 ASP A N   
2541 C CA  . ASP A 327 ? 2.5987 2.7367 2.7963  0.2285  -0.3407 0.2363  400 ASP A CA  
2542 C C   . ASP A 327 ? 2.5832 2.6991 2.7660  0.2443  -0.3524 0.2306  400 ASP A C   
2543 O O   . ASP A 327 ? 2.7532 2.8205 2.9142  0.2503  -0.3786 0.2296  400 ASP A O   
2544 C CB  . ASP A 327 ? 2.7427 2.8787 2.9290  0.2438  -0.3524 0.2115  400 ASP A CB  
2545 C CG  . ASP A 327 ? 2.8767 3.0596 3.0704  0.2635  -0.3370 0.1867  400 ASP A CG  
2546 O OD1 . ASP A 327 ? 2.8964 3.0991 3.0950  0.2730  -0.3267 0.1827  400 ASP A OD1 
2547 O OD2 . ASP A 327 ? 2.9458 3.1472 3.1398  0.2684  -0.3354 0.1716  400 ASP A OD2 
2548 N N   . ALA A 328 ? 2.2871 2.4374 2.4809  0.2506  -0.3337 0.2274  401 ALA A N   
2549 C CA  . ALA A 328 ? 1.9618 2.0986 2.1438  0.2653  -0.3422 0.2224  401 ALA A CA  
2550 C C   . ALA A 328 ? 1.6193 1.7826 1.7984  0.2932  -0.3412 0.1923  401 ALA A C   
2551 O O   . ALA A 328 ? 1.3275 1.5336 1.5194  0.2973  -0.3211 0.1862  401 ALA A O   
2552 C CB  . ALA A 328 ? 1.9138 2.0694 2.1086  0.2509  -0.3231 0.2417  401 ALA A CB  
2553 N N   . GLY A 329 ? 1.8535 1.9916 2.0151  0.3122  -0.3631 0.1732  402 GLY A N   
2554 C CA  . GLY A 329 ? 1.8629 2.0265 2.0212  0.3403  -0.3637 0.1440  402 GLY A CA  
2555 C C   . GLY A 329 ? 1.9481 2.0711 2.0830  0.3620  -0.3921 0.1253  402 GLY A C   
2556 O O   . GLY A 329 ? 2.2599 2.3276 2.3779  0.3570  -0.4145 0.1357  402 GLY A O   
2557 N N   . PRO A 330 ? 1.7246 1.8748 1.8577  0.3868  -0.3918 0.0969  403 PRO A N   
2558 C CA  . PRO A 330 ? 1.8521 1.9652 1.9623  0.4103  -0.4180 0.0759  403 PRO A CA  
2559 C C   . PRO A 330 ? 1.8304 1.9081 1.9305  0.3958  -0.4299 0.0813  403 PRO A C   
2560 O O   . PRO A 330 ? 1.9465 1.9738 2.0231  0.4085  -0.4562 0.0717  403 PRO A O   
2561 C CB  . PRO A 330 ? 1.8823 2.0474 1.9983  0.4353  -0.4079 0.0460  403 PRO A CB  
2562 C CG  . PRO A 330 ? 1.5935 1.8120 1.7309  0.4294  -0.3828 0.0524  403 PRO A CG  
2563 C CD  . PRO A 330 ? 1.5698 1.7853 1.7203  0.3953  -0.3684 0.0826  403 PRO A CD  
2564 N N   . SER A 331 ? 1.2596 1.3613 1.3762  0.3696  -0.4117 0.0967  404 SER A N   
2565 C CA  . SER A 331 ? 1.4703 1.5430 1.5792  0.3532  -0.4220 0.1039  404 SER A CA  
2566 C C   . SER A 331 ? 1.5565 1.5643 1.6490  0.3399  -0.4451 0.1243  404 SER A C   
2567 O O   . SER A 331 ? 1.7955 1.7636 1.8719  0.3337  -0.4637 0.1245  404 SER A O   
2568 C CB  . SER A 331 ? 1.6300 1.7441 1.7627  0.3271  -0.3970 0.1199  404 SER A CB  
2569 O OG  . SER A 331 ? 1.7060 1.8792 1.8528  0.3376  -0.3763 0.1023  404 SER A OG  
2570 N N   . LEU A 332 ? 1.4777 1.4742 1.5729  0.3343  -0.4447 0.1418  405 LEU A N   
2571 C CA  . LEU A 332 ? 1.4288 1.3646 1.5074  0.3212  -0.4674 0.1621  405 LEU A CA  
2572 C C   . LEU A 332 ? 1.5145 1.3960 1.5631  0.3454  -0.4993 0.1430  405 LEU A C   
2573 O O   . LEU A 332 ? 1.8920 1.7159 1.9213  0.3348  -0.5232 0.1541  405 LEU A O   
2574 C CB  . LEU A 332 ? 1.3108 1.2516 1.3986  0.3106  -0.4586 0.1840  405 LEU A CB  
2575 C CG  . LEU A 332 ? 1.3162 1.2098 1.3948  0.2863  -0.4734 0.2140  405 LEU A CG  
2576 C CD1 . LEU A 332 ? 1.2792 1.2039 1.3779  0.2670  -0.4506 0.2381  405 LEU A CD1 
2577 C CD2 . LEU A 332 ? 1.3776 1.2122 1.4284  0.3017  -0.5047 0.2096  405 LEU A CD2 
2578 N N   . LEU A 333 ? 1.4739 1.3729 1.5182  0.3778  -0.5003 0.1145  406 LEU A N   
2579 C CA  . LEU A 333 ? 1.7932 1.6443 1.8100  0.4059  -0.5293 0.0929  406 LEU A CA  
2580 C C   . LEU A 333 ? 2.0464 1.9007 2.0535  0.4208  -0.5343 0.0658  406 LEU A C   
2581 O O   . LEU A 333 ? 2.2761 2.0742 2.2573  0.4280  -0.5610 0.0571  406 LEU A O   
2582 C CB  . LEU A 333 ? 1.6804 1.5477 1.6977  0.4353  -0.5295 0.0782  406 LEU A CB  
2583 C CG  . LEU A 333 ? 1.7490 1.6072 1.7705  0.4250  -0.5289 0.1019  406 LEU A CG  
2584 C CD1 . LEU A 333 ? 1.5195 1.3992 1.5419  0.4557  -0.5290 0.0846  406 LEU A CD1 
2585 C CD2 . LEU A 333 ? 2.0366 1.8204 2.0355  0.4117  -0.5572 0.1217  406 LEU A CD2 
2586 N N   . PHE A 334 ? 1.8717 1.7903 1.8978  0.4249  -0.5097 0.0522  407 PHE A N   
2587 C CA  . PHE A 334 ? 1.4192 1.3487 1.4362  0.4414  -0.5127 0.0241  407 PHE A CA  
2588 C C   . PHE A 334 ? 1.6707 1.5869 1.6848  0.4154  -0.5141 0.0342  407 PHE A C   
2589 O O   . PHE A 334 ? 1.8068 1.7112 1.8047  0.4267  -0.5248 0.0129  407 PHE A O   
2590 C CB  . PHE A 334 ? 1.3695 1.3759 1.4072  0.4555  -0.4863 0.0059  407 PHE A CB  
2591 C CG  . PHE A 334 ? 1.5831 1.6058 1.6197  0.4882  -0.4884 -0.0131 407 PHE A CG  
2592 C CD1 . PHE A 334 ? 1.6736 1.6789 1.6904  0.5227  -0.5067 -0.0434 407 PHE A CD1 
2593 C CD2 . PHE A 334 ? 1.4133 1.4703 1.4689  0.4848  -0.4720 -0.0011 407 PHE A CD2 
2594 C CE1 . PHE A 334 ? 1.7460 1.7695 1.7636  0.5537  -0.5089 -0.0602 407 PHE A CE1 
2595 C CE2 . PHE A 334 ? 1.3457 1.4203 1.4010  0.5140  -0.4744 -0.0175 407 PHE A CE2 
2596 C CZ  . PHE A 334 ? 1.4927 1.5517 1.5299  0.5487  -0.4929 -0.0467 407 PHE A CZ  
2597 N N   . ILE A 335 ? 1.3907 1.3103 1.4201  0.3814  -0.5033 0.0656  408 ILE A N   
2598 C CA  . ILE A 335 ? 1.5552 1.4659 1.5843  0.3552  -0.5042 0.0777  408 ILE A CA  
2599 C C   . ILE A 335 ? 1.7615 1.6105 1.7775  0.3321  -0.5250 0.1041  408 ILE A C   
2600 O O   . ILE A 335 ? 2.2524 2.0489 2.2432  0.3313  -0.5502 0.0988  408 ILE A O   
2601 C CB  . ILE A 335 ? 1.3405 1.3150 1.4010  0.3337  -0.4724 0.0921  408 ILE A CB  
2602 C CG1 . ILE A 335 ? 1.2896 1.3247 1.3610  0.3541  -0.4534 0.0661  408 ILE A CG1 
2603 C CG2 . ILE A 335 ? 1.3225 1.2866 1.3836  0.3056  -0.4748 0.1078  408 ILE A CG2 
2604 C CD1 . ILE A 335 ? 1.3215 1.4168 1.4220  0.3339  -0.4234 0.0791  408 ILE A CD1 
2605 N N   . THR A 336 ? 1.5650 1.4201 1.5970  0.3126  -0.5149 0.1326  409 THR A N   
2606 C CA  . THR A 336 ? 1.6012 1.4059 1.6240  0.2869  -0.5318 0.1612  409 THR A CA  
2607 C C   . THR A 336 ? 1.6594 1.3928 1.6491  0.3019  -0.5661 0.1528  409 THR A C   
2608 O O   . THR A 336 ? 2.0090 1.6910 1.9766  0.2923  -0.5899 0.1549  409 THR A O   
2609 C CB  . THR A 336 ? 1.5636 1.3921 1.6087  0.2680  -0.5135 0.1900  409 THR A CB  
2610 O OG1 . THR A 336 ? 1.7365 1.6268 1.8114  0.2541  -0.4827 0.1978  409 THR A OG1 
2611 C CG2 . THR A 336 ? 1.5268 1.3078 1.5630  0.2401  -0.5304 0.2207  409 THR A CG2 
2612 N N   . TYR A 337 ? 1.5108 1.2389 1.4961  0.3248  -0.5697 0.1441  410 TYR A N   
2613 C CA  . TYR A 337 ? 1.7934 1.4527 1.7480  0.3404  -0.6027 0.1376  410 TYR A CA  
2614 C C   . TYR A 337 ? 2.0753 1.7028 2.0046  0.3633  -0.6228 0.1066  410 TYR A C   
2615 O O   . TYR A 337 ? 2.1000 1.6585 2.0004  0.3621  -0.6532 0.1069  410 TYR A O   
2616 C CB  . TYR A 337 ? 1.5764 1.2458 1.5340  0.3635  -0.6002 0.1320  410 TYR A CB  
2617 C CG  . TYR A 337 ? 1.6394 1.2395 1.5712  0.3692  -0.6311 0.1398  410 TYR A CG  
2618 C CD1 . TYR A 337 ? 1.7045 1.2521 1.6071  0.3969  -0.6597 0.1159  410 TYR A CD1 
2619 C CD2 . TYR A 337 ? 1.6356 1.2228 1.5717  0.3470  -0.6317 0.1711  410 TYR A CD2 
2620 C CE1 . TYR A 337 ? 1.8675 1.3487 1.7457  0.4021  -0.6892 0.1240  410 TYR A CE1 
2621 C CE2 . TYR A 337 ? 1.6944 1.2184 1.6063  0.3506  -0.6606 0.1799  410 TYR A CE2 
2622 C CZ  . TYR A 337 ? 1.7873 1.2571 1.6703  0.3780  -0.6898 0.1567  410 TYR A CZ  
2623 O OH  . TYR A 337 ? 1.8214 1.2251 1.6795  0.3817  -0.7199 0.1662  410 TYR A OH  
2624 N N   . ALA A 338 ? 1.9640 1.6408 1.9026  0.3837  -0.6065 0.0795  411 ALA A N   
2625 C CA  . ALA A 338 ? 1.8623 1.5151 1.7771  0.4066  -0.6232 0.0479  411 ALA A CA  
2626 C C   . ALA A 338 ? 1.6710 1.2917 1.5727  0.3809  -0.6351 0.0563  411 ALA A C   
2627 O O   . ALA A 338 ? 1.7923 1.3518 1.6625  0.3892  -0.6634 0.0434  411 ALA A O   
2628 C CB  . ALA A 338 ? 1.6070 1.3282 1.5371  0.4303  -0.6002 0.0198  411 ALA A CB  
2629 N N   . GLU A 339 ? 1.7412 1.4020 1.6661  0.3498  -0.6142 0.0777  412 GLU A N   
2630 C CA  . GLU A 339 ? 1.8347 1.4693 1.7495  0.3226  -0.6250 0.0890  412 GLU A CA  
2631 C C   . GLU A 339 ? 1.9912 1.5518 1.8843  0.3035  -0.6538 0.1113  412 GLU A C   
2632 O O   . GLU A 339 ? 2.1683 1.6809 2.0375  0.2925  -0.6763 0.1100  412 GLU A O   
2633 C CB  . GLU A 339 ? 1.8703 1.5646 1.8173  0.2933  -0.5965 0.1108  412 GLU A CB  
2634 C CG  . GLU A 339 ? 1.9932 1.6736 1.9330  0.2677  -0.6044 0.1190  412 GLU A CG  
2635 C CD  . GLU A 339 ? 2.0675 1.8091 2.0408  0.2415  -0.5760 0.1404  412 GLU A CD  
2636 O OE1 . GLU A 339 ? 2.0654 1.8221 2.0387  0.2306  -0.5737 0.1365  412 GLU A OE1 
2637 O OE2 . GLU A 339 ? 2.1937 1.9677 2.1928  0.2322  -0.5563 0.1609  412 GLU A OE2 
2638 N N   . ALA A 340 ? 1.9948 1.5453 1.8948  0.2981  -0.6541 0.1322  413 ALA A N   
2639 C CA  . ALA A 340 ? 1.7451 1.2247 1.6230  0.2807  -0.6828 0.1536  413 ALA A CA  
2640 C C   . ALA A 340 ? 1.9888 1.3993 1.8289  0.3088  -0.7159 0.1286  413 ALA A C   
2641 O O   . ALA A 340 ? 2.1961 1.5386 2.0083  0.2953  -0.7453 0.1361  413 ALA A O   
2642 C CB  . ALA A 340 ? 1.7195 1.2097 1.6139  0.2687  -0.6737 0.1816  413 ALA A CB  
2643 N N   . ILE A 341 ? 1.9732 1.4002 1.8116  0.3480  -0.7119 0.0985  414 ILE A N   
2644 C CA  . ILE A 341 ? 2.2710 1.6354 2.0748  0.3796  -0.7422 0.0720  414 ILE A CA  
2645 C C   . ILE A 341 ? 2.5000 1.8366 2.2800  0.3829  -0.7566 0.0498  414 ILE A C   
2646 O O   . ILE A 341 ? 2.7555 2.0161 2.5004  0.3885  -0.7894 0.0417  414 ILE A O   
2647 C CB  . ILE A 341 ? 2.2621 1.6602 2.0735  0.4216  -0.7322 0.0455  414 ILE A CB  
2648 C CG1 . ILE A 341 ? 2.3508 1.7613 2.1782  0.4189  -0.7249 0.0674  414 ILE A CG1 
2649 C CG2 . ILE A 341 ? 2.2237 1.5645 2.0009  0.4586  -0.7611 0.0131  414 ILE A CG2 
2650 C CD1 . ILE A 341 ? 2.3298 1.7773 2.1664  0.4579  -0.7148 0.0438  414 ILE A CD1 
2651 N N   . ALA A 342 ? 2.3947 1.7908 2.1923  0.3788  -0.7331 0.0396  415 ALA A N   
2652 C CA  . ALA A 342 ? 2.4684 1.8453 2.2437  0.3831  -0.7446 0.0163  415 ALA A CA  
2653 C C   . ALA A 342 ? 2.5837 1.8960 2.3361  0.3497  -0.7701 0.0364  415 ALA A C   
2654 O O   . ALA A 342 ? 2.8728 2.1368 2.5933  0.3567  -0.7926 0.0163  415 ALA A O   
2655 C CB  . ALA A 342 ? 2.3965 1.8539 2.1976  0.3792  -0.7131 0.0077  415 ALA A CB  
2656 N N   . ASN A 343 ? 2.4243 1.7355 2.1916  0.3131  -0.7670 0.0756  416 ASN A N   
2657 C CA  . ASN A 343 ? 2.4097 1.6683 2.1593  0.2768  -0.7891 0.0991  416 ASN A CA  
2658 C C   . ASN A 343 ? 2.7950 1.9694 2.5152  0.2747  -0.8232 0.1104  416 ASN A C   
2659 O O   . ASN A 343 ? 2.8688 2.0067 2.5813  0.2390  -0.8384 0.1403  416 ASN A O   
2660 C CB  . ASN A 343 ? 2.2979 1.6062 2.0811  0.2365  -0.7667 0.1367  416 ASN A CB  
2661 C CG  . ASN A 343 ? 2.4863 1.8697 2.2955  0.2335  -0.7367 0.1287  416 ASN A CG  
2662 O OD1 . ASN A 343 ? 2.4467 1.8970 2.2914  0.2296  -0.7060 0.1405  416 ASN A OD1 
2663 N ND2 . ASN A 343 ? 2.5505 1.9221 2.3411  0.2350  -0.7461 0.1088  416 ASN A ND2 
2664 N N   . MET A 344 ? 2.6189 1.7629 2.3227  0.3118  -0.8358 0.0880  417 MET A N   
2665 C CA  . MET A 344 ? 2.6241 1.6866 2.2989  0.3138  -0.8691 0.0968  417 MET A CA  
2666 C C   . MET A 344 ? 2.7180 1.7144 2.3524  0.3482  -0.8985 0.0601  417 MET A C   
2667 O O   . MET A 344 ? 2.6959 1.7226 2.3308  0.3813  -0.8878 0.0247  417 MET A O   
2668 C CB  . MET A 344 ? 2.5664 1.6483 2.2590  0.3265  -0.8595 0.1086  417 MET A CB  
2669 C CG  . MET A 344 ? 2.4935 1.6342 2.2230  0.2940  -0.8322 0.1451  417 MET A CG  
2670 S SD  . MET A 344 ? 2.5700 1.7156 2.3112  0.3041  -0.8285 0.1619  417 MET A SD  
2671 C CE  . MET A 344 ? 2.4197 1.5980 2.1645  0.3601  -0.8178 0.1183  417 MET A CE  
2672 N N   . PRO A 345 ? 2.8797 1.7852 2.4780  0.3408  -0.9359 0.0675  418 PRO A N   
2673 C CA  . PRO A 345 ? 2.8780 1.7136 2.4360  0.3763  -0.9657 0.0323  418 PRO A CA  
2674 C C   . PRO A 345 ? 2.7182 1.5702 2.2816  0.4250  -0.9601 0.0072  418 PRO A C   
2675 O O   . PRO A 345 ? 2.5183 1.4027 2.1056  0.4267  -0.9466 0.0246  418 PRO A O   
2676 C CB  . PRO A 345 ? 3.0061 1.7439 2.5294  0.3528  -1.0052 0.0548  418 PRO A CB  
2677 C CG  . PRO A 345 ? 2.9886 1.7531 2.5385  0.3162  -0.9936 0.1000  418 PRO A CG  
2678 C CD  . PRO A 345 ? 2.9120 1.7739 2.5039  0.2989  -0.9532 0.1089  418 PRO A CD  
2679 N N   . ALA A 346 ? 2.7789 1.6091 2.3194  0.4649  -0.9708 -0.0343 419 ALA A N   
2680 C CA  . ALA A 346 ? 2.8405 1.6943 2.3869  0.5153  -0.9642 -0.0635 419 ALA A CA  
2681 C C   . ALA A 346 ? 2.6609 1.6230 2.2543  0.5188  -0.9215 -0.0605 419 ALA A C   
2682 O O   . ALA A 346 ? 2.5846 1.5752 2.1960  0.5380  -0.9118 -0.0579 419 ALA A O   
2683 C CB  . ALA A 346 ? 2.9874 1.7758 2.5165  0.5302  -0.9913 -0.0543 419 ALA A CB  
2684 N N   . SER A 347 ? 2.6668 1.6886 2.2792  0.4988  -0.8965 -0.0602 420 SER A N   
2685 C CA  . SER A 347 ? 2.4810 1.6037 2.1372  0.4966  -0.8560 -0.0550 420 SER A CA  
2686 C C   . SER A 347 ? 2.3145 1.4816 1.9795  0.5451  -0.8433 -0.0895 420 SER A C   
2687 O O   . SER A 347 ? 2.3456 1.5760 2.0421  0.5513  -0.8187 -0.0825 420 SER A O   
2688 C CB  . SER A 347 ? 2.4660 1.6362 2.1359  0.4691  -0.8358 -0.0516 420 SER A CB  
2689 O OG  . SER A 347 ? 2.5830 1.7214 2.2230  0.4827  -0.8511 -0.0820 420 SER A OG  
2690 N N   . THR A 348 ? 2.3584 1.4963 1.9962  0.5794  -0.8589 -0.1273 421 THR A N   
2691 C CA  . THR A 348 ? 2.3988 1.5772 2.0434  0.6279  -0.8491 -0.1614 421 THR A CA  
2692 C C   . THR A 348 ? 2.5550 1.7190 2.2053  0.6474  -0.8571 -0.1525 421 THR A C   
2693 O O   . THR A 348 ? 2.4672 1.6987 2.1452  0.6664  -0.8344 -0.1579 421 THR A O   
2694 C CB  . THR A 348 ? 2.3813 1.5160 1.9902  0.6619  -0.8700 -0.2025 421 THR A CB  
2695 O OG1 . THR A 348 ? 2.3666 1.5239 1.9718  0.6436  -0.8599 -0.2114 421 THR A OG1 
2696 C CG2 . THR A 348 ? 2.4513 1.6285 2.0673  0.7141  -0.8611 -0.2377 421 THR A CG2 
2697 N N   . PHE A 349 ? 2.5169 1.5925 2.1400  0.6419  -0.8902 -0.1381 422 PHE A N   
2698 C CA  . PHE A 349 ? 2.5684 1.6223 2.1937  0.6572  -0.9013 -0.1263 422 PHE A CA  
2699 C C   . PHE A 349 ? 2.2889 1.4096 1.9532  0.6321  -0.8729 -0.0943 422 PHE A C   
2700 O O   . PHE A 349 ? 2.2499 1.4252 1.9368  0.6556  -0.8561 -0.1012 422 PHE A O   
2701 C CB  . PHE A 349 ? 2.7031 1.6489 2.2920  0.6449  -0.9417 -0.1100 422 PHE A CB  
2702 C CG  . PHE A 349 ? 2.7584 1.6772 2.3487  0.6514  -0.9547 -0.0900 422 PHE A CG  
2703 C CD1 . PHE A 349 ? 2.8057 1.7011 2.3840  0.6989  -0.9707 -0.1138 422 PHE A CD1 
2704 C CD2 . PHE A 349 ? 2.7297 1.6464 2.3325  0.6102  -0.9517 -0.0472 422 PHE A CD2 
2705 C CE1 . PHE A 349 ? 2.7860 1.6566 2.3651  0.7044  -0.9837 -0.0945 422 PHE A CE1 
2706 C CE2 . PHE A 349 ? 2.6974 1.5900 2.3000  0.6150  -0.9640 -0.0283 422 PHE A CE2 
2707 C CZ  . PHE A 349 ? 2.7398 1.6086 2.3303  0.6617  -0.9804 -0.0516 422 PHE A CZ  
2708 N N   . PHE A 350 ? 2.3482 1.4675 2.0211  0.5842  -0.8668 -0.0595 423 PHE A N   
2709 C CA  . PHE A 350 ? 2.3919 1.5676 2.0991  0.5583  -0.8413 -0.0277 423 PHE A CA  
2710 C C   . PHE A 350 ? 2.4393 1.7167 2.1826  0.5653  -0.8016 -0.0393 423 PHE A C   
2711 O O   . PHE A 350 ? 2.3009 1.6304 2.0729  0.5535  -0.7791 -0.0198 423 PHE A O   
2712 C CB  . PHE A 350 ? 2.3817 1.5357 2.0898  0.5065  -0.8431 0.0100  423 PHE A CB  
2713 C CG  . PHE A 350 ? 2.3809 1.4434 2.0590  0.4924  -0.8791 0.0309  423 PHE A CG  
2714 C CD1 . PHE A 350 ? 2.3446 1.3938 2.0267  0.4896  -0.8851 0.0537  423 PHE A CD1 
2715 C CD2 . PHE A 350 ? 2.6568 1.6462 2.3014  0.4806  -0.9076 0.0283  423 PHE A CD2 
2716 C CE1 . PHE A 350 ? 2.3867 1.3519 2.0404  0.4751  -0.9189 0.0743  423 PHE A CE1 
2717 C CE2 . PHE A 350 ? 2.8432 1.7468 2.4590  0.4658  -0.9418 0.0485  423 PHE A CE2 
2718 C CZ  . PHE A 350 ? 2.7466 1.6382 2.3671  0.4629  -0.9476 0.0720  423 PHE A CZ  
2719 N N   . ALA A 351 ? 2.4979 1.8043 2.2394  0.5830  -0.7929 -0.0701 424 ALA A N   
2720 C CA  . ALA A 351 ? 2.3382 1.7400 2.1117  0.5926  -0.7572 -0.0833 424 ALA A CA  
2721 C C   . ALA A 351 ? 2.3930 1.8215 2.1710  0.6383  -0.7555 -0.1092 424 ALA A C   
2722 O O   . ALA A 351 ? 2.4908 1.9858 2.2980  0.6416  -0.7311 -0.1041 424 ALA A O   
2723 C CB  . ALA A 351 ? 2.2630 1.6891 2.0331  0.5896  -0.7479 -0.1034 424 ALA A CB  
2724 N N   . ILE A 352 ? 2.1622 1.5389 1.9110  0.6742  -0.7819 -0.1373 425 ILE A N   
2725 C CA  . ILE A 352 ? 2.2731 1.6719 2.0245  0.7211  -0.7832 -0.1636 425 ILE A CA  
2726 C C   . ILE A 352 ? 2.2972 1.6964 2.0617  0.7202  -0.7844 -0.1402 425 ILE A C   
2727 O O   . ILE A 352 ? 2.2645 1.7297 2.0538  0.7371  -0.7646 -0.1457 425 ILE A O   
2728 C CB  . ILE A 352 ? 2.3417 1.6711 2.0559  0.7583  -0.8154 -0.1950 425 ILE A CB  
2729 C CG1 . ILE A 352 ? 2.2542 1.6038 1.9591  0.7672  -0.8084 -0.2253 425 ILE A CG1 
2730 C CG2 . ILE A 352 ? 2.1915 1.5301 1.9072  0.8060  -0.8225 -0.2154 425 ILE A CG2 
2731 C CD1 . ILE A 352 ? 2.2672 1.5476 1.9334  0.8032  -0.8392 -0.2582 425 ILE A CD1 
2732 N N   . ILE A 353 ? 2.5319 1.8575 2.2787  0.7001  -0.8086 -0.1136 426 ILE A N   
2733 C CA  . ILE A 353 ? 2.3997 1.7212 2.1555  0.6996  -0.8124 -0.0914 426 ILE A CA  
2734 C C   . ILE A 353 ? 2.2641 1.6587 2.0556  0.6680  -0.7785 -0.0651 426 ILE A C   
2735 O O   . ILE A 353 ? 2.2650 1.6880 2.0722  0.6738  -0.7709 -0.0546 426 ILE A O   
2736 C CB  . ILE A 353 ? 2.5353 1.7596 2.2618  0.6837  -0.8473 -0.0680 426 ILE A CB  
2737 C CG1 . ILE A 353 ? 2.5141 1.7245 2.2430  0.6306  -0.8423 -0.0340 426 ILE A CG1 
2738 C CG2 . ILE A 353 ? 2.7967 1.9425 2.4851  0.7128  -0.8816 -0.0944 426 ILE A CG2 
2739 C CD1 . ILE A 353 ? 2.5791 1.7055 2.2839  0.6090  -0.8731 -0.0049 426 ILE A CD1 
2740 N N   . PHE A 354 ? 2.3347 1.7597 2.1388  0.6347  -0.7585 -0.0543 427 PHE A N   
2741 C CA  . PHE A 354 ? 2.3103 1.8024 2.1477  0.6050  -0.7262 -0.0302 427 PHE A CA  
2742 C C   . PHE A 354 ? 2.1378 1.7175 2.0018  0.6275  -0.6975 -0.0511 427 PHE A C   
2743 O O   . PHE A 354 ? 2.0668 1.6890 1.9512  0.6274  -0.6822 -0.0404 427 PHE A O   
2744 C CB  . PHE A 354 ? 2.1891 1.6854 2.0316  0.5646  -0.7150 -0.0129 427 PHE A CB  
2745 C CG  . PHE A 354 ? 1.7770 1.3376 1.6527  0.5335  -0.6824 0.0124  427 PHE A CG  
2746 C CD1 . PHE A 354 ? 1.9808 1.5265 1.8622  0.5069  -0.6827 0.0464  427 PHE A CD1 
2747 C CD2 . PHE A 354 ? 1.7149 1.3496 1.6148  0.5308  -0.6518 0.0020  427 PHE A CD2 
2748 C CE1 . PHE A 354 ? 1.8360 1.4393 1.7467  0.4799  -0.6525 0.0681  427 PHE A CE1 
2749 C CE2 . PHE A 354 ? 1.8045 1.4945 1.7336  0.5032  -0.6226 0.0244  427 PHE A CE2 
2750 C CZ  . PHE A 354 ? 1.6367 1.3104 1.5711  0.4786  -0.6227 0.0568  427 PHE A CZ  
2751 N N   . PHE A 355 ? 2.3087 1.9168 2.1716  0.6464  -0.6905 -0.0812 428 PHE A N   
2752 C CA  . PHE A 355 ? 2.2193 1.9130 2.1067  0.6667  -0.6637 -0.1015 428 PHE A CA  
2753 C C   . PHE A 355 ? 1.7946 1.4938 1.6809  0.7063  -0.6734 -0.1174 428 PHE A C   
2754 O O   . PHE A 355 ? 1.7452 1.5098 1.6559  0.7126  -0.6524 -0.1173 428 PHE A O   
2755 C CB  . PHE A 355 ? 2.4354 2.1525 2.3179  0.6782  -0.6574 -0.1301 428 PHE A CB  
2756 C CG  . PHE A 355 ? 1.7467 1.4668 1.6331  0.6394  -0.6462 -0.1144 428 PHE A CG  
2757 C CD1 . PHE A 355 ? 1.6948 1.4346 1.6017  0.6005  -0.6287 -0.0805 428 PHE A CD1 
2758 C CD2 . PHE A 355 ? 2.3636 2.0618 2.2311  0.6418  -0.6552 -0.1326 428 PHE A CD2 
2759 C CE1 . PHE A 355 ? 1.6715 1.4144 1.5831  0.5660  -0.6193 -0.0650 428 PHE A CE1 
2760 C CE2 . PHE A 355 ? 2.3592 2.0596 2.2302  0.6057  -0.6464 -0.1168 428 PHE A CE2 
2761 C CZ  . PHE A 355 ? 2.2049 1.9283 2.0988  0.5681  -0.6285 -0.0825 428 PHE A CZ  
2762 N N   . LEU A 356 ? 1.8714 1.5013 1.7290  0.7331  -0.7058 -0.1306 429 LEU A N   
2763 C CA  . LEU A 356 ? 2.2458 1.8724 2.1009  0.7707  -0.7187 -0.1425 429 LEU A CA  
2764 C C   . LEU A 356 ? 2.2278 1.8585 2.0962  0.7521  -0.7152 -0.1109 429 LEU A C   
2765 O O   . LEU A 356 ? 2.0633 1.7372 1.9469  0.7723  -0.7076 -0.1155 429 LEU A O   
2766 C CB  . LEU A 356 ? 2.0544 1.5945 1.8739  0.7991  -0.7567 -0.1585 429 LEU A CB  
2767 C CG  . LEU A 356 ? 2.0286 1.5736 1.8447  0.8497  -0.7695 -0.1834 429 LEU A CG  
2768 C CD1 . LEU A 356 ? 1.9923 1.6214 1.8268  0.8780  -0.7465 -0.2160 429 LEU A CD1 
2769 C CD2 . LEU A 356 ? 2.4284 1.8791 2.2070  0.8740  -0.8076 -0.1972 429 LEU A CD2 
2770 N N   . MET A 357 ? 2.0651 1.6526 1.9276  0.7131  -0.7207 -0.0784 430 MET A N   
2771 C CA  . MET A 357 ? 1.8491 1.4430 1.7237  0.6914  -0.7151 -0.0469 430 MET A CA  
2772 C C   . MET A 357 ? 1.7650 1.4516 1.6740  0.6807  -0.6779 -0.0433 430 MET A C   
2773 O O   . MET A 357 ? 1.8384 1.5557 1.7600  0.6881  -0.6714 -0.0369 430 MET A O   
2774 C CB  . MET A 357 ? 1.8612 1.4007 1.7249  0.6489  -0.7243 -0.0134 430 MET A CB  
2775 C CG  . MET A 357 ? 1.8330 1.3816 1.7087  0.6242  -0.7170 0.0198  430 MET A CG  
2776 S SD  . MET A 357 ? 1.9228 1.4309 1.7936  0.5701  -0.7188 0.0603  430 MET A SD  
2777 C CE  . MET A 357 ? 1.7601 1.3331 1.6550  0.5481  -0.6843 0.0558  430 MET A CE  
2778 N N   . LEU A 358 ? 1.7174 1.4473 1.6408  0.6614  -0.6539 -0.0458 431 LEU A N   
2779 C CA  . LEU A 358 ? 1.6883 1.5046 1.6431  0.6508  -0.6186 -0.0438 431 LEU A CA  
2780 C C   . LEU A 358 ? 1.6731 1.5442 1.6390  0.6882  -0.6117 -0.0697 431 LEU A C   
2781 O O   . LEU A 358 ? 1.6624 1.5807 1.6470  0.6861  -0.5961 -0.0614 431 LEU A O   
2782 C CB  . LEU A 358 ? 1.7488 1.5968 1.7134  0.6306  -0.5986 -0.0477 431 LEU A CB  
2783 C CG  . LEU A 358 ? 1.6618 1.5127 1.6382  0.5848  -0.5826 -0.0158 431 LEU A CG  
2784 C CD1 . LEU A 358 ? 1.6122 1.3862 1.5692  0.5652  -0.6067 0.0098  431 LEU A CD1 
2785 C CD2 . LEU A 358 ? 1.5377 1.4124 1.5199  0.5705  -0.5684 -0.0231 431 LEU A CD2 
2786 N N   . ILE A 359 ? 1.6647 1.5325 1.6191  0.7226  -0.6229 -0.1017 432 ILE A N   
2787 C CA  . ILE A 359 ? 2.0042 1.9256 1.9687  0.7609  -0.6178 -0.1282 432 ILE A CA  
2788 C C   . ILE A 359 ? 2.1676 2.0730 2.1299  0.7790  -0.6330 -0.1209 432 ILE A C   
2789 O O   . ILE A 359 ? 2.1903 2.1573 2.1725  0.7887  -0.6179 -0.1236 432 ILE A O   
2790 C CB  . ILE A 359 ? 1.8643 1.7736 1.8124  0.7957  -0.6310 -0.1635 432 ILE A CB  
2791 C CG1 . ILE A 359 ? 1.6764 1.6093 1.6278  0.7757  -0.6139 -0.1700 432 ILE A CG1 
2792 C CG2 . ILE A 359 ? 1.8502 1.8184 1.8097  0.8367  -0.6258 -0.1910 432 ILE A CG2 
2793 C CD1 . ILE A 359 ? 1.7209 1.6415 1.6542  0.8061  -0.6257 -0.2042 432 ILE A CD1 
2794 N N   . THR A 360 ? 2.0007 1.8233 1.9383  0.7831  -0.6638 -0.1108 433 THR A N   
2795 C CA  . THR A 360 ? 1.9096 1.7139 1.8437  0.7973  -0.6786 -0.1017 433 THR A CA  
2796 C C   . THR A 360 ? 1.9393 1.7655 1.8894  0.7649  -0.6645 -0.0689 433 THR A C   
2797 O O   . THR A 360 ? 1.7276 1.5645 1.6817  0.7711  -0.6651 -0.0622 433 THR A O   
2798 C CB  . THR A 360 ? 1.8985 1.6066 1.8001  0.8026  -0.7112 -0.0988 433 THR A CB  
2799 O OG1 . THR A 360 ? 1.8638 1.5162 1.7531  0.7712  -0.7235 -0.0737 433 THR A OG1 
2800 C CG2 . THR A 360 ? 2.1533 1.8401 2.0373  0.8378  -0.7242 -0.1345 433 THR A CG2 
2801 N N   . LEU A 361 ? 1.9686 1.7999 1.9259  0.7237  -0.6470 -0.0480 434 LEU A N   
2802 C CA  . LEU A 361 ? 1.8064 1.6665 1.7803  0.6903  -0.6276 -0.0191 434 LEU A CA  
2803 C C   . LEU A 361 ? 1.6709 1.6216 1.6725  0.6948  -0.5977 -0.0288 434 LEU A C   
2804 O O   . LEU A 361 ? 1.6799 1.6579 1.6923  0.6873  -0.5890 -0.0146 434 LEU A O   
2805 C CB  . LEU A 361 ? 1.8439 1.6852 1.8183  0.6481  -0.6173 0.0032  434 LEU A CB  
2806 C CG  . LEU A 361 ? 1.9191 1.6766 1.8699  0.6304  -0.6437 0.0268  434 LEU A CG  
2807 C CD1 . LEU A 361 ? 1.7450 1.4909 1.6976  0.5926  -0.6334 0.0442  434 LEU A CD1 
2808 C CD2 . LEU A 361 ? 2.0438 1.7942 1.9955  0.6196  -0.6472 0.0518  434 LEU A CD2 
2809 N N   . GLY A 362 ? 1.5472 1.5450 1.5592  0.7060  -0.5823 -0.0527 435 GLY A N   
2810 C CA  . GLY A 362 ? 1.5903 1.6754 1.6277  0.7091  -0.5540 -0.0636 435 GLY A CA  
2811 C C   . GLY A 362 ? 1.5022 1.6218 1.5438  0.7480  -0.5606 -0.0842 435 GLY A C   
2812 O O   . GLY A 362 ? 1.4611 1.6414 1.5216  0.7462  -0.5430 -0.0820 435 GLY A O   
2813 N N   . LEU A 363 ? 1.5618 1.6425 1.5857  0.7838  -0.5865 -0.1045 436 LEU A N   
2814 C CA  . LEU A 363 ? 1.8451 1.9626 1.8728  0.8153  -0.5847 -0.1282 436 LEU A CA  
2815 C C   . LEU A 363 ? 1.8589 1.9856 1.8921  0.8115  -0.5842 -0.1123 436 LEU A C   
2816 O O   . LEU A 363 ? 2.0573 2.2490 2.1070  0.8202  -0.5679 -0.1219 436 LEU A O   
2817 C CB  . LEU A 363 ? 1.6501 1.7110 1.6532  0.8446  -0.6084 -0.1502 436 LEU A CB  
2818 C CG  . LEU A 363 ? 1.6524 1.7358 1.6540  0.8626  -0.6035 -0.1797 436 LEU A CG  
2819 C CD1 . LEU A 363 ? 1.7848 1.7952 1.7569  0.8874  -0.6310 -0.1975 436 LEU A CD1 
2820 C CD2 . LEU A 363 ? 1.6187 1.7905 1.6400  0.8789  -0.5802 -0.2017 436 LEU A CD2 
2821 N N   . ASP A 364 ? 2.0633 2.1253 2.0816  0.7986  -0.6031 -0.0883 437 ASP A N   
2822 C CA  . ASP A 364 ? 1.9364 2.0026 1.9569  0.7980  -0.6060 -0.0746 437 ASP A CA  
2823 C C   . ASP A 364 ? 1.9654 2.1024 2.0102  0.7777  -0.5806 -0.0615 437 ASP A C   
2824 O O   . ASP A 364 ? 2.0915 2.2753 2.1477  0.7855  -0.5717 -0.0649 437 ASP A O   
2825 C CB  . ASP A 364 ? 1.9850 1.9694 1.9843  0.7839  -0.6303 -0.0490 437 ASP A CB  
2826 C CG  . ASP A 364 ? 2.0943 2.0186 2.0781  0.7688  -0.6426 -0.0408 437 ASP A CG  
2827 O OD1 . ASP A 364 ? 2.2433 2.1966 2.2369  0.7624  -0.6289 -0.0482 437 ASP A OD1 
2828 O OD2 . ASP A 364 ? 1.9659 1.8149 1.9274  0.7621  -0.6662 -0.0263 437 ASP A OD2 
2829 N N   . SER A 365 ? 1.7919 1.9385 1.8446  0.7519  -0.5687 -0.0472 438 SER A N   
2830 C CA  . SER A 365 ? 1.7220 1.9317 1.7958  0.7272  -0.5409 -0.0351 438 SER A CA  
2831 C C   . SER A 365 ? 1.6160 1.9085 1.7103  0.7422  -0.5202 -0.0590 438 SER A C   
2832 O O   . SER A 365 ? 1.6656 2.0159 1.7764  0.7309  -0.5009 -0.0539 438 SER A O   
2833 C CB  . SER A 365 ? 1.5506 1.7437 1.6258  0.6851  -0.5245 -0.0147 438 SER A CB  
2834 O OG  . SER A 365 ? 1.4911 1.6184 1.5502  0.6664  -0.5404 0.0113  438 SER A OG  
2835 N N   . SER A 366 ? 1.7397 2.0391 1.8318  0.7634  -0.5216 -0.0848 439 SER A N   
2836 C CA  . SER A 366 ? 1.8401 2.2203 1.9507  0.7725  -0.4991 -0.1061 439 SER A CA  
2837 C C   . SER A 366 ? 2.1249 2.5241 2.2345  0.7970  -0.5036 -0.1206 439 SER A C   
2838 O O   . SER A 366 ? 2.1236 2.5933 2.2500  0.7976  -0.4849 -0.1284 439 SER A O   
2839 C CB  . SER A 366 ? 2.0279 2.4179 2.1376  0.7825  -0.4950 -0.1279 439 SER A CB  
2840 O OG  . SER A 366 ? 2.0710 2.5424 2.1987  0.7866  -0.4715 -0.1458 439 SER A OG  
2841 N N   . PHE A 367 ? 2.1663 2.5022 2.2563  0.8150  -0.5287 -0.1216 440 PHE A N   
2842 C CA  . PHE A 367 ? 1.4971 1.8438 1.5854  0.8381  -0.5359 -0.1318 440 PHE A CA  
2843 C C   . PHE A 367 ? 1.4631 1.8471 1.5648  0.8214  -0.5259 -0.1126 440 PHE A C   
2844 O O   . PHE A 367 ? 1.8802 2.3284 1.9962  0.8280  -0.5121 -0.1225 440 PHE A O   
2845 C CB  . PHE A 367 ? 1.5700 1.8336 1.6339  0.8550  -0.5661 -0.1302 440 PHE A CB  
2846 C CG  . PHE A 367 ? 1.6148 1.8396 1.6623  0.8768  -0.5788 -0.1529 440 PHE A CG  
2847 C CD1 . PHE A 367 ? 1.5952 1.8686 1.6507  0.8884  -0.5637 -0.1781 440 PHE A CD1 
2848 C CD2 . PHE A 367 ? 1.6796 1.8179 1.7021  0.8852  -0.6067 -0.1489 440 PHE A CD2 
2849 C CE1 . PHE A 367 ? 1.9678 2.2051 2.0064  0.9095  -0.5764 -0.2000 440 PHE A CE1 
2850 C CE2 . PHE A 367 ? 1.7247 1.8242 1.7299  0.9055  -0.6198 -0.1707 440 PHE A CE2 
2851 C CZ  . PHE A 367 ? 2.0283 2.1775 2.0413  0.9185  -0.6047 -0.1968 440 PHE A CZ  
2852 N N   . ALA A 368 ? 1.6459 1.9895 1.7417  0.7988  -0.5336 -0.0847 441 ALA A N   
2853 C CA  . ALA A 368 ? 1.6357 2.0102 1.7412  0.7823  -0.5259 -0.0656 441 ALA A CA  
2854 C C   . ALA A 368 ? 1.4838 1.9363 1.6115  0.7648  -0.4969 -0.0672 441 ALA A C   
2855 O O   . ALA A 368 ? 1.5092 2.0172 1.6493  0.7634  -0.4852 -0.0681 441 ALA A O   
2856 C CB  . ALA A 368 ? 1.6362 1.9508 1.7288  0.7610  -0.5397 -0.0357 441 ALA A CB  
2857 N N   . GLY A 369 ? 1.3309 1.7867 1.4630  0.7497  -0.4857 -0.0659 442 GLY A N   
2858 C CA  . GLY A 369 ? 1.4028 1.9273 1.5549  0.7314  -0.4584 -0.0669 442 GLY A CA  
2859 C C   . GLY A 369 ? 1.2533 1.8495 1.4190  0.7437  -0.4433 -0.0877 442 GLY A C   
2860 O O   . GLY A 369 ? 1.2122 1.8658 1.3924  0.7287  -0.4254 -0.0829 442 GLY A O   
2861 N N   . LEU A 370 ? 1.2874 1.8828 1.4480  0.7706  -0.4502 -0.1113 443 LEU A N   
2862 C CA  . LEU A 370 ? 1.4058 2.0672 1.5771  0.7849  -0.4378 -0.1321 443 LEU A CA  
2863 C C   . LEU A 370 ? 1.3680 2.0335 1.5378  0.7967  -0.4478 -0.1286 443 LEU A C   
2864 O O   . LEU A 370 ? 1.2835 2.0119 1.4660  0.7950  -0.4343 -0.1333 443 LEU A O   
2865 C CB  . LEU A 370 ? 1.5134 2.1721 1.6780  0.8109  -0.4419 -0.1593 443 LEU A CB  
2866 C CG  . LEU A 370 ? 1.6258 2.2989 1.7944  0.8016  -0.4290 -0.1676 443 LEU A CG  
2867 C CD1 . LEU A 370 ? 1.7078 2.3770 1.8667  0.8305  -0.4355 -0.1958 443 LEU A CD1 
2868 C CD2 . LEU A 370 ? 1.2227 1.9734 1.4116  0.7786  -0.4010 -0.1657 443 LEU A CD2 
2869 N N   . GLU A 371 ? 1.5371 2.1358 1.6909  0.8076  -0.4717 -0.1198 444 GLU A N   
2870 C CA  . GLU A 371 ? 1.6272 2.2204 1.7773  0.8227  -0.4852 -0.1172 444 GLU A CA  
2871 C C   . GLU A 371 ? 1.5841 2.2210 1.7460  0.8021  -0.4744 -0.0999 444 GLU A C   
2872 O O   . GLU A 371 ? 1.3554 2.0320 1.5241  0.8123  -0.4731 -0.1052 444 GLU A O   
2873 C CB  . GLU A 371 ? 1.4430 1.9489 1.5722  0.8314  -0.5133 -0.1055 444 GLU A CB  
2874 C CG  . GLU A 371 ? 1.4887 1.9823 1.6122  0.8520  -0.5303 -0.1056 444 GLU A CG  
2875 C CD  . GLU A 371 ? 1.7662 2.2808 1.8899  0.8856  -0.5326 -0.1346 444 GLU A CD  
2876 O OE1 . GLU A 371 ? 1.5378 2.1243 1.6769  0.8907  -0.5168 -0.1463 444 GLU A OE1 
2877 O OE2 . GLU A 371 ? 1.9020 2.3612 2.0094  0.9066  -0.5504 -0.1455 444 GLU A OE2 
2878 N N   . GLY A 372 ? 1.8099 2.4399 1.9738  0.7736  -0.4670 -0.0794 445 GLY A N   
2879 C CA  . GLY A 372 ? 1.8417 2.5116 2.0148  0.7524  -0.4563 -0.0631 445 GLY A CA  
2880 C C   . GLY A 372 ? 1.7334 2.4881 1.9248  0.7472  -0.4327 -0.0763 445 GLY A C   
2881 O O   . GLY A 372 ? 1.7353 2.5295 1.9328  0.7457  -0.4299 -0.0736 445 GLY A O   
2882 N N   . VAL A 373 ? 1.6234 2.4061 1.8228  0.7435  -0.4165 -0.0900 446 VAL A N   
2883 C CA  . VAL A 373 ? 1.6122 2.4741 1.8276  0.7355  -0.3933 -0.1020 446 VAL A CA  
2884 C C   . VAL A 373 ? 1.6301 2.5254 1.8476  0.7611  -0.3967 -0.1215 446 VAL A C   
2885 O O   . VAL A 373 ? 1.8775 2.8307 2.1049  0.7557  -0.3863 -0.1231 446 VAL A O   
2886 C CB  . VAL A 373 ? 1.1422 2.0215 1.3639  0.7255  -0.3768 -0.1113 446 VAL A CB  
2887 C CG1 . VAL A 373 ? 1.1050 2.0653 1.3418  0.7146  -0.3532 -0.1220 446 VAL A CG1 
2888 C CG2 . VAL A 373 ? 1.3230 2.1703 1.5436  0.7011  -0.3736 -0.0912 446 VAL A CG2 
2889 N N   . ILE A 374 ? 1.6230 2.4819 1.8304  0.7891  -0.4115 -0.1364 447 ILE A N   
2890 C CA  . ILE A 374 ? 1.5927 2.4786 1.8006  0.8173  -0.4162 -0.1560 447 ILE A CA  
2891 C C   . ILE A 374 ? 1.7143 2.6038 1.9226  0.8222  -0.4273 -0.1451 447 ILE A C   
2892 O O   . ILE A 374 ? 1.6534 2.6008 1.8711  0.8279  -0.4199 -0.1531 447 ILE A O   
2893 C CB  . ILE A 374 ? 1.5396 2.3748 1.7333  0.8471  -0.4330 -0.1727 447 ILE A CB  
2894 C CG1 . ILE A 374 ? 1.7002 2.5446 1.8945  0.8436  -0.4205 -0.1866 447 ILE A CG1 
2895 C CG2 . ILE A 374 ? 1.5211 2.3783 1.7139  0.8787  -0.4406 -0.1912 447 ILE A CG2 
2896 C CD1 . ILE A 374 ? 1.7756 2.5619 1.9534  0.8689  -0.4378 -0.2011 447 ILE A CD1 
2897 N N   . THR A 375 ? 1.5532 2.3815 1.7508  0.8189  -0.4453 -0.1259 448 THR A N   
2898 C CA  . THR A 375 ? 1.4249 2.2513 1.6215  0.8209  -0.4574 -0.1122 448 THR A CA  
2899 C C   . THR A 375 ? 1.2883 2.1805 1.4985  0.7961  -0.4394 -0.1028 448 THR A C   
2900 O O   . THR A 375 ? 1.2955 2.2259 1.5116  0.8023  -0.4407 -0.1036 448 THR A O   
2901 C CB  . THR A 375 ? 1.5490 2.2981 1.7302  0.8153  -0.4782 -0.0900 448 THR A CB  
2902 O OG1 . THR A 375 ? 1.5057 2.1912 1.6725  0.8386  -0.4969 -0.0987 448 THR A OG1 
2903 C CG2 . THR A 375 ? 1.6112 2.3618 1.7911  0.8151  -0.4902 -0.0744 448 THR A CG2 
2904 N N   . ALA A 376 ? 1.2423 2.1458 1.4567  0.7676  -0.4241 -0.0926 449 ALA A N   
2905 C CA  . ALA A 376 ? 1.2020 2.1642 1.4270  0.7442  -0.4085 -0.0840 449 ALA A CA  
2906 C C   . ALA A 376 ? 1.4672 2.5042 1.7053  0.7485  -0.3922 -0.1025 449 ALA A C   
2907 O O   . ALA A 376 ? 1.6449 2.7265 1.8891  0.7451  -0.3896 -0.1004 449 ALA A O   
2908 C CB  . ALA A 376 ? 1.3156 2.2765 1.5424  0.7135  -0.3943 -0.0704 449 ALA A CB  
2909 N N   . VAL A 377 ? 1.3495 2.4011 1.5909  0.7553  -0.3818 -0.1204 450 VAL A N   
2910 C CA  . VAL A 377 ? 1.3796 2.5056 1.6324  0.7543  -0.3638 -0.1364 450 VAL A CA  
2911 C C   . VAL A 377 ? 1.1974 2.3495 1.4517  0.7802  -0.3731 -0.1476 450 VAL A C   
2912 O O   . VAL A 377 ? 1.1835 2.3985 1.4470  0.7739  -0.3628 -0.1504 450 VAL A O   
2913 C CB  . VAL A 377 ? 1.3828 2.5168 1.6368  0.7568  -0.3519 -0.1529 450 VAL A CB  
2914 C CG1 . VAL A 377 ? 1.5066 2.7157 1.7697  0.7590  -0.3358 -0.1701 450 VAL A CG1 
2915 C CG2 . VAL A 377 ? 1.1097 2.2301 1.3654  0.7281  -0.3399 -0.1408 450 VAL A CG2 
2916 N N   . LEU A 378 ? 1.3504 2.4519 1.5951  0.8093  -0.3932 -0.1535 451 LEU A N   
2917 C CA  . LEU A 378 ? 1.5953 2.7077 1.8398  0.8383  -0.4063 -0.1629 451 LEU A CA  
2918 C C   . LEU A 378 ? 1.7492 2.8717 1.9967  0.8305  -0.4143 -0.1452 451 LEU A C   
2919 O O   . LEU A 378 ? 1.8441 3.0100 2.0982  0.8430  -0.4158 -0.1510 451 LEU A O   
2920 C CB  . LEU A 378 ? 1.6316 2.6759 1.8627  0.8693  -0.4278 -0.1711 451 LEU A CB  
2921 C CG  . LEU A 378 ? 1.5635 2.6047 1.7903  0.8863  -0.4230 -0.1942 451 LEU A CG  
2922 C CD1 . LEU A 378 ? 1.4173 2.3892 1.6289  0.9178  -0.4467 -0.2022 451 LEU A CD1 
2923 C CD2 . LEU A 378 ? 1.3495 2.4694 1.5863  0.8952  -0.4073 -0.2141 451 LEU A CD2 
2924 N N   . ASP A 379 ? 1.6563 2.7406 1.8984  0.8096  -0.4197 -0.1233 452 ASP A N   
2925 C CA  . ASP A 379 ? 1.6156 2.7077 1.8582  0.7994  -0.4276 -0.1051 452 ASP A CA  
2926 C C   . ASP A 379 ? 1.4606 2.6246 1.7146  0.7716  -0.4071 -0.1011 452 ASP A C   
2927 O O   . ASP A 379 ? 1.3404 2.5292 1.5968  0.7640  -0.4109 -0.0901 452 ASP A O   
2928 C CB  . ASP A 379 ? 1.6847 2.7088 1.9147  0.7873  -0.4416 -0.0828 452 ASP A CB  
2929 C CG  . ASP A 379 ? 1.6797 2.6319 1.8967  0.8138  -0.4666 -0.0823 452 ASP A CG  
2930 O OD1 . ASP A 379 ? 1.6692 2.6123 1.8853  0.8394  -0.4700 -0.1017 452 ASP A OD1 
2931 O OD2 . ASP A 379 ? 1.6128 2.5173 1.8191  0.8086  -0.4832 -0.0625 452 ASP A OD2 
2932 N N   . GLU A 380 ? 1.5036 2.6947 1.7629  0.7526  -0.3864 -0.1067 453 GLU A N   
2933 C CA  . GLU A 380 ? 1.4808 2.7385 1.7496  0.7248  -0.3663 -0.1038 453 GLU A CA  
2934 C C   . GLU A 380 ? 1.5517 2.8783 1.8306  0.7342  -0.3560 -0.1213 453 GLU A C   
2935 O O   . GLU A 380 ? 1.6102 2.9918 1.8957  0.7189  -0.3479 -0.1173 453 GLU A O   
2936 C CB  . GLU A 380 ? 1.4968 2.7532 1.7669  0.6985  -0.3487 -0.1007 453 GLU A CB  
2937 C CG  . GLU A 380 ? 1.4700 2.7918 1.7489  0.6680  -0.3274 -0.0981 453 GLU A CG  
2938 C CD  . GLU A 380 ? 1.6169 2.9572 1.8948  0.6525  -0.3316 -0.0824 453 GLU A CD  
2939 O OE1 . GLU A 380 ? 1.8330 3.2357 2.1179  0.6389  -0.3204 -0.0848 453 GLU A OE1 
2940 O OE2 . GLU A 380 ? 1.3791 2.6718 1.6480  0.6531  -0.3465 -0.0672 453 GLU A OE2 
2941 N N   . PHE A 381 ? 1.7964 3.1149 2.0745  0.7592  -0.3575 -0.1399 454 PHE A N   
2942 C CA  . PHE A 381 ? 1.9587 3.3418 2.2447  0.7715  -0.3487 -0.1574 454 PHE A CA  
2943 C C   . PHE A 381 ? 2.2106 3.5742 2.4934  0.8108  -0.3675 -0.1685 454 PHE A C   
2944 O O   . PHE A 381 ? 2.3600 3.7213 2.6404  0.8338  -0.3676 -0.1874 454 PHE A O   
2945 C CB  . PHE A 381 ? 1.8843 3.2941 2.1725  0.7649  -0.3300 -0.1722 454 PHE A CB  
2946 C CG  . PHE A 381 ? 1.8939 3.3432 2.1877  0.7266  -0.3090 -0.1638 454 PHE A CG  
2947 C CD1 . PHE A 381 ? 1.8814 3.2953 2.1726  0.7019  -0.3069 -0.1469 454 PHE A CD1 
2948 C CD2 . PHE A 381 ? 1.9451 3.4664 2.2459  0.7151  -0.2916 -0.1728 454 PHE A CD2 
2949 C CE1 . PHE A 381 ? 1.8308 3.2796 2.1269  0.6674  -0.2880 -0.1396 454 PHE A CE1 
2950 C CE2 . PHE A 381 ? 1.9228 3.4774 2.2276  0.6791  -0.2732 -0.1647 454 PHE A CE2 
2951 C CZ  . PHE A 381 ? 1.8777 3.3954 2.1804  0.6557  -0.2714 -0.1485 454 PHE A CZ  
2952 N N   . PRO A 382 ? 2.1962 3.5457 2.4782  0.8197  -0.3841 -0.1575 455 PRO A N   
2953 C CA  . PRO A 382 ? 2.1276 3.4464 2.4054  0.8575  -0.4042 -0.1663 455 PRO A CA  
2954 C C   . PRO A 382 ? 2.0425 3.4249 2.3286  0.8776  -0.3987 -0.1846 455 PRO A C   
2955 O O   . PRO A 382 ? 1.8540 3.2962 2.1495  0.8669  -0.3917 -0.1806 455 PRO A O   
2956 C CB  . PRO A 382 ? 2.1120 3.4105 2.3884  0.8547  -0.4208 -0.1464 455 PRO A CB  
2957 C CG  . PRO A 382 ? 2.1272 3.4920 2.4131  0.8251  -0.4051 -0.1378 455 PRO A CG  
2958 C CD  . PRO A 382 ? 2.1679 3.5555 2.4558  0.7991  -0.3821 -0.1421 455 PRO A CD  
2959 N N   . HIS A 383 ? 2.3699 3.7408 2.6517  0.9057  -0.4015 -0.2047 456 HIS A N   
2960 C CA  . HIS A 383 ? 2.5613 3.9751 2.8478  0.9356  -0.4038 -0.2226 456 HIS A CA  
2961 C C   . HIS A 383 ? 2.4944 3.9964 2.7912  0.9209  -0.3814 -0.2311 456 HIS A C   
2962 O O   . HIS A 383 ? 2.4406 3.9931 2.7430  0.9407  -0.3801 -0.2443 456 HIS A O   
2963 C CB  . HIS A 383 ? 2.6133 4.0170 2.9023  0.9544  -0.4237 -0.2138 456 HIS A CB  
2964 C CG  . HIS A 383 ? 2.5396 3.8732 2.8178  0.9886  -0.4467 -0.2195 456 HIS A CG  
2965 N ND1 . HIS A 383 ? 2.4764 3.7437 2.7474  0.9896  -0.4672 -0.2013 456 HIS A ND1 
2966 C CD2 . HIS A 383 ? 2.4858 3.8040 2.7576  1.0225  -0.4530 -0.2412 456 HIS A CD2 
2967 C CE1 . HIS A 383 ? 2.4799 3.6925 2.7407  1.0219  -0.4853 -0.2111 456 HIS A CE1 
2968 N NE2 . HIS A 383 ? 2.4585 3.7002 2.7195  1.0430  -0.4772 -0.2360 456 HIS A NE2 
2969 N N   . VAL A 384 ? 2.5522 4.0725 2.8513  0.8844  -0.3643 -0.2218 457 VAL A N   
2970 C CA  . VAL A 384 ? 2.4390 3.9958 2.7388  0.8685  -0.3434 -0.2321 457 VAL A CA  
2971 C C   . VAL A 384 ? 2.2617 3.7598 2.5508  0.8849  -0.3488 -0.2435 457 VAL A C   
2972 O O   . VAL A 384 ? 2.2285 3.7492 2.5152  0.8935  -0.3394 -0.2614 457 VAL A O   
2973 C CB  . VAL A 384 ? 2.2511 3.8225 2.5544  0.8252  -0.3282 -0.2154 457 VAL A CB  
2974 C CG1 . VAL A 384 ? 2.3100 3.8059 2.6063  0.8150  -0.3378 -0.1998 457 VAL A CG1 
2975 C CG2 . VAL A 384 ? 2.0798 3.6936 2.3842  0.8077  -0.3064 -0.2256 457 VAL A CG2 
2976 N N   . TRP A 385 ? 2.2036 3.6263 2.4853  0.8882  -0.3647 -0.2321 458 TRP A N   
2977 C CA  . TRP A 385 ? 2.2683 3.6265 2.5384  0.9015  -0.3725 -0.2397 458 TRP A CA  
2978 C C   . TRP A 385 ? 2.4671 3.7639 2.7285  0.9337  -0.3981 -0.2405 458 TRP A C   
2979 O O   . TRP A 385 ? 2.5204 3.8154 2.7850  0.9397  -0.4101 -0.2299 458 TRP A O   
2980 C CB  . TRP A 385 ? 2.1025 3.4212 2.3698  0.8708  -0.3671 -0.2234 458 TRP A CB  
2981 C CG  . TRP A 385 ? 1.9138 3.2623 2.1830  0.8528  -0.3467 -0.2316 458 TRP A CG  
2982 C CD1 . TRP A 385 ? 1.8231 3.2120 2.0999  0.8176  -0.3274 -0.2219 458 TRP A CD1 
2983 C CD2 . TRP A 385 ? 1.8634 3.2053 2.1261  0.8689  -0.3439 -0.2513 458 TRP A CD2 
2984 N NE1 . TRP A 385 ? 1.6726 3.0800 1.9487  0.8103  -0.3127 -0.2334 458 TRP A NE1 
2985 C CE2 . TRP A 385 ? 1.8154 3.1955 2.0828  0.8415  -0.3225 -0.2517 458 TRP A CE2 
2986 C CE3 . TRP A 385 ? 1.8496 3.1560 2.1018  0.9040  -0.3579 -0.2690 458 TRP A CE3 
2987 C CZ2 . TRP A 385 ? 1.8079 3.1938 2.0704  0.8475  -0.3148 -0.2683 458 TRP A CZ2 
2988 C CZ3 . TRP A 385 ? 1.8465 3.1587 2.0933  0.9104  -0.3502 -0.2867 458 TRP A CZ3 
2989 C CH2 . TRP A 385 ? 1.8154 3.1680 2.0676  0.8823  -0.3289 -0.2860 458 TRP A CH2 
2990 N N   . ALA A 386 ? 2.7003 3.9413 2.9496  0.9524  -0.4077 -0.2514 459 ALA A N   
2991 C CA  . ALA A 386 ? 2.8990 4.0772 3.1380  0.9827  -0.4330 -0.2524 459 ALA A CA  
2992 C C   . ALA A 386 ? 2.9447 4.1532 3.1836  1.0193  -0.4379 -0.2750 459 ALA A C   
2993 O O   . ALA A 386 ? 2.9800 4.1465 3.2117  1.0482  -0.4587 -0.2784 459 ALA A O   
2994 C CB  . ALA A 386 ? 2.8746 4.0322 3.1164  0.9733  -0.4458 -0.2286 459 ALA A CB  
2995 N N   . LYS A 387 ? 2.9952 4.2769 3.2416  1.0181  -0.4190 -0.2905 460 LYS A N   
2996 C CA  . LYS A 387 ? 2.8820 4.1984 3.1278  1.0528  -0.4219 -0.3134 460 LYS A CA  
2997 C C   . LYS A 387 ? 2.8764 4.1278 3.1053  1.0808  -0.4362 -0.3297 460 LYS A C   
2998 O O   . LYS A 387 ? 2.8310 4.0611 3.0535  1.1161  -0.4528 -0.3419 460 LYS A O   
2999 C CB  . LYS A 387 ? 2.7410 4.1418 2.9945  1.0423  -0.3981 -0.3267 460 LYS A CB  
3000 C CG  . LYS A 387 ? 2.4789 3.8711 2.7256  1.0271  -0.3851 -0.3343 460 LYS A CG  
3001 C CD  . LYS A 387 ? 2.3795 3.8572 2.6330  1.0156  -0.3623 -0.3459 460 LYS A CD  
3002 C CE  . LYS A 387 ? 2.3381 3.8690 2.6054  0.9789  -0.3468 -0.3271 460 LYS A CE  
3003 N NZ  . LYS A 387 ? 2.4312 4.0446 2.7037  0.9650  -0.3252 -0.3367 460 LYS A NZ  
3004 N N   . ARG A 388 ? 2.8343 4.0523 3.0546  1.0672  -0.4307 -0.3320 461 ARG A N   
3005 C CA  . ARG A 388 ? 2.8915 4.0358 3.0940  1.0862  -0.4455 -0.3428 461 ARG A CA  
3006 C C   . ARG A 388 ? 2.7574 3.8561 2.9569  1.0540  -0.4422 -0.3249 461 ARG A C   
3007 O O   . ARG A 388 ? 2.6529 3.7935 2.8626  1.0223  -0.4222 -0.3161 461 ARG A O   
3008 C CB  . ARG A 388 ? 2.8961 4.0691 3.0913  1.1074  -0.4383 -0.3721 461 ARG A CB  
3009 C CG  . ARG A 388 ? 2.9324 4.1556 3.1301  1.1404  -0.4403 -0.3915 461 ARG A CG  
3010 C CD  . ARG A 388 ? 2.9865 4.1507 3.1745  1.1753  -0.4668 -0.3948 461 ARG A CD  
3011 N NE  . ARG A 388 ? 3.0432 4.2581 3.2352  1.2073  -0.4687 -0.4123 461 ARG A NE  
3012 C CZ  . ARG A 388 ? 3.1603 4.3438 3.3484  1.2386  -0.4894 -0.4150 461 ARG A CZ  
3013 N NH1 . ARG A 388 ? 3.2148 4.3150 3.3937  1.2410  -0.5105 -0.4006 461 ARG A NH1 
3014 N NH2 . ARG A 388 ? 3.2242 4.4604 3.4174  1.2672  -0.4894 -0.4312 461 ARG A NH2 
3015 N N   . ARG A 389 ? 2.6368 3.6488 2.8224  1.0616  -0.4630 -0.3175 462 ARG A N   
3016 C CA  . ARG A 389 ? 2.4137 3.3798 2.5961  1.0319  -0.4617 -0.2988 462 ARG A CA  
3017 C C   . ARG A 389 ? 2.3750 3.3297 2.5492  1.0295  -0.4541 -0.3131 462 ARG A C   
3018 O O   . ARG A 389 ? 2.2750 3.2382 2.4548  0.9992  -0.4399 -0.3024 462 ARG A O   
3019 C CB  . ARG A 389 ? 2.1137 2.9932 2.2838  1.0367  -0.4868 -0.2822 462 ARG A CB  
3020 C CG  . ARG A 389 ? 1.6377 2.4679 1.8035  1.0068  -0.4870 -0.2619 462 ARG A CG  
3021 C CD  . ARG A 389 ? 1.6996 2.4680 1.8588  1.0008  -0.5069 -0.2374 462 ARG A CD  
3022 N NE  . ARG A 389 ? 1.8585 2.5897 2.0151  0.9694  -0.5048 -0.2161 462 ARG A NE  
3023 C CZ  . ARG A 389 ? 2.0501 2.7419 2.2037  0.9530  -0.5158 -0.1903 462 ARG A CZ  
3024 N NH1 . ARG A 389 ? 1.5819 2.2657 1.7348  0.9646  -0.5300 -0.1821 462 ARG A NH1 
3025 N NH2 . ARG A 389 ? 1.9780 2.6398 2.1289  0.9251  -0.5127 -0.1722 462 ARG A NH2 
3026 N N   . GLU A 390 ? 2.7486 3.6841 2.9095  1.0624  -0.4644 -0.3373 463 GLU A N   
3027 C CA  . GLU A 390 ? 2.9588 3.8825 3.1099  1.0641  -0.4596 -0.3533 463 GLU A CA  
3028 C C   . GLU A 390 ? 3.1238 4.1268 3.2886  1.0413  -0.4318 -0.3574 463 GLU A C   
3029 O O   . GLU A 390 ? 3.3000 4.2951 3.4625  1.0249  -0.4234 -0.3578 463 GLU A O   
3030 C CB  . GLU A 390 ? 3.0883 3.9928 3.2232  1.1053  -0.4735 -0.3818 463 GLU A CB  
3031 N N   . ARG A 391 ? 2.4783 3.5578 2.6569  1.0396  -0.4179 -0.3600 464 ARG A N   
3032 C CA  . ARG A 391 ? 2.0974 3.2536 2.2879  1.0160  -0.3919 -0.3625 464 ARG A CA  
3033 C C   . ARG A 391 ? 2.2544 3.4064 2.4546  0.9745  -0.3801 -0.3378 464 ARG A C   
3034 O O   . ARG A 391 ? 2.5036 3.6700 2.7052  0.9553  -0.3661 -0.3389 464 ARG A O   
3035 C CB  . ARG A 391 ? 1.7163 2.9507 1.9185  1.0211  -0.3819 -0.3675 464 ARG A CB  
3036 N N   . PHE A 392 ? 2.0621 3.1951 2.2686  0.9604  -0.3857 -0.3151 465 PHE A N   
3037 C CA  . PHE A 392 ? 1.8568 2.9861 2.0718  0.9220  -0.3749 -0.2916 465 PHE A CA  
3038 C C   . PHE A 392 ? 1.9132 2.9737 2.1184  0.9149  -0.3826 -0.2854 465 PHE A C   
3039 O O   . PHE A 392 ? 1.8116 2.8834 2.0221  0.8883  -0.3682 -0.2780 465 PHE A O   
3040 C CB  . PHE A 392 ? 1.7065 2.8302 1.9284  0.9106  -0.3808 -0.2697 465 PHE A CB  
3041 C CG  . PHE A 392 ? 1.5797 2.6985 1.8088  0.8728  -0.3708 -0.2460 465 PHE A CG  
3042 C CD1 . PHE A 392 ? 1.2365 2.4208 1.4783  0.8448  -0.3480 -0.2416 465 PHE A CD1 
3043 C CD2 . PHE A 392 ? 1.3983 2.4467 1.6205  0.8648  -0.3845 -0.2279 465 PHE A CD2 
3044 C CE1 . PHE A 392 ? 1.1925 2.3719 1.4404  0.8111  -0.3389 -0.2207 465 PHE A CE1 
3045 C CE2 . PHE A 392 ? 1.5109 2.5569 1.7393  0.8312  -0.3750 -0.2067 465 PHE A CE2 
3046 C CZ  . PHE A 392 ? 1.1968 2.3081 1.4383  0.8050  -0.3521 -0.2036 465 PHE A CZ  
3047 N N   . VAL A 393 ? 2.1913 3.1792 2.3818  0.9376  -0.4060 -0.2873 466 VAL A N   
3048 C CA  . VAL A 393 ? 2.0740 2.9931 2.2536  0.9312  -0.4155 -0.2809 466 VAL A CA  
3049 C C   . VAL A 393 ? 2.3550 3.2932 2.5319  0.9317  -0.4043 -0.2987 466 VAL A C   
3050 O O   . VAL A 393 ? 2.5232 3.4448 2.7013  0.9097  -0.3981 -0.2891 466 VAL A O   
3051 C CB  . VAL A 393 ? 2.0621 2.9007 2.2238  0.9575  -0.4440 -0.2821 466 VAL A CB  
3052 C CG1 . VAL A 393 ? 1.8782 2.6459 2.0266  0.9512  -0.4549 -0.2767 466 VAL A CG1 
3053 C CG2 . VAL A 393 ? 2.2611 3.0802 2.4255  0.9530  -0.4549 -0.2612 466 VAL A CG2 
3054 N N   . LEU A 394 ? 2.1278 3.1032 2.3010  0.9569  -0.4017 -0.3246 467 LEU A N   
3055 C CA  . LEU A 394 ? 2.0283 3.0307 2.1987  0.9575  -0.3902 -0.3426 467 LEU A CA  
3056 C C   . LEU A 394 ? 1.9463 3.0123 2.1333  0.9222  -0.3641 -0.3324 467 LEU A C   
3057 O O   . LEU A 394 ? 2.0394 3.1020 2.2267  0.9061  -0.3560 -0.3312 467 LEU A O   
3058 C CB  . LEU A 394 ? 1.7966 2.8332 1.9596  0.9915  -0.3920 -0.3718 467 LEU A CB  
3059 C CG  . LEU A 394 ? 1.7198 2.7867 1.8770  0.9979  -0.3823 -0.3943 467 LEU A CG  
3060 C CD1 . LEU A 394 ? 1.8665 2.9112 2.0056  1.0400  -0.3987 -0.4219 467 LEU A CD1 
3061 C CD2 . LEU A 394 ? 1.6692 2.8303 1.8406  0.9808  -0.3569 -0.3975 467 LEU A CD2 
3062 N N   . ALA A 395 ? 1.8744 2.9981 2.0748  0.9094  -0.3514 -0.3248 468 ALA A N   
3063 C CA  . ALA A 395 ? 1.6711 2.8548 1.8860  0.8749  -0.3273 -0.3147 468 ALA A CA  
3064 C C   . ALA A 395 ? 1.5821 2.7293 1.8022  0.8439  -0.3245 -0.2905 468 ALA A C   
3065 O O   . ALA A 395 ? 1.5658 2.7463 1.7946  0.8164  -0.3063 -0.2840 468 ALA A O   
3066 C CB  . ALA A 395 ? 1.7565 3.0010 1.9826  0.8678  -0.3176 -0.3100 468 ALA A CB  
3067 N N   . VAL A 396 ? 1.7100 2.7899 1.9244  0.8475  -0.3423 -0.2764 469 VAL A N   
3068 C CA  . VAL A 396 ? 1.6561 2.6980 1.8739  0.8202  -0.3414 -0.2533 469 VAL A CA  
3069 C C   . VAL A 396 ? 1.6343 2.6325 1.8430  0.8231  -0.3472 -0.2586 469 VAL A C   
3070 O O   . VAL A 396 ? 1.6468 2.6525 1.8624  0.7981  -0.3349 -0.2489 469 VAL A O   
3071 C CB  . VAL A 396 ? 1.5973 2.5876 1.8116  0.8207  -0.3583 -0.2343 469 VAL A CB  
3072 C CG1 . VAL A 396 ? 1.5915 2.5347 1.8058  0.7965  -0.3604 -0.2117 469 VAL A CG1 
3073 C CG2 . VAL A 396 ? 1.5190 2.5581 1.7442  0.8116  -0.3503 -0.2261 469 VAL A CG2 
3074 N N   . VAL A 397 ? 1.2606 2.2121 1.4534  0.8539  -0.3666 -0.2740 470 VAL A N   
3075 C CA  . VAL A 397 ? 1.2753 2.1791 1.4568  0.8588  -0.3755 -0.2797 470 VAL A CA  
3076 C C   . VAL A 397 ? 1.4332 2.3903 1.6209  0.8492  -0.3564 -0.2922 470 VAL A C   
3077 O O   . VAL A 397 ? 1.3682 2.3094 1.5576  0.8316  -0.3526 -0.2842 470 VAL A O   
3078 C CB  . VAL A 397 ? 1.3430 2.1919 1.5045  0.8958  -0.3998 -0.2975 470 VAL A CB  
3079 C CG1 . VAL A 397 ? 1.8484 2.6619 1.9973  0.9038  -0.4072 -0.3099 470 VAL A CG1 
3080 C CG2 . VAL A 397 ? 1.3722 2.1533 1.5257  0.8992  -0.4209 -0.2798 470 VAL A CG2 
3081 N N   . ILE A 398 ? 1.2890 2.3109 1.4798  0.8600  -0.3445 -0.3113 471 ILE A N   
3082 C CA  . ILE A 398 ? 1.2569 2.3331 1.4522  0.8501  -0.3263 -0.3230 471 ILE A CA  
3083 C C   . ILE A 398 ? 1.1953 2.3039 1.4073  0.8097  -0.3062 -0.3014 471 ILE A C   
3084 O O   . ILE A 398 ? 1.2218 2.3367 1.4366  0.7940  -0.2976 -0.2998 471 ILE A O   
3085 C CB  . ILE A 398 ? 1.3892 2.5314 1.5837  0.8681  -0.3178 -0.3456 471 ILE A CB  
3086 C CG1 . ILE A 398 ? 1.5854 2.6946 1.7617  0.9096  -0.3372 -0.3703 471 ILE A CG1 
3087 C CG2 . ILE A 398 ? 1.2726 2.4803 1.4736  0.8503  -0.2961 -0.3526 471 ILE A CG2 
3088 C CD1 . ILE A 398 ? 1.6760 2.8502 1.8495  0.9295  -0.3291 -0.3952 471 ILE A CD1 
3089 N N   . THR A 399 ? 1.1346 2.2639 1.3575  0.7924  -0.2990 -0.2848 472 THR A N   
3090 C CA  . THR A 399 ? 1.0798 2.2362 1.3173  0.7544  -0.2808 -0.2642 472 THR A CA  
3091 C C   . THR A 399 ? 1.4002 2.5002 1.6379  0.7396  -0.2868 -0.2468 472 THR A C   
3092 O O   . THR A 399 ? 1.3847 2.5030 1.6310  0.7144  -0.2727 -0.2380 472 THR A O   
3093 C CB  . THR A 399 ? 1.2496 2.4283 1.4959  0.7417  -0.2759 -0.2499 472 THR A CB  
3094 O OG1 . THR A 399 ? 1.5166 2.7475 1.7625  0.7568  -0.2720 -0.2657 472 THR A OG1 
3095 C CG2 . THR A 399 ? 1.0100 2.2209 1.2701  0.7029  -0.2562 -0.2311 472 THR A CG2 
3096 N N   . CYS A 400 ? 1.3804 2.4114 1.6081  0.7543  -0.3082 -0.2408 473 CYS A N   
3097 C CA  . CYS A 400 ? 1.2243 2.1989 1.4499  0.7417  -0.3162 -0.2242 473 CYS A CA  
3098 C C   . CYS A 400 ? 1.3519 2.3179 1.5719  0.7472  -0.3174 -0.2368 473 CYS A C   
3099 O O   . CYS A 400 ? 1.5004 2.4515 1.7253  0.7269  -0.3136 -0.2231 473 CYS A O   
3100 C CB  . CYS A 400 ? 1.2817 2.1830 1.4948  0.7568  -0.3406 -0.2156 473 CYS A CB  
3101 S SG  . CYS A 400 ? 1.3769 2.2802 1.5965  0.7450  -0.3407 -0.1948 473 CYS A SG  
3102 N N   . PHE A 401 ? 1.4164 2.3919 1.6257  0.7750  -0.3233 -0.2629 474 PHE A N   
3103 C CA  . PHE A 401 ? 1.3303 2.3023 1.5332  0.7812  -0.3245 -0.2768 474 PHE A CA  
3104 C C   . PHE A 401 ? 1.3621 2.3978 1.5798  0.7538  -0.2999 -0.2733 474 PHE A C   
3105 O O   . PHE A 401 ? 1.5737 2.5981 1.7943  0.7388  -0.2977 -0.2658 474 PHE A O   
3106 C CB  . PHE A 401 ? 1.2902 2.2653 1.4779  0.8175  -0.3345 -0.3072 474 PHE A CB  
3107 C CG  . PHE A 401 ? 1.2393 2.2248 1.4207  0.8239  -0.3330 -0.3245 474 PHE A CG  
3108 C CD1 . PHE A 401 ? 1.3172 2.2404 1.4876  0.8288  -0.3501 -0.3229 474 PHE A CD1 
3109 C CD2 . PHE A 401 ? 1.2259 2.2838 1.4114  0.8240  -0.3153 -0.3415 474 PHE A CD2 
3110 C CE1 . PHE A 401 ? 1.2646 2.1985 1.4291  0.8347  -0.3496 -0.3389 474 PHE A CE1 
3111 C CE2 . PHE A 401 ? 1.2313 2.3010 1.4106  0.8295  -0.3141 -0.3573 474 PHE A CE2 
3112 C CZ  . PHE A 401 ? 1.2503 2.2583 1.4195  0.8355  -0.3313 -0.3565 474 PHE A CZ  
3113 N N   . PHE A 402 ? 1.3406 2.4438 1.5672  0.7459  -0.2819 -0.2778 475 PHE A N   
3114 C CA  . PHE A 402 ? 1.2544 2.4166 1.4939  0.7169  -0.2587 -0.2724 475 PHE A CA  
3115 C C   . PHE A 402 ? 1.1817 2.3304 1.4345  0.6833  -0.2507 -0.2437 475 PHE A C   
3116 O O   . PHE A 402 ? 1.1118 2.2852 1.3735  0.6589  -0.2365 -0.2357 475 PHE A O   
3117 C CB  . PHE A 402 ? 1.4115 2.6448 1.6552  0.7143  -0.2430 -0.2817 475 PHE A CB  
3118 C CG  . PHE A 402 ? 1.6264 2.8919 1.8591  0.7405  -0.2443 -0.3101 475 PHE A CG  
3119 C CD1 . PHE A 402 ? 1.5339 2.8248 1.7643  0.7370  -0.2369 -0.3209 475 PHE A CD1 
3120 C CD2 . PHE A 402 ? 1.8294 3.1015 2.0540  0.7689  -0.2530 -0.3258 475 PHE A CD2 
3121 C CE1 . PHE A 402 ? 1.8278 3.1506 2.0470  0.7615  -0.2379 -0.3477 475 PHE A CE1 
3122 C CE2 . PHE A 402 ? 1.9592 3.2626 2.1732  0.7940  -0.2540 -0.3524 475 PHE A CE2 
3123 C CZ  . PHE A 402 ? 1.9688 3.2978 2.1795  0.7905  -0.2464 -0.3638 475 PHE A CZ  
3124 N N   . GLY A 403 ? 1.3285 2.4378 1.5820  0.6819  -0.2599 -0.2280 476 GLY A N   
3125 C CA  . GLY A 403 ? 1.2486 2.3414 1.5131  0.6530  -0.2539 -0.2013 476 GLY A CA  
3126 C C   . GLY A 403 ? 1.0932 2.1244 1.3515  0.6462  -0.2634 -0.1901 476 GLY A C   
3127 O O   . GLY A 403 ? 1.1283 2.1368 1.3898  0.6129  -0.2524 -0.1673 476 GLY A O   
3128 N N   . SER A 404 ? 0.9913 1.9841 1.2347  0.6708  -0.2808 -0.2051 477 SER A N   
3129 C CA  . SER A 404 ? 1.0089 1.9295 1.2384  0.6592  -0.2895 -0.1950 477 SER A CA  
3130 C C   . SER A 404 ? 1.2639 2.2022 1.4916  0.6504  -0.2807 -0.2038 477 SER A C   
3131 O O   . SER A 404 ? 1.1862 2.0707 1.4030  0.6386  -0.2867 -0.1958 477 SER A O   
3132 C CB  . SER A 404 ? 1.2902 2.1466 1.5011  0.6898  -0.3172 -0.2041 477 SER A CB  
3133 O OG  . SER A 404 ? 1.4017 2.2359 1.6129  0.6957  -0.3267 -0.1930 477 SER A OG  
3134 N N   . LEU A 405 ? 1.0806 2.0944 1.3184  0.6551  -0.2670 -0.2196 478 LEU A N   
3135 C CA  . LEU A 405 ? 1.1591 2.1935 1.3943  0.6466  -0.2587 -0.2282 478 LEU A CA  
3136 C C   . LEU A 405 ? 1.2872 2.3104 1.5293  0.6041  -0.2428 -0.2028 478 LEU A C   
3137 O O   . LEU A 405 ? 1.2594 2.2698 1.4955  0.5926  -0.2409 -0.2025 478 LEU A O   
3138 C CB  . LEU A 405 ? 1.1061 2.2289 1.3511  0.6597  -0.2471 -0.2494 478 LEU A CB  
3139 C CG  . LEU A 405 ? 1.4067 2.5437 1.6424  0.7020  -0.2603 -0.2780 478 LEU A CG  
3140 C CD1 . LEU A 405 ? 1.5804 2.7940 1.8181  0.7001  -0.2420 -0.2942 478 LEU A CD1 
3141 C CD2 . LEU A 405 ? 1.5401 2.6229 1.7567  0.7274  -0.2812 -0.2937 478 LEU A CD2 
3142 N N   . VAL A 406 ? 1.4529 2.4810 1.7073  0.5810  -0.2315 -0.1815 479 VAL A N   
3143 C CA  . VAL A 406 ? 1.3661 2.3794 1.6273  0.5425  -0.2168 -0.1566 479 VAL A CA  
3144 C C   . VAL A 406 ? 1.2439 2.1764 1.4930  0.5356  -0.2299 -0.1427 479 VAL A C   
3145 O O   . VAL A 406 ? 1.0455 1.9597 1.2959  0.5106  -0.2226 -0.1281 479 VAL A O   
3146 C CB  . VAL A 406 ? 1.2834 2.3191 1.5586  0.5219  -0.2024 -0.1392 479 VAL A CB  
3147 C CG1 . VAL A 406 ? 1.2085 2.2355 1.4917  0.4838  -0.1855 -0.1157 479 VAL A CG1 
3148 C CG2 . VAL A 406 ? 1.6028 2.7176 1.8887  0.5309  -0.1927 -0.1538 479 VAL A CG2 
3149 N N   . THR A 407 ? 1.2447 2.1287 1.4819  0.5576  -0.2500 -0.1464 480 THR A N   
3150 C CA  . THR A 407 ? 1.3080 2.1142 1.5325  0.5514  -0.2647 -0.1326 480 THR A CA  
3151 C C   . THR A 407 ? 1.4206 2.1981 1.6285  0.5664  -0.2796 -0.1484 480 THR A C   
3152 O O   . THR A 407 ? 1.7321 2.4532 1.9307  0.5533  -0.2881 -0.1357 480 THR A O   
3153 C CB  . THR A 407 ? 1.6098 2.3748 1.8276  0.5662  -0.2807 -0.1277 480 THR A CB  
3154 O OG1 . THR A 407 ? 1.9247 2.7254 2.1565  0.5568  -0.2674 -0.1181 480 THR A OG1 
3155 C CG2 . THR A 407 ? 1.4960 2.1860 1.7039  0.5509  -0.2917 -0.1067 480 THR A CG2 
3156 N N   . LEU A 408 ? 1.2005 2.0170 1.4043  0.5931  -0.2829 -0.1760 481 LEU A N   
3157 C CA  . LEU A 408 ? 1.1160 1.9082 1.3020  0.6098  -0.2969 -0.1945 481 LEU A CA  
3158 C C   . LEU A 408 ? 1.0265 1.8427 1.2154  0.5867  -0.2833 -0.1920 481 LEU A C   
3159 O O   . LEU A 408 ? 1.0551 1.8564 1.2290  0.5970  -0.2928 -0.2073 481 LEU A O   
3160 C CB  . LEU A 408 ? 1.3864 2.2121 1.5662  0.6502  -0.3058 -0.2265 481 LEU A CB  
3161 C CG  . LEU A 408 ? 1.1106 1.9058 1.2838  0.6798  -0.3245 -0.2330 481 LEU A CG  
3162 C CD1 . LEU A 408 ? 1.1324 1.9751 1.3040  0.7194  -0.3292 -0.2646 481 LEU A CD1 
3163 C CD2 . LEU A 408 ? 1.1569 1.8610 1.3089  0.6847  -0.3486 -0.2272 481 LEU A CD2 
3164 N N   . THR A 409 ? 0.9790 1.8305 1.1858  0.5559  -0.2618 -0.1731 482 THR A N   
3165 C CA  . THR A 409 ? 0.9796 1.8548 1.1906  0.5322  -0.2485 -0.1679 482 THR A CA  
3166 C C   . THR A 409 ? 1.1600 1.9698 1.3618  0.5134  -0.2573 -0.1504 482 THR A C   
3167 O O   . THR A 409 ? 1.2433 1.9908 1.4362  0.5165  -0.2727 -0.1411 482 THR A O   
3168 C CB  . THR A 409 ? 0.9059 1.8341 1.1382  0.5054  -0.2241 -0.1520 482 THR A CB  
3169 O OG1 . THR A 409 ? 0.8890 1.7827 1.1294  0.4864  -0.2207 -0.1262 482 THR A OG1 
3170 C CG2 . THR A 409 ? 1.0126 2.0112 1.2536  0.5219  -0.2156 -0.1695 482 THR A CG2 
3171 N N   . PHE A 410 ? 1.1269 1.9525 1.3306  0.4931  -0.2482 -0.1456 483 PHE A N   
3172 C CA  . PHE A 410 ? 0.9648 1.7354 1.1614  0.4734  -0.2557 -0.1284 483 PHE A CA  
3173 C C   . PHE A 410 ? 1.4549 2.1957 1.6644  0.4482  -0.2491 -0.0970 483 PHE A C   
3174 O O   . PHE A 410 ? 1.4513 2.1314 1.6529  0.4417  -0.2621 -0.0833 483 PHE A O   
3175 C CB  . PHE A 410 ? 0.9860 1.7872 1.1836  0.4566  -0.2462 -0.1291 483 PHE A CB  
3176 C CG  . PHE A 410 ? 1.1316 1.9645 1.3152  0.4806  -0.2517 -0.1604 483 PHE A CG  
3177 C CD1 . PHE A 410 ? 1.2691 2.0578 1.4295  0.5045  -0.2738 -0.1793 483 PHE A CD1 
3178 C CD2 . PHE A 410 ? 1.2727 2.1795 1.4654  0.4792  -0.2351 -0.1712 483 PHE A CD2 
3179 C CE1 . PHE A 410 ? 1.3695 2.1877 1.5160  0.5283  -0.2784 -0.2097 483 PHE A CE1 
3180 C CE2 . PHE A 410 ? 1.3882 2.3281 1.5680  0.5017  -0.2393 -0.2004 483 PHE A CE2 
3181 C CZ  . PHE A 410 ? 1.4706 2.3664 1.6274  0.5272  -0.2605 -0.2204 483 PHE A CZ  
3182 N N   . GLY A 411 ? 1.3183 2.1011 1.5468  0.4340  -0.2293 -0.0859 484 GLY A N   
3183 C CA  . GLY A 411 ? 1.2159 1.9756 1.4566  0.4124  -0.2212 -0.0586 484 GLY A CA  
3184 C C   . GLY A 411 ? 1.2504 2.0025 1.4915  0.4274  -0.2254 -0.0604 484 GLY A C   
3185 O O   . GLY A 411 ? 1.2092 1.9814 1.4641  0.4147  -0.2109 -0.0477 484 GLY A O   
3186 N N   . GLY A 412 ? 1.6836 2.4058 1.9088  0.4547  -0.2458 -0.0764 485 GLY A N   
3187 C CA  . GLY A 412 ? 2.0123 2.7280 2.2364  0.4720  -0.2523 -0.0798 485 GLY A CA  
3188 C C   . GLY A 412 ? 2.0181 2.6815 2.2423  0.4582  -0.2570 -0.0554 485 GLY A C   
3189 O O   . GLY A 412 ? 2.1037 2.7767 2.3349  0.4578  -0.2514 -0.0486 485 GLY A O   
3190 N N   . ALA A 413 ? 0.9504 1.5604 1.1664  0.4458  -0.2670 -0.0416 486 ALA A N   
3191 C CA  . ALA A 413 ? 0.9553 1.5160 1.1705  0.4323  -0.2722 -0.0178 486 ALA A CA  
3192 C C   . ALA A 413 ? 1.4052 1.9912 1.6396  0.4072  -0.2493 0.0031  486 ALA A C   
3193 O O   . ALA A 413 ? 1.8244 2.3923 2.0604  0.4028  -0.2490 0.0165  486 ALA A O   
3194 C CB  . ALA A 413 ? 0.9784 1.4850 1.1833  0.4200  -0.2854 -0.0058 486 ALA A CB  
3195 N N   . TYR A 414 ? 1.1446 1.7716 1.3924  0.3906  -0.2302 0.0059  487 TYR A N   
3196 C CA  . TYR A 414 ? 0.9804 1.6329 1.2457  0.3681  -0.2078 0.0235  487 TYR A CA  
3197 C C   . TYR A 414 ? 1.2615 1.9430 1.5302  0.3785  -0.2021 0.0162  487 TYR A C   
3198 O O   . TYR A 414 ? 1.4059 2.0779 1.6799  0.3671  -0.1946 0.0318  487 TYR A O   
3199 C CB  . TYR A 414 ? 0.8737 1.5685 1.1509  0.3525  -0.1906 0.0238  487 TYR A CB  
3200 C CG  . TYR A 414 ? 1.1470 1.8157 1.4221  0.3395  -0.1953 0.0335  487 TYR A CG  
3201 C CD1 . TYR A 414 ? 1.1852 1.8017 1.4576  0.3282  -0.2035 0.0533  487 TYR A CD1 
3202 C CD2 . TYR A 414 ? 1.1741 1.8720 1.4496  0.3380  -0.1921 0.0232  487 TYR A CD2 
3203 C CE1 . TYR A 414 ? 0.8346 1.4291 1.1055  0.3155  -0.2086 0.0629  487 TYR A CE1 
3204 C CE2 . TYR A 414 ? 0.8182 1.4930 1.0913  0.3255  -0.1973 0.0324  487 TYR A CE2 
3205 C CZ  . TYR A 414 ? 0.8299 1.4531 1.1010  0.3143  -0.2056 0.0523  487 TYR A CZ  
3206 O OH  . TYR A 414 ? 1.1740 1.7765 1.4432  0.3010  -0.2113 0.0621  487 TYR A OH  
3207 N N   . VAL A 415 ? 1.1925 1.9114 1.4580  0.4004  -0.2056 -0.0077 488 VAL A N   
3208 C CA  . VAL A 415 ? 0.8293 1.5799 1.0980  0.4120  -0.2020 -0.0160 488 VAL A CA  
3209 C C   . VAL A 415 ? 0.8564 1.5625 1.1147  0.4244  -0.2184 -0.0115 488 VAL A C   
3210 O O   . VAL A 415 ? 1.4395 2.1555 1.7019  0.4219  -0.2128 -0.0055 488 VAL A O   
3211 C CB  . VAL A 415 ? 0.8338 1.6358 1.1016  0.4344  -0.2036 -0.0429 488 VAL A CB  
3212 C CG1 . VAL A 415 ? 0.8233 1.6662 1.0969  0.4434  -0.1981 -0.0501 488 VAL A CG1 
3213 C CG2 . VAL A 415 ? 0.8985 1.7409 1.1746  0.4199  -0.1888 -0.0456 488 VAL A CG2 
3214 N N   . VAL A 416 ? 0.8930 1.5488 1.1368  0.4369  -0.2394 -0.0138 489 VAL A N   
3215 C CA  . VAL A 416 ? 0.9226 1.5312 1.1551  0.4471  -0.2568 -0.0075 489 VAL A CA  
3216 C C   . VAL A 416 ? 0.9051 1.4912 1.1435  0.4211  -0.2469 0.0198  489 VAL A C   
3217 O O   . VAL A 416 ? 1.2188 1.8020 1.4565  0.4227  -0.2473 0.0259  489 VAL A O   
3218 C CB  . VAL A 416 ? 0.9673 1.5211 1.1818  0.4611  -0.2813 -0.0129 489 VAL A CB  
3219 C CG1 . VAL A 416 ? 1.0003 1.5037 1.2023  0.4702  -0.3004 -0.0047 489 VAL A CG1 
3220 C CG2 . VAL A 416 ? 0.9873 1.5632 1.1947  0.4884  -0.2905 -0.0415 489 VAL A CG2 
3221 N N   . LYS A 417 ? 0.8916 1.4605 1.1352  0.3975  -0.2388 0.0367  490 LYS A N   
3222 C CA  . LYS A 417 ? 0.8740 1.4257 1.1246  0.3729  -0.2274 0.0622  490 LYS A CA  
3223 C C   . LYS A 417 ? 0.8407 1.4369 1.1036  0.3642  -0.2064 0.0640  490 LYS A C   
3224 O O   . LYS A 417 ? 1.0657 1.6515 1.3274  0.3593  -0.2042 0.0747  490 LYS A O   
3225 C CB  . LYS A 417 ? 0.8608 1.3994 1.1185  0.3504  -0.2195 0.0777  490 LYS A CB  
3226 C CG  . LYS A 417 ? 1.1256 1.6061 1.3738  0.3432  -0.2352 0.0939  490 LYS A CG  
3227 C CD  . LYS A 417 ? 1.2562 1.7152 1.5080  0.3256  -0.2287 0.1180  490 LYS A CD  
3228 C CE  . LYS A 417 ? 1.3840 1.7911 1.6284  0.3146  -0.2429 0.1359  490 LYS A CE  
3229 N NZ  . LYS A 417 ? 1.6485 2.0374 1.8966  0.2966  -0.2359 0.1603  490 LYS A NZ  
3230 N N   . LEU A 418 ? 0.8147 1.4604 1.0881  0.3612  -0.1912 0.0537  491 LEU A N   
3231 C CA  . LEU A 418 ? 0.7841 1.4715 1.0685  0.3498  -0.1710 0.0559  491 LEU A CA  
3232 C C   . LEU A 418 ? 0.7936 1.4940 1.0727  0.3652  -0.1769 0.0470  491 LEU A C   
3233 O O   . LEU A 418 ? 1.0961 1.7982 1.3775  0.3538  -0.1673 0.0578  491 LEU A O   
3234 C CB  . LEU A 418 ? 0.7606 1.4991 1.0549  0.3458  -0.1575 0.0446  491 LEU A CB  
3235 C CG  . LEU A 418 ? 0.7302 1.5113 1.0353  0.3308  -0.1364 0.0474  491 LEU A CG  
3236 C CD1 . LEU A 418 ? 0.7122 1.4729 1.0247  0.3047  -0.1210 0.0706  491 LEU A CD1 
3237 C CD2 . LEU A 418 ? 1.2287 2.0625 1.5410  0.3302  -0.1271 0.0338  491 LEU A CD2 
3238 N N   . LEU A 419 ? 1.1332 1.8429 1.4047  0.3918  -0.1928 0.0270  492 LEU A N   
3239 C CA  . LEU A 419 ? 1.1944 1.9206 1.4619  0.4087  -0.1996 0.0178  492 LEU A CA  
3240 C C   . LEU A 419 ? 1.3583 2.0342 1.6149  0.4109  -0.2134 0.0310  492 LEU A C   
3241 O O   . LEU A 419 ? 1.6864 2.3713 1.9421  0.4107  -0.2116 0.0346  492 LEU A O   
3242 C CB  . LEU A 419 ? 0.8451 1.5964 1.1084  0.4386  -0.2130 -0.0076 492 LEU A CB  
3243 C CG  . LEU A 419 ? 0.8218 1.6432 1.0958  0.4419  -0.1997 -0.0236 492 LEU A CG  
3244 C CD1 . LEU A 419 ? 0.7907 1.6356 1.0753  0.4176  -0.1799 -0.0175 492 LEU A CD1 
3245 C CD2 . LEU A 419 ? 0.8458 1.6860 1.1146  0.4737  -0.2146 -0.0484 492 LEU A CD2 
3246 N N   . GLU A 420 ? 1.2239 1.8471 1.4713  0.4117  -0.2278 0.0389  493 GLU A N   
3247 C CA  . GLU A 420 ? 1.2510 1.8250 1.4863  0.4142  -0.2434 0.0515  493 GLU A CA  
3248 C C   . GLU A 420 ? 1.0280 1.5888 1.2675  0.3870  -0.2290 0.0756  493 GLU A C   
3249 O O   . GLU A 420 ? 1.0445 1.5832 1.2761  0.3868  -0.2362 0.0855  493 GLU A O   
3250 C CB  . GLU A 420 ? 1.6398 2.1610 1.8625  0.4225  -0.2647 0.0525  493 GLU A CB  
3251 C CG  . GLU A 420 ? 1.8418 2.3111 2.0494  0.4286  -0.2854 0.0631  493 GLU A CG  
3252 C CD  . GLU A 420 ? 2.1124 2.5275 2.3061  0.4354  -0.3075 0.0639  493 GLU A CD  
3253 O OE1 . GLU A 420 ? 1.9992 2.3687 2.1783  0.4428  -0.3280 0.0708  493 GLU A OE1 
3254 O OE2 . GLU A 420 ? 2.3171 2.7344 2.5135  0.4323  -0.3050 0.0581  493 GLU A OE2 
3255 N N   . GLU A 421 ? 0.8546 1.4281 1.1058  0.3645  -0.2091 0.0854  494 GLU A N   
3256 C CA  . GLU A 421 ? 0.8401 1.3983 1.0953  0.3399  -0.1954 0.1079  494 GLU A CA  
3257 C C   . GLU A 421 ? 0.8068 1.4069 1.0728  0.3257  -0.1713 0.1090  494 GLU A C   
3258 O O   . GLU A 421 ? 0.8024 1.3940 1.0671  0.3127  -0.1630 0.1226  494 GLU A O   
3259 C CB  . GLU A 421 ? 1.1236 1.6549 1.3833  0.3237  -0.1923 0.1225  494 GLU A CB  
3260 C CG  . GLU A 421 ? 1.5080 2.0125 1.7690  0.3025  -0.1842 0.1471  494 GLU A CG  
3261 C CD  . GLU A 421 ? 1.6765 2.1408 1.9357  0.2937  -0.1935 0.1615  494 GLU A CD  
3262 O OE1 . GLU A 421 ? 1.4786 1.9355 1.7353  0.3030  -0.2054 0.1519  494 GLU A OE1 
3263 O OE2 . GLU A 421 ? 1.8341 2.2754 2.0939  0.2773  -0.1892 0.1824  494 GLU A OE2 
3264 N N   . TYR A 422 ? 0.7853 1.4293 1.0608  0.3267  -0.1601 0.0956  495 TYR A N   
3265 C CA  . TYR A 422 ? 0.7562 1.4378 1.0409  0.3112  -0.1379 0.0969  495 TYR A CA  
3266 C C   . TYR A 422 ? 1.0893 1.8106 1.3720  0.3232  -0.1388 0.0813  495 TYR A C   
3267 O O   . TYR A 422 ? 1.2707 2.0162 1.5569  0.3100  -0.1233 0.0840  495 TYR A O   
3268 C CB  . TYR A 422 ? 0.7316 1.4383 1.0287  0.2994  -0.1229 0.0953  495 TYR A CB  
3269 C CG  . TYR A 422 ? 0.7211 1.4013 1.0249  0.2788  -0.1120 0.1151  495 TYR A CG  
3270 C CD1 . TYR A 422 ? 0.7316 1.3720 1.0311  0.2708  -0.1141 0.1328  495 TYR A CD1 
3271 C CD2 . TYR A 422 ? 1.1627 1.8607 1.4778  0.2671  -0.0995 0.1166  495 TYR A CD2 
3272 C CE1 . TYR A 422 ? 0.7764 1.3969 1.0836  0.2528  -0.1036 0.1510  495 TYR A CE1 
3273 C CE2 . TYR A 422 ? 1.1902 1.8665 1.5130  0.2495  -0.0897 0.1350  495 TYR A CE2 
3274 C CZ  . TYR A 422 ? 0.8926 1.5312 1.2121  0.2429  -0.0916 0.1519  495 TYR A CZ  
3275 O OH  . TYR A 422 ? 0.6925 1.3134 1.0212  0.2263  -0.0814 0.1703  495 TYR A OH  
3276 N N   . ALA A 423 ? 0.7749 1.5036 1.0518  0.3481  -0.1567 0.0651  496 ALA A N   
3277 C CA  . ALA A 423 ? 0.7737 1.5470 1.0510  0.3617  -0.1583 0.0491  496 ALA A CA  
3278 C C   . ALA A 423 ? 0.9457 1.6999 1.2117  0.3776  -0.1755 0.0489  496 ALA A C   
3279 O O   . ALA A 423 ? 1.1874 1.9480 1.4510  0.3688  -0.1697 0.0558  496 ALA A O   
3280 C CB  . ALA A 423 ? 0.7748 1.5820 1.0561  0.3799  -0.1639 0.0285  496 ALA A CB  
3281 N N   . THR A 424 ? 0.8298 1.5593 1.0879  0.4010  -0.1974 0.0410  497 THR A N   
3282 C CA  . THR A 424 ? 1.1001 1.8143 1.3475  0.4205  -0.2166 0.0384  497 THR A CA  
3283 C C   . THR A 424 ? 1.2035 1.8772 1.4424  0.4054  -0.2177 0.0596  497 THR A C   
3284 O O   . THR A 424 ? 1.5764 2.2592 1.8107  0.4075  -0.2204 0.0617  497 THR A O   
3285 C CB  . THR A 424 ? 1.0282 1.7144 1.2672  0.4474  -0.2403 0.0270  497 THR A CB  
3286 O OG1 . THR A 424 ? 1.0383 1.6736 1.2722  0.4371  -0.2448 0.0394  497 THR A OG1 
3287 C CG2 . THR A 424 ? 1.0060 1.7374 1.2524  0.4645  -0.2390 0.0040  497 THR A CG2 
3288 N N   . GLY A 425 ? 0.8703 1.5010 1.1067  0.3901  -0.2163 0.0758  498 GLY A N   
3289 C CA  . GLY A 425 ? 0.8813 1.4732 1.1092  0.3759  -0.2181 0.0964  498 GLY A CA  
3290 C C   . GLY A 425 ? 1.1989 1.8137 1.4279  0.3599  -0.2020 0.1039  498 GLY A C   
3291 O O   . GLY A 425 ? 1.1672 1.7770 1.3868  0.3658  -0.2116 0.1066  498 GLY A O   
3292 N N   . PRO A 426 ? 1.2318 1.8719 1.4714  0.3395  -0.1780 0.1070  499 PRO A N   
3293 C CA  . PRO A 426 ? 1.3456 2.0039 1.5842  0.3229  -0.1621 0.1136  499 PRO A CA  
3294 C C   . PRO A 426 ? 1.2848 1.9817 1.5210  0.3350  -0.1665 0.1001  499 PRO A C   
3295 O O   . PRO A 426 ? 1.4039 2.1060 1.6336  0.3257  -0.1617 0.1062  499 PRO A O   
3296 C CB  . PRO A 426 ? 1.3175 1.9969 1.5685  0.3029  -0.1377 0.1153  499 PRO A CB  
3297 C CG  . PRO A 426 ? 1.1330 1.8248 1.3927  0.3139  -0.1417 0.1032  499 PRO A CG  
3298 C CD  . PRO A 426 ? 1.1308 1.7829 1.3825  0.3307  -0.1647 0.1044  499 PRO A CD  
3299 N N   . ALA A 427 ? 1.1058 1.8318 1.3471  0.3554  -0.1755 0.0818  500 ALA A N   
3300 C CA  . ALA A 427 ? 1.1028 1.8696 1.3434  0.3683  -0.1806 0.0691  500 ALA A CA  
3301 C C   . ALA A 427 ? 1.1749 1.9170 1.4032  0.3870  -0.2038 0.0712  500 ALA A C   
3302 O O   . ALA A 427 ? 1.3839 2.1449 1.6077  0.3874  -0.2056 0.0714  500 ALA A O   
3303 C CB  . ALA A 427 ? 1.2590 2.0703 1.5102  0.3840  -0.1812 0.0489  500 ALA A CB  
3304 N N   . VAL A 428 ? 0.8839 1.5835 1.1061  0.4021  -0.2225 0.0729  501 VAL A N   
3305 C CA  . VAL A 428 ? 1.2164 1.8858 1.4256  0.4186  -0.2459 0.0770  501 VAL A CA  
3306 C C   . VAL A 428 ? 1.2322 1.8738 1.4311  0.3978  -0.2420 0.0980  501 VAL A C   
3307 O O   . VAL A 428 ? 1.6529 2.2956 1.8431  0.4032  -0.2520 0.1013  501 VAL A O   
3308 C CB  . VAL A 428 ? 0.9495 1.5746 1.1526  0.4373  -0.2671 0.0746  501 VAL A CB  
3309 C CG1 . VAL A 428 ? 0.9901 1.5754 1.1778  0.4511  -0.2920 0.0824  501 VAL A CG1 
3310 C CG2 . VAL A 428 ? 0.9487 1.6047 1.1599  0.4611  -0.2721 0.0515  501 VAL A CG2 
3311 N N   . LEU A 429 ? 0.9117 1.5290 1.1115  0.3742  -0.2277 0.1127  502 LEU A N   
3312 C CA  . LEU A 429 ? 0.9143 1.5115 1.1050  0.3532  -0.2205 0.1318  502 LEU A CA  
3313 C C   . LEU A 429 ? 0.8965 1.5356 1.0880  0.3424  -0.2053 0.1285  502 LEU A C   
3314 O O   . LEU A 429 ? 1.3212 1.9532 1.5013  0.3362  -0.2084 0.1380  502 LEU A O   
3315 C CB  . LEU A 429 ? 0.9651 1.5348 1.1587  0.3310  -0.2062 0.1470  502 LEU A CB  
3316 C CG  . LEU A 429 ? 1.0796 1.5955 1.2645  0.3345  -0.2247 0.1599  502 LEU A CG  
3317 C CD1 . LEU A 429 ? 1.2245 1.7217 1.4171  0.3179  -0.2126 0.1702  502 LEU A CD1 
3318 C CD2 . LEU A 429 ? 0.9536 1.4446 1.1233  0.3265  -0.2323 0.1767  502 LEU A CD2 
3319 N N   . THR A 430 ? 0.8681 1.5506 1.0719  0.3384  -0.1889 0.1158  503 THR A N   
3320 C CA  . THR A 430 ? 0.8785 1.6007 1.0823  0.3262  -0.1746 0.1123  503 THR A CA  
3321 C C   . THR A 430 ? 0.8984 1.6424 1.0961  0.3438  -0.1914 0.1047  503 THR A C   
3322 O O   . THR A 430 ? 0.8787 1.6243 1.0660  0.3345  -0.1908 0.1122  503 THR A O   
3323 C CB  . THR A 430 ? 1.1813 1.9450 1.3991  0.3189  -0.1562 0.1003  503 THR A CB  
3324 O OG1 . THR A 430 ? 0.8065 1.5485 1.0303  0.3031  -0.1414 0.1087  503 THR A OG1 
3325 C CG2 . THR A 430 ? 0.8084 1.6102 1.0246  0.3035  -0.1417 0.0973  503 THR A CG2 
3326 N N   . VAL A 431 ? 1.0897 1.8512 1.2933  0.3700  -0.2070 0.0899  504 VAL A N   
3327 C CA  . VAL A 431 ? 1.3185 2.1050 1.5186  0.3891  -0.2233 0.0821  504 VAL A CA  
3328 C C   . VAL A 431 ? 1.3370 2.0795 1.5215  0.3955  -0.2430 0.0957  504 VAL A C   
3329 O O   . VAL A 431 ? 1.1459 1.9030 1.3235  0.3999  -0.2518 0.0971  504 VAL A O   
3330 C CB  . VAL A 431 ? 1.4085 2.2240 1.6193  0.4177  -0.2349 0.0623  504 VAL A CB  
3331 C CG1 . VAL A 431 ? 1.3704 2.1395 1.5781  0.4362  -0.2523 0.0620  504 VAL A CG1 
3332 C CG2 . VAL A 431 ? 1.5742 2.4265 1.7847  0.4370  -0.2487 0.0532  504 VAL A CG2 
3333 N N   . ALA A 432 ? 0.9465 1.6354 1.1249  0.3947  -0.2507 0.1069  505 ALA A N   
3334 C CA  . ALA A 432 ? 1.3306 1.9749 1.4929  0.3962  -0.2685 0.1228  505 ALA A CA  
3335 C C   . ALA A 432 ? 0.9737 1.6176 1.1266  0.3697  -0.2548 0.1379  505 ALA A C   
3336 O O   . ALA A 432 ? 0.9971 1.6308 1.1371  0.3712  -0.2675 0.1468  505 ALA A O   
3337 C CB  . ALA A 432 ? 1.4429 2.0318 1.6009  0.3974  -0.2784 0.1323  505 ALA A CB  
3338 N N   . LEU A 433 ? 0.9447 1.5977 1.1030  0.3454  -0.2292 0.1413  506 LEU A N   
3339 C CA  . LEU A 433 ? 0.9384 1.5941 1.0875  0.3202  -0.2132 0.1529  506 LEU A CA  
3340 C C   . LEU A 433 ? 1.2250 1.9256 1.3718  0.3215  -0.2124 0.1440  506 LEU A C   
3341 O O   . LEU A 433 ? 1.0497 1.7474 1.1827  0.3113  -0.2137 0.1535  506 LEU A O   
3342 C CB  . LEU A 433 ? 0.9090 1.5669 1.0659  0.2974  -0.1861 0.1555  506 LEU A CB  
3343 C CG  . LEU A 433 ? 0.9033 1.5540 1.0510  0.2703  -0.1665 0.1684  506 LEU A CG  
3344 C CD1 . LEU A 433 ? 0.8890 1.5820 1.0351  0.2590  -0.1518 0.1594  506 LEU A CD1 
3345 C CD2 . LEU A 433 ? 0.9327 1.5477 1.0634  0.2666  -0.1791 0.1859  506 LEU A CD2 
3346 N N   . ILE A 434 ? 1.4338 2.1784 1.5937  0.3326  -0.2097 0.1262  507 ILE A N   
3347 C CA  . ILE A 434 ? 1.2187 2.0113 1.3782  0.3336  -0.2093 0.1173  507 ILE A CA  
3348 C C   . ILE A 434 ? 1.1145 1.9013 1.2644  0.3526  -0.2348 0.1204  507 ILE A C   
3349 O O   . ILE A 434 ? 0.9548 1.7576 1.0948  0.3445  -0.2360 0.1248  507 ILE A O   
3350 C CB  . ILE A 434 ? 1.1362 1.9783 1.3128  0.3437  -0.2037 0.0981  507 ILE A CB  
3351 C CG1 . ILE A 434 ? 0.8632 1.7091 1.0488  0.3241  -0.1795 0.0964  507 ILE A CG1 
3352 C CG2 . ILE A 434 ? 1.0455 1.9401 1.2221  0.3415  -0.2024 0.0902  507 ILE A CG2 
3353 C CD1 . ILE A 434 ? 0.8510 1.7027 1.0292  0.2947  -0.1585 0.1032  507 ILE A CD1 
3354 N N   . GLU A 435 ? 1.3206 2.0827 1.4722  0.3780  -0.2563 0.1185  508 GLU A N   
3355 C CA  . GLU A 435 ? 1.5681 2.3189 1.7103  0.3981  -0.2826 0.1223  508 GLU A CA  
3356 C C   . GLU A 435 ? 1.4970 2.2075 1.6201  0.3813  -0.2868 0.1436  508 GLU A C   
3357 O O   . GLU A 435 ? 1.4935 2.2135 1.6063  0.3820  -0.2971 0.1491  508 GLU A O   
3358 C CB  . GLU A 435 ? 1.8579 2.5831 2.0043  0.4281  -0.3043 0.1155  508 GLU A CB  
3359 C CG  . GLU A 435 ? 1.9408 2.7096 2.1047  0.4491  -0.3034 0.0933  508 GLU A CG  
3360 C CD  . GLU A 435 ? 2.1748 2.9160 2.3401  0.4806  -0.3261 0.0855  508 GLU A CD  
3361 O OE1 . GLU A 435 ? 2.2589 2.9514 2.4108  0.4893  -0.3468 0.0969  508 GLU A OE1 
3362 O OE2 . GLU A 435 ? 2.3317 3.0988 2.5101  0.4962  -0.3235 0.0679  508 GLU A OE2 
3363 N N   . ALA A 436 ? 1.7112 2.3782 1.8294  0.3658  -0.2793 0.1562  509 ALA A N   
3364 C CA  . ALA A 436 ? 1.8455 2.4754 1.9457  0.3487  -0.2821 0.1773  509 ALA A CA  
3365 C C   . ALA A 436 ? 1.7840 2.4420 1.8759  0.3256  -0.2652 0.1811  509 ALA A C   
3366 O O   . ALA A 436 ? 1.8501 2.4957 1.9255  0.3184  -0.2738 0.1942  509 ALA A O   
3367 C CB  . ALA A 436 ? 1.9034 2.4907 2.0029  0.3342  -0.2731 0.1891  509 ALA A CB  
3368 N N   . VAL A 437 ? 1.6450 2.3397 1.7468  0.3130  -0.2417 0.1700  510 VAL A N   
3369 C CA  . VAL A 437 ? 1.5214 2.2425 1.6141  0.2909  -0.2256 0.1715  510 VAL A CA  
3370 C C   . VAL A 437 ? 1.4717 2.2317 1.5620  0.3026  -0.2394 0.1641  510 VAL A C   
3371 O O   . VAL A 437 ? 1.6421 2.4076 1.7170  0.2904  -0.2406 0.1720  510 VAL A O   
3372 C CB  . VAL A 437 ? 1.4158 2.1596 1.5188  0.2733  -0.1973 0.1624  510 VAL A CB  
3373 C CG1 . VAL A 437 ? 1.2958 2.0728 1.3899  0.2537  -0.1830 0.1594  510 VAL A CG1 
3374 C CG2 . VAL A 437 ? 1.3389 2.0440 1.4415  0.2580  -0.1825 0.1734  510 VAL A CG2 
3375 N N   . ALA A 438 ? 1.3636 2.1533 1.4688  0.3262  -0.2499 0.1489  511 ALA A N   
3376 C CA  . ALA A 438 ? 1.2788 2.1132 1.3850  0.3380  -0.2618 0.1410  511 ALA A CA  
3377 C C   . ALA A 438 ? 1.4733 2.2856 1.5656  0.3506  -0.2875 0.1530  511 ALA A C   
3378 O O   . ALA A 438 ? 1.5287 2.3630 1.6109  0.3437  -0.2917 0.1570  511 ALA A O   
3379 C CB  . ALA A 438 ? 1.0313 1.9029 1.1578  0.3626  -0.2674 0.1221  511 ALA A CB  
3380 N N   . VAL A 439 ? 1.4439 2.2124 1.5350  0.3689  -0.3062 0.1592  512 VAL A N   
3381 C CA  . VAL A 439 ? 1.1031 1.8479 1.1809  0.3826  -0.3332 0.1710  512 VAL A CA  
3382 C C   . VAL A 439 ? 1.7555 2.4746 1.8118  0.3560  -0.3289 0.1911  512 VAL A C   
3383 O O   . VAL A 439 ? 1.8799 2.6021 1.9234  0.3577  -0.3443 0.2000  512 VAL A O   
3384 C CB  . VAL A 439 ? 1.1271 1.8269 1.2072  0.4076  -0.3546 0.1724  512 VAL A CB  
3385 C CG1 . VAL A 439 ? 1.3165 1.9892 1.3824  0.4225  -0.3843 0.1851  512 VAL A CG1 
3386 C CG2 . VAL A 439 ? 1.2745 2.0032 1.3749  0.4344  -0.3577 0.1508  512 VAL A CG2 
3387 N N   . SER A 440 ? 1.6785 2.3741 1.7303  0.3313  -0.3079 0.1986  513 SER A N   
3388 C CA  . SER A 440 ? 1.9001 2.5687 1.9310  0.3073  -0.3038 0.2180  513 SER A CA  
3389 C C   . SER A 440 ? 1.9795 2.6837 2.0016  0.2833  -0.2845 0.2163  513 SER A C   
3390 O O   . SER A 440 ? 2.1537 2.8518 2.1567  0.2706  -0.2892 0.2293  513 SER A O   
3391 C CB  . SER A 440 ? 1.8554 2.4819 1.8852  0.2928  -0.2911 0.2281  513 SER A CB  
3392 O OG  . SER A 440 ? 1.8248 2.4288 1.8348  0.2696  -0.2859 0.2467  513 SER A OG  
3393 N N   . TRP A 441 ? 1.8535 2.5939 1.8880  0.2760  -0.2633 0.2007  514 TRP A N   
3394 C CA  . TRP A 441 ? 1.9851 2.7528 2.0102  0.2502  -0.2422 0.1984  514 TRP A CA  
3395 C C   . TRP A 441 ? 2.0706 2.8936 2.1013  0.2549  -0.2445 0.1844  514 TRP A C   
3396 O O   . TRP A 441 ? 2.3304 3.1765 2.3504  0.2334  -0.2305 0.1827  514 TRP A O   
3397 C CB  . TRP A 441 ? 1.9460 2.7078 1.9776  0.2318  -0.2132 0.1938  514 TRP A CB  
3398 C CG  . TRP A 441 ? 1.9029 2.6164 1.9274  0.2214  -0.2069 0.2090  514 TRP A CG  
3399 C CD1 . TRP A 441 ? 1.8443 2.5219 1.8549  0.2224  -0.2227 0.2266  514 TRP A CD1 
3400 C CD2 . TRP A 441 ? 1.8969 2.5948 1.9280  0.2074  -0.1834 0.2089  514 TRP A CD2 
3401 N NE1 . TRP A 441 ? 1.9593 2.6023 1.9680  0.2096  -0.2101 0.2375  514 TRP A NE1 
3402 C CE2 . TRP A 441 ? 2.0182 2.6733 2.0399  0.2010  -0.1858 0.2267  514 TRP A CE2 
3403 C CE3 . TRP A 441 ? 1.7448 2.4613 1.7891  0.1996  -0.1611 0.1963  514 TRP A CE3 
3404 C CZ2 . TRP A 441 ? 2.0850 2.7180 2.1113  0.1882  -0.1663 0.2319  514 TRP A CZ2 
3405 C CZ3 . TRP A 441 ? 1.8982 2.5899 1.9464  0.1875  -0.1423 0.2015  514 TRP A CZ3 
3406 C CH2 . TRP A 441 ? 2.0491 2.7007 2.0891  0.1824  -0.1448 0.2190  514 TRP A CH2 
3407 N N   . PHE A 442 ? 1.8955 2.7413 1.9424  0.2821  -0.2613 0.1740  515 PHE A N   
3408 C CA  . PHE A 442 ? 1.7827 2.6856 1.8369  0.2887  -0.2655 0.1615  515 PHE A CA  
3409 C C   . PHE A 442 ? 1.9772 2.8871 2.0274  0.3105  -0.2948 0.1668  515 PHE A C   
3410 O O   . PHE A 442 ? 2.2155 3.1516 2.2547  0.3017  -0.2995 0.1702  515 PHE A O   
3411 C CB  . PHE A 442 ? 1.5905 2.5250 1.6687  0.3024  -0.2590 0.1433  515 PHE A CB  
3412 C CG  . PHE A 442 ? 1.5849 2.5424 1.6667  0.2778  -0.2311 0.1346  515 PHE A CG  
3413 C CD1 . PHE A 442 ? 1.7136 2.6382 1.7958  0.2631  -0.2116 0.1372  515 PHE A CD1 
3414 C CD2 . PHE A 442 ? 1.4801 2.4923 1.5651  0.2693  -0.2253 0.1243  515 PHE A CD2 
3415 C CE1 . PHE A 442 ? 1.8177 2.7605 1.9027  0.2413  -0.1869 0.1296  515 PHE A CE1 
3416 C CE2 . PHE A 442 ? 1.6353 2.6653 1.7221  0.2457  -0.2009 0.1168  515 PHE A CE2 
3417 C CZ  . PHE A 442 ? 1.7537 2.7476 1.8403  0.2323  -0.1818 0.1193  515 PHE A CZ  
3418 N N   . TYR A 443 ? 1.9253 2.8111 1.9837  0.3391  -0.3154 0.1676  516 TYR A N   
3419 C CA  . TYR A 443 ? 1.8443 2.7314 1.8990  0.3623  -0.3449 0.1732  516 TYR A CA  
3420 C C   . TYR A 443 ? 1.8524 2.7032 1.8823  0.3472  -0.3537 0.1945  516 TYR A C   
3421 O O   . TYR A 443 ? 2.0999 2.9628 2.1215  0.3550  -0.3731 0.2013  516 TYR A O   
3422 C CB  . TYR A 443 ? 1.7095 2.5726 1.7767  0.3965  -0.3645 0.1683  516 TYR A CB  
3423 C CG  . TYR A 443 ? 1.7603 2.6125 1.8222  0.4223  -0.3968 0.1758  516 TYR A CG  
3424 C CD1 . TYR A 443 ? 1.8819 2.7853 1.9516  0.4393  -0.4095 0.1683  516 TYR A CD1 
3425 C CD2 . TYR A 443 ? 1.6730 2.4638 1.7221  0.4297  -0.4152 0.1911  516 TYR A CD2 
3426 C CE1 . TYR A 443 ? 1.9617 2.8548 2.0272  0.4646  -0.4398 0.1754  516 TYR A CE1 
3427 C CE2 . TYR A 443 ? 1.8291 2.6065 1.8725  0.4536  -0.4459 0.1986  516 TYR A CE2 
3428 C CZ  . TYR A 443 ? 1.9809 2.8092 2.0328  0.4718  -0.4581 0.1906  516 TYR A CZ  
3429 O OH  . TYR A 443 ? 2.1337 2.9485 2.1805  0.4971  -0.4893 0.1984  516 TYR A OH  
3430 N N   . GLY A 444 ? 1.6729 2.4814 1.6911  0.3255  -0.3396 0.2055  517 GLY A N   
3431 C CA  . GLY A 444 ? 1.7837 2.5579 1.7779  0.3089  -0.3456 0.2261  517 GLY A CA  
3432 C C   . GLY A 444 ? 1.7069 2.4253 1.6957  0.3232  -0.3669 0.2403  517 GLY A C   
3433 O O   . GLY A 444 ? 1.5982 2.3108 1.5947  0.3527  -0.3917 0.2377  517 GLY A O   
3434 N N   . ILE A 445 ? 1.7576 2.4346 1.7328  0.3024  -0.3576 0.2552  518 ILE A N   
3435 C CA  . ILE A 445 ? 1.6161 2.2381 1.5850  0.3120  -0.3772 0.2702  518 ILE A CA  
3436 C C   . ILE A 445 ? 1.5454 2.1535 1.4959  0.3168  -0.4043 0.2869  518 ILE A C   
3437 O O   . ILE A 445 ? 1.5100 2.0803 1.4577  0.3354  -0.4303 0.2959  518 ILE A O   
3438 C CB  . ILE A 445 ? 1.6023 2.1891 1.5640  0.2871  -0.3581 0.2817  518 ILE A CB  
3439 C CG1 . ILE A 445 ? 1.5769 2.1077 1.5344  0.2971  -0.3787 0.2959  518 ILE A CG1 
3440 C CG2 . ILE A 445 ? 1.5643 2.1563 1.5046  0.2568  -0.3445 0.2947  518 ILE A CG2 
3441 C CD1 . ILE A 445 ? 1.7068 2.2294 1.6827  0.3279  -0.3933 0.2822  518 ILE A CD1 
3442 N N   . THR A 446 ? 1.5238 2.1607 1.4606  0.2997  -0.3993 0.2916  519 THR A N   
3443 C CA  . THR A 446 ? 1.6317 2.2590 1.5501  0.3024  -0.4247 0.3084  519 THR A CA  
3444 C C   . THR A 446 ? 1.6743 2.3172 1.6050  0.3377  -0.4525 0.3004  519 THR A C   
3445 O O   . THR A 446 ? 1.6429 2.2527 1.5657  0.3540  -0.4815 0.3134  519 THR A O   
3446 C CB  . THR A 446 ? 1.7463 2.4059 1.6477  0.2756  -0.4114 0.3128  519 THR A CB  
3447 O OG1 . THR A 446 ? 1.9474 2.6630 1.8625  0.2790  -0.3996 0.2926  519 THR A OG1 
3448 C CG2 . THR A 446 ? 1.4075 2.0499 1.2960  0.2429  -0.3839 0.3201  519 THR A CG2 
3449 N N   . GLN A 447 ? 1.5350 2.2285 1.4850  0.3501  -0.4443 0.2792  520 GLN A N   
3450 C CA  . GLN A 447 ? 1.6767 2.3915 1.6409  0.3855  -0.4685 0.2695  520 GLN A CA  
3451 C C   . GLN A 447 ? 1.7792 2.4527 1.7542  0.4136  -0.4844 0.2658  520 GLN A C   
3452 O O   . GLN A 447 ? 1.7161 2.3798 1.6938  0.4435  -0.5130 0.2666  520 GLN A O   
3453 C CB  . GLN A 447 ? 1.4979 2.2795 1.4812  0.3900  -0.4537 0.2476  520 GLN A CB  
3454 C CG  . GLN A 447 ? 1.6666 2.4809 1.6658  0.4263  -0.4771 0.2371  520 GLN A CG  
3455 C CD  . GLN A 447 ? 2.0582 2.8761 2.0434  0.4323  -0.5029 0.2524  520 GLN A CD  
3456 O OE1 . GLN A 447 ? 2.2284 3.0503 2.1943  0.4048  -0.4975 0.2657  520 GLN A OE1 
3457 N NE2 . GLN A 447 ? 2.1399 2.9560 2.1342  0.4687  -0.5315 0.2503  520 GLN A NE2 
3458 N N   . PHE A 448 ? 2.1607 2.8093 2.1415  0.4047  -0.4666 0.2615  521 PHE A N   
3459 C CA  . PHE A 448 ? 1.9817 2.5863 1.9696  0.4277  -0.4811 0.2589  521 PHE A CA  
3460 C C   . PHE A 448 ? 1.9806 2.5250 1.9484  0.4292  -0.5074 0.2819  521 PHE A C   
3461 O O   . PHE A 448 ? 1.7892 2.3050 1.7584  0.4584  -0.5349 0.2816  521 PHE A O   
3462 C CB  . PHE A 448 ? 1.7460 2.3383 1.7428  0.4133  -0.4554 0.2518  521 PHE A CB  
3463 C CG  . PHE A 448 ? 1.7922 2.3337 1.7925  0.4309  -0.4692 0.2518  521 PHE A CG  
3464 C CD1 . PHE A 448 ? 1.6334 2.1837 1.6505  0.4642  -0.4806 0.2330  521 PHE A CD1 
3465 C CD2 . PHE A 448 ? 1.9545 2.4409 1.9408  0.4136  -0.4707 0.2703  521 PHE A CD2 
3466 C CE1 . PHE A 448 ? 1.6544 2.1561 1.6727  0.4799  -0.4937 0.2320  521 PHE A CE1 
3467 C CE2 . PHE A 448 ? 1.9124 2.3511 1.9006  0.4280  -0.4843 0.2706  521 PHE A CE2 
3468 C CZ  . PHE A 448 ? 1.7285 2.1733 1.7320  0.4612  -0.4961 0.2510  521 PHE A CZ  
3469 N N   . CYS A 449 ? 2.2147 2.7390 2.1625  0.3976  -0.4995 0.3020  522 CYS A N   
3470 C CA  . CYS A 449 ? 2.3615 2.8318 2.2883  0.3949  -0.5243 0.3262  522 CYS A CA  
3471 C C   . CYS A 449 ? 2.5151 2.9944 2.4350  0.4148  -0.5538 0.3321  522 CYS A C   
3472 O O   . CYS A 449 ? 2.7492 3.1821 2.6568  0.4268  -0.5830 0.3473  522 CYS A O   
3473 C CB  . CYS A 449 ? 2.2918 2.7482 2.1990  0.3557  -0.5073 0.3458  522 CYS A CB  
3474 S SG  . CYS A 449 ? 2.0791 2.5189 1.9937  0.3330  -0.4751 0.3427  522 CYS A SG  
3475 N N   . ARG A 450 ? 2.4703 3.0088 2.3978  0.4181  -0.5474 0.3210  523 ARG A N   
3476 C CA  . ARG A 450 ? 2.5007 3.0545 2.4247  0.4390  -0.5752 0.3254  523 ARG A CA  
3477 C C   . ARG A 450 ? 2.6028 3.1520 2.5446  0.4825  -0.5974 0.3105  523 ARG A C   
3478 O O   . ARG A 450 ? 2.7545 3.2813 2.6900  0.5056  -0.6293 0.3194  523 ARG A O   
3479 C CB  . ARG A 450 ? 2.4431 3.0646 2.3700  0.4273  -0.5609 0.3181  523 ARG A CB  
3480 C CG  . ARG A 450 ? 2.4708 3.1099 2.3894  0.4396  -0.5877 0.3284  523 ARG A CG  
3481 C CD  . ARG A 450 ? 2.4656 3.1426 2.4074  0.4791  -0.6029 0.3099  523 ARG A CD  
3482 N NE  . ARG A 450 ? 2.6054 3.3010 2.5410  0.4927  -0.6295 0.3203  523 ARG A NE  
3483 C CZ  . ARG A 450 ? 2.6557 3.3884 2.6096  0.5273  -0.6461 0.3078  523 ARG A CZ  
3484 N NH1 . ARG A 450 ? 2.6718 3.4277 2.6505  0.5513  -0.6384 0.2840  523 ARG A NH1 
3485 N NH2 . ARG A 450 ? 2.6688 3.4174 2.6164  0.5381  -0.6706 0.3194  523 ARG A NH2 
3486 N N   . ASP A 451 ? 2.3076 2.8776 2.2711  0.4947  -0.5811 0.2875  524 ASP A N   
3487 C CA  . ASP A 451 ? 2.1692 2.7351 2.1493  0.5363  -0.5997 0.2710  524 ASP A CA  
3488 C C   . ASP A 451 ? 2.2583 2.7475 2.2271  0.5482  -0.6223 0.2818  524 ASP A C   
3489 O O   . ASP A 451 ? 2.3874 2.8538 2.3565  0.5817  -0.6524 0.2807  524 ASP A O   
3490 C CB  . ASP A 451 ? 1.9231 2.5291 1.9269  0.5419  -0.5747 0.2452  524 ASP A CB  
3491 C CG  . ASP A 451 ? 1.9757 2.6578 1.9908  0.5310  -0.5543 0.2339  524 ASP A CG  
3492 O OD1 . ASP A 451 ? 2.0133 2.7255 2.0247  0.5354  -0.5672 0.2396  524 ASP A OD1 
3493 O OD2 . ASP A 451 ? 1.9531 2.6641 1.9802  0.5169  -0.5261 0.2202  524 ASP A OD2 
3494 N N   . VAL A 452 ? 2.3315 2.7798 2.2900  0.5210  -0.6088 0.2925  525 VAL A N   
3495 C CA  . VAL A 452 ? 2.4094 2.7830 2.3541  0.5262  -0.6306 0.3062  525 VAL A CA  
3496 C C   . VAL A 452 ? 2.4940 2.8355 2.4168  0.5263  -0.6603 0.3305  525 VAL A C   
3497 O O   . VAL A 452 ? 2.6944 2.9836 2.6087  0.5480  -0.6911 0.3375  525 VAL A O   
3498 C CB  . VAL A 452 ? 2.3301 2.6740 2.2686  0.4931  -0.6083 0.3150  525 VAL A CB  
3499 C CG1 . VAL A 452 ? 2.3212 2.5883 2.2441  0.4952  -0.6319 0.3311  525 VAL A CG1 
3500 C CG2 . VAL A 452 ? 2.2415 2.6168 2.2019  0.4941  -0.5803 0.2914  525 VAL A CG2 
3501 N N   . LYS A 453 ? 2.1497 2.5214 2.0621  0.5019  -0.6521 0.3436  526 LYS A N   
3502 C CA  . LYS A 453 ? 2.1399 2.4880 2.0312  0.5001  -0.6794 0.3674  526 LYS A CA  
3503 C C   . LYS A 453 ? 2.0609 2.4220 1.9604  0.5411  -0.7088 0.3594  526 LYS A C   
3504 O O   . LYS A 453 ? 2.1796 2.5014 2.0636  0.5521  -0.7408 0.3771  526 LYS A O   
3505 C CB  . LYS A 453 ? 2.2282 2.6133 2.1072  0.4649  -0.6614 0.3801  526 LYS A CB  
3506 C CG  . LYS A 453 ? 2.4907 2.8512 2.3446  0.4552  -0.6864 0.4079  526 LYS A CG  
3507 C CD  . LYS A 453 ? 2.5669 2.9654 2.40