data_5IH2
# 
_entry.id   5IH2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5IH2         
WWPDB D_1000218776 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5IH2 
_pdbx_database_status.recvd_initial_deposition_date   2016-02-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bhatt, V.S.'       1 
'Zeng, D.'          2 
'Krieger, I.'       3 
'Sacchettini, J.C.' 4 
'Cho, J.-H.'        5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Biophys.J. 
_citation.journal_id_ASTM           BIOJAU 
_citation.journal_id_CSD            0030 
_citation.journal_id_ISSN           1542-0086 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            110 
_citation.language                  ? 
_citation.page_first                2630 
_citation.page_last                 2641 
_citation.title                     'Binding Mechanism of the N-Terminal SH3 Domain of CrkII and Proline-Rich Motifs in cAbl.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.bpj.2016.05.008 
_citation.pdbx_database_id_PubMed   27332121 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bhatt, V.S.'       1 
primary 'Zeng, D.'          2 
primary 'Krieger, I.'       3 
primary 'Sacchettini, J.C.' 4 
primary 'Cho, J.H.'         5 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   94.31 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5IH2 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     45.222 
_cell.length_a_esd                 ? 
_cell.length_b                     29.479 
_cell.length_b_esd                 ? 
_cell.length_c                     45.756 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5IH2 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Adapter molecule crk'              6971.731 2   ? ? 'UNP residues 134-191' ? 
2 polymer     syn 'Proline rich Peptide'              1285.561 2   ? ? ?                      ? 
3 non-polymer syn 'DI(HYDROXYETHYL)ETHER'             106.120  1   ? ? ?                      ? 
4 non-polymer syn 'SODIUM ION'                        22.990   4   ? ? ?                      ? 
5 non-polymer syn '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE' 162.227  2   ? ? ?                      ? 
6 water       nat water                               18.015   181 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Proto-oncogene c-Crk,p38' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR 
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR A,B ? 
2 'polypeptide(L)' no yes '(ACE)YEKPALPRKR(NH2)'                                     XYEKPALPRKRX M,N ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  GLU n 
1 3  TYR n 
1 4  VAL n 
1 5  ARG n 
1 6  ALA n 
1 7  LEU n 
1 8  PHE n 
1 9  ASP n 
1 10 PHE n 
1 11 ASN n 
1 12 GLY n 
1 13 ASN n 
1 14 ASP n 
1 15 GLU n 
1 16 GLU n 
1 17 ASP n 
1 18 LEU n 
1 19 PRO n 
1 20 PHE n 
1 21 LYS n 
1 22 LYS n 
1 23 GLY n 
1 24 ASP n 
1 25 ILE n 
1 26 LEU n 
1 27 ARG n 
1 28 ILE n 
1 29 ARG n 
1 30 ASP n 
1 31 LYS n 
1 32 PRO n 
1 33 GLU n 
1 34 GLU n 
1 35 GLN n 
1 36 TRP n 
1 37 TRP n 
1 38 ASN n 
1 39 ALA n 
1 40 GLU n 
1 41 ASP n 
1 42 SER n 
1 43 GLU n 
1 44 GLY n 
1 45 LYS n 
1 46 ARG n 
1 47 GLY n 
1 48 MET n 
1 49 ILE n 
1 50 PRO n 
1 51 VAL n 
1 52 PRO n 
1 53 TYR n 
1 54 VAL n 
1 55 GLU n 
1 56 LYS n 
1 57 TYR n 
1 58 ARG n 
2 1  ACE n 
2 2  TYR n 
2 3  GLU n 
2 4  LYS n 
2 5  PRO n 
2 6  ALA n 
2 7  LEU n 
2 8  PRO n 
2 9  ARG n 
2 10 LYS n 
2 11 ARG n 
2 12 NH2 n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   58 
_entity_src_gen.gene_src_common_name               Mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Crk, Crko' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       12 
_pdbx_entity_src_syn.organism_scientific    'Endothia gyrosa' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       40263 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CRK_MOUSE Q64010 ? 1 AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR 134 
2 PDB 5IH2      5IH2   ? 2 ?                                                          1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5IH2 A 1 ? 58 ? Q64010 134 ? 191 ? 134 191 
2 1 5IH2 B 1 ? 58 ? Q64010 134 ? 191 ? 134 191 
3 2 5IH2 M 1 ? 12 ? 5IH2   -1  ? 10  ? -1  10  
4 2 5IH2 N 1 ? 12 ? 5IH2   -1  ? 10  ? -1  10  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'                      ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE                             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE                           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                             ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER                               ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                          ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'                        ? 'Na 1'           22.990  
NH2 non-polymer         . 'AMINO GROUP'                       ? 'H2 N'           16.023  
P4G non-polymer         . '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE' ? 'C8 H18 O3'      162.227 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER'             ? 'C4 H10 O3'      106.120 
PHE 'L-peptide linking' y PHENYLALANINE                       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                              ? 'C3 H7 N O3'     105.093 
TRP 'L-peptide linking' y TRYPTOPHAN                          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                              ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5IH2 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            1.84 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         33.21 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU RAXIS IV++' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-02-18 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        RIGAKU 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5IH2 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.8 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       11478 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.1 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.5 
_reflns.pdbx_Rmerge_I_obs                0.144 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            38.055 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.8 
_reflns_shell.d_res_low                   1.83 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.52 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.10 
_refine.aniso_B[2][2]                            -0.03 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            0.53 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               20.533 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.900 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5IH2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.80 
_refine.ls_d_res_low                             45.63 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     10714 
_refine.ls_number_reflns_R_free                  612 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.81 
_refine.ls_percent_reflns_R_free                 5.4 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.17323 
_refine.ls_R_factor_R_free                       0.24252 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.16964 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1cka 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.163 
_refine.pdbx_overall_ESU_R_Free                  0.161 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5IH2 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        1146 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         26 
_refine_hist.number_atoms_solvent             181 
_refine_hist.number_atoms_total               1353 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        45.63 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.022  0.020  1238 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.000  0.020  1168 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 2.039  1.995  1656 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 3.453  3.012  2710 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.132  5.000  138  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 40.848 23.425 73   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 12.171 15.000 221  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 17.973 15.000 13   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.113  0.200  150  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.011  0.021  1381 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.024  0.020  280  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 1.538  1.776  556  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 1.536  1.774  555  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 2.096  2.642  694  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 2.096  2.645  695  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 2.792  2.144  682  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.927  2.142  683  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.236  3.090  963  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 6.450  16.411 1517 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 5.884  15.548 1437 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.798 
_refine_ls_shell.d_res_low                        1.845 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             48 
_refine_ls_shell.number_reflns_R_work             762 
_refine_ls_shell.percent_reflns_obs               96.09 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.273 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.101 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5IH2 
_struct.title                        
;Structure, thermodynamics, and the role of conformational dynamics in the interactions between the N-terminal SH3 domain of CrkII and proline-rich motifs in cAbl
;
_struct.pdbx_descriptor              'Adapter molecule crk, Proline rich Peptide' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5IH2 
_struct_keywords.text            'SH3 domain Polyproline II motif, SIGNALING PROTEIN' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 4 ? 
K N N 5 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A ALA 1  O  ? ? ? 1_555 G NA  .  NA ? ? A ALA 134 A NA  203 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc2  metalc ?    ? A ARG 46 O  ? ? ? 1_555 F NA  .  NA ? ? A ARG 179 A NA  202 1_555 ? ? ? ? ? ? ? 2.449 ? 
metalc3  metalc ?    ? B GLY 12 O  ? ? ? 1_555 J NA  .  NA ? ? B GLY 145 B NA  202 1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc4  metalc ?    ? B ASP 14 O  ? ? ? 1_555 J NA  .  NA ? ? B ASP 147 B NA  202 1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc5  metalc ?    ? B ASP 17 O  ? ? ? 1_555 J NA  .  NA ? ? B ASP 150 B NA  202 1_555 ? ? ? ? ? ? ? 2.501 ? 
covale1  covale both ? C ACE 1  C  ? ? ? 1_555 C TYR 2  N  ? ? M ACE -1  M TYR 0   1_555 ? ? ? ? ? ? ? 1.461 ? 
covale2  covale both ? C ARG 11 C  ? ? ? 1_555 C NH2 12 N  ? ? M ARG 9   M NH2 10  1_555 ? ? ? ? ? ? ? 1.490 ? 
covale3  covale both ? D ACE 1  C  ? ? ? 1_555 D TYR 2  N  ? ? N ACE -1  N TYR 0   1_555 ? ? ? ? ? ? ? 1.470 ? 
covale4  covale both ? D ARG 11 C  ? ? ? 1_555 D NH2 12 N  ? ? N ARG 9   N NH2 10  1_555 ? ? ? ? ? ? ? 1.295 ? 
metalc6  metalc ?    ? F NA  .  NA ? ? ? 1_555 L HOH .  O  ? ? A NA  202 A HOH 309 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc7  metalc ?    ? F NA  .  NA ? ? ? 1_555 M HOH .  O  ? ? A NA  202 B HOH 335 1_555 ? ? ? ? ? ? ? 2.592 ? 
metalc8  metalc ?    ? G NA  .  NA ? ? ? 1_555 L HOH .  O  ? ? A NA  203 A HOH 351 1_555 ? ? ? ? ? ? ? 2.768 ? 
metalc9  metalc ?    ? G NA  .  NA ? ? ? 1_555 L HOH .  O  ? ? A NA  203 A HOH 365 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc10 metalc ?    ? G NA  .  NA ? ? ? 1_555 L HOH .  O  ? ? A NA  203 A HOH 381 1_555 ? ? ? ? ? ? ? 2.397 ? 
metalc11 metalc ?    ? G NA  .  NA ? ? ? 1_555 L HOH .  O  ? ? A NA  203 A HOH 362 1_555 ? ? ? ? ? ? ? 2.541 ? 
metalc12 metalc ?    ? H NA  .  NA ? ? ? 1_555 N HOH .  O  ? ? A NA  204 M HOH 116 1_555 ? ? ? ? ? ? ? 3.110 ? 
metalc13 metalc ?    ? J NA  .  NA ? ? ? 1_555 M HOH .  O  ? ? B NA  202 B HOH 324 1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc14 metalc ?    ? J NA  .  NA ? ? ? 1_555 M HOH .  O  ? ? B NA  202 B HOH 319 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc15 metalc ?    ? F NA  .  NA ? ? ? 1_555 L HOH .  O  ? ? A NA  202 A HOH 305 1_565 ? ? ? ? ? ? ? 2.323 ? 
metalc16 metalc ?    ? G NA  .  NA ? ? ? 1_555 M HOH .  O  ? ? A NA  203 B HOH 342 1_545 ? ? ? ? ? ? ? 2.481 ? 
metalc17 metalc ?    ? G NA  .  NA ? ? ? 1_555 M HOH .  O  ? ? A NA  203 B HOH 350 1_545 ? ? ? ? ? ? ? 2.253 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 46 ? PRO A 50 ? ARG A 179 PRO A 183 
AA1 2 TRP A 36 ? GLU A 40 ? TRP A 169 GLU A 173 
AA1 3 ILE A 25 ? ASP A 30 ? ILE A 158 ASP A 163 
AA1 4 GLU A 2  ? ALA A 6  ? GLU A 135 ALA A 139 
AA1 5 VAL A 54 ? LYS A 56 ? VAL A 187 LYS A 189 
AA2 1 ARG B 46 ? PRO B 50 ? ARG B 179 PRO B 183 
AA2 2 TRP B 36 ? GLU B 40 ? TRP B 169 GLU B 173 
AA2 3 ILE B 25 ? ASP B 30 ? ILE B 158 ASP B 163 
AA2 4 TYR B 3  ? ALA B 6  ? TYR B 136 ALA B 139 
AA2 5 VAL B 54 ? GLU B 55 ? VAL B 187 GLU B 188 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLY A 47 ? O GLY A 180 N ALA A 39 ? N ALA A 172 
AA1 2 3 O GLU A 40 ? O GLU A 173 N ARG A 27 ? N ARG A 160 
AA1 3 4 O ILE A 28 ? O ILE A 161 N GLU A 2  ? N GLU A 135 
AA1 4 5 N ARG A 5  ? N ARG A 138 O GLU A 55 ? O GLU A 188 
AA2 1 2 O ILE B 49 ? O ILE B 182 N TRP B 37 ? N TRP B 170 
AA2 2 3 O ASN B 38 ? O ASN B 171 N ARG B 29 ? N ARG B 162 
AA2 3 4 O LEU B 26 ? O LEU B 159 N VAL B 4  ? N VAL B 137 
AA2 4 5 N ARG B 5  ? N ARG B 138 O GLU B 55 ? O GLU B 188 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PEG 201 ? 7 'binding site for residue PEG A 201' 
AC2 Software A NA  202 ? 4 'binding site for residue NA A 202'  
AC3 Software A NA  203 ? 7 'binding site for residue NA A 203'  
AC4 Software A NA  204 ? 2 'binding site for residue NA A 204'  
AC5 Software B P4G 201 ? 3 'binding site for residue P4G B 201' 
AC6 Software B NA  202 ? 6 'binding site for residue NA B 202'  
AC7 Software N P4G 101 ? 5 'binding site for residue P4G N 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 ILE A 25 ? ILE A 158 . ? 1_555 ? 
2  AC1 7 GLU A 40 ? GLU A 173 . ? 1_555 ? 
3  AC1 7 ASP A 41 ? ASP A 174 . ? 1_555 ? 
4  AC1 7 SER A 42 ? SER A 175 . ? 1_555 ? 
5  AC1 7 HOH L .  ? HOH A 321 . ? 1_555 ? 
6  AC1 7 HOH L .  ? HOH A 326 . ? 1_555 ? 
7  AC1 7 HOH L .  ? HOH A 327 . ? 1_555 ? 
8  AC2 4 ARG A 46 ? ARG A 179 . ? 1_555 ? 
9  AC2 4 HOH L .  ? HOH A 305 . ? 1_565 ? 
10 AC2 4 HOH L .  ? HOH A 309 . ? 1_555 ? 
11 AC2 4 HOH M .  ? HOH B 335 . ? 1_555 ? 
12 AC3 7 ALA A 1  ? ALA A 134 . ? 1_555 ? 
13 AC3 7 HOH L .  ? HOH A 351 . ? 1_555 ? 
14 AC3 7 HOH L .  ? HOH A 362 . ? 1_555 ? 
15 AC3 7 HOH L .  ? HOH A 365 . ? 1_555 ? 
16 AC3 7 HOH L .  ? HOH A 381 . ? 1_555 ? 
17 AC3 7 HOH M .  ? HOH B 342 . ? 1_545 ? 
18 AC3 7 HOH M .  ? HOH B 350 . ? 1_545 ? 
19 AC4 2 ASN A 11 ? ASN A 144 . ? 1_555 ? 
20 AC4 2 LYS A 21 ? LYS A 154 . ? 1_555 ? 
21 AC5 3 ASP B 41 ? ASP B 174 . ? 1_555 ? 
22 AC5 3 SER B 42 ? SER B 175 . ? 1_555 ? 
23 AC5 3 HOH M .  ? HOH B 337 . ? 1_555 ? 
24 AC6 6 GLY B 12 ? GLY B 145 . ? 1_555 ? 
25 AC6 6 ASP B 14 ? ASP B 147 . ? 1_555 ? 
26 AC6 6 GLU B 15 ? GLU B 148 . ? 1_555 ? 
27 AC6 6 ASP B 17 ? ASP B 150 . ? 1_555 ? 
28 AC6 6 HOH M .  ? HOH B 319 . ? 1_555 ? 
29 AC6 6 HOH M .  ? HOH B 324 . ? 1_555 ? 
30 AC7 5 PHE B 8  ? PHE B 141 . ? 1_555 ? 
31 AC7 5 ASP B 9  ? ASP B 142 . ? 1_555 ? 
32 AC7 5 TYR D 2  ? TYR N 0   . ? 1_555 ? 
33 AC7 5 LYS D 4  ? LYS N 2   . ? 1_555 ? 
34 AC7 5 HOH O .  ? HOH N 203 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5IH2 
_atom_sites.fract_transf_matrix[1][1]   0.022113 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001668 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.033922 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021917 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 1  ? 4.394   -8.913  -7.774  1.00 26.27 ? 134 ALA A N   1 
ATOM   2    C  CA  . ALA A 1 1  ? 3.204   -8.128  -8.256  1.00 24.74 ? 134 ALA A CA  1 
ATOM   3    C  C   . ALA A 1 1  ? 1.915   -8.816  -7.980  1.00 22.07 ? 134 ALA A C   1 
ATOM   4    O  O   . ALA A 1 1  ? 1.869   -10.031 -7.704  1.00 23.48 ? 134 ALA A O   1 
ATOM   5    C  CB  . ALA A 1 1  ? 3.334   -7.892  -9.745  1.00 23.06 ? 134 ALA A CB  1 
ATOM   6    N  N   . GLU A 1 2  ? 0.837   -8.021  -7.957  1.00 21.26 ? 135 GLU A N   1 
ATOM   7    C  CA  . GLU A 1 2  ? -0.496  -8.477  -7.571  1.00 20.79 ? 135 GLU A CA  1 
ATOM   8    C  C   . GLU A 1 2  ? -1.336  -8.251  -8.753  1.00 17.74 ? 135 GLU A C   1 
ATOM   9    O  O   . GLU A 1 2  ? -1.486  -7.124  -9.099  1.00 16.19 ? 135 GLU A O   1 
ATOM   10   C  CB  . GLU A 1 2  ? -1.011  -7.600  -6.445  1.00 24.20 ? 135 GLU A CB  1 
ATOM   11   C  CG  . GLU A 1 2  ? -2.275  -8.052  -5.832  1.00 24.90 ? 135 GLU A CG  1 
ATOM   12   C  CD  . GLU A 1 2  ? -2.601  -7.279  -4.578  1.00 29.54 ? 135 GLU A CD  1 
ATOM   13   O  OE1 . GLU A 1 2  ? -1.779  -6.382  -4.152  1.00 29.99 ? 135 GLU A OE1 1 
ATOM   14   O  OE2 . GLU A 1 2  ? -3.733  -7.518  -4.102  1.00 27.57 ? 135 GLU A OE2 1 
ATOM   15   N  N   . TYR A 1 3  ? -1.896  -9.303  -9.358  1.00 16.35 ? 136 TYR A N   1 
ATOM   16   C  CA  . TYR A 1 3  ? -2.760  -9.172  -10.508 1.00 16.55 ? 136 TYR A CA  1 
ATOM   17   C  C   . TYR A 1 3  ? -4.162  -9.642  -10.146 1.00 16.85 ? 136 TYR A C   1 
ATOM   18   O  O   . TYR A 1 3  ? -4.367  -10.601 -9.349  1.00 15.63 ? 136 TYR A O   1 
ATOM   19   C  CB  . TYR A 1 3  ? -2.274  -10.055 -11.623 1.00 17.40 ? 136 TYR A CB  1 
ATOM   20   C  CG  . TYR A 1 3  ? -0.953  -9.547  -12.209 1.00 18.42 ? 136 TYR A CG  1 
ATOM   21   C  CD1 . TYR A 1 3  ? 0.290   -9.955  -11.691 1.00 22.71 ? 136 TYR A CD1 1 
ATOM   22   C  CD2 . TYR A 1 3  ? -0.953  -8.651  -13.278 1.00 19.88 ? 136 TYR A CD2 1 
ATOM   23   C  CE1 . TYR A 1 3  ? 1.477   -9.509  -12.295 1.00 22.66 ? 136 TYR A CE1 1 
ATOM   24   C  CE2 . TYR A 1 3  ? 0.222   -8.187  -13.837 1.00 20.57 ? 136 TYR A CE2 1 
ATOM   25   C  CZ  . TYR A 1 3  ? 1.417   -8.647  -13.358 1.00 21.69 ? 136 TYR A CZ  1 
ATOM   26   O  OH  . TYR A 1 3  ? 2.560   -8.120  -14.016 1.00 28.80 ? 136 TYR A OH  1 
ATOM   27   N  N   . VAL A 1 4  ? -5.091  -8.925  -10.718 1.00 15.68 ? 137 VAL A N   1 
ATOM   28   C  CA  . VAL A 1 4  ? -6.528  -9.263  -10.691 1.00 15.61 ? 137 VAL A CA  1 
ATOM   29   C  C   . VAL A 1 4  ? -7.121  -9.494  -12.112 1.00 15.63 ? 137 VAL A C   1 
ATOM   30   O  O   . VAL A 1 4  ? -6.551  -9.150  -13.094 1.00 15.48 ? 137 VAL A O   1 
ATOM   31   C  CB  . VAL A 1 4  ? -7.384  -8.223  -9.946  1.00 16.24 ? 137 VAL A CB  1 
ATOM   32   C  CG1 . VAL A 1 4  ? -6.969  -8.122  -8.494  1.00 14.86 ? 137 VAL A CG1 1 
ATOM   33   C  CG2 . VAL A 1 4  ? -7.346  -6.888  -10.688 1.00 16.33 ? 137 VAL A CG2 1 
ATOM   34   N  N   . ARG A 1 5  ? -8.282  -10.132 -12.159 1.00 15.62 ? 138 ARG A N   1 
ATOM   35   C  CA  . ARG A 1 5  ? -8.988  -10.385 -13.400 1.00 16.79 ? 138 ARG A CA  1 
ATOM   36   C  C   . ARG A 1 5  ? -10.418 -9.832  -13.238 1.00 15.48 ? 138 ARG A C   1 
ATOM   37   O  O   . ARG A 1 5  ? -11.112 -10.121 -12.270 1.00 14.90 ? 138 ARG A O   1 
ATOM   38   C  CB  . ARG A 1 5  ? -9.000  -11.879 -13.716 1.00 17.83 ? 138 ARG A CB  1 
ATOM   39   C  CG  . ARG A 1 5  ? -9.930  -12.262 -14.886 1.00 20.83 ? 138 ARG A CG  1 
ATOM   40   C  CD  . ARG A 1 5  ? -10.359 -13.693 -14.681 1.00 28.11 ? 138 ARG A CD  1 
ATOM   41   N  NE  . ARG A 1 5  ? -9.281  -14.612 -14.844 1.00 30.18 ? 138 ARG A NE  1 
ATOM   42   C  CZ  . ARG A 1 5  ? -8.778  -15.540 -14.013 1.00 24.80 ? 138 ARG A CZ  1 
ATOM   43   N  NH1 . ARG A 1 5  ? -9.143  -15.821 -12.765 1.00 26.20 ? 138 ARG A NH1 1 
ATOM   44   N  NH2 . ARG A 1 5  ? -7.792  -16.235 -14.530 1.00 26.11 ? 138 ARG A NH2 1 
ATOM   45   N  N   . ALA A 1 6  ? -10.813 -9.002  -14.193 1.00 14.67 ? 139 ALA A N   1 
ATOM   46   C  CA  . ALA A 1 6  ? -12.168 -8.409  -14.187 1.00 15.54 ? 139 ALA A CA  1 
ATOM   47   C  C   . ALA A 1 6  ? -13.264 -9.480  -14.403 1.00 15.28 ? 139 ALA A C   1 
ATOM   48   O  O   . ALA A 1 6  ? -13.229 -10.279 -15.353 1.00 15.68 ? 139 ALA A O   1 
ATOM   49   C  CB  . ALA A 1 6  ? -12.296 -7.315  -15.235 1.00 14.92 ? 139 ALA A CB  1 
ATOM   50   N  N   . LEU A 1 7  ? -14.237 -9.476  -13.479 1.00 15.41 ? 140 LEU A N   1 
ATOM   51   C  CA  . LEU A 1 7  ? -15.443 -10.314 -13.549 1.00 15.53 ? 140 LEU A CA  1 
ATOM   52   C  C   . LEU A 1 7  ? -16.591 -9.711  -14.323 1.00 15.41 ? 140 LEU A C   1 
ATOM   53   O  O   . LEU A 1 7  ? -17.481 -10.447 -14.842 1.00 14.30 ? 140 LEU A O   1 
ATOM   54   C  CB  . LEU A 1 7  ? -15.894 -10.639 -12.096 1.00 17.85 ? 140 LEU A CB  1 
ATOM   55   C  CG  . LEU A 1 7  ? -14.946 -11.398 -11.214 1.00 20.51 ? 140 LEU A CG  1 
ATOM   56   C  CD1 . LEU A 1 7  ? -15.485 -11.292 -9.796  1.00 21.44 ? 140 LEU A CD1 1 
ATOM   57   C  CD2 . LEU A 1 7  ? -14.690 -12.864 -11.608 1.00 21.00 ? 140 LEU A CD2 1 
ATOM   58   N  N   . PHE A 1 8  ? -16.563 -8.385  -14.405 1.00 15.19 ? 141 PHE A N   1 
ATOM   59   C  CA  . PHE A 1 8  ? -17.562 -7.553  -15.033 1.00 16.15 ? 141 PHE A CA  1 
ATOM   60   C  C   . PHE A 1 8  ? -16.915 -6.355  -15.722 1.00 15.22 ? 141 PHE A C   1 
ATOM   61   O  O   . PHE A 1 8  ? -15.743 -6.018  -15.502 1.00 15.35 ? 141 PHE A O   1 
ATOM   62   C  CB  . PHE A 1 8  ? -18.517 -7.026  -13.944 1.00 15.58 ? 141 PHE A CB  1 
ATOM   63   C  CG  . PHE A 1 8  ? -19.238 -8.119  -13.188 1.00 15.73 ? 141 PHE A CG  1 
ATOM   64   C  CD1 . PHE A 1 8  ? -20.299 -8.747  -13.799 1.00 17.97 ? 141 PHE A CD1 1 
ATOM   65   C  CD2 . PHE A 1 8  ? -18.828 -8.512  -11.916 1.00 17.25 ? 141 PHE A CD2 1 
ATOM   66   C  CE1 . PHE A 1 8  ? -20.962 -9.726  -13.140 1.00 19.47 ? 141 PHE A CE1 1 
ATOM   67   C  CE2 . PHE A 1 8  ? -19.489 -9.518  -11.270 1.00 18.04 ? 141 PHE A CE2 1 
ATOM   68   C  CZ  . PHE A 1 8  ? -20.545 -10.134 -11.902 1.00 17.11 ? 141 PHE A CZ  1 
ATOM   69   N  N   . ASP A 1 9  ? -17.741 -5.718  -16.549 1.00 16.80 ? 142 ASP A N   1 
ATOM   70   C  CA  . ASP A 1 9  ? -17.379 -4.488  -17.249 1.00 15.93 ? 142 ASP A CA  1 
ATOM   71   C  C   . ASP A 1 9  ? -17.482 -3.323  -16.281 1.00 16.13 ? 142 ASP A C   1 
ATOM   72   O  O   . ASP A 1 9  ? -18.286 -3.358  -15.349 1.00 15.37 ? 142 ASP A O   1 
ATOM   73   C  CB  . ASP A 1 9  ? -18.330 -4.217  -18.431 1.00 17.86 ? 142 ASP A CB  1 
ATOM   74   C  CG  . ASP A 1 9  ? -18.179 -5.184  -19.583 1.00 19.76 ? 142 ASP A CG  1 
ATOM   75   O  OD1 . ASP A 1 9  ? -17.256 -6.011  -19.613 1.00 17.95 ? 142 ASP A OD1 1 
ATOM   76   O  OD2 . ASP A 1 9  ? -19.059 -5.058  -20.476 1.00 19.48 ? 142 ASP A OD2 1 
ATOM   77   N  N   . PHE A 1 10 ? -16.660 -2.306  -16.499 1.00 15.19 ? 143 PHE A N   1 
ATOM   78   C  CA  . PHE A 1 10 ? -16.695 -1.058  -15.743 1.00 15.45 ? 143 PHE A CA  1 
ATOM   79   C  C   . PHE A 1 10 ? -16.450 0.101   -16.681 1.00 15.91 ? 143 PHE A C   1 
ATOM   80   O  O   . PHE A 1 10 ? -15.448 0.142   -17.370 1.00 16.48 ? 143 PHE A O   1 
ATOM   81   C  CB  . PHE A 1 10 ? -15.656 -1.121  -14.631 1.00 15.42 ? 143 PHE A CB  1 
ATOM   82   C  CG  . PHE A 1 10 ? -15.492 0.134   -13.851 1.00 14.36 ? 143 PHE A CG  1 
ATOM   83   C  CD1 . PHE A 1 10 ? -16.551 0.774   -13.282 1.00 15.62 ? 143 PHE A CD1 1 
ATOM   84   C  CD2 . PHE A 1 10 ? -14.207 0.715   -13.719 1.00 16.37 ? 143 PHE A CD2 1 
ATOM   85   C  CE1 . PHE A 1 10 ? -16.369 1.947   -12.595 1.00 15.14 ? 143 PHE A CE1 1 
ATOM   86   C  CE2 . PHE A 1 10 ? -14.031 1.876   -13.040 1.00 14.65 ? 143 PHE A CE2 1 
ATOM   87   C  CZ  . PHE A 1 10 ? -15.114 2.493   -12.424 1.00 13.94 ? 143 PHE A CZ  1 
ATOM   88   N  N   . ASN A 1 11 ? -17.410 1.049   -16.770 1.00 15.80 ? 144 ASN A N   1 
ATOM   89   C  CA  . ASN A 1 11 ? -17.275 2.162   -17.698 1.00 16.75 ? 144 ASN A CA  1 
ATOM   90   C  C   . ASN A 1 11 ? -16.231 3.201   -17.323 1.00 17.11 ? 144 ASN A C   1 
ATOM   91   O  O   . ASN A 1 11 ? -15.698 3.893   -18.192 1.00 19.90 ? 144 ASN A O   1 
ATOM   92   C  CB  . ASN A 1 11 ? -18.637 2.861   -17.781 1.00 17.27 ? 144 ASN A CB  1 
ATOM   93   C  CG  . ASN A 1 11 ? -18.667 3.940   -18.761 1.00 20.08 ? 144 ASN A CG  1 
ATOM   94   O  OD1 . ASN A 1 11 ? -18.363 3.705   -19.924 1.00 20.55 ? 144 ASN A OD1 1 
ATOM   95   N  ND2 . ASN A 1 11 ? -19.019 5.174   -18.307 1.00 21.81 ? 144 ASN A ND2 1 
ATOM   96   N  N   . GLY A 1 12 ? -16.000 3.371   -16.023 1.00 16.78 ? 145 GLY A N   1 
ATOM   97   C  CA  . GLY A 1 12 ? -15.074 4.412   -15.554 1.00 18.55 ? 145 GLY A CA  1 
ATOM   98   C  C   . GLY A 1 12 ? -15.674 5.787   -15.491 1.00 20.26 ? 145 GLY A C   1 
ATOM   99   O  O   . GLY A 1 12 ? -15.389 6.652   -16.293 1.00 22.66 ? 145 GLY A O   1 
ATOM   100  N  N   . ASN A 1 13 ? -16.569 5.989   -14.556 1.00 17.60 ? 146 ASN A N   1 
ATOM   101  C  CA  . ASN A 1 13 ? -17.475 7.173   -14.560 1.00 18.50 ? 146 ASN A CA  1 
ATOM   102  C  C   . ASN A 1 13 ? -16.987 8.508   -13.970 1.00 17.73 ? 146 ASN A C   1 
ATOM   103  O  O   . ASN A 1 13 ? -17.629 9.546   -14.129 1.00 18.73 ? 146 ASN A O   1 
ATOM   104  C  CB  . ASN A 1 13 ? -18.729 6.704   -13.842 1.00 18.59 ? 146 ASN A CB  1 
ATOM   105  C  CG  . ASN A 1 13 ? -19.237 5.433   -14.419 1.00 17.11 ? 146 ASN A CG  1 
ATOM   106  O  OD1 . ASN A 1 13 ? -19.427 5.340   -15.600 1.00 16.83 ? 146 ASN A OD1 1 
ATOM   107  N  ND2 . ASN A 1 13 ? -19.337 4.427   -13.613 1.00 18.56 ? 146 ASN A ND2 1 
ATOM   108  N  N   . ASP A 1 14 ? -15.911 8.422   -13.186 1.00 18.04 ? 147 ASP A N   1 
ATOM   109  C  CA  . ASP A 1 14 ? -15.136 9.587   -12.752 1.00 18.81 ? 147 ASP A CA  1 
ATOM   110  C  C   . ASP A 1 14 ? -13.804 9.563   -13.498 1.00 18.90 ? 147 ASP A C   1 
ATOM   111  O  O   . ASP A 1 14 ? -13.357 8.509   -13.973 1.00 17.50 ? 147 ASP A O   1 
ATOM   112  C  CB  . ASP A 1 14 ? -14.858 9.563   -11.249 1.00 20.02 ? 147 ASP A CB  1 
ATOM   113  C  CG  . ASP A 1 14 ? -16.106 9.622   -10.378 1.00 20.18 ? 147 ASP A CG  1 
ATOM   114  O  OD1 . ASP A 1 14 ? -17.231 9.947   -10.871 1.00 18.92 ? 147 ASP A OD1 1 
ATOM   115  O  OD2 . ASP A 1 14 ? -15.909 9.416   -9.141  1.00 17.24 ? 147 ASP A OD2 1 
ATOM   116  N  N   . GLU A 1 15 ? -13.172 10.719  -13.688 1.00 18.48 ? 148 GLU A N   1 
ATOM   117  C  CA  . GLU A 1 15 ? -11.974 10.732  -14.520 1.00 18.60 ? 148 GLU A CA  1 
ATOM   118  C  C   . GLU A 1 15 ? -10.771 10.021  -13.910 1.00 16.89 ? 148 GLU A C   1 
ATOM   119  O  O   . GLU A 1 15 ? -9.850  9.655   -14.668 1.00 15.72 ? 148 GLU A O   1 
ATOM   120  C  CB  . GLU A 1 15 ? -11.590 12.185  -14.905 1.00 21.77 ? 148 GLU A CB  1 
ATOM   121  C  CG  . GLU A 1 15 ? -12.592 12.845  -15.815 1.00 24.47 ? 148 GLU A CG  1 
ATOM   122  C  CD  . GLU A 1 15 ? -12.629 12.161  -17.173 1.00 31.87 ? 148 GLU A CD  1 
ATOM   123  O  OE1 . GLU A 1 15 ? -11.582 12.091  -17.812 1.00 34.71 ? 148 GLU A OE1 1 
ATOM   124  O  OE2 . GLU A 1 15 ? -13.690 11.671  -17.577 1.00 32.66 ? 148 GLU A OE2 1 
ATOM   125  N  N   . GLU A 1 16 ? -10.756 9.793   -12.605 1.00 15.34 ? 149 GLU A N   1 
ATOM   126  C  CA  . GLU A 1 16 ? -9.663  9.071   -11.987 1.00 14.54 ? 149 GLU A CA  1 
ATOM   127  C  C   . GLU A 1 16 ? -9.752  7.590   -12.312 1.00 14.72 ? 149 GLU A C   1 
ATOM   128  O  O   . GLU A 1 16 ? -8.807  6.825   -12.016 1.00 14.15 ? 149 GLU A O   1 
ATOM   129  C  CB  . GLU A 1 16 ? -9.621  9.247   -10.441 1.00 16.37 ? 149 GLU A CB  1 
ATOM   130  C  CG  . GLU A 1 16 ? -10.733 8.560   -9.669  1.00 17.10 ? 149 GLU A CG  1 
ATOM   131  C  CD  . GLU A 1 16 ? -10.582 8.713   -8.153  1.00 19.52 ? 149 GLU A CD  1 
ATOM   132  O  OE1 . GLU A 1 16 ? -9.506  9.156   -7.670  1.00 18.96 ? 149 GLU A OE1 1 
ATOM   133  O  OE2 . GLU A 1 16 ? -11.539 8.316   -7.470  1.00 19.30 ? 149 GLU A OE2 1 
ATOM   134  N  N   . ASP A 1 17 ? -10.909 7.156   -12.794 1.00 14.00 ? 150 ASP A N   1 
ATOM   135  C  CA  . ASP A 1 17 ? -11.120 5.735   -12.928 1.00 14.11 ? 150 ASP A CA  1 
ATOM   136  C  C   . ASP A 1 17 ? -10.401 5.113   -14.104 1.00 14.73 ? 150 ASP A C   1 
ATOM   137  O  O   . ASP A 1 17 ? -10.177 5.776   -15.121 1.00 14.46 ? 150 ASP A O   1 
ATOM   138  C  CB  . ASP A 1 17 ? -12.609 5.478   -13.079 1.00 13.72 ? 150 ASP A CB  1 
ATOM   139  C  CG  . ASP A 1 17 ? -13.442 5.815   -11.857 1.00 15.23 ? 150 ASP A CG  1 
ATOM   140  O  OD1 . ASP A 1 17 ? -12.958 6.018   -10.759 1.00 15.62 ? 150 ASP A OD1 1 
ATOM   141  O  OD2 . ASP A 1 17 ? -14.671 5.882   -12.067 1.00 14.57 ? 150 ASP A OD2 1 
ATOM   142  N  N   . LEU A 1 18 ? -10.091 3.810   -14.011 1.00 13.15 ? 151 LEU A N   1 
ATOM   143  C  CA  . LEU A 1 18 ? -9.669  2.967   -15.170 1.00 13.53 ? 151 LEU A CA  1 
ATOM   144  C  C   . LEU A 1 18 ? -10.789 2.085   -15.703 1.00 14.35 ? 151 LEU A C   1 
ATOM   145  O  O   . LEU A 1 18 ? -11.212 1.188   -15.027 1.00 17.01 ? 151 LEU A O   1 
ATOM   146  C  CB  . LEU A 1 18 ? -8.505  2.052   -14.811 1.00 14.84 ? 151 LEU A CB  1 
ATOM   147  C  CG  . LEU A 1 18 ? -7.944  1.130   -15.889 1.00 15.43 ? 151 LEU A CG  1 
ATOM   148  C  CD1 . LEU A 1 18 ? -7.256  1.960   -16.974 1.00 17.10 ? 151 LEU A CD1 1 
ATOM   149  C  CD2 . LEU A 1 18 ? -6.956  0.225   -15.132 1.00 15.69 ? 151 LEU A CD2 1 
ATOM   150  N  N   . PRO A 1 19 ? -11.296 2.370   -16.931 1.00 15.34 ? 152 PRO A N   1 
ATOM   151  C  CA  . PRO A 1 19 ? -12.335 1.498   -17.469 1.00 14.82 ? 152 PRO A CA  1 
ATOM   152  C  C   . PRO A 1 19 ? -11.720 0.151   -17.831 1.00 14.23 ? 152 PRO A C   1 
ATOM   153  O  O   . PRO A 1 19 ? -10.540 0.076   -18.117 1.00 18.68 ? 152 PRO A O   1 
ATOM   154  C  CB  . PRO A 1 19 ? -12.798 2.234   -18.704 1.00 17.24 ? 152 PRO A CB  1 
ATOM   155  C  CG  . PRO A 1 19 ? -12.284 3.618   -18.593 1.00 17.69 ? 152 PRO A CG  1 
ATOM   156  C  CD  . PRO A 1 19 ? -11.017 3.497   -17.850 1.00 18.28 ? 152 PRO A CD  1 
ATOM   157  N  N   . PHE A 1 20 ? -12.536 -0.877  -17.869 1.00 14.57 ? 153 PHE A N   1 
ATOM   158  C  CA  . PHE A 1 20 ? -12.142 -2.203  -18.192 1.00 15.39 ? 153 PHE A CA  1 
ATOM   159  C  C   . PHE A 1 20 ? -13.339 -3.014  -18.578 1.00 16.92 ? 153 PHE A C   1 
ATOM   160  O  O   . PHE A 1 20 ? -14.457 -2.605  -18.340 1.00 15.37 ? 153 PHE A O   1 
ATOM   161  C  CB  . PHE A 1 20 ? -11.297 -2.851  -17.087 1.00 15.49 ? 153 PHE A CB  1 
ATOM   162  C  CG  . PHE A 1 20 ? -11.959 -2.947  -15.742 1.00 13.57 ? 153 PHE A CG  1 
ATOM   163  C  CD1 . PHE A 1 20 ? -12.914 -3.925  -15.458 1.00 14.45 ? 153 PHE A CD1 1 
ATOM   164  C  CD2 . PHE A 1 20 ? -11.631 -2.054  -14.744 1.00 13.07 ? 153 PHE A CD2 1 
ATOM   165  C  CE1 . PHE A 1 20 ? -13.544 -3.970  -14.253 1.00 13.50 ? 153 PHE A CE1 1 
ATOM   166  C  CE2 . PHE A 1 20 ? -12.236 -2.153  -13.517 1.00 12.54 ? 153 PHE A CE2 1 
ATOM   167  C  CZ  . PHE A 1 20 ? -13.157 -3.162  -13.243 1.00 13.20 ? 153 PHE A CZ  1 
ATOM   168  N  N   . LYS A 1 21 ? -13.076 -4.166  -19.199 1.00 15.47 ? 154 LYS A N   1 
ATOM   169  C  CA  . LYS A 1 21 ? -14.081 -5.117  -19.619 1.00 13.60 ? 154 LYS A CA  1 
ATOM   170  C  C   . LYS A 1 21 ? -13.826 -6.459  -18.930 1.00 14.39 ? 154 LYS A C   1 
ATOM   171  O  O   . LYS A 1 21 ? -12.708 -6.816  -18.643 1.00 13.99 ? 154 LYS A O   1 
ATOM   172  C  CB  . LYS A 1 21 ? -14.071 -5.364  -21.125 1.00 13.84 ? 154 LYS A CB  1 
ATOM   173  C  CG  . LYS A 1 21 ? -14.129 -4.126  -22.041 1.00 15.77 ? 154 LYS A CG  1 
ATOM   174  C  CD  . LYS A 1 21 ? -15.471 -3.423  -21.848 1.00 18.16 ? 154 LYS A CD  1 
ATOM   175  C  CE  . LYS A 1 21 ? -15.741 -2.152  -22.685 1.00 17.87 ? 154 LYS A CE  1 
ATOM   176  N  NZ  . LYS A 1 21 ? -17.115 -1.649  -22.444 1.00 17.07 ? 154 LYS A NZ  1 
ATOM   177  N  N   . LYS A 1 22 ? -14.879 -7.200  -18.682 1.00 15.28 ? 155 LYS A N   1 
ATOM   178  C  CA  . LYS A 1 22 ? -14.745 -8.565  -18.177 1.00 16.33 ? 155 LYS A CA  1 
ATOM   179  C  C   . LYS A 1 22 ? -13.633 -9.354  -18.885 1.00 14.93 ? 155 LYS A C   1 
ATOM   180  O  O   . LYS A 1 22 ? -13.528 -9.325  -20.088 1.00 16.29 ? 155 LYS A O   1 
ATOM   181  C  CB  . LYS A 1 22 ? -16.056 -9.328  -18.385 1.00 16.70 ? 155 LYS A CB  1 
ATOM   182  C  CG  . LYS A 1 22 ? -15.981 -10.764 -17.961 1.00 18.20 ? 155 LYS A CG  1 
ATOM   183  C  CD  . LYS A 1 22 ? -17.372 -11.361 -18.171 1.00 21.93 ? 155 LYS A CD  1 
ATOM   184  C  CE  . LYS A 1 22 ? -17.502 -12.737 -17.605 1.00 24.45 ? 155 LYS A CE  1 
ATOM   185  N  NZ  . LYS A 1 22 ? -16.463 -13.658 -18.033 1.00 31.02 ? 155 LYS A NZ  1 
ATOM   186  N  N   . GLY A 1 23 ? -12.740 -9.946  -18.101 1.00 15.63 ? 156 GLY A N   1 
ATOM   187  C  CA  . GLY A 1 23 ? -11.654 -10.793 -18.563 1.00 15.55 ? 156 GLY A CA  1 
ATOM   188  C  C   . GLY A 1 23 ? -10.321 -10.075 -18.546 1.00 15.17 ? 156 GLY A C   1 
ATOM   189  O  O   . GLY A 1 23 ? -9.278  -10.736 -18.648 1.00 16.57 ? 156 GLY A O   1 
ATOM   190  N  N   . ASP A 1 24 ? -10.337 -8.734  -18.506 1.00 14.18 ? 157 ASP A N   1 
ATOM   191  C  CA  . ASP A 1 24 ? -9.083  -7.929  -18.424 1.00 14.34 ? 157 ASP A CA  1 
ATOM   192  C  C   . ASP A 1 24 ? -8.257  -8.307  -17.246 1.00 14.38 ? 157 ASP A C   1 
ATOM   193  O  O   . ASP A 1 24 ? -8.802  -8.494  -16.156 1.00 16.88 ? 157 ASP A O   1 
ATOM   194  C  CB  . ASP A 1 24 ? -9.362  -6.399  -18.406 1.00 14.12 ? 157 ASP A CB  1 
ATOM   195  C  CG  . ASP A 1 24 ? -9.811  -5.861  -19.727 1.00 16.08 ? 157 ASP A CG  1 
ATOM   196  O  OD1 . ASP A 1 24 ? -9.798  -6.606  -20.773 1.00 17.14 ? 157 ASP A OD1 1 
ATOM   197  O  OD2 . ASP A 1 24 ? -10.222 -4.667  -19.770 1.00 15.94 ? 157 ASP A OD2 1 
ATOM   198  N  N   . ILE A 1 25 ? -6.934  -8.461  -17.428 1.00 13.24 ? 158 ILE A N   1 
ATOM   199  C  CA  . ILE A 1 25 ? -5.995  -8.635  -16.328 1.00 15.24 ? 158 ILE A CA  1 
ATOM   200  C  C   . ILE A 1 25 ? -5.338  -7.324  -15.979 1.00 14.27 ? 158 ILE A C   1 
ATOM   201  O  O   . ILE A 1 25 ? -4.861  -6.646  -16.843 1.00 16.10 ? 158 ILE A O   1 
ATOM   202  C  CB  . ILE A 1 25 ? -4.932  -9.674  -16.708 1.00 15.91 ? 158 ILE A CB  1 
ATOM   203  C  CG1 . ILE A 1 25 ? -5.583  -10.945 -17.220 1.00 18.76 ? 158 ILE A CG1 1 
ATOM   204  C  CG2 . ILE A 1 25 ? -4.035  -9.954  -15.526 1.00 16.30 ? 158 ILE A CG2 1 
ATOM   205  C  CD1 . ILE A 1 25 ? -6.522  -11.669 -16.338 1.00 21.04 ? 158 ILE A CD1 1 
ATOM   206  N  N   . LEU A 1 26 ? -5.368  -6.961  -14.705 1.00 15.24 ? 159 LEU A N   1 
ATOM   207  C  CA  . LEU A 1 26 ? -4.962  -5.669  -14.274 1.00 15.29 ? 159 LEU A CA  1 
ATOM   208  C  C   . LEU A 1 26 ? -3.936  -5.875  -13.152 1.00 14.97 ? 159 LEU A C   1 
ATOM   209  O  O   . LEU A 1 26 ? -4.109  -6.752  -12.239 1.00 15.02 ? 159 LEU A O   1 
ATOM   210  C  CB  . LEU A 1 26 ? -6.176  -4.864  -13.783 1.00 15.90 ? 159 LEU A CB  1 
ATOM   211  C  CG  . LEU A 1 26 ? -7.418  -4.733  -14.667 1.00 16.95 ? 159 LEU A CG  1 
ATOM   212  C  CD1 . LEU A 1 26 ? -8.503  -4.031  -13.860 1.00 18.79 ? 159 LEU A CD1 1 
ATOM   213  C  CD2 . LEU A 1 26 ? -7.038  -3.886  -15.882 1.00 17.26 ? 159 LEU A CD2 1 
ATOM   214  N  N   . ARG A 1 27 ? -2.874  -5.054  -13.140 1.00 15.49 ? 160 ARG A N   1 
ATOM   215  C  CA  . ARG A 1 27 ? -1.905  -5.089  -12.048 1.00 15.01 ? 160 ARG A CA  1 
ATOM   216  C  C   . ARG A 1 27 ? -2.245  -4.107  -10.942 1.00 14.78 ? 160 ARG A C   1 
ATOM   217  O  O   . ARG A 1 27 ? -2.456  -2.923  -11.257 1.00 13.62 ? 160 ARG A O   1 
ATOM   218  C  CB  . ARG A 1 27 ? -0.499  -4.737  -12.594 1.00 15.90 ? 160 ARG A CB  1 
ATOM   219  C  CG  . ARG A 1 27 ? 0.588   -5.191  -11.694 1.00 16.16 ? 160 ARG A CG  1 
ATOM   220  C  CD  . ARG A 1 27 ? 2.015   -5.071  -12.172 1.00 17.26 ? 160 ARG A CD  1 
ATOM   221  N  NE  . ARG A 1 27 ? 2.316   -3.749  -12.660 1.00 21.85 ? 160 ARG A NE  1 
ATOM   222  C  CZ  . ARG A 1 27 ? 2.548   -2.742  -11.859 1.00 20.62 ? 160 ARG A CZ  1 
ATOM   223  N  NH1 . ARG A 1 27 ? 2.485   -2.917  -10.538 1.00 23.66 ? 160 ARG A NH1 1 
ATOM   224  N  NH2 . ARG A 1 27 ? 2.792   -1.534  -12.355 1.00 22.36 ? 160 ARG A NH2 1 
ATOM   225  N  N   . ILE A 1 28 ? -2.266  -4.539  -9.701  1.00 14.11 ? 161 ILE A N   1 
ATOM   226  C  CA  . ILE A 1 28 ? -2.588  -3.617  -8.656  1.00 16.30 ? 161 ILE A CA  1 
ATOM   227  C  C   . ILE A 1 28 ? -1.347  -2.829  -8.254  1.00 18.20 ? 161 ILE A C   1 
ATOM   228  O  O   . ILE A 1 28 ? -0.303  -3.419  -7.886  1.00 17.33 ? 161 ILE A O   1 
ATOM   229  C  CB  . ILE A 1 28 ? -3.129  -4.340  -7.444  1.00 16.21 ? 161 ILE A CB  1 
ATOM   230  C  CG1 . ILE A 1 28 ? -4.367  -5.165  -7.840  1.00 17.16 ? 161 ILE A CG1 1 
ATOM   231  C  CG2 . ILE A 1 28 ? -3.488  -3.365  -6.342  1.00 15.66 ? 161 ILE A CG2 1 
ATOM   232  C  CD1 . ILE A 1 28 ? -5.425  -4.407  -8.630  1.00 19.04 ? 161 ILE A CD1 1 
ATOM   233  N  N   . ARG A 1 29 ? -1.485  -1.509  -8.242  1.00 16.61 ? 162 ARG A N   1 
ATOM   234  C  CA  . ARG A 1 29 ? -0.375  -0.626  -7.917  1.00 15.85 ? 162 ARG A CA  1 
ATOM   235  C  C   . ARG A 1 29 ? -0.424  -0.112  -6.464  1.00 16.23 ? 162 ARG A C   1 
ATOM   236  O  O   . ARG A 1 29 ? 0.645   0.223   -5.847  1.00 14.05 ? 162 ARG A O   1 
ATOM   237  C  CB  . ARG A 1 29 ? -0.351  0.552   -8.903  1.00 16.26 ? 162 ARG A CB  1 
ATOM   238  C  CG  . ARG A 1 29 ? -0.066  0.096   -10.303 1.00 15.03 ? 162 ARG A CG  1 
ATOM   239  C  CD  . ARG A 1 29 ? 0.155   1.225   -11.230 1.00 15.59 ? 162 ARG A CD  1 
ATOM   240  N  NE  . ARG A 1 29 ? 1.248   2.067   -10.815 1.00 15.54 ? 162 ARG A NE  1 
ATOM   241  C  CZ  . ARG A 1 29 ? 1.178   3.275   -10.286 1.00 16.59 ? 162 ARG A CZ  1 
ATOM   242  N  NH1 . ARG A 1 29 ? 0.020   3.899   -10.045 1.00 15.55 ? 162 ARG A NH1 1 
ATOM   243  N  NH2 . ARG A 1 29 ? 2.306   3.908   -9.976  1.00 16.86 ? 162 ARG A NH2 1 
ATOM   244  N  N   . ASP A 1 30 ? -1.643  0.156   -5.973  1.00 14.93 ? 163 ASP A N   1 
ATOM   245  C  CA  . ASP A 1 30 ? -1.814  0.797   -4.639  1.00 16.43 ? 163 ASP A CA  1 
ATOM   246  C  C   . ASP A 1 30 ? -3.209  0.520   -4.123  1.00 15.78 ? 163 ASP A C   1 
ATOM   247  O  O   . ASP A 1 30 ? -4.123  0.310   -4.943  1.00 17.69 ? 163 ASP A O   1 
ATOM   248  C  CB  . ASP A 1 30 ? -1.586  2.351   -4.714  1.00 19.53 ? 163 ASP A CB  1 
ATOM   249  C  CG  . ASP A 1 30 ? -1.290  2.983   -3.347  1.00 22.25 ? 163 ASP A CG  1 
ATOM   250  O  OD1 . ASP A 1 30 ? -0.709  2.331   -2.466  1.00 25.86 ? 163 ASP A OD1 1 
ATOM   251  O  OD2 . ASP A 1 30 ? -1.625  4.169   -3.185  1.00 22.44 ? 163 ASP A OD2 1 
ATOM   252  N  N   . LYS A 1 31 ? -3.374  0.496   -2.794  1.00 16.54 ? 164 LYS A N   1 
ATOM   253  C  CA  . LYS A 1 31 ? -4.675  0.333   -2.158  1.00 16.58 ? 164 LYS A CA  1 
ATOM   254  C  C   . LYS A 1 31 ? -5.005  1.486   -1.239  1.00 17.31 ? 164 LYS A C   1 
ATOM   255  O  O   . LYS A 1 31 ? -5.008  1.322   -0.019  1.00 17.26 ? 164 LYS A O   1 
ATOM   256  C  CB  . LYS A 1 31 ? -4.768  -0.979  -1.374  1.00 18.63 ? 164 LYS A CB  1 
ATOM   257  C  CG  . LYS A 1 31 ? -4.388  -2.182  -2.230  1.00 16.39 ? 164 LYS A CG  1 
ATOM   258  C  CD  . LYS A 1 31 ? -4.521  -3.536  -1.569  1.00 17.81 ? 164 LYS A CD  1 
ATOM   259  C  CE  . LYS A 1 31 ? -4.187  -4.659  -2.567  1.00 20.60 ? 164 LYS A CE  1 
ATOM   260  N  NZ  . LYS A 1 31 ? -4.045  -6.040  -1.926  1.00 20.59 ? 164 LYS A NZ  1 
ATOM   261  N  N   . PRO A 1 32 ? -5.337  2.662   -1.789  1.00 16.12 ? 165 PRO A N   1 
ATOM   262  C  CA  . PRO A 1 32 ? -5.582  3.801   -0.913  1.00 16.44 ? 165 PRO A CA  1 
ATOM   263  C  C   . PRO A 1 32 ? -6.909  3.744   -0.161  1.00 18.35 ? 165 PRO A C   1 
ATOM   264  O  O   . PRO A 1 32 ? -7.095  4.481   0.840   1.00 19.13 ? 165 PRO A O   1 
ATOM   265  C  CB  . PRO A 1 32 ? -5.539  4.984   -1.913  1.00 17.56 ? 165 PRO A CB  1 
ATOM   266  C  CG  . PRO A 1 32 ? -5.991  4.368   -3.184  1.00 17.25 ? 165 PRO A CG  1 
ATOM   267  C  CD  . PRO A 1 32 ? -5.346  3.034   -3.202  1.00 16.34 ? 165 PRO A CD  1 
ATOM   268  N  N   . GLU A 1 33 ? -7.842  2.983   -0.712  1.00 16.86 ? 166 GLU A N   1 
ATOM   269  C  CA  . GLU A 1 33 ? -9.138  2.718   -0.125  1.00 18.87 ? 166 GLU A CA  1 
ATOM   270  C  C   . GLU A 1 33 ? -9.369  1.226   -0.107  1.00 18.50 ? 166 GLU A C   1 
ATOM   271  O  O   . GLU A 1 33 ? -8.788  0.510   -0.901  1.00 19.73 ? 166 GLU A O   1 
ATOM   272  C  CB  . GLU A 1 33 ? -10.223 3.394   -0.944  1.00 20.09 ? 166 GLU A CB  1 
ATOM   273  C  CG  . GLU A 1 33 ? -10.432 4.849   -0.692  1.00 22.92 ? 166 GLU A CG  1 
ATOM   274  C  CD  . GLU A 1 33 ? -9.410  5.727   -1.294  1.00 23.14 ? 166 GLU A CD  1 
ATOM   275  O  OE1 . GLU A 1 33 ? -9.065  5.491   -2.470  1.00 25.61 ? 166 GLU A OE1 1 
ATOM   276  O  OE2 . GLU A 1 33 ? -8.932  6.631   -0.603  1.00 24.73 ? 166 GLU A OE2 1 
ATOM   277  N  N   . GLU A 1 34 ? -10.281 0.763   0.749   1.00 17.72 ? 167 GLU A N   1 
ATOM   278  C  CA  . GLU A 1 34 ? -10.573 -0.669  0.817   1.00 19.60 ? 167 GLU A CA  1 
ATOM   279  C  C   . GLU A 1 34 ? -11.168 -1.288  -0.460  1.00 18.09 ? 167 GLU A C   1 
ATOM   280  O  O   . GLU A 1 34 ? -10.832 -2.444  -0.798  1.00 21.34 ? 167 GLU A O   1 
ATOM   281  C  CB  . GLU A 1 34 ? -11.502 -0.957  1.988   1.00 17.92 ? 167 GLU A CB  1 
ATOM   282  C  CG  . GLU A 1 34 ? -10.836 -0.752  3.321   1.00 18.90 ? 167 GLU A CG  1 
ATOM   283  C  CD  . GLU A 1 34 ? -11.666 -1.052  4.530   1.00 19.26 ? 167 GLU A CD  1 
ATOM   284  O  OE1 . GLU A 1 34 ? -12.873 -1.354  4.367   1.00 19.51 ? 167 GLU A OE1 1 
ATOM   285  O  OE2 . GLU A 1 34 ? -11.097 -0.911  5.647   1.00 17.76 ? 167 GLU A OE2 1 
ATOM   286  N  N   . GLN A 1 35 ? -12.032 -0.545  -1.146  1.00 17.36 ? 168 GLN A N   1 
ATOM   287  C  CA  . GLN A 1 35 ? -12.776 -1.067  -2.293  1.00 17.36 ? 168 GLN A CA  1 
ATOM   288  C  C   . GLN A 1 35 ? -12.427 -0.324  -3.591  1.00 16.02 ? 168 GLN A C   1 
ATOM   289  O  O   . GLN A 1 35 ? -13.007 -0.631  -4.636  1.00 14.08 ? 168 GLN A O   1 
ATOM   290  C  CB  . GLN A 1 35 ? -14.262 -0.922  -2.076  1.00 20.35 ? 168 GLN A CB  1 
ATOM   291  C  CG  . GLN A 1 35 ? -14.790 -1.542  -0.759  1.00 21.30 ? 168 GLN A CG  1 
ATOM   292  C  CD  . GLN A 1 35 ? -16.263 -1.665  -0.812  1.00 24.05 ? 168 GLN A CD  1 
ATOM   293  O  OE1 . GLN A 1 35 ? -16.989 -0.789  -0.337  1.00 25.13 ? 168 GLN A OE1 1 
ATOM   294  N  NE2 . GLN A 1 35 ? -16.741 -2.747  -1.388  1.00 23.86 ? 168 GLN A NE2 1 
ATOM   295  N  N   . TRP A 1 36 ? -11.522 0.655   -3.533  1.00 14.46 ? 169 TRP A N   1 
ATOM   296  C  CA  . TRP A 1 36 ? -11.057 1.309   -4.753  1.00 14.23 ? 169 TRP A CA  1 
ATOM   297  C  C   . TRP A 1 36 ? -9.547  1.251   -4.789  1.00 14.63 ? 169 TRP A C   1 
ATOM   298  O  O   . TRP A 1 36 ? -8.909  1.777   -3.911  1.00 13.73 ? 169 TRP A O   1 
ATOM   299  C  CB  . TRP A 1 36 ? -11.535 2.719   -4.818  1.00 15.79 ? 169 TRP A CB  1 
ATOM   300  C  CG  . TRP A 1 36 ? -12.993 2.808   -5.098  1.00 16.17 ? 169 TRP A CG  1 
ATOM   301  C  CD1 . TRP A 1 36 ? -14.021 2.890   -4.182  1.00 16.66 ? 169 TRP A CD1 1 
ATOM   302  C  CD2 . TRP A 1 36 ? -13.590 2.830   -6.382  1.00 15.83 ? 169 TRP A CD2 1 
ATOM   303  N  NE1 . TRP A 1 36 ? -15.226 2.921   -4.847  1.00 15.37 ? 169 TRP A NE1 1 
ATOM   304  C  CE2 . TRP A 1 36 ? -14.977 2.916   -6.200  1.00 15.44 ? 169 TRP A CE2 1 
ATOM   305  C  CE3 . TRP A 1 36 ? -13.081 2.792   -7.683  1.00 16.86 ? 169 TRP A CE3 1 
ATOM   306  C  CZ2 . TRP A 1 36 ? -15.860 2.951   -7.278  1.00 15.28 ? 169 TRP A CZ2 1 
ATOM   307  C  CZ3 . TRP A 1 36 ? -13.939 2.890   -8.733  1.00 17.96 ? 169 TRP A CZ3 1 
ATOM   308  C  CH2 . TRP A 1 36 ? -15.312 2.964   -8.536  1.00 16.25 ? 169 TRP A CH2 1 
ATOM   309  N  N   . TRP A 1 37 ? -8.975  0.537   -5.765  1.00 14.56 ? 170 TRP A N   1 
ATOM   310  C  CA  . TRP A 1 37 ? -7.521  0.344   -5.842  1.00 15.35 ? 170 TRP A CA  1 
ATOM   311  C  C   . TRP A 1 37 ? -6.922  0.984   -7.094  1.00 15.63 ? 170 TRP A C   1 
ATOM   312  O  O   . TRP A 1 37 ? -7.607  1.051   -8.093  1.00 14.81 ? 170 TRP A O   1 
ATOM   313  C  CB  . TRP A 1 37 ? -7.166  -1.158  -5.837  1.00 15.81 ? 170 TRP A CB  1 
ATOM   314  C  CG  . TRP A 1 37 ? -7.460  -1.872  -4.563  1.00 15.15 ? 170 TRP A CG  1 
ATOM   315  C  CD1 . TRP A 1 37 ? -7.811  -1.332  -3.367  1.00 14.91 ? 170 TRP A CD1 1 
ATOM   316  C  CD2 . TRP A 1 37 ? -7.424  -3.278  -4.376  1.00 15.05 ? 170 TRP A CD2 1 
ATOM   317  N  NE1 . TRP A 1 37 ? -7.995  -2.325  -2.443  1.00 14.17 ? 170 TRP A NE1 1 
ATOM   318  C  CE2 . TRP A 1 37 ? -7.784  -3.534  -3.036  1.00 14.06 ? 170 TRP A CE2 1 
ATOM   319  C  CE3 . TRP A 1 37 ? -7.123  -4.352  -5.207  1.00 14.97 ? 170 TRP A CE3 1 
ATOM   320  C  CZ2 . TRP A 1 37 ? -7.834  -4.804  -2.533  1.00 14.93 ? 170 TRP A CZ2 1 
ATOM   321  C  CZ3 . TRP A 1 37 ? -7.192  -5.647  -4.689  1.00 16.45 ? 170 TRP A CZ3 1 
ATOM   322  C  CH2 . TRP A 1 37 ? -7.555  -5.845  -3.363  1.00 15.00 ? 170 TRP A CH2 1 
ATOM   323  N  N   A ASN A 1 38 ? -5.680  1.472   -7.038  0.50 14.80 ? 171 ASN A N   1 
ATOM   324  N  N   B ASN A 1 38 ? -5.667  1.431   -7.024  0.50 14.90 ? 171 ASN A N   1 
ATOM   325  C  CA  A ASN A 1 38 ? -5.071  1.954   -8.286  0.50 16.42 ? 171 ASN A CA  1 
ATOM   326  C  CA  B ASN A 1 38 ? -4.974  1.935   -8.217  0.50 16.68 ? 171 ASN A CA  1 
ATOM   327  C  C   A ASN A 1 38 ? -4.566  0.745   -9.056  0.50 15.90 ? 171 ASN A C   1 
ATOM   328  C  C   B ASN A 1 38 ? -4.513  0.745   -9.060  0.50 16.07 ? 171 ASN A C   1 
ATOM   329  O  O   A ASN A 1 38 ? -3.840  -0.063  -8.480  0.50 15.84 ? 171 ASN A O   1 
ATOM   330  O  O   B ASN A 1 38 ? -3.751  -0.061  -8.531  0.50 16.08 ? 171 ASN A O   1 
ATOM   331  C  CB  A ASN A 1 38 ? -3.905  2.905   -8.073  0.50 15.99 ? 171 ASN A CB  1 
ATOM   332  C  CB  B ASN A 1 38 ? -3.743  2.732   -7.792  0.50 15.93 ? 171 ASN A CB  1 
ATOM   333  C  CG  A ASN A 1 38 ? -3.498  3.576   -9.377  0.50 15.71 ? 171 ASN A CG  1 
ATOM   334  C  CG  B ASN A 1 38 ? -4.101  4.060   -7.178  0.50 16.59 ? 171 ASN A CG  1 
ATOM   335  O  OD1 A ASN A 1 38 ? -3.945  4.675   -9.657  0.50 18.27 ? 171 ASN A OD1 1 
ATOM   336  O  OD1 B ASN A 1 38 ? -4.378  4.129   -5.986  0.50 17.72 ? 171 ASN A OD1 1 
ATOM   337  N  ND2 A ASN A 1 38 ? -2.775  2.878   -10.241 0.50 14.32 ? 171 ASN A ND2 1 
ATOM   338  N  ND2 B ASN A 1 38 ? -4.139  5.125   -7.995  0.50 16.39 ? 171 ASN A ND2 1 
ATOM   339  N  N   . ALA A 1 39 ? -4.889  0.656   -10.360 1.00 16.42 ? 172 ALA A N   1 
ATOM   340  C  CA  . ALA A 1 39 ? -4.566  -0.526  -11.187 1.00 14.47 ? 172 ALA A CA  1 
ATOM   341  C  C   . ALA A 1 39 ? -4.028  -0.108  -12.532 1.00 14.03 ? 172 ALA A C   1 
ATOM   342  O  O   . ALA A 1 39 ? -4.063  1.065   -12.863 1.00 14.09 ? 172 ALA A O   1 
ATOM   343  C  CB  . ALA A 1 39 ? -5.748  -1.493  -11.334 1.00 15.22 ? 172 ALA A CB  1 
ATOM   344  N  N   . GLU A 1 40 ? -3.355  -1.034  -13.180 1.00 14.17 ? 173 GLU A N   1 
ATOM   345  C  CA  . GLU A 1 40 ? -2.811  -0.767  -14.538 1.00 14.85 ? 173 GLU A CA  1 
ATOM   346  C  C   . GLU A 1 40 ? -3.194  -1.893  -15.479 1.00 16.49 ? 173 GLU A C   1 
ATOM   347  O  O   . GLU A 1 40 ? -3.129  -3.059  -15.069 1.00 15.67 ? 173 GLU A O   1 
ATOM   348  C  CB  . GLU A 1 40 ? -1.305  -0.659  -14.454 1.00 15.09 ? 173 GLU A CB  1 
ATOM   349  C  CG  . GLU A 1 40 ? -0.556  -0.325  -15.756 1.00 16.49 ? 173 GLU A CG  1 
ATOM   350  C  CD  . GLU A 1 40 ? 0.925   -0.211  -15.558 1.00 21.19 ? 173 GLU A CD  1 
ATOM   351  O  OE1 . GLU A 1 40 ? 1.332   0.525   -14.600 1.00 20.99 ? 173 GLU A OE1 1 
ATOM   352  O  OE2 . GLU A 1 40 ? 1.687   -0.873  -16.328 1.00 18.57 ? 173 GLU A OE2 1 
ATOM   353  N  N   . ASP A 1 41 ? -3.577  -1.523  -16.699 1.00 15.25 ? 174 ASP A N   1 
ATOM   354  C  CA  . ASP A 1 41 ? -4.059  -2.503  -17.723 1.00 15.27 ? 174 ASP A CA  1 
ATOM   355  C  C   . ASP A 1 41 ? -2.886  -2.873  -18.668 1.00 15.53 ? 174 ASP A C   1 
ATOM   356  O  O   . ASP A 1 41 ? -1.755  -2.358  -18.524 1.00 15.42 ? 174 ASP A O   1 
ATOM   357  C  CB  . ASP A 1 41 ? -5.323  -2.041  -18.446 1.00 14.93 ? 174 ASP A CB  1 
ATOM   358  C  CG  . ASP A 1 41 ? -5.124  -0.878  -19.396 1.00 16.48 ? 174 ASP A CG  1 
ATOM   359  O  OD1 . ASP A 1 41 ? -4.006  -0.614  -19.881 1.00 17.08 ? 174 ASP A OD1 1 
ATOM   360  O  OD2 . ASP A 1 41 ? -6.164  -0.195  -19.760 1.00 13.81 ? 174 ASP A OD2 1 
ATOM   361  N  N   . SER A 1 42 ? -3.190  -3.738  -19.641 1.00 17.11 ? 175 SER A N   1 
ATOM   362  C  CA  . SER A 1 42 ? -2.163  -4.303  -20.561 1.00 16.88 ? 175 SER A CA  1 
ATOM   363  C  C   . SER A 1 42 ? -1.555  -3.310  -21.532 1.00 17.10 ? 175 SER A C   1 
ATOM   364  O  O   . SER A 1 42 ? -0.520  -3.588  -22.103 1.00 18.07 ? 175 SER A O   1 
ATOM   365  C  CB  . SER A 1 42 ? -2.746  -5.454  -21.317 1.00 17.55 ? 175 SER A CB  1 
ATOM   366  O  OG  . SER A 1 42 ? -3.647  -4.988  -22.254 1.00 17.51 ? 175 SER A OG  1 
ATOM   367  N  N   . GLU A 1 43 ? -2.226  -2.186  -21.745 1.00 16.01 ? 176 GLU A N   1 
ATOM   368  C  CA  . GLU A 1 43 ? -1.690  -1.019  -22.465 1.00 18.99 ? 176 GLU A CA  1 
ATOM   369  C  C   . GLU A 1 43 ? -0.940  -0.045  -21.607 1.00 19.31 ? 176 GLU A C   1 
ATOM   370  O  O   . GLU A 1 43 ? -0.443  0.931   -22.135 1.00 20.23 ? 176 GLU A O   1 
ATOM   371  C  CB  . GLU A 1 43 ? -2.813  -0.220  -23.176 1.00 22.40 ? 176 GLU A CB  1 
ATOM   372  C  CG  . GLU A 1 43 ? -3.770  -0.996  -24.006 1.00 25.65 ? 176 GLU A CG  1 
ATOM   373  C  CD  . GLU A 1 43 ? -4.735  -0.015  -24.746 1.00 27.82 ? 176 GLU A CD  1 
ATOM   374  O  OE1 . GLU A 1 43 ? -5.556  0.785   -24.156 1.00 32.57 ? 176 GLU A OE1 1 
ATOM   375  O  OE2 . GLU A 1 43 ? -4.601  0.000   -25.949 1.00 33.54 ? 176 GLU A OE2 1 
ATOM   376  N  N   . GLY A 1 44 ? -0.853  -0.296  -20.302 1.00 15.72 ? 177 GLY A N   1 
ATOM   377  C  CA  . GLY A 1 44 ? -0.165  0.624   -19.360 1.00 18.53 ? 177 GLY A CA  1 
ATOM   378  C  C   . GLY A 1 44 ? -0.949  1.806   -18.825 1.00 18.01 ? 177 GLY A C   1 
ATOM   379  O  O   . GLY A 1 44 ? -0.420  2.661   -18.110 1.00 16.25 ? 177 GLY A O   1 
ATOM   380  N  N   . LYS A 1 45 ? -2.230  1.851   -19.130 1.00 15.53 ? 178 LYS A N   1 
ATOM   381  C  CA  . LYS A 1 45 ? -3.114  2.852   -18.573 1.00 17.46 ? 178 LYS A CA  1 
ATOM   382  C  C   . LYS A 1 45 ? -3.362  2.530   -17.121 1.00 17.05 ? 178 LYS A C   1 
ATOM   383  O  O   . LYS A 1 45 ? -3.448  1.360   -16.711 1.00 16.31 ? 178 LYS A O   1 
ATOM   384  C  CB  . LYS A 1 45 ? -4.433  2.921   -19.363 1.00 17.58 ? 178 LYS A CB  1 
ATOM   385  C  CG  . LYS A 1 45 ? -4.312  3.180   -20.852 1.00 19.74 ? 178 LYS A CG  1 
ATOM   386  C  CD  . LYS A 1 45 ? -5.668  3.684   -21.373 1.00 21.32 ? 178 LYS A CD  1 
ATOM   387  C  CE  . LYS A 1 45 ? -6.873  2.875   -20.936 1.00 21.04 ? 178 LYS A CE  1 
ATOM   388  N  NZ  . LYS A 1 45 ? -6.862  1.483   -21.502 1.00 22.23 ? 178 LYS A NZ  1 
ATOM   389  N  N   . ARG A 1 46 ? -3.485  3.626   -16.368 1.00 17.09 ? 179 ARG A N   1 
ATOM   390  C  CA  . ARG A 1 46 ? -3.702  3.603   -14.969 1.00 15.32 ? 179 ARG A CA  1 
ATOM   391  C  C   . ARG A 1 46 ? -4.960  4.345   -14.516 1.00 15.54 ? 179 ARG A C   1 
ATOM   392  O  O   . ARG A 1 46 ? -5.361  5.294   -15.095 1.00 15.26 ? 179 ARG A O   1 
ATOM   393  C  CB  . ARG A 1 46 ? -2.499  4.169   -14.226 1.00 16.91 ? 179 ARG A CB  1 
ATOM   394  C  CG  . ARG A 1 46 ? -1.183  3.459   -14.542 1.00 17.53 ? 179 ARG A CG  1 
ATOM   395  C  CD  . ARG A 1 46 ? -0.043  4.281   -13.988 1.00 19.20 ? 179 ARG A CD  1 
ATOM   396  N  NE  . ARG A 1 46 ? 1.232   3.591   -14.107 1.00 18.87 ? 179 ARG A NE  1 
ATOM   397  C  CZ  . ARG A 1 46 ? 2.375   4.045   -13.609 1.00 19.91 ? 179 ARG A CZ  1 
ATOM   398  N  NH1 . ARG A 1 46 ? 2.441   5.211   -13.030 1.00 20.93 ? 179 ARG A NH1 1 
ATOM   399  N  NH2 . ARG A 1 46 ? 3.469   3.311   -13.713 1.00 21.99 ? 179 ARG A NH2 1 
ATOM   400  N  N   . GLY A 1 47 ? -5.548  3.857   -13.435 1.00 15.74 ? 180 GLY A N   1 
ATOM   401  C  CA  . GLY A 1 47 ? -6.634  4.526   -12.756 1.00 16.75 ? 180 GLY A CA  1 
ATOM   402  C  C   . GLY A 1 47 ? -7.237  3.689   -11.676 1.00 15.83 ? 180 GLY A C   1 
ATOM   403  O  O   . GLY A 1 47 ? -6.738  2.605   -11.337 1.00 16.51 ? 180 GLY A O   1 
ATOM   404  N  N   . MET A 1 48 ? -8.351  4.193   -11.122 1.00 16.00 ? 181 MET A N   1 
ATOM   405  C  CA  . MET A 1 48 ? -8.975  3.569   -9.967  1.00 14.49 ? 181 MET A CA  1 
ATOM   406  C  C   . MET A 1 48 ? -9.987  2.530   -10.477 1.00 16.36 ? 181 MET A C   1 
ATOM   407  O  O   . MET A 1 48 ? -10.674 2.785   -11.504 1.00 15.15 ? 181 MET A O   1 
ATOM   408  C  CB  . MET A 1 48 ? -9.667  4.647   -9.114  1.00 14.27 ? 181 MET A CB  1 
ATOM   409  C  CG  . MET A 1 48 ? -8.776  5.729   -8.532  1.00 14.78 ? 181 MET A CG  1 
ATOM   410  S  SD  . MET A 1 48 ? -7.328  5.098   -7.673  1.00 17.27 ? 181 MET A SD  1 
ATOM   411  C  CE  . MET A 1 48 ? -8.058  4.248   -6.277  1.00 17.54 ? 181 MET A CE  1 
ATOM   412  N  N   . ILE A 1 49 ? -10.056 1.406   -9.758  1.00 14.17 ? 182 ILE A N   1 
ATOM   413  C  CA  . ILE A 1 49 ? -10.962 0.268   -10.084 1.00 14.36 ? 182 ILE A CA  1 
ATOM   414  C  C   . ILE A 1 49 ? -11.784 -0.107  -8.876  1.00 15.41 ? 182 ILE A C   1 
ATOM   415  O  O   . ILE A 1 49 ? -11.258 -0.049  -7.767  1.00 14.98 ? 182 ILE A O   1 
ATOM   416  C  CB  . ILE A 1 49 ? -10.209 -0.966  -10.624 1.00 13.06 ? 182 ILE A CB  1 
ATOM   417  C  CG1 . ILE A 1 49 ? -9.263  -1.627  -9.629  1.00 14.08 ? 182 ILE A CG1 1 
ATOM   418  C  CG2 . ILE A 1 49 ? -9.418  -0.560  -11.887 1.00 13.65 ? 182 ILE A CG2 1 
ATOM   419  C  CD1 . ILE A 1 49 ? -8.845  -3.008  -10.035 1.00 15.39 ? 182 ILE A CD1 1 
ATOM   420  N  N   . PRO A 1 50 ? -13.037 -0.566  -9.092  1.00 15.02 ? 183 PRO A N   1 
ATOM   421  C  CA  . PRO A 1 50 ? -13.871 -0.995  -7.982  1.00 14.18 ? 183 PRO A CA  1 
ATOM   422  C  C   . PRO A 1 50 ? -13.531 -2.485  -7.676  1.00 14.48 ? 183 PRO A C   1 
ATOM   423  O  O   . PRO A 1 50 ? -13.788 -3.360  -8.500  1.00 14.60 ? 183 PRO A O   1 
ATOM   424  C  CB  . PRO A 1 50 ? -15.263 -0.882  -8.545  1.00 13.36 ? 183 PRO A CB  1 
ATOM   425  C  CG  . PRO A 1 50 ? -15.114 -1.064  -9.992  1.00 13.90 ? 183 PRO A CG  1 
ATOM   426  C  CD  . PRO A 1 50 ? -13.793 -0.446  -10.340 1.00 14.14 ? 183 PRO A CD  1 
ATOM   427  N  N   . VAL A 1 51 ? -13.069 -2.761  -6.471  1.00 15.54 ? 184 VAL A N   1 
ATOM   428  C  CA  . VAL A 1 51 ? -12.554 -4.115  -6.154  1.00 13.83 ? 184 VAL A CA  1 
ATOM   429  C  C   . VAL A 1 51 ? -13.655 -5.185  -6.298  1.00 15.58 ? 184 VAL A C   1 
ATOM   430  O  O   . VAL A 1 51 ? -13.369 -6.341  -6.661  1.00 15.92 ? 184 VAL A O   1 
ATOM   431  C  CB  . VAL A 1 51 ? -11.878 -4.103  -4.759  1.00 13.93 ? 184 VAL A CB  1 
ATOM   432  C  CG1 . VAL A 1 51 ? -11.489 -5.486  -4.301  1.00 15.11 ? 184 VAL A CG1 1 
ATOM   433  C  CG2 . VAL A 1 51 ? -10.708 -3.130  -4.712  1.00 15.06 ? 184 VAL A CG2 1 
ATOM   434  N  N   . PRO A 1 52 ? -14.933 -4.823  -6.067  1.00 16.07 ? 185 PRO A N   1 
ATOM   435  C  CA  . PRO A 1 52 ? -15.970 -5.870  -6.176  1.00 16.15 ? 185 PRO A CA  1 
ATOM   436  C  C   . PRO A 1 52 ? -16.086 -6.472  -7.563  1.00 15.05 ? 185 PRO A C   1 
ATOM   437  O  O   . PRO A 1 52 ? -16.707 -7.523  -7.728  1.00 16.60 ? 185 PRO A O   1 
ATOM   438  C  CB  . PRO A 1 52 ? -17.253 -5.113  -5.833  1.00 15.89 ? 185 PRO A CB  1 
ATOM   439  C  CG  . PRO A 1 52 ? -16.791 -4.151  -4.809  1.00 17.96 ? 185 PRO A CG  1 
ATOM   440  C  CD  . PRO A 1 52 ? -15.521 -3.627  -5.422  1.00 16.34 ? 185 PRO A CD  1 
ATOM   441  N  N   . TYR A 1 53 ? -15.601 -5.749  -8.562  1.00 16.58 ? 186 TYR A N   1 
ATOM   442  C  CA  . TYR A 1 53 ? -15.716 -6.180  -9.934  1.00 15.93 ? 186 TYR A CA  1 
ATOM   443  C  C   . TYR A 1 53 ? -14.583 -7.030  -10.436 1.00 16.49 ? 186 TYR A C   1 
ATOM   444  O  O   . TYR A 1 53 ? -14.513 -7.379  -11.639 1.00 16.48 ? 186 TYR A O   1 
ATOM   445  C  CB  . TYR A 1 53 ? -15.828 -4.974  -10.860 1.00 16.28 ? 186 TYR A CB  1 
ATOM   446  C  CG  . TYR A 1 53 ? -17.177 -4.215  -10.852 1.00 17.16 ? 186 TYR A CG  1 
ATOM   447  C  CD1 . TYR A 1 53 ? -18.121 -4.348  -9.804  1.00 18.75 ? 186 TYR A CD1 1 
ATOM   448  C  CD2 . TYR A 1 53 ? -17.509 -3.373  -11.928 1.00 17.93 ? 186 TYR A CD2 1 
ATOM   449  C  CE1 . TYR A 1 53 ? -19.326 -3.644  -9.836  1.00 19.15 ? 186 TYR A CE1 1 
ATOM   450  C  CE2 . TYR A 1 53 ? -18.685 -2.636  -11.936 1.00 17.31 ? 186 TYR A CE2 1 
ATOM   451  C  CZ  . TYR A 1 53 ? -19.586 -2.769  -10.856 1.00 16.32 ? 186 TYR A CZ  1 
ATOM   452  O  OH  . TYR A 1 53 ? -20.779 -2.091  -10.866 1.00 16.18 ? 186 TYR A OH  1 
ATOM   453  N  N   . VAL A 1 54 ? -13.642 -7.346  -9.574  1.00 15.15 ? 187 VAL A N   1 
ATOM   454  C  CA  . VAL A 1 54 ? -12.455 -8.122  -9.997  1.00 16.48 ? 187 VAL A CA  1 
ATOM   455  C  C   . VAL A 1 54 ? -12.238 -9.278  -9.081  1.00 16.96 ? 187 VAL A C   1 
ATOM   456  O  O   . VAL A 1 54 ? -12.800 -9.252  -7.988  1.00 16.52 ? 187 VAL A O   1 
ATOM   457  C  CB  . VAL A 1 54 ? -11.172 -7.234  -10.065 1.00 15.83 ? 187 VAL A CB  1 
ATOM   458  C  CG1 . VAL A 1 54 ? -11.431 -5.955  -10.923 1.00 15.06 ? 187 VAL A CG1 1 
ATOM   459  C  CG2 . VAL A 1 54 ? -10.592 -6.878  -8.676  1.00 15.74 ? 187 VAL A CG2 1 
ATOM   460  N  N   . GLU A 1 55 ? -11.490 -10.302 -9.526  1.00 16.48 ? 188 GLU A N   1 
ATOM   461  C  CA  . GLU A 1 55 ? -11.014 -11.390 -8.639  1.00 16.19 ? 188 GLU A CA  1 
ATOM   462  C  C   . GLU A 1 55 ? -9.504  -11.508 -8.688  1.00 18.08 ? 188 GLU A C   1 
ATOM   463  O  O   . GLU A 1 55 ? -8.877  -11.070 -9.664  1.00 16.14 ? 188 GLU A O   1 
ATOM   464  C  CB  . GLU A 1 55 ? -11.613 -12.713 -9.084  1.00 16.31 ? 188 GLU A CB  1 
ATOM   465  C  CG  . GLU A 1 55 ? -11.315 -13.151 -10.546 1.00 17.07 ? 188 GLU A CG  1 
ATOM   466  C  CD  . GLU A 1 55 ? -11.875 -14.552 -10.846 1.00 21.97 ? 188 GLU A CD  1 
ATOM   467  O  OE1 . GLU A 1 55 ? -12.538 -15.162 -9.971  1.00 21.62 ? 188 GLU A OE1 1 
ATOM   468  O  OE2 . GLU A 1 55 ? -11.615 -15.074 -11.956 1.00 20.34 ? 188 GLU A OE2 1 
ATOM   469  N  N   . LYS A 1 56 ? -8.899  -12.161 -7.683  1.00 18.12 ? 189 LYS A N   1 
ATOM   470  C  CA  . LYS A 1 56 ? -7.513  -12.527 -7.832  1.00 18.58 ? 189 LYS A CA  1 
ATOM   471  C  C   . LYS A 1 56 ? -7.205  -13.341 -9.087  1.00 19.08 ? 189 LYS A C   1 
ATOM   472  O  O   . LYS A 1 56 ? -7.934  -14.236 -9.430  1.00 16.88 ? 189 LYS A O   1 
ATOM   473  C  CB  . LYS A 1 56 ? -7.046  -13.299 -6.609  1.00 22.12 ? 189 LYS A CB  1 
ATOM   474  C  CG  . LYS A 1 56 ? -6.815  -12.437 -5.401  1.00 26.05 ? 189 LYS A CG  1 
ATOM   475  C  CD  . LYS A 1 56 ? -6.000  -13.233 -4.360  1.00 32.19 ? 189 LYS A CD  1 
ATOM   476  C  CE  . LYS A 1 56 ? -5.596  -12.370 -3.189  1.00 37.61 ? 189 LYS A CE  1 
ATOM   477  N  NZ  . LYS A 1 56 ? -4.102  -12.214 -3.077  1.00 48.31 ? 189 LYS A NZ  1 
ATOM   478  N  N   . TYR A 1 57 ? -6.163  -12.944 -9.802  1.00 18.49 ? 190 TYR A N   1 
ATOM   479  C  CA  . TYR A 1 57 ? -5.751  -13.630 -11.014 1.00 18.98 ? 190 TYR A CA  1 
ATOM   480  C  C   . TYR A 1 57 ? -5.039  -14.933 -10.646 1.00 20.96 ? 190 TYR A C   1 
ATOM   481  O  O   . TYR A 1 57 ? -3.959  -14.961 -10.033 1.00 22.50 ? 190 TYR A O   1 
ATOM   482  C  CB  . TYR A 1 57 ? -4.896  -12.741 -11.901 1.00 18.93 ? 190 TYR A CB  1 
ATOM   483  C  CG  . TYR A 1 57 ? -4.308  -13.488 -13.052 1.00 19.68 ? 190 TYR A CG  1 
ATOM   484  C  CD1 . TYR A 1 57 ? -5.089  -13.969 -14.021 1.00 20.36 ? 190 TYR A CD1 1 
ATOM   485  C  CD2 . TYR A 1 57 ? -2.944  -13.797 -13.097 1.00 25.01 ? 190 TYR A CD2 1 
ATOM   486  C  CE1 . TYR A 1 57 ? -4.581  -14.741 -15.055 1.00 23.79 ? 190 TYR A CE1 1 
ATOM   487  C  CE2 . TYR A 1 57 ? -2.406  -14.524 -14.136 1.00 28.63 ? 190 TYR A CE2 1 
ATOM   488  C  CZ  . TYR A 1 57 ? -3.238  -15.015 -15.123 1.00 31.04 ? 190 TYR A CZ  1 
ATOM   489  O  OH  . TYR A 1 57 ? -2.696  -15.737 -16.186 1.00 36.64 ? 190 TYR A OH  1 
ATOM   490  N  N   . ARG A 1 58 ? -5.687  -16.028 -10.998 1.00 17.91 ? 191 ARG A N   1 
ATOM   491  C  CA  . ARG A 1 58 ? -5.075  -17.350 -10.845 1.00 20.40 ? 191 ARG A CA  1 
ATOM   492  C  C   . ARG A 1 58 ? -5.778  -18.367 -11.754 1.00 22.07 ? 191 ARG A C   1 
ATOM   493  O  O   . ARG A 1 58 ? -5.400  -19.566 -11.887 1.00 23.08 ? 191 ARG A O   1 
ATOM   494  C  CB  . ARG A 1 58 ? -5.137  -17.797 -9.384  1.00 19.45 ? 191 ARG A CB  1 
ATOM   495  C  CG  . ARG A 1 58 ? -6.483  -18.329 -8.838  1.00 18.60 ? 191 ARG A CG  1 
ATOM   496  C  CD  . ARG A 1 58 ? -7.557  -17.224 -8.693  1.00 19.93 ? 191 ARG A CD  1 
ATOM   497  N  NE  . ARG A 1 58 ? -8.783  -17.716 -8.037  1.00 20.47 ? 191 ARG A NE  1 
ATOM   498  C  CZ  . ARG A 1 58 ? -9.828  -16.979 -7.638  1.00 20.97 ? 191 ARG A CZ  1 
ATOM   499  N  NH1 . ARG A 1 58 ? -9.862  -15.656 -7.806  1.00 19.42 ? 191 ARG A NH1 1 
ATOM   500  N  NH2 . ARG A 1 58 ? -10.834 -17.576 -7.004  1.00 18.97 ? 191 ARG A NH2 1 
ATOM   501  O  OXT . ARG A 1 58 ? -6.832  -18.047 -12.316 1.00 21.63 ? 191 ARG A OXT 1 
ATOM   502  N  N   . ALA B 1 1  ? 15.753  -2.258  -25.200 1.00 30.60 ? 134 ALA B N   1 
ATOM   503  C  CA  . ALA B 1 1  ? 15.530  -1.261  -24.109 1.00 27.72 ? 134 ALA B CA  1 
ATOM   504  C  C   . ALA B 1 1  ? 16.064  -1.753  -22.733 1.00 26.67 ? 134 ALA B C   1 
ATOM   505  O  O   . ALA B 1 1  ? 16.273  -2.959  -22.543 1.00 25.84 ? 134 ALA B O   1 
ATOM   506  C  CB  . ALA B 1 1  ? 14.039  -0.938  -24.023 1.00 27.82 ? 134 ALA B CB  1 
ATOM   507  N  N   . GLU B 1 2  ? 16.235  -0.814  -21.804 1.00 20.77 ? 135 GLU B N   1 
ATOM   508  C  CA  . GLU B 1 2  ? 16.674  -1.077  -20.471 1.00 25.69 ? 135 GLU B CA  1 
ATOM   509  C  C   . GLU B 1 2  ? 15.517  -0.754  -19.503 1.00 20.83 ? 135 GLU B C   1 
ATOM   510  O  O   . GLU B 1 2  ? 15.045  0.322   -19.454 1.00 19.66 ? 135 GLU B O   1 
ATOM   511  C  CB  . GLU B 1 2  ? 17.891  -0.263  -20.144 1.00 23.66 ? 135 GLU B CB  1 
ATOM   512  C  CG  . GLU B 1 2  ? 18.375  -0.488  -18.745 1.00 26.75 ? 135 GLU B CG  1 
ATOM   513  C  CD  . GLU B 1 2  ? 19.600  0.316   -18.384 1.00 28.65 ? 135 GLU B CD  1 
ATOM   514  O  OE1 . GLU B 1 2  ? 20.119  0.985   -19.268 1.00 26.44 ? 135 GLU B OE1 1 
ATOM   515  O  OE2 . GLU B 1 2  ? 19.990  0.242   -17.199 1.00 28.51 ? 135 GLU B OE2 1 
ATOM   516  N  N   . TYR B 1 3  ? 15.088  -1.749  -18.779 1.00 20.44 ? 136 TYR B N   1 
ATOM   517  C  CA  . TYR B 1 3  ? 13.985  -1.615  -17.860 1.00 21.77 ? 136 TYR B CA  1 
ATOM   518  C  C   . TYR B 1 3  ? 14.410  -2.033  -16.463 1.00 20.22 ? 136 TYR B C   1 
ATOM   519  O  O   . TYR B 1 3  ? 15.242  -2.912  -16.272 1.00 18.27 ? 136 TYR B O   1 
ATOM   520  C  CB  . TYR B 1 3  ? 12.843  -2.504  -18.240 1.00 22.24 ? 136 TYR B CB  1 
ATOM   521  C  CG  . TYR B 1 3  ? 12.261  -2.234  -19.566 1.00 21.45 ? 136 TYR B CG  1 
ATOM   522  C  CD1 . TYR B 1 3  ? 11.252  -1.318  -19.722 1.00 23.52 ? 136 TYR B CD1 1 
ATOM   523  C  CD2 . TYR B 1 3  ? 12.682  -2.947  -20.666 1.00 22.86 ? 136 TYR B CD2 1 
ATOM   524  C  CE1 . TYR B 1 3  ? 10.714  -1.088  -20.981 1.00 23.77 ? 136 TYR B CE1 1 
ATOM   525  C  CE2 . TYR B 1 3  ? 12.157  -2.719  -21.907 1.00 23.51 ? 136 TYR B CE2 1 
ATOM   526  C  CZ  . TYR B 1 3  ? 11.165  -1.792  -22.049 1.00 24.72 ? 136 TYR B CZ  1 
ATOM   527  O  OH  . TYR B 1 3  ? 10.620  -1.632  -23.312 1.00 28.15 ? 136 TYR B OH  1 
ATOM   528  N  N   . VAL B 1 4  ? 13.762  -1.408  -15.501 1.00 17.75 ? 137 VAL B N   1 
ATOM   529  C  CA  . VAL B 1 4  ? 13.943  -1.681  -14.077 1.00 16.48 ? 137 VAL B CA  1 
ATOM   530  C  C   . VAL B 1 4  ? 12.549  -1.830  -13.439 1.00 17.85 ? 137 VAL B C   1 
ATOM   531  O  O   . VAL B 1 4  ? 11.562  -1.401  -14.001 1.00 17.18 ? 137 VAL B O   1 
ATOM   532  C  CB  . VAL B 1 4  ? 14.692  -0.581  -13.302 1.00 17.93 ? 137 VAL B CB  1 
ATOM   533  C  CG1 . VAL B 1 4  ? 16.126  -0.438  -13.810 1.00 16.98 ? 137 VAL B CG1 1 
ATOM   534  C  CG2 . VAL B 1 4  ? 13.912  0.716   -13.281 1.00 18.71 ? 137 VAL B CG2 1 
ATOM   535  N  N   . ARG B 1 5  ? 12.485  -2.561  -12.339 1.00 17.92 ? 138 ARG B N   1 
ATOM   536  C  CA  . ARG B 1 5  ? 11.235  -2.794  -11.614 1.00 16.91 ? 138 ARG B CA  1 
ATOM   537  C  C   . ARG B 1 5  ? 11.407  -2.144  -10.260 1.00 16.24 ? 138 ARG B C   1 
ATOM   538  O  O   . ARG B 1 5  ? 12.390  -2.393  -9.568  1.00 17.64 ? 138 ARG B O   1 
ATOM   539  C  CB  . ARG B 1 5  ? 10.929  -4.270  -11.380 1.00 20.72 ? 138 ARG B CB  1 
ATOM   540  C  CG  . ARG B 1 5  ? 9.743   -4.490  -10.426 1.00 25.71 ? 138 ARG B CG  1 
ATOM   541  C  CD  . ARG B 1 5  ? 8.989   -5.777  -10.619 1.00 32.44 ? 138 ARG B CD  1 
ATOM   542  N  NE  . ARG B 1 5  ? 9.782   -6.805  -11.261 1.00 40.31 ? 138 ARG B NE  1 
ATOM   543  C  CZ  . ARG B 1 5  ? 9.451   -7.481  -12.353 1.00 42.61 ? 138 ARG B CZ  1 
ATOM   544  N  NH1 . ARG B 1 5  ? 8.264   -7.344  -12.970 1.00 42.79 ? 138 ARG B NH1 1 
ATOM   545  N  NH2 . ARG B 1 5  ? 10.314  -8.378  -12.786 1.00 45.19 ? 138 ARG B NH2 1 
ATOM   546  N  N   . ALA B 1 6  ? 10.426  -1.346  -9.887  1.00 14.06 ? 139 ALA B N   1 
ATOM   547  C  CA  . ALA B 1 6  ? 10.407  -0.679  -8.577  1.00 13.88 ? 139 ALA B CA  1 
ATOM   548  C  C   . ALA B 1 6  ? 10.246  -1.679  -7.434  1.00 15.70 ? 139 ALA B C   1 
ATOM   549  O  O   . ALA B 1 6  ? 9.353   -2.539  -7.444  1.00 15.72 ? 139 ALA B O   1 
ATOM   550  C  CB  . ALA B 1 6  ? 9.338   0.401   -8.468  1.00 15.10 ? 139 ALA B CB  1 
ATOM   551  N  N   . LEU B 1 7  ? 11.166  -1.574  -6.481  1.00 16.51 ? 140 LEU B N   1 
ATOM   552  C  CA  . LEU B 1 7  ? 11.153  -2.339  -5.210  1.00 16.83 ? 140 LEU B CA  1 
ATOM   553  C  C   . LEU B 1 7  ? 10.375  -1.690  -4.093  1.00 18.30 ? 140 LEU B C   1 
ATOM   554  O  O   . LEU B 1 7  ? 10.014  -2.352  -3.175  1.00 17.37 ? 140 LEU B O   1 
ATOM   555  C  CB  . LEU B 1 7  ? 12.580  -2.564  -4.760  1.00 18.37 ? 140 LEU B CB  1 
ATOM   556  C  CG  . LEU B 1 7  ? 13.460  -3.359  -5.715  1.00 20.38 ? 140 LEU B CG  1 
ATOM   557  C  CD1 . LEU B 1 7  ? 14.885  -3.226  -5.300  1.00 19.82 ? 140 LEU B CD1 1 
ATOM   558  C  CD2 . LEU B 1 7  ? 13.017  -4.826  -5.697  1.00 22.61 ? 140 LEU B CD2 1 
ATOM   559  N  N   . PHE B 1 8  ? 10.122  -0.369  -4.187  1.00 16.60 ? 141 PHE B N   1 
ATOM   560  C  CA  . PHE B 1 8  ? 9.522   0.390   -3.164  1.00 16.87 ? 141 PHE B CA  1 
ATOM   561  C  C   . PHE B 1 8  ? 8.672   1.463   -3.829  1.00 17.22 ? 141 PHE B C   1 
ATOM   562  O  O   . PHE B 1 8  ? 8.851   1.715   -5.013  1.00 16.93 ? 141 PHE B O   1 
ATOM   563  C  CB  . PHE B 1 8  ? 10.576  1.051   -2.308  1.00 17.22 ? 141 PHE B CB  1 
ATOM   564  C  CG  . PHE B 1 8  ? 11.566  0.082   -1.644  1.00 14.68 ? 141 PHE B CG  1 
ATOM   565  C  CD1 . PHE B 1 8  ? 11.223  -0.702  -0.541  1.00 16.49 ? 141 PHE B CD1 1 
ATOM   566  C  CD2 . PHE B 1 8  ? 12.815  -0.071  -2.150  1.00 17.10 ? 141 PHE B CD2 1 
ATOM   567  C  CE1 . PHE B 1 8  ? 12.155  -1.585  0.001   1.00 17.55 ? 141 PHE B CE1 1 
ATOM   568  C  CE2 . PHE B 1 8  ? 13.705  -0.967  -1.589  1.00 17.16 ? 141 PHE B CE2 1 
ATOM   569  C  CZ  . PHE B 1 8  ? 13.351  -1.686  -0.506  1.00 17.39 ? 141 PHE B CZ  1 
ATOM   570  N  N   . ASP B 1 9  ? 7.820   2.126   -3.037  1.00 15.78 ? 142 ASP B N   1 
ATOM   571  C  CA  . ASP B 1 9  ? 7.075   3.305   -3.497  1.00 16.07 ? 142 ASP B CA  1 
ATOM   572  C  C   . ASP B 1 9  ? 8.026   4.518   -3.490  1.00 15.68 ? 142 ASP B C   1 
ATOM   573  O  O   . ASP B 1 9  ? 8.967   4.563   -2.658  1.00 15.34 ? 142 ASP B O   1 
ATOM   574  C  CB  . ASP B 1 9  ? 5.879   3.630   -2.595  1.00 16.07 ? 142 ASP B CB  1 
ATOM   575  C  CG  . ASP B 1 9  ? 4.797   2.616   -2.611  1.00 19.64 ? 142 ASP B CG  1 
ATOM   576  O  OD1 . ASP B 1 9  ? 4.728   1.741   -3.479  1.00 18.85 ? 142 ASP B OD1 1 
ATOM   577  O  OD2 . ASP B 1 9  ? 4.002   2.661   -1.645  1.00 18.52 ? 142 ASP B OD2 1 
ATOM   578  N  N   . PHE B 1 10 ? 7.819   5.495   -4.394  1.00 16.30 ? 143 PHE B N   1 
ATOM   579  C  CA  . PHE B 1 10 ? 8.603   6.721   -4.385  1.00 15.50 ? 143 PHE B CA  1 
ATOM   580  C  C   . PHE B 1 10 ? 7.600   7.807   -4.648  1.00 17.14 ? 143 PHE B C   1 
ATOM   581  O  O   . PHE B 1 10 ? 6.914   7.789   -5.690  1.00 14.75 ? 143 PHE B O   1 
ATOM   582  C  CB  . PHE B 1 10 ? 9.642   6.705   -5.518  1.00 14.40 ? 143 PHE B CB  1 
ATOM   583  C  CG  . PHE B 1 10 ? 10.355  8.020   -5.711  1.00 14.88 ? 143 PHE B CG  1 
ATOM   584  C  CD1 . PHE B 1 10 ? 10.864  8.735   -4.682  1.00 16.37 ? 143 PHE B CD1 1 
ATOM   585  C  CD2 . PHE B 1 10 ? 10.461  8.566   -7.026  1.00 15.87 ? 143 PHE B CD2 1 
ATOM   586  C  CE1 . PHE B 1 10 ? 11.506  9.939   -4.897  1.00 16.27 ? 143 PHE B CE1 1 
ATOM   587  C  CE2 . PHE B 1 10 ? 11.139  9.759   -7.230  1.00 17.43 ? 143 PHE B CE2 1 
ATOM   588  C  CZ  . PHE B 1 10 ? 11.649  10.455  -6.166  1.00 16.57 ? 143 PHE B CZ  1 
ATOM   589  N  N   . ASN B 1 11 ? 7.473   8.697   -3.675  1.00 15.38 ? 144 ASN B N   1 
ATOM   590  C  CA  . ASN B 1 11 ? 6.507   9.792   -3.775  1.00 16.19 ? 144 ASN B CA  1 
ATOM   591  C  C   . ASN B 1 11 ? 6.753   10.712  -4.958  1.00 16.95 ? 144 ASN B C   1 
ATOM   592  O  O   . ASN B 1 11 ? 5.792   11.288  -5.558  1.00 17.07 ? 144 ASN B O   1 
ATOM   593  C  CB  . ASN B 1 11 ? 6.408   10.552  -2.441  1.00 16.58 ? 144 ASN B CB  1 
ATOM   594  C  CG  . ASN B 1 11 ? 7.598   11.380  -2.138  1.00 21.30 ? 144 ASN B CG  1 
ATOM   595  O  OD1 . ASN B 1 11 ? 7.723   12.500  -2.626  1.00 23.16 ? 144 ASN B OD1 1 
ATOM   596  N  ND2 . ASN B 1 11 ? 8.464   10.886  -1.238  1.00 23.96 ? 144 ASN B ND2 1 
ATOM   597  N  N   . GLY B 1 12 ? 8.001   10.940  -5.324  1.00 15.45 ? 145 GLY B N   1 
ATOM   598  C  CA  . GLY B 1 12 ? 8.302   11.754  -6.538  1.00 16.68 ? 145 GLY B CA  1 
ATOM   599  C  C   . GLY B 1 12 ? 7.746   13.163  -6.516  1.00 18.96 ? 145 GLY B C   1 
ATOM   600  O  O   . GLY B 1 12 ? 7.350   13.729  -7.513  1.00 20.53 ? 145 GLY B O   1 
ATOM   601  N  N   . ASN B 1 13 ? 7.656   13.740  -5.351  1.00 19.99 ? 146 ASN B N   1 
ATOM   602  C  CA  . ASN B 1 13 ? 6.961   15.015  -5.265  1.00 21.87 ? 146 ASN B CA  1 
ATOM   603  C  C   . ASN B 1 13 ? 7.675   16.193  -5.913  1.00 22.72 ? 146 ASN B C   1 
ATOM   604  O  O   . ASN B 1 13 ? 7.018   17.129  -6.333  1.00 22.20 ? 146 ASN B O   1 
ATOM   605  C  CB  . ASN B 1 13 ? 6.501   15.228  -3.807  1.00 25.61 ? 146 ASN B CB  1 
ATOM   606  C  CG  . ASN B 1 13 ? 5.296   14.325  -3.448  1.00 26.80 ? 146 ASN B CG  1 
ATOM   607  O  OD1 . ASN B 1 13 ? 4.553   13.856  -4.332  1.00 28.85 ? 146 ASN B OD1 1 
ATOM   608  N  ND2 . ASN B 1 13 ? 5.105   14.072  -2.177  1.00 26.91 ? 146 ASN B ND2 1 
ATOM   609  N  N   . ASP B 1 14 ? 8.967   16.112  -6.163  1.00 20.87 ? 147 ASP B N   1 
ATOM   610  C  CA  . ASP B 1 14 ? 9.701   17.169  -6.912  1.00 22.49 ? 147 ASP B CA  1 
ATOM   611  C  C   . ASP B 1 14 ? 9.216   17.060  -8.318  1.00 22.15 ? 147 ASP B C   1 
ATOM   612  O  O   . ASP B 1 14 ? 9.097   15.942  -8.838  1.00 18.55 ? 147 ASP B O   1 
ATOM   613  C  CB  . ASP B 1 14 ? 11.228  16.920  -6.762  1.00 22.14 ? 147 ASP B CB  1 
ATOM   614  C  CG  . ASP B 1 14 ? 12.120  17.832  -7.613  1.00 28.49 ? 147 ASP B CG  1 
ATOM   615  O  OD1 . ASP B 1 14 ? 11.739  18.339  -8.723  1.00 28.77 ? 147 ASP B OD1 1 
ATOM   616  O  OD2 . ASP B 1 14 ? 13.315  17.946  -7.215  1.00 29.56 ? 147 ASP B OD2 1 
ATOM   617  N  N   A GLU B 1 15 ? 8.870   18.176  -8.984  0.50 21.98 ? 148 GLU B N   1 
ATOM   618  N  N   B GLU B 1 15 ? 8.964   18.198  -8.939  0.50 21.49 ? 148 GLU B N   1 
ATOM   619  C  CA  A GLU B 1 15 ? 8.295   18.094  -10.367 0.50 23.69 ? 148 GLU B CA  1 
ATOM   620  C  CA  B GLU B 1 15 ? 8.429   18.260  -10.285 0.50 23.01 ? 148 GLU B CA  1 
ATOM   621  C  C   A GLU B 1 15 ? 9.252   17.431  -11.358 0.50 23.61 ? 148 GLU B C   1 
ATOM   622  C  C   B GLU B 1 15 ? 9.251   17.489  -11.306 0.50 23.25 ? 148 GLU B C   1 
ATOM   623  O  O   A GLU B 1 15 ? 8.794   16.825  -12.333 0.50 23.95 ? 148 GLU B O   1 
ATOM   624  O  O   B GLU B 1 15 ? 8.702   16.868  -12.218 0.50 24.67 ? 148 GLU B O   1 
ATOM   625  C  CB  A GLU B 1 15 ? 7.775   19.438  -10.935 0.50 25.83 ? 148 GLU B CB  1 
ATOM   626  C  CB  B GLU B 1 15 ? 8.357   19.722  -10.646 0.50 23.54 ? 148 GLU B CB  1 
ATOM   627  C  CG  A GLU B 1 15 ? 6.335   19.861  -10.552 0.50 25.28 ? 148 GLU B CG  1 
ATOM   628  C  CG  B GLU B 1 15 ? 7.836   20.551  -9.486  0.50 23.84 ? 148 GLU B CG  1 
ATOM   629  C  CD  A GLU B 1 15 ? 5.200   18.902  -10.976 0.50 25.64 ? 148 GLU B CD  1 
ATOM   630  C  CD  B GLU B 1 15 ? 8.879   20.753  -8.395  0.50 22.84 ? 148 GLU B CD  1 
ATOM   631  O  OE1 A GLU B 1 15 ? 4.583   18.254  -10.110 0.50 22.19 ? 148 GLU B OE1 1 
ATOM   632  O  OE1 B GLU B 1 15 ? 9.953   21.360  -8.597  0.50 34.90 ? 148 GLU B OE1 1 
ATOM   633  O  OE2 A GLU B 1 15 ? 4.851   18.811  -12.175 0.50 29.17 ? 148 GLU B OE2 1 
ATOM   634  O  OE2 B GLU B 1 15 ? 8.635   20.336  -7.294  0.50 23.45 ? 148 GLU B OE2 1 
ATOM   635  N  N   . GLU B 1 16 ? 10.546  17.427  -11.076 1.00 20.44 ? 149 GLU B N   1 
ATOM   636  C  CA  . GLU B 1 16 ? 11.487  16.805  -12.004 1.00 23.56 ? 149 GLU B CA  1 
ATOM   637  C  C   . GLU B 1 16 ? 11.582  15.286  -11.829 1.00 17.59 ? 149 GLU B C   1 
ATOM   638  O  O   . GLU B 1 16 ? 12.211  14.659  -12.601 1.00 17.65 ? 149 GLU B O   1 
ATOM   639  C  CB  . GLU B 1 16 ? 12.921  17.389  -11.818 1.00 31.70 ? 149 GLU B CB  1 
ATOM   640  C  CG  . GLU B 1 16 ? 13.533  16.880  -10.506 1.00 41.99 ? 149 GLU B CG  1 
ATOM   641  C  CD  . GLU B 1 16 ? 15.095  16.858  -10.309 1.00 49.87 ? 149 GLU B CD  1 
ATOM   642  O  OE1 . GLU B 1 16 ? 15.658  15.836  -9.722  1.00 72.72 ? 149 GLU B OE1 1 
ATOM   643  O  OE2 . GLU B 1 16 ? 15.737  17.885  -10.694 1.00 46.54 ? 149 GLU B OE2 1 
ATOM   644  N  N   . ASP B 1 17 ? 10.966  14.754  -10.783 1.00 17.05 ? 150 ASP B N   1 
ATOM   645  C  CA  . ASP B 1 17 ? 11.085  13.318  -10.409 1.00 16.42 ? 150 ASP B CA  1 
ATOM   646  C  C   . ASP B 1 17 ? 9.862   12.547  -10.840 1.00 16.07 ? 150 ASP B C   1 
ATOM   647  O  O   . ASP B 1 17 ? 8.775   13.112  -10.902 1.00 17.54 ? 150 ASP B O   1 
ATOM   648  C  CB  . ASP B 1 17 ? 11.364  13.226  -8.902  1.00 17.60 ? 150 ASP B CB  1 
ATOM   649  C  CG  . ASP B 1 17 ? 12.710  13.815  -8.532  1.00 19.04 ? 150 ASP B CG  1 
ATOM   650  O  OD1 . ASP B 1 17 ? 13.514  14.133  -9.435  1.00 16.23 ? 150 ASP B OD1 1 
ATOM   651  O  OD2 . ASP B 1 17 ? 12.951  14.030  -7.348  1.00 17.75 ? 150 ASP B OD2 1 
ATOM   652  N  N   . LEU B 1 18 ? 10.058  11.288  -11.202 1.00 15.08 ? 151 LEU B N   1 
ATOM   653  C  CA  . LEU B 1 18 ? 8.995   10.408  -11.648 1.00 14.25 ? 151 LEU B CA  1 
ATOM   654  C  C   . LEU B 1 18 ? 8.457   9.576   -10.467 1.00 15.09 ? 151 LEU B C   1 
ATOM   655  O  O   . LEU B 1 18 ? 9.137   8.678   -9.971  1.00 14.72 ? 151 LEU B O   1 
ATOM   656  C  CB  . LEU B 1 18 ? 9.535   9.449   -12.710 1.00 14.54 ? 151 LEU B CB  1 
ATOM   657  C  CG  . LEU B 1 18 ? 8.490   8.475   -13.226 1.00 14.44 ? 151 LEU B CG  1 
ATOM   658  C  CD1 . LEU B 1 18 ? 7.338   9.144   -13.977 1.00 15.76 ? 151 LEU B CD1 1 
ATOM   659  C  CD2 . LEU B 1 18 ? 9.196   7.513   -14.172 1.00 15.18 ? 151 LEU B CD2 1 
ATOM   660  N  N   . PRO B 1 19 ? 7.206   9.824   -10.037 1.00 15.82 ? 152 PRO B N   1 
ATOM   661  C  CA  . PRO B 1 19 ? 6.694   8.982   -8.941  1.00 14.83 ? 152 PRO B CA  1 
ATOM   662  C  C   . PRO B 1 19 ? 6.464   7.557   -9.398  1.00 15.29 ? 152 PRO B C   1 
ATOM   663  O  O   . PRO B 1 19 ? 6.171   7.320   -10.602 1.00 16.58 ? 152 PRO B O   1 
ATOM   664  C  CB  . PRO B 1 19 ? 5.333   9.644   -8.615  1.00 15.24 ? 152 PRO B CB  1 
ATOM   665  C  CG  . PRO B 1 19 ? 5.360   10.965  -9.265  1.00 15.66 ? 152 PRO B CG  1 
ATOM   666  C  CD  . PRO B 1 19 ? 6.178   10.785  -10.484 1.00 15.42 ? 152 PRO B CD  1 
ATOM   667  N  N   . PHE B 1 20 ? 6.511   6.614   -8.463  1.00 15.57 ? 153 PHE B N   1 
ATOM   668  C  CA  . PHE B 1 20 ? 6.133   5.225   -8.783  1.00 14.99 ? 153 PHE B CA  1 
ATOM   669  C  C   . PHE B 1 20 ? 5.737   4.446   -7.576  1.00 14.96 ? 153 PHE B C   1 
ATOM   670  O  O   . PHE B 1 20 ? 5.957   4.888   -6.445  1.00 14.53 ? 153 PHE B O   1 
ATOM   671  C  CB  . PHE B 1 20 ? 7.296   4.531   -9.542  1.00 15.04 ? 153 PHE B CB  1 
ATOM   672  C  CG  . PHE B 1 20 ? 8.607   4.560   -8.860  1.00 16.67 ? 153 PHE B CG  1 
ATOM   673  C  CD1 . PHE B 1 20 ? 8.947   3.645   -7.857  1.00 15.48 ? 153 PHE B CD1 1 
ATOM   674  C  CD2 . PHE B 1 20 ? 9.618   5.443   -9.304  1.00 16.09 ? 153 PHE B CD2 1 
ATOM   675  C  CE1 . PHE B 1 20 ? 10.226  3.622   -7.344  1.00 15.31 ? 153 PHE B CE1 1 
ATOM   676  C  CE2 . PHE B 1 20 ? 10.872  5.406   -8.761  1.00 17.20 ? 153 PHE B CE2 1 
ATOM   677  C  CZ  . PHE B 1 20 ? 11.177  4.501   -7.760  1.00 15.29 ? 153 PHE B CZ  1 
ATOM   678  N  N   . LYS B 1 21 ? 5.152   3.284   -7.792  1.00 15.65 ? 154 LYS B N   1 
ATOM   679  C  CA  . LYS B 1 21 ? 4.812   2.369   -6.716  1.00 16.11 ? 154 LYS B CA  1 
ATOM   680  C  C   . LYS B 1 21 ? 5.556   1.043   -6.918  1.00 17.33 ? 154 LYS B C   1 
ATOM   681  O  O   . LYS B 1 21 ? 5.891   0.685   -8.056  1.00 13.95 ? 154 LYS B O   1 
ATOM   682  C  CB  . LYS B 1 21 ? 3.308   2.097   -6.755  1.00 16.47 ? 154 LYS B CB  1 
ATOM   683  C  CG  . LYS B 1 21 ? 2.445   3.324   -6.600  1.00 18.94 ? 154 LYS B CG  1 
ATOM   684  C  CD  . LYS B 1 21 ? 2.498   3.895   -5.221  1.00 22.48 ? 154 LYS B CD  1 
ATOM   685  C  CE  . LYS B 1 21 ? 1.579   5.126   -5.188  1.00 24.87 ? 154 LYS B CE  1 
ATOM   686  N  NZ  . LYS B 1 21 ? 1.887   5.998   -4.016  1.00 27.46 ? 154 LYS B NZ  1 
ATOM   687  N  N   . LYS B 1 22 ? 5.761   0.321   -5.854  1.00 16.42 ? 155 LYS B N   1 
ATOM   688  C  CA  . LYS B 1 22 ? 6.397   -0.991  -5.913  1.00 18.04 ? 155 LYS B CA  1 
ATOM   689  C  C   . LYS B 1 22 ? 5.753   -1.807  -6.957  1.00 16.55 ? 155 LYS B C   1 
ATOM   690  O  O   . LYS B 1 22 ? 4.468   -1.898  -7.027  1.00 17.13 ? 155 LYS B O   1 
ATOM   691  C  CB  . LYS B 1 22 ? 6.218   -1.760  -4.612  1.00 18.00 ? 155 LYS B CB  1 
ATOM   692  C  CG  . LYS B 1 22 ? 6.813   -3.159  -4.564  1.00 20.80 ? 155 LYS B CG  1 
ATOM   693  C  CD  . LYS B 1 22 ? 6.758   -3.667  -3.145  1.00 22.04 ? 155 LYS B CD  1 
ATOM   694  C  CE  . LYS B 1 22 ? 7.237   -5.094  -3.051  1.00 31.57 ? 155 LYS B CE  1 
ATOM   695  N  NZ  . LYS B 1 22 ? 6.080   -6.000  -3.307  1.00 36.96 ? 155 LYS B NZ  1 
ATOM   696  N  N   . GLY B 1 23 ? 6.599   -2.469  -7.758  1.00 17.77 ? 156 GLY B N   1 
ATOM   697  C  CA  . GLY B 1 23 ? 6.144   -3.259  -8.899  1.00 17.52 ? 156 GLY B CA  1 
ATOM   698  C  C   . GLY B 1 23 ? 6.119   -2.646  -10.297 1.00 17.03 ? 156 GLY B C   1 
ATOM   699  O  O   . GLY B 1 23 ? 6.013   -3.365  -11.263 1.00 17.06 ? 156 GLY B O   1 
ATOM   700  N  N   . ASP B 1 24 ? 6.127   -1.329  -10.379 1.00 15.12 ? 157 ASP B N   1 
ATOM   701  C  CA  . ASP B 1 24 ? 6.138   -0.601  -11.663 1.00 14.45 ? 157 ASP B CA  1 
ATOM   702  C  C   . ASP B 1 24 ? 7.393   -0.961  -12.415 1.00 15.60 ? 157 ASP B C   1 
ATOM   703  O  O   . ASP B 1 24 ? 8.519   -0.952  -11.901 1.00 15.31 ? 157 ASP B O   1 
ATOM   704  C  CB  . ASP B 1 24 ? 6.110   0.951   -11.424 1.00 16.00 ? 157 ASP B CB  1 
ATOM   705  C  CG  . ASP B 1 24 ? 4.786   1.499   -10.917 1.00 16.28 ? 157 ASP B CG  1 
ATOM   706  O  OD1 . ASP B 1 24 ? 3.733   0.791   -10.877 1.00 15.02 ? 157 ASP B OD1 1 
ATOM   707  O  OD2 . ASP B 1 24 ? 4.717   2.754   -10.604 1.00 14.85 ? 157 ASP B OD2 1 
ATOM   708  N  N   . ILE B 1 25 ? 7.229   -1.216  -13.695 1.00 16.73 ? 158 ILE B N   1 
ATOM   709  C  CA  . ILE B 1 25 ? 8.349   -1.368  -14.643 1.00 16.46 ? 158 ILE B CA  1 
ATOM   710  C  C   . ILE B 1 25 ? 8.607   0.026   -15.305 1.00 15.97 ? 158 ILE B C   1 
ATOM   711  O  O   . ILE B 1 25 ? 7.695   0.657   -15.810 1.00 14.71 ? 158 ILE B O   1 
ATOM   712  C  CB  . ILE B 1 25 ? 7.957   -2.407  -15.719 1.00 18.75 ? 158 ILE B CB  1 
ATOM   713  C  CG1 . ILE B 1 25 ? 7.560   -3.725  -15.010 1.00 21.19 ? 158 ILE B CG1 1 
ATOM   714  C  CG2 . ILE B 1 25 ? 9.075   -2.578  -16.737 1.00 20.12 ? 158 ILE B CG2 1 
ATOM   715  C  CD1 . ILE B 1 25 ? 8.682   -4.257  -14.180 1.00 25.52 ? 158 ILE B CD1 1 
ATOM   716  N  N   . LEU B 1 26 ? 9.854   0.473   -15.249 1.00 15.58 ? 159 LEU B N   1 
ATOM   717  C  CA  . LEU B 1 26 ? 10.274  1.768   -15.765 1.00 16.74 ? 159 LEU B CA  1 
ATOM   718  C  C   . LEU B 1 26 ? 11.397  1.609   -16.784 1.00 15.92 ? 159 LEU B C   1 
ATOM   719  O  O   . LEU B 1 26 ? 12.300  0.783   -16.640 1.00 15.56 ? 159 LEU B O   1 
ATOM   720  C  CB  . LEU B 1 26 ? 10.738  2.677   -14.635 1.00 15.87 ? 159 LEU B CB  1 
ATOM   721  C  CG  . LEU B 1 26 ? 9.804   2.827   -13.419 1.00 16.62 ? 159 LEU B CG  1 
ATOM   722  C  CD1 . LEU B 1 26 ? 10.476  3.558   -12.288 1.00 19.32 ? 159 LEU B CD1 1 
ATOM   723  C  CD2 . LEU B 1 26 ? 8.556   3.588   -13.753 1.00 17.16 ? 159 LEU B CD2 1 
ATOM   724  N  N   . ARG B 1 27 ? 11.286  2.328   -17.877 1.00 15.76 ? 160 ARG B N   1 
ATOM   725  C  CA  . ARG B 1 27 ? 12.314  2.271   -18.905 1.00 14.92 ? 160 ARG B CA  1 
ATOM   726  C  C   . ARG B 1 27 ? 13.383  3.306   -18.627 1.00 15.26 ? 160 ARG B C   1 
ATOM   727  O  O   . ARG B 1 27 ? 13.064  4.460   -18.363 1.00 16.80 ? 160 ARG B O   1 
ATOM   728  C  CB  . ARG B 1 27 ? 11.742  2.446   -20.331 1.00 15.38 ? 160 ARG B CB  1 
ATOM   729  C  CG  . ARG B 1 27 ? 12.790  2.204   -21.407 1.00 16.63 ? 160 ARG B CG  1 
ATOM   730  C  CD  . ARG B 1 27 ? 12.212  2.209   -22.814 1.00 18.20 ? 160 ARG B CD  1 
ATOM   731  N  NE  . ARG B 1 27 ? 11.726  3.529   -23.205 1.00 18.68 ? 160 ARG B NE  1 
ATOM   732  C  CZ  . ARG B 1 27 ? 12.503  4.557   -23.523 1.00 19.38 ? 160 ARG B CZ  1 
ATOM   733  N  NH1 . ARG B 1 27 ? 13.847  4.429   -23.538 1.00 19.01 ? 160 ARG B NH1 1 
ATOM   734  N  NH2 . ARG B 1 27 ? 11.948  5.704   -23.864 1.00 18.88 ? 160 ARG B NH2 1 
ATOM   735  N  N   . ILE B 1 28 ? 14.662  2.916   -18.726 1.00 14.98 ? 161 ILE B N   1 
ATOM   736  C  CA  . ILE B 1 28 ? 15.729  3.877   -18.406 1.00 15.98 ? 161 ILE B CA  1 
ATOM   737  C  C   . ILE B 1 28 ? 16.083  4.660   -19.673 1.00 15.11 ? 161 ILE B C   1 
ATOM   738  O  O   . ILE B 1 28 ? 16.388  4.062   -20.698 1.00 17.03 ? 161 ILE B O   1 
ATOM   739  C  CB  . ILE B 1 28 ? 16.966  3.177   -17.782 1.00 14.77 ? 161 ILE B CB  1 
ATOM   740  C  CG1 . ILE B 1 28 ? 16.549  2.384   -16.528 1.00 15.08 ? 161 ILE B CG1 1 
ATOM   741  C  CG2 . ILE B 1 28 ? 18.055  4.210   -17.487 1.00 15.61 ? 161 ILE B CG2 1 
ATOM   742  C  CD1 . ILE B 1 28 ? 15.819  3.191   -15.455 1.00 15.17 ? 161 ILE B CD1 1 
ATOM   743  N  N   . ARG B 1 29 ? 16.081  5.983   -19.565 1.00 15.76 ? 162 ARG B N   1 
ATOM   744  C  CA  . ARG B 1 29 ? 16.421  6.863   -20.703 1.00 15.05 ? 162 ARG B CA  1 
ATOM   745  C  C   . ARG B 1 29 ? 17.837  7.390   -20.677 1.00 15.56 ? 162 ARG B C   1 
ATOM   746  O  O   . ARG B 1 29 ? 18.500  7.524   -21.695 1.00 14.94 ? 162 ARG B O   1 
ATOM   747  C  CB  . ARG B 1 29 ? 15.442  8.038   -20.760 1.00 15.02 ? 162 ARG B CB  1 
ATOM   748  C  CG  . ARG B 1 29 ? 14.004  7.615   -20.845 1.00 15.15 ? 162 ARG B CG  1 
ATOM   749  C  CD  . ARG B 1 29 ? 13.049  8.752   -21.204 1.00 14.27 ? 162 ARG B CD  1 
ATOM   750  N  NE  . ARG B 1 29 ? 13.434  9.536   -22.351 1.00 15.02 ? 162 ARG B NE  1 
ATOM   751  C  CZ  . ARG B 1 29 ? 14.058  10.709  -22.291 1.00 17.49 ? 162 ARG B CZ  1 
ATOM   752  N  NH1 . ARG B 1 29 ? 14.329  11.316  -21.123 1.00 16.69 ? 162 ARG B NH1 1 
ATOM   753  N  NH2 . ARG B 1 29 ? 14.386  11.325  -23.404 1.00 18.61 ? 162 ARG B NH2 1 
ATOM   754  N  N   . ASP B 1 30 ? 18.305  7.699   -19.520 1.00 15.60 ? 163 ASP B N   1 
ATOM   755  C  CA  . ASP B 1 30 ? 19.632  8.332   -19.338 1.00 18.06 ? 163 ASP B CA  1 
ATOM   756  C  C   . ASP B 1 30 ? 20.121  8.106   -17.898 1.00 16.99 ? 163 ASP B C   1 
ATOM   757  O  O   . ASP B 1 30 ? 19.326  8.003   -16.955 1.00 18.40 ? 163 ASP B O   1 
ATOM   758  C  CB  . ASP B 1 30 ? 19.518  9.814   -19.692 1.00 19.62 ? 163 ASP B CB  1 
ATOM   759  C  CG  . ASP B 1 30 ? 20.837  10.453  -20.036 1.00 24.57 ? 163 ASP B CG  1 
ATOM   760  O  OD1 . ASP B 1 30 ? 21.729  9.735   -20.541 1.00 29.83 ? 163 ASP B OD1 1 
ATOM   761  O  OD2 . ASP B 1 30 ? 20.991  11.667  -19.770 1.00 23.31 ? 163 ASP B OD2 1 
ATOM   762  N  N   . LYS B 1 31 ? 21.441  8.123   -17.749 1.00 16.60 ? 164 LYS B N   1 
ATOM   763  C  CA  . LYS B 1 31 ? 22.121  7.859   -16.491 1.00 16.03 ? 164 LYS B CA  1 
ATOM   764  C  C   . LYS B 1 31 ? 23.054  9.047   -16.246 1.00 17.03 ? 164 LYS B C   1 
ATOM   765  O  O   . LYS B 1 31 ? 24.293  8.943   -16.411 1.00 18.20 ? 164 LYS B O   1 
ATOM   766  C  CB  . LYS B 1 31 ? 22.866  6.527   -16.545 1.00 16.69 ? 164 LYS B CB  1 
ATOM   767  C  CG  . LYS B 1 31 ? 21.921  5.367   -16.727 1.00 16.84 ? 164 LYS B CG  1 
ATOM   768  C  CD  . LYS B 1 31 ? 22.682  4.027   -16.677 1.00 16.82 ? 164 LYS B CD  1 
ATOM   769  C  CE  . LYS B 1 31 ? 21.761  2.846   -16.785 1.00 16.44 ? 164 LYS B CE  1 
ATOM   770  N  NZ  . LYS B 1 31 ? 22.451  1.535   -16.687 1.00 17.90 ? 164 LYS B NZ  1 
ATOM   771  N  N   . PRO B 1 32 ? 22.495  10.193  -15.857 1.00 17.72 ? 165 PRO B N   1 
ATOM   772  C  CA  . PRO B 1 32 ? 23.387  11.377  -15.698 1.00 18.84 ? 165 PRO B CA  1 
ATOM   773  C  C   . PRO B 1 32 ? 24.235  11.413  -14.430 1.00 20.72 ? 165 PRO B C   1 
ATOM   774  O  O   . PRO B 1 32 ? 25.131  12.268  -14.299 1.00 20.98 ? 165 PRO B O   1 
ATOM   775  C  CB  . PRO B 1 32 ? 22.415  12.533  -15.658 1.00 17.89 ? 165 PRO B CB  1 
ATOM   776  C  CG  . PRO B 1 32 ? 21.154  11.902  -15.214 1.00 19.98 ? 165 PRO B CG  1 
ATOM   777  C  CD  . PRO B 1 32 ? 21.068  10.604  -15.824 1.00 19.78 ? 165 PRO B CD  1 
ATOM   778  N  N   . GLU B 1 33 ? 23.924  10.537  -13.485 1.00 19.06 ? 166 GLU B N   1 
ATOM   779  C  CA  . GLU B 1 33 ? 24.739  10.355  -12.292 1.00 19.47 ? 166 GLU B CA  1 
ATOM   780  C  C   . GLU B 1 33 ? 24.500  8.987   -11.718 1.00 17.92 ? 166 GLU B C   1 
ATOM   781  O  O   . GLU B 1 33 ? 23.663  8.232   -12.202 1.00 16.54 ? 166 GLU B O   1 
ATOM   782  C  CB  . GLU B 1 33 ? 24.468  11.443  -11.240 1.00 21.85 ? 166 GLU B CB  1 
ATOM   783  C  CG  . GLU B 1 33 ? 23.052  11.437  -10.706 1.00 23.18 ? 166 GLU B CG  1 
ATOM   784  C  CD  . GLU B 1 33 ? 22.727  12.658  -9.885  1.00 25.06 ? 166 GLU B CD  1 
ATOM   785  O  OE1 . GLU B 1 33 ? 22.267  13.659  -10.485 1.00 29.22 ? 166 GLU B OE1 1 
ATOM   786  O  OE2 . GLU B 1 33 ? 22.894  12.585  -8.663  1.00 24.40 ? 166 GLU B OE2 1 
ATOM   787  N  N   . GLU B 1 34 ? 25.324  8.623   -10.740 1.00 16.39 ? 167 GLU B N   1 
ATOM   788  C  CA  . GLU B 1 34 ? 25.284  7.230   -10.246 1.00 17.30 ? 167 GLU B CA  1 
ATOM   789  C  C   . GLU B 1 34 ? 23.921  6.792   -9.733  1.00 17.25 ? 167 GLU B C   1 
ATOM   790  O  O   . GLU B 1 34 ? 23.496  5.686   -9.997  1.00 16.06 ? 167 GLU B O   1 
ATOM   791  C  CB  . GLU B 1 34 ? 26.303  7.061   -9.127  1.00 17.80 ? 167 GLU B CB  1 
ATOM   792  C  CG  . GLU B 1 34 ? 26.963  5.712   -9.053  1.00 16.93 ? 167 GLU B CG  1 
ATOM   793  C  CD  . GLU B 1 34 ? 27.906  5.548   -10.204 1.00 17.92 ? 167 GLU B CD  1 
ATOM   794  O  OE1 . GLU B 1 34 ? 28.991  6.207   -10.199 1.00 17.60 ? 167 GLU B OE1 1 
ATOM   795  O  OE2 . GLU B 1 34 ? 27.546  4.854   -11.188 1.00 19.18 ? 167 GLU B OE2 1 
ATOM   796  N  N   . GLN B 1 35 ? 23.254  7.651   -8.919  1.00 14.51 ? 168 GLN B N   1 
ATOM   797  C  CA  . GLN B 1 35 ? 22.060  7.196   -8.161  1.00 15.24 ? 168 GLN B CA  1 
ATOM   798  C  C   . GLN B 1 35 ? 20.680  7.801   -8.546  1.00 15.07 ? 168 GLN B C   1 
ATOM   799  O  O   . GLN B 1 35 ? 19.662  7.427   -7.918  1.00 13.82 ? 168 GLN B O   1 
ATOM   800  C  CB  . GLN B 1 35 ? 22.296  7.333   -6.626  1.00 16.43 ? 168 GLN B CB  1 
ATOM   801  C  CG  . GLN B 1 35 ? 23.458  6.465   -6.110  1.00 17.37 ? 168 GLN B CG  1 
ATOM   802  C  CD  . GLN B 1 35 ? 23.234  4.959   -6.221  1.00 18.26 ? 168 GLN B CD  1 
ATOM   803  O  OE1 . GLN B 1 35 ? 22.128  4.491   -6.434  1.00 19.46 ? 168 GLN B OE1 1 
ATOM   804  N  NE2 . GLN B 1 35 ? 24.287  4.207   -6.103  1.00 22.14 ? 168 GLN B NE2 1 
ATOM   805  N  N   . TRP B 1 36 ? 20.704  8.675   -9.569  1.00 14.23 ? 169 TRP B N   1 
ATOM   806  C  CA  . TRP B 1 36 ? 19.539  9.312   -10.159 1.00 15.09 ? 169 TRP B CA  1 
ATOM   807  C  C   . TRP B 1 36 ? 19.584  9.130   -11.653 1.00 14.74 ? 169 TRP B C   1 
ATOM   808  O  O   . TRP B 1 36 ? 20.522  9.570   -12.286 1.00 15.31 ? 169 TRP B O   1 
ATOM   809  C  CB  . TRP B 1 36 ? 19.452  10.766  -9.787  1.00 16.62 ? 169 TRP B CB  1 
ATOM   810  C  CG  . TRP B 1 36 ? 19.048  10.960  -8.306  1.00 16.76 ? 169 TRP B CG  1 
ATOM   811  C  CD1 . TRP B 1 36 ? 19.885  11.161  -7.260  1.00 17.08 ? 169 TRP B CD1 1 
ATOM   812  C  CD2 . TRP B 1 36 ? 17.742  10.988  -7.767  1.00 16.91 ? 169 TRP B CD2 1 
ATOM   813  N  NE1 . TRP B 1 36 ? 19.200  11.243  -6.114  1.00 16.91 ? 169 TRP B NE1 1 
ATOM   814  C  CE2 . TRP B 1 36 ? 17.865  11.197  -6.391  1.00 15.68 ? 169 TRP B CE2 1 
ATOM   815  C  CE3 . TRP B 1 36 ? 16.461  10.880  -8.308  1.00 18.00 ? 169 TRP B CE3 1 
ATOM   816  C  CZ2 . TRP B 1 36 ? 16.754  11.284  -5.543  1.00 18.20 ? 169 TRP B CZ2 1 
ATOM   817  C  CZ3 . TRP B 1 36 ? 15.385  11.012  -7.461  1.00 15.62 ? 169 TRP B CZ3 1 
ATOM   818  C  CH2 . TRP B 1 36 ? 15.540  11.188  -6.113  1.00 15.42 ? 169 TRP B CH2 1 
ATOM   819  N  N   . TRP B 1 37 ? 18.594  8.376   -12.166 1.00 14.29 ? 170 TRP B N   1 
ATOM   820  C  CA  . TRP B 1 37 ? 18.508  8.109   -13.625 1.00 14.66 ? 170 TRP B CA  1 
ATOM   821  C  C   . TRP B 1 37 ? 17.250  8.695   -14.171 1.00 15.85 ? 170 TRP B C   1 
ATOM   822  O  O   . TRP B 1 37 ? 16.258  8.788   -13.440 1.00 14.25 ? 170 TRP B O   1 
ATOM   823  C  CB  . TRP B 1 37 ? 18.550  6.633   -13.904 1.00 15.30 ? 170 TRP B CB  1 
ATOM   824  C  CG  . TRP B 1 37 ? 19.817  5.964   -13.521 1.00 12.95 ? 170 TRP B CG  1 
ATOM   825  C  CD1 . TRP B 1 37 ? 21.031  6.552   -13.229 1.00 13.34 ? 170 TRP B CD1 1 
ATOM   826  C  CD2 . TRP B 1 37 ? 20.075  4.550   -13.567 1.00 14.04 ? 170 TRP B CD2 1 
ATOM   827  N  NE1 . TRP B 1 37 ? 21.942  5.615   -12.934 1.00 14.05 ? 170 TRP B NE1 1 
ATOM   828  C  CE2 . TRP B 1 37 ? 21.431  4.373   -13.191 1.00 13.53 ? 170 TRP B CE2 1 
ATOM   829  C  CE3 . TRP B 1 37 ? 19.284  3.413   -13.808 1.00 14.52 ? 170 TRP B CE3 1 
ATOM   830  C  CZ2 . TRP B 1 37 ? 21.991  3.107   -13.017 1.00 14.61 ? 170 TRP B CZ2 1 
ATOM   831  C  CZ3 . TRP B 1 37 ? 19.847  2.176   -13.654 1.00 15.45 ? 170 TRP B CZ3 1 
ATOM   832  C  CH2 . TRP B 1 37 ? 21.208  2.033   -13.278 1.00 14.13 ? 170 TRP B CH2 1 
ATOM   833  N  N   . ASN B 1 38 ? 17.235  9.015   -15.474 1.00 14.64 ? 171 ASN B N   1 
ATOM   834  C  CA  . ASN B 1 38 ? 15.994  9.501   -16.111 1.00 16.78 ? 171 ASN B CA  1 
ATOM   835  C  C   . ASN B 1 38 ? 15.251  8.262   -16.609 1.00 16.21 ? 171 ASN B C   1 
ATOM   836  O  O   . ASN B 1 38 ? 15.830  7.476   -17.357 1.00 14.63 ? 171 ASN B O   1 
ATOM   837  C  CB  . ASN B 1 38 ? 16.228  10.437  -17.316 1.00 17.84 ? 171 ASN B CB  1 
ATOM   838  C  CG  . ASN B 1 38 ? 14.938  11.134  -17.721 1.00 23.11 ? 171 ASN B CG  1 
ATOM   839  O  OD1 . ASN B 1 38 ? 14.159  10.602  -18.495 1.00 22.34 ? 171 ASN B OD1 1 
ATOM   840  N  ND2 . ASN B 1 38 ? 14.611  12.242  -17.033 1.00 26.93 ? 171 ASN B ND2 1 
ATOM   841  N  N   . ALA B 1 39 ? 13.965  8.164   -16.272 1.00 15.31 ? 172 ALA B N   1 
ATOM   842  C  CA  . ALA B 1 39 ? 13.161  7.052   -16.614 1.00 14.04 ? 172 ALA B CA  1 
ATOM   843  C  C   . ALA B 1 39 ? 11.794  7.449   -17.090 1.00 14.04 ? 172 ALA B C   1 
ATOM   844  O  O   . ALA B 1 39 ? 11.389  8.608   -17.039 1.00 14.37 ? 172 ALA B O   1 
ATOM   845  C  CB  . ALA B 1 39 ? 13.099  6.076   -15.445 1.00 15.85 ? 172 ALA B CB  1 
ATOM   846  N  N   . GLU B 1 40 ? 11.094  6.469   -17.637 1.00 14.32 ? 173 GLU B N   1 
ATOM   847  C  CA  . GLU B 1 40 ? 9.771   6.683   -18.207 1.00 15.74 ? 173 GLU B CA  1 
ATOM   848  C  C   . GLU B 1 40 ? 8.796   5.579   -17.724 1.00 17.08 ? 173 GLU B C   1 
ATOM   849  O  O   . GLU B 1 40 ? 9.171   4.448   -17.672 1.00 14.93 ? 173 GLU B O   1 
ATOM   850  C  CB  . GLU B 1 40 ? 9.834   6.676   -19.737 1.00 17.98 ? 173 GLU B CB  1 
ATOM   851  C  CG  . GLU B 1 40 ? 8.495   6.789   -20.458 1.00 18.86 ? 173 GLU B CG  1 
ATOM   852  C  CD  . GLU B 1 40 ? 8.612   6.936   -21.960 1.00 26.25 ? 173 GLU B CD  1 
ATOM   853  O  OE1 . GLU B 1 40 ? 9.556   7.611   -22.359 1.00 31.82 ? 173 GLU B OE1 1 
ATOM   854  O  OE2 . GLU B 1 40 ? 7.748   6.479   -22.710 1.00 22.40 ? 173 GLU B OE2 1 
ATOM   855  N  N   . ASP B 1 41 ? 7.587   5.977   -17.379 1.00 16.08 ? 174 ASP B N   1 
ATOM   856  C  CA  . ASP B 1 41 ? 6.558   5.001   -16.882 1.00 15.40 ? 174 ASP B CA  1 
ATOM   857  C  C   . ASP B 1 41 ? 5.612   4.510   -18.024 1.00 15.42 ? 174 ASP B C   1 
ATOM   858  O  O   . ASP B 1 41 ? 5.804   4.852   -19.227 1.00 15.20 ? 174 ASP B O   1 
ATOM   859  C  CB  . ASP B 1 41 ? 5.793   5.503   -15.654 1.00 15.14 ? 174 ASP B CB  1 
ATOM   860  C  CG  . ASP B 1 41 ? 4.794   6.638   -15.937 1.00 16.32 ? 174 ASP B CG  1 
ATOM   861  O  OD1 . ASP B 1 41 ? 4.368   6.854   -17.106 1.00 16.21 ? 174 ASP B OD1 1 
ATOM   862  O  OD2 . ASP B 1 41 ? 4.326   7.272   -14.946 1.00 16.28 ? 174 ASP B OD2 1 
ATOM   863  N  N   . SER B 1 42 ? 4.683   3.601   -17.689 1.00 14.99 ? 175 SER B N   1 
ATOM   864  C  CA  . SER B 1 42 ? 3.789   2.980   -18.681 1.00 15.56 ? 175 SER B CA  1 
ATOM   865  C  C   . SER B 1 42 ? 2.860   3.929   -19.392 1.00 15.35 ? 175 SER B C   1 
ATOM   866  O  O   . SER B 1 42 ? 2.224   3.543   -20.405 1.00 16.24 ? 175 SER B O   1 
ATOM   867  C  CB  . SER B 1 42 ? 3.001   1.855   -18.049 1.00 16.76 ? 175 SER B CB  1 
ATOM   868  O  OG  . SER B 1 42 ? 2.119   2.334   -17.080 1.00 16.24 ? 175 SER B OG  1 
ATOM   869  N  N   . GLU B 1 43 ? 2.726   5.112   -18.825 1.00 17.86 ? 176 GLU B N   1 
ATOM   870  C  CA  . GLU B 1 43 ? 1.864   6.193   -19.355 1.00 17.65 ? 176 GLU B CA  1 
ATOM   871  C  C   . GLU B 1 43 ? 2.661   7.177   -20.199 1.00 18.64 ? 176 GLU B C   1 
ATOM   872  O  O   . GLU B 1 43 ? 2.052   8.109   -20.774 1.00 16.80 ? 176 GLU B O   1 
ATOM   873  C  CB  . GLU B 1 43 ? 1.113   6.930   -18.224 1.00 21.14 ? 176 GLU B CB  1 
ATOM   874  C  CG  . GLU B 1 43 ? 0.085   6.037   -17.584 1.00 22.94 ? 176 GLU B CG  1 
ATOM   875  C  CD  . GLU B 1 43 ? -0.855  6.754   -16.647 1.00 25.48 ? 176 GLU B CD  1 
ATOM   876  O  OE1 . GLU B 1 43 ? -0.388  7.514   -15.792 1.00 28.95 ? 176 GLU B OE1 1 
ATOM   877  O  OE2 . GLU B 1 43 ? -2.053  6.539   -16.856 1.00 31.07 ? 176 GLU B OE2 1 
ATOM   878  N  N   . GLY B 1 44 ? 3.976   6.993   -20.285 1.00 14.83 ? 177 GLY B N   1 
ATOM   879  C  CA  . GLY B 1 44 ? 4.832   7.866   -21.059 1.00 15.37 ? 177 GLY B CA  1 
ATOM   880  C  C   . GLY B 1 44 ? 5.402   9.042   -20.278 1.00 15.82 ? 177 GLY B C   1 
ATOM   881  O  O   . GLY B 1 44 ? 6.138   9.835   -20.842 1.00 15.89 ? 177 GLY B O   1 
ATOM   882  N  N   A LYS B 1 45 ? 5.122   9.098   -18.954 0.50 15.54 ? 178 LYS B N   1 
ATOM   883  N  N   B LYS B 1 45 ? 5.116   9.101   -18.982 0.50 15.54 ? 178 LYS B N   1 
ATOM   884  C  CA  A LYS B 1 45 ? 5.597   10.190  -18.157 0.50 17.16 ? 178 LYS B CA  1 
ATOM   885  C  CA  B LYS B 1 45 ? 5.635   10.189  -18.212 0.50 17.16 ? 178 LYS B CA  1 
ATOM   886  C  C   A LYS B 1 45 ? 7.083   9.955   -17.929 0.50 16.68 ? 178 LYS B C   1 
ATOM   887  C  C   B LYS B 1 45 ? 7.117   9.949   -18.001 0.50 16.68 ? 178 LYS B C   1 
ATOM   888  O  O   A LYS B 1 45 ? 7.516   8.829   -17.751 0.50 15.37 ? 178 LYS B O   1 
ATOM   889  O  O   B LYS B 1 45 ? 7.528   8.883   -17.719 0.50 15.37 ? 178 LYS B O   1 
ATOM   890  C  CB  A LYS B 1 45 ? 4.833   10.269  -16.825 0.50 20.43 ? 178 LYS B CB  1 
ATOM   891  C  CB  B LYS B 1 45 ? 4.950   10.348  -16.876 0.50 20.43 ? 178 LYS B CB  1 
ATOM   892  C  CG  A LYS B 1 45 ? 5.197   11.416  -15.898 0.50 27.88 ? 178 LYS B CG  1 
ATOM   893  C  CG  B LYS B 1 45 ? 3.518   9.947   -16.901 0.50 27.88 ? 178 LYS B CG  1 
ATOM   894  C  CD  A LYS B 1 45 ? 4.276   11.482  -14.682 0.50 33.49 ? 178 LYS B CD  1 
ATOM   895  C  CD  B LYS B 1 45 ? 2.643   10.914  -16.160 0.50 33.49 ? 178 LYS B CD  1 
ATOM   896  C  CE  A LYS B 1 45 ? 4.749   12.564  -13.693 0.50 40.28 ? 178 LYS B CE  1 
ATOM   897  C  CE  B LYS B 1 45 ? 1.198   10.498  -16.293 0.50 40.28 ? 178 LYS B CE  1 
ATOM   898  N  NZ  A LYS B 1 45 ? 3.866   12.673  -12.470 0.50 45.91 ? 178 LYS B NZ  1 
ATOM   899  N  NZ  B LYS B 1 45 ? 0.557   10.643  -17.618 0.50 45.91 ? 178 LYS B NZ  1 
ATOM   900  N  N   . ARG B 1 46 ? 7.835   11.046  -17.901 1.00 14.22 ? 179 ARG B N   1 
ATOM   901  C  CA  . ARG B 1 46 ? 9.282   11.002  -17.704 1.00 15.59 ? 179 ARG B CA  1 
ATOM   902  C  C   . ARG B 1 46 ? 9.697   11.722  -16.420 1.00 16.70 ? 179 ARG B C   1 
ATOM   903  O  O   . ARG B 1 46 ? 9.082   12.691  -16.033 1.00 17.36 ? 179 ARG B O   1 
ATOM   904  C  CB  . ARG B 1 46 ? 10.020  11.741  -18.830 1.00 18.32 ? 179 ARG B CB  1 
ATOM   905  C  CG  . ARG B 1 46 ? 9.953   11.067  -20.160 1.00 17.69 ? 179 ARG B CG  1 
ATOM   906  C  CD  . ARG B 1 46 ? 10.575  11.963  -21.169 1.00 16.97 ? 179 ARG B CD  1 
ATOM   907  N  NE  . ARG B 1 46 ? 10.534  11.377  -22.479 1.00 19.16 ? 179 ARG B NE  1 
ATOM   908  C  CZ  . ARG B 1 46 ? 11.059  11.968  -23.584 1.00 18.68 ? 179 ARG B CZ  1 
ATOM   909  N  NH1 . ARG B 1 46 ? 11.608  13.162  -23.507 1.00 17.97 ? 179 ARG B NH1 1 
ATOM   910  N  NH2 . ARG B 1 46 ? 11.008  11.323  -24.761 1.00 18.26 ? 179 ARG B NH2 1 
ATOM   911  N  N   . GLY B 1 47 ? 10.792  11.285  -15.809 1.00 14.92 ? 180 GLY B N   1 
ATOM   912  C  CA  . GLY B 1 47 ? 11.378  12.041  -14.705 1.00 15.83 ? 180 GLY B CA  1 
ATOM   913  C  C   . GLY B 1 47 ? 12.510  11.281  -14.085 1.00 15.12 ? 180 GLY B C   1 
ATOM   914  O  O   . GLY B 1 47 ? 12.728  10.110  -14.416 1.00 15.21 ? 180 GLY B O   1 
ATOM   915  N  N   . MET B 1 48 ? 13.143  11.878  -13.094 1.00 15.45 ? 181 MET B N   1 
ATOM   916  C  CA  . MET B 1 48 ? 14.286  11.213  -12.444 1.00 15.24 ? 181 MET B CA  1 
ATOM   917  C  C   . MET B 1 48 ? 13.812  10.280  -11.360 1.00 14.87 ? 181 MET B C   1 
ATOM   918  O  O   . MET B 1 48 ? 12.821  10.536  -10.679 1.00 13.53 ? 181 MET B O   1 
ATOM   919  C  CB  . MET B 1 48 ? 15.222  12.211  -11.803 1.00 15.66 ? 181 MET B CB  1 
ATOM   920  C  CG  . MET B 1 48 ? 15.711  13.299  -12.708 1.00 17.73 ? 181 MET B CG  1 
ATOM   921  S  SD  . MET B 1 48 ? 16.677  12.679  -14.077 1.00 18.88 ? 181 MET B SD  1 
ATOM   922  C  CE  . MET B 1 48 ? 18.038  12.053  -13.119 1.00 20.15 ? 181 MET B CE  1 
ATOM   923  N  N   . ILE B 1 49 ? 14.508  9.169   -11.238 1.00 14.28 ? 182 ILE B N   1 
ATOM   924  C  CA  . ILE B 1 49 ? 14.229  8.136   -10.265 1.00 15.45 ? 182 ILE B CA  1 
ATOM   925  C  C   . ILE B 1 49 ? 15.465  7.783   -9.405  1.00 15.75 ? 182 ILE B C   1 
ATOM   926  O  O   . ILE B 1 49 ? 16.586  7.833   -9.908  1.00 14.55 ? 182 ILE B O   1 
ATOM   927  C  CB  . ILE B 1 49 ? 13.683  6.817   -10.880 1.00 15.72 ? 182 ILE B CB  1 
ATOM   928  C  CG1 . ILE B 1 49 ? 14.718  6.175   -11.856 1.00 15.48 ? 182 ILE B CG1 1 
ATOM   929  C  CG2 . ILE B 1 49 ? 12.308  7.122   -11.495 1.00 16.42 ? 182 ILE B CG2 1 
ATOM   930  C  CD1 . ILE B 1 49 ? 14.470  4.730   -12.235 1.00 15.55 ? 182 ILE B CD1 1 
ATOM   931  N  N   . PRO B 1 50 ? 15.237  7.420   -8.120  1.00 16.20 ? 183 PRO B N   1 
ATOM   932  C  CA  . PRO B 1 50 ? 16.329  6.964   -7.286  1.00 15.58 ? 183 PRO B CA  1 
ATOM   933  C  C   . PRO B 1 50 ? 16.671  5.480   -7.556  1.00 18.04 ? 183 PRO B C   1 
ATOM   934  O  O   . PRO B 1 50 ? 15.858  4.560   -7.309  1.00 17.02 ? 183 PRO B O   1 
ATOM   935  C  CB  . PRO B 1 50 ? 15.794  7.156   -5.861  1.00 15.86 ? 183 PRO B CB  1 
ATOM   936  C  CG  . PRO B 1 50 ? 14.341  6.986   -5.997  1.00 16.55 ? 183 PRO B CG  1 
ATOM   937  C  CD  . PRO B 1 50 ? 13.946  7.434   -7.382  1.00 16.58 ? 183 PRO B CD  1 
ATOM   938  N  N   . VAL B 1 51 ? 17.907  5.277   -7.978  1.00 17.05 ? 184 VAL B N   1 
ATOM   939  C  CA  . VAL B 1 51 ? 18.401  3.923   -8.344  1.00 17.28 ? 184 VAL B CA  1 
ATOM   940  C  C   . VAL B 1 51 ? 18.314  2.923   -7.182  1.00 17.53 ? 184 VAL B C   1 
ATOM   941  O  O   . VAL B 1 51 ? 18.029  1.754   -7.419  1.00 17.98 ? 184 VAL B O   1 
ATOM   942  C  CB  . VAL B 1 51 ? 19.823  4.031   -8.914  1.00 19.56 ? 184 VAL B CB  1 
ATOM   943  C  CG1 . VAL B 1 51 ? 20.474  2.633   -9.155  1.00 19.60 ? 184 VAL B CG1 1 
ATOM   944  C  CG2 . VAL B 1 51 ? 19.762  4.810   -10.222 1.00 19.57 ? 184 VAL B CG2 1 
ATOM   945  N  N   . PRO B 1 52 ? 18.580  3.349   -5.937  1.00 17.04 ? 185 PRO B N   1 
ATOM   946  C  CA  . PRO B 1 52 ? 18.385  2.391   -4.816  1.00 17.40 ? 185 PRO B CA  1 
ATOM   947  C  C   . PRO B 1 52 ? 17.009  1.753   -4.692  1.00 16.42 ? 185 PRO B C   1 
ATOM   948  O  O   . PRO B 1 52 ? 16.901  0.711   -4.004  1.00 18.69 ? 185 PRO B O   1 
ATOM   949  C  CB  . PRO B 1 52 ? 18.656  3.214   -3.589  1.00 16.54 ? 185 PRO B CB  1 
ATOM   950  C  CG  . PRO B 1 52 ? 19.619  4.255   -4.061  1.00 16.84 ? 185 PRO B CG  1 
ATOM   951  C  CD  . PRO B 1 52 ? 19.112  4.625   -5.430  1.00 16.45 ? 185 PRO B CD  1 
ATOM   952  N  N   . TYR B 1 53 ? 15.983  2.361   -5.291  1.00 15.96 ? 186 TYR B N   1 
ATOM   953  C  CA  . TYR B 1 53 ? 14.629  1.859   -5.131  1.00 15.96 ? 186 TYR B CA  1 
ATOM   954  C  C   . TYR B 1 53 ? 14.195  0.908   -6.251  1.00 15.79 ? 186 TYR B C   1 
ATOM   955  O  O   . TYR B 1 53 ? 13.072  0.393   -6.188  1.00 16.31 ? 186 TYR B O   1 
ATOM   956  C  CB  . TYR B 1 53 ? 13.623  2.977   -5.073  1.00 17.45 ? 186 TYR B CB  1 
ATOM   957  C  CG  . TYR B 1 53 ? 13.600  3.781   -3.818  1.00 17.09 ? 186 TYR B CG  1 
ATOM   958  C  CD1 . TYR B 1 53 ? 14.664  3.717   -2.858  1.00 19.76 ? 186 TYR B CD1 1 
ATOM   959  C  CD2 . TYR B 1 53 ? 12.540  4.660   -3.589  1.00 19.80 ? 186 TYR B CD2 1 
ATOM   960  C  CE1 . TYR B 1 53 ? 14.614  4.540   -1.720  1.00 20.21 ? 186 TYR B CE1 1 
ATOM   961  C  CE2 . TYR B 1 53 ? 12.490  5.444   -2.475  1.00 20.46 ? 186 TYR B CE2 1 
ATOM   962  C  CZ  . TYR B 1 53 ? 13.499  5.416   -1.565  1.00 23.08 ? 186 TYR B CZ  1 
ATOM   963  O  OH  . TYR B 1 53 ? 13.352  6.246   -0.461  1.00 25.68 ? 186 TYR B OH  1 
ATOM   964  N  N   . VAL B 1 54 ? 15.064  0.627   -7.190  1.00 15.39 ? 187 VAL B N   1 
ATOM   965  C  CA  . VAL B 1 54 ? 14.697  -0.262  -8.308  1.00 17.69 ? 187 VAL B CA  1 
ATOM   966  C  C   . VAL B 1 54 ? 15.674  -1.431  -8.427  1.00 19.97 ? 187 VAL B C   1 
ATOM   967  O  O   . VAL B 1 54 ? 16.805  -1.356  -7.940  1.00 21.03 ? 187 VAL B O   1 
ATOM   968  C  CB  . VAL B 1 54 ? 14.652  0.500   -9.636  1.00 17.47 ? 187 VAL B CB  1 
ATOM   969  C  CG1 . VAL B 1 54 ? 13.793  1.740   -9.528  1.00 16.78 ? 187 VAL B CG1 1 
ATOM   970  C  CG2 . VAL B 1 54 ? 16.032  0.850   -10.154 1.00 17.49 ? 187 VAL B CG2 1 
ATOM   971  N  N   A GLU B 1 55 ? 15.262  -2.493  -9.086  0.50 22.03 ? 188 GLU B N   1 
ATOM   972  N  N   B GLU B 1 55 ? 15.208  -2.513  -9.040  0.50 20.23 ? 188 GLU B N   1 
ATOM   973  C  CA  A GLU B 1 55 ? 16.272  -3.456  -9.524  0.50 24.85 ? 188 GLU B CA  1 
ATOM   974  C  CA  B GLU B 1 55 ? 16.120  -3.581  -9.496  0.50 21.91 ? 188 GLU B CA  1 
ATOM   975  C  C   A GLU B 1 55 ? 16.234  -3.696  -10.997 0.50 21.84 ? 188 GLU B C   1 
ATOM   976  C  C   B GLU B 1 55 ? 16.209  -3.709  -11.008 0.50 20.30 ? 188 GLU B C   1 
ATOM   977  O  O   A GLU B 1 55 ? 15.249  -3.427  -11.640 0.50 17.44 ? 188 GLU B O   1 
ATOM   978  O  O   B GLU B 1 55 ? 15.260  -3.404  -11.692 0.50 16.48 ? 188 GLU B O   1 
ATOM   979  C  CB  A GLU B 1 55 ? 16.151  -4.735  -8.750  0.50 26.62 ? 188 GLU B CB  1 
ATOM   980  C  CB  B GLU B 1 55 ? 15.717  -4.902  -8.908  0.50 21.48 ? 188 GLU B CB  1 
ATOM   981  C  CG  A GLU B 1 55 ? 15.280  -5.812  -9.326  0.50 27.76 ? 188 GLU B CG  1 
ATOM   982  C  CG  B GLU B 1 55 ? 14.299  -5.335  -9.083  0.50 21.67 ? 188 GLU B CG  1 
ATOM   983  C  CD  A GLU B 1 55 ? 15.587  -7.102  -8.624  0.50 31.22 ? 188 GLU B CD  1 
ATOM   984  C  CD  B GLU B 1 55 ? 14.139  -6.812  -8.692  0.50 24.90 ? 188 GLU B CD  1 
ATOM   985  O  OE1 A GLU B 1 55 ? 16.388  -7.048  -7.651  0.50 32.08 ? 188 GLU B OE1 1 
ATOM   986  O  OE1 B GLU B 1 55 ? 14.991  -7.292  -7.892  0.50 23.35 ? 188 GLU B OE1 1 
ATOM   987  O  OE2 A GLU B 1 55 ? 15.050  -8.148  -9.042  0.50 34.99 ? 188 GLU B OE2 1 
ATOM   988  O  OE2 B GLU B 1 55 ? 13.160  -7.481  -9.141  0.50 27.53 ? 188 GLU B OE2 1 
ATOM   989  N  N   . LYS B 1 56 ? 17.335  -4.182  -11.527 1.00 23.86 ? 189 LYS B N   1 
ATOM   990  C  CA  . LYS B 1 56 ? 17.306  -4.582  -12.943 1.00 28.51 ? 189 LYS B CA  1 
ATOM   991  C  C   . LYS B 1 56 ? 16.161  -5.534  -13.348 1.00 34.26 ? 189 LYS B C   1 
ATOM   992  O  O   . LYS B 1 56 ? 15.990  -6.512  -12.748 1.00 37.39 ? 189 LYS B O   1 
ATOM   993  C  CB  . LYS B 1 56 ? 18.532  -5.356  -13.333 1.00 29.01 ? 189 LYS B CB  1 
ATOM   994  C  CG  . LYS B 1 56 ? 18.584  -5.449  -14.812 1.00 30.89 ? 189 LYS B CG  1 
ATOM   995  C  CD  . LYS B 1 56 ? 19.414  -6.554  -15.360 1.00 32.53 ? 189 LYS B CD  1 
ATOM   996  C  CE  . LYS B 1 56 ? 19.484  -6.335  -16.803 1.00 33.33 ? 189 LYS B CE  1 
ATOM   997  N  NZ  . LYS B 1 56 ? 20.001  -5.002  -17.103 1.00 34.56 ? 189 LYS B NZ  1 
HETATM 998  C  C   . ACE C 2 1  ? -21.664 -13.764 -12.880 1.00 36.14 ? -1  ACE M C   1 
HETATM 999  O  O   . ACE C 2 1  ? -20.785 -14.380 -12.383 1.00 39.02 ? -1  ACE M O   1 
HETATM 1000 C  CH3 . ACE C 2 1  ? -21.311 -12.946 -14.081 1.00 30.83 ? -1  ACE M CH3 1 
ATOM   1001 N  N   . TYR C 2 2  ? -23.072 -13.810 -12.491 1.00 40.12 ? 0   TYR M N   1 
ATOM   1002 C  CA  . TYR C 2 2  ? -24.185 -13.208 -13.260 1.00 39.42 ? 0   TYR M CA  1 
ATOM   1003 C  C   . TYR C 2 2  ? -24.663 -11.819 -12.786 1.00 39.09 ? 0   TYR M C   1 
ATOM   1004 O  O   . TYR C 2 2  ? -24.663 -10.885 -13.588 1.00 41.34 ? 0   TYR M O   1 
ATOM   1005 C  CB  . TYR C 2 2  ? -25.379 -14.176 -13.302 1.00 45.59 ? 0   TYR M CB  1 
ATOM   1006 C  CG  . TYR C 2 2  ? -26.585 -13.598 -14.024 1.00 56.40 ? 0   TYR M CG  1 
ATOM   1007 C  CD1 . TYR C 2 2  ? -26.598 -13.442 -15.429 1.00 62.44 ? 0   TYR M CD1 1 
ATOM   1008 C  CD2 . TYR C 2 2  ? -27.718 -13.194 -13.308 1.00 57.34 ? 0   TYR M CD2 1 
ATOM   1009 C  CE1 . TYR C 2 2  ? -27.710 -12.897 -16.078 1.00 64.46 ? 0   TYR M CE1 1 
ATOM   1010 C  CE2 . TYR C 2 2  ? -28.831 -12.664 -13.951 1.00 63.10 ? 0   TYR M CE2 1 
ATOM   1011 C  CZ  . TYR C 2 2  ? -28.827 -12.517 -15.325 1.00 65.46 ? 0   TYR M CZ  1 
ATOM   1012 O  OH  . TYR C 2 2  ? -29.953 -11.977 -15.906 1.00 72.59 ? 0   TYR M OH  1 
ATOM   1013 N  N   . GLU C 2 3  ? -25.127 -11.663 -11.534 1.00 37.57 ? 1   GLU M N   1 
ATOM   1014 C  CA  . GLU C 2 3  ? -25.506 -10.291 -11.093 1.00 37.00 ? 1   GLU M CA  1 
ATOM   1015 C  C   . GLU C 2 3  ? -24.308 -9.506  -10.559 1.00 29.61 ? 1   GLU M C   1 
ATOM   1016 O  O   . GLU C 2 3  ? -23.494 -9.970  -9.742  1.00 29.11 ? 1   GLU M O   1 
ATOM   1017 C  CB  . GLU C 2 3  ? -26.750 -10.137 -10.177 1.00 44.16 ? 1   GLU M CB  1 
ATOM   1018 C  CG  . GLU C 2 3  ? -27.048 -11.189 -9.120  1.00 50.68 ? 1   GLU M CG  1 
ATOM   1019 C  CD  . GLU C 2 3  ? -28.319 -10.837 -8.333  1.00 46.50 ? 1   GLU M CD  1 
ATOM   1020 O  OE1 . GLU C 2 3  ? -29.374 -11.484 -8.490  1.00 51.06 ? 1   GLU M OE1 1 
ATOM   1021 O  OE2 . GLU C 2 3  ? -28.270 -9.868  -7.579  1.00 51.85 ? 1   GLU M OE2 1 
ATOM   1022 N  N   . LYS C 2 4  ? -24.264 -8.278  -11.025 1.00 26.28 ? 2   LYS M N   1 
ATOM   1023 C  CA  . LYS C 2 4  ? -23.152 -7.395  -10.837 1.00 23.89 ? 2   LYS M CA  1 
ATOM   1024 C  C   . LYS C 2 4  ? -23.209 -6.912  -9.389  1.00 21.74 ? 2   LYS M C   1 
ATOM   1025 O  O   . LYS C 2 4  ? -24.289 -6.558  -8.929  1.00 20.78 ? 2   LYS M O   1 
ATOM   1026 C  CB  . LYS C 2 4  ? -23.378 -6.257  -11.828 1.00 27.25 ? 2   LYS M CB  1 
ATOM   1027 C  CG  . LYS C 2 4  ? -22.151 -5.594  -12.299 1.00 26.96 ? 2   LYS M CG  1 
ATOM   1028 C  CD  . LYS C 2 4  ? -22.337 -5.008  -13.684 1.00 22.46 ? 2   LYS M CD  1 
ATOM   1029 C  CE  . LYS C 2 4  ? -21.196 -4.070  -13.903 1.00 23.80 ? 2   LYS M CE  1 
ATOM   1030 N  NZ  . LYS C 2 4  ? -21.099 -3.573  -15.260 1.00 22.37 ? 2   LYS M NZ  1 
ATOM   1031 N  N   . PRO C 2 5  ? -22.079 -6.917  -8.648  1.00 19.97 ? 3   PRO M N   1 
ATOM   1032 C  CA  . PRO C 2 5  ? -22.047 -6.358  -7.324  1.00 20.33 ? 3   PRO M CA  1 
ATOM   1033 C  C   . PRO C 2 5  ? -22.368 -4.905  -7.338  1.00 19.21 ? 3   PRO M C   1 
ATOM   1034 O  O   . PRO C 2 5  ? -22.310 -4.238  -8.396  1.00 17.64 ? 3   PRO M O   1 
ATOM   1035 C  CB  . PRO C 2 5  ? -20.581 -6.503  -6.914  1.00 21.33 ? 3   PRO M CB  1 
ATOM   1036 C  CG  . PRO C 2 5  ? -20.111 -7.610  -7.685  1.00 21.92 ? 3   PRO M CG  1 
ATOM   1037 C  CD  . PRO C 2 5  ? -20.754 -7.468  -9.014  1.00 22.61 ? 3   PRO M CD  1 
ATOM   1038 N  N   . ALA C 2 6  ? -22.671 -4.404  -6.153  1.00 21.41 ? 4   ALA M N   1 
ATOM   1039 C  CA  . ALA C 2 6  ? -22.905 -2.972  -5.970  1.00 21.97 ? 4   ALA M CA  1 
ATOM   1040 C  C   . ALA C 2 6  ? -21.605 -2.234  -6.314  1.00 21.80 ? 4   ALA M C   1 
ATOM   1041 O  O   . ALA C 2 6  ? -20.532 -2.689  -5.941  1.00 22.55 ? 4   ALA M O   1 
ATOM   1042 C  CB  . ALA C 2 6  ? -23.282 -2.697  -4.528  1.00 21.01 ? 4   ALA M CB  1 
ATOM   1043 N  N   . LEU C 2 7  ? -21.714 -1.135  -7.042  1.00 20.39 ? 5   LEU M N   1 
ATOM   1044 C  CA  . LEU C 2 7  ? -20.577 -0.286  -7.299  1.00 19.79 ? 5   LEU M CA  1 
ATOM   1045 C  C   . LEU C 2 7  ? -20.240 0.442   -5.987  1.00 17.22 ? 5   LEU M C   1 
ATOM   1046 O  O   . LEU C 2 7  ? -21.109 1.137   -5.423  1.00 19.03 ? 5   LEU M O   1 
ATOM   1047 C  CB  . LEU C 2 7  ? -20.961 0.687   -8.387  1.00 22.25 ? 5   LEU M CB  1 
ATOM   1048 C  CG  . LEU C 2 7  ? -19.822 1.458   -9.024  1.00 22.93 ? 5   LEU M CG  1 
ATOM   1049 C  CD1 . LEU C 2 7  ? -18.739 0.567   -9.684  1.00 24.23 ? 5   LEU M CD1 1 
ATOM   1050 C  CD2 . LEU C 2 7  ? -20.392 2.451   -10.031 1.00 23.63 ? 5   LEU M CD2 1 
ATOM   1051 N  N   . PRO C 2 8  ? -19.042 0.256   -5.432  1.00 17.45 ? 6   PRO M N   1 
ATOM   1052 C  CA  . PRO C 2 8  ? -18.832 0.673   -4.053  1.00 17.32 ? 6   PRO M CA  1 
ATOM   1053 C  C   . PRO C 2 8  ? -18.642 2.165   -3.861  1.00 19.49 ? 6   PRO M C   1 
ATOM   1054 O  O   . PRO C 2 8  ? -18.170 2.874   -4.743  1.00 18.52 ? 6   PRO M O   1 
ATOM   1055 C  CB  . PRO C 2 8  ? -17.573 -0.093  -3.625  1.00 17.41 ? 6   PRO M CB  1 
ATOM   1056 C  CG  . PRO C 2 8  ? -16.875 -0.304  -4.881  1.00 17.79 ? 6   PRO M CG  1 
ATOM   1057 C  CD  . PRO C 2 8  ? -17.919 -0.540  -5.931  1.00 17.55 ? 6   PRO M CD  1 
ATOM   1058 N  N   . ARG C 2 9  ? -18.994 2.654   -2.667  1.00 21.88 ? 7   ARG M N   1 
ATOM   1059 C  CA  . ARG C 2 9  ? -18.841 4.049   -2.353  1.00 23.06 ? 7   ARG M CA  1 
ATOM   1060 C  C   . ARG C 2 9  ? -17.375 4.433   -2.316  1.00 22.26 ? 7   ARG M C   1 
ATOM   1061 O  O   . ARG C 2 9  ? -16.518 3.650   -1.852  1.00 23.76 ? 7   ARG M O   1 
ATOM   1062 C  CB  . ARG C 2 9  ? -19.461 4.360   -0.985  1.00 26.85 ? 7   ARG M CB  1 
ATOM   1063 C  CG  . ARG C 2 9  ? -20.974 4.281   -1.071  1.00 33.94 ? 7   ARG M CG  1 
ATOM   1064 C  CD  . ARG C 2 9  ? -21.598 5.536   -1.680  1.00 39.92 ? 7   ARG M CD  1 
ATOM   1065 N  NE  . ARG C 2 9  ? -23.030 5.358   -1.783  1.00 44.55 ? 7   ARG M NE  1 
ATOM   1066 C  CZ  . ARG C 2 9  ? -23.928 5.631   -0.819  1.00 50.30 ? 7   ARG M CZ  1 
ATOM   1067 N  NH1 . ARG C 2 9  ? -23.596 6.174   0.344   1.00 52.43 ? 7   ARG M NH1 1 
ATOM   1068 N  NH2 . ARG C 2 9  ? -25.202 5.355   -1.035  1.00 56.67 ? 7   ARG M NH2 1 
ATOM   1069 N  N   . LYS C 2 10 ? -17.109 5.621   -2.812  1.00 18.74 ? 8   LYS M N   1 
ATOM   1070 C  CA  . LYS C 2 10 ? -15.784 6.218   -2.671  1.00 18.17 ? 8   LYS M CA  1 
ATOM   1071 C  C   . LYS C 2 10 ? -15.672 6.995   -1.370  1.00 20.55 ? 8   LYS M C   1 
ATOM   1072 O  O   . LYS C 2 10 ? -16.667 7.451   -0.791  1.00 24.20 ? 8   LYS M O   1 
ATOM   1073 C  CB  . LYS C 2 10 ? -15.548 7.126   -3.889  1.00 19.26 ? 8   LYS M CB  1 
ATOM   1074 C  CG  . LYS C 2 10 ? -15.261 6.312   -5.124  1.00 17.84 ? 8   LYS M CG  1 
ATOM   1075 C  CD  . LYS C 2 10 ? -14.816 7.188   -6.254  1.00 16.88 ? 8   LYS M CD  1 
ATOM   1076 C  CE  . LYS C 2 10 ? -14.390 6.337   -7.447  1.00 16.51 ? 8   LYS M CE  1 
ATOM   1077 N  NZ  . LYS C 2 10 ? -13.911 7.246   -8.548  1.00 17.81 ? 8   LYS M NZ  1 
ATOM   1078 N  N   . ARG C 2 11 ? -14.448 7.210   -0.908  1.00 22.84 ? 9   ARG M N   1 
ATOM   1079 C  CA  . ARG C 2 11 ? -14.270 8.042   0.311   1.00 24.69 ? 9   ARG M CA  1 
ATOM   1080 C  C   . ARG C 2 11 ? -14.948 9.433   0.192   1.00 24.43 ? 9   ARG M C   1 
ATOM   1081 O  O   . ARG C 2 11 ? -15.522 10.040  1.189   1.00 27.57 ? 9   ARG M O   1 
ATOM   1082 C  CB  . ARG C 2 11 ? -12.779 8.136   0.643   1.00 22.92 ? 9   ARG M CB  1 
ATOM   1083 C  CG  . ARG C 2 11 ? -12.361 9.309   1.533   1.00 23.07 ? 9   ARG M CG  1 
ATOM   1084 C  CD  . ARG C 2 11 ? -10.919 9.077   2.027   1.00 25.72 ? 9   ARG M CD  1 
ATOM   1085 N  NE  . ARG C 2 11 ? -9.963  8.902   0.912   1.00 26.06 ? 9   ARG M NE  1 
ATOM   1086 C  CZ  . ARG C 2 11 ? -9.314  9.873   0.285   1.00 27.17 ? 9   ARG M CZ  1 
ATOM   1087 N  NH1 . ARG C 2 11 ? -9.477  11.144  0.643   1.00 28.50 ? 9   ARG M NH1 1 
ATOM   1088 N  NH2 . ARG C 2 11 ? -8.486  9.574   -0.738  1.00 29.30 ? 9   ARG M NH2 1 
HETATM 1089 N  N   . NH2 C 2 12 ? -14.720 10.156  -1.091  1.00 19.65 ? 10  NH2 M N   1 
HETATM 1090 C  C   . ACE D 2 1  ? 11.894  -7.666  3.992   1.00 21.76 ? -1  ACE N C   1 
HETATM 1091 O  O   . ACE D 2 1  ? 12.270  -8.089  2.897   1.00 19.84 ? -1  ACE N O   1 
HETATM 1092 C  CH3 . ACE D 2 1  ? 11.283  -8.619  4.984   1.00 19.24 ? -1  ACE N CH3 1 
ATOM   1093 N  N   . TYR D 2 2  ? 11.946  -6.262  4.424   1.00 23.55 ? 0   TYR N N   1 
ATOM   1094 C  CA  . TYR D 2 2  ? 12.591  -5.303  3.552   1.00 20.84 ? 0   TYR N CA  1 
ATOM   1095 C  C   . TYR D 2 2  ? 13.278  -4.249  4.391   1.00 20.81 ? 0   TYR N C   1 
ATOM   1096 O  O   . TYR D 2 2  ? 12.909  -4.065  5.547   1.00 18.63 ? 0   TYR N O   1 
ATOM   1097 C  CB  . TYR D 2 2  ? 11.568  -4.630  2.663   1.00 21.75 ? 0   TYR N CB  1 
ATOM   1098 C  CG  . TYR D 2 2  ? 10.504  -3.803  3.361   1.00 22.60 ? 0   TYR N CG  1 
ATOM   1099 C  CD1 . TYR D 2 2  ? 9.301   -4.396  3.784   1.00 24.10 ? 0   TYR N CD1 1 
ATOM   1100 C  CD2 . TYR D 2 2  ? 10.668  -2.421  3.574   1.00 23.81 ? 0   TYR N CD2 1 
ATOM   1101 C  CE1 . TYR D 2 2  ? 8.325   -3.641  4.443   1.00 24.30 ? 0   TYR N CE1 1 
ATOM   1102 C  CE2 . TYR D 2 2  ? 9.692   -1.677  4.208   1.00 24.50 ? 0   TYR N CE2 1 
ATOM   1103 C  CZ  . TYR D 2 2  ? 8.506   -2.280  4.612   1.00 26.23 ? 0   TYR N CZ  1 
ATOM   1104 O  OH  . TYR D 2 2  ? 7.509   -1.539  5.237   1.00 27.36 ? 0   TYR N OH  1 
ATOM   1105 N  N   . GLU D 2 3  ? 14.226  -3.546  3.772   1.00 21.67 ? 1   GLU N N   1 
ATOM   1106 C  CA  . GLU D 2 3  ? 14.857  -2.374  4.353   1.00 21.05 ? 1   GLU N CA  1 
ATOM   1107 C  C   . GLU D 2 3  ? 14.952  -1.303  3.239   1.00 20.36 ? 1   GLU N C   1 
ATOM   1108 O  O   . GLU D 2 3  ? 15.735  -1.447  2.271   1.00 20.81 ? 1   GLU N O   1 
ATOM   1109 C  CB  . GLU D 2 3  ? 16.225  -2.749  4.913   1.00 22.99 ? 1   GLU N CB  1 
ATOM   1110 C  CG  . GLU D 2 3  ? 16.207  -3.793  6.064   1.00 25.56 ? 1   GLU N CG  1 
ATOM   1111 C  CD  . GLU D 2 3  ? 17.589  -4.365  6.456   1.00 31.98 ? 1   GLU N CD  1 
ATOM   1112 O  OE1 . GLU D 2 3  ? 18.483  -4.387  5.589   1.00 38.98 ? 1   GLU N OE1 1 
ATOM   1113 O  OE2 . GLU D 2 3  ? 17.781  -4.788  7.647   1.00 25.94 ? 1   GLU N OE2 1 
ATOM   1114 N  N   . LYS D 2 4  ? 14.107  -0.285  3.346   1.00 22.21 ? 2   LYS N N   1 
ATOM   1115 C  CA  . LYS D 2 4  ? 13.963  0.729   2.301   1.00 19.27 ? 2   LYS N CA  1 
ATOM   1116 C  C   . LYS D 2 4  ? 15.058  1.727   2.544   1.00 17.95 ? 2   LYS N C   1 
ATOM   1117 O  O   . LYS D 2 4  ? 15.125  2.281   3.654   1.00 20.92 ? 2   LYS N O   1 
ATOM   1118 C  CB  . LYS D 2 4  ? 12.619  1.394   2.375   1.00 17.82 ? 2   LYS N CB  1 
ATOM   1119 C  CG  . LYS D 2 4  ? 12.345  2.364   1.287   1.00 18.20 ? 2   LYS N CG  1 
ATOM   1120 C  CD  . LYS D 2 4  ? 10.885  2.846   1.261   1.00 19.54 ? 2   LYS N CD  1 
ATOM   1121 C  CE  . LYS D 2 4  ? 10.688  3.923   0.185   1.00 21.36 ? 2   LYS N CE  1 
ATOM   1122 N  NZ  . LYS D 2 4  ? 9.298   4.460   0.198   1.00 23.77 ? 2   LYS N NZ  1 
ATOM   1123 N  N   . PRO D 2 5  ? 15.929  1.941   1.554   1.00 18.58 ? 3   PRO N N   1 
ATOM   1124 C  CA  . PRO D 2 5  ? 17.062  2.841   1.733   1.00 17.46 ? 3   PRO N CA  1 
ATOM   1125 C  C   . PRO D 2 5  ? 16.645  4.277   1.869   1.00 18.45 ? 3   PRO N C   1 
ATOM   1126 O  O   . PRO D 2 5  ? 15.583  4.638   1.417   1.00 17.74 ? 3   PRO N O   1 
ATOM   1127 C  CB  . PRO D 2 5  ? 17.852  2.709   0.432   1.00 17.48 ? 3   PRO N CB  1 
ATOM   1128 C  CG  . PRO D 2 5  ? 17.222  1.571   -0.335  1.00 18.25 ? 3   PRO N CG  1 
ATOM   1129 C  CD  . PRO D 2 5  ? 15.907  1.261   0.253   1.00 16.80 ? 3   PRO N CD  1 
ATOM   1130 N  N   . ALA D 2 6  ? 17.508  5.090   2.449   1.00 18.37 ? 4   ALA N N   1 
ATOM   1131 C  CA  . ALA D 2 6  ? 17.340  6.543   2.295   1.00 20.27 ? 4   ALA N CA  1 
ATOM   1132 C  C   . ALA D 2 6  ? 17.464  6.960   0.816   1.00 20.05 ? 4   ALA N C   1 
ATOM   1133 O  O   . ALA D 2 6  ? 18.282  6.438   0.029   1.00 20.85 ? 4   ALA N O   1 
ATOM   1134 C  CB  . ALA D 2 6  ? 18.400  7.267   3.138   1.00 22.56 ? 4   ALA N CB  1 
ATOM   1135 N  N   . LEU D 2 7  ? 16.708  7.951   0.459   1.00 20.27 ? 5   LEU N N   1 
ATOM   1136 C  CA  . LEU D 2 7  ? 16.809  8.433   -0.878  1.00 20.60 ? 5   LEU N CA  1 
ATOM   1137 C  C   . LEU D 2 7  ? 18.225  8.944   -1.012  1.00 19.36 ? 5   LEU N C   1 
ATOM   1138 O  O   . LEU D 2 7  ? 18.740  9.503   -0.130  1.00 20.51 ? 5   LEU N O   1 
ATOM   1139 C  CB  . LEU D 2 7  ? 15.839  9.586   -1.084  1.00 22.52 ? 5   LEU N CB  1 
ATOM   1140 C  CG  . LEU D 2 7  ? 14.896  9.784   -2.247  1.00 24.48 ? 5   LEU N CG  1 
ATOM   1141 C  CD1 . LEU D 2 7  ? 14.347  8.540   -2.883  1.00 21.76 ? 5   LEU N CD1 1 
ATOM   1142 C  CD2 . LEU D 2 7  ? 13.814  10.735  -1.843  1.00 25.48 ? 5   LEU N CD2 1 
ATOM   1143 N  N   . PRO D 2 8  ? 18.838  8.752   -2.182  1.00 17.37 ? 6   PRO N N   1 
ATOM   1144 C  CA  . PRO D 2 8  ? 20.201  9.222   -2.401  1.00 17.50 ? 6   PRO N CA  1 
ATOM   1145 C  C   . PRO D 2 8  ? 20.296  10.743  -2.631  1.00 18.46 ? 6   PRO N C   1 
ATOM   1146 O  O   . PRO D 2 8  ? 19.397  11.318  -3.130  1.00 18.87 ? 6   PRO N O   1 
ATOM   1147 C  CB  . PRO D 2 8  ? 20.610  8.504   -3.680  1.00 21.06 ? 6   PRO N CB  1 
ATOM   1148 C  CG  . PRO D 2 8  ? 19.334  8.310   -4.389  1.00 18.76 ? 6   PRO N CG  1 
ATOM   1149 C  CD  . PRO D 2 8  ? 18.347  7.986   -3.323  1.00 17.61 ? 6   PRO N CD  1 
ATOM   1150 N  N   . ARG D 2 9  ? 21.411  11.349  -2.251  1.00 17.97 ? 7   ARG N N   1 
ATOM   1151 C  CA  . ARG D 2 9  ? 21.578  12.747  -2.430  1.00 22.14 ? 7   ARG N CA  1 
ATOM   1152 C  C   . ARG D 2 9  ? 21.564  13.010  -3.916  1.00 20.26 ? 7   ARG N C   1 
ATOM   1153 O  O   . ARG D 2 9  ? 21.919  12.174  -4.678  1.00 23.52 ? 7   ARG N O   1 
ATOM   1154 C  CB  . ARG D 2 9  ? 22.918  13.242  -1.848  1.00 28.74 ? 7   ARG N CB  1 
ATOM   1155 C  CG  . ARG D 2 9  ? 23.290  12.721  -0.486  1.00 39.49 ? 7   ARG N CG  1 
ATOM   1156 C  CD  . ARG D 2 9  ? 24.413  13.521  0.228   1.00 49.12 ? 7   ARG N CD  1 
ATOM   1157 N  NE  . ARG D 2 9  ? 24.146  14.937  0.131   1.00 57.63 ? 7   ARG N NE  1 
ATOM   1158 C  CZ  . ARG D 2 9  ? 23.908  15.753  1.154   1.00 62.67 ? 7   ARG N CZ  1 
ATOM   1159 N  NH1 . ARG D 2 9  ? 23.968  15.340  2.435   1.00 68.75 ? 7   ARG N NH1 1 
ATOM   1160 N  NH2 . ARG D 2 9  ? 23.632  17.000  0.862   1.00 63.55 ? 7   ARG N NH2 1 
ATOM   1161 N  N   . LYS D 2 10 ? 21.163  14.192  -4.302  1.00 21.24 ? 8   LYS N N   1 
ATOM   1162 C  CA  . LYS D 2 10 ? 21.174  14.569  -5.685  1.00 20.52 ? 8   LYS N CA  1 
ATOM   1163 C  C   . LYS D 2 10 ? 22.441  15.398  -5.988  1.00 26.80 ? 8   LYS N C   1 
ATOM   1164 O  O   . LYS D 2 10 ? 22.744  16.293  -5.267  1.00 28.40 ? 8   LYS N O   1 
ATOM   1165 C  CB  . LYS D 2 10 ? 19.938  15.392  -5.995  1.00 20.82 ? 8   LYS N CB  1 
ATOM   1166 C  CG  . LYS D 2 10 ? 18.667  14.587  -6.083  1.00 20.00 ? 8   LYS N CG  1 
ATOM   1167 C  CD  . LYS D 2 10 ? 17.481  15.456  -6.394  1.00 20.40 ? 8   LYS N CD  1 
ATOM   1168 C  CE  . LYS D 2 10 ? 16.167  14.748  -6.242  1.00 21.40 ? 8   LYS N CE  1 
ATOM   1169 N  NZ  . LYS D 2 10 ? 15.057  15.615  -6.589  1.00 20.66 ? 8   LYS N NZ  1 
ATOM   1170 N  N   . ARG D 2 11 ? 23.160  15.089  -7.057  1.00 25.85 ? 9   ARG N N   1 
ATOM   1171 C  CA  . ARG D 2 11 ? 24.342  15.851  -7.404  1.00 26.29 ? 9   ARG N CA  1 
ATOM   1172 C  C   . ARG D 2 11 ? 23.975  17.181  -8.002  1.00 28.53 ? 9   ARG N C   1 
ATOM   1173 O  O   . ARG D 2 11 ? 24.819  17.995  -8.040  1.00 29.22 ? 9   ARG N O   1 
ATOM   1174 C  CB  . ARG D 2 11 ? 25.289  15.112  -8.353  1.00 25.61 ? 9   ARG N CB  1 
ATOM   1175 C  CG  . ARG D 2 11 ? 25.878  13.838  -7.811  1.00 25.79 ? 9   ARG N CG  1 
ATOM   1176 C  CD  . ARG D 2 11 ? 27.071  13.358  -8.620  1.00 27.38 ? 9   ARG N CD  1 
ATOM   1177 N  NE  . ARG D 2 11 ? 28.313  13.981  -8.216  1.00 27.91 ? 9   ARG N NE  1 
ATOM   1178 C  CZ  . ARG D 2 11 ? 29.423  13.954  -8.923  1.00 29.28 ? 9   ARG N CZ  1 
ATOM   1179 N  NH1 . ARG D 2 11 ? 29.455  13.351  -10.091 1.00 27.29 ? 9   ARG N NH1 1 
ATOM   1180 N  NH2 . ARG D 2 11 ? 30.511  14.515  -8.445  1.00 28.91 ? 9   ARG N NH2 1 
HETATM 1181 N  N   . NH2 D 2 12 ? 22.919  17.481  -8.688  1.00 27.03 ? 10  NH2 N N   1 
HETATM 1182 C  C1  . PEG E 3 .  ? 1.705   -4.335  -16.332 1.00 34.03 ? 201 PEG A C1  1 
HETATM 1183 O  O1  . PEG E 3 .  ? 2.329   -4.822  -17.532 1.00 35.50 ? 201 PEG A O1  1 
HETATM 1184 C  C2  . PEG E 3 .  ? 0.282   -4.332  -16.657 1.00 31.12 ? 201 PEG A C2  1 
HETATM 1185 O  O2  . PEG E 3 .  ? -0.061  -5.663  -16.901 1.00 28.18 ? 201 PEG A O2  1 
HETATM 1186 C  C3  . PEG E 3 .  ? -1.437  -5.913  -17.215 1.00 26.22 ? 201 PEG A C3  1 
HETATM 1187 C  C4  . PEG E 3 .  ? -1.537  -7.364  -17.576 1.00 25.36 ? 201 PEG A C4  1 
HETATM 1188 O  O4  . PEG E 3 .  ? -1.340  -7.646  -18.987 1.00 27.17 ? 201 PEG A O4  1 
HETATM 1189 NA NA  . NA  F 4 .  ? -6.006  7.638   -15.393 1.00 28.51 ? 202 NA  A NA  1 
HETATM 1190 NA NA  . NA  G 4 .  ? 1.236   -12.302 -7.457  1.00 29.28 ? 203 NA  A NA  1 
HETATM 1191 NA NA  . NA  H 4 .  ? -18.767 -0.551  -19.664 1.00 15.87 ? 204 NA  A NA  1 
HETATM 1192 C  C8  . P4G I 5 .  ? 7.276   2.329   -22.803 1.00 31.23 ? 201 P4G B C8  1 
HETATM 1193 C  C7  . P4G I 5 .  ? 8.008   2.170   -21.459 1.00 31.88 ? 201 P4G B C7  1 
HETATM 1194 O  O4  . P4G I 5 .  ? 7.145   1.882   -20.439 0.50 24.59 ? 201 P4G B O4  1 
HETATM 1195 C  C6  . P4G I 5 .  ? 7.389   0.845   -19.593 0.50 24.38 ? 201 P4G B C6  1 
HETATM 1196 C  C5  . P4G I 5 .  ? 6.039   0.247   -19.434 0.50 24.05 ? 201 P4G B C5  1 
HETATM 1197 O  O3  . P4G I 5 .  ? 6.096   -0.937  -18.827 0.50 28.62 ? 201 P4G B O3  1 
HETATM 1198 C  C4  . P4G I 5 .  ? 5.346   -1.838  -19.584 0.50 26.13 ? 201 P4G B C4  1 
HETATM 1199 C  C3  . P4G I 5 .  ? 3.850   -1.554  -19.658 0.50 25.10 ? 201 P4G B C3  1 
HETATM 1200 O  O2  . P4G I 5 .  ? 3.367   -1.645  -20.949 0.50 24.86 ? 201 P4G B O2  1 
HETATM 1201 NA NA  . NA  J 4 .  ? 7.222   14.646  -9.682  1.00 18.69 ? 202 NA  B NA  1 
HETATM 1202 O  O3  . P4G K 5 .  ? 7.560   2.053   0.184   0.75 17.91 ? 101 P4G N O3  1 
HETATM 1203 C  C4  . P4G K 5 .  ? 7.783   0.853   0.175   0.75 17.76 ? 101 P4G N C4  1 
HETATM 1204 C  C3  . P4G K 5 .  ? 6.863   0.076   -0.680  0.75 23.38 ? 101 P4G N C3  1 
HETATM 1205 O  O2  . P4G K 5 .  ? 6.569   -1.171  -0.066  0.75 30.34 ? 101 P4G N O2  1 
HETATM 1206 C  C2  . P4G K 5 .  ? 7.601   -1.981  0.290   0.75 29.09 ? 101 P4G N C2  1 
HETATM 1207 C  C1  . P4G K 5 .  ? 8.059   -1.699  1.663   0.75 27.33 ? 101 P4G N C1  1 
HETATM 1208 O  O   . HOH L 6 .  ? -5.077  -8.989  -5.251  1.00 31.76 ? 301 HOH A O   1 
HETATM 1209 O  O   . HOH L 6 .  ? -3.104  -1.216  -27.228 1.00 23.12 ? 302 HOH A O   1 
HETATM 1210 O  O   . HOH L 6 .  ? -2.778  5.751   -4.553  1.00 27.04 ? 303 HOH A O   1 
HETATM 1211 O  O   . HOH L 6 .  ? -9.217  11.653  -17.625 1.00 30.02 ? 304 HOH A O   1 
HETATM 1212 O  O   . HOH L 6 .  ? -6.282  -21.596 -13.100 1.00 29.40 ? 305 HOH A O   1 
HETATM 1213 O  O   . HOH L 6 .  ? 5.033   -8.263  -13.420 1.00 30.42 ? 306 HOH A O   1 
HETATM 1214 O  O   . HOH L 6 .  ? -3.279  -13.802 -7.860  1.00 34.12 ? 307 HOH A O   1 
HETATM 1215 O  O   . HOH L 6 .  ? -16.786 -9.469  -6.052  1.00 27.77 ? 308 HOH A O   1 
HETATM 1216 O  O   . HOH L 6 .  ? -8.270  7.266   -15.985 1.00 30.06 ? 309 HOH A O   1 
HETATM 1217 O  O   . HOH L 6 .  ? -21.428 -0.649  -12.925 1.00 22.72 ? 310 HOH A O   1 
HETATM 1218 O  O   . HOH L 6 .  ? -4.510  -10.992 -0.818  1.00 32.92 ? 311 HOH A O   1 
HETATM 1219 O  O   . HOH L 6 .  ? 0.617   0.164   -1.880  1.00 30.67 ? 312 HOH A O   1 
HETATM 1220 O  O   . HOH L 6 .  ? -11.703 -4.913  -0.734  1.00 34.38 ? 313 HOH A O   1 
HETATM 1221 O  O   . HOH L 6 .  ? -15.436 6.309   -19.193 1.00 27.75 ? 314 HOH A O   1 
HETATM 1222 O  O   . HOH L 6 .  ? -6.779  0.891   -27.122 1.00 46.63 ? 315 HOH A O   1 
HETATM 1223 O  O   . HOH L 6 .  ? -19.065 -3.565  -22.655 1.00 25.64 ? 316 HOH A O   1 
HETATM 1224 O  O   . HOH L 6 .  ? -7.475  7.429   -3.361  1.00 22.18 ? 317 HOH A O   1 
HETATM 1225 O  O   . HOH L 6 .  ? -1.631  4.609   -0.554  1.00 32.90 ? 318 HOH A O   1 
HETATM 1226 O  O   . HOH L 6 .  ? -8.536  -1.442  -19.010 1.00 19.83 ? 319 HOH A O   1 
HETATM 1227 O  O   . HOH L 6 .  ? -7.700  8.063   -6.014  1.00 25.32 ? 320 HOH A O   1 
HETATM 1228 O  O   . HOH L 6 .  ? 1.300   -6.683  -19.232 1.00 25.26 ? 321 HOH A O   1 
HETATM 1229 O  O   . HOH L 6 .  ? -12.107 -17.787 -10.562 1.00 18.33 ? 322 HOH A O   1 
HETATM 1230 O  O   . HOH L 6 .  ? -9.124  -13.439 -18.988 1.00 25.75 ? 323 HOH A O   1 
HETATM 1231 O  O   . HOH L 6 .  ? 1.671   -5.227  -8.476  1.00 18.84 ? 324 HOH A O   1 
HETATM 1232 O  O   . HOH L 6 .  ? -16.864 0.597   -24.010 1.00 33.60 ? 325 HOH A O   1 
HETATM 1233 O  O   . HOH L 6 .  ? 0.404   -8.989  -20.650 1.00 30.22 ? 326 HOH A O   1 
HETATM 1234 O  O   . HOH L 6 .  ? 4.427   -5.849  -19.015 1.00 46.00 ? 327 HOH A O   1 
HETATM 1235 O  O   . HOH L 6 .  ? -14.046 13.175  -12.696 1.00 17.66 ? 328 HOH A O   1 
HETATM 1236 O  O   . HOH L 6 .  ? -19.819 -11.644 -15.788 1.00 35.33 ? 329 HOH A O   1 
HETATM 1237 O  O   . HOH L 6 .  ? 0.223   -3.588  -5.136  1.00 28.87 ? 330 HOH A O   1 
HETATM 1238 O  O   . HOH L 6 .  ? -18.324 9.959   -16.834 1.00 25.41 ? 331 HOH A O   1 
HETATM 1239 O  O   . HOH L 6 .  ? -5.944  -7.284  -0.247  1.00 30.54 ? 332 HOH A O   1 
HETATM 1240 O  O   . HOH L 6 .  ? 4.324   -1.197  -15.371 1.00 11.94 ? 333 HOH A O   1 
HETATM 1241 O  O   . HOH L 6 .  ? -17.559 -1.353  2.372   1.00 23.53 ? 334 HOH A O   1 
HETATM 1242 O  O   . HOH L 6 .  ? -13.615 -13.044 -15.800 1.00 22.48 ? 335 HOH A O   1 
HETATM 1243 O  O   . HOH L 6 .  ? -17.887 -13.177 -14.192 1.00 33.96 ? 336 HOH A O   1 
HETATM 1244 O  O   . HOH L 6 .  ? -15.034 -0.411  2.791   1.00 25.48 ? 337 HOH A O   1 
HETATM 1245 O  O   . HOH L 6 .  ? -5.611  -5.379  -19.272 1.00 15.79 ? 338 HOH A O   1 
HETATM 1246 O  O   . HOH L 6 .  ? -17.654 -7.709  -21.856 1.00 37.80 ? 339 HOH A O   1 
HETATM 1247 O  O   . HOH L 6 .  ? 5.351   5.012   -12.379 1.00 19.41 ? 340 HOH A O   1 
HETATM 1248 O  O   . HOH L 6 .  ? -5.947  -21.895 -10.286 1.00 38.06 ? 341 HOH A O   1 
HETATM 1249 O  O   . HOH L 6 .  ? -19.556 -3.193  -1.793  1.00 39.82 ? 342 HOH A O   1 
HETATM 1250 O  O   . HOH L 6 .  ? -0.214  6.474   -8.744  1.00 26.78 ? 343 HOH A O   1 
HETATM 1251 O  O   . HOH L 6 .  ? 0.361   7.140   -12.388 1.00 31.32 ? 344 HOH A O   1 
HETATM 1252 O  O   . HOH L 6 .  ? -13.312 1.874   -0.103  1.00 27.33 ? 345 HOH A O   1 
HETATM 1253 O  O   . HOH L 6 .  ? 0.491   -3.480  -24.850 1.00 30.52 ? 346 HOH A O   1 
HETATM 1254 O  O   . HOH L 6 .  ? -9.720  0.950   -20.791 1.00 25.04 ? 347 HOH A O   1 
HETATM 1255 O  O   . HOH L 6 .  ? -17.490 12.344  -12.539 1.00 27.15 ? 348 HOH A O   1 
HETATM 1256 O  O   . HOH L 6 .  ? -12.193 7.385   -16.528 1.00 22.42 ? 349 HOH A O   1 
HETATM 1257 O  O   . HOH L 6 .  ? -10.464 -12.765 -5.240  1.00 20.23 ? 350 HOH A O   1 
HETATM 1258 O  O   . HOH L 6 .  ? -1.330  -12.083 -8.472  1.00 24.83 ? 351 HOH A O   1 
HETATM 1259 O  O   . HOH L 6 .  ? 0.723   0.595   -24.855 1.00 36.77 ? 352 HOH A O   1 
HETATM 1260 O  O   . HOH L 6 .  ? -15.309 -0.092  -20.348 1.00 18.86 ? 353 HOH A O   1 
HETATM 1261 O  O   . HOH L 6 .  ? 6.528   -6.840  -8.248  1.00 28.61 ? 354 HOH A O   1 
HETATM 1262 O  O   . HOH L 6 .  ? -1.282  0.037   -0.570  1.00 31.75 ? 355 HOH A O   1 
HETATM 1263 O  O   . HOH L 6 .  ? -7.446  -15.501 -17.510 1.00 20.52 ? 356 HOH A O   1 
HETATM 1264 O  O   . HOH L 6 .  ? -11.656 2.712   2.791   1.00 14.17 ? 357 HOH A O   1 
HETATM 1265 O  O   . HOH L 6 .  ? 1.865   -8.436  -17.065 1.00 37.76 ? 358 HOH A O   1 
HETATM 1266 O  O   . HOH L 6 .  ? 2.712   6.801   -8.651  1.00 10.83 ? 359 HOH A O   1 
HETATM 1267 O  O   . HOH L 6 .  ? -21.240 -2.706  -20.562 1.00 44.18 ? 360 HOH A O   1 
HETATM 1268 O  O   . HOH L 6 .  ? -15.724 2.400   -21.305 1.00 26.32 ? 361 HOH A O   1 
HETATM 1269 O  O   . HOH L 6 .  ? 0.218   -11.473 -5.282  1.00 35.57 ? 362 HOH A O   1 
HETATM 1270 O  O   . HOH L 6 .  ? -2.015  2.544   0.551   1.00 43.72 ? 363 HOH A O   1 
HETATM 1271 O  O   . HOH L 6 .  ? -10.299 8.705   -17.886 1.00 39.23 ? 364 HOH A O   1 
HETATM 1272 O  O   . HOH L 6 .  ? 3.108   -12.872 -6.156  1.00 33.16 ? 365 HOH A O   1 
HETATM 1273 O  O   . HOH L 6 .  ? -15.628 -15.389 -21.007 1.00 41.50 ? 366 HOH A O   1 
HETATM 1274 O  O   . HOH L 6 .  ? -14.272 -13.036 -20.765 1.00 23.85 ? 367 HOH A O   1 
HETATM 1275 O  O   . HOH L 6 .  ? -15.460 -14.670 -14.663 1.00 25.14 ? 368 HOH A O   1 
HETATM 1276 O  O   . HOH L 6 .  ? -0.952  -4.367  -0.680  1.00 42.22 ? 369 HOH A O   1 
HETATM 1277 O  O   . HOH L 6 .  ? -0.528  -2.140  -3.193  1.00 28.67 ? 370 HOH A O   1 
HETATM 1278 O  O   . HOH L 6 .  ? -19.287 -9.214  -20.040 1.00 41.64 ? 371 HOH A O   1 
HETATM 1279 O  O   . HOH L 6 .  ? -22.087 -4.301  -23.101 1.00 45.10 ? 372 HOH A O   1 
HETATM 1280 O  O   . HOH L 6 .  ? 1.450   -10.613 -18.369 1.00 44.45 ? 373 HOH A O   1 
HETATM 1281 O  O   . HOH L 6 .  ? -1.543  -9.006  -0.238  1.00 38.95 ? 374 HOH A O   1 
HETATM 1282 O  O   . HOH L 6 .  ? -0.824  -12.286 -17.776 1.00 51.40 ? 375 HOH A O   1 
HETATM 1283 O  O   . HOH L 6 .  ? -5.213  8.934   -6.222  1.00 32.97 ? 376 HOH A O   1 
HETATM 1284 O  O   . HOH L 6 .  ? -2.660  -15.716 -5.918  1.00 39.11 ? 377 HOH A O   1 
HETATM 1285 O  O   . HOH L 6 .  ? -8.202  5.885   -19.085 1.00 23.98 ? 378 HOH A O   1 
HETATM 1286 O  O   . HOH L 6 .  ? 0.224   -13.808 -11.382 1.00 39.48 ? 379 HOH A O   1 
HETATM 1287 O  O   . HOH L 6 .  ? -20.966 -9.889  -17.727 1.00 42.17 ? 380 HOH A O   1 
HETATM 1288 O  O   . HOH L 6 .  ? 0.553   -14.573 -7.108  1.00 32.00 ? 381 HOH A O   1 
HETATM 1289 O  O   . HOH L 6 .  ? -10.310 5.238   -20.972 1.00 46.49 ? 382 HOH A O   1 
HETATM 1290 O  O   . HOH L 6 .  ? -13.116 2.392   -22.796 1.00 40.65 ? 383 HOH A O   1 
HETATM 1291 O  O   . HOH M 6 .  ? 19.067  -1.251  -15.404 1.00 30.00 ? 301 HOH B O   1 
HETATM 1292 O  O   . HOH M 6 .  ? 23.191  12.886  -19.491 1.00 45.26 ? 302 HOH B O   1 
HETATM 1293 O  O   . HOH M 6 .  ? 15.249  6.539   -23.814 1.00 21.95 ? 303 HOH B O   1 
HETATM 1294 O  O   . HOH M 6 .  ? 9.202   15.208  -15.568 1.00 31.35 ? 304 HOH B O   1 
HETATM 1295 O  O   . HOH M 6 .  ? 18.861  5.728   -23.556 1.00 23.66 ? 305 HOH B O   1 
HETATM 1296 O  O   . HOH M 6 .  ? 20.494  15.390  -9.594  1.00 21.77 ? 306 HOH B O   1 
HETATM 1297 O  O   . HOH M 6 .  ? 2.570   -1.608  -5.206  1.00 20.68 ? 307 HOH B O   1 
HETATM 1298 O  O   . HOH M 6 .  ? 12.167  14.803  -21.501 1.00 28.44 ? 308 HOH B O   1 
HETATM 1299 O  O   . HOH M 6 .  ? 4.288   8.188   -12.268 1.00 35.57 ? 309 HOH B O   1 
HETATM 1300 O  O   . HOH M 6 .  ? 2.850   -0.780  -8.893  1.00 20.36 ? 310 HOH B O   1 
HETATM 1301 O  O   . HOH M 6 .  ? 2.573   0.174   -3.116  1.00 35.08 ? 311 HOH B O   1 
HETATM 1302 O  O   . HOH M 6 .  ? 17.881  -3.373  -15.964 1.00 30.00 ? 312 HOH B O   1 
HETATM 1303 O  O   . HOH M 6 .  ? -0.279  3.762   -21.399 1.00 24.89 ? 313 HOH B O   1 
HETATM 1304 O  O   . HOH M 6 .  ? 22.038  -0.423  -20.558 1.00 38.61 ? 314 HOH B O   1 
HETATM 1305 O  O   . HOH M 6 .  ? 6.033   -6.074  -11.432 1.00 28.46 ? 315 HOH B O   1 
HETATM 1306 O  O   . HOH M 6 .  ? 5.237   1.795   -15.376 1.00 19.02 ? 316 HOH B O   1 
HETATM 1307 O  O   . HOH M 6 .  ? 7.830   13.766  -13.827 1.00 36.15 ? 317 HOH B O   1 
HETATM 1308 O  O   . HOH M 6 .  ? 15.730  13.694  -21.056 1.00 25.27 ? 318 HOH B O   1 
HETATM 1309 O  O   . HOH M 6 .  ? 5.649   16.101  -8.737  1.00 25.91 ? 319 HOH B O   1 
HETATM 1310 O  O   . HOH M 6 .  ? 18.557  -2.162  -5.954  1.00 40.85 ? 320 HOH B O   1 
HETATM 1311 O  O   . HOH M 6 .  ? 1.571   4.022   -1.806  1.00 27.19 ? 321 HOH B O   1 
HETATM 1312 O  O   . HOH M 6 .  ? 0.076   8.126   -4.180  1.00 38.26 ? 322 HOH B O   1 
HETATM 1313 O  O   . HOH M 6 .  ? 9.711   0.679   -24.614 1.00 37.49 ? 323 HOH B O   1 
HETATM 1314 O  O   . HOH M 6 .  ? 5.952   14.262  -11.448 1.00 30.00 ? 324 HOH B O   1 
HETATM 1315 O  O   . HOH M 6 .  ? 8.842   6.361   -25.305 1.00 7.42  ? 325 HOH B O   1 
HETATM 1316 O  O   . HOH M 6 .  ? 3.370   1.819   -22.335 1.00 39.03 ? 326 HOH B O   1 
HETATM 1317 O  O   . HOH M 6 .  ? 26.836  5.453   -6.035  1.00 29.12 ? 327 HOH B O   1 
HETATM 1318 O  O   . HOH M 6 .  ? 9.020   -5.293  -6.688  1.00 27.86 ? 328 HOH B O   1 
HETATM 1319 O  O   . HOH M 6 .  ? 15.649  2.079   -22.652 1.00 19.80 ? 329 HOH B O   1 
HETATM 1320 O  O   . HOH M 6 .  ? 5.857   -7.582  -0.902  1.00 46.54 ? 330 HOH B O   1 
HETATM 1321 O  O   . HOH M 6 .  ? 19.351  13.336  -18.076 1.00 32.50 ? 331 HOH B O   1 
HETATM 1322 O  O   . HOH M 6 .  ? 4.560   18.512  -5.691  1.00 35.78 ? 332 HOH B O   1 
HETATM 1323 O  O   . HOH M 6 .  ? 13.650  6.650   2.397   1.00 40.18 ? 333 HOH B O   1 
HETATM 1324 O  O   . HOH M 6 .  ? 13.053  15.321  -15.299 1.00 29.98 ? 334 HOH B O   1 
HETATM 1325 O  O   . HOH M 6 .  ? -3.510  8.177   -14.949 1.00 33.44 ? 335 HOH B O   1 
HETATM 1326 O  O   . HOH M 6 .  ? 19.188  3.655   -21.382 1.00 31.75 ? 336 HOH B O   1 
HETATM 1327 O  O   . HOH M 6 .  ? 5.358   0.210   -22.052 1.00 32.38 ? 337 HOH B O   1 
HETATM 1328 O  O   . HOH M 6 .  ? 4.012   7.489   -5.981  1.00 22.01 ? 338 HOH B O   1 
HETATM 1329 O  O   . HOH M 6 .  ? 24.339  10.061  -7.630  1.00 18.86 ? 339 HOH B O   1 
HETATM 1330 O  O   . HOH M 6 .  ? 26.128  14.415  -16.119 1.00 55.86 ? 340 HOH B O   1 
HETATM 1331 O  O   . HOH M 6 .  ? 3.767   13.346  -7.184  1.00 33.09 ? 341 HOH B O   1 
HETATM 1332 O  O   . HOH M 6 .  ? 2.101   16.606  -9.711  1.00 26.57 ? 342 HOH B O   1 
HETATM 1333 O  O   . HOH M 6 .  ? 12.452  14.194  -17.840 1.00 29.02 ? 343 HOH B O   1 
HETATM 1334 O  O   . HOH M 6 .  ? 23.613  1.531   -19.496 1.00 25.83 ? 344 HOH B O   1 
HETATM 1335 O  O   . HOH M 6 .  ? 18.053  13.922  -9.652  1.00 30.00 ? 345 HOH B O   1 
HETATM 1336 O  O   . HOH M 6 .  ? 8.634   7.766   -0.783  1.00 19.33 ? 346 HOH B O   1 
HETATM 1337 O  O   . HOH M 6 .  ? 16.029  -4.728  -19.366 1.00 25.80 ? 347 HOH B O   1 
HETATM 1338 O  O   . HOH M 6 .  ? 4.442   7.159   -2.442  1.00 13.23 ? 348 HOH B O   1 
HETATM 1339 O  O   . HOH M 6 .  ? 3.670   -5.020  -6.413  1.00 26.88 ? 349 HOH B O   1 
HETATM 1340 O  O   . HOH M 6 .  ? 3.123   16.108  -8.067  1.00 80.28 ? 350 HOH B O   1 
HETATM 1341 O  O   . HOH M 6 .  ? 2.088   12.505  -1.334  1.00 23.47 ? 351 HOH B O   1 
HETATM 1342 O  O   . HOH M 6 .  ? 2.614   9.833   -5.874  1.00 37.44 ? 352 HOH B O   1 
HETATM 1343 O  O   . HOH M 6 .  ? 3.251   10.416  -3.170  1.00 35.75 ? 353 HOH B O   1 
HETATM 1344 O  O   . HOH M 6 .  ? 16.201  0.751   -27.136 1.00 29.06 ? 354 HOH B O   1 
HETATM 1345 O  O   . HOH M 6 .  ? 7.726   -4.110  -23.398 1.00 57.57 ? 355 HOH B O   1 
HETATM 1346 O  O   . HOH M 6 .  ? -2.010  6.130   -20.780 1.00 30.52 ? 356 HOH B O   1 
HETATM 1347 O  O   . HOH M 6 .  ? 21.571  4.980   -20.480 1.00 37.14 ? 357 HOH B O   1 
HETATM 1348 O  O   . HOH M 6 .  ? 13.477  -8.181  -3.872  1.00 36.34 ? 358 HOH B O   1 
HETATM 1349 O  O   . HOH M 6 .  ? 7.668   -4.666  -20.626 1.00 51.05 ? 359 HOH B O   1 
HETATM 1350 O  O   . HOH M 6 .  ? 0.594   5.271   -24.362 1.00 39.73 ? 360 HOH B O   1 
HETATM 1351 O  O   . HOH M 6 .  ? 23.765  15.572  -17.306 1.00 37.53 ? 361 HOH B O   1 
HETATM 1352 O  O   . HOH N 6 .  ? -26.479 -10.562 -6.013  1.00 44.18 ? 101 HOH M O   1 
HETATM 1353 O  O   . HOH N 6 .  ? -16.183 1.817   -0.033  1.00 26.61 ? 102 HOH M O   1 
HETATM 1354 O  O   . HOH N 6 .  ? -30.936 -9.785  -17.035 1.00 52.90 ? 103 HOH M O   1 
HETATM 1355 O  O   . HOH N 6 .  ? -23.666 1.886   -5.808  1.00 24.22 ? 104 HOH M O   1 
HETATM 1356 O  O   . HOH N 6 .  ? -25.830 -7.193  -6.749  1.00 33.03 ? 105 HOH M O   1 
HETATM 1357 O  O   . HOH N 6 .  ? -25.773 -4.224  -9.230  1.00 32.46 ? 106 HOH M O   1 
HETATM 1358 O  O   . HOH N 6 .  ? -20.058 -4.633  -3.936  1.00 29.62 ? 107 HOH M O   1 
HETATM 1359 O  O   . HOH N 6 .  ? -23.797 -2.389  -10.069 1.00 31.95 ? 108 HOH M O   1 
HETATM 1360 O  O   . HOH N 6 .  ? -19.171 7.407   -3.837  1.00 31.70 ? 109 HOH M O   1 
HETATM 1361 O  O   . HOH N 6 .  ? -16.092 8.263   3.503   1.00 31.40 ? 110 HOH M O   1 
HETATM 1362 O  O   . HOH N 6 .  ? -8.653  6.726   2.501   1.00 44.14 ? 111 HOH M O   1 
HETATM 1363 O  O   . HOH N 6 .  ? -23.243 -1.489  -15.047 1.00 18.11 ? 112 HOH M O   1 
HETATM 1364 O  O   . HOH N 6 .  ? -19.903 0.616   -0.603  1.00 23.59 ? 113 HOH M O   1 
HETATM 1365 O  O   . HOH N 6 .  ? -24.681 -0.554  -7.390  1.00 34.78 ? 114 HOH M O   1 
HETATM 1366 O  O   . HOH N 6 .  ? -13.651 4.236   -0.806  1.00 41.32 ? 115 HOH M O   1 
HETATM 1367 O  O   . HOH N 6 .  ? -20.313 -1.126  -17.028 1.00 23.09 ? 116 HOH M O   1 
HETATM 1368 O  O   . HOH N 6 .  ? -22.338 -6.321  -3.520  1.00 24.01 ? 117 HOH M O   1 
HETATM 1369 O  O   . HOH N 6 .  ? -20.940 -6.392  -16.953 1.00 11.98 ? 118 HOH M O   1 
HETATM 1370 O  O   . HOH N 6 .  ? -5.393  8.802   -1.909  1.00 32.48 ? 119 HOH M O   1 
HETATM 1371 O  O   . HOH N 6 .  ? -20.336 5.861   1.395   1.00 34.65 ? 120 HOH M O   1 
HETATM 1372 O  O   . HOH N 6 .  ? -34.216 -11.363 -17.861 1.00 39.72 ? 121 HOH M O   1 
HETATM 1373 O  O   . HOH O 6 .  ? 26.794  18.046  -6.349  1.00 32.97 ? 201 HOH N O   1 
HETATM 1374 O  O   . HOH O 6 .  ? 23.813  10.414  -4.958  1.00 27.50 ? 202 HOH N O   1 
HETATM 1375 O  O   . HOH O 6 .  ? 4.198   -1.189  -1.269  1.00 49.99 ? 203 HOH N O   1 
HETATM 1376 O  O   . HOH O 6 .  ? 4.964   -2.566  5.491   1.00 30.58 ? 204 HOH N O   1 
HETATM 1377 O  O   . HOH O 6 .  ? 13.500  -3.880  8.265   1.00 23.85 ? 205 HOH N O   1 
HETATM 1378 O  O   . HOH O 6 .  ? 14.563  16.835  -4.053  1.00 35.29 ? 206 HOH N O   1 
HETATM 1379 O  O   . HOH O 6 .  ? 28.512  15.781  -5.885  1.00 43.52 ? 207 HOH N O   1 
HETATM 1380 O  O   . HOH O 6 .  ? 19.759  3.776   3.841   1.00 30.05 ? 208 HOH N O   1 
HETATM 1381 O  O   . HOH O 6 .  ? 19.960  15.929  -2.227  1.00 30.00 ? 209 HOH N O   1 
HETATM 1382 O  O   . HOH O 6 .  ? 23.431  9.606   -0.668  1.00 25.38 ? 210 HOH N O   1 
HETATM 1383 O  O   . HOH O 6 .  ? 6.585   5.040   1.604   1.00 43.72 ? 211 HOH N O   1 
HETATM 1384 O  O   . HOH O 6 .  ? 12.502  -0.100  6.073   1.00 10.06 ? 212 HOH N O   1 
HETATM 1385 O  O   . HOH O 6 .  ? 14.582  9.511   2.250   1.00 9.91  ? 213 HOH N O   1 
HETATM 1386 O  O   . HOH O 6 .  ? 10.819  7.089   1.461   1.00 37.86 ? 214 HOH N O   1 
HETATM 1387 O  O   . HOH O 6 .  ? 21.229  13.452  1.840   1.00 37.77 ? 215 HOH N O   1 
HETATM 1388 O  O   . HOH O 6 .  ? 18.721  -0.266  3.980   1.00 30.00 ? 216 HOH N O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  134 134 ALA ALA A . n 
A 1 2  GLU 2  135 135 GLU GLU A . n 
A 1 3  TYR 3  136 136 TYR TYR A . n 
A 1 4  VAL 4  137 137 VAL VAL A . n 
A 1 5  ARG 5  138 138 ARG ARG A . n 
A 1 6  ALA 6  139 139 ALA ALA A . n 
A 1 7  LEU 7  140 140 LEU LEU A . n 
A 1 8  PHE 8  141 141 PHE PHE A . n 
A 1 9  ASP 9  142 142 ASP ASP A . n 
A 1 10 PHE 10 143 143 PHE PHE A . n 
A 1 11 ASN 11 144 144 ASN ASN A . n 
A 1 12 GLY 12 145 145 GLY GLY A . n 
A 1 13 ASN 13 146 146 ASN ASN A . n 
A 1 14 ASP 14 147 147 ASP ASP A . n 
A 1 15 GLU 15 148 148 GLU GLU A . n 
A 1 16 GLU 16 149 149 GLU GLU A . n 
A 1 17 ASP 17 150 150 ASP ASP A . n 
A 1 18 LEU 18 151 151 LEU LEU A . n 
A 1 19 PRO 19 152 152 PRO PRO A . n 
A 1 20 PHE 20 153 153 PHE PHE A . n 
A 1 21 LYS 21 154 154 LYS LYS A . n 
A 1 22 LYS 22 155 155 LYS LYS A . n 
A 1 23 GLY 23 156 156 GLY GLY A . n 
A 1 24 ASP 24 157 157 ASP ASP A . n 
A 1 25 ILE 25 158 158 ILE ILE A . n 
A 1 26 LEU 26 159 159 LEU LEU A . n 
A 1 27 ARG 27 160 160 ARG ARG A . n 
A 1 28 ILE 28 161 161 ILE ILE A . n 
A 1 29 ARG 29 162 162 ARG ARG A . n 
A 1 30 ASP 30 163 163 ASP ASP A . n 
A 1 31 LYS 31 164 164 LYS LYS A . n 
A 1 32 PRO 32 165 165 PRO PRO A . n 
A 1 33 GLU 33 166 166 GLU GLU A . n 
A 1 34 GLU 34 167 167 GLU GLU A . n 
A 1 35 GLN 35 168 168 GLN GLN A . n 
A 1 36 TRP 36 169 169 TRP TRP A . n 
A 1 37 TRP 37 170 170 TRP TRP A . n 
A 1 38 ASN 38 171 171 ASN ASN A . n 
A 1 39 ALA 39 172 172 ALA ALA A . n 
A 1 40 GLU 40 173 173 GLU GLU A . n 
A 1 41 ASP 41 174 174 ASP ASP A . n 
A 1 42 SER 42 175 175 SER SER A . n 
A 1 43 GLU 43 176 176 GLU GLU A . n 
A 1 44 GLY 44 177 177 GLY GLY A . n 
A 1 45 LYS 45 178 178 LYS LYS A . n 
A 1 46 ARG 46 179 179 ARG ARG A . n 
A 1 47 GLY 47 180 180 GLY GLY A . n 
A 1 48 MET 48 181 181 MET MET A . n 
A 1 49 ILE 49 182 182 ILE ILE A . n 
A 1 50 PRO 50 183 183 PRO PRO A . n 
A 1 51 VAL 51 184 184 VAL VAL A . n 
A 1 52 PRO 52 185 185 PRO PRO A . n 
A 1 53 TYR 53 186 186 TYR TYR A . n 
A 1 54 VAL 54 187 187 VAL VAL A . n 
A 1 55 GLU 55 188 188 GLU GLU A . n 
A 1 56 LYS 56 189 189 LYS LYS A . n 
A 1 57 TYR 57 190 190 TYR TYR A . n 
A 1 58 ARG 58 191 191 ARG ARG A . n 
B 1 1  ALA 1  134 134 ALA ALA B . n 
B 1 2  GLU 2  135 135 GLU GLU B . n 
B 1 3  TYR 3  136 136 TYR TYR B . n 
B 1 4  VAL 4  137 137 VAL VAL B . n 
B 1 5  ARG 5  138 138 ARG ARG B . n 
B 1 6  ALA 6  139 139 ALA ALA B . n 
B 1 7  LEU 7  140 140 LEU LEU B . n 
B 1 8  PHE 8  141 141 PHE PHE B . n 
B 1 9  ASP 9  142 142 ASP ASP B . n 
B 1 10 PHE 10 143 143 PHE PHE B . n 
B 1 11 ASN 11 144 144 ASN ASN B . n 
B 1 12 GLY 12 145 145 GLY GLY B . n 
B 1 13 ASN 13 146 146 ASN ASN B . n 
B 1 14 ASP 14 147 147 ASP ASP B . n 
B 1 15 GLU 15 148 148 GLU GLU B . n 
B 1 16 GLU 16 149 149 GLU GLU B . n 
B 1 17 ASP 17 150 150 ASP ASP B . n 
B 1 18 LEU 18 151 151 LEU LEU B . n 
B 1 19 PRO 19 152 152 PRO PRO B . n 
B 1 20 PHE 20 153 153 PHE PHE B . n 
B 1 21 LYS 21 154 154 LYS LYS B . n 
B 1 22 LYS 22 155 155 LYS LYS B . n 
B 1 23 GLY 23 156 156 GLY GLY B . n 
B 1 24 ASP 24 157 157 ASP ASP B . n 
B 1 25 ILE 25 158 158 ILE ILE B . n 
B 1 26 LEU 26 159 159 LEU LEU B . n 
B 1 27 ARG 27 160 160 ARG ARG B . n 
B 1 28 ILE 28 161 161 ILE ILE B . n 
B 1 29 ARG 29 162 162 ARG ARG B . n 
B 1 30 ASP 30 163 163 ASP ASP B . n 
B 1 31 LYS 31 164 164 LYS LYS B . n 
B 1 32 PRO 32 165 165 PRO PRO B . n 
B 1 33 GLU 33 166 166 GLU GLU B . n 
B 1 34 GLU 34 167 167 GLU GLU B . n 
B 1 35 GLN 35 168 168 GLN GLN B . n 
B 1 36 TRP 36 169 169 TRP TRP B . n 
B 1 37 TRP 37 170 170 TRP TRP B . n 
B 1 38 ASN 38 171 171 ASN ASN B . n 
B 1 39 ALA 39 172 172 ALA ALA B . n 
B 1 40 GLU 40 173 173 GLU GLU B . n 
B 1 41 ASP 41 174 174 ASP ASP B . n 
B 1 42 SER 42 175 175 SER SER B . n 
B 1 43 GLU 43 176 176 GLU GLU B . n 
B 1 44 GLY 44 177 177 GLY GLY B . n 
B 1 45 LYS 45 178 178 LYS LYS B . n 
B 1 46 ARG 46 179 179 ARG ARG B . n 
B 1 47 GLY 47 180 180 GLY GLY B . n 
B 1 48 MET 48 181 181 MET MET B . n 
B 1 49 ILE 49 182 182 ILE ILE B . n 
B 1 50 PRO 50 183 183 PRO PRO B . n 
B 1 51 VAL 51 184 184 VAL VAL B . n 
B 1 52 PRO 52 185 185 PRO PRO B . n 
B 1 53 TYR 53 186 186 TYR TYR B . n 
B 1 54 VAL 54 187 187 VAL VAL B . n 
B 1 55 GLU 55 188 188 GLU GLU B . n 
B 1 56 LYS 56 189 189 LYS LYS B . n 
B 1 57 TYR 57 190 ?   ?   ?   B . n 
B 1 58 ARG 58 191 ?   ?   ?   B . n 
C 2 1  ACE 1  -1  -1  ACE ACE M . n 
C 2 2  TYR 2  0   0   TYR TYR M . n 
C 2 3  GLU 3  1   1   GLU GLU M . n 
C 2 4  LYS 4  2   2   LYS LYS M . n 
C 2 5  PRO 5  3   3   PRO PRO M . n 
C 2 6  ALA 6  4   4   ALA ALA M . n 
C 2 7  LEU 7  5   5   LEU LEU M . n 
C 2 8  PRO 8  6   6   PRO PRO M . n 
C 2 9  ARG 9  7   7   ARG ARG M . n 
C 2 10 LYS 10 8   8   LYS LYS M . n 
C 2 11 ARG 11 9   9   ARG ARG M . n 
C 2 12 NH2 12 10  10  NH2 NH2 M . n 
D 2 1  ACE 1  -1  -1  ACE ACE N . n 
D 2 2  TYR 2  0   0   TYR TYR N . n 
D 2 3  GLU 3  1   1   GLU GLU N . n 
D 2 4  LYS 4  2   2   LYS LYS N . n 
D 2 5  PRO 5  3   3   PRO PRO N . n 
D 2 6  ALA 6  4   4   ALA ALA N . n 
D 2 7  LEU 7  5   5   LEU LEU N . n 
D 2 8  PRO 8  6   6   PRO PRO N . n 
D 2 9  ARG 9  7   7   ARG ARG N . n 
D 2 10 LYS 10 8   8   LYS LYS N . n 
D 2 11 ARG 11 9   9   ARG ARG N . n 
D 2 12 NH2 12 10  10  NH2 NH2 N . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 PEG 1  201 1439 PEG PEG A . 
F 4 NA  1  202 1    NA  NA  A . 
G 4 NA  1  203 3    NA  NA  A . 
H 4 NA  1  204 6    NA  NA  A . 
I 5 P4G 1  201 1440 P4G PEG B . 
J 4 NA  1  202 9    NA  NA  B . 
K 5 P4G 1  101 1441 P4G PEG N . 
L 6 HOH 1  301 95   HOH HOH A . 
L 6 HOH 2  302 24   HOH HOH A . 
L 6 HOH 3  303 40   HOH HOH A . 
L 6 HOH 4  304 145  HOH HOH A . 
L 6 HOH 5  305 80   HOH HOH A . 
L 6 HOH 6  306 106  HOH HOH A . 
L 6 HOH 7  307 32   HOH HOH A . 
L 6 HOH 8  308 102  HOH HOH A . 
L 6 HOH 9  309 151  HOH HOH A . 
L 6 HOH 10 310 23   HOH HOH A . 
L 6 HOH 11 311 147  HOH HOH A . 
L 6 HOH 12 312 125  HOH HOH A . 
L 6 HOH 13 313 122  HOH HOH A . 
L 6 HOH 14 314 99   HOH HOH A . 
L 6 HOH 15 315 119  HOH HOH A . 
L 6 HOH 16 316 43   HOH HOH A . 
L 6 HOH 17 317 4    HOH HOH A . 
L 6 HOH 18 318 25   HOH HOH A . 
L 6 HOH 19 319 143  HOH HOH A . 
L 6 HOH 20 320 101  HOH HOH A . 
L 6 HOH 21 321 149  HOH HOH A . 
L 6 HOH 22 322 9    HOH HOH A . 
L 6 HOH 23 323 39   HOH HOH A . 
L 6 HOH 24 324 15   HOH HOH A . 
L 6 HOH 25 325 67   HOH HOH A . 
L 6 HOH 26 326 142  HOH HOH A . 
L 6 HOH 27 327 131  HOH HOH A . 
L 6 HOH 28 328 28   HOH HOH A . 
L 6 HOH 29 329 49   HOH HOH A . 
L 6 HOH 30 330 56   HOH HOH A . 
L 6 HOH 31 331 155  HOH HOH A . 
L 6 HOH 32 332 174  HOH HOH A . 
L 6 HOH 33 333 5    HOH HOH A . 
L 6 HOH 34 334 52   HOH HOH A . 
L 6 HOH 35 335 20   HOH HOH A . 
L 6 HOH 36 336 107  HOH HOH A . 
L 6 HOH 37 337 61   HOH HOH A . 
L 6 HOH 38 338 7    HOH HOH A . 
L 6 HOH 39 339 48   HOH HOH A . 
L 6 HOH 40 340 64   HOH HOH A . 
L 6 HOH 41 341 164  HOH HOH A . 
L 6 HOH 42 342 41   HOH HOH A . 
L 6 HOH 43 343 161  HOH HOH A . 
L 6 HOH 44 344 109  HOH HOH A . 
L 6 HOH 45 345 53   HOH HOH A . 
L 6 HOH 46 346 16   HOH HOH A . 
L 6 HOH 47 347 45   HOH HOH A . 
L 6 HOH 48 348 18   HOH HOH A . 
L 6 HOH 49 349 59   HOH HOH A . 
L 6 HOH 50 350 71   HOH HOH A . 
L 6 HOH 51 351 26   HOH HOH A . 
L 6 HOH 52 352 57   HOH HOH A . 
L 6 HOH 53 353 38   HOH HOH A . 
L 6 HOH 54 354 144  HOH HOH A . 
L 6 HOH 55 355 166  HOH HOH A . 
L 6 HOH 56 356 11   HOH HOH A . 
L 6 HOH 57 357 93   HOH HOH A . 
L 6 HOH 58 358 104  HOH HOH A . 
L 6 HOH 59 359 2    HOH HOH A . 
L 6 HOH 60 360 66   HOH HOH A . 
L 6 HOH 61 361 55   HOH HOH A . 
L 6 HOH 62 362 103  HOH HOH A . 
L 6 HOH 63 363 159  HOH HOH A . 
L 6 HOH 64 364 133  HOH HOH A . 
L 6 HOH 65 365 180  HOH HOH A . 
L 6 HOH 66 366 74   HOH HOH A . 
L 6 HOH 67 367 90   HOH HOH A . 
L 6 HOH 68 368 117  HOH HOH A . 
L 6 HOH 69 369 175  HOH HOH A . 
L 6 HOH 70 370 75   HOH HOH A . 
L 6 HOH 71 371 96   HOH HOH A . 
L 6 HOH 72 372 54   HOH HOH A . 
L 6 HOH 73 373 165  HOH HOH A . 
L 6 HOH 74 374 120  HOH HOH A . 
L 6 HOH 75 375 171  HOH HOH A . 
L 6 HOH 76 376 127  HOH HOH A . 
L 6 HOH 77 377 58   HOH HOH A . 
L 6 HOH 78 378 170  HOH HOH A . 
L 6 HOH 79 379 173  HOH HOH A . 
L 6 HOH 80 380 87   HOH HOH A . 
L 6 HOH 81 381 163  HOH HOH A . 
L 6 HOH 82 382 111  HOH HOH A . 
L 6 HOH 83 383 108  HOH HOH A . 
M 6 HOH 1  301 136  HOH HOH B . 
M 6 HOH 2  302 112  HOH HOH B . 
M 6 HOH 3  303 44   HOH HOH B . 
M 6 HOH 4  304 36   HOH HOH B . 
M 6 HOH 5  305 21   HOH HOH B . 
M 6 HOH 6  306 27   HOH HOH B . 
M 6 HOH 7  307 148  HOH HOH B . 
M 6 HOH 8  308 179  HOH HOH B . 
M 6 HOH 9  309 123  HOH HOH B . 
M 6 HOH 10 310 14   HOH HOH B . 
M 6 HOH 11 311 35   HOH HOH B . 
M 6 HOH 12 312 137  HOH HOH B . 
M 6 HOH 13 313 46   HOH HOH B . 
M 6 HOH 14 314 128  HOH HOH B . 
M 6 HOH 15 315 146  HOH HOH B . 
M 6 HOH 16 316 30   HOH HOH B . 
M 6 HOH 17 317 51   HOH HOH B . 
M 6 HOH 18 318 115  HOH HOH B . 
M 6 HOH 19 319 19   HOH HOH B . 
M 6 HOH 20 320 157  HOH HOH B . 
M 6 HOH 21 321 169  HOH HOH B . 
M 6 HOH 22 322 114  HOH HOH B . 
M 6 HOH 23 323 92   HOH HOH B . 
M 6 HOH 24 324 138  HOH HOH B . 
M 6 HOH 25 325 176  HOH HOH B . 
M 6 HOH 26 326 63   HOH HOH B . 
M 6 HOH 27 327 167  HOH HOH B . 
M 6 HOH 28 328 153  HOH HOH B . 
M 6 HOH 29 329 13   HOH HOH B . 
M 6 HOH 30 330 154  HOH HOH B . 
M 6 HOH 31 331 22   HOH HOH B . 
M 6 HOH 32 332 105  HOH HOH B . 
M 6 HOH 33 333 129  HOH HOH B . 
M 6 HOH 34 334 100  HOH HOH B . 
M 6 HOH 35 335 50   HOH HOH B . 
M 6 HOH 36 336 31   HOH HOH B . 
M 6 HOH 37 337 134  HOH HOH B . 
M 6 HOH 38 338 17   HOH HOH B . 
M 6 HOH 39 339 6    HOH HOH B . 
M 6 HOH 40 340 158  HOH HOH B . 
M 6 HOH 41 341 47   HOH HOH B . 
M 6 HOH 42 342 150  HOH HOH B . 
M 6 HOH 43 343 29   HOH HOH B . 
M 6 HOH 44 344 79   HOH HOH B . 
M 6 HOH 45 345 140  HOH HOH B . 
M 6 HOH 46 346 8    HOH HOH B . 
M 6 HOH 47 347 12   HOH HOH B . 
M 6 HOH 48 348 178  HOH HOH B . 
M 6 HOH 49 349 65   HOH HOH B . 
M 6 HOH 50 350 181  HOH HOH B . 
M 6 HOH 51 351 172  HOH HOH B . 
M 6 HOH 52 352 121  HOH HOH B . 
M 6 HOH 53 353 81   HOH HOH B . 
M 6 HOH 54 354 91   HOH HOH B . 
M 6 HOH 55 355 77   HOH HOH B . 
M 6 HOH 56 356 97   HOH HOH B . 
M 6 HOH 57 357 78   HOH HOH B . 
M 6 HOH 58 358 94   HOH HOH B . 
M 6 HOH 59 359 72   HOH HOH B . 
M 6 HOH 60 360 110  HOH HOH B . 
M 6 HOH 61 361 132  HOH HOH B . 
N 6 HOH 1  101 152  HOH HOH M . 
N 6 HOH 2  102 34   HOH HOH M . 
N 6 HOH 3  103 126  HOH HOH M . 
N 6 HOH 4  104 141  HOH HOH M . 
N 6 HOH 5  105 168  HOH HOH M . 
N 6 HOH 6  106 82   HOH HOH M . 
N 6 HOH 7  107 42   HOH HOH M . 
N 6 HOH 8  108 83   HOH HOH M . 
N 6 HOH 9  109 85   HOH HOH M . 
N 6 HOH 10 110 116  HOH HOH M . 
N 6 HOH 11 111 156  HOH HOH M . 
N 6 HOH 12 112 3    HOH HOH M . 
N 6 HOH 13 113 98   HOH HOH M . 
N 6 HOH 14 114 73   HOH HOH M . 
N 6 HOH 15 115 86   HOH HOH M . 
N 6 HOH 16 116 62   HOH HOH M . 
N 6 HOH 17 117 33   HOH HOH M . 
N 6 HOH 18 118 177  HOH HOH M . 
N 6 HOH 19 119 124  HOH HOH M . 
N 6 HOH 20 120 84   HOH HOH M . 
N 6 HOH 21 121 118  HOH HOH M . 
O 6 HOH 1  201 89   HOH HOH N . 
O 6 HOH 2  202 60   HOH HOH N . 
O 6 HOH 3  203 113  HOH HOH N . 
O 6 HOH 4  204 76   HOH HOH N . 
O 6 HOH 5  205 10   HOH HOH N . 
O 6 HOH 6  206 130  HOH HOH N . 
O 6 HOH 7  207 88   HOH HOH N . 
O 6 HOH 8  208 37   HOH HOH N . 
O 6 HOH 9  209 135  HOH HOH N . 
O 6 HOH 10 210 69   HOH HOH N . 
O 6 HOH 11 211 162  HOH HOH N . 
O 6 HOH 12 212 70   HOH HOH N . 
O 6 HOH 13 213 1    HOH HOH N . 
O 6 HOH 14 214 68   HOH HOH N . 
O 6 HOH 15 215 160  HOH HOH N . 
O 6 HOH 16 216 139  HOH HOH N . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,F,G,H,L,N 
2 1 B,D,I,J,K,M,O   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1550 ? 
1 MORE         -25  ? 
1 'SSA (A^2)'  5540 ? 
2 'ABSA (A^2)' 1160 ? 
2 MORE         -17  ? 
2 'SSA (A^2)'  5220 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? A ALA 1  ? A ALA 134 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? L HOH .  ? A HOH 351 ? 1_555 97.7  ? 
2  O ? A ALA 1  ? A ALA 134 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? L HOH .  ? A HOH 365 ? 1_555 94.4  ? 
3  O ? L HOH .  ? A HOH 351 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? L HOH .  ? A HOH 365 ? 1_555 163.9 ? 
4  O ? A ALA 1  ? A ALA 134 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? L HOH .  ? A HOH 381 ? 1_555 177.3 ? 
5  O ? L HOH .  ? A HOH 351 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? L HOH .  ? A HOH 381 ? 1_555 82.2  ? 
6  O ? L HOH .  ? A HOH 365 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? L HOH .  ? A HOH 381 ? 1_555 85.2  ? 
7  O ? A ALA 1  ? A ALA 134 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? L HOH .  ? A HOH 362 ? 1_555 83.3  ? 
8  O ? L HOH .  ? A HOH 351 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? L HOH .  ? A HOH 362 ? 1_555 85.2  ? 
9  O ? L HOH .  ? A HOH 365 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? L HOH .  ? A HOH 362 ? 1_555 85.7  ? 
10 O ? L HOH .  ? A HOH 381 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? L HOH .  ? A HOH 362 ? 1_555 94.0  ? 
11 O ? A ALA 1  ? A ALA 134 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? M HOH .  ? B HOH 342 ? 1_545 91.9  ? 
12 O ? L HOH .  ? A HOH 351 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? M HOH .  ? B HOH 342 ? 1_545 90.5  ? 
13 O ? L HOH .  ? A HOH 365 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? M HOH .  ? B HOH 342 ? 1_545 99.8  ? 
14 O ? L HOH .  ? A HOH 381 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? M HOH .  ? B HOH 342 ? 1_545 90.8  ? 
15 O ? L HOH .  ? A HOH 362 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? M HOH .  ? B HOH 342 ? 1_545 173.0 ? 
16 O ? A ALA 1  ? A ALA 134 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? M HOH .  ? B HOH 350 ? 1_545 101.7 ? 
17 O ? L HOH .  ? A HOH 351 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? M HOH .  ? B HOH 350 ? 1_545 135.6 ? 
18 O ? L HOH .  ? A HOH 365 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? M HOH .  ? B HOH 350 ? 1_545 50.8  ? 
19 O ? L HOH .  ? A HOH 381 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? M HOH .  ? B HOH 350 ? 1_545 80.1  ? 
20 O ? L HOH .  ? A HOH 362 ? 1_555 NA ? G NA . ? A NA 203 ? 1_555 O ? M HOH .  ? B HOH 350 ? 1_545 136.2 ? 
21 O ? M HOH .  ? B HOH 342 ? 1_545 NA ? G NA . ? A NA 203 ? 1_555 O ? M HOH .  ? B HOH 350 ? 1_545 49.7  ? 
22 O ? A ARG 46 ? A ARG 179 ? 1_555 NA ? F NA . ? A NA 202 ? 1_555 O ? L HOH .  ? A HOH 309 ? 1_555 97.6  ? 
23 O ? A ARG 46 ? A ARG 179 ? 1_555 NA ? F NA . ? A NA 202 ? 1_555 O ? M HOH .  ? B HOH 335 ? 1_555 85.7  ? 
24 O ? L HOH .  ? A HOH 309 ? 1_555 NA ? F NA . ? A NA 202 ? 1_555 O ? M HOH .  ? B HOH 335 ? 1_555 174.6 ? 
25 O ? A ARG 46 ? A ARG 179 ? 1_555 NA ? F NA . ? A NA 202 ? 1_555 O ? L HOH .  ? A HOH 305 ? 1_565 90.7  ? 
26 O ? L HOH .  ? A HOH 309 ? 1_555 NA ? F NA . ? A NA 202 ? 1_555 O ? L HOH .  ? A HOH 305 ? 1_565 98.6  ? 
27 O ? M HOH .  ? B HOH 335 ? 1_555 NA ? F NA . ? A NA 202 ? 1_555 O ? L HOH .  ? A HOH 305 ? 1_565 85.6  ? 
28 O ? B GLY 12 ? B GLY 145 ? 1_555 NA ? J NA . ? B NA 202 ? 1_555 O ? B ASP 14 ? B ASP 147 ? 1_555 81.1  ? 
29 O ? B GLY 12 ? B GLY 145 ? 1_555 NA ? J NA . ? B NA 202 ? 1_555 O ? B ASP 17 ? B ASP 150 ? 1_555 100.2 ? 
30 O ? B ASP 14 ? B ASP 147 ? 1_555 NA ? J NA . ? B NA 202 ? 1_555 O ? B ASP 17 ? B ASP 150 ? 1_555 91.0  ? 
31 O ? B GLY 12 ? B GLY 145 ? 1_555 NA ? J NA . ? B NA 202 ? 1_555 O ? M HOH .  ? B HOH 324 ? 1_555 134.3 ? 
32 O ? B ASP 14 ? B ASP 147 ? 1_555 NA ? J NA . ? B NA 202 ? 1_555 O ? M HOH .  ? B HOH 324 ? 1_555 144.5 ? 
33 O ? B ASP 17 ? B ASP 150 ? 1_555 NA ? J NA . ? B NA 202 ? 1_555 O ? M HOH .  ? B HOH 324 ? 1_555 82.0  ? 
34 O ? B GLY 12 ? B GLY 145 ? 1_555 NA ? J NA . ? B NA 202 ? 1_555 O ? M HOH .  ? B HOH 319 ? 1_555 84.7  ? 
35 O ? B ASP 14 ? B ASP 147 ? 1_555 NA ? J NA . ? B NA 202 ? 1_555 O ? M HOH .  ? B HOH 319 ? 1_555 92.7  ? 
36 O ? B ASP 17 ? B ASP 150 ? 1_555 NA ? J NA . ? B NA 202 ? 1_555 O ? M HOH .  ? B HOH 319 ? 1_555 174.3 ? 
37 O ? M HOH .  ? B HOH 324 ? 1_555 NA ? J NA . ? B NA 202 ? 1_555 O ? M HOH .  ? B HOH 319 ? 1_555 92.5  ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2016-06-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC   ? ? ? 5.8.0103 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .        4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    342 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    350 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.00 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     365 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     350 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   1_545 
_pdbx_validate_symm_contact.dist              1.98 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C 
_pdbx_validate_rmsd_bond.auth_asym_id_1            M 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ARG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             9 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            N 
_pdbx_validate_rmsd_bond.auth_asym_id_2            M 
_pdbx_validate_rmsd_bond.auth_comp_id_2            NH2 
_pdbx_validate_rmsd_bond.auth_seq_id_2             10 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.490 
_pdbx_validate_rmsd_bond.bond_target_value         1.336 
_pdbx_validate_rmsd_bond.bond_deviation            0.154 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.023 
_pdbx_validate_rmsd_bond.linker_flag               Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 128.57 120.30 8.27  0.50 N 
2 1 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH2 A ARG 138 ? ? 113.79 120.30 -6.51 0.50 N 
3 1 NE B ARG 138 ? ? CZ B ARG 138 ? ? NH2 B ARG 138 ? ? 117.00 120.30 -3.30 0.50 N 
4 1 NE N ARG 7   ? ? CZ N ARG 7   ? ? NH2 N ARG 7   ? ? 116.76 120.30 -3.54 0.50 N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 N 1 B P4G 201 ? C2 ? I P4G 1 C2 
2 1 N 1 B P4G 201 ? C1 ? I P4G 1 C1 
3 1 N 1 N P4G 101 ? C8 ? K P4G 1 C8 
4 1 N 1 N P4G 101 ? C7 ? K P4G 1 C7 
5 1 N 1 N P4G 101 ? O4 ? K P4G 1 O4 
6 1 N 1 N P4G 101 ? C6 ? K P4G 1 C6 
7 1 N 1 N P4G 101 ? C5 ? K P4G 1 C5 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B TYR 190 ? B TYR 57 
2 1 Y 1 B ARG 191 ? B ARG 58 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'DI(HYDROXYETHYL)ETHER'             PEG 
4 'SODIUM ION'                        NA  
5 '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE' P4G 
6 water                               HOH 
#