data_5IG0
# 
_entry.id   5IG0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5IG0         
WWPDB D_1000218752 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5IG1 unspecified 
PDB . 5IG3 unspecified 
PDB . 5IG4 unspecified 
PDB . 5IG5 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5IG0 
_pdbx_database_status.recvd_initial_deposition_date   2016-02-26 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bhattacharyya, M.' 1 
'Gee, C.L.'         2 
'Barros, T.'        3 
'Kuriyan, J.'       4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            5 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Molecular mechanism of activation-triggered subunit exchange in Ca(2+)/calmodulin-dependent protein kinase II.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.13405 
_citation.pdbx_database_id_PubMed   26949248 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bhattacharyya, M.' 1  ? 
primary 'Stratton, M.M.'    2  ? 
primary 'Going, C.C.'       3  ? 
primary 'McSpadden, E.D.'   4  ? 
primary 'Huang, Y.'         5  ? 
primary 'Susa, A.C.'        6  ? 
primary 'Elleman, A.'       7  ? 
primary 'Cao, Y.M.'         8  ? 
primary 'Pappireddi, N.'    9  ? 
primary 'Burkhardt, P.'     10 ? 
primary 'Gee, C.L.'         11 ? 
primary 'Barros, T.'        12 ? 
primary 'Schulman, H.'      13 ? 
primary 'Williams, E.R.'    14 ? 
primary 'Kuriyan, J.'       15 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5IG0 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     96.805 
_cell.length_a_esd                 ? 
_cell.length_b                     96.805 
_cell.length_b_esd                 ? 
_cell.length_c                     58.416 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5IG0 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CAMK/CAMK2 protein kinase' 16249.354 1  ? ? 'UNP residues 335-479' ? 
2 non-polymer syn 'SULFATE ION'               96.063    1  ? ? ?                      ? 
3 non-polymer syn GLYCEROL                    92.094    3  ? ? ?                      ? 
4 water       nat water                       18.015    88 ? ? ?                      ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPHTVAEKQDTLVPAGPAKAVLEVNDELLKAVASGDWDAYTTMVDPNVTCFEPEAAGVLAKGLAFHKFFFDNRSPNADKM
KTTLHDPAVQMFGDTAIVTALRVVQFVADDGPKTTRYEETRVWVKDAAFKFGWKLVHFHRSGAHATPN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPHTVAEKQDTLVPAGPAKAVLEVNDELLKAVASGDWDAYTTMVDPNVTCFEPEAAGVLAKGLAFHKFFFDNRSPNADKM
KTTLHDPAVQMFGDTAIVTALRVVQFVADDGPKTTRYEETRVWVKDAAFKFGWKLVHFHRSGAHATPN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   THR n 
1 5   VAL n 
1 6   ALA n 
1 7   GLU n 
1 8   LYS n 
1 9   GLN n 
1 10  ASP n 
1 11  THR n 
1 12  LEU n 
1 13  VAL n 
1 14  PRO n 
1 15  ALA n 
1 16  GLY n 
1 17  PRO n 
1 18  ALA n 
1 19  LYS n 
1 20  ALA n 
1 21  VAL n 
1 22  LEU n 
1 23  GLU n 
1 24  VAL n 
1 25  ASN n 
1 26  ASP n 
1 27  GLU n 
1 28  LEU n 
1 29  LEU n 
1 30  LYS n 
1 31  ALA n 
1 32  VAL n 
1 33  ALA n 
1 34  SER n 
1 35  GLY n 
1 36  ASP n 
1 37  TRP n 
1 38  ASP n 
1 39  ALA n 
1 40  TYR n 
1 41  THR n 
1 42  THR n 
1 43  MET n 
1 44  VAL n 
1 45  ASP n 
1 46  PRO n 
1 47  ASN n 
1 48  VAL n 
1 49  THR n 
1 50  CYS n 
1 51  PHE n 
1 52  GLU n 
1 53  PRO n 
1 54  GLU n 
1 55  ALA n 
1 56  ALA n 
1 57  GLY n 
1 58  VAL n 
1 59  LEU n 
1 60  ALA n 
1 61  LYS n 
1 62  GLY n 
1 63  LEU n 
1 64  ALA n 
1 65  PHE n 
1 66  HIS n 
1 67  LYS n 
1 68  PHE n 
1 69  PHE n 
1 70  PHE n 
1 71  ASP n 
1 72  ASN n 
1 73  ARG n 
1 74  SER n 
1 75  PRO n 
1 76  ASN n 
1 77  ALA n 
1 78  ASP n 
1 79  LYS n 
1 80  MET n 
1 81  LYS n 
1 82  THR n 
1 83  THR n 
1 84  LEU n 
1 85  HIS n 
1 86  ASP n 
1 87  PRO n 
1 88  ALA n 
1 89  VAL n 
1 90  GLN n 
1 91  MET n 
1 92  PHE n 
1 93  GLY n 
1 94  ASP n 
1 95  THR n 
1 96  ALA n 
1 97  ILE n 
1 98  VAL n 
1 99  THR n 
1 100 ALA n 
1 101 LEU n 
1 102 ARG n 
1 103 VAL n 
1 104 VAL n 
1 105 GLN n 
1 106 PHE n 
1 107 VAL n 
1 108 ALA n 
1 109 ASP n 
1 110 ASP n 
1 111 GLY n 
1 112 PRO n 
1 113 LYS n 
1 114 THR n 
1 115 THR n 
1 116 ARG n 
1 117 TYR n 
1 118 GLU n 
1 119 GLU n 
1 120 THR n 
1 121 ARG n 
1 122 VAL n 
1 123 TRP n 
1 124 VAL n 
1 125 LYS n 
1 126 ASP n 
1 127 ALA n 
1 128 ALA n 
1 129 PHE n 
1 130 LYS n 
1 131 PHE n 
1 132 GLY n 
1 133 TRP n 
1 134 LYS n 
1 135 LEU n 
1 136 VAL n 
1 137 HIS n 
1 138 PHE n 
1 139 HIS n 
1 140 ARG n 
1 141 SER n 
1 142 GLY n 
1 143 ALA n 
1 144 HIS n 
1 145 ALA n 
1 146 THR n 
1 147 PRO n 
1 148 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   148 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PTSG_10090 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 50818 / BSB-021' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Salpingoeca rosetta (strain ATCC 50818 / BSB-021)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     946362 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    F2UPG5_SALR5 
_struct_ref.pdbx_db_accession          F2UPG5 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TVAEKQDTLVPAGPAKAVLEVNDELLKAVASGDWDAYTTMVDPNVTCFEPEAAGVLAKGLAFHKFFFDNRSPNADKMKTT
LHDPAVQMFGDTAIVTALRVVQFVADDGPKTTRYEETRVWVKDAAFKFGWKLVHFHRSGAHATPN
;
_struct_ref.pdbx_align_begin           335 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5IG0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 148 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             F2UPG5 
_struct_ref_seq.db_align_beg                  335 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  479 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       335 
_struct_ref_seq.pdbx_auth_seq_align_end       479 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5IG0 GLY A 1 ? UNP F2UPG5 ? ? 'expression tag' 332 1 
1 5IG0 PRO A 2 ? UNP F2UPG5 ? ? 'expression tag' 333 2 
1 5IG0 HIS A 3 ? UNP F2UPG5 ? ? 'expression tag' 334 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5IG0 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.43 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.41 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M lithium sulphate, 0.1 M Tris pH 7.0, 2.0 M ammonium sulphate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      'M1: parabola M2: torroid' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-10-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'DCM Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 8.2.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   8.2.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            23.6 
_reflns.entry_id                         5IG0 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.75 
_reflns.d_resolution_low                 48.40 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       16674 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.1 
_reflns.pdbx_Rmerge_I_obs                .043 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  .043 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            22.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.75 
_reflns_shell.d_res_low                   1.78 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.7 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                .783 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5IG0 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.750 
_refine.ls_d_res_low                             41.918 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     16670 
_refine.ls_number_reflns_R_free                  853 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.27 
_refine.ls_percent_reflns_R_free                 5.12 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1923 
_refine.ls_R_factor_R_free                       0.2111 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1913 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1HKX 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.21 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.21 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1019 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             88 
_refine_hist.number_atoms_total               1130 
_refine_hist.d_res_high                       1.750 
_refine_hist.d_res_low                        41.918 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 1066 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.833  ? 1445 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 12.686 ? 372  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.034  ? 157  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 184  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.7500 1.8597  . . 157 2577 100.00 . . . 0.3100 . 0.2712 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8597 2.0032  . . 155 2587 100.00 . . . 0.2951 . 0.2295 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0032 2.2048  . . 140 2600 100.00 . . . 0.2144 . 0.1973 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2048 2.5238  . . 114 2645 99.00  . . . 0.2392 . 0.1972 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5238 3.1796  . . 146 2636 99.00  . . . 0.2021 . 0.1894 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1796 41.9298 . . 141 2772 98.00  . . . 0.1818 . 0.1760 . . . . . . . . . . 
# 
_struct.entry_id                     5IG0 
_struct.title                        'Crystal structure of S. rosetta CaMKII hub' 
_struct.pdbx_descriptor              'CAMK/CAMK2 protein kinase' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5IG0 
_struct_keywords.text            'Ca2+/CaM-dependent kinase, choanoflagellate, open-spiral, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLY A 16 ? SER A 34 ? GLY A 347 SER A 365 1 ? 19 
HELX_P HELX_P2 AA2 ASP A 36 ? THR A 42 ? ASP A 367 THR A 373 1 ? 7  
HELX_P HELX_P3 AA3 GLU A 52 ? ALA A 56 ? GLU A 383 ALA A 387 5 ? 5  
HELX_P HELX_P4 AA4 GLY A 62 ? ASN A 72 ? GLY A 393 ASN A 403 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           74 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            405 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    75 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     406 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -9.98 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 60  ? LYS A 61  ? ALA A 391 LYS A 392 
AA1 2 VAL A 44  ? PHE A 51  ? VAL A 375 PHE A 382 
AA1 3 TRP A 133 ? GLY A 142 ? TRP A 464 GLY A 473 
AA1 4 GLY A 111 ? LYS A 125 ? GLY A 442 LYS A 456 
AA1 5 THR A 95  ? ALA A 108 ? THR A 426 ALA A 439 
AA1 6 LYS A 81  ? PHE A 92  ? LYS A 412 PHE A 423 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ALA A 60  ? O ALA A 391 N CYS A 50  ? N CYS A 381 
AA1 2 3 N PHE A 51  ? N PHE A 382 O ARG A 140 ? O ARG A 471 
AA1 3 4 O HIS A 137 ? O HIS A 468 N VAL A 122 ? N VAL A 453 
AA1 4 5 O LYS A 113 ? O LYS A 444 N PHE A 106 ? N PHE A 437 
AA1 5 6 O LEU A 101 ? O LEU A 432 N HIS A 85  ? N HIS A 416 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 501 ? 8 'binding site for residue SO4 A 501' 
AC2 Software A GOL 502 ? 5 'binding site for residue GOL A 502' 
AC3 Software A GOL 503 ? 7 'binding site for residue GOL A 503' 
AC4 Software A GOL 504 ? 7 'binding site for residue GOL A 504' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 VAL A 32  ? VAL A 363 . ? 1_555  ? 
2  AC1 8 TYR A 40  ? TYR A 371 . ? 1_555  ? 
3  AC1 8 GLU A 52  ? GLU A 383 . ? 1_555  ? 
4  AC1 8 ARG A 121 ? ARG A 452 . ? 1_555  ? 
5  AC1 8 PHE A 138 ? PHE A 469 . ? 1_555  ? 
6  AC1 8 ARG A 140 ? ARG A 471 . ? 1_555  ? 
7  AC1 8 HOH F .   ? HOH A 615 . ? 1_555  ? 
8  AC1 8 HOH F .   ? HOH A 629 . ? 1_555  ? 
9  AC2 5 PRO A 53  ? PRO A 384 . ? 1_555  ? 
10 AC2 5 GLU A 54  ? GLU A 385 . ? 1_555  ? 
11 AC2 5 TYR A 117 ? TYR A 448 . ? 1_555  ? 
12 AC2 5 ARG A 140 ? ARG A 471 . ? 1_555  ? 
13 AC2 5 HOH F .   ? HOH A 603 . ? 1_555  ? 
14 AC3 7 LEU A 59  ? LEU A 390 . ? 12_555 ? 
15 AC3 7 LYS A 61  ? LYS A 392 . ? 12_555 ? 
16 AC3 7 HIS A 85  ? HIS A 416 . ? 7_555  ? 
17 AC3 7 ASP A 86  ? ASP A 417 . ? 1_555  ? 
18 AC3 7 ASP A 86  ? ASP A 417 . ? 7_555  ? 
19 AC3 7 PRO A 87  ? PRO A 418 . ? 7_555  ? 
20 AC3 7 HOH F .   ? HOH A 646 . ? 7_555  ? 
21 AC4 7 LYS A 125 ? LYS A 456 . ? 1_555  ? 
22 AC4 7 ALA A 127 ? ALA A 458 . ? 10_444 ? 
23 AC4 7 PHE A 129 ? PHE A 460 . ? 10_444 ? 
24 AC4 7 LYS A 130 ? LYS A 461 . ? 10_444 ? 
25 AC4 7 GLY A 132 ? GLY A 463 . ? 1_555  ? 
26 AC4 7 TRP A 133 ? TRP A 464 . ? 1_555  ? 
27 AC4 7 HOH F .   ? HOH A 612 . ? 1_555  ? 
# 
_atom_sites.entry_id                    5IG0 
_atom_sites.fract_transf_matrix[1][1]   0.010330 
_atom_sites.fract_transf_matrix[1][2]   0.005964 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011928 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017119 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . VAL A 1 13  ? -28.068 -46.111 -3.790  1.00 49.68  ?  344 VAL A N    1 
ATOM   2    C CA   . VAL A 1 13  ? -28.796 -45.691 -2.599  1.00 47.34  ?  344 VAL A CA   1 
ATOM   3    C C    . VAL A 1 13  ? -29.214 -44.225 -2.726  1.00 45.49  ?  344 VAL A C    1 
ATOM   4    O O    . VAL A 1 13  ? -28.374 -43.365 -2.992  1.00 47.57  ?  344 VAL A O    1 
ATOM   5    C CB   . VAL A 1 13  ? -27.948 -45.869 -1.325  1.00 45.73  ?  344 VAL A CB   1 
ATOM   6    C CG1  . VAL A 1 13  ? -28.752 -45.491 -0.087  1.00 41.99  ?  344 VAL A CG1  1 
ATOM   7    C CG2  . VAL A 1 13  ? -27.449 -47.301 -1.215  1.00 57.07  ?  344 VAL A CG2  1 
ATOM   8    H HA   . VAL A 1 13  ? -29.598 -46.229 -2.508  1.00 56.81  ?  344 VAL A HA   1 
ATOM   9    H HB   . VAL A 1 13  ? -27.176 -45.284 -1.373  1.00 54.87  ?  344 VAL A HB   1 
ATOM   10   H HG11 . VAL A 1 13  ? -28.196 -45.612 0.698   1.00 50.39  ?  344 VAL A HG11 1 
ATOM   11   H HG12 . VAL A 1 13  ? -29.024 -44.563 -0.160  1.00 50.39  ?  344 VAL A HG12 1 
ATOM   12   H HG13 . VAL A 1 13  ? -29.533 -46.063 -0.032  1.00 50.39  ?  344 VAL A HG13 1 
ATOM   13   H HG21 . VAL A 1 13  ? -26.919 -47.389 -0.407  1.00 68.48  ?  344 VAL A HG21 1 
ATOM   14   H HG22 . VAL A 1 13  ? -28.212 -47.899 -1.178  1.00 68.48  ?  344 VAL A HG22 1 
ATOM   15   H HG23 . VAL A 1 13  ? -26.905 -47.506 -1.992  1.00 68.48  ?  344 VAL A HG23 1 
ATOM   16   N N    . PRO A 1 14  ? -30.514 -43.934 -2.535  1.00 35.93  ?  345 PRO A N    1 
ATOM   17   C CA   . PRO A 1 14  ? -30.987 -42.553 -2.666  1.00 30.65  ?  345 PRO A CA   1 
ATOM   18   C C    . PRO A 1 14  ? -30.644 -41.708 -1.446  1.00 35.84  ?  345 PRO A C    1 
ATOM   19   O O    . PRO A 1 14  ? -30.521 -42.244 -0.345  1.00 28.59  ?  345 PRO A O    1 
ATOM   20   C CB   . PRO A 1 14  ? -32.499 -42.719 -2.801  1.00 31.48  ?  345 PRO A CB   1 
ATOM   21   C CG   . PRO A 1 14  ? -32.797 -43.927 -1.997  1.00 33.81  ?  345 PRO A CG   1 
ATOM   22   C CD   . PRO A 1 14  ? -31.613 -44.847 -2.172  1.00 32.18  ?  345 PRO A CD   1 
ATOM   23   H HA   . PRO A 1 14  ? -30.628 -42.139 -3.466  1.00 36.78  ?  345 PRO A HA   1 
ATOM   24   H HB2  . PRO A 1 14  ? -32.951 -41.941 -2.439  1.00 37.77  ?  345 PRO A HB2  1 
ATOM   25   H HB3  . PRO A 1 14  ? -32.734 -42.857 -3.732  1.00 37.77  ?  345 PRO A HB3  1 
ATOM   26   H HG2  . PRO A 1 14  ? -32.899 -43.678 -1.065  1.00 40.58  ?  345 PRO A HG2  1 
ATOM   27   H HG3  . PRO A 1 14  ? -33.606 -44.346 -2.328  1.00 40.58  ?  345 PRO A HG3  1 
ATOM   28   H HD2  . PRO A 1 14  ? -31.413 -45.302 -1.339  1.00 38.62  ?  345 PRO A HD2  1 
ATOM   29   H HD3  . PRO A 1 14  ? -31.779 -45.478 -2.890  1.00 38.62  ?  345 PRO A HD3  1 
ATOM   30   N N    . ALA A 1 15  ? -30.500 -40.402 -1.643  1.00 36.11  ?  346 ALA A N    1 
ATOM   31   C CA   . ALA A 1 15  ? -30.187 -39.496 -0.545  1.00 37.57  ?  346 ALA A CA   1 
ATOM   32   C C    . ALA A 1 15  ? -31.455 -38.988 0.131   1.00 30.28  ?  346 ALA A C    1 
ATOM   33   O O    . ALA A 1 15  ? -32.427 -38.624 -0.538  1.00 31.34  ?  346 ALA A O    1 
ATOM   34   C CB   . ALA A 1 15  ? -29.354 -38.324 -1.052  1.00 36.59  ?  346 ALA A CB   1 
ATOM   35   H H    . ALA A 1 15  ? -30.579 -40.014 -2.406  1.00 43.34  ?  346 ALA A H    1 
ATOM   36   H HA   . ALA A 1 15  ? -29.664 -39.972 0.118   1.00 45.08  ?  346 ALA A HA   1 
ATOM   37   H HB1  . ALA A 1 15  ? -29.156 -37.732 -0.309  1.00 43.91  ?  346 ALA A HB1  1 
ATOM   38   H HB2  . ALA A 1 15  ? -28.529 -38.664 -1.433  1.00 43.91  ?  346 ALA A HB2  1 
ATOM   39   H HB3  . ALA A 1 15  ? -29.859 -37.847 -1.729  1.00 43.91  ?  346 ALA A HB3  1 
ATOM   40   N N    . GLY A 1 16  ? -31.439 -38.957 1.461   1.00 31.22  ?  347 GLY A N    1 
ATOM   41   C CA   . GLY A 1 16  ? -32.494 -38.309 2.220   1.00 41.98  ?  347 GLY A CA   1 
ATOM   42   C C    . GLY A 1 16  ? -32.428 -36.809 1.992   1.00 36.84  ?  347 GLY A C    1 
ATOM   43   O O    . GLY A 1 16  ? -31.507 -36.331 1.336   1.00 36.33  ?  347 GLY A O    1 
ATOM   44   H H    . GLY A 1 16  ? -30.822 -39.308 1.947   1.00 37.47  ?  347 GLY A H    1 
ATOM   45   H HA2  . GLY A 1 16  ? -33.360 -38.636 1.932   1.00 50.37  ?  347 GLY A HA2  1 
ATOM   46   H HA3  . GLY A 1 16  ? -32.384 -38.491 3.166   1.00 50.37  ?  347 GLY A HA3  1 
ATOM   47   N N    . PRO A 1 17  ? -33.401 -36.060 2.534   1.00 32.05  ?  348 PRO A N    1 
ATOM   48   C CA   . PRO A 1 17  ? -33.524 -34.617 2.285   1.00 34.08  ?  348 PRO A CA   1 
ATOM   49   C C    . PRO A 1 17  ? -32.240 -33.836 2.568   1.00 29.88  ?  348 PRO A C    1 
ATOM   50   O O    . PRO A 1 17  ? -31.803 -33.057 1.721   1.00 31.80  ?  348 PRO A O    1 
ATOM   51   C CB   . PRO A 1 17  ? -34.638 -34.191 3.245   1.00 40.04  ?  348 PRO A CB   1 
ATOM   52   C CG   . PRO A 1 17  ? -35.435 -35.423 3.472   1.00 39.32  ?  348 PRO A CG   1 
ATOM   53   C CD   . PRO A 1 17  ? -34.466 -36.558 3.421   1.00 32.59  ?  348 PRO A CD   1 
ATOM   54   H HA   . PRO A 1 17  ? -33.807 -34.454 1.371   1.00 40.89  ?  348 PRO A HA   1 
ATOM   55   H HB2  . PRO A 1 17  ? -34.251 -33.874 4.076   1.00 48.05  ?  348 PRO A HB2  1 
ATOM   56   H HB3  . PRO A 1 17  ? -35.181 -33.502 2.832   1.00 48.05  ?  348 PRO A HB3  1 
ATOM   57   H HG2  . PRO A 1 17  ? -35.861 -35.378 4.342   1.00 47.19  ?  348 PRO A HG2  1 
ATOM   58   H HG3  . PRO A 1 17  ? -36.101 -35.513 2.771   1.00 47.19  ?  348 PRO A HG3  1 
ATOM   59   H HD2  . PRO A 1 17  ? -34.112 -36.740 4.306   1.00 39.11  ?  348 PRO A HD2  1 
ATOM   60   H HD3  . PRO A 1 17  ? -34.885 -37.344 3.037   1.00 39.11  ?  348 PRO A HD3  1 
ATOM   61   N N    . ALA A 1 18  ? -31.647 -34.050 3.738   1.00 35.27  ?  349 ALA A N    1 
ATOM   62   C CA   . ALA A 1 18  ? -30.455 -33.308 4.139   1.00 32.67  ?  349 ALA A CA   1 
ATOM   63   C C    . ALA A 1 18  ? -29.259 -33.658 3.256   1.00 31.64  ?  349 ALA A C    1 
ATOM   64   O O    . ALA A 1 18  ? -28.546 -32.778 2.781   1.00 28.54  ?  349 ALA A O    1 
ATOM   65   C CB   . ALA A 1 18  ? -30.133 -33.582 5.601   1.00 35.90  ?  349 ALA A CB   1 
ATOM   66   H H    . ALA A 1 18  ? -31.916 -34.622 4.321   1.00 42.33  ?  349 ALA A H    1 
ATOM   67   H HA   . ALA A 1 18  ? -30.628 -32.359 4.044   1.00 39.20  ?  349 ALA A HA   1 
ATOM   68   H HB1  . ALA A 1 18  ? -29.340 -33.081 5.848   1.00 43.08  ?  349 ALA A HB1  1 
ATOM   69   H HB2  . ALA A 1 18  ? -30.885 -33.302 6.146   1.00 43.08  ?  349 ALA A HB2  1 
ATOM   70   H HB3  . ALA A 1 18  ? -29.975 -34.532 5.716   1.00 43.08  ?  349 ALA A HB3  1 
ATOM   71   N N    . LYS A 1 19  ? -29.033 -34.948 3.039   1.00 27.91  ?  350 LYS A N    1 
ATOM   72   C CA   . LYS A 1 19  ? -27.942 -35.377 2.177   1.00 31.03  ?  350 LYS A CA   1 
ATOM   73   C C    . LYS A 1 19  ? -28.192 -34.909 0.745   1.00 26.98  ?  350 LYS A C    1 
ATOM   74   O O    . LYS A 1 19  ? -27.261 -34.536 0.032   1.00 25.51  ?  350 LYS A O    1 
ATOM   75   C CB   . LYS A 1 19  ? -27.779 -36.897 2.223   1.00 34.50  ?  350 LYS A CB   1 
ATOM   76   C CG   . LYS A 1 19  ? -26.602 -37.410 1.406   1.00 39.90  ?  350 LYS A CG   1 
ATOM   77   C CD   . LYS A 1 19  ? -26.458 -38.922 1.509   1.00 55.02  ?  350 LYS A CD   1 
ATOM   78   C CE   . LYS A 1 19  ? -25.342 -39.431 0.609   1.00 59.84  ?  350 LYS A CE   1 
ATOM   79   N NZ   . LYS A 1 19  ? -25.107 -40.892 0.760   1.00 72.76  ?  350 LYS A NZ   1 
ATOM   80   H H    . LYS A 1 19  ? -29.495 -35.591 3.376   1.00 33.50  ?  350 LYS A H    1 
ATOM   81   H HA   . LYS A 1 19  ? -27.115 -34.974 2.487   1.00 37.23  ?  350 LYS A HA   1 
ATOM   82   H HB2  . LYS A 1 19  ? -27.642 -37.169 3.144   1.00 41.40  ?  350 LYS A HB2  1 
ATOM   83   H HB3  . LYS A 1 19  ? -28.585 -37.309 1.874   1.00 41.40  ?  350 LYS A HB3  1 
ATOM   84   H HG2  . LYS A 1 19  ? -26.738 -37.182 0.473   1.00 47.88  ?  350 LYS A HG2  1 
ATOM   85   H HG3  . LYS A 1 19  ? -25.785 -37.005 1.734   1.00 47.88  ?  350 LYS A HG3  1 
ATOM   86   H HD2  . LYS A 1 19  ? -26.245 -39.162 2.424   1.00 66.02  ?  350 LYS A HD2  1 
ATOM   87   H HD3  . LYS A 1 19  ? -27.288 -39.343 1.235   1.00 66.02  ?  350 LYS A HD3  1 
ATOM   88   H HE2  . LYS A 1 19  ? -25.579 -39.258 -0.316  1.00 71.81  ?  350 LYS A HE2  1 
ATOM   89   H HE3  . LYS A 1 19  ? -24.519 -38.969 0.833   1.00 71.81  ?  350 LYS A HE3  1 
ATOM   90   H HZ1  . LYS A 1 19  ? -24.449 -41.152 0.219   1.00 87.32  ?  350 LYS A HZ1  1 
ATOM   91   H HZ2  . LYS A 1 19  ? -24.881 -41.078 1.600   1.00 87.32  ?  350 LYS A HZ2  1 
ATOM   92   H HZ3  . LYS A 1 19  ? -25.846 -41.342 0.553   1.00 87.32  ?  350 LYS A HZ3  1 
ATOM   93   N N    . ALA A 1 20  ? -29.458 -34.915 0.338   1.00 23.80  ?  351 ALA A N    1 
ATOM   94   C CA   . ALA A 1 20  ? -29.826 -34.529 -1.017  1.00 25.55  ?  351 ALA A CA   1 
ATOM   95   C C    . ALA A 1 20  ? -29.474 -33.068 -1.294  1.00 26.22  ?  351 ALA A C    1 
ATOM   96   O O    . ALA A 1 20  ? -28.889 -32.759 -2.330  1.00 25.98  ?  351 ALA A O    1 
ATOM   97   C CB   . ALA A 1 20  ? -31.310 -34.767 -1.253  1.00 28.47  ?  351 ALA A CB   1 
ATOM   98   H H    . ALA A 1 20  ? -30.125 -35.140 0.831   1.00 28.56  ?  351 ALA A H    1 
ATOM   99   H HA   . ALA A 1 20  ? -29.332 -35.078 -1.646  1.00 30.66  ?  351 ALA A HA   1 
ATOM   100  H HB1  . ALA A 1 20  ? -31.531 -34.503 -2.160  1.00 34.16  ?  351 ALA A HB1  1 
ATOM   101  H HB2  . ALA A 1 20  ? -31.502 -35.709 -1.126  1.00 34.16  ?  351 ALA A HB2  1 
ATOM   102  H HB3  . ALA A 1 20  ? -31.818 -34.237 -0.620  1.00 34.16  ?  351 ALA A HB3  1 
ATOM   103  N N    . VAL A 1 21  ? -29.819 -32.169 -0.375  1.00 27.05  ?  352 VAL A N    1 
ATOM   104  C CA   . VAL A 1 21  ? -29.527 -30.749 -0.593  1.00 21.06  ?  352 VAL A CA   1 
ATOM   105  C C    . VAL A 1 21  ? -28.026 -30.491 -0.586  1.00 22.19  ?  352 VAL A C    1 
ATOM   106  O O    . VAL A 1 21  ? -27.537 -29.650 -1.342  1.00 23.36  ?  352 VAL A O    1 
ATOM   107  C CB   . VAL A 1 21  ? -30.187 -29.829 0.462   1.00 28.89  ?  352 VAL A CB   1 
ATOM   108  C CG1  . VAL A 1 21  ? -31.668 -29.896 0.349   1.00 42.26  ?  352 VAL A CG1  1 
ATOM   109  C CG2  . VAL A 1 21  ? -29.756 -30.190 1.856   1.00 42.89  ?  352 VAL A CG2  1 
ATOM   110  H H    . VAL A 1 21  ? -30.214 -32.347 0.368   1.00 32.46  ?  352 VAL A H    1 
ATOM   111  H HA   . VAL A 1 21  ? -29.868 -30.491 -1.464  1.00 25.27  ?  352 VAL A HA   1 
ATOM   112  H HB   . VAL A 1 21  ? -29.915 -28.913 0.293   1.00 34.67  ?  352 VAL A HB   1 
ATOM   113  H HG11 . VAL A 1 21  ? -32.061 -29.313 1.017   1.00 50.71  ?  352 VAL A HG11 1 
ATOM   114  H HG12 . VAL A 1 21  ? -31.929 -29.605 -0.539  1.00 50.71  ?  352 VAL A HG12 1 
ATOM   115  H HG13 . VAL A 1 21  ? -31.955 -30.810 0.496   1.00 50.71  ?  352 VAL A HG13 1 
ATOM   116  H HG21 . VAL A 1 21  ? -30.190 -29.592 2.485   1.00 51.47  ?  352 VAL A HG21 1 
ATOM   117  H HG22 . VAL A 1 21  ? -30.014 -31.107 2.039   1.00 51.47  ?  352 VAL A HG22 1 
ATOM   118  H HG23 . VAL A 1 21  ? -28.792 -30.097 1.923   1.00 51.47  ?  352 VAL A HG23 1 
ATOM   119  N N    . LEU A 1 22  ? -27.294 -31.203 0.267   1.00 25.71  ?  353 LEU A N    1 
ATOM   120  C CA   . LEU A 1 22  ? -25.841 -31.069 0.283   1.00 25.78  ?  353 LEU A CA   1 
ATOM   121  C C    . LEU A 1 22  ? -25.265 -31.454 -1.072  1.00 27.48  ?  353 LEU A C    1 
ATOM   122  O O    . LEU A 1 22  ? -24.359 -30.800 -1.574  1.00 25.55  ?  353 LEU A O    1 
ATOM   123  C CB   . LEU A 1 22  ? -25.211 -31.927 1.382   1.00 29.81  ?  353 LEU A CB   1 
ATOM   124  C CG   . LEU A 1 22  ? -25.352 -31.382 2.803   1.00 34.91  ?  353 LEU A CG   1 
ATOM   125  C CD1  . LEU A 1 22  ? -24.807 -32.368 3.824   1.00 48.64  ?  353 LEU A CD1  1 
ATOM   126  C CD2  . LEU A 1 22  ? -24.658 -30.023 2.944   1.00 40.30  ?  353 LEU A CD2  1 
ATOM   127  H H    . LEU A 1 22  ? -27.608 -31.763 0.839   1.00 30.86  ?  353 LEU A H    1 
ATOM   128  H HA   . LEU A 1 22  ? -25.610 -30.143 0.456   1.00 30.94  ?  353 LEU A HA   1 
ATOM   129  H HB2  . LEU A 1 22  ? -25.628 -32.803 1.364   1.00 35.77  ?  353 LEU A HB2  1 
ATOM   130  H HB3  . LEU A 1 22  ? -24.263 -32.016 1.197   1.00 35.77  ?  353 LEU A HB3  1 
ATOM   131  H HG   . LEU A 1 22  ? -26.294 -31.252 2.993   1.00 41.90  ?  353 LEU A HG   1 
ATOM   132  H HD11 . LEU A 1 22  ? -24.911 -31.992 4.712   1.00 58.37  ?  353 LEU A HD11 1 
ATOM   133  H HD12 . LEU A 1 22  ? -25.303 -33.199 3.756   1.00 58.37  ?  353 LEU A HD12 1 
ATOM   134  H HD13 . LEU A 1 22  ? -23.868 -32.527 3.640   1.00 58.37  ?  353 LEU A HD13 1 
ATOM   135  H HD21 . LEU A 1 22  ? -24.766 -29.707 3.855   1.00 48.35  ?  353 LEU A HD21 1 
ATOM   136  H HD22 . LEU A 1 22  ? -23.715 -30.128 2.740   1.00 48.35  ?  353 LEU A HD22 1 
ATOM   137  H HD23 . LEU A 1 22  ? -25.064 -29.396 2.325   1.00 48.35  ?  353 LEU A HD23 1 
ATOM   138  N N    . GLU A 1 23  ? -25.802 -32.510 -1.672  1.00 23.28  ?  354 GLU A N    1 
ATOM   139  C CA   . GLU A 1 23  ? -25.311 -32.958 -2.968  1.00 24.05  ?  354 GLU A CA   1 
ATOM   140  C C    . GLU A 1 23  ? -25.600 -31.932 -4.058  1.00 22.05  ?  354 GLU A C    1 
ATOM   141  O O    . GLU A 1 23  ? -24.742 -31.659 -4.895  1.00 26.38  ?  354 GLU A O    1 
ATOM   142  C CB   . GLU A 1 23  ? -25.923 -34.313 -3.332  1.00 25.95  ?  354 GLU A CB   1 
ATOM   143  C CG   . GLU A 1 23  ? -25.377 -35.452 -2.487  1.00 31.48  ?  354 GLU A CG   1 
ATOM   144  C CD   . GLU A 1 23  ? -26.034 -36.781 -2.795  1.00 36.85  ?  354 GLU A CD   1 
ATOM   145  O OE1  . GLU A 1 23  ? -27.037 -36.796 -3.538  1.00 40.22  ?  354 GLU A OE1  1 
ATOM   146  O OE2  . GLU A 1 23  ? -25.543 -37.810 -2.288  1.00 44.15  ?  354 GLU A OE2  1 
ATOM   147  H H    . GLU A 1 23  ? -26.447 -32.981 -1.352  1.00 27.94  ?  354 GLU A H    1 
ATOM   148  H HA   . GLU A 1 23  ? -24.349 -33.072 -2.915  1.00 28.86  ?  354 GLU A HA   1 
ATOM   149  H HB2  . GLU A 1 23  ? -26.883 -34.272 -3.197  1.00 31.15  ?  354 GLU A HB2  1 
ATOM   150  H HB3  . GLU A 1 23  ? -25.727 -34.508 -4.262  1.00 31.15  ?  354 GLU A HB3  1 
ATOM   151  H HG2  . GLU A 1 23  ? -24.426 -35.542 -2.656  1.00 37.77  ?  354 GLU A HG2  1 
ATOM   152  H HG3  . GLU A 1 23  ? -25.530 -35.251 -1.551  1.00 37.77  ?  354 GLU A HG3  1 
ATOM   153  N N    . VAL A 1 24  ? -26.798 -31.354 -4.042  1.00 22.43  ?  355 VAL A N    1 
ATOM   154  C CA   . VAL A 1 24  ? -27.165 -30.366 -5.051  1.00 20.96  ?  355 VAL A CA   1 
ATOM   155  C C    . VAL A 1 24  ? -26.326 -29.105 -4.843  1.00 20.69  ?  355 VAL A C    1 
ATOM   156  O O    . VAL A 1 24  ? -25.896 -28.467 -5.804  1.00 25.83  ?  355 VAL A O    1 
ATOM   157  C CB   . VAL A 1 24  ? -28.665 -30.013 -5.000  1.00 22.76  ?  355 VAL A CB   1 
ATOM   158  C CG1  . VAL A 1 24  ? -29.009 -28.977 -6.053  1.00 27.01  ?  355 VAL A CG1  1 
ATOM   159  C CG2  . VAL A 1 24  ? -29.507 -31.256 -5.220  1.00 28.17  ?  355 VAL A CG2  1 
ATOM   160  H H    . VAL A 1 24  ? -27.412 -31.516 -3.462  1.00 26.92  ?  355 VAL A H    1 
ATOM   161  H HA   . VAL A 1 24  ? -26.967 -30.720 -5.932  1.00 25.16  ?  355 VAL A HA   1 
ATOM   162  H HB   . VAL A 1 24  ? -28.881 -29.647 -4.128  1.00 27.32  ?  355 VAL A HB   1 
ATOM   163  H HG11 . VAL A 1 24  ? -29.956 -28.775 -5.998  1.00 32.41  ?  355 VAL A HG11 1 
ATOM   164  H HG12 . VAL A 1 24  ? -28.488 -28.175 -5.888  1.00 32.41  ?  355 VAL A HG12 1 
ATOM   165  H HG13 . VAL A 1 24  ? -28.797 -29.336 -6.929  1.00 32.41  ?  355 VAL A HG13 1 
ATOM   166  H HG21 . VAL A 1 24  ? -30.445 -31.012 -5.185  1.00 33.80  ?  355 VAL A HG21 1 
ATOM   167  H HG22 . VAL A 1 24  ? -29.295 -31.631 -6.090  1.00 33.80  ?  355 VAL A HG22 1 
ATOM   168  H HG23 . VAL A 1 24  ? -29.305 -31.901 -4.524  1.00 33.80  ?  355 VAL A HG23 1 
ATOM   169  N N    . ASN A 1 25  ? -26.087 -28.762 -3.582  1.00 22.44  ?  356 ASN A N    1 
ATOM   170  C CA   . ASN A 1 25  ? -25.253 -27.609 -3.257  1.00 21.60  ?  356 ASN A CA   1 
ATOM   171  C C    . ASN A 1 25  ? -23.830 -27.798 -3.790  1.00 25.01  ?  356 ASN A C    1 
ATOM   172  O O    . ASN A 1 25  ? -23.232 -26.866 -4.336  1.00 27.45  ?  356 ASN A O    1 
ATOM   173  C CB   . ASN A 1 25  ? -25.242 -27.379 -1.746  1.00 20.65  ?  356 ASN A CB   1 
ATOM   174  C CG   . ASN A 1 25  ? -24.628 -26.046 -1.360  1.00 26.90  ?  356 ASN A CG   1 
ATOM   175  O OD1  . ASN A 1 25  ? -25.266 -24.999 -1.478  1.00 24.45  ?  356 ASN A OD1  1 
ATOM   176  N ND2  . ASN A 1 25  ? -23.389 -26.081 -0.878  1.00 29.51  ?  356 ASN A ND2  1 
ATOM   177  H H    . ASN A 1 25  ? -26.396 -29.179 -2.897  1.00 26.93  ?  356 ASN A H    1 
ATOM   178  H HA   . ASN A 1 25  ? -25.627 -26.820 -3.678  1.00 25.92  ?  356 ASN A HA   1 
ATOM   179  H HB2  . ASN A 1 25  ? -26.154 -27.395 -1.417  1.00 24.78  ?  356 ASN A HB2  1 
ATOM   180  H HB3  . ASN A 1 25  ? -24.724 -28.082 -1.323  1.00 24.78  ?  356 ASN A HB3  1 
ATOM   181  H HD21 . ASN A 1 25  ? -22.998 -25.352 -0.645  1.00 35.41  ?  356 ASN A HD21 1 
ATOM   182  H HD22 . ASN A 1 25  ? -22.979 -26.833 -0.799  1.00 35.41  ?  356 ASN A HD22 1 
ATOM   183  N N    . ASP A 1 26  ? -23.297 -29.011 -3.648  1.00 26.13  ?  357 ASP A N    1 
ATOM   184  C CA   . ASP A 1 26  ? -21.989 -29.349 -4.211  1.00 27.43  ?  357 ASP A CA   1 
ATOM   185  C C    . ASP A 1 26  ? -22.008 -29.294 -5.736  1.00 30.72  ?  357 ASP A C    1 
ATOM   186  O O    . ASP A 1 26  ? -21.056 -28.825 -6.360  1.00 25.05  ?  357 ASP A O    1 
ATOM   187  C CB   . ASP A 1 26  ? -21.543 -30.744 -3.763  1.00 36.37  ?  357 ASP A CB   1 
ATOM   188  C CG   . ASP A 1 26  ? -20.939 -30.756 -2.369  1.00 53.99  ?  357 ASP A CG   1 
ATOM   189  O OD1  . ASP A 1 26  ? -20.460 -29.701 -1.904  1.00 48.15  ?  357 ASP A OD1  1 
ATOM   190  O OD2  . ASP A 1 26  ? -20.932 -31.835 -1.742  1.00 65.70  ?  357 ASP A OD2  1 
ATOM   191  H H    . ASP A 1 26  ? -23.675 -29.659 -3.228  1.00 31.36  ?  357 ASP A H    1 
ATOM   192  H HA   . ASP A 1 26  ? -21.333 -28.707 -3.895  1.00 32.91  ?  357 ASP A HA   1 
ATOM   193  H HB2  . ASP A 1 26  ? -22.312 -31.335 -3.761  1.00 43.65  ?  357 ASP A HB2  1 
ATOM   194  H HB3  . ASP A 1 26  ? -20.873 -31.075 -4.382  1.00 43.65  ?  357 ASP A HB3  1 
ATOM   195  N N    . GLU A 1 27  ? -23.089 -29.789 -6.331  1.00 26.76  ?  358 GLU A N    1 
ATOM   196  C CA   . GLU A 1 27  ? -23.220 -29.806 -7.784  1.00 29.98  ?  358 GLU A CA   1 
ATOM   197  C C    . GLU A 1 27  ? -23.247 -28.386 -8.343  1.00 27.00  ?  358 GLU A C    1 
ATOM   198  O O    . GLU A 1 27  ? -22.725 -28.127 -9.428  1.00 28.27  ?  358 GLU A O    1 
ATOM   199  C CB   . GLU A 1 27  ? -24.484 -30.561 -8.200  1.00 32.96  ?  358 GLU A CB   1 
ATOM   200  C CG   . GLU A 1 27  ? -24.607 -30.795 -9.699  1.00 33.96  ?  358 GLU A CG   1 
ATOM   201  C CD   . GLU A 1 27  ? -23.511 -31.690 -10.255 1.00 47.54  ?  358 GLU A CD   1 
ATOM   202  O OE1  . GLU A 1 27  ? -22.890 -32.448 -9.478  1.00 35.60  ?  358 GLU A OE1  1 
ATOM   203  O OE2  . GLU A 1 27  ? -23.271 -31.633 -11.479 1.00 55.05  ?  358 GLU A OE2  1 
ATOM   204  H H    . GLU A 1 27  ? -23.763 -30.122 -5.914  1.00 32.12  ?  358 GLU A H    1 
ATOM   205  H HA   . GLU A 1 27  ? -22.455 -30.265 -8.166  1.00 35.97  ?  358 GLU A HA   1 
ATOM   206  H HB2  . GLU A 1 27  ? -24.485 -31.428 -7.765  1.00 39.55  ?  358 GLU A HB2  1 
ATOM   207  H HB3  . GLU A 1 27  ? -25.258 -30.051 -7.916  1.00 39.55  ?  358 GLU A HB3  1 
ATOM   208  H HG2  . GLU A 1 27  ? -25.460 -31.218 -9.882  1.00 40.75  ?  358 GLU A HG2  1 
ATOM   209  H HG3  . GLU A 1 27  ? -24.557 -29.940 -10.156 1.00 40.75  ?  358 GLU A HG3  1 
ATOM   210  N N    . LEU A 1 28  ? -23.850 -27.465 -7.596  1.00 23.96  ?  359 LEU A N    1 
ATOM   211  C CA   . LEU A 1 28  ? -23.920 -26.074 -8.028  1.00 21.84  ?  359 LEU A CA   1 
ATOM   212  C C    . LEU A 1 28  ? -22.517 -25.467 -8.099  1.00 24.12  ?  359 LEU A C    1 
ATOM   213  O O    . LEU A 1 28  ? -22.184 -24.768 -9.059  1.00 25.29  ?  359 LEU A O    1 
ATOM   214  C CB   . LEU A 1 28  ? -24.811 -25.255 -7.089  1.00 22.79  ?  359 LEU A CB   1 
ATOM   215  C CG   . LEU A 1 28  ? -25.025 -23.795 -7.504  1.00 23.95  ?  359 LEU A CG   1 
ATOM   216  C CD1  . LEU A 1 28  ? -25.675 -23.700 -8.882  1.00 25.18  ?  359 LEU A CD1  1 
ATOM   217  C CD2  . LEU A 1 28  ? -25.866 -23.055 -6.477  1.00 28.21  ?  359 LEU A CD2  1 
ATOM   218  H H    . LEU A 1 28  ? -24.225 -27.619 -6.838  1.00 28.76  ?  359 LEU A H    1 
ATOM   219  H HA   . LEU A 1 28  ? -24.307 -26.038 -8.917  1.00 26.21  ?  359 LEU A HA   1 
ATOM   220  H HB2  . LEU A 1 28  ? -25.684 -25.677 -7.046  1.00 27.34  ?  359 LEU A HB2  1 
ATOM   221  H HB3  . LEU A 1 28  ? -24.408 -25.252 -6.207  1.00 27.34  ?  359 LEU A HB3  1 
ATOM   222  H HG   . LEU A 1 28  ? -24.162 -23.354 -7.552  1.00 28.74  ?  359 LEU A HG   1 
ATOM   223  H HD11 . LEU A 1 28  ? -25.794 -22.765 -9.111  1.00 30.22  ?  359 LEU A HD11 1 
ATOM   224  H HD12 . LEU A 1 28  ? -25.098 -24.129 -9.533  1.00 30.22  ?  359 LEU A HD12 1 
ATOM   225  H HD13 . LEU A 1 28  ? -26.535 -24.148 -8.857  1.00 30.22  ?  359 LEU A HD13 1 
ATOM   226  H HD21 . LEU A 1 28  ? -25.983 -22.137 -6.768  1.00 33.85  ?  359 LEU A HD21 1 
ATOM   227  H HD22 . LEU A 1 28  ? -26.729 -23.492 -6.403  1.00 33.85  ?  359 LEU A HD22 1 
ATOM   228  H HD23 . LEU A 1 28  ? -25.410 -23.076 -5.621  1.00 33.85  ?  359 LEU A HD23 1 
ATOM   229  N N    . LEU A 1 29  ? -21.696 -25.739 -7.089  1.00 25.36  ?  360 LEU A N    1 
ATOM   230  C CA   . LEU A 1 29  ? -20.301 -25.304 -7.106  1.00 31.34  ?  360 LEU A CA   1 
ATOM   231  C C    . LEU A 1 29  ? -19.570 -25.833 -8.338  1.00 31.37  ?  360 LEU A C    1 
ATOM   232  O O    . LEU A 1 29  ? -18.769 -25.120 -8.943  1.00 30.54  ?  360 LEU A O    1 
ATOM   233  C CB   . LEU A 1 29  ? -19.568 -25.761 -5.843  1.00 31.77  ?  360 LEU A CB   1 
ATOM   234  C CG   . LEU A 1 29  ? -18.050 -25.527 -5.864  1.00 36.87  ?  360 LEU A CG   1 
ATOM   235  C CD1  . LEU A 1 29  ? -17.741 -24.038 -5.948  1.00 41.43  ?  360 LEU A CD1  1 
ATOM   236  C CD2  . LEU A 1 29  ? -17.373 -26.147 -4.654  1.00 50.28  ?  360 LEU A CD2  1 
ATOM   237  H H    . LEU A 1 29  ? -21.921 -26.174 -6.382  1.00 30.43  ?  360 LEU A H    1 
ATOM   238  H HA   . LEU A 1 29  ? -20.273 -24.334 -7.135  1.00 37.61  ?  360 LEU A HA   1 
ATOM   239  H HB2  . LEU A 1 29  ? -19.929 -25.278 -5.083  1.00 38.12  ?  360 LEU A HB2  1 
ATOM   240  H HB3  . LEU A 1 29  ? -19.717 -26.712 -5.725  1.00 38.12  ?  360 LEU A HB3  1 
ATOM   241  H HG   . LEU A 1 29  ? -17.682 -25.949 -6.655  1.00 44.25  ?  360 LEU A HG   1 
ATOM   242  H HD11 . LEU A 1 29  ? -16.779 -23.916 -5.960  1.00 49.72  ?  360 LEU A HD11 1 
ATOM   243  H HD12 . LEU A 1 29  ? -18.130 -23.681 -6.762  1.00 49.72  ?  360 LEU A HD12 1 
ATOM   244  H HD13 . LEU A 1 29  ? -18.122 -23.593 -5.176  1.00 49.72  ?  360 LEU A HD13 1 
ATOM   245  H HD21 . LEU A 1 29  ? -16.420 -25.978 -4.705  1.00 60.33  ?  360 LEU A HD21 1 
ATOM   246  H HD22 . LEU A 1 29  ? -17.738 -25.747 -3.850  1.00 60.33  ?  360 LEU A HD22 1 
ATOM   247  H HD23 . LEU A 1 29  ? -17.541 -27.102 -4.655  1.00 60.33  ?  360 LEU A HD23 1 
ATOM   248  N N    . LYS A 1 30  ? -19.837 -27.087 -8.697  1.00 31.56  ?  361 LYS A N    1 
ATOM   249  C CA   . LYS A 1 30  ? -19.206 -27.699 -9.865  1.00 36.22  ?  361 LYS A CA   1 
ATOM   250  C C    . LYS A 1 30  ? -19.617 -26.974 -11.136 1.00 35.21  ?  361 LYS A C    1 
ATOM   251  O O    . LYS A 1 30  ? -18.809 -26.789 -12.045 1.00 34.65  ?  361 LYS A O    1 
ATOM   252  C CB   . LYS A 1 30  ? -19.577 -29.179 -9.976  1.00 34.30  ?  361 LYS A CB   1 
ATOM   253  C CG   . LYS A 1 30  ? -18.850 -30.081 -8.996  1.00 45.92  ?  361 LYS A CG   1 
ATOM   254  C CD   . LYS A 1 30  ? -19.288 -31.534 -9.162  1.00 54.59  ?  361 LYS A CD   1 
ATOM   255  C CE   . LYS A 1 30  ? -18.656 -32.447 -8.120  1.00 49.17  ?  361 LYS A CE   1 
ATOM   256  N NZ   . LYS A 1 30  ? -17.270 -32.035 -7.754  1.00 82.10  ?  361 LYS A NZ   1 
ATOM   257  H H    . LYS A 1 30  ? -20.381 -27.606 -8.280  1.00 37.87  ?  361 LYS A H    1 
ATOM   258  H HA   . LYS A 1 30  ? -18.243 -27.634 -9.778  1.00 43.46  ?  361 LYS A HA   1 
ATOM   259  H HB2  . LYS A 1 30  ? -20.528 -29.274 -9.815  1.00 41.16  ?  361 LYS A HB2  1 
ATOM   260  H HB3  . LYS A 1 30  ? -19.365 -29.486 -10.872 1.00 41.16  ?  361 LYS A HB3  1 
ATOM   261  H HG2  . LYS A 1 30  ? -17.895 -30.030 -9.158  1.00 55.10  ?  361 LYS A HG2  1 
ATOM   262  H HG3  . LYS A 1 30  ? -19.055 -29.802 -8.090  1.00 55.10  ?  361 LYS A HG3  1 
ATOM   263  H HD2  . LYS A 1 30  ? -20.252 -31.589 -9.067  1.00 65.50  ?  361 LYS A HD2  1 
ATOM   264  H HD3  . LYS A 1 30  ? -19.022 -31.849 -10.040 1.00 65.50  ?  361 LYS A HD3  1 
ATOM   265  H HE2  . LYS A 1 30  ? -19.196 -32.428 -7.314  1.00 59.00  ?  361 LYS A HE2  1 
ATOM   266  H HE3  . LYS A 1 30  ? -18.617 -33.350 -8.472  1.00 59.00  ?  361 LYS A HE3  1 
ATOM   267  H HZ1  . LYS A 1 30  ? -16.938 -32.592 -7.145  1.00 98.51  ?  361 LYS A HZ1  1 
ATOM   268  H HZ2  . LYS A 1 30  ? -16.748 -32.050 -8.475  1.00 98.51  ?  361 LYS A HZ2  1 
ATOM   269  H HZ3  . LYS A 1 30  ? -17.276 -31.210 -7.419  1.00 98.51  ?  361 LYS A HZ3  1 
ATOM   270  N N    . ALA A 1 31  ? -20.881 -26.568 -11.191 1.00 25.67  ?  362 ALA A N    1 
ATOM   271  C CA   . ALA A 1 31  ? -21.408 -25.872 -12.356 1.00 29.83  ?  362 ALA A CA   1 
ATOM   272  C C    . ALA A 1 31  ? -20.764 -24.495 -12.489 1.00 35.40  ?  362 ALA A C    1 
ATOM   273  O O    . ALA A 1 31  ? -20.400 -24.074 -13.586 1.00 32.29  ?  362 ALA A O    1 
ATOM   274  C CB   . ALA A 1 31  ? -22.918 -25.749 -12.262 1.00 29.77  ?  362 ALA A CB   1 
ATOM   275  H H    . ALA A 1 31  ? -21.457 -26.684 -10.563 1.00 30.80  ?  362 ALA A H    1 
ATOM   276  H HA   . ALA A 1 31  ? -21.196 -26.382 -13.153 1.00 35.79  ?  362 ALA A HA   1 
ATOM   277  H HB1  . ALA A 1 31  ? -23.246 -25.284 -13.047 1.00 35.73  ?  362 ALA A HB1  1 
ATOM   278  H HB2  . ALA A 1 31  ? -23.304 -26.638 -12.218 1.00 35.73  ?  362 ALA A HB2  1 
ATOM   279  H HB3  . ALA A 1 31  ? -23.145 -25.250 -11.461 1.00 35.73  ?  362 ALA A HB3  1 
ATOM   280  N N    . VAL A 1 32  ? -20.616 -23.801 -11.365 1.00 30.30  ?  363 VAL A N    1 
ATOM   281  C CA   . VAL A 1 32  ? -20.028 -22.467 -11.369 1.00 29.00  ?  363 VAL A CA   1 
ATOM   282  C C    . VAL A 1 32  ? -18.548 -22.554 -11.727 1.00 32.05  ?  363 VAL A C    1 
ATOM   283  O O    . VAL A 1 32  ? -18.045 -21.759 -12.521 1.00 32.52  ?  363 VAL A O    1 
ATOM   284  C CB   . VAL A 1 32  ? -20.204 -21.765 -10.001 1.00 28.18  ?  363 VAL A CB   1 
ATOM   285  C CG1  . VAL A 1 32  ? -19.440 -20.447 -9.958  1.00 35.82  ?  363 VAL A CG1  1 
ATOM   286  C CG2  . VAL A 1 32  ? -21.682 -21.523 -9.720  1.00 30.35  ?  363 VAL A CG2  1 
ATOM   287  H H    . VAL A 1 32  ? -20.848 -24.082 -10.586 1.00 36.36  ?  363 VAL A H    1 
ATOM   288  H HA   . VAL A 1 32  ? -20.470 -21.927 -12.043 1.00 34.80  ?  363 VAL A HA   1 
ATOM   289  H HB   . VAL A 1 32  ? -19.854 -22.339 -9.302  1.00 33.81  ?  363 VAL A HB   1 
ATOM   290  H HG11 . VAL A 1 32  ? -19.571 -20.035 -9.090  1.00 42.98  ?  363 VAL A HG11 1 
ATOM   291  H HG12 . VAL A 1 32  ? -18.497 -20.624 -10.101 1.00 42.98  ?  363 VAL A HG12 1 
ATOM   292  H HG13 . VAL A 1 32  ? -19.777 -19.864 -10.656 1.00 42.98  ?  363 VAL A HG13 1 
ATOM   293  H HG21 . VAL A 1 32  ? -21.771 -21.083 -8.860  1.00 36.42  ?  363 VAL A HG21 1 
ATOM   294  H HG22 . VAL A 1 32  ? -22.048 -20.959 -10.419 1.00 36.42  ?  363 VAL A HG22 1 
ATOM   295  H HG23 . VAL A 1 32  ? -22.144 -22.375 -9.705  1.00 36.42  ?  363 VAL A HG23 1 
ATOM   296  N N    . ALA A 1 33  ? -17.860 -23.532 -11.149 1.00 35.96  ?  364 ALA A N    1 
ATOM   297  C CA   . ALA A 1 33  ? -16.433 -23.707 -11.386 1.00 38.77  ?  364 ALA A CA   1 
ATOM   298  C C    . ALA A 1 33  ? -16.142 -23.988 -12.857 1.00 42.97  ?  364 ALA A C    1 
ATOM   299  O O    . ALA A 1 33  ? -15.108 -23.572 -13.379 1.00 56.03  ?  364 ALA A O    1 
ATOM   300  C CB   . ALA A 1 33  ? -15.891 -24.831 -10.519 1.00 40.93  ?  364 ALA A CB   1 
ATOM   301  H H    . ALA A 1 33  ? -18.199 -24.111 -10.611 1.00 43.15  ?  364 ALA A H    1 
ATOM   302  H HA   . ALA A 1 33  ? -15.970 -22.891 -11.140 1.00 46.53  ?  364 ALA A HA   1 
ATOM   303  H HB1  . ALA A 1 33  ? -14.942 -24.932 -10.690 1.00 49.11  ?  364 ALA A HB1  1 
ATOM   304  H HB2  . ALA A 1 33  ? -16.037 -24.608 -9.586  1.00 49.11  ?  364 ALA A HB2  1 
ATOM   305  H HB3  . ALA A 1 33  ? -16.357 -25.653 -10.740 1.00 49.11  ?  364 ALA A HB3  1 
ATOM   306  N N    . SER A 1 34  ? -17.060 -24.684 -13.524 1.00 39.24  ?  365 SER A N    1 
ATOM   307  C CA   . SER A 1 34  ? -16.851 -25.102 -14.910 1.00 40.80  ?  365 SER A CA   1 
ATOM   308  C C    . SER A 1 34  ? -17.526 -24.174 -15.921 1.00 43.75  ?  365 SER A C    1 
ATOM   309  O O    . SER A 1 34  ? -17.454 -24.409 -17.126 1.00 40.39  ?  365 SER A O    1 
ATOM   310  C CB   . SER A 1 34  ? -17.361 -26.532 -15.110 1.00 45.04  ?  365 SER A CB   1 
ATOM   311  O OG   . SER A 1 34  ? -18.773 -26.590 -15.015 1.00 46.10  ?  365 SER A OG   1 
ATOM   312  H H    . SER A 1 34  ? -17.816 -24.928 -13.195 1.00 47.08  ?  365 SER A H    1 
ATOM   313  H HA   . SER A 1 34  ? -15.899 -25.099 -15.096 1.00 48.96  ?  365 SER A HA   1 
ATOM   314  H HB2  . SER A 1 34  ? -17.091 -26.842 -15.988 1.00 54.05  ?  365 SER A HB2  1 
ATOM   315  H HB3  . SER A 1 34  ? -16.976 -27.102 -14.426 1.00 54.05  ?  365 SER A HB3  1 
ATOM   316  H HG   . SER A 1 34  ? -19.021 -26.324 -14.258 1.00 55.32  ?  365 SER A HG   1 
ATOM   317  N N    . GLY A 1 35  ? -18.179 -23.123 -15.436 1.00 36.34  ?  366 GLY A N    1 
ATOM   318  C CA   . GLY A 1 35  ? -18.846 -22.175 -16.310 1.00 33.00  ?  366 GLY A CA   1 
ATOM   319  C C    . GLY A 1 35  ? -20.028 -22.775 -17.049 1.00 39.79  ?  366 GLY A C    1 
ATOM   320  O O    . GLY A 1 35  ? -20.387 -22.323 -18.135 1.00 36.51  ?  366 GLY A O    1 
ATOM   321  H H    . GLY A 1 35  ? -18.249 -22.939 -14.598 1.00 43.61  ?  366 GLY A H    1 
ATOM   322  H HA2  . GLY A 1 35  ? -19.165 -21.423 -15.785 1.00 39.61  ?  366 GLY A HA2  1 
ATOM   323  H HA3  . GLY A 1 35  ? -18.214 -21.843 -16.966 1.00 39.61  ?  366 GLY A HA3  1 
ATOM   324  N N    . ASP A 1 36  ? -20.637 -23.796 -16.454 1.00 32.14  ?  367 ASP A N    1 
ATOM   325  C CA   . ASP A 1 36  ? -21.785 -24.470 -17.049 1.00 32.01  ?  367 ASP A CA   1 
ATOM   326  C C    . ASP A 1 36  ? -23.074 -23.729 -16.711 1.00 29.36  ?  367 ASP A C    1 
ATOM   327  O O    . ASP A 1 36  ? -23.742 -24.055 -15.728 1.00 27.02  ?  367 ASP A O    1 
ATOM   328  C CB   . ASP A 1 36  ? -21.858 -25.917 -16.556 1.00 28.12  ?  367 ASP A CB   1 
ATOM   329  C CG   . ASP A 1 36  ? -22.896 -26.743 -17.293 1.00 32.31  ?  367 ASP A CG   1 
ATOM   330  O OD1  . ASP A 1 36  ? -23.777 -26.161 -17.960 1.00 35.50  -1 367 ASP A OD1  1 
ATOM   331  O OD2  . ASP A 1 36  ? -22.833 -27.985 -17.194 1.00 39.45  ?  367 ASP A OD2  1 
ATOM   332  H H    . ASP A 1 36  ? -20.400 -24.121 -15.694 1.00 38.57  ?  367 ASP A H    1 
ATOM   333  H HA   . ASP A 1 36  ? -21.685 -24.481 -18.014 1.00 38.41  ?  367 ASP A HA   1 
ATOM   334  H HB2  . ASP A 1 36  ? -20.994 -26.338 -16.685 1.00 33.74  ?  367 ASP A HB2  1 
ATOM   335  H HB3  . ASP A 1 36  ? -22.089 -25.918 -15.613 1.00 33.74  ?  367 ASP A HB3  1 
ATOM   336  N N    . TRP A 1 37  ? -23.429 -22.740 -17.528 1.00 27.07  ?  368 TRP A N    1 
ATOM   337  C CA   . TRP A 1 37  ? -24.606 -21.923 -17.257 1.00 26.74  ?  368 TRP A CA   1 
ATOM   338  C C    . TRP A 1 37  ? -25.901 -22.732 -17.273 1.00 33.39  ?  368 TRP A C    1 
ATOM   339  O O    . TRP A 1 37  ? -26.783 -22.513 -16.445 1.00 28.29  ?  368 TRP A O    1 
ATOM   340  C CB   . TRP A 1 37  ? -24.721 -20.779 -18.266 1.00 28.76  ?  368 TRP A CB   1 
ATOM   341  C CG   . TRP A 1 37  ? -25.972 -19.983 -18.061 1.00 27.83  ?  368 TRP A CG   1 
ATOM   342  C CD1  . TRP A 1 37  ? -27.055 -19.924 -18.889 1.00 30.09  ?  368 TRP A CD1  1 
ATOM   343  C CD2  . TRP A 1 37  ? -26.281 -19.151 -16.934 1.00 26.46  ?  368 TRP A CD2  1 
ATOM   344  N NE1  . TRP A 1 37  ? -28.016 -19.100 -18.352 1.00 29.52  ?  368 TRP A NE1  1 
ATOM   345  C CE2  . TRP A 1 37  ? -27.565 -18.613 -17.154 1.00 28.15  ?  368 TRP A CE2  1 
ATOM   346  C CE3  . TRP A 1 37  ? -25.593 -18.806 -15.767 1.00 25.87  ?  368 TRP A CE3  1 
ATOM   347  C CZ2  . TRP A 1 37  ? -28.175 -17.750 -16.246 1.00 24.85  ?  368 TRP A CZ2  1 
ATOM   348  C CZ3  . TRP A 1 37  ? -26.201 -17.946 -14.867 1.00 25.42  ?  368 TRP A CZ3  1 
ATOM   349  C CH2  . TRP A 1 37  ? -27.477 -17.427 -15.112 1.00 26.10  ?  368 TRP A CH2  1 
ATOM   350  H H    . TRP A 1 37  ? -23.005 -22.523 -18.244 1.00 32.49  ?  368 TRP A H    1 
ATOM   351  H HA   . TRP A 1 37  ? -24.514 -21.531 -16.375 1.00 32.09  ?  368 TRP A HA   1 
ATOM   352  H HB2  . TRP A 1 37  ? -23.962 -20.183 -18.161 1.00 34.51  ?  368 TRP A HB2  1 
ATOM   353  H HB3  . TRP A 1 37  ? -24.738 -21.145 -19.164 1.00 34.51  ?  368 TRP A HB3  1 
ATOM   354  H HD1  . TRP A 1 37  ? -27.133 -20.375 -19.698 1.00 36.11  ?  368 TRP A HD1  1 
ATOM   355  H HE1  . TRP A 1 37  ? -28.776 -18.919 -18.710 1.00 35.43  ?  368 TRP A HE1  1 
ATOM   356  H HE3  . TRP A 1 37  ? -24.745 -19.147 -15.598 1.00 31.04  ?  368 TRP A HE3  1 
ATOM   357  H HZ2  . TRP A 1 37  ? -29.022 -17.401 -16.407 1.00 29.82  ?  368 TRP A HZ2  1 
ATOM   358  H HZ3  . TRP A 1 37  ? -25.753 -17.709 -14.087 1.00 30.50  ?  368 TRP A HZ3  1 
ATOM   359  H HH2  . TRP A 1 37  ? -27.861 -16.851 -14.491 1.00 31.32  ?  368 TRP A HH2  1 
ATOM   360  N N    . ASP A 1 38  ? -26.026 -23.659 -18.216 1.00 31.54  ?  369 ASP A N    1 
ATOM   361  C CA   . ASP A 1 38  ? -27.244 -24.455 -18.313 1.00 32.27  ?  369 ASP A CA   1 
ATOM   362  C C    . ASP A 1 38  ? -27.487 -25.212 -17.012 1.00 28.16  ?  369 ASP A C    1 
ATOM   363  O O    . ASP A 1 38  ? -28.608 -25.245 -16.510 1.00 29.07  ?  369 ASP A O    1 
ATOM   364  C CB   . ASP A 1 38  ? -27.169 -25.431 -19.490 1.00 36.65  ?  369 ASP A CB   1 
ATOM   365  C CG   . ASP A 1 38  ? -27.237 -24.728 -20.835 1.00 58.75  ?  369 ASP A CG   1 
ATOM   366  O OD1  . ASP A 1 38  ? -27.853 -23.643 -20.914 1.00 56.83  ?  369 ASP A OD1  1 
ATOM   367  O OD2  . ASP A 1 38  ? -26.673 -25.262 -21.813 1.00 70.36  ?  369 ASP A OD2  1 
ATOM   368  H H    . ASP A 1 38  ? -25.428 -23.844 -18.806 1.00 37.85  ?  369 ASP A H    1 
ATOM   369  H HA   . ASP A 1 38  ? -27.998 -23.863 -18.461 1.00 38.73  ?  369 ASP A HA   1 
ATOM   370  H HB2  . ASP A 1 38  ? -26.330 -25.916 -19.446 1.00 43.98  ?  369 ASP A HB2  1 
ATOM   371  H HB3  . ASP A 1 38  ? -27.914 -26.049 -19.436 1.00 43.98  ?  369 ASP A HB3  1 
ATOM   372  N N    . ALA A 1 39  ? -26.427 -25.792 -16.458 1.00 29.34  ?  370 ALA A N    1 
ATOM   373  C CA   . ALA A 1 39  ? -26.522 -26.499 -15.185 1.00 29.35  ?  370 ALA A CA   1 
ATOM   374  C C    . ALA A 1 39  ? -26.949 -25.549 -14.073 1.00 25.51  ?  370 ALA A C    1 
ATOM   375  O O    . ALA A 1 39  ? -27.778 -25.893 -13.231 1.00 23.55  ?  370 ALA A O    1 
ATOM   376  C CB   . ALA A 1 39  ? -25.196 -27.150 -14.840 1.00 28.49  ?  370 ALA A CB   1 
ATOM   377  H H    . ALA A 1 39  ? -25.639 -25.791 -16.801 1.00 35.21  ?  370 ALA A H    1 
ATOM   378  H HA   . ALA A 1 39  ? -27.191 -27.197 -15.259 1.00 35.21  ?  370 ALA A HA   1 
ATOM   379  H HB1  . ALA A 1 39  ? -25.283 -27.613 -13.992 1.00 34.18  ?  370 ALA A HB1  1 
ATOM   380  H HB2  . ALA A 1 39  ? -24.963 -27.781 -15.539 1.00 34.18  ?  370 ALA A HB2  1 
ATOM   381  H HB3  . ALA A 1 39  ? -24.514 -26.463 -14.774 1.00 34.18  ?  370 ALA A HB3  1 
ATOM   382  N N    . TYR A 1 40  ? -26.381 -24.348 -14.078 1.00 25.83  ?  371 TYR A N    1 
ATOM   383  C CA   . TYR A 1 40  ? -26.700 -23.347 -13.068 1.00 25.88  ?  371 TYR A CA   1 
ATOM   384  C C    . TYR A 1 40  ? -28.205 -23.112 -13.032 1.00 25.84  ?  371 TYR A C    1 
ATOM   385  O O    . TYR A 1 40  ? -28.806 -23.047 -11.961 1.00 26.37  ?  371 TYR A O    1 
ATOM   386  C CB   . TYR A 1 40  ? -25.952 -22.043 -13.358 1.00 27.21  ?  371 TYR A CB   1 
ATOM   387  C CG   . TYR A 1 40  ? -25.940 -21.031 -12.223 1.00 24.82  ?  371 TYR A CG   1 
ATOM   388  C CD1  . TYR A 1 40  ? -25.014 -21.126 -11.190 1.00 20.59  ?  371 TYR A CD1  1 
ATOM   389  C CD2  . TYR A 1 40  ? -26.837 -19.970 -12.200 1.00 26.40  ?  371 TYR A CD2  1 
ATOM   390  C CE1  . TYR A 1 40  ? -24.989 -20.196 -10.158 1.00 26.22  ?  371 TYR A CE1  1 
ATOM   391  C CE2  . TYR A 1 40  ? -26.818 -19.034 -11.173 1.00 27.73  ?  371 TYR A CE2  1 
ATOM   392  C CZ   . TYR A 1 40  ? -25.892 -19.154 -10.157 1.00 24.32  ?  371 TYR A CZ   1 
ATOM   393  O OH   . TYR A 1 40  ? -25.875 -18.228 -9.135  1.00 29.58  ?  371 TYR A OH   1 
ATOM   394  H H    . TYR A 1 40  ? -25.803 -24.087 -14.660 1.00 31.00  ?  371 TYR A H    1 
ATOM   395  H HA   . TYR A 1 40  ? -26.421 -23.671 -12.197 1.00 31.05  ?  371 TYR A HA   1 
ATOM   396  H HB2  . TYR A 1 40  ? -25.029 -22.258 -13.566 1.00 32.65  ?  371 TYR A HB2  1 
ATOM   397  H HB3  . TYR A 1 40  ? -26.365 -21.616 -14.124 1.00 32.65  ?  371 TYR A HB3  1 
ATOM   398  H HD1  . TYR A 1 40  ? -24.402 -21.826 -11.189 1.00 24.70  ?  371 TYR A HD1  1 
ATOM   399  H HD2  . TYR A 1 40  ? -27.461 -19.884 -12.884 1.00 31.68  ?  371 TYR A HD2  1 
ATOM   400  H HE1  . TYR A 1 40  ? -24.366 -20.276 -9.473  1.00 31.47  ?  371 TYR A HE1  1 
ATOM   401  H HE2  . TYR A 1 40  ? -27.427 -18.332 -11.169 1.00 33.28  ?  371 TYR A HE2  1 
ATOM   402  H HH   . TYR A 1 40  ? -26.474 -17.653 -9.259  1.00 35.49  ?  371 TYR A HH   1 
ATOM   403  N N    . THR A 1 41  ? -28.819 -23.025 -14.209 1.00 22.60  ?  372 THR A N    1 
ATOM   404  C CA   . THR A 1 41  ? -30.238 -22.704 -14.294 1.00 22.81  ?  372 THR A CA   1 
ATOM   405  C C    . THR A 1 41  ? -31.127 -23.877 -13.896 1.00 27.20  ?  372 THR A C    1 
ATOM   406  O O    . THR A 1 41  ? -32.317 -23.691 -13.670 1.00 28.19  ?  372 THR A O    1 
ATOM   407  C CB   . THR A 1 41  ? -30.641 -22.248 -15.712 1.00 32.65  ?  372 THR A CB   1 
ATOM   408  O OG1  . THR A 1 41  ? -30.423 -23.309 -16.649 1.00 29.16  ?  372 THR A OG1  1 
ATOM   409  C CG2  . THR A 1 41  ? -29.845 -21.026 -16.127 1.00 27.60  ?  372 THR A CG2  1 
ATOM   410  H H    . THR A 1 41  ? -28.437 -23.146 -14.970 1.00 27.11  ?  372 THR A H    1 
ATOM   411  H HA   . THR A 1 41  ? -30.426 -21.973 -13.685 1.00 27.38  ?  372 THR A HA   1 
ATOM   412  H HB   . THR A 1 41  ? -31.582 -22.011 -15.714 1.00 39.18  ?  372 THR A HB   1 
ATOM   413  H HG1  . THR A 1 41  ? -29.611 -23.526 -16.654 1.00 35.00  ?  372 THR A HG1  1 
ATOM   414  H HG21 . THR A 1 41  ? -30.106 -20.748 -17.019 1.00 33.12  ?  372 THR A HG21 1 
ATOM   415  H HG22 . THR A 1 41  ? -30.010 -20.298 -15.508 1.00 33.12  ?  372 THR A HG22 1 
ATOM   416  H HG23 . THR A 1 41  ? -28.897 -21.233 -16.126 1.00 33.12  ?  372 THR A HG23 1 
ATOM   417  N N    . THR A 1 42  ? -30.568 -25.081 -13.808 1.00 27.18  ?  373 THR A N    1 
ATOM   418  C CA   . THR A 1 42  ? -31.365 -26.219 -13.352 1.00 26.66  ?  373 THR A CA   1 
ATOM   419  C C    . THR A 1 42  ? -31.475 -26.240 -11.828 1.00 26.72  ?  373 THR A C    1 
ATOM   420  O O    . THR A 1 42  ? -32.250 -27.018 -11.272 1.00 21.82  ?  373 THR A O    1 
ATOM   421  C CB   . THR A 1 42  ? -30.788 -27.575 -13.828 1.00 24.25  ?  373 THR A CB   1 
ATOM   422  O OG1  . THR A 1 42  ? -29.509 -27.811 -13.229 1.00 25.74  ?  373 THR A OG1  1 
ATOM   423  C CG2  . THR A 1 42  ? -30.670 -27.611 -15.348 1.00 30.19  ?  373 THR A CG2  1 
ATOM   424  H H    . THR A 1 42  ? -29.750 -25.265 -14.000 1.00 32.61  ?  373 THR A H    1 
ATOM   425  H HA   . THR A 1 42  ? -32.262 -26.135 -13.713 1.00 31.99  ?  373 THR A HA   1 
ATOM   426  H HB   . THR A 1 42  ? -31.394 -28.284 -13.560 1.00 29.10  ?  373 THR A HB   1 
ATOM   427  H HG1  . THR A 1 42  ? -28.974 -27.200 -13.444 1.00 30.89  ?  373 THR A HG1  1 
ATOM   428  H HG21 . THR A 1 42  ? -30.308 -28.465 -15.632 1.00 36.23  ?  373 THR A HG21 1 
ATOM   429  H HG22 . THR A 1 42  ? -31.544 -27.489 -15.751 1.00 36.23  ?  373 THR A HG22 1 
ATOM   430  H HG23 . THR A 1 42  ? -30.081 -26.902 -15.651 1.00 36.23  ?  373 THR A HG23 1 
ATOM   431  N N    . MET A 1 43  ? -30.711 -25.377 -11.156 1.00 22.22  ?  374 MET A N    1 
ATOM   432  C CA   . MET A 1 43  ? -30.627 -25.413 -9.696  1.00 20.14  ?  374 MET A CA   1 
ATOM   433  C C    . MET A 1 43  ? -30.998 -24.094 -9.016  1.00 21.34  ?  374 MET A C    1 
ATOM   434  O O    . MET A 1 43  ? -31.342 -24.084 -7.835  1.00 22.62  ?  374 MET A O    1 
ATOM   435  C CB   . MET A 1 43  ? -29.209 -25.816 -9.271  1.00 23.79  ?  374 MET A CB   1 
ATOM   436  C CG   . MET A 1 43  ? -28.913 -27.303 -9.443  1.00 20.71  ?  374 MET A CG   1 
ATOM   437  S SD   . MET A 1 43  ? -27.207 -27.720 -9.052  1.00 24.42  ?  374 MET A SD   1 
ATOM   438  C CE   . MET A 1 43  ? -26.370 -27.303 -10.580 1.00 26.97  ?  374 MET A CE   1 
ATOM   439  H H    . MET A 1 43  ? -30.232 -24.763 -11.521 1.00 26.66  ?  374 MET A H    1 
ATOM   440  H HA   . MET A 1 43  ? -31.231 -26.100 -9.374  1.00 24.17  ?  374 MET A HA   1 
ATOM   441  H HB2  . MET A 1 43  ? -28.570 -25.323 -9.808  1.00 28.55  ?  374 MET A HB2  1 
ATOM   442  H HB3  . MET A 1 43  ? -29.090 -25.597 -8.334  1.00 28.55  ?  374 MET A HB3  1 
ATOM   443  H HG2  . MET A 1 43  ? -29.490 -27.811 -8.851  1.00 24.86  ?  374 MET A HG2  1 
ATOM   444  H HG3  . MET A 1 43  ? -29.080 -27.554 -10.365 1.00 24.86  ?  374 MET A HG3  1 
ATOM   445  H HE1  . MET A 1 43  ? -25.423 -27.491 -10.483 1.00 32.37  ?  374 MET A HE1  1 
ATOM   446  H HE2  . MET A 1 43  ? -26.741 -27.837 -11.300 1.00 32.37  ?  374 MET A HE2  1 
ATOM   447  H HE3  . MET A 1 43  ? -26.503 -26.360 -10.766 1.00 32.37  ?  374 MET A HE3  1 
ATOM   448  N N    . VAL A 1 44  ? -30.927 -22.990 -9.752  1.00 21.18  ?  375 VAL A N    1 
ATOM   449  C CA   . VAL A 1 44  ? -31.078 -21.667 -9.151  1.00 20.62  ?  375 VAL A CA   1 
ATOM   450  C C    . VAL A 1 44  ? -32.370 -20.990 -9.588  1.00 29.29  ?  375 VAL A C    1 
ATOM   451  O O    . VAL A 1 44  ? -32.673 -20.904 -10.782 1.00 25.26  ?  375 VAL A O    1 
ATOM   452  C CB   . VAL A 1 44  ? -29.874 -20.772 -9.503  1.00 21.67  ?  375 VAL A CB   1 
ATOM   453  C CG1  . VAL A 1 44  ? -30.031 -19.388 -8.900  1.00 21.05  ?  375 VAL A CG1  1 
ATOM   454  C CG2  . VAL A 1 44  ? -28.588 -21.423 -9.007  1.00 22.86  ?  375 VAL A CG2  1 
ATOM   455  H H    . VAL A 1 44  ? -30.792 -22.978 -10.601 1.00 25.41  ?  375 VAL A H    1 
ATOM   456  H HA   . VAL A 1 44  ? -31.105 -21.763 -8.186  1.00 24.74  ?  375 VAL A HA   1 
ATOM   457  H HB   . VAL A 1 44  ? -29.815 -20.679 -10.466 1.00 26.01  ?  375 VAL A HB   1 
ATOM   458  H HG11 . VAL A 1 44  ? -29.259 -18.851 -9.139  1.00 25.26  ?  375 VAL A HG11 1 
ATOM   459  H HG12 . VAL A 1 44  ? -30.839 -18.981 -9.251  1.00 25.26  ?  375 VAL A HG12 1 
ATOM   460  H HG13 . VAL A 1 44  ? -30.093 -19.469 -7.935  1.00 25.26  ?  375 VAL A HG13 1 
ATOM   461  H HG21 . VAL A 1 44  ? -27.838 -20.852 -9.233  1.00 27.43  ?  375 VAL A HG21 1 
ATOM   462  H HG22 . VAL A 1 44  ? -28.642 -21.534 -8.045  1.00 27.43  ?  375 VAL A HG22 1 
ATOM   463  H HG23 . VAL A 1 44  ? -28.487 -22.288 -9.435  1.00 27.43  ?  375 VAL A HG23 1 
ATOM   464  N N    . ASP A 1 45  ? -33.125 -20.509 -8.605  1.00 20.93  ?  376 ASP A N    1 
ATOM   465  C CA   . ASP A 1 45  ? -34.402 -19.852 -8.862  1.00 23.57  ?  376 ASP A CA   1 
ATOM   466  C C    . ASP A 1 45  ? -34.202 -18.602 -9.712  1.00 25.35  ?  376 ASP A C    1 
ATOM   467  O O    . ASP A 1 45  ? -33.227 -17.875 -9.514  1.00 27.47  ?  376 ASP A O    1 
ATOM   468  C CB   . ASP A 1 45  ? -35.093 -19.482 -7.551  1.00 24.73  ?  376 ASP A CB   1 
ATOM   469  C CG   . ASP A 1 45  ? -36.513 -18.992 -7.763  1.00 31.48  ?  376 ASP A CG   1 
ATOM   470  O OD1  . ASP A 1 45  ? -37.438 -19.828 -7.743  1.00 47.90  ?  376 ASP A OD1  1 
ATOM   471  O OD2  . ASP A 1 45  ? -36.705 -17.776 -7.960  1.00 31.77  -1 376 ASP A OD2  1 
ATOM   472  H H    . ASP A 1 45  ? -32.918 -20.551 -7.771  1.00 25.12  ?  376 ASP A H    1 
ATOM   473  H HA   . ASP A 1 45  ? -34.981 -20.460 -9.348  1.00 28.29  ?  376 ASP A HA   1 
ATOM   474  H HB2  . ASP A 1 45  ? -35.127 -20.264 -6.978  1.00 29.68  ?  376 ASP A HB2  1 
ATOM   475  H HB3  . ASP A 1 45  ? -34.592 -18.773 -7.117  1.00 29.68  ?  376 ASP A HB3  1 
ATOM   476  N N    . PRO A 1 46  ? -35.121 -18.347 -10.664 1.00 23.79  ?  377 PRO A N    1 
ATOM   477  C CA   . PRO A 1 46  ? -34.978 -17.168 -11.528 1.00 27.45  ?  377 PRO A CA   1 
ATOM   478  C C    . PRO A 1 46  ? -34.961 -15.848 -10.762 1.00 27.20  ?  377 PRO A C    1 
ATOM   479  O O    . PRO A 1 46  ? -34.447 -14.857 -11.279 1.00 31.27  ?  377 PRO A O    1 
ATOM   480  C CB   . PRO A 1 46  ? -36.211 -17.244 -12.434 1.00 31.26  ?  377 PRO A CB   1 
ATOM   481  C CG   . PRO A 1 46  ? -36.582 -18.677 -12.451 1.00 30.83  ?  377 PRO A CG   1 
ATOM   482  C CD   . PRO A 1 46  ? -36.243 -19.206 -11.092 1.00 27.02  ?  377 PRO A CD   1 
ATOM   483  H HA   . PRO A 1 46  ? -34.175 -17.239 -12.069 1.00 32.94  ?  377 PRO A HA   1 
ATOM   484  H HB2  . PRO A 1 46  ? -36.927 -16.708 -12.059 1.00 37.51  ?  377 PRO A HB2  1 
ATOM   485  H HB3  . PRO A 1 46  ? -35.982 -16.938 -13.325 1.00 37.51  ?  377 PRO A HB3  1 
ATOM   486  H HG2  . PRO A 1 46  ? -37.532 -18.764 -12.623 1.00 37.00  ?  377 PRO A HG2  1 
ATOM   487  H HG3  . PRO A 1 46  ? -36.068 -19.137 -13.133 1.00 37.00  ?  377 PRO A HG3  1 
ATOM   488  H HD2  . PRO A 1 46  ? -36.997 -19.102 -10.491 1.00 32.42  ?  377 PRO A HD2  1 
ATOM   489  H HD3  . PRO A 1 46  ? -35.959 -20.131 -11.150 1.00 32.42  ?  377 PRO A HD3  1 
ATOM   490  N N    . ASN A 1 47  ? -35.520 -15.844 -9.555  1.00 24.24  ?  378 ASN A N    1 
ATOM   491  C CA   . ASN A 1 47  ? -35.581 -14.647 -8.725  1.00 26.78  ?  378 ASN A CA   1 
ATOM   492  C C    . ASN A 1 47  ? -34.646 -14.744 -7.522  1.00 27.14  ?  378 ASN A C    1 
ATOM   493  O O    . ASN A 1 47  ? -34.885 -14.129 -6.479  1.00 25.77  ?  378 ASN A O    1 
ATOM   494  C CB   . ASN A 1 47  ? -37.016 -14.413 -8.260  1.00 29.31  ?  378 ASN A CB   1 
ATOM   495  C CG   . ASN A 1 47  ? -37.948 -14.098 -9.410  1.00 40.76  ?  378 ASN A CG   1 
ATOM   496  O OD1  . ASN A 1 47  ? -37.657 -13.230 -10.235 1.00 35.97  ?  378 ASN A OD1  1 
ATOM   497  N ND2  . ASN A 1 47  ? -39.063 -14.814 -9.484  1.00 51.41  ?  378 ASN A ND2  1 
ATOM   498  H H    . ASN A 1 47  ? -35.876 -16.536 -9.190  1.00 29.09  ?  378 ASN A H    1 
ATOM   499  H HA   . ASN A 1 47  ? -35.310 -13.881 -9.254  1.00 32.14  ?  378 ASN A HA   1 
ATOM   500  H HB2  . ASN A 1 47  ? -37.341 -15.214 -7.819  1.00 35.18  ?  378 ASN A HB2  1 
ATOM   501  H HB3  . ASN A 1 47  ? -37.032 -13.664 -7.644  1.00 35.18  ?  378 ASN A HB3  1 
ATOM   502  H HD21 . ASN A 1 47  ? -39.624 -14.671 -10.120 1.00 61.70  ?  378 ASN A HD21 1 
ATOM   503  H HD22 . ASN A 1 47  ? -39.224 -15.421 -8.897  1.00 61.70  ?  378 ASN A HD22 1 
ATOM   504  N N    . VAL A 1 48  ? -33.583 -15.525 -7.678  1.00 25.49  ?  379 VAL A N    1 
ATOM   505  C CA   . VAL A 1 48  ? -32.579 -15.675 -6.634  1.00 18.43  ?  379 VAL A CA   1 
ATOM   506  C C    . VAL A 1 48  ? -32.054 -14.308 -6.206  1.00 22.04  ?  379 VAL A C    1 
ATOM   507  O O    . VAL A 1 48  ? -31.879 -13.420 -7.041  1.00 23.11  ?  379 VAL A O    1 
ATOM   508  C CB   . VAL A 1 48  ? -31.398 -16.559 -7.114  1.00 21.11  ?  379 VAL A CB   1 
ATOM   509  C CG1  . VAL A 1 48  ? -30.704 -15.938 -8.316  1.00 23.81  ?  379 VAL A CG1  1 
ATOM   510  C CG2  . VAL A 1 48  ? -30.408 -16.801 -5.981  1.00 23.04  ?  379 VAL A CG2  1 
ATOM   511  H H    . VAL A 1 48  ? -33.419 -15.982 -8.387  1.00 30.59  ?  379 VAL A H    1 
ATOM   512  H HA   . VAL A 1 48  ? -32.983 -16.101 -5.862  1.00 22.11  ?  379 VAL A HA   1 
ATOM   513  H HB   . VAL A 1 48  ? -31.747 -17.422 -7.388  1.00 25.34  ?  379 VAL A HB   1 
ATOM   514  H HG11 . VAL A 1 48  ? -29.973 -16.513 -8.590  1.00 28.58  ?  379 VAL A HG11 1 
ATOM   515  H HG12 . VAL A 1 48  ? -31.345 -15.849 -9.039  1.00 28.58  ?  379 VAL A HG12 1 
ATOM   516  H HG13 . VAL A 1 48  ? -30.363 -15.065 -8.067  1.00 28.58  ?  379 VAL A HG13 1 
ATOM   517  H HG21 . VAL A 1 48  ? -29.682 -17.355 -6.309  1.00 27.65  ?  379 VAL A HG21 1 
ATOM   518  H HG22 . VAL A 1 48  ? -30.061 -15.947 -5.677  1.00 27.65  ?  379 VAL A HG22 1 
ATOM   519  H HG23 . VAL A 1 48  ? -30.865 -17.250 -5.253  1.00 27.65  ?  379 VAL A HG23 1 
ATOM   520  N N    . THR A 1 49  ? -31.823 -14.140 -4.905  1.00 18.56  ?  380 THR A N    1 
ATOM   521  C CA   . THR A 1 49  ? -31.172 -12.935 -4.395  1.00 19.52  ?  380 THR A CA   1 
ATOM   522  C C    . THR A 1 49  ? -29.851 -13.312 -3.749  1.00 18.00  ?  380 THR A C    1 
ATOM   523  O O    . THR A 1 49  ? -29.654 -14.455 -3.350  1.00 18.76  ?  380 THR A O    1 
ATOM   524  C CB   . THR A 1 49  ? -32.037 -12.189 -3.362  1.00 19.55  ?  380 THR A CB   1 
ATOM   525  O OG1  . THR A 1 49  ? -32.326 -13.056 -2.255  1.00 20.78  ?  380 THR A OG1  1 
ATOM   526  C CG2  . THR A 1 49  ? -33.334 -11.703 -3.999  1.00 25.02  ?  380 THR A CG2  1 
ATOM   527  H H    . THR A 1 49  ? -32.035 -14.709 -4.296  1.00 22.27  ?  380 THR A H    1 
ATOM   528  H HA   . THR A 1 49  ? -30.991 -12.331 -5.132  1.00 23.43  ?  380 THR A HA   1 
ATOM   529  H HB   . THR A 1 49  ? -31.550 -11.414 -3.040  1.00 23.46  ?  380 THR A HB   1 
ATOM   530  H HG1  . THR A 1 49  ? -32.797 -12.652 -1.689  1.00 24.94  ?  380 THR A HG1  1 
ATOM   531  H HG21 . THR A 1 49  ? -33.871 -11.235 -3.340  1.00 30.02  ?  380 THR A HG21 1 
ATOM   532  H HG22 . THR A 1 49  ? -33.138 -11.099 -4.732  1.00 30.02  ?  380 THR A HG22 1 
ATOM   533  H HG23 . THR A 1 49  ? -33.840 -12.458 -4.339  1.00 30.02  ?  380 THR A HG23 1 
ATOM   534  N N    . CYS A 1 50  ? -28.930 -12.363 -3.638  1.00 18.32  ?  381 CYS A N    1 
ATOM   535  C CA   . CYS A 1 50  ? -27.695 -12.680 -2.949  1.00 19.24  ?  381 CYS A CA   1 
ATOM   536  C C    . CYS A 1 50  ? -26.909 -11.474 -2.466  1.00 19.23  ?  381 CYS A C    1 
ATOM   537  O O    . CYS A 1 50  ? -27.005 -10.377 -3.021  1.00 19.45  ?  381 CYS A O    1 
ATOM   538  C CB   . CYS A 1 50  ? -26.803 -13.530 -3.855  1.00 23.58  ?  381 CYS A CB   1 
ATOM   539  S SG   . CYS A 1 50  ? -26.077 -12.640 -5.241  1.00 24.43  ?  381 CYS A SG   1 
ATOM   540  H H    . CYS A 1 50  ? -28.993 -11.560 -3.940  1.00 21.99  ?  381 CYS A H    1 
ATOM   541  H HA   . CYS A 1 50  ? -27.910 -13.215 -2.169  1.00 23.09  ?  381 CYS A HA   1 
ATOM   542  H HB2  . CYS A 1 50  ? -26.075 -13.890 -3.324  1.00 28.29  ?  381 CYS A HB2  1 
ATOM   543  H HB3  . CYS A 1 50  ? -27.333 -14.257 -4.218  1.00 28.29  ?  381 CYS A HB3  1 
ATOM   544  H HG   . CYS A 1 50  ? -25.400 -11.744 -4.818  1.00 29.32  ?  381 CYS A HG   1 
ATOM   545  N N    . PHE A 1 51  ? -26.163 -11.707 -1.390  1.00 17.66  ?  382 PHE A N    1 
ATOM   546  C CA   . PHE A 1 51  ? -25.059 -10.849 -0.980  1.00 16.37  ?  382 PHE A CA   1 
ATOM   547  C C    . PHE A 1 51  ? -23.778 -11.590 -1.336  1.00 22.34  ?  382 PHE A C    1 
ATOM   548  O O    . PHE A 1 51  ? -23.603 -12.738 -0.934  1.00 18.16  ?  382 PHE A O    1 
ATOM   549  C CB   . PHE A 1 51  ? -25.075 -10.560 0.525   1.00 16.31  ?  382 PHE A CB   1 
ATOM   550  C CG   . PHE A 1 51  ? -26.155 -9.612  0.979   1.00 16.54  ?  382 PHE A CG   1 
ATOM   551  C CD1  . PHE A 1 51  ? -26.211 -8.314  0.500   1.00 16.70  ?  382 PHE A CD1  1 
ATOM   552  C CD2  . PHE A 1 51  ? -27.079 -10.007 1.934   1.00 16.30  ?  382 PHE A CD2  1 
ATOM   553  C CE1  . PHE A 1 51  ? -27.182 -7.435  0.942   1.00 19.88  ?  382 PHE A CE1  1 
ATOM   554  C CE2  . PHE A 1 51  ? -28.052 -9.132  2.381   1.00 18.32  ?  382 PHE A CE2  1 
ATOM   555  C CZ   . PHE A 1 51  ? -28.105 -7.848  1.883   1.00 18.44  ?  382 PHE A CZ   1 
ATOM   556  H H    . PHE A 1 51  ? -26.283 -12.379 -0.866  1.00 21.19  ?  382 PHE A H    1 
ATOM   557  H HA   . PHE A 1 51  ? -25.087 -10.011 -1.466  1.00 19.65  ?  382 PHE A HA   1 
ATOM   558  H HB2  . PHE A 1 51  ? -25.203 -11.397 0.998   1.00 19.57  ?  382 PHE A HB2  1 
ATOM   559  H HB3  . PHE A 1 51  ? -24.222 -10.172 0.774   1.00 19.57  ?  382 PHE A HB3  1 
ATOM   560  H HD1  . PHE A 1 51  ? -25.591 -8.031  -0.133  1.00 20.04  ?  382 PHE A HD1  1 
ATOM   561  H HD2  . PHE A 1 51  ? -27.047 -10.872 2.275   1.00 19.56  ?  382 PHE A HD2  1 
ATOM   562  H HE1  . PHE A 1 51  ? -27.216 -6.570  0.604   1.00 23.86  ?  382 PHE A HE1  1 
ATOM   563  H HE2  . PHE A 1 51  ? -28.674 -9.412  3.013   1.00 21.99  ?  382 PHE A HE2  1 
ATOM   564  H HZ   . PHE A 1 51  ? -28.762 -7.260  2.179   1.00 22.12  ?  382 PHE A HZ   1 
ATOM   565  N N    . GLU A 1 52  ? -22.885 -10.952 -2.083  1.00 17.94  ?  383 GLU A N    1 
ATOM   566  C CA   . GLU A 1 52  ? -21.593 -11.556 -2.397  1.00 16.24  ?  383 GLU A CA   1 
ATOM   567  C C    . GLU A 1 52  ? -20.617 -10.449 -2.771  1.00 20.31  ?  383 GLU A C    1 
ATOM   568  O O    . GLU A 1 52  ? -21.041 -9.348  -3.116  1.00 20.73  ?  383 GLU A O    1 
ATOM   569  C CB   . GLU A 1 52  ? -21.721 -12.579 -3.530  1.00 20.67  ?  383 GLU A CB   1 
ATOM   570  C CG   . GLU A 1 52  ? -22.160 -11.985 -4.862  1.00 23.45  ?  383 GLU A CG   1 
ATOM   571  C CD   . GLU A 1 52  ? -22.125 -12.987 -6.001  1.00 31.80  ?  383 GLU A CD   1 
ATOM   572  O OE1  . GLU A 1 52  ? -22.343 -12.574 -7.159  1.00 29.03  ?  383 GLU A OE1  1 
ATOM   573  O OE2  . GLU A 1 52  ? -21.874 -14.183 -5.745  1.00 34.61  -1 383 GLU A OE2  1 
ATOM   574  H H    . GLU A 1 52  ? -23.001 -10.170 -2.421  1.00 21.52  ?  383 GLU A H    1 
ATOM   575  H HA   . GLU A 1 52  ? -21.252 -12.011 -1.611  1.00 19.49  ?  383 GLU A HA   1 
ATOM   576  H HB2  . GLU A 1 52  ? -20.860 -13.003 -3.665  1.00 24.80  ?  383 GLU A HB2  1 
ATOM   577  H HB3  . GLU A 1 52  ? -22.378 -13.246 -3.274  1.00 24.80  ?  383 GLU A HB3  1 
ATOM   578  H HG2  . GLU A 1 52  ? -23.070 -11.660 -4.778  1.00 28.14  ?  383 GLU A HG2  1 
ATOM   579  H HG3  . GLU A 1 52  ? -21.567 -11.253 -5.091  1.00 28.14  ?  383 GLU A HG3  1 
ATOM   580  N N    . PRO A 1 53  ? -19.307 -10.725 -2.682  1.00 21.16  ?  384 PRO A N    1 
ATOM   581  C CA   . PRO A 1 53  ? -18.318 -9.690  -3.010  1.00 28.31  ?  384 PRO A CA   1 
ATOM   582  C C    . PRO A 1 53  ? -18.565 -9.040  -4.373  1.00 27.00  ?  384 PRO A C    1 
ATOM   583  O O    . PRO A 1 53  ? -18.418 -7.824  -4.508  1.00 28.69  ?  384 PRO A O    1 
ATOM   584  C CB   . PRO A 1 53  ? -16.997 -10.458 -2.997  1.00 26.83  ?  384 PRO A CB   1 
ATOM   585  C CG   . PRO A 1 53  ? -17.224 -11.558 -2.020  1.00 27.98  ?  384 PRO A CG   1 
ATOM   586  C CD   . PRO A 1 53  ? -18.672 -11.952 -2.170  1.00 21.72  ?  384 PRO A CD   1 
ATOM   587  H HA   . PRO A 1 53  ? -18.301 -9.005  -2.323  1.00 33.97  ?  384 PRO A HA   1 
ATOM   588  H HB2  . PRO A 1 53  ? -16.814 -10.813 -3.881  1.00 32.19  ?  384 PRO A HB2  1 
ATOM   589  H HB3  . PRO A 1 53  ? -16.280 -9.876  -2.702  1.00 32.19  ?  384 PRO A HB3  1 
ATOM   590  H HG2  . PRO A 1 53  ? -16.644 -12.306 -2.232  1.00 33.58  ?  384 PRO A HG2  1 
ATOM   591  H HG3  . PRO A 1 53  ? -17.050 -11.236 -1.122  1.00 33.58  ?  384 PRO A HG3  1 
ATOM   592  H HD2  . PRO A 1 53  ? -18.761 -12.672 -2.813  1.00 26.06  ?  384 PRO A HD2  1 
ATOM   593  H HD3  . PRO A 1 53  ? -19.048 -12.193 -1.309  1.00 26.06  ?  384 PRO A HD3  1 
ATOM   594  N N    . GLU A 1 54  ? -18.972 -9.841  -5.353  1.00 26.23  ?  385 GLU A N    1 
ATOM   595  C CA   . GLU A 1 54  ? -19.191 -9.353  -6.713  1.00 29.02  ?  385 GLU A CA   1 
ATOM   596  C C    . GLU A 1 54  ? -20.398 -8.422  -6.851  1.00 29.23  ?  385 GLU A C    1 
ATOM   597  O O    . GLU A 1 54  ? -20.596 -7.813  -7.904  1.00 32.63  ?  385 GLU A O    1 
ATOM   598  C CB   . GLU A 1 54  ? -19.371 -10.532 -7.670  1.00 31.96  ?  385 GLU A CB   1 
ATOM   599  C CG   . GLU A 1 54  ? -18.129 -11.390 -7.868  1.00 37.80  ?  385 GLU A CG   1 
ATOM   600  C CD   . GLU A 1 54  ? -17.939 -12.441 -6.787  1.00 45.76  ?  385 GLU A CD   1 
ATOM   601  O OE1  . GLU A 1 54  ? -18.697 -12.439 -5.794  1.00 31.30  ?  385 GLU A OE1  1 
ATOM   602  O OE2  . GLU A 1 54  ? -17.026 -13.280 -6.938  1.00 51.74  -1 385 GLU A OE2  1 
ATOM   603  H H    . GLU A 1 54  ? -19.131 -10.681 -5.256  1.00 31.48  ?  385 GLU A H    1 
ATOM   604  H HA   . GLU A 1 54  ? -18.405 -8.860  -6.996  1.00 34.83  ?  385 GLU A HA   1 
ATOM   605  H HB2  . GLU A 1 54  ? -20.072 -11.106 -7.325  1.00 38.35  ?  385 GLU A HB2  1 
ATOM   606  H HB3  . GLU A 1 54  ? -19.631 -10.187 -8.539  1.00 38.35  ?  385 GLU A HB3  1 
ATOM   607  H HG2  . GLU A 1 54  ? -18.197 -11.848 -8.720  1.00 45.37  ?  385 GLU A HG2  1 
ATOM   608  H HG3  . GLU A 1 54  ? -17.347 -10.815 -7.864  1.00 45.37  ?  385 GLU A HG3  1 
ATOM   609  N N    . ALA A 1 55  ? -21.207 -8.317  -5.802  1.00 25.47  ?  386 ALA A N    1 
ATOM   610  C CA   . ALA A 1 55  ? -22.458 -7.566  -5.883  1.00 23.63  ?  386 ALA A CA   1 
ATOM   611  C C    . ALA A 1 55  ? -22.310 -6.133  -5.368  1.00 25.73  ?  386 ALA A C    1 
ATOM   612  O O    . ALA A 1 55  ? -23.295 -5.405  -5.257  1.00 24.12  ?  386 ALA A O    1 
ATOM   613  C CB   . ALA A 1 55  ? -23.552 -8.293  -5.119  1.00 28.81  ?  386 ALA A CB   1 
ATOM   614  H H    . ALA A 1 55  ? -21.056 -8.669  -5.033  1.00 30.56  ?  386 ALA A H    1 
ATOM   615  H HA   . ALA A 1 55  ? -22.731 -7.518  -6.813  1.00 28.36  ?  386 ALA A HA   1 
ATOM   616  H HB1  . ALA A 1 55  ? -24.374 -7.782  -5.183  1.00 34.57  ?  386 ALA A HB1  1 
ATOM   617  H HB2  . ALA A 1 55  ? -23.677 -9.173  -5.507  1.00 34.57  ?  386 ALA A HB2  1 
ATOM   618  H HB3  . ALA A 1 55  ? -23.285 -8.376  -4.190  1.00 34.57  ?  386 ALA A HB3  1 
ATOM   619  N N    . ALA A 1 56  ? -21.078 -5.739  -5.059  1.00 20.45  ?  387 ALA A N    1 
ATOM   620  C CA   . ALA A 1 56  ? -20.754 -4.351  -4.726  1.00 23.93  ?  387 ALA A CA   1 
ATOM   621  C C    . ALA A 1 56  ? -21.535 -3.808  -3.528  1.00 22.61  ?  387 ALA A C    1 
ATOM   622  O O    . ALA A 1 56  ? -21.929 -2.639  -3.512  1.00 24.21  ?  387 ALA A O    1 
ATOM   623  C CB   . ALA A 1 56  ? -20.984 -3.466  -5.942  1.00 25.00  ?  387 ALA A CB   1 
ATOM   624  H H    . ALA A 1 56  ? -20.398 -6.265  -5.034  1.00 24.54  ?  387 ALA A H    1 
ATOM   625  H HA   . ALA A 1 56  ? -19.811 -4.301  -4.504  1.00 28.72  ?  387 ALA A HA   1 
ATOM   626  H HB1  . ALA A 1 56  ? -20.767 -2.549  -5.711  1.00 30.00  ?  387 ALA A HB1  1 
ATOM   627  H HB2  . ALA A 1 56  ? -20.413 -3.769  -6.666  1.00 30.00  ?  387 ALA A HB2  1 
ATOM   628  H HB3  . ALA A 1 56  ? -21.915 -3.529  -6.207  1.00 30.00  ?  387 ALA A HB3  1 
ATOM   629  N N    . GLY A 1 57  ? -21.760 -4.656  -2.531  1.00 25.11  ?  388 GLY A N    1 
ATOM   630  C CA   . GLY A 1 57  ? -22.251 -4.202  -1.242  1.00 25.19  ?  388 GLY A CA   1 
ATOM   631  C C    . GLY A 1 57  ? -23.758 -4.146  -1.074  1.00 30.74  ?  388 GLY A C    1 
ATOM   632  O O    . GLY A 1 57  ? -24.238 -3.820  0.011   1.00 30.95  ?  388 GLY A O    1 
ATOM   633  H H    . GLY A 1 57  ? -21.633 -5.506  -2.579  1.00 30.13  ?  388 GLY A H    1 
ATOM   634  H HA2  . GLY A 1 57  ? -21.901 -4.789  -0.554  1.00 30.23  ?  388 GLY A HA2  1 
ATOM   635  H HA3  . GLY A 1 57  ? -21.904 -3.312  -1.075  1.00 30.23  ?  388 GLY A HA3  1 
ATOM   636  N N    . VAL A 1 58  ? -24.503 -4.453  -2.131  1.00 25.00  ?  389 VAL A N    1 
ATOM   637  C CA   . VAL A 1 58  ? -25.961 -4.458  -2.052  1.00 21.85  ?  389 VAL A CA   1 
ATOM   638  C C    . VAL A 1 58  ? -26.524 -5.781  -2.557  1.00 24.61  ?  389 VAL A C    1 
ATOM   639  O O    . VAL A 1 58  ? -25.828 -6.566  -3.201  1.00 25.47  ?  389 VAL A O    1 
ATOM   640  C CB   . VAL A 1 58  ? -26.582 -3.296  -2.853  1.00 32.68  ?  389 VAL A CB   1 
ATOM   641  C CG1  . VAL A 1 58  ? -25.972 -1.970  -2.421  1.00 47.54  ?  389 VAL A CG1  1 
ATOM   642  C CG2  . VAL A 1 58  ? -26.396 -3.501  -4.341  1.00 34.89  ?  389 VAL A CG2  1 
ATOM   643  H H    . VAL A 1 58  ? -24.191 -4.661  -2.905  1.00 30.00  ?  389 VAL A H    1 
ATOM   644  H HA   . VAL A 1 58  ? -26.226 -4.355  -1.124  1.00 26.22  ?  389 VAL A HA   1 
ATOM   645  H HB   . VAL A 1 58  ? -27.535 -3.261  -2.672  1.00 39.22  ?  389 VAL A HB   1 
ATOM   646  H HG11 . VAL A 1 58  ? -26.375 -1.254  -2.937  1.00 57.05  ?  389 VAL A HG11 1 
ATOM   647  H HG12 . VAL A 1 58  ? -26.145 -1.836  -1.476  1.00 57.05  ?  389 VAL A HG12 1 
ATOM   648  H HG13 . VAL A 1 58  ? -25.015 -1.995  -2.582  1.00 57.05  ?  389 VAL A HG13 1 
ATOM   649  H HG21 . VAL A 1 58  ? -26.796 -2.755  -4.815  1.00 41.87  ?  389 VAL A HG21 1 
ATOM   650  H HG22 . VAL A 1 58  ? -25.447 -3.547  -4.537  1.00 41.87  ?  389 VAL A HG22 1 
ATOM   651  H HG23 . VAL A 1 58  ? -26.828 -4.330  -4.602  1.00 41.87  ?  389 VAL A HG23 1 
ATOM   652  N N    . LEU A 1 59  ? -27.794 -6.021  -2.257  1.00 21.69  ?  390 LEU A N    1 
ATOM   653  C CA   . LEU A 1 59  ? -28.445 -7.262  -2.644  1.00 19.84  ?  390 LEU A CA   1 
ATOM   654  C C    . LEU A 1 59  ? -28.671 -7.317  -4.147  1.00 27.62  ?  390 LEU A C    1 
ATOM   655  O O    . LEU A 1 59  ? -29.366 -6.466  -4.706  1.00 31.06  ?  390 LEU A O    1 
ATOM   656  C CB   . LEU A 1 59  ? -29.783 -7.404  -1.918  1.00 25.19  ?  390 LEU A CB   1 
ATOM   657  C CG   . LEU A 1 59  ? -30.430 -8.779  -2.016  1.00 22.83  ?  390 LEU A CG   1 
ATOM   658  C CD1  . LEU A 1 59  ? -29.755 -9.738  -1.057  1.00 18.92  ?  390 LEU A CD1  1 
ATOM   659  C CD2  . LEU A 1 59  ? -31.927 -8.686  -1.742  1.00 30.19  ?  390 LEU A CD2  1 
ATOM   660  H H    . LEU A 1 59  ? -28.303 -5.477  -1.827  1.00 26.02  ?  390 LEU A H    1 
ATOM   661  H HA   . LEU A 1 59  ? -27.882 -8.011  -2.394  1.00 23.81  ?  390 LEU A HA   1 
ATOM   662  H HB2  . LEU A 1 59  ? -29.644 -7.213  -0.977  1.00 30.23  ?  390 LEU A HB2  1 
ATOM   663  H HB3  . LEU A 1 59  ? -30.406 -6.761  -2.291  1.00 30.23  ?  390 LEU A HB3  1 
ATOM   664  H HG   . LEU A 1 59  ? -30.311 -9.121  -2.916  1.00 27.39  ?  390 LEU A HG   1 
ATOM   665  H HD11 . LEU A 1 59  ? -30.178 -10.608 -1.131  1.00 22.70  ?  390 LEU A HD11 1 
ATOM   666  H HD12 . LEU A 1 59  ? -28.815 -9.806  -1.288  1.00 22.70  ?  390 LEU A HD12 1 
ATOM   667  H HD13 . LEU A 1 59  ? -29.850 -9.399  -0.153  1.00 22.70  ?  390 LEU A HD13 1 
ATOM   668  H HD21 . LEU A 1 59  ? -32.315 -9.572  -1.810  1.00 36.23  ?  390 LEU A HD21 1 
ATOM   669  H HD22 . LEU A 1 59  ? -32.063 -8.333  -0.849  1.00 36.23  ?  390 LEU A HD22 1 
ATOM   670  H HD23 . LEU A 1 59  ? -32.331 -8.096  -2.397  1.00 36.23  ?  390 LEU A HD23 1 
ATOM   671  N N    . ALA A 1 60  ? -28.084 -8.318  -4.796  1.00 19.62  ?  391 ALA A N    1 
ATOM   672  C CA   . ALA A 1 60  ? -28.307 -8.554  -6.220  1.00 21.74  ?  391 ALA A CA   1 
ATOM   673  C C    . ALA A 1 60  ? -29.482 -9.507  -6.408  1.00 26.23  ?  391 ALA A C    1 
ATOM   674  O O    . ALA A 1 60  ? -29.703 -10.388 -5.584  1.00 22.21  ?  391 ALA A O    1 
ATOM   675  C CB   . ALA A 1 60  ? -27.052 -9.120  -6.868  1.00 23.26  ?  391 ALA A CB   1 
ATOM   676  H H    . ALA A 1 60  ? -27.547 -8.881  -4.431  1.00 23.54  ?  391 ALA A H    1 
ATOM   677  H HA   . ALA A 1 60  ? -28.522 -7.715  -6.655  1.00 26.09  ?  391 ALA A HA   1 
ATOM   678  H HB1  . ALA A 1 60  ? -27.223 -9.268  -7.811  1.00 27.91  ?  391 ALA A HB1  1 
ATOM   679  H HB2  . ALA A 1 60  ? -26.327 -8.485  -6.759  1.00 27.91  ?  391 ALA A HB2  1 
ATOM   680  H HB3  . ALA A 1 60  ? -26.825 -9.959  -6.437  1.00 27.91  ?  391 ALA A HB3  1 
ATOM   681  N N    . LYS A 1 61  ? -30.235 -9.335  -7.490  1.00 23.80  ?  392 LYS A N    1 
ATOM   682  C CA   . LYS A 1 61  ? -31.411 -10.170 -7.730  1.00 23.46  ?  392 LYS A CA   1 
ATOM   683  C C    . LYS A 1 61  ? -31.488 -10.622 -9.178  1.00 25.59  ?  392 LYS A C    1 
ATOM   684  O O    . LYS A 1 61  ? -31.190 -9.854  -10.092 1.00 26.99  ?  392 LYS A O    1 
ATOM   685  C CB   . LYS A 1 61  ? -32.699 -9.428  -7.385  1.00 32.31  ?  392 LYS A CB   1 
ATOM   686  C CG   . LYS A 1 61  ? -32.639 -8.499  -6.193  1.00 41.93  ?  392 LYS A CG   1 
ATOM   687  C CD   . LYS A 1 61  ? -33.517 -7.318  -6.494  1.00 53.89  ?  392 LYS A CD   1 
ATOM   688  C CE   . LYS A 1 61  ? -33.557 -6.300  -5.394  1.00 57.05  ?  392 LYS A CE   1 
ATOM   689  N NZ   . LYS A 1 61  ? -34.583 -5.299  -5.787  1.00 70.12  ?  392 LYS A NZ   1 
ATOM   690  H H    . LYS A 1 61  ? -30.089 -8.745  -8.099  1.00 28.57  ?  392 LYS A H    1 
ATOM   691  H HA   . LYS A 1 61  ? -31.359 -10.960 -7.170  1.00 28.16  ?  392 LYS A HA   1 
ATOM   692  H HB2  . LYS A 1 61  ? -32.958 -8.895  -8.153  1.00 38.77  ?  392 LYS A HB2  1 
ATOM   693  H HB3  . LYS A 1 61  ? -33.389 -10.085 -7.203  1.00 38.77  ?  392 LYS A HB3  1 
ATOM   694  H HG2  . LYS A 1 61  ? -32.976 -8.950  -5.403  1.00 50.32  ?  392 LYS A HG2  1 
ATOM   695  H HG3  . LYS A 1 61  ? -31.730 -8.191  -6.058  1.00 50.32  ?  392 LYS A HG3  1 
ATOM   696  H HD2  . LYS A 1 61  ? -33.187 -6.879  -7.293  1.00 64.67  ?  392 LYS A HD2  1 
ATOM   697  H HD3  . LYS A 1 61  ? -34.423 -7.632  -6.641  1.00 64.67  ?  392 LYS A HD3  1 
ATOM   698  H HE2  . LYS A 1 61  ? -33.821 -6.718  -4.559  1.00 68.45  ?  392 LYS A HE2  1 
ATOM   699  H HE3  . LYS A 1 61  ? -32.696 -5.861  -5.311  1.00 68.45  ?  392 LYS A HE3  1 
ATOM   700  H HZ1  . LYS A 1 61  ? -34.646 -4.667  -5.163  1.00 84.14  ?  392 LYS A HZ1  1 
ATOM   701  H HZ2  . LYS A 1 61  ? -34.357 -4.920  -6.560  1.00 84.14  ?  392 LYS A HZ2  1 
ATOM   702  H HZ3  . LYS A 1 61  ? -35.374 -5.695  -5.880  1.00 84.14  ?  392 LYS A HZ3  1 
ATOM   703  N N    . GLY A 1 62  ? -31.904 -11.868 -9.377  1.00 25.38  ?  393 GLY A N    1 
ATOM   704  C CA   . GLY A 1 62  ? -32.132 -12.396 -10.710 1.00 25.78  ?  393 GLY A CA   1 
ATOM   705  C C    . GLY A 1 62  ? -30.936 -13.102 -11.312 1.00 29.13  ?  393 GLY A C    1 
ATOM   706  O O    . GLY A 1 62  ? -29.798 -12.905 -10.888 1.00 26.04  ?  393 GLY A O    1 
ATOM   707  H H    . GLY A 1 62  ? -32.063 -12.431 -8.747  1.00 30.45  ?  393 GLY A H    1 
ATOM   708  H HA2  . GLY A 1 62  ? -32.870 -13.026 -10.679 1.00 30.93  ?  393 GLY A HA2  1 
ATOM   709  H HA3  . GLY A 1 62  ? -32.381 -11.669 -11.301 1.00 30.93  ?  393 GLY A HA3  1 
ATOM   710  N N    . LEU A 1 63  ? -31.205 -13.924 -12.320 1.00 27.70  ?  394 LEU A N    1 
ATOM   711  C CA   . LEU A 1 63  ? -30.176 -14.733 -12.955 1.00 22.85  ?  394 LEU A CA   1 
ATOM   712  C C    . LEU A 1 63  ? -29.272 -13.932 -13.879 1.00 26.28  ?  394 LEU A C    1 
ATOM   713  O O    . LEU A 1 63  ? -28.105 -14.280 -14.056 1.00 28.08  ?  394 LEU A O    1 
ATOM   714  C CB   . LEU A 1 63  ? -30.823 -15.872 -13.744 1.00 25.74  ?  394 LEU A CB   1 
ATOM   715  C CG   . LEU A 1 63  ? -31.410 -17.007 -12.907 1.00 30.32  ?  394 LEU A CG   1 
ATOM   716  C CD1  . LEU A 1 63  ? -32.156 -17.977 -13.803 1.00 38.95  ?  394 LEU A CD1  1 
ATOM   717  C CD2  . LEU A 1 63  ? -30.320 -17.731 -12.130 1.00 34.62  ?  394 LEU A CD2  1 
ATOM   718  H H    . LEU A 1 63  ? -31.989 -14.031 -12.659 1.00 33.24  ?  394 LEU A H    1 
ATOM   719  H HA   . LEU A 1 63  ? -29.620 -15.128 -12.265 1.00 27.42  ?  394 LEU A HA   1 
ATOM   720  H HB2  . LEU A 1 63  ? -31.544 -15.503 -14.279 1.00 30.88  ?  394 LEU A HB2  1 
ATOM   721  H HB3  . LEU A 1 63  ? -30.153 -16.259 -14.329 1.00 30.88  ?  394 LEU A HB3  1 
ATOM   722  H HG   . LEU A 1 63  ? -32.042 -16.638 -12.269 1.00 36.39  ?  394 LEU A HG   1 
ATOM   723  H HD11 . LEU A 1 63  ? -32.523 -18.691 -13.259 1.00 46.73  ?  394 LEU A HD11 1 
ATOM   724  H HD12 . LEU A 1 63  ? -32.873 -17.503 -14.254 1.00 46.73  ?  394 LEU A HD12 1 
ATOM   725  H HD13 . LEU A 1 63  ? -31.538 -18.342 -14.456 1.00 46.73  ?  394 LEU A HD13 1 
ATOM   726  H HD21 . LEU A 1 63  ? -30.724 -18.443 -11.610 1.00 41.55  ?  394 LEU A HD21 1 
ATOM   727  H HD22 . LEU A 1 63  ? -29.679 -18.101 -12.757 1.00 41.55  ?  394 LEU A HD22 1 
ATOM   728  H HD23 . LEU A 1 63  ? -29.881 -17.099 -11.540 1.00 41.55  ?  394 LEU A HD23 1 
ATOM   729  N N    . ALA A 1 64  ? -29.812 -12.868 -14.470 1.00 33.14  ?  395 ALA A N    1 
ATOM   730  C CA   . ALA A 1 64  ? -29.059 -12.058 -15.424 1.00 32.44  ?  395 ALA A CA   1 
ATOM   731  C C    . ALA A 1 64  ? -27.771 -11.533 -14.798 1.00 27.01  ?  395 ALA A C    1 
ATOM   732  O O    . ALA A 1 64  ? -26.719 -11.527 -15.436 1.00 27.18  ?  395 ALA A O    1 
ATOM   733  C CB   . ALA A 1 64  ? -29.916 -10.903 -15.930 1.00 38.53  ?  395 ALA A CB   1 
ATOM   734  H H    . ALA A 1 64  ? -30.616 -12.594 -14.335 1.00 39.77  ?  395 ALA A H    1 
ATOM   735  H HA   . ALA A 1 64  ? -28.819 -12.609 -16.186 1.00 38.93  ?  395 ALA A HA   1 
ATOM   736  H HB1  . ALA A 1 64  ? -29.397 -10.379 -16.561 1.00 46.24  ?  395 ALA A HB1  1 
ATOM   737  H HB2  . ALA A 1 64  ? -30.704 -11.263 -16.367 1.00 46.24  ?  395 ALA A HB2  1 
ATOM   738  H HB3  . ALA A 1 64  ? -30.177 -10.351 -15.177 1.00 46.24  ?  395 ALA A HB3  1 
ATOM   739  N N    . PHE A 1 65  ? -27.861 -11.106 -13.542 1.00 30.49  ?  396 PHE A N    1 
ATOM   740  C CA   . PHE A 1 65  ? -26.693 -10.641 -12.801 1.00 26.94  ?  396 PHE A CA   1 
ATOM   741  C C    . PHE A 1 65  ? -25.589 -11.693 -12.785 1.00 24.81  ?  396 PHE A C    1 
ATOM   742  O O    . PHE A 1 65  ? -24.411 -11.380 -12.960 1.00 27.34  ?  396 PHE A O    1 
ATOM   743  C CB   . PHE A 1 65  ? -27.079 -10.280 -11.366 1.00 27.95  ?  396 PHE A CB   1 
ATOM   744  C CG   . PHE A 1 65  ? -25.908 -9.917  -10.506 1.00 28.22  ?  396 PHE A CG   1 
ATOM   745  C CD1  . PHE A 1 65  ? -25.471 -8.604  -10.432 1.00 29.28  ?  396 PHE A CD1  1 
ATOM   746  C CD2  . PHE A 1 65  ? -25.233 -10.887 -9.781  1.00 30.32  ?  396 PHE A CD2  1 
ATOM   747  C CE1  . PHE A 1 65  ? -24.391 -8.264  -9.650  1.00 27.91  ?  396 PHE A CE1  1 
ATOM   748  C CE2  . PHE A 1 65  ? -24.150 -10.550 -8.998  1.00 29.87  ?  396 PHE A CE2  1 
ATOM   749  C CZ   . PHE A 1 65  ? -23.729 -9.235  -8.933  1.00 27.46  ?  396 PHE A CZ   1 
ATOM   750  H H    . PHE A 1 65  ? -28.594 -11.075 -13.093 1.00 36.59  ?  396 PHE A H    1 
ATOM   751  H HA   . PHE A 1 65  ? -26.344 -9.844  -13.229 1.00 32.33  ?  396 PHE A HA   1 
ATOM   752  H HB2  . PHE A 1 65  ? -27.681 -9.519  -11.385 1.00 33.54  ?  396 PHE A HB2  1 
ATOM   753  H HB3  . PHE A 1 65  ? -27.522 -11.041 -10.959 1.00 33.54  ?  396 PHE A HB3  1 
ATOM   754  H HD1  . PHE A 1 65  ? -25.914 -7.944  -10.916 1.00 35.14  ?  396 PHE A HD1  1 
ATOM   755  H HD2  . PHE A 1 65  ? -25.514 -11.772 -9.824  1.00 36.39  ?  396 PHE A HD2  1 
ATOM   756  H HE1  . PHE A 1 65  ? -24.107 -7.379  -9.607  1.00 33.50  ?  396 PHE A HE1  1 
ATOM   757  H HE2  . PHE A 1 65  ? -23.704 -11.206 -8.512  1.00 35.84  ?  396 PHE A HE2  1 
ATOM   758  H HZ   . PHE A 1 65  ? -23.000 -9.006  -8.403  1.00 32.95  ?  396 PHE A HZ   1 
ATOM   759  N N    . HIS A 1 66  ? -25.978 -12.944 -12.573 1.00 25.41  ?  397 HIS A N    1 
ATOM   760  C CA   . HIS A 1 66  ? -25.013 -14.033 -12.496 1.00 22.00  ?  397 HIS A CA   1 
ATOM   761  C C    . HIS A 1 66  ? -24.504 -14.447 -13.870 1.00 23.28  ?  397 HIS A C    1 
ATOM   762  O O    . HIS A 1 66  ? -23.322 -14.751 -14.029 1.00 28.56  ?  397 HIS A O    1 
ATOM   763  C CB   . HIS A 1 66  ? -25.640 -15.222 -11.772 1.00 22.61  ?  397 HIS A CB   1 
ATOM   764  C CG   . HIS A 1 66  ? -26.033 -14.908 -10.365 1.00 23.48  ?  397 HIS A CG   1 
ATOM   765  N ND1  . HIS A 1 66  ? -25.111 -14.821 -9.342  1.00 24.93  ?  397 HIS A ND1  1 
ATOM   766  C CD2  . HIS A 1 66  ? -27.233 -14.616 -9.811  1.00 24.15  ?  397 HIS A CD2  1 
ATOM   767  C CE1  . HIS A 1 66  ? -25.729 -14.509 -8.220  1.00 32.45  ?  397 HIS A CE1  1 
ATOM   768  N NE2  . HIS A 1 66  ? -27.019 -14.373 -8.477  1.00 25.34  ?  397 HIS A NE2  1 
ATOM   769  H H    . HIS A 1 66  ? -26.795 -13.189 -12.470 1.00 30.49  ?  397 HIS A H    1 
ATOM   770  H HA   . HIS A 1 66  ? -24.251 -13.738 -11.975 1.00 26.40  ?  397 HIS A HA   1 
ATOM   771  H HB2  . HIS A 1 66  ? -26.438 -15.498 -12.250 1.00 27.13  ?  397 HIS A HB2  1 
ATOM   772  H HB3  . HIS A 1 66  ? -25.000 -15.950 -11.749 1.00 27.13  ?  397 HIS A HB3  1 
ATOM   773  H HD1  . HIS A 1 66  ? -24.265 -14.956 -9.422  1.00 29.92  ?  397 HIS A HD1  1 
ATOM   774  H HD2  . HIS A 1 66  ? -28.051 -14.588 -10.252 1.00 28.98  ?  397 HIS A HD2  1 
ATOM   775  H HE1  . HIS A 1 66  ? -25.325 -14.400 -7.389  1.00 38.93  ?  397 HIS A HE1  1 
ATOM   776  N N    . LYS A 1 67  ? -25.390 -14.450 -14.859 1.00 25.65  ?  398 LYS A N    1 
ATOM   777  C CA   . LYS A 1 67  ? -25.008 -14.848 -16.213 1.00 27.56  ?  398 LYS A CA   1 
ATOM   778  C C    . LYS A 1 67  ? -23.896 -13.951 -16.751 1.00 29.06  ?  398 LYS A C    1 
ATOM   779  O O    . LYS A 1 67  ? -23.043 -14.396 -17.520 1.00 32.84  ?  398 LYS A O    1 
ATOM   780  C CB   . LYS A 1 67  ? -26.214 -14.808 -17.155 1.00 29.60  ?  398 LYS A CB   1 
ATOM   781  C CG   . LYS A 1 67  ? -25.914 -15.385 -18.532 1.00 36.99  ?  398 LYS A CG   1 
ATOM   782  C CD   . LYS A 1 67  ? -27.164 -15.522 -19.388 1.00 43.58  ?  398 LYS A CD   1 
ATOM   783  C CE   . LYS A 1 67  ? -26.823 -16.011 -20.794 1.00 49.29  ?  398 LYS A CE   1 
ATOM   784  N NZ   . LYS A 1 67  ? -25.903 -17.185 -20.783 1.00 57.24  ?  398 LYS A NZ   1 
ATOM   785  H H    . LYS A 1 67  ? -26.216 -14.226 -14.776 1.00 30.78  ?  398 LYS A H    1 
ATOM   786  H HA   . LYS A 1 67  ? -24.674 -15.759 -16.192 1.00 33.08  ?  398 LYS A HA   1 
ATOM   787  H HB2  . LYS A 1 67  ? -26.936 -15.325 -16.765 1.00 35.52  ?  398 LYS A HB2  1 
ATOM   788  H HB3  . LYS A 1 67  ? -26.492 -13.886 -17.271 1.00 35.52  ?  398 LYS A HB3  1 
ATOM   789  H HG2  . LYS A 1 67  ? -25.295 -14.797 -18.994 1.00 44.39  ?  398 LYS A HG2  1 
ATOM   790  H HG3  . LYS A 1 67  ? -25.521 -16.266 -18.428 1.00 44.39  ?  398 LYS A HG3  1 
ATOM   791  H HD2  . LYS A 1 67  ? -27.764 -16.166 -18.979 1.00 52.30  ?  398 LYS A HD2  1 
ATOM   792  H HD3  . LYS A 1 67  ? -27.598 -14.658 -19.463 1.00 52.30  ?  398 LYS A HD3  1 
ATOM   793  H HE2  . LYS A 1 67  ? -27.641 -16.274 -21.245 1.00 59.15  ?  398 LYS A HE2  1 
ATOM   794  H HE3  . LYS A 1 67  ? -26.390 -15.294 -21.282 1.00 59.15  ?  398 LYS A HE3  1 
ATOM   795  H HZ1  . LYS A 1 67  ? -25.727 -17.441 -21.616 1.00 68.68  ?  398 LYS A HZ1  1 
ATOM   796  H HZ2  . LYS A 1 67  ? -25.140 -16.969 -20.379 1.00 68.68  ?  398 LYS A HZ2  1 
ATOM   797  H HZ3  . LYS A 1 67  ? -26.280 -17.862 -20.345 1.00 68.68  ?  398 LYS A HZ3  1 
ATOM   798  N N    . PHE A 1 68  ? -23.908 -12.689 -16.333 1.00 28.08  ?  399 PHE A N    1 
ATOM   799  C CA   . PHE A 1 68  ? -22.884 -11.732 -16.730 1.00 28.29  ?  399 PHE A CA   1 
ATOM   800  C C    . PHE A 1 68  ? -21.484 -12.258 -16.436 1.00 30.00  ?  399 PHE A C    1 
ATOM   801  O O    . PHE A 1 68  ? -20.556 -12.058 -17.222 1.00 33.06  ?  399 PHE A O    1 
ATOM   802  C CB   . PHE A 1 68  ? -23.098 -10.400 -16.010 1.00 26.05  ?  399 PHE A CB   1 
ATOM   803  C CG   . PHE A 1 68  ? -22.152 -9.318  -16.443 1.00 32.58  ?  399 PHE A CG   1 
ATOM   804  C CD1  . PHE A 1 68  ? -22.457 -8.511  -17.522 1.00 36.07  ?  399 PHE A CD1  1 
ATOM   805  C CD2  . PHE A 1 68  ? -20.962 -9.105  -15.768 1.00 29.62  ?  399 PHE A CD2  1 
ATOM   806  C CE1  . PHE A 1 68  ? -21.596 -7.513  -17.920 1.00 27.38  ?  399 PHE A CE1  1 
ATOM   807  C CE2  . PHE A 1 68  ? -20.095 -8.106  -16.166 1.00 33.29  ?  399 PHE A CE2  1 
ATOM   808  C CZ   . PHE A 1 68  ? -20.415 -7.311  -17.245 1.00 28.56  ?  399 PHE A CZ   1 
ATOM   809  H H    . PHE A 1 68  ? -24.508 -12.360 -15.811 1.00 33.70  ?  399 PHE A H    1 
ATOM   810  H HA   . PHE A 1 68  ? -22.952 -11.572 -17.685 1.00 33.95  ?  399 PHE A HA   1 
ATOM   811  H HB2  . PHE A 1 68  ? -24.001 -10.092 -16.185 1.00 31.25  ?  399 PHE A HB2  1 
ATOM   812  H HB3  . PHE A 1 68  ? -22.976 -10.537 -15.058 1.00 31.25  ?  399 PHE A HB3  1 
ATOM   813  H HD1  . PHE A 1 68  ? -23.254 -8.641  -17.983 1.00 43.29  ?  399 PHE A HD1  1 
ATOM   814  H HD2  . PHE A 1 68  ? -20.743 -9.640  -15.040 1.00 35.55  ?  399 PHE A HD2  1 
ATOM   815  H HE1  . PHE A 1 68  ? -21.812 -6.977  -18.648 1.00 32.86  ?  399 PHE A HE1  1 
ATOM   816  H HE2  . PHE A 1 68  ? -19.297 -7.971  -15.708 1.00 39.95  ?  399 PHE A HE2  1 
ATOM   817  H HZ   . PHE A 1 68  ? -19.833 -6.637  -17.516 1.00 34.27  ?  399 PHE A HZ   1 
ATOM   818  N N    . PHE A 1 69  ? -21.336 -12.932 -15.300 1.00 25.54  ?  400 PHE A N    1 
ATOM   819  C CA   . PHE A 1 69  ? -20.043 -13.474 -14.905 1.00 25.11  ?  400 PHE A CA   1 
ATOM   820  C C    . PHE A 1 69  ? -19.728 -14.762 -15.654 1.00 27.45  ?  400 PHE A C    1 
ATOM   821  O O    . PHE A 1 69  ? -18.562 -15.102 -15.834 1.00 37.31  ?  400 PHE A O    1 
ATOM   822  C CB   . PHE A 1 69  ? -20.002 -13.714 -13.398 1.00 26.11  ?  400 PHE A CB   1 
ATOM   823  C CG   . PHE A 1 69  ? -20.044 -12.452 -12.596 1.00 25.06  ?  400 PHE A CG   1 
ATOM   824  C CD1  . PHE A 1 69  ? -18.903 -11.683 -12.434 1.00 29.03  ?  400 PHE A CD1  1 
ATOM   825  C CD2  . PHE A 1 69  ? -21.226 -12.020 -12.021 1.00 28.11  ?  400 PHE A CD2  1 
ATOM   826  C CE1  . PHE A 1 69  ? -18.938 -10.512 -11.701 1.00 34.08  ?  400 PHE A CE1  1 
ATOM   827  C CE2  . PHE A 1 69  ? -21.267 -10.851 -11.286 1.00 32.97  ?  400 PHE A CE2  1 
ATOM   828  C CZ   . PHE A 1 69  ? -20.123 -10.096 -11.129 1.00 36.13  ?  400 PHE A CZ   1 
ATOM   829  H H    . PHE A 1 69  ? -21.969 -13.089 -14.740 1.00 30.64  ?  400 PHE A H    1 
ATOM   830  H HA   . PHE A 1 69  ? -19.353 -12.827 -15.122 1.00 30.13  ?  400 PHE A HA   1 
ATOM   831  H HB2  . PHE A 1 69  ? -20.767 -14.254 -13.145 1.00 31.33  ?  400 PHE A HB2  1 
ATOM   832  H HB3  . PHE A 1 69  ? -19.181 -14.180 -13.177 1.00 31.33  ?  400 PHE A HB3  1 
ATOM   833  H HD1  . PHE A 1 69  ? -18.104 -11.961 -12.819 1.00 34.84  ?  400 PHE A HD1  1 
ATOM   834  H HD2  . PHE A 1 69  ? -21.999 -12.526 -12.125 1.00 33.74  ?  400 PHE A HD2  1 
ATOM   835  H HE1  . PHE A 1 69  ? -18.166 -10.005 -11.595 1.00 40.90  ?  400 PHE A HE1  1 
ATOM   836  H HE2  . PHE A 1 69  ? -22.066 -10.571 -10.900 1.00 39.56  ?  400 PHE A HE2  1 
ATOM   837  H HZ   . PHE A 1 69  ? -20.150 -9.309  -10.634 1.00 43.36  ?  400 PHE A HZ   1 
ATOM   838  N N    . PHE A 1 70  ? -20.761 -15.478 -16.087 1.00 26.78  ?  401 PHE A N    1 
ATOM   839  C CA   . PHE A 1 70  ? -20.557 -16.658 -16.924 1.00 28.50  ?  401 PHE A CA   1 
ATOM   840  C C    . PHE A 1 70  ? -20.126 -16.232 -18.327 1.00 34.39  ?  401 PHE A C    1 
ATOM   841  O O    . PHE A 1 70  ? -19.208 -16.812 -18.904 1.00 38.56  ?  401 PHE A O    1 
ATOM   842  C CB   . PHE A 1 70  ? -21.827 -17.510 -16.998 1.00 28.62  ?  401 PHE A CB   1 
ATOM   843  C CG   . PHE A 1 70  ? -22.038 -18.399 -15.800 1.00 29.93  ?  401 PHE A CG   1 
ATOM   844  C CD1  . PHE A 1 70  ? -22.499 -17.877 -14.603 1.00 30.51  ?  401 PHE A CD1  1 
ATOM   845  C CD2  . PHE A 1 70  ? -21.787 -19.760 -15.879 1.00 33.58  ?  401 PHE A CD2  1 
ATOM   846  C CE1  . PHE A 1 70  ? -22.700 -18.695 -13.501 1.00 29.25  ?  401 PHE A CE1  1 
ATOM   847  C CE2  . PHE A 1 70  ? -21.985 -20.583 -14.783 1.00 29.65  ?  401 PHE A CE2  1 
ATOM   848  C CZ   . PHE A 1 70  ? -22.438 -20.051 -13.592 1.00 29.78  ?  401 PHE A CZ   1 
ATOM   849  H H    . PHE A 1 70  ? -21.585 -15.303 -15.913 1.00 32.13  ?  401 PHE A H    1 
ATOM   850  H HA   . PHE A 1 70  ? -19.850 -17.201 -16.541 1.00 34.20  ?  401 PHE A HA   1 
ATOM   851  H HB2  . PHE A 1 70  ? -22.595 -16.920 -17.067 1.00 34.34  ?  401 PHE A HB2  1 
ATOM   852  H HB3  . PHE A 1 70  ? -21.777 -18.077 -17.783 1.00 34.34  ?  401 PHE A HB3  1 
ATOM   853  H HD1  . PHE A 1 70  ? -22.674 -16.966 -14.536 1.00 36.61  ?  401 PHE A HD1  1 
ATOM   854  H HD2  . PHE A 1 70  ? -21.479 -20.124 -16.677 1.00 40.30  ?  401 PHE A HD2  1 
ATOM   855  H HE1  . PHE A 1 70  ? -23.006 -18.333 -12.701 1.00 35.10  ?  401 PHE A HE1  1 
ATOM   856  H HE2  . PHE A 1 70  ? -21.809 -21.494 -14.848 1.00 35.58  ?  401 PHE A HE2  1 
ATOM   857  H HZ   . PHE A 1 70  ? -22.573 -20.603 -12.855 1.00 35.74  ?  401 PHE A HZ   1 
ATOM   858  N N    . ASP A 1 71  ? -20.790 -15.209 -18.861 1.00 37.50  ?  402 ASP A N    1 
ATOM   859  C CA   . ASP A 1 71  ? -20.525 -14.730 -20.217 1.00 45.10  ?  402 ASP A CA   1 
ATOM   860  C C    . ASP A 1 71  ? -19.189 -14.003 -20.331 1.00 46.50  ?  402 ASP A C    1 
ATOM   861  O O    . ASP A 1 71  ? -18.629 -13.896 -21.424 1.00 46.03  ?  402 ASP A O    1 
ATOM   862  C CB   . ASP A 1 71  ? -21.647 -13.797 -20.684 1.00 35.95  ?  402 ASP A CB   1 
ATOM   863  C CG   . ASP A 1 71  ? -22.962 -14.518 -20.894 1.00 41.79  ?  402 ASP A CG   1 
ATOM   864  O OD1  . ASP A 1 71  ? -22.953 -15.763 -21.010 1.00 52.07  ?  402 ASP A OD1  1 
ATOM   865  O OD2  . ASP A 1 71  ? -24.008 -13.838 -20.953 1.00 51.70  ?  402 ASP A OD2  1 
ATOM   866  H H    . ASP A 1 71  ? -21.406 -14.769 -18.453 1.00 45.00  ?  402 ASP A H    1 
ATOM   867  H HA   . ASP A 1 71  ? -20.501 -15.491 -20.819 1.00 54.12  ?  402 ASP A HA   1 
ATOM   868  H HB2  . ASP A 1 71  ? -21.785 -13.110 -20.014 1.00 43.14  ?  402 ASP A HB2  1 
ATOM   869  H HB3  . ASP A 1 71  ? -21.389 -13.391 -21.527 1.00 43.14  ?  402 ASP A HB3  1 
ATOM   870  N N    . ASN A 1 72  ? -18.691 -13.494 -19.206 1.00 34.06  ?  403 ASN A N    1 
ATOM   871  C CA   . ASN A 1 72  ? -17.425 -12.768 -19.175 1.00 35.93  ?  403 ASN A CA   1 
ATOM   872  C C    . ASN A 1 72  ? -16.435 -13.367 -18.182 1.00 50.22  ?  403 ASN A C    1 
ATOM   873  O O    . ASN A 1 72  ? -15.852 -12.651 -17.375 1.00 58.75  ?  403 ASN A O    1 
ATOM   874  C CB   . ASN A 1 72  ? -17.665 -11.295 -18.833 1.00 38.74  ?  403 ASN A CB   1 
ATOM   875  C CG   . ASN A 1 72  ? -18.561 -10.599 -19.840 1.00 38.72  ?  403 ASN A CG   1 
ATOM   876  O OD1  . ASN A 1 72  ? -18.122 -10.231 -20.930 1.00 44.29  ?  403 ASN A OD1  1 
ATOM   877  N ND2  . ASN A 1 72  ? -19.821 -10.404 -19.475 1.00 33.23  ?  403 ASN A ND2  1 
ATOM   878  H H    . ASN A 1 72  ? -19.074 -13.557 -18.438 1.00 40.87  ?  403 ASN A H    1 
ATOM   879  H HA   . ASN A 1 72  ? -17.021 -12.807 -20.056 1.00 43.12  ?  403 ASN A HA   1 
ATOM   880  H HB2  . ASN A 1 72  ? -18.090 -11.238 -17.963 1.00 46.49  ?  403 ASN A HB2  1 
ATOM   881  H HB3  . ASN A 1 72  ? -16.813 -10.831 -18.817 1.00 46.49  ?  403 ASN A HB3  1 
ATOM   882  H HD21 . ASN A 1 72  ? -20.369 -10.014 -20.011 1.00 39.88  ?  403 ASN A HD21 1 
ATOM   883  H HD22 . ASN A 1 72  ? -20.090 -10.668 -18.702 1.00 39.88  ?  403 ASN A HD22 1 
ATOM   884  N N    . ARG A 1 73  ? -16.251 -14.682 -18.236 1.00 58.42  ?  404 ARG A N    1 
ATOM   885  C CA   . ARG A 1 73  ? -15.269 -15.346 -17.383 1.00 58.55  ?  404 ARG A CA   1 
ATOM   886  C C    . ARG A 1 73  ? -13.858 -14.862 -17.694 1.00 68.79  ?  404 ARG A C    1 
ATOM   887  O O    . ARG A 1 73  ? -13.332 -15.140 -18.772 1.00 75.05  ?  404 ARG A O    1 
ATOM   888  C CB   . ARG A 1 73  ? -15.335 -16.862 -17.564 1.00 56.08  ?  404 ARG A CB   1 
ATOM   889  C CG   . ARG A 1 73  ? -16.494 -17.540 -16.863 1.00 61.10  ?  404 ARG A CG   1 
ATOM   890  C CD   . ARG A 1 73  ? -16.010 -18.674 -15.969 1.00 68.60  ?  404 ARG A CD   1 
ATOM   891  N NE   . ARG A 1 73  ? -15.225 -19.661 -16.705 1.00 75.18  ?  404 ARG A NE   1 
ATOM   892  C CZ   . ARG A 1 73  ? -14.691 -20.751 -16.162 1.00 65.76  ?  404 ARG A CZ   1 
ATOM   893  N NH1  . ARG A 1 73  ? -14.856 -21.004 -14.871 1.00 66.04  ?  404 ARG A NH1  1 
ATOM   894  N NH2  . ARG A 1 73  ? -13.991 -21.591 -16.912 1.00 70.17  ?  404 ARG A NH2  1 
ATOM   895  H H    . ARG A 1 73  ? -16.681 -15.213 -18.758 1.00 70.11  ?  404 ARG A H    1 
ATOM   896  H HA   . ARG A 1 73  ? -15.463 -15.143 -16.454 1.00 70.26  ?  404 ARG A HA   1 
ATOM   897  H HB2  . ARG A 1 73  ? -15.412 -17.056 -18.512 1.00 67.29  ?  404 ARG A HB2  1 
ATOM   898  H HB3  . ARG A 1 73  ? -14.516 -17.250 -17.218 1.00 67.29  ?  404 ARG A HB3  1 
ATOM   899  H HG2  . ARG A 1 73  ? -16.958 -16.893 -16.310 1.00 73.33  ?  404 ARG A HG2  1 
ATOM   900  H HG3  . ARG A 1 73  ? -17.097 -17.912 -17.526 1.00 73.33  ?  404 ARG A HG3  1 
ATOM   901  H HD2  . ARG A 1 73  ? -15.451 -18.307 -15.266 1.00 82.32  ?  404 ARG A HD2  1 
ATOM   902  H HD3  . ARG A 1 73  ? -16.778 -19.124 -15.584 1.00 82.32  ?  404 ARG A HD3  1 
ATOM   903  H HE   . ARG A 1 73  ? -15.100 -19.529 -17.546 1.00 90.22  ?  404 ARG A HE   1 
ATOM   904  H HH11 . ARG A 1 73  ? -15.309 -20.462 -14.381 1.00 79.24  ?  404 ARG A HH11 1 
ATOM   905  H HH12 . ARG A 1 73  ? -14.510 -21.711 -14.523 1.00 79.24  ?  404 ARG A HH12 1 
ATOM   906  H HH21 . ARG A 1 73  ? -13.882 -21.431 -17.750 1.00 84.21  ?  404 ARG A HH21 1 
ATOM   907  H HH22 . ARG A 1 73  ? -13.647 -22.297 -16.560 1.00 84.21  ?  404 ARG A HH22 1 
ATOM   908  N N    . SER A 1 74  ? -13.246 -14.136 -16.761 1.00 66.59  ?  405 SER A N    1 
ATOM   909  C CA   . SER A 1 74  ? -11.878 -13.657 -16.953 1.00 75.64  ?  405 SER A CA   1 
ATOM   910  C C    . SER A 1 74  ? -11.178 -13.370 -15.625 1.00 82.20  ?  405 SER A C    1 
ATOM   911  O O    . SER A 1 74  ? -11.843 -13.145 -14.612 1.00 81.47  ?  405 SER A O    1 
ATOM   912  C CB   . SER A 1 74  ? -11.862 -12.386 -17.809 1.00 71.14  ?  405 SER A CB   1 
ATOM   913  O OG   . SER A 1 74  ? -13.024 -12.269 -18.614 1.00 72.33  ?  405 SER A OG   1 
ATOM   914  H H    . SER A 1 74  ? -13.599 -13.907 -16.011 1.00 79.91  ?  405 SER A H    1 
ATOM   915  H HA   . SER A 1 74  ? -11.368 -14.338 -17.419 1.00 90.77  ?  405 SER A HA   1 
ATOM   916  H HB2  . SER A 1 74  ? -11.811 -11.616 -17.222 1.00 85.36  ?  405 SER A HB2  1 
ATOM   917  H HB3  . SER A 1 74  ? -11.083 -12.410 -18.387 1.00 85.36  ?  405 SER A HB3  1 
ATOM   918  H HG   . SER A 1 74  ? -13.082 -12.928 -19.132 1.00 86.80  ?  405 SER A HG   1 
ATOM   919  N N    . PRO A 1 75  ? -9.831  -13.384 -15.619 1.00 97.08  ?  406 PRO A N    1 
ATOM   920  C CA   . PRO A 1 75  ? -8.924  -13.835 -16.681 1.00 99.40  ?  406 PRO A CA   1 
ATOM   921  C C    . PRO A 1 75  ? -8.259  -15.179 -16.368 1.00 100.67 ?  406 PRO A C    1 
ATOM   922  O O    . PRO A 1 75  ? -7.838  -15.884 -17.286 1.00 95.68  ?  406 PRO A O    1 
ATOM   923  C CB   . PRO A 1 75  ? -7.884  -12.712 -16.743 1.00 92.08  ?  406 PRO A CB   1 
ATOM   924  C CG   . PRO A 1 75  ? -7.916  -12.057 -15.370 1.00 89.60  ?  406 PRO A CG   1 
ATOM   925  C CD   . PRO A 1 75  ? -9.095  -12.616 -14.602 1.00 91.05  ?  406 PRO A CD   1 
ATOM   926  H HA   . PRO A 1 75  ? -9.392  -13.892 -17.529 1.00 119.28 ?  406 PRO A HA   1 
ATOM   927  H HB2  . PRO A 1 75  ? -7.008  -13.088 -16.922 1.00 110.49 ?  406 PRO A HB2  1 
ATOM   928  H HB3  . PRO A 1 75  ? -8.131  -12.076 -17.432 1.00 110.49 ?  406 PRO A HB3  1 
ATOM   929  H HG2  . PRO A 1 75  ? -7.090  -12.257 -14.904 1.00 107.52 ?  406 PRO A HG2  1 
ATOM   930  H HG3  . PRO A 1 75  ? -8.014  -11.098 -15.479 1.00 107.52 ?  406 PRO A HG3  1 
ATOM   931  H HD2  . PRO A 1 75  ? -8.789  -13.201 -13.892 1.00 109.26 ?  406 PRO A HD2  1 
ATOM   932  H HD3  . PRO A 1 75  ? -9.646  -11.896 -14.257 1.00 109.26 ?  406 PRO A HD3  1 
ATOM   933  N N    . ASN A 1 76  ? -8.172  -15.516 -15.083 1.00 90.46  ?  407 ASN A N    1 
ATOM   934  C CA   . ASN A 1 76  ? -7.534  -16.749 -14.629 1.00 85.71  ?  407 ASN A CA   1 
ATOM   935  C C    . ASN A 1 76  ? -8.490  -17.571 -13.769 1.00 79.30  ?  407 ASN A C    1 
ATOM   936  O O    . ASN A 1 76  ? -8.073  -18.250 -12.830 1.00 72.35  ?  407 ASN A O    1 
ATOM   937  C CB   . ASN A 1 76  ? -6.259  -16.433 -13.838 1.00 85.78  ?  407 ASN A CB   1 
ATOM   938  C CG   . ASN A 1 76  ? -5.157  -15.855 -14.707 1.00 93.47  ?  407 ASN A CG   1 
ATOM   939  O OD1  . ASN A 1 76  ? -5.393  -15.447 -15.844 1.00 96.20  ?  407 ASN A OD1  1 
ATOM   940  N ND2  . ASN A 1 76  ? -3.942  -15.815 -14.170 1.00 79.65  ?  407 ASN A ND2  1 
ATOM   941  H H    . ASN A 1 76  ? -8.483  -15.036 -14.441 1.00 108.55 ?  407 ASN A H    1 
ATOM   942  H HA   . ASN A 1 76  ? -7.287  -17.282 -15.400 1.00 102.85 ?  407 ASN A HA   1 
ATOM   943  H HB2  . ASN A 1 76  ? -6.468  -15.785 -13.148 1.00 102.94 ?  407 ASN A HB2  1 
ATOM   944  H HB3  . ASN A 1 76  ? -5.926  -17.251 -13.436 1.00 102.94 ?  407 ASN A HB3  1 
ATOM   945  H HD21 . ASN A 1 76  ? -3.283  -15.497 -14.621 1.00 95.58  ?  407 ASN A HD21 1 
ATOM   946  H HD22 . ASN A 1 76  ? -3.815  -16.108 -13.371 1.00 95.58  ?  407 ASN A HD22 1 
ATOM   947  N N    . ALA A 1 77  ? -9.776  -17.503 -14.099 1.00 71.82  ?  408 ALA A N    1 
ATOM   948  C CA   . ALA A 1 77  ? -10.802 -18.230 -13.360 1.00 60.96  ?  408 ALA A CA   1 
ATOM   949  C C    . ALA A 1 77  ? -10.641 -19.737 -13.523 1.00 59.07  ?  408 ALA A C    1 
ATOM   950  O O    . ALA A 1 77  ? -11.205 -20.519 -12.756 1.00 57.86  ?  408 ALA A O    1 
ATOM   951  C CB   . ALA A 1 77  ? -12.185 -17.799 -13.818 1.00 75.79  ?  408 ALA A CB   1 
ATOM   952  H H    . ALA A 1 77  ? -10.083 -17.037 -14.753 1.00 86.18  ?  408 ALA A H    1 
ATOM   953  H HA   . ALA A 1 77  ? -10.720 -18.020 -12.416 1.00 73.16  ?  408 ALA A HA   1 
ATOM   954  H HB1  . ALA A 1 77  ? -12.852 -18.293 -13.316 1.00 90.95  ?  408 ALA A HB1  1 
ATOM   955  H HB2  . ALA A 1 77  ? -12.288 -16.848 -13.660 1.00 90.95  ?  408 ALA A HB2  1 
ATOM   956  H HB3  . ALA A 1 77  ? -12.276 -17.989 -14.765 1.00 90.95  ?  408 ALA A HB3  1 
ATOM   957  N N    . ASP A 1 78  ? -9.871  -20.139 -14.527 1.00 60.07  ?  409 ASP A N    1 
ATOM   958  C CA   . ASP A 1 78  ? -9.654  -21.550 -14.807 1.00 63.73  ?  409 ASP A CA   1 
ATOM   959  C C    . ASP A 1 78  ? -8.562  -22.128 -13.914 1.00 54.74  ?  409 ASP A C    1 
ATOM   960  O O    . ASP A 1 78  ? -8.571  -23.319 -13.603 1.00 57.21  ?  409 ASP A O    1 
ATOM   961  C CB   . ASP A 1 78  ? -9.296  -21.740 -16.280 1.00 73.43  ?  409 ASP A CB   1 
ATOM   962  C CG   . ASP A 1 78  ? -10.411 -21.298 -17.206 1.00 79.88  ?  409 ASP A CG   1 
ATOM   963  O OD1  . ASP A 1 78  ? -11.586 -21.605 -16.910 1.00 76.55  ?  409 ASP A OD1  1 
ATOM   964  O OD2  . ASP A 1 78  ? -10.115 -20.638 -18.225 1.00 78.81  ?  409 ASP A OD2  1 
ATOM   965  H H    . ASP A 1 78  ? -9.461  -19.608 -15.065 1.00 72.08  ?  409 ASP A H    1 
ATOM   966  H HA   . ASP A 1 78  ? -10.474 -22.037 -14.632 1.00 76.48  ?  409 ASP A HA   1 
ATOM   967  H HB2  . ASP A 1 78  ? -8.508  -21.214 -16.485 1.00 88.12  ?  409 ASP A HB2  1 
ATOM   968  H HB3  . ASP A 1 78  ? -9.122  -22.680 -16.445 1.00 88.12  ?  409 ASP A HB3  1 
ATOM   969  N N    . LYS A 1 79  ? -7.626  -21.281 -13.500 1.00 53.08  ?  410 LYS A N    1 
ATOM   970  C CA   . LYS A 1 79  ? -6.577  -21.707 -12.583 1.00 54.56  ?  410 LYS A CA   1 
ATOM   971  C C    . LYS A 1 79  ? -7.141  -21.955 -11.189 1.00 52.18  ?  410 LYS A C    1 
ATOM   972  O O    . LYS A 1 79  ? -6.570  -22.714 -10.407 1.00 51.04  ?  410 LYS A O    1 
ATOM   973  C CB   . LYS A 1 79  ? -5.461  -20.662 -12.511 1.00 57.55  ?  410 LYS A CB   1 
ATOM   974  C CG   . LYS A 1 79  ? -4.608  -20.587 -13.766 1.00 66.88  ?  410 LYS A CG   1 
ATOM   975  C CD   . LYS A 1 79  ? -3.314  -19.833 -13.511 1.00 69.27  ?  410 LYS A CD   1 
ATOM   976  C CE   . LYS A 1 79  ? -2.475  -19.718 -14.773 1.00 80.02  ?  410 LYS A CE   1 
ATOM   977  N NZ   . LYS A 1 79  ? -2.154  -21.046 -15.368 1.00 78.80  ?  410 LYS A NZ   1 
ATOM   978  H H    . LYS A 1 79  ? -7.575  -20.456 -13.735 1.00 63.70  ?  410 LYS A H    1 
ATOM   979  H HA   . LYS A 1 79  ? -6.192  -22.537 -12.904 1.00 65.47  ?  410 LYS A HA   1 
ATOM   980  H HB2  . LYS A 1 79  ? -5.860  -19.789 -12.371 1.00 69.05  ?  410 LYS A HB2  1 
ATOM   981  H HB3  . LYS A 1 79  ? -4.877  -20.880 -11.768 1.00 69.05  ?  410 LYS A HB3  1 
ATOM   982  H HG2  . LYS A 1 79  ? -4.385  -21.485 -14.056 1.00 80.26  ?  410 LYS A HG2  1 
ATOM   983  H HG3  . LYS A 1 79  ? -5.100  -20.122 -14.460 1.00 80.26  ?  410 LYS A HG3  1 
ATOM   984  H HD2  . LYS A 1 79  ? -3.522  -18.938 -13.202 1.00 83.13  ?  410 LYS A HD2  1 
ATOM   985  H HD3  . LYS A 1 79  ? -2.795  -20.307 -12.843 1.00 83.13  ?  410 LYS A HD3  1 
ATOM   986  H HE2  . LYS A 1 79  ? -2.965  -19.203 -15.434 1.00 96.03  ?  410 LYS A HE2  1 
ATOM   987  H HE3  . LYS A 1 79  ? -1.639  -19.275 -14.559 1.00 96.03  ?  410 LYS A HE3  1 
ATOM   988  H HZ1  . LYS A 1 79  ? -1.663  -20.939 -16.103 1.00 94.56  ?  410 LYS A HZ1  1 
ATOM   989  H HZ2  . LYS A 1 79  ? -1.697  -21.538 -14.784 1.00 94.56  ?  410 LYS A HZ2  1 
ATOM   990  H HZ3  . LYS A 1 79  ? -2.905  -21.473 -15.582 1.00 94.56  ?  410 LYS A HZ3  1 
ATOM   991  N N    . MET A 1 80  ? -8.268  -21.322 -10.886 1.00 53.09  ?  411 MET A N    1 
ATOM   992  C CA   . MET A 1 80  ? -8.827  -21.371 -9.541  1.00 35.01  ?  411 MET A CA   1 
ATOM   993  C C    . MET A 1 80  ? -9.272  -22.769 -9.131  1.00 39.67  ?  411 MET A C    1 
ATOM   994  O O    . MET A 1 80  ? -9.803  -23.531 -9.940  1.00 39.61  ?  411 MET A O    1 
ATOM   995  C CB   . MET A 1 80  ? -10.011 -20.412 -9.425  1.00 39.59  ?  411 MET A CB   1 
ATOM   996  C CG   . MET A 1 80  ? -9.636  -18.956 -9.602  1.00 49.01  ?  411 MET A CG   1 
ATOM   997  S SD   . MET A 1 80  ? -10.958 -17.849 -9.088  1.00 61.97  ?  411 MET A SD   1 
ATOM   998  C CE   . MET A 1 80  ? -10.191 -16.259 -9.387  1.00 65.53  ?  411 MET A CE   1 
ATOM   999  H H    . MET A 1 80  ? -8.729  -20.855 -11.442 1.00 63.71  ?  411 MET A H    1 
ATOM   1000 H HA   . MET A 1 80  ? -8.148  -21.071 -8.917  1.00 42.02  ?  411 MET A HA   1 
ATOM   1001 H HB2  . MET A 1 80  ? -10.662 -20.636 -10.108 1.00 47.50  ?  411 MET A HB2  1 
ATOM   1002 H HB3  . MET A 1 80  ? -10.409 -20.512 -8.546  1.00 47.50  ?  411 MET A HB3  1 
ATOM   1003 H HG2  . MET A 1 80  ? -8.853  -18.761 -9.064  1.00 58.81  ?  411 MET A HG2  1 
ATOM   1004 H HG3  . MET A 1 80  ? -9.449  -18.787 -10.539 1.00 58.81  ?  411 MET A HG3  1 
ATOM   1005 H HE1  . MET A 1 80  ? -10.815 -15.557 -9.144  1.00 78.64  ?  411 MET A HE1  1 
ATOM   1006 H HE2  . MET A 1 80  ? -9.388  -16.189 -8.847  1.00 78.64  ?  411 MET A HE2  1 
ATOM   1007 H HE3  . MET A 1 80  ? -9.965  -16.190 -10.328 1.00 78.64  ?  411 MET A HE3  1 
ATOM   1008 N N    . LYS A 1 81  ? -9.039  -23.088 -7.861  1.00 27.98  ?  412 LYS A N    1 
ATOM   1009 C CA   . LYS A 1 81  ? -9.537  -24.317 -7.253  1.00 30.38  ?  412 LYS A CA   1 
ATOM   1010 C C    . LYS A 1 81  ? -10.391 -23.958 -6.047  1.00 32.98  ?  412 LYS A C    1 
ATOM   1011 O O    . LYS A 1 81  ? -9.950  -23.212 -5.177  1.00 24.87  ?  412 LYS A O    1 
ATOM   1012 C CB   . LYS A 1 81  ? -8.386  -25.231 -6.825  1.00 31.87  ?  412 LYS A CB   1 
ATOM   1013 C CG   . LYS A 1 81  ? -7.553  -25.774 -7.975  1.00 39.27  ?  412 LYS A CG   1 
ATOM   1014 C CD   . LYS A 1 81  ? -6.373  -26.606 -7.473  1.00 51.46  ?  412 LYS A CD   1 
ATOM   1015 C CE   . LYS A 1 81  ? -6.820  -27.820 -6.666  1.00 44.01  ?  412 LYS A CE   1 
ATOM   1016 N NZ   . LYS A 1 81  ? -7.758  -28.696 -7.425  1.00 61.54  ?  412 LYS A NZ   1 
ATOM   1017 H H    . LYS A 1 81  ? -8.585  -22.598 -7.320  1.00 33.57  ?  412 LYS A H    1 
ATOM   1018 H HA   . LYS A 1 81  ? -10.089 -24.795 -7.891  1.00 36.46  ?  412 LYS A HA   1 
ATOM   1019 H HB2  . LYS A 1 81  ? -7.793  -24.731 -6.242  1.00 38.25  ?  412 LYS A HB2  1 
ATOM   1020 H HB3  . LYS A 1 81  ? -8.754  -25.989 -6.344  1.00 38.25  ?  412 LYS A HB3  1 
ATOM   1021 H HG2  . LYS A 1 81  ? -8.108  -26.342 -8.532  1.00 47.13  ?  412 LYS A HG2  1 
ATOM   1022 H HG3  . LYS A 1 81  ? -7.203  -25.033 -8.494  1.00 47.13  ?  412 LYS A HG3  1 
ATOM   1023 H HD2  . LYS A 1 81  ? -5.861  -26.922 -8.234  1.00 61.75  ?  412 LYS A HD2  1 
ATOM   1024 H HD3  . LYS A 1 81  ? -5.815  -26.053 -6.903  1.00 61.75  ?  412 LYS A HD3  1 
ATOM   1025 H HE2  . LYS A 1 81  ? -6.041  -28.347 -6.429  1.00 52.81  ?  412 LYS A HE2  1 
ATOM   1026 H HE3  . LYS A 1 81  ? -7.273  -27.517 -5.864  1.00 52.81  ?  412 LYS A HE3  1 
ATOM   1027 H HZ1  . LYS A 1 81  ? -7.997  -29.392 -6.924  1.00 73.85  ?  412 LYS A HZ1  1 
ATOM   1028 H HZ2  . LYS A 1 81  ? -8.487  -28.238 -7.650  1.00 73.85  ?  412 LYS A HZ2  1 
ATOM   1029 H HZ3  . LYS A 1 81  ? -7.364  -28.994 -8.165  1.00 73.85  ?  412 LYS A HZ3  1 
ATOM   1030 N N    . THR A 1 82  ? -11.605 -24.497 -5.999  1.00 32.49  ?  413 THR A N    1 
ATOM   1031 C CA   . THR A 1 82  ? -12.544 -24.180 -4.931  1.00 27.88  ?  413 THR A CA   1 
ATOM   1032 C C    . THR A 1 82  ? -13.015 -25.444 -4.230  1.00 28.33  ?  413 THR A C    1 
ATOM   1033 O O    . THR A 1 82  ? -13.348 -26.439 -4.875  1.00 30.31  ?  413 THR A O    1 
ATOM   1034 C CB   . THR A 1 82  ? -13.769 -23.411 -5.471  1.00 30.72  ?  413 THR A CB   1 
ATOM   1035 O OG1  . THR A 1 82  ? -13.329 -22.234 -6.155  1.00 30.38  ?  413 THR A OG1  1 
ATOM   1036 C CG2  . THR A 1 82  ? -14.695 -23.011 -4.340  1.00 30.83  ?  413 THR A CG2  1 
ATOM   1037 H H    . THR A 1 82  ? -11.911 -25.054 -6.578  1.00 38.99  ?  413 THR A H    1 
ATOM   1038 H HA   . THR A 1 82  ? -12.101 -23.619 -4.276  1.00 33.46  ?  413 THR A HA   1 
ATOM   1039 H HB   . THR A 1 82  ? -14.261 -23.978 -6.086  1.00 36.86  ?  413 THR A HB   1 
ATOM   1040 H HG1  . THR A 1 82  ? -13.991 -21.810 -6.452  1.00 36.45  ?  413 THR A HG1  1 
ATOM   1041 H HG21 . THR A 1 82  ? -15.460 -22.529 -4.693  1.00 37.00  ?  413 THR A HG21 1 
ATOM   1042 H HG22 . THR A 1 82  ? -15.009 -23.801 -3.873  1.00 37.00  ?  413 THR A HG22 1 
ATOM   1043 H HG23 . THR A 1 82  ? -14.225 -22.440 -3.713  1.00 37.00  ?  413 THR A HG23 1 
ATOM   1044 N N    . THR A 1 83  ? -13.037 -25.394 -2.903  1.00 22.72  ?  414 THR A N    1 
ATOM   1045 C CA   . THR A 1 83  ? -13.532 -26.497 -2.096  1.00 26.08  ?  414 THR A CA   1 
ATOM   1046 C C    . THR A 1 83  ? -14.473 -25.980 -1.019  1.00 29.32  ?  414 THR A C    1 
ATOM   1047 O O    . THR A 1 83  ? -14.321 -24.853 -0.540  1.00 26.05  ?  414 THR A O    1 
ATOM   1048 C CB   . THR A 1 83  ? -12.379 -27.273 -1.433  1.00 35.11  ?  414 THR A CB   1 
ATOM   1049 O OG1  . THR A 1 83  ? -11.608 -26.386 -0.613  1.00 34.64  ?  414 THR A OG1  1 
ATOM   1050 C CG2  . THR A 1 83  ? -11.477 -27.888 -2.488  1.00 29.92  ?  414 THR A CG2  1 
ATOM   1051 H H    . THR A 1 83  ? -12.766 -24.720 -2.442  1.00 27.26  ?  414 THR A H    1 
ATOM   1052 H HA   . THR A 1 83  ? -14.026 -27.111 -2.662  1.00 31.29  ?  414 THR A HA   1 
ATOM   1053 H HB   . THR A 1 83  ? -12.742 -27.987 -0.885  1.00 42.13  ?  414 THR A HB   1 
ATOM   1054 H HG1  . THR A 1 83  ? -10.978 -26.805 -0.249  1.00 41.56  ?  414 THR A HG1  1 
ATOM   1055 H HG21 . THR A 1 83  ? -10.754 -28.375 -2.063  1.00 35.90  ?  414 THR A HG21 1 
ATOM   1056 H HG22 . THR A 1 83  ? -11.986 -28.500 -3.043  1.00 35.90  ?  414 THR A HG22 1 
ATOM   1057 H HG23 . THR A 1 83  ? -11.102 -27.192 -3.050  1.00 35.90  ?  414 THR A HG23 1 
ATOM   1058 N N    . LEU A 1 84  ? -15.458 -26.799 -0.660  1.00 25.16  ?  415 LEU A N    1 
ATOM   1059 C CA   . LEU A 1 84  ? -16.346 -26.492 0.452   1.00 24.50  ?  415 LEU A CA   1 
ATOM   1060 C C    . LEU A 1 84  ? -15.923 -27.279 1.677   1.00 29.25  ?  415 LEU A C    1 
ATOM   1061 O O    . LEU A 1 84  ? -15.628 -28.476 1.604   1.00 32.99  ?  415 LEU A O    1 
ATOM   1062 C CB   . LEU A 1 84  ? -17.806 -26.801 0.102   1.00 23.87  ?  415 LEU A CB   1 
ATOM   1063 C CG   . LEU A 1 84  ? -18.462 -25.877 -0.925  1.00 26.80  ?  415 LEU A CG   1 
ATOM   1064 C CD1  . LEU A 1 84  ? -19.866 -26.365 -1.254  1.00 34.56  ?  415 LEU A CD1  1 
ATOM   1065 C CD2  . LEU A 1 84  ? -18.500 -24.425 -0.450  1.00 31.88  ?  415 LEU A CD2  1 
ATOM   1066 H H    . LEU A 1 84  ? -15.632 -27.545 -1.051  1.00 30.19  ?  415 LEU A H    1 
ATOM   1067 H HA   . LEU A 1 84  ? -16.279 -25.547 0.662   1.00 29.39  ?  415 LEU A HA   1 
ATOM   1068 H HB2  . LEU A 1 84  ? -17.850 -27.703 -0.252  1.00 28.65  ?  415 LEU A HB2  1 
ATOM   1069 H HB3  . LEU A 1 84  ? -18.332 -26.749 0.915   1.00 28.65  ?  415 LEU A HB3  1 
ATOM   1070 H HG   . LEU A 1 84  ? -17.942 -25.904 -1.743  1.00 32.16  ?  415 LEU A HG   1 
ATOM   1071 H HD11 . LEU A 1 84  ? -20.264 -25.766 -1.905  1.00 41.47  ?  415 LEU A HD11 1 
ATOM   1072 H HD12 . LEU A 1 84  ? -19.811 -27.262 -1.619  1.00 41.47  ?  415 LEU A HD12 1 
ATOM   1073 H HD13 . LEU A 1 84  ? -20.397 -26.370 -0.442  1.00 41.47  ?  415 LEU A HD13 1 
ATOM   1074 H HD21 . LEU A 1 84  ? -18.923 -23.881 -1.132  1.00 38.26  ?  415 LEU A HD21 1 
ATOM   1075 H HD22 . LEU A 1 84  ? -19.008 -24.376 0.375   1.00 38.26  ?  415 LEU A HD22 1 
ATOM   1076 H HD23 . LEU A 1 84  ? -17.592 -24.119 -0.298  1.00 38.26  ?  415 LEU A HD23 1 
ATOM   1077 N N    . HIS A 1 85  ? -15.906 -26.583 2.803   1.00 21.53  ?  416 HIS A N    1 
ATOM   1078 C CA   . HIS A 1 85  ? -15.454 -27.128 4.068   1.00 22.70  ?  416 HIS A CA   1 
ATOM   1079 C C    . HIS A 1 85  ? -16.524 -26.978 5.131   1.00 32.19  ?  416 HIS A C    1 
ATOM   1080 O O    . HIS A 1 85  ? -17.271 -25.998 5.138   1.00 27.68  ?  416 HIS A O    1 
ATOM   1081 C CB   . HIS A 1 85  ? -14.171 -26.419 4.499   1.00 25.33  ?  416 HIS A CB   1 
ATOM   1082 C CG   . HIS A 1 85  ? -12.995 -26.741 3.637   1.00 28.62  ?  416 HIS A CG   1 
ATOM   1083 N ND1  . HIS A 1 85  ? -12.025 -27.648 4.003   1.00 33.98  ?  416 HIS A ND1  1 
ATOM   1084 C CD2  . HIS A 1 85  ? -12.635 -26.278 2.414   1.00 26.80  ?  416 HIS A CD2  1 
ATOM   1085 C CE1  . HIS A 1 85  ? -11.115 -27.729 3.045   1.00 32.81  ?  416 HIS A CE1  1 
ATOM   1086 N NE2  . HIS A 1 85  ? -11.466 -26.905 2.072   1.00 25.46  ?  416 HIS A NE2  1 
ATOM   1087 H H    . HIS A 1 85  ? -16.162 -25.764 2.859   1.00 25.84  ?  416 HIS A H    1 
ATOM   1088 H HA   . HIS A 1 85  ? -15.260 -28.073 3.960   1.00 27.24  ?  416 HIS A HA   1 
ATOM   1089 H HB2  . HIS A 1 85  ? -14.315 -25.460 4.460   1.00 30.39  ?  416 HIS A HB2  1 
ATOM   1090 H HB3  . HIS A 1 85  ? -13.956 -26.683 5.407   1.00 30.39  ?  416 HIS A HB3  1 
ATOM   1091 H HD1  . HIS A 1 85  ? -12.012 -28.091 4.739   1.00 40.77  ?  416 HIS A HD1  1 
ATOM   1092 H HD2  . HIS A 1 85  ? -13.094 -25.651 1.904   1.00 32.15  ?  416 HIS A HD2  1 
ATOM   1093 H HE1  . HIS A 1 85  ? -10.359 -28.271 3.055   1.00 39.37  ?  416 HIS A HE1  1 
ATOM   1094 N N    . ASP A 1 86  ? -16.605 -27.968 6.013   1.00 32.53  ?  417 ASP A N    1 
ATOM   1095 C CA   . ASP A 1 86  ? -17.454 -27.885 7.190   1.00 28.64  ?  417 ASP A CA   1 
ATOM   1096 C C    . ASP A 1 86  ? -18.921 -27.640 6.812   1.00 26.81  ?  417 ASP A C    1 
ATOM   1097 O O    . ASP A 1 86  ? -19.589 -26.792 7.409   1.00 28.31  ?  417 ASP A O    1 
ATOM   1098 C CB   . ASP A 1 86  ? -16.936 -26.772 8.103   1.00 34.52  ?  417 ASP A CB   1 
ATOM   1099 C CG   . ASP A 1 86  ? -17.619 -26.744 9.448   1.00 40.16  ?  417 ASP A CG   1 
ATOM   1100 O OD1  . ASP A 1 86  ? -17.916 -27.828 9.996   1.00 47.30  ?  417 ASP A OD1  1 
ATOM   1101 O OD2  . ASP A 1 86  ? -17.857 -25.625 9.949   1.00 49.75  ?  417 ASP A OD2  1 
ATOM   1102 H H    . ASP A 1 86  ? -16.171 -28.708 5.949   1.00 39.04  ?  417 ASP A H    1 
ATOM   1103 H HA   . ASP A 1 86  ? -17.405 -28.723 7.677   1.00 34.37  ?  417 ASP A HA   1 
ATOM   1104 H HB2  . ASP A 1 86  ? -15.986 -26.904 8.252   1.00 41.43  ?  417 ASP A HB2  1 
ATOM   1105 H HB3  . ASP A 1 86  ? -17.087 -25.916 7.673   1.00 41.43  ?  417 ASP A HB3  1 
ATOM   1106 N N    . PRO A 1 87  ? -19.426 -28.372 5.806   1.00 30.84  ?  418 PRO A N    1 
ATOM   1107 C CA   . PRO A 1 87  ? -20.812 -28.101 5.423   1.00 31.00  ?  418 PRO A CA   1 
ATOM   1108 C C    . PRO A 1 87  ? -21.797 -28.637 6.452   1.00 44.36  ?  418 PRO A C    1 
ATOM   1109 O O    . PRO A 1 87  ? -21.518 -29.622 7.135   1.00 34.97  ?  418 PRO A O    1 
ATOM   1110 C CB   . PRO A 1 87  ? -20.953 -28.825 4.086   1.00 30.05  ?  418 PRO A CB   1 
ATOM   1111 C CG   . PRO A 1 87  ? -19.997 -29.953 4.179   1.00 40.67  ?  418 PRO A CG   1 
ATOM   1112 C CD   . PRO A 1 87  ? -18.838 -29.458 5.001   1.00 38.60  ?  418 PRO A CD   1 
ATOM   1113 H HA   . PRO A 1 87  ? -20.953 -27.150 5.297   1.00 37.21  ?  418 PRO A HA   1 
ATOM   1114 H HB2  . PRO A 1 87  ? -21.861 -29.150 3.982   1.00 36.06  ?  418 PRO A HB2  1 
ATOM   1115 H HB3  . PRO A 1 87  ? -20.713 -28.228 3.361   1.00 36.06  ?  418 PRO A HB3  1 
ATOM   1116 H HG2  . PRO A 1 87  ? -20.425 -30.705 4.616   1.00 48.81  ?  418 PRO A HG2  1 
ATOM   1117 H HG3  . PRO A 1 87  ? -19.700 -30.200 3.289   1.00 48.81  ?  418 PRO A HG3  1 
ATOM   1118 H HD2  . PRO A 1 87  ? -18.506 -30.164 5.577   1.00 46.32  ?  418 PRO A HD2  1 
ATOM   1119 H HD3  . PRO A 1 87  ? -18.139 -29.111 4.425   1.00 46.32  ?  418 PRO A HD3  1 
ATOM   1120 N N    . ALA A 1 88  ? -22.934 -27.967 6.571   1.00 26.65  ?  419 ALA A N    1 
ATOM   1121 C CA   . ALA A 1 88  ? -23.994 -28.400 7.468   1.00 29.55  ?  419 ALA A CA   1 
ATOM   1122 C C    . ALA A 1 88  ? -25.321 -27.961 6.890   1.00 25.18  ?  419 ALA A C    1 
ATOM   1123 O O    . ALA A 1 88  ? -25.387 -26.948 6.198   1.00 21.16  ?  419 ALA A O    1 
ATOM   1124 C CB   . ALA A 1 88  ? -23.799 -27.822 8.857   1.00 34.97  ?  419 ALA A CB   1 
ATOM   1125 H H    . ALA A 1 88  ? -23.119 -27.248 6.136   1.00 31.98  ?  419 ALA A H    1 
ATOM   1126 H HA   . ALA A 1 88  ? -23.990 -29.368 7.533   1.00 35.46  ?  419 ALA A HA   1 
ATOM   1127 H HB1  . ALA A 1 88  ? -24.519 -28.128 9.430   1.00 41.97  ?  419 ALA A HB1  1 
ATOM   1128 H HB2  . ALA A 1 88  ? -22.946 -28.123 9.207   1.00 41.97  ?  419 ALA A HB2  1 
ATOM   1129 H HB3  . ALA A 1 88  ? -23.810 -26.853 8.800   1.00 41.97  ?  419 ALA A HB3  1 
ATOM   1130 N N    . VAL A 1 89  ? -26.372 -28.726 7.166   1.00 20.68  ?  420 VAL A N    1 
ATOM   1131 C CA   . VAL A 1 89  ? -27.718 -28.357 6.752   1.00 22.07  ?  420 VAL A CA   1 
ATOM   1132 C C    . VAL A 1 89  ? -28.655 -28.345 7.935   1.00 24.12  ?  420 VAL A C    1 
ATOM   1133 O O    . VAL A 1 89  ? -28.569 -29.203 8.812   1.00 30.23  ?  420 VAL A O    1 
ATOM   1134 C CB   . VAL A 1 89  ? -28.305 -29.319 5.714   1.00 31.79  ?  420 VAL A CB   1 
ATOM   1135 C CG1  . VAL A 1 89  ? -29.576 -28.724 5.114   1.00 28.36  ?  420 VAL A CG1  1 
ATOM   1136 C CG2  . VAL A 1 89  ? -27.313 -29.606 4.643   1.00 44.28  ?  420 VAL A CG2  1 
ATOM   1137 H H    . VAL A 1 89  ? -26.329 -29.470 7.596   1.00 24.81  ?  420 VAL A H    1 
ATOM   1138 H HA   . VAL A 1 89  ? -27.702 -27.466 6.367   1.00 26.48  ?  420 VAL A HA   1 
ATOM   1139 H HB   . VAL A 1 89  ? -28.536 -30.156 6.147   1.00 38.15  ?  420 VAL A HB   1 
ATOM   1140 H HG11 . VAL A 1 89  ? -29.936 -29.342 4.460   1.00 34.03  ?  420 VAL A HG11 1 
ATOM   1141 H HG12 . VAL A 1 89  ? -30.222 -28.579 5.824   1.00 34.03  ?  420 VAL A HG12 1 
ATOM   1142 H HG13 . VAL A 1 89  ? -29.358 -27.880 4.687   1.00 34.03  ?  420 VAL A HG13 1 
ATOM   1143 H HG21 . VAL A 1 89  ? -27.710 -30.216 4.001   1.00 53.14  ?  420 VAL A HG21 1 
ATOM   1144 H HG22 . VAL A 1 89  ? -27.073 -28.775 4.205   1.00 53.14  ?  420 VAL A HG22 1 
ATOM   1145 H HG23 . VAL A 1 89  ? -26.527 -30.010 5.041   1.00 53.14  ?  420 VAL A HG23 1 
ATOM   1146 N N    . GLN A 1 90  ? -29.554 -27.372 7.938   1.00 25.02  ?  421 GLN A N    1 
ATOM   1147 C CA   . GLN A 1 90  ? -30.637 -27.318 8.899   1.00 27.02  ?  421 GLN A CA   1 
ATOM   1148 C C    . GLN A 1 90  ? -31.947 -27.223 8.145   1.00 27.98  ?  421 GLN A C    1 
ATOM   1149 O O    . GLN A 1 90  ? -32.099 -26.383 7.261   1.00 23.97  ?  421 GLN A O    1 
ATOM   1150 C CB   . GLN A 1 90  ? -30.463 -26.126 9.835   1.00 33.15  ?  421 GLN A CB   1 
ATOM   1151 C CG   . GLN A 1 90  ? -29.121 -26.108 10.548  1.00 35.76  ?  421 GLN A CG   1 
ATOM   1152 C CD   . GLN A 1 90  ? -28.831 -24.782 11.227  1.00 61.94  ?  421 GLN A CD   1 
ATOM   1153 O OE1  . GLN A 1 90  ? -28.104 -23.934 10.684  1.00 46.30  ?  421 GLN A OE1  1 
ATOM   1154 N NE2  . GLN A 1 90  ? -29.431 -24.576 12.398  1.00 46.06  ?  421 GLN A NE2  1 
ATOM   1155 H H    . GLN A 1 90  ? -29.556 -26.718 7.379   1.00 30.03  ?  421 GLN A H    1 
ATOM   1156 H HA   . GLN A 1 90  ? -30.642 -28.131 9.429   1.00 32.42  ?  421 GLN A HA   1 
ATOM   1157 H HB2  . GLN A 1 90  ? -30.538 -25.308 9.319   1.00 39.77  ?  421 GLN A HB2  1 
ATOM   1158 H HB3  . GLN A 1 90  ? -31.159 -26.154 10.511  1.00 39.77  ?  421 GLN A HB3  1 
ATOM   1159 H HG2  . GLN A 1 90  ? -29.115 -26.800 11.228  1.00 42.92  ?  421 GLN A HG2  1 
ATOM   1160 H HG3  . GLN A 1 90  ? -28.417 -26.273 9.901   1.00 42.92  ?  421 GLN A HG3  1 
ATOM   1161 H HE21 . GLN A 1 90  ? -29.949 -25.179 12.727  1.00 55.27  ?  421 GLN A HE21 1 
ATOM   1162 H HE22 . GLN A 1 90  ? -29.301 -23.841 12.825  1.00 55.27  ?  421 GLN A HE22 1 
ATOM   1163 N N    . MET A 1 91  ? -32.880 -28.105 8.491   1.00 24.02  ?  422 MET A N    1 
ATOM   1164 C CA   . MET A 1 91  ? -34.157 -28.206 7.798   1.00 23.97  ?  422 MET A CA   1 
ATOM   1165 C C    . MET A 1 91  ? -35.256 -27.498 8.566   1.00 27.43  ?  422 MET A C    1 
ATOM   1166 O O    . MET A 1 91  ? -35.389 -27.675 9.778   1.00 28.53  ?  422 MET A O    1 
ATOM   1167 C CB   . MET A 1 91  ? -34.550 -29.674 7.607   1.00 28.65  ?  422 MET A CB   1 
ATOM   1168 C CG   . MET A 1 91  ? -33.503 -30.523 6.920   1.00 33.76  ?  422 MET A CG   1 
ATOM   1169 S SD   . MET A 1 91  ? -33.139 -29.966 5.246   1.00 41.74  ?  422 MET A SD   1 
ATOM   1170 C CE   . MET A 1 91  ? -34.735 -30.172 4.469   1.00 41.39  ?  422 MET A CE   1 
ATOM   1171 H H    . MET A 1 91  ? -32.794 -28.666 9.138   1.00 28.82  ?  422 MET A H    1 
ATOM   1172 H HA   . MET A 1 91  ? -34.073 -27.802 6.921   1.00 28.76  ?  422 MET A HA   1 
ATOM   1173 H HB2  . MET A 1 91  ? -34.719 -30.065 8.479   1.00 34.38  ?  422 MET A HB2  1 
ATOM   1174 H HB3  . MET A 1 91  ? -35.357 -29.712 7.071   1.00 34.38  ?  422 MET A HB3  1 
ATOM   1175 H HG2  . MET A 1 91  ? -32.681 -30.487 7.433   1.00 40.51  ?  422 MET A HG2  1 
ATOM   1176 H HG3  . MET A 1 91  ? -33.822 -31.438 6.869   1.00 40.51  ?  422 MET A HG3  1 
ATOM   1177 H HE1  . MET A 1 91  ? -34.670 -29.899 3.540   1.00 49.67  ?  422 MET A HE1  1 
ATOM   1178 H HE2  . MET A 1 91  ? -34.993 -31.105 4.523   1.00 49.67  ?  422 MET A HE2  1 
ATOM   1179 H HE3  . MET A 1 91  ? -35.384 -29.621 4.932   1.00 49.67  ?  422 MET A HE3  1 
ATOM   1180 N N    . PHE A 1 92  ? -36.045 -26.705 7.851   1.00 25.06  ?  423 PHE A N    1 
ATOM   1181 C CA   . PHE A 1 92  ? -37.220 -26.055 8.413   1.00 27.84  ?  423 PHE A CA   1 
ATOM   1182 C C    . PHE A 1 92  ? -38.357 -26.197 7.416   1.00 31.29  ?  423 PHE A C    1 
ATOM   1183 O O    . PHE A 1 92  ? -38.535 -25.365 6.530   1.00 25.26  ?  423 PHE A O    1 
ATOM   1184 C CB   . PHE A 1 92  ? -36.931 -24.586 8.731   1.00 28.63  ?  423 PHE A CB   1 
ATOM   1185 C CG   . PHE A 1 92  ? -35.769 -24.398 9.663   1.00 28.13  ?  423 PHE A CG   1 
ATOM   1186 C CD1  . PHE A 1 92  ? -35.955 -24.408 11.034  1.00 41.88  ?  423 PHE A CD1  1 
ATOM   1187 C CD2  . PHE A 1 92  ? -34.487 -24.242 9.167   1.00 31.94  ?  423 PHE A CD2  1 
ATOM   1188 C CE1  . PHE A 1 92  ? -34.881 -24.249 11.892  1.00 31.86  ?  423 PHE A CE1  1 
ATOM   1189 C CE2  . PHE A 1 92  ? -33.413 -24.084 10.021  1.00 33.11  ?  423 PHE A CE2  1 
ATOM   1190 C CZ   . PHE A 1 92  ? -33.612 -24.089 11.384  1.00 30.40  ?  423 PHE A CZ   1 
ATOM   1191 H H    . PHE A 1 92  ? -35.917 -26.526 7.020   1.00 30.08  ?  423 PHE A H    1 
ATOM   1192 H HA   . PHE A 1 92  ? -37.474 -26.502 9.236   1.00 33.41  ?  423 PHE A HA   1 
ATOM   1193 H HB2  . PHE A 1 92  ? -36.729 -24.120 7.904   1.00 34.36  ?  423 PHE A HB2  1 
ATOM   1194 H HB3  . PHE A 1 92  ? -37.715 -24.195 9.147   1.00 34.36  ?  423 PHE A HB3  1 
ATOM   1195 H HD1  . PHE A 1 92  ? -36.810 -24.517 11.382  1.00 50.26  ?  423 PHE A HD1  1 
ATOM   1196 H HD2  . PHE A 1 92  ? -34.347 -24.239 8.248   1.00 38.33  ?  423 PHE A HD2  1 
ATOM   1197 H HE1  . PHE A 1 92  ? -35.016 -24.252 12.812  1.00 38.23  ?  423 PHE A HE1  1 
ATOM   1198 H HE2  . PHE A 1 92  ? -32.557 -23.975 9.676   1.00 39.73  ?  423 PHE A HE2  1 
ATOM   1199 H HZ   . PHE A 1 92  ? -32.890 -23.980 11.960  1.00 36.48  ?  423 PHE A HZ   1 
ATOM   1200 N N    . GLY A 1 93  ? -39.116 -27.278 7.551   1.00 42.25  ?  424 GLY A N    1 
ATOM   1201 C CA   . GLY A 1 93  ? -40.153 -27.587 6.588   1.00 38.10  ?  424 GLY A CA   1 
ATOM   1202 C C    . GLY A 1 93  ? -39.541 -27.817 5.220   1.00 25.23  ?  424 GLY A C    1 
ATOM   1203 O O    . GLY A 1 93  ? -38.665 -28.669 5.059   1.00 32.24  ?  424 GLY A O    1 
ATOM   1204 H H    . GLY A 1 93  ? -39.047 -27.847 8.192   1.00 50.70  ?  424 GLY A H    1 
ATOM   1205 H HA2  . GLY A 1 93  ? -40.629 -28.387 6.859   1.00 45.72  ?  424 GLY A HA2  1 
ATOM   1206 H HA3  . GLY A 1 93  ? -40.782 -26.850 6.531   1.00 45.72  ?  424 GLY A HA3  1 
ATOM   1207 N N    . ASP A 1 94  ? -39.994 -27.044 4.236   1.00 23.13  ?  425 ASP A N    1 
ATOM   1208 C CA   . ASP A 1 94  ? -39.510 -27.175 2.868   1.00 25.51  ?  425 ASP A CA   1 
ATOM   1209 C C    . ASP A 1 94  ? -38.274 -26.316 2.621   1.00 29.54  ?  425 ASP A C    1 
ATOM   1210 O O    . ASP A 1 94  ? -37.814 -26.210 1.486   1.00 26.71  ?  425 ASP A O    1 
ATOM   1211 C CB   . ASP A 1 94  ? -40.605 -26.788 1.873   1.00 29.54  ?  425 ASP A CB   1 
ATOM   1212 C CG   . ASP A 1 94  ? -41.749 -27.789 1.842   1.00 49.69  ?  425 ASP A CG   1 
ATOM   1213 O OD1  . ASP A 1 94  ? -41.540 -28.953 2.251   1.00 36.82  ?  425 ASP A OD1  1 
ATOM   1214 O OD2  . ASP A 1 94  ? -42.855 -27.411 1.402   1.00 57.70  ?  425 ASP A OD2  1 
ATOM   1215 H H    . ASP A 1 94  ? -40.588 -26.431 4.338   1.00 27.75  ?  425 ASP A H    1 
ATOM   1216 H HA   . ASP A 1 94  ? -39.269 -28.100 2.706   1.00 30.61  ?  425 ASP A HA   1 
ATOM   1217 H HB2  . ASP A 1 94  ? -40.969 -25.924 2.123   1.00 35.45  ?  425 ASP A HB2  1 
ATOM   1218 H HB3  . ASP A 1 94  ? -40.222 -26.742 0.983   1.00 35.45  ?  425 ASP A HB3  1 
ATOM   1219 N N    . THR A 1 95  ? -37.748 -25.707 3.681   1.00 24.60  ?  426 THR A N    1 
ATOM   1220 C CA   . THR A 1 95  ? -36.552 -24.871 3.578   1.00 23.20  ?  426 THR A CA   1 
ATOM   1221 C C    . THR A 1 95  ? -35.335 -25.592 4.144   1.00 23.74  ?  426 THR A C    1 
ATOM   1222 O O    . THR A 1 95  ? -35.414 -26.228 5.193   1.00 24.46  ?  426 THR A O    1 
ATOM   1223 C CB   . THR A 1 95  ? -36.735 -23.534 4.319   1.00 18.15  ?  426 THR A CB   1 
ATOM   1224 O OG1  . THR A 1 95  ? -37.792 -22.791 3.705   1.00 24.05  ?  426 THR A OG1  1 
ATOM   1225 C CG2  . THR A 1 95  ? -35.456 -22.701 4.267   1.00 28.78  ?  426 THR A CG2  1 
ATOM   1226 H H    . THR A 1 95  ? -38.067 -25.761 4.478   1.00 29.52  ?  426 THR A H    1 
ATOM   1227 H HA   . THR A 1 95  ? -36.380 -24.676 2.643   1.00 27.84  ?  426 THR A HA   1 
ATOM   1228 H HB   . THR A 1 95  ? -36.955 -23.704 5.248   1.00 21.78  ?  426 THR A HB   1 
ATOM   1229 H HG1  . THR A 1 95  ? -38.509 -23.228 3.742   1.00 28.86  ?  426 THR A HG1  1 
ATOM   1230 H HG21 . THR A 1 95  ? -35.587 -21.863 4.737   1.00 34.53  ?  426 THR A HG21 1 
ATOM   1231 H HG22 . THR A 1 95  ? -34.727 -23.187 4.685   1.00 34.53  ?  426 THR A HG22 1 
ATOM   1232 H HG23 . THR A 1 95  ? -35.221 -22.512 3.345   1.00 34.53  ?  426 THR A HG23 1 
ATOM   1233 N N    . ALA A 1 96  ? -34.214 -25.487 3.433   1.00 20.14  ?  427 ALA A N    1 
ATOM   1234 C CA   . ALA A 1 96  ? -32.941 -26.022 3.896   1.00 19.75  ?  427 ALA A CA   1 
ATOM   1235 C C    . ALA A 1 96  ? -31.898 -24.909 3.929   1.00 19.68  ?  427 ALA A C    1 
ATOM   1236 O O    . ALA A 1 96  ? -31.678 -24.233 2.927   1.00 21.94  ?  427 ALA A O    1 
ATOM   1237 C CB   . ALA A 1 96  ? -32.474 -27.159 2.997   1.00 26.40  ?  427 ALA A CB   1 
ATOM   1238 H H    . ALA A 1 96  ? -34.167 -25.103 2.665   1.00 24.16  ?  427 ALA A H    1 
ATOM   1239 H HA   . ALA A 1 96  ? -33.047 -26.368 4.796   1.00 23.70  ?  427 ALA A HA   1 
ATOM   1240 H HB1  . ALA A 1 96  ? -31.627 -27.495 3.328   1.00 31.67  ?  427 ALA A HB1  1 
ATOM   1241 H HB2  . ALA A 1 96  ? -33.139 -27.865 3.010   1.00 31.67  ?  427 ALA A HB2  1 
ATOM   1242 H HB3  . ALA A 1 96  ? -32.367 -26.822 2.093   1.00 31.67  ?  427 ALA A HB3  1 
ATOM   1243 N N    . ILE A 1 97  ? -31.274 -24.717 5.084   1.00 19.34  ?  428 ILE A N    1 
ATOM   1244 C CA   . ILE A 1 97  ? -30.205 -23.734 5.221   1.00 18.42  ?  428 ILE A CA   1 
ATOM   1245 C C    . ILE A 1 97  ? -28.880 -24.472 5.213   1.00 19.74  ?  428 ILE A C    1 
ATOM   1246 O O    . ILE A 1 97  ? -28.572 -25.197 6.154   1.00 20.17  ?  428 ILE A O    1 
ATOM   1247 C CB   . ILE A 1 97  ? -30.335 -22.909 6.516   1.00 21.04  ?  428 ILE A CB   1 
ATOM   1248 C CG1  . ILE A 1 97  ? -31.711 -22.240 6.589   1.00 25.05  ?  428 ILE A CG1  1 
ATOM   1249 C CG2  . ILE A 1 97  ? -29.231 -21.855 6.585   1.00 21.28  ?  428 ILE A CG2  1 
ATOM   1250 C CD1  . ILE A 1 97  ? -31.995 -21.586 7.917   1.00 35.34  ?  428 ILE A CD1  1 
ATOM   1251 H H    . ILE A 1 97  ? -31.451 -25.146 5.809   1.00 23.21  ?  428 ILE A H    1 
ATOM   1252 H HA   . ILE A 1 97  ? -30.224 -23.126 4.466   1.00 22.10  ?  428 ILE A HA   1 
ATOM   1253 H HB   . ILE A 1 97  ? -30.240 -23.507 7.275   1.00 25.25  ?  428 ILE A HB   1 
ATOM   1254 H HG12 . ILE A 1 97  ? -31.762 -21.556 5.903   1.00 30.07  ?  428 ILE A HG12 1 
ATOM   1255 H HG13 . ILE A 1 97  ? -32.394 -22.912 6.436   1.00 30.07  ?  428 ILE A HG13 1 
ATOM   1256 H HG21 . ILE A 1 97  ? -29.331 -21.348 7.406   1.00 25.54  ?  428 ILE A HG21 1 
ATOM   1257 H HG22 . ILE A 1 97  ? -28.369 -22.299 6.573   1.00 25.54  ?  428 ILE A HG22 1 
ATOM   1258 H HG23 . ILE A 1 97  ? -29.311 -21.264 5.820   1.00 25.54  ?  428 ILE A HG23 1 
ATOM   1259 H HD11 . ILE A 1 97  ? -32.878 -21.186 7.889   1.00 42.41  ?  428 ILE A HD11 1 
ATOM   1260 H HD12 . ILE A 1 97  ? -31.959 -22.259 8.614   1.00 42.41  ?  428 ILE A HD12 1 
ATOM   1261 H HD13 . ILE A 1 97  ? -31.327 -20.902 8.081   1.00 42.41  ?  428 ILE A HD13 1 
ATOM   1262 N N    . VAL A 1 98  ? -28.113 -24.302 4.139   1.00 16.73  ?  429 VAL A N    1 
ATOM   1263 C CA   . VAL A 1 98  ? -26.798 -24.917 4.029   1.00 15.00  ?  429 VAL A CA   1 
ATOM   1264 C C    . VAL A 1 98  ? -25.745 -23.885 4.394   1.00 21.88  ?  429 VAL A C    1 
ATOM   1265 O O    . VAL A 1 98  ? -25.716 -22.793 3.824   1.00 19.75  ?  429 VAL A O    1 
ATOM   1266 C CB   . VAL A 1 98  ? -26.514 -25.448 2.606   1.00 22.99  ?  429 VAL A CB   1 
ATOM   1267 C CG1  . VAL A 1 98  ? -25.115 -26.057 2.522   1.00 22.22  ?  429 VAL A CG1  1 
ATOM   1268 C CG2  . VAL A 1 98  ? -27.556 -26.476 2.198   1.00 24.12  ?  429 VAL A CG2  1 
ATOM   1269 H H    . VAL A 1 98  ? -28.335 -23.830 3.456   1.00 20.08  ?  429 VAL A H    1 
ATOM   1270 H HA   . VAL A 1 98  ? -26.733 -25.657 4.652   1.00 18.00  ?  429 VAL A HA   1 
ATOM   1271 H HB   . VAL A 1 98  ? -26.558 -24.710 1.979   1.00 27.59  ?  429 VAL A HB   1 
ATOM   1272 H HG11 . VAL A 1 98  ? -24.966 -26.381 1.620   1.00 26.67  ?  429 VAL A HG11 1 
ATOM   1273 H HG12 . VAL A 1 98  ? -24.460 -25.376 2.742   1.00 26.67  ?  429 VAL A HG12 1 
ATOM   1274 H HG13 . VAL A 1 98  ? -25.053 -26.792 3.153   1.00 26.67  ?  429 VAL A HG13 1 
ATOM   1275 H HG21 . VAL A 1 98  ? -27.354 -26.791 1.303   1.00 28.94  ?  429 VAL A HG21 1 
ATOM   1276 H HG22 . VAL A 1 98  ? -27.531 -27.216 2.824   1.00 28.94  ?  429 VAL A HG22 1 
ATOM   1277 H HG23 . VAL A 1 98  ? -28.433 -26.060 2.212   1.00 28.94  ?  429 VAL A HG23 1 
ATOM   1278 N N    . THR A 1 99  ? -24.888 -24.239 5.343   1.00 18.51  ?  430 THR A N    1 
ATOM   1279 C CA   . THR A 1 99  ? -23.779 -23.378 5.728   1.00 16.19  ?  430 THR A CA   1 
ATOM   1280 C C    . THR A 1 99  ? -22.473 -24.097 5.436   1.00 20.67  ?  430 THR A C    1 
ATOM   1281 O O    . THR A 1 99  ? -22.390 -25.314 5.551   1.00 20.21  ?  430 THR A O    1 
ATOM   1282 C CB   . THR A 1 99  ? -23.860 -22.986 7.214   1.00 19.54  ?  430 THR A CB   1 
ATOM   1283 O OG1  . THR A 1 99  ? -23.975 -24.161 8.023   1.00 22.92  ?  430 THR A OG1  1 
ATOM   1284 C CG2  . THR A 1 99  ? -25.070 -22.096 7.457   1.00 19.66  ?  430 THR A CG2  1 
ATOM   1285 H H    . THR A 1 99  ? -24.927 -24.977 5.782   1.00 22.22  ?  430 THR A H    1 
ATOM   1286 H HA   . THR A 1 99  ? -23.805 -22.566 5.198   1.00 19.43  ?  430 THR A HA   1 
ATOM   1287 H HB   . THR A 1 99  ? -23.062 -22.496 7.465   1.00 23.45  ?  430 THR A HB   1 
ATOM   1288 H HG1  . THR A 1 99  ? -23.307 -24.656 7.908   1.00 27.51  ?  430 THR A HG1  1 
ATOM   1289 H HG21 . THR A 1 99  ? -25.118 -21.851 8.394   1.00 23.60  ?  430 THR A HG21 1 
ATOM   1290 H HG22 . THR A 1 99  ? -25.000 -21.290 6.923   1.00 23.60  ?  430 THR A HG22 1 
ATOM   1291 H HG23 . THR A 1 99  ? -25.882 -22.567 7.212   1.00 23.60  ?  430 THR A HG23 1 
ATOM   1292 N N    . ALA A 1 100 ? -21.456 -23.343 5.038   1.00 17.46  ?  431 ALA A N    1 
ATOM   1293 C CA   . ALA A 1 100 ? -20.170 -23.938 4.717   1.00 19.39  ?  431 ALA A CA   1 
ATOM   1294 C C    . ALA A 1 100 ? -19.092 -22.876 4.651   1.00 23.63  ?  431 ALA A C    1 
ATOM   1295 O O    . ALA A 1 100 ? -19.387 -21.679 4.595   1.00 17.88  ?  431 ALA A O    1 
ATOM   1296 C CB   . ALA A 1 100 ? -20.249 -24.690 3.397   1.00 19.12  ?  431 ALA A CB   1 
ATOM   1297 H H    . ALA A 1 100 ? -21.486 -22.488 4.946   1.00 20.95  ?  431 ALA A H    1 
ATOM   1298 H HA   . ALA A 1 100 ? -19.929 -24.570 5.412   1.00 23.27  ?  431 ALA A HA   1 
ATOM   1299 H HB1  . ALA A 1 100 ? -19.382 -25.078 3.203   1.00 22.95  ?  431 ALA A HB1  1 
ATOM   1300 H HB2  . ALA A 1 100 ? -20.916 -25.391 3.473   1.00 22.95  ?  431 ALA A HB2  1 
ATOM   1301 H HB3  . ALA A 1 100 ? -20.500 -24.069 2.695   1.00 22.95  ?  431 ALA A HB3  1 
ATOM   1302 N N    . LEU A 1 101 ? -17.845 -23.329 4.672   1.00 19.48  ?  432 LEU A N    1 
ATOM   1303 C CA   . LEU A 1 101 ? -16.702 -22.466 4.426   1.00 20.45  ?  432 LEU A CA   1 
ATOM   1304 C C    . LEU A 1 101 ? -16.158 -22.779 3.043   1.00 27.05  ?  432 LEU A C    1 
ATOM   1305 O O    . LEU A 1 101 ? -15.871 -23.931 2.723   1.00 28.11  ?  432 LEU A O    1 
ATOM   1306 C CB   . LEU A 1 101 ? -15.618 -22.663 5.486   1.00 19.08  ?  432 LEU A CB   1 
ATOM   1307 C CG   . LEU A 1 101 ? -16.005 -22.366 6.936   1.00 25.09  ?  432 LEU A CG   1 
ATOM   1308 C CD1  . LEU A 1 101 ? -14.869 -22.749 7.872   1.00 30.02  ?  432 LEU A CD1  1 
ATOM   1309 C CD2  . LEU A 1 101 ? -16.372 -20.901 7.107   1.00 24.78  ?  432 LEU A CD2  1 
ATOM   1310 H H    . LEU A 1 101 ? -17.633 -24.147 4.830   1.00 23.38  ?  432 LEU A H    1 
ATOM   1311 H HA   . LEU A 1 101 ? -16.986 -21.539 4.444   1.00 24.54  ?  432 LEU A HA   1 
ATOM   1312 H HB2  . LEU A 1 101 ? -15.326 -23.587 5.451   1.00 22.89  ?  432 LEU A HB2  1 
ATOM   1313 H HB3  . LEU A 1 101 ? -14.872 -22.084 5.265   1.00 22.89  ?  432 LEU A HB3  1 
ATOM   1314 H HG   . LEU A 1 101 ? -16.780 -22.899 7.172   1.00 30.11  ?  432 LEU A HG   1 
ATOM   1315 H HD11 . LEU A 1 101 ? -15.134 -22.553 8.785   1.00 36.03  ?  432 LEU A HD11 1 
ATOM   1316 H HD12 . LEU A 1 101 ? -14.687 -23.696 7.776   1.00 36.03  ?  432 LEU A HD12 1 
ATOM   1317 H HD13 . LEU A 1 101 ? -14.081 -22.234 7.638   1.00 36.03  ?  432 LEU A HD13 1 
ATOM   1318 H HD21 . LEU A 1 101 ? -16.612 -20.742 8.034   1.00 29.73  ?  432 LEU A HD21 1 
ATOM   1319 H HD22 . LEU A 1 101 ? -15.608 -20.355 6.865   1.00 29.73  ?  432 LEU A HD22 1 
ATOM   1320 H HD23 . LEU A 1 101 ? -17.124 -20.695 6.530   1.00 29.73  ?  432 LEU A HD23 1 
ATOM   1321 N N    . ARG A 1 102 ? -16.039 -21.744 2.223   1.00 21.08  ?  433 ARG A N    1 
ATOM   1322 C CA   . ARG A 1 102 ? -15.558 -21.880 0.858   1.00 21.56  ?  433 ARG A CA   1 
ATOM   1323 C C    . ARG A 1 102 ? -14.100 -21.451 0.811   1.00 23.97  ?  433 ARG A C    1 
ATOM   1324 O O    . ARG A 1 102 ? -13.779 -20.315 1.157   1.00 21.80  ?  433 ARG A O    1 
ATOM   1325 C CB   . ARG A 1 102 ? -16.423 -21.031 -0.077  1.00 26.85  ?  433 ARG A CB   1 
ATOM   1326 C CG   . ARG A 1 102 ? -16.100 -21.115 -1.555  1.00 32.34  ?  433 ARG A CG   1 
ATOM   1327 C CD   . ARG A 1 102 ? -16.803 -19.980 -2.282  1.00 41.08  ?  433 ARG A CD   1 
ATOM   1328 N NE   . ARG A 1 102 ? -16.925 -20.200 -3.720  1.00 52.30  ?  433 ARG A NE   1 
ATOM   1329 C CZ   . ARG A 1 102 ? -17.999 -20.710 -4.320  1.00 41.80  ?  433 ARG A CZ   1 
ATOM   1330 N NH1  . ARG A 1 102 ? -19.066 -21.070 -3.617  1.00 44.70  ?  433 ARG A NH1  1 
ATOM   1331 N NH2  . ARG A 1 102 ? -18.004 -20.859 -5.637  1.00 54.27  ?  433 ARG A NH2  1 
ATOM   1332 H H    . ARG A 1 102 ? -16.236 -20.935 2.440   1.00 25.29  ?  433 ARG A H    1 
ATOM   1333 H HA   . ARG A 1 102 ? -15.619 -22.808 0.581   1.00 25.88  ?  433 ARG A HA   1 
ATOM   1334 H HB2  . ARG A 1 102 ? -17.347 -21.305 0.031   1.00 32.22  ?  433 ARG A HB2  1 
ATOM   1335 H HB3  . ARG A 1 102 ? -16.331 -20.102 0.185   1.00 32.22  ?  433 ARG A HB3  1 
ATOM   1336 H HG2  . ARG A 1 102 ? -15.144 -21.025 -1.687  1.00 38.81  ?  433 ARG A HG2  1 
ATOM   1337 H HG3  . ARG A 1 102 ? -16.419 -21.958 -1.913  1.00 38.81  ?  433 ARG A HG3  1 
ATOM   1338 H HD2  . ARG A 1 102 ? -17.697 -19.880 -1.918  1.00 49.29  ?  433 ARG A HD2  1 
ATOM   1339 H HD3  . ARG A 1 102 ? -16.299 -19.162 -2.147  1.00 49.29  ?  433 ARG A HD3  1 
ATOM   1340 H HE   . ARG A 1 102 ? -16.256 -19.985 -4.215  1.00 62.76  ?  433 ARG A HE   1 
ATOM   1341 H HH11 . ARG A 1 102 ? -19.071 -20.974 -2.763  1.00 53.64  ?  433 ARG A HH11 1 
ATOM   1342 H HH12 . ARG A 1 102 ? -19.753 -21.399 -4.017  1.00 53.64  ?  433 ARG A HH12 1 
ATOM   1343 H HH21 . ARG A 1 102 ? -17.316 -20.630 -6.098  1.00 65.13  ?  433 ARG A HH21 1 
ATOM   1344 H HH22 . ARG A 1 102 ? -18.694 -21.191 -6.029  1.00 65.13  ?  433 ARG A HH22 1 
ATOM   1345 N N    . VAL A 1 103 ? -13.219 -22.367 0.417   1.00 19.64  ?  434 VAL A N    1 
ATOM   1346 C CA   . VAL A 1 103 ? -11.800 -22.056 0.302   1.00 18.03  ?  434 VAL A CA   1 
ATOM   1347 C C    . VAL A 1 103 ? -11.406 -22.027 -1.164  1.00 22.66  ?  434 VAL A C    1 
ATOM   1348 O O    . VAL A 1 103 ? -11.637 -22.993 -1.894  1.00 25.36  ?  434 VAL A O    1 
ATOM   1349 C CB   . VAL A 1 103 ? -10.931 -23.073 1.060   1.00 27.17  ?  434 VAL A CB   1 
ATOM   1350 C CG1  . VAL A 1 103 ? -9.451  -22.781 0.851   1.00 29.75  ?  434 VAL A CG1  1 
ATOM   1351 C CG2  . VAL A 1 103 ? -11.263 -23.039 2.534   1.00 27.93  ?  434 VAL A CG2  1 
ATOM   1352 H H    . VAL A 1 103 ? -13.419 -23.177 0.210   1.00 23.57  ?  434 VAL A H    1 
ATOM   1353 H HA   . VAL A 1 103 ? -11.634 -21.177 0.678   1.00 21.63  ?  434 VAL A HA   1 
ATOM   1354 H HB   . VAL A 1 103 ? -11.116 -23.965 0.726   1.00 32.60  ?  434 VAL A HB   1 
ATOM   1355 H HG11 . VAL A 1 103 ? -8.929  -23.437 1.339   1.00 35.70  ?  434 VAL A HG11 1 
ATOM   1356 H HG12 . VAL A 1 103 ? -9.249  -22.836 -0.096  1.00 35.70  ?  434 VAL A HG12 1 
ATOM   1357 H HG13 . VAL A 1 103 ? -9.256  -21.890 1.181   1.00 35.70  ?  434 VAL A HG13 1 
ATOM   1358 H HG21 . VAL A 1 103 ? -10.707 -23.686 2.997   1.00 33.51  ?  434 VAL A HG21 1 
ATOM   1359 H HG22 . VAL A 1 103 ? -11.090 -22.148 2.876   1.00 33.51  ?  434 VAL A HG22 1 
ATOM   1360 H HG23 . VAL A 1 103 ? -12.200 -23.263 2.651   1.00 33.51  ?  434 VAL A HG23 1 
ATOM   1361 N N    . VAL A 1 104 ? -10.808 -20.913 -1.577  1.00 20.89  ?  435 VAL A N    1 
ATOM   1362 C CA   . VAL A 1 104 ? -10.463 -20.691 -2.972  1.00 21.90  ?  435 VAL A CA   1 
ATOM   1363 C C    . VAL A 1 104 ? -8.971  -20.458 -3.116  1.00 19.97  ?  435 VAL A C    1 
ATOM   1364 O O    . VAL A 1 104 ? -8.410  -19.567 -2.483  1.00 21.34  ?  435 VAL A O    1 
ATOM   1365 C CB   . VAL A 1 104 ? -11.218 -19.482 -3.562  1.00 23.57  ?  435 VAL A CB   1 
ATOM   1366 C CG1  . VAL A 1 104 ? -10.930 -19.348 -5.059  1.00 29.68  ?  435 VAL A CG1  1 
ATOM   1367 C CG2  . VAL A 1 104 ? -12.714 -19.624 -3.322  1.00 29.01  ?  435 VAL A CG2  1 
ATOM   1368 H H    . VAL A 1 104 ? -10.589 -20.263 -1.058  1.00 25.06  ?  435 VAL A H    1 
ATOM   1369 H HA   . VAL A 1 104 ? -10.699 -21.477 -3.488  1.00 26.28  ?  435 VAL A HA   1 
ATOM   1370 H HB   . VAL A 1 104 ? -10.916 -18.672 -3.122  1.00 28.28  ?  435 VAL A HB   1 
ATOM   1371 H HG11 . VAL A 1 104 ? -11.415 -18.583 -5.406  1.00 35.62  ?  435 VAL A HG11 1 
ATOM   1372 H HG12 . VAL A 1 104 ? -9.976  -19.221 -5.186  1.00 35.62  ?  435 VAL A HG12 1 
ATOM   1373 H HG13 . VAL A 1 104 ? -11.220 -20.156 -5.509  1.00 35.62  ?  435 VAL A HG13 1 
ATOM   1374 H HG21 . VAL A 1 104 ? -13.168 -18.855 -3.700  1.00 34.82  ?  435 VAL A HG21 1 
ATOM   1375 H HG22 . VAL A 1 104 ? -13.026 -20.437 -3.749  1.00 34.82  ?  435 VAL A HG22 1 
ATOM   1376 H HG23 . VAL A 1 104 ? -12.877 -19.668 -2.366  1.00 34.82  ?  435 VAL A HG23 1 
ATOM   1377 N N    . GLN A 1 105 ? -8.346  -21.287 -3.945  1.00 23.67  ?  436 GLN A N    1 
ATOM   1378 C CA   . GLN A 1 105 ? -6.962  -21.098 -4.353  1.00 24.57  ?  436 GLN A CA   1 
ATOM   1379 C C    . GLN A 1 105 ? -6.957  -20.347 -5.672  1.00 26.43  ?  436 GLN A C    1 
ATOM   1380 O O    . GLN A 1 105 ? -7.659  -20.733 -6.603  1.00 25.38  ?  436 GLN A O    1 
ATOM   1381 C CB   . GLN A 1 105 ? -6.245  -22.437 -4.516  1.00 22.82  ?  436 GLN A CB   1 
ATOM   1382 C CG   . GLN A 1 105 ? -6.120  -23.256 -3.253  1.00 25.84  ?  436 GLN A CG   1 
ATOM   1383 C CD   . GLN A 1 105 ? -5.359  -24.545 -3.496  1.00 24.75  ?  436 GLN A CD   1 
ATOM   1384 O OE1  . GLN A 1 105 ? -5.933  -25.552 -3.912  1.00 30.17  ?  436 GLN A OE1  1 
ATOM   1385 N NE2  . GLN A 1 105 ? -4.059  -24.514 -3.249  1.00 28.18  ?  436 GLN A NE2  1 
ATOM   1386 H H    . GLN A 1 105 ? -8.713  -21.983 -4.293  1.00 28.41  ?  436 GLN A H    1 
ATOM   1387 H HA   . GLN A 1 105 ? -6.493  -20.569 -3.689  1.00 29.48  ?  436 GLN A HA   1 
ATOM   1388 H HB2  . GLN A 1 105 ? -6.732  -22.970 -5.163  1.00 27.38  ?  436 GLN A HB2  1 
ATOM   1389 H HB3  . GLN A 1 105 ? -5.348  -22.267 -4.844  1.00 27.38  ?  436 GLN A HB3  1 
ATOM   1390 H HG2  . GLN A 1 105 ? -5.641  -22.742 -2.584  1.00 31.00  ?  436 GLN A HG2  1 
ATOM   1391 H HG3  . GLN A 1 105 ? -7.006  -23.483 -2.931  1.00 31.00  ?  436 GLN A HG3  1 
ATOM   1392 H HE21 . GLN A 1 105 ? -3.692  -23.789 -2.967  1.00 33.81  ?  436 GLN A HE21 1 
ATOM   1393 H HE22 . GLN A 1 105 ? -3.581  -25.219 -3.370  1.00 33.81  ?  436 GLN A HE22 1 
ATOM   1394 N N    . PHE A 1 106 ? -6.176  -19.279 -5.754  1.00 24.40  ?  437 PHE A N    1 
ATOM   1395 C CA   . PHE A 1 106 ? -6.096  -18.503 -6.983  1.00 30.63  ?  437 PHE A CA   1 
ATOM   1396 C C    . PHE A 1 106 ? -4.715  -17.884 -7.118  1.00 36.31  ?  437 PHE A C    1 
ATOM   1397 O O    . PHE A 1 106 ? -3.929  -17.896 -6.170  1.00 29.53  ?  437 PHE A O    1 
ATOM   1398 C CB   . PHE A 1 106 ? -7.179  -17.420 -7.006  1.00 32.99  ?  437 PHE A CB   1 
ATOM   1399 C CG   . PHE A 1 106 ? -7.021  -16.377 -5.936  1.00 34.40  ?  437 PHE A CG   1 
ATOM   1400 C CD1  . PHE A 1 106 ? -7.460  -16.615 -4.643  1.00 32.25  ?  437 PHE A CD1  1 
ATOM   1401 C CD2  . PHE A 1 106 ? -6.441  -15.154 -6.224  1.00 37.67  ?  437 PHE A CD2  1 
ATOM   1402 C CE1  . PHE A 1 106 ? -7.318  -15.654 -3.658  1.00 41.54  ?  437 PHE A CE1  1 
ATOM   1403 C CE2  . PHE A 1 106 ? -6.297  -14.189 -5.244  1.00 32.09  ?  437 PHE A CE2  1 
ATOM   1404 C CZ   . PHE A 1 106 ? -6.735  -14.439 -3.960  1.00 40.46  ?  437 PHE A CZ   1 
ATOM   1405 H H    . PHE A 1 106 ? -5.684  -18.983 -5.114  1.00 29.28  ?  437 PHE A H    1 
ATOM   1406 H HA   . PHE A 1 106 ? -6.239  -19.091 -7.741  1.00 36.75  ?  437 PHE A HA   1 
ATOM   1407 H HB2  . PHE A 1 106 ? -7.151  -16.969 -7.864  1.00 39.59  ?  437 PHE A HB2  1 
ATOM   1408 H HB3  . PHE A 1 106 ? -8.044  -17.841 -6.884  1.00 39.59  ?  437 PHE A HB3  1 
ATOM   1409 H HD1  . PHE A 1 106 ? -7.853  -17.432 -4.434  1.00 38.70  ?  437 PHE A HD1  1 
ATOM   1410 H HD2  . PHE A 1 106 ? -6.143  -14.979 -7.088  1.00 45.20  ?  437 PHE A HD2  1 
ATOM   1411 H HE1  . PHE A 1 106 ? -7.615  -15.826 -2.794  1.00 49.84  ?  437 PHE A HE1  1 
ATOM   1412 H HE2  . PHE A 1 106 ? -5.904  -13.371 -5.451  1.00 38.51  ?  437 PHE A HE2  1 
ATOM   1413 H HZ   . PHE A 1 106 ? -6.639  -13.791 -3.299  1.00 48.56  ?  437 PHE A HZ   1 
ATOM   1414 N N    . VAL A 1 107 ? -4.416  -17.361 -8.304  1.00 32.83  ?  438 VAL A N    1 
ATOM   1415 C CA   . VAL A 1 107 ? -3.150  -16.678 -8.529  1.00 36.01  ?  438 VAL A CA   1 
ATOM   1416 C C    . VAL A 1 107 ? -3.392  -15.180 -8.651  1.00 43.91  ?  438 VAL A C    1 
ATOM   1417 O O    . VAL A 1 107 ? -4.261  -14.734 -9.399  1.00 42.25  ?  438 VAL A O    1 
ATOM   1418 C CB   . VAL A 1 107 ? -2.420  -17.211 -9.789  1.00 47.53  ?  438 VAL A CB   1 
ATOM   1419 C CG1  . VAL A 1 107 ? -3.311  -17.129 -11.021 1.00 54.26  ?  438 VAL A CG1  1 
ATOM   1420 C CG2  . VAL A 1 107 ? -1.109  -16.458 -10.007 1.00 49.96  ?  438 VAL A CG2  1 
ATOM   1421 H H    . VAL A 1 107 ? -4.930  -17.389 -8.993  1.00 39.40  ?  438 VAL A H    1 
ATOM   1422 H HA   . VAL A 1 107 ? -2.572  -16.827 -7.764  1.00 43.22  ?  438 VAL A HA   1 
ATOM   1423 H HB   . VAL A 1 107 ? -2.201  -18.145 -9.647  1.00 57.04  ?  438 VAL A HB   1 
ATOM   1424 H HG11 . VAL A 1 107 ? -2.822  -17.470 -11.786 1.00 65.11  ?  438 VAL A HG11 1 
ATOM   1425 H HG12 . VAL A 1 107 ? -4.106  -17.665 -10.871 1.00 65.11  ?  438 VAL A HG12 1 
ATOM   1426 H HG13 . VAL A 1 107 ? -3.558  -16.203 -11.171 1.00 65.11  ?  438 VAL A HG13 1 
ATOM   1427 H HG21 . VAL A 1 107 ? -0.672  -16.808 -10.799 1.00 59.96  ?  438 VAL A HG21 1 
ATOM   1428 H HG22 . VAL A 1 107 ? -1.302  -15.515 -10.125 1.00 59.96  ?  438 VAL A HG22 1 
ATOM   1429 H HG23 . VAL A 1 107 ? -0.540  -16.584 -9.231  1.00 59.96  ?  438 VAL A HG23 1 
ATOM   1430 N N    . ALA A 1 108 ? -2.627  -14.417 -7.879  1.00 46.54  ?  439 ALA A N    1 
ATOM   1431 C CA   . ALA A 1 108 ? -2.680  -12.966 -7.921  1.00 49.50  ?  439 ALA A CA   1 
ATOM   1432 C C    . ALA A 1 108 ? -1.405  -12.441 -8.564  1.00 64.27  ?  439 ALA A C    1 
ATOM   1433 O O    . ALA A 1 108 ? -0.594  -13.217 -9.072  1.00 59.94  ?  439 ALA A O    1 
ATOM   1434 C CB   . ALA A 1 108 ? -2.855  -12.397 -6.524  1.00 53.03  ?  439 ALA A CB   1 
ATOM   1435 H H    . ALA A 1 108 ? -2.059  -14.725 -7.312  1.00 55.85  ?  439 ALA A H    1 
ATOM   1436 H HA   . ALA A 1 108 ? -3.435  -12.686 -8.463  1.00 59.40  ?  439 ALA A HA   1 
ATOM   1437 H HB1  . ALA A 1 108 ? -2.887  -11.429 -6.579  1.00 63.63  ?  439 ALA A HB1  1 
ATOM   1438 H HB2  . ALA A 1 108 ? -3.682  -12.735 -6.147  1.00 63.63  ?  439 ALA A HB2  1 
ATOM   1439 H HB3  . ALA A 1 108 ? -2.104  -12.673 -5.975  1.00 63.63  ?  439 ALA A HB3  1 
ATOM   1440 N N    . ASP A 1 109 ? -1.230  -11.125 -8.544  1.00 67.10  ?  440 ASP A N    1 
ATOM   1441 C CA   . ASP A 1 109 ? -0.025  -10.516 -9.086  1.00 67.88  ?  440 ASP A CA   1 
ATOM   1442 C C    . ASP A 1 109 ? 1.182   -10.950 -8.267  1.00 59.54  ?  440 ASP A C    1 
ATOM   1443 O O    . ASP A 1 109 ? 2.281   -11.109 -8.796  1.00 65.84  ?  440 ASP A O    1 
ATOM   1444 C CB   . ASP A 1 109 ? -0.136  -8.990  -9.086  1.00 83.82  ?  440 ASP A CB   1 
ATOM   1445 C CG   . ASP A 1 109 ? -1.472  -8.500  -9.608  1.00 87.66  ?  440 ASP A CG   1 
ATOM   1446 O OD1  . ASP A 1 109 ? -2.164  -9.277  -10.299 1.00 83.52  ?  440 ASP A OD1  1 
ATOM   1447 O OD2  . ASP A 1 109 ? -1.830  -7.337  -9.327  1.00 93.82  ?  440 ASP A OD2  1 
ATOM   1448 H H    . ASP A 1 109 ? -1.796  -10.563 -8.221  1.00 80.52  ?  440 ASP A H    1 
ATOM   1449 H HA   . ASP A 1 109 ? 0.103   -10.813 -10.001 1.00 81.45  ?  440 ASP A HA   1 
ATOM   1450 H HB2  . ASP A 1 109 ? -0.031  -8.665  -8.178  1.00 100.58 ?  440 ASP A HB2  1 
ATOM   1451 H HB3  . ASP A 1 109 ? 0.560   -8.622  -9.653  1.00 100.58 ?  440 ASP A HB3  1 
ATOM   1452 N N    . ASP A 1 110 ? 0.959   -11.149 -6.972  1.00 65.49  ?  441 ASP A N    1 
ATOM   1453 C CA   . ASP A 1 110 ? 2.035   -11.466 -6.042  1.00 69.04  ?  441 ASP A CA   1 
ATOM   1454 C C    . ASP A 1 110 ? 2.319   -12.965 -5.976  1.00 72.48  ?  441 ASP A C    1 
ATOM   1455 O O    . ASP A 1 110 ? 3.264   -13.389 -5.312  1.00 73.53  ?  441 ASP A O    1 
ATOM   1456 C CB   . ASP A 1 110 ? 1.689   -10.947 -4.646  1.00 75.41  ?  441 ASP A CB   1 
ATOM   1457 C CG   . ASP A 1 110 ? 2.894   -10.384 -3.913  1.00 93.89  ?  441 ASP A CG   1 
ATOM   1458 O OD1  . ASP A 1 110 ? 4.027   -10.847 -4.169  1.00 93.11  ?  441 ASP A OD1  1 
ATOM   1459 O OD2  . ASP A 1 110 ? 2.705   -9.475  -3.077  1.00 98.89  ?  441 ASP A OD2  1 
ATOM   1460 H H    . ASP A 1 110 ? 0.183   -11.106 -6.604  1.00 78.59  ?  441 ASP A H    1 
ATOM   1461 H HA   . ASP A 1 110 ? 2.846   -11.021 -6.335  1.00 82.85  ?  441 ASP A HA   1 
ATOM   1462 H HB2  . ASP A 1 110 ? 1.030   -10.240 -4.726  1.00 90.50  ?  441 ASP A HB2  1 
ATOM   1463 H HB3  . ASP A 1 110 ? 1.331   -11.677 -4.117  1.00 90.50  ?  441 ASP A HB3  1 
ATOM   1464 N N    . GLY A 1 111 ? 1.494   -13.760 -6.655  1.00 59.93  ?  442 GLY A N    1 
ATOM   1465 C CA   . GLY A 1 111 ? 1.669   -15.202 -6.686  1.00 51.61  ?  442 GLY A CA   1 
ATOM   1466 C C    . GLY A 1 111 ? 0.416   -15.939 -6.252  1.00 51.04  ?  442 GLY A C    1 
ATOM   1467 O O    . GLY A 1 111 ? -0.675  -15.370 -6.278  1.00 42.94  ?  442 GLY A O    1 
ATOM   1468 H H    . GLY A 1 111 ? 0.820   -13.481 -7.110  1.00 71.92  ?  442 GLY A H    1 
ATOM   1469 H HA2  . GLY A 1 111 ? 1.895   -15.482 -7.587  1.00 61.93  ?  442 GLY A HA2  1 
ATOM   1470 H HA3  . GLY A 1 111 ? 2.395   -15.454 -6.094  1.00 61.93  ?  442 GLY A HA3  1 
ATOM   1471 N N    . PRO A 1 112 ? 0.564   -17.212 -5.846  1.00 43.05  ?  443 PRO A N    1 
ATOM   1472 C CA   . PRO A 1 112 ? -0.584  -18.021 -5.431  1.00 46.82  ?  443 PRO A CA   1 
ATOM   1473 C C    . PRO A 1 112 ? -1.122  -17.575 -4.079  1.00 43.87  ?  443 PRO A C    1 
ATOM   1474 O O    . PRO A 1 112 ? -0.340  -17.322 -3.162  1.00 39.21  ?  443 PRO A O    1 
ATOM   1475 C CB   . PRO A 1 112 ? -0.007  -19.438 -5.360  1.00 45.60  ?  443 PRO A CB   1 
ATOM   1476 C CG   . PRO A 1 112 ? 1.425   -19.235 -5.025  1.00 39.82  ?  443 PRO A CG   1 
ATOM   1477 C CD   . PRO A 1 112 ? 1.837   -17.933 -5.665  1.00 53.16  ?  443 PRO A CD   1 
ATOM   1478 H HA   . PRO A 1 112 ? -1.290  -17.986 -6.095  1.00 56.19  ?  443 PRO A HA   1 
ATOM   1479 H HB2  . PRO A 1 112 ? -0.457  -19.943 -4.664  1.00 54.71  ?  443 PRO A HB2  1 
ATOM   1480 H HB3  . PRO A 1 112 ? -0.102  -19.875 -6.221  1.00 54.71  ?  443 PRO A HB3  1 
ATOM   1481 H HG2  . PRO A 1 112 ? 1.526   -19.185 -4.061  1.00 47.79  ?  443 PRO A HG2  1 
ATOM   1482 H HG3  . PRO A 1 112 ? 1.948   -19.969 -5.383  1.00 47.79  ?  443 PRO A HG3  1 
ATOM   1483 H HD2  . PRO A 1 112 ? 2.424   -17.437 -5.073  1.00 63.79  ?  443 PRO A HD2  1 
ATOM   1484 H HD3  . PRO A 1 112 ? 2.256   -18.098 -6.524  1.00 63.79  ?  443 PRO A HD3  1 
ATOM   1485 N N    . LYS A 1 113 ? -2.443  -17.467 -3.968  1.00 33.01  ?  444 LYS A N    1 
ATOM   1486 C CA   . LYS A 1 113 ? -3.073  -17.057 -2.721  1.00 33.94  ?  444 LYS A CA   1 
ATOM   1487 C C    . LYS A 1 113 ? -4.232  -17.984 -2.383  1.00 26.95  ?  444 LYS A C    1 
ATOM   1488 O O    . LYS A 1 113 ? -4.715  -18.728 -3.237  1.00 26.72  ?  444 LYS A O    1 
ATOM   1489 C CB   . LYS A 1 113 ? -3.564  -15.612 -2.812  1.00 39.49  ?  444 LYS A CB   1 
ATOM   1490 C CG   . LYS A 1 113 ? -2.459  -14.609 -3.097  1.00 45.47  ?  444 LYS A CG   1 
ATOM   1491 C CD   . LYS A 1 113 ? -2.645  -13.336 -2.286  1.00 64.97  ?  444 LYS A CD   1 
ATOM   1492 C CE   . LYS A 1 113 ? -1.548  -12.322 -2.575  1.00 78.79  ?  444 LYS A CE   1 
ATOM   1493 N NZ   . LYS A 1 113 ? -0.188  -12.878 -2.322  1.00 69.02  ?  444 LYS A NZ   1 
ATOM   1494 H H    . LYS A 1 113 ? -2.998  -17.626 -4.605  1.00 39.61  ?  444 LYS A H    1 
ATOM   1495 H HA   . LYS A 1 113 ? -2.423  -17.111 -2.003  1.00 40.73  ?  444 LYS A HA   1 
ATOM   1496 H HB2  . LYS A 1 113 ? -4.215  -15.547 -3.528  1.00 47.39  ?  444 LYS A HB2  1 
ATOM   1497 H HB3  . LYS A 1 113 ? -3.976  -15.367 -1.969  1.00 47.39  ?  444 LYS A HB3  1 
ATOM   1498 H HG2  . LYS A 1 113 ? -1.603  -14.998 -2.860  1.00 54.56  ?  444 LYS A HG2  1 
ATOM   1499 H HG3  . LYS A 1 113 ? -2.474  -14.375 -4.038  1.00 54.56  ?  444 LYS A HG3  1 
ATOM   1500 H HD2  . LYS A 1 113 ? -3.498  -12.934 -2.514  1.00 77.96  ?  444 LYS A HD2  1 
ATOM   1501 H HD3  . LYS A 1 113 ? -2.618  -13.552 -1.341  1.00 77.96  ?  444 LYS A HD3  1 
ATOM   1502 H HE2  . LYS A 1 113 ? -1.596  -12.058 -3.507  1.00 94.55  ?  444 LYS A HE2  1 
ATOM   1503 H HE3  . LYS A 1 113 ? -1.670  -11.549 -2.002  1.00 94.55  ?  444 LYS A HE3  1 
ATOM   1504 H HZ1  . LYS A 1 113 ? 0.430   -12.263 -2.499  1.00 82.83  ?  444 LYS A HZ1  1 
ATOM   1505 H HZ2  . LYS A 1 113 ? -0.115  -13.124 -1.470  1.00 82.83  ?  444 LYS A HZ2  1 
ATOM   1506 H HZ3  . LYS A 1 113 ? -0.048  -13.587 -2.841  1.00 82.83  ?  444 LYS A HZ3  1 
ATOM   1507 N N    . THR A 1 114 ? -4.656  -17.937 -1.124  1.00 28.80  ?  445 THR A N    1 
ATOM   1508 C CA   . THR A 1 114 ? -5.814  -18.690 -0.671  1.00 29.58  ?  445 THR A CA   1 
ATOM   1509 C C    . THR A 1 114 ? -6.709  -17.770 0.141   1.00 27.66  ?  445 THR A C    1 
ATOM   1510 O O    . THR A 1 114 ? -6.229  -16.987 0.960   1.00 27.09  ?  445 THR A O    1 
ATOM   1511 C CB   . THR A 1 114 ? -5.416  -19.910 0.180   1.00 31.48  ?  445 THR A CB   1 
ATOM   1512 O OG1  . THR A 1 114 ? -4.350  -20.619 -0.463  1.00 34.77  ?  445 THR A OG1  1 
ATOM   1513 C CG2  . THR A 1 114 ? -6.602  -20.840 0.352   1.00 30.02  ?  445 THR A CG2  1 
ATOM   1514 H H    . THR A 1 114 ? -4.282  -17.469 -0.507  1.00 34.55  ?  445 THR A H    1 
ATOM   1515 H HA   . THR A 1 114 ? -6.315  -19.004 -1.440  1.00 35.50  ?  445 THR A HA   1 
ATOM   1516 H HB   . THR A 1 114 ? -5.126  -19.614 1.057   1.00 37.77  ?  445 THR A HB   1 
ATOM   1517 H HG1  . THR A 1 114 ? -4.130  -21.286 -0.002  1.00 41.73  ?  445 THR A HG1  1 
ATOM   1518 H HG21 . THR A 1 114 ? -6.346  -21.607 0.888   1.00 36.03  ?  445 THR A HG21 1 
ATOM   1519 H HG22 . THR A 1 114 ? -7.327  -20.373 0.796   1.00 36.03  ?  445 THR A HG22 1 
ATOM   1520 H HG23 . THR A 1 114 ? -6.909  -21.150 -0.514  1.00 36.03  ?  445 THR A HG23 1 
ATOM   1521 N N    . THR A 1 115 ? -8.012  -17.859 -0.107  1.00 22.50  ?  446 THR A N    1 
ATOM   1522 C CA   . THR A 1 115 ? -8.993  -17.042 0.592   1.00 23.09  ?  446 THR A CA   1 
ATOM   1523 C C    . THR A 1 115 ? -10.107 -17.937 1.102   1.00 20.02  ?  446 THR A C    1 
ATOM   1524 O O    . THR A 1 115 ? -10.440 -18.940 0.468   1.00 23.80  ?  446 THR A O    1 
ATOM   1525 C CB   . THR A 1 115 ? -9.589  -15.944 -0.322  1.00 27.17  ?  446 THR A CB   1 
ATOM   1526 O OG1  . THR A 1 115 ? -8.545  -15.071 -0.764  1.00 41.35  ?  446 THR A OG1  1 
ATOM   1527 C CG2  . THR A 1 115 ? -10.640 -15.124 0.419   1.00 41.05  ?  446 THR A CG2  1 
ATOM   1528 H H    . THR A 1 115 ? -8.357  -18.394 -0.686  1.00 27.00  ?  446 THR A H    1 
ATOM   1529 H HA   . THR A 1 115 ? -8.572  -16.613 1.353   1.00 27.71  ?  446 THR A HA   1 
ATOM   1530 H HB   . THR A 1 115 ? -10.010 -16.359 -1.091  1.00 32.61  ?  446 THR A HB   1 
ATOM   1531 H HG1  . THR A 1 115 ? -8.862  -14.472 -1.261  1.00 49.62  ?  446 THR A HG1  1 
ATOM   1532 H HG21 . THR A 1 115 ? -11.002 -14.442 -0.167  1.00 49.26  ?  446 THR A HG21 1 
ATOM   1533 H HG22 . THR A 1 115 ? -11.361 -15.701 0.716   1.00 49.26  ?  446 THR A HG22 1 
ATOM   1534 H HG23 . THR A 1 115 ? -10.240 -14.696 1.193   1.00 49.26  ?  446 THR A HG23 1 
ATOM   1535 N N    . ARG A 1 116 ? -10.658 -17.572 2.255   1.00 23.06  ?  447 ARG A N    1 
ATOM   1536 C CA   . ARG A 1 116 ? -11.784 -18.288 2.840   1.00 21.98  ?  447 ARG A CA   1 
ATOM   1537 C C    . ARG A 1 116 ? -13.020 -17.398 2.868   1.00 24.16  ?  447 ARG A C    1 
ATOM   1538 O O    . ARG A 1 116 ? -12.937 -16.215 3.202   1.00 23.19  ?  447 ARG A O    1 
ATOM   1539 C CB   . ARG A 1 116 ? -11.456 -18.753 4.258   1.00 21.59  ?  447 ARG A CB   1 
ATOM   1540 C CG   . ARG A 1 116 ? -12.510 -19.689 4.844   1.00 28.29  ?  447 ARG A CG   1 
ATOM   1541 C CD   . ARG A 1 116 ? -12.496 -19.696 6.364   1.00 34.18  ?  447 ARG A CD   1 
ATOM   1542 N NE   . ARG A 1 116 ? -11.172 -19.413 6.908   1.00 59.76  ?  447 ARG A NE   1 
ATOM   1543 C CZ   . ARG A 1 116 ? -10.854 -18.338 7.627   1.00 41.03  ?  447 ARG A CZ   1 
ATOM   1544 N NH1  . ARG A 1 116 ? -11.759 -17.412 7.928   1.00 39.27  ?  447 ARG A NH1  1 
ATOM   1545 N NH2  . ARG A 1 116 ? -9.611  -18.195 8.060   1.00 41.49  ?  447 ARG A NH2  1 
ATOM   1546 H H    . ARG A 1 116 ? -10.393 -16.902 2.724   1.00 27.67  ?  447 ARG A H    1 
ATOM   1547 H HA   . ARG A 1 116 ? -11.983 -19.070 2.301   1.00 26.38  ?  447 ARG A HA   1 
ATOM   1548 H HB2  . ARG A 1 116 ? -10.610 -19.228 4.245   1.00 25.91  ?  447 ARG A HB2  1 
ATOM   1549 H HB3  . ARG A 1 116 ? -11.391 -17.977 4.836   1.00 25.91  ?  447 ARG A HB3  1 
ATOM   1550 H HG2  . ARG A 1 116 ? -13.388 -19.400 4.553   1.00 33.94  ?  447 ARG A HG2  1 
ATOM   1551 H HG3  . ARG A 1 116 ? -12.338 -20.593 4.537   1.00 33.94  ?  447 ARG A HG3  1 
ATOM   1552 H HD2  . ARG A 1 116 ? -13.107 -19.017 6.690   1.00 41.02  ?  447 ARG A HD2  1 
ATOM   1553 H HD3  . ARG A 1 116 ? -12.770 -20.571 6.680   1.00 41.02  ?  447 ARG A HD3  1 
ATOM   1554 H HE   . ARG A 1 116 ? -10.548 -19.985 6.753   1.00 71.72  ?  447 ARG A HE   1 
ATOM   1555 H HH11 . ARG A 1 116 ? -12.569 -17.497 7.651   1.00 47.12  ?  447 ARG A HH11 1 
ATOM   1556 H HH12 . ARG A 1 116 ? -11.534 -16.727 8.396   1.00 47.12  ?  447 ARG A HH12 1 
ATOM   1557 H HH21 . ARG A 1 116 ? -9.020  -18.791 7.873   1.00 49.78  ?  447 ARG A HH21 1 
ATOM   1558 H HH22 . ARG A 1 116 ? -9.396  -17.507 8.529   1.00 49.78  ?  447 ARG A HH22 1 
ATOM   1559 N N    . TYR A 1 117 ? -14.162 -17.979 2.517   1.00 18.63  ?  448 TYR A N    1 
ATOM   1560 C CA   . TYR A 1 117 ? -15.445 -17.291 2.586   1.00 17.35  ?  448 TYR A CA   1 
ATOM   1561 C C    . TYR A 1 117 ? -16.421 -18.065 3.459   1.00 19.15  ?  448 TYR A C    1 
ATOM   1562 O O    . TYR A 1 117 ? -16.438 -19.295 3.432   1.00 21.13  ?  448 TYR A O    1 
ATOM   1563 C CB   . TYR A 1 117 ? -16.056 -17.127 1.196   1.00 21.51  ?  448 TYR A CB   1 
ATOM   1564 C CG   . TYR A 1 117 ? -15.196 -16.371 0.217   1.00 20.56  ?  448 TYR A CG   1 
ATOM   1565 C CD1  . TYR A 1 117 ? -14.243 -17.028 -0.548  1.00 26.29  ?  448 TYR A CD1  1 
ATOM   1566 C CD2  . TYR A 1 117 ? -15.347 -15.004 0.048   1.00 24.58  ?  448 TYR A CD2  1 
ATOM   1567 C CE1  . TYR A 1 117 ? -13.455 -16.338 -1.449  1.00 27.54  ?  448 TYR A CE1  1 
ATOM   1568 C CE2  . TYR A 1 117 ? -14.566 -14.307 -0.851  1.00 28.66  ?  448 TYR A CE2  1 
ATOM   1569 C CZ   . TYR A 1 117 ? -13.623 -14.979 -1.595  1.00 31.52  ?  448 TYR A CZ   1 
ATOM   1570 O OH   . TYR A 1 117 ? -12.846 -14.286 -2.490  1.00 28.72  ?  448 TYR A OH   1 
ATOM   1571 H H    . TYR A 1 117 ? -14.220 -18.788 2.230   1.00 22.35  ?  448 TYR A H    1 
ATOM   1572 H HA   . TYR A 1 117 ? -15.319 -16.410 2.973   1.00 20.82  ?  448 TYR A HA   1 
ATOM   1573 H HB2  . TYR A 1 117 ? -16.219 -18.008 0.825   1.00 25.82  ?  448 TYR A HB2  1 
ATOM   1574 H HB3  . TYR A 1 117 ? -16.895 -16.649 1.281   1.00 25.82  ?  448 TYR A HB3  1 
ATOM   1575 H HD1  . TYR A 1 117 ? -14.128 -17.945 -0.449  1.00 31.55  ?  448 TYR A HD1  1 
ATOM   1576 H HD2  . TYR A 1 117 ? -15.983 -14.549 0.551   1.00 29.49  ?  448 TYR A HD2  1 
ATOM   1577 H HE1  . TYR A 1 117 ? -12.818 -16.789 -1.954  1.00 33.05  ?  448 TYR A HE1  1 
ATOM   1578 H HE2  . TYR A 1 117 ? -14.676 -13.389 -0.953  1.00 34.39  ?  448 TYR A HE2  1 
ATOM   1579 H HH   . TYR A 1 117 ? -13.051 -13.472 -2.479  1.00 34.46  ?  448 TYR A HH   1 
ATOM   1580 N N    . GLU A 1 118 ? -17.227 -17.341 4.228   1.00 18.97  ?  449 GLU A N    1 
ATOM   1581 C CA   . GLU A 1 118 ? -18.396 -17.917 4.885   1.00 17.43  ?  449 GLU A CA   1 
ATOM   1582 C C    . GLU A 1 118 ? -19.545 -17.914 3.892   1.00 18.31  ?  449 GLU A C    1 
ATOM   1583 O O    . GLU A 1 118 ? -19.754 -16.914 3.218   1.00 18.50  ?  449 GLU A O    1 
ATOM   1584 C CB   . GLU A 1 118 ? -18.782 -17.113 6.124   1.00 17.86  ?  449 GLU A CB   1 
ATOM   1585 C CG   . GLU A 1 118 ? -17.680 -16.991 7.164   1.00 25.61  ?  449 GLU A CG   1 
ATOM   1586 C CD   . GLU A 1 118 ? -17.964 -15.905 8.190   1.00 32.42  ?  449 GLU A CD   1 
ATOM   1587 O OE1  . GLU A 1 118 ? -18.780 -15.002 7.902   1.00 28.54  ?  449 GLU A OE1  1 
ATOM   1588 O OE2  . GLU A 1 118 ? -17.371 -15.951 9.287   1.00 35.87  -1 449 GLU A OE2  1 
ATOM   1589 H H    . GLU A 1 118 ? -17.117 -16.503 4.388   1.00 22.77  ?  449 GLU A H    1 
ATOM   1590 H HA   . GLU A 1 118 ? -18.210 -18.832 5.149   1.00 20.92  ?  449 GLU A HA   1 
ATOM   1591 H HB2  . GLU A 1 118 ? -19.026 -16.216 5.847   1.00 21.44  ?  449 GLU A HB2  1 
ATOM   1592 H HB3  . GLU A 1 118 ? -19.541 -17.542 6.548   1.00 21.44  ?  449 GLU A HB3  1 
ATOM   1593 H HG2  . GLU A 1 118 ? -17.594 -17.834 7.635   1.00 30.73  ?  449 GLU A HG2  1 
ATOM   1594 H HG3  . GLU A 1 118 ? -16.846 -16.773 6.718   1.00 30.73  ?  449 GLU A HG3  1 
ATOM   1595 N N    . GLU A 1 119 ? -20.293 -19.015 3.803   1.00 17.60  ?  450 GLU A N    1 
ATOM   1596 C CA   . GLU A 1 119 ? -21.405 -19.098 2.857   1.00 15.78  ?  450 GLU A CA   1 
ATOM   1597 C C    . GLU A 1 119 ? -22.672 -19.620 3.502   1.00 14.68  ?  450 GLU A C    1 
ATOM   1598 O O    . GLU A 1 119 ? -22.665 -20.682 4.120   1.00 16.51  ?  450 GLU A O    1 
ATOM   1599 C CB   . GLU A 1 119 ? -21.059 -20.004 1.670   1.00 22.64  ?  450 GLU A CB   1 
ATOM   1600 C CG   . GLU A 1 119 ? -20.253 -19.342 0.563   1.00 39.05  ?  450 GLU A CG   1 
ATOM   1601 C CD   . GLU A 1 119 ? -20.540 -19.941 -0.809  1.00 36.95  ?  450 GLU A CD   1 
ATOM   1602 O OE1  . GLU A 1 119 ? -20.747 -21.170 -0.901  1.00 39.87  ?  450 GLU A OE1  1 
ATOM   1603 O OE2  . GLU A 1 119 ? -20.570 -19.181 -1.797  1.00 51.39  -1 450 GLU A OE2  1 
ATOM   1604 H H    . GLU A 1 119 ? -20.178 -19.723 4.277   1.00 21.12  ?  450 GLU A H    1 
ATOM   1605 H HA   . GLU A 1 119 ? -21.590 -18.211 2.511   1.00 18.94  ?  450 GLU A HA   1 
ATOM   1606 H HB2  . GLU A 1 119 ? -20.542 -20.757 1.998   1.00 27.17  ?  450 GLU A HB2  1 
ATOM   1607 H HB3  . GLU A 1 119 ? -21.886 -20.325 1.277   1.00 27.17  ?  450 GLU A HB3  1 
ATOM   1608 H HG2  . GLU A 1 119 ? -20.475 -18.398 0.531   1.00 46.86  ?  450 GLU A HG2  1 
ATOM   1609 H HG3  . GLU A 1 119 ? -19.307 -19.455 0.748   1.00 46.86  ?  450 GLU A HG3  1 
ATOM   1610 N N    . THR A 1 120 ? -23.750 -18.854 3.346   1.00 17.16  ?  451 THR A N    1 
ATOM   1611 C CA   . THR A 1 120 ? -25.099 -19.316 3.656   1.00 15.51  ?  451 THR A CA   1 
ATOM   1612 C C    . THR A 1 120 ? -25.853 -19.508 2.344   1.00 21.33  ?  451 THR A C    1 
ATOM   1613 O O    . THR A 1 120 ? -25.896 -18.602 1.520   1.00 17.80  ?  451 THR A O    1 
ATOM   1614 C CB   . THR A 1 120 ? -25.872 -18.317 4.534   1.00 18.50  ?  451 THR A CB   1 
ATOM   1615 O OG1  . THR A 1 120 ? -25.201 -18.135 5.786   1.00 17.68  ?  451 THR A OG1  1 
ATOM   1616 C CG2  . THR A 1 120 ? -27.289 -18.817 4.799   1.00 19.14  ?  451 THR A CG2  1 
ATOM   1617 H H    . THR A 1 120 ? -23.723 -18.045 3.056   1.00 20.60  ?  451 THR A H    1 
ATOM   1618 H HA   . THR A 1 120 ? -25.056 -20.168 4.118   1.00 18.61  ?  451 THR A HA   1 
ATOM   1619 H HB   . THR A 1 120 ? -25.930 -17.465 4.075   1.00 22.20  ?  451 THR A HB   1 
ATOM   1620 H HG1  . THR A 1 120 ? -25.626 -17.589 6.262   1.00 21.21  ?  451 THR A HG1  1 
ATOM   1621 H HG21 . THR A 1 120 ? -27.767 -18.180 5.353   1.00 22.97  ?  451 THR A HG21 1 
ATOM   1622 H HG22 . THR A 1 120 ? -27.765 -18.924 3.961   1.00 22.97  ?  451 THR A HG22 1 
ATOM   1623 H HG23 . THR A 1 120 ? -27.259 -19.672 5.256   1.00 22.97  ?  451 THR A HG23 1 
ATOM   1624 N N    . ARG A 1 121 ? -26.438 -20.688 2.154   1.00 16.84  ?  452 ARG A N    1 
ATOM   1625 C CA   . ARG A 1 121 ? -27.239 -20.975 0.969   1.00 17.38  ?  452 ARG A CA   1 
ATOM   1626 C C    . ARG A 1 121 ? -28.612 -21.448 1.406   1.00 20.15  ?  452 ARG A C    1 
ATOM   1627 O O    . ARG A 1 121 ? -28.719 -22.436 2.128   1.00 20.52  ?  452 ARG A O    1 
ATOM   1628 C CB   . ARG A 1 121 ? -26.571 -22.039 0.100   1.00 22.23  ?  452 ARG A CB   1 
ATOM   1629 C CG   . ARG A 1 121 ? -25.217 -21.634 -0.464  1.00 24.54  ?  452 ARG A CG   1 
ATOM   1630 C CD   . ARG A 1 121 ? -25.284 -21.479 -1.972  1.00 37.44  ?  452 ARG A CD   1 
ATOM   1631 N NE   . ARG A 1 121 ? -23.955 -21.401 -2.572  1.00 38.58  ?  452 ARG A NE   1 
ATOM   1632 C CZ   . ARG A 1 121 ? -23.661 -20.721 -3.677  1.00 48.02  ?  452 ARG A CZ   1 
ATOM   1633 N NH1  . ARG A 1 121 ? -24.597 -20.038 -4.324  1.00 45.30  ?  452 ARG A NH1  1 
ATOM   1634 N NH2  . ARG A 1 121 ? -22.417 -20.716 -4.137  1.00 50.30  ?  452 ARG A NH2  1 
ATOM   1635 H H    . ARG A 1 121 ? -26.385 -21.346 2.705   1.00 20.21  ?  452 ARG A H    1 
ATOM   1636 H HA   . ARG A 1 121 ? -27.343 -20.167 0.443   1.00 20.85  ?  452 ARG A HA   1 
ATOM   1637 H HB2  . ARG A 1 121 ? -26.440 -22.838 0.635   1.00 26.68  ?  452 ARG A HB2  1 
ATOM   1638 H HB3  . ARG A 1 121 ? -27.154 -22.239 -0.649  1.00 26.68  ?  452 ARG A HB3  1 
ATOM   1639 H HG2  . ARG A 1 121 ? -24.949 -20.784 -0.081  1.00 29.45  ?  452 ARG A HG2  1 
ATOM   1640 H HG3  . ARG A 1 121 ? -24.562 -22.319 -0.256  1.00 29.45  ?  452 ARG A HG3  1 
ATOM   1641 H HD2  . ARG A 1 121 ? -25.743 -22.246 -2.351  1.00 44.92  ?  452 ARG A HD2  1 
ATOM   1642 H HD3  . ARG A 1 121 ? -25.763 -20.663 -2.188  1.00 44.92  ?  452 ARG A HD3  1 
ATOM   1643 H HE   . ARG A 1 121 ? -23.317 -21.825 -2.183  1.00 46.29  ?  452 ARG A HE   1 
ATOM   1644 H HH11 . ARG A 1 121 ? -25.406 -20.035 -4.032  1.00 54.36  ?  452 ARG A HH11 1 
ATOM   1645 H HH12 . ARG A 1 121 ? -24.395 -19.601 -5.036  1.00 54.36  ?  452 ARG A HH12 1 
ATOM   1646 H HH21 . ARG A 1 121 ? -21.804 -21.155 -3.723  1.00 60.36  ?  452 ARG A HH21 1 
ATOM   1647 H HH22 . ARG A 1 121 ? -22.224 -20.276 -4.850  1.00 60.36  ?  452 ARG A HH22 1 
ATOM   1648 N N    . VAL A 1 122 ? -29.653 -20.746 0.973   1.00 17.81  ?  453 VAL A N    1 
ATOM   1649 C CA   . VAL A 1 122 ? -31.023 -21.107 1.334   1.00 17.39  ?  453 VAL A CA   1 
ATOM   1650 C C    . VAL A 1 122 ? -31.696 -21.799 0.159   1.00 18.92  ?  453 VAL A C    1 
ATOM   1651 O O    . VAL A 1 122 ? -31.926 -21.186 -0.885  1.00 18.90  ?  453 VAL A O    1 
ATOM   1652 C CB   . VAL A 1 122 ? -31.865 -19.885 1.744   1.00 22.84  ?  453 VAL A CB   1 
ATOM   1653 C CG1  . VAL A 1 122 ? -33.221 -20.338 2.287   1.00 25.94  ?  453 VAL A CG1  1 
ATOM   1654 C CG2  . VAL A 1 122 ? -31.129 -19.057 2.786   1.00 21.98  ?  453 VAL A CG2  1 
ATOM   1655 H H    . VAL A 1 122 ? -29.595 -20.052 0.467   1.00 21.37  ?  453 VAL A H    1 
ATOM   1656 H HA   . VAL A 1 122 ? -31.004 -21.726 2.080   1.00 20.86  ?  453 VAL A HA   1 
ATOM   1657 H HB   . VAL A 1 122 ? -32.020 -19.326 0.966   1.00 27.41  ?  453 VAL A HB   1 
ATOM   1658 H HG11 . VAL A 1 122 ? -33.736 -19.557 2.540   1.00 31.13  ?  453 VAL A HG11 1 
ATOM   1659 H HG12 . VAL A 1 122 ? -33.687 -20.833 1.596   1.00 31.13  ?  453 VAL A HG12 1 
ATOM   1660 H HG13 . VAL A 1 122 ? -33.077 -20.905 3.061   1.00 31.13  ?  453 VAL A HG13 1 
ATOM   1661 H HG21 . VAL A 1 122 ? -31.677 -18.295 3.028   1.00 26.38  ?  453 VAL A HG21 1 
ATOM   1662 H HG22 . VAL A 1 122 ? -30.964 -19.608 3.567   1.00 26.38  ?  453 VAL A HG22 1 
ATOM   1663 H HG23 . VAL A 1 122 ? -30.287 -18.754 2.410   1.00 26.38  ?  453 VAL A HG23 1 
ATOM   1664 N N    . TRP A 1 123 ? -32.005 -23.076 0.352   1.00 21.00  ?  454 TRP A N    1 
ATOM   1665 C CA   . TRP A 1 123 ? -32.621 -23.906 -0.676  1.00 19.59  ?  454 TRP A CA   1 
ATOM   1666 C C    . TRP A 1 123 ? -34.068 -24.192 -0.303  1.00 21.33  ?  454 TRP A C    1 
ATOM   1667 O O    . TRP A 1 123 ? -34.389 -24.325 0.878   1.00 18.20  ?  454 TRP A O    1 
ATOM   1668 C CB   . TRP A 1 123 ? -31.869 -25.225 -0.837  1.00 18.59  ?  454 TRP A CB   1 
ATOM   1669 C CG   . TRP A 1 123 ? -30.475 -25.101 -1.371  1.00 19.21  ?  454 TRP A CG   1 
ATOM   1670 C CD1  . TRP A 1 123 ? -29.341 -24.846 -0.656  1.00 19.93  ?  454 TRP A CD1  1 
ATOM   1671 C CD2  . TRP A 1 123 ? -30.065 -25.255 -2.734  1.00 19.36  ?  454 TRP A CD2  1 
ATOM   1672 N NE1  . TRP A 1 123 ? -28.247 -24.822 -1.494  1.00 18.05  ?  454 TRP A NE1  1 
ATOM   1673 C CE2  . TRP A 1 123 ? -28.668 -25.073 -2.777  1.00 20.24  ?  454 TRP A CE2  1 
ATOM   1674 C CE3  . TRP A 1 123 ? -30.746 -25.525 -3.926  1.00 19.33  ?  454 TRP A CE3  1 
ATOM   1675 C CZ2  . TRP A 1 123 ? -27.940 -25.149 -3.965  1.00 19.60  ?  454 TRP A CZ2  1 
ATOM   1676 C CZ3  . TRP A 1 123 ? -30.023 -25.602 -5.103  1.00 21.56  ?  454 TRP A CZ3  1 
ATOM   1677 C CH2  . TRP A 1 123 ? -28.635 -25.415 -5.114  1.00 21.25  ?  454 TRP A CH2  1 
ATOM   1678 H H    . TRP A 1 123 ? -31.863 -23.495 1.089   1.00 25.20  ?  454 TRP A H    1 
ATOM   1679 H HA   . TRP A 1 123 ? -32.608 -23.437 -1.525  1.00 23.51  ?  454 TRP A HA   1 
ATOM   1680 H HB2  . TRP A 1 123 ? -31.812 -25.655 0.030   1.00 22.30  ?  454 TRP A HB2  1 
ATOM   1681 H HB3  . TRP A 1 123 ? -32.366 -25.791 -1.448  1.00 22.30  ?  454 TRP A HB3  1 
ATOM   1682 H HD1  . TRP A 1 123 ? -29.311 -24.707 0.263   1.00 23.92  ?  454 TRP A HD1  1 
ATOM   1683 H HE1  . TRP A 1 123 ? -27.434 -24.676 -1.254  1.00 21.65  ?  454 TRP A HE1  1 
ATOM   1684 H HE3  . TRP A 1 123 ? -31.668 -25.651 -3.927  1.00 23.19  ?  454 TRP A HE3  1 
ATOM   1685 H HZ2  . TRP A 1 123 ? -27.019 -25.024 -3.975  1.00 23.52  ?  454 TRP A HZ2  1 
ATOM   1686 H HZ3  . TRP A 1 123 ? -30.466 -25.781 -5.901  1.00 25.88  ?  454 TRP A HZ3  1 
ATOM   1687 H HH2  . TRP A 1 123 ? -28.175 -25.471 -5.920  1.00 25.50  ?  454 TRP A HH2  1 
ATOM   1688 N N    . VAL A 1 124 ? -34.927 -24.305 -1.311  1.00 18.84  ?  455 VAL A N    1 
ATOM   1689 C CA   . VAL A 1 124 ? -36.341 -24.584 -1.086  1.00 21.74  ?  455 VAL A CA   1 
ATOM   1690 C C    . VAL A 1 124 ? -36.770 -25.758 -1.955  1.00 26.89  ?  455 VAL A C    1 
ATOM   1691 O O    . VAL A 1 124 ? -36.338 -25.879 -3.098  1.00 24.64  ?  455 VAL A O    1 
ATOM   1692 C CB   . VAL A 1 124 ? -37.208 -23.346 -1.385  1.00 25.47  ?  455 VAL A CB   1 
ATOM   1693 C CG1  . VAL A 1 124 ? -38.686 -23.669 -1.261  1.00 32.15  ?  455 VAL A CG1  1 
ATOM   1694 C CG2  . VAL A 1 124 ? -36.836 -22.211 -0.438  1.00 24.62  ?  455 VAL A CG2  1 
ATOM   1695 H H    . VAL A 1 124 ? -34.714 -24.224 -2.141  1.00 22.61  ?  455 VAL A H    1 
ATOM   1696 H HA   . VAL A 1 124 ? -36.473 -24.830 -0.157  1.00 26.09  ?  455 VAL A HA   1 
ATOM   1697 H HB   . VAL A 1 124 ? -37.038 -23.051 -2.293  1.00 30.56  ?  455 VAL A HB   1 
ATOM   1698 H HG11 . VAL A 1 124 ? -39.200 -22.869 -1.455  1.00 38.58  ?  455 VAL A HG11 1 
ATOM   1699 H HG12 . VAL A 1 124 ? -38.910 -24.369 -1.893  1.00 38.58  ?  455 VAL A HG12 1 
ATOM   1700 H HG13 . VAL A 1 124 ? -38.868 -23.968 -0.356  1.00 38.58  ?  455 VAL A HG13 1 
ATOM   1701 H HG21 . VAL A 1 124 ? -37.389 -21.440 -0.638  1.00 29.54  ?  455 VAL A HG21 1 
ATOM   1702 H HG22 . VAL A 1 124 ? -36.987 -22.500 0.475   1.00 29.54  ?  455 VAL A HG22 1 
ATOM   1703 H HG23 . VAL A 1 124 ? -35.900 -21.989 -0.565  1.00 29.54  ?  455 VAL A HG23 1 
ATOM   1704 N N    . LYS A 1 125 ? -37.599 -26.635 -1.397  1.00 26.40  ?  456 LYS A N    1 
ATOM   1705 C CA   . LYS A 1 125 ? -38.109 -27.780 -2.142  1.00 33.67  ?  456 LYS A CA   1 
ATOM   1706 C C    . LYS A 1 125 ? -38.946 -27.321 -3.320  1.00 26.50  ?  456 LYS A C    1 
ATOM   1707 O O    . LYS A 1 125 ? -39.765 -26.408 -3.197  1.00 32.04  ?  456 LYS A O    1 
ATOM   1708 C CB   . LYS A 1 125 ? -38.956 -28.688 -1.251  1.00 30.50  ?  456 LYS A CB   1 
ATOM   1709 C CG   . LYS A 1 125 ? -38.167 -29.568 -0.316  1.00 35.20  ?  456 LYS A CG   1 
ATOM   1710 C CD   . LYS A 1 125 ? -39.083 -30.542 0.407   1.00 44.98  ?  456 LYS A CD   1 
ATOM   1711 C CE   . LYS A 1 125 ? -38.369 -31.220 1.560   1.00 45.30  ?  456 LYS A CE   1 
ATOM   1712 N NZ   . LYS A 1 125 ? -39.223 -32.254 2.203   1.00 56.73  ?  456 LYS A NZ   1 
ATOM   1713 H H    . LYS A 1 125 ? -37.882 -26.589 -0.586  1.00 31.68  ?  456 LYS A H    1 
ATOM   1714 H HA   . LYS A 1 125 ? -37.363 -28.298 -2.482  1.00 40.41  ?  456 LYS A HA   1 
ATOM   1715 H HB2  . LYS A 1 125 ? -39.540 -28.134 -0.710  1.00 36.60  ?  456 LYS A HB2  1 
ATOM   1716 H HB3  . LYS A 1 125 ? -39.490 -29.267 -1.818  1.00 36.60  ?  456 LYS A HB3  1 
ATOM   1717 H HG2  . LYS A 1 125 ? -37.517 -30.078 -0.824  1.00 42.24  ?  456 LYS A HG2  1 
ATOM   1718 H HG3  . LYS A 1 125 ? -37.722 -29.017 0.347   1.00 42.24  ?  456 LYS A HG3  1 
ATOM   1719 H HD2  . LYS A 1 125 ? -39.846 -30.061 0.762   1.00 53.98  ?  456 LYS A HD2  1 
ATOM   1720 H HD3  . LYS A 1 125 ? -39.377 -31.227 -0.214  1.00 53.98  ?  456 LYS A HD3  1 
ATOM   1721 H HE2  . LYS A 1 125 ? -37.566 -31.652 1.229   1.00 54.36  ?  456 LYS A HE2  1 
ATOM   1722 H HE3  . LYS A 1 125 ? -38.141 -30.556 2.229   1.00 54.36  ?  456 LYS A HE3  1 
ATOM   1723 H HZ1  . LYS A 1 125 ? -38.782 -32.637 2.875   1.00 68.08  ?  456 LYS A HZ1  1 
ATOM   1724 H HZ2  . LYS A 1 125 ? -39.966 -31.882 2.519   1.00 68.08  ?  456 LYS A HZ2  1 
ATOM   1725 H HZ3  . LYS A 1 125 ? -39.443 -32.879 1.608   1.00 68.08  ?  456 LYS A HZ3  1 
ATOM   1726 N N    . ASP A 1 126 ? -38.730 -27.959 -4.464  1.00 32.73  ?  457 ASP A N    1 
ATOM   1727 C CA   . ASP A 1 126 ? -39.560 -27.729 -5.635  1.00 35.17  ?  457 ASP A CA   1 
ATOM   1728 C C    . ASP A 1 126 ? -39.420 -28.916 -6.581  1.00 34.22  ?  457 ASP A C    1 
ATOM   1729 O O    . ASP A 1 126 ? -38.393 -29.080 -7.239  1.00 31.06  ?  457 ASP A O    1 
ATOM   1730 C CB   . ASP A 1 126 ? -39.176 -26.426 -6.338  1.00 36.86  ?  457 ASP A CB   1 
ATOM   1731 C CG   . ASP A 1 126 ? -40.232 -25.966 -7.324  1.00 43.66  ?  457 ASP A CG   1 
ATOM   1732 O OD1  . ASP A 1 126 ? -40.961 -26.828 -7.856  1.00 41.18  ?  457 ASP A OD1  1 
ATOM   1733 O OD2  . ASP A 1 126 ? -40.340 -24.744 -7.564  1.00 37.48  ?  457 ASP A OD2  1 
ATOM   1734 H H    . ASP A 1 126 ? -38.103 -28.534 -4.587  1.00 39.28  ?  457 ASP A H    1 
ATOM   1735 H HA   . ASP A 1 126 ? -40.488 -27.665 -5.362  1.00 42.20  ?  457 ASP A HA   1 
ATOM   1736 H HB2  . ASP A 1 126 ? -39.060 -25.729 -5.673  1.00 44.23  ?  457 ASP A HB2  1 
ATOM   1737 H HB3  . ASP A 1 126 ? -38.348 -26.561 -6.826  1.00 44.23  ?  457 ASP A HB3  1 
ATOM   1738 N N    . ALA A 1 127 ? -40.458 -29.745 -6.637  1.00 42.63  ?  458 ALA A N    1 
ATOM   1739 C CA   . ALA A 1 127 ? -40.436 -30.948 -7.462  1.00 37.48  ?  458 ALA A CA   1 
ATOM   1740 C C    . ALA A 1 127 ? -40.311 -30.613 -8.946  1.00 32.79  ?  458 ALA A C    1 
ATOM   1741 O O    . ALA A 1 127 ? -39.971 -31.473 -9.755  1.00 40.19  ?  458 ALA A O    1 
ATOM   1742 C CB   . ALA A 1 127 ? -41.687 -31.778 -7.212  1.00 41.41  ?  458 ALA A CB   1 
ATOM   1743 H H    . ALA A 1 127 ? -41.192 -29.631 -6.204  1.00 51.16  ?  458 ALA A H    1 
ATOM   1744 H HA   . ALA A 1 127 ? -39.667 -31.485 -7.212  1.00 44.98  ?  458 ALA A HA   1 
ATOM   1745 H HB1  . ALA A 1 127 ? -41.654 -32.572 -7.768  1.00 49.69  ?  458 ALA A HB1  1 
ATOM   1746 H HB2  . ALA A 1 127 ? -41.716 -32.029 -6.276  1.00 49.69  ?  458 ALA A HB2  1 
ATOM   1747 H HB3  . ALA A 1 127 ? -42.467 -31.247 -7.438  1.00 49.69  ?  458 ALA A HB3  1 
ATOM   1748 N N    . ALA A 1 128 ? -40.587 -29.363 -9.298  1.00 31.96  ?  459 ALA A N    1 
ATOM   1749 C CA   . ALA A 1 128 ? -40.460 -28.911 -10.679 1.00 35.82  ?  459 ALA A CA   1 
ATOM   1750 C C    . ALA A 1 128 ? -38.998 -28.790 -11.111 1.00 41.50  ?  459 ALA A C    1 
ATOM   1751 O O    . ALA A 1 128 ? -38.689 -28.880 -12.298 1.00 36.32  ?  459 ALA A O    1 
ATOM   1752 C CB   . ALA A 1 128 ? -41.164 -27.578 -10.861 1.00 32.82  ?  459 ALA A CB   1 
ATOM   1753 H H    . ALA A 1 128 ? -40.852 -28.752 -8.753  1.00 38.35  ?  459 ALA A H    1 
ATOM   1754 H HA   . ALA A 1 128 ? -40.890 -29.557 -11.261 1.00 42.99  ?  459 ALA A HA   1 
ATOM   1755 H HB1  . ALA A 1 128 ? -41.069 -27.294 -11.784 1.00 39.38  ?  459 ALA A HB1  1 
ATOM   1756 H HB2  . ALA A 1 128 ? -42.103 -27.685 -10.643 1.00 39.38  ?  459 ALA A HB2  1 
ATOM   1757 H HB3  . ALA A 1 128 ? -40.760 -26.924 -10.270 1.00 39.38  ?  459 ALA A HB3  1 
ATOM   1758 N N    . PHE A 1 129 ? -38.102 -28.578 -10.152 1.00 37.19  ?  460 PHE A N    1 
ATOM   1759 C CA   . PHE A 1 129 ? -36.683 -28.423 -10.460 1.00 31.01  ?  460 PHE A CA   1 
ATOM   1760 C C    . PHE A 1 129 ? -35.996 -29.780 -10.562 1.00 33.42  ?  460 PHE A C    1 
ATOM   1761 O O    . PHE A 1 129 ? -36.400 -30.739 -9.908  1.00 30.37  ?  460 PHE A O    1 
ATOM   1762 C CB   . PHE A 1 129 ? -35.997 -27.549 -9.404  1.00 30.40  ?  460 PHE A CB   1 
ATOM   1763 C CG   . PHE A 1 129 ? -36.120 -26.074 -9.671  1.00 27.39  ?  460 PHE A CG   1 
ATOM   1764 C CD1  . PHE A 1 129 ? -37.344 -25.433 -9.556  1.00 31.88  ?  460 PHE A CD1  1 
ATOM   1765 C CD2  . PHE A 1 129 ? -35.011 -25.327 -10.041 1.00 30.60  ?  460 PHE A CD2  1 
ATOM   1766 C CE1  . PHE A 1 129 ? -37.459 -24.080 -9.806  1.00 28.22  ?  460 PHE A CE1  1 
ATOM   1767 C CE2  . PHE A 1 129 ? -35.121 -23.971 -10.291 1.00 29.01  ?  460 PHE A CE2  1 
ATOM   1768 C CZ   . PHE A 1 129 ? -36.345 -23.346 -10.174 1.00 26.67  ?  460 PHE A CZ   1 
ATOM   1769 H H    . PHE A 1 129 ? -38.290 -28.519 -9.314  1.00 44.62  ?  460 PHE A H    1 
ATOM   1770 H HA   . PHE A 1 129 ? -36.595 -27.979 -11.317 1.00 37.22  ?  460 PHE A HA   1 
ATOM   1771 H HB2  . PHE A 1 129 ? -36.398 -27.729 -8.539  1.00 36.48  ?  460 PHE A HB2  1 
ATOM   1772 H HB3  . PHE A 1 129 ? -35.052 -27.770 -9.381  1.00 36.48  ?  460 PHE A HB3  1 
ATOM   1773 H HD1  . PHE A 1 129 ? -38.096 -25.921 -9.310  1.00 38.26  ?  460 PHE A HD1  1 
ATOM   1774 H HD2  . PHE A 1 129 ? -34.184 -25.744 -10.122 1.00 36.72  ?  460 PHE A HD2  1 
ATOM   1775 H HE1  . PHE A 1 129 ? -38.286 -23.661 -9.725  1.00 33.86  ?  460 PHE A HE1  1 
ATOM   1776 H HE2  . PHE A 1 129 ? -34.370 -23.481 -10.538 1.00 34.81  ?  460 PHE A HE2  1 
ATOM   1777 H HZ   . PHE A 1 129 ? -36.420 -22.434 -10.340 1.00 32.00  ?  460 PHE A HZ   1 
ATOM   1778 N N    . LYS A 1 130 ? -34.951 -29.838 -11.384 1.00 35.00  ?  461 LYS A N    1 
ATOM   1779 C CA   . LYS A 1 130 ? -34.299 -31.090 -11.760 1.00 29.80  ?  461 LYS A CA   1 
ATOM   1780 C C    . LYS A 1 130 ? -33.936 -31.973 -10.569 1.00 40.54  ?  461 LYS A C    1 
ATOM   1781 O O    . LYS A 1 130 ? -34.135 -33.188 -10.612 1.00 30.83  ?  461 LYS A O    1 
ATOM   1782 C CB   . LYS A 1 130 ? -33.042 -30.784 -12.580 1.00 26.22  ?  461 LYS A CB   1 
ATOM   1783 C CG   . LYS A 1 130 ? -32.230 -32.003 -12.981 1.00 32.81  ?  461 LYS A CG   1 
ATOM   1784 C CD   . LYS A 1 130 ? -31.087 -31.607 -13.899 1.00 28.99  ?  461 LYS A CD   1 
ATOM   1785 C CE   . LYS A 1 130 ? -30.301 -32.812 -14.379 1.00 35.03  ?  461 LYS A CE   1 
ATOM   1786 N NZ   . LYS A 1 130 ? -29.238 -32.427 -15.347 1.00 38.62  ?  461 LYS A NZ   1 
ATOM   1787 H H    . LYS A 1 130 ? -34.592 -29.145 -11.747 1.00 42.00  ?  461 LYS A H    1 
ATOM   1788 H HA   . LYS A 1 130 ? -34.904 -31.595 -12.326 1.00 35.76  ?  461 LYS A HA   1 
ATOM   1789 H HB2  . LYS A 1 130 ? -33.307 -30.327 -13.393 1.00 31.46  ?  461 LYS A HB2  1 
ATOM   1790 H HB3  . LYS A 1 130 ? -32.465 -30.207 -12.056 1.00 31.46  ?  461 LYS A HB3  1 
ATOM   1791 H HG2  . LYS A 1 130 ? -31.857 -32.418 -12.188 1.00 39.37  ?  461 LYS A HG2  1 
ATOM   1792 H HG3  . LYS A 1 130 ? -32.800 -32.629 -13.454 1.00 39.37  ?  461 LYS A HG3  1 
ATOM   1793 H HD2  . LYS A 1 130 ? -31.446 -31.151 -14.677 1.00 34.79  ?  461 LYS A HD2  1 
ATOM   1794 H HD3  . LYS A 1 130 ? -30.481 -31.022 -13.419 1.00 34.79  ?  461 LYS A HD3  1 
ATOM   1795 H HE2  . LYS A 1 130 ? -29.877 -33.240 -13.618 1.00 42.04  ?  461 LYS A HE2  1 
ATOM   1796 H HE3  . LYS A 1 130 ? -30.903 -33.431 -14.820 1.00 42.04  ?  461 LYS A HE3  1 
ATOM   1797 H HZ1  . LYS A 1 130 ? -28.792 -33.150 -15.612 1.00 46.34  ?  461 LYS A HZ1  1 
ATOM   1798 H HZ2  . LYS A 1 130 ? -29.602 -32.034 -16.058 1.00 46.34  ?  461 LYS A HZ2  1 
ATOM   1799 H HZ3  . LYS A 1 130 ? -28.668 -31.860 -14.964 1.00 46.34  ?  461 LYS A HZ3  1 
ATOM   1800 N N    . PHE A 1 131 ? -33.412 -31.366 -9.508  1.00 27.45  ?  462 PHE A N    1 
ATOM   1801 C CA   . PHE A 1 131 ? -32.961 -32.124 -8.345  1.00 26.01  ?  462 PHE A CA   1 
ATOM   1802 C C    . PHE A 1 131 ? -33.902 -31.980 -7.156  1.00 28.31  ?  462 PHE A C    1 
ATOM   1803 O O    . PHE A 1 131 ? -33.575 -32.398 -6.046  1.00 28.87  ?  462 PHE A O    1 
ATOM   1804 C CB   . PHE A 1 131 ? -31.552 -31.692 -7.955  1.00 28.10  ?  462 PHE A CB   1 
ATOM   1805 C CG   . PHE A 1 131 ? -30.546 -31.900 -9.044  1.00 26.71  ?  462 PHE A CG   1 
ATOM   1806 C CD1  . PHE A 1 131 ? -30.222 -33.178 -9.468  1.00 29.56  ?  462 PHE A CD1  1 
ATOM   1807 C CD2  . PHE A 1 131 ? -29.933 -30.822 -9.653  1.00 31.82  ?  462 PHE A CD2  1 
ATOM   1808 C CE1  . PHE A 1 131 ? -29.300 -33.374 -10.475 1.00 30.30  ?  462 PHE A CE1  1 
ATOM   1809 C CE2  . PHE A 1 131 ? -29.009 -31.011 -10.658 1.00 26.44  ?  462 PHE A CE2  1 
ATOM   1810 C CZ   . PHE A 1 131 ? -28.691 -32.289 -11.072 1.00 33.69  ?  462 PHE A CZ   1 
ATOM   1811 H H    . PHE A 1 131 ? -33.307 -30.516 -9.436  1.00 32.94  ?  462 PHE A H    1 
ATOM   1812 H HA   . PHE A 1 131 ? -32.926 -33.065 -8.582  1.00 31.21  ?  462 PHE A HA   1 
ATOM   1813 H HB2  . PHE A 1 131 ? -31.563 -30.747 -7.736  1.00 33.72  ?  462 PHE A HB2  1 
ATOM   1814 H HB3  . PHE A 1 131 ? -31.267 -32.206 -7.184  1.00 33.72  ?  462 PHE A HB3  1 
ATOM   1815 H HD1  . PHE A 1 131 ? -30.629 -33.912 -9.068  1.00 35.47  ?  462 PHE A HD1  1 
ATOM   1816 H HD2  . PHE A 1 131 ? -30.143 -29.959 -9.379  1.00 38.19  ?  462 PHE A HD2  1 
ATOM   1817 H HE1  . PHE A 1 131 ? -29.087 -34.237 -10.750 1.00 36.36  ?  462 PHE A HE1  1 
ATOM   1818 H HE2  . PHE A 1 131 ? -28.602 -30.278 -11.059 1.00 31.73  ?  462 PHE A HE2  1 
ATOM   1819 H HZ   . PHE A 1 131 ? -28.068 -32.419 -11.751 1.00 40.43  ?  462 PHE A HZ   1 
ATOM   1820 N N    . GLY A 1 132 ? -35.066 -31.389 -7.399  1.00 24.00  ?  463 GLY A N    1 
ATOM   1821 C CA   . GLY A 1 132 ? -36.106 -31.282 -6.392  1.00 28.00  ?  463 GLY A CA   1 
ATOM   1822 C C    . GLY A 1 132 ? -35.904 -30.114 -5.451  1.00 29.72  ?  463 GLY A C    1 
ATOM   1823 O O    . GLY A 1 132 ? -36.661 -29.943 -4.494  1.00 26.28  ?  463 GLY A O    1 
ATOM   1824 H H    . GLY A 1 132 ? -35.278 -31.036 -8.154  1.00 28.80  ?  463 GLY A H    1 
ATOM   1825 H HA2  . GLY A 1 132 ? -36.966 -31.176 -6.829  1.00 33.60  ?  463 GLY A HA2  1 
ATOM   1826 H HA3  . GLY A 1 132 ? -36.129 -32.097 -5.867  1.00 33.60  ?  463 GLY A HA3  1 
ATOM   1827 N N    . TRP A 1 133 ? -34.887 -29.307 -5.739  1.00 22.53  ?  464 TRP A N    1 
ATOM   1828 C CA   . TRP A 1 133 ? -34.509 -28.176 -4.897  1.00 26.33  ?  464 TRP A CA   1 
ATOM   1829 C C    . TRP A 1 133 ? -34.118 -26.976 -5.750  1.00 23.06  ?  464 TRP A C    1 
ATOM   1830 O O    . TRP A 1 133 ? -33.587 -27.143 -6.847  1.00 24.71  ?  464 TRP A O    1 
ATOM   1831 C CB   . TRP A 1 133 ? -33.341 -28.553 -3.989  1.00 24.46  ?  464 TRP A CB   1 
ATOM   1832 C CG   . TRP A 1 133 ? -33.672 -29.569 -2.957  1.00 28.47  ?  464 TRP A CG   1 
ATOM   1833 C CD1  . TRP A 1 133 ? -33.539 -30.924 -3.062  1.00 31.27  ?  464 TRP A CD1  1 
ATOM   1834 C CD2  . TRP A 1 133 ? -34.189 -29.315 -1.648  1.00 23.05  ?  464 TRP A CD2  1 
ATOM   1835 N NE1  . TRP A 1 133 ? -33.940 -31.529 -1.896  1.00 33.13  ?  464 TRP A NE1  1 
ATOM   1836 C CE2  . TRP A 1 133 ? -34.350 -30.564 -1.014  1.00 33.02  ?  464 TRP A CE2  1 
ATOM   1837 C CE3  . TRP A 1 133 ? -34.529 -28.153 -0.950  1.00 25.06  ?  464 TRP A CE3  1 
ATOM   1838 C CZ2  . TRP A 1 133 ? -34.832 -30.682 0.285   1.00 40.37  ?  464 TRP A CZ2  1 
ATOM   1839 C CZ3  . TRP A 1 133 ? -35.010 -28.272 0.338   1.00 33.02  ?  464 TRP A CZ3  1 
ATOM   1840 C CH2  . TRP A 1 133 ? -35.157 -29.528 0.942   1.00 40.02  ?  464 TRP A CH2  1 
ATOM   1841 H H    . TRP A 1 133 ? -34.388 -29.397 -6.435  1.00 27.03  ?  464 TRP A H    1 
ATOM   1842 H HA   . TRP A 1 133 ? -35.261 -27.924 -4.339  1.00 31.59  ?  464 TRP A HA   1 
ATOM   1843 H HB2  . TRP A 1 133 ? -32.625 -28.912 -4.537  1.00 29.35  ?  464 TRP A HB2  1 
ATOM   1844 H HB3  . TRP A 1 133 ? -33.033 -27.756 -3.530  1.00 29.35  ?  464 TRP A HB3  1 
ATOM   1845 H HD1  . TRP A 1 133 ? -33.223 -31.371 -3.813  1.00 37.52  ?  464 TRP A HD1  1 
ATOM   1846 H HE1  . TRP A 1 133 ? -33.944 -32.377 -1.747  1.00 39.75  ?  464 TRP A HE1  1 
ATOM   1847 H HE3  . TRP A 1 133 ? -34.433 -27.317 -1.345  1.00 30.07  ?  464 TRP A HE3  1 
ATOM   1848 H HZ2  . TRP A 1 133 ? -34.931 -31.513 0.690   1.00 48.45  ?  464 TRP A HZ2  1 
ATOM   1849 H HZ3  . TRP A 1 133 ? -35.243 -27.506 0.812   1.00 39.63  ?  464 TRP A HZ3  1 
ATOM   1850 H HH2  . TRP A 1 133 ? -35.486 -29.578 1.811   1.00 48.03  ?  464 TRP A HH2  1 
ATOM   1851 N N    . LYS A 1 134 ? -34.371 -25.772 -5.243  1.00 22.09  ?  465 LYS A N    1 
ATOM   1852 C CA   . LYS A 1 134 ? -33.940 -24.555 -5.922  1.00 21.24  ?  465 LYS A CA   1 
ATOM   1853 C C    . LYS A 1 134 ? -33.289 -23.593 -4.938  1.00 24.40  ?  465 LYS A C    1 
ATOM   1854 O O    . LYS A 1 134 ? -33.724 -23.471 -3.795  1.00 21.54  ?  465 LYS A O    1 
ATOM   1855 C CB   . LYS A 1 134 ? -35.117 -23.878 -6.618  1.00 21.60  ?  465 LYS A CB   1 
ATOM   1856 C CG   . LYS A 1 134 ? -36.183 -23.378 -5.667  1.00 23.41  ?  465 LYS A CG   1 
ATOM   1857 C CD   . LYS A 1 134 ? -37.427 -22.929 -6.413  1.00 28.57  ?  465 LYS A CD   1 
ATOM   1858 C CE   . LYS A 1 134 ? -38.504 -22.466 -5.450  1.00 32.39  ?  465 LYS A CE   1 
ATOM   1859 N NZ   . LYS A 1 134 ? -39.749 -22.068 -6.164  1.00 49.57  ?  465 LYS A NZ   1 
ATOM   1860 H H    . LYS A 1 134 ? -34.792 -25.634 -4.505  1.00 26.51  ?  465 LYS A H    1 
ATOM   1861 H HA   . LYS A 1 134 ? -33.283 -24.786 -6.597  1.00 25.48  ?  465 LYS A HA   1 
ATOM   1862 H HB2  . LYS A 1 134 ? -34.787 -23.117 -7.121  1.00 25.92  ?  465 LYS A HB2  1 
ATOM   1863 H HB3  . LYS A 1 134 ? -35.533 -24.515 -7.220  1.00 25.92  ?  465 LYS A HB3  1 
ATOM   1864 H HG2  . LYS A 1 134 ? -36.434 -24.093 -5.062  1.00 28.09  ?  465 LYS A HG2  1 
ATOM   1865 H HG3  . LYS A 1 134 ? -35.838 -22.621 -5.169  1.00 28.09  ?  465 LYS A HG3  1 
ATOM   1866 H HD2  . LYS A 1 134 ? -37.202 -22.188 -6.997  1.00 34.29  ?  465 LYS A HD2  1 
ATOM   1867 H HD3  . LYS A 1 134 ? -37.778 -23.671 -6.930  1.00 34.29  ?  465 LYS A HD3  1 
ATOM   1868 H HE2  . LYS A 1 134 ? -38.722 -23.190 -4.843  1.00 38.87  ?  465 LYS A HE2  1 
ATOM   1869 H HE3  . LYS A 1 134 ? -38.180 -21.698 -4.954  1.00 38.87  ?  465 LYS A HE3  1 
ATOM   1870 H HZ1  . LYS A 1 134 ? -40.364 -21.801 -5.578  1.00 59.48  ?  465 LYS A HZ1  1 
ATOM   1871 H HZ2  . LYS A 1 134 ? -39.577 -21.399 -6.726  1.00 59.48  ?  465 LYS A HZ2  1 
ATOM   1872 H HZ3  . LYS A 1 134 ? -40.070 -22.758 -6.625  1.00 59.48  ?  465 LYS A HZ3  1 
ATOM   1873 N N    . LEU A 1 135 ? -32.233 -22.924 -5.388  1.00 20.00  ?  466 LEU A N    1 
ATOM   1874 C CA   . LEU A 1 135 ? -31.557 -21.920 -4.575  1.00 20.72  ?  466 LEU A CA   1 
ATOM   1875 C C    . LEU A 1 135 ? -32.295 -20.587 -4.690  1.00 19.96  ?  466 LEU A C    1 
ATOM   1876 O O    . LEU A 1 135 ? -32.461 -20.072 -5.794  1.00 20.84  ?  466 LEU A O    1 
ATOM   1877 C CB   . LEU A 1 135 ? -30.102 -21.769 -5.022  1.00 19.58  ?  466 LEU A CB   1 
ATOM   1878 C CG   . LEU A 1 135 ? -29.267 -20.752 -4.243  1.00 20.44  ?  466 LEU A CG   1 
ATOM   1879 C CD1  . LEU A 1 135 ? -29.054 -21.232 -2.823  1.00 20.32  ?  466 LEU A CD1  1 
ATOM   1880 C CD2  . LEU A 1 135 ? -27.940 -20.506 -4.944  1.00 21.26  ?  466 LEU A CD2  1 
ATOM   1881 H H    . LEU A 1 135 ? -31.886 -23.035 -6.167  1.00 24.00  ?  466 LEU A H    1 
ATOM   1882 H HA   . LEU A 1 135 ? -31.566 -22.196 -3.646  1.00 24.86  ?  466 LEU A HA   1 
ATOM   1883 H HB2  . LEU A 1 135 ? -29.665 -22.630 -4.934  1.00 23.50  ?  466 LEU A HB2  1 
ATOM   1884 H HB3  . LEU A 1 135 ? -30.095 -21.497 -5.953  1.00 23.50  ?  466 LEU A HB3  1 
ATOM   1885 H HG   . LEU A 1 135 ? -29.748 -19.910 -4.206  1.00 24.53  ?  466 LEU A HG   1 
ATOM   1886 H HD11 . LEU A 1 135 ? -28.524 -20.576 -2.344  1.00 24.39  ?  466 LEU A HD11 1 
ATOM   1887 H HD12 . LEU A 1 135 ? -29.918 -21.338 -2.393  1.00 24.39  ?  466 LEU A HD12 1 
ATOM   1888 H HD13 . LEU A 1 135 ? -28.589 -22.083 -2.844  1.00 24.39  ?  466 LEU A HD13 1 
ATOM   1889 H HD21 . LEU A 1 135 ? -27.428 -19.860 -4.433  1.00 25.51  ?  466 LEU A HD21 1 
ATOM   1890 H HD22 . LEU A 1 135 ? -27.453 -21.344 -4.999  1.00 25.51  ?  466 LEU A HD22 1 
ATOM   1891 H HD23 . LEU A 1 135 ? -28.112 -20.164 -5.834  1.00 25.51  ?  466 LEU A HD23 1 
ATOM   1892 N N    . VAL A 1 136 ? -32.740 -20.035 -3.560  1.00 18.10  ?  467 VAL A N    1 
ATOM   1893 C CA   . VAL A 1 136 ? -33.537 -18.806 -3.571  1.00 19.01  ?  467 VAL A CA   1 
ATOM   1894 C C    . VAL A 1 136 ? -32.769 -17.607 -3.013  1.00 21.21  ?  467 VAL A C    1 
ATOM   1895 O O    . VAL A 1 136 ? -33.077 -16.460 -3.339  1.00 17.89  ?  467 VAL A O    1 
ATOM   1896 C CB   . VAL A 1 136 ? -34.857 -18.975 -2.776  1.00 21.92  ?  467 VAL A CB   1 
ATOM   1897 C CG1  . VAL A 1 136 ? -35.716 -20.055 -3.410  1.00 22.92  ?  467 VAL A CG1  1 
ATOM   1898 C CG2  . VAL A 1 136 ? -34.589 -19.304 -1.316  1.00 25.07  ?  467 VAL A CG2  1 
ATOM   1899 H H    . VAL A 1 136 ? -32.595 -20.353 -2.774  1.00 21.72  ?  467 VAL A H    1 
ATOM   1900 H HA   . VAL A 1 136 ? -33.773 -18.600 -4.489  1.00 22.81  ?  467 VAL A HA   1 
ATOM   1901 H HB   . VAL A 1 136 ? -35.353 -18.142 -2.808  1.00 26.30  ?  467 VAL A HB   1 
ATOM   1902 H HG11 . VAL A 1 136 ? -36.536 -20.147 -2.900  1.00 27.50  ?  467 VAL A HG11 1 
ATOM   1903 H HG12 . VAL A 1 136 ? -35.921 -19.799 -4.323  1.00 27.50  ?  467 VAL A HG12 1 
ATOM   1904 H HG13 . VAL A 1 136 ? -35.226 -20.892 -3.403  1.00 27.50  ?  467 VAL A HG13 1 
ATOM   1905 H HG21 . VAL A 1 136 ? -35.437 -19.402 -0.854  1.00 30.09  ?  467 VAL A HG21 1 
ATOM   1906 H HG22 . VAL A 1 136 ? -34.087 -20.133 -1.267  1.00 30.09  ?  467 VAL A HG22 1 
ATOM   1907 H HG23 . VAL A 1 136 ? -34.077 -18.582 -0.919  1.00 30.09  ?  467 VAL A HG23 1 
ATOM   1908 N N    . HIS A 1 137 ? -31.770 -17.876 -2.181  1.00 20.34  ?  468 HIS A N    1 
ATOM   1909 C CA   . HIS A 1 137 ? -30.939 -16.815 -1.618  1.00 15.80  ?  468 HIS A CA   1 
ATOM   1910 C C    . HIS A 1 137 ? -29.604 -17.353 -1.135  1.00 16.34  ?  468 HIS A C    1 
ATOM   1911 O O    . HIS A 1 137 ? -29.527 -18.466 -0.614  1.00 19.03  ?  468 HIS A O    1 
ATOM   1912 C CB   . HIS A 1 137 ? -31.652 -16.127 -0.454  1.00 17.26  ?  468 HIS A CB   1 
ATOM   1913 C CG   . HIS A 1 137 ? -30.804 -15.117 0.258   1.00 15.55  ?  468 HIS A CG   1 
ATOM   1914 N ND1  . HIS A 1 137 ? -30.589 -13.846 -0.234  1.00 22.97  ?  468 HIS A ND1  1 
ATOM   1915 C CD2  . HIS A 1 137 ? -30.107 -15.194 1.415   1.00 19.92  ?  468 HIS A CD2  1 
ATOM   1916 C CE1  . HIS A 1 137 ? -29.802 -13.185 0.594   1.00 18.67  ?  468 HIS A CE1  1 
ATOM   1917 N NE2  . HIS A 1 137 ? -29.491 -13.978 1.602   1.00 18.56  ?  468 HIS A NE2  1 
ATOM   1918 H H    . HIS A 1 137 ? -31.551 -18.667 -1.925  1.00 24.40  ?  468 HIS A H    1 
ATOM   1919 H HA   . HIS A 1 137 ? -30.767 -16.150 -2.302  1.00 18.96  ?  468 HIS A HA   1 
ATOM   1920 H HB2  . HIS A 1 137 ? -32.436 -15.670 -0.795  1.00 20.72  ?  468 HIS A HB2  1 
ATOM   1921 H HB3  . HIS A 1 137 ? -31.917 -16.800 0.192   1.00 20.72  ?  468 HIS A HB3  1 
ATOM   1922 H HD2  . HIS A 1 137 ? -30.054 -15.932 1.979   1.00 23.90  ?  468 HIS A HD2  1 
ATOM   1923 H HE1  . HIS A 1 137 ? -29.513 -12.307 0.484   1.00 22.40  ?  468 HIS A HE1  1 
ATOM   1924 H HE2  . HIS A 1 137 ? -28.991 -13.767 2.269   1.00 22.27  ?  468 HIS A HE2  1 
ATOM   1925 N N    . PHE A 1 138 ? -28.543 -16.569 -1.297  1.00 14.07  ?  469 PHE A N    1 
ATOM   1926 C CA   . PHE A 1 138 ? -27.293 -16.929 -0.650  1.00 16.02  ?  469 PHE A CA   1 
ATOM   1927 C C    . PHE A 1 138 ? -26.510 -15.694 -0.233  1.00 15.51  ?  469 PHE A C    1 
ATOM   1928 O O    . PHE A 1 138 ? -26.750 -14.590 -0.710  1.00 15.73  ?  469 PHE A O    1 
ATOM   1929 C CB   . PHE A 1 138 ? -26.455 -17.853 -1.548  1.00 17.01  ?  469 PHE A CB   1 
ATOM   1930 C CG   . PHE A 1 138 ? -25.896 -17.203 -2.789  1.00 20.98  ?  469 PHE A CG   1 
ATOM   1931 C CD1  . PHE A 1 138 ? -26.635 -17.159 -3.961  1.00 23.31  ?  469 PHE A CD1  1 
ATOM   1932 C CD2  . PHE A 1 138 ? -24.606 -16.694 -2.798  1.00 20.59  ?  469 PHE A CD2  1 
ATOM   1933 C CE1  . PHE A 1 138 ? -26.111 -16.589 -5.109  1.00 25.51  ?  469 PHE A CE1  1 
ATOM   1934 C CE2  . PHE A 1 138 ? -24.080 -16.118 -3.940  1.00 23.23  ?  469 PHE A CE2  1 
ATOM   1935 C CZ   . PHE A 1 138 ? -24.831 -16.070 -5.097  1.00 23.39  ?  469 PHE A CZ   1 
ATOM   1936 H H    . PHE A 1 138 ? -28.521 -15.846 -1.762  1.00 16.88  ?  469 PHE A H    1 
ATOM   1937 H HA   . PHE A 1 138 ? -27.500 -17.425 0.157   1.00 19.23  ?  469 PHE A HA   1 
ATOM   1938 H HB2  . PHE A 1 138 ? -25.706 -18.189 -1.032  1.00 20.41  ?  469 PHE A HB2  1 
ATOM   1939 H HB3  . PHE A 1 138 ? -27.012 -18.594 -1.833  1.00 20.41  ?  469 PHE A HB3  1 
ATOM   1940 H HD1  . PHE A 1 138 ? -27.496 -17.508 -3.973  1.00 27.97  ?  469 PHE A HD1  1 
ATOM   1941 H HD2  . PHE A 1 138 ? -24.096 -16.724 -2.022  1.00 24.71  ?  469 PHE A HD2  1 
ATOM   1942 H HE1  . PHE A 1 138 ? -26.621 -16.554 -5.886  1.00 30.61  ?  469 PHE A HE1  1 
ATOM   1943 H HE2  . PHE A 1 138 ? -23.218 -15.770 -3.930  1.00 27.88  ?  469 PHE A HE2  1 
ATOM   1944 H HZ   . PHE A 1 138 ? -24.478 -15.682 -5.865  1.00 28.07  ?  469 PHE A HZ   1 
ATOM   1945 N N    . HIS A 1 139 ? -25.609 -15.911 0.712   1.00 14.78  ?  470 HIS A N    1 
ATOM   1946 C CA   . HIS A 1 139 ? -24.835 -14.849 1.338   1.00 14.55  ?  470 HIS A CA   1 
ATOM   1947 C C    . HIS A 1 139 ? -23.415 -15.367 1.443   1.00 15.50  ?  470 HIS A C    1 
ATOM   1948 O O    . HIS A 1 139 ? -23.174 -16.346 2.136   1.00 15.81  ?  470 HIS A O    1 
ATOM   1949 C CB   . HIS A 1 139 ? -25.428 -14.518 2.708   1.00 17.37  ?  470 HIS A CB   1 
ATOM   1950 C CG   . HIS A 1 139 ? -24.878 -13.277 3.346   1.00 16.41  ?  470 HIS A CG   1 
ATOM   1951 N ND1  . HIS A 1 139 ? -23.596 -12.821 3.119   1.00 20.91  ?  470 HIS A ND1  1 
ATOM   1952 C CD2  . HIS A 1 139 ? -25.440 -12.408 4.214   1.00 11.98  ?  470 HIS A CD2  1 
ATOM   1953 C CE1  . HIS A 1 139 ? -23.398 -11.721 3.823   1.00 15.74  ?  470 HIS A CE1  1 
ATOM   1954 N NE2  . HIS A 1 139 ? -24.496 -11.444 4.496   1.00 23.11  ?  470 HIS A NE2  1 
ATOM   1955 H H    . HIS A 1 139 ? -25.421 -16.692 1.018   1.00 17.74  ?  470 HIS A H    1 
ATOM   1956 H HA   . HIS A 1 139 ? -24.845 -14.054 0.783   1.00 17.46  ?  470 HIS A HA   1 
ATOM   1957 H HB2  . HIS A 1 139 ? -26.385 -14.398 2.611   1.00 20.84  ?  470 HIS A HB2  1 
ATOM   1958 H HB3  . HIS A 1 139 ? -25.252 -15.259 3.309   1.00 20.84  ?  470 HIS A HB3  1 
ATOM   1959 H HD2  . HIS A 1 139 ? -26.303 -12.452 4.558   1.00 14.38  ?  470 HIS A HD2  1 
ATOM   1960 H HE1  . HIS A 1 139 ? -22.613 -11.222 3.838   1.00 18.88  ?  470 HIS A HE1  1 
ATOM   1961 H HE2  . HIS A 1 139 ? -24.606 -10.773 5.022   1.00 27.73  ?  470 HIS A HE2  1 
ATOM   1962 N N    . ARG A 1 140 ? -22.493 -14.744 0.713   1.00 13.92  ?  471 ARG A N    1 
ATOM   1963 C CA   . ARG A 1 140 ? -21.087 -15.112 0.758   1.00 14.76  ?  471 ARG A CA   1 
ATOM   1964 C C    . ARG A 1 140 ? -20.281 -13.906 1.208   1.00 17.93  ?  471 ARG A C    1 
ATOM   1965 O O    . ARG A 1 140 ? -20.471 -12.800 0.698   1.00 17.98  ?  471 ARG A O    1 
ATOM   1966 C CB   . ARG A 1 140 ? -20.584 -15.600 -0.604  1.00 20.03  ?  471 ARG A CB   1 
ATOM   1967 C CG   . ARG A 1 140 ? -19.077 -15.836 -0.616  1.00 19.79  ?  471 ARG A CG   1 
ATOM   1968 C CD   . ARG A 1 140 ? -18.605 -16.683 -1.792  1.00 31.88  ?  471 ARG A CD   1 
ATOM   1969 N NE   . ARG A 1 140 ? -18.852 -16.053 -3.088  1.00 36.22  ?  471 ARG A NE   1 
ATOM   1970 C CZ   . ARG A 1 140 ? -19.732 -16.482 -3.993  1.00 34.39  ?  471 ARG A CZ   1 
ATOM   1971 N NH1  . ARG A 1 140 ? -20.474 -17.560 -3.776  1.00 32.36  ?  471 ARG A NH1  1 
ATOM   1972 N NH2  . ARG A 1 140 ? -19.866 -15.824 -5.135  1.00 42.89  ?  471 ARG A NH2  1 
ATOM   1973 H H    . ARG A 1 140 ? -22.663 -14.094 0.176   1.00 16.71  ?  471 ARG A H    1 
ATOM   1974 H HA   . ARG A 1 140 ? -20.961 -15.824 1.405   1.00 17.71  ?  471 ARG A HA   1 
ATOM   1975 H HB2  . ARG A 1 140 ? -21.022 -16.438 -0.823  1.00 24.03  ?  471 ARG A HB2  1 
ATOM   1976 H HB3  . ARG A 1 140 ? -20.790 -14.932 -1.277  1.00 24.03  ?  471 ARG A HB3  1 
ATOM   1977 H HG2  . ARG A 1 140 ? -18.626 -14.979 -0.666  1.00 23.75  ?  471 ARG A HG2  1 
ATOM   1978 H HG3  . ARG A 1 140 ? -18.825 -16.294 0.201   1.00 23.75  ?  471 ARG A HG3  1 
ATOM   1979 H HD2  . ARG A 1 140 ? -17.650 -16.831 -1.710  1.00 38.26  ?  471 ARG A HD2  1 
ATOM   1980 H HD3  . ARG A 1 140 ? -19.075 -17.531 -1.778  1.00 38.26  ?  471 ARG A HD3  1 
ATOM   1981 H HE   . ARG A 1 140 ? -18.395 -15.350 -3.281  1.00 43.46  ?  471 ARG A HE   1 
ATOM   1982 H HH11 . ARG A 1 140 ? -20.395 -17.995 -3.039  1.00 38.83  ?  471 ARG A HH11 1 
ATOM   1983 H HH12 . ARG A 1 140 ? -21.036 -17.822 -4.372  1.00 38.83  ?  471 ARG A HH12 1 
ATOM   1984 H HH21 . ARG A 1 140 ? -19.389 -15.125 -5.287  1.00 51.46  ?  471 ARG A HH21 1 
ATOM   1985 H HH22 . ARG A 1 140 ? -20.430 -16.096 -5.724  1.00 51.46  ?  471 ARG A HH22 1 
ATOM   1986 N N    . SER A 1 141 ? -19.395 -14.114 2.176   1.00 18.54  ?  472 SER A N    1 
ATOM   1987 C CA   . SER A 1 141 ? -18.553 -13.029 2.657   1.00 20.93  ?  472 SER A CA   1 
ATOM   1988 C C    . SER A 1 141 ? -17.130 -13.491 2.900   1.00 25.44  ?  472 SER A C    1 
ATOM   1989 O O    . SER A 1 141 ? -16.900 -14.600 3.380   1.00 21.67  ?  472 SER A O    1 
ATOM   1990 C CB   . SER A 1 141 ? -19.134 -12.438 3.932   1.00 22.23  ?  472 SER A CB   1 
ATOM   1991 O OG   . SER A 1 141 ? -19.179 -13.406 4.959   1.00 23.72  ?  472 SER A OG   1 
ATOM   1992 H H    . SER A 1 141 ? -19.263 -14.868 2.568   1.00 22.24  ?  472 SER A H    1 
ATOM   1993 H HA   . SER A 1 141 ? -18.529 -12.328 1.987   1.00 25.12  ?  472 SER A HA   1 
ATOM   1994 H HB2  . SER A 1 141 ? -18.576 -11.699 4.219   1.00 26.68  ?  472 SER A HB2  1 
ATOM   1995 H HB3  . SER A 1 141 ? -20.034 -12.125 3.753   1.00 26.68  ?  472 SER A HB3  1 
ATOM   1996 H HG   . SER A 1 141 ? -19.501 -13.068 5.657   1.00 28.47  ?  472 SER A HG   1 
ATOM   1997 N N    . GLY A 1 142 ? -16.182 -12.618 2.571   1.00 32.26  ?  473 GLY A N    1 
ATOM   1998 C CA   . GLY A 1 142 ? -14.769 -12.939 2.649   1.00 33.86  ?  473 GLY A CA   1 
ATOM   1999 C C    . GLY A 1 142 ? -14.179 -12.706 4.023   1.00 50.71  ?  473 GLY A C    1 
ATOM   2000 O O    . GLY A 1 142 ? -14.720 -11.948 4.827   1.00 53.58  ?  473 GLY A O    1 
ATOM   2001 H H    . GLY A 1 142 ? -16.340 -11.819 2.295   1.00 38.71  ?  473 GLY A H    1 
ATOM   2002 H HA2  . GLY A 1 142 ? -14.639 -13.872 2.416   1.00 40.63  ?  473 GLY A HA2  1 
ATOM   2003 H HA3  . GLY A 1 142 ? -14.282 -12.394 2.012   1.00 40.63  ?  473 GLY A HA3  1 
ATOM   2004 N N    . ALA A 1 143 ? -13.054 -13.364 4.283   1.00 68.03  ?  474 ALA A N    1 
ATOM   2005 C CA   . ALA A 1 143 ? -12.385 -13.270 5.573   1.00 66.77  ?  474 ALA A CA   1 
ATOM   2006 C C    . ALA A 1 143 ? -11.742 -11.899 5.756   1.00 74.66  ?  474 ALA A C    1 
ATOM   2007 O O    . ALA A 1 143 ? -11.659 -11.109 4.814   1.00 76.63  ?  474 ALA A O    1 
ATOM   2008 C CB   . ALA A 1 143 ? -11.343 -14.366 5.701   1.00 58.81  ?  474 ALA A CB   1 
ATOM   2009 H H    . ALA A 1 143 ? -12.654 -13.878 3.721   1.00 81.64  ?  474 ALA A H    1 
ATOM   2010 H HA   . ALA A 1 143 ? -13.039 -13.393 6.279   1.00 80.13  ?  474 ALA A HA   1 
ATOM   2011 H HB1  . ALA A 1 143 ? -10.908 -14.289 6.565   1.00 70.58  ?  474 ALA A HB1  1 
ATOM   2012 H HB2  . ALA A 1 143 ? -11.781 -15.229 5.627   1.00 70.58  ?  474 ALA A HB2  1 
ATOM   2013 H HB3  . ALA A 1 143 ? -10.690 -14.265 4.991   1.00 70.58  ?  474 ALA A HB3  1 
HETATM 2014 S S    . SO4 B 2 .   ? -22.349 -18.342 -7.078  1.00 58.20  ?  501 SO4 A S    1 
HETATM 2015 O O1   . SO4 B 2 .   ? -22.243 -18.302 -8.534  1.00 66.81  ?  501 SO4 A O1   1 
HETATM 2016 O O2   . SO4 B 2 .   ? -23.688 -18.801 -6.710  1.00 50.08  ?  501 SO4 A O2   1 
HETATM 2017 O O3   . SO4 B 2 .   ? -21.354 -19.260 -6.531  1.00 46.64  ?  501 SO4 A O3   1 
HETATM 2018 O O4   . SO4 B 2 .   ? -22.110 -17.002 -6.546  1.00 56.72  ?  501 SO4 A O4   1 
HETATM 2019 C C1   . GOL C 3 .   ? -15.989 -14.832 -4.418  1.00 41.56  ?  502 GOL A C1   1 
HETATM 2020 O O1   . GOL C 3 .   ? -17.320 -14.375 -4.354  1.00 41.00  ?  502 GOL A O1   1 
HETATM 2021 C C2   . GOL C 3 .   ? -15.880 -15.926 -5.471  1.00 57.48  ?  502 GOL A C2   1 
HETATM 2022 O O2   . GOL C 3 .   ? -15.864 -15.353 -6.759  1.00 68.13  ?  502 GOL A O2   1 
HETATM 2023 C C3   . GOL C 3 .   ? -14.606 -16.725 -5.240  1.00 43.32  ?  502 GOL A C3   1 
HETATM 2024 O O3   . GOL C 3 .   ? -14.492 -17.731 -6.221  1.00 51.64  ?  502 GOL A O3   1 
HETATM 2025 H H11  . GOL C 3 .   ? -15.686 -15.223 -3.447  1.00 49.87  ?  502 GOL A H11  1 
HETATM 2026 H H12  . GOL C 3 .   ? -15.327 -14.006 -4.674  1.00 49.87  ?  502 GOL A H12  1 
HETATM 2027 H HO1  . GOL C 3 .   ? -17.405 -13.718 -3.632  1.00 49.20  ?  502 GOL A HO1  1 
HETATM 2028 H H2   . GOL C 3 .   ? -16.736 -16.594 -5.373  1.00 68.98  ?  502 GOL A H2   1 
HETATM 2029 H HO2  . GOL C 3 .   ? -15.084 -14.766 -6.846  1.00 81.75  ?  502 GOL A HO2  1 
HETATM 2030 H H31  . GOL C 3 .   ? -14.629 -17.178 -4.249  1.00 51.99  ?  502 GOL A H31  1 
HETATM 2031 H H32  . GOL C 3 .   ? -13.742 -16.063 -5.291  1.00 51.99  ?  502 GOL A H32  1 
HETATM 2032 H HO3  . GOL C 3 .   ? -14.975 -17.457 -7.028  1.00 61.97  ?  502 GOL A HO3  1 
HETATM 2033 C C1   . GOL D 3 .   ? -19.325 -28.792 12.925  1.00 55.99  ?  503 GOL A C1   1 
HETATM 2034 O O1   . GOL D 3 .   ? -19.335 -29.722 13.987  1.00 65.28  ?  503 GOL A O1   1 
HETATM 2035 C C2   . GOL D 3 .   ? -19.643 -27.407 13.473  1.00 52.44  ?  503 GOL A C2   1 
HETATM 2036 O O2   . GOL D 3 .   ? -19.629 -27.444 14.881  1.00 62.37  ?  503 GOL A O2   1 
HETATM 2037 C C3   . GOL D 3 .   ? -18.627 -26.390 12.992  1.00 57.40  ?  503 GOL A C3   1 
HETATM 2038 O O3   . GOL D 3 .   ? -19.101 -25.074 13.190  1.00 40.23  ?  503 GOL A O3   1 
HETATM 2039 H H11  . GOL D 3 .   ? -20.068 -29.075 12.179  1.00 67.19  ?  503 GOL A H11  1 
HETATM 2040 H H12  . GOL D 3 .   ? -18.346 -28.786 12.448  1.00 67.19  ?  503 GOL A H12  1 
HETATM 2041 H HO1  . GOL D 3 .   ? -19.196 -30.625 13.632  1.00 78.34  ?  503 GOL A HO1  1 
HETATM 2042 H H2   . GOL D 3 .   ? -20.631 -27.109 13.120  1.00 62.93  ?  503 GOL A H2   1 
HETATM 2043 H HO2  . GOL D 3 .   ? -18.732 -27.687 15.193  1.00 74.84  ?  503 GOL A HO2  1 
HETATM 2044 H H31  . GOL D 3 .   ? -18.426 -26.549 11.933  1.00 68.88  ?  503 GOL A H31  1 
HETATM 2045 H H32  . GOL D 3 .   ? -17.692 -26.525 13.536  1.00 68.88  ?  503 GOL A H32  1 
HETATM 2046 H HO3  . GOL D 3 .   ? -18.571 -24.451 12.650  1.00 48.28  ?  503 GOL A HO3  1 
HETATM 2047 C C1   . GOL E 3 .   ? -36.242 -34.393 -2.801  1.00 68.93  ?  504 GOL A C1   1 
HETATM 2048 O O1   . GOL E 3 .   ? -35.191 -34.361 -1.859  1.00 65.82  ?  504 GOL A O1   1 
HETATM 2049 C C2   . GOL E 3 .   ? -37.303 -33.361 -2.429  1.00 67.95  ?  504 GOL A C2   1 
HETATM 2050 O O2   . GOL E 3 .   ? -38.042 -32.998 -3.577  1.00 64.02  ?  504 GOL A O2   1 
HETATM 2051 C C3   . GOL E 3 .   ? -38.253 -33.933 -1.382  1.00 66.24  ?  504 GOL A C3   1 
HETATM 2052 O O3   . GOL E 3 .   ? -37.538 -34.356 -0.241  1.00 66.87  ?  504 GOL A O3   1 
HETATM 2053 H H11  . GOL E 3 .   ? -36.687 -35.387 -2.821  1.00 82.71  ?  504 GOL A H11  1 
HETATM 2054 H H12  . GOL E 3 .   ? -35.851 -34.175 -3.795  1.00 82.71  ?  504 GOL A H12  1 
HETATM 2055 H HO1  . GOL E 3 .   ? -34.546 -35.069 -2.065  1.00 78.99  ?  504 GOL A HO1  1 
HETATM 2056 H H2   . GOL E 3 .   ? -36.809 -32.484 -2.013  1.00 81.55  ?  504 GOL A H2   1 
HETATM 2057 H HO2  . GOL E 3 .   ? -38.502 -33.787 -3.933  1.00 76.82  ?  504 GOL A HO2  1 
HETATM 2058 H H31  . GOL E 3 .   ? -38.797 -34.777 -1.805  1.00 79.49  ?  504 GOL A H31  1 
HETATM 2059 H H32  . GOL E 3 .   ? -38.980 -33.173 -1.096  1.00 79.49  ?  504 GOL A H32  1 
HETATM 2060 H HO3  . GOL E 3 .   ? -38.150 -34.804 0.380   1.00 80.24  ?  504 GOL A HO3  1 
HETATM 2061 O O    . HOH F 4 .   ? -9.531  -21.880 -19.651 1.00 67.53  ?  601 HOH A O    1 
HETATM 2062 O O    . HOH F 4 .   ? -30.883 -23.434 13.748  1.00 42.51  ?  602 HOH A O    1 
HETATM 2063 O O    . HOH F 4 .   ? -15.128 -20.068 -6.241  1.00 47.89  ?  603 HOH A O    1 
HETATM 2064 O O    . HOH F 4 .   ? -21.546 -32.785 -7.447  1.00 42.02  ?  604 HOH A O    1 
HETATM 2065 O O    . HOH F 4 .   ? -18.334 -23.207 10.108  1.00 35.67  ?  605 HOH A O    1 
HETATM 2066 O O    . HOH F 4 .   ? -24.401 -11.546 -20.095 1.00 45.05  ?  606 HOH A O    1 
HETATM 2067 O O    . HOH F 4 .   ? -19.315 -24.067 8.629   1.00 41.38  ?  607 HOH A O    1 
HETATM 2068 O O    . HOH F 4 .   ? -22.984 -29.202 -12.058 1.00 45.81  ?  608 HOH A O    1 
HETATM 2069 O O    . HOH F 4 .   ? -8.167  -26.706 -3.584  1.00 34.94  ?  609 HOH A O    1 
HETATM 2070 O O    . HOH F 4 .   ? -34.079 -14.137 -13.763 1.00 43.93  ?  610 HOH A O    1 
HETATM 2071 O O    . HOH F 4 .   ? -40.226 -23.186 2.821   1.00 33.81  ?  611 HOH A O    1 
HETATM 2072 O O    . HOH F 4 .   ? -34.267 -36.757 -0.528  1.00 33.82  ?  612 HOH A O    1 
HETATM 2073 O O    . HOH F 4 .   ? 0.563   -18.319 -0.907  1.00 55.54  ?  613 HOH A O    1 
HETATM 2074 O O    . HOH F 4 .   ? -16.839 -13.286 6.158   1.00 41.86  ?  614 HOH A O    1 
HETATM 2075 O O    . HOH F 4 .   ? -22.288 -16.333 -10.315 1.00 45.44  ?  615 HOH A O    1 
HETATM 2076 O O    . HOH F 4 .   ? -18.989 -12.727 9.261   1.00 26.21  ?  616 HOH A O    1 
HETATM 2077 O O    . HOH F 4 .   ? -28.912 -12.751 -7.552  1.00 29.29  ?  617 HOH A O    1 
HETATM 2078 O O    . HOH F 4 .   ? -12.898 -23.103 -8.637  1.00 44.29  ?  618 HOH A O    1 
HETATM 2079 O O    . HOH F 4 .   ? -33.714 -21.377 -13.202 1.00 26.19  ?  619 HOH A O    1 
HETATM 2080 O O    . HOH F 4 .   ? -22.118 -23.402 -0.314  1.00 34.79  ?  620 HOH A O    1 
HETATM 2081 O O    . HOH F 4 .   ? -30.428 -10.069 -12.664 1.00 27.19  ?  621 HOH A O    1 
HETATM 2082 O O    . HOH F 4 .   ? -26.761 -24.886 8.552   1.00 24.99  ?  622 HOH A O    1 
HETATM 2083 O O    . HOH F 4 .   ? -9.506  -25.117 -1.731  1.00 34.90  ?  623 HOH A O    1 
HETATM 2084 O O    . HOH F 4 .   ? -26.198 -45.934 -5.731  1.00 58.12  ?  624 HOH A O    1 
HETATM 2085 O O    . HOH F 4 .   ? -16.493 -14.361 11.311  1.00 28.19  ?  625 HOH A O    1 
HETATM 2086 O O    . HOH F 4 .   ? -22.464 -3.988  2.090   1.00 37.03  ?  626 HOH A O    1 
HETATM 2087 O O    . HOH F 4 .   ? -21.462 -25.178 8.602   1.00 27.39  ?  627 HOH A O    1 
HETATM 2088 O O    . HOH F 4 .   ? -32.599 -28.638 -8.934  1.00 22.84  ?  628 HOH A O    1 
HETATM 2089 O O    . HOH F 4 .   ? -21.051 -22.262 -5.981  1.00 37.43  ?  629 HOH A O    1 
HETATM 2090 O O    . HOH F 4 .   ? -29.549 -39.825 3.297   1.00 44.30  ?  630 HOH A O    1 
HETATM 2091 O O    . HOH F 4 .   ? -22.619 -29.038 -0.236  1.00 35.48  ?  631 HOH A O    1 
HETATM 2092 O O    . HOH F 4 .   ? -34.492 -27.594 -13.009 1.00 30.89  ?  632 HOH A O    1 
HETATM 2093 O O    . HOH F 4 .   ? -28.047 -29.920 -14.374 1.00 31.21  ?  633 HOH A O    1 
HETATM 2094 O O    . HOH F 4 .   ? -18.820 -16.537 11.623  1.00 26.25  ?  634 HOH A O    1 
HETATM 2095 O O    . HOH F 4 .   ? -32.515 -34.684 -4.785  1.00 57.07  ?  635 HOH A O    1 
HETATM 2096 O O    . HOH F 4 .   ? -8.905  -26.332 1.032   1.00 28.45  ?  636 HOH A O    1 
HETATM 2097 O O    . HOH F 4 .   ? -23.454 -22.771 2.095   1.00 34.63  ?  637 HOH A O    1 
HETATM 2098 O O    . HOH F 4 .   ? -15.356 -10.656 -21.526 1.00 50.67  ?  638 HOH A O    1 
HETATM 2099 O O    . HOH F 4 .   ? -22.563 -24.107 -3.872  1.00 44.90  ?  639 HOH A O    1 
HETATM 2100 O O    . HOH F 4 .   ? -25.915 -5.837  -6.364  1.00 26.63  ?  640 HOH A O    1 
HETATM 2101 O O    . HOH F 4 .   ? -41.611 -25.673 -1.112  1.00 43.54  ?  641 HOH A O    1 
HETATM 2102 O O    . HOH F 4 .   ? -33.657 -27.800 12.078  1.00 46.96  ?  642 HOH A O    1 
HETATM 2103 O O    . HOH F 4 .   ? -37.157 -16.807 -5.273  1.00 39.32  ?  643 HOH A O    1 
HETATM 2104 O O    . HOH F 4 .   ? -32.355 -30.139 10.515  1.00 32.20  ?  644 HOH A O    1 
HETATM 2105 O O    . HOH F 4 .   ? -26.604 -11.419 -18.351 1.00 47.52  ?  645 HOH A O    1 
HETATM 2106 O O    . HOH F 4 .   ? -13.248 -30.164 1.806   1.00 44.34  ?  646 HOH A O    1 
HETATM 2107 O O    . HOH F 4 .   ? -17.546 -30.648 1.181   1.00 49.01  ?  647 HOH A O    1 
HETATM 2108 O O    . HOH F 4 .   ? -15.486 -29.331 -2.150  1.00 38.29  ?  648 HOH A O    1 
HETATM 2109 O O    . HOH F 4 .   ? -6.690  -17.345 -10.395 1.00 51.64  ?  649 HOH A O    1 
HETATM 2110 O O    . HOH F 4 .   ? -16.164 -14.574 -14.161 1.00 45.82  ?  650 HOH A O    1 
HETATM 2111 O O    . HOH F 4 .   ? -24.218 -23.903 -20.770 1.00 44.03  ?  651 HOH A O    1 
HETATM 2112 O O    . HOH F 4 .   ? -25.557 -31.321 8.426   1.00 38.23  ?  652 HOH A O    1 
HETATM 2113 O O    . HOH F 4 .   ? -29.527 -6.916  -9.115  1.00 28.00  ?  653 HOH A O    1 
HETATM 2114 O O    . HOH F 4 .   ? -16.188 -28.218 -11.755 1.00 58.52  ?  654 HOH A O    1 
HETATM 2115 O O    . HOH F 4 .   ? -16.524 -9.540  4.868   0.5  37.46  ?  655 HOH A O    1 
HETATM 2116 O O    . HOH F 4 .   ? -8.975  -15.747 3.979   1.00 35.23  ?  656 HOH A O    1 
HETATM 2117 O O    . HOH F 4 .   ? -12.526 -26.092 -8.415  1.00 44.14  ?  657 HOH A O    1 
HETATM 2118 O O    . HOH F 4 .   ? -39.704 -28.587 10.243  1.00 54.68  ?  658 HOH A O    1 
HETATM 2119 O O    . HOH F 4 .   ? -41.726 -24.310 -4.247  1.00 54.57  ?  659 HOH A O    1 
HETATM 2120 O O    . HOH F 4 .   ? -30.701 -31.011 -17.690 1.00 46.71  ?  660 HOH A O    1 
HETATM 2121 O O    . HOH F 4 .   ? -42.977 -28.874 -5.010  1.00 41.51  ?  661 HOH A O    1 
HETATM 2122 O O    . HOH F 4 .   ? -2.972  -16.173 0.829   1.00 49.93  ?  662 HOH A O    1 
HETATM 2123 O O    . HOH F 4 .   ? -21.446 -29.014 -14.550 1.00 47.54  ?  663 HOH A O    1 
HETATM 2124 O O    . HOH F 4 .   ? -30.641 -22.497 -19.913 1.00 56.57  ?  664 HOH A O    1 
HETATM 2125 O O    . HOH F 4 .   ? -25.510 -30.408 -13.373 1.00 42.91  ?  665 HOH A O    1 
HETATM 2126 O O    . HOH F 4 .   ? -2.282  -17.972 1.066   1.00 48.70  ?  666 HOH A O    1 
HETATM 2127 O O    . HOH F 4 .   ? -22.684 -22.606 -20.678 1.00 43.48  ?  667 HOH A O    1 
HETATM 2128 O O    . HOH F 4 .   ? -33.009 -39.007 -3.739  1.00 50.38  ?  668 HOH A O    1 
HETATM 2129 O O    . HOH F 4 .   ? -21.216 -26.242 10.836  1.00 43.53  ?  669 HOH A O    1 
HETATM 2130 O O    . HOH F 4 .   ? -21.393 -15.085 -9.365  1.00 48.40  ?  670 HOH A O    1 
HETATM 2131 O O    . HOH F 4 .   ? -29.364 -7.550  -12.112 1.00 33.46  ?  671 HOH A O    1 
HETATM 2132 O O    . HOH F 4 .   ? -27.721 -29.033 -17.445 1.00 44.85  ?  672 HOH A O    1 
HETATM 2133 O O    . HOH F 4 .   ? -39.831 -25.751 10.822  1.00 55.81  ?  673 HOH A O    1 
HETATM 2134 O O    . HOH F 4 .   ? -11.051 -30.421 0.863   1.00 42.27  ?  674 HOH A O    1 
HETATM 2135 O O    . HOH F 4 .   ? -43.011 -28.240 -2.337  1.00 57.22  ?  675 HOH A O    1 
HETATM 2136 O O    . HOH F 4 .   ? -33.313 -11.234 -14.380 1.00 42.04  ?  676 HOH A O    1 
HETATM 2137 O O    . HOH F 4 .   ? -41.289 -24.580 9.330   1.00 42.49  ?  677 HOH A O    1 
HETATM 2138 O O    . HOH F 4 .   ? -30.341 -14.007 -18.159 1.00 55.89  ?  678 HOH A O    1 
HETATM 2139 O O    . HOH F 4 .   ? -35.899 -25.250 -13.851 1.00 49.06  ?  679 HOH A O    1 
HETATM 2140 O O    . HOH F 4 .   ? -32.336 -13.940 -17.264 1.00 56.38  ?  680 HOH A O    1 
HETATM 2141 O O    . HOH F 4 .   ? -14.939 -27.809 -8.573  1.00 56.79  ?  681 HOH A O    1 
HETATM 2142 O O    . HOH F 4 .   ? -33.239 -36.700 -4.868  0.5  59.70  ?  682 HOH A O    1 
HETATM 2143 O O    . HOH F 4 .   ? -27.136 -33.253 8.597   1.00 51.55  ?  683 HOH A O    1 
HETATM 2144 O O    . HOH F 4 .   ? -29.041 -12.296 -19.066 1.00 60.50  ?  684 HOH A O    1 
HETATM 2145 O O    . HOH F 4 .   ? 3.060   -19.498 -1.412  1.00 61.99  ?  685 HOH A O    1 
HETATM 2146 O O    . HOH F 4 .   ? -34.197 -20.125 -15.621 1.00 39.51  ?  686 HOH A O    1 
HETATM 2147 O O    . HOH F 4 .   ? -29.222 -33.593 9.612   1.00 63.55  ?  687 HOH A O    1 
HETATM 2148 O O    . HOH F 4 .   ? -37.906 -24.165 -15.269 1.00 56.35  ?  688 HOH A O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   332 ?   ?   ?   A . n 
A 1 2   PRO 2   333 ?   ?   ?   A . n 
A 1 3   HIS 3   334 ?   ?   ?   A . n 
A 1 4   THR 4   335 ?   ?   ?   A . n 
A 1 5   VAL 5   336 ?   ?   ?   A . n 
A 1 6   ALA 6   337 ?   ?   ?   A . n 
A 1 7   GLU 7   338 ?   ?   ?   A . n 
A 1 8   LYS 8   339 ?   ?   ?   A . n 
A 1 9   GLN 9   340 ?   ?   ?   A . n 
A 1 10  ASP 10  341 ?   ?   ?   A . n 
A 1 11  THR 11  342 ?   ?   ?   A . n 
A 1 12  LEU 12  343 ?   ?   ?   A . n 
A 1 13  VAL 13  344 344 VAL VAL A . n 
A 1 14  PRO 14  345 345 PRO PRO A . n 
A 1 15  ALA 15  346 346 ALA ALA A . n 
A 1 16  GLY 16  347 347 GLY GLY A . n 
A 1 17  PRO 17  348 348 PRO PRO A . n 
A 1 18  ALA 18  349 349 ALA ALA A . n 
A 1 19  LYS 19  350 350 LYS LYS A . n 
A 1 20  ALA 20  351 351 ALA ALA A . n 
A 1 21  VAL 21  352 352 VAL VAL A . n 
A 1 22  LEU 22  353 353 LEU LEU A . n 
A 1 23  GLU 23  354 354 GLU GLU A . n 
A 1 24  VAL 24  355 355 VAL VAL A . n 
A 1 25  ASN 25  356 356 ASN ASN A . n 
A 1 26  ASP 26  357 357 ASP ASP A . n 
A 1 27  GLU 27  358 358 GLU GLU A . n 
A 1 28  LEU 28  359 359 LEU LEU A . n 
A 1 29  LEU 29  360 360 LEU LEU A . n 
A 1 30  LYS 30  361 361 LYS LYS A . n 
A 1 31  ALA 31  362 362 ALA ALA A . n 
A 1 32  VAL 32  363 363 VAL VAL A . n 
A 1 33  ALA 33  364 364 ALA ALA A . n 
A 1 34  SER 34  365 365 SER SER A . n 
A 1 35  GLY 35  366 366 GLY GLY A . n 
A 1 36  ASP 36  367 367 ASP ASP A . n 
A 1 37  TRP 37  368 368 TRP TRP A . n 
A 1 38  ASP 38  369 369 ASP ASP A . n 
A 1 39  ALA 39  370 370 ALA ALA A . n 
A 1 40  TYR 40  371 371 TYR TYR A . n 
A 1 41  THR 41  372 372 THR THR A . n 
A 1 42  THR 42  373 373 THR THR A . n 
A 1 43  MET 43  374 374 MET MET A . n 
A 1 44  VAL 44  375 375 VAL VAL A . n 
A 1 45  ASP 45  376 376 ASP ASP A . n 
A 1 46  PRO 46  377 377 PRO PRO A . n 
A 1 47  ASN 47  378 378 ASN ASN A . n 
A 1 48  VAL 48  379 379 VAL VAL A . n 
A 1 49  THR 49  380 380 THR THR A . n 
A 1 50  CYS 50  381 381 CYS CYS A . n 
A 1 51  PHE 51  382 382 PHE PHE A . n 
A 1 52  GLU 52  383 383 GLU GLU A . n 
A 1 53  PRO 53  384 384 PRO PRO A . n 
A 1 54  GLU 54  385 385 GLU GLU A . n 
A 1 55  ALA 55  386 386 ALA ALA A . n 
A 1 56  ALA 56  387 387 ALA ALA A . n 
A 1 57  GLY 57  388 388 GLY GLY A . n 
A 1 58  VAL 58  389 389 VAL VAL A . n 
A 1 59  LEU 59  390 390 LEU LEU A . n 
A 1 60  ALA 60  391 391 ALA ALA A . n 
A 1 61  LYS 61  392 392 LYS LYS A . n 
A 1 62  GLY 62  393 393 GLY GLY A . n 
A 1 63  LEU 63  394 394 LEU LEU A . n 
A 1 64  ALA 64  395 395 ALA ALA A . n 
A 1 65  PHE 65  396 396 PHE PHE A . n 
A 1 66  HIS 66  397 397 HIS HIS A . n 
A 1 67  LYS 67  398 398 LYS LYS A . n 
A 1 68  PHE 68  399 399 PHE PHE A . n 
A 1 69  PHE 69  400 400 PHE PHE A . n 
A 1 70  PHE 70  401 401 PHE PHE A . n 
A 1 71  ASP 71  402 402 ASP ASP A . n 
A 1 72  ASN 72  403 403 ASN ASN A . n 
A 1 73  ARG 73  404 404 ARG ARG A . n 
A 1 74  SER 74  405 405 SER SER A . n 
A 1 75  PRO 75  406 406 PRO PRO A . n 
A 1 76  ASN 76  407 407 ASN ASN A . n 
A 1 77  ALA 77  408 408 ALA ALA A . n 
A 1 78  ASP 78  409 409 ASP ASP A . n 
A 1 79  LYS 79  410 410 LYS LYS A . n 
A 1 80  MET 80  411 411 MET MET A . n 
A 1 81  LYS 81  412 412 LYS LYS A . n 
A 1 82  THR 82  413 413 THR THR A . n 
A 1 83  THR 83  414 414 THR THR A . n 
A 1 84  LEU 84  415 415 LEU LEU A . n 
A 1 85  HIS 85  416 416 HIS HIS A . n 
A 1 86  ASP 86  417 417 ASP ASP A . n 
A 1 87  PRO 87  418 418 PRO PRO A . n 
A 1 88  ALA 88  419 419 ALA ALA A . n 
A 1 89  VAL 89  420 420 VAL VAL A . n 
A 1 90  GLN 90  421 421 GLN GLN A . n 
A 1 91  MET 91  422 422 MET MET A . n 
A 1 92  PHE 92  423 423 PHE PHE A . n 
A 1 93  GLY 93  424 424 GLY GLY A . n 
A 1 94  ASP 94  425 425 ASP ASP A . n 
A 1 95  THR 95  426 426 THR THR A . n 
A 1 96  ALA 96  427 427 ALA ALA A . n 
A 1 97  ILE 97  428 428 ILE ILE A . n 
A 1 98  VAL 98  429 429 VAL VAL A . n 
A 1 99  THR 99  430 430 THR THR A . n 
A 1 100 ALA 100 431 431 ALA ALA A . n 
A 1 101 LEU 101 432 432 LEU LEU A . n 
A 1 102 ARG 102 433 433 ARG ARG A . n 
A 1 103 VAL 103 434 434 VAL VAL A . n 
A 1 104 VAL 104 435 435 VAL VAL A . n 
A 1 105 GLN 105 436 436 GLN GLN A . n 
A 1 106 PHE 106 437 437 PHE PHE A . n 
A 1 107 VAL 107 438 438 VAL VAL A . n 
A 1 108 ALA 108 439 439 ALA ALA A . n 
A 1 109 ASP 109 440 440 ASP ASP A . n 
A 1 110 ASP 110 441 441 ASP ASP A . n 
A 1 111 GLY 111 442 442 GLY GLY A . n 
A 1 112 PRO 112 443 443 PRO PRO A . n 
A 1 113 LYS 113 444 444 LYS LYS A . n 
A 1 114 THR 114 445 445 THR THR A . n 
A 1 115 THR 115 446 446 THR THR A . n 
A 1 116 ARG 116 447 447 ARG ARG A . n 
A 1 117 TYR 117 448 448 TYR TYR A . n 
A 1 118 GLU 118 449 449 GLU GLU A . n 
A 1 119 GLU 119 450 450 GLU GLU A . n 
A 1 120 THR 120 451 451 THR THR A . n 
A 1 121 ARG 121 452 452 ARG ARG A . n 
A 1 122 VAL 122 453 453 VAL VAL A . n 
A 1 123 TRP 123 454 454 TRP TRP A . n 
A 1 124 VAL 124 455 455 VAL VAL A . n 
A 1 125 LYS 125 456 456 LYS LYS A . n 
A 1 126 ASP 126 457 457 ASP ASP A . n 
A 1 127 ALA 127 458 458 ALA ALA A . n 
A 1 128 ALA 128 459 459 ALA ALA A . n 
A 1 129 PHE 129 460 460 PHE PHE A . n 
A 1 130 LYS 130 461 461 LYS LYS A . n 
A 1 131 PHE 131 462 462 PHE PHE A . n 
A 1 132 GLY 132 463 463 GLY GLY A . n 
A 1 133 TRP 133 464 464 TRP TRP A . n 
A 1 134 LYS 134 465 465 LYS LYS A . n 
A 1 135 LEU 135 466 466 LEU LEU A . n 
A 1 136 VAL 136 467 467 VAL VAL A . n 
A 1 137 HIS 137 468 468 HIS HIS A . n 
A 1 138 PHE 138 469 469 PHE PHE A . n 
A 1 139 HIS 139 470 470 HIS HIS A . n 
A 1 140 ARG 140 471 471 ARG ARG A . n 
A 1 141 SER 141 472 472 SER SER A . n 
A 1 142 GLY 142 473 473 GLY GLY A . n 
A 1 143 ALA 143 474 474 ALA ALA A . n 
A 1 144 HIS 144 475 ?   ?   ?   A . n 
A 1 145 ALA 145 476 ?   ?   ?   A . n 
A 1 146 THR 146 477 ?   ?   ?   A . n 
A 1 147 PRO 147 478 ?   ?   ?   A . n 
A 1 148 ASN 148 479 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1  501 1  SO4 SO4 A . 
C 3 GOL 1  502 1  GOL GOL A . 
D 3 GOL 1  503 2  GOL GOL A . 
E 3 GOL 1  504 4  GOL GOL A . 
F 4 HOH 1  601 74 HOH HOH A . 
F 4 HOH 2  602 22 HOH HOH A . 
F 4 HOH 3  603 1  HOH HOH A . 
F 4 HOH 4  604 66 HOH HOH A . 
F 4 HOH 5  605 50 HOH HOH A . 
F 4 HOH 6  606 25 HOH HOH A . 
F 4 HOH 7  607 51 HOH HOH A . 
F 4 HOH 8  608 46 HOH HOH A . 
F 4 HOH 9  609 18 HOH HOH A . 
F 4 HOH 10 610 32 HOH HOH A . 
F 4 HOH 11 611 20 HOH HOH A . 
F 4 HOH 12 612 60 HOH HOH A . 
F 4 HOH 13 613 39 HOH HOH A . 
F 4 HOH 14 614 8  HOH HOH A . 
F 4 HOH 15 615 81 HOH HOH A . 
F 4 HOH 16 616 9  HOH HOH A . 
F 4 HOH 17 617 24 HOH HOH A . 
F 4 HOH 18 618 45 HOH HOH A . 
F 4 HOH 19 619 4  HOH HOH A . 
F 4 HOH 20 620 2  HOH HOH A . 
F 4 HOH 21 621 17 HOH HOH A . 
F 4 HOH 22 622 29 HOH HOH A . 
F 4 HOH 23 623 77 HOH HOH A . 
F 4 HOH 24 624 84 HOH HOH A . 
F 4 HOH 25 625 13 HOH HOH A . 
F 4 HOH 26 626 16 HOH HOH A . 
F 4 HOH 27 627 7  HOH HOH A . 
F 4 HOH 28 628 5  HOH HOH A . 
F 4 HOH 29 629 30 HOH HOH A . 
F 4 HOH 30 630 54 HOH HOH A . 
F 4 HOH 31 631 3  HOH HOH A . 
F 4 HOH 32 632 11 HOH HOH A . 
F 4 HOH 33 633 10 HOH HOH A . 
F 4 HOH 34 634 14 HOH HOH A . 
F 4 HOH 35 635 63 HOH HOH A . 
F 4 HOH 36 636 37 HOH HOH A . 
F 4 HOH 37 637 6  HOH HOH A . 
F 4 HOH 38 638 49 HOH HOH A . 
F 4 HOH 39 639 55 HOH HOH A . 
F 4 HOH 40 640 15 HOH HOH A . 
F 4 HOH 41 641 21 HOH HOH A . 
F 4 HOH 42 642 36 HOH HOH A . 
F 4 HOH 43 643 12 HOH HOH A . 
F 4 HOH 44 644 43 HOH HOH A . 
F 4 HOH 45 645 26 HOH HOH A . 
F 4 HOH 46 646 48 HOH HOH A . 
F 4 HOH 47 647 61 HOH HOH A . 
F 4 HOH 48 648 19 HOH HOH A . 
F 4 HOH 49 649 27 HOH HOH A . 
F 4 HOH 50 650 58 HOH HOH A . 
F 4 HOH 51 651 73 HOH HOH A . 
F 4 HOH 52 652 47 HOH HOH A . 
F 4 HOH 53 653 35 HOH HOH A . 
F 4 HOH 54 654 86 HOH HOH A . 
F 4 HOH 55 655 44 HOH HOH A . 
F 4 HOH 56 656 78 HOH HOH A . 
F 4 HOH 57 657 33 HOH HOH A . 
F 4 HOH 58 658 75 HOH HOH A . 
F 4 HOH 59 659 82 HOH HOH A . 
F 4 HOH 60 660 57 HOH HOH A . 
F 4 HOH 61 661 31 HOH HOH A . 
F 4 HOH 62 662 59 HOH HOH A . 
F 4 HOH 63 663 42 HOH HOH A . 
F 4 HOH 64 664 62 HOH HOH A . 
F 4 HOH 65 665 23 HOH HOH A . 
F 4 HOH 66 666 56 HOH HOH A . 
F 4 HOH 67 667 65 HOH HOH A . 
F 4 HOH 68 668 70 HOH HOH A . 
F 4 HOH 69 669 28 HOH HOH A . 
F 4 HOH 70 670 80 HOH HOH A . 
F 4 HOH 71 671 38 HOH HOH A . 
F 4 HOH 72 672 79 HOH HOH A . 
F 4 HOH 73 673 68 HOH HOH A . 
F 4 HOH 74 674 52 HOH HOH A . 
F 4 HOH 75 675 83 HOH HOH A . 
F 4 HOH 76 676 41 HOH HOH A . 
F 4 HOH 77 677 53 HOH HOH A . 
F 4 HOH 78 678 71 HOH HOH A . 
F 4 HOH 79 679 40 HOH HOH A . 
F 4 HOH 80 680 88 HOH HOH A . 
F 4 HOH 81 681 67 HOH HOH A . 
F 4 HOH 82 682 72 HOH HOH A . 
F 4 HOH 83 683 64 HOH HOH A . 
F 4 HOH 84 684 76 HOH HOH A . 
F 4 HOH 85 685 87 HOH HOH A . 
F 4 HOH 86 686 34 HOH HOH A . 
F 4 HOH 87 687 69 HOH HOH A . 
F 4 HOH 88 688 85 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3740  ? 
1 MORE         -53   ? 
1 'SSA (A^2)'  13410 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z        1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 12_555 x,x-y,-z+1/6 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 9.7360000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 655 ? F HOH . 
2 1 A HOH 682 ? F HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-03-23 
2 'Structure model' 1 1 2016-04-06 
3 'Structure model' 1 2 2016-09-28 
4 'Structure model' 1 3 2017-09-27 
5 'Structure model' 1 4 2019-11-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Structure summary'          
2 3 'Structure model' 'Data collection'            
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Derived calculations'       
5 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_audit_support    
2 4 'Structure model' pdbx_struct_oper_list 
3 5 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_audit_support.funding_organization'  
2 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3 5 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? 1.9_1692 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 615 ? ? O A HOH 670 ? ? 1.81 
2 1 O   A HOH 662 ? ? O A HOH 666 ? ? 1.94 
3 1 O   A HOH 605 ? ? O A HOH 607 ? ? 1.97 
4 1 OD2 A ASP 409 ? ? O A HOH 601 ? ? 1.98 
5 1 O   A HOH 651 ? ? O A HOH 667 ? ? 2.01 
6 1 O   A HOH 678 ? ? O A HOH 680 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     635 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     668 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   10_444 
_pdbx_validate_symm_contact.dist              2.13 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 332 ? A GLY 1   
2  1 Y 1 A PRO 333 ? A PRO 2   
3  1 Y 1 A HIS 334 ? A HIS 3   
4  1 Y 1 A THR 335 ? A THR 4   
5  1 Y 1 A VAL 336 ? A VAL 5   
6  1 Y 1 A ALA 337 ? A ALA 6   
7  1 Y 1 A GLU 338 ? A GLU 7   
8  1 Y 1 A LYS 339 ? A LYS 8   
9  1 Y 1 A GLN 340 ? A GLN 9   
10 1 Y 1 A ASP 341 ? A ASP 10  
11 1 Y 1 A THR 342 ? A THR 11  
12 1 Y 1 A LEU 343 ? A LEU 12  
13 1 Y 1 A HIS 475 ? A HIS 144 
14 1 Y 1 A ALA 476 ? A ALA 145 
15 1 Y 1 A THR 477 ? A THR 146 
16 1 Y 1 A PRO 478 ? A PRO 147 
17 1 Y 1 A ASN 479 ? A ASN 148 
# 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.funding_organization   'Howard Hughes Medical Institute (HHMI)' 
_pdbx_audit_support.grant_number           ? 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 GLYCEROL      GOL 
4 water         HOH 
#