data_5IJN
# 
_entry.id   5IJN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5IJN         
WWPDB D_1000218916 
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Sub-unit of the Inner ring of the Nuclear Pore Complex' 
_pdbx_database_related.db_id          EMD-8085 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5IJN 
_pdbx_database_status.recvd_initial_deposition_date   2016-03-02 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kosinski, J.'    1 
'Mosalaganti, S.' 2 
'von Appen, A.'   3 
'Beck, M.'        4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            352 
_citation.language                  ? 
_citation.page_first                363 
_citation.page_last                 365 
_citation.title                     'Molecular architecture of the inner ring scaffold of the human nuclear pore complex.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aaf0643 
_citation.pdbx_database_id_PubMed   27081072 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kosinski, J.'    1  ? 
primary 'Mosalaganti, S.' 2  ? 
primary 'von Appen, A.'   3  ? 
primary 'Teimer, R.'      4  ? 
primary 'DiGuilio, A.L.'  5  ? 
primary 'Wan, W.'         6  ? 
primary 'Bui, K.H.'       7  ? 
primary 'Hagen, W.J.'     8  ? 
primary 'Briggs, J.A.'    9  ? 
primary 'Glavy, J.S.'     10 ? 
primary 'Hurt, E.'        11 ? 
primary 'Beck, M.'        12 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'NUCLEAR PORE COMPLEX PROTEIN NUP155' 155357.281 6 ? ? ? ? 
2 polymer man 'NUCLEAR PORE COMPLEX PROTEIN NUP93'  93599.102  4 ? ? ? ? 
3 polymer man 'NUCLEAR PORE COMPLEX PROTEIN NUP205' 228172.875 4 ? ? ? ? 
4 polymer man 'NUCLEAR PORE COMPLEX PROTEIN NUP54'  55491.156  4 ? ? ? ? 
5 polymer man 'NUCLEAR PORE COMPLEX PROTEIN NUP58'  60941.480  4 ? ? ? ? 
6 polymer man 'Nuclear pore glycoprotein p62'       53289.574  4 ? ? ? ? 
# 
_entity_name_com.entity_id   6 
_entity_name_com.name        '62 kDa nucleoporin,Nucleoporin Nup62' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGMSDMDYPLQGPGLLSVPNLPE
ISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPH
VRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAY
QAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQ
NAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASS
TVEKPSKVHRALYSKGILLMAASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDH
IPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAA
CDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGSPVYSSSPVPSGSPYPNPSFLGTPSHGIQPPAMSTPVCALG
NPATQATNMSCVTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEF
LDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALALWKLLCE
HQFTIIVAELQKELQEQLKITTFKDLVIRDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANEL
LQRSRQVQNKTEKERMLRESLKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIV
GLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALY
NWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIAR
AILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAE
CKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNW
DVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGY
LVELQSMSSSVAVQAITGNFKSLQAKLERLH
;
;MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGMSDMDYPLQGPGLLSVPNLPE
ISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPH
VRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAY
QAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQ
NAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASS
TVEKPSKVHRALYSKGILLMAASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDH
IPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAA
CDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGSPVYSSSPVPSGSPYPNPSFLGTPSHGIQPPAMSTPVCALG
NPATQATNMSCVTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEF
LDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALALWKLLCE
HQFTIIVAELQKELQEQLKITTFKDLVIRDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANEL
LQRSRQVQNKTEKERMLRESLKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIV
GLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALY
NWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIAR
AILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAE
CKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNW
DVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGY
LVELQSMSSSVAVQAITGNFKSLQAKLERLH
;
A,B,E,K,Q,W ? 
2 'polypeptide(L)' no no 
;MDTEGFGELLQQAEQLAAETEGISELPHVERNLQEIQQAGERLRSRTLTRTSQETADVKASVLLGSRGLDISHISQRLES
LSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKRTFGMAEEYHRESMLVEWEQVKQRILHTLLASGEDALDFTQ
ESEPSYISDVGPPGRSSLDNIEMAYARQIYIYNEKIVNGHLQPNLVDLCASVAELDDKSISDMWTMVKQMTDVLLTPATD
ALKNRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLHQAQLGGVPGTYQLVRSFLNIKLPAPLPGLQDGEVEGHPVWA
LIYYCMRCGDLLAASQVVNRAQHQLGEFKTWFQEYMNSKDRRLSPATENKLRLHYRRALRNNTDPYKRAVYCIIGRCDVT
DNQSEVADKTEDYLWLKLNQVCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLYFQVLFLTAQFEAAVAFLF
RMERLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDPPCLRRLNFVRLLMLYTRKFESTDPREALQYFYFLRDEKDS
QGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDKFTSDTKPIINKVASVAENKGLFEEAAKLYDLAKNADKVLE
LMNKLLSPVVPQISAPQSNKERLKNMALSIAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLV
PLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIEDRDSQLRSQARTLITFAGMIP
YRTSGDTNARLVQMEVLMN
;
;MDTEGFGELLQQAEQLAAETEGISELPHVERNLQEIQQAGERLRSRTLTRTSQETADVKASVLLGSRGLDISHISQRLES
LSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKRTFGMAEEYHRESMLVEWEQVKQRILHTLLASGEDALDFTQ
ESEPSYISDVGPPGRSSLDNIEMAYARQIYIYNEKIVNGHLQPNLVDLCASVAELDDKSISDMWTMVKQMTDVLLTPATD
ALKNRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLHQAQLGGVPGTYQLVRSFLNIKLPAPLPGLQDGEVEGHPVWA
LIYYCMRCGDLLAASQVVNRAQHQLGEFKTWFQEYMNSKDRRLSPATENKLRLHYRRALRNNTDPYKRAVYCIIGRCDVT
DNQSEVADKTEDYLWLKLNQVCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLYFQVLFLTAQFEAAVAFLF
RMERLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDPPCLRRLNFVRLLMLYTRKFESTDPREALQYFYFLRDEKDS
QGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDKFTSDTKPIINKVASVAENKGLFEEAAKLYDLAKNADKVLE
LMNKLLSPVVPQISAPQSNKERLKNMALSIAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLV
PLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIEDRDSQLRSQARTLITFAGMIP
YRTSGDTNARLVQMEVLMN
;
C,I,O,U     ? 
3 'polypeptide(L)' no no 
;MATPLAVNSAASLWGPYKDIWHKVGNALWRRQPEAVHLLDKILKKHKPDFISLFKNPPKNVQQHEKVQKASTEGVAIQGQ
QGTRLLPEQLIKEAFILSDLFDIGELAAVELLLAGEHQQPHFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTL
ELSPELASMTTRFTDELMEQGLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSP
LGKEDTLLLIGHLERVTVEANGSLDAVNLALLMALLYCFDISFIEQSTEERDDMIHQLPLLTEKQYIATIHSRLQDSQLW
KLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAMAELAIADNVFLFLMESVVVSEYFYQEEFYIRRVHNLITDFL
ALMPMKVKQLRNRADEDARMIHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFHLELALEYWCPTEPLQTPTIMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSSHVENIQGAGGSPVSWEHFFH
SLMLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAFLQLTSTIITWSENARLALCEHPQWTPVVVILGLLQCSIPP
VLKAELLKTLAAFGKSPEIAASLWQSLEYTQILQTVRIPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQLEDFVDQFVELQGEEIIAYKP
PGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKKHLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVCPLE
QLLQGINPRTKKADNVVNIARYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSISQKLMAGFVECLDCEDA
EEFVRLEEGSELEKKLVAIRHETRIHILNLLITSLECNPPNLALYLLGFELKKPVSTTNLQDPGVLGCPRTCLHAILNIL
EKGTEGRTGPVAVRESPQLAELCYQVIYQLCACSDTSGPTMRYLRTSQDFLFSQLQYLPFSNKEYEISMLNQMSWLMKTA
SIELRVTSLNRQRSHTQRLLHLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTATKVRRKILNILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEISTVLQYVVGRNKLLQCLHAKR
HALESWRQLVEIILTACPQDLIQAEDRQLIIRDILQDVHDKILDDEAAQELMPVVAGAVFTLTAHLSQAVLTEQKETSVL
GPAEAHYAFMLDSCFTSPPPEENPLVGFASIGDSSLYIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDT
LEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRMLALALLDRIVSVDKQQQWLLYLSNSG
YLKVLVDSLVEDDRTLQSLLTPQPPLLKALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDMRPETDPQSMF
GMRDPPMFIPTPVDRYRQILLPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAGSLQELALLTGII
SKAALPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKFQDDNVEGDKVSKKDEIELAMQQICANV
MEYCQSLMLQSSPTFQHAVCLFTPSLSETVNRDGPRQDTQAPVVPYWRLPGLGIIIYLLKQSANDFFSYYDSHRQSVSKL
QNVEQLPPDEIKELCQSVMPAGVDKISTAQKYVLARRRLVKVINNRAKLLSLCSFIIETCLFILWRHLEYYLLHCMPTDS
QDSLFASRTLFKSRRLQDSFASETNLDFRSGLAIVSQHDLDQLQADAINAFGESLQKKLLDIEGLYSKVRSRYSFIQALV
RRIRGLLRISRN
;
;MATPLAVNSAASLWGPYKDIWHKVGNALWRRQPEAVHLLDKILKKHKPDFISLFKNPPKNVQQHEKVQKASTEGVAIQGQ
QGTRLLPEQLIKEAFILSDLFDIGELAAVELLLAGEHQQPHFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTL
ELSPELASMTTRFTDELMEQGLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSP
LGKEDTLLLIGHLERVTVEANGSLDAVNLALLMALLYCFDISFIEQSTEERDDMIHQLPLLTEKQYIATIHSRLQDSQLW
KLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAMAELAIADNVFLFLMESVVVSEYFYQEEFYIRRVHNLITDFL
ALMPMKVKQLRNRADEDARMIHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFHLELALEYWCPTEPLQTPTIMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSSHVENIQGAGGSPVSWEHFFH
SLMLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAFLQLTSTIITWSENARLALCEHPQWTPVVVILGLLQCSIPP
VLKAELLKTLAAFGKSPEIAASLWQSLEYTQILQTVRIPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQLEDFVDQFVELQGEEIIAYKP
PGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKKHLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVCPLE
QLLQGINPRTKKADNVVNIARYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSISQKLMAGFVECLDCEDA
EEFVRLEEGSELEKKLVAIRHETRIHILNLLITSLECNPPNLALYLLGFELKKPVSTTNLQDPGVLGCPRTCLHAILNIL
EKGTEGRTGPVAVRESPQLAELCYQVIYQLCACSDTSGPTMRYLRTSQDFLFSQLQYLPFSNKEYEISMLNQMSWLMKTA
SIELRVTSLNRQRSHTQRLLHLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTATKVRRKILNILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEISTVLQYVVGRNKLLQCLHAKR
HALESWRQLVEIILTACPQDLIQAEDRQLIIRDILQDVHDKILDDEAAQELMPVVAGAVFTLTAHLSQAVLTEQKETSVL
GPAEAHYAFMLDSCFTSPPPEENPLVGFASIGDSSLYIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDT
LEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRMLALALLDRIVSVDKQQQWLLYLSNSG
YLKVLVDSLVEDDRTLQSLLTPQPPLLKALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDMRPETDPQSMF
GMRDPPMFIPTPVDRYRQILLPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAGSLQELALLTGII
SKAALPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKFQDDNVEGDKVSKKDEIELAMQQICANV
MEYCQSLMLQSSPTFQHAVCLFTPSLSETVNRDGPRQDTQAPVVPYWRLPGLGIIIYLLKQSANDFFSYYDSHRQSVSKL
QNVEQLPPDEIKELCQSVMPAGVDKISTAQKYVLARRRLVKVINNRAKLLSLCSFIIETCLFILWRHLEYYLLHCMPTDS
QDSLFASRTLFKSRRLQDSFASETNLDFRSGLAIVSQHDLDQLQADAINAFGESLQKKLLDIEGLYSKVRSRYSFIQALV
RRIRGLLRISRN
;
D,J,P,V     ? 
4 'polypeptide(L)' no no 
;MAFNFGAPSGTSGTAAATAAPAGGFGGFGTTSTTAGSAFSFSAPTNTGTTGLFGGTQNKGFGFGTGFGTTTGTSTGLGTG
LGTGLGFGGFNTQQQQQTTLGGLFSQPTQAPTQSNQLINTASALSAPTLLGDERDAILAKWNQLQAFWGTGKGYFNNNIP
PVEFTQENPFCRFKAVGYSCMPSNKDEDGLVVLVFNKKETEIRSQQQQLVESLHKVLGGNQTLTVNVEGTKTLPDDQTEV
VIYVVERSPNGTSRRVPATTLYAHFEQANIKTQLQQLGVTLSMTRTELSPAQIKQLLQNPPAGVDPIIWEQAKVDNPDSE
KLIPVPMVGFKELLRRLKVQDQMTKQHQTRLDIISEDISELQKNQTTSVAKIAQYKRKLMDLSHRTLQVLIKQEIQRKSG
YAIQADEEQLRVQLDTIQGELNAPTQFKGRLNELMSQIRMQNHFGAVRSEERYYIDADLLREIKQHLKQQQEGLSHLISI
IKDDLEDIKLVEHGLNETIHIRGGVFS
;
;MAFNFGAPSGTSGTAAATAAPAGGFGGFGTTSTTAGSAFSFSAPTNTGTTGLFGGTQNKGFGFGTGFGTTTGTSTGLGTG
LGTGLGFGGFNTQQQQQTTLGGLFSQPTQAPTQSNQLINTASALSAPTLLGDERDAILAKWNQLQAFWGTGKGYFNNNIP
PVEFTQENPFCRFKAVGYSCMPSNKDEDGLVVLVFNKKETEIRSQQQQLVESLHKVLGGNQTLTVNVEGTKTLPDDQTEV
VIYVVERSPNGTSRRVPATTLYAHFEQANIKTQLQQLGVTLSMTRTELSPAQIKQLLQNPPAGVDPIIWEQAKVDNPDSE
KLIPVPMVGFKELLRRLKVQDQMTKQHQTRLDIISEDISELQKNQTTSVAKIAQYKRKLMDLSHRTLQVLIKQEIQRKSG
YAIQADEEQLRVQLDTIQGELNAPTQFKGRLNELMSQIRMQNHFGAVRSEERYYIDADLLREIKQHLKQQQEGLSHLISI
IKDDLEDIKLVEHGLNETIHIRGGVFS
;
F,L,R,X     ? 
5 'polypeptide(L)' no no 
;MSTGFSFGSGTLGSTTVAAGGTSTGGVFSFGTGASSNPSVGLNFGNLGSTSTPATTSAPSSGFGTGLFGSKPATGFTLGG
TNTGIATTITTGLTLGTPATTSAATTGFSLGFNKPAASATPFALPITSTSASGLTLSSALTSTPAASTGFTLNNLGGTTA
TTTTASTGLSLGGALAGLGGSLFQSTNTGTSGLGQNALGLTLGTTAATSTAGNEGLGGIDFSSSSDKKSDKTGTRPEDSK
ALKDENLPPVICQDVENLQKFVKEQKQVQEEISRMSSKAMLKVQEDIKALKQLLSLAANGIQRNTLNIDKLKIETAQELK
NAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALA
AQLQSIHENVKVLKEQYLGYRKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGP
QPSLGVSFGTPFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGSLSAGFGSSSTSGFNFSNPGI
TASAGLTFGVSNPASAGFGTGGQLLQLKKPPAGNKRGKR
;
;MSTGFSFGSGTLGSTTVAAGGTSTGGVFSFGTGASSNPSVGLNFGNLGSTSTPATTSAPSSGFGTGLFGSKPATGFTLGG
TNTGIATTITTGLTLGTPATTSAATTGFSLGFNKPAASATPFALPITSTSASGLTLSSALTSTPAASTGFTLNNLGGTTA
TTTTASTGLSLGGALAGLGGSLFQSTNTGTSGLGQNALGLTLGTTAATSTAGNEGLGGIDFSSSSDKKSDKTGTRPEDSK
ALKDENLPPVICQDVENLQKFVKEQKQVQEEISRMSSKAMLKVQEDIKALKQLLSLAANGIQRNTLNIDKLKIETAQELK
NAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALA
AQLQSIHENVKVLKEQYLGYRKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGP
QPSLGVSFGTPFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGSLSAGFGSSSTSGFNFSNPGI
TASAGLTFGVSNPASAGFGTGGQLLQLKKPPAGNKRGKR
;
G,M,S,Y     ? 
6 'polypeptide(L)' no no 
;MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLFSLATQTPATQTTGFTFGTAT
LASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPSTTSVAPATTSGGFSF
TGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTAGATQPAAPTPTATITSTGPSLFASIATAPTSSATTGLSLC
TPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPAGIPSNTAAAVTAPPGPGAAA
GAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQ
KELEDLLSPLEELVKEQSGTIYLQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNA
HMDSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD
;
;MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLFSLATQTPATQTTGFTFGTAT
LASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPSTTSVAPATTSGGFSF
TGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTAGATQPAAPTPTATITSTGPSLFASIATAPTSSATTGLSLC
TPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPAGIPSNTAAAVTAPPGPGAAA
GAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQ
KELEDLLSPLEELVKEQSGTIYLQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNA
HMDSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD
;
H,N,T,Z     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    PRO n 
1 3    SER n 
1 4    SER n 
1 5    LEU n 
1 6    LEU n 
1 7    GLY n 
1 8    ALA n 
1 9    ALA n 
1 10   MET n 
1 11   PRO n 
1 12   ALA n 
1 13   SER n 
1 14   THR n 
1 15   SER n 
1 16   ALA n 
1 17   ALA n 
1 18   ALA n 
1 19   LEU n 
1 20   GLN n 
1 21   GLU n 
1 22   ALA n 
1 23   LEU n 
1 24   GLU n 
1 25   ASN n 
1 26   ALA n 
1 27   GLY n 
1 28   ARG n 
1 29   LEU n 
1 30   ILE n 
1 31   ASP n 
1 32   ARG n 
1 33   GLN n 
1 34   LEU n 
1 35   GLN n 
1 36   GLU n 
1 37   ASP n 
1 38   ARG n 
1 39   MET n 
1 40   TYR n 
1 41   PRO n 
1 42   ASP n 
1 43   LEU n 
1 44   SER n 
1 45   GLU n 
1 46   LEU n 
1 47   LEU n 
1 48   MET n 
1 49   VAL n 
1 50   SER n 
1 51   ALA n 
1 52   PRO n 
1 53   ASN n 
1 54   ASN n 
1 55   PRO n 
1 56   THR n 
1 57   VAL n 
1 58   SER n 
1 59   GLY n 
1 60   MET n 
1 61   SER n 
1 62   ASP n 
1 63   MET n 
1 64   ASP n 
1 65   TYR n 
1 66   PRO n 
1 67   LEU n 
1 68   GLN n 
1 69   GLY n 
1 70   PRO n 
1 71   GLY n 
1 72   LEU n 
1 73   LEU n 
1 74   SER n 
1 75   VAL n 
1 76   PRO n 
1 77   ASN n 
1 78   LEU n 
1 79   PRO n 
1 80   GLU n 
1 81   ILE n 
1 82   SER n 
1 83   SER n 
1 84   ILE n 
1 85   ARG n 
1 86   ARG n 
1 87   VAL n 
1 88   PRO n 
1 89   LEU n 
1 90   PRO n 
1 91   PRO n 
1 92   GLU n 
1 93   LEU n 
1 94   VAL n 
1 95   GLU n 
1 96   GLN n 
1 97   PHE n 
1 98   GLY n 
1 99   HIS n 
1 100  MET n 
1 101  GLN n 
1 102  CYS n 
1 103  ASN n 
1 104  CYS n 
1 105  MET n 
1 106  MET n 
1 107  GLY n 
1 108  VAL n 
1 109  PHE n 
1 110  PRO n 
1 111  PRO n 
1 112  ILE n 
1 113  SER n 
1 114  ARG n 
1 115  ALA n 
1 116  TRP n 
1 117  LEU n 
1 118  THR n 
1 119  ILE n 
1 120  ASP n 
1 121  SER n 
1 122  ASP n 
1 123  ILE n 
1 124  PHE n 
1 125  MET n 
1 126  TRP n 
1 127  ASN n 
1 128  TYR n 
1 129  GLU n 
1 130  ASP n 
1 131  GLY n 
1 132  GLY n 
1 133  ASP n 
1 134  LEU n 
1 135  ALA n 
1 136  TYR n 
1 137  PHE n 
1 138  ASP n 
1 139  GLY n 
1 140  LEU n 
1 141  SER n 
1 142  GLU n 
1 143  THR n 
1 144  ILE n 
1 145  LEU n 
1 146  ALA n 
1 147  VAL n 
1 148  GLY n 
1 149  LEU n 
1 150  VAL n 
1 151  LYS n 
1 152  PRO n 
1 153  LYS n 
1 154  ALA n 
1 155  GLY n 
1 156  ILE n 
1 157  PHE n 
1 158  GLN n 
1 159  PRO n 
1 160  HIS n 
1 161  VAL n 
1 162  ARG n 
1 163  HIS n 
1 164  LEU n 
1 165  LEU n 
1 166  VAL n 
1 167  LEU n 
1 168  ALA n 
1 169  THR n 
1 170  PRO n 
1 171  VAL n 
1 172  ASP n 
1 173  ILE n 
1 174  VAL n 
1 175  ILE n 
1 176  LEU n 
1 177  GLY n 
1 178  LEU n 
1 179  SER n 
1 180  TYR n 
1 181  ALA n 
1 182  ASN n 
1 183  LEU n 
1 184  GLN n 
1 185  THR n 
1 186  GLY n 
1 187  SER n 
1 188  GLY n 
1 189  VAL n 
1 190  LEU n 
1 191  ASN n 
1 192  ASP n 
1 193  SER n 
1 194  LEU n 
1 195  SER n 
1 196  GLY n 
1 197  GLY n 
1 198  MET n 
1 199  GLN n 
1 200  LEU n 
1 201  LEU n 
1 202  PRO n 
1 203  ASP n 
1 204  PRO n 
1 205  LEU n 
1 206  TYR n 
1 207  SER n 
1 208  LEU n 
1 209  PRO n 
1 210  THR n 
1 211  ASP n 
1 212  ASN n 
1 213  THR n 
1 214  TYR n 
1 215  LEU n 
1 216  LEU n 
1 217  THR n 
1 218  ILE n 
1 219  THR n 
1 220  SER n 
1 221  THR n 
1 222  ASP n 
1 223  ASN n 
1 224  GLY n 
1 225  ARG n 
1 226  ILE n 
1 227  PHE n 
1 228  LEU n 
1 229  ALA n 
1 230  GLY n 
1 231  LYS n 
1 232  ASP n 
1 233  GLY n 
1 234  CYS n 
1 235  LEU n 
1 236  TYR n 
1 237  GLU n 
1 238  VAL n 
1 239  ALA n 
1 240  TYR n 
1 241  GLN n 
1 242  ALA n 
1 243  GLU n 
1 244  ALA n 
1 245  GLY n 
1 246  TRP n 
1 247  PHE n 
1 248  SER n 
1 249  GLN n 
1 250  ARG n 
1 251  CYS n 
1 252  ARG n 
1 253  LYS n 
1 254  ILE n 
1 255  ASN n 
1 256  HIS n 
1 257  SER n 
1 258  LYS n 
1 259  SER n 
1 260  SER n 
1 261  LEU n 
1 262  SER n 
1 263  PHE n 
1 264  LEU n 
1 265  VAL n 
1 266  PRO n 
1 267  SER n 
1 268  LEU n 
1 269  LEU n 
1 270  GLN n 
1 271  PHE n 
1 272  THR n 
1 273  PHE n 
1 274  SER n 
1 275  GLU n 
1 276  ASP n 
1 277  ASP n 
1 278  PRO n 
1 279  ILE n 
1 280  LEU n 
1 281  GLN n 
1 282  ILE n 
1 283  ALA n 
1 284  ILE n 
1 285  ASP n 
1 286  ASN n 
1 287  SER n 
1 288  ARG n 
1 289  ASN n 
1 290  ILE n 
1 291  LEU n 
1 292  TYR n 
1 293  THR n 
1 294  ARG n 
1 295  SER n 
1 296  GLU n 
1 297  LYS n 
1 298  GLY n 
1 299  VAL n 
1 300  ILE n 
1 301  GLN n 
1 302  VAL n 
1 303  TYR n 
1 304  ASP n 
1 305  LEU n 
1 306  GLY n 
1 307  GLN n 
1 308  ASP n 
1 309  GLY n 
1 310  GLN n 
1 311  GLY n 
1 312  MET n 
1 313  SER n 
1 314  ARG n 
1 315  VAL n 
1 316  ALA n 
1 317  SER n 
1 318  VAL n 
1 319  SER n 
1 320  GLN n 
1 321  ASN n 
1 322  ALA n 
1 323  ILE n 
1 324  VAL n 
1 325  SER n 
1 326  ALA n 
1 327  ALA n 
1 328  GLY n 
1 329  ASN n 
1 330  ILE n 
1 331  ALA n 
1 332  ARG n 
1 333  THR n 
1 334  ILE n 
1 335  ASP n 
1 336  ARG n 
1 337  SER n 
1 338  VAL n 
1 339  PHE n 
1 340  LYS n 
1 341  PRO n 
1 342  ILE n 
1 343  VAL n 
1 344  GLN n 
1 345  ILE n 
1 346  ALA n 
1 347  VAL n 
1 348  ILE n 
1 349  GLU n 
1 350  ASN n 
1 351  SER n 
1 352  GLU n 
1 353  SER n 
1 354  LEU n 
1 355  ASP n 
1 356  CYS n 
1 357  GLN n 
1 358  LEU n 
1 359  LEU n 
1 360  ALA n 
1 361  VAL n 
1 362  THR n 
1 363  HIS n 
1 364  ALA n 
1 365  GLY n 
1 366  VAL n 
1 367  ARG n 
1 368  LEU n 
1 369  TYR n 
1 370  PHE n 
1 371  SER n 
1 372  THR n 
1 373  CYS n 
1 374  PRO n 
1 375  PHE n 
1 376  ARG n 
1 377  GLN n 
1 378  PRO n 
1 379  LEU n 
1 380  ALA n 
1 381  ARG n 
1 382  PRO n 
1 383  ASN n 
1 384  THR n 
1 385  LEU n 
1 386  THR n 
1 387  LEU n 
1 388  VAL n 
1 389  HIS n 
1 390  VAL n 
1 391  ARG n 
1 392  LEU n 
1 393  PRO n 
1 394  PRO n 
1 395  GLY n 
1 396  PHE n 
1 397  SER n 
1 398  ALA n 
1 399  SER n 
1 400  SER n 
1 401  THR n 
1 402  VAL n 
1 403  GLU n 
1 404  LYS n 
1 405  PRO n 
1 406  SER n 
1 407  LYS n 
1 408  VAL n 
1 409  HIS n 
1 410  ARG n 
1 411  ALA n 
1 412  LEU n 
1 413  TYR n 
1 414  SER n 
1 415  LYS n 
1 416  GLY n 
1 417  ILE n 
1 418  LEU n 
1 419  LEU n 
1 420  MET n 
1 421  ALA n 
1 422  ALA n 
1 423  SER n 
1 424  GLU n 
1 425  ASN n 
1 426  GLU n 
1 427  ASP n 
1 428  ASN n 
1 429  ASP n 
1 430  ILE n 
1 431  LEU n 
1 432  TRP n 
1 433  CYS n 
1 434  VAL n 
1 435  ASN n 
1 436  HIS n 
1 437  ASP n 
1 438  THR n 
1 439  PHE n 
1 440  PRO n 
1 441  PHE n 
1 442  GLN n 
1 443  LYS n 
1 444  PRO n 
1 445  MET n 
1 446  MET n 
1 447  GLU n 
1 448  THR n 
1 449  GLN n 
1 450  MET n 
1 451  THR n 
1 452  ALA n 
1 453  GLY n 
1 454  VAL n 
1 455  ASP n 
1 456  GLY n 
1 457  HIS n 
1 458  SER n 
1 459  TRP n 
1 460  ALA n 
1 461  LEU n 
1 462  SER n 
1 463  ALA n 
1 464  ILE n 
1 465  ASP n 
1 466  GLU n 
1 467  LEU n 
1 468  LYS n 
1 469  VAL n 
1 470  ASP n 
1 471  LYS n 
1 472  ILE n 
1 473  ILE n 
1 474  THR n 
1 475  PRO n 
1 476  LEU n 
1 477  ASN n 
1 478  LYS n 
1 479  ASP n 
1 480  HIS n 
1 481  ILE n 
1 482  PRO n 
1 483  ILE n 
1 484  THR n 
1 485  ASP n 
1 486  SER n 
1 487  PRO n 
1 488  VAL n 
1 489  VAL n 
1 490  VAL n 
1 491  GLN n 
1 492  GLN n 
1 493  HIS n 
1 494  MET n 
1 495  LEU n 
1 496  PRO n 
1 497  PRO n 
1 498  LYS n 
1 499  LYS n 
1 500  PHE n 
1 501  VAL n 
1 502  LEU n 
1 503  LEU n 
1 504  SER n 
1 505  ALA n 
1 506  GLN n 
1 507  GLY n 
1 508  SER n 
1 509  LEU n 
1 510  MET n 
1 511  PHE n 
1 512  HIS n 
1 513  LYS n 
1 514  LEU n 
1 515  ARG n 
1 516  PRO n 
1 517  VAL n 
1 518  ASP n 
1 519  GLN n 
1 520  LEU n 
1 521  ARG n 
1 522  HIS n 
1 523  LEU n 
1 524  LEU n 
1 525  VAL n 
1 526  SER n 
1 527  ASN n 
1 528  VAL n 
1 529  GLY n 
1 530  GLY n 
1 531  ASP n 
1 532  GLY n 
1 533  GLU n 
1 534  GLU n 
1 535  ILE n 
1 536  GLU n 
1 537  ARG n 
1 538  PHE n 
1 539  PHE n 
1 540  LYS n 
1 541  LEU n 
1 542  HIS n 
1 543  GLN n 
1 544  GLU n 
1 545  ASP n 
1 546  GLN n 
1 547  ALA n 
1 548  CYS n 
1 549  ALA n 
1 550  THR n 
1 551  CYS n 
1 552  LEU n 
1 553  ILE n 
1 554  LEU n 
1 555  ALA n 
1 556  CYS n 
1 557  SER n 
1 558  THR n 
1 559  ALA n 
1 560  ALA n 
1 561  CYS n 
1 562  ASP n 
1 563  ARG n 
1 564  GLU n 
1 565  VAL n 
1 566  SER n 
1 567  ALA n 
1 568  TRP n 
1 569  ALA n 
1 570  THR n 
1 571  ARG n 
1 572  ALA n 
1 573  PHE n 
1 574  PHE n 
1 575  ARG n 
1 576  TYR n 
1 577  GLY n 
1 578  GLY n 
1 579  GLU n 
1 580  ALA n 
1 581  GLN n 
1 582  MET n 
1 583  ARG n 
1 584  PHE n 
1 585  PRO n 
1 586  THR n 
1 587  THR n 
1 588  LEU n 
1 589  PRO n 
1 590  PRO n 
1 591  PRO n 
1 592  SER n 
1 593  ASN n 
1 594  VAL n 
1 595  GLY n 
1 596  PRO n 
1 597  ILE n 
1 598  LEU n 
1 599  GLY n 
1 600  SER n 
1 601  PRO n 
1 602  VAL n 
1 603  TYR n 
1 604  SER n 
1 605  SER n 
1 606  SER n 
1 607  PRO n 
1 608  VAL n 
1 609  PRO n 
1 610  SER n 
1 611  GLY n 
1 612  SER n 
1 613  PRO n 
1 614  TYR n 
1 615  PRO n 
1 616  ASN n 
1 617  PRO n 
1 618  SER n 
1 619  PHE n 
1 620  LEU n 
1 621  GLY n 
1 622  THR n 
1 623  PRO n 
1 624  SER n 
1 625  HIS n 
1 626  GLY n 
1 627  ILE n 
1 628  GLN n 
1 629  PRO n 
1 630  PRO n 
1 631  ALA n 
1 632  MET n 
1 633  SER n 
1 634  THR n 
1 635  PRO n 
1 636  VAL n 
1 637  CYS n 
1 638  ALA n 
1 639  LEU n 
1 640  GLY n 
1 641  ASN n 
1 642  PRO n 
1 643  ALA n 
1 644  THR n 
1 645  GLN n 
1 646  ALA n 
1 647  THR n 
1 648  ASN n 
1 649  MET n 
1 650  SER n 
1 651  CYS n 
1 652  VAL n 
1 653  THR n 
1 654  GLY n 
1 655  PRO n 
1 656  GLU n 
1 657  ILE n 
1 658  VAL n 
1 659  TYR n 
1 660  SER n 
1 661  GLY n 
1 662  LYS n 
1 663  HIS n 
1 664  ASN n 
1 665  GLY n 
1 666  ILE n 
1 667  CYS n 
1 668  ILE n 
1 669  TYR n 
1 670  PHE n 
1 671  SER n 
1 672  ARG n 
1 673  ILE n 
1 674  MET n 
1 675  GLY n 
1 676  ASN n 
1 677  ILE n 
1 678  TRP n 
1 679  ASP n 
1 680  ALA n 
1 681  SER n 
1 682  LEU n 
1 683  VAL n 
1 684  VAL n 
1 685  GLU n 
1 686  ARG n 
1 687  ILE n 
1 688  PHE n 
1 689  LYS n 
1 690  SER n 
1 691  GLY n 
1 692  ASN n 
1 693  ARG n 
1 694  GLU n 
1 695  ILE n 
1 696  THR n 
1 697  ALA n 
1 698  ILE n 
1 699  GLU n 
1 700  SER n 
1 701  SER n 
1 702  VAL n 
1 703  PRO n 
1 704  CYS n 
1 705  GLN n 
1 706  LEU n 
1 707  LEU n 
1 708  GLU n 
1 709  SER n 
1 710  VAL n 
1 711  LEU n 
1 712  GLN n 
1 713  GLU n 
1 714  LEU n 
1 715  LYS n 
1 716  GLY n 
1 717  LEU n 
1 718  GLN n 
1 719  GLU n 
1 720  PHE n 
1 721  LEU n 
1 722  ASP n 
1 723  ARG n 
1 724  ASN n 
1 725  SER n 
1 726  GLN n 
1 727  PHE n 
1 728  ALA n 
1 729  GLY n 
1 730  GLY n 
1 731  PRO n 
1 732  LEU n 
1 733  GLY n 
1 734  ASN n 
1 735  PRO n 
1 736  ASN n 
1 737  THR n 
1 738  THR n 
1 739  ALA n 
1 740  LYS n 
1 741  VAL n 
1 742  GLN n 
1 743  GLN n 
1 744  ARG n 
1 745  LEU n 
1 746  ILE n 
1 747  GLY n 
1 748  PHE n 
1 749  MET n 
1 750  ARG n 
1 751  PRO n 
1 752  GLU n 
1 753  ASN n 
1 754  GLY n 
1 755  ASN n 
1 756  PRO n 
1 757  GLN n 
1 758  GLN n 
1 759  MET n 
1 760  GLN n 
1 761  GLN n 
1 762  GLU n 
1 763  LEU n 
1 764  GLN n 
1 765  ARG n 
1 766  LYS n 
1 767  PHE n 
1 768  HIS n 
1 769  GLU n 
1 770  ALA n 
1 771  GLN n 
1 772  LEU n 
1 773  SER n 
1 774  GLU n 
1 775  LYS n 
1 776  ILE n 
1 777  SER n 
1 778  LEU n 
1 779  GLN n 
1 780  ALA n 
1 781  ILE n 
1 782  GLN n 
1 783  GLN n 
1 784  LEU n 
1 785  VAL n 
1 786  ARG n 
1 787  LYS n 
1 788  SER n 
1 789  TYR n 
1 790  GLN n 
1 791  ALA n 
1 792  LEU n 
1 793  ALA n 
1 794  LEU n 
1 795  TRP n 
1 796  LYS n 
1 797  LEU n 
1 798  LEU n 
1 799  CYS n 
1 800  GLU n 
1 801  HIS n 
1 802  GLN n 
1 803  PHE n 
1 804  THR n 
1 805  ILE n 
1 806  ILE n 
1 807  VAL n 
1 808  ALA n 
1 809  GLU n 
1 810  LEU n 
1 811  GLN n 
1 812  LYS n 
1 813  GLU n 
1 814  LEU n 
1 815  GLN n 
1 816  GLU n 
1 817  GLN n 
1 818  LEU n 
1 819  LYS n 
1 820  ILE n 
1 821  THR n 
1 822  THR n 
1 823  PHE n 
1 824  LYS n 
1 825  ASP n 
1 826  LEU n 
1 827  VAL n 
1 828  ILE n 
1 829  ARG n 
1 830  ASP n 
1 831  LYS n 
1 832  GLU n 
1 833  LEU n 
1 834  THR n 
1 835  GLY n 
1 836  ALA n 
1 837  LEU n 
1 838  ILE n 
1 839  ALA n 
1 840  SER n 
1 841  LEU n 
1 842  ILE n 
1 843  ASN n 
1 844  CYS n 
1 845  TYR n 
1 846  ILE n 
1 847  ARG n 
1 848  ASP n 
1 849  ASN n 
1 850  ALA n 
1 851  ALA n 
1 852  VAL n 
1 853  ASP n 
1 854  GLY n 
1 855  ILE n 
1 856  SER n 
1 857  LEU n 
1 858  HIS n 
1 859  LEU n 
1 860  GLN n 
1 861  ASP n 
1 862  ILE n 
1 863  CYS n 
1 864  PRO n 
1 865  LEU n 
1 866  LEU n 
1 867  TYR n 
1 868  SER n 
1 869  THR n 
1 870  ASP n 
1 871  ASP n 
1 872  ALA n 
1 873  ILE n 
1 874  CYS n 
1 875  SER n 
1 876  LYS n 
1 877  ALA n 
1 878  ASN n 
1 879  GLU n 
1 880  LEU n 
1 881  LEU n 
1 882  GLN n 
1 883  ARG n 
1 884  SER n 
1 885  ARG n 
1 886  GLN n 
1 887  VAL n 
1 888  GLN n 
1 889  ASN n 
1 890  LYS n 
1 891  THR n 
1 892  GLU n 
1 893  LYS n 
1 894  GLU n 
1 895  ARG n 
1 896  MET n 
1 897  LEU n 
1 898  ARG n 
1 899  GLU n 
1 900  SER n 
1 901  LEU n 
1 902  LYS n 
1 903  GLU n 
1 904  TYR n 
1 905  GLN n 
1 906  LYS n 
1 907  ILE n 
1 908  SER n 
1 909  ASN n 
1 910  GLN n 
1 911  VAL n 
1 912  ASP n 
1 913  LEU n 
1 914  SER n 
1 915  ASN n 
1 916  VAL n 
1 917  CYS n 
1 918  ALA n 
1 919  GLN n 
1 920  TYR n 
1 921  ARG n 
1 922  GLN n 
1 923  VAL n 
1 924  ARG n 
1 925  PHE n 
1 926  TYR n 
1 927  GLU n 
1 928  GLY n 
1 929  VAL n 
1 930  VAL n 
1 931  GLU n 
1 932  LEU n 
1 933  SER n 
1 934  LEU n 
1 935  THR n 
1 936  ALA n 
1 937  ALA n 
1 938  GLU n 
1 939  LYS n 
1 940  LYS n 
1 941  ASP n 
1 942  PRO n 
1 943  GLN n 
1 944  GLY n 
1 945  LEU n 
1 946  GLY n 
1 947  LEU n 
1 948  HIS n 
1 949  PHE n 
1 950  TYR n 
1 951  LYS n 
1 952  HIS n 
1 953  GLY n 
1 954  GLU n 
1 955  PRO n 
1 956  GLU n 
1 957  GLU n 
1 958  ASP n 
1 959  ILE n 
1 960  VAL n 
1 961  GLY n 
1 962  LEU n 
1 963  GLN n 
1 964  ALA n 
1 965  PHE n 
1 966  GLN n 
1 967  GLU n 
1 968  ARG n 
1 969  LEU n 
1 970  ASN n 
1 971  SER n 
1 972  TYR n 
1 973  LYS n 
1 974  CYS n 
1 975  ILE n 
1 976  THR n 
1 977  ASP n 
1 978  THR n 
1 979  LEU n 
1 980  GLN n 
1 981  GLU n 
1 982  LEU n 
1 983  VAL n 
1 984  ASN n 
1 985  GLN n 
1 986  SER n 
1 987  LYS n 
1 988  ALA n 
1 989  ALA n 
1 990  PRO n 
1 991  GLN n 
1 992  SER n 
1 993  PRO n 
1 994  SER n 
1 995  VAL n 
1 996  PRO n 
1 997  LYS n 
1 998  LYS n 
1 999  PRO n 
1 1000 GLY n 
1 1001 PRO n 
1 1002 PRO n 
1 1003 VAL n 
1 1004 LEU n 
1 1005 SER n 
1 1006 SER n 
1 1007 ASP n 
1 1008 PRO n 
1 1009 ASN n 
1 1010 MET n 
1 1011 LEU n 
1 1012 SER n 
1 1013 ASN n 
1 1014 GLU n 
1 1015 GLU n 
1 1016 ALA n 
1 1017 GLY n 
1 1018 HIS n 
1 1019 HIS n 
1 1020 PHE n 
1 1021 GLU n 
1 1022 GLN n 
1 1023 MET n 
1 1024 LEU n 
1 1025 LYS n 
1 1026 LEU n 
1 1027 SER n 
1 1028 GLN n 
1 1029 ARG n 
1 1030 SER n 
1 1031 LYS n 
1 1032 ASP n 
1 1033 GLU n 
1 1034 LEU n 
1 1035 PHE n 
1 1036 SER n 
1 1037 ILE n 
1 1038 ALA n 
1 1039 LEU n 
1 1040 TYR n 
1 1041 ASN n 
1 1042 TRP n 
1 1043 LEU n 
1 1044 ILE n 
1 1045 GLN n 
1 1046 VAL n 
1 1047 ASP n 
1 1048 LEU n 
1 1049 ALA n 
1 1050 ASP n 
1 1051 LYS n 
1 1052 LEU n 
1 1053 LEU n 
1 1054 GLN n 
1 1055 VAL n 
1 1056 ALA n 
1 1057 SER n 
1 1058 PRO n 
1 1059 PHE n 
1 1060 LEU n 
1 1061 GLU n 
1 1062 PRO n 
1 1063 HIS n 
1 1064 LEU n 
1 1065 VAL n 
1 1066 ARG n 
1 1067 MET n 
1 1068 ALA n 
1 1069 LYS n 
1 1070 VAL n 
1 1071 ASP n 
1 1072 GLN n 
1 1073 ASN n 
1 1074 ARG n 
1 1075 VAL n 
1 1076 ARG n 
1 1077 TYR n 
1 1078 MET n 
1 1079 ASP n 
1 1080 LEU n 
1 1081 LEU n 
1 1082 TRP n 
1 1083 ARG n 
1 1084 TYR n 
1 1085 TYR n 
1 1086 GLU n 
1 1087 LYS n 
1 1088 ASN n 
1 1089 ARG n 
1 1090 SER n 
1 1091 PHE n 
1 1092 SER n 
1 1093 ASN n 
1 1094 ALA n 
1 1095 ALA n 
1 1096 ARG n 
1 1097 VAL n 
1 1098 LEU n 
1 1099 SER n 
1 1100 ARG n 
1 1101 LEU n 
1 1102 ALA n 
1 1103 ASP n 
1 1104 MET n 
1 1105 HIS n 
1 1106 SER n 
1 1107 THR n 
1 1108 GLU n 
1 1109 ILE n 
1 1110 SER n 
1 1111 LEU n 
1 1112 GLN n 
1 1113 GLN n 
1 1114 ARG n 
1 1115 LEU n 
1 1116 GLU n 
1 1117 TYR n 
1 1118 ILE n 
1 1119 ALA n 
1 1120 ARG n 
1 1121 ALA n 
1 1122 ILE n 
1 1123 LEU n 
1 1124 SER n 
1 1125 ALA n 
1 1126 LYS n 
1 1127 SER n 
1 1128 SER n 
1 1129 THR n 
1 1130 ALA n 
1 1131 ILE n 
1 1132 SER n 
1 1133 SER n 
1 1134 ILE n 
1 1135 ALA n 
1 1136 ALA n 
1 1137 ASP n 
1 1138 GLY n 
1 1139 GLU n 
1 1140 PHE n 
1 1141 LEU n 
1 1142 HIS n 
1 1143 GLU n 
1 1144 LEU n 
1 1145 GLU n 
1 1146 GLU n 
1 1147 LYS n 
1 1148 MET n 
1 1149 GLU n 
1 1150 VAL n 
1 1151 ALA n 
1 1152 ARG n 
1 1153 ILE n 
1 1154 GLN n 
1 1155 LEU n 
1 1156 GLN n 
1 1157 ILE n 
1 1158 GLN n 
1 1159 GLU n 
1 1160 THR n 
1 1161 LEU n 
1 1162 GLN n 
1 1163 ARG n 
1 1164 GLN n 
1 1165 TYR n 
1 1166 SER n 
1 1167 HIS n 
1 1168 HIS n 
1 1169 SER n 
1 1170 SER n 
1 1171 VAL n 
1 1172 GLN n 
1 1173 ASP n 
1 1174 ALA n 
1 1175 VAL n 
1 1176 SER n 
1 1177 GLN n 
1 1178 LEU n 
1 1179 ASP n 
1 1180 SER n 
1 1181 GLU n 
1 1182 LEU n 
1 1183 MET n 
1 1184 ASP n 
1 1185 ILE n 
1 1186 THR n 
1 1187 LYS n 
1 1188 LEU n 
1 1189 TYR n 
1 1190 GLY n 
1 1191 GLU n 
1 1192 PHE n 
1 1193 ALA n 
1 1194 ASP n 
1 1195 PRO n 
1 1196 PHE n 
1 1197 LYS n 
1 1198 LEU n 
1 1199 ALA n 
1 1200 GLU n 
1 1201 CYS n 
1 1202 LYS n 
1 1203 LEU n 
1 1204 ALA n 
1 1205 ILE n 
1 1206 ILE n 
1 1207 HIS n 
1 1208 CYS n 
1 1209 ALA n 
1 1210 GLY n 
1 1211 TYR n 
1 1212 SER n 
1 1213 ASP n 
1 1214 PRO n 
1 1215 ILE n 
1 1216 LEU n 
1 1217 VAL n 
1 1218 GLN n 
1 1219 THR n 
1 1220 LEU n 
1 1221 TRP n 
1 1222 GLN n 
1 1223 ASP n 
1 1224 ILE n 
1 1225 ILE n 
1 1226 GLU n 
1 1227 LYS n 
1 1228 GLU n 
1 1229 LEU n 
1 1230 SER n 
1 1231 ASP n 
1 1232 SER n 
1 1233 VAL n 
1 1234 THR n 
1 1235 LEU n 
1 1236 SER n 
1 1237 SER n 
1 1238 SER n 
1 1239 ASP n 
1 1240 ARG n 
1 1241 MET n 
1 1242 HIS n 
1 1243 ALA n 
1 1244 LEU n 
1 1245 SER n 
1 1246 LEU n 
1 1247 LYS n 
1 1248 ILE n 
1 1249 VAL n 
1 1250 LEU n 
1 1251 LEU n 
1 1252 GLY n 
1 1253 LYS n 
1 1254 ILE n 
1 1255 TYR n 
1 1256 ALA n 
1 1257 GLY n 
1 1258 THR n 
1 1259 PRO n 
1 1260 ARG n 
1 1261 PHE n 
1 1262 PHE n 
1 1263 PRO n 
1 1264 LEU n 
1 1265 ASP n 
1 1266 PHE n 
1 1267 ILE n 
1 1268 VAL n 
1 1269 GLN n 
1 1270 PHE n 
1 1271 LEU n 
1 1272 GLU n 
1 1273 GLN n 
1 1274 GLN n 
1 1275 VAL n 
1 1276 CYS n 
1 1277 THR n 
1 1278 LEU n 
1 1279 ASN n 
1 1280 TRP n 
1 1281 ASP n 
1 1282 VAL n 
1 1283 GLY n 
1 1284 PHE n 
1 1285 VAL n 
1 1286 ILE n 
1 1287 GLN n 
1 1288 THR n 
1 1289 MET n 
1 1290 ASN n 
1 1291 GLU n 
1 1292 ILE n 
1 1293 GLY n 
1 1294 VAL n 
1 1295 PRO n 
1 1296 LEU n 
1 1297 PRO n 
1 1298 ARG n 
1 1299 LEU n 
1 1300 LEU n 
1 1301 GLU n 
1 1302 VAL n 
1 1303 TYR n 
1 1304 ASP n 
1 1305 GLN n 
1 1306 LEU n 
1 1307 PHE n 
1 1308 LYS n 
1 1309 SER n 
1 1310 ARG n 
1 1311 ASP n 
1 1312 PRO n 
1 1313 PHE n 
1 1314 TRP n 
1 1315 ASN n 
1 1316 ARG n 
1 1317 MET n 
1 1318 LYS n 
1 1319 LYS n 
1 1320 PRO n 
1 1321 LEU n 
1 1322 HIS n 
1 1323 LEU n 
1 1324 LEU n 
1 1325 ASP n 
1 1326 CYS n 
1 1327 ILE n 
1 1328 HIS n 
1 1329 VAL n 
1 1330 LEU n 
1 1331 LEU n 
1 1332 ILE n 
1 1333 ARG n 
1 1334 TYR n 
1 1335 VAL n 
1 1336 GLU n 
1 1337 ASN n 
1 1338 PRO n 
1 1339 SER n 
1 1340 GLN n 
1 1341 VAL n 
1 1342 LEU n 
1 1343 ASN n 
1 1344 CYS n 
1 1345 GLU n 
1 1346 ARG n 
1 1347 ARG n 
1 1348 ARG n 
1 1349 PHE n 
1 1350 THR n 
1 1351 ASN n 
1 1352 LEU n 
1 1353 CYS n 
1 1354 LEU n 
1 1355 ASP n 
1 1356 ALA n 
1 1357 VAL n 
1 1358 CYS n 
1 1359 GLY n 
1 1360 TYR n 
1 1361 LEU n 
1 1362 VAL n 
1 1363 GLU n 
1 1364 LEU n 
1 1365 GLN n 
1 1366 SER n 
1 1367 MET n 
1 1368 SER n 
1 1369 SER n 
1 1370 SER n 
1 1371 VAL n 
1 1372 ALA n 
1 1373 VAL n 
1 1374 GLN n 
1 1375 ALA n 
1 1376 ILE n 
1 1377 THR n 
1 1378 GLY n 
1 1379 ASN n 
1 1380 PHE n 
1 1381 LYS n 
1 1382 SER n 
1 1383 LEU n 
1 1384 GLN n 
1 1385 ALA n 
1 1386 LYS n 
1 1387 LEU n 
1 1388 GLU n 
1 1389 ARG n 
1 1390 LEU n 
1 1391 HIS n 
2 1    MET n 
2 2    ASP n 
2 3    THR n 
2 4    GLU n 
2 5    GLY n 
2 6    PHE n 
2 7    GLY n 
2 8    GLU n 
2 9    LEU n 
2 10   LEU n 
2 11   GLN n 
2 12   GLN n 
2 13   ALA n 
2 14   GLU n 
2 15   GLN n 
2 16   LEU n 
2 17   ALA n 
2 18   ALA n 
2 19   GLU n 
2 20   THR n 
2 21   GLU n 
2 22   GLY n 
2 23   ILE n 
2 24   SER n 
2 25   GLU n 
2 26   LEU n 
2 27   PRO n 
2 28   HIS n 
2 29   VAL n 
2 30   GLU n 
2 31   ARG n 
2 32   ASN n 
2 33   LEU n 
2 34   GLN n 
2 35   GLU n 
2 36   ILE n 
2 37   GLN n 
2 38   GLN n 
2 39   ALA n 
2 40   GLY n 
2 41   GLU n 
2 42   ARG n 
2 43   LEU n 
2 44   ARG n 
2 45   SER n 
2 46   ARG n 
2 47   THR n 
2 48   LEU n 
2 49   THR n 
2 50   ARG n 
2 51   THR n 
2 52   SER n 
2 53   GLN n 
2 54   GLU n 
2 55   THR n 
2 56   ALA n 
2 57   ASP n 
2 58   VAL n 
2 59   LYS n 
2 60   ALA n 
2 61   SER n 
2 62   VAL n 
2 63   LEU n 
2 64   LEU n 
2 65   GLY n 
2 66   SER n 
2 67   ARG n 
2 68   GLY n 
2 69   LEU n 
2 70   ASP n 
2 71   ILE n 
2 72   SER n 
2 73   HIS n 
2 74   ILE n 
2 75   SER n 
2 76   GLN n 
2 77   ARG n 
2 78   LEU n 
2 79   GLU n 
2 80   SER n 
2 81   LEU n 
2 82   SER n 
2 83   ALA n 
2 84   ALA n 
2 85   THR n 
2 86   THR n 
2 87   PHE n 
2 88   GLU n 
2 89   PRO n 
2 90   LEU n 
2 91   GLU n 
2 92   PRO n 
2 93   VAL n 
2 94   LYS n 
2 95   ASP n 
2 96   THR n 
2 97   ASP n 
2 98   ILE n 
2 99   GLN n 
2 100  GLY n 
2 101  PHE n 
2 102  LEU n 
2 103  LYS n 
2 104  ASN n 
2 105  GLU n 
2 106  LYS n 
2 107  ASP n 
2 108  ASN n 
2 109  ALA n 
2 110  LEU n 
2 111  LEU n 
2 112  SER n 
2 113  ALA n 
2 114  ILE n 
2 115  GLU n 
2 116  GLU n 
2 117  SER n 
2 118  ARG n 
2 119  LYS n 
2 120  ARG n 
2 121  THR n 
2 122  PHE n 
2 123  GLY n 
2 124  MET n 
2 125  ALA n 
2 126  GLU n 
2 127  GLU n 
2 128  TYR n 
2 129  HIS n 
2 130  ARG n 
2 131  GLU n 
2 132  SER n 
2 133  MET n 
2 134  LEU n 
2 135  VAL n 
2 136  GLU n 
2 137  TRP n 
2 138  GLU n 
2 139  GLN n 
2 140  VAL n 
2 141  LYS n 
2 142  GLN n 
2 143  ARG n 
2 144  ILE n 
2 145  LEU n 
2 146  HIS n 
2 147  THR n 
2 148  LEU n 
2 149  LEU n 
2 150  ALA n 
2 151  SER n 
2 152  GLY n 
2 153  GLU n 
2 154  ASP n 
2 155  ALA n 
2 156  LEU n 
2 157  ASP n 
2 158  PHE n 
2 159  THR n 
2 160  GLN n 
2 161  GLU n 
2 162  SER n 
2 163  GLU n 
2 164  PRO n 
2 165  SER n 
2 166  TYR n 
2 167  ILE n 
2 168  SER n 
2 169  ASP n 
2 170  VAL n 
2 171  GLY n 
2 172  PRO n 
2 173  PRO n 
2 174  GLY n 
2 175  ARG n 
2 176  SER n 
2 177  SER n 
2 178  LEU n 
2 179  ASP n 
2 180  ASN n 
2 181  ILE n 
2 182  GLU n 
2 183  MET n 
2 184  ALA n 
2 185  TYR n 
2 186  ALA n 
2 187  ARG n 
2 188  GLN n 
2 189  ILE n 
2 190  TYR n 
2 191  ILE n 
2 192  TYR n 
2 193  ASN n 
2 194  GLU n 
2 195  LYS n 
2 196  ILE n 
2 197  VAL n 
2 198  ASN n 
2 199  GLY n 
2 200  HIS n 
2 201  LEU n 
2 202  GLN n 
2 203  PRO n 
2 204  ASN n 
2 205  LEU n 
2 206  VAL n 
2 207  ASP n 
2 208  LEU n 
2 209  CYS n 
2 210  ALA n 
2 211  SER n 
2 212  VAL n 
2 213  ALA n 
2 214  GLU n 
2 215  LEU n 
2 216  ASP n 
2 217  ASP n 
2 218  LYS n 
2 219  SER n 
2 220  ILE n 
2 221  SER n 
2 222  ASP n 
2 223  MET n 
2 224  TRP n 
2 225  THR n 
2 226  MET n 
2 227  VAL n 
2 228  LYS n 
2 229  GLN n 
2 230  MET n 
2 231  THR n 
2 232  ASP n 
2 233  VAL n 
2 234  LEU n 
2 235  LEU n 
2 236  THR n 
2 237  PRO n 
2 238  ALA n 
2 239  THR n 
2 240  ASP n 
2 241  ALA n 
2 242  LEU n 
2 243  LYS n 
2 244  ASN n 
2 245  ARG n 
2 246  SER n 
2 247  SER n 
2 248  VAL n 
2 249  GLU n 
2 250  VAL n 
2 251  ARG n 
2 252  MET n 
2 253  GLU n 
2 254  PHE n 
2 255  VAL n 
2 256  ARG n 
2 257  GLN n 
2 258  ALA n 
2 259  LEU n 
2 260  ALA n 
2 261  TYR n 
2 262  LEU n 
2 263  GLU n 
2 264  GLN n 
2 265  SER n 
2 266  TYR n 
2 267  LYS n 
2 268  ASN n 
2 269  TYR n 
2 270  THR n 
2 271  LEU n 
2 272  VAL n 
2 273  THR n 
2 274  VAL n 
2 275  PHE n 
2 276  GLY n 
2 277  ASN n 
2 278  LEU n 
2 279  HIS n 
2 280  GLN n 
2 281  ALA n 
2 282  GLN n 
2 283  LEU n 
2 284  GLY n 
2 285  GLY n 
2 286  VAL n 
2 287  PRO n 
2 288  GLY n 
2 289  THR n 
2 290  TYR n 
2 291  GLN n 
2 292  LEU n 
2 293  VAL n 
2 294  ARG n 
2 295  SER n 
2 296  PHE n 
2 297  LEU n 
2 298  ASN n 
2 299  ILE n 
2 300  LYS n 
2 301  LEU n 
2 302  PRO n 
2 303  ALA n 
2 304  PRO n 
2 305  LEU n 
2 306  PRO n 
2 307  GLY n 
2 308  LEU n 
2 309  GLN n 
2 310  ASP n 
2 311  GLY n 
2 312  GLU n 
2 313  VAL n 
2 314  GLU n 
2 315  GLY n 
2 316  HIS n 
2 317  PRO n 
2 318  VAL n 
2 319  TRP n 
2 320  ALA n 
2 321  LEU n 
2 322  ILE n 
2 323  TYR n 
2 324  TYR n 
2 325  CYS n 
2 326  MET n 
2 327  ARG n 
2 328  CYS n 
2 329  GLY n 
2 330  ASP n 
2 331  LEU n 
2 332  LEU n 
2 333  ALA n 
2 334  ALA n 
2 335  SER n 
2 336  GLN n 
2 337  VAL n 
2 338  VAL n 
2 339  ASN n 
2 340  ARG n 
2 341  ALA n 
2 342  GLN n 
2 343  HIS n 
2 344  GLN n 
2 345  LEU n 
2 346  GLY n 
2 347  GLU n 
2 348  PHE n 
2 349  LYS n 
2 350  THR n 
2 351  TRP n 
2 352  PHE n 
2 353  GLN n 
2 354  GLU n 
2 355  TYR n 
2 356  MET n 
2 357  ASN n 
2 358  SER n 
2 359  LYS n 
2 360  ASP n 
2 361  ARG n 
2 362  ARG n 
2 363  LEU n 
2 364  SER n 
2 365  PRO n 
2 366  ALA n 
2 367  THR n 
2 368  GLU n 
2 369  ASN n 
2 370  LYS n 
2 371  LEU n 
2 372  ARG n 
2 373  LEU n 
2 374  HIS n 
2 375  TYR n 
2 376  ARG n 
2 377  ARG n 
2 378  ALA n 
2 379  LEU n 
2 380  ARG n 
2 381  ASN n 
2 382  ASN n 
2 383  THR n 
2 384  ASP n 
2 385  PRO n 
2 386  TYR n 
2 387  LYS n 
2 388  ARG n 
2 389  ALA n 
2 390  VAL n 
2 391  TYR n 
2 392  CYS n 
2 393  ILE n 
2 394  ILE n 
2 395  GLY n 
2 396  ARG n 
2 397  CYS n 
2 398  ASP n 
2 399  VAL n 
2 400  THR n 
2 401  ASP n 
2 402  ASN n 
2 403  GLN n 
2 404  SER n 
2 405  GLU n 
2 406  VAL n 
2 407  ALA n 
2 408  ASP n 
2 409  LYS n 
2 410  THR n 
2 411  GLU n 
2 412  ASP n 
2 413  TYR n 
2 414  LEU n 
2 415  TRP n 
2 416  LEU n 
2 417  LYS n 
2 418  LEU n 
2 419  ASN n 
2 420  GLN n 
2 421  VAL n 
2 422  CYS n 
2 423  PHE n 
2 424  ASP n 
2 425  ASP n 
2 426  ASP n 
2 427  GLY n 
2 428  THR n 
2 429  SER n 
2 430  SER n 
2 431  PRO n 
2 432  GLN n 
2 433  ASP n 
2 434  ARG n 
2 435  LEU n 
2 436  THR n 
2 437  LEU n 
2 438  SER n 
2 439  GLN n 
2 440  PHE n 
2 441  GLN n 
2 442  LYS n 
2 443  GLN n 
2 444  LEU n 
2 445  LEU n 
2 446  GLU n 
2 447  ASP n 
2 448  TYR n 
2 449  GLY n 
2 450  GLU n 
2 451  SER n 
2 452  HIS n 
2 453  PHE n 
2 454  THR n 
2 455  VAL n 
2 456  ASN n 
2 457  GLN n 
2 458  GLN n 
2 459  PRO n 
2 460  PHE n 
2 461  LEU n 
2 462  TYR n 
2 463  PHE n 
2 464  GLN n 
2 465  VAL n 
2 466  LEU n 
2 467  PHE n 
2 468  LEU n 
2 469  THR n 
2 470  ALA n 
2 471  GLN n 
2 472  PHE n 
2 473  GLU n 
2 474  ALA n 
2 475  ALA n 
2 476  VAL n 
2 477  ALA n 
2 478  PHE n 
2 479  LEU n 
2 480  PHE n 
2 481  ARG n 
2 482  MET n 
2 483  GLU n 
2 484  ARG n 
2 485  LEU n 
2 486  ARG n 
2 487  CYS n 
2 488  HIS n 
2 489  ALA n 
2 490  VAL n 
2 491  HIS n 
2 492  VAL n 
2 493  ALA n 
2 494  LEU n 
2 495  VAL n 
2 496  LEU n 
2 497  PHE n 
2 498  GLU n 
2 499  LEU n 
2 500  LYS n 
2 501  LEU n 
2 502  LEU n 
2 503  LEU n 
2 504  LYS n 
2 505  SER n 
2 506  SER n 
2 507  GLY n 
2 508  GLN n 
2 509  SER n 
2 510  ALA n 
2 511  GLN n 
2 512  LEU n 
2 513  LEU n 
2 514  SER n 
2 515  HIS n 
2 516  GLU n 
2 517  PRO n 
2 518  GLY n 
2 519  ASP n 
2 520  PRO n 
2 521  PRO n 
2 522  CYS n 
2 523  LEU n 
2 524  ARG n 
2 525  ARG n 
2 526  LEU n 
2 527  ASN n 
2 528  PHE n 
2 529  VAL n 
2 530  ARG n 
2 531  LEU n 
2 532  LEU n 
2 533  MET n 
2 534  LEU n 
2 535  TYR n 
2 536  THR n 
2 537  ARG n 
2 538  LYS n 
2 539  PHE n 
2 540  GLU n 
2 541  SER n 
2 542  THR n 
2 543  ASP n 
2 544  PRO n 
2 545  ARG n 
2 546  GLU n 
2 547  ALA n 
2 548  LEU n 
2 549  GLN n 
2 550  TYR n 
2 551  PHE n 
2 552  TYR n 
2 553  PHE n 
2 554  LEU n 
2 555  ARG n 
2 556  ASP n 
2 557  GLU n 
2 558  LYS n 
2 559  ASP n 
2 560  SER n 
2 561  GLN n 
2 562  GLY n 
2 563  GLU n 
2 564  ASN n 
2 565  MET n 
2 566  PHE n 
2 567  LEU n 
2 568  ARG n 
2 569  CYS n 
2 570  VAL n 
2 571  SER n 
2 572  GLU n 
2 573  LEU n 
2 574  VAL n 
2 575  ILE n 
2 576  GLU n 
2 577  SER n 
2 578  ARG n 
2 579  GLU n 
2 580  PHE n 
2 581  ASP n 
2 582  MET n 
2 583  ILE n 
2 584  LEU n 
2 585  GLY n 
2 586  LYS n 
2 587  LEU n 
2 588  GLU n 
2 589  ASN n 
2 590  ASP n 
2 591  GLY n 
2 592  SER n 
2 593  ARG n 
2 594  LYS n 
2 595  PRO n 
2 596  GLY n 
2 597  VAL n 
2 598  ILE n 
2 599  ASP n 
2 600  LYS n 
2 601  PHE n 
2 602  THR n 
2 603  SER n 
2 604  ASP n 
2 605  THR n 
2 606  LYS n 
2 607  PRO n 
2 608  ILE n 
2 609  ILE n 
2 610  ASN n 
2 611  LYS n 
2 612  VAL n 
2 613  ALA n 
2 614  SER n 
2 615  VAL n 
2 616  ALA n 
2 617  GLU n 
2 618  ASN n 
2 619  LYS n 
2 620  GLY n 
2 621  LEU n 
2 622  PHE n 
2 623  GLU n 
2 624  GLU n 
2 625  ALA n 
2 626  ALA n 
2 627  LYS n 
2 628  LEU n 
2 629  TYR n 
2 630  ASP n 
2 631  LEU n 
2 632  ALA n 
2 633  LYS n 
2 634  ASN n 
2 635  ALA n 
2 636  ASP n 
2 637  LYS n 
2 638  VAL n 
2 639  LEU n 
2 640  GLU n 
2 641  LEU n 
2 642  MET n 
2 643  ASN n 
2 644  LYS n 
2 645  LEU n 
2 646  LEU n 
2 647  SER n 
2 648  PRO n 
2 649  VAL n 
2 650  VAL n 
2 651  PRO n 
2 652  GLN n 
2 653  ILE n 
2 654  SER n 
2 655  ALA n 
2 656  PRO n 
2 657  GLN n 
2 658  SER n 
2 659  ASN n 
2 660  LYS n 
2 661  GLU n 
2 662  ARG n 
2 663  LEU n 
2 664  LYS n 
2 665  ASN n 
2 666  MET n 
2 667  ALA n 
2 668  LEU n 
2 669  SER n 
2 670  ILE n 
2 671  ALA n 
2 672  GLU n 
2 673  ARG n 
2 674  TYR n 
2 675  ARG n 
2 676  ALA n 
2 677  GLN n 
2 678  GLY n 
2 679  ILE n 
2 680  SER n 
2 681  ALA n 
2 682  ASN n 
2 683  LYS n 
2 684  PHE n 
2 685  VAL n 
2 686  ASP n 
2 687  SER n 
2 688  THR n 
2 689  PHE n 
2 690  TYR n 
2 691  LEU n 
2 692  LEU n 
2 693  LEU n 
2 694  ASP n 
2 695  LEU n 
2 696  ILE n 
2 697  THR n 
2 698  PHE n 
2 699  PHE n 
2 700  ASP n 
2 701  GLU n 
2 702  TYR n 
2 703  HIS n 
2 704  SER n 
2 705  GLY n 
2 706  HIS n 
2 707  ILE n 
2 708  ASP n 
2 709  ARG n 
2 710  ALA n 
2 711  PHE n 
2 712  ASP n 
2 713  ILE n 
2 714  ILE n 
2 715  GLU n 
2 716  ARG n 
2 717  LEU n 
2 718  LYS n 
2 719  LEU n 
2 720  VAL n 
2 721  PRO n 
2 722  LEU n 
2 723  ASN n 
2 724  GLN n 
2 725  GLU n 
2 726  SER n 
2 727  VAL n 
2 728  GLU n 
2 729  GLU n 
2 730  ARG n 
2 731  VAL n 
2 732  ALA n 
2 733  ALA n 
2 734  PHE n 
2 735  ARG n 
2 736  ASN n 
2 737  PHE n 
2 738  SER n 
2 739  ASP n 
2 740  GLU n 
2 741  ILE n 
2 742  ARG n 
2 743  HIS n 
2 744  ASN n 
2 745  LEU n 
2 746  SER n 
2 747  GLU n 
2 748  VAL n 
2 749  LEU n 
2 750  LEU n 
2 751  ALA n 
2 752  THR n 
2 753  MET n 
2 754  ASN n 
2 755  ILE n 
2 756  LEU n 
2 757  PHE n 
2 758  THR n 
2 759  GLN n 
2 760  PHE n 
2 761  LYS n 
2 762  ARG n 
2 763  LEU n 
2 764  LYS n 
2 765  GLY n 
2 766  THR n 
2 767  SER n 
2 768  PRO n 
2 769  SER n 
2 770  SER n 
2 771  SER n 
2 772  SER n 
2 773  ARG n 
2 774  PRO n 
2 775  GLN n 
2 776  ARG n 
2 777  VAL n 
2 778  ILE n 
2 779  GLU n 
2 780  ASP n 
2 781  ARG n 
2 782  ASP n 
2 783  SER n 
2 784  GLN n 
2 785  LEU n 
2 786  ARG n 
2 787  SER n 
2 788  GLN n 
2 789  ALA n 
2 790  ARG n 
2 791  THR n 
2 792  LEU n 
2 793  ILE n 
2 794  THR n 
2 795  PHE n 
2 796  ALA n 
2 797  GLY n 
2 798  MET n 
2 799  ILE n 
2 800  PRO n 
2 801  TYR n 
2 802  ARG n 
2 803  THR n 
2 804  SER n 
2 805  GLY n 
2 806  ASP n 
2 807  THR n 
2 808  ASN n 
2 809  ALA n 
2 810  ARG n 
2 811  LEU n 
2 812  VAL n 
2 813  GLN n 
2 814  MET n 
2 815  GLU n 
2 816  VAL n 
2 817  LEU n 
2 818  MET n 
2 819  ASN n 
3 1    MET n 
3 2    ALA n 
3 3    THR n 
3 4    PRO n 
3 5    LEU n 
3 6    ALA n 
3 7    VAL n 
3 8    ASN n 
3 9    SER n 
3 10   ALA n 
3 11   ALA n 
3 12   SER n 
3 13   LEU n 
3 14   TRP n 
3 15   GLY n 
3 16   PRO n 
3 17   TYR n 
3 18   LYS n 
3 19   ASP n 
3 20   ILE n 
3 21   TRP n 
3 22   HIS n 
3 23   LYS n 
3 24   VAL n 
3 25   GLY n 
3 26   ASN n 
3 27   ALA n 
3 28   LEU n 
3 29   TRP n 
3 30   ARG n 
3 31   ARG n 
3 32   GLN n 
3 33   PRO n 
3 34   GLU n 
3 35   ALA n 
3 36   VAL n 
3 37   HIS n 
3 38   LEU n 
3 39   LEU n 
3 40   ASP n 
3 41   LYS n 
3 42   ILE n 
3 43   LEU n 
3 44   LYS n 
3 45   LYS n 
3 46   HIS n 
3 47   LYS n 
3 48   PRO n 
3 49   ASP n 
3 50   PHE n 
3 51   ILE n 
3 52   SER n 
3 53   LEU n 
3 54   PHE n 
3 55   LYS n 
3 56   ASN n 
3 57   PRO n 
3 58   PRO n 
3 59   LYS n 
3 60   ASN n 
3 61   VAL n 
3 62   GLN n 
3 63   GLN n 
3 64   HIS n 
3 65   GLU n 
3 66   LYS n 
3 67   VAL n 
3 68   GLN n 
3 69   LYS n 
3 70   ALA n 
3 71   SER n 
3 72   THR n 
3 73   GLU n 
3 74   GLY n 
3 75   VAL n 
3 76   ALA n 
3 77   ILE n 
3 78   GLN n 
3 79   GLY n 
3 80   GLN n 
3 81   GLN n 
3 82   GLY n 
3 83   THR n 
3 84   ARG n 
3 85   LEU n 
3 86   LEU n 
3 87   PRO n 
3 88   GLU n 
3 89   GLN n 
3 90   LEU n 
3 91   ILE n 
3 92   LYS n 
3 93   GLU n 
3 94   ALA n 
3 95   PHE n 
3 96   ILE n 
3 97   LEU n 
3 98   SER n 
3 99   ASP n 
3 100  LEU n 
3 101  PHE n 
3 102  ASP n 
3 103  ILE n 
3 104  GLY n 
3 105  GLU n 
3 106  LEU n 
3 107  ALA n 
3 108  ALA n 
3 109  VAL n 
3 110  GLU n 
3 111  LEU n 
3 112  LEU n 
3 113  LEU n 
3 114  ALA n 
3 115  GLY n 
3 116  GLU n 
3 117  HIS n 
3 118  GLN n 
3 119  GLN n 
3 120  PRO n 
3 121  HIS n 
3 122  PHE n 
3 123  PRO n 
3 124  GLY n 
3 125  LEU n 
3 126  THR n 
3 127  ARG n 
3 128  GLY n 
3 129  LEU n 
3 130  VAL n 
3 131  ALA n 
3 132  VAL n 
3 133  LEU n 
3 134  LEU n 
3 135  TYR n 
3 136  TRP n 
3 137  ASP n 
3 138  GLY n 
3 139  LYS n 
3 140  ARG n 
3 141  CYS n 
3 142  ILE n 
3 143  ALA n 
3 144  ASN n 
3 145  SER n 
3 146  LEU n 
3 147  LYS n 
3 148  ALA n 
3 149  LEU n 
3 150  ILE n 
3 151  GLN n 
3 152  SER n 
3 153  ARG n 
3 154  ARG n 
3 155  GLY n 
3 156  LYS n 
3 157  THR n 
3 158  TRP n 
3 159  THR n 
3 160  LEU n 
3 161  GLU n 
3 162  LEU n 
3 163  SER n 
3 164  PRO n 
3 165  GLU n 
3 166  LEU n 
3 167  ALA n 
3 168  SER n 
3 169  MET n 
3 170  THR n 
3 171  THR n 
3 172  ARG n 
3 173  PHE n 
3 174  THR n 
3 175  ASP n 
3 176  GLU n 
3 177  LEU n 
3 178  MET n 
3 179  GLU n 
3 180  GLN n 
3 181  GLY n 
3 182  LEU n 
3 183  THR n 
3 184  TYR n 
3 185  LYS n 
3 186  VAL n 
3 187  LEU n 
3 188  THR n 
3 189  LEU n 
3 190  VAL n 
3 191  SER n 
3 192  GLN n 
3 193  ILE n 
3 194  ASP n 
3 195  VAL n 
3 196  ASN n 
3 197  ASN n 
3 198  GLU n 
3 199  PHE n 
3 200  GLU n 
3 201  LYS n 
3 202  LEU n 
3 203  GLN n 
3 204  ARG n 
3 205  GLU n 
3 206  ARG n 
3 207  GLY n 
3 208  LEU n 
3 209  GLY n 
3 210  SER n 
3 211  GLU n 
3 212  LYS n 
3 213  HIS n 
3 214  ARG n 
3 215  LYS n 
3 216  GLU n 
3 217  VAL n 
3 218  SER n 
3 219  ASP n 
3 220  LEU n 
3 221  ILE n 
3 222  LYS n 
3 223  GLU n 
3 224  CYS n 
3 225  ARG n 
3 226  GLN n 
3 227  SER n 
3 228  LEU n 
3 229  ALA n 
3 230  GLU n 
3 231  SER n 
3 232  LEU n 
3 233  PHE n 
3 234  ALA n 
3 235  TRP n 
3 236  ALA n 
3 237  CYS n 
3 238  GLN n 
3 239  SER n 
3 240  PRO n 
3 241  LEU n 
3 242  GLY n 
3 243  LYS n 
3 244  GLU n 
3 245  ASP n 
3 246  THR n 
3 247  LEU n 
3 248  LEU n 
3 249  LEU n 
3 250  ILE n 
3 251  GLY n 
3 252  HIS n 
3 253  LEU n 
3 254  GLU n 
3 255  ARG n 
3 256  VAL n 
3 257  THR n 
3 258  VAL n 
3 259  GLU n 
3 260  ALA n 
3 261  ASN n 
3 262  GLY n 
3 263  SER n 
3 264  LEU n 
3 265  ASP n 
3 266  ALA n 
3 267  VAL n 
3 268  ASN n 
3 269  LEU n 
3 270  ALA n 
3 271  LEU n 
3 272  LEU n 
3 273  MET n 
3 274  ALA n 
3 275  LEU n 
3 276  LEU n 
3 277  TYR n 
3 278  CYS n 
3 279  PHE n 
3 280  ASP n 
3 281  ILE n 
3 282  SER n 
3 283  PHE n 
3 284  ILE n 
3 285  GLU n 
3 286  GLN n 
3 287  SER n 
3 288  THR n 
3 289  GLU n 
3 290  GLU n 
3 291  ARG n 
3 292  ASP n 
3 293  ASP n 
3 294  MET n 
3 295  ILE n 
3 296  HIS n 
3 297  GLN n 
3 298  LEU n 
3 299  PRO n 
3 300  LEU n 
3 301  LEU n 
3 302  THR n 
3 303  GLU n 
3 304  LYS n 
3 305  GLN n 
3 306  TYR n 
3 307  ILE n 
3 308  ALA n 
3 309  THR n 
3 310  ILE n 
3 311  HIS n 
3 312  SER n 
3 313  ARG n 
3 314  LEU n 
3 315  GLN n 
3 316  ASP n 
3 317  SER n 
3 318  GLN n 
3 319  LEU n 
3 320  TRP n 
3 321  LYS n 
3 322  LEU n 
3 323  PRO n 
3 324  GLY n 
3 325  LEU n 
3 326  GLN n 
3 327  ALA n 
3 328  THR n 
3 329  VAL n 
3 330  ARG n 
3 331  LEU n 
3 332  ALA n 
3 333  TRP n 
3 334  ALA n 
3 335  LEU n 
3 336  ALA n 
3 337  LEU n 
3 338  ARG n 
3 339  GLY n 
3 340  ILE n 
3 341  SER n 
3 342  GLN n 
3 343  LEU n 
3 344  PRO n 
3 345  ASP n 
3 346  VAL n 
3 347  THR n 
3 348  ALA n 
3 349  LEU n 
3 350  ALA n 
3 351  GLU n 
3 352  PHE n 
3 353  THR n 
3 354  GLU n 
3 355  ALA n 
3 356  ASP n 
3 357  GLU n 
3 358  ALA n 
3 359  MET n 
3 360  ALA n 
3 361  GLU n 
3 362  LEU n 
3 363  ALA n 
3 364  ILE n 
3 365  ALA n 
3 366  ASP n 
3 367  ASN n 
3 368  VAL n 
3 369  PHE n 
3 370  LEU n 
3 371  PHE n 
3 372  LEU n 
3 373  MET n 
3 374  GLU n 
3 375  SER n 
3 376  VAL n 
3 377  VAL n 
3 378  VAL n 
3 379  SER n 
3 380  GLU n 
3 381  TYR n 
3 382  PHE n 
3 383  TYR n 
3 384  GLN n 
3 385  GLU n 
3 386  GLU n 
3 387  PHE n 
3 388  TYR n 
3 389  ILE n 
3 390  ARG n 
3 391  ARG n 
3 392  VAL n 
3 393  HIS n 
3 394  ASN n 
3 395  LEU n 
3 396  ILE n 
3 397  THR n 
3 398  ASP n 
3 399  PHE n 
3 400  LEU n 
3 401  ALA n 
3 402  LEU n 
3 403  MET n 
3 404  PRO n 
3 405  MET n 
3 406  LYS n 
3 407  VAL n 
3 408  LYS n 
3 409  GLN n 
3 410  LEU n 
3 411  ARG n 
3 412  ASN n 
3 413  ARG n 
3 414  ALA n 
3 415  ASP n 
3 416  GLU n 
3 417  ASP n 
3 418  ALA n 
3 419  ARG n 
3 420  MET n 
3 421  ILE n 
3 422  HIS n 
3 423  MET n 
3 424  SER n 
3 425  MET n 
3 426  GLN n 
3 427  MET n 
3 428  GLY n 
3 429  ASN n 
3 430  GLU n 
3 431  PRO n 
3 432  PRO n 
3 433  ILE n 
3 434  SER n 
3 435  LEU n 
3 436  ARG n 
3 437  ARG n 
3 438  ASP n 
3 439  LEU n 
3 440  GLU n 
3 441  HIS n 
3 442  LEU n 
3 443  MET n 
3 444  LEU n 
3 445  LEU n 
3 446  ILE n 
3 447  GLY n 
3 448  GLU n 
3 449  LEU n 
3 450  TYR n 
3 451  LYS n 
3 452  LYS n 
3 453  ASN n 
3 454  PRO n 
3 455  PHE n 
3 456  HIS n 
3 457  LEU n 
3 458  GLU n 
3 459  LEU n 
3 460  ALA n 
3 461  LEU n 
3 462  GLU n 
3 463  TYR n 
3 464  TRP n 
3 465  CYS n 
3 466  PRO n 
3 467  THR n 
3 468  GLU n 
3 469  PRO n 
3 470  LEU n 
3 471  GLN n 
3 472  THR n 
3 473  PRO n 
3 474  THR n 
3 475  ILE n 
3 476  MET n 
3 477  GLY n 
3 478  SER n 
3 479  TYR n 
3 480  LEU n 
3 481  GLY n 
3 482  VAL n 
3 483  ALA n 
3 484  HIS n 
3 485  GLN n 
3 486  ARG n 
3 487  PRO n 
3 488  PRO n 
3 489  GLN n 
3 490  ARG n 
3 491  GLN n 
3 492  VAL n 
3 493  VAL n 
3 494  LEU n 
3 495  SER n 
3 496  LYS n 
3 497  PHE n 
3 498  VAL n 
3 499  ARG n 
3 500  GLN n 
3 501  MET n 
3 502  GLY n 
3 503  ASP n 
3 504  LEU n 
3 505  LEU n 
3 506  PRO n 
3 507  PRO n 
3 508  THR n 
3 509  ILE n 
3 510  TYR n 
3 511  ILE n 
3 512  PRO n 
3 513  TYR n 
3 514  LEU n 
3 515  LYS n 
3 516  MET n 
3 517  LEU n 
3 518  GLN n 
3 519  GLY n 
3 520  LEU n 
3 521  ALA n 
3 522  ASN n 
3 523  GLY n 
3 524  PRO n 
3 525  GLN n 
3 526  CYS n 
3 527  ALA n 
3 528  HIS n 
3 529  TYR n 
3 530  CYS n 
3 531  PHE n 
3 532  SER n 
3 533  LEU n 
3 534  LEU n 
3 535  LYS n 
3 536  VAL n 
3 537  ASN n 
3 538  GLY n 
3 539  SER n 
3 540  SER n 
3 541  HIS n 
3 542  VAL n 
3 543  GLU n 
3 544  ASN n 
3 545  ILE n 
3 546  GLN n 
3 547  GLY n 
3 548  ALA n 
3 549  GLY n 
3 550  GLY n 
3 551  SER n 
3 552  PRO n 
3 553  VAL n 
3 554  SER n 
3 555  TRP n 
3 556  GLU n 
3 557  HIS n 
3 558  PHE n 
3 559  PHE n 
3 560  HIS n 
3 561  SER n 
3 562  LEU n 
3 563  MET n 
3 564  LEU n 
3 565  TYR n 
3 566  HIS n 
3 567  GLU n 
3 568  HIS n 
3 569  LEU n 
3 570  ARG n 
3 571  LYS n 
3 572  ASP n 
3 573  LEU n 
3 574  PRO n 
3 575  SER n 
3 576  ALA n 
3 577  ASP n 
3 578  SER n 
3 579  VAL n 
3 580  GLN n 
3 581  TYR n 
3 582  ARG n 
3 583  HIS n 
3 584  LEU n 
3 585  PRO n 
3 586  SER n 
3 587  ARG n 
3 588  GLY n 
3 589  ILE n 
3 590  THR n 
3 591  GLN n 
3 592  LYS n 
3 593  GLU n 
3 594  GLN n 
3 595  ASP n 
3 596  GLY n 
3 597  LEU n 
3 598  ILE n 
3 599  ALA n 
3 600  PHE n 
3 601  LEU n 
3 602  GLN n 
3 603  LEU n 
3 604  THR n 
3 605  SER n 
3 606  THR n 
3 607  ILE n 
3 608  ILE n 
3 609  THR n 
3 610  TRP n 
3 611  SER n 
3 612  GLU n 
3 613  ASN n 
3 614  ALA n 
3 615  ARG n 
3 616  LEU n 
3 617  ALA n 
3 618  LEU n 
3 619  CYS n 
3 620  GLU n 
3 621  HIS n 
3 622  PRO n 
3 623  GLN n 
3 624  TRP n 
3 625  THR n 
3 626  PRO n 
3 627  VAL n 
3 628  VAL n 
3 629  VAL n 
3 630  ILE n 
3 631  LEU n 
3 632  GLY n 
3 633  LEU n 
3 634  LEU n 
3 635  GLN n 
3 636  CYS n 
3 637  SER n 
3 638  ILE n 
3 639  PRO n 
3 640  PRO n 
3 641  VAL n 
3 642  LEU n 
3 643  LYS n 
3 644  ALA n 
3 645  GLU n 
3 646  LEU n 
3 647  LEU n 
3 648  LYS n 
3 649  THR n 
3 650  LEU n 
3 651  ALA n 
3 652  ALA n 
3 653  PHE n 
3 654  GLY n 
3 655  LYS n 
3 656  SER n 
3 657  PRO n 
3 658  GLU n 
3 659  ILE n 
3 660  ALA n 
3 661  ALA n 
3 662  SER n 
3 663  LEU n 
3 664  TRP n 
3 665  GLN n 
3 666  SER n 
3 667  LEU n 
3 668  GLU n 
3 669  TYR n 
3 670  THR n 
3 671  GLN n 
3 672  ILE n 
3 673  LEU n 
3 674  GLN n 
3 675  THR n 
3 676  VAL n 
3 677  ARG n 
3 678  ILE n 
3 679  PRO n 
3 680  SER n 
3 681  GLN n 
3 682  ARG n 
3 683  GLN n 
3 684  ALA n 
3 685  ILE n 
3 686  GLY n 
3 687  ILE n 
3 688  GLU n 
3 689  VAL n 
3 690  GLU n 
3 691  LEU n 
3 692  ASN n 
3 693  GLU n 
3 694  ILE n 
3 695  GLU n 
3 696  SER n 
3 697  ARG n 
3 698  CYS n 
3 699  GLU n 
3 700  GLU n 
3 701  TYR n 
3 702  PRO n 
3 703  LEU n 
3 704  THR n 
3 705  ARG n 
3 706  ALA n 
3 707  PHE n 
3 708  CYS n 
3 709  GLN n 
3 710  LEU n 
3 711  ILE n 
3 712  SER n 
3 713  THR n 
3 714  LEU n 
3 715  VAL n 
3 716  GLU n 
3 717  SER n 
3 718  SER n 
3 719  PHE n 
3 720  PRO n 
3 721  SER n 
3 722  ASN n 
3 723  LEU n 
3 724  GLY n 
3 725  ALA n 
3 726  GLY n 
3 727  LEU n 
3 728  ARG n 
3 729  PRO n 
3 730  PRO n 
3 731  GLY n 
3 732  PHE n 
3 733  ASP n 
3 734  PRO n 
3 735  TYR n 
3 736  LEU n 
3 737  GLN n 
3 738  PHE n 
3 739  LEU n 
3 740  ARG n 
3 741  ASP n 
3 742  SER n 
3 743  VAL n 
3 744  PHE n 
3 745  LEU n 
3 746  ARG n 
3 747  PHE n 
3 748  ARG n 
3 749  THR n 
3 750  ARG n 
3 751  ALA n 
3 752  TYR n 
3 753  ARG n 
3 754  ARG n 
3 755  ALA n 
3 756  ALA n 
3 757  GLU n 
3 758  LYS n 
3 759  TRP n 
3 760  GLU n 
3 761  VAL n 
3 762  ALA n 
3 763  GLU n 
3 764  VAL n 
3 765  VAL n 
3 766  LEU n 
3 767  GLU n 
3 768  VAL n 
3 769  PHE n 
3 770  TYR n 
3 771  LYS n 
3 772  LEU n 
3 773  LEU n 
3 774  ARG n 
3 775  ASP n 
3 776  TYR n 
3 777  GLU n 
3 778  PRO n 
3 779  GLN n 
3 780  LEU n 
3 781  GLU n 
3 782  ASP n 
3 783  PHE n 
3 784  VAL n 
3 785  ASP n 
3 786  GLN n 
3 787  PHE n 
3 788  VAL n 
3 789  GLU n 
3 790  LEU n 
3 791  GLN n 
3 792  GLY n 
3 793  GLU n 
3 794  GLU n 
3 795  ILE n 
3 796  ILE n 
3 797  ALA n 
3 798  TYR n 
3 799  LYS n 
3 800  PRO n 
3 801  PRO n 
3 802  GLY n 
3 803  PHE n 
3 804  SER n 
3 805  LEU n 
3 806  MET n 
3 807  TYR n 
3 808  HIS n 
3 809  LEU n 
3 810  LEU n 
3 811  ASN n 
3 812  GLU n 
3 813  SER n 
3 814  PRO n 
3 815  MET n 
3 816  LEU n 
3 817  GLU n 
3 818  LEU n 
3 819  ALA n 
3 820  LEU n 
3 821  SER n 
3 822  LEU n 
3 823  LEU n 
3 824  GLU n 
3 825  GLU n 
3 826  GLY n 
3 827  VAL n 
3 828  LYS n 
3 829  GLN n 
3 830  LEU n 
3 831  ASP n 
3 832  THR n 
3 833  TYR n 
3 834  ALA n 
3 835  PRO n 
3 836  PHE n 
3 837  PRO n 
3 838  GLY n 
3 839  LYS n 
3 840  LYS n 
3 841  HIS n 
3 842  LEU n 
3 843  GLU n 
3 844  LYS n 
3 845  ALA n 
3 846  VAL n 
3 847  GLN n 
3 848  HIS n 
3 849  CYS n 
3 850  LEU n 
3 851  ALA n 
3 852  LEU n 
3 853  LEU n 
3 854  ASN n 
3 855  LEU n 
3 856  THR n 
3 857  LEU n 
3 858  GLN n 
3 859  LYS n 
3 860  GLU n 
3 861  ASN n 
3 862  LEU n 
3 863  PHE n 
3 864  MET n 
3 865  ASP n 
3 866  LEU n 
3 867  LEU n 
3 868  ARG n 
3 869  GLU n 
3 870  SER n 
3 871  GLN n 
3 872  LEU n 
3 873  ALA n 
3 874  LEU n 
3 875  ILE n 
3 876  VAL n 
3 877  CYS n 
3 878  PRO n 
3 879  LEU n 
3 880  GLU n 
3 881  GLN n 
3 882  LEU n 
3 883  LEU n 
3 884  GLN n 
3 885  GLY n 
3 886  ILE n 
3 887  ASN n 
3 888  PRO n 
3 889  ARG n 
3 890  THR n 
3 891  LYS n 
3 892  LYS n 
3 893  ALA n 
3 894  ASP n 
3 895  ASN n 
3 896  VAL n 
3 897  VAL n 
3 898  ASN n 
3 899  ILE n 
3 900  ALA n 
3 901  ARG n 
3 902  TYR n 
3 903  LEU n 
3 904  TYR n 
3 905  HIS n 
3 906  GLY n 
3 907  ASN n 
3 908  THR n 
3 909  ASN n 
3 910  PRO n 
3 911  GLU n 
3 912  LEU n 
3 913  ALA n 
3 914  PHE n 
3 915  GLU n 
3 916  SER n 
3 917  ALA n 
3 918  LYS n 
3 919  ILE n 
3 920  LEU n 
3 921  CYS n 
3 922  CYS n 
3 923  ILE n 
3 924  SER n 
3 925  CYS n 
3 926  ASN n 
3 927  SER n 
3 928  ASN n 
3 929  ILE n 
3 930  GLN n 
3 931  ILE n 
3 932  LYS n 
3 933  LEU n 
3 934  VAL n 
3 935  GLY n 
3 936  ASP n 
3 937  PHE n 
3 938  THR n 
3 939  HIS n 
3 940  ASP n 
3 941  GLN n 
3 942  SER n 
3 943  ILE n 
3 944  SER n 
3 945  GLN n 
3 946  LYS n 
3 947  LEU n 
3 948  MET n 
3 949  ALA n 
3 950  GLY n 
3 951  PHE n 
3 952  VAL n 
3 953  GLU n 
3 954  CYS n 
3 955  LEU n 
3 956  ASP n 
3 957  CYS n 
3 958  GLU n 
3 959  ASP n 
3 960  ALA n 
3 961  GLU n 
3 962  GLU n 
3 963  PHE n 
3 964  VAL n 
3 965  ARG n 
3 966  LEU n 
3 967  GLU n 
3 968  GLU n 
3 969  GLY n 
3 970  SER n 
3 971  GLU n 
3 972  LEU n 
3 973  GLU n 
3 974  LYS n 
3 975  LYS n 
3 976  LEU n 
3 977  VAL n 
3 978  ALA n 
3 979  ILE n 
3 980  ARG n 
3 981  HIS n 
3 982  GLU n 
3 983  THR n 
3 984  ARG n 
3 985  ILE n 
3 986  HIS n 
3 987  ILE n 
3 988  LEU n 
3 989  ASN n 
3 990  LEU n 
3 991  LEU n 
3 992  ILE n 
3 993  THR n 
3 994  SER n 
3 995  LEU n 
3 996  GLU n 
3 997  CYS n 
3 998  ASN n 
3 999  PRO n 
3 1000 PRO n 
3 1001 ASN n 
3 1002 LEU n 
3 1003 ALA n 
3 1004 LEU n 
3 1005 TYR n 
3 1006 LEU n 
3 1007 LEU n 
3 1008 GLY n 
3 1009 PHE n 
3 1010 GLU n 
3 1011 LEU n 
3 1012 LYS n 
3 1013 LYS n 
3 1014 PRO n 
3 1015 VAL n 
3 1016 SER n 
3 1017 THR n 
3 1018 THR n 
3 1019 ASN n 
3 1020 LEU n 
3 1021 GLN n 
3 1022 ASP n 
3 1023 PRO n 
3 1024 GLY n 
3 1025 VAL n 
3 1026 LEU n 
3 1027 GLY n 
3 1028 CYS n 
3 1029 PRO n 
3 1030 ARG n 
3 1031 THR n 
3 1032 CYS n 
3 1033 LEU n 
3 1034 HIS n 
3 1035 ALA n 
3 1036 ILE n 
3 1037 LEU n 
3 1038 ASN n 
3 1039 ILE n 
3 1040 LEU n 
3 1041 GLU n 
3 1042 LYS n 
3 1043 GLY n 
3 1044 THR n 
3 1045 GLU n 
3 1046 GLY n 
3 1047 ARG n 
3 1048 THR n 
3 1049 GLY n 
3 1050 PRO n 
3 1051 VAL n 
3 1052 ALA n 
3 1053 VAL n 
3 1054 ARG n 
3 1055 GLU n 
3 1056 SER n 
3 1057 PRO n 
3 1058 GLN n 
3 1059 LEU n 
3 1060 ALA n 
3 1061 GLU n 
3 1062 LEU n 
3 1063 CYS n 
3 1064 TYR n 
3 1065 GLN n 
3 1066 VAL n 
3 1067 ILE n 
3 1068 TYR n 
3 1069 GLN n 
3 1070 LEU n 
3 1071 CYS n 
3 1072 ALA n 
3 1073 CYS n 
3 1074 SER n 
3 1075 ASP n 
3 1076 THR n 
3 1077 SER n 
3 1078 GLY n 
3 1079 PRO n 
3 1080 THR n 
3 1081 MET n 
3 1082 ARG n 
3 1083 TYR n 
3 1084 LEU n 
3 1085 ARG n 
3 1086 THR n 
3 1087 SER n 
3 1088 GLN n 
3 1089 ASP n 
3 1090 PHE n 
3 1091 LEU n 
3 1092 PHE n 
3 1093 SER n 
3 1094 GLN n 
3 1095 LEU n 
3 1096 GLN n 
3 1097 TYR n 
3 1098 LEU n 
3 1099 PRO n 
3 1100 PHE n 
3 1101 SER n 
3 1102 ASN n 
3 1103 LYS n 
3 1104 GLU n 
3 1105 TYR n 
3 1106 GLU n 
3 1107 ILE n 
3 1108 SER n 
3 1109 MET n 
3 1110 LEU n 
3 1111 ASN n 
3 1112 GLN n 
3 1113 MET n 
3 1114 SER n 
3 1115 TRP n 
3 1116 LEU n 
3 1117 MET n 
3 1118 LYS n 
3 1119 THR n 
3 1120 ALA n 
3 1121 SER n 
3 1122 ILE n 
3 1123 GLU n 
3 1124 LEU n 
3 1125 ARG n 
3 1126 VAL n 
3 1127 THR n 
3 1128 SER n 
3 1129 LEU n 
3 1130 ASN n 
3 1131 ARG n 
3 1132 GLN n 
3 1133 ARG n 
3 1134 SER n 
3 1135 HIS n 
3 1136 THR n 
3 1137 GLN n 
3 1138 ARG n 
3 1139 LEU n 
3 1140 LEU n 
3 1141 HIS n 
3 1142 LEU n 
3 1143 LEU n 
3 1144 LEU n 
3 1145 ASP n 
3 1146 ASP n 
3 1147 MET n 
3 1148 PRO n 
3 1149 VAL n 
3 1150 LYS n 
3 1151 PRO n 
3 1152 TYR n 
3 1153 SER n 
3 1154 ASP n 
3 1155 GLY n 
3 1156 GLU n 
3 1157 GLY n 
3 1158 GLY n 
3 1159 ILE n 
3 1160 GLU n 
3 1161 ASP n 
3 1162 GLU n 
3 1163 ASN n 
3 1164 ARG n 
3 1165 SER n 
3 1166 VAL n 
3 1167 SER n 
3 1168 GLY n 
3 1169 PHE n 
3 1170 LEU n 
3 1171 HIS n 
3 1172 PHE n 
3 1173 ASP n 
3 1174 THR n 
3 1175 ALA n 
3 1176 THR n 
3 1177 LYS n 
3 1178 VAL n 
3 1179 ARG n 
3 1180 ARG n 
3 1181 LYS n 
3 1182 ILE n 
3 1183 LEU n 
3 1184 ASN n 
3 1185 ILE n 
3 1186 LEU n 
3 1187 ASP n 
3 1188 SER n 
3 1189 ILE n 
3 1190 ASP n 
3 1191 PHE n 
3 1192 SER n 
3 1193 GLN n 
3 1194 GLU n 
3 1195 ILE n 
3 1196 PRO n 
3 1197 GLU n 
3 1198 PRO n 
3 1199 LEU n 
3 1200 GLN n 
3 1201 LEU n 
3 1202 ASP n 
3 1203 PHE n 
3 1204 PHE n 
3 1205 ASP n 
3 1206 ARG n 
3 1207 ALA n 
3 1208 GLN n 
3 1209 ILE n 
3 1210 GLU n 
3 1211 GLN n 
3 1212 VAL n 
3 1213 ILE n 
3 1214 ALA n 
3 1215 ASN n 
3 1216 CYS n 
3 1217 GLU n 
3 1218 HIS n 
3 1219 LYS n 
3 1220 ASN n 
3 1221 LEU n 
3 1222 ARG n 
3 1223 GLY n 
3 1224 GLN n 
3 1225 THR n 
3 1226 VAL n 
3 1227 CYS n 
3 1228 ASN n 
3 1229 VAL n 
3 1230 LYS n 
3 1231 LEU n 
3 1232 LEU n 
3 1233 HIS n 
3 1234 ARG n 
3 1235 VAL n 
3 1236 LEU n 
3 1237 VAL n 
3 1238 ALA n 
3 1239 GLU n 
3 1240 VAL n 
3 1241 ASN n 
3 1242 ALA n 
3 1243 LEU n 
3 1244 GLN n 
3 1245 GLY n 
3 1246 MET n 
3 1247 ALA n 
3 1248 ALA n 
3 1249 ILE n 
3 1250 GLY n 
3 1251 GLN n 
3 1252 ARG n 
3 1253 PRO n 
3 1254 LEU n 
3 1255 LEU n 
3 1256 MET n 
3 1257 GLU n 
3 1258 GLU n 
3 1259 ILE n 
3 1260 SER n 
3 1261 THR n 
3 1262 VAL n 
3 1263 LEU n 
3 1264 GLN n 
3 1265 TYR n 
3 1266 VAL n 
3 1267 VAL n 
3 1268 GLY n 
3 1269 ARG n 
3 1270 ASN n 
3 1271 LYS n 
3 1272 LEU n 
3 1273 LEU n 
3 1274 GLN n 
3 1275 CYS n 
3 1276 LEU n 
3 1277 HIS n 
3 1278 ALA n 
3 1279 LYS n 
3 1280 ARG n 
3 1281 HIS n 
3 1282 ALA n 
3 1283 LEU n 
3 1284 GLU n 
3 1285 SER n 
3 1286 TRP n 
3 1287 ARG n 
3 1288 GLN n 
3 1289 LEU n 
3 1290 VAL n 
3 1291 GLU n 
3 1292 ILE n 
3 1293 ILE n 
3 1294 LEU n 
3 1295 THR n 
3 1296 ALA n 
3 1297 CYS n 
3 1298 PRO n 
3 1299 GLN n 
3 1300 ASP n 
3 1301 LEU n 
3 1302 ILE n 
3 1303 GLN n 
3 1304 ALA n 
3 1305 GLU n 
3 1306 ASP n 
3 1307 ARG n 
3 1308 GLN n 
3 1309 LEU n 
3 1310 ILE n 
3 1311 ILE n 
3 1312 ARG n 
3 1313 ASP n 
3 1314 ILE n 
3 1315 LEU n 
3 1316 GLN n 
3 1317 ASP n 
3 1318 VAL n 
3 1319 HIS n 
3 1320 ASP n 
3 1321 LYS n 
3 1322 ILE n 
3 1323 LEU n 
3 1324 ASP n 
3 1325 ASP n 
3 1326 GLU n 
3 1327 ALA n 
3 1328 ALA n 
3 1329 GLN n 
3 1330 GLU n 
3 1331 LEU n 
3 1332 MET n 
3 1333 PRO n 
3 1334 VAL n 
3 1335 VAL n 
3 1336 ALA n 
3 1337 GLY n 
3 1338 ALA n 
3 1339 VAL n 
3 1340 PHE n 
3 1341 THR n 
3 1342 LEU n 
3 1343 THR n 
3 1344 ALA n 
3 1345 HIS n 
3 1346 LEU n 
3 1347 SER n 
3 1348 GLN n 
3 1349 ALA n 
3 1350 VAL n 
3 1351 LEU n 
3 1352 THR n 
3 1353 GLU n 
3 1354 GLN n 
3 1355 LYS n 
3 1356 GLU n 
3 1357 THR n 
3 1358 SER n 
3 1359 VAL n 
3 1360 LEU n 
3 1361 GLY n 
3 1362 PRO n 
3 1363 ALA n 
3 1364 GLU n 
3 1365 ALA n 
3 1366 HIS n 
3 1367 TYR n 
3 1368 ALA n 
3 1369 PHE n 
3 1370 MET n 
3 1371 LEU n 
3 1372 ASP n 
3 1373 SER n 
3 1374 CYS n 
3 1375 PHE n 
3 1376 THR n 
3 1377 SER n 
3 1378 PRO n 
3 1379 PRO n 
3 1380 PRO n 
3 1381 GLU n 
3 1382 GLU n 
3 1383 ASN n 
3 1384 PRO n 
3 1385 LEU n 
3 1386 VAL n 
3 1387 GLY n 
3 1388 PHE n 
3 1389 ALA n 
3 1390 SER n 
3 1391 ILE n 
3 1392 GLY n 
3 1393 ASP n 
3 1394 SER n 
3 1395 SER n 
3 1396 LEU n 
3 1397 TYR n 
3 1398 ILE n 
3 1399 ILE n 
3 1400 LEU n 
3 1401 LYS n 
3 1402 LYS n 
3 1403 LEU n 
3 1404 LEU n 
3 1405 ASP n 
3 1406 PHE n 
3 1407 ILE n 
3 1408 LEU n 
3 1409 LYS n 
3 1410 THR n 
3 1411 GLY n 
3 1412 GLY n 
3 1413 GLY n 
3 1414 PHE n 
3 1415 GLN n 
3 1416 ARG n 
3 1417 VAL n 
3 1418 ARG n 
3 1419 THR n 
3 1420 HIS n 
3 1421 LEU n 
3 1422 TYR n 
3 1423 GLY n 
3 1424 SER n 
3 1425 LEU n 
3 1426 LEU n 
3 1427 TYR n 
3 1428 TYR n 
3 1429 LEU n 
3 1430 GLN n 
3 1431 ILE n 
3 1432 ALA n 
3 1433 GLN n 
3 1434 ARG n 
3 1435 PRO n 
3 1436 ASP n 
3 1437 GLU n 
3 1438 PRO n 
3 1439 ASP n 
3 1440 THR n 
3 1441 LEU n 
3 1442 GLU n 
3 1443 ALA n 
3 1444 ALA n 
3 1445 LYS n 
3 1446 LYS n 
3 1447 THR n 
3 1448 MET n 
3 1449 TRP n 
3 1450 GLU n 
3 1451 ARG n 
3 1452 LEU n 
3 1453 THR n 
3 1454 ALA n 
3 1455 PRO n 
3 1456 GLU n 
3 1457 ASP n 
3 1458 VAL n 
3 1459 PHE n 
3 1460 SER n 
3 1461 LYS n 
3 1462 LEU n 
3 1463 GLN n 
3 1464 ARG n 
3 1465 GLU n 
3 1466 ASN n 
3 1467 ILE n 
3 1468 ALA n 
3 1469 ILE n 
3 1470 ILE n 
3 1471 GLU n 
3 1472 SER n 
3 1473 TYR n 
3 1474 GLY n 
3 1475 ALA n 
3 1476 ALA n 
3 1477 LEU n 
3 1478 MET n 
3 1479 GLU n 
3 1480 VAL n 
3 1481 VAL n 
3 1482 CYS n 
3 1483 ARG n 
3 1484 ASP n 
3 1485 ALA n 
3 1486 CYS n 
3 1487 ASP n 
3 1488 GLY n 
3 1489 HIS n 
3 1490 GLU n 
3 1491 ILE n 
3 1492 GLY n 
3 1493 ARG n 
3 1494 MET n 
3 1495 LEU n 
3 1496 ALA n 
3 1497 LEU n 
3 1498 ALA n 
3 1499 LEU n 
3 1500 LEU n 
3 1501 ASP n 
3 1502 ARG n 
3 1503 ILE n 
3 1504 VAL n 
3 1505 SER n 
3 1506 VAL n 
3 1507 ASP n 
3 1508 LYS n 
3 1509 GLN n 
3 1510 GLN n 
3 1511 GLN n 
3 1512 TRP n 
3 1513 LEU n 
3 1514 LEU n 
3 1515 TYR n 
3 1516 LEU n 
3 1517 SER n 
3 1518 ASN n 
3 1519 SER n 
3 1520 GLY n 
3 1521 TYR n 
3 1522 LEU n 
3 1523 LYS n 
3 1524 VAL n 
3 1525 LEU n 
3 1526 VAL n 
3 1527 ASP n 
3 1528 SER n 
3 1529 LEU n 
3 1530 VAL n 
3 1531 GLU n 
3 1532 ASP n 
3 1533 ASP n 
3 1534 ARG n 
3 1535 THR n 
3 1536 LEU n 
3 1537 GLN n 
3 1538 SER n 
3 1539 LEU n 
3 1540 LEU n 
3 1541 THR n 
3 1542 PRO n 
3 1543 GLN n 
3 1544 PRO n 
3 1545 PRO n 
3 1546 LEU n 
3 1547 LEU n 
3 1548 LYS n 
3 1549 ALA n 
3 1550 LEU n 
3 1551 TYR n 
3 1552 THR n 
3 1553 TYR n 
3 1554 GLU n 
3 1555 SER n 
3 1556 LYS n 
3 1557 MET n 
3 1558 ALA n 
3 1559 PHE n 
3 1560 LEU n 
3 1561 THR n 
3 1562 ARG n 
3 1563 VAL n 
3 1564 ALA n 
3 1565 LYS n 
3 1566 ILE n 
3 1567 GLN n 
3 1568 GLN n 
3 1569 GLY n 
3 1570 ALA n 
3 1571 LEU n 
3 1572 GLU n 
3 1573 LEU n 
3 1574 LEU n 
3 1575 ARG n 
3 1576 SER n 
3 1577 GLY n 
3 1578 VAL n 
3 1579 ILE n 
3 1580 VAL n 
3 1581 ARG n 
3 1582 LEU n 
3 1583 ALA n 
3 1584 GLN n 
3 1585 CYS n 
3 1586 GLN n 
3 1587 VAL n 
3 1588 TYR n 
3 1589 ASP n 
3 1590 MET n 
3 1591 ARG n 
3 1592 PRO n 
3 1593 GLU n 
3 1594 THR n 
3 1595 ASP n 
3 1596 PRO n 
3 1597 GLN n 
3 1598 SER n 
3 1599 MET n 
3 1600 PHE n 
3 1601 GLY n 
3 1602 MET n 
3 1603 ARG n 
3 1604 ASP n 
3 1605 PRO n 
3 1606 PRO n 
3 1607 MET n 
3 1608 PHE n 
3 1609 ILE n 
3 1610 PRO n 
3 1611 THR n 
3 1612 PRO n 
3 1613 VAL n 
3 1614 ASP n 
3 1615 ARG n 
3 1616 TYR n 
3 1617 ARG n 
3 1618 GLN n 
3 1619 ILE n 
3 1620 LEU n 
3 1621 LEU n 
3 1622 PRO n 
3 1623 ALA n 
3 1624 LEU n 
3 1625 GLN n 
3 1626 LEU n 
3 1627 CYS n 
3 1628 GLN n 
3 1629 VAL n 
3 1630 ILE n 
3 1631 LEU n 
3 1632 THR n 
3 1633 SER n 
3 1634 SER n 
3 1635 MET n 
3 1636 ALA n 
3 1637 GLN n 
3 1638 HIS n 
3 1639 LEU n 
3 1640 GLN n 
3 1641 ALA n 
3 1642 ALA n 
3 1643 GLY n 
3 1644 GLN n 
3 1645 VAL n 
3 1646 LEU n 
3 1647 GLN n 
3 1648 PHE n 
3 1649 LEU n 
3 1650 ILE n 
3 1651 SER n 
3 1652 HIS n 
3 1653 SER n 
3 1654 ASP n 
3 1655 THR n 
3 1656 ILE n 
3 1657 GLN n 
3 1658 ALA n 
3 1659 ILE n 
3 1660 LEU n 
3 1661 ARG n 
3 1662 CYS n 
3 1663 GLN n 
3 1664 ASP n 
3 1665 VAL n 
3 1666 SER n 
3 1667 ALA n 
3 1668 GLY n 
3 1669 SER n 
3 1670 LEU n 
3 1671 GLN n 
3 1672 GLU n 
3 1673 LEU n 
3 1674 ALA n 
3 1675 LEU n 
3 1676 LEU n 
3 1677 THR n 
3 1678 GLY n 
3 1679 ILE n 
3 1680 ILE n 
3 1681 SER n 
3 1682 LYS n 
3 1683 ALA n 
3 1684 ALA n 
3 1685 LEU n 
3 1686 PRO n 
3 1687 GLY n 
3 1688 ILE n 
3 1689 LEU n 
3 1690 SER n 
3 1691 GLU n 
3 1692 LEU n 
3 1693 ASP n 
3 1694 VAL n 
3 1695 ASP n 
3 1696 VAL n 
3 1697 ASN n 
3 1698 GLU n 
3 1699 GLY n 
3 1700 SER n 
3 1701 LEU n 
3 1702 MET n 
3 1703 GLU n 
3 1704 LEU n 
3 1705 GLN n 
3 1706 GLY n 
3 1707 HIS n 
3 1708 ILE n 
3 1709 GLY n 
3 1710 ARG n 
3 1711 PHE n 
3 1712 GLN n 
3 1713 ARG n 
3 1714 GLN n 
3 1715 CYS n 
3 1716 LEU n 
3 1717 GLY n 
3 1718 LEU n 
3 1719 LEU n 
3 1720 SER n 
3 1721 ARG n 
3 1722 PHE n 
3 1723 GLY n 
3 1724 GLY n 
3 1725 SER n 
3 1726 ASP n 
3 1727 ARG n 
3 1728 LEU n 
3 1729 ARG n 
3 1730 GLN n 
3 1731 PHE n 
3 1732 LYS n 
3 1733 PHE n 
3 1734 GLN n 
3 1735 ASP n 
3 1736 ASP n 
3 1737 ASN n 
3 1738 VAL n 
3 1739 GLU n 
3 1740 GLY n 
3 1741 ASP n 
3 1742 LYS n 
3 1743 VAL n 
3 1744 SER n 
3 1745 LYS n 
3 1746 LYS n 
3 1747 ASP n 
3 1748 GLU n 
3 1749 ILE n 
3 1750 GLU n 
3 1751 LEU n 
3 1752 ALA n 
3 1753 MET n 
3 1754 GLN n 
3 1755 GLN n 
3 1756 ILE n 
3 1757 CYS n 
3 1758 ALA n 
3 1759 ASN n 
3 1760 VAL n 
3 1761 MET n 
3 1762 GLU n 
3 1763 TYR n 
3 1764 CYS n 
3 1765 GLN n 
3 1766 SER n 
3 1767 LEU n 
3 1768 MET n 
3 1769 LEU n 
3 1770 GLN n 
3 1771 SER n 
3 1772 SER n 
3 1773 PRO n 
3 1774 THR n 
3 1775 PHE n 
3 1776 GLN n 
3 1777 HIS n 
3 1778 ALA n 
3 1779 VAL n 
3 1780 CYS n 
3 1781 LEU n 
3 1782 PHE n 
3 1783 THR n 
3 1784 PRO n 
3 1785 SER n 
3 1786 LEU n 
3 1787 SER n 
3 1788 GLU n 
3 1789 THR n 
3 1790 VAL n 
3 1791 ASN n 
3 1792 ARG n 
3 1793 ASP n 
3 1794 GLY n 
3 1795 PRO n 
3 1796 ARG n 
3 1797 GLN n 
3 1798 ASP n 
3 1799 THR n 
3 1800 GLN n 
3 1801 ALA n 
3 1802 PRO n 
3 1803 VAL n 
3 1804 VAL n 
3 1805 PRO n 
3 1806 TYR n 
3 1807 TRP n 
3 1808 ARG n 
3 1809 LEU n 
3 1810 PRO n 
3 1811 GLY n 
3 1812 LEU n 
3 1813 GLY n 
3 1814 ILE n 
3 1815 ILE n 
3 1816 ILE n 
3 1817 TYR n 
3 1818 LEU n 
3 1819 LEU n 
3 1820 LYS n 
3 1821 GLN n 
3 1822 SER n 
3 1823 ALA n 
3 1824 ASN n 
3 1825 ASP n 
3 1826 PHE n 
3 1827 PHE n 
3 1828 SER n 
3 1829 TYR n 
3 1830 TYR n 
3 1831 ASP n 
3 1832 SER n 
3 1833 HIS n 
3 1834 ARG n 
3 1835 GLN n 
3 1836 SER n 
3 1837 VAL n 
3 1838 SER n 
3 1839 LYS n 
3 1840 LEU n 
3 1841 GLN n 
3 1842 ASN n 
3 1843 VAL n 
3 1844 GLU n 
3 1845 GLN n 
3 1846 LEU n 
3 1847 PRO n 
3 1848 PRO n 
3 1849 ASP n 
3 1850 GLU n 
3 1851 ILE n 
3 1852 LYS n 
3 1853 GLU n 
3 1854 LEU n 
3 1855 CYS n 
3 1856 GLN n 
3 1857 SER n 
3 1858 VAL n 
3 1859 MET n 
3 1860 PRO n 
3 1861 ALA n 
3 1862 GLY n 
3 1863 VAL n 
3 1864 ASP n 
3 1865 LYS n 
3 1866 ILE n 
3 1867 SER n 
3 1868 THR n 
3 1869 ALA n 
3 1870 GLN n 
3 1871 LYS n 
3 1872 TYR n 
3 1873 VAL n 
3 1874 LEU n 
3 1875 ALA n 
3 1876 ARG n 
3 1877 ARG n 
3 1878 ARG n 
3 1879 LEU n 
3 1880 VAL n 
3 1881 LYS n 
3 1882 VAL n 
3 1883 ILE n 
3 1884 ASN n 
3 1885 ASN n 
3 1886 ARG n 
3 1887 ALA n 
3 1888 LYS n 
3 1889 LEU n 
3 1890 LEU n 
3 1891 SER n 
3 1892 LEU n 
3 1893 CYS n 
3 1894 SER n 
3 1895 PHE n 
3 1896 ILE n 
3 1897 ILE n 
3 1898 GLU n 
3 1899 THR n 
3 1900 CYS n 
3 1901 LEU n 
3 1902 PHE n 
3 1903 ILE n 
3 1904 LEU n 
3 1905 TRP n 
3 1906 ARG n 
3 1907 HIS n 
3 1908 LEU n 
3 1909 GLU n 
3 1910 TYR n 
3 1911 TYR n 
3 1912 LEU n 
3 1913 LEU n 
3 1914 HIS n 
3 1915 CYS n 
3 1916 MET n 
3 1917 PRO n 
3 1918 THR n 
3 1919 ASP n 
3 1920 SER n 
3 1921 GLN n 
3 1922 ASP n 
3 1923 SER n 
3 1924 LEU n 
3 1925 PHE n 
3 1926 ALA n 
3 1927 SER n 
3 1928 ARG n 
3 1929 THR n 
3 1930 LEU n 
3 1931 PHE n 
3 1932 LYS n 
3 1933 SER n 
3 1934 ARG n 
3 1935 ARG n 
3 1936 LEU n 
3 1937 GLN n 
3 1938 ASP n 
3 1939 SER n 
3 1940 PHE n 
3 1941 ALA n 
3 1942 SER n 
3 1943 GLU n 
3 1944 THR n 
3 1945 ASN n 
3 1946 LEU n 
3 1947 ASP n 
3 1948 PHE n 
3 1949 ARG n 
3 1950 SER n 
3 1951 GLY n 
3 1952 LEU n 
3 1953 ALA n 
3 1954 ILE n 
3 1955 VAL n 
3 1956 SER n 
3 1957 GLN n 
3 1958 HIS n 
3 1959 ASP n 
3 1960 LEU n 
3 1961 ASP n 
3 1962 GLN n 
3 1963 LEU n 
3 1964 GLN n 
3 1965 ALA n 
3 1966 ASP n 
3 1967 ALA n 
3 1968 ILE n 
3 1969 ASN n 
3 1970 ALA n 
3 1971 PHE n 
3 1972 GLY n 
3 1973 GLU n 
3 1974 SER n 
3 1975 LEU n 
3 1976 GLN n 
3 1977 LYS n 
3 1978 LYS n 
3 1979 LEU n 
3 1980 LEU n 
3 1981 ASP n 
3 1982 ILE n 
3 1983 GLU n 
3 1984 GLY n 
3 1985 LEU n 
3 1986 TYR n 
3 1987 SER n 
3 1988 LYS n 
3 1989 VAL n 
3 1990 ARG n 
3 1991 SER n 
3 1992 ARG n 
3 1993 TYR n 
3 1994 SER n 
3 1995 PHE n 
3 1996 ILE n 
3 1997 GLN n 
3 1998 ALA n 
3 1999 LEU n 
3 2000 VAL n 
3 2001 ARG n 
3 2002 ARG n 
3 2003 ILE n 
3 2004 ARG n 
3 2005 GLY n 
3 2006 LEU n 
3 2007 LEU n 
3 2008 ARG n 
3 2009 ILE n 
3 2010 SER n 
3 2011 ARG n 
3 2012 ASN n 
4 1    MET n 
4 2    ALA n 
4 3    PHE n 
4 4    ASN n 
4 5    PHE n 
4 6    GLY n 
4 7    ALA n 
4 8    PRO n 
4 9    SER n 
4 10   GLY n 
4 11   THR n 
4 12   SER n 
4 13   GLY n 
4 14   THR n 
4 15   ALA n 
4 16   ALA n 
4 17   ALA n 
4 18   THR n 
4 19   ALA n 
4 20   ALA n 
4 21   PRO n 
4 22   ALA n 
4 23   GLY n 
4 24   GLY n 
4 25   PHE n 
4 26   GLY n 
4 27   GLY n 
4 28   PHE n 
4 29   GLY n 
4 30   THR n 
4 31   THR n 
4 32   SER n 
4 33   THR n 
4 34   THR n 
4 35   ALA n 
4 36   GLY n 
4 37   SER n 
4 38   ALA n 
4 39   PHE n 
4 40   SER n 
4 41   PHE n 
4 42   SER n 
4 43   ALA n 
4 44   PRO n 
4 45   THR n 
4 46   ASN n 
4 47   THR n 
4 48   GLY n 
4 49   THR n 
4 50   THR n 
4 51   GLY n 
4 52   LEU n 
4 53   PHE n 
4 54   GLY n 
4 55   GLY n 
4 56   THR n 
4 57   GLN n 
4 58   ASN n 
4 59   LYS n 
4 60   GLY n 
4 61   PHE n 
4 62   GLY n 
4 63   PHE n 
4 64   GLY n 
4 65   THR n 
4 66   GLY n 
4 67   PHE n 
4 68   GLY n 
4 69   THR n 
4 70   THR n 
4 71   THR n 
4 72   GLY n 
4 73   THR n 
4 74   SER n 
4 75   THR n 
4 76   GLY n 
4 77   LEU n 
4 78   GLY n 
4 79   THR n 
4 80   GLY n 
4 81   LEU n 
4 82   GLY n 
4 83   THR n 
4 84   GLY n 
4 85   LEU n 
4 86   GLY n 
4 87   PHE n 
4 88   GLY n 
4 89   GLY n 
4 90   PHE n 
4 91   ASN n 
4 92   THR n 
4 93   GLN n 
4 94   GLN n 
4 95   GLN n 
4 96   GLN n 
4 97   GLN n 
4 98   THR n 
4 99   THR n 
4 100  LEU n 
4 101  GLY n 
4 102  GLY n 
4 103  LEU n 
4 104  PHE n 
4 105  SER n 
4 106  GLN n 
4 107  PRO n 
4 108  THR n 
4 109  GLN n 
4 110  ALA n 
4 111  PRO n 
4 112  THR n 
4 113  GLN n 
4 114  SER n 
4 115  ASN n 
4 116  GLN n 
4 117  LEU n 
4 118  ILE n 
4 119  ASN n 
4 120  THR n 
4 121  ALA n 
4 122  SER n 
4 123  ALA n 
4 124  LEU n 
4 125  SER n 
4 126  ALA n 
4 127  PRO n 
4 128  THR n 
4 129  LEU n 
4 130  LEU n 
4 131  GLY n 
4 132  ASP n 
4 133  GLU n 
4 134  ARG n 
4 135  ASP n 
4 136  ALA n 
4 137  ILE n 
4 138  LEU n 
4 139  ALA n 
4 140  LYS n 
4 141  TRP n 
4 142  ASN n 
4 143  GLN n 
4 144  LEU n 
4 145  GLN n 
4 146  ALA n 
4 147  PHE n 
4 148  TRP n 
4 149  GLY n 
4 150  THR n 
4 151  GLY n 
4 152  LYS n 
4 153  GLY n 
4 154  TYR n 
4 155  PHE n 
4 156  ASN n 
4 157  ASN n 
4 158  ASN n 
4 159  ILE n 
4 160  PRO n 
4 161  PRO n 
4 162  VAL n 
4 163  GLU n 
4 164  PHE n 
4 165  THR n 
4 166  GLN n 
4 167  GLU n 
4 168  ASN n 
4 169  PRO n 
4 170  PHE n 
4 171  CYS n 
4 172  ARG n 
4 173  PHE n 
4 174  LYS n 
4 175  ALA n 
4 176  VAL n 
4 177  GLY n 
4 178  TYR n 
4 179  SER n 
4 180  CYS n 
4 181  MET n 
4 182  PRO n 
4 183  SER n 
4 184  ASN n 
4 185  LYS n 
4 186  ASP n 
4 187  GLU n 
4 188  ASP n 
4 189  GLY n 
4 190  LEU n 
4 191  VAL n 
4 192  VAL n 
4 193  LEU n 
4 194  VAL n 
4 195  PHE n 
4 196  ASN n 
4 197  LYS n 
4 198  LYS n 
4 199  GLU n 
4 200  THR n 
4 201  GLU n 
4 202  ILE n 
4 203  ARG n 
4 204  SER n 
4 205  GLN n 
4 206  GLN n 
4 207  GLN n 
4 208  GLN n 
4 209  LEU n 
4 210  VAL n 
4 211  GLU n 
4 212  SER n 
4 213  LEU n 
4 214  HIS n 
4 215  LYS n 
4 216  VAL n 
4 217  LEU n 
4 218  GLY n 
4 219  GLY n 
4 220  ASN n 
4 221  GLN n 
4 222  THR n 
4 223  LEU n 
4 224  THR n 
4 225  VAL n 
4 226  ASN n 
4 227  VAL n 
4 228  GLU n 
4 229  GLY n 
4 230  THR n 
4 231  LYS n 
4 232  THR n 
4 233  LEU n 
4 234  PRO n 
4 235  ASP n 
4 236  ASP n 
4 237  GLN n 
4 238  THR n 
4 239  GLU n 
4 240  VAL n 
4 241  VAL n 
4 242  ILE n 
4 243  TYR n 
4 244  VAL n 
4 245  VAL n 
4 246  GLU n 
4 247  ARG n 
4 248  SER n 
4 249  PRO n 
4 250  ASN n 
4 251  GLY n 
4 252  THR n 
4 253  SER n 
4 254  ARG n 
4 255  ARG n 
4 256  VAL n 
4 257  PRO n 
4 258  ALA n 
4 259  THR n 
4 260  THR n 
4 261  LEU n 
4 262  TYR n 
4 263  ALA n 
4 264  HIS n 
4 265  PHE n 
4 266  GLU n 
4 267  GLN n 
4 268  ALA n 
4 269  ASN n 
4 270  ILE n 
4 271  LYS n 
4 272  THR n 
4 273  GLN n 
4 274  LEU n 
4 275  GLN n 
4 276  GLN n 
4 277  LEU n 
4 278  GLY n 
4 279  VAL n 
4 280  THR n 
4 281  LEU n 
4 282  SER n 
4 283  MET n 
4 284  THR n 
4 285  ARG n 
4 286  THR n 
4 287  GLU n 
4 288  LEU n 
4 289  SER n 
4 290  PRO n 
4 291  ALA n 
4 292  GLN n 
4 293  ILE n 
4 294  LYS n 
4 295  GLN n 
4 296  LEU n 
4 297  LEU n 
4 298  GLN n 
4 299  ASN n 
4 300  PRO n 
4 301  PRO n 
4 302  ALA n 
4 303  GLY n 
4 304  VAL n 
4 305  ASP n 
4 306  PRO n 
4 307  ILE n 
4 308  ILE n 
4 309  TRP n 
4 310  GLU n 
4 311  GLN n 
4 312  ALA n 
4 313  LYS n 
4 314  VAL n 
4 315  ASP n 
4 316  ASN n 
4 317  PRO n 
4 318  ASP n 
4 319  SER n 
4 320  GLU n 
4 321  LYS n 
4 322  LEU n 
4 323  ILE n 
4 324  PRO n 
4 325  VAL n 
4 326  PRO n 
4 327  MET n 
4 328  VAL n 
4 329  GLY n 
4 330  PHE n 
4 331  LYS n 
4 332  GLU n 
4 333  LEU n 
4 334  LEU n 
4 335  ARG n 
4 336  ARG n 
4 337  LEU n 
4 338  LYS n 
4 339  VAL n 
4 340  GLN n 
4 341  ASP n 
4 342  GLN n 
4 343  MET n 
4 344  THR n 
4 345  LYS n 
4 346  GLN n 
4 347  HIS n 
4 348  GLN n 
4 349  THR n 
4 350  ARG n 
4 351  LEU n 
4 352  ASP n 
4 353  ILE n 
4 354  ILE n 
4 355  SER n 
4 356  GLU n 
4 357  ASP n 
4 358  ILE n 
4 359  SER n 
4 360  GLU n 
4 361  LEU n 
4 362  GLN n 
4 363  LYS n 
4 364  ASN n 
4 365  GLN n 
4 366  THR n 
4 367  THR n 
4 368  SER n 
4 369  VAL n 
4 370  ALA n 
4 371  LYS n 
4 372  ILE n 
4 373  ALA n 
4 374  GLN n 
4 375  TYR n 
4 376  LYS n 
4 377  ARG n 
4 378  LYS n 
4 379  LEU n 
4 380  MET n 
4 381  ASP n 
4 382  LEU n 
4 383  SER n 
4 384  HIS n 
4 385  ARG n 
4 386  THR n 
4 387  LEU n 
4 388  GLN n 
4 389  VAL n 
4 390  LEU n 
4 391  ILE n 
4 392  LYS n 
4 393  GLN n 
4 394  GLU n 
4 395  ILE n 
4 396  GLN n 
4 397  ARG n 
4 398  LYS n 
4 399  SER n 
4 400  GLY n 
4 401  TYR n 
4 402  ALA n 
4 403  ILE n 
4 404  GLN n 
4 405  ALA n 
4 406  ASP n 
4 407  GLU n 
4 408  GLU n 
4 409  GLN n 
4 410  LEU n 
4 411  ARG n 
4 412  VAL n 
4 413  GLN n 
4 414  LEU n 
4 415  ASP n 
4 416  THR n 
4 417  ILE n 
4 418  GLN n 
4 419  GLY n 
4 420  GLU n 
4 421  LEU n 
4 422  ASN n 
4 423  ALA n 
4 424  PRO n 
4 425  THR n 
4 426  GLN n 
4 427  PHE n 
4 428  LYS n 
4 429  GLY n 
4 430  ARG n 
4 431  LEU n 
4 432  ASN n 
4 433  GLU n 
4 434  LEU n 
4 435  MET n 
4 436  SER n 
4 437  GLN n 
4 438  ILE n 
4 439  ARG n 
4 440  MET n 
4 441  GLN n 
4 442  ASN n 
4 443  HIS n 
4 444  PHE n 
4 445  GLY n 
4 446  ALA n 
4 447  VAL n 
4 448  ARG n 
4 449  SER n 
4 450  GLU n 
4 451  GLU n 
4 452  ARG n 
4 453  TYR n 
4 454  TYR n 
4 455  ILE n 
4 456  ASP n 
4 457  ALA n 
4 458  ASP n 
4 459  LEU n 
4 460  LEU n 
4 461  ARG n 
4 462  GLU n 
4 463  ILE n 
4 464  LYS n 
4 465  GLN n 
4 466  HIS n 
4 467  LEU n 
4 468  LYS n 
4 469  GLN n 
4 470  GLN n 
4 471  GLN n 
4 472  GLU n 
4 473  GLY n 
4 474  LEU n 
4 475  SER n 
4 476  HIS n 
4 477  LEU n 
4 478  ILE n 
4 479  SER n 
4 480  ILE n 
4 481  ILE n 
4 482  LYS n 
4 483  ASP n 
4 484  ASP n 
4 485  LEU n 
4 486  GLU n 
4 487  ASP n 
4 488  ILE n 
4 489  LYS n 
4 490  LEU n 
4 491  VAL n 
4 492  GLU n 
4 493  HIS n 
4 494  GLY n 
4 495  LEU n 
4 496  ASN n 
4 497  GLU n 
4 498  THR n 
4 499  ILE n 
4 500  HIS n 
4 501  ILE n 
4 502  ARG n 
4 503  GLY n 
4 504  GLY n 
4 505  VAL n 
4 506  PHE n 
4 507  SER n 
5 1    MET n 
5 2    SER n 
5 3    THR n 
5 4    GLY n 
5 5    PHE n 
5 6    SER n 
5 7    PHE n 
5 8    GLY n 
5 9    SER n 
5 10   GLY n 
5 11   THR n 
5 12   LEU n 
5 13   GLY n 
5 14   SER n 
5 15   THR n 
5 16   THR n 
5 17   VAL n 
5 18   ALA n 
5 19   ALA n 
5 20   GLY n 
5 21   GLY n 
5 22   THR n 
5 23   SER n 
5 24   THR n 
5 25   GLY n 
5 26   GLY n 
5 27   VAL n 
5 28   PHE n 
5 29   SER n 
5 30   PHE n 
5 31   GLY n 
5 32   THR n 
5 33   GLY n 
5 34   ALA n 
5 35   SER n 
5 36   SER n 
5 37   ASN n 
5 38   PRO n 
5 39   SER n 
5 40   VAL n 
5 41   GLY n 
5 42   LEU n 
5 43   ASN n 
5 44   PHE n 
5 45   GLY n 
5 46   ASN n 
5 47   LEU n 
5 48   GLY n 
5 49   SER n 
5 50   THR n 
5 51   SER n 
5 52   THR n 
5 53   PRO n 
5 54   ALA n 
5 55   THR n 
5 56   THR n 
5 57   SER n 
5 58   ALA n 
5 59   PRO n 
5 60   SER n 
5 61   SER n 
5 62   GLY n 
5 63   PHE n 
5 64   GLY n 
5 65   THR n 
5 66   GLY n 
5 67   LEU n 
5 68   PHE n 
5 69   GLY n 
5 70   SER n 
5 71   LYS n 
5 72   PRO n 
5 73   ALA n 
5 74   THR n 
5 75   GLY n 
5 76   PHE n 
5 77   THR n 
5 78   LEU n 
5 79   GLY n 
5 80   GLY n 
5 81   THR n 
5 82   ASN n 
5 83   THR n 
5 84   GLY n 
5 85   ILE n 
5 86   ALA n 
5 87   THR n 
5 88   THR n 
5 89   ILE n 
5 90   THR n 
5 91   THR n 
5 92   GLY n 
5 93   LEU n 
5 94   THR n 
5 95   LEU n 
5 96   GLY n 
5 97   THR n 
5 98   PRO n 
5 99   ALA n 
5 100  THR n 
5 101  THR n 
5 102  SER n 
5 103  ALA n 
5 104  ALA n 
5 105  THR n 
5 106  THR n 
5 107  GLY n 
5 108  PHE n 
5 109  SER n 
5 110  LEU n 
5 111  GLY n 
5 112  PHE n 
5 113  ASN n 
5 114  LYS n 
5 115  PRO n 
5 116  ALA n 
5 117  ALA n 
5 118  SER n 
5 119  ALA n 
5 120  THR n 
5 121  PRO n 
5 122  PHE n 
5 123  ALA n 
5 124  LEU n 
5 125  PRO n 
5 126  ILE n 
5 127  THR n 
5 128  SER n 
5 129  THR n 
5 130  SER n 
5 131  ALA n 
5 132  SER n 
5 133  GLY n 
5 134  LEU n 
5 135  THR n 
5 136  LEU n 
5 137  SER n 
5 138  SER n 
5 139  ALA n 
5 140  LEU n 
5 141  THR n 
5 142  SER n 
5 143  THR n 
5 144  PRO n 
5 145  ALA n 
5 146  ALA n 
5 147  SER n 
5 148  THR n 
5 149  GLY n 
5 150  PHE n 
5 151  THR n 
5 152  LEU n 
5 153  ASN n 
5 154  ASN n 
5 155  LEU n 
5 156  GLY n 
5 157  GLY n 
5 158  THR n 
5 159  THR n 
5 160  ALA n 
5 161  THR n 
5 162  THR n 
5 163  THR n 
5 164  THR n 
5 165  ALA n 
5 166  SER n 
5 167  THR n 
5 168  GLY n 
5 169  LEU n 
5 170  SER n 
5 171  LEU n 
5 172  GLY n 
5 173  GLY n 
5 174  ALA n 
5 175  LEU n 
5 176  ALA n 
5 177  GLY n 
5 178  LEU n 
5 179  GLY n 
5 180  GLY n 
5 181  SER n 
5 182  LEU n 
5 183  PHE n 
5 184  GLN n 
5 185  SER n 
5 186  THR n 
5 187  ASN n 
5 188  THR n 
5 189  GLY n 
5 190  THR n 
5 191  SER n 
5 192  GLY n 
5 193  LEU n 
5 194  GLY n 
5 195  GLN n 
5 196  ASN n 
5 197  ALA n 
5 198  LEU n 
5 199  GLY n 
5 200  LEU n 
5 201  THR n 
5 202  LEU n 
5 203  GLY n 
5 204  THR n 
5 205  THR n 
5 206  ALA n 
5 207  ALA n 
5 208  THR n 
5 209  SER n 
5 210  THR n 
5 211  ALA n 
5 212  GLY n 
5 213  ASN n 
5 214  GLU n 
5 215  GLY n 
5 216  LEU n 
5 217  GLY n 
5 218  GLY n 
5 219  ILE n 
5 220  ASP n 
5 221  PHE n 
5 222  SER n 
5 223  SER n 
5 224  SER n 
5 225  SER n 
5 226  ASP n 
5 227  LYS n 
5 228  LYS n 
5 229  SER n 
5 230  ASP n 
5 231  LYS n 
5 232  THR n 
5 233  GLY n 
5 234  THR n 
5 235  ARG n 
5 236  PRO n 
5 237  GLU n 
5 238  ASP n 
5 239  SER n 
5 240  LYS n 
5 241  ALA n 
5 242  LEU n 
5 243  LYS n 
5 244  ASP n 
5 245  GLU n 
5 246  ASN n 
5 247  LEU n 
5 248  PRO n 
5 249  PRO n 
5 250  VAL n 
5 251  ILE n 
5 252  CYS n 
5 253  GLN n 
5 254  ASP n 
5 255  VAL n 
5 256  GLU n 
5 257  ASN n 
5 258  LEU n 
5 259  GLN n 
5 260  LYS n 
5 261  PHE n 
5 262  VAL n 
5 263  LYS n 
5 264  GLU n 
5 265  GLN n 
5 266  LYS n 
5 267  GLN n 
5 268  VAL n 
5 269  GLN n 
5 270  GLU n 
5 271  GLU n 
5 272  ILE n 
5 273  SER n 
5 274  ARG n 
5 275  MET n 
5 276  SER n 
5 277  SER n 
5 278  LYS n 
5 279  ALA n 
5 280  MET n 
5 281  LEU n 
5 282  LYS n 
5 283  VAL n 
5 284  GLN n 
5 285  GLU n 
5 286  ASP n 
5 287  ILE n 
5 288  LYS n 
5 289  ALA n 
5 290  LEU n 
5 291  LYS n 
5 292  GLN n 
5 293  LEU n 
5 294  LEU n 
5 295  SER n 
5 296  LEU n 
5 297  ALA n 
5 298  ALA n 
5 299  ASN n 
5 300  GLY n 
5 301  ILE n 
5 302  GLN n 
5 303  ARG n 
5 304  ASN n 
5 305  THR n 
5 306  LEU n 
5 307  ASN n 
5 308  ILE n 
5 309  ASP n 
5 310  LYS n 
5 311  LEU n 
5 312  LYS n 
5 313  ILE n 
5 314  GLU n 
5 315  THR n 
5 316  ALA n 
5 317  GLN n 
5 318  GLU n 
5 319  LEU n 
5 320  LYS n 
5 321  ASN n 
5 322  ALA n 
5 323  GLU n 
5 324  ILE n 
5 325  ALA n 
5 326  LEU n 
5 327  ARG n 
5 328  THR n 
5 329  GLN n 
5 330  LYS n 
5 331  THR n 
5 332  PRO n 
5 333  PRO n 
5 334  GLY n 
5 335  LEU n 
5 336  GLN n 
5 337  HIS n 
5 338  GLU n 
5 339  TYR n 
5 340  ALA n 
5 341  ALA n 
5 342  PRO n 
5 343  ALA n 
5 344  ASP n 
5 345  TYR n 
5 346  PHE n 
5 347  ARG n 
5 348  ILE n 
5 349  LEU n 
5 350  VAL n 
5 351  GLN n 
5 352  GLN n 
5 353  PHE n 
5 354  GLU n 
5 355  VAL n 
5 356  GLN n 
5 357  LEU n 
5 358  GLN n 
5 359  GLN n 
5 360  TYR n 
5 361  ARG n 
5 362  GLN n 
5 363  GLN n 
5 364  ILE n 
5 365  GLU n 
5 366  GLU n 
5 367  LEU n 
5 368  GLU n 
5 369  ASN n 
5 370  HIS n 
5 371  LEU n 
5 372  ALA n 
5 373  THR n 
5 374  GLN n 
5 375  ALA n 
5 376  ASN n 
5 377  ASN n 
5 378  SER n 
5 379  HIS n 
5 380  ILE n 
5 381  THR n 
5 382  PRO n 
5 383  GLN n 
5 384  ASP n 
5 385  LEU n 
5 386  SER n 
5 387  MET n 
5 388  ALA n 
5 389  MET n 
5 390  GLN n 
5 391  LYS n 
5 392  ILE n 
5 393  TYR n 
5 394  GLN n 
5 395  THR n 
5 396  PHE n 
5 397  VAL n 
5 398  ALA n 
5 399  LEU n 
5 400  ALA n 
5 401  ALA n 
5 402  GLN n 
5 403  LEU n 
5 404  GLN n 
5 405  SER n 
5 406  ILE n 
5 407  HIS n 
5 408  GLU n 
5 409  ASN n 
5 410  VAL n 
5 411  LYS n 
5 412  VAL n 
5 413  LEU n 
5 414  LYS n 
5 415  GLU n 
5 416  GLN n 
5 417  TYR n 
5 418  LEU n 
5 419  GLY n 
5 420  TYR n 
5 421  ARG n 
5 422  LYS n 
5 423  MET n 
5 424  PHE n 
5 425  LEU n 
5 426  GLY n 
5 427  ASP n 
5 428  ALA n 
5 429  VAL n 
5 430  ASP n 
5 431  VAL n 
5 432  PHE n 
5 433  GLU n 
5 434  THR n 
5 435  ARG n 
5 436  ARG n 
5 437  ALA n 
5 438  GLU n 
5 439  ALA n 
5 440  LYS n 
5 441  LYS n 
5 442  TRP n 
5 443  GLN n 
5 444  ASN n 
5 445  THR n 
5 446  PRO n 
5 447  ARG n 
5 448  VAL n 
5 449  THR n 
5 450  THR n 
5 451  GLY n 
5 452  PRO n 
5 453  THR n 
5 454  PRO n 
5 455  PHE n 
5 456  SER n 
5 457  THR n 
5 458  MET n 
5 459  PRO n 
5 460  ASN n 
5 461  ALA n 
5 462  ALA n 
5 463  ALA n 
5 464  VAL n 
5 465  ALA n 
5 466  MET n 
5 467  ALA n 
5 468  ALA n 
5 469  THR n 
5 470  LEU n 
5 471  THR n 
5 472  GLN n 
5 473  GLN n 
5 474  GLN n 
5 475  GLN n 
5 476  PRO n 
5 477  ALA n 
5 478  THR n 
5 479  GLY n 
5 480  PRO n 
5 481  GLN n 
5 482  PRO n 
5 483  SER n 
5 484  LEU n 
5 485  GLY n 
5 486  VAL n 
5 487  SER n 
5 488  PHE n 
5 489  GLY n 
5 490  THR n 
5 491  PRO n 
5 492  PHE n 
5 493  GLY n 
5 494  SER n 
5 495  GLY n 
5 496  ILE n 
5 497  GLY n 
5 498  THR n 
5 499  GLY n 
5 500  LEU n 
5 501  GLN n 
5 502  SER n 
5 503  SER n 
5 504  GLY n 
5 505  LEU n 
5 506  GLY n 
5 507  SER n 
5 508  SER n 
5 509  ASN n 
5 510  LEU n 
5 511  GLY n 
5 512  GLY n 
5 513  PHE n 
5 514  GLY n 
5 515  THR n 
5 516  SER n 
5 517  SER n 
5 518  GLY n 
5 519  PHE n 
5 520  GLY n 
5 521  CYS n 
5 522  SER n 
5 523  THR n 
5 524  THR n 
5 525  GLY n 
5 526  ALA n 
5 527  SER n 
5 528  THR n 
5 529  PHE n 
5 530  GLY n 
5 531  PHE n 
5 532  GLY n 
5 533  THR n 
5 534  THR n 
5 535  ASN n 
5 536  LYS n 
5 537  PRO n 
5 538  SER n 
5 539  GLY n 
5 540  SER n 
5 541  LEU n 
5 542  SER n 
5 543  ALA n 
5 544  GLY n 
5 545  PHE n 
5 546  GLY n 
5 547  SER n 
5 548  SER n 
5 549  SER n 
5 550  THR n 
5 551  SER n 
5 552  GLY n 
5 553  PHE n 
5 554  ASN n 
5 555  PHE n 
5 556  SER n 
5 557  ASN n 
5 558  PRO n 
5 559  GLY n 
5 560  ILE n 
5 561  THR n 
5 562  ALA n 
5 563  SER n 
5 564  ALA n 
5 565  GLY n 
5 566  LEU n 
5 567  THR n 
5 568  PHE n 
5 569  GLY n 
5 570  VAL n 
5 571  SER n 
5 572  ASN n 
5 573  PRO n 
5 574  ALA n 
5 575  SER n 
5 576  ALA n 
5 577  GLY n 
5 578  PHE n 
5 579  GLY n 
5 580  THR n 
5 581  GLY n 
5 582  GLY n 
5 583  GLN n 
5 584  LEU n 
5 585  LEU n 
5 586  GLN n 
5 587  LEU n 
5 588  LYS n 
5 589  LYS n 
5 590  PRO n 
5 591  PRO n 
5 592  ALA n 
5 593  GLY n 
5 594  ASN n 
5 595  LYS n 
5 596  ARG n 
5 597  GLY n 
5 598  LYS n 
5 599  ARG n 
6 1    MET n 
6 2    SER n 
6 3    GLY n 
6 4    PHE n 
6 5    ASN n 
6 6    PHE n 
6 7    GLY n 
6 8    GLY n 
6 9    THR n 
6 10   GLY n 
6 11   ALA n 
6 12   PRO n 
6 13   THR n 
6 14   GLY n 
6 15   GLY n 
6 16   PHE n 
6 17   THR n 
6 18   PHE n 
6 19   GLY n 
6 20   THR n 
6 21   ALA n 
6 22   LYS n 
6 23   THR n 
6 24   ALA n 
6 25   THR n 
6 26   THR n 
6 27   THR n 
6 28   PRO n 
6 29   ALA n 
6 30   THR n 
6 31   GLY n 
6 32   PHE n 
6 33   SER n 
6 34   PHE n 
6 35   SER n 
6 36   THR n 
6 37   SER n 
6 38   GLY n 
6 39   THR n 
6 40   GLY n 
6 41   GLY n 
6 42   PHE n 
6 43   ASN n 
6 44   PHE n 
6 45   GLY n 
6 46   ALA n 
6 47   PRO n 
6 48   PHE n 
6 49   GLN n 
6 50   PRO n 
6 51   ALA n 
6 52   THR n 
6 53   SER n 
6 54   THR n 
6 55   PRO n 
6 56   SER n 
6 57   THR n 
6 58   GLY n 
6 59   LEU n 
6 60   PHE n 
6 61   SER n 
6 62   LEU n 
6 63   ALA n 
6 64   THR n 
6 65   GLN n 
6 66   THR n 
6 67   PRO n 
6 68   ALA n 
6 69   THR n 
6 70   GLN n 
6 71   THR n 
6 72   THR n 
6 73   GLY n 
6 74   PHE n 
6 75   THR n 
6 76   PHE n 
6 77   GLY n 
6 78   THR n 
6 79   ALA n 
6 80   THR n 
6 81   LEU n 
6 82   ALA n 
6 83   SER n 
6 84   GLY n 
6 85   GLY n 
6 86   THR n 
6 87   GLY n 
6 88   PHE n 
6 89   SER n 
6 90   LEU n 
6 91   GLY n 
6 92   ILE n 
6 93   GLY n 
6 94   ALA n 
6 95   SER n 
6 96   LYS n 
6 97   LEU n 
6 98   ASN n 
6 99   LEU n 
6 100  SER n 
6 101  ASN n 
6 102  THR n 
6 103  ALA n 
6 104  ALA n 
6 105  THR n 
6 106  PRO n 
6 107  ALA n 
6 108  MET n 
6 109  ALA n 
6 110  ASN n 
6 111  PRO n 
6 112  SER n 
6 113  GLY n 
6 114  PHE n 
6 115  GLY n 
6 116  LEU n 
6 117  GLY n 
6 118  SER n 
6 119  SER n 
6 120  ASN n 
6 121  LEU n 
6 122  THR n 
6 123  ASN n 
6 124  ALA n 
6 125  ILE n 
6 126  SER n 
6 127  SER n 
6 128  THR n 
6 129  VAL n 
6 130  THR n 
6 131  SER n 
6 132  SER n 
6 133  GLN n 
6 134  GLY n 
6 135  THR n 
6 136  ALA n 
6 137  PRO n 
6 138  THR n 
6 139  GLY n 
6 140  PHE n 
6 141  VAL n 
6 142  PHE n 
6 143  GLY n 
6 144  PRO n 
6 145  SER n 
6 146  THR n 
6 147  THR n 
6 148  SER n 
6 149  VAL n 
6 150  ALA n 
6 151  PRO n 
6 152  ALA n 
6 153  THR n 
6 154  THR n 
6 155  SER n 
6 156  GLY n 
6 157  GLY n 
6 158  PHE n 
6 159  SER n 
6 160  PHE n 
6 161  THR n 
6 162  GLY n 
6 163  GLY n 
6 164  SER n 
6 165  THR n 
6 166  ALA n 
6 167  GLN n 
6 168  PRO n 
6 169  SER n 
6 170  GLY n 
6 171  PHE n 
6 172  ASN n 
6 173  ILE n 
6 174  GLY n 
6 175  SER n 
6 176  ALA n 
6 177  GLY n 
6 178  ASN n 
6 179  SER n 
6 180  ALA n 
6 181  GLN n 
6 182  PRO n 
6 183  THR n 
6 184  ALA n 
6 185  PRO n 
6 186  ALA n 
6 187  THR n 
6 188  LEU n 
6 189  PRO n 
6 190  PHE n 
6 191  THR n 
6 192  PRO n 
6 193  ALA n 
6 194  THR n 
6 195  PRO n 
6 196  ALA n 
6 197  ALA n 
6 198  THR n 
6 199  THR n 
6 200  ALA n 
6 201  GLY n 
6 202  ALA n 
6 203  THR n 
6 204  GLN n 
6 205  PRO n 
6 206  ALA n 
6 207  ALA n 
6 208  PRO n 
6 209  THR n 
6 210  PRO n 
6 211  THR n 
6 212  ALA n 
6 213  THR n 
6 214  ILE n 
6 215  THR n 
6 216  SER n 
6 217  THR n 
6 218  GLY n 
6 219  PRO n 
6 220  SER n 
6 221  LEU n 
6 222  PHE n 
6 223  ALA n 
6 224  SER n 
6 225  ILE n 
6 226  ALA n 
6 227  THR n 
6 228  ALA n 
6 229  PRO n 
6 230  THR n 
6 231  SER n 
6 232  SER n 
6 233  ALA n 
6 234  THR n 
6 235  THR n 
6 236  GLY n 
6 237  LEU n 
6 238  SER n 
6 239  LEU n 
6 240  CYS n 
6 241  THR n 
6 242  PRO n 
6 243  VAL n 
6 244  THR n 
6 245  THR n 
6 246  ALA n 
6 247  GLY n 
6 248  ALA n 
6 249  PRO n 
6 250  THR n 
6 251  ALA n 
6 252  GLY n 
6 253  THR n 
6 254  GLN n 
6 255  GLY n 
6 256  PHE n 
6 257  SER n 
6 258  LEU n 
6 259  LYS n 
6 260  ALA n 
6 261  PRO n 
6 262  GLY n 
6 263  ALA n 
6 264  ALA n 
6 265  SER n 
6 266  GLY n 
6 267  THR n 
6 268  SER n 
6 269  THR n 
6 270  THR n 
6 271  THR n 
6 272  SER n 
6 273  THR n 
6 274  ALA n 
6 275  ALA n 
6 276  THR n 
6 277  ALA n 
6 278  THR n 
6 279  ALA n 
6 280  THR n 
6 281  THR n 
6 282  THR n 
6 283  SER n 
6 284  SER n 
6 285  SER n 
6 286  SER n 
6 287  THR n 
6 288  THR n 
6 289  GLY n 
6 290  PHE n 
6 291  ALA n 
6 292  LEU n 
6 293  ASN n 
6 294  LEU n 
6 295  LYS n 
6 296  PRO n 
6 297  LEU n 
6 298  ALA n 
6 299  PRO n 
6 300  ALA n 
6 301  GLY n 
6 302  ILE n 
6 303  PRO n 
6 304  SER n 
6 305  ASN n 
6 306  THR n 
6 307  ALA n 
6 308  ALA n 
6 309  ALA n 
6 310  VAL n 
6 311  THR n 
6 312  ALA n 
6 313  PRO n 
6 314  PRO n 
6 315  GLY n 
6 316  PRO n 
6 317  GLY n 
6 318  ALA n 
6 319  ALA n 
6 320  ALA n 
6 321  GLY n 
6 322  ALA n 
6 323  ALA n 
6 324  ALA n 
6 325  SER n 
6 326  SER n 
6 327  ALA n 
6 328  MET n 
6 329  THR n 
6 330  TYR n 
6 331  ALA n 
6 332  GLN n 
6 333  LEU n 
6 334  GLU n 
6 335  SER n 
6 336  LEU n 
6 337  ILE n 
6 338  ASN n 
6 339  LYS n 
6 340  TRP n 
6 341  SER n 
6 342  LEU n 
6 343  GLU n 
6 344  LEU n 
6 345  GLU n 
6 346  ASP n 
6 347  GLN n 
6 348  GLU n 
6 349  ARG n 
6 350  HIS n 
6 351  PHE n 
6 352  LEU n 
6 353  GLN n 
6 354  GLN n 
6 355  ALA n 
6 356  THR n 
6 357  GLN n 
6 358  VAL n 
6 359  ASN n 
6 360  ALA n 
6 361  TRP n 
6 362  ASP n 
6 363  ARG n 
6 364  THR n 
6 365  LEU n 
6 366  ILE n 
6 367  GLU n 
6 368  ASN n 
6 369  GLY n 
6 370  GLU n 
6 371  LYS n 
6 372  ILE n 
6 373  THR n 
6 374  SER n 
6 375  LEU n 
6 376  HIS n 
6 377  ARG n 
6 378  GLU n 
6 379  VAL n 
6 380  GLU n 
6 381  LYS n 
6 382  VAL n 
6 383  LYS n 
6 384  LEU n 
6 385  ASP n 
6 386  GLN n 
6 387  LYS n 
6 388  ARG n 
6 389  LEU n 
6 390  ASP n 
6 391  GLN n 
6 392  GLU n 
6 393  LEU n 
6 394  ASP n 
6 395  PHE n 
6 396  ILE n 
6 397  LEU n 
6 398  SER n 
6 399  GLN n 
6 400  GLN n 
6 401  LYS n 
6 402  GLU n 
6 403  LEU n 
6 404  GLU n 
6 405  ASP n 
6 406  LEU n 
6 407  LEU n 
6 408  SER n 
6 409  PRO n 
6 410  LEU n 
6 411  GLU n 
6 412  GLU n 
6 413  LEU n 
6 414  VAL n 
6 415  LYS n 
6 416  GLU n 
6 417  GLN n 
6 418  SER n 
6 419  GLY n 
6 420  THR n 
6 421  ILE n 
6 422  TYR n 
6 423  LEU n 
6 424  GLN n 
6 425  HIS n 
6 426  ALA n 
6 427  ASP n 
6 428  GLU n 
6 429  GLU n 
6 430  ARG n 
6 431  GLU n 
6 432  LYS n 
6 433  THR n 
6 434  TYR n 
6 435  LYS n 
6 436  LEU n 
6 437  ALA n 
6 438  GLU n 
6 439  ASN n 
6 440  ILE n 
6 441  ASP n 
6 442  ALA n 
6 443  GLN n 
6 444  LEU n 
6 445  LYS n 
6 446  ARG n 
6 447  MET n 
6 448  ALA n 
6 449  GLN n 
6 450  ASP n 
6 451  LEU n 
6 452  LYS n 
6 453  ASP n 
6 454  ILE n 
6 455  ILE n 
6 456  GLU n 
6 457  HIS n 
6 458  LEU n 
6 459  ASN n 
6 460  THR n 
6 461  SER n 
6 462  GLY n 
6 463  ALA n 
6 464  PRO n 
6 465  ALA n 
6 466  ASP n 
6 467  THR n 
6 468  SER n 
6 469  ASP n 
6 470  PRO n 
6 471  LEU n 
6 472  GLN n 
6 473  GLN n 
6 474  ILE n 
6 475  CYS n 
6 476  LYS n 
6 477  ILE n 
6 478  LEU n 
6 479  ASN n 
6 480  ALA n 
6 481  HIS n 
6 482  MET n 
6 483  ASP n 
6 484  SER n 
6 485  LEU n 
6 486  GLN n 
6 487  TRP n 
6 488  ILE n 
6 489  ASP n 
6 490  GLN n 
6 491  ASN n 
6 492  SER n 
6 493  ALA n 
6 494  LEU n 
6 495  LEU n 
6 496  GLN n 
6 497  ARG n 
6 498  LYS n 
6 499  VAL n 
6 500  GLU n 
6 501  GLU n 
6 502  VAL n 
6 503  THR n 
6 504  LYS n 
6 505  VAL n 
6 506  CYS n 
6 507  GLU n 
6 508  GLY n 
6 509  ARG n 
6 510  ARG n 
6 511  LYS n 
6 512  GLU n 
6 513  GLN n 
6 514  GLU n 
6 515  ARG n 
6 516  SER n 
6 517  PHE n 
6 518  ARG n 
6 519  ILE n 
6 520  THR n 
6 521  PHE n 
6 522  ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 1391 Human ? ?     ? ? ? ? ? ? 'Homo sapiens' 9606 ? HELA ? ? ? ? ? Human 'Homo sapiens' 9606 ? 
? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 819  Human ? ?     ? ? ? ? ? ? 'Homo sapiens' 9606 ? HELA ? ? ? ? ? Human 'Homo sapiens' 9606 ? 
? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 2012 Human ? ?     ? ? ? ? ? ? 'Homo sapiens' 9606 ? HELA ? ? ? ? ? Human 'Homo sapiens' 9606 ? 
? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 507  Human ? ?     ? ? ? ? ? ? 'Homo sapiens' 9606 ? HELA ? ? ? ? ? Human 'Homo sapiens' 9606 ? 
? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 599  Human ? ?     ? ? ? ? ? ? 'Homo sapiens' 9606 ? HELA ? ? ? ? ? Human 'Homo sapiens' 9606 ? 
? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 522  Human ? NUP62 ? ? ? ? ? ? 'Homo sapiens' 9606 ? HELA ? ? ? ? ? Human 'Homo sapiens' 9606 ? 
? ? ? ? ? ? ? HELA ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP NU155_HUMAN O75694 ? 1 
;MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGMSDMDYPLQGPGLLSVPNLPE
ISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPH
VRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAY
QAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQ
NAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASS
TVEKPSKVHRALYSKGILLMAASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDH
IPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAA
CDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGSPVYSSSPVPSGSPYPNPSFLGTPSHGIQPPAMSTPVCALG
NPATQATNMSCVTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEF
LDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALALWKLLCE
HQFTIIVAELQKELQEQLKITTFKDLVIRDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANEL
LQRSRQVQNKTEKERMLRESLKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIV
GLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALY
NWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIAR
AILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAE
CKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNW
DVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGY
LVELQSMSSSVAVQAITGNFKSLQAKLERLH
;
1 
2 UNP NUP93_HUMAN Q8N1F7 ? 2 
;MDTEGFGELLQQAEQLAAETEGISELPHVERNLQEIQQAGERLRSRTLTRTSQETADVKASVLLGSRGLDISHISQRLES
LSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKRTFGMAEEYHRESMLVEWEQVKQRILHTLLASGEDALDFTQ
ESEPSYISDVGPPGRSSLDNIEMAYARQIYIYNEKIVNGHLQPNLVDLCASVAELDDKSISDMWTMVKQMTDVLLTPATD
ALKNRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLHQAQLGGVPGTYQLVRSFLNIKLPAPLPGLQDGEVEGHPVWA
LIYYCMRCGDLLAASQVVNRAQHQLGEFKTWFQEYMNSKDRRLSPATENKLRLHYRRALRNNTDPYKRAVYCIIGRCDVT
DNQSEVADKTEDYLWLKLNQVCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLYFQVLFLTAQFEAAVAFLF
RMERLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDPPCLRRLNFVRLLMLYTRKFESTDPREALQYFYFLRDEKDS
QGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDKFTSDTKPIINKVASVAENKGLFEEAAKLYDLAKNADKVLE
LMNKLLSPVVPQISAPQSNKERLKNMALSIAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLV
PLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIEDRDSQLRSQARTLITFAGMIP
YRTSGDTNARLVQMEVLMN
;
1 
3 UNP NU205_HUMAN Q92621 ? 3 
;MATPLAVNSAASLWGPYKDIWHKVGNALWRRQPEAVHLLDKILKKHKPDFISLFKNPPKNVQQHEKVQKASTEGVAIQGQ
QGTRLLPEQLIKEAFILSDLFDIGELAAVELLLAGEHQQPHFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTL
ELSPELASMTTRFTDELMEQGLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSP
LGKEDTLLLIGHLERVTVEANGSLDAVNLALLMALLYCFDISFIEQSTEERDDMIHQLPLLTEKQYIATIHSRLQDSQLW
KLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAMAELAIADNVFLFLMESVVVSEYFYQEEFYIRRVHNLITDFL
ALMPMKVKQLRNRADEDARMIHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFHLELALEYWCPTEPLQTPTIMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSSHVENIQGAGGSPVSWEHFFH
SLMLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAFLQLTSTIITWSENARLALCEHPQWTPVVVILGLLQCSIPP
VLKAELLKTLAAFGKSPEIAASLWQSLEYTQILQTVRIPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQLEDFVDQFVELQGEEIIAYKP
PGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKKHLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVCPLE
QLLQGINPRTKKADNVVNIARYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSISQKLMAGFVECLDCEDA
EEFVRLEEGSELEKKLVAIRHETRIHILNLLITSLECNPPNLALYLLGFELKKPVSTTNLQDPGVLGCPRTCLHAILNIL
EKGTEGRTGPVAVRESPQLAELCYQVIYQLCACSDTSGPTMRYLRTSQDFLFSQLQYLPFSNKEYEISMLNQMSWLMKTA
SIELRVTSLNRQRSHTQRLLHLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTATKVRRKILNILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEISTVLQYVVGRNKLLQCLHAKR
HALESWRQLVEIILTACPQDLIQAEDRQLIIRDILQDVHDKILDDEAAQELMPVVAGAVFTLTAHLSQAVLTEQKETSVL
GPAEAHYAFMLDSCFTSPPPEENPLVGFASIGDSSLYIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDT
LEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRMLALALLDRIVSVDKQQQWLLYLSNSG
YLKVLVDSLVEDDRTLQSLLTPQPPLLKALYTYESKMAFLTRVAKIQQGALELLRSGVIVRLAQCQVYDMRPETDPQSMF
GMRDPPMFIPTPVDRYRQILLPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAGSLQELALLTGII
SKAALPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKFQDDNVEGDKVSKKDEIELAMQQICANV
MEYCQSLMLQSSPTFQHAVCLFTPSLSETVNRDGPRQDTQAPVVPYWRLPGLGIIIYLLKQSANDFFSYYDSHRQSVSKL
QNVEQLPPDEIKELCQSVMPAGVDKISTAQKYVLARRRLVKVINNRAKLLSLCSFIIETCLFILWRHLEYYLLHCMPTDS
QDSLFASRTLFKSRRLQDSFASETNLDFRSGLAIVSQHDLDQLQADAINAFGESLQKKLLDIEGLYSKVRSRYSFIQALV
RRIRGLLRISRN
;
1 
4 UNP NUP54_HUMAN Q7Z3B4 ? 4 
;MAFNFGAPSGTSGTAAATAAPAGGFGGFGTTSTTAGSAFSFSAPTNTGTTGLFGGTQNKGFGFGTGFGTTTGTSTGLGTG
LGTGLGFGGFNTQQQQQTTLGGLFSQPTQAPTQSNQLINTASALSAPTLLGDERDAILAKWNQLQAFWGTGKGYFNNNIP
PVEFTQENPFCRFKAVGYSCMPSNKDEDGLVVLVFNKKETEIRSQQQQLVESLHKVLGGNQTLTVNVEGTKTLPDDQTEV
VIYVVERSPNGTSRRVPATTLYAHFEQANIKTQLQQLGVTLSMTRTELSPAQIKQLLQNPPAGVDPIIWEQAKVDNPDSE
KLIPVPMVGFKELLRRLKVQDQMTKQHQTRLDIISEDISELQKNQTTSVAKIAQYKRKLMDLSHRTLQVLIKQEIQRKSG
YAIQADEEQLRVQLDTIQGELNAPTQFKGRLNELMSQIRMQNHFGAVRSEERYYIDADLLREIKQHLKQQQEGLSHLISI
IKDDLEDIKLVEHGLNETIHIRGGVFS
;
1 
5 UNP NUP58_HUMAN Q9BVL2 ? 5 
;MSTGFSFGSGTLGSTTVAAGGTSTGGVFSFGTGASSNPSVGLNFGNLGSTSTPATTSAPSSGFGTGLFGSKPATGFTLGG
TNTGIATTITTGLTLGTPATTSAATTGFSLGFNKPAASATPFALPITSTSASGLTLSSALTSTPAASTGFTLNNLGGTTA
TTTTASTGLSLGGALAGLGGSLFQSTNTGTSGLGQNALGLTLGTTAATSTAGNEGLGGIDFSSSSDKKSDKTGTRPEDSK
ALKDENLPPVICQDVENLQKFVKEQKQVQEEISRMSSKAMLKVQEDIKALKQLLSLAANGIQRNTLNIDKLKIETAQELK
NAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALA
AQLQSIHENVKVLKEQYLGYRKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGP
QPSLGVSFGTPFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGSLSAGFGSSSTSGFNFSNPGI
TASAGLTFGVSNPASAGFGTGGQLLQLKKPPAGNKRGKR
;
1 
6 UNP NUP62_HUMAN P37198 ? 6 
;MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLFSLATQTPATQTTGFTFGTAT
LASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPSTTSVAPATTSGGFSF
TGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTAGATQPAAPTPTATITSTGPSLFASIATAPTSSATTGLSLC
TPVTTAGAPTAGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPAGIPSNTAAAVTAPPGPGAAA
GAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQ
KELEDLLSPLEELVKEQSGTIYLQHADEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNA
HMDSLQWIDQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5IJN A 1 ? 1391 ? O75694 1 ? 1391 ? 1 1391 
2  1 5IJN B 1 ? 1391 ? O75694 1 ? 1391 ? 1 1391 
3  2 5IJN C 1 ? 819  ? Q8N1F7 1 ? 819  ? 1 819  
4  3 5IJN D 1 ? 2012 ? Q92621 1 ? 2012 ? 1 2012 
5  1 5IJN E 1 ? 1391 ? O75694 1 ? 1391 ? 1 1391 
6  4 5IJN F 1 ? 507  ? Q7Z3B4 1 ? 507  ? 1 507  
7  5 5IJN G 1 ? 599  ? Q9BVL2 1 ? 599  ? 1 599  
8  6 5IJN H 1 ? 522  ? P37198 1 ? 522  ? 1 522  
9  2 5IJN I 1 ? 819  ? Q8N1F7 1 ? 819  ? 1 819  
10 3 5IJN J 1 ? 2012 ? Q92621 1 ? 2012 ? 1 2012 
11 1 5IJN K 1 ? 1391 ? O75694 1 ? 1391 ? 1 1391 
12 4 5IJN L 1 ? 507  ? Q7Z3B4 1 ? 507  ? 1 507  
13 5 5IJN M 1 ? 599  ? Q9BVL2 1 ? 599  ? 1 599  
14 6 5IJN N 1 ? 522  ? P37198 1 ? 522  ? 1 522  
15 2 5IJN O 1 ? 819  ? Q8N1F7 1 ? 819  ? 1 819  
16 3 5IJN P 1 ? 2012 ? Q92621 1 ? 2012 ? 1 2012 
17 1 5IJN Q 1 ? 1391 ? O75694 1 ? 1391 ? 1 1391 
18 4 5IJN R 1 ? 507  ? Q7Z3B4 1 ? 507  ? 1 507  
19 5 5IJN S 1 ? 599  ? Q9BVL2 1 ? 599  ? 1 599  
20 6 5IJN T 1 ? 522  ? P37198 1 ? 522  ? 1 522  
21 2 5IJN U 1 ? 819  ? Q8N1F7 1 ? 819  ? 1 819  
22 3 5IJN V 1 ? 2012 ? Q92621 1 ? 2012 ? 1 2012 
23 1 5IJN W 1 ? 1391 ? O75694 1 ? 1391 ? 1 1391 
24 4 5IJN X 1 ? 507  ? Q7Z3B4 1 ? 507  ? 1 507  
25 5 5IJN Y 1 ? 599  ? Q9BVL2 1 ? 599  ? 1 599  
26 6 5IJN Z 1 ? 522  ? P37198 1 ? 522  ? 1 522  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5IJN 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5IJN 
_struct.title                        
'Composite structure of the inner ring of the human nuclear pore complex (32 copies of Nup205)' 
_struct.pdbx_descriptor              
;NUCLEAR PORE COMPLEX PROTEIN NUP155, NUCLEAR PORE COMPLEX PROTEIN NUP93, NUCLEAR PORE COMPLEX PROTEIN NUP205, NUCLEAR PORE COMPLEX PROTEIN NUP54, NUCLEAR PORE COMPLEX PROTEIN NUP58, Nuclear pore glycoprotein p62
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5IJN 
_struct_keywords.text            'Nuclear pore complex, Nucleocytoplasmic transport, Transport protein' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 1 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 2 ? 
J N N 3 ? 
K N N 1 ? 
L N N 4 ? 
M N N 5 ? 
N N N 6 ? 
O N N 2 ? 
P N N 3 ? 
Q N N 1 ? 
R N N 4 ? 
S N N 5 ? 
T N N 6 ? 
U N N 2 ? 
V N N 3 ? 
W N N 1 ? 
X N N 4 ? 
Y N N 5 ? 
Z N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLU A 21   ? TYR A 40   ? GLU A 21   TYR A 40   1 ? 20 
HELX_P HELX_P2   AA2 GLU A 45   ? SER A 50   ? GLU A 45   SER A 50   5 ? 6  
HELX_P HELX_P3   AA3 PRO A 90   ? GLN A 96   ? PRO A 90   GLN A 96   1 ? 7  
HELX_P HELX_P4   AA4 SER A 319  ? GLY A 328  ? SER A 319  GLY A 328  1 ? 10 
HELX_P HELX_P5   AA5 ARG A 515  ? LEU A 523  ? ARG A 515  LEU A 523  1 ? 9  
HELX_P HELX_P6   AA6 ILE A 535  ? GLN A 543  ? ILE A 535  GLN A 543  1 ? 9  
HELX_P HELX_P7   AA7 GLN A 543  ? SER A 557  ? GLN A 543  SER A 557  1 ? 15 
HELX_P HELX_P8   AA8 ARG A 563  ? GLY A 577  ? ARG A 563  GLY A 577  1 ? 15 
HELX_P HELX_P9   AA9 SER A 660  ? ALA A 680  ? SER A 660  ALA A 680  1 ? 21 
HELX_P HELX_P10  AB1 PRO A 703  ? ASN A 724  ? PRO A 703  ASN A 724  1 ? 22 
HELX_P HELX_P11  AB2 ASN A 724  ? GLY A 729  ? ASN A 724  GLY A 729  1 ? 6  
HELX_P HELX_P12  AB3 ALA A 770  ? GLU A 800  ? ALA A 770  GLU A 800  1 ? 31 
HELX_P HELX_P13  AB4 GLN A 802  ? GLN A 811  ? GLN A 802  GLN A 811  1 ? 10 
HELX_P HELX_P14  AB5 LEU A 814  ? ILE A 820  ? LEU A 814  ILE A 820  1 ? 7  
HELX_P HELX_P15  AB6 THR A 822  ? ILE A 828  ? THR A 822  ILE A 828  1 ? 7  
HELX_P HELX_P16  AB7 ASP A 830  ? CYS A 844  ? ASP A 830  CYS A 844  1 ? 15 
HELX_P HELX_P17  AB8 ASN A 849  ? CYS A 863  ? ASN A 849  CYS A 863  1 ? 15 
HELX_P HELX_P18  AB9 GLU B 21   ? TYR B 40   ? GLU B 21   TYR B 40   1 ? 20 
HELX_P HELX_P19  AC1 GLU B 45   ? SER B 50   ? GLU B 45   SER B 50   5 ? 6  
HELX_P HELX_P20  AC2 PRO B 90   ? GLN B 96   ? PRO B 90   GLN B 96   1 ? 7  
HELX_P HELX_P21  AC3 SER B 319  ? GLY B 328  ? SER B 319  GLY B 328  1 ? 10 
HELX_P HELX_P22  AC4 ARG B 515  ? LEU B 523  ? ARG B 515  LEU B 523  1 ? 9  
HELX_P HELX_P23  AC5 ILE B 535  ? GLN B 543  ? ILE B 535  GLN B 543  1 ? 9  
HELX_P HELX_P24  AC6 GLN B 543  ? SER B 557  ? GLN B 543  SER B 557  1 ? 15 
HELX_P HELX_P25  AC7 ARG B 563  ? GLY B 577  ? ARG B 563  GLY B 577  1 ? 15 
HELX_P HELX_P26  AC8 SER B 660  ? ALA B 680  ? SER B 660  ALA B 680  1 ? 21 
HELX_P HELX_P27  AC9 PRO B 703  ? ASN B 724  ? PRO B 703  ASN B 724  1 ? 22 
HELX_P HELX_P28  AD1 ASN B 724  ? GLY B 729  ? ASN B 724  GLY B 729  1 ? 6  
HELX_P HELX_P29  AD2 ALA B 770  ? GLU B 800  ? ALA B 770  GLU B 800  1 ? 31 
HELX_P HELX_P30  AD3 GLN B 802  ? GLN B 811  ? GLN B 802  GLN B 811  1 ? 10 
HELX_P HELX_P31  AD4 LEU B 814  ? ILE B 820  ? LEU B 814  ILE B 820  1 ? 7  
HELX_P HELX_P32  AD5 THR B 822  ? ILE B 828  ? THR B 822  ILE B 828  1 ? 7  
HELX_P HELX_P33  AD6 ASP B 830  ? CYS B 844  ? ASP B 830  CYS B 844  1 ? 15 
HELX_P HELX_P34  AD7 ASN B 849  ? CYS B 863  ? ASN B 849  CYS B 863  1 ? 15 
HELX_P HELX_P35  AD8 GLU C 4    ? ALA C 17   ? GLU C 4    ALA C 17   1 ? 14 
HELX_P HELX_P36  AD9 ASN C 32   ? ARG C 42   ? ASN C 32   ARG C 42   1 ? 11 
HELX_P HELX_P37  AE1 SER C 176  ? GLY C 199  ? SER C 176  GLY C 199  1 ? 24 
HELX_P HELX_P38  AE2 PRO C 203  ? ALA C 213  ? PRO C 203  ALA C 213  1 ? 11 
HELX_P HELX_P39  AE3 SER C 219  ? MET C 230  ? SER C 219  MET C 230  1 ? 12 
HELX_P HELX_P40  AE4 GLU C 253  ? PHE C 275  ? GLU C 253  PHE C 275  1 ? 23 
HELX_P HELX_P41  AE5 GLY C 288  ? LYS C 300  ? GLY C 288  LYS C 300  1 ? 13 
HELX_P HELX_P42  AE6 VAL C 318  ? GLY C 329  ? VAL C 318  GLY C 329  1 ? 12 
HELX_P HELX_P43  AE7 ASP C 330  ? ALA C 341  ? ASP C 330  ALA C 341  1 ? 12 
HELX_P HELX_P44  AE8 GLY C 346  ? GLN C 353  ? GLY C 346  GLN C 353  1 ? 8  
HELX_P HELX_P45  AE9 GLU C 368  ? ALA C 378  ? GLU C 368  ALA C 378  1 ? 11 
HELX_P HELX_P46  AF1 ASP C 384  ? ARG C 396  ? ASP C 384  ARG C 396  1 ? 13 
HELX_P HELX_P47  AF2 LYS C 409  ? VAL C 421  ? LYS C 409  VAL C 421  1 ? 13 
HELX_P HELX_P48  AF3 THR C 436  ? ASP C 447  ? THR C 436  ASP C 447  1 ? 12 
HELX_P HELX_P49  AF4 GLY C 449  ? PHE C 453  ? GLY C 449  PHE C 453  1 ? 5  
HELX_P HELX_P50  AF5 LEU C 461  ? ALA C 470  ? LEU C 461  ALA C 470  1 ? 10 
HELX_P HELX_P51  AF6 GLN C 471  ? PHE C 480  ? GLN C 471  PHE C 480  1 ? 10 
HELX_P HELX_P52  AF7 LEU C 485  ? LEU C 499  ? LEU C 485  LEU C 499  1 ? 15 
HELX_P HELX_P53  AF8 ASN C 527  ? GLU C 540  ? ASN C 527  GLU C 540  1 ? 14 
HELX_P HELX_P54  AF9 ASP C 543  ? PHE C 553  ? ASP C 543  PHE C 553  1 ? 11 
HELX_P HELX_P55  AG1 LEU C 554  ? GLU C 557  ? LEU C 554  GLU C 557  5 ? 4  
HELX_P HELX_P56  AG2 GLN C 561  ? ARG C 578  ? GLN C 561  ARG C 578  1 ? 18 
HELX_P HELX_P57  AG3 GLU C 579  ? LEU C 584  ? GLU C 579  LEU C 584  1 ? 6  
HELX_P HELX_P58  AG4 GLY C 596  ? THR C 602  ? GLY C 596  THR C 602  1 ? 7  
HELX_P HELX_P59  AG5 THR C 605  ? GLY C 620  ? THR C 605  GLY C 620  1 ? 16 
HELX_P HELX_P60  AG6 GLU C 623  ? LYS C 633  ? GLU C 623  LYS C 633  1 ? 11 
HELX_P HELX_P61  AG7 ASN C 634  ? SER C 647  ? ASN C 634  SER C 647  1 ? 14 
HELX_P HELX_P62  AG8 ARG C 662  ? ALA C 676  ? ARG C 662  ALA C 676  1 ? 15 
HELX_P HELX_P63  AG9 ASN C 682  ? TYR C 702  ? ASN C 682  TYR C 702  1 ? 21 
HELX_P HELX_P64  AH1 HIS C 706  ? LYS C 718  ? HIS C 706  LYS C 718  1 ? 13 
HELX_P HELX_P65  AH2 GLU C 728  ? ASN C 736  ? GLU C 728  ASN C 736  1 ? 9  
HELX_P HELX_P66  AH3 SER C 738  ? PHE C 760  ? SER C 738  PHE C 760  1 ? 23 
HELX_P HELX_P67  AH4 ARG C 786  ? ILE C 799  ? ARG C 786  ILE C 799  1 ? 14 
HELX_P HELX_P68  AH5 ASN C 808  ? MET C 814  ? ASN C 808  MET C 814  1 ? 7  
HELX_P HELX_P69  AH6 TRP D 14   ? VAL D 24   ? TRP D 14   VAL D 24   1 ? 11 
HELX_P HELX_P70  AH7 ASP D 40   ? HIS D 46   ? ASP D 40   HIS D 46   1 ? 7  
HELX_P HELX_P71  AH8 LYS D 47   ? SER D 52   ? LYS D 47   SER D 52   5 ? 6  
HELX_P HELX_P72  AH9 VAL D 61   ? LYS D 69   ? VAL D 61   LYS D 69   1 ? 9  
HELX_P HELX_P73  AI1 PRO D 87   ? ASP D 102  ? PRO D 87   ASP D 102  1 ? 16 
HELX_P HELX_P74  AI2 GLY D 104  ? GLY D 115  ? GLY D 104  GLY D 115  1 ? 12 
HELX_P HELX_P75  AI3 VAL D 130  ? ARG D 153  ? VAL D 130  ARG D 153  1 ? 24 
HELX_P HELX_P76  AI4 GLU D 165  ? PHE D 173  ? GLU D 165  PHE D 173  1 ? 9  
HELX_P HELX_P77  AI5 LEU D 182  ? ASP D 194  ? LEU D 182  ASP D 194  1 ? 13 
HELX_P HELX_P78  AI6 ASN D 196  ? ARG D 206  ? ASN D 196  ARG D 206  1 ? 11 
HELX_P HELX_P79  AI7 SER D 210  ? GLN D 238  ? SER D 210  GLN D 238  1 ? 29 
HELX_P HELX_P80  AI8 GLY D 242  ? ARG D 255  ? GLY D 242  ARG D 255  1 ? 14 
HELX_P HELX_P81  AI9 VAL D 267  ? ILE D 281  ? VAL D 267  ILE D 281  1 ? 15 
HELX_P HELX_P82  AJ1 GLN D 305  ? SER D 317  ? GLN D 305  SER D 317  1 ? 13 
HELX_P HELX_P83  AJ2 GLN D 318  ? TRP D 320  ? GLN D 318  TRP D 320  5 ? 3  
HELX_P HELX_P84  AJ3 PRO D 323  ? SER D 341  ? PRO D 323  SER D 341  1 ? 19 
HELX_P HELX_P85  AJ4 LEU D 343  ? ALA D 350  ? LEU D 343  ALA D 350  1 ? 8  
HELX_P HELX_P86  AJ5 GLU D 351  ? ASP D 356  ? GLU D 351  ASP D 356  1 ? 6  
HELX_P HELX_P87  AJ6 ASP D 356  ? ASP D 366  ? ASP D 356  ASP D 366  1 ? 11 
HELX_P HELX_P88  AJ7 ASN D 367  ? VAL D 378  ? ASN D 367  VAL D 378  1 ? 12 
HELX_P HELX_P89  AJ8 GLU D 385  ? MET D 403  ? GLU D 385  MET D 403  1 ? 19 
HELX_P HELX_P90  AJ9 MET D 403  ? ALA D 418  ? MET D 403  ALA D 418  1 ? 16 
HELX_P HELX_P91  AK1 ASN D 429  ? ARG D 436  ? ASN D 429  ARG D 436  1 ? 8  
HELX_P HELX_P92  AK2 ARG D 437  ? LYS D 451  ? ARG D 437  LYS D 451  1 ? 15 
HELX_P HELX_P93  AK3 ALA D 460  ? CYS D 465  ? ALA D 460  CYS D 465  1 ? 6  
HELX_P HELX_P94  AK4 LEU D 494  ? LEU D 504  ? LEU D 494  LEU D 504  1 ? 11 
HELX_P HELX_P95  AK5 PRO D 506  ? ALA D 521  ? PRO D 506  ALA D 521  1 ? 16 
HELX_P HELX_P96  AK6 GLY D 523  ? VAL D 536  ? GLY D 523  VAL D 536  1 ? 14 
HELX_P HELX_P97  AK7 SER D 554  ? LEU D 573  ? SER D 554  LEU D 573  1 ? 20 
HELX_P HELX_P98  AK8 LYS D 592  ? TRP D 610  ? LYS D 592  TRP D 610  1 ? 19 
HELX_P HELX_P99  AK9 ASN D 613  ? GLU D 620  ? ASN D 613  GLU D 620  1 ? 8  
HELX_P HELX_P100 AL1 PRO D 626  ? CYS D 636  ? PRO D 626  CYS D 636  1 ? 11 
HELX_P HELX_P101 AL2 LYS D 643  ? GLY D 654  ? LYS D 643  GLY D 654  1 ? 12 
HELX_P HELX_P102 AL3 ALA D 660  ? THR D 670  ? ALA D 660  THR D 670  1 ? 11 
HELX_P HELX_P103 AL4 LEU D 673  ? GLN D 674  ? LEU D 673  GLN D 674  1 ? 2  
HELX_P HELX_P104 AL5 ILE D 687  ? CYS D 698  ? ILE D 687  CYS D 698  1 ? 12 
HELX_P HELX_P105 AL6 GLU D 700  ? GLU D 716  ? GLU D 700  GLU D 716  1 ? 17 
HELX_P HELX_P106 AL7 PHE D 732  ? VAL D 743  ? PHE D 732  VAL D 743  1 ? 12 
HELX_P HELX_P107 AL8 ALA D 755  ? ASP D 775  ? ALA D 755  ASP D 775  1 ? 21 
HELX_P HELX_P108 AL9 PRO D 778  ? PHE D 783  ? PRO D 778  PHE D 783  1 ? 6  
HELX_P HELX_P109 AM1 GLU D 793  ? LYS D 799  ? GLU D 793  LYS D 799  1 ? 7  
HELX_P HELX_P110 AM2 PRO D 801  ? ASN D 811  ? PRO D 801  ASN D 811  1 ? 11 
HELX_P HELX_P111 AM3 ASN D 811  ? GLU D 812  ? ASN D 811  GLU D 812  1 ? 2  
HELX_P HELX_P112 AM4 MET D 815  ? GLU D 825  ? MET D 815  GLU D 825  1 ? 11 
HELX_P HELX_P113 AM5 LYS D 840  ? ASP D 865  ? LYS D 840  ASP D 865  1 ? 26 
HELX_P HELX_P114 AM6 ASP D 865  ? SER D 870  ? ASP D 865  SER D 870  1 ? 6  
HELX_P HELX_P115 AM7 LEU D 882  ? ASN D 887  ? LEU D 882  ASN D 887  1 ? 6  
HELX_P HELX_P116 AM8 ALA D 893  ? LEU D 903  ? ALA D 893  LEU D 903  1 ? 11 
HELX_P HELX_P117 AM9 PRO D 910  ? SER D 924  ? PRO D 910  SER D 924  1 ? 15 
HELX_P HELX_P118 AN1 ASP D 1393 ? THR D 1410 ? ASP D 1393 THR D 1410 1 ? 18 
HELX_P HELX_P119 AN2 PHE D 1414 ? GLN D 1433 ? PHE D 1414 GLN D 1433 1 ? 20 
HELX_P HELX_P120 AN3 GLU D 1437 ? TRP D 1449 ? GLU D 1437 TRP D 1449 1 ? 13 
HELX_P HELX_P121 AN4 ASP D 1457 ? LEU D 1539 ? ASP D 1457 LEU D 1539 1 ? 83 
HELX_P HELX_P122 AN5 PRO D 1544 ? LYS D 1565 ? PRO D 1544 LYS D 1565 1 ? 22 
HELX_P HELX_P123 AN6 ILE D 1566 ? SER D 1576 ? ILE D 1566 SER D 1576 1 ? 11 
HELX_P HELX_P124 AN7 GLY D 1577 ? GLN D 1586 ? GLY D 1577 GLN D 1586 1 ? 10 
HELX_P HELX_P125 AN8 ARG D 1591 ? ASP D 1595 ? ARG D 1591 ASP D 1595 5 ? 5  
HELX_P HELX_P126 AN9 ILE D 1609 ? SER D 1633 ? ILE D 1609 SER D 1633 1 ? 25 
HELX_P HELX_P127 AO1 LEU D 1639 ? HIS D 1652 ? LEU D 1639 HIS D 1652 1 ? 14 
HELX_P HELX_P128 AO2 ASP D 1654 ? LEU D 1660 ? ASP D 1654 LEU D 1660 1 ? 7  
HELX_P HELX_P129 AO3 ASP D 1664 ? ALA D 1684 ? ASP D 1664 ALA D 1684 1 ? 21 
HELX_P HELX_P130 AO4 PRO D 1686 ? GLU D 1691 ? PRO D 1686 GLU D 1691 1 ? 6  
HELX_P HELX_P131 AO5 GLU E 21   ? TYR E 40   ? GLU E 21   TYR E 40   1 ? 20 
HELX_P HELX_P132 AO6 GLU E 45   ? SER E 50   ? GLU E 45   SER E 50   5 ? 6  
HELX_P HELX_P133 AO7 PRO E 90   ? GLN E 96   ? PRO E 90   GLN E 96   1 ? 7  
HELX_P HELX_P134 AO8 SER E 319  ? GLY E 328  ? SER E 319  GLY E 328  1 ? 10 
HELX_P HELX_P135 AO9 ARG E 515  ? LEU E 523  ? ARG E 515  LEU E 523  1 ? 9  
HELX_P HELX_P136 AP1 ILE E 535  ? GLN E 543  ? ILE E 535  GLN E 543  1 ? 9  
HELX_P HELX_P137 AP2 GLN E 543  ? SER E 557  ? GLN E 543  SER E 557  1 ? 15 
HELX_P HELX_P138 AP3 ARG E 563  ? GLY E 577  ? ARG E 563  GLY E 577  1 ? 15 
HELX_P HELX_P139 AP4 SER E 660  ? ALA E 680  ? SER E 660  ALA E 680  1 ? 21 
HELX_P HELX_P140 AP5 PRO E 703  ? ASN E 724  ? PRO E 703  ASN E 724  1 ? 22 
HELX_P HELX_P141 AP6 ASN E 724  ? GLY E 729  ? ASN E 724  GLY E 729  1 ? 6  
HELX_P HELX_P142 AP7 ALA E 770  ? GLU E 800  ? ALA E 770  GLU E 800  1 ? 31 
HELX_P HELX_P143 AP8 GLN E 802  ? GLN E 811  ? GLN E 802  GLN E 811  1 ? 10 
HELX_P HELX_P144 AP9 LEU E 814  ? ILE E 820  ? LEU E 814  ILE E 820  1 ? 7  
HELX_P HELX_P145 AQ1 THR E 822  ? ILE E 828  ? THR E 822  ILE E 828  1 ? 7  
HELX_P HELX_P146 AQ2 ASP E 830  ? CYS E 844  ? ASP E 830  CYS E 844  1 ? 15 
HELX_P HELX_P147 AQ3 ASN E 849  ? CYS E 863  ? ASN E 849  CYS E 863  1 ? 15 
HELX_P HELX_P148 AQ4 ALA E 872  ? VAL E 887  ? ALA E 872  VAL E 887  1 ? 16 
HELX_P HELX_P149 AQ5 GLU E 899  ? SER E 908  ? GLU E 899  SER E 908  1 ? 10 
HELX_P HELX_P150 AQ6 VAL E 911  ? VAL E 923  ? VAL E 911  VAL E 923  1 ? 13 
HELX_P HELX_P151 AQ7 PHE E 925  ? ASP E 941  ? PHE E 925  ASP E 941  1 ? 17 
HELX_P HELX_P152 AQ8 GLY E 944  ? GLY E 953  ? GLY E 944  GLY E 953  1 ? 10 
HELX_P HELX_P153 AQ9 GLY E 961  ? VAL E 983  ? GLY E 961  VAL E 983  1 ? 23 
HELX_P HELX_P154 AR1 ALA E 1016 ? LYS E 1025 ? ALA E 1016 LYS E 1025 1 ? 10 
HELX_P HELX_P155 AR2 GLN E 1028 ? ARG E 1029 ? GLN E 1028 ARG E 1029 1 ? 2  
HELX_P HELX_P156 AR3 PHE E 1035 ? ASP E 1047 ? PHE E 1035 ASP E 1047 1 ? 13 
HELX_P HELX_P157 AR4 LEU E 1048 ? VAL E 1055 ? LEU E 1048 VAL E 1055 1 ? 8  
HELX_P HELX_P158 AR5 PHE E 1059 ? ALA E 1068 ? PHE E 1059 ALA E 1068 1 ? 10 
HELX_P HELX_P159 AR6 TYR E 1077 ? ASN E 1088 ? TYR E 1077 ASN E 1088 1 ? 12 
HELX_P HELX_P160 AR7 SER E 1090 ? MET E 1104 ? SER E 1090 MET E 1104 1 ? 15 
HELX_P HELX_P161 AR8 SER E 1110 ? SER E 1124 ? SER E 1110 SER E 1124 1 ? 15 
HELX_P HELX_P162 AR9 PHE E 1140 ? GLN E 1164 ? PHE E 1140 GLN E 1164 1 ? 25 
HELX_P HELX_P163 AS1 GLN E 1172 ? GLU E 1181 ? GLN E 1172 GLU E 1181 1 ? 10 
HELX_P HELX_P164 AS2 ASP E 1184 ? PHE E 1192 ? ASP E 1184 PHE E 1192 1 ? 9  
HELX_P HELX_P165 AS3 LEU E 1198 ? GLY E 1210 ? LEU E 1198 GLY E 1210 1 ? 13 
HELX_P HELX_P166 AS4 ASP E 1213 ? SER E 1232 ? ASP E 1213 SER E 1232 1 ? 20 
HELX_P HELX_P167 AS5 SER E 1236 ? ALA E 1256 ? SER E 1236 ALA E 1256 1 ? 21 
HELX_P HELX_P168 AS6 PRO E 1263 ? THR E 1277 ? PRO E 1263 THR E 1277 1 ? 15 
HELX_P HELX_P169 AS7 GLY E 1283 ? GLY E 1293 ? GLY E 1283 GLY E 1293 1 ? 11 
HELX_P HELX_P170 AS8 PRO E 1295 ? ARG E 1310 ? PRO E 1295 ARG E 1310 1 ? 16 
HELX_P HELX_P171 AS9 PRO E 1320 ? ASN E 1337 ? PRO E 1320 ASN E 1337 1 ? 18 
HELX_P HELX_P172 AT1 ASP E 1355 ? LEU E 1364 ? ASP E 1355 LEU E 1364 1 ? 10 
HELX_P HELX_P173 AT2 LEU F 129  ? TRP F 141  ? LEU F 129  TRP F 141  1 ? 13 
HELX_P HELX_P174 AT3 LYS F 198  ? GLN F 205  ? LYS F 198  GLN F 205  1 ? 8  
HELX_P HELX_P175 AT4 GLN F 205  ? LEU F 217  ? GLN F 205  LEU F 217  1 ? 13 
HELX_P HELX_P176 AT5 PRO F 257  ? GLU F 266  ? PRO F 257  GLU F 266  1 ? 10 
HELX_P HELX_P177 AT6 GLN F 267  ? GLY F 278  ? GLN F 267  GLY F 278  1 ? 12 
HELX_P HELX_P178 AT7 ALA F 291  ? GLN F 298  ? ALA F 291  GLN F 298  1 ? 8  
HELX_P HELX_P179 AT8 ASP F 305  ? ASN F 316  ? ASP F 305  ASN F 316  1 ? 12 
HELX_P HELX_P180 AT9 VAL F 328  ? ARG F 397  ? VAL F 328  ARG F 397  1 ? 70 
HELX_P HELX_P181 AU1 ASP F 406  ? ALA F 423  ? ASP F 406  ALA F 423  1 ? 18 
HELX_P HELX_P182 AU2 ALA F 423  ? GLU F 451  ? ALA F 423  GLU F 451  1 ? 29 
HELX_P HELX_P183 AU3 TYR F 454  ? ASP F 458  ? TYR F 454  ASP F 458  5 ? 5  
HELX_P HELX_P184 AU4 GLU F 462  ? VAL F 491  ? GLU F 462  VAL F 491  1 ? 30 
HELX_P HELX_P185 AU5 PRO G 249  ? SER G 276  ? PRO G 249  SER G 276  1 ? 28 
HELX_P HELX_P186 AU6 LYS G 278  ? ALA G 322  ? LYS G 278  ALA G 322  1 ? 45 
HELX_P HELX_P187 AU7 ALA G 325  ? GLN G 329  ? ALA G 325  GLN G 329  5 ? 5  
HELX_P HELX_P188 AU8 LYS G 330  ? LEU G 335  ? LYS G 330  LEU G 335  1 ? 6  
HELX_P HELX_P189 AU9 ALA G 341  ? ASN G 377  ? ALA G 341  ASN G 377  1 ? 37 
HELX_P HELX_P190 AV1 PRO G 382  ? LEU G 418  ? PRO G 382  LEU G 418  1 ? 37 
HELX_P HELX_P191 AV2 SER H 335  ? LEU H 406  ? SER H 335  LEU H 406  1 ? 72 
HELX_P HELX_P192 AV3 LEU H 410  ? LEU H 423  ? LEU H 410  LEU H 423  1 ? 14 
HELX_P HELX_P193 AV4 GLU H 431  ? SER H 461  ? GLU H 431  SER H 461  1 ? 31 
HELX_P HELX_P194 AV5 PRO H 470  ? VAL H 499  ? PRO H 470  VAL H 499  1 ? 30 
HELX_P HELX_P195 AV6 GLU H 500  ? VAL H 502  ? GLU H 500  VAL H 502  5 ? 3  
HELX_P HELX_P196 AV7 GLU I 4    ? ALA I 17   ? GLU I 4    ALA I 17   1 ? 14 
HELX_P HELX_P197 AV8 ASN I 32   ? ARG I 42   ? ASN I 32   ARG I 42   1 ? 11 
HELX_P HELX_P198 AV9 SER I 176  ? GLY I 199  ? SER I 176  GLY I 199  1 ? 24 
HELX_P HELX_P199 AW1 PRO I 203  ? ALA I 213  ? PRO I 203  ALA I 213  1 ? 11 
HELX_P HELX_P200 AW2 SER I 219  ? MET I 230  ? SER I 219  MET I 230  1 ? 12 
HELX_P HELX_P201 AW3 GLU I 253  ? PHE I 275  ? GLU I 253  PHE I 275  1 ? 23 
HELX_P HELX_P202 AW4 GLY I 288  ? LYS I 300  ? GLY I 288  LYS I 300  1 ? 13 
HELX_P HELX_P203 AW5 VAL I 318  ? GLY I 329  ? VAL I 318  GLY I 329  1 ? 12 
HELX_P HELX_P204 AW6 ASP I 330  ? ALA I 341  ? ASP I 330  ALA I 341  1 ? 12 
HELX_P HELX_P205 AW7 GLY I 346  ? GLN I 353  ? GLY I 346  GLN I 353  1 ? 8  
HELX_P HELX_P206 AW8 GLU I 368  ? ALA I 378  ? GLU I 368  ALA I 378  1 ? 11 
HELX_P HELX_P207 AW9 ASP I 384  ? ARG I 396  ? ASP I 384  ARG I 396  1 ? 13 
HELX_P HELX_P208 AX1 LYS I 409  ? VAL I 421  ? LYS I 409  VAL I 421  1 ? 13 
HELX_P HELX_P209 AX2 THR I 436  ? ASP I 447  ? THR I 436  ASP I 447  1 ? 12 
HELX_P HELX_P210 AX3 GLY I 449  ? PHE I 453  ? GLY I 449  PHE I 453  1 ? 5  
HELX_P HELX_P211 AX4 LEU I 461  ? ALA I 470  ? LEU I 461  ALA I 470  1 ? 10 
HELX_P HELX_P212 AX5 GLN I 471  ? PHE I 480  ? GLN I 471  PHE I 480  1 ? 10 
HELX_P HELX_P213 AX6 LEU I 485  ? LEU I 499  ? LEU I 485  LEU I 499  1 ? 15 
HELX_P HELX_P214 AX7 ASN I 527  ? GLU I 540  ? ASN I 527  GLU I 540  1 ? 14 
HELX_P HELX_P215 AX8 ASP I 543  ? PHE I 553  ? ASP I 543  PHE I 553  1 ? 11 
HELX_P HELX_P216 AX9 LEU I 554  ? GLU I 557  ? LEU I 554  GLU I 557  5 ? 4  
HELX_P HELX_P217 AY1 GLN I 561  ? ARG I 578  ? GLN I 561  ARG I 578  1 ? 18 
HELX_P HELX_P218 AY2 GLU I 579  ? LEU I 584  ? GLU I 579  LEU I 584  1 ? 6  
HELX_P HELX_P219 AY3 GLY I 596  ? THR I 602  ? GLY I 596  THR I 602  1 ? 7  
HELX_P HELX_P220 AY4 THR I 605  ? GLY I 620  ? THR I 605  GLY I 620  1 ? 16 
HELX_P HELX_P221 AY5 GLU I 623  ? LYS I 633  ? GLU I 623  LYS I 633  1 ? 11 
HELX_P HELX_P222 AY6 ASN I 634  ? SER I 647  ? ASN I 634  SER I 647  1 ? 14 
HELX_P HELX_P223 AY7 ARG I 662  ? ALA I 676  ? ARG I 662  ALA I 676  1 ? 15 
HELX_P HELX_P224 AY8 ASN I 682  ? TYR I 702  ? ASN I 682  TYR I 702  1 ? 21 
HELX_P HELX_P225 AY9 HIS I 706  ? LYS I 718  ? HIS I 706  LYS I 718  1 ? 13 
HELX_P HELX_P226 AZ1 GLU I 728  ? ASN I 736  ? GLU I 728  ASN I 736  1 ? 9  
HELX_P HELX_P227 AZ2 SER I 738  ? PHE I 760  ? SER I 738  PHE I 760  1 ? 23 
HELX_P HELX_P228 AZ3 ARG I 786  ? ILE I 799  ? ARG I 786  ILE I 799  1 ? 14 
HELX_P HELX_P229 AZ4 ASN I 808  ? MET I 814  ? ASN I 808  MET I 814  1 ? 7  
HELX_P HELX_P230 AZ5 TRP J 14   ? VAL J 24   ? TRP J 14   VAL J 24   1 ? 11 
HELX_P HELX_P231 AZ6 ASP J 40   ? HIS J 46   ? ASP J 40   HIS J 46   1 ? 7  
HELX_P HELX_P232 AZ7 LYS J 47   ? SER J 52   ? LYS J 47   SER J 52   5 ? 6  
HELX_P HELX_P233 AZ8 VAL J 61   ? LYS J 69   ? VAL J 61   LYS J 69   1 ? 9  
HELX_P HELX_P234 AZ9 PRO J 87   ? ASP J 102  ? PRO J 87   ASP J 102  1 ? 16 
HELX_P HELX_P235 BA1 GLY J 104  ? GLY J 115  ? GLY J 104  GLY J 115  1 ? 12 
HELX_P HELX_P236 BA2 VAL J 130  ? ARG J 153  ? VAL J 130  ARG J 153  1 ? 24 
HELX_P HELX_P237 BA3 GLU J 165  ? PHE J 173  ? GLU J 165  PHE J 173  1 ? 9  
HELX_P HELX_P238 BA4 LEU J 182  ? ASP J 194  ? LEU J 182  ASP J 194  1 ? 13 
HELX_P HELX_P239 BA5 ASN J 196  ? ARG J 206  ? ASN J 196  ARG J 206  1 ? 11 
HELX_P HELX_P240 BA6 SER J 210  ? GLN J 238  ? SER J 210  GLN J 238  1 ? 29 
HELX_P HELX_P241 BA7 GLY J 242  ? ARG J 255  ? GLY J 242  ARG J 255  1 ? 14 
HELX_P HELX_P242 BA8 VAL J 267  ? ILE J 281  ? VAL J 267  ILE J 281  1 ? 15 
HELX_P HELX_P243 BA9 GLN J 305  ? SER J 317  ? GLN J 305  SER J 317  1 ? 13 
HELX_P HELX_P244 BB1 GLN J 318  ? TRP J 320  ? GLN J 318  TRP J 320  5 ? 3  
HELX_P HELX_P245 BB2 PRO J 323  ? SER J 341  ? PRO J 323  SER J 341  1 ? 19 
HELX_P HELX_P246 BB3 LEU J 343  ? ALA J 350  ? LEU J 343  ALA J 350  1 ? 8  
HELX_P HELX_P247 BB4 GLU J 351  ? ASP J 356  ? GLU J 351  ASP J 356  1 ? 6  
HELX_P HELX_P248 BB5 ASP J 356  ? ASP J 366  ? ASP J 356  ASP J 366  1 ? 11 
HELX_P HELX_P249 BB6 ASN J 367  ? VAL J 378  ? ASN J 367  VAL J 378  1 ? 12 
HELX_P HELX_P250 BB7 GLU J 385  ? MET J 403  ? GLU J 385  MET J 403  1 ? 19 
HELX_P HELX_P251 BB8 MET J 403  ? ALA J 418  ? MET J 403  ALA J 418  1 ? 16 
HELX_P HELX_P252 BB9 ASN J 429  ? ARG J 436  ? ASN J 429  ARG J 436  1 ? 8  
HELX_P HELX_P253 BC1 ARG J 437  ? LYS J 451  ? ARG J 437  LYS J 451  1 ? 15 
HELX_P HELX_P254 BC2 ALA J 460  ? CYS J 465  ? ALA J 460  CYS J 465  1 ? 6  
HELX_P HELX_P255 BC3 LEU J 494  ? LEU J 504  ? LEU J 494  LEU J 504  1 ? 11 
HELX_P HELX_P256 BC4 PRO J 506  ? ALA J 521  ? PRO J 506  ALA J 521  1 ? 16 
HELX_P HELX_P257 BC5 GLY J 523  ? VAL J 536  ? GLY J 523  VAL J 536  1 ? 14 
HELX_P HELX_P258 BC6 SER J 554  ? LEU J 573  ? SER J 554  LEU J 573  1 ? 20 
HELX_P HELX_P259 BC7 LYS J 592  ? TRP J 610  ? LYS J 592  TRP J 610  1 ? 19 
HELX_P HELX_P260 BC8 ASN J 613  ? GLU J 620  ? ASN J 613  GLU J 620  1 ? 8  
HELX_P HELX_P261 BC9 PRO J 626  ? CYS J 636  ? PRO J 626  CYS J 636  1 ? 11 
HELX_P HELX_P262 BD1 LYS J 643  ? GLY J 654  ? LYS J 643  GLY J 654  1 ? 12 
HELX_P HELX_P263 BD2 ALA J 660  ? THR J 670  ? ALA J 660  THR J 670  1 ? 11 
HELX_P HELX_P264 BD3 LEU J 673  ? GLN J 674  ? LEU J 673  GLN J 674  1 ? 2  
HELX_P HELX_P265 BD4 ILE J 687  ? CYS J 698  ? ILE J 687  CYS J 698  1 ? 12 
HELX_P HELX_P266 BD5 GLU J 700  ? GLU J 716  ? GLU J 700  GLU J 716  1 ? 17 
HELX_P HELX_P267 BD6 PHE J 732  ? VAL J 743  ? PHE J 732  VAL J 743  1 ? 12 
HELX_P HELX_P268 BD7 ALA J 755  ? ASP J 775  ? ALA J 755  ASP J 775  1 ? 21 
HELX_P HELX_P269 BD8 PRO J 778  ? PHE J 783  ? PRO J 778  PHE J 783  1 ? 6  
HELX_P HELX_P270 BD9 GLU J 793  ? LYS J 799  ? GLU J 793  LYS J 799  1 ? 7  
HELX_P HELX_P271 BE1 PRO J 801  ? ASN J 811  ? PRO J 801  ASN J 811  1 ? 11 
HELX_P HELX_P272 BE2 ASN J 811  ? GLU J 812  ? ASN J 811  GLU J 812  1 ? 2  
HELX_P HELX_P273 BE3 MET J 815  ? GLU J 825  ? MET J 815  GLU J 825  1 ? 11 
HELX_P HELX_P274 BE4 LYS J 840  ? ASP J 865  ? LYS J 840  ASP J 865  1 ? 26 
HELX_P HELX_P275 BE5 ASP J 865  ? SER J 870  ? ASP J 865  SER J 870  1 ? 6  
HELX_P HELX_P276 BE6 LEU J 882  ? ASN J 887  ? LEU J 882  ASN J 887  1 ? 6  
HELX_P HELX_P277 BE7 ALA J 893  ? LEU J 903  ? ALA J 893  LEU J 903  1 ? 11 
HELX_P HELX_P278 BE8 PRO J 910  ? SER J 924  ? PRO J 910  SER J 924  1 ? 15 
HELX_P HELX_P279 BE9 ASP J 1393 ? THR J 1410 ? ASP J 1393 THR J 1410 1 ? 18 
HELX_P HELX_P280 BF1 PHE J 1414 ? GLN J 1433 ? PHE J 1414 GLN J 1433 1 ? 20 
HELX_P HELX_P281 BF2 GLU J 1437 ? TRP J 1449 ? GLU J 1437 TRP J 1449 1 ? 13 
HELX_P HELX_P282 BF3 ASP J 1457 ? LEU J 1539 ? ASP J 1457 LEU J 1539 1 ? 83 
HELX_P HELX_P283 BF4 PRO J 1544 ? LYS J 1565 ? PRO J 1544 LYS J 1565 1 ? 22 
HELX_P HELX_P284 BF5 ILE J 1566 ? SER J 1576 ? ILE J 1566 SER J 1576 1 ? 11 
HELX_P HELX_P285 BF6 GLY J 1577 ? GLN J 1586 ? GLY J 1577 GLN J 1586 1 ? 10 
HELX_P HELX_P286 BF7 ARG J 1591 ? ASP J 1595 ? ARG J 1591 ASP J 1595 5 ? 5  
HELX_P HELX_P287 BF8 ILE J 1609 ? SER J 1633 ? ILE J 1609 SER J 1633 1 ? 25 
HELX_P HELX_P288 BF9 LEU J 1639 ? HIS J 1652 ? LEU J 1639 HIS J 1652 1 ? 14 
HELX_P HELX_P289 BG1 ASP J 1654 ? LEU J 1660 ? ASP J 1654 LEU J 1660 1 ? 7  
HELX_P HELX_P290 BG2 ASP J 1664 ? ALA J 1684 ? ASP J 1664 ALA J 1684 1 ? 21 
HELX_P HELX_P291 BG3 PRO J 1686 ? GLU J 1691 ? PRO J 1686 GLU J 1691 1 ? 6  
HELX_P HELX_P292 BG4 GLU K 21   ? TYR K 40   ? GLU K 21   TYR K 40   1 ? 20 
HELX_P HELX_P293 BG5 GLU K 45   ? SER K 50   ? GLU K 45   SER K 50   5 ? 6  
HELX_P HELX_P294 BG6 PRO K 90   ? GLN K 96   ? PRO K 90   GLN K 96   1 ? 7  
HELX_P HELX_P295 BG7 SER K 319  ? GLY K 328  ? SER K 319  GLY K 328  1 ? 10 
HELX_P HELX_P296 BG8 ARG K 515  ? LEU K 523  ? ARG K 515  LEU K 523  1 ? 9  
HELX_P HELX_P297 BG9 ILE K 535  ? GLN K 543  ? ILE K 535  GLN K 543  1 ? 9  
HELX_P HELX_P298 BH1 GLN K 543  ? SER K 557  ? GLN K 543  SER K 557  1 ? 15 
HELX_P HELX_P299 BH2 ARG K 563  ? GLY K 577  ? ARG K 563  GLY K 577  1 ? 15 
HELX_P HELX_P300 BH3 SER K 660  ? ALA K 680  ? SER K 660  ALA K 680  1 ? 21 
HELX_P HELX_P301 BH4 PRO K 703  ? ASN K 724  ? PRO K 703  ASN K 724  1 ? 22 
HELX_P HELX_P302 BH5 ASN K 724  ? GLY K 729  ? ASN K 724  GLY K 729  1 ? 6  
HELX_P HELX_P303 BH6 ALA K 770  ? GLU K 800  ? ALA K 770  GLU K 800  1 ? 31 
HELX_P HELX_P304 BH7 GLN K 802  ? GLN K 811  ? GLN K 802  GLN K 811  1 ? 10 
HELX_P HELX_P305 BH8 LEU K 814  ? ILE K 820  ? LEU K 814  ILE K 820  1 ? 7  
HELX_P HELX_P306 BH9 THR K 822  ? ILE K 828  ? THR K 822  ILE K 828  1 ? 7  
HELX_P HELX_P307 BI1 ASP K 830  ? CYS K 844  ? ASP K 830  CYS K 844  1 ? 15 
HELX_P HELX_P308 BI2 ASN K 849  ? CYS K 863  ? ASN K 849  CYS K 863  1 ? 15 
HELX_P HELX_P309 BI3 ALA K 872  ? VAL K 887  ? ALA K 872  VAL K 887  1 ? 16 
HELX_P HELX_P310 BI4 GLU K 899  ? SER K 908  ? GLU K 899  SER K 908  1 ? 10 
HELX_P HELX_P311 BI5 VAL K 911  ? VAL K 923  ? VAL K 911  VAL K 923  1 ? 13 
HELX_P HELX_P312 BI6 PHE K 925  ? ASP K 941  ? PHE K 925  ASP K 941  1 ? 17 
HELX_P HELX_P313 BI7 GLY K 944  ? GLY K 953  ? GLY K 944  GLY K 953  1 ? 10 
HELX_P HELX_P314 BI8 GLY K 961  ? VAL K 983  ? GLY K 961  VAL K 983  1 ? 23 
HELX_P HELX_P315 BI9 ALA K 1016 ? LYS K 1025 ? ALA K 1016 LYS K 1025 1 ? 10 
HELX_P HELX_P316 BJ1 GLN K 1028 ? ARG K 1029 ? GLN K 1028 ARG K 1029 1 ? 2  
HELX_P HELX_P317 BJ2 PHE K 1035 ? ASP K 1047 ? PHE K 1035 ASP K 1047 1 ? 13 
HELX_P HELX_P318 BJ3 LEU K 1048 ? VAL K 1055 ? LEU K 1048 VAL K 1055 1 ? 8  
HELX_P HELX_P319 BJ4 PHE K 1059 ? ALA K 1068 ? PHE K 1059 ALA K 1068 1 ? 10 
HELX_P HELX_P320 BJ5 TYR K 1077 ? ASN K 1088 ? TYR K 1077 ASN K 1088 1 ? 12 
HELX_P HELX_P321 BJ6 SER K 1090 ? MET K 1104 ? SER K 1090 MET K 1104 1 ? 15 
HELX_P HELX_P322 BJ7 SER K 1110 ? SER K 1124 ? SER K 1110 SER K 1124 1 ? 15 
HELX_P HELX_P323 BJ8 PHE K 1140 ? GLN K 1164 ? PHE K 1140 GLN K 1164 1 ? 25 
HELX_P HELX_P324 BJ9 GLN K 1172 ? GLU K 1181 ? GLN K 1172 GLU K 1181 1 ? 10 
HELX_P HELX_P325 BK1 ASP K 1184 ? PHE K 1192 ? ASP K 1184 PHE K 1192 1 ? 9  
HELX_P HELX_P326 BK2 LEU K 1198 ? GLY K 1210 ? LEU K 1198 GLY K 1210 1 ? 13 
HELX_P HELX_P327 BK3 ASP K 1213 ? SER K 1232 ? ASP K 1213 SER K 1232 1 ? 20 
HELX_P HELX_P328 BK4 SER K 1236 ? ALA K 1256 ? SER K 1236 ALA K 1256 1 ? 21 
HELX_P HELX_P329 BK5 PRO K 1263 ? THR K 1277 ? PRO K 1263 THR K 1277 1 ? 15 
HELX_P HELX_P330 BK6 GLY K 1283 ? GLY K 1293 ? GLY K 1283 GLY K 1293 1 ? 11 
HELX_P HELX_P331 BK7 PRO K 1295 ? ARG K 1310 ? PRO K 1295 ARG K 1310 1 ? 16 
HELX_P HELX_P332 BK8 PRO K 1320 ? ASN K 1337 ? PRO K 1320 ASN K 1337 1 ? 18 
HELX_P HELX_P333 BK9 ASP K 1355 ? LEU K 1364 ? ASP K 1355 LEU K 1364 1 ? 10 
HELX_P HELX_P334 BL1 LEU L 129  ? TRP L 141  ? LEU L 129  TRP L 141  1 ? 13 
HELX_P HELX_P335 BL2 LYS L 198  ? GLN L 205  ? LYS L 198  GLN L 205  1 ? 8  
HELX_P HELX_P336 BL3 GLN L 205  ? LEU L 217  ? GLN L 205  LEU L 217  1 ? 13 
HELX_P HELX_P337 BL4 PRO L 257  ? GLU L 266  ? PRO L 257  GLU L 266  1 ? 10 
HELX_P HELX_P338 BL5 GLN L 267  ? GLY L 278  ? GLN L 267  GLY L 278  1 ? 12 
HELX_P HELX_P339 BL6 ALA L 291  ? GLN L 298  ? ALA L 291  GLN L 298  1 ? 8  
HELX_P HELX_P340 BL7 ASP L 305  ? ASN L 316  ? ASP L 305  ASN L 316  1 ? 12 
HELX_P HELX_P341 BL8 VAL L 328  ? ARG L 397  ? VAL L 328  ARG L 397  1 ? 70 
HELX_P HELX_P342 BL9 ASP L 406  ? ALA L 423  ? ASP L 406  ALA L 423  1 ? 18 
HELX_P HELX_P343 BM1 ALA L 423  ? GLU L 451  ? ALA L 423  GLU L 451  1 ? 29 
HELX_P HELX_P344 BM2 TYR L 454  ? ASP L 458  ? TYR L 454  ASP L 458  5 ? 5  
HELX_P HELX_P345 BM3 GLU L 462  ? VAL L 491  ? GLU L 462  VAL L 491  1 ? 30 
HELX_P HELX_P346 BM4 PRO M 249  ? SER M 276  ? PRO M 249  SER M 276  1 ? 28 
HELX_P HELX_P347 BM5 LYS M 278  ? ALA M 322  ? LYS M 278  ALA M 322  1 ? 45 
HELX_P HELX_P348 BM6 ALA M 325  ? GLN M 329  ? ALA M 325  GLN M 329  5 ? 5  
HELX_P HELX_P349 BM7 LYS M 330  ? LEU M 335  ? LYS M 330  LEU M 335  1 ? 6  
HELX_P HELX_P350 BM8 ALA M 341  ? ASN M 377  ? ALA M 341  ASN M 377  1 ? 37 
HELX_P HELX_P351 BM9 PRO M 382  ? LEU M 418  ? PRO M 382  LEU M 418  1 ? 37 
HELX_P HELX_P352 BN1 SER N 335  ? LEU N 406  ? SER N 335  LEU N 406  1 ? 72 
HELX_P HELX_P353 BN2 LEU N 410  ? LEU N 423  ? LEU N 410  LEU N 423  1 ? 14 
HELX_P HELX_P354 BN3 GLU N 431  ? SER N 461  ? GLU N 431  SER N 461  1 ? 31 
HELX_P HELX_P355 BN4 PRO N 470  ? VAL N 499  ? PRO N 470  VAL N 499  1 ? 30 
HELX_P HELX_P356 BN5 GLU N 500  ? VAL N 502  ? GLU N 500  VAL N 502  5 ? 3  
HELX_P HELX_P357 BN6 GLU O 4    ? ALA O 17   ? GLU O 4    ALA O 17   1 ? 14 
HELX_P HELX_P358 BN7 ASN O 32   ? ARG O 42   ? ASN O 32   ARG O 42   1 ? 11 
HELX_P HELX_P359 BN8 SER O 176  ? GLY O 199  ? SER O 176  GLY O 199  1 ? 24 
HELX_P HELX_P360 BN9 PRO O 203  ? ALA O 213  ? PRO O 203  ALA O 213  1 ? 11 
HELX_P HELX_P361 BO1 SER O 219  ? MET O 230  ? SER O 219  MET O 230  1 ? 12 
HELX_P HELX_P362 BO2 GLU O 253  ? PHE O 275  ? GLU O 253  PHE O 275  1 ? 23 
HELX_P HELX_P363 BO3 GLY O 288  ? LYS O 300  ? GLY O 288  LYS O 300  1 ? 13 
HELX_P HELX_P364 BO4 VAL O 318  ? GLY O 329  ? VAL O 318  GLY O 329  1 ? 12 
HELX_P HELX_P365 BO5 ASP O 330  ? ALA O 341  ? ASP O 330  ALA O 341  1 ? 12 
HELX_P HELX_P366 BO6 GLY O 346  ? GLN O 353  ? GLY O 346  GLN O 353  1 ? 8  
HELX_P HELX_P367 BO7 GLU O 368  ? ALA O 378  ? GLU O 368  ALA O 378  1 ? 11 
HELX_P HELX_P368 BO8 ASP O 384  ? ARG O 396  ? ASP O 384  ARG O 396  1 ? 13 
HELX_P HELX_P369 BO9 LYS O 409  ? VAL O 421  ? LYS O 409  VAL O 421  1 ? 13 
HELX_P HELX_P370 BP1 THR O 436  ? ASP O 447  ? THR O 436  ASP O 447  1 ? 12 
HELX_P HELX_P371 BP2 GLY O 449  ? PHE O 453  ? GLY O 449  PHE O 453  1 ? 5  
HELX_P HELX_P372 BP3 LEU O 461  ? ALA O 470  ? LEU O 461  ALA O 470  1 ? 10 
HELX_P HELX_P373 BP4 GLN O 471  ? PHE O 480  ? GLN O 471  PHE O 480  1 ? 10 
HELX_P HELX_P374 BP5 LEU O 485  ? LEU O 499  ? LEU O 485  LEU O 499  1 ? 15 
HELX_P HELX_P375 BP6 ASN O 527  ? GLU O 540  ? ASN O 527  GLU O 540  1 ? 14 
HELX_P HELX_P376 BP7 ASP O 543  ? PHE O 553  ? ASP O 543  PHE O 553  1 ? 11 
HELX_P HELX_P377 BP8 LEU O 554  ? GLU O 557  ? LEU O 554  GLU O 557  5 ? 4  
HELX_P HELX_P378 BP9 GLN O 561  ? ARG O 578  ? GLN O 561  ARG O 578  1 ? 18 
HELX_P HELX_P379 BQ1 GLU O 579  ? LEU O 584  ? GLU O 579  LEU O 584  1 ? 6  
HELX_P HELX_P380 BQ2 GLY O 596  ? THR O 602  ? GLY O 596  THR O 602  1 ? 7  
HELX_P HELX_P381 BQ3 THR O 605  ? GLY O 620  ? THR O 605  GLY O 620  1 ? 16 
HELX_P HELX_P382 BQ4 GLU O 623  ? LYS O 633  ? GLU O 623  LYS O 633  1 ? 11 
HELX_P HELX_P383 BQ5 ASN O 634  ? SER O 647  ? ASN O 634  SER O 647  1 ? 14 
HELX_P HELX_P384 BQ6 ARG O 662  ? ALA O 676  ? ARG O 662  ALA O 676  1 ? 15 
HELX_P HELX_P385 BQ7 ASN O 682  ? TYR O 702  ? ASN O 682  TYR O 702  1 ? 21 
HELX_P HELX_P386 BQ8 HIS O 706  ? LYS O 718  ? HIS O 706  LYS O 718  1 ? 13 
HELX_P HELX_P387 BQ9 GLU O 728  ? ASN O 736  ? GLU O 728  ASN O 736  1 ? 9  
HELX_P HELX_P388 BR1 SER O 738  ? PHE O 760  ? SER O 738  PHE O 760  1 ? 23 
HELX_P HELX_P389 BR2 ARG O 786  ? ILE O 799  ? ARG O 786  ILE O 799  1 ? 14 
HELX_P HELX_P390 BR3 ASN O 808  ? MET O 814  ? ASN O 808  MET O 814  1 ? 7  
HELX_P HELX_P391 BR4 TRP P 14   ? VAL P 24   ? TRP P 14   VAL P 24   1 ? 11 
HELX_P HELX_P392 BR5 ASP P 40   ? HIS P 46   ? ASP P 40   HIS P 46   1 ? 7  
HELX_P HELX_P393 BR6 LYS P 47   ? SER P 52   ? LYS P 47   SER P 52   5 ? 6  
HELX_P HELX_P394 BR7 VAL P 61   ? LYS P 69   ? VAL P 61   LYS P 69   1 ? 9  
HELX_P HELX_P395 BR8 PRO P 87   ? ASP P 102  ? PRO P 87   ASP P 102  1 ? 16 
HELX_P HELX_P396 BR9 GLY P 104  ? GLY P 115  ? GLY P 104  GLY P 115  1 ? 12 
HELX_P HELX_P397 BS1 VAL P 130  ? ARG P 153  ? VAL P 130  ARG P 153  1 ? 24 
HELX_P HELX_P398 BS2 GLU P 165  ? PHE P 173  ? GLU P 165  PHE P 173  1 ? 9  
HELX_P HELX_P399 BS3 LEU P 182  ? ASP P 194  ? LEU P 182  ASP P 194  1 ? 13 
HELX_P HELX_P400 BS4 ASN P 196  ? ARG P 206  ? ASN P 196  ARG P 206  1 ? 11 
HELX_P HELX_P401 BS5 SER P 210  ? GLN P 238  ? SER P 210  GLN P 238  1 ? 29 
HELX_P HELX_P402 BS6 GLY P 242  ? ARG P 255  ? GLY P 242  ARG P 255  1 ? 14 
HELX_P HELX_P403 BS7 VAL P 267  ? ILE P 281  ? VAL P 267  ILE P 281  1 ? 15 
HELX_P HELX_P404 BS8 GLN P 305  ? SER P 317  ? GLN P 305  SER P 317  1 ? 13 
HELX_P HELX_P405 BS9 GLN P 318  ? TRP P 320  ? GLN P 318  TRP P 320  5 ? 3  
HELX_P HELX_P406 BT1 PRO P 323  ? SER P 341  ? PRO P 323  SER P 341  1 ? 19 
HELX_P HELX_P407 BT2 LEU P 343  ? ALA P 350  ? LEU P 343  ALA P 350  1 ? 8  
HELX_P HELX_P408 BT3 GLU P 351  ? ASP P 356  ? GLU P 351  ASP P 356  1 ? 6  
HELX_P HELX_P409 BT4 ASP P 356  ? ASP P 366  ? ASP P 356  ASP P 366  1 ? 11 
HELX_P HELX_P410 BT5 ASN P 367  ? VAL P 378  ? ASN P 367  VAL P 378  1 ? 12 
HELX_P HELX_P411 BT6 GLU P 385  ? MET P 403  ? GLU P 385  MET P 403  1 ? 19 
HELX_P HELX_P412 BT7 MET P 403  ? ALA P 418  ? MET P 403  ALA P 418  1 ? 16 
HELX_P HELX_P413 BT8 ASN P 429  ? ARG P 436  ? ASN P 429  ARG P 436  1 ? 8  
HELX_P HELX_P414 BT9 ARG P 437  ? LYS P 451  ? ARG P 437  LYS P 451  1 ? 15 
HELX_P HELX_P415 BU1 ALA P 460  ? CYS P 465  ? ALA P 460  CYS P 465  1 ? 6  
HELX_P HELX_P416 BU2 LEU P 494  ? LEU P 504  ? LEU P 494  LEU P 504  1 ? 11 
HELX_P HELX_P417 BU3 PRO P 506  ? ALA P 521  ? PRO P 506  ALA P 521  1 ? 16 
HELX_P HELX_P418 BU4 GLY P 523  ? VAL P 536  ? GLY P 523  VAL P 536  1 ? 14 
HELX_P HELX_P419 BU5 SER P 554  ? LEU P 573  ? SER P 554  LEU P 573  1 ? 20 
HELX_P HELX_P420 BU6 LYS P 592  ? TRP P 610  ? LYS P 592  TRP P 610  1 ? 19 
HELX_P HELX_P421 BU7 ASN P 613  ? GLU P 620  ? ASN P 613  GLU P 620  1 ? 8  
HELX_P HELX_P422 BU8 PRO P 626  ? CYS P 636  ? PRO P 626  CYS P 636  1 ? 11 
HELX_P HELX_P423 BU9 LYS P 643  ? GLY P 654  ? LYS P 643  GLY P 654  1 ? 12 
HELX_P HELX_P424 BV1 ALA P 660  ? THR P 670  ? ALA P 660  THR P 670  1 ? 11 
HELX_P HELX_P425 BV2 LEU P 673  ? GLN P 674  ? LEU P 673  GLN P 674  1 ? 2  
HELX_P HELX_P426 BV3 ILE P 687  ? CYS P 698  ? ILE P 687  CYS P 698  1 ? 12 
HELX_P HELX_P427 BV4 GLU P 700  ? GLU P 716  ? GLU P 700  GLU P 716  1 ? 17 
HELX_P HELX_P428 BV5 PHE P 732  ? VAL P 743  ? PHE P 732  VAL P 743  1 ? 12 
HELX_P HELX_P429 BV6 ALA P 755  ? ASP P 775  ? ALA P 755  ASP P 775  1 ? 21 
HELX_P HELX_P430 BV7 PRO P 778  ? PHE P 783  ? PRO P 778  PHE P 783  1 ? 6  
HELX_P HELX_P431 BV8 GLU P 793  ? LYS P 799  ? GLU P 793  LYS P 799  1 ? 7  
HELX_P HELX_P432 BV9 PRO P 801  ? ASN P 811  ? PRO P 801  ASN P 811  1 ? 11 
HELX_P HELX_P433 BW1 ASN P 811  ? GLU P 812  ? ASN P 811  GLU P 812  1 ? 2  
HELX_P HELX_P434 BW2 MET P 815  ? GLU P 825  ? MET P 815  GLU P 825  1 ? 11 
HELX_P HELX_P435 BW3 LYS P 840  ? ASP P 865  ? LYS P 840  ASP P 865  1 ? 26 
HELX_P HELX_P436 BW4 ASP P 865  ? SER P 870  ? ASP P 865  SER P 870  1 ? 6  
HELX_P HELX_P437 BW5 LEU P 882  ? ASN P 887  ? LEU P 882  ASN P 887  1 ? 6  
HELX_P HELX_P438 BW6 ALA P 893  ? LEU P 903  ? ALA P 893  LEU P 903  1 ? 11 
HELX_P HELX_P439 BW7 PRO P 910  ? SER P 924  ? PRO P 910  SER P 924  1 ? 15 
HELX_P HELX_P440 BW8 ASP P 1393 ? THR P 1410 ? ASP P 1393 THR P 1410 1 ? 18 
HELX_P HELX_P441 BW9 PHE P 1414 ? GLN P 1433 ? PHE P 1414 GLN P 1433 1 ? 20 
HELX_P HELX_P442 BX1 GLU P 1437 ? TRP P 1449 ? GLU P 1437 TRP P 1449 1 ? 13 
HELX_P HELX_P443 BX2 ASP P 1457 ? LEU P 1539 ? ASP P 1457 LEU P 1539 1 ? 83 
HELX_P HELX_P444 BX3 PRO P 1544 ? LYS P 1565 ? PRO P 1544 LYS P 1565 1 ? 22 
HELX_P HELX_P445 BX4 ILE P 1566 ? SER P 1576 ? ILE P 1566 SER P 1576 1 ? 11 
HELX_P HELX_P446 BX5 GLY P 1577 ? GLN P 1586 ? GLY P 1577 GLN P 1586 1 ? 10 
HELX_P HELX_P447 BX6 ARG P 1591 ? ASP P 1595 ? ARG P 1591 ASP P 1595 5 ? 5  
HELX_P HELX_P448 BX7 ILE P 1609 ? SER P 1633 ? ILE P 1609 SER P 1633 1 ? 25 
HELX_P HELX_P449 BX8 LEU P 1639 ? HIS P 1652 ? LEU P 1639 HIS P 1652 1 ? 14 
HELX_P HELX_P450 BX9 ASP P 1654 ? LEU P 1660 ? ASP P 1654 LEU P 1660 1 ? 7  
HELX_P HELX_P451 BY1 ASP P 1664 ? ALA P 1684 ? ASP P 1664 ALA P 1684 1 ? 21 
HELX_P HELX_P452 BY2 PRO P 1686 ? GLU P 1691 ? PRO P 1686 GLU P 1691 1 ? 6  
HELX_P HELX_P453 BY3 GLU Q 21   ? TYR Q 40   ? GLU Q 21   TYR Q 40   1 ? 20 
HELX_P HELX_P454 BY4 GLU Q 45   ? SER Q 50   ? GLU Q 45   SER Q 50   5 ? 6  
HELX_P HELX_P455 BY5 PRO Q 90   ? GLN Q 96   ? PRO Q 90   GLN Q 96   1 ? 7  
HELX_P HELX_P456 BY6 SER Q 319  ? GLY Q 328  ? SER Q 319  GLY Q 328  1 ? 10 
HELX_P HELX_P457 BY7 ARG Q 515  ? LEU Q 523  ? ARG Q 515  LEU Q 523  1 ? 9  
HELX_P HELX_P458 BY8 ILE Q 535  ? GLN Q 543  ? ILE Q 535  GLN Q 543  1 ? 9  
HELX_P HELX_P459 BY9 GLN Q 543  ? SER Q 557  ? GLN Q 543  SER Q 557  1 ? 15 
HELX_P HELX_P460 BZ1 ARG Q 563  ? GLY Q 577  ? ARG Q 563  GLY Q 577  1 ? 15 
HELX_P HELX_P461 BZ2 SER Q 660  ? ALA Q 680  ? SER Q 660  ALA Q 680  1 ? 21 
HELX_P HELX_P462 BZ3 PRO Q 703  ? ASN Q 724  ? PRO Q 703  ASN Q 724  1 ? 22 
HELX_P HELX_P463 BZ4 ASN Q 724  ? GLY Q 729  ? ASN Q 724  GLY Q 729  1 ? 6  
HELX_P HELX_P464 BZ5 ALA Q 770  ? GLU Q 800  ? ALA Q 770  GLU Q 800  1 ? 31 
HELX_P HELX_P465 BZ6 GLN Q 802  ? GLN Q 811  ? GLN Q 802  GLN Q 811  1 ? 10 
HELX_P HELX_P466 BZ7 LEU Q 814  ? ILE Q 820  ? LEU Q 814  ILE Q 820  1 ? 7  
HELX_P HELX_P467 BZ8 THR Q 822  ? ILE Q 828  ? THR Q 822  ILE Q 828  1 ? 7  
HELX_P HELX_P468 BZ9 ASP Q 830  ? CYS Q 844  ? ASP Q 830  CYS Q 844  1 ? 15 
HELX_P HELX_P469 CA1 ASN Q 849  ? CYS Q 863  ? ASN Q 849  CYS Q 863  1 ? 15 
HELX_P HELX_P470 CA2 ALA Q 872  ? VAL Q 887  ? ALA Q 872  VAL Q 887  1 ? 16 
HELX_P HELX_P471 CA3 GLU Q 899  ? SER Q 908  ? GLU Q 899  SER Q 908  1 ? 10 
HELX_P HELX_P472 CA4 VAL Q 911  ? VAL Q 923  ? VAL Q 911  VAL Q 923  1 ? 13 
HELX_P HELX_P473 CA5 PHE Q 925  ? ASP Q 941  ? PHE Q 925  ASP Q 941  1 ? 17 
HELX_P HELX_P474 CA6 GLY Q 944  ? GLY Q 953  ? GLY Q 944  GLY Q 953  1 ? 10 
HELX_P HELX_P475 CA7 GLY Q 961  ? VAL Q 983  ? GLY Q 961  VAL Q 983  1 ? 23 
HELX_P HELX_P476 CA8 ALA Q 1016 ? LYS Q 1025 ? ALA Q 1016 LYS Q 1025 1 ? 10 
HELX_P HELX_P477 CA9 GLN Q 1028 ? ARG Q 1029 ? GLN Q 1028 ARG Q 1029 1 ? 2  
HELX_P HELX_P478 CB1 PHE Q 1035 ? ASP Q 1047 ? PHE Q 1035 ASP Q 1047 1 ? 13 
HELX_P HELX_P479 CB2 LEU Q 1048 ? VAL Q 1055 ? LEU Q 1048 VAL Q 1055 1 ? 8  
HELX_P HELX_P480 CB3 PHE Q 1059 ? ALA Q 1068 ? PHE Q 1059 ALA Q 1068 1 ? 10 
HELX_P HELX_P481 CB4 TYR Q 1077 ? ASN Q 1088 ? TYR Q 1077 ASN Q 1088 1 ? 12 
HELX_P HELX_P482 CB5 SER Q 1090 ? MET Q 1104 ? SER Q 1090 MET Q 1104 1 ? 15 
HELX_P HELX_P483 CB6 SER Q 1110 ? SER Q 1124 ? SER Q 1110 SER Q 1124 1 ? 15 
HELX_P HELX_P484 CB7 PHE Q 1140 ? GLN Q 1164 ? PHE Q 1140 GLN Q 1164 1 ? 25 
HELX_P HELX_P485 CB8 GLN Q 1172 ? GLU Q 1181 ? GLN Q 1172 GLU Q 1181 1 ? 10 
HELX_P HELX_P486 CB9 ASP Q 1184 ? PHE Q 1192 ? ASP Q 1184 PHE Q 1192 1 ? 9  
HELX_P HELX_P487 CC1 LEU Q 1198 ? GLY Q 1210 ? LEU Q 1198 GLY Q 1210 1 ? 13 
HELX_P HELX_P488 CC2 ASP Q 1213 ? SER Q 1232 ? ASP Q 1213 SER Q 1232 1 ? 20 
HELX_P HELX_P489 CC3 SER Q 1236 ? ALA Q 1256 ? SER Q 1236 ALA Q 1256 1 ? 21 
HELX_P HELX_P490 CC4 PRO Q 1263 ? THR Q 1277 ? PRO Q 1263 THR Q 1277 1 ? 15 
HELX_P HELX_P491 CC5 GLY Q 1283 ? GLY Q 1293 ? GLY Q 1283 GLY Q 1293 1 ? 11 
HELX_P HELX_P492 CC6 PRO Q 1295 ? ARG Q 1310 ? PRO Q 1295 ARG Q 1310 1 ? 16 
HELX_P HELX_P493 CC7 PRO Q 1320 ? ASN Q 1337 ? PRO Q 1320 ASN Q 1337 1 ? 18 
HELX_P HELX_P494 CC8 ASP Q 1355 ? LEU Q 1364 ? ASP Q 1355 LEU Q 1364 1 ? 10 
HELX_P HELX_P495 CC9 LEU R 129  ? TRP R 141  ? LEU R 129  TRP R 141  1 ? 13 
HELX_P HELX_P496 CD1 LYS R 198  ? GLN R 205  ? LYS R 198  GLN R 205  1 ? 8  
HELX_P HELX_P497 CD2 GLN R 205  ? LEU R 217  ? GLN R 205  LEU R 217  1 ? 13 
HELX_P HELX_P498 CD3 PRO R 257  ? GLU R 266  ? PRO R 257  GLU R 266  1 ? 10 
HELX_P HELX_P499 CD4 GLN R 267  ? GLY R 278  ? GLN R 267  GLY R 278  1 ? 12 
HELX_P HELX_P500 CD5 ALA R 291  ? GLN R 298  ? ALA R 291  GLN R 298  1 ? 8  
HELX_P HELX_P501 CD6 ASP R 305  ? ASN R 316  ? ASP R 305  ASN R 316  1 ? 12 
HELX_P HELX_P502 CD7 VAL R 328  ? ARG R 397  ? VAL R 328  ARG R 397  1 ? 70 
HELX_P HELX_P503 CD8 ASP R 406  ? ALA R 423  ? ASP R 406  ALA R 423  1 ? 18 
HELX_P HELX_P504 CD9 ALA R 423  ? GLU R 451  ? ALA R 423  GLU R 451  1 ? 29 
HELX_P HELX_P505 CE1 TYR R 454  ? ASP R 458  ? TYR R 454  ASP R 458  5 ? 5  
HELX_P HELX_P506 CE2 GLU R 462  ? VAL R 491  ? GLU R 462  VAL R 491  1 ? 30 
HELX_P HELX_P507 CE3 PRO S 249  ? SER S 276  ? PRO S 249  SER S 276  1 ? 28 
HELX_P HELX_P508 CE4 LYS S 278  ? ALA S 322  ? LYS S 278  ALA S 322  1 ? 45 
HELX_P HELX_P509 CE5 ALA S 325  ? GLN S 329  ? ALA S 325  GLN S 329  5 ? 5  
HELX_P HELX_P510 CE6 LYS S 330  ? LEU S 335  ? LYS S 330  LEU S 335  1 ? 6  
HELX_P HELX_P511 CE7 ALA S 341  ? ASN S 377  ? ALA S 341  ASN S 377  1 ? 37 
HELX_P HELX_P512 CE8 PRO S 382  ? LEU S 418  ? PRO S 382  LEU S 418  1 ? 37 
HELX_P HELX_P513 CE9 SER T 335  ? LEU T 406  ? SER T 335  LEU T 406  1 ? 72 
HELX_P HELX_P514 CF1 LEU T 410  ? LEU T 423  ? LEU T 410  LEU T 423  1 ? 14 
HELX_P HELX_P515 CF2 GLU T 431  ? SER T 461  ? GLU T 431  SER T 461  1 ? 31 
HELX_P HELX_P516 CF3 PRO T 470  ? VAL T 499  ? PRO T 470  VAL T 499  1 ? 30 
HELX_P HELX_P517 CF4 GLU T 500  ? VAL T 502  ? GLU T 500  VAL T 502  5 ? 3  
HELX_P HELX_P518 CF5 GLU U 4    ? ALA U 17   ? GLU U 4    ALA U 17   1 ? 14 
HELX_P HELX_P519 CF6 ASN U 32   ? ARG U 42   ? ASN U 32   ARG U 42   1 ? 11 
HELX_P HELX_P520 CF7 SER U 176  ? GLY U 199  ? SER U 176  GLY U 199  1 ? 24 
HELX_P HELX_P521 CF8 PRO U 203  ? ALA U 213  ? PRO U 203  ALA U 213  1 ? 11 
HELX_P HELX_P522 CF9 SER U 219  ? MET U 230  ? SER U 219  MET U 230  1 ? 12 
HELX_P HELX_P523 CG1 GLU U 253  ? PHE U 275  ? GLU U 253  PHE U 275  1 ? 23 
HELX_P HELX_P524 CG2 GLY U 288  ? LYS U 300  ? GLY U 288  LYS U 300  1 ? 13 
HELX_P HELX_P525 CG3 VAL U 318  ? GLY U 329  ? VAL U 318  GLY U 329  1 ? 12 
HELX_P HELX_P526 CG4 ASP U 330  ? ALA U 341  ? ASP U 330  ALA U 341  1 ? 12 
HELX_P HELX_P527 CG5 GLY U 346  ? GLN U 353  ? GLY U 346  GLN U 353  1 ? 8  
HELX_P HELX_P528 CG6 GLU U 368  ? ALA U 378  ? GLU U 368  ALA U 378  1 ? 11 
HELX_P HELX_P529 CG7 ASP U 384  ? ARG U 396  ? ASP U 384  ARG U 396  1 ? 13 
HELX_P HELX_P530 CG8 LYS U 409  ? VAL U 421  ? LYS U 409  VAL U 421  1 ? 13 
HELX_P HELX_P531 CG9 THR U 436  ? ASP U 447  ? THR U 436  ASP U 447  1 ? 12 
HELX_P HELX_P532 CH1 GLY U 449  ? PHE U 453  ? GLY U 449  PHE U 453  1 ? 5  
HELX_P HELX_P533 CH2 LEU U 461  ? ALA U 470  ? LEU U 461  ALA U 470  1 ? 10 
HELX_P HELX_P534 CH3 GLN U 471  ? PHE U 480  ? GLN U 471  PHE U 480  1 ? 10 
HELX_P HELX_P535 CH4 LEU U 485  ? LEU U 499  ? LEU U 485  LEU U 499  1 ? 15 
HELX_P HELX_P536 CH5 ASN U 527  ? GLU U 540  ? ASN U 527  GLU U 540  1 ? 14 
HELX_P HELX_P537 CH6 ASP U 543  ? PHE U 553  ? ASP U 543  PHE U 553  1 ? 11 
HELX_P HELX_P538 CH7 LEU U 554  ? GLU U 557  ? LEU U 554  GLU U 557  5 ? 4  
HELX_P HELX_P539 CH8 GLN U 561  ? ARG U 578  ? GLN U 561  ARG U 578  1 ? 18 
HELX_P HELX_P540 CH9 GLU U 579  ? LEU U 584  ? GLU U 579  LEU U 584  1 ? 6  
HELX_P HELX_P541 CI1 GLY U 596  ? THR U 602  ? GLY U 596  THR U 602  1 ? 7  
HELX_P HELX_P542 CI2 THR U 605  ? GLY U 620  ? THR U 605  GLY U 620  1 ? 16 
HELX_P HELX_P543 CI3 GLU U 623  ? LYS U 633  ? GLU U 623  LYS U 633  1 ? 11 
HELX_P HELX_P544 CI4 ASN U 634  ? SER U 647  ? ASN U 634  SER U 647  1 ? 14 
HELX_P HELX_P545 CI5 ARG U 662  ? ALA U 676  ? ARG U 662  ALA U 676  1 ? 15 
HELX_P HELX_P546 CI6 ASN U 682  ? TYR U 702  ? ASN U 682  TYR U 702  1 ? 21 
HELX_P HELX_P547 CI7 HIS U 706  ? LYS U 718  ? HIS U 706  LYS U 718  1 ? 13 
HELX_P HELX_P548 CI8 GLU U 728  ? ASN U 736  ? GLU U 728  ASN U 736  1 ? 9  
HELX_P HELX_P549 CI9 SER U 738  ? PHE U 760  ? SER U 738  PHE U 760  1 ? 23 
HELX_P HELX_P550 CJ1 ARG U 786  ? ILE U 799  ? ARG U 786  ILE U 799  1 ? 14 
HELX_P HELX_P551 CJ2 ASN U 808  ? MET U 814  ? ASN U 808  MET U 814  1 ? 7  
HELX_P HELX_P552 CJ3 TRP V 14   ? VAL V 24   ? TRP V 14   VAL V 24   1 ? 11 
HELX_P HELX_P553 CJ4 ASP V 40   ? HIS V 46   ? ASP V 40   HIS V 46   1 ? 7  
HELX_P HELX_P554 CJ5 LYS V 47   ? SER V 52   ? LYS V 47   SER V 52   5 ? 6  
HELX_P HELX_P555 CJ6 VAL V 61   ? LYS V 69   ? VAL V 61   LYS V 69   1 ? 9  
HELX_P HELX_P556 CJ7 PRO V 87   ? ASP V 102  ? PRO V 87   ASP V 102  1 ? 16 
HELX_P HELX_P557 CJ8 GLY V 104  ? GLY V 115  ? GLY V 104  GLY V 115  1 ? 12 
HELX_P HELX_P558 CJ9 VAL V 130  ? ARG V 153  ? VAL V 130  ARG V 153  1 ? 24 
HELX_P HELX_P559 CK1 GLU V 165  ? PHE V 173  ? GLU V 165  PHE V 173  1 ? 9  
HELX_P HELX_P560 CK2 LEU V 182  ? ASP V 194  ? LEU V 182  ASP V 194  1 ? 13 
HELX_P HELX_P561 CK3 ASN V 196  ? ARG V 206  ? ASN V 196  ARG V 206  1 ? 11 
HELX_P HELX_P562 CK4 SER V 210  ? GLN V 238  ? SER V 210  GLN V 238  1 ? 29 
HELX_P HELX_P563 CK5 GLY V 242  ? ARG V 255  ? GLY V 242  ARG V 255  1 ? 14 
HELX_P HELX_P564 CK6 VAL V 267  ? ILE V 281  ? VAL V 267  ILE V 281  1 ? 15 
HELX_P HELX_P565 CK7 GLN V 305  ? SER V 317  ? GLN V 305  SER V 317  1 ? 13 
HELX_P HELX_P566 CK8 GLN V 318  ? TRP V 320  ? GLN V 318  TRP V 320  5 ? 3  
HELX_P HELX_P567 CK9 PRO V 323  ? SER V 341  ? PRO V 323  SER V 341  1 ? 19 
HELX_P HELX_P568 CL1 LEU V 343  ? ALA V 350  ? LEU V 343  ALA V 350  1 ? 8  
HELX_P HELX_P569 CL2 GLU V 351  ? ASP V 356  ? GLU V 351  ASP V 356  1 ? 6  
HELX_P HELX_P570 CL3 ASP V 356  ? ASP V 366  ? ASP V 356  ASP V 366  1 ? 11 
HELX_P HELX_P571 CL4 ASN V 367  ? VAL V 378  ? ASN V 367  VAL V 378  1 ? 12 
HELX_P HELX_P572 CL5 GLU V 385  ? MET V 403  ? GLU V 385  MET V 403  1 ? 19 
HELX_P HELX_P573 CL6 MET V 403  ? ALA V 418  ? MET V 403  ALA V 418  1 ? 16 
HELX_P HELX_P574 CL7 ASN V 429  ? ARG V 436  ? ASN V 429  ARG V 436  1 ? 8  
HELX_P HELX_P575 CL8 ARG V 437  ? LYS V 451  ? ARG V 437  LYS V 451  1 ? 15 
HELX_P HELX_P576 CL9 ALA V 460  ? CYS V 465  ? ALA V 460  CYS V 465  1 ? 6  
HELX_P HELX_P577 CM1 LEU V 494  ? LEU V 504  ? LEU V 494  LEU V 504  1 ? 11 
HELX_P HELX_P578 CM2 PRO V 506  ? ALA V 521  ? PRO V 506  ALA V 521  1 ? 16 
HELX_P HELX_P579 CM3 GLY V 523  ? VAL V 536  ? GLY V 523  VAL V 536  1 ? 14 
HELX_P HELX_P580 CM4 SER V 554  ? LEU V 573  ? SER V 554  LEU V 573  1 ? 20 
HELX_P HELX_P581 CM5 LYS V 592  ? TRP V 610  ? LYS V 592  TRP V 610  1 ? 19 
HELX_P HELX_P582 CM6 ASN V 613  ? GLU V 620  ? ASN V 613  GLU V 620  1 ? 8  
HELX_P HELX_P583 CM7 PRO V 626  ? CYS V 636  ? PRO V 626  CYS V 636  1 ? 11 
HELX_P HELX_P584 CM8 LYS V 643  ? GLY V 654  ? LYS V 643  GLY V 654  1 ? 12 
HELX_P HELX_P585 CM9 ALA V 660  ? THR V 670  ? ALA V 660  THR V 670  1 ? 11 
HELX_P HELX_P586 CN1 LEU V 673  ? GLN V 674  ? LEU V 673  GLN V 674  1 ? 2  
HELX_P HELX_P587 CN2 ILE V 687  ? CYS V 698  ? ILE V 687  CYS V 698  1 ? 12 
HELX_P HELX_P588 CN3 GLU V 700  ? GLU V 716  ? GLU V 700  GLU V 716  1 ? 17 
HELX_P HELX_P589 CN4 PHE V 732  ? VAL V 743  ? PHE V 732  VAL V 743  1 ? 12 
HELX_P HELX_P590 CN5 ALA V 755  ? ASP V 775  ? ALA V 755  ASP V 775  1 ? 21 
HELX_P HELX_P591 CN6 PRO V 778  ? PHE V 783  ? PRO V 778  PHE V 783  1 ? 6  
HELX_P HELX_P592 CN7 GLU V 793  ? LYS V 799  ? GLU V 793  LYS V 799  1 ? 7  
HELX_P HELX_P593 CN8 PRO V 801  ? ASN V 811  ? PRO V 801  ASN V 811  1 ? 11 
HELX_P HELX_P594 CN9 ASN V 811  ? GLU V 812  ? ASN V 811  GLU V 812  1 ? 2  
HELX_P HELX_P595 CO1 MET V 815  ? GLU V 825  ? MET V 815  GLU V 825  1 ? 11 
HELX_P HELX_P596 CO2 LYS V 840  ? ASP V 865  ? LYS V 840  ASP V 865  1 ? 26 
HELX_P HELX_P597 CO3 ASP V 865  ? SER V 870  ? ASP V 865  SER V 870  1 ? 6  
HELX_P HELX_P598 CO4 LEU V 882  ? ASN V 887  ? LEU V 882  ASN V 887  1 ? 6  
HELX_P HELX_P599 CO5 ALA V 893  ? LEU V 903  ? ALA V 893  LEU V 903  1 ? 11 
HELX_P HELX_P600 CO6 PRO V 910  ? SER V 924  ? PRO V 910  SER V 924  1 ? 15 
HELX_P HELX_P601 CO7 ASP V 1393 ? THR V 1410 ? ASP V 1393 THR V 1410 1 ? 18 
HELX_P HELX_P602 CO8 PHE V 1414 ? GLN V 1433 ? PHE V 1414 GLN V 1433 1 ? 20 
HELX_P HELX_P603 CO9 GLU V 1437 ? TRP V 1449 ? GLU V 1437 TRP V 1449 1 ? 13 
HELX_P HELX_P604 CP1 ASP V 1457 ? LEU V 1539 ? ASP V 1457 LEU V 1539 1 ? 83 
HELX_P HELX_P605 CP2 PRO V 1544 ? LYS V 1565 ? PRO V 1544 LYS V 1565 1 ? 22 
HELX_P HELX_P606 CP3 ILE V 1566 ? SER V 1576 ? ILE V 1566 SER V 1576 1 ? 11 
HELX_P HELX_P607 CP4 GLY V 1577 ? GLN V 1586 ? GLY V 1577 GLN V 1586 1 ? 10 
HELX_P HELX_P608 CP5 ARG V 1591 ? ASP V 1595 ? ARG V 1591 ASP V 1595 5 ? 5  
HELX_P HELX_P609 CP6 ILE V 1609 ? SER V 1633 ? ILE V 1609 SER V 1633 1 ? 25 
HELX_P HELX_P610 CP7 LEU V 1639 ? HIS V 1652 ? LEU V 1639 HIS V 1652 1 ? 14 
HELX_P HELX_P611 CP8 ASP V 1654 ? LEU V 1660 ? ASP V 1654 LEU V 1660 1 ? 7  
HELX_P HELX_P612 CP9 ASP V 1664 ? ALA V 1684 ? ASP V 1664 ALA V 1684 1 ? 21 
HELX_P HELX_P613 CQ1 PRO V 1686 ? GLU V 1691 ? PRO V 1686 GLU V 1691 1 ? 6  
HELX_P HELX_P614 CQ2 GLU W 21   ? TYR W 40   ? GLU W 21   TYR W 40   1 ? 20 
HELX_P HELX_P615 CQ3 GLU W 45   ? SER W 50   ? GLU W 45   SER W 50   5 ? 6  
HELX_P HELX_P616 CQ4 PRO W 90   ? GLN W 96   ? PRO W 90   GLN W 96   1 ? 7  
HELX_P HELX_P617 CQ5 SER W 319  ? GLY W 328  ? SER W 319  GLY W 328  1 ? 10 
HELX_P HELX_P618 CQ6 ARG W 515  ? LEU W 523  ? ARG W 515  LEU W 523  1 ? 9  
HELX_P HELX_P619 CQ7 ILE W 535  ? GLN W 543  ? ILE W 535  GLN W 543  1 ? 9  
HELX_P HELX_P620 CQ8 GLN W 543  ? SER W 557  ? GLN W 543  SER W 557  1 ? 15 
HELX_P HELX_P621 CQ9 ARG W 563  ? GLY W 577  ? ARG W 563  GLY W 577  1 ? 15 
HELX_P HELX_P622 CR1 SER W 660  ? ALA W 680  ? SER W 660  ALA W 680  1 ? 21 
HELX_P HELX_P623 CR2 PRO W 703  ? ASN W 724  ? PRO W 703  ASN W 724  1 ? 22 
HELX_P HELX_P624 CR3 ASN W 724  ? GLY W 729  ? ASN W 724  GLY W 729  1 ? 6  
HELX_P HELX_P625 CR4 ALA W 770  ? GLU W 800  ? ALA W 770  GLU W 800  1 ? 31 
HELX_P HELX_P626 CR5 GLN W 802  ? GLN W 811  ? GLN W 802  GLN W 811  1 ? 10 
HELX_P HELX_P627 CR6 LEU W 814  ? ILE W 820  ? LEU W 814  ILE W 820  1 ? 7  
HELX_P HELX_P628 CR7 THR W 822  ? ILE W 828  ? THR W 822  ILE W 828  1 ? 7  
HELX_P HELX_P629 CR8 ASP W 830  ? CYS W 844  ? ASP W 830  CYS W 844  1 ? 15 
HELX_P HELX_P630 CR9 ASN W 849  ? CYS W 863  ? ASN W 849  CYS W 863  1 ? 15 
HELX_P HELX_P631 CS1 ALA W 872  ? VAL W 887  ? ALA W 872  VAL W 887  1 ? 16 
HELX_P HELX_P632 CS2 GLU W 899  ? SER W 908  ? GLU W 899  SER W 908  1 ? 10 
HELX_P HELX_P633 CS3 VAL W 911  ? VAL W 923  ? VAL W 911  VAL W 923  1 ? 13 
HELX_P HELX_P634 CS4 PHE W 925  ? ASP W 941  ? PHE W 925  ASP W 941  1 ? 17 
HELX_P HELX_P635 CS5 GLY W 944  ? GLY W 953  ? GLY W 944  GLY W 953  1 ? 10 
HELX_P HELX_P636 CS6 GLY W 961  ? VAL W 983  ? GLY W 961  VAL W 983  1 ? 23 
HELX_P HELX_P637 CS7 ALA W 1016 ? LYS W 1025 ? ALA W 1016 LYS W 1025 1 ? 10 
HELX_P HELX_P638 CS8 GLN W 1028 ? ARG W 1029 ? GLN W 1028 ARG W 1029 1 ? 2  
HELX_P HELX_P639 CS9 PHE W 1035 ? ASP W 1047 ? PHE W 1035 ASP W 1047 1 ? 13 
HELX_P HELX_P640 CT1 LEU W 1048 ? VAL W 1055 ? LEU W 1048 VAL W 1055 1 ? 8  
HELX_P HELX_P641 CT2 PHE W 1059 ? ALA W 1068 ? PHE W 1059 ALA W 1068 1 ? 10 
HELX_P HELX_P642 CT3 TYR W 1077 ? ASN W 1088 ? TYR W 1077 ASN W 1088 1 ? 12 
HELX_P HELX_P643 CT4 SER W 1090 ? MET W 1104 ? SER W 1090 MET W 1104 1 ? 15 
HELX_P HELX_P644 CT5 SER W 1110 ? SER W 1124 ? SER W 1110 SER W 1124 1 ? 15 
HELX_P HELX_P645 CT6 PHE W 1140 ? GLN W 1164 ? PHE W 1140 GLN W 1164 1 ? 25 
HELX_P HELX_P646 CT7 GLN W 1172 ? GLU W 1181 ? GLN W 1172 GLU W 1181 1 ? 10 
HELX_P HELX_P647 CT8 ASP W 1184 ? PHE W 1192 ? ASP W 1184 PHE W 1192 1 ? 9  
HELX_P HELX_P648 CT9 LEU W 1198 ? GLY W 1210 ? LEU W 1198 GLY W 1210 1 ? 13 
HELX_P HELX_P649 CU1 ASP W 1213 ? SER W 1232 ? ASP W 1213 SER W 1232 1 ? 20 
HELX_P HELX_P650 CU2 SER W 1236 ? ALA W 1256 ? SER W 1236 ALA W 1256 1 ? 21 
HELX_P HELX_P651 CU3 PRO W 1263 ? THR W 1277 ? PRO W 1263 THR W 1277 1 ? 15 
HELX_P HELX_P652 CU4 GLY W 1283 ? GLY W 1293 ? GLY W 1283 GLY W 1293 1 ? 11 
HELX_P HELX_P653 CU5 PRO W 1295 ? ARG W 1310 ? PRO W 1295 ARG W 1310 1 ? 16 
HELX_P HELX_P654 CU6 PRO W 1320 ? ASN W 1337 ? PRO W 1320 ASN W 1337 1 ? 18 
HELX_P HELX_P655 CU7 ASP W 1355 ? LEU W 1364 ? ASP W 1355 LEU W 1364 1 ? 10 
HELX_P HELX_P656 CU8 LEU X 129  ? TRP X 141  ? LEU X 129  TRP X 141  1 ? 13 
HELX_P HELX_P657 CU9 LYS X 198  ? GLN X 205  ? LYS X 198  GLN X 205  1 ? 8  
HELX_P HELX_P658 CV1 GLN X 205  ? LEU X 217  ? GLN X 205  LEU X 217  1 ? 13 
HELX_P HELX_P659 CV2 PRO X 257  ? GLU X 266  ? PRO X 257  GLU X 266  1 ? 10 
HELX_P HELX_P660 CV3 GLN X 267  ? GLY X 278  ? GLN X 267  GLY X 278  1 ? 12 
HELX_P HELX_P661 CV4 ALA X 291  ? GLN X 298  ? ALA X 291  GLN X 298  1 ? 8  
HELX_P HELX_P662 CV5 ASP X 305  ? ASN X 316  ? ASP X 305  ASN X 316  1 ? 12 
HELX_P HELX_P663 CV6 VAL X 328  ? ARG X 397  ? VAL X 328  ARG X 397  1 ? 70 
HELX_P HELX_P664 CV7 ASP X 406  ? ALA X 423  ? ASP X 406  ALA X 423  1 ? 18 
HELX_P HELX_P665 CV8 ALA X 423  ? GLU X 451  ? ALA X 423  GLU X 451  1 ? 29 
HELX_P HELX_P666 CV9 TYR X 454  ? ASP X 458  ? TYR X 454  ASP X 458  5 ? 5  
HELX_P HELX_P667 CW1 GLU X 462  ? VAL X 491  ? GLU X 462  VAL X 491  1 ? 30 
HELX_P HELX_P668 CW2 PRO Y 249  ? SER Y 276  ? PRO Y 249  SER Y 276  1 ? 28 
HELX_P HELX_P669 CW3 LYS Y 278  ? ALA Y 322  ? LYS Y 278  ALA Y 322  1 ? 45 
HELX_P HELX_P670 CW4 ALA Y 325  ? GLN Y 329  ? ALA Y 325  GLN Y 329  5 ? 5  
HELX_P HELX_P671 CW5 LYS Y 330  ? LEU Y 335  ? LYS Y 330  LEU Y 335  1 ? 6  
HELX_P HELX_P672 CW6 ALA Y 341  ? ASN Y 377  ? ALA Y 341  ASN Y 377  1 ? 37 
HELX_P HELX_P673 CW7 PRO Y 382  ? LEU Y 418  ? PRO Y 382  LEU Y 418  1 ? 37 
HELX_P HELX_P674 CW8 SER Z 335  ? LEU Z 406  ? SER Z 335  LEU Z 406  1 ? 72 
HELX_P HELX_P675 CW9 LEU Z 410  ? LEU Z 423  ? LEU Z 410  LEU Z 423  1 ? 14 
HELX_P HELX_P676 CX1 GLU Z 431  ? SER Z 461  ? GLU Z 431  SER Z 461  1 ? 31 
HELX_P HELX_P677 CX2 PRO Z 470  ? VAL Z 499  ? PRO Z 470  VAL Z 499  1 ? 30 
HELX_P HELX_P678 CX3 GLU Z 500  ? VAL Z 502  ? GLU Z 500  VAL Z 502  5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1   MET 312 A . ? MET 312 A SER 313 A ? SER 313 A 1 -0.26  
2   LYS 404 A . ? LYS 404 A PRO 405 A ? PRO 405 A 1 -11.16 
3   MET 312 B . ? MET 312 B SER 313 B ? SER 313 B 1 -0.29  
4   LYS 404 B . ? LYS 404 B PRO 405 B ? PRO 405 B 1 -11.12 
5   GLU 19  C . ? GLU 19  C THR 20  C ? THR 20  C 1 4.23   
6   MET 312 E . ? MET 312 E SER 313 E ? SER 313 E 1 -0.34  
7   LYS 404 E . ? LYS 404 E PRO 405 E ? PRO 405 E 1 -11.17 
8   PRO 942 E . ? PRO 942 E GLN 943 E ? GLN 943 E 1 -3.87  
9   GLU 19  I . ? GLU 19  I THR 20  I ? THR 20  I 1 4.22   
10  MET 312 K . ? MET 312 K SER 313 K ? SER 313 K 1 -0.43  
11  LYS 404 K . ? LYS 404 K PRO 405 K ? PRO 405 K 1 -11.27 
12  PRO 942 K . ? PRO 942 K GLN 943 K ? GLN 943 K 1 -3.89  
13  GLU 19  O . ? GLU 19  O THR 20  O ? THR 20  O 1 4.23   
14  MET 312 Q . ? MET 312 Q SER 313 Q ? SER 313 Q 1 -0.20  
15  LYS 404 Q . ? LYS 404 Q PRO 405 Q ? PRO 405 Q 1 -11.14 
16  PRO 942 Q . ? PRO 942 Q GLN 943 Q ? GLN 943 Q 1 -3.93  
17  GLU 19  U . ? GLU 19  U THR 20  U ? THR 20  U 1 4.24   
18  MET 312 W . ? MET 312 W SER 313 W ? SER 313 W 1 -0.35  
19  LYS 404 W . ? LYS 404 W PRO 405 W ? PRO 405 W 1 -11.16 
20  PRO 942 W . ? PRO 942 W GLN 943 W ? GLN 943 W 1 -3.92  
21  MET 312 A . ? MET 312 A SER 313 A ? SER 313 A 2 -0.20  
22  LYS 404 A . ? LYS 404 A PRO 405 A ? PRO 405 A 2 -11.10 
23  MET 312 B . ? MET 312 B SER 313 B ? SER 313 B 2 -0.31  
24  LYS 404 B . ? LYS 404 B PRO 405 B ? PRO 405 B 2 -11.15 
25  GLU 19  C . ? GLU 19  C THR 20  C ? THR 20  C 2 4.18   
26  MET 312 E . ? MET 312 E SER 313 E ? SER 313 E 2 -0.29  
27  LYS 404 E . ? LYS 404 E PRO 405 E ? PRO 405 E 2 -11.15 
28  PRO 942 E . ? PRO 942 E GLN 943 E ? GLN 943 E 2 -3.94  
29  GLU 19  I . ? GLU 19  I THR 20  I ? THR 20  I 2 4.17   
30  MET 312 K . ? MET 312 K SER 313 K ? SER 313 K 2 -0.33  
31  LYS 404 K . ? LYS 404 K PRO 405 K ? PRO 405 K 2 -11.12 
32  PRO 942 K . ? PRO 942 K GLN 943 K ? GLN 943 K 2 -3.86  
33  GLU 19  O . ? GLU 19  O THR 20  O ? THR 20  O 2 4.24   
34  MET 312 Q . ? MET 312 Q SER 313 Q ? SER 313 Q 2 -0.14  
35  LYS 404 Q . ? LYS 404 Q PRO 405 Q ? PRO 405 Q 2 -11.14 
36  PRO 942 Q . ? PRO 942 Q GLN 943 Q ? GLN 943 Q 2 -3.86  
37  GLU 19  U . ? GLU 19  U THR 20  U ? THR 20  U 2 4.11   
38  MET 312 W . ? MET 312 W SER 313 W ? SER 313 W 2 -0.24  
39  LYS 404 W . ? LYS 404 W PRO 405 W ? PRO 405 W 2 -11.10 
40  PRO 942 W . ? PRO 942 W GLN 943 W ? GLN 943 W 2 -3.92  
41  MET 312 A . ? MET 312 A SER 313 A ? SER 313 A 3 -0.20  
42  LYS 404 A . ? LYS 404 A PRO 405 A ? PRO 405 A 3 -11.10 
43  MET 312 B . ? MET 312 B SER 313 B ? SER 313 B 3 -0.31  
44  LYS 404 B . ? LYS 404 B PRO 405 B ? PRO 405 B 3 -11.15 
45  GLU 19  C . ? GLU 19  C THR 20  C ? THR 20  C 3 4.18   
46  MET 312 E . ? MET 312 E SER 313 E ? SER 313 E 3 -0.29  
47  LYS 404 E . ? LYS 404 E PRO 405 E ? PRO 405 E 3 -11.15 
48  PRO 942 E . ? PRO 942 E GLN 943 E ? GLN 943 E 3 -3.94  
49  GLU 19  I . ? GLU 19  I THR 20  I ? THR 20  I 3 4.29   
50  MET 312 K . ? MET 312 K SER 313 K ? SER 313 K 3 -0.33  
51  LYS 404 K . ? LYS 404 K PRO 405 K ? PRO 405 K 3 -11.12 
52  PRO 942 K . ? PRO 942 K GLN 943 K ? GLN 943 K 3 -3.86  
53  GLU 19  O . ? GLU 19  O THR 20  O ? THR 20  O 3 4.24   
54  MET 312 Q . ? MET 312 Q SER 313 Q ? SER 313 Q 3 -0.14  
55  LYS 404 Q . ? LYS 404 Q PRO 405 Q ? PRO 405 Q 3 -11.14 
56  PRO 942 Q . ? PRO 942 Q GLN 943 Q ? GLN 943 Q 3 -3.86  
57  GLU 19  U . ? GLU 19  U THR 20  U ? THR 20  U 3 4.34   
58  MET 312 W . ? MET 312 W SER 313 W ? SER 313 W 3 -0.24  
59  LYS 404 W . ? LYS 404 W PRO 405 W ? PRO 405 W 3 -11.10 
60  PRO 942 W . ? PRO 942 W GLN 943 W ? GLN 943 W 3 -3.92  
61  MET 312 A . ? MET 312 A SER 313 A ? SER 313 A 4 -0.20  
62  LYS 404 A . ? LYS 404 A PRO 405 A ? PRO 405 A 4 -11.10 
63  MET 312 B . ? MET 312 B SER 313 B ? SER 313 B 4 -0.31  
64  LYS 404 B . ? LYS 404 B PRO 405 B ? PRO 405 B 4 -11.15 
65  GLU 19  C . ? GLU 19  C THR 20  C ? THR 20  C 4 4.22   
66  MET 312 E . ? MET 312 E SER 313 E ? SER 313 E 4 -0.29  
67  LYS 404 E . ? LYS 404 E PRO 405 E ? PRO 405 E 4 -11.15 
68  PRO 942 E . ? PRO 942 E GLN 943 E ? GLN 943 E 4 -3.94  
69  GLU 19  I . ? GLU 19  I THR 20  I ? THR 20  I 4 4.17   
70  MET 312 K . ? MET 312 K SER 313 K ? SER 313 K 4 -0.33  
71  LYS 404 K . ? LYS 404 K PRO 405 K ? PRO 405 K 4 -11.12 
72  PRO 942 K . ? PRO 942 K GLN 943 K ? GLN 943 K 4 -3.86  
73  GLU 19  O . ? GLU 19  O THR 20  O ? THR 20  O 4 4.22   
74  MET 312 Q . ? MET 312 Q SER 313 Q ? SER 313 Q 4 -0.14  
75  LYS 404 Q . ? LYS 404 Q PRO 405 Q ? PRO 405 Q 4 -11.14 
76  PRO 942 Q . ? PRO 942 Q GLN 943 Q ? GLN 943 Q 4 -3.86  
77  GLU 19  U . ? GLU 19  U THR 20  U ? THR 20  U 4 4.11   
78  MET 312 W . ? MET 312 W SER 313 W ? SER 313 W 4 -0.24  
79  LYS 404 W . ? LYS 404 W PRO 405 W ? PRO 405 W 4 -11.10 
80  PRO 942 W . ? PRO 942 W GLN 943 W ? GLN 943 W 4 -3.92  
81  MET 312 A . ? MET 312 A SER 313 A ? SER 313 A 5 -0.20  
82  LYS 404 A . ? LYS 404 A PRO 405 A ? PRO 405 A 5 -11.10 
83  MET 312 B . ? MET 312 B SER 313 B ? SER 313 B 5 -0.31  
84  LYS 404 B . ? LYS 404 B PRO 405 B ? PRO 405 B 5 -11.15 
85  GLU 19  C . ? GLU 19  C THR 20  C ? THR 20  C 5 4.22   
86  MET 312 E . ? MET 312 E SER 313 E ? SER 313 E 5 -0.29  
87  LYS 404 E . ? LYS 404 E PRO 405 E ? PRO 405 E 5 -11.15 
88  PRO 942 E . ? PRO 942 E GLN 943 E ? GLN 943 E 5 -3.94  
89  GLU 19  I . ? GLU 19  I THR 20  I ? THR 20  I 5 4.17   
90  MET 312 K . ? MET 312 K SER 313 K ? SER 313 K 5 -0.33  
91  LYS 404 K . ? LYS 404 K PRO 405 K ? PRO 405 K 5 -11.12 
92  PRO 942 K . ? PRO 942 K GLN 943 K ? GLN 943 K 5 -3.86  
93  GLU 19  O . ? GLU 19  O THR 20  O ? THR 20  O 5 4.22   
94  MET 312 Q . ? MET 312 Q SER 313 Q ? SER 313 Q 5 -0.14  
95  LYS 404 Q . ? LYS 404 Q PRO 405 Q ? PRO 405 Q 5 -11.14 
96  PRO 942 Q . ? PRO 942 Q GLN 943 Q ? GLN 943 Q 5 -3.86  
97  GLU 19  U . ? GLU 19  U THR 20  U ? THR 20  U 5 4.11   
98  MET 312 W . ? MET 312 W SER 313 W ? SER 313 W 5 -0.24  
99  LYS 404 W . ? LYS 404 W PRO 405 W ? PRO 405 W 5 -11.10 
100 PRO 942 W . ? PRO 942 W GLN 943 W ? GLN 943 W 5 -3.92  
101 MET 312 A . ? MET 312 A SER 313 A ? SER 313 A 6 -0.20  
102 LYS 404 A . ? LYS 404 A PRO 405 A ? PRO 405 A 6 -11.10 
103 MET 312 B . ? MET 312 B SER 313 B ? SER 313 B 6 -0.31  
104 LYS 404 B . ? LYS 404 B PRO 405 B ? PRO 405 B 6 -11.15 
105 GLU 19  C . ? GLU 19  C THR 20  C ? THR 20  C 6 4.22   
106 MET 312 E . ? MET 312 E SER 313 E ? SER 313 E 6 -0.31  
107 LYS 404 E . ? LYS 404 E PRO 405 E ? PRO 405 E 6 -11.04 
108 PRO 942 E . ? PRO 942 E GLN 943 E ? GLN 943 E 6 -3.85  
109 GLU 19  I . ? GLU 19  I THR 20  I ? THR 20  I 6 4.17   
110 MET 312 K . ? MET 312 K SER 313 K ? SER 313 K 6 -0.33  
111 LYS 404 K . ? LYS 404 K PRO 405 K ? PRO 405 K 6 -11.12 
112 PRO 942 K . ? PRO 942 K GLN 943 K ? GLN 943 K 6 -3.86  
113 GLU 19  O . ? GLU 19  O THR 20  O ? THR 20  O 6 4.22   
114 MET 312 Q . ? MET 312 Q SER 313 Q ? SER 313 Q 6 -0.23  
115 LYS 404 Q . ? LYS 404 Q PRO 405 Q ? PRO 405 Q 6 -11.06 
116 PRO 942 Q . ? PRO 942 Q GLN 943 Q ? GLN 943 Q 6 -3.91  
117 GLU 19  U . ? GLU 19  U THR 20  U ? THR 20  U 6 4.11   
118 MET 312 W . ? MET 312 W SER 313 W ? SER 313 W 6 -0.24  
119 LYS 404 W . ? LYS 404 W PRO 405 W ? PRO 405 W 6 -11.10 
120 PRO 942 W . ? PRO 942 W GLN 943 W ? GLN 943 W 6 -3.92  
121 MET 312 A . ? MET 312 A SER 313 A ? SER 313 A 7 -0.20  
122 LYS 404 A . ? LYS 404 A PRO 405 A ? PRO 405 A 7 -11.10 
123 MET 312 B . ? MET 312 B SER 313 B ? SER 313 B 7 -0.31  
124 LYS 404 B . ? LYS 404 B PRO 405 B ? PRO 405 B 7 -11.15 
125 GLU 19  C . ? GLU 19  C THR 20  C ? THR 20  C 7 4.22   
126 MET 312 E . ? MET 312 E SER 313 E ? SER 313 E 7 -0.31  
127 LYS 404 E . ? LYS 404 E PRO 405 E ? PRO 405 E 7 -11.04 
128 PRO 942 E . ? PRO 942 E GLN 943 E ? GLN 943 E 7 -3.85  
129 GLU 19  I . ? GLU 19  I THR 20  I ? THR 20  I 7 4.17   
130 MET 312 K . ? MET 312 K SER 313 K ? SER 313 K 7 -0.33  
131 LYS 404 K . ? LYS 404 K PRO 405 K ? PRO 405 K 7 -11.12 
132 PRO 942 K . ? PRO 942 K GLN 943 K ? GLN 943 K 7 -3.86  
133 GLU 19  O . ? GLU 19  O THR 20  O ? THR 20  O 7 4.22   
134 MET 312 Q . ? MET 312 Q SER 313 Q ? SER 313 Q 7 -0.23  
135 LYS 404 Q . ? LYS 404 Q PRO 405 Q ? PRO 405 Q 7 -11.06 
136 PRO 942 Q . ? PRO 942 Q GLN 943 Q ? GLN 943 Q 7 -3.91  
137 GLU 19  U . ? GLU 19  U THR 20  U ? THR 20  U 7 4.11   
138 MET 312 W . ? MET 312 W SER 313 W ? SER 313 W 7 -0.24  
139 LYS 404 W . ? LYS 404 W PRO 405 W ? PRO 405 W 7 -11.10 
140 PRO 942 W . ? PRO 942 W GLN 943 W ? GLN 943 W 7 -3.92  
141 MET 312 A . ? MET 312 A SER 313 A ? SER 313 A 8 -0.20  
142 LYS 404 A . ? LYS 404 A PRO 405 A ? PRO 405 A 8 -11.10 
143 MET 312 B . ? MET 312 B SER 313 B ? SER 313 B 8 -0.31  
144 LYS 404 B . ? LYS 404 B PRO 405 B ? PRO 405 B 8 -11.15 
145 GLU 19  C . ? GLU 19  C THR 20  C ? THR 20  C 8 4.22   
146 MET 312 E . ? MET 312 E SER 313 E ? SER 313 E 8 -0.31  
147 LYS 404 E . ? LYS 404 E PRO 405 E ? PRO 405 E 8 -11.04 
148 PRO 942 E . ? PRO 942 E GLN 943 E ? GLN 943 E 8 -3.85  
149 GLU 19  I . ? GLU 19  I THR 20  I ? THR 20  I 8 4.29   
150 MET 312 K . ? MET 312 K SER 313 K ? SER 313 K 8 -0.33  
151 LYS 404 K . ? LYS 404 K PRO 405 K ? PRO 405 K 8 -11.12 
152 PRO 942 K . ? PRO 942 K GLN 943 K ? GLN 943 K 8 -3.86  
153 GLU 19  O . ? GLU 19  O THR 20  O ? THR 20  O 8 4.22   
154 MET 312 Q . ? MET 312 Q SER 313 Q ? SER 313 Q 8 -0.23  
155 LYS 404 Q . ? LYS 404 Q PRO 405 Q ? PRO 405 Q 8 -11.06 
156 PRO 942 Q . ? PRO 942 Q GLN 943 Q ? GLN 943 Q 8 -3.91  
157 GLU 19  U . ? GLU 19  U THR 20  U ? THR 20  U 8 4.34   
158 MET 312 W . ? MET 312 W SER 313 W ? SER 313 W 8 -0.24  
159 LYS 404 W . ? LYS 404 W PRO 405 W ? PRO 405 W 8 -11.10 
160 PRO 942 W . ? PRO 942 W GLN 943 W ? GLN 943 W 8 -3.92  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 4 ? 
AB1 ? 5 ? 
AB2 ? 4 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 4 ? 
AB9 ? 4 ? 
AC1 ? 2 ? 
AC2 ? 2 ? 
AC3 ? 2 ? 
AC4 ? 5 ? 
AC5 ? 4 ? 
AC6 ? 4 ? 
AC7 ? 4 ? 
AC8 ? 4 ? 
AC9 ? 4 ? 
AD1 ? 4 ? 
AD2 ? 4 ? 
AD3 ? 4 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 4 ? 
AD7 ? 2 ? 
AD8 ? 2 ? 
AD9 ? 2 ? 
AE1 ? 5 ? 
AE2 ? 4 ? 
AE3 ? 4 ? 
AE4 ? 4 ? 
AE5 ? 4 ? 
AE6 ? 4 ? 
AE7 ? 4 ? 
AE8 ? 4 ? 
AE9 ? 4 ? 
AF1 ? 2 ? 
AF2 ? 3 ? 
AF3 ? 4 ? 
AF4 ? 2 ? 
AF5 ? 2 ? 
AF6 ? 2 ? 
AF7 ? 5 ? 
AF8 ? 4 ? 
AF9 ? 4 ? 
AG1 ? 4 ? 
AG2 ? 4 ? 
AG3 ? 4 ? 
AG4 ? 4 ? 
AG5 ? 4 ? 
AG6 ? 4 ? 
AG7 ? 2 ? 
AG8 ? 3 ? 
AG9 ? 4 ? 
AH1 ? 2 ? 
AH2 ? 2 ? 
AH3 ? 2 ? 
AH4 ? 5 ? 
AH5 ? 4 ? 
AH6 ? 4 ? 
AH7 ? 4 ? 
AH8 ? 4 ? 
AH9 ? 4 ? 
AI1 ? 4 ? 
AI2 ? 4 ? 
AI3 ? 4 ? 
AI4 ? 2 ? 
AI5 ? 3 ? 
AI6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? parallel      
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AE1 1 2 ? parallel      
AE1 2 3 ? anti-parallel 
AE1 3 4 ? anti-parallel 
AE1 4 5 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE2 3 4 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE4 3 4 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE6 3 4 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE7 3 4 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE8 3 4 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AE9 3 4 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF7 1 2 ? parallel      
AF7 2 3 ? anti-parallel 
AF7 3 4 ? anti-parallel 
AF7 4 5 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF8 2 3 ? anti-parallel 
AF8 3 4 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AF9 2 3 ? anti-parallel 
AF9 3 4 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG1 3 4 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG2 2 3 ? anti-parallel 
AG2 3 4 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG3 2 3 ? anti-parallel 
AG3 3 4 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG4 2 3 ? anti-parallel 
AG4 3 4 ? anti-parallel 
AG5 1 2 ? anti-parallel 
AG5 2 3 ? anti-parallel 
AG5 3 4 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG6 3 4 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG8 2 3 ? anti-parallel 
AG9 1 2 ? anti-parallel 
AG9 2 3 ? anti-parallel 
AG9 3 4 ? anti-parallel 
AH1 1 2 ? anti-parallel 
AH2 1 2 ? anti-parallel 
AH3 1 2 ? anti-parallel 
AH4 1 2 ? parallel      
AH4 2 3 ? anti-parallel 
AH4 3 4 ? anti-parallel 
AH4 4 5 ? anti-parallel 
AH5 1 2 ? anti-parallel 
AH5 2 3 ? anti-parallel 
AH5 3 4 ? anti-parallel 
AH6 1 2 ? anti-parallel 
AH6 2 3 ? anti-parallel 
AH6 3 4 ? anti-parallel 
AH7 1 2 ? anti-parallel 
AH7 2 3 ? anti-parallel 
AH7 3 4 ? anti-parallel 
AH8 1 2 ? anti-parallel 
AH8 2 3 ? anti-parallel 
AH8 3 4 ? anti-parallel 
AH9 1 2 ? anti-parallel 
AH9 2 3 ? anti-parallel 
AH9 3 4 ? anti-parallel 
AI1 1 2 ? anti-parallel 
AI1 2 3 ? anti-parallel 
AI1 3 4 ? anti-parallel 
AI2 1 2 ? anti-parallel 
AI2 2 3 ? anti-parallel 
AI2 3 4 ? anti-parallel 
AI3 1 2 ? anti-parallel 
AI3 2 3 ? anti-parallel 
AI3 3 4 ? anti-parallel 
AI4 1 2 ? anti-parallel 
AI5 1 2 ? anti-parallel 
AI5 2 3 ? anti-parallel 
AI6 1 2 ? anti-parallel 
AI6 2 3 ? anti-parallel 
AI6 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 63  ? ASP A 64  ? MET A 63  ASP A 64  
AA1 2 GLU A 447 ? ALA A 452 ? GLU A 447 ALA A 452 
AA1 3 ASP A 429 ? HIS A 436 ? ASP A 429 HIS A 436 
AA1 4 ILE A 417 ? SER A 423 ? ILE A 417 SER A 423 
AA1 5 ALA A 411 ? TYR A 413 ? ALA A 411 TYR A 413 
AA2 1 ILE A 81  ? PRO A 88  ? ILE A 81  PRO A 88  
AA2 2 GLY A 507 ? LYS A 513 ? GLY A 507 LYS A 513 
AA2 3 LYS A 499 ? LEU A 503 ? LYS A 499 LEU A 503 
AA2 4 ALA A 460 ? ALA A 463 ? ALA A 460 ALA A 463 
AA3 1 CYS A 104 ? PHE A 109 ? CYS A 104 PHE A 109 
AA3 2 ARG A 114 ? ILE A 119 ? ARG A 114 ILE A 119 
AA3 3 ASP A 122 ? ASN A 127 ? ASP A 122 ASN A 127 
AA3 4 LEU A 134 ? PHE A 137 ? LEU A 134 PHE A 137 
AA4 1 ALA A 146 ? VAL A 150 ? ALA A 146 VAL A 150 
AA4 2 HIS A 163 ? ALA A 168 ? HIS A 163 ALA A 168 
AA4 3 ASP A 172 ? TYR A 180 ? ASP A 172 TYR A 180 
AA4 4 MET A 198 ? PRO A 202 ? MET A 198 PRO A 202 
AA5 1 ALA A 146 ? VAL A 150 ? ALA A 146 VAL A 150 
AA5 2 HIS A 163 ? ALA A 168 ? HIS A 163 ALA A 168 
AA5 3 ASP A 172 ? TYR A 180 ? ASP A 172 TYR A 180 
AA5 4 LEU A 208 ? PRO A 209 ? LEU A 208 PRO A 209 
AA6 1 LEU A 215 ? SER A 220 ? LEU A 215 SER A 220 
AA6 2 ILE A 226 ? GLY A 230 ? ILE A 226 GLY A 230 
AA6 3 TYR A 236 ? VAL A 238 ? TYR A 236 VAL A 238 
AA6 4 ASN A 255 ? HIS A 256 ? ASN A 255 HIS A 256 
AA7 1 ILE A 279 ? ASP A 285 ? ILE A 279 ASP A 285 
AA7 2 ILE A 290 ? SER A 295 ? ILE A 290 SER A 295 
AA7 3 ILE A 300 ? GLY A 306 ? ILE A 300 GLY A 306 
AA7 4 GLY A 309 ? GLY A 311 ? GLY A 309 GLY A 311 
AA8 1 ILE A 279 ? ASP A 285 ? ILE A 279 ASP A 285 
AA8 2 ILE A 290 ? SER A 295 ? ILE A 290 SER A 295 
AA8 3 ILE A 300 ? GLY A 306 ? ILE A 300 GLY A 306 
AA8 4 SER A 317 ? VAL A 318 ? SER A 317 VAL A 318 
AA9 1 VAL A 343 ? VAL A 347 ? VAL A 343 VAL A 347 
AA9 2 CYS A 356 ? THR A 362 ? CYS A 356 THR A 362 
AA9 3 ARG A 367 ? SER A 371 ? ARG A 367 SER A 371 
AA9 4 THR A 386 ? ARG A 391 ? THR A 386 ARG A 391 
AB1 1 MET B 63  ? ASP B 64  ? MET B 63  ASP B 64  
AB1 2 GLU B 447 ? ALA B 452 ? GLU B 447 ALA B 452 
AB1 3 ASP B 429 ? HIS B 436 ? ASP B 429 HIS B 436 
AB1 4 ILE B 417 ? SER B 423 ? ILE B 417 SER B 423 
AB1 5 ALA B 411 ? TYR B 413 ? ALA B 411 TYR B 413 
AB2 1 ILE B 81  ? PRO B 88  ? ILE B 81  PRO B 88  
AB2 2 GLY B 507 ? LYS B 513 ? GLY B 507 LYS B 513 
AB2 3 LYS B 499 ? LEU B 503 ? LYS B 499 LEU B 503 
AB2 4 ALA B 460 ? ALA B 463 ? ALA B 460 ALA B 463 
AB3 1 CYS B 104 ? PHE B 109 ? CYS B 104 PHE B 109 
AB3 2 ARG B 114 ? ILE B 119 ? ARG B 114 ILE B 119 
AB3 3 ASP B 122 ? ASN B 127 ? ASP B 122 ASN B 127 
AB3 4 LEU B 134 ? PHE B 137 ? LEU B 134 PHE B 137 
AB4 1 ALA B 146 ? VAL B 150 ? ALA B 146 VAL B 150 
AB4 2 HIS B 163 ? ALA B 168 ? HIS B 163 ALA B 168 
AB4 3 ASP B 172 ? TYR B 180 ? ASP B 172 TYR B 180 
AB4 4 MET B 198 ? PRO B 202 ? MET B 198 PRO B 202 
AB5 1 ALA B 146 ? VAL B 150 ? ALA B 146 VAL B 150 
AB5 2 HIS B 163 ? ALA B 168 ? HIS B 163 ALA B 168 
AB5 3 ASP B 172 ? TYR B 180 ? ASP B 172 TYR B 180 
AB5 4 LEU B 208 ? PRO B 209 ? LEU B 208 PRO B 209 
AB6 1 LEU B 215 ? SER B 220 ? LEU B 215 SER B 220 
AB6 2 ILE B 226 ? GLY B 230 ? ILE B 226 GLY B 230 
AB6 3 TYR B 236 ? VAL B 238 ? TYR B 236 VAL B 238 
AB6 4 ASN B 255 ? HIS B 256 ? ASN B 255 HIS B 256 
AB7 1 ILE B 279 ? ASP B 285 ? ILE B 279 ASP B 285 
AB7 2 ILE B 290 ? SER B 295 ? ILE B 290 SER B 295 
AB7 3 ILE B 300 ? GLY B 306 ? ILE B 300 GLY B 306 
AB7 4 GLY B 309 ? GLY B 311 ? GLY B 309 GLY B 311 
AB8 1 ILE B 279 ? ASP B 285 ? ILE B 279 ASP B 285 
AB8 2 ILE B 290 ? SER B 295 ? ILE B 290 SER B 295 
AB8 3 ILE B 300 ? GLY B 306 ? ILE B 300 GLY B 306 
AB8 4 SER B 317 ? VAL B 318 ? SER B 317 VAL B 318 
AB9 1 VAL B 343 ? VAL B 347 ? VAL B 343 VAL B 347 
AB9 2 CYS B 356 ? THR B 362 ? CYS B 356 THR B 362 
AB9 3 ARG B 367 ? SER B 371 ? ARG B 367 SER B 371 
AB9 4 THR B 386 ? ARG B 391 ? THR B 386 ARG B 391 
AC1 1 GLU C 312 ? VAL C 313 ? GLU C 312 VAL C 313 
AC1 2 HIS C 316 ? PRO C 317 ? HIS C 316 PRO C 317 
AC2 1 GLY C 585 ? LYS C 586 ? GLY C 585 LYS C 586 
AC2 2 LYS C 594 ? PRO C 595 ? LYS C 594 PRO C 595 
AC3 1 SER D 71  ? THR D 72  ? SER D 71  THR D 72  
AC3 2 ARG D 84  ? LEU D 85  ? ARG D 84  LEU D 85  
AC4 1 MET E 63  ? ASP E 64  ? MET E 63  ASP E 64  
AC4 2 GLU E 447 ? ALA E 452 ? GLU E 447 ALA E 452 
AC4 3 ASP E 429 ? HIS E 436 ? ASP E 429 HIS E 436 
AC4 4 ILE E 417 ? SER E 423 ? ILE E 417 SER E 423 
AC4 5 ALA E 411 ? TYR E 413 ? ALA E 411 TYR E 413 
AC5 1 ILE E 81  ? PRO E 88  ? ILE E 81  PRO E 88  
AC5 2 GLY E 507 ? LYS E 513 ? GLY E 507 LYS E 513 
AC5 3 LYS E 499 ? LEU E 503 ? LYS E 499 LEU E 503 
AC5 4 ALA E 460 ? ALA E 463 ? ALA E 460 ALA E 463 
AC6 1 CYS E 104 ? PHE E 109 ? CYS E 104 PHE E 109 
AC6 2 ARG E 114 ? ILE E 119 ? ARG E 114 ILE E 119 
AC6 3 ASP E 122 ? ASN E 127 ? ASP E 122 ASN E 127 
AC6 4 LEU E 134 ? PHE E 137 ? LEU E 134 PHE E 137 
AC7 1 ALA E 146 ? VAL E 150 ? ALA E 146 VAL E 150 
AC7 2 HIS E 163 ? ALA E 168 ? HIS E 163 ALA E 168 
AC7 3 ASP E 172 ? TYR E 180 ? ASP E 172 TYR E 180 
AC7 4 MET E 198 ? PRO E 202 ? MET E 198 PRO E 202 
AC8 1 ALA E 146 ? VAL E 150 ? ALA E 146 VAL E 150 
AC8 2 HIS E 163 ? ALA E 168 ? HIS E 163 ALA E 168 
AC8 3 ASP E 172 ? TYR E 180 ? ASP E 172 TYR E 180 
AC8 4 LEU E 208 ? PRO E 209 ? LEU E 208 PRO E 209 
AC9 1 LEU E 215 ? SER E 220 ? LEU E 215 SER E 220 
AC9 2 ILE E 226 ? GLY E 230 ? ILE E 226 GLY E 230 
AC9 3 TYR E 236 ? VAL E 238 ? TYR E 236 VAL E 238 
AC9 4 ASN E 255 ? HIS E 256 ? ASN E 255 HIS E 256 
AD1 1 ILE E 279 ? ASP E 285 ? ILE E 279 ASP E 285 
AD1 2 ILE E 290 ? SER E 295 ? ILE E 290 SER E 295 
AD1 3 ILE E 300 ? GLY E 306 ? ILE E 300 GLY E 306 
AD1 4 GLY E 309 ? GLY E 311 ? GLY E 309 GLY E 311 
AD2 1 ILE E 279 ? ASP E 285 ? ILE E 279 ASP E 285 
AD2 2 ILE E 290 ? SER E 295 ? ILE E 290 SER E 295 
AD2 3 ILE E 300 ? GLY E 306 ? ILE E 300 GLY E 306 
AD2 4 SER E 317 ? VAL E 318 ? SER E 317 VAL E 318 
AD3 1 VAL E 343 ? VAL E 347 ? VAL E 343 VAL E 347 
AD3 2 CYS E 356 ? THR E 362 ? CYS E 356 THR E 362 
AD3 3 ARG E 367 ? SER E 371 ? ARG E 367 SER E 371 
AD3 4 THR E 386 ? ARG E 391 ? THR E 386 ARG E 391 
AD4 1 TYR F 154 ? ASN F 157 ? TYR F 154 ASN F 157 
AD4 2 ILE F 323 ? PRO F 326 ? ILE F 323 PRO F 326 
AD5 1 THR F 224 ? THR F 232 ? THR F 224 THR F 232 
AD5 2 THR F 238 ? ARG F 247 ? THR F 238 ARG F 247 
AD5 3 SER F 253 ? ARG F 255 ? SER F 253 ARG F 255 
AD6 1 THR F 224 ? THR F 232 ? THR F 224 THR F 232 
AD6 2 THR F 238 ? ARG F 247 ? THR F 238 ARG F 247 
AD6 3 VAL F 191 ? PHE F 195 ? VAL F 191 PHE F 195 
AD6 4 VAL F 279 ? THR F 284 ? VAL F 279 THR F 284 
AD7 1 GLU I 312 ? VAL I 313 ? GLU I 312 VAL I 313 
AD7 2 HIS I 316 ? PRO I 317 ? HIS I 316 PRO I 317 
AD8 1 GLY I 585 ? LYS I 586 ? GLY I 585 LYS I 586 
AD8 2 LYS I 594 ? PRO I 595 ? LYS I 594 PRO I 595 
AD9 1 SER J 71  ? THR J 72  ? SER J 71  THR J 72  
AD9 2 ARG J 84  ? LEU J 85  ? ARG J 84  LEU J 85  
AE1 1 MET K 63  ? ASP K 64  ? MET K 63  ASP K 64  
AE1 2 GLU K 447 ? ALA K 452 ? GLU K 447 ALA K 452 
AE1 3 ASP K 429 ? HIS K 436 ? ASP K 429 HIS K 436 
AE1 4 ILE K 417 ? SER K 423 ? ILE K 417 SER K 423 
AE1 5 ALA K 411 ? TYR K 413 ? ALA K 411 TYR K 413 
AE2 1 ILE K 81  ? PRO K 88  ? ILE K 81  PRO K 88  
AE2 2 GLY K 507 ? LYS K 513 ? GLY K 507 LYS K 513 
AE2 3 LYS K 499 ? LEU K 503 ? LYS K 499 LEU K 503 
AE2 4 ALA K 460 ? ALA K 463 ? ALA K 460 ALA K 463 
AE3 1 CYS K 104 ? PHE K 109 ? CYS K 104 PHE K 109 
AE3 2 ARG K 114 ? ILE K 119 ? ARG K 114 ILE K 119 
AE3 3 ASP K 122 ? ASN K 127 ? ASP K 122 ASN K 127 
AE3 4 LEU K 134 ? PHE K 137 ? LEU K 134 PHE K 137 
AE4 1 ALA K 146 ? VAL K 150 ? ALA K 146 VAL K 150 
AE4 2 HIS K 163 ? ALA K 168 ? HIS K 163 ALA K 168 
AE4 3 ASP K 172 ? TYR K 180 ? ASP K 172 TYR K 180 
AE4 4 MET K 198 ? PRO K 202 ? MET K 198 PRO K 202 
AE5 1 ALA K 146 ? VAL K 150 ? ALA K 146 VAL K 150 
AE5 2 HIS K 163 ? ALA K 168 ? HIS K 163 ALA K 168 
AE5 3 ASP K 172 ? TYR K 180 ? ASP K 172 TYR K 180 
AE5 4 LEU K 208 ? PRO K 209 ? LEU K 208 PRO K 209 
AE6 1 LEU K 215 ? SER K 220 ? LEU K 215 SER K 220 
AE6 2 ILE K 226 ? GLY K 230 ? ILE K 226 GLY K 230 
AE6 3 TYR K 236 ? VAL K 238 ? TYR K 236 VAL K 238 
AE6 4 ASN K 255 ? HIS K 256 ? ASN K 255 HIS K 256 
AE7 1 ILE K 279 ? ASP K 285 ? ILE K 279 ASP K 285 
AE7 2 ILE K 290 ? SER K 295 ? ILE K 290 SER K 295 
AE7 3 ILE K 300 ? GLY K 306 ? ILE K 300 GLY K 306 
AE7 4 GLY K 309 ? GLY K 311 ? GLY K 309 GLY K 311 
AE8 1 ILE K 279 ? ASP K 285 ? ILE K 279 ASP K 285 
AE8 2 ILE K 290 ? SER K 295 ? ILE K 290 SER K 295 
AE8 3 ILE K 300 ? GLY K 306 ? ILE K 300 GLY K 306 
AE8 4 SER K 317 ? VAL K 318 ? SER K 317 VAL K 318 
AE9 1 VAL K 343 ? VAL K 347 ? VAL K 343 VAL K 347 
AE9 2 CYS K 356 ? THR K 362 ? CYS K 356 THR K 362 
AE9 3 ARG K 367 ? SER K 371 ? ARG K 367 SER K 371 
AE9 4 THR K 386 ? ARG K 391 ? THR K 386 ARG K 391 
AF1 1 TYR L 154 ? ASN L 157 ? TYR L 154 ASN L 157 
AF1 2 ILE L 323 ? PRO L 326 ? ILE L 323 PRO L 326 
AF2 1 THR L 224 ? THR L 232 ? THR L 224 THR L 232 
AF2 2 THR L 238 ? ARG L 247 ? THR L 238 ARG L 247 
AF2 3 SER L 253 ? ARG L 255 ? SER L 253 ARG L 255 
AF3 1 THR L 224 ? THR L 232 ? THR L 224 THR L 232 
AF3 2 THR L 238 ? ARG L 247 ? THR L 238 ARG L 247 
AF3 3 VAL L 191 ? PHE L 195 ? VAL L 191 PHE L 195 
AF3 4 VAL L 279 ? THR L 284 ? VAL L 279 THR L 284 
AF4 1 GLU O 312 ? VAL O 313 ? GLU O 312 VAL O 313 
AF4 2 HIS O 316 ? PRO O 317 ? HIS O 316 PRO O 317 
AF5 1 GLY O 585 ? LYS O 586 ? GLY O 585 LYS O 586 
AF5 2 LYS O 594 ? PRO O 595 ? LYS O 594 PRO O 595 
AF6 1 SER P 71  ? THR P 72  ? SER P 71  THR P 72  
AF6 2 ARG P 84  ? LEU P 85  ? ARG P 84  LEU P 85  
AF7 1 MET Q 63  ? ASP Q 64  ? MET Q 63  ASP Q 64  
AF7 2 GLU Q 447 ? ALA Q 452 ? GLU Q 447 ALA Q 452 
AF7 3 ASP Q 429 ? HIS Q 436 ? ASP Q 429 HIS Q 436 
AF7 4 ILE Q 417 ? SER Q 423 ? ILE Q 417 SER Q 423 
AF7 5 ALA Q 411 ? TYR Q 413 ? ALA Q 411 TYR Q 413 
AF8 1 ILE Q 81  ? PRO Q 88  ? ILE Q 81  PRO Q 88  
AF8 2 GLY Q 507 ? LYS Q 513 ? GLY Q 507 LYS Q 513 
AF8 3 LYS Q 499 ? LEU Q 503 ? LYS Q 499 LEU Q 503 
AF8 4 ALA Q 460 ? ALA Q 463 ? ALA Q 460 ALA Q 463 
AF9 1 CYS Q 104 ? PHE Q 109 ? CYS Q 104 PHE Q 109 
AF9 2 ARG Q 114 ? ILE Q 119 ? ARG Q 114 ILE Q 119 
AF9 3 ASP Q 122 ? ASN Q 127 ? ASP Q 122 ASN Q 127 
AF9 4 LEU Q 134 ? PHE Q 137 ? LEU Q 134 PHE Q 137 
AG1 1 ALA Q 146 ? VAL Q 150 ? ALA Q 146 VAL Q 150 
AG1 2 HIS Q 163 ? ALA Q 168 ? HIS Q 163 ALA Q 168 
AG1 3 ASP Q 172 ? TYR Q 180 ? ASP Q 172 TYR Q 180 
AG1 4 MET Q 198 ? PRO Q 202 ? MET Q 198 PRO Q 202 
AG2 1 ALA Q 146 ? VAL Q 150 ? ALA Q 146 VAL Q 150 
AG2 2 HIS Q 163 ? ALA Q 168 ? HIS Q 163 ALA Q 168 
AG2 3 ASP Q 172 ? TYR Q 180 ? ASP Q 172 TYR Q 180 
AG2 4 LEU Q 208 ? PRO Q 209 ? LEU Q 208 PRO Q 209 
AG3 1 LEU Q 215 ? SER Q 220 ? LEU Q 215 SER Q 220 
AG3 2 ILE Q 226 ? GLY Q 230 ? ILE Q 226 GLY Q 230 
AG3 3 TYR Q 236 ? VAL Q 238 ? TYR Q 236 VAL Q 238 
AG3 4 ASN Q 255 ? HIS Q 256 ? ASN Q 255 HIS Q 256 
AG4 1 ILE Q 279 ? ASP Q 285 ? ILE Q 279 ASP Q 285 
AG4 2 ILE Q 290 ? SER Q 295 ? ILE Q 290 SER Q 295 
AG4 3 ILE Q 300 ? GLY Q 306 ? ILE Q 300 GLY Q 306 
AG4 4 GLY Q 309 ? GLY Q 311 ? GLY Q 309 GLY Q 311 
AG5 1 ILE Q 279 ? ASP Q 285 ? ILE Q 279 ASP Q 285 
AG5 2 ILE Q 290 ? SER Q 295 ? ILE Q 290 SER Q 295 
AG5 3 ILE Q 300 ? GLY Q 306 ? ILE Q 300 GLY Q 306 
AG5 4 SER Q 317 ? VAL Q 318 ? SER Q 317 VAL Q 318 
AG6 1 VAL Q 343 ? VAL Q 347 ? VAL Q 343 VAL Q 347 
AG6 2 CYS Q 356 ? THR Q 362 ? CYS Q 356 THR Q 362 
AG6 3 ARG Q 367 ? SER Q 371 ? ARG Q 367 SER Q 371 
AG6 4 THR Q 386 ? ARG Q 391 ? THR Q 386 ARG Q 391 
AG7 1 TYR R 154 ? ASN R 157 ? TYR R 154 ASN R 157 
AG7 2 ILE R 323 ? PRO R 326 ? ILE R 323 PRO R 326 
AG8 1 THR R 224 ? THR R 232 ? THR R 224 THR R 232 
AG8 2 THR R 238 ? ARG R 247 ? THR R 238 ARG R 247 
AG8 3 SER R 253 ? ARG R 255 ? SER R 253 ARG R 255 
AG9 1 THR R 224 ? THR R 232 ? THR R 224 THR R 232 
AG9 2 THR R 238 ? ARG R 247 ? THR R 238 ARG R 247 
AG9 3 VAL R 191 ? PHE R 195 ? VAL R 191 PHE R 195 
AG9 4 VAL R 279 ? THR R 284 ? VAL R 279 THR R 284 
AH1 1 GLU U 312 ? VAL U 313 ? GLU U 312 VAL U 313 
AH1 2 HIS U 316 ? PRO U 317 ? HIS U 316 PRO U 317 
AH2 1 GLY U 585 ? LYS U 586 ? GLY U 585 LYS U 586 
AH2 2 LYS U 594 ? PRO U 595 ? LYS U 594 PRO U 595 
AH3 1 SER V 71  ? THR V 72  ? SER V 71  THR V 72  
AH3 2 ARG V 84  ? LEU V 85  ? ARG V 84  LEU V 85  
AH4 1 MET W 63  ? ASP W 64  ? MET W 63  ASP W 64  
AH4 2 GLU W 447 ? ALA W 452 ? GLU W 447 ALA W 452 
AH4 3 ASP W 429 ? HIS W 436 ? ASP W 429 HIS W 436 
AH4 4 ILE W 417 ? SER W 423 ? ILE W 417 SER W 423 
AH4 5 ALA W 411 ? TYR W 413 ? ALA W 411 TYR W 413 
AH5 1 ILE W 81  ? PRO W 88  ? ILE W 81  PRO W 88  
AH5 2 GLY W 507 ? LYS W 513 ? GLY W 507 LYS W 513 
AH5 3 LYS W 499 ? LEU W 503 ? LYS W 499 LEU W 503 
AH5 4 ALA W 460 ? ALA W 463 ? ALA W 460 ALA W 463 
AH6 1 CYS W 104 ? PHE W 109 ? CYS W 104 PHE W 109 
AH6 2 ARG W 114 ? ILE W 119 ? ARG W 114 ILE W 119 
AH6 3 ASP W 122 ? ASN W 127 ? ASP W 122 ASN W 127 
AH6 4 LEU W 134 ? PHE W 137 ? LEU W 134 PHE W 137 
AH7 1 ALA W 146 ? VAL W 150 ? ALA W 146 VAL W 150 
AH7 2 HIS W 163 ? ALA W 168 ? HIS W 163 ALA W 168 
AH7 3 ASP W 172 ? TYR W 180 ? ASP W 172 TYR W 180 
AH7 4 MET W 198 ? PRO W 202 ? MET W 198 PRO W 202 
AH8 1 ALA W 146 ? VAL W 150 ? ALA W 146 VAL W 150 
AH8 2 HIS W 163 ? ALA W 168 ? HIS W 163 ALA W 168 
AH8 3 ASP W 172 ? TYR W 180 ? ASP W 172 TYR W 180 
AH8 4 LEU W 208 ? PRO W 209 ? LEU W 208 PRO W 209 
AH9 1 LEU W 215 ? SER W 220 ? LEU W 215 SER W 220 
AH9 2 ILE W 226 ? GLY W 230 ? ILE W 226 GLY W 230 
AH9 3 TYR W 236 ? VAL W 238 ? TYR W 236 VAL W 238 
AH9 4 ASN W 255 ? HIS W 256 ? ASN W 255 HIS W 256 
AI1 1 ILE W 279 ? ASP W 285 ? ILE W 279 ASP W 285 
AI1 2 ILE W 290 ? SER W 295 ? ILE W 290 SER W 295 
AI1 3 ILE W 300 ? GLY W 306 ? ILE W 300 GLY W 306 
AI1 4 GLY W 309 ? GLY W 311 ? GLY W 309 GLY W 311 
AI2 1 ILE W 279 ? ASP W 285 ? ILE W 279 ASP W 285 
AI2 2 ILE W 290 ? SER W 295 ? ILE W 290 SER W 295 
AI2 3 ILE W 300 ? GLY W 306 ? ILE W 300 GLY W 306 
AI2 4 SER W 317 ? VAL W 318 ? SER W 317 VAL W 318 
AI3 1 VAL W 343 ? VAL W 347 ? VAL W 343 VAL W 347 
AI3 2 CYS W 356 ? THR W 362 ? CYS W 356 THR W 362 
AI3 3 ARG W 367 ? SER W 371 ? ARG W 367 SER W 371 
AI3 4 THR W 386 ? ARG W 391 ? THR W 386 ARG W 391 
AI4 1 TYR X 154 ? ASN X 157 ? TYR X 154 ASN X 157 
AI4 2 ILE X 323 ? PRO X 326 ? ILE X 323 PRO X 326 
AI5 1 THR X 224 ? THR X 232 ? THR X 224 THR X 232 
AI5 2 THR X 238 ? ARG X 247 ? THR X 238 ARG X 247 
AI5 3 SER X 253 ? ARG X 255 ? SER X 253 ARG X 255 
AI6 1 THR X 224 ? THR X 232 ? THR X 224 THR X 232 
AI6 2 THR X 238 ? ARG X 247 ? THR X 238 ARG X 247 
AI6 3 VAL X 191 ? PHE X 195 ? VAL X 191 PHE X 195 
AI6 4 VAL X 279 ? THR X 284 ? VAL X 279 THR X 284 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ASP A 64  ? N ASP A 64  O GLN A 449 ? O GLN A 449 
AA1 2 3 O THR A 448 ? O THR A 448 N ASN A 435 ? N ASN A 435 
AA1 3 4 O ILE A 430 ? O ILE A 430 N ALA A 422 ? N ALA A 422 
AA1 4 5 O ILE A 417 ? O ILE A 417 N TYR A 413 ? N TYR A 413 
AA2 1 2 N VAL A 87  ? N VAL A 87  O SER A 508 ? O SER A 508 
AA2 2 3 O LEU A 509 ? O LEU A 509 N LEU A 502 ? N LEU A 502 
AA2 3 4 O VAL A 501 ? O VAL A 501 N SER A 462 ? N SER A 462 
AA3 1 2 N MET A 105 ? N MET A 105 O THR A 118 ? O THR A 118 
AA3 2 3 N ALA A 115 ? N ALA A 115 O TRP A 126 ? O TRP A 126 
AA3 3 4 N MET A 125 ? N MET A 125 O ALA A 135 ? O ALA A 135 
AA4 1 2 N ALA A 146 ? N ALA A 146 O ALA A 168 ? O ALA A 168 
AA4 2 3 N LEU A 167 ? N LEU A 167 O VAL A 174 ? O VAL A 174 
AA4 3 4 N SER A 179 ? N SER A 179 O GLN A 199 ? O GLN A 199 
AA5 1 2 N ALA A 146 ? N ALA A 146 O ALA A 168 ? O ALA A 168 
AA5 2 3 N LEU A 167 ? N LEU A 167 O VAL A 174 ? O VAL A 174 
AA5 3 4 N ILE A 173 ? N ILE A 173 O LEU A 208 ? O LEU A 208 
AA6 1 2 N THR A 219 ? N THR A 219 O PHE A 227 ? O PHE A 227 
AA6 2 3 N ILE A 226 ? N ILE A 226 O VAL A 238 ? O VAL A 238 
AA6 3 4 N GLU A 237 ? N GLU A 237 O HIS A 256 ? O HIS A 256 
AA7 1 2 N ASP A 285 ? N ASP A 285 O ILE A 290 ? O ILE A 290 
AA7 2 3 N LEU A 291 ? N LEU A 291 O TYR A 303 ? O TYR A 303 
AA7 3 4 N ASP A 304 ? N ASP A 304 O GLY A 311 ? O GLY A 311 
AA8 1 2 N ASP A 285 ? N ASP A 285 O ILE A 290 ? O ILE A 290 
AA8 2 3 N LEU A 291 ? N LEU A 291 O TYR A 303 ? O TYR A 303 
AA8 3 4 N ILE A 300 ? N ILE A 300 O VAL A 318 ? O VAL A 318 
AA9 1 2 N GLN A 344 ? N GLN A 344 O VAL A 361 ? O VAL A 361 
AA9 2 3 N ALA A 360 ? N ALA A 360 O LEU A 368 ? O LEU A 368 
AA9 3 4 N TYR A 369 ? N TYR A 369 O HIS A 389 ? O HIS A 389 
AB1 1 2 N ASP B 64  ? N ASP B 64  O GLN B 449 ? O GLN B 449 
AB1 2 3 O THR B 448 ? O THR B 448 N ASN B 435 ? N ASN B 435 
AB1 3 4 O ILE B 430 ? O ILE B 430 N ALA B 422 ? N ALA B 422 
AB1 4 5 O ILE B 417 ? O ILE B 417 N TYR B 413 ? N TYR B 413 
AB2 1 2 N VAL B 87  ? N VAL B 87  O SER B 508 ? O SER B 508 
AB2 2 3 O LEU B 509 ? O LEU B 509 N LEU B 502 ? N LEU B 502 
AB2 3 4 O VAL B 501 ? O VAL B 501 N SER B 462 ? N SER B 462 
AB3 1 2 N MET B 105 ? N MET B 105 O THR B 118 ? O THR B 118 
AB3 2 3 N ALA B 115 ? N ALA B 115 O TRP B 126 ? O TRP B 126 
AB3 3 4 N MET B 125 ? N MET B 125 O ALA B 135 ? O ALA B 135 
AB4 1 2 N ALA B 146 ? N ALA B 146 O ALA B 168 ? O ALA B 168 
AB4 2 3 N LEU B 167 ? N LEU B 167 O VAL B 174 ? O VAL B 174 
AB4 3 4 N SER B 179 ? N SER B 179 O GLN B 199 ? O GLN B 199 
AB5 1 2 N ALA B 146 ? N ALA B 146 O ALA B 168 ? O ALA B 168 
AB5 2 3 N LEU B 167 ? N LEU B 167 O VAL B 174 ? O VAL B 174 
AB5 3 4 N ILE B 173 ? N ILE B 173 O LEU B 208 ? O LEU B 208 
AB6 1 2 N THR B 219 ? N THR B 219 O PHE B 227 ? O PHE B 227 
AB6 2 3 N ILE B 226 ? N ILE B 226 O VAL B 238 ? O VAL B 238 
AB6 3 4 N GLU B 237 ? N GLU B 237 O HIS B 256 ? O HIS B 256 
AB7 1 2 N ASP B 285 ? N ASP B 285 O ILE B 290 ? O ILE B 290 
AB7 2 3 N LEU B 291 ? N LEU B 291 O TYR B 303 ? O TYR B 303 
AB7 3 4 N ASP B 304 ? N ASP B 304 O GLY B 311 ? O GLY B 311 
AB8 1 2 N ASP B 285 ? N ASP B 285 O ILE B 290 ? O ILE B 290 
AB8 2 3 N LEU B 291 ? N LEU B 291 O TYR B 303 ? O TYR B 303 
AB8 3 4 N ILE B 300 ? N ILE B 300 O VAL B 318 ? O VAL B 318 
AB9 1 2 N GLN B 344 ? N GLN B 344 O VAL B 361 ? O VAL B 361 
AB9 2 3 N ALA B 360 ? N ALA B 360 O LEU B 368 ? O LEU B 368 
AB9 3 4 N TYR B 369 ? N TYR B 369 O HIS B 389 ? O HIS B 389 
AC1 1 2 N VAL C 313 ? N VAL C 313 O HIS C 316 ? O HIS C 316 
AC2 1 2 N LYS C 586 ? N LYS C 586 O LYS C 594 ? O LYS C 594 
AC3 1 2 N THR D 72  ? N THR D 72  O ARG D 84  ? O ARG D 84  
AC4 1 2 N ASP E 64  ? N ASP E 64  O GLN E 449 ? O GLN E 449 
AC4 2 3 O THR E 448 ? O THR E 448 N ASN E 435 ? N ASN E 435 
AC4 3 4 O ILE E 430 ? O ILE E 430 N ALA E 422 ? N ALA E 422 
AC4 4 5 O ILE E 417 ? O ILE E 417 N TYR E 413 ? N TYR E 413 
AC5 1 2 N VAL E 87  ? N VAL E 87  O SER E 508 ? O SER E 508 
AC5 2 3 O LEU E 509 ? O LEU E 509 N LEU E 502 ? N LEU E 502 
AC5 3 4 O VAL E 501 ? O VAL E 501 N SER E 462 ? N SER E 462 
AC6 1 2 N MET E 105 ? N MET E 105 O THR E 118 ? O THR E 118 
AC6 2 3 N ALA E 115 ? N ALA E 115 O TRP E 126 ? O TRP E 126 
AC6 3 4 N MET E 125 ? N MET E 125 O ALA E 135 ? O ALA E 135 
AC7 1 2 N ALA E 146 ? N ALA E 146 O ALA E 168 ? O ALA E 168 
AC7 2 3 N LEU E 167 ? N LEU E 167 O VAL E 174 ? O VAL E 174 
AC7 3 4 N SER E 179 ? N SER E 179 O GLN E 199 ? O GLN E 199 
AC8 1 2 N ALA E 146 ? N ALA E 146 O ALA E 168 ? O ALA E 168 
AC8 2 3 N LEU E 167 ? N LEU E 167 O VAL E 174 ? O VAL E 174 
AC8 3 4 N ILE E 173 ? N ILE E 173 O LEU E 208 ? O LEU E 208 
AC9 1 2 N THR E 219 ? N THR E 219 O PHE E 227 ? O PHE E 227 
AC9 2 3 N ILE E 226 ? N ILE E 226 O VAL E 238 ? O VAL E 238 
AC9 3 4 N GLU E 237 ? N GLU E 237 O HIS E 256 ? O HIS E 256 
AD1 1 2 N ASP E 285 ? N ASP E 285 O ILE E 290 ? O ILE E 290 
AD1 2 3 N LEU E 291 ? N LEU E 291 O TYR E 303 ? O TYR E 303 
AD1 3 4 N ASP E 304 ? N ASP E 304 O GLY E 311 ? O GLY E 311 
AD2 1 2 N ASP E 285 ? N ASP E 285 O ILE E 290 ? O ILE E 290 
AD2 2 3 N LEU E 291 ? N LEU E 291 O TYR E 303 ? O TYR E 303 
AD2 3 4 N ILE E 300 ? N ILE E 300 O VAL E 318 ? O VAL E 318 
AD3 1 2 N GLN E 344 ? N GLN E 344 O VAL E 361 ? O VAL E 361 
AD3 2 3 N ALA E 360 ? N ALA E 360 O LEU E 368 ? O LEU E 368 
AD3 3 4 N TYR E 369 ? N TYR E 369 O HIS E 389 ? O HIS E 389 
AD4 1 2 N ASN F 157 ? N ASN F 157 O ILE F 323 ? O ILE F 323 
AD5 1 2 N THR F 224 ? N THR F 224 O VAL F 245 ? O VAL F 245 
AD5 2 3 N GLU F 246 ? N GLU F 246 O ARG F 254 ? O ARG F 254 
AD6 1 2 N THR F 224 ? N THR F 224 O VAL F 245 ? O VAL F 245 
AD6 2 3 O ILE F 242 ? O ILE F 242 N VAL F 191 ? N VAL F 191 
AD6 3 4 N VAL F 192 ? N VAL F 192 O MET F 283 ? O MET F 283 
AD7 1 2 N VAL I 313 ? N VAL I 313 O HIS I 316 ? O HIS I 316 
AD8 1 2 N LYS I 586 ? N LYS I 586 O LYS I 594 ? O LYS I 594 
AD9 1 2 N THR J 72  ? N THR J 72  O ARG J 84  ? O ARG J 84  
AE1 1 2 N ASP K 64  ? N ASP K 64  O GLN K 449 ? O GLN K 449 
AE1 2 3 O THR K 448 ? O THR K 448 N ASN K 435 ? N ASN K 435 
AE1 3 4 O ILE K 430 ? O ILE K 430 N ALA K 422 ? N ALA K 422 
AE1 4 5 O ILE K 417 ? O ILE K 417 N TYR K 413 ? N TYR K 413 
AE2 1 2 N VAL K 87  ? N VAL K 87  O SER K 508 ? O SER K 508 
AE2 2 3 O LEU K 509 ? O LEU K 509 N LEU K 502 ? N LEU K 502 
AE2 3 4 O VAL K 501 ? O VAL K 501 N SER K 462 ? N SER K 462 
AE3 1 2 N MET K 105 ? N MET K 105 O THR K 118 ? O THR K 118 
AE3 2 3 N ALA K 115 ? N ALA K 115 O TRP K 126 ? O TRP K 126 
AE3 3 4 N MET K 125 ? N MET K 125 O ALA K 135 ? O ALA K 135 
AE4 1 2 N ALA K 146 ? N ALA K 146 O ALA K 168 ? O ALA K 168 
AE4 2 3 N LEU K 167 ? N LEU K 167 O VAL K 174 ? O VAL K 174 
AE4 3 4 N SER K 179 ? N SER K 179 O GLN K 199 ? O GLN K 199 
AE5 1 2 N ALA K 146 ? N ALA K 146 O ALA K 168 ? O ALA K 168 
AE5 2 3 N LEU K 167 ? N LEU K 167 O VAL K 174 ? O VAL K 174 
AE5 3 4 N ILE K 173 ? N ILE K 173 O LEU K 208 ? O LEU K 208 
AE6 1 2 N THR K 219 ? N THR K 219 O PHE K 227 ? O PHE K 227 
AE6 2 3 N ILE K 226 ? N ILE K 226 O VAL K 238 ? O VAL K 238 
AE6 3 4 N GLU K 237 ? N GLU K 237 O HIS K 256 ? O HIS K 256 
AE7 1 2 N ASP K 285 ? N ASP K 285 O ILE K 290 ? O ILE K 290 
AE7 2 3 N LEU K 291 ? N LEU K 291 O TYR K 303 ? O TYR K 303 
AE7 3 4 N ASP K 304 ? N ASP K 304 O GLY K 311 ? O GLY K 311 
AE8 1 2 N ASP K 285 ? N ASP K 285 O ILE K 290 ? O ILE K 290 
AE8 2 3 N LEU K 291 ? N LEU K 291 O TYR K 303 ? O TYR K 303 
AE8 3 4 N ILE K 300 ? N ILE K 300 O VAL K 318 ? O VAL K 318 
AE9 1 2 N GLN K 344 ? N GLN K 344 O VAL K 361 ? O VAL K 361 
AE9 2 3 N ALA K 360 ? N ALA K 360 O LEU K 368 ? O LEU K 368 
AE9 3 4 N TYR K 369 ? N TYR K 369 O HIS K 389 ? O HIS K 389 
AF1 1 2 N ASN L 157 ? N ASN L 157 O ILE L 323 ? O ILE L 323 
AF2 1 2 N THR L 224 ? N THR L 224 O VAL L 245 ? O VAL L 245 
AF2 2 3 N GLU L 246 ? N GLU L 246 O ARG L 254 ? O ARG L 254 
AF3 1 2 N THR L 224 ? N THR L 224 O VAL L 245 ? O VAL L 245 
AF3 2 3 O ILE L 242 ? O ILE L 242 N VAL L 191 ? N VAL L 191 
AF3 3 4 N VAL L 192 ? N VAL L 192 O MET L 283 ? O MET L 283 
AF4 1 2 N VAL O 313 ? N VAL O 313 O HIS O 316 ? O HIS O 316 
AF5 1 2 N LYS O 586 ? N LYS O 586 O LYS O 594 ? O LYS O 594 
AF6 1 2 N THR P 72  ? N THR P 72  O ARG P 84  ? O ARG P 84  
AF7 1 2 N ASP Q 64  ? N ASP Q 64  O GLN Q 449 ? O GLN Q 449 
AF7 2 3 O THR Q 448 ? O THR Q 448 N ASN Q 435 ? N ASN Q 435 
AF7 3 4 O ILE Q 430 ? O ILE Q 430 N ALA Q 422 ? N ALA Q 422 
AF7 4 5 O ILE Q 417 ? O ILE Q 417 N TYR Q 413 ? N TYR Q 413 
AF8 1 2 N VAL Q 87  ? N VAL Q 87  O SER Q 508 ? O SER Q 508 
AF8 2 3 O LEU Q 509 ? O LEU Q 509 N LEU Q 502 ? N LEU Q 502 
AF8 3 4 O VAL Q 501 ? O VAL Q 501 N SER Q 462 ? N SER Q 462 
AF9 1 2 N MET Q 105 ? N MET Q 105 O THR Q 118 ? O THR Q 118 
AF9 2 3 N ALA Q 115 ? N ALA Q 115 O TRP Q 126 ? O TRP Q 126 
AF9 3 4 N MET Q 125 ? N MET Q 125 O ALA Q 135 ? O ALA Q 135 
AG1 1 2 N ALA Q 146 ? N ALA Q 146 O ALA Q 168 ? O ALA Q 168 
AG1 2 3 N LEU Q 167 ? N LEU Q 167 O VAL Q 174 ? O VAL Q 174 
AG1 3 4 N SER Q 179 ? N SER Q 179 O GLN Q 199 ? O GLN Q 199 
AG2 1 2 N ALA Q 146 ? N ALA Q 146 O ALA Q 168 ? O ALA Q 168 
AG2 2 3 N LEU Q 167 ? N LEU Q 167 O VAL Q 174 ? O VAL Q 174 
AG2 3 4 N ILE Q 173 ? N ILE Q 173 O LEU Q 208 ? O LEU Q 208 
AG3 1 2 N THR Q 219 ? N THR Q 219 O PHE Q 227 ? O PHE Q 227 
AG3 2 3 N ILE Q 226 ? N ILE Q 226 O VAL Q 238 ? O VAL Q 238 
AG3 3 4 N GLU Q 237 ? N GLU Q 237 O HIS Q 256 ? O HIS Q 256 
AG4 1 2 N ASP Q 285 ? N ASP Q 285 O ILE Q 290 ? O ILE Q 290 
AG4 2 3 N LEU Q 291 ? N LEU Q 291 O TYR Q 303 ? O TYR Q 303 
AG4 3 4 N ASP Q 304 ? N ASP Q 304 O GLY Q 311 ? O GLY Q 311 
AG5 1 2 N ASP Q 285 ? N ASP Q 285 O ILE Q 290 ? O ILE Q 290 
AG5 2 3 N LEU Q 291 ? N LEU Q 291 O TYR Q 303 ? O TYR Q 303 
AG5 3 4 N ILE Q 300 ? N ILE Q 300 O VAL Q 318 ? O VAL Q 318 
AG6 1 2 N GLN Q 344 ? N GLN Q 344 O VAL Q 361 ? O VAL Q 361 
AG6 2 3 N ALA Q 360 ? N ALA Q 360 O LEU Q 368 ? O LEU Q 368 
AG6 3 4 N TYR Q 369 ? N TYR Q 369 O HIS Q 389 ? O HIS Q 389 
AG7 1 2 N ASN R 157 ? N ASN R 157 O ILE R 323 ? O ILE R 323 
AG8 1 2 N THR R 224 ? N THR R 224 O VAL R 245 ? O VAL R 245 
AG8 2 3 N GLU R 246 ? N GLU R 246 O ARG R 254 ? O ARG R 254 
AG9 1 2 N THR R 224 ? N THR R 224 O VAL R 245 ? O VAL R 245 
AG9 2 3 O ILE R 242 ? O ILE R 242 N VAL R 191 ? N VAL R 191 
AG9 3 4 N VAL R 192 ? N VAL R 192 O MET R 283 ? O MET R 283 
AH1 1 2 N VAL U 313 ? N VAL U 313 O HIS U 316 ? O HIS U 316 
AH2 1 2 N LYS U 586 ? N LYS U 586 O LYS U 594 ? O LYS U 594 
AH3 1 2 N THR V 72  ? N THR V 72  O ARG V 84  ? O ARG V 84  
AH4 1 2 N ASP W 64  ? N ASP W 64  O GLN W 449 ? O GLN W 449 
AH4 2 3 O THR W 448 ? O THR W 448 N ASN W 435 ? N ASN W 435 
AH4 3 4 O ILE W 430 ? O ILE W 430 N ALA W 422 ? N ALA W 422 
AH4 4 5 O ILE W 417 ? O ILE W 417 N TYR W 413 ? N TYR W 413 
AH5 1 2 N VAL W 87  ? N VAL W 87  O SER W 508 ? O SER W 508 
AH5 2 3 O LEU W 509 ? O LEU W 509 N LEU W 502 ? N LEU W 502 
AH5 3 4 O VAL W 501 ? O VAL W 501 N SER W 462 ? N SER W 462 
AH6 1 2 N MET W 105 ? N MET W 105 O THR W 118 ? O THR W 118 
AH6 2 3 N ALA W 115 ? N ALA W 115 O TRP W 126 ? O TRP W 126 
AH6 3 4 N MET W 125 ? N MET W 125 O ALA W 135 ? O ALA W 135 
AH7 1 2 N ALA W 146 ? N ALA W 146 O ALA W 168 ? O ALA W 168 
AH7 2 3 N LEU W 167 ? N LEU W 167 O VAL W 174 ? O VAL W 174 
AH7 3 4 N SER W 179 ? N SER W 179 O GLN W 199 ? O GLN W 199 
AH8 1 2 N ALA W 146 ? N ALA W 146 O ALA W 168 ? O ALA W 168 
AH8 2 3 N LEU W 167 ? N LEU W 167 O VAL W 174 ? O VAL W 174 
AH8 3 4 N ILE W 173 ? N ILE W 173 O LEU W 208 ? O LEU W 208 
AH9 1 2 N THR W 219 ? N THR W 219 O PHE W 227 ? O PHE W 227 
AH9 2 3 N ILE W 226 ? N ILE W 226 O VAL W 238 ? O VAL W 238 
AH9 3 4 N GLU W 237 ? N GLU W 237 O HIS W 256 ? O HIS W 256 
AI1 1 2 N ASP W 285 ? N ASP W 285 O ILE W 290 ? O ILE W 290 
AI1 2 3 N LEU W 291 ? N LEU W 291 O TYR W 303 ? O TYR W 303 
AI1 3 4 N ASP W 304 ? N ASP W 304 O GLY W 311 ? O GLY W 311 
AI2 1 2 N ASP W 285 ? N ASP W 285 O ILE W 290 ? O ILE W 290 
AI2 2 3 N LEU W 291 ? N LEU W 291 O TYR W 303 ? O TYR W 303 
AI2 3 4 N ILE W 300 ? N ILE W 300 O VAL W 318 ? O VAL W 318 
AI3 1 2 N GLN W 344 ? N GLN W 344 O VAL W 361 ? O VAL W 361 
AI3 2 3 N ALA W 360 ? N ALA W 360 O LEU W 368 ? O LEU W 368 
AI3 3 4 N TYR W 369 ? N TYR W 369 O HIS W 389 ? O HIS W 389 
AI4 1 2 N ASN X 157 ? N ASN X 157 O ILE X 323 ? O ILE X 323 
AI5 1 2 N THR X 224 ? N THR X 224 O VAL X 245 ? O VAL X 245 
AI5 2 3 N GLU X 246 ? N GLU X 246 O ARG X 254 ? O ARG X 254 
AI6 1 2 N THR X 224 ? N THR X 224 O VAL X 245 ? O VAL X 245 
AI6 2 3 O ILE X 242 ? O ILE X 242 N VAL X 191 ? N VAL X 191 
AI6 3 4 N VAL X 192 ? N VAL X 192 O MET X 283 ? O MET X 283 
# 
_atom_sites.entry_id                    5IJN 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N  . GLN A 1 20   ? 1128.582 714.733 842.891 1.00 0.00 ? 20   GLN A N  1 
ATOM 2      C CA . GLN A 1 20   ? 1127.765 714.280 844.037 1.00 0.00 ? 20   GLN A CA 1 
ATOM 3      C C  . GLN A 1 20   ? 1126.812 715.361 844.422 1.00 0.00 ? 20   GLN A C  1 
ATOM 4      O O  . GLN A 1 20   ? 1125.626 715.109 844.634 1.00 0.00 ? 20   GLN A O  1 
ATOM 5      C CB . GLN A 1 20   ? 1128.674 713.945 845.232 1.00 0.00 ? 20   GLN A CB 1 
ATOM 6      N N  . GLU A 1 21   ? 1127.307 716.609 844.505 1.00 0.00 ? 21   GLU A N  1 
ATOM 7      C CA . GLU A 1 21   ? 1126.426 717.679 844.854 1.00 0.00 ? 21   GLU A CA 1 
ATOM 8      C C  . GLU A 1 21   ? 1125.427 717.772 843.748 1.00 0.00 ? 21   GLU A C  1 
ATOM 9      O O  . GLU A 1 21   ? 1125.770 717.645 842.573 1.00 0.00 ? 21   GLU A O  1 
ATOM 10     C CB . GLU A 1 21   ? 1127.121 719.047 844.977 1.00 0.00 ? 21   GLU A CB 1 
ATOM 11     N N  . ALA A 1 22   ? 1124.150 717.974 844.112 1.00 0.00 ? 22   ALA A N  1 
ATOM 12     C CA . ALA A 1 22   ? 1123.091 718.025 843.150 1.00 0.00 ? 22   ALA A CA 1 
ATOM 13     C C  . ALA A 1 22   ? 1123.263 719.204 842.246 1.00 0.00 ? 22   ALA A C  1 
ATOM 14     O O  . ALA A 1 22   ? 1123.063 719.098 841.037 1.00 0.00 ? 22   ALA A O  1 
ATOM 15     C CB . ALA A 1 22   ? 1121.700 718.135 843.796 1.00 0.00 ? 22   ALA A CB 1 
ATOM 16     N N  . LEU A 1 23   ? 1123.657 720.362 842.809 1.00 0.00 ? 23   LEU A N  1 
ATOM 17     C CA . LEU A 1 23   ? 1123.727 721.570 842.039 1.00 0.00 ? 23   LEU A CA 1 
ATOM 18     C C  . LEU A 1 23   ? 1124.725 721.423 840.935 1.00 0.00 ? 23   LEU A C  1 
ATOM 19     O O  . LEU A 1 23   ? 1124.432 721.748 839.784 1.00 0.00 ? 23   LEU A O  1 
ATOM 20     C CB . LEU A 1 23   ? 1124.138 722.780 842.895 1.00 0.00 ? 23   LEU A CB 1 
ATOM 21     N N  . GLU A 1 24   ? 1125.931 720.912 841.242 1.00 0.00 ? 24   GLU A N  1 
ATOM 22     C CA . GLU A 1 24   ? 1126.917 720.761 840.212 1.00 0.00 ? 24   GLU A CA 1 
ATOM 23     C C  . GLU A 1 24   ? 1126.412 719.745 839.247 1.00 0.00 ? 24   GLU A C  1 
ATOM 24     O O  . GLU A 1 24   ? 1126.596 719.870 838.038 1.00 0.00 ? 24   GLU A O  1 
ATOM 25     C CB . GLU A 1 24   ? 1128.275 720.256 840.732 1.00 0.00 ? 24   GLU A CB 1 
ATOM 26     N N  . ASN A 1 25   ? 1125.739 718.713 839.780 1.00 0.00 ? 25   ASN A N  1 
ATOM 27     C CA . ASN A 1 25   ? 1125.263 717.626 838.980 1.00 0.00 ? 25   ASN A CA 1 
ATOM 28     C C  . ASN A 1 25   ? 1124.317 718.156 837.949 1.00 0.00 ? 25   ASN A C  1 
ATOM 29     O O  . ASN A 1 25   ? 1124.471 717.881 836.761 1.00 0.00 ? 25   ASN A O  1 
ATOM 30     C CB . ASN A 1 25   ? 1124.494 716.603 839.837 1.00 0.00 ? 25   ASN A CB 1 
ATOM 31     N N  . ALA A 1 26   ? 1123.340 718.977 838.371 1.00 0.00 ? 26   ALA A N  1 
ATOM 32     C CA . ALA A 1 26   ? 1122.341 719.467 837.467 1.00 0.00 ? 26   ALA A CA 1 
ATOM 33     C C  . ALA A 1 26   ? 1122.993 720.288 836.407 1.00 0.00 ? 26   ALA A C  1 
ATOM 34     O O  . ALA A 1 26   ? 1122.631 720.199 835.234 1.00 0.00 ? 26   ALA A O  1 
ATOM 35     C CB . ALA A 1 26   ? 1121.296 720.358 838.164 1.00 0.00 ? 26   ALA A CB 1 
ATOM 36     N N  . GLY A 1 27   ? 1123.985 721.107 836.791 1.00 0.00 ? 27   GLY A N  1 
ATOM 37     C CA . GLY A 1 27   ? 1124.618 721.959 835.831 1.00 0.00 ? 27   GLY A CA 1 
ATOM 38     C C  . GLY A 1 27   ? 1125.258 721.111 834.782 1.00 0.00 ? 27   GLY A C  1 
ATOM 39     O O  . GLY A 1 27   ? 1125.203 721.429 833.597 1.00 0.00 ? 27   GLY A O  1 
ATOM 40     N N  . ARG A 1 28   ? 1125.892 720.002 835.201 1.00 0.00 ? 28   ARG A N  1 
ATOM 41     C CA . ARG A 1 28   ? 1126.571 719.161 834.262 1.00 0.00 ? 28   ARG A CA 1 
ATOM 42     C C  . ARG A 1 28   ? 1125.582 718.588 833.300 1.00 0.00 ? 28   ARG A C  1 
ATOM 43     O O  . ARG A 1 28   ? 1125.849 718.524 832.101 1.00 0.00 ? 28   ARG A O  1 
ATOM 44     C CB . ARG A 1 28   ? 1127.340 718.009 834.933 1.00 0.00 ? 28   ARG A CB 1 
ATOM 45     N N  . LEU A 1 29   ? 1124.400 718.166 833.787 1.00 0.00 ? 29   LEU A N  1 
ATOM 46     C CA . LEU A 1 29   ? 1123.445 717.585 832.889 1.00 0.00 ? 29   LEU A CA 1 
ATOM 47     C C  . LEU A 1 29   ? 1123.028 718.589 831.863 1.00 0.00 ? 29   LEU A C  1 
ATOM 48     O O  . LEU A 1 29   ? 1122.979 718.273 830.675 1.00 0.00 ? 29   LEU A O  1 
ATOM 49     C CB . LEU A 1 29   ? 1122.155 717.080 833.565 1.00 0.00 ? 29   LEU A CB 1 
ATOM 50     N N  . ILE A 1 30   ? 1122.734 719.838 832.273 1.00 0.00 ? 30   ILE A N  1 
ATOM 51     C CA . ILE A 1 30   ? 1122.249 720.746 831.277 1.00 0.00 ? 30   ILE A CA 1 
ATOM 52     C C  . ILE A 1 30   ? 1123.312 721.006 830.263 1.00 0.00 ? 30   ILE A C  1 
ATOM 53     O O  . ILE A 1 30   ? 1123.025 721.077 829.070 1.00 0.00 ? 30   ILE A O  1 
ATOM 54     C CB . ILE A 1 30   ? 1121.808 722.095 831.754 1.00 0.00 ? 30   ILE A CB 1 
ATOM 55     N N  . ASP A 1 31   ? 1124.570 721.168 830.710 1.00 0.00 ? 31   ASP A N  1 
ATOM 56     C CA . ASP A 1 31   ? 1125.630 721.506 829.804 1.00 0.00 ? 31   ASP A CA 1 
ATOM 57     C C  . ASP A 1 31   ? 1125.786 720.421 828.792 1.00 0.00 ? 31   ASP A C  1 
ATOM 58     O O  . ASP A 1 31   ? 1125.970 720.692 827.607 1.00 0.00 ? 31   ASP A O  1 
ATOM 59     C CB . ASP A 1 31   ? 1126.984 721.684 830.511 1.00 0.00 ? 31   ASP A CB 1 
ATOM 60     N N  . ARG A 1 32   ? 1125.705 719.150 829.228 1.00 0.00 ? 32   ARG A N  1 
ATOM 61     C CA . ARG A 1 32   ? 1125.888 718.056 828.322 1.00 0.00 ? 32   ARG A CA 1 
ATOM 62     C C  . ARG A 1 32   ? 1124.823 718.110 827.273 1.00 0.00 ? 32   ARG A C  1 
ATOM 63     O O  . ARG A 1 32   ? 1125.102 717.951 826.085 1.00 0.00 ? 32   ARG A O  1 
ATOM 64     C CB . ARG A 1 32   ? 1125.769 716.695 829.024 1.00 0.00 ? 32   ARG A CB 1 
ATOM 65     N N  . GLN A 1 33   ? 1123.569 718.358 827.693 1.00 0.00 ? 33   GLN A N  1 
ATOM 66     C CA . GLN A 1 33   ? 1122.459 718.389 826.783 1.00 0.00 ? 33   GLN A CA 1 
ATOM 67     C C  . GLN A 1 33   ? 1122.630 719.525 825.827 1.00 0.00 ? 33   GLN A C  1 
ATOM 68     O O  . GLN A 1 33   ? 1122.324 719.396 824.642 1.00 0.00 ? 33   GLN A O  1 
ATOM 69     C CB . GLN A 1 33   ? 1121.110 718.575 827.497 1.00 0.00 ? 33   GLN A CB 1 
ATOM 70     N N  . LEU A 1 34   ? 1123.130 720.673 826.316 1.00 0.00 ? 34   LEU A N  1 
ATOM 71     C CA . LEU A 1 34   ? 1123.274 721.833 825.485 1.00 0.00 ? 34   LEU A CA 1 
ATOM 72     C C  . LEU A 1 34   ? 1124.233 721.462 824.401 1.00 0.00 ? 34   LEU A C  1 
ATOM 73     O O  . LEU A 1 34   ? 1124.027 721.787 823.233 1.00 0.00 ? 34   LEU A O  1 
ATOM 74     C CB . LEU A 1 34   ? 1123.862 723.031 826.259 1.00 0.00 ? 34   LEU A CB 1 
ATOM 75     N N  . GLN A 1 35   ? 1125.305 720.736 824.767 1.00 0.00 ? 35   GLN A N  1 
ATOM 76     C CA . GLN A 1 35   ? 1126.301 720.366 823.809 1.00 0.00 ? 35   GLN A CA 1 
ATOM 77     C C  . GLN A 1 35   ? 1125.650 719.525 822.760 1.00 0.00 ? 35   GLN A C  1 
ATOM 78     O O  . GLN A 1 35   ? 1125.907 719.699 821.570 1.00 0.00 ? 35   GLN A O  1 
ATOM 79     C CB . GLN A 1 35   ? 1127.427 719.519 824.425 1.00 0.00 ? 35   GLN A CB 1 
ATOM 80     N N  . GLU A 1 36   ? 1124.771 718.598 823.177 1.00 0.00 ? 36   GLU A N  1 
ATOM 81     C CA . GLU A 1 36   ? 1124.145 717.716 822.235 1.00 0.00 ? 36   GLU A CA 1 
ATOM 82     C C  . GLU A 1 36   ? 1123.298 718.509 821.294 1.00 0.00 ? 36   GLU A C  1 
ATOM 83     O O  . GLU A 1 36   ? 1123.263 718.223 820.099 1.00 0.00 ? 36   GLU A O  1 
ATOM 84     C CB . GLU A 1 36   ? 1123.259 716.645 822.896 1.00 0.00 ? 36   GLU A CB 1 
ATOM 85     N N  . ASP A 1 37   ? 1122.599 719.539 821.802 1.00 0.00 ? 37   ASP A N  1 
ATOM 86     C CA . ASP A 1 37   ? 1121.730 720.302 820.953 1.00 0.00 ? 37   ASP A CA 1 
ATOM 87     C C  . ASP A 1 37   ? 1122.546 720.942 819.871 1.00 0.00 ? 37   ASP A C  1 
ATOM 88     O O  . ASP A 1 37   ? 1122.152 720.917 818.709 1.00 0.00 ? 37   ASP A O  1 
ATOM 89     C CB . ASP A 1 37   ? 1120.956 721.386 821.720 1.00 0.00 ? 37   ASP A CB 1 
ATOM 90     N N  . ARG A 1 38   ? 1123.725 721.494 820.222 1.00 0.00 ? 38   ARG A N  1 
ATOM 91     C CA . ARG A 1 38   ? 1124.591 722.208 819.313 1.00 0.00 ? 38   ARG A CA 1 
ATOM 92     C C  . ARG A 1 38   ? 1125.169 721.296 818.256 1.00 0.00 ? 38   ARG A C  1 
ATOM 93     O O  . ARG A 1 38   ? 1125.461 721.726 817.144 1.00 0.00 ? 38   ARG A O  1 
ATOM 94     C CB . ARG A 1 38   ? 1125.792 722.869 820.015 1.00 0.00 ? 38   ARG A CB 1 
ATOM 95     N N  . MET A 1 39   ? 1125.434 720.025 818.597 1.00 0.00 ? 39   MET A N  1 
ATOM 96     C CA . MET A 1 39   ? 1126.072 719.104 817.693 1.00 0.00 ? 39   MET A CA 1 
ATOM 97     C C  . MET A 1 39   ? 1125.229 718.602 816.554 1.00 0.00 ? 39   MET A C  1 
ATOM 98     O O  . MET A 1 39   ? 1125.797 718.128 815.571 1.00 0.00 ? 39   MET A O  1 
ATOM 99     C CB . MET A 1 39   ? 1126.811 717.955 818.395 1.00 0.00 ? 39   MET A CB 1 
ATOM 100    N N  . TYR A 1 40   ? 1123.884 718.614 816.699 1.00 0.00 ? 40   TYR A N  1 
ATOM 101    C CA . TYR A 1 40   ? 1122.866 718.212 815.749 1.00 0.00 ? 40   TYR A CA 1 
ATOM 102    C C  . TYR A 1 40   ? 1123.377 718.299 814.341 1.00 0.00 ? 40   TYR A C  1 
ATOM 103    O O  . TYR A 1 40   ? 1124.143 719.191 813.975 1.00 0.00 ? 40   TYR A O  1 
ATOM 104    C CB . TYR A 1 40   ? 1121.640 719.110 815.898 1.00 0.00 ? 40   TYR A CB 1 
ATOM 105    N N  . PRO A 1 41   ? 1122.943 717.353 813.551 1.00 0.00 ? 41   PRO A N  1 
ATOM 106    C CA . PRO A 1 41   ? 1123.435 717.189 812.207 1.00 0.00 ? 41   PRO A CA 1 
ATOM 107    C C  . PRO A 1 41   ? 1123.171 718.334 811.286 1.00 0.00 ? 41   PRO A C  1 
ATOM 108    O O  . PRO A 1 41   ? 1122.232 719.095 811.510 1.00 0.00 ? 41   PRO A O  1 
ATOM 109    C CB . PRO A 1 41   ? 1122.861 715.859 811.722 1.00 0.00 ? 41   PRO A CB 1 
ATOM 110    N N  . ASP A 1 42   ? 1124.028 718.469 810.251 1.00 0.00 ? 42   ASP A N  1 
ATOM 111    C CA . ASP A 1 42   ? 1123.941 719.517 809.276 1.00 0.00 ? 42   ASP A CA 1 
ATOM 112    C C  . ASP A 1 42   ? 1122.673 719.301 808.511 1.00 0.00 ? 42   ASP A C  1 
ATOM 113    O O  . ASP A 1 42   ? 1122.265 718.166 808.273 1.00 0.00 ? 42   ASP A O  1 
ATOM 114    C CB . ASP A 1 42   ? 1125.119 719.494 808.283 1.00 0.00 ? 42   ASP A CB 1 
ATOM 115    N N  . LEU A 1 43   ? 1122.020 720.408 808.106 1.00 0.00 ? 43   LEU A N  1 
ATOM 116    C CA . LEU A 1 43   ? 1120.741 720.360 807.457 1.00 0.00 ? 43   LEU A CA 1 
ATOM 117    C C  . LEU A 1 43   ? 1120.817 719.670 806.136 1.00 0.00 ? 43   LEU A C  1 
ATOM 118    O O  . LEU A 1 43   ? 1119.986 718.811 805.843 1.00 0.00 ? 43   LEU A O  1 
ATOM 119    C CB . LEU A 1 43   ? 1120.150 721.758 807.212 1.00 0.00 ? 43   LEU A CB 1 
ATOM 120    N N  . SER A 1 44   ? 1121.821 719.992 805.300 1.00 0.00 ? 44   SER A N  1 
ATOM 121    C CA . SER A 1 44   ? 1121.776 719.394 803.997 1.00 0.00 ? 44   SER A CA 1 
ATOM 122    C C  . SER A 1 44   ? 1122.972 718.536 803.790 1.00 0.00 ? 44   SER A C  1 
ATOM 123    O O  . SER A 1 44   ? 1124.100 718.905 804.122 1.00 0.00 ? 44   SER A O  1 
ATOM 124    C CB . SER A 1 44   ? 1121.754 720.424 802.857 1.00 0.00 ? 44   SER A CB 1 
ATOM 125    N N  . GLU A 1 45   ? 1122.723 717.334 803.241 1.00 0.00 ? 45   GLU A N  1 
ATOM 126    C CA . GLU A 1 45   ? 1123.767 716.427 802.887 1.00 0.00 ? 45   GLU A CA 1 
ATOM 127    C C  . GLU A 1 45   ? 1123.276 715.723 801.663 1.00 0.00 ? 45   GLU A C  1 
ATOM 128    O O  . GLU A 1 45   ? 1122.103 715.367 801.566 1.00 0.00 ? 45   GLU A O  1 
ATOM 129    C CB . GLU A 1 45   ? 1124.062 715.377 803.974 1.00 0.00 ? 45   GLU A CB 1 
ATOM 130    N N  . LEU A 1 46   ? 1124.172 715.510 800.687 1.00 0.00 ? 46   LEU A N  1 
ATOM 131    C CA . LEU A 1 46   ? 1123.822 714.877 799.451 1.00 0.00 ? 46   LEU A CA 1 
ATOM 132    C C  . LEU A 1 46   ? 1123.398 713.472 799.725 1.00 0.00 ? 46   LEU A C  1 
ATOM 133    O O  . LEU A 1 46   ? 1122.506 712.938 799.066 1.00 0.00 ? 46   LEU A O  1 
ATOM 134    C CB . LEU A 1 46   ? 1124.960 714.871 798.405 1.00 0.00 ? 46   LEU A CB 1 
ATOM 135    N N  . LEU A 1 47   ? 1124.026 712.844 800.731 1.00 0.00 ? 47   LEU A N  1 
ATOM 136    C CA . LEU A 1 47   ? 1123.767 711.477 801.076 1.00 0.00 ? 47   LEU A CA 1 
ATOM 137    C C  . LEU A 1 47   ? 1122.338 711.327 801.493 1.00 0.00 ? 47   LEU A C  1 
ATOM 138    O O  . LEU A 1 47   ? 1121.741 710.269 801.296 1.00 0.00 ? 47   LEU A O  1 
ATOM 139    C CB . LEU A 1 47   ? 1124.643 710.975 802.236 1.00 0.00 ? 47   LEU A CB 1 
ATOM 140    N N  . MET A 1 48   ? 1121.745 712.382 802.082 1.00 0.00 ? 48   MET A N  1 
ATOM 141    C CA . MET A 1 48   ? 1120.422 712.278 802.630 1.00 0.00 ? 48   MET A CA 1 
ATOM 142    C C  . MET A 1 48   ? 1119.432 711.875 801.576 1.00 0.00 ? 48   MET A C  1 
ATOM 143    O O  . MET A 1 48   ? 1118.607 711.004 801.828 1.00 0.00 ? 48   MET A O  1 
ATOM 144    C CB . MET A 1 48   ? 1119.935 713.612 803.216 1.00 0.00 ? 48   MET A CB 1 
ATOM 145    N N  . VAL A 1 49   ? 1119.466 712.492 800.370 1.00 0.00 ? 49   VAL A N  1 
ATOM 146    C CA . VAL A 1 49   ? 1118.473 712.128 799.393 1.00 0.00 ? 49   VAL A CA 1 
ATOM 147    C C  . VAL A 1 49   ? 1119.192 711.792 798.103 1.00 0.00 ? 49   VAL A C  1 
ATOM 148    O O  . VAL A 1 49   ? 1118.772 712.169 797.012 1.00 0.00 ? 49   VAL A O  1 
ATOM 149    C CB . VAL A 1 49   ? 1117.541 713.300 799.180 1.00 0.00 ? 49   VAL A CB 1 
ATOM 150    N N  . SER A 1 50   ? 1120.268 710.988 798.175 1.00 0.00 ? 50   SER A N  1 
ATOM 151    C CA . SER A 1 50   ? 1121.010 710.705 796.976 1.00 0.00 ? 50   SER A CA 1 
ATOM 152    C C  . SER A 1 50   ? 1120.117 709.981 796.037 1.00 0.00 ? 50   SER A C  1 
ATOM 153    O O  . SER A 1 50   ? 1119.757 710.493 794.977 1.00 0.00 ? 50   SER A O  1 
ATOM 154    C CB . SER A 1 50   ? 1122.253 709.833 797.227 1.00 0.00 ? 50   SER A CB 1 
ATOM 155    N N  . SER A 1 58   ? 1118.706 708.078 797.786 1.00 0.00 ? 58   SER A N  1 
ATOM 156    C CA . SER A 1 58   ? 1118.147 707.849 796.491 1.00 0.00 ? 58   SER A CA 1 
ATOM 157    C C  . SER A 1 58   ? 1116.736 708.319 796.556 1.00 0.00 ? 58   SER A C  1 
ATOM 158    O O  . SER A 1 58   ? 1115.870 707.649 797.113 1.00 0.00 ? 58   SER A O  1 
ATOM 159    C CB . SER A 1 58   ? 1118.130 706.367 796.087 1.00 0.00 ? 58   SER A CB 1 
ATOM 160    N N  . GLY A 1 59   ? 1116.483 709.512 795.988 1.00 0.00 ? 59   GLY A N  1 
ATOM 161    C CA . GLY A 1 59   ? 1115.146 710.014 795.932 1.00 0.00 ? 59   GLY A CA 1 
ATOM 162    C C  . GLY A 1 59   ? 1114.832 710.720 797.199 1.00 0.00 ? 59   GLY A C  1 
ATOM 163    O O  . GLY A 1 59   ? 1115.419 710.463 798.249 1.00 0.00 ? 59   GLY A O  1 
ATOM 164    N N  . MET A 1 60   ? 1113.846 711.631 797.113 1.00 0.00 ? 60   MET A N  1 
ATOM 165    C CA . MET A 1 60   ? 1113.422 712.402 798.239 1.00 0.00 ? 60   MET A CA 1 
ATOM 166    C C  . MET A 1 60   ? 1112.116 711.810 798.656 1.00 0.00 ? 60   MET A C  1 
ATOM 167    O O  . MET A 1 60   ? 1111.061 712.120 798.107 1.00 0.00 ? 60   MET A O  1 
ATOM 168    C CB . MET A 1 60   ? 1113.161 713.863 797.858 1.00 0.00 ? 60   MET A CB 1 
ATOM 169    N N  . ASP A 1 62   ? 1112.867 711.786 801.360 1.00 0.00 ? 62   ASP A N  1 
ATOM 170    C CA . ASP A 1 62   ? 1111.614 711.214 801.746 1.00 0.00 ? 62   ASP A CA 1 
ATOM 171    C C  . ASP A 1 62   ? 1110.633 712.340 801.802 1.00 0.00 ? 62   ASP A C  1 
ATOM 172    O O  . ASP A 1 62   ? 1110.914 713.381 802.395 1.00 0.00 ? 62   ASP A O  1 
ATOM 173    C CB . ASP A 1 62   ? 1111.698 710.561 803.135 1.00 0.00 ? 62   ASP A CB 1 
ATOM 174    N N  . MET A 1 63   ? 1109.453 712.176 801.172 1.00 0.00 ? 63   MET A N  1 
ATOM 175    C CA . MET A 1 63   ? 1108.520 713.267 801.162 1.00 0.00 ? 63   MET A CA 1 
ATOM 176    C C  . MET A 1 63   ? 1107.250 712.877 801.842 1.00 0.00 ? 63   MET A C  1 
ATOM 177    O O  . MET A 1 63   ? 1106.747 711.764 801.685 1.00 0.00 ? 63   MET A O  1 
ATOM 178    C CB . MET A 1 63   ? 1108.146 713.730 799.746 1.00 0.00 ? 63   MET A CB 1 
ATOM 179    N N  . ASP A 1 64   ? 1106.726 713.811 802.661 1.00 0.00 ? 64   ASP A N  1 
ATOM 180    C CA . ASP A 1 64   ? 1105.440 713.698 803.285 1.00 0.00 ? 64   ASP A CA 1 
ATOM 181    C C  . ASP A 1 64   ? 1104.661 714.749 802.564 1.00 0.00 ? 64   ASP A C  1 
ATOM 182    O O  . ASP A 1 64   ? 1104.553 715.880 803.033 1.00 0.00 ? 64   ASP A O  1 
ATOM 183    C CB . ASP A 1 64   ? 1105.468 714.082 804.775 1.00 0.00 ? 64   ASP A CB 1 
ATOM 184    N N  . TYR A 1 65   ? 1104.108 714.395 801.386 1.00 0.00 ? 65   TYR A N  1 
ATOM 185    C CA . TYR A 1 65   ? 1103.542 715.401 800.537 1.00 0.00 ? 65   TYR A CA 1 
ATOM 186    C C  . TYR A 1 65   ? 1102.098 715.192 800.235 1.00 0.00 ? 65   TYR A C  1 
ATOM 187    O O  . TYR A 1 65   ? 1101.715 714.259 799.532 1.00 0.00 ? 65   TYR A O  1 
ATOM 188    C CB . TYR A 1 65   ? 1104.292 715.431 799.198 1.00 0.00 ? 65   TYR A CB 1 
ATOM 189    N N  . PRO A 1 66   ? 1101.280 716.021 800.821 1.00 0.00 ? 66   PRO A N  1 
ATOM 190    C CA . PRO A 1 66   ? 1099.901 716.008 800.407 1.00 0.00 ? 66   PRO A CA 1 
ATOM 191    C C  . PRO A 1 66   ? 1099.538 717.152 799.500 1.00 0.00 ? 66   PRO A C  1 
ATOM 192    O O  . PRO A 1 66   ? 1099.983 718.273 799.750 1.00 0.00 ? 66   PRO A O  1 
ATOM 193    C CB . PRO A 1 66   ? 1099.058 715.948 801.669 1.00 0.00 ? 66   PRO A CB 1 
ATOM 194    N N  . LEU A 1 67   ? 1098.703 716.902 798.467 1.00 0.00 ? 67   LEU A N  1 
ATOM 195    C CA . LEU A 1 67   ? 1098.161 717.962 797.654 1.00 0.00 ? 67   LEU A CA 1 
ATOM 196    C C  . LEU A 1 67   ? 1097.193 718.743 798.468 1.00 0.00 ? 67   LEU A C  1 
ATOM 197    O O  . LEU A 1 67   ? 1097.082 719.960 798.328 1.00 0.00 ? 67   LEU A O  1 
ATOM 198    C CB . LEU A 1 67   ? 1097.389 717.489 796.408 1.00 0.00 ? 67   LEU A CB 1 
ATOM 199    N N  . GLN A 1 68   ? 1096.436 718.048 799.327 1.00 0.00 ? 68   GLN A N  1 
ATOM 200    C CA . GLN A 1 68   ? 1095.451 718.710 800.122 1.00 0.00 ? 68   GLN A CA 1 
ATOM 201    C C  . GLN A 1 68   ? 1096.158 719.292 801.297 1.00 0.00 ? 68   GLN A C  1 
ATOM 202    O O  . GLN A 1 68   ? 1097.300 719.733 801.222 1.00 0.00 ? 68   GLN A O  1 
ATOM 203    C CB . GLN A 1 68   ? 1094.386 717.740 800.653 1.00 0.00 ? 68   GLN A CB 1 
ATOM 204    N N  . LEU A 1 72   ? 1094.552 721.579 801.499 1.00 0.00 ? 72   LEU A N  1 
ATOM 205    C CA . LEU A 1 72   ? 1095.152 722.301 802.575 1.00 0.00 ? 72   LEU A CA 1 
ATOM 206    C C  . LEU A 1 72   ? 1094.878 721.532 803.830 1.00 0.00 ? 72   LEU A C  1 
ATOM 207    O O  . LEU A 1 72   ? 1093.822 720.919 803.976 1.00 0.00 ? 72   LEU A O  1 
ATOM 208    C CB . LEU A 1 72   ? 1094.553 723.724 802.683 1.00 0.00 ? 72   LEU A CB 1 
ATOM 209    N N  . LEU A 1 73   ? 1095.852 721.539 804.763 1.00 0.00 ? 73   LEU A N  1 
ATOM 210    C CA . LEU A 1 73   ? 1095.697 720.918 806.048 1.00 0.00 ? 73   LEU A CA 1 
ATOM 211    C C  . LEU A 1 73   ? 1095.678 719.433 805.818 1.00 0.00 ? 73   LEU A C  1 
ATOM 212    O O  . LEU A 1 73   ? 1095.221 718.655 806.654 1.00 0.00 ? 73   LEU A O  1 
ATOM 213    C CB . LEU A 1 73   ? 1094.360 721.351 806.705 1.00 0.00 ? 73   LEU A CB 1 
ATOM 214    N N  . SER A 1 74   ? 1096.198 718.967 804.666 1.00 0.00 ? 74   SER A N  1 
ATOM 215    C CA . SER A 1 74   ? 1096.165 717.547 804.483 1.00 0.00 ? 74   SER A CA 1 
ATOM 216    C C  . SER A 1 74   ? 1097.033 716.925 805.519 1.00 0.00 ? 74   SER A C  1 
ATOM 217    O O  . SER A 1 74   ? 1096.694 715.870 806.055 1.00 0.00 ? 74   SER A O  1 
ATOM 218    C CB . SER A 1 74   ? 1096.659 717.058 803.123 1.00 0.00 ? 74   SER A CB 1 
ATOM 219    N N  . VAL A 1 75   ? 1098.177 717.555 805.844 1.00 0.00 ? 75   VAL A N  1 
ATOM 220    C CA . VAL A 1 75   ? 1098.971 716.932 806.859 1.00 0.00 ? 75   VAL A CA 1 
ATOM 221    C C  . VAL A 1 75   ? 1098.412 717.486 808.134 1.00 0.00 ? 75   VAL A C  1 
ATOM 222    O O  . VAL A 1 75   ? 1098.813 718.556 808.576 1.00 0.00 ? 75   VAL A O  1 
ATOM 223    C CB . VAL A 1 75   ? 1100.406 717.342 806.867 1.00 0.00 ? 75   VAL A CB 1 
ATOM 224    N N  . PRO A 1 76   ? 1097.488 716.810 808.743 1.00 0.00 ? 76   PRO A N  1 
ATOM 225    C CA . PRO A 1 76   ? 1096.817 717.343 809.902 1.00 0.00 ? 76   PRO A CA 1 
ATOM 226    C C  . PRO A 1 76   ? 1097.676 717.873 811.016 1.00 0.00 ? 76   PRO A C  1 
ATOM 227    O O  . PRO A 1 76   ? 1097.665 719.078 811.258 1.00 0.00 ? 76   PRO A O  1 
ATOM 228    C CB . PRO A 1 76   ? 1095.949 716.196 810.411 1.00 0.00 ? 76   PRO A CB 1 
ATOM 229    N N  . ASN A 1 77   ? 1098.407 716.981 811.707 1.00 0.00 ? 77   ASN A N  1 
ATOM 230    C CA . ASN A 1 77   ? 1099.202 717.314 812.861 1.00 0.00 ? 77   ASN A CA 1 
ATOM 231    C C  . ASN A 1 77   ? 1100.433 718.055 812.476 1.00 0.00 ? 77   ASN A C  1 
ATOM 232    O O  . ASN A 1 77   ? 1100.807 719.050 813.094 1.00 0.00 ? 77   ASN A O  1 
ATOM 233    C CB . ASN A 1 77   ? 1099.661 716.060 813.619 1.00 0.00 ? 77   ASN A CB 1 
ATOM 234    N N  . LEU A 1 78   ? 1101.075 717.595 811.389 1.00 0.00 ? 78   LEU A N  1 
ATOM 235    C CA . LEU A 1 78   ? 1102.345 718.065 810.907 1.00 0.00 ? 78   LEU A CA 1 
ATOM 236    C C  . LEU A 1 78   ? 1102.370 719.395 810.197 1.00 0.00 ? 78   LEU A C  1 
ATOM 237    O O  . LEU A 1 78   ? 1103.486 719.905 810.138 1.00 0.00 ? 78   LEU A O  1 
ATOM 238    C CB . LEU A 1 78   ? 1103.094 717.058 810.011 1.00 0.00 ? 78   LEU A CB 1 
ATOM 239    N N  . PRO A 1 79   ? 1101.293 719.971 809.646 1.00 0.00 ? 79   PRO A N  1 
ATOM 240    C CA . PRO A 1 79   ? 1101.397 721.060 808.705 1.00 0.00 ? 79   PRO A CA 1 
ATOM 241    C C  . PRO A 1 79   ? 1102.331 722.119 809.168 1.00 0.00 ? 79   PRO A C  1 
ATOM 242    O O  . PRO A 1 79   ? 1102.159 722.650 810.265 1.00 0.00 ? 79   PRO A O  1 
ATOM 243    C CB . PRO A 1 79   ? 1100.001 721.644 808.543 1.00 0.00 ? 79   PRO A CB 1 
ATOM 244    N N  . GLU A 1 80   ? 1103.337 722.405 808.335 1.00 0.00 ? 80   GLU A N  1 
ATOM 245    C CA . GLU A 1 80   ? 1104.379 723.313 808.672 1.00 0.00 ? 80   GLU A CA 1 
ATOM 246    C C  . GLU A 1 80   ? 1103.851 724.706 808.794 1.00 0.00 ? 80   GLU A C  1 
ATOM 247    O O  . GLU A 1 80   ? 1104.219 725.427 809.719 1.00 0.00 ? 80   GLU A O  1 
ATOM 248    C CB . GLU A 1 80   ? 1105.509 723.294 807.624 1.00 0.00 ? 80   GLU A CB 1 
ATOM 249    N N  . ILE A 1 81   ? 1102.950 725.121 807.884 1.00 0.00 ? 81   ILE A N  1 
ATOM 250    C CA . ILE A 1 81   ? 1102.538 726.495 807.921 1.00 0.00 ? 81   ILE A CA 1 
ATOM 251    C C  . ILE A 1 81   ? 1101.044 726.569 807.932 1.00 0.00 ? 81   ILE A C  1 
ATOM 252    O O  . ILE A 1 81   ? 1100.356 725.666 807.460 1.00 0.00 ? 81   ILE A O  1 
ATOM 253    C CB . ILE A 1 81   ? 1102.982 727.246 806.702 1.00 0.00 ? 81   ILE A CB 1 
ATOM 254    N N  . SER A 1 82   ? 1100.512 727.666 808.508 1.00 0.00 ? 82   SER A N  1 
ATOM 255    C CA . SER A 1 82   ? 1099.098 727.902 808.530 1.00 0.00 ? 82   SER A CA 1 
ATOM 256    C C  . SER A 1 82   ? 1098.922 729.330 808.123 1.00 0.00 ? 82   SER A C  1 
ATOM 257    O O  . SER A 1 82   ? 1099.859 730.120 808.209 1.00 0.00 ? 82   SER A O  1 
ATOM 258    C CB . SER A 1 82   ? 1098.469 727.745 809.925 1.00 0.00 ? 82   SER A CB 1 
ATOM 259    N N  . SER A 1 83   ? 1097.719 729.704 807.643 1.00 0.00 ? 83   SER A N  1 
ATOM 260    C CA . SER A 1 83   ? 1097.543 731.070 807.238 1.00 0.00 ? 83   SER A CA 1 
ATOM 261    C C  . SER A 1 83   ? 1096.812 731.774 808.336 1.00 0.00 ? 83   SER A C  1 
ATOM 262    O O  . SER A 1 83   ? 1095.627 731.533 808.562 1.00 0.00 ? 83   SER A O  1 
ATOM 263    C CB . SER A 1 83   ? 1096.708 731.226 805.956 1.00 0.00 ? 83   SER A CB 1 
ATOM 264    N N  . ILE A 1 84   ? 1097.526 732.648 809.069 1.00 0.00 ? 84   ILE A N  1 
ATOM 265    C CA . ILE A 1 84   ? 1096.937 733.367 810.161 1.00 0.00 ? 84   ILE A CA 1 
ATOM 266    C C  . ILE A 1 84   ? 1095.976 734.419 809.694 1.00 0.00 ? 84   ILE A C  1 
ATOM 267    O O  . ILE A 1 84   ? 1094.851 734.485 810.185 1.00 0.00 ? 84   ILE A O  1 
ATOM 268    C CB . ILE A 1 84   ? 1097.956 734.020 811.057 1.00 0.00 ? 84   ILE A CB 1 
ATOM 269    N N  . ARG A 1 85   ? 1096.371 735.265 808.716 1.00 0.00 ? 85   ARG A N  1 
ATOM 270    C CA . ARG A 1 85   ? 1095.479 736.335 808.368 1.00 0.00 ? 85   ARG A CA 1 
ATOM 271    C C  . ARG A 1 85   ? 1095.753 736.808 806.979 1.00 0.00 ? 85   ARG A C  1 
ATOM 272    O O  . ARG A 1 85   ? 1096.776 736.491 806.377 1.00 0.00 ? 85   ARG A O  1 
ATOM 273    C CB . ARG A 1 85   ? 1095.630 737.553 809.293 1.00 0.00 ? 85   ARG A CB 1 
ATOM 274    N N  . ARG A 1 86   ? 1094.792 737.585 806.437 1.00 0.00 ? 86   ARG A N  1 
ATOM 275    C CA . ARG A 1 86   ? 1094.892 738.154 805.126 1.00 0.00 ? 86   ARG A CA 1 
ATOM 276    C C  . ARG A 1 86   ? 1094.578 739.608 805.268 1.00 0.00 ? 86   ARG A C  1 
ATOM 277    O O  . ARG A 1 86   ? 1093.555 739.971 805.845 1.00 0.00 ? 86   ARG A O  1 
ATOM 278    C CB . ARG A 1 86   ? 1093.853 737.549 804.169 1.00 0.00 ? 86   ARG A CB 1 
ATOM 279    N N  . VAL A 1 87   ? 1095.460 740.492 804.759 1.00 0.00 ? 87   VAL A N  1 
ATOM 280    C CA . VAL A 1 87   ? 1095.148 741.885 804.852 1.00 0.00 ? 87   VAL A CA 1 
ATOM 281    C C  . VAL A 1 87   ? 1095.096 742.437 803.465 1.00 0.00 ? 87   VAL A C  1 
ATOM 282    O O  . VAL A 1 87   ? 1096.028 742.297 802.674 1.00 0.00 ? 87   VAL A O  1 
ATOM 283    C CB . VAL A 1 87   ? 1096.139 742.689 805.641 1.00 0.00 ? 87   VAL A CB 1 
ATOM 284    N N  . PRO A 1 88   ? 1093.987 743.046 803.155 1.00 0.00 ? 88   PRO A N  1 
ATOM 285    C CA . PRO A 1 88   ? 1093.846 743.617 801.846 1.00 0.00 ? 88   PRO A CA 1 
ATOM 286    C C  . PRO A 1 88   ? 1094.559 744.922 801.748 1.00 0.00 ? 88   PRO A C  1 
ATOM 287    O O  . PRO A 1 88   ? 1094.805 745.547 802.778 1.00 0.00 ? 88   PRO A O  1 
ATOM 288    C CB . PRO A 1 88   ? 1092.345 743.744 801.596 1.00 0.00 ? 88   PRO A CB 1 
ATOM 289    N N  . LEU A 1 89   ? 1094.918 745.354 800.524 1.00 0.00 ? 89   LEU A N  1 
ATOM 290    C CA . LEU A 1 89   ? 1095.518 746.647 800.417 1.00 0.00 ? 89   LEU A CA 1 
ATOM 291    C C  . LEU A 1 89   ? 1094.420 747.610 800.736 1.00 0.00 ? 89   LEU A C  1 
ATOM 292    O O  . LEU A 1 89   ? 1093.302 747.474 800.244 1.00 0.00 ? 89   LEU A O  1 
ATOM 293    C CB . LEU A 1 89   ? 1095.992 747.026 799.002 1.00 0.00 ? 89   LEU A CB 1 
ATOM 294    N N  . PRO A 1 90   ? 1094.707 748.580 801.554 1.00 0.00 ? 90   PRO A N  1 
ATOM 295    C CA . PRO A 1 90   ? 1093.737 749.566 801.944 1.00 0.00 ? 90   PRO A CA 1 
ATOM 296    C C  . PRO A 1 90   ? 1093.229 750.278 800.727 1.00 0.00 ? 90   PRO A C  1 
ATOM 297    O O  . PRO A 1 90   ? 1094.010 750.514 799.807 1.00 0.00 ? 90   PRO A O  1 
ATOM 298    C CB . PRO A 1 90   ? 1094.484 750.510 802.880 1.00 0.00 ? 90   PRO A CB 1 
ATOM 299    N N  . PRO A 1 91   ? 1091.964 750.599 800.689 1.00 0.00 ? 91   PRO A N  1 
ATOM 300    C CA . PRO A 1 91   ? 1091.437 751.305 799.555 1.00 0.00 ? 91   PRO A CA 1 
ATOM 301    C C  . PRO A 1 91   ? 1091.984 752.690 799.459 1.00 0.00 ? 91   PRO A C  1 
ATOM 302    O O  . PRO A 1 91   ? 1092.046 753.230 798.355 1.00 0.00 ? 91   PRO A O  1 
ATOM 303    C CB . PRO A 1 91   ? 1089.918 751.234 799.689 1.00 0.00 ? 91   PRO A CB 1 
ATOM 304    N N  . GLU A 1 92   ? 1092.377 753.288 800.595 1.00 0.00 ? 92   GLU A N  1 
ATOM 305    C CA . GLU A 1 92   ? 1092.893 754.619 800.564 1.00 0.00 ? 92   GLU A CA 1 
ATOM 306    C C  . GLU A 1 92   ? 1094.169 754.603 799.787 1.00 0.00 ? 92   GLU A C  1 
ATOM 307    O O  . GLU A 1 92   ? 1094.450 755.526 799.025 1.00 0.00 ? 92   GLU A O  1 
ATOM 308    C CB . GLU A 1 92   ? 1093.153 755.204 801.967 1.00 0.00 ? 92   GLU A CB 1 
ATOM 309    N N  . LEU A 1 93   ? 1094.989 753.550 799.982 1.00 0.00 ? 93   LEU A N  1 
ATOM 310    C CA . LEU A 1 93   ? 1096.242 753.418 799.294 1.00 0.00 ? 93   LEU A CA 1 
ATOM 311    C C  . LEU A 1 93   ? 1095.982 753.172 797.836 1.00 0.00 ? 93   LEU A C  1 
ATOM 312    O O  . LEU A 1 93   ? 1096.617 753.773 796.972 1.00 0.00 ? 93   LEU A O  1 
ATOM 313    C CB . LEU A 1 93   ? 1097.065 752.234 799.851 1.00 0.00 ? 93   LEU A CB 1 
ATOM 314    N N  . VAL A 1 94   ? 1095.014 752.286 797.534 1.00 0.00 ? 94   VAL A N  1 
ATOM 315    C CA . VAL A 1 94   ? 1094.734 751.867 796.188 1.00 0.00 ? 94   VAL A CA 1 
ATOM 316    C C  . VAL A 1 94   ? 1094.285 753.037 795.377 1.00 0.00 ? 94   VAL A C  1 
ATOM 317    O O  . VAL A 1 94   ? 1094.594 753.138 794.191 1.00 0.00 ? 94   VAL A O  1 
ATOM 318    C CB . VAL A 1 94   ? 1093.654 750.829 796.119 1.00 0.00 ? 94   VAL A CB 1 
ATOM 319    N N  . GLU A 1 95   ? 1093.544 753.961 796.008 1.00 0.00 ? 95   GLU A N  1 
ATOM 320    C CA . GLU A 1 95   ? 1092.978 755.075 795.310 1.00 0.00 ? 95   GLU A CA 1 
ATOM 321    C C  . GLU A 1 95   ? 1094.074 755.876 794.678 1.00 0.00 ? 95   GLU A C  1 
ATOM 322    O O  . GLU A 1 95   ? 1093.899 756.394 793.576 1.00 0.00 ? 95   GLU A O  1 
ATOM 323    C CB . GLU A 1 95   ? 1092.178 756.007 796.236 1.00 0.00 ? 95   GLU A CB 1 
ATOM 324    N N  . GLN A 1 96   ? 1095.234 756.013 795.349 1.00 0.00 ? 96   GLN A N  1 
ATOM 325    C CA . GLN A 1 96   ? 1096.274 756.810 794.765 1.00 0.00 ? 96   GLN A CA 1 
ATOM 326    C C  . GLN A 1 96   ? 1097.129 755.926 793.910 1.00 0.00 ? 96   GLN A C  1 
ATOM 327    O O  . GLN A 1 96   ? 1098.329 756.158 793.764 1.00 0.00 ? 96   GLN A O  1 
ATOM 328    C CB . GLN A 1 96   ? 1097.167 757.460 795.837 1.00 0.00 ? 96   GLN A CB 1 
ATOM 329    N N  . PHE A 1 97   ? 1096.517 754.894 793.304 1.00 0.00 ? 97   PHE A N  1 
ATOM 330    C CA . PHE A 1 97   ? 1097.196 754.004 792.406 1.00 0.00 ? 97   PHE A CA 1 
ATOM 331    C C  . PHE A 1 97   ? 1096.257 753.828 791.251 1.00 0.00 ? 97   PHE A C  1 
ATOM 332    O O  . PHE A 1 97   ? 1096.547 753.150 790.266 1.00 0.00 ? 97   PHE A O  1 
ATOM 333    C CB . PHE A 1 97   ? 1097.425 752.624 793.060 1.00 0.00 ? 97   PHE A CB 1 
ATOM 334    N N  . GLY A 1 98   ? 1095.112 754.523 791.320 1.00 0.00 ? 98   GLY A N  1 
ATOM 335    C CA . GLY A 1 98   ? 1094.075 754.337 790.349 1.00 0.00 ? 98   GLY A CA 1 
ATOM 336    C C  . GLY A 1 98   ? 1094.557 754.681 788.977 1.00 0.00 ? 98   GLY A C  1 
ATOM 337    O O  . GLY A 1 98   ? 1094.259 753.966 788.022 1.00 0.00 ? 98   GLY A O  1 
ATOM 338    N N  . HIS A 1 99   ? 1095.317 755.782 788.824 1.00 0.00 ? 99   HIS A N  1 
ATOM 339    C CA . HIS A 1 99   ? 1095.674 756.154 787.484 1.00 0.00 ? 99   HIS A CA 1 
ATOM 340    C C  . HIS A 1 99   ? 1097.112 755.820 787.256 1.00 0.00 ? 99   HIS A C  1 
ATOM 341    O O  . HIS A 1 99   ? 1097.999 756.397 787.882 1.00 0.00 ? 99   HIS A O  1 
ATOM 342    C CB . HIS A 1 99   ? 1095.491 757.661 787.229 1.00 0.00 ? 99   HIS A CB 1 
ATOM 343    N N  . MET A 1 100  ? 1097.375 754.862 786.343 1.00 0.00 ? 100  MET A N  1 
ATOM 344    C CA . MET A 1 100  ? 1098.731 754.471 786.074 1.00 0.00 ? 100  MET A CA 1 
ATOM 345    C C  . MET A 1 100  ? 1098.846 754.140 784.625 1.00 0.00 ? 100  MET A C  1 
ATOM 346    O O  . MET A 1 100  ? 1098.437 753.056 784.210 1.00 0.00 ? 100  MET A O  1 
ATOM 347    C CB . MET A 1 100  ? 1099.068 753.165 786.772 1.00 0.00 ? 100  MET A CB 1 
ATOM 348    N N  . GLN A 1 101  ? 1099.383 755.047 783.789 1.00 0.00 ? 101  GLN A N  1 
ATOM 349    C CA . GLN A 1 101  ? 1099.479 754.616 782.430 1.00 0.00 ? 101  GLN A CA 1 
ATOM 350    C C  . GLN A 1 101  ? 1100.579 753.604 782.252 1.00 0.00 ? 101  GLN A C  1 
ATOM 351    O O  . GLN A 1 101  ? 1100.338 752.463 781.863 1.00 0.00 ? 101  GLN A O  1 
ATOM 352    C CB . GLN A 1 101  ? 1099.823 755.756 781.453 1.00 0.00 ? 101  GLN A CB 1 
ATOM 353    N N  . CYS A 1 102  ? 1101.823 754.031 782.567 1.00 0.00 ? 102  CYS A N  1 
ATOM 354    C CA . CYS A 1 102  ? 1103.020 753.289 782.254 1.00 0.00 ? 102  CYS A CA 1 
ATOM 355    C C  . CYS A 1 102  ? 1103.364 752.074 783.070 1.00 0.00 ? 102  CYS A C  1 
ATOM 356    O O  . CYS A 1 102  ? 1103.471 750.980 782.517 1.00 0.00 ? 102  CYS A O  1 
ATOM 357    C CB . CYS A 1 102  ? 1104.274 754.178 782.253 1.00 0.00 ? 102  CYS A CB 1 
ATOM 358    N N  . ASN A 1 103  ? 1103.527 752.196 784.408 1.00 0.00 ? 103  ASN A N  1 
ATOM 359    C CA . ASN A 1 103  ? 1104.146 751.060 785.043 1.00 0.00 ? 103  ASN A CA 1 
ATOM 360    C C  . ASN A 1 103  ? 1103.689 750.895 786.461 1.00 0.00 ? 103  ASN A C  1 
ATOM 361    O O  . ASN A 1 103  ? 1103.504 751.872 787.185 1.00 0.00 ? 103  ASN A O  1 
ATOM 362    C CB . ASN A 1 103  ? 1105.682 751.215 785.075 1.00 0.00 ? 103  ASN A CB 1 
ATOM 363    N N  . CYS A 1 104  ? 1103.537 749.617 786.883 1.00 0.00 ? 104  CYS A N  1 
ATOM 364    C CA . CYS A 1 104  ? 1103.120 749.231 788.206 1.00 0.00 ? 104  CYS A CA 1 
ATOM 365    C C  . CYS A 1 104  ? 1104.135 748.274 788.749 1.00 0.00 ? 104  CYS A C  1 
ATOM 366    O O  . CYS A 1 104  ? 1104.843 747.610 787.995 1.00 0.00 ? 104  CYS A O  1 
ATOM 367    C CB . CYS A 1 104  ? 1101.829 748.392 788.218 1.00 0.00 ? 104  CYS A CB 1 
ATOM 368    N N  . MET A 1 105  ? 1104.240 748.205 790.091 1.00 0.00 ? 105  MET A N  1 
ATOM 369    C CA . MET A 1 105  ? 1105.059 747.212 790.726 1.00 0.00 ? 105  MET A CA 1 
ATOM 370    C C  . MET A 1 105  ? 1104.865 747.356 792.202 1.00 0.00 ? 105  MET A C  1 
ATOM 371    O O  . MET A 1 105  ? 1104.511 748.431 792.682 1.00 0.00 ? 105  MET A O  1 
ATOM 372    C CB . MET A 1 105  ? 1106.561 747.331 790.432 1.00 0.00 ? 105  MET A CB 1 
ATOM 373    N N  . MET A 1 106  ? 1105.071 746.267 792.971 1.00 0.00 ? 106  MET A N  1 
ATOM 374    C CA . MET A 1 106  ? 1104.904 746.376 794.393 1.00 0.00 ? 106  MET A CA 1 
ATOM 375    C C  . MET A 1 106  ? 1105.781 745.359 795.050 1.00 0.00 ? 106  MET A C  1 
ATOM 376    O O  . MET A 1 106  ? 1106.323 744.478 794.389 1.00 0.00 ? 106  MET A O  1 
ATOM 377    C CB . MET A 1 106  ? 1103.448 746.173 794.854 1.00 0.00 ? 106  MET A CB 1 
ATOM 378    N N  . GLY A 1 107  ? 1105.975 745.472 796.380 1.00 0.00 ? 107  GLY A N  1 
ATOM 379    C CA . GLY A 1 107  ? 1106.819 744.517 797.038 1.00 0.00 ? 107  GLY A CA 1 
ATOM 380    C C  . GLY A 1 107  ? 1106.763 744.761 798.511 1.00 0.00 ? 107  GLY A C  1 
ATOM 381    O O  . GLY A 1 107  ? 1106.084 745.669 798.981 1.00 0.00 ? 107  GLY A O  1 
ATOM 382    N N  . VAL A 1 108  ? 1107.491 743.927 799.284 1.00 0.00 ? 108  VAL A N  1 
ATOM 383    C CA . VAL A 1 108  ? 1107.492 744.074 800.708 1.00 0.00 ? 108  VAL A CA 1 
ATOM 384    C C  . VAL A 1 108  ? 1108.897 744.350 801.143 1.00 0.00 ? 108  VAL A C  1 
ATOM 385    O O  . VAL A 1 108  ? 1109.841 743.789 800.588 1.00 0.00 ? 108  VAL A O  1 
ATOM 386    C CB . VAL A 1 108  ? 1107.043 742.837 801.433 1.00 0.00 ? 108  VAL A CB 1 
ATOM 387    N N  . PHE A 1 109  ? 1109.086 745.250 802.134 1.00 0.00 ? 109  PHE A N  1 
ATOM 388    C CA . PHE A 1 109  ? 1110.432 745.437 802.592 1.00 0.00 ? 109  PHE A CA 1 
ATOM 389    C C  . PHE A 1 109  ? 1110.562 744.627 803.841 1.00 0.00 ? 109  PHE A C  1 
ATOM 390    O O  . PHE A 1 109  ? 1109.840 744.830 804.816 1.00 0.00 ? 109  PHE A O  1 
ATOM 391    C CB . PHE A 1 109  ? 1110.838 746.877 802.948 1.00 0.00 ? 109  PHE A CB 1 
ATOM 392    N N  . PRO A 1 110  ? 1111.471 743.696 803.824 1.00 0.00 ? 110  PRO A N  1 
ATOM 393    C CA . PRO A 1 110  ? 1111.613 742.810 804.941 1.00 0.00 ? 110  PRO A CA 1 
ATOM 394    C C  . PRO A 1 110  ? 1111.951 743.425 806.264 1.00 0.00 ? 110  PRO A C  1 
ATOM 395    O O  . PRO A 1 110  ? 1111.334 743.020 807.249 1.00 0.00 ? 110  PRO A O  1 
ATOM 396    C CB . PRO A 1 110  ? 1112.571 741.713 804.480 1.00 0.00 ? 110  PRO A CB 1 
ATOM 397    N N  . PRO A 1 111  ? 1112.891 744.326 806.355 1.00 0.00 ? 111  PRO A N  1 
ATOM 398    C CA . PRO A 1 111  ? 1113.184 744.885 807.649 1.00 0.00 ? 111  PRO A CA 1 
ATOM 399    C C  . PRO A 1 111  ? 1112.130 745.797 808.191 1.00 0.00 ? 111  PRO A C  1 
ATOM 400    O O  . PRO A 1 111  ? 1111.886 745.793 809.397 1.00 0.00 ? 111  PRO A O  1 
ATOM 401    C CB . PRO A 1 111  ? 1114.561 745.530 807.527 1.00 0.00 ? 111  PRO A CB 1 
ATOM 402    N N  . ILE A 1 112  ? 1111.513 746.590 807.302 1.00 0.00 ? 112  ILE A N  1 
ATOM 403    C CA . ILE A 1 112  ? 1110.547 747.601 807.614 1.00 0.00 ? 112  ILE A CA 1 
ATOM 404    C C  . ILE A 1 112  ? 1109.259 746.986 808.075 1.00 0.00 ? 112  ILE A C  1 
ATOM 405    O O  . ILE A 1 112  ? 1108.592 747.525 808.959 1.00 0.00 ? 112  ILE A O  1 
ATOM 406    C CB . ILE A 1 112  ? 1110.284 748.469 806.425 1.00 0.00 ? 112  ILE A CB 1 
ATOM 407    N N  . SER A 1 113  ? 1108.881 745.822 807.508 1.00 0.00 ? 113  SER A N  1 
ATOM 408    C CA . SER A 1 113  ? 1107.599 745.248 807.808 1.00 0.00 ? 113  SER A CA 1 
ATOM 409    C C  . SER A 1 113  ? 1106.566 746.156 807.229 1.00 0.00 ? 113  SER A C  1 
ATOM 410    O O  . SER A 1 113  ? 1105.485 746.355 807.784 1.00 0.00 ? 113  SER A O  1 
ATOM 411    C CB . SER A 1 113  ? 1107.333 745.109 809.318 1.00 0.00 ? 113  SER A CB 1 
ATOM 412    N N  . ARG A 1 114  ? 1106.911 746.731 806.065 1.00 0.00 ? 114  ARG A N  1 
ATOM 413    C CA . ARG A 1 114  ? 1106.079 747.618 805.312 1.00 0.00 ? 114  ARG A CA 1 
ATOM 414    C C  . ARG A 1 114  ? 1106.035 747.124 803.904 1.00 0.00 ? 114  ARG A C  1 
ATOM 415    O O  . ARG A 1 114  ? 1106.906 746.374 803.467 1.00 0.00 ? 114  ARG A O  1 
ATOM 416    C CB . ARG A 1 114  ? 1106.587 749.070 805.276 1.00 0.00 ? 114  ARG A CB 1 
ATOM 417    N N  . ALA A 1 115  ? 1104.985 747.533 803.166 1.00 0.00 ? 115  ALA A N  1 
ATOM 418    C CA . ALA A 1 115  ? 1104.829 747.137 801.798 1.00 0.00 ? 115  ALA A CA 1 
ATOM 419    C C  . ALA A 1 115  ? 1104.920 748.384 800.977 1.00 0.00 ? 115  ALA A C  1 
ATOM 420    O O  . ALA A 1 115  ? 1104.633 749.474 801.466 1.00 0.00 ? 115  ALA A O  1 
ATOM 421    C CB . ALA A 1 115  ? 1103.472 746.481 801.495 1.00 0.00 ? 115  ALA A CB 1 
ATOM 422    N N  . TRP A 1 116  ? 1105.359 748.256 799.709 1.00 0.00 ? 116  TRP A N  1 
ATOM 423    C CA . TRP A 1 116  ? 1105.500 749.413 798.872 1.00 0.00 ? 116  TRP A CA 1 
ATOM 424    C C  . TRP A 1 116  ? 1104.792 749.175 797.576 1.00 0.00 ? 116  TRP A C  1 
ATOM 425    O O  . TRP A 1 116  ? 1104.690 748.043 797.106 1.00 0.00 ? 116  TRP A O  1 
ATOM 426    C CB . TRP A 1 116  ? 1106.968 749.740 798.552 1.00 0.00 ? 116  TRP A CB 1 
ATOM 427    N N  . LEU A 1 117  ? 1104.253 750.260 796.978 1.00 0.00 ? 117  LEU A N  1 
ATOM 428    C CA . LEU A 1 117  ? 1103.569 750.164 795.720 1.00 0.00 ? 117  LEU A CA 1 
ATOM 429    C C  . LEU A 1 117  ? 1104.116 751.262 794.865 1.00 0.00 ? 117  LEU A C  1 
ATOM 430    O O  . LEU A 1 117  ? 1104.283 752.390 795.327 1.00 0.00 ? 117  LEU A O  1 
ATOM 431    C CB . LEU A 1 117  ? 1102.045 750.380 795.867 1.00 0.00 ? 117  LEU A CB 1 
ATOM 432    N N  . THR A 1 118  ? 1104.430 750.950 793.589 1.00 0.00 ? 118  THR A N  1 
ATOM 433    C CA . THR A 1 118  ? 1104.916 751.959 792.695 1.00 0.00 ? 118  THR A CA 1 
ATOM 434    C C  . THR A 1 118  ? 1104.032 751.980 791.496 1.00 0.00 ? 118  THR A C  1 
ATOM 435    O O  . THR A 1 118  ? 1103.828 750.965 790.831 1.00 0.00 ? 118  THR A O  1 
ATOM 436    C CB . THR A 1 118  ? 1106.293 751.695 792.160 1.00 0.00 ? 118  THR A CB 1 
ATOM 437    N N  . ILE A 1 119  ? 1103.457 753.159 791.216 1.00 0.00 ? 119  ILE A N  1 
ATOM 438    C CA . ILE A 1 119  ? 1102.694 753.386 790.031 1.00 0.00 ? 119  ILE A CA 1 
ATOM 439    C C  . ILE A 1 119  ? 1103.292 754.594 789.390 1.00 0.00 ? 119  ILE A C  1 
ATOM 440    O O  . ILE A 1 119  ? 1103.250 755.694 789.935 1.00 0.00 ? 119  ILE A O  1 
ATOM 441    C CB . ILE A 1 119  ? 1101.224 753.570 790.323 1.00 0.00 ? 119  ILE A CB 1 
ATOM 442    N N  . ASP A 1 120  ? 1103.879 754.415 788.194 1.00 0.00 ? 120  ASP A N  1 
ATOM 443    C CA . ASP A 1 120  ? 1104.508 755.524 787.543 1.00 0.00 ? 120  ASP A CA 1 
ATOM 444    C C  . ASP A 1 120  ? 1105.522 756.127 788.464 1.00 0.00 ? 120  ASP A C  1 
ATOM 445    O O  . ASP A 1 120  ? 1106.380 755.439 789.017 1.00 0.00 ? 120  ASP A O  1 
ATOM 446    C CB . ASP A 1 120  ? 1103.512 756.625 787.139 1.00 0.00 ? 120  ASP A CB 1 
ATOM 447    N N  . SER A 1 121  ? 1105.457 757.464 788.595 1.00 0.00 ? 121  SER A N  1 
ATOM 448    C CA . SER A 1 121  ? 1106.382 758.255 789.354 1.00 0.00 ? 121  SER A CA 1 
ATOM 449    C C  . SER A 1 121  ? 1106.234 758.089 790.840 1.00 0.00 ? 121  SER A C  1 
ATOM 450    O O  . SER A 1 121  ? 1107.225 758.162 791.564 1.00 0.00 ? 121  SER A O  1 
ATOM 451    C CB . SER A 1 121  ? 1106.237 759.757 789.050 1.00 0.00 ? 121  SER A CB 1 
ATOM 452    N N  . ASP A 1 122  ? 1105.005 757.868 791.347 1.00 0.00 ? 122  ASP A N  1 
ATOM 453    C CA . ASP A 1 122  ? 1104.822 757.897 792.774 1.00 0.00 ? 122  ASP A CA 1 
ATOM 454    C C  . ASP A 1 122  ? 1105.105 756.586 793.448 1.00 0.00 ? 122  ASP A C  1 
ATOM 455    O O  . ASP A 1 122  ? 1105.049 755.522 792.831 1.00 0.00 ? 122  ASP A O  1 
ATOM 456    C CB . ASP A 1 122  ? 1103.433 758.420 793.175 1.00 0.00 ? 122  ASP A CB 1 
ATOM 457    N N  . ILE A 1 123  ? 1105.440 756.659 794.757 1.00 0.00 ? 123  ILE A N  1 
ATOM 458    C CA . ILE A 1 123  ? 1105.692 755.492 795.557 1.00 0.00 ? 123  ILE A CA 1 
ATOM 459    C C  . ILE A 1 123  ? 1104.976 755.629 796.862 1.00 0.00 ? 123  ILE A C  1 
ATOM 460    O O  . ILE A 1 123  ? 1104.890 756.713 797.439 1.00 0.00 ? 123  ILE A O  1 
ATOM 461    C CB . ILE A 1 123  ? 1107.142 755.264 795.872 1.00 0.00 ? 123  ILE A CB 1 
ATOM 462    N N  . PHE A 1 124  ? 1104.426 754.501 797.348 1.00 0.00 ? 124  PHE A N  1 
ATOM 463    C CA . PHE A 1 124  ? 1103.754 754.439 798.614 1.00 0.00 ? 124  PHE A CA 1 
ATOM 464    C C  . PHE A 1 124  ? 1104.442 753.436 799.472 1.00 0.00 ? 124  PHE A C  1 
ATOM 465    O O  . PHE A 1 124  ? 1105.000 752.452 798.988 1.00 0.00 ? 124  PHE A O  1 
ATOM 466    C CB . PHE A 1 124  ? 1102.321 753.885 798.571 1.00 0.00 ? 124  PHE A CB 1 
ATOM 467    N N  . MET A 1 125  ? 1104.425 753.687 800.792 1.00 0.00 ? 125  MET A N  1 
ATOM 468    C CA . MET A 1 125  ? 1104.875 752.711 801.737 1.00 0.00 ? 125  MET A CA 1 
ATOM 469    C C  . MET A 1 125  ? 1103.758 752.605 802.724 1.00 0.00 ? 125  MET A C  1 
ATOM 470    O O  . MET A 1 125  ? 1103.209 753.618 803.154 1.00 0.00 ? 125  MET A O  1 
ATOM 471    C CB . MET A 1 125  ? 1106.135 753.100 802.533 1.00 0.00 ? 125  MET A CB 1 
ATOM 472    N N  . TRP A 1 126  ? 1103.363 751.373 803.098 1.00 0.00 ? 126  TRP A N  1 
ATOM 473    C CA . TRP A 1 126  ? 1102.275 751.280 804.029 1.00 0.00 ? 126  TRP A CA 1 
ATOM 474    C C  . TRP A 1 126  ? 1102.625 750.300 805.104 1.00 0.00 ? 126  TRP A C  1 
ATOM 475    O O  . TRP A 1 126  ? 1103.314 749.308 804.867 1.00 0.00 ? 126  TRP A O  1 
ATOM 476    C CB . TRP A 1 126  ? 1100.941 750.907 803.358 1.00 0.00 ? 126  TRP A CB 1 
ATOM 477    N N  . ASN A 1 127  ? 1102.158 750.589 806.337 1.00 0.00 ? 127  ASN A N  1 
ATOM 478    C CA . ASN A 1 127  ? 1102.451 749.788 807.490 1.00 0.00 ? 127  ASN A CA 1 
ATOM 479    C C  . ASN A 1 127  ? 1101.694 748.508 807.377 1.00 0.00 ? 127  ASN A C  1 
ATOM 480    O O  . ASN A 1 127  ? 1100.499 748.486 807.084 1.00 0.00 ? 127  ASN A O  1 
ATOM 481    C CB . ASN A 1 127  ? 1102.040 750.482 808.804 1.00 0.00 ? 127  ASN A CB 1 
ATOM 482    N N  . TYR A 1 128  ? 1102.412 747.398 807.609 1.00 0.00 ? 128  TYR A N  1 
ATOM 483    C CA . TYR A 1 128  ? 1101.914 746.062 807.484 1.00 0.00 ? 128  TYR A CA 1 
ATOM 484    C C  . TYR A 1 128  ? 1100.868 745.881 808.536 1.00 0.00 ? 128  TYR A C  1 
ATOM 485    O O  . TYR A 1 128  ? 1099.745 745.458 808.270 1.00 0.00 ? 128  TYR A O  1 
ATOM 486    C CB . TYR A 1 128  ? 1103.048 745.100 807.850 1.00 0.00 ? 128  TYR A CB 1 
ATOM 487    N N  . GLU A 1 129  ? 1101.241 746.230 809.782 1.00 0.00 ? 129  GLU A N  1 
ATOM 488    C CA . GLU A 1 129  ? 1100.413 746.049 810.936 1.00 0.00 ? 129  GLU A CA 1 
ATOM 489    C C  . GLU A 1 129  ? 1099.252 746.990 810.922 1.00 0.00 ? 129  GLU A C  1 
ATOM 490    O O  . GLU A 1 129  ? 1098.144 746.615 811.306 1.00 0.00 ? 129  GLU A O  1 
ATOM 491    C CB . GLU A 1 129  ? 1101.209 746.224 812.241 1.00 0.00 ? 129  GLU A CB 1 
ATOM 492    N N  . ASP A 1 130  ? 1099.461 748.238 810.468 1.00 0.00 ? 130  ASP A N  1 
ATOM 493    C CA . ASP A 1 130  ? 1098.393 749.193 810.532 1.00 0.00 ? 130  ASP A CA 1 
ATOM 494    C C  . ASP A 1 130  ? 1097.624 749.137 809.248 1.00 0.00 ? 130  ASP A C  1 
ATOM 495    O O  . ASP A 1 130  ? 1096.592 748.478 809.162 1.00 0.00 ? 130  ASP A O  1 
ATOM 496    C CB . ASP A 1 130  ? 1098.901 750.630 810.749 1.00 0.00 ? 130  ASP A CB 1 
ATOM 497    N N  . GLY A 1 131  ? 1098.118 749.835 808.207 1.00 0.00 ? 131  GLY A N  1 
ATOM 498    C CA . GLY A 1 131  ? 1097.457 749.850 806.932 1.00 0.00 ? 131  GLY A CA 1 
ATOM 499    C C  . GLY A 1 131  ? 1096.897 751.217 806.743 1.00 0.00 ? 131  GLY A C  1 
ATOM 500    O O  . GLY A 1 131  ? 1096.862 751.733 805.625 1.00 0.00 ? 131  GLY A O  1 
ATOM 501    N N  . GLY A 1 132  ? 1096.423 751.828 807.843 1.00 0.00 ? 132  GLY A N  1 
ATOM 502    C CA . GLY A 1 132  ? 1095.939 753.174 807.791 1.00 0.00 ? 132  GLY A CA 1 
ATOM 503    C C  . GLY A 1 132  ? 1097.113 754.064 807.543 1.00 0.00 ? 132  GLY A C  1 
ATOM 504    O O  . GLY A 1 132  ? 1097.033 755.028 806.784 1.00 0.00 ? 132  GLY A O  1 
ATOM 505    N N  . ASP A 1 133  ? 1098.245 753.739 808.199 1.00 0.00 ? 133  ASP A N  1 
ATOM 506    C CA . ASP A 1 133  ? 1099.440 754.525 808.129 1.00 0.00 ? 133  ASP A CA 1 
ATOM 507    C C  . ASP A 1 133  ? 1100.120 754.262 806.822 1.00 0.00 ? 133  ASP A C  1 
ATOM 508    O O  . ASP A 1 133  ? 1100.519 753.135 806.533 1.00 0.00 ? 133  ASP A O  1 
ATOM 509    C CB . ASP A 1 133  ? 1100.432 754.165 809.253 1.00 0.00 ? 133  ASP A CB 1 
ATOM 510    N N  . LEU A 1 134  ? 1100.252 755.311 805.984 1.00 0.00 ? 134  LEU A N  1 
ATOM 511    C CA . LEU A 1 134  ? 1100.943 755.157 804.740 1.00 0.00 ? 134  LEU A CA 1 
ATOM 512    C C  . LEU A 1 134  ? 1101.763 756.388 804.505 1.00 0.00 ? 134  LEU A C  1 
ATOM 513    O O  . LEU A 1 134  ? 1101.419 757.471 804.975 1.00 0.00 ? 134  LEU A O  1 
ATOM 514    C CB . LEU A 1 134  ? 1100.013 754.912 803.532 1.00 0.00 ? 134  LEU A CB 1 
ATOM 515    N N  . ALA A 1 135  ? 1102.891 756.240 803.782 1.00 0.00 ? 135  ALA A N  1 
ATOM 516    C CA . ALA A 1 135  ? 1103.749 757.356 803.497 1.00 0.00 ? 135  ALA A CA 1 
ATOM 517    C C  . ALA A 1 135  ? 1103.821 757.479 802.012 1.00 0.00 ? 135  ALA A C  1 
ATOM 518    O O  . ALA A 1 135  ? 1103.690 756.494 801.288 1.00 0.00 ? 135  ALA A O  1 
ATOM 519    C CB . ALA A 1 135  ? 1105.186 757.177 804.011 1.00 0.00 ? 135  ALA A CB 1 
ATOM 520    N N  . TYR A 1 136  ? 1104.012 758.714 801.516 1.00 0.00 ? 136  TYR A N  1 
ATOM 521    C CA . TYR A 1 136  ? 1104.027 758.906 800.098 1.00 0.00 ? 136  TYR A CA 1 
ATOM 522    C C  . TYR A 1 136  ? 1105.212 759.744 799.724 1.00 0.00 ? 136  TYR A C  1 
ATOM 523    O O  . TYR A 1 136  ? 1105.565 760.694 800.423 1.00 0.00 ? 136  TYR A O  1 
ATOM 524    C CB . TYR A 1 136  ? 1102.747 759.613 799.629 1.00 0.00 ? 136  TYR A CB 1 
ATOM 525    N N  . PHE A 1 137  ? 1105.872 759.389 798.602 1.00 0.00 ? 137  PHE A N  1 
ATOM 526    C CA . PHE A 1 137  ? 1106.984 760.153 798.102 1.00 0.00 ? 137  PHE A CA 1 
ATOM 527    C C  . PHE A 1 137  ? 1106.473 761.069 797.041 1.00 0.00 ? 137  PHE A C  1 
ATOM 528    O O  . PHE A 1 137  ? 1105.830 760.634 796.087 1.00 0.00 ? 137  PHE A O  1 
ATOM 529    C CB . PHE A 1 137  ? 1108.058 759.338 797.367 1.00 0.00 ? 137  PHE A CB 1 
ATOM 530    N N  . ASP A 1 138  ? 1106.764 762.373 797.186 1.00 0.00 ? 138  ASP A N  1 
ATOM 531    C CA . ASP A 1 138  ? 1106.362 763.338 796.204 1.00 0.00 ? 138  ASP A CA 1 
ATOM 532    C C  . ASP A 1 138  ? 1107.606 763.816 795.527 1.00 0.00 ? 138  ASP A C  1 
ATOM 533    O O  . ASP A 1 138  ? 1107.550 764.568 794.555 1.00 0.00 ? 138  ASP A O  1 
ATOM 534    C CB . ASP A 1 138  ? 1105.753 764.602 796.841 1.00 0.00 ? 138  ASP A CB 1 
ATOM 535    N N  . GLY A 1 139  ? 1108.770 763.361 796.018 1.00 0.00 ? 139  GLY A N  1 
ATOM 536    C CA . GLY A 1 139  ? 1110.031 763.840 795.535 1.00 0.00 ? 139  GLY A CA 1 
ATOM 537    C C  . GLY A 1 139  ? 1110.246 763.492 794.095 1.00 0.00 ? 139  GLY A C  1 
ATOM 538    O O  . GLY A 1 139  ? 1110.758 764.313 793.336 1.00 0.00 ? 139  GLY A O  1 
ATOM 539    N N  . LEU A 1 140  ? 1109.860 762.275 793.661 1.00 0.00 ? 140  LEU A N  1 
ATOM 540    C CA . LEU A 1 140  ? 1110.245 761.883 792.332 1.00 0.00 ? 140  LEU A CA 1 
ATOM 541    C C  . LEU A 1 140  ? 1109.429 762.514 791.255 1.00 0.00 ? 140  LEU A C  1 
ATOM 542    O O  . LEU A 1 140  ? 1108.199 762.523 791.290 1.00 0.00 ? 140  LEU A O  1 
ATOM 543    C CB . LEU A 1 140  ? 1110.181 760.376 792.036 1.00 0.00 ? 140  LEU A CB 1 
ATOM 544    N N  . SER A 1 141  ? 1110.152 763.083 790.269 1.00 0.00 ? 141  SER A N  1 
ATOM 545    C CA . SER A 1 141  ? 1109.616 763.692 789.087 1.00 0.00 ? 141  SER A CA 1 
ATOM 546    C C  . SER A 1 141  ? 1109.263 762.661 788.051 1.00 0.00 ? 141  SER A C  1 
ATOM 547    O O  . SER A 1 141  ? 1108.287 762.829 787.322 1.00 0.00 ? 141  SER A O  1 
ATOM 548    C CB . SER A 1 141  ? 1110.612 764.665 788.433 1.00 0.00 ? 141  SER A CB 1 
ATOM 549    N N  . GLU A 1 142  ? 1110.031 761.551 787.962 1.00 0.00 ? 142  GLU A N  1 
ATOM 550    C CA . GLU A 1 142  ? 1109.853 760.664 786.840 1.00 0.00 ? 142  GLU A CA 1 
ATOM 551    C C  . GLU A 1 142  ? 1109.476 759.282 787.284 1.00 0.00 ? 142  GLU A C  1 
ATOM 552    O O  . GLU A 1 142  ? 1109.379 758.986 788.474 1.00 0.00 ? 142  GLU A O  1 
ATOM 553    C CB . GLU A 1 142  ? 1111.122 760.554 785.979 1.00 0.00 ? 142  GLU A CB 1 
ATOM 554    N N  . THR A 1 143  ? 1109.254 758.396 786.288 1.00 0.00 ? 143  THR A N  1 
ATOM 555    C CA . THR A 1 143  ? 1108.827 757.045 786.506 1.00 0.00 ? 143  THR A CA 1 
ATOM 556    C C  . THR A 1 143  ? 1109.821 756.374 787.390 1.00 0.00 ? 143  THR A C  1 
ATOM 557    O O  . THR A 1 143  ? 1111.008 756.699 787.378 1.00 0.00 ? 143  THR A O  1 
ATOM 558    C CB . THR A 1 143  ? 1108.725 756.243 785.239 1.00 0.00 ? 143  THR A CB 1 
ATOM 559    N N  . ILE A 1 144  ? 1109.350 755.417 788.213 1.00 0.00 ? 144  ILE A N  1 
ATOM 560    C CA . ILE A 1 144  ? 1110.255 754.762 789.111 1.00 0.00 ? 144  ILE A CA 1 
ATOM 561    C C  . ILE A 1 144  ? 1110.511 753.390 788.589 1.00 0.00 ? 144  ILE A C  1 
ATOM 562    O O  . ILE A 1 144  ? 1109.615 752.547 788.557 1.00 0.00 ? 144  ILE A O  1 
ATOM 563    C CB . ILE A 1 144  ? 1109.690 754.595 790.493 1.00 0.00 ? 144  ILE A CB 1 
ATOM 564    N N  . LEU A 1 145  ? 1111.752 753.154 788.124 1.00 0.00 ? 145  LEU A N  1 
ATOM 565    C CA . LEU A 1 145  ? 1112.128 751.873 787.605 1.00 0.00 ? 145  LEU A CA 1 
ATOM 566    C C  . LEU A 1 145  ? 1112.247 750.851 788.698 1.00 0.00 ? 145  LEU A C  1 
ATOM 567    O O  . LEU A 1 145  ? 1111.685 749.763 788.588 1.00 0.00 ? 145  LEU A O  1 
ATOM 568    C CB . LEU A 1 145  ? 1113.463 751.923 786.846 1.00 0.00 ? 145  LEU A CB 1 
ATOM 569    N N  . ALA A 1 146  ? 1112.960 751.171 789.802 1.00 0.00 ? 146  ALA A N  1 
ATOM 570    C CA . ALA A 1 146  ? 1113.142 750.156 790.804 1.00 0.00 ? 146  ALA A CA 1 
ATOM 571    C C  . ALA A 1 146  ? 1113.335 750.797 792.144 1.00 0.00 ? 146  ALA A C  1 
ATOM 572    O O  . ALA A 1 146  ? 1113.715 751.961 792.245 1.00 0.00 ? 146  ALA A O  1 
ATOM 573    C CB . ALA A 1 146  ? 1114.371 749.266 790.552 1.00 0.00 ? 146  ALA A CB 1 
ATOM 574    N N  . VAL A 1 147  ? 1113.050 750.028 793.215 1.00 0.00 ? 147  VAL A N  1 
ATOM 575    C CA . VAL A 1 147  ? 1113.235 750.493 794.560 1.00 0.00 ? 147  VAL A CA 1 
ATOM 576    C C  . VAL A 1 147  ? 1113.914 749.389 795.309 1.00 0.00 ? 147  VAL A C  1 
ATOM 577    O O  . VAL A 1 147  ? 1113.823 748.225 794.923 1.00 0.00 ? 147  VAL A O  1 
ATOM 578    C CB . VAL A 1 147  ? 1111.955 750.804 795.277 1.00 0.00 ? 147  VAL A CB 1 
ATOM 579    N N  . GLY A 1 148  ? 1114.635 749.728 796.395 1.00 0.00 ? 148  GLY A N  1 
ATOM 580    C CA . GLY A 1 148  ? 1115.293 748.687 797.134 1.00 0.00 ? 148  GLY A CA 1 
ATOM 581    C C  . GLY A 1 148  ? 1115.624 749.204 798.496 1.00 0.00 ? 148  GLY A C  1 
ATOM 582    O O  . GLY A 1 148  ? 1115.739 750.409 798.711 1.00 0.00 ? 148  GLY A O  1 
ATOM 583    N N  . LEU A 1 149  ? 1115.791 748.278 799.462 1.00 0.00 ? 149  LEU A N  1 
ATOM 584    C CA . LEU A 1 149  ? 1116.136 748.674 800.793 1.00 0.00 ? 149  LEU A CA 1 
ATOM 585    C C  . LEU A 1 149  ? 1117.554 748.224 800.976 1.00 0.00 ? 149  LEU A C  1 
ATOM 586    O O  . LEU A 1 149  ? 1117.896 747.094 800.640 1.00 0.00 ? 149  LEU A O  1 
ATOM 587    C CB . LEU A 1 149  ? 1115.264 747.998 801.864 1.00 0.00 ? 149  LEU A CB 1 
ATOM 588    N N  . VAL A 1 150  ? 1118.428 749.110 801.502 1.00 0.00 ? 150  VAL A N  1 
ATOM 589    C CA . VAL A 1 150  ? 1119.816 748.752 801.609 1.00 0.00 ? 150  VAL A CA 1 
ATOM 590    C C  . VAL A 1 150  ? 1120.338 749.251 802.928 1.00 0.00 ? 150  VAL A C  1 
ATOM 591    O O  . VAL A 1 150  ? 1119.730 750.104 803.568 1.00 0.00 ? 150  VAL A O  1 
ATOM 592    C CB . VAL A 1 150  ? 1120.638 749.382 800.512 1.00 0.00 ? 150  VAL A CB 1 
ATOM 593    N N  . LYS A 1 151  ? 1121.483 748.692 803.377 1.00 0.00 ? 151  LYS A N  1 
ATOM 594    C CA . LYS A 1 151  ? 1122.112 749.101 804.598 1.00 0.00 ? 151  LYS A CA 1 
ATOM 595    C C  . LYS A 1 151  ? 1123.059 750.216 804.266 1.00 0.00 ? 151  LYS A C  1 
ATOM 596    O O  . LYS A 1 151  ? 1123.555 750.324 803.145 1.00 0.00 ? 151  LYS A O  1 
ATOM 597    C CB . LYS A 1 151  ? 1122.940 747.988 805.265 1.00 0.00 ? 151  LYS A CB 1 
ATOM 598    N N  . PRO A 1 152  ? 1123.292 751.069 805.226 1.00 0.00 ? 152  PRO A N  1 
ATOM 599    C CA . PRO A 1 152  ? 1124.187 752.179 805.041 1.00 0.00 ? 152  PRO A CA 1 
ATOM 600    C C  . PRO A 1 152  ? 1125.612 751.745 805.128 1.00 0.00 ? 152  PRO A C  1 
ATOM 601    O O  . PRO A 1 152  ? 1125.886 750.674 805.666 1.00 0.00 ? 152  PRO A O  1 
ATOM 602    C CB . PRO A 1 152  ? 1123.803 753.223 806.092 1.00 0.00 ? 152  PRO A CB 1 
ATOM 603    N N  . LYS A 1 153  ? 1126.531 752.575 804.600 1.00 0.00 ? 153  LYS A N  1 
ATOM 604    C CA . LYS A 1 153  ? 1127.929 752.270 804.604 1.00 0.00 ? 153  LYS A CA 1 
ATOM 605    C C  . LYS A 1 153  ? 1128.437 752.426 805.999 1.00 0.00 ? 153  LYS A C  1 
ATOM 606    O O  . LYS A 1 153  ? 1127.819 753.075 806.845 1.00 0.00 ? 153  LYS A O  1 
ATOM 607    C CB . LYS A 1 153  ? 1128.768 753.187 803.698 1.00 0.00 ? 153  LYS A CB 1 
ATOM 608    N N  . ALA A 1 154  ? 1129.606 751.814 806.251 1.00 0.00 ? 154  ALA A N  1 
ATOM 609    C CA . ALA A 1 154  ? 1130.264 751.767 807.522 1.00 0.00 ? 154  ALA A CA 1 
ATOM 610    C C  . ALA A 1 154  ? 1130.602 753.144 807.962 1.00 0.00 ? 154  ALA A C  1 
ATOM 611    O O  . ALA A 1 154  ? 1130.556 753.446 809.153 1.00 0.00 ? 154  ALA A O  1 
ATOM 612    C CB . ALA A 1 154  ? 1131.574 750.962 807.486 1.00 0.00 ? 154  ALA A CB 1 
ATOM 613    N N  . GLY A 1 155  ? 1130.918 754.050 807.025 1.00 0.00 ? 155  GLY A N  1 
ATOM 614    C CA . GLY A 1 155  ? 1131.303 755.312 807.562 1.00 0.00 ? 155  GLY A CA 1 
ATOM 615    C C  . GLY A 1 155  ? 1131.110 756.352 806.524 1.00 0.00 ? 155  GLY A C  1 
ATOM 616    O O  . GLY A 1 155  ? 1131.942 756.601 805.655 1.00 0.00 ? 155  GLY A O  1 
ATOM 617    N N  . ILE A 1 156  ? 1129.933 756.984 806.663 1.00 0.00 ? 156  ILE A N  1 
ATOM 618    C CA . ILE A 1 156  ? 1129.447 758.102 805.924 1.00 0.00 ? 156  ILE A CA 1 
ATOM 619    C C  . ILE A 1 156  ? 1128.742 758.923 806.947 1.00 0.00 ? 156  ILE A C  1 
ATOM 620    O O  . ILE A 1 156  ? 1128.715 758.565 808.124 1.00 0.00 ? 156  ILE A O  1 
ATOM 621    C CB . ILE A 1 156  ? 1128.456 757.782 804.843 1.00 0.00 ? 156  ILE A CB 1 
ATOM 622    N N  . PHE A 1 157  ? 1128.175 760.065 806.537 1.00 0.00 ? 157  PHE A N  1 
ATOM 623    C CA . PHE A 1 157  ? 1127.498 760.902 807.478 1.00 0.00 ? 157  PHE A CA 1 
ATOM 624    C C  . PHE A 1 157  ? 1126.277 760.216 808.007 1.00 0.00 ? 157  PHE A C  1 
ATOM 625    O O  . PHE A 1 157  ? 1125.904 760.440 809.157 1.00 0.00 ? 157  PHE A O  1 
ATOM 626    C CB . PHE A 1 157  ? 1127.200 762.329 806.964 1.00 0.00 ? 157  PHE A CB 1 
ATOM 627    N N  . GLN A 1 158  ? 1125.614 759.346 807.210 1.00 0.00 ? 158  GLN A N  1 
ATOM 628    C CA . GLN A 1 158  ? 1124.421 758.691 807.695 1.00 0.00 ? 158  GLN A CA 1 
ATOM 629    C C  . GLN A 1 158  ? 1124.700 757.246 808.070 1.00 0.00 ? 158  GLN A C  1 
ATOM 630    O O  . GLN A 1 158  ? 1123.852 756.393 807.811 1.00 0.00 ? 158  GLN A O  1 
ATOM 631    C CB . GLN A 1 158  ? 1123.343 758.676 806.593 1.00 0.00 ? 158  GLN A CB 1 
ATOM 632    N N  . PRO A 1 159  ? 1125.803 756.878 808.678 1.00 0.00 ? 159  PRO A N  1 
ATOM 633    C CA . PRO A 1 159  ? 1126.012 755.489 808.986 1.00 0.00 ? 159  PRO A CA 1 
ATOM 634    C C  . PRO A 1 159  ? 1124.978 755.036 809.973 1.00 0.00 ? 159  PRO A C  1 
ATOM 635    O O  . PRO A 1 159  ? 1124.652 753.850 809.999 1.00 0.00 ? 159  PRO A O  1 
ATOM 636    C CB . PRO A 1 159  ? 1127.369 755.446 809.670 1.00 0.00 ? 159  PRO A CB 1 
ATOM 637    N N  . HIS A 1 160  ? 1124.484 755.972 810.806 1.00 0.00 ? 160  HIS A N  1 
ATOM 638    C CA . HIS A 1 160  ? 1123.625 755.701 811.923 1.00 0.00 ? 160  HIS A CA 1 
ATOM 639    C C  . HIS A 1 160  ? 1122.307 755.142 811.489 1.00 0.00 ? 160  HIS A C  1 
ATOM 640    O O  . HIS A 1 160  ? 1121.798 754.213 812.113 1.00 0.00 ? 160  HIS A O  1 
ATOM 641    C CB . HIS A 1 160  ? 1123.345 756.963 812.758 1.00 0.00 ? 160  HIS A CB 1 
ATOM 642    N N  . VAL A 1 161  ? 1121.726 755.672 810.398 1.00 0.00 ? 161  VAL A N  1 
ATOM 643    C CA . VAL A 1 161  ? 1120.398 755.269 810.032 1.00 0.00 ? 161  VAL A CA 1 
ATOM 644    C C  . VAL A 1 161  ? 1120.347 753.787 809.821 1.00 0.00 ? 161  VAL A C  1 
ATOM 645    O O  . VAL A 1 161  ? 1121.302 753.174 809.350 1.00 0.00 ? 161  VAL A O  1 
ATOM 646    C CB . VAL A 1 161  ? 1119.882 755.934 808.790 1.00 0.00 ? 161  VAL A CB 1 
ATOM 647    N N  . ARG A 1 162  ? 1119.207 753.182 810.214 1.00 0.00 ? 162  ARG A N  1 
ATOM 648    C CA . ARG A 1 162  ? 1118.992 751.765 810.140 1.00 0.00 ? 162  ARG A CA 1 
ATOM 649    C C  . ARG A 1 162  ? 1118.993 751.308 808.712 1.00 0.00 ? 162  ARG A C  1 
ATOM 650    O O  . ARG A 1 162  ? 1119.671 750.339 808.373 1.00 0.00 ? 162  ARG A O  1 
ATOM 651    C CB . ARG A 1 162  ? 1117.644 751.344 810.753 1.00 0.00 ? 162  ARG A CB 1 
ATOM 652    N N  . HIS A 1 163  ? 1118.250 752.001 807.823 1.00 0.00 ? 163  HIS A N  1 
ATOM 653    C CA . HIS A 1 163  ? 1118.191 751.526 806.468 1.00 0.00 ? 163  HIS A CA 1 
ATOM 654    C C  . HIS A 1 163  ? 1118.152 752.695 805.536 1.00 0.00 ? 163  HIS A C  1 
ATOM 655    O O  . HIS A 1 163  ? 1117.882 753.826 805.938 1.00 0.00 ? 163  HIS A O  1 
ATOM 656    C CB . HIS A 1 163  ? 1116.946 750.674 806.171 1.00 0.00 ? 163  HIS A CB 1 
ATOM 657    N N  . LEU A 1 164  ? 1118.452 752.427 804.251 1.00 0.00 ? 164  LEU A N  1 
ATOM 658    C CA . LEU A 1 164  ? 1118.439 753.426 803.218 1.00 0.00 ? 164  LEU A CA 1 
ATOM 659    C C  . LEU A 1 164  ? 1117.478 752.950 802.177 1.00 0.00 ? 164  LEU A C  1 
ATOM 660    O O  . LEU A 1 164  ? 1117.310 751.745 801.980 1.00 0.00 ? 164  LEU A O  1 
ATOM 661    C CB . LEU A 1 164  ? 1119.799 753.590 802.515 1.00 0.00 ? 164  LEU A CB 1 
ATOM 662    N N  . LEU A 1 165  ? 1116.794 753.886 801.494 1.00 0.00 ? 165  LEU A N  1 
ATOM 663    C CA . LEU A 1 165  ? 1115.889 753.482 800.460 1.00 0.00 ? 165  LEU A CA 1 
ATOM 664    C C  . LEU A 1 165  ? 1116.458 753.964 799.165 1.00 0.00 ? 165  LEU A C  1 
ATOM 665    O O  . LEU A 1 165  ? 1116.653 755.164 798.974 1.00 0.00 ? 165  LEU A O  1 
ATOM 666    C CB . LEU A 1 165  ? 1114.486 754.098 800.604 1.00 0.00 ? 165  LEU A CB 1 
ATOM 667    N N  . VAL A 1 166  ? 1116.756 753.036 798.234 1.00 0.00 ? 166  VAL A N  1 
ATOM 668    C CA . VAL A 1 166  ? 1117.297 753.458 796.974 1.00 0.00 ? 166  VAL A CA 1 
ATOM 669    C C  . VAL A 1 166  ? 1116.179 753.461 795.985 1.00 0.00 ? 166  VAL A C  1 
ATOM 670    O O  . VAL A 1 166  ? 1115.392 752.517 795.922 1.00 0.00 ? 166  VAL A O  1 
ATOM 671    C CB . VAL A 1 166  ? 1118.380 752.553 796.452 1.00 0.00 ? 166  VAL A CB 1 
ATOM 672    N N  . LEU A 1 167  ? 1116.055 754.546 795.199 1.00 0.00 ? 167  LEU A N  1 
ATOM 673    C CA . LEU A 1 167  ? 1115.009 754.546 794.225 1.00 0.00 ? 167  LEU A CA 1 
ATOM 674    C C  . LEU A 1 167  ? 1115.627 754.942 792.924 1.00 0.00 ? 167  LEU A C  1 
ATOM 675    O O  . LEU A 1 167  ? 1116.391 755.900 792.854 1.00 0.00 ? 167  LEU A O  1 
ATOM 676    C CB . LEU A 1 167  ? 1113.847 755.492 794.580 1.00 0.00 ? 167  LEU A CB 1 
ATOM 677    N N  . ALA A 1 168  ? 1115.319 754.187 791.854 1.00 0.00 ? 168  ALA A N  1 
ATOM 678    C CA . ALA A 1 168  ? 1115.897 754.509 790.585 1.00 0.00 ? 168  ALA A CA 1 
ATOM 679    C C  . ALA A 1 168  ? 1114.790 754.806 789.629 1.00 0.00 ? 168  ALA A C  1 
ATOM 680    O O  . ALA A 1 168  ? 1113.788 754.093 789.574 1.00 0.00 ? 168  ALA A O  1 
ATOM 681    C CB . ALA A 1 168  ? 1116.719 753.360 789.977 1.00 0.00 ? 168  ALA A CB 1 
ATOM 682    N N  . THR A 1 169  ? 1114.949 755.907 788.873 1.00 0.00 ? 169  THR A N  1 
ATOM 683    C CA . THR A 1 169  ? 1114.017 756.271 787.849 1.00 0.00 ? 169  THR A CA 1 
ATOM 684    C C  . THR A 1 169  ? 1114.784 756.179 786.579 1.00 0.00 ? 169  THR A C  1 
ATOM 685    O O  . THR A 1 169  ? 1115.903 755.670 786.562 1.00 0.00 ? 169  THR A O  1 
ATOM 686    C CB . THR A 1 169  ? 1113.520 757.683 787.949 1.00 0.00 ? 169  THR A CB 1 
ATOM 687    N N  . PRO A 1 170  ? 1114.222 756.615 785.491 1.00 0.00 ? 170  PRO A N  1 
ATOM 688    C CA . PRO A 1 170  ? 1114.998 756.585 784.297 1.00 0.00 ? 170  PRO A CA 1 
ATOM 689    C C  . PRO A 1 170  ? 1116.208 757.454 784.414 1.00 0.00 ? 170  PRO A C  1 
ATOM 690    O O  . PRO A 1 170  ? 1117.305 756.988 784.110 1.00 0.00 ? 170  PRO A O  1 
ATOM 691    C CB . PRO A 1 170  ? 1114.036 756.937 783.167 1.00 0.00 ? 170  PRO A CB 1 
ATOM 692    N N  . VAL A 1 171  ? 1116.022 758.722 784.833 1.00 0.00 ? 171  VAL A N  1 
ATOM 693    C CA . VAL A 1 171  ? 1117.093 759.673 784.941 1.00 0.00 ? 171  VAL A CA 1 
ATOM 694    C C  . VAL A 1 171  ? 1117.969 759.508 786.148 1.00 0.00 ? 171  VAL A C  1 
ATOM 695    O O  . VAL A 1 171  ? 1119.192 759.498 786.022 1.00 0.00 ? 171  VAL A O  1 
ATOM 696    C CB . VAL A 1 171  ? 1116.602 761.091 784.960 1.00 0.00 ? 171  VAL A CB 1 
ATOM 697    N N  . ASP A 1 172  ? 1117.383 759.360 787.358 1.00 0.00 ? 172  ASP A N  1 
ATOM 698    C CA . ASP A 1 172  ? 1118.246 759.474 788.504 1.00 0.00 ? 172  ASP A CA 1 
ATOM 699    C C  . ASP A 1 172  ? 1118.031 758.382 789.496 1.00 0.00 ? 172  ASP A C  1 
ATOM 700    O O  . ASP A 1 172  ? 1117.041 757.652 789.459 1.00 0.00 ? 172  ASP A O  1 
ATOM 701    C CB . ASP A 1 172  ? 1118.018 760.785 789.275 1.00 0.00 ? 172  ASP A CB 1 
ATOM 702    N N  . ILE A 1 173  ? 1119.011 758.255 790.415 1.00 0.00 ? 173  ILE A N  1 
ATOM 703    C CA . ILE A 1 173  ? 1118.938 757.349 791.521 1.00 0.00 ? 173  ILE A CA 1 
ATOM 704    C C  . ILE A 1 173  ? 1118.955 758.220 792.734 1.00 0.00 ? 173  ILE A C  1 
ATOM 705    O O  . ILE A 1 173  ? 1119.829 759.073 792.887 1.00 0.00 ? 173  ILE A O  1 
ATOM 706    C CB . ILE A 1 173  ? 1120.102 756.407 791.617 1.00 0.00 ? 173  ILE A CB 1 
ATOM 707    N N  . VAL A 1 174  ? 1117.962 758.037 793.624 1.00 0.00 ? 174  VAL A N  1 
ATOM 708    C CA . VAL A 1 174  ? 1117.894 758.864 794.790 1.00 0.00 ? 174  VAL A CA 1 
ATOM 709    C C  . VAL A 1 174  ? 1118.077 757.987 795.982 1.00 0.00 ? 174  VAL A C  1 
ATOM 710    O O  . VAL A 1 174  ? 1117.671 756.825 795.984 1.00 0.00 ? 174  VAL A O  1 
ATOM 711    C CB . VAL A 1 174  ? 1116.571 759.551 794.959 1.00 0.00 ? 174  VAL A CB 1 
ATOM 712    N N  . ILE A 1 175  ? 1118.726 758.525 797.034 1.00 0.00 ? 175  ILE A N  1 
ATOM 713    C CA . ILE A 1 175  ? 1118.933 757.736 798.211 1.00 0.00 ? 175  ILE A CA 1 
ATOM 714    C C  . ILE A 1 175  ? 1118.296 758.453 799.362 1.00 0.00 ? 175  ILE A C  1 
ATOM 715    O O  . ILE A 1 175  ? 1118.567 759.631 799.596 1.00 0.00 ? 175  ILE A O  1 
ATOM 716    C CB . ILE A 1 175  ? 1120.388 757.562 798.545 1.00 0.00 ? 175  ILE A CB 1 
ATOM 717    N N  . LEU A 1 176  ? 1117.410 757.763 800.110 1.00 0.00 ? 176  LEU A N  1 
ATOM 718    C CA . LEU A 1 176  ? 1116.795 758.406 801.236 1.00 0.00 ? 176  LEU A CA 1 
ATOM 719    C C  . LEU A 1 176  ? 1117.015 757.569 802.449 1.00 0.00 ? 176  LEU A C  1 
ATOM 720    O O  . LEU A 1 176  ? 1117.471 756.430 802.365 1.00 0.00 ? 176  LEU A O  1 
ATOM 721    C CB . LEU A 1 176  ? 1115.289 758.672 801.104 1.00 0.00 ? 176  LEU A CB 1 
ATOM 722    N N  . GLY A 1 177  ? 1116.708 758.138 803.632 1.00 0.00 ? 177  GLY A N  1 
ATOM 723    C CA . GLY A 1 177  ? 1116.905 757.406 804.845 1.00 0.00 ? 177  GLY A CA 1 
ATOM 724    C C  . GLY A 1 177  ? 1115.568 757.093 805.428 1.00 0.00 ? 177  GLY A C  1 
ATOM 725    O O  . GLY A 1 177  ? 1114.647 757.907 805.387 1.00 0.00 ? 177  GLY A O  1 
ATOM 726    N N  . LEU A 1 178  ? 1115.449 755.874 805.991 1.00 0.00 ? 178  LEU A N  1 
ATOM 727    C CA . LEU A 1 178  ? 1114.254 755.408 806.635 1.00 0.00 ? 178  LEU A CA 1 
ATOM 728    C C  . LEU A 1 178  ? 1114.594 755.273 808.078 1.00 0.00 ? 178  LEU A C  1 
ATOM 729    O O  . LEU A 1 178  ? 1115.694 754.847 808.427 1.00 0.00 ? 178  LEU A O  1 
ATOM 730    C CB . LEU A 1 178  ? 1113.849 753.981 806.227 1.00 0.00 ? 178  LEU A CB 1 
ATOM 731    N N  . SER A 1 179  ? 1113.653 755.650 808.959 1.00 0.00 ? 179  SER A N  1 
ATOM 732    C CA . SER A 1 179  ? 1113.890 755.485 810.359 1.00 0.00 ? 179  SER A CA 1 
ATOM 733    C C  . SER A 1 179  ? 1112.557 755.497 811.029 1.00 0.00 ? 179  SER A C  1 
ATOM 734    O O  . SER A 1 179  ? 1111.540 755.816 810.414 1.00 0.00 ? 179  SER A O  1 
ATOM 735    C CB . SER A 1 179  ? 1114.741 756.605 810.983 1.00 0.00 ? 179  SER A CB 1 
ATOM 736    N N  . TYR A 1 180  ? 1112.529 755.123 812.320 1.00 0.00 ? 180  TYR A N  1 
ATOM 737    C CA . TYR A 1 180  ? 1111.303 755.143 813.058 1.00 0.00 ? 180  TYR A CA 1 
ATOM 738    C C  . TYR A 1 180  ? 1111.398 756.194 814.103 1.00 0.00 ? 180  TYR A C  1 
ATOM 739    O O  . TYR A 1 180  ? 1112.404 756.305 814.802 1.00 0.00 ? 180  TYR A O  1 
ATOM 740    C CB . TYR A 1 180  ? 1110.979 753.854 813.834 1.00 0.00 ? 180  TYR A CB 1 
ATOM 741    N N  . ALA A 1 181  ? 1110.342 757.020 814.215 1.00 0.00 ? 181  ALA A N  1 
ATOM 742    C CA . ALA A 1 181  ? 1110.350 757.978 815.271 1.00 0.00 ? 181  ALA A CA 1 
ATOM 743    C C  . ALA A 1 181  ? 1110.234 757.160 816.512 1.00 0.00 ? 181  ALA A C  1 
ATOM 744    O O  . ALA A 1 181  ? 1109.475 756.195 816.565 1.00 0.00 ? 181  ALA A O  1 
ATOM 745    C CB . ALA A 1 181  ? 1109.160 758.950 815.233 1.00 0.00 ? 181  ALA A CB 1 
ATOM 746    N N  . ASN A 1 182  ? 1111.008 757.512 817.546 1.00 0.00 ? 182  ASN A N  1 
ATOM 747    C CA . ASN A 1 182  ? 1110.988 756.727 818.739 1.00 0.00 ? 182  ASN A CA 1 
ATOM 748    C C  . ASN A 1 182  ? 1109.655 756.875 819.394 1.00 0.00 ? 182  ASN A C  1 
ATOM 749    O O  . ASN A 1 182  ? 1109.563 757.239 820.565 1.00 0.00 ? 182  ASN A O  1 
ATOM 750    C CB . ASN A 1 182  ? 1112.057 757.157 819.750 1.00 0.00 ? 182  ASN A CB 1 
ATOM 751    N N  . LEU A 1 194  ? 1109.151 759.613 818.931 1.00 0.00 ? 194  LEU A N  1 
ATOM 752    C CA . LEU A 1 194  ? 1107.987 759.873 819.722 1.00 0.00 ? 194  LEU A CA 1 
ATOM 753    C C  . LEU A 1 194  ? 1106.771 759.188 819.188 1.00 0.00 ? 194  LEU A C  1 
ATOM 754    O O  . LEU A 1 194  ? 1106.149 758.383 819.876 1.00 0.00 ? 194  LEU A O  1 
ATOM 755    C CB . LEU A 1 194  ? 1107.667 761.375 819.775 1.00 0.00 ? 194  LEU A CB 1 
ATOM 756    N N  . SER A 1 195  ? 1106.414 759.474 817.921 1.00 0.00 ? 195  SER A N  1 
ATOM 757    C CA . SER A 1 195  ? 1105.192 758.953 817.379 1.00 0.00 ? 195  SER A CA 1 
ATOM 758    C C  . SER A 1 195  ? 1105.334 757.504 817.070 1.00 0.00 ? 195  SER A C  1 
ATOM 759    O O  . SER A 1 195  ? 1104.385 756.733 817.218 1.00 0.00 ? 195  SER A O  1 
ATOM 760    C CB . SER A 1 195  ? 1104.750 759.649 816.083 1.00 0.00 ? 195  SER A CB 1 
ATOM 761    N N  . GLY A 1 196  ? 1106.533 757.078 816.647 1.00 0.00 ? 196  GLY A N  1 
ATOM 762    C CA . GLY A 1 196  ? 1106.651 755.710 816.246 1.00 0.00 ? 196  GLY A CA 1 
ATOM 763    C C  . GLY A 1 196  ? 1106.234 755.664 814.810 1.00 0.00 ? 196  GLY A C  1 
ATOM 764    O O  . GLY A 1 196  ? 1105.937 754.602 814.266 1.00 0.00 ? 196  GLY A O  1 
ATOM 765    N N  . GLY A 1 197  ? 1106.200 756.847 814.166 1.00 0.00 ? 197  GLY A N  1 
ATOM 766    C CA . GLY A 1 197  ? 1105.832 756.937 812.783 1.00 0.00 ? 197  GLY A CA 1 
ATOM 767    C C  . GLY A 1 197  ? 1107.059 756.656 811.979 1.00 0.00 ? 197  GLY A C  1 
ATOM 768    O O  . GLY A 1 197  ? 1108.094 756.262 812.513 1.00 0.00 ? 197  GLY A O  1 
ATOM 769    N N  . MET A 1 198  ? 1106.963 756.864 810.654 1.00 0.00 ? 198  MET A N  1 
ATOM 770    C CA . MET A 1 198  ? 1108.046 756.561 809.767 1.00 0.00 ? 198  MET A CA 1 
ATOM 771    C C  . MET A 1 198  ? 1108.661 757.856 809.350 1.00 0.00 ? 198  MET A C  1 
ATOM 772    O O  . MET A 1 198  ? 1107.961 758.820 809.044 1.00 0.00 ? 198  MET A O  1 
ATOM 773    C CB . MET A 1 198  ? 1107.533 755.860 808.503 1.00 0.00 ? 198  MET A CB 1 
ATOM 774    N N  . GLN A 1 199  ? 1110.006 757.920 809.350 1.00 0.00 ? 199  GLN A N  1 
ATOM 775    C CA . GLN A 1 199  ? 1110.628 759.140 808.934 1.00 0.00 ? 199  GLN A CA 1 
ATOM 776    C C  . GLN A 1 199  ? 1111.454 758.873 807.725 1.00 0.00 ? 199  GLN A C  1 
ATOM 777    O O  . GLN A 1 199  ? 1112.296 757.973 807.703 1.00 0.00 ? 199  GLN A O  1 
ATOM 778    C CB . GLN A 1 199  ? 1111.544 759.783 809.991 1.00 0.00 ? 199  GLN A CB 1 
ATOM 779    N N  . LEU A 1 200  ? 1111.201 759.664 806.668 1.00 0.00 ? 200  LEU A N  1 
ATOM 780    C CA . LEU A 1 200  ? 1111.928 759.589 805.438 1.00 0.00 ? 200  LEU A CA 1 
ATOM 781    C C  . LEU A 1 200  ? 1112.561 760.913 805.201 1.00 0.00 ? 200  LEU A C  1 
ATOM 782    O O  . LEU A 1 200  ? 1111.899 761.949 805.232 1.00 0.00 ? 200  LEU A O  1 
ATOM 783    C CB . LEU A 1 200  ? 1111.034 759.269 804.235 1.00 0.00 ? 200  LEU A CB 1 
ATOM 784    N N  . LEU A 1 201  ? 1113.885 760.909 804.975 1.00 0.00 ? 201  LEU A N  1 
ATOM 785    C CA . LEU A 1 201  ? 1114.534 762.151 804.706 1.00 0.00 ? 201  LEU A CA 1 
ATOM 786    C C  . LEU A 1 201  ? 1115.385 761.956 803.503 1.00 0.00 ? 201  LEU A C  1 
ATOM 787    O O  . LEU A 1 201  ? 1116.040 760.928 803.340 1.00 0.00 ? 201  LEU A O  1 
ATOM 788    C CB . LEU A 1 201  ? 1115.434 762.641 805.849 1.00 0.00 ? 201  LEU A CB 1 
ATOM 789    N N  . PRO A 1 202  ? 1115.355 762.917 802.632 1.00 0.00 ? 202  PRO A N  1 
ATOM 790    C CA . PRO A 1 202  ? 1116.167 762.883 801.461 1.00 0.00 ? 202  PRO A CA 1 
ATOM 791    C C  . PRO A 1 202  ? 1117.572 763.079 801.902 1.00 0.00 ? 202  PRO A C  1 
ATOM 792    O O  . PRO A 1 202  ? 1117.841 763.996 802.676 1.00 0.00 ? 202  PRO A O  1 
ATOM 793    C CB . PRO A 1 202  ? 1115.647 763.998 800.551 1.00 0.00 ? 202  PRO A CB 1 
ATOM 794    N N  . ASP A 1 203  ? 1118.483 762.224 801.421 1.00 0.00 ? 203  ASP A N  1 
ATOM 795    C CA . ASP A 1 203  ? 1119.869 762.397 801.712 1.00 0.00 ? 203  ASP A CA 1 
ATOM 796    C C  . ASP A 1 203  ? 1120.352 762.767 800.371 1.00 0.00 ? 203  ASP A C  1 
ATOM 797    O O  . ASP A 1 203  ? 1120.937 761.916 799.707 1.00 0.00 ? 203  ASP A O  1 
ATOM 798    C CB . ASP A 1 203  ? 1120.536 761.058 802.069 1.00 0.00 ? 203  ASP A CB 1 
ATOM 799    N N  . PRO A 1 204  ? 1120.111 764.020 800.018 1.00 0.00 ? 204  PRO A N  1 
ATOM 800    C CA . PRO A 1 204  ? 1120.274 764.510 798.671 1.00 0.00 ? 204  PRO A CA 1 
ATOM 801    C C  . PRO A 1 204  ? 1121.473 763.958 797.999 1.00 0.00 ? 204  PRO A C  1 
ATOM 802    O O  . PRO A 1 204  ? 1122.567 764.512 798.087 1.00 0.00 ? 204  PRO A O  1 
ATOM 803    C CB . PRO A 1 204  ? 1120.262 766.034 798.762 1.00 0.00 ? 204  PRO A CB 1 
ATOM 804    N N  . LEU A 1 205  ? 1121.221 762.846 797.296 1.00 0.00 ? 205  LEU A N  1 
ATOM 805    C CA . LEU A 1 205  ? 1122.175 762.070 796.589 1.00 0.00 ? 205  LEU A CA 1 
ATOM 806    C C  . LEU A 1 205  ? 1121.332 761.236 795.688 1.00 0.00 ? 205  LEU A C  1 
ATOM 807    O O  . LEU A 1 205  ? 1120.203 761.609 795.368 1.00 0.00 ? 205  LEU A O  1 
ATOM 808    C CB . LEU A 1 205  ? 1122.924 761.041 797.459 1.00 0.00 ? 205  LEU A CB 1 
ATOM 809    N N  . SER A 1 207  ? 1122.342 763.149 793.883 1.00 0.00 ? 207  SER A N  1 
ATOM 810    C CA . SER A 1 207  ? 1121.574 762.342 792.987 1.00 0.00 ? 207  SER A CA 1 
ATOM 811    C C  . SER A 1 207  ? 1122.553 761.756 792.033 1.00 0.00 ? 207  SER A C  1 
ATOM 812    O O  . SER A 1 207  ? 1123.609 762.339 791.780 1.00 0.00 ? 207  SER A O  1 
ATOM 813    C CB . SER A 1 207  ? 1120.527 763.129 792.183 1.00 0.00 ? 207  SER A CB 1 
ATOM 814    N N  . LEU A 1 208  ? 1122.244 760.561 791.505 1.00 0.00 ? 208  LEU A N  1 
ATOM 815    C CA . LEU A 1 208  ? 1123.177 759.940 790.619 1.00 0.00 ? 208  LEU A CA 1 
ATOM 816    C C  . LEU A 1 208  ? 1122.526 759.899 789.276 1.00 0.00 ? 208  LEU A C  1 
ATOM 817    O O  . LEU A 1 208  ? 1121.430 759.360 789.121 1.00 0.00 ? 208  LEU A O  1 
ATOM 818    C CB . LEU A 1 208  ? 1123.507 758.503 791.067 1.00 0.00 ? 208  LEU A CB 1 
ATOM 819    N N  . PRO A 1 209  ? 1123.154 760.504 788.306 1.00 0.00 ? 209  PRO A N  1 
ATOM 820    C CA . PRO A 1 209  ? 1122.593 760.463 786.989 1.00 0.00 ? 209  PRO A CA 1 
ATOM 821    C C  . PRO A 1 209  ? 1122.758 759.103 786.410 1.00 0.00 ? 209  PRO A C  1 
ATOM 822    O O  . PRO A 1 209  ? 1123.891 758.629 786.328 1.00 0.00 ? 209  PRO A O  1 
ATOM 823    C CB . PRO A 1 209  ? 1123.287 761.567 786.195 1.00 0.00 ? 209  PRO A CB 1 
ATOM 824    N N  . THR A 1 210  ? 1121.663 758.456 785.981 1.00 0.00 ? 210  THR A N  1 
ATOM 825    C CA . THR A 1 210  ? 1121.839 757.167 785.386 1.00 0.00 ? 210  THR A CA 1 
ATOM 826    C C  . THR A 1 210  ? 1120.840 757.082 784.264 1.00 0.00 ? 210  THR A C  1 
ATOM 827    O O  . THR A 1 210  ? 1120.035 756.158 784.162 1.00 0.00 ? 210  THR A O  1 
ATOM 828    C CB . THR A 1 210  ? 1121.688 756.091 786.434 1.00 0.00 ? 210  THR A CB 1 
ATOM 829    N N  . ASP A 1 211  ? 1120.930 758.057 783.341 1.00 0.00 ? 211  ASP A N  1 
ATOM 830    C CA . ASP A 1 211  ? 1119.976 758.236 782.283 1.00 0.00 ? 211  ASP A CA 1 
ATOM 831    C C  . ASP A 1 211  ? 1119.932 757.055 781.362 1.00 0.00 ? 211  ASP A C  1 
ATOM 832    O O  . ASP A 1 211  ? 1118.865 756.514 781.084 1.00 0.00 ? 211  ASP A O  1 
ATOM 833    C CB . ASP A 1 211  ? 1120.327 759.469 781.428 1.00 0.00 ? 211  ASP A CB 1 
ATOM 834    N N  . ASN A 1 212  ? 1121.102 756.616 780.875 1.00 0.00 ? 212  ASN A N  1 
ATOM 835    C CA . ASN A 1 212  ? 1121.171 755.579 779.887 1.00 0.00 ? 212  ASN A CA 1 
ATOM 836    C C  . ASN A 1 212  ? 1120.790 754.247 780.467 1.00 0.00 ? 212  ASN A C  1 
ATOM 837    O O  . ASN A 1 212  ? 1120.198 753.410 779.788 1.00 0.00 ? 212  ASN A O  1 
ATOM 838    C CB . ASN A 1 212  ? 1122.581 755.447 779.276 1.00 0.00 ? 212  ASN A CB 1 
ATOM 839    N N  . THR A 1 213  ? 1121.089 754.035 781.762 1.00 0.00 ? 213  THR A N  1 
ATOM 840    C CA . THR A 1 213  ? 1121.045 752.727 782.358 1.00 0.00 ? 213  THR A CA 1 
ATOM 841    C C  . THR A 1 213  ? 1119.721 752.012 782.307 1.00 0.00 ? 213  THR A C  1 
ATOM 842    O O  . THR A 1 213  ? 1119.700 750.844 781.921 1.00 0.00 ? 213  THR A O  1 
ATOM 843    C CB . THR A 1 213  ? 1121.486 752.710 783.794 1.00 0.00 ? 213  THR A CB 1 
ATOM 844    N N  . TYR A 1 214  ? 1118.576 752.653 782.625 1.00 0.00 ? 214  TYR A N  1 
ATOM 845    C CA . TYR A 1 214  ? 1117.381 751.864 782.760 1.00 0.00 ? 214  TYR A CA 1 
ATOM 846    C C  . TYR A 1 214  ? 1117.672 750.782 783.765 1.00 0.00 ? 214  TYR A C  1 
ATOM 847    O O  . TYR A 1 214  ? 1117.661 749.596 783.438 1.00 0.00 ? 214  TYR A O  1 
ATOM 848    C CB . TYR A 1 214  ? 1116.921 751.192 781.451 1.00 0.00 ? 214  TYR A CB 1 
ATOM 849    N N  . LEU A 1 215  ? 1117.957 751.193 785.022 1.00 0.00 ? 215  LEU A N  1 
ATOM 850    C CA . LEU A 1 215  ? 1118.352 750.329 786.104 1.00 0.00 ? 215  LEU A CA 1 
ATOM 851    C C  . LEU A 1 215  ? 1117.279 749.316 786.365 1.00 0.00 ? 215  LEU A C  1 
ATOM 852    O O  . LEU A 1 215  ? 1116.212 749.647 786.875 1.00 0.00 ? 215  LEU A O  1 
ATOM 853    C CB . LEU A 1 215  ? 1118.613 751.145 787.393 1.00 0.00 ? 215  LEU A CB 1 
ATOM 854    N N  . LEU A 1 216  ? 1117.543 748.050 785.969 1.00 0.00 ? 216  LEU A N  1 
ATOM 855    C CA . LEU A 1 216  ? 1116.645 746.951 786.193 1.00 0.00 ? 216  LEU A CA 1 
ATOM 856    C C  . LEU A 1 216  ? 1116.687 746.480 787.621 1.00 0.00 ? 216  LEU A C  1 
ATOM 857    O O  . LEU A 1 216  ? 1115.641 746.346 788.257 1.00 0.00 ? 216  LEU A O  1 
ATOM 858    C CB . LEU A 1 216  ? 1116.969 745.756 785.266 1.00 0.00 ? 216  LEU A CB 1 
ATOM 859    N N  . THR A 1 217  ? 1117.897 746.237 788.179 1.00 0.00 ? 217  THR A N  1 
ATOM 860    C CA . THR A 1 217  ? 1117.949 745.598 789.469 1.00 0.00 ? 217  THR A CA 1 
ATOM 861    C C  . THR A 1 217  ? 1118.910 746.303 790.375 1.00 0.00 ? 217  THR A C  1 
ATOM 862    O O  . THR A 1 217  ? 1119.857 746.946 789.929 1.00 0.00 ? 217  THR A O  1 
ATOM 863    C CB . THR A 1 217  ? 1118.398 744.169 789.388 1.00 0.00 ? 217  THR A CB 1 
ATOM 864    N N  . ILE A 1 218  ? 1118.652 746.204 791.698 1.00 0.00 ? 218  ILE A N  1 
ATOM 865    C CA . ILE A 1 218  ? 1119.514 746.793 792.681 1.00 0.00 ? 218  ILE A CA 1 
ATOM 866    C C  . ILE A 1 218  ? 1119.685 745.799 793.788 1.00 0.00 ? 218  ILE A C  1 
ATOM 867    O O  . ILE A 1 218  ? 1118.742 745.102 794.158 1.00 0.00 ? 218  ILE A O  1 
ATOM 868    C CB . ILE A 1 218  ? 1118.940 748.037 793.296 1.00 0.00 ? 218  ILE A CB 1 
ATOM 869    N N  . THR A 1 219  ? 1120.916 745.690 794.329 1.00 0.00 ? 219  THR A N  1 
ATOM 870    C CA . THR A 1 219  ? 1121.154 744.822 795.447 1.00 0.00 ? 219  THR A CA 1 
ATOM 871    C C  . THR A 1 219  ? 1122.246 745.457 796.242 1.00 0.00 ? 219  THR A C  1 
ATOM 872    O O  . THR A 1 219  ? 1122.823 746.458 795.825 1.00 0.00 ? 219  THR A O  1 
ATOM 873    C CB . THR A 1 219  ? 1121.639 743.453 795.079 1.00 0.00 ? 219  THR A CB 1 
ATOM 874    N N  . SER A 1 220  ? 1122.551 744.901 797.430 1.00 0.00 ? 220  SER A N  1 
ATOM 875    C CA . SER A 1 220  ? 1123.603 745.507 798.187 1.00 0.00 ? 220  SER A CA 1 
ATOM 876    C C  . SER A 1 220  ? 1124.336 744.450 798.935 1.00 0.00 ? 220  SER A C  1 
ATOM 877    O O  . SER A 1 220  ? 1123.832 743.352 799.161 1.00 0.00 ? 220  SER A O  1 
ATOM 878    C CB . SER A 1 220  ? 1123.103 746.513 799.235 1.00 0.00 ? 220  SER A CB 1 
ATOM 879    N N  . THR A 1 221  ? 1125.585 744.776 799.311 1.00 0.00 ? 221  THR A N  1 
ATOM 880    C CA . THR A 1 221  ? 1126.368 743.932 800.157 1.00 0.00 ? 221  THR A CA 1 
ATOM 881    C C  . THR A 1 221  ? 1126.330 744.679 801.441 1.00 0.00 ? 221  THR A C  1 
ATOM 882    O O  . THR A 1 221  ? 1126.260 745.908 801.433 1.00 0.00 ? 221  THR A O  1 
ATOM 883    C CB . THR A 1 221  ? 1127.804 743.810 799.732 1.00 0.00 ? 221  THR A CB 1 
ATOM 884    N N  . ASP A 1 222  ? 1126.360 743.988 802.594 1.00 0.00 ? 222  ASP A N  1 
ATOM 885    C CA . ASP A 1 222  ? 1126.202 744.760 803.789 1.00 0.00 ? 222  ASP A CA 1 
ATOM 886    C C  . ASP A 1 222  ? 1127.475 745.478 804.112 1.00 0.00 ? 222  ASP A C  1 
ATOM 887    O O  . ASP A 1 222  ? 1127.650 745.981 805.219 1.00 0.00 ? 222  ASP A O  1 
ATOM 888    C CB . ASP A 1 222  ? 1125.750 743.932 805.000 1.00 0.00 ? 222  ASP A CB 1 
ATOM 889    N N  . ASN A 1 223  ? 1128.398 745.552 803.136 1.00 0.00 ? 223  ASN A N  1 
ATOM 890    C CA . ASN A 1 223  ? 1129.555 746.385 803.267 1.00 0.00 ? 223  ASN A CA 1 
ATOM 891    C C  . ASN A 1 223  ? 1128.966 747.747 803.195 1.00 0.00 ? 223  ASN A C  1 
ATOM 892    O O  . ASN A 1 223  ? 1129.496 748.717 803.734 1.00 0.00 ? 223  ASN A O  1 
ATOM 893    C CB . ASN A 1 223  ? 1130.549 746.241 802.103 1.00 0.00 ? 223  ASN A CB 1 
ATOM 894    N N  . GLY A 1 224  ? 1127.807 747.822 802.516 1.00 0.00 ? 224  GLY A N  1 
ATOM 895    C CA . GLY A 1 224  ? 1127.130 749.061 802.310 1.00 0.00 ? 224  GLY A CA 1 
ATOM 896    C C  . GLY A 1 224  ? 1127.283 749.394 800.869 1.00 0.00 ? 224  GLY A C  1 
ATOM 897    O O  . GLY A 1 224  ? 1126.740 750.387 800.389 1.00 0.00 ? 224  GLY A O  1 
ATOM 898    N N  . ARG A 1 225  ? 1128.042 748.552 800.145 1.00 0.00 ? 225  ARG A N  1 
ATOM 899    C CA . ARG A 1 225  ? 1128.231 748.756 798.744 1.00 0.00 ? 225  ARG A CA 1 
ATOM 900    C C  . ARG A 1 225  ? 1126.948 748.403 798.071 1.00 0.00 ? 225  ARG A C  1 
ATOM 901    O O  . ARG A 1 225  ? 1126.224 747.513 798.516 1.00 0.00 ? 225  ARG A O  1 
ATOM 902    C CB . ARG A 1 225  ? 1129.342 747.877 798.148 1.00 0.00 ? 225  ARG A CB 1 
ATOM 903    N N  . ILE A 1 226  ? 1126.619 749.125 796.983 1.00 0.00 ? 226  ILE A N  1 
ATOM 904    C CA . ILE A 1 226  ? 1125.398 748.847 796.290 1.00 0.00 ? 226  ILE A CA 1 
ATOM 905    C C  . ILE A 1 226  ? 1125.753 748.486 794.885 1.00 0.00 ? 226  ILE A C  1 
ATOM 906    O O  . ILE A 1 226  ? 1126.526 749.183 794.230 1.00 0.00 ? 226  ILE A O  1 
ATOM 907    C CB . ILE A 1 226  ? 1124.471 750.025 796.240 1.00 0.00 ? 226  ILE A CB 1 
ATOM 908    N N  . PHE A 1 227  ? 1125.199 747.361 794.394 1.00 0.00 ? 227  PHE A N  1 
ATOM 909    C CA . PHE A 1 227  ? 1125.475 746.941 793.053 1.00 0.00 ? 227  PHE A CA 1 
ATOM 910    C C  . PHE A 1 227  ? 1124.167 746.979 792.338 1.00 0.00 ? 227  PHE A C  1 
ATOM 911    O O  . PHE A 1 227  ? 1123.154 746.533 792.871 1.00 0.00 ? 227  PHE A O  1 
ATOM 912    C CB . PHE A 1 227  ? 1125.946 745.481 792.954 1.00 0.00 ? 227  PHE A CB 1 
ATOM 913    N N  . LEU A 1 228  ? 1124.137 747.538 791.113 1.00 0.00 ? 228  LEU A N  1 
ATOM 914    C CA . LEU A 1 228  ? 1122.888 747.509 790.417 1.00 0.00 ? 228  LEU A CA 1 
ATOM 915    C C  . LEU A 1 228  ? 1123.167 747.209 788.986 1.00 0.00 ? 228  LEU A C  1 
ATOM 916    O O  . LEU A 1 228  ? 1124.287 747.383 788.514 1.00 0.00 ? 228  LEU A O  1 
ATOM 917    C CB . LEU A 1 228  ? 1122.023 748.783 790.619 1.00 0.00 ? 228  LEU A CB 1 
ATOM 918    N N  . ALA A 1 229  ? 1122.150 746.717 788.259 1.00 0.00 ? 229  ALA A N  1 
ATOM 919    C CA . ALA A 1 229  ? 1122.373 746.439 786.877 1.00 0.00 ? 229  ALA A CA 1 
ATOM 920    C C  . ALA A 1 229  ? 1121.361 747.202 786.101 1.00 0.00 ? 229  ALA A C  1 
ATOM 921    O O  . ALA A 1 229  ? 1120.225 747.383 786.533 1.00 0.00 ? 229  ALA A O  1 
ATOM 922    C CB . ALA A 1 229  ? 1122.203 744.955 786.510 1.00 0.00 ? 229  ALA A CB 1 
ATOM 923    N N  . GLY A 1 230  ? 1121.772 747.717 784.934 1.00 0.00 ? 230  GLY A N  1 
ATOM 924    C CA . GLY A 1 230  ? 1120.826 748.383 784.104 1.00 0.00 ? 230  GLY A CA 1 
ATOM 925    C C  . GLY A 1 230  ? 1120.450 747.383 783.077 1.00 0.00 ? 230  GLY A C  1 
ATOM 926    O O  . GLY A 1 230  ? 1120.842 746.220 783.157 1.00 0.00 ? 230  GLY A O  1 
ATOM 927    N N  . LYS A 1 231  ? 1119.683 747.810 782.064 1.00 0.00 ? 231  LYS A N  1 
ATOM 928    C CA . LYS A 1 231  ? 1119.397 746.890 781.011 1.00 0.00 ? 231  LYS A CA 1 
ATOM 929    C C  . LYS A 1 231  ? 1120.564 747.083 780.092 1.00 0.00 ? 231  LYS A C  1 
ATOM 930    O O  . LYS A 1 231  ? 1120.411 747.394 778.911 1.00 0.00 ? 231  LYS A O  1 
ATOM 931    C CB . LYS A 1 231  ? 1118.101 747.286 780.280 1.00 0.00 ? 231  LYS A CB 1 
ATOM 932    N N  . ASP A 1 232  ? 1121.779 746.896 780.651 1.00 0.00 ? 232  ASP A N  1 
ATOM 933    C CA . ASP A 1 232  ? 1123.014 747.126 779.968 1.00 0.00 ? 232  ASP A CA 1 
ATOM 934    C C  . ASP A 1 232  ? 1123.954 746.048 780.392 1.00 0.00 ? 232  ASP A C  1 
ATOM 935    O O  . ASP A 1 232  ? 1124.978 746.314 781.022 1.00 0.00 ? 232  ASP A O  1 
ATOM 936    C CB . ASP A 1 232  ? 1123.652 748.457 780.405 1.00 0.00 ? 232  ASP A CB 1 
ATOM 937    N N  . GLY A 1 233  ? 1123.631 744.786 780.065 1.00 0.00 ? 233  GLY A N  1 
ATOM 938    C CA . GLY A 1 233  ? 1124.536 743.734 780.406 1.00 0.00 ? 233  GLY A CA 1 
ATOM 939    C C  . GLY A 1 233  ? 1124.419 743.423 781.865 1.00 0.00 ? 233  GLY A C  1 
ATOM 940    O O  . GLY A 1 233  ? 1123.433 743.755 782.521 1.00 0.00 ? 233  GLY A O  1 
ATOM 941    N N  . CYS A 1 234  ? 1125.440 742.701 782.369 1.00 0.00 ? 234  CYS A N  1 
ATOM 942    C CA . CYS A 1 234  ? 1125.533 742.173 783.703 1.00 0.00 ? 234  CYS A CA 1 
ATOM 943    C C  . CYS A 1 234  ? 1125.712 743.153 784.869 1.00 0.00 ? 234  CYS A C  1 
ATOM 944    O O  . CYS A 1 234  ? 1124.840 743.205 785.735 1.00 0.00 ? 234  CYS A O  1 
ATOM 945    C CB . CYS A 1 234  ? 1126.705 741.188 783.816 1.00 0.00 ? 234  CYS A CB 1 
ATOM 946    N N  . LEU A 1 235  ? 1126.802 743.979 784.946 1.00 0.00 ? 235  LEU A N  1 
ATOM 947    C CA . LEU A 1 235  ? 1127.023 744.673 786.215 1.00 0.00 ? 235  LEU A CA 1 
ATOM 948    C C  . LEU A 1 235  ? 1127.653 746.034 786.245 1.00 0.00 ? 235  LEU A C  1 
ATOM 949    O O  . LEU A 1 235  ? 1128.485 746.417 785.422 1.00 0.00 ? 235  LEU A O  1 
ATOM 950    C CB . LEU A 1 235  ? 1127.825 743.907 787.264 1.00 0.00 ? 235  LEU A CB 1 
ATOM 951    N N  . TYR A 1 236  ? 1127.247 746.766 787.317 1.00 0.00 ? 236  TYR A N  1 
ATOM 952    C CA . TYR A 1 236  ? 1127.640 748.099 787.690 1.00 0.00 ? 236  TYR A CA 1 
ATOM 953    C C  . TYR A 1 236  ? 1127.605 748.244 789.217 1.00 0.00 ? 236  TYR A C  1 
ATOM 954    O O  . TYR A 1 236  ? 1126.843 747.534 789.873 1.00 0.00 ? 236  TYR A O  1 
ATOM 955    C CB . TYR A 1 236  ? 1126.690 749.108 787.032 1.00 0.00 ? 236  TYR A CB 1 
ATOM 956    N N  . GLU A 1 237  ? 1128.432 749.147 789.834 1.00 0.00 ? 237  GLU A N  1 
ATOM 957    C CA . GLU A 1 237  ? 1128.396 749.384 791.272 1.00 0.00 ? 237  GLU A CA 1 
ATOM 958    C C  . GLU A 1 237  ? 1128.407 750.865 791.586 1.00 0.00 ? 237  GLU A C  1 
ATOM 959    O O  . GLU A 1 237  ? 1129.157 751.632 790.986 1.00 0.00 ? 237  GLU A O  1 
ATOM 960    C CB . GLU A 1 237  ? 1129.591 748.803 792.052 1.00 0.00 ? 237  GLU A CB 1 
ATOM 961    N N  . VAL A 1 238  ? 1127.606 751.294 792.597 1.00 0.00 ? 238  VAL A N  1 
ATOM 962    C CA . VAL A 1 238  ? 1127.488 752.691 792.954 1.00 0.00 ? 238  VAL A CA 1 
ATOM 963    C C  . VAL A 1 238  ? 1128.246 752.956 794.222 1.00 0.00 ? 238  VAL A C  1 
ATOM 964    O O  . VAL A 1 238  ? 1128.316 752.106 795.111 1.00 0.00 ? 238  VAL A O  1 
ATOM 965    C CB . VAL A 1 238  ? 1126.095 753.126 793.317 1.00 0.00 ? 238  VAL A CB 1 
ATOM 966    N N  . ALA A 1 239  ? 1128.858 754.157 794.329 1.00 0.00 ? 239  ALA A N  1 
ATOM 967    C CA . ALA A 1 239  ? 1129.481 754.537 795.563 1.00 0.00 ? 239  ALA A CA 1 
ATOM 968    C C  . ALA A 1 239  ? 1129.058 755.945 795.885 1.00 0.00 ? 239  ALA A C  1 
ATOM 969    O O  . ALA A 1 239  ? 1129.258 756.865 795.094 1.00 0.00 ? 239  ALA A O  1 
ATOM 970    C CB . ALA A 1 239  ? 1131.018 754.526 795.514 1.00 0.00 ? 239  ALA A CB 1 
ATOM 971    N N  . TYR A 1 240  ? 1128.421 756.115 797.059 1.00 0.00 ? 240  TYR A N  1 
ATOM 972    C CA . TYR A 1 240  ? 1127.971 757.346 797.656 1.00 0.00 ? 240  TYR A CA 1 
ATOM 973    C C  . TYR A 1 240  ? 1129.063 758.116 798.327 1.00 0.00 ? 240  TYR A C  1 
ATOM 974    O O  . TYR A 1 240  ? 1128.860 759.266 798.718 1.00 0.00 ? 240  TYR A O  1 
ATOM 975    C CB . TYR A 1 240  ? 1126.669 757.287 798.484 1.00 0.00 ? 240  TYR A CB 1 
ATOM 976    N N  . GLN A 1 241  ? 1130.254 757.501 798.450 1.00 0.00 ? 241  GLN A N  1 
ATOM 977    C CA . GLN A 1 241  ? 1131.384 757.895 799.246 1.00 0.00 ? 241  GLN A CA 1 
ATOM 978    C C  . GLN A 1 241  ? 1131.309 757.086 800.496 1.00 0.00 ? 241  GLN A C  1 
ATOM 979    O O  . GLN A 1 241  ? 1132.296 756.507 800.945 1.00 0.00 ? 241  GLN A O  1 
ATOM 980    C CB . GLN A 1 241  ? 1131.463 759.403 799.554 1.00 0.00 ? 241  GLN A CB 1 
ATOM 981    N N  . LYS A 1 253  ? 1128.704 759.919 793.890 1.00 0.00 ? 253  LYS A N  1 
ATOM 982    C CA . LYS A 1 253  ? 1127.558 759.630 793.089 1.00 0.00 ? 253  LYS A CA 1 
ATOM 983    C C  . LYS A 1 253  ? 1127.938 758.621 792.062 1.00 0.00 ? 253  LYS A C  1 
ATOM 984    O O  . LYS A 1 253  ? 1127.166 757.741 791.687 1.00 0.00 ? 253  LYS A O  1 
ATOM 985    C CB . LYS A 1 253  ? 1126.956 760.848 792.367 1.00 0.00 ? 253  LYS A CB 1 
ATOM 986    N N  . ILE A 1 254  ? 1129.200 758.761 791.619 1.00 0.00 ? 254  ILE A N  1 
ATOM 987    C CA . ILE A 1 254  ? 1129.793 758.125 790.485 1.00 0.00 ? 254  ILE A CA 1 
ATOM 988    C C  . ILE A 1 254  ? 1129.469 756.680 790.372 1.00 0.00 ? 254  ILE A C  1 
ATOM 989    O O  . ILE A 1 254  ? 1129.355 755.947 791.355 1.00 0.00 ? 254  ILE A O  1 
ATOM 990    C CB . ILE A 1 254  ? 1131.281 758.297 790.414 1.00 0.00 ? 254  ILE A CB 1 
ATOM 991    N N  . ASN A 1 255  ? 1129.282 756.271 789.103 1.00 0.00 ? 255  ASN A N  1 
ATOM 992    C CA . ASN A 1 255  ? 1128.994 754.935 788.695 1.00 0.00 ? 255  ASN A CA 1 
ATOM 993    C C  . ASN A 1 255  ? 1130.302 754.398 788.189 1.00 0.00 ? 255  ASN A C  1 
ATOM 994    O O  . ASN A 1 255  ? 1131.052 755.115 787.527 1.00 0.00 ? 255  ASN A O  1 
ATOM 995    C CB . ASN A 1 255  ? 1128.114 754.864 787.423 1.00 0.00 ? 255  ASN A CB 1 
ATOM 996    N N  . HIS A 1 256  ? 1130.634 753.136 788.514 1.00 0.00 ? 256  HIS A N  1 
ATOM 997    C CA . HIS A 1 256  ? 1131.790 752.518 787.931 1.00 0.00 ? 256  HIS A CA 1 
ATOM 998    C C  . HIS A 1 256  ? 1131.403 751.117 787.580 1.00 0.00 ? 256  HIS A C  1 
ATOM 999    O O  . HIS A 1 256  ? 1130.833 750.397 788.401 1.00 0.00 ? 256  HIS A O  1 
ATOM 1000   C CB . HIS A 1 256  ? 1133.025 752.481 788.848 1.00 0.00 ? 256  HIS A CB 1 
ATOM 1001   N N  . SER A 1 257  ? 1131.676 750.700 786.325 1.00 0.00 ? 257  SER A N  1 
ATOM 1002   C CA . SER A 1 257  ? 1131.312 749.376 785.913 1.00 0.00 ? 257  SER A CA 1 
ATOM 1003   C C  . SER A 1 257  ? 1132.342 748.443 786.452 1.00 0.00 ? 257  SER A C  1 
ATOM 1004   O O  . SER A 1 257  ? 1133.542 748.692 786.343 1.00 0.00 ? 257  SER A O  1 
ATOM 1005   C CB . SER A 1 257  ? 1131.255 749.215 784.386 1.00 0.00 ? 257  SER A CB 1 
ATOM 1006   N N  . LYS A 1 258  ? 1131.888 747.368 787.124 1.00 0.00 ? 258  LYS A N  1 
ATOM 1007   C CA . LYS A 1 258  ? 1132.823 746.419 787.655 1.00 0.00 ? 258  LYS A CA 1 
ATOM 1008   C C  . LYS A 1 258  ? 1133.365 745.535 786.575 1.00 0.00 ? 258  LYS A C  1 
ATOM 1009   O O  . LYS A 1 258  ? 1134.565 745.277 786.508 1.00 0.00 ? 258  LYS A O  1 
ATOM 1010   C CB . LYS A 1 258  ? 1132.198 745.538 788.745 1.00 0.00 ? 258  LYS A CB 1 
ATOM 1011   N N  . SER A 1 259  ? 1132.452 745.052 785.710 1.00 0.00 ? 259  SER A N  1 
ATOM 1012   C CA . SER A 1 259  ? 1132.722 744.070 784.698 1.00 0.00 ? 259  SER A CA 1 
ATOM 1013   C C  . SER A 1 259  ? 1133.484 744.587 783.515 1.00 0.00 ? 259  SER A C  1 
ATOM 1014   O O  . SER A 1 259  ? 1134.240 743.830 782.906 1.00 0.00 ? 259  SER A O  1 
ATOM 1015   C CB . SER A 1 259  ? 1131.426 743.433 784.170 1.00 0.00 ? 259  SER A CB 1 
ATOM 1016   N N  . SER A 1 260  ? 1134.124 745.727 783.654 1.00 0.00 ? 260  SER A N  1 
ATOM 1017   C CA . SER A 1 260  ? 1134.826 746.715 782.898 1.00 0.00 ? 260  SER A CA 1 
ATOM 1018   C C  . SER A 1 260  ? 1133.899 747.205 781.842 1.00 0.00 ? 260  SER A C  1 
ATOM 1019   O O  . SER A 1 260  ? 1133.072 746.449 781.330 1.00 0.00 ? 260  SER A O  1 
ATOM 1020   C CB . SER A 1 260  ? 1136.084 746.178 782.198 1.00 0.00 ? 260  SER A CB 1 
ATOM 1021   N N  . LEU A 1 261  ? 1133.987 748.505 781.514 1.00 0.00 ? 261  LEU A N  1 
ATOM 1022   C CA . LEU A 1 261  ? 1133.166 749.005 780.456 1.00 0.00 ? 261  LEU A CA 1 
ATOM 1023   C C  . LEU A 1 261  ? 1133.653 748.286 779.249 1.00 0.00 ? 261  LEU A C  1 
ATOM 1024   O O  . LEU A 1 261  ? 1132.875 747.774 778.444 1.00 0.00 ? 261  LEU A O  1 
ATOM 1025   C CB . LEU A 1 261  ? 1133.362 750.512 780.213 1.00 0.00 ? 261  LEU A CB 1 
ATOM 1026   N N  . ASP A 1 276  ? 1124.525 735.863 778.981 1.00 0.00 ? 276  ASP A N  1 
ATOM 1027   C CA . ASP A 1 276  ? 1123.291 736.486 778.645 1.00 0.00 ? 276  ASP A CA 1 
ATOM 1028   C C  . ASP A 1 276  ? 1123.523 737.956 778.694 1.00 0.00 ? 276  ASP A C  1 
ATOM 1029   O O  . ASP A 1 276  ? 1124.388 738.455 779.414 1.00 0.00 ? 276  ASP A O  1 
ATOM 1030   C CB . ASP A 1 276  ? 1122.089 736.168 779.536 1.00 0.00 ? 276  ASP A CB 1 
ATOM 1031   N N  . ASP A 1 277  ? 1122.307 737.851 778.046 1.00 0.00 ? 277  ASP A N  1 
ATOM 1032   C CA . ASP A 1 277  ? 1121.804 739.075 777.508 1.00 0.00 ? 277  ASP A CA 1 
ATOM 1033   C C  . ASP A 1 277  ? 1121.419 740.033 778.622 1.00 0.00 ? 277  ASP A C  1 
ATOM 1034   O O  . ASP A 1 277  ? 1122.124 741.032 778.769 1.00 0.00 ? 277  ASP A O  1 
ATOM 1035   C CB . ASP A 1 277  ? 1120.668 738.780 776.493 1.00 0.00 ? 277  ASP A CB 1 
ATOM 1036   N N  . PRO A 1 278  ? 1120.401 739.843 779.449 1.00 0.00 ? 278  PRO A N  1 
ATOM 1037   C CA . PRO A 1 278  ? 1120.253 740.807 780.512 1.00 0.00 ? 278  PRO A CA 1 
ATOM 1038   C C  . PRO A 1 278  ? 1120.513 740.117 781.809 1.00 0.00 ? 278  PRO A C  1 
ATOM 1039   O O  . PRO A 1 278  ? 1120.700 738.903 781.815 1.00 0.00 ? 278  PRO A O  1 
ATOM 1040   C CB . PRO A 1 278  ? 1118.813 741.314 780.455 1.00 0.00 ? 278  PRO A CB 1 
ATOM 1041   N N  . ILE A 1 279  ? 1120.485 740.869 782.927 1.00 0.00 ? 279  ILE A N  1 
ATOM 1042   C CA . ILE A 1 279  ? 1120.582 740.242 784.209 1.00 0.00 ? 279  ILE A CA 1 
ATOM 1043   C C  . ILE A 1 279  ? 1119.229 740.354 784.826 1.00 0.00 ? 279  ILE A C  1 
ATOM 1044   O O  . ILE A 1 279  ? 1118.812 741.436 785.233 1.00 0.00 ? 279  ILE A O  1 
ATOM 1045   C CB . ILE A 1 279  ? 1121.541 740.930 785.138 1.00 0.00 ? 279  ILE A CB 1 
ATOM 1046   N N  . LEU A 1 280  ? 1118.486 739.232 784.875 1.00 0.00 ? 280  LEU A N  1 
ATOM 1047   C CA . LEU A 1 280  ? 1117.167 739.251 785.433 1.00 0.00 ? 280  LEU A CA 1 
ATOM 1048   C C  . LEU A 1 280  ? 1117.261 739.448 786.912 1.00 0.00 ? 280  LEU A C  1 
ATOM 1049   O O  . LEU A 1 280  ? 1116.552 740.282 787.474 1.00 0.00 ? 280  LEU A O  1 
ATOM 1050   C CB . LEU A 1 280  ? 1116.391 737.944 785.154 1.00 0.00 ? 280  LEU A CB 1 
ATOM 1051   N N  . GLN A 1 281  ? 1118.158 738.702 787.591 1.00 0.00 ? 281  GLN A N  1 
ATOM 1052   C CA . GLN A 1 281  ? 1118.154 738.782 789.024 1.00 0.00 ? 281  GLN A CA 1 
ATOM 1053   C C  . GLN A 1 281  ? 1119.538 738.976 789.541 1.00 0.00 ? 281  GLN A C  1 
ATOM 1054   O O  . GLN A 1 281  ? 1120.525 738.621 788.900 1.00 0.00 ? 281  GLN A O  1 
ATOM 1055   C CB . GLN A 1 281  ? 1117.613 737.509 789.692 1.00 0.00 ? 281  GLN A CB 1 
ATOM 1056   N N  . ILE A 1 282  ? 1119.624 739.580 790.745 1.00 0.00 ? 282  ILE A N  1 
ATOM 1057   C CA . ILE A 1 282  ? 1120.872 739.798 791.408 1.00 0.00 ? 282  ILE A CA 1 
ATOM 1058   C C  . ILE A 1 282  ? 1120.729 739.251 792.791 1.00 0.00 ? 282  ILE A C  1 
ATOM 1059   O O  . ILE A 1 282  ? 1119.701 739.446 793.439 1.00 0.00 ? 282  ILE A O  1 
ATOM 1060   C CB . ILE A 1 282  ? 1121.229 741.251 791.512 1.00 0.00 ? 282  ILE A CB 1 
ATOM 1061   N N  . ALA A 1 283  ? 1121.749 738.517 793.280 1.00 0.00 ? 283  ALA A N  1 
ATOM 1062   C CA . ALA A 1 283  ? 1121.657 737.992 794.612 1.00 0.00 ? 283  ALA A CA 1 
ATOM 1063   C C  . ALA A 1 283  ? 1122.989 738.158 795.268 1.00 0.00 ? 283  ALA A C  1 
ATOM 1064   O O  . ALA A 1 283  ? 1124.027 738.127 794.609 1.00 0.00 ? 283  ALA A O  1 
ATOM 1065   C CB . ALA A 1 283  ? 1121.318 736.499 794.678 1.00 0.00 ? 283  ALA A CB 1 
ATOM 1066   N N  . ILE A 1 284  ? 1122.986 738.359 796.600 1.00 0.00 ? 284  ILE A N  1 
ATOM 1067   C CA . ILE A 1 284  ? 1124.238 738.492 797.281 1.00 0.00 ? 284  ILE A CA 1 
ATOM 1068   C C  . ILE A 1 284  ? 1124.299 737.510 798.398 1.00 0.00 ? 284  ILE A C  1 
ATOM 1069   O O  . ILE A 1 284  ? 1123.334 737.318 799.136 1.00 0.00 ? 284  ILE A O  1 
ATOM 1070   C CB . ILE A 1 284  ? 1124.486 739.838 797.892 1.00 0.00 ? 284  ILE A CB 1 
ATOM 1071   N N  . ASP A 1 285  ? 1125.460 736.844 798.518 1.00 0.00 ? 285  ASP A N  1 
ATOM 1072   C CA . ASP A 1 285  ? 1125.705 735.951 799.605 1.00 0.00 ? 285  ASP A CA 1 
ATOM 1073   C C  . ASP A 1 285  ? 1126.379 736.796 800.630 1.00 0.00 ? 285  ASP A C  1 
ATOM 1074   O O  . ASP A 1 285  ? 1127.549 737.153 800.496 1.00 0.00 ? 285  ASP A O  1 
ATOM 1075   C CB . ASP A 1 285  ? 1126.634 734.795 799.205 1.00 0.00 ? 285  ASP A CB 1 
ATOM 1076   N N  . ASN A 1 286  ? 1125.619 737.156 801.675 1.00 0.00 ? 286  ASN A N  1 
ATOM 1077   C CA . ASN A 1 286  ? 1126.079 738.047 802.697 1.00 0.00 ? 286  ASN A CA 1 
ATOM 1078   C C  . ASN A 1 286  ? 1127.208 737.424 803.455 1.00 0.00 ? 286  ASN A C  1 
ATOM 1079   O O  . ASN A 1 286  ? 1128.183 738.094 803.791 1.00 0.00 ? 286  ASN A O  1 
ATOM 1080   C CB . ASN A 1 286  ? 1124.976 738.379 803.715 1.00 0.00 ? 286  ASN A CB 1 
ATOM 1081   N N  . SER A 1 287  ? 1127.101 736.115 803.747 1.00 0.00 ? 287  SER A N  1 
ATOM 1082   C CA . SER A 1 287  ? 1128.080 735.457 804.565 1.00 0.00 ? 287  SER A CA 1 
ATOM 1083   C C  . SER A 1 287  ? 1129.415 735.403 803.887 1.00 0.00 ? 287  SER A C  1 
ATOM 1084   O O  . SER A 1 287  ? 1130.439 735.539 804.552 1.00 0.00 ? 287  SER A O  1 
ATOM 1085   C CB . SER A 1 287  ? 1127.688 734.014 804.931 1.00 0.00 ? 287  SER A CB 1 
ATOM 1086   N N  . ARG A 1 288  ? 1129.462 735.204 802.552 1.00 0.00 ? 288  ARG A N  1 
ATOM 1087   C CA . ARG A 1 288  ? 1130.764 735.044 801.969 1.00 0.00 ? 288  ARG A CA 1 
ATOM 1088   C C  . ARG A 1 288  ? 1131.097 736.192 801.064 1.00 0.00 ? 288  ARG A C  1 
ATOM 1089   O O  . ARG A 1 288  ? 1132.102 736.130 800.359 1.00 0.00 ? 288  ARG A O  1 
ATOM 1090   C CB . ARG A 1 288  ? 1130.862 733.796 801.075 1.00 0.00 ? 288  ARG A CB 1 
ATOM 1091   N N  . ASN A 1 289  ? 1130.308 737.285 801.086 1.00 0.00 ? 289  ASN A N  1 
ATOM 1092   C CA . ASN A 1 289  ? 1130.597 738.418 800.249 1.00 0.00 ? 289  ASN A CA 1 
ATOM 1093   C C  . ASN A 1 289  ? 1130.750 737.962 798.832 1.00 0.00 ? 289  ASN A C  1 
ATOM 1094   O O  . ASN A 1 289  ? 1131.744 738.264 798.172 1.00 0.00 ? 289  ASN A O  1 
ATOM 1095   C CB . ASN A 1 289  ? 1131.882 739.153 800.662 1.00 0.00 ? 289  ASN A CB 1 
ATOM 1096   N N  . ILE A 1 290  ? 1129.753 737.216 798.335 1.00 0.00 ? 290  ILE A N  1 
ATOM 1097   C CA . ILE A 1 290  ? 1129.780 736.679 797.008 1.00 0.00 ? 290  ILE A CA 1 
ATOM 1098   C C  . ILE A 1 290  ? 1128.585 737.161 796.261 1.00 0.00 ? 290  ILE A C  1 
ATOM 1099   O O  . ILE A 1 290  ? 1127.473 737.207 796.784 1.00 0.00 ? 290  ILE A O  1 
ATOM 1100   C CB . ILE A 1 290  ? 1129.849 735.180 797.049 1.00 0.00 ? 290  ILE A CB 1 
ATOM 1101   N N  . LEU A 1 291  ? 1128.808 737.564 794.995 1.00 0.00 ? 291  LEU A N  1 
ATOM 1102   C CA . LEU A 1 291  ? 1127.744 738.109 794.210 1.00 0.00 ? 291  LEU A CA 1 
ATOM 1103   C C  . LEU A 1 291  ? 1127.337 737.081 793.211 1.00 0.00 ? 291  LEU A C  1 
ATOM 1104   O O  . LEU A 1 291  ? 1128.154 736.308 792.714 1.00 0.00 ? 291  LEU A O  1 
ATOM 1105   C CB . LEU A 1 291  ? 1128.142 739.381 793.466 1.00 0.00 ? 291  LEU A CB 1 
ATOM 1106   N N  . TYR A 1 292  ? 1126.028 737.032 792.921 1.00 0.00 ? 292  TYR A N  1 
ATOM 1107   C CA . TYR A 1 292  ? 1125.496 736.100 791.979 1.00 0.00 ? 292  TYR A CA 1 
ATOM 1108   C C  . TYR A 1 292  ? 1124.672 736.896 791.030 1.00 0.00 ? 292  TYR A C  1 
ATOM 1109   O O  . TYR A 1 292  ? 1124.010 737.858 791.420 1.00 0.00 ? 292  TYR A O  1 
ATOM 1110   C CB . TYR A 1 292  ? 1124.554 735.088 792.660 1.00 0.00 ? 292  TYR A CB 1 
ATOM 1111   N N  . THR A 1 293  ? 1124.699 736.516 789.742 1.00 0.00 ? 293  THR A N  1 
ATOM 1112   C CA . THR A 1 293  ? 1123.846 737.184 788.813 1.00 0.00 ? 293  THR A CA 1 
ATOM 1113   C C  . THR A 1 293  ? 1123.194 736.138 787.977 1.00 0.00 ? 293  THR A C  1 
ATOM 1114   O O  . THR A 1 293  ? 1123.834 735.175 787.555 1.00 0.00 ? 293  THR A O  1 
ATOM 1115   C CB . THR A 1 293  ? 1124.567 738.110 787.876 1.00 0.00 ? 293  THR A CB 1 
ATOM 1116   N N  . ARG A 1 294  ? 1121.880 736.292 787.729 1.00 0.00 ? 294  ARG A N  1 
ATOM 1117   C CA . ARG A 1 294  ? 1121.226 735.351 786.874 1.00 0.00 ? 294  ARG A CA 1 
ATOM 1118   C C  . ARG A 1 294  ? 1120.820 736.127 785.667 1.00 0.00 ? 294  ARG A C  1 
ATOM 1119   O O  . ARG A 1 294  ? 1120.312 737.242 785.782 1.00 0.00 ? 294  ARG A O  1 
ATOM 1120   C CB . ARG A 1 294  ? 1119.964 734.706 787.475 1.00 0.00 ? 294  ARG A CB 1 
ATOM 1121   N N  . SER A 1 295  ? 1121.064 735.571 784.466 1.00 0.00 ? 295  SER A N  1 
ATOM 1122   C CA . SER A 1 295  ? 1120.720 736.286 783.273 1.00 0.00 ? 295  SER A CA 1 
ATOM 1123   C C  . SER A 1 295  ? 1119.449 735.710 782.744 1.00 0.00 ? 295  SER A C  1 
ATOM 1124   O O  . SER A 1 295  ? 1118.957 734.690 783.228 1.00 0.00 ? 295  SER A O  1 
ATOM 1125   C CB . SER A 1 295  ? 1121.757 736.167 782.145 1.00 0.00 ? 295  SER A CB 1 
ATOM 1126   N N  . GLU A 1 296  ? 1118.895 736.360 781.706 1.00 0.00 ? 296  GLU A N  1 
ATOM 1127   C CA . GLU A 1 296  ? 1117.648 735.945 781.137 1.00 0.00 ? 296  GLU A CA 1 
ATOM 1128   C C  . GLU A 1 296  ? 1117.798 734.560 780.594 1.00 0.00 ? 296  GLU A C  1 
ATOM 1129   O O  . GLU A 1 296  ? 1116.896 733.733 780.728 1.00 0.00 ? 296  GLU A O  1 
ATOM 1130   C CB . GLU A 1 296  ? 1117.182 736.865 779.994 1.00 0.00 ? 296  GLU A CB 1 
ATOM 1131   N N  . LYS A 1 297  ? 1118.956 734.267 779.973 1.00 0.00 ? 297  LYS A N  1 
ATOM 1132   C CA . LYS A 1 297  ? 1119.179 732.983 779.371 1.00 0.00 ? 297  LYS A CA 1 
ATOM 1133   C C  . LYS A 1 297  ? 1119.286 731.885 780.384 1.00 0.00 ? 297  LYS A C  1 
ATOM 1134   O O  . LYS A 1 297  ? 1119.049 730.727 780.047 1.00 0.00 ? 297  LYS A O  1 
ATOM 1135   C CB . LYS A 1 297  ? 1120.340 732.917 778.363 1.00 0.00 ? 297  LYS A CB 1 
ATOM 1136   N N  . GLY A 1 298  ? 1119.646 732.176 781.649 1.00 0.00 ? 298  GLY A N  1 
ATOM 1137   C CA . GLY A 1 298  ? 1119.716 731.066 782.563 1.00 0.00 ? 298  GLY A CA 1 
ATOM 1138   C C  . GLY A 1 298  ? 1121.148 730.774 782.883 1.00 0.00 ? 298  GLY A C  1 
ATOM 1139   O O  . GLY A 1 298  ? 1121.481 729.674 783.327 1.00 0.00 ? 298  GLY A O  1 
ATOM 1140   N N  . VAL A 1 299  ? 1122.049 731.746 782.647 1.00 0.00 ? 299  VAL A N  1 
ATOM 1141   C CA . VAL A 1 299  ? 1123.421 731.536 783.015 1.00 0.00 ? 299  VAL A CA 1 
ATOM 1142   C C  . VAL A 1 299  ? 1123.636 732.205 784.339 1.00 0.00 ? 299  VAL A C  1 
ATOM 1143   O O  . VAL A 1 299  ? 1123.016 733.228 784.631 1.00 0.00 ? 299  VAL A O  1 
ATOM 1144   C CB . VAL A 1 299  ? 1124.414 732.119 782.048 1.00 0.00 ? 299  VAL A CB 1 
ATOM 1145   N N  . ILE A 1 300  ? 1124.515 731.636 785.193 1.00 0.00 ? 300  ILE A N  1 
ATOM 1146   C CA . ILE A 1 300  ? 1124.714 732.237 786.481 1.00 0.00 ? 300  ILE A CA 1 
ATOM 1147   C C  . ILE A 1 300  ? 1126.146 732.653 786.514 1.00 0.00 ? 300  ILE A C  1 
ATOM 1148   O O  . ILE A 1 300  ? 1127.002 732.032 785.883 1.00 0.00 ? 300  ILE A O  1 
ATOM 1149   C CB . ILE A 1 300  ? 1124.594 731.311 787.650 1.00 0.00 ? 300  ILE A CB 1 
ATOM 1150   N N  . GLN A 1 301  ? 1126.438 733.752 787.225 1.00 0.00 ? 301  GLN A N  1 
ATOM 1151   C CA . GLN A 1 301  ? 1127.801 734.169 787.344 1.00 0.00 ? 301  GLN A CA 1 
ATOM 1152   C C  . GLN A 1 301  ? 1127.997 734.561 788.775 1.00 0.00 ? 301  GLN A C  1 
ATOM 1153   O O  . GLN A 1 301  ? 1127.223 735.350 789.317 1.00 0.00 ? 301  GLN A O  1 
ATOM 1154   C CB . GLN A 1 301  ? 1128.106 735.379 786.451 1.00 0.00 ? 301  GLN A CB 1 
ATOM 1155   N N  . VAL A 1 302  ? 1129.027 733.997 789.439 1.00 0.00 ? 302  VAL A N  1 
ATOM 1156   C CA . VAL A 1 302  ? 1129.273 734.324 790.821 1.00 0.00 ? 302  VAL A CA 1 
ATOM 1157   C C  . VAL A 1 302  ? 1130.567 735.074 791.067 1.00 0.00 ? 302  VAL A C  1 
ATOM 1158   O O  . VAL A 1 302  ? 1131.652 734.498 791.137 1.00 0.00 ? 302  VAL A O  1 
ATOM 1159   C CB . VAL A 1 302  ? 1129.323 733.119 791.702 1.00 0.00 ? 302  VAL A CB 1 
ATOM 1160   N N  . TYR A 1 303  ? 1130.502 736.396 791.278 1.00 0.00 ? 303  TYR A N  1 
ATOM 1161   C CA . TYR A 1 303  ? 1131.723 737.145 791.410 1.00 0.00 ? 303  TYR A CA 1 
ATOM 1162   C C  . TYR A 1 303  ? 1132.119 737.190 792.852 1.00 0.00 ? 303  TYR A C  1 
ATOM 1163   O O  . TYR A 1 303  ? 1131.274 737.223 793.745 1.00 0.00 ? 303  TYR A O  1 
ATOM 1164   C CB . TYR A 1 303  ? 1131.577 738.616 791.007 1.00 0.00 ? 303  TYR A CB 1 
ATOM 1165   N N  . ASP A 1 304  ? 1133.443 737.156 793.111 1.00 0.00 ? 304  ASP A N  1 
ATOM 1166   C CA . ASP A 1 304  ? 1133.935 737.288 794.447 1.00 0.00 ? 304  ASP A CA 1 
ATOM 1167   C C  . ASP A 1 304  ? 1133.990 738.759 794.692 1.00 0.00 ? 304  ASP A C  1 
ATOM 1168   O O  . ASP A 1 304  ? 1134.615 739.497 793.933 1.00 0.00 ? 304  ASP A O  1 
ATOM 1169   C CB . ASP A 1 304  ? 1135.359 736.728 794.621 1.00 0.00 ? 304  ASP A CB 1 
ATOM 1170   N N  . LEU A 1 305  ? 1133.317 739.236 795.754 1.00 0.00 ? 305  LEU A N  1 
ATOM 1171   C CA . LEU A 1 305  ? 1133.340 740.647 795.986 1.00 0.00 ? 305  LEU A CA 1 
ATOM 1172   C C  . LEU A 1 305  ? 1134.551 740.900 796.810 1.00 0.00 ? 305  LEU A C  1 
ATOM 1173   O O  . LEU A 1 305  ? 1134.734 740.311 797.876 1.00 0.00 ? 305  LEU A O  1 
ATOM 1174   C CB . LEU A 1 305  ? 1132.083 741.167 796.717 1.00 0.00 ? 305  LEU A CB 1 
ATOM 1175   N N  . GLY A 1 306  ? 1135.424 741.790 796.309 1.00 0.00 ? 306  GLY A N  1 
ATOM 1176   C CA . GLY A 1 306  ? 1136.631 742.101 797.005 1.00 0.00 ? 306  GLY A CA 1 
ATOM 1177   C C  . GLY A 1 306  ? 1136.675 743.581 797.124 1.00 0.00 ? 306  GLY A C  1 
ATOM 1178   O O  . GLY A 1 306  ? 1135.856 744.294 796.546 1.00 0.00 ? 306  GLY A O  1 
ATOM 1179   N N  . GLN A 1 307  ? 1137.646 744.079 797.904 1.00 0.00 ? 307  GLN A N  1 
ATOM 1180   C CA . GLN A 1 307  ? 1137.778 745.487 798.107 1.00 0.00 ? 307  GLN A CA 1 
ATOM 1181   C C  . GLN A 1 307  ? 1138.147 746.118 796.803 1.00 0.00 ? 307  GLN A C  1 
ATOM 1182   O O  . GLN A 1 307  ? 1137.684 747.214 796.487 1.00 0.00 ? 307  GLN A O  1 
ATOM 1183   C CB . GLN A 1 307  ? 1138.867 745.828 799.137 1.00 0.00 ? 307  GLN A CB 1 
ATOM 1184   N N  . ASP A 1 308  ? 1138.984 745.434 795.996 1.00 0.00 ? 308  ASP A N  1 
ATOM 1185   C CA . ASP A 1 308  ? 1139.449 746.044 794.785 1.00 0.00 ? 308  ASP A CA 1 
ATOM 1186   C C  . ASP A 1 308  ? 1138.572 745.692 793.622 1.00 0.00 ? 308  ASP A C  1 
ATOM 1187   O O  . ASP A 1 308  ? 1138.965 745.905 792.478 1.00 0.00 ? 308  ASP A O  1 
ATOM 1188   C CB . ASP A 1 308  ? 1140.876 745.607 794.411 1.00 0.00 ? 308  ASP A CB 1 
ATOM 1189   N N  . GLY A 1 309  ? 1137.354 745.165 793.854 1.00 0.00 ? 309  GLY A N  1 
ATOM 1190   C CA . GLY A 1 309  ? 1136.538 744.928 792.697 1.00 0.00 ? 309  GLY A CA 1 
ATOM 1191   C C  . GLY A 1 309  ? 1135.949 743.558 792.751 1.00 0.00 ? 309  GLY A C  1 
ATOM 1192   O O  . GLY A 1 309  ? 1135.984 742.881 793.779 1.00 0.00 ? 309  GLY A O  1 
ATOM 1193   N N  . GLN A 1 310  ? 1135.382 743.124 791.607 1.00 0.00 ? 310  GLN A N  1 
ATOM 1194   C CA . GLN A 1 310  ? 1134.756 741.840 791.515 1.00 0.00 ? 310  GLN A CA 1 
ATOM 1195   C C  . GLN A 1 310  ? 1135.739 740.921 790.876 1.00 0.00 ? 310  GLN A C  1 
ATOM 1196   O O  . GLN A 1 310  ? 1136.510 741.326 790.007 1.00 0.00 ? 310  GLN A O  1 
ATOM 1197   C CB . GLN A 1 310  ? 1133.483 741.860 790.658 1.00 0.00 ? 310  GLN A CB 1 
ATOM 1198   N N  . GLY A 1 311  ? 1135.757 739.646 791.314 1.00 0.00 ? 311  GLY A N  1 
ATOM 1199   C CA . GLY A 1 311  ? 1136.683 738.728 790.725 1.00 0.00 ? 311  GLY A CA 1 
ATOM 1200   C C  . GLY A 1 311  ? 1135.899 737.579 790.200 1.00 0.00 ? 311  GLY A C  1 
ATOM 1201   O O  . GLY A 1 311  ? 1135.254 736.846 790.947 1.00 0.00 ? 311  GLY A O  1 
ATOM 1202   N N  . MET A 1 312  ? 1135.947 737.402 788.870 1.00 0.00 ? 312  MET A N  1 
ATOM 1203   C CA . MET A 1 312  ? 1135.258 736.330 788.233 1.00 0.00 ? 312  MET A CA 1 
ATOM 1204   C C  . MET A 1 312  ? 1135.363 736.697 786.773 1.00 0.00 ? 312  MET A C  1 
ATOM 1205   O O  . MET A 1 312  ? 1136.318 737.387 786.420 1.00 0.00 ? 312  MET A O  1 
ATOM 1206   C CB . MET A 1 312  ? 1133.805 736.213 788.709 1.00 0.00 ? 312  MET A CB 1 
ATOM 1207   N N  . SER A 1 313  ? 1134.460 736.290 785.842 1.00 0.00 ? 313  SER A N  1 
ATOM 1208   C CA . SER A 1 313  ? 1133.283 735.486 785.942 1.00 0.00 ? 313  SER A CA 1 
ATOM 1209   C C  . SER A 1 313  ? 1133.229 734.607 784.736 1.00 0.00 ? 313  SER A C  1 
ATOM 1210   O O  . SER A 1 313  ? 1134.052 733.713 784.555 1.00 0.00 ? 313  SER A O  1 
ATOM 1211   C CB . SER A 1 313  ? 1131.995 736.325 785.874 1.00 0.00 ? 313  SER A CB 1 
ATOM 1212   N N  . ALA A 1 316  ? 1133.132 732.621 786.739 1.00 0.00 ? 316  ALA A N  1 
ATOM 1213   C CA . ALA A 1 316  ? 1132.842 731.239 786.685 1.00 0.00 ? 316  ALA A CA 1 
ATOM 1214   C C  . ALA A 1 316  ? 1131.391 731.219 786.333 1.00 0.00 ? 316  ALA A C  1 
ATOM 1215   O O  . ALA A 1 316  ? 1130.659 732.181 786.565 1.00 0.00 ? 316  ALA A O  1 
ATOM 1216   C CB . ALA A 1 316  ? 1133.045 730.495 788.015 1.00 0.00 ? 316  ALA A CB 1 
ATOM 1217   N N  . SER A 1 317  ? 1130.916 730.150 785.691 1.00 0.00 ? 317  SER A N  1 
ATOM 1218   C CA . SER A 1 317  ? 1129.531 730.263 785.380 1.00 0.00 ? 317  SER A CA 1 
ATOM 1219   C C  . SER A 1 317  ? 1128.905 728.924 785.454 1.00 0.00 ? 317  SER A C  1 
ATOM 1220   O O  . SER A 1 317  ? 1129.570 727.899 785.308 1.00 0.00 ? 317  SER A O  1 
ATOM 1221   C CB . SER A 1 317  ? 1129.266 730.801 783.962 1.00 0.00 ? 317  SER A CB 1 
ATOM 1222   N N  . VAL A 1 318  ? 1127.587 728.902 785.735 1.00 0.00 ? 318  VAL A N  1 
ATOM 1223   C CA . VAL A 1 318  ? 1126.934 727.637 785.635 1.00 0.00 ? 318  VAL A CA 1 
ATOM 1224   C C  . VAL A 1 318  ? 1125.946 727.823 784.548 1.00 0.00 ? 318  VAL A C  1 
ATOM 1225   O O  . VAL A 1 318  ? 1125.331 728.883 784.423 1.00 0.00 ? 318  VAL A O  1 
ATOM 1226   C CB . VAL A 1 318  ? 1126.163 727.147 786.833 1.00 0.00 ? 318  VAL A CB 1 
ATOM 1227   N N  . SER A 1 319  ? 1125.787 726.792 783.712 1.00 0.00 ? 319  SER A N  1 
ATOM 1228   C CA . SER A 1 319  ? 1124.880 726.908 782.621 1.00 0.00 ? 319  SER A CA 1 
ATOM 1229   C C  . SER A 1 319  ? 1124.177 725.600 782.547 1.00 0.00 ? 319  SER A C  1 
ATOM 1230   O O  . SER A 1 319  ? 1124.381 724.716 783.378 1.00 0.00 ? 319  SER A O  1 
ATOM 1231   C CB . SER A 1 319  ? 1125.589 727.167 781.276 1.00 0.00 ? 319  SER A CB 1 
ATOM 1232   N N  . GLN A 1 320  ? 1123.306 725.462 781.541 1.00 0.00 ? 320  GLN A N  1 
ATOM 1233   C CA . GLN A 1 320  ? 1122.541 724.274 781.346 1.00 0.00 ? 320  GLN A CA 1 
ATOM 1234   C C  . GLN A 1 320  ? 1123.494 723.147 781.109 1.00 0.00 ? 320  GLN A C  1 
ATOM 1235   O O  . GLN A 1 320  ? 1123.290 722.035 781.595 1.00 0.00 ? 320  GLN A O  1 
ATOM 1236   C CB . GLN A 1 320  ? 1121.650 724.409 780.113 1.00 0.00 ? 320  GLN A CB 1 
ATOM 1237   N N  . ASN A 1 321  ? 1124.575 723.416 780.355 1.00 0.00 ? 321  ASN A N  1 
ATOM 1238   C CA . ASN A 1 321  ? 1125.530 722.402 780.017 1.00 0.00 ? 321  ASN A CA 1 
ATOM 1239   C C  . ASN A 1 321  ? 1126.167 721.886 781.272 1.00 0.00 ? 321  ASN A C  1 
ATOM 1240   O O  . ASN A 1 321  ? 1126.306 720.678 781.454 1.00 0.00 ? 321  ASN A O  1 
ATOM 1241   C CB . ASN A 1 321  ? 1126.659 722.946 779.120 1.00 0.00 ? 321  ASN A CB 1 
ATOM 1242   N N  . ALA A 1 322  ? 1126.552 722.795 782.186 1.00 0.00 ? 322  ALA A N  1 
ATOM 1243   C CA . ALA A 1 322  ? 1127.222 722.390 783.387 1.00 0.00 ? 322  ALA A CA 1 
ATOM 1244   C C  . ALA A 1 322  ? 1126.310 721.508 784.177 1.00 0.00 ? 322  ALA A C  1 
ATOM 1245   O O  . ALA A 1 322  ? 1126.736 720.497 784.732 1.00 0.00 ? 322  ALA A O  1 
ATOM 1246   C CB . ALA A 1 322  ? 1127.609 723.577 784.282 1.00 0.00 ? 322  ALA A CB 1 
ATOM 1247   N N  . ILE A 1 323  ? 1125.016 721.869 784.235 1.00 0.00 ? 323  ILE A N  1 
ATOM 1248   C CA . ILE A 1 323  ? 1124.070 721.124 785.013 1.00 0.00 ? 323  ILE A CA 1 
ATOM 1249   C C  . ILE A 1 323  ? 1123.946 719.743 784.457 1.00 0.00 ? 323  ILE A C  1 
ATOM 1250   O O  . ILE A 1 323  ? 1123.906 718.768 785.206 1.00 0.00 ? 323  ILE A O  1 
ATOM 1251   C CB . ILE A 1 323  ? 1122.699 721.732 785.011 1.00 0.00 ? 323  ILE A CB 1 
ATOM 1252   N N  . VAL A 1 324  ? 1123.889 719.621 783.117 1.00 0.00 ? 324  VAL A N  1 
ATOM 1253   C CA . VAL A 1 324  ? 1123.709 718.331 782.517 1.00 0.00 ? 324  VAL A CA 1 
ATOM 1254   C C  . VAL A 1 324  ? 1124.843 717.456 782.928 1.00 0.00 ? 324  VAL A C  1 
ATOM 1255   O O  . VAL A 1 324  ? 1124.644 716.310 783.328 1.00 0.00 ? 324  VAL A O  1 
ATOM 1256   C CB . VAL A 1 324  ? 1123.709 718.389 781.017 1.00 0.00 ? 324  VAL A CB 1 
ATOM 1257   N N  . SER A 1 325  ? 1126.075 717.987 782.861 1.00 0.00 ? 325  SER A N  1 
ATOM 1258   C CA . SER A 1 325  ? 1127.212 717.197 783.224 1.00 0.00 ? 325  SER A CA 1 
ATOM 1259   C C  . SER A 1 325  ? 1127.083 716.850 784.673 1.00 0.00 ? 325  SER A C  1 
ATOM 1260   O O  . SER A 1 325  ? 1127.443 715.753 785.095 1.00 0.00 ? 325  SER A O  1 
ATOM 1261   C CB . SER A 1 325  ? 1128.536 717.960 783.048 1.00 0.00 ? 325  SER A CB 1 
ATOM 1262   N N  . ALA A 1 326  ? 1126.539 717.789 785.466 1.00 0.00 ? 326  ALA A N  1 
ATOM 1263   C CA . ALA A 1 326  ? 1126.441 717.622 786.884 1.00 0.00 ? 326  ALA A CA 1 
ATOM 1264   C C  . ALA A 1 326  ? 1125.570 716.459 787.240 1.00 0.00 ? 326  ALA A C  1 
ATOM 1265   O O  . ALA A 1 326  ? 1125.943 715.665 788.101 1.00 0.00 ? 326  ALA A O  1 
ATOM 1266   C CB . ALA A 1 326  ? 1125.847 718.862 787.573 1.00 0.00 ? 326  ALA A CB 1 
ATOM 1267   N N  . ALA A 1 327  ? 1124.396 716.306 786.591 1.00 0.00 ? 327  ALA A N  1 
ATOM 1268   C CA . ALA A 1 327  ? 1123.538 715.242 787.034 1.00 0.00 ? 327  ALA A CA 1 
ATOM 1269   C C  . ALA A 1 327  ? 1124.235 713.938 786.835 1.00 0.00 ? 327  ALA A C  1 
ATOM 1270   O O  . ALA A 1 327  ? 1124.418 713.169 787.777 1.00 0.00 ? 327  ALA A O  1 
ATOM 1271   C CB . ALA A 1 327  ? 1122.217 715.184 786.249 1.00 0.00 ? 327  ALA A CB 1 
ATOM 1272   N N  . GLY A 1 328  ? 1124.665 713.664 785.592 1.00 0.00 ? 328  GLY A N  1 
ATOM 1273   C CA . GLY A 1 328  ? 1125.434 712.491 785.302 1.00 0.00 ? 328  GLY A CA 1 
ATOM 1274   C C  . GLY A 1 328  ? 1124.733 711.258 785.790 1.00 0.00 ? 328  GLY A C  1 
ATOM 1275   O O  . GLY A 1 328  ? 1125.353 710.201 785.878 1.00 0.00 ? 328  GLY A O  1 
ATOM 1276   N N  . ASN A 1 329  ? 1123.431 711.330 786.136 1.00 0.00 ? 329  ASN A N  1 
ATOM 1277   C CA . ASN A 1 329  ? 1122.837 710.114 786.615 1.00 0.00 ? 329  ASN A CA 1 
ATOM 1278   C C  . ASN A 1 329  ? 1121.352 710.211 786.432 1.00 0.00 ? 329  ASN A C  1 
ATOM 1279   O O  . ASN A 1 329  ? 1120.679 709.200 786.232 1.00 0.00 ? 329  ASN A O  1 
ATOM 1280   C CB . ASN A 1 329  ? 1123.139 709.855 788.103 1.00 0.00 ? 329  ASN A CB 1 
ATOM 1281   N N  . ILE A 1 330  ? 1120.800 711.442 786.493 1.00 0.00 ? 330  ILE A N  1 
ATOM 1282   C CA . ILE A 1 330  ? 1119.380 711.632 786.363 1.00 0.00 ? 330  ILE A CA 1 
ATOM 1283   C C  . ILE A 1 330  ? 1119.135 712.668 785.304 1.00 0.00 ? 330  ILE A C  1 
ATOM 1284   O O  . ILE A 1 330  ? 1119.978 713.537 785.087 1.00 0.00 ? 330  ILE A O  1 
ATOM 1285   C CB . ILE A 1 330  ? 1118.743 712.186 787.600 1.00 0.00 ? 330  ILE A CB 1 
ATOM 1286   N N  . ALA A 1 331  ? 1117.992 712.589 784.578 1.00 0.00 ? 331  ALA A N  1 
ATOM 1287   C CA . ALA A 1 331  ? 1117.719 713.651 783.647 1.00 0.00 ? 331  ALA A CA 1 
ATOM 1288   C C  . ALA A 1 331  ? 1116.389 713.466 782.961 1.00 0.00 ? 331  ALA A C  1 
ATOM 1289   O O  . ALA A 1 331  ? 1115.930 712.345 782.742 1.00 0.00 ? 331  ALA A O  1 
ATOM 1290   C CB . ALA A 1 331  ? 1118.776 713.781 782.537 1.00 0.00 ? 331  ALA A CB 1 
ATOM 1291   N N  . ARG A 1 332  ? 1115.734 714.606 782.627 1.00 0.00 ? 332  ARG A N  1 
ATOM 1292   C CA . ARG A 1 332  ? 1114.528 714.675 781.840 1.00 0.00 ? 332  ARG A CA 1 
ATOM 1293   C C  . ARG A 1 332  ? 1113.870 715.992 782.115 1.00 0.00 ? 332  ARG A C  1 
ATOM 1294   O O  . ARG A 1 332  ? 1113.732 716.824 781.218 1.00 0.00 ? 332  ARG A O  1 
ATOM 1295   C CB . ARG A 1 332  ? 1113.500 713.536 782.008 1.00 0.00 ? 332  ARG A CB 1 
ATOM 1296   N N  . THR A 1 333  ? 1113.454 716.214 783.380 1.00 0.00 ? 333  THR A N  1 
ATOM 1297   C CA . THR A 1 333  ? 1112.829 717.447 783.773 1.00 0.00 ? 333  THR A CA 1 
ATOM 1298   C C  . THR A 1 333  ? 1113.837 718.504 783.484 1.00 0.00 ? 333  THR A C  1 
ATOM 1299   O O  . THR A 1 333  ? 1113.490 719.622 783.108 1.00 0.00 ? 333  THR A O  1 
ATOM 1300   C CB . THR A 1 333  ? 1112.473 717.478 785.232 1.00 0.00 ? 333  THR A CB 1 
ATOM 1301   N N  . ILE A 1 334  ? 1115.127 718.158 783.661 1.00 0.00 ? 334  ILE A N  1 
ATOM 1302   C CA . ILE A 1 334  ? 1116.169 719.084 783.347 1.00 0.00 ? 334  ILE A CA 1 
ATOM 1303   C C  . ILE A 1 334  ? 1116.501 718.853 781.902 1.00 0.00 ? 334  ILE A C  1 
ATOM 1304   O O  . ILE A 1 334  ? 1117.650 718.631 781.526 1.00 0.00 ? 334  ILE A O  1 
ATOM 1305   C CB . ILE A 1 334  ? 1117.393 718.816 784.197 1.00 0.00 ? 334  ILE A CB 1 
ATOM 1306   N N  . ASP A 1 335  ? 1115.477 718.951 781.029 1.00 0.00 ? 335  ASP A N  1 
ATOM 1307   C CA . ASP A 1 335  ? 1115.715 718.714 779.636 1.00 0.00 ? 335  ASP A CA 1 
ATOM 1308   C C  . ASP A 1 335  ? 1116.195 719.993 779.044 1.00 0.00 ? 335  ASP A C  1 
ATOM 1309   O O  . ASP A 1 335  ? 1116.102 721.049 779.667 1.00 0.00 ? 335  ASP A O  1 
ATOM 1310   C CB . ASP A 1 335  ? 1114.472 718.269 778.848 1.00 0.00 ? 335  ASP A CB 1 
ATOM 1311   N N  . ARG A 1 336  ? 1116.745 719.929 777.819 1.00 0.00 ? 336  ARG A N  1 
ATOM 1312   C CA . ARG A 1 336  ? 1117.250 721.129 777.231 1.00 0.00 ? 336  ARG A CA 1 
ATOM 1313   C C  . ARG A 1 336  ? 1116.129 722.082 776.962 1.00 0.00 ? 336  ARG A C  1 
ATOM 1314   O O  . ARG A 1 336  ? 1116.223 723.265 777.281 1.00 0.00 ? 336  ARG A O  1 
ATOM 1315   C CB . ARG A 1 336  ? 1118.008 720.919 775.908 1.00 0.00 ? 336  ARG A CB 1 
ATOM 1316   N N  . SER A 1 337  ? 1115.031 721.583 776.368 1.00 0.00 ? 337  SER A N  1 
ATOM 1317   C CA . SER A 1 337  ? 1113.940 722.452 776.038 1.00 0.00 ? 337  SER A CA 1 
ATOM 1318   C C  . SER A 1 337  ? 1113.302 722.946 777.294 1.00 0.00 ? 337  SER A C  1 
ATOM 1319   O O  . SER A 1 337  ? 1113.069 724.143 777.460 1.00 0.00 ? 337  SER A O  1 
ATOM 1320   C CB . SER A 1 337  ? 1112.848 721.748 775.211 1.00 0.00 ? 337  SER A CB 1 
ATOM 1321   N N  . VAL A 1 338  ? 1113.026 722.017 778.225 1.00 0.00 ? 338  VAL A N  1 
ATOM 1322   C CA . VAL A 1 338  ? 1112.332 722.309 779.443 1.00 0.00 ? 338  VAL A CA 1 
ATOM 1323   C C  . VAL A 1 338  ? 1113.148 723.204 780.324 1.00 0.00 ? 338  VAL A C  1 
ATOM 1324   O O  . VAL A 1 338  ? 1112.604 724.068 781.009 1.00 0.00 ? 338  VAL A O  1 
ATOM 1325   C CB . VAL A 1 338  ? 1112.012 721.079 780.238 1.00 0.00 ? 338  VAL A CB 1 
ATOM 1326   N N  . PHE A 1 339  ? 1114.481 723.030 780.321 1.00 0.00 ? 339  PHE A N  1 
ATOM 1327   C CA . PHE A 1 339  ? 1115.324 723.707 781.267 1.00 0.00 ? 339  PHE A CA 1 
ATOM 1328   C C  . PHE A 1 339  ? 1115.182 725.191 781.225 1.00 0.00 ? 339  PHE A C  1 
ATOM 1329   O O  . PHE A 1 339  ? 1115.435 725.854 780.221 1.00 0.00 ? 339  PHE A O  1 
ATOM 1330   C CB . PHE A 1 339  ? 1116.816 723.386 781.084 1.00 0.00 ? 339  PHE A CB 1 
ATOM 1331   N N  . LYS A 1 340  ? 1114.770 725.751 782.377 1.00 0.00 ? 340  LYS A N  1 
ATOM 1332   C CA . LYS A 1 340  ? 1114.720 727.163 782.576 1.00 0.00 ? 340  LYS A CA 1 
ATOM 1333   C C  . LYS A 1 340  ? 1114.825 727.331 784.049 1.00 0.00 ? 340  LYS A C  1 
ATOM 1334   O O  . LYS A 1 340  ? 1114.800 726.370 784.816 1.00 0.00 ? 340  LYS A O  1 
ATOM 1335   C CB . LYS A 1 340  ? 1113.418 727.847 782.130 1.00 0.00 ? 340  LYS A CB 1 
ATOM 1336   N N  . ILE A 1 342  ? 1116.253 729.680 784.573 1.00 0.00 ? 342  ILE A N  1 
ATOM 1337   C CA . ILE A 1 342  ? 1116.101 729.254 785.932 1.00 0.00 ? 342  ILE A CA 1 
ATOM 1338   C C  . ILE A 1 342  ? 1115.138 730.195 786.563 1.00 0.00 ? 342  ILE A C  1 
ATOM 1339   O O  . ILE A 1 342  ? 1115.194 731.403 786.336 1.00 0.00 ? 342  ILE A O  1 
ATOM 1340   C CB . ILE A 1 342  ? 1117.383 729.352 786.707 1.00 0.00 ? 342  ILE A CB 1 
ATOM 1341   N N  . VAL A 1 343  ? 1114.188 729.643 787.331 1.00 0.00 ? 343  VAL A N  1 
ATOM 1342   C CA . VAL A 1 343  ? 1113.196 730.447 787.976 1.00 0.00 ? 343  VAL A CA 1 
ATOM 1343   C C  . VAL A 1 343  ? 1113.813 731.377 788.973 1.00 0.00 ? 343  VAL A C  1 
ATOM 1344   O O  . VAL A 1 343  ? 1113.618 732.588 788.899 1.00 0.00 ? 343  VAL A O  1 
ATOM 1345   C CB . VAL A 1 343  ? 1112.234 729.618 788.754 1.00 0.00 ? 343  VAL A CB 1 
ATOM 1346   N N  . GLN A 1 344  ? 1114.592 730.835 789.930 1.00 0.00 ? 344  GLN A N  1 
ATOM 1347   C CA . GLN A 1 344  ? 1115.106 731.689 790.959 1.00 0.00 ? 344  GLN A CA 1 
ATOM 1348   C C  . GLN A 1 344  ? 1116.384 731.105 791.460 1.00 0.00 ? 344  GLN A C  1 
ATOM 1349   O O  . GLN A 1 344  ? 1116.668 729.923 791.272 1.00 0.00 ? 344  GLN A O  1 
ATOM 1350   C CB . GLN A 1 344  ? 1114.162 731.797 792.172 1.00 0.00 ? 344  GLN A CB 1 
ATOM 1351   N N  . ILE A 1 345  ? 1117.202 731.953 792.105 1.00 0.00 ? 345  ILE A N  1 
ATOM 1352   C CA . ILE A 1 345  ? 1118.445 731.527 792.671 1.00 0.00 ? 345  ILE A CA 1 
ATOM 1353   C C  . ILE A 1 345  ? 1118.471 732.038 794.076 1.00 0.00 ? 345  ILE A C  1 
ATOM 1354   O O  . ILE A 1 345  ? 1117.993 733.137 794.357 1.00 0.00 ? 345  ILE A O  1 
ATOM 1355   C CB . ILE A 1 345  ? 1119.617 732.069 791.909 1.00 0.00 ? 345  ILE A CB 1 
ATOM 1356   N N  . ALA A 1 346  ? 1118.997 731.232 795.018 1.00 0.00 ? 346  ALA A N  1 
ATOM 1357   C CA . ALA A 1 346  ? 1119.071 731.706 796.367 1.00 0.00 ? 346  ALA A CA 1 
ATOM 1358   C C  . ALA A 1 346  ? 1120.411 731.318 796.901 1.00 0.00 ? 346  ALA A C  1 
ATOM 1359   O O  . ALA A 1 346  ? 1120.901 730.218 796.649 1.00 0.00 ? 346  ALA A O  1 
ATOM 1360   C CB . ALA A 1 346  ? 1118.009 731.093 797.296 1.00 0.00 ? 346  ALA A CB 1 
ATOM 1361   N N  . VAL A 1 347  ? 1121.038 732.231 797.663 1.00 0.00 ? 347  VAL A N  1 
ATOM 1362   C CA . VAL A 1 347  ? 1122.331 731.960 798.214 1.00 0.00 ? 347  VAL A CA 1 
ATOM 1363   C C  . VAL A 1 347  ? 1122.141 731.258 799.518 1.00 0.00 ? 347  VAL A C  1 
ATOM 1364   O O  . VAL A 1 347  ? 1121.123 731.429 800.187 1.00 0.00 ? 347  VAL A O  1 
ATOM 1365   C CB . VAL A 1 347  ? 1123.136 733.198 798.480 1.00 0.00 ? 347  VAL A CB 1 
ATOM 1366   N N  . ILE A 1 348  ? 1123.124 730.419 799.898 1.00 0.00 ? 348  ILE A N  1 
ATOM 1367   C CA . ILE A 1 348  ? 1123.068 729.714 801.142 1.00 0.00 ? 348  ILE A CA 1 
ATOM 1368   C C  . ILE A 1 348  ? 1124.209 730.203 801.976 1.00 0.00 ? 348  ILE A C  1 
ATOM 1369   O O  . ILE A 1 348  ? 1125.329 730.355 801.492 1.00 0.00 ? 348  ILE A O  1 
ATOM 1370   C CB . ILE A 1 348  ? 1123.200 728.225 800.994 1.00 0.00 ? 348  ILE A CB 1 
ATOM 1371   N N  . GLU A 1 349  ? 1123.931 730.487 803.264 1.00 0.00 ? 349  GLU A N  1 
ATOM 1372   C CA . GLU A 1 349  ? 1124.933 731.004 804.151 1.00 0.00 ? 349  GLU A CA 1 
ATOM 1373   C C  . GLU A 1 349  ? 1125.890 729.915 804.494 1.00 0.00 ? 349  GLU A C  1 
ATOM 1374   O O  . GLU A 1 349  ? 1125.532 728.740 804.549 1.00 0.00 ? 349  GLU A O  1 
ATOM 1375   C CB . GLU A 1 349  ? 1124.356 731.546 805.468 1.00 0.00 ? 349  GLU A CB 1 
ATOM 1376   N N  . ASN A 1 350  ? 1127.158 730.301 804.726 1.00 0.00 ? 350  ASN A N  1 
ATOM 1377   C CA . ASN A 1 350  ? 1128.178 729.366 805.098 1.00 0.00 ? 350  ASN A CA 1 
ATOM 1378   C C  . ASN A 1 350  ? 1127.827 728.826 806.443 1.00 0.00 ? 350  ASN A C  1 
ATOM 1379   O O  . ASN A 1 350  ? 1128.151 727.687 806.773 1.00 0.00 ? 350  ASN A O  1 
ATOM 1380   C CB . ASN A 1 350  ? 1129.607 729.960 805.110 1.00 0.00 ? 350  ASN A CB 1 
ATOM 1381   N N  . SER A 1 351  ? 1127.145 729.645 807.262 1.00 0.00 ? 351  SER A N  1 
ATOM 1382   C CA . SER A 1 351  ? 1126.748 729.222 808.569 1.00 0.00 ? 351  SER A CA 1 
ATOM 1383   C C  . SER A 1 351  ? 1125.892 728.005 808.419 1.00 0.00 ? 351  SER A C  1 
ATOM 1384   O O  . SER A 1 351  ? 1126.061 727.028 809.147 1.00 0.00 ? 351  SER A O  1 
ATOM 1385   C CB . SER A 1 351  ? 1125.905 730.286 809.289 1.00 0.00 ? 351  SER A CB 1 
ATOM 1386   N N  . GLU A 1 352  ? 1124.929 728.040 807.477 1.00 0.00 ? 352  GLU A N  1 
ATOM 1387   C CA . GLU A 1 352  ? 1124.054 726.919 807.291 1.00 0.00 ? 352  GLU A CA 1 
ATOM 1388   C C  . GLU A 1 352  ? 1124.822 725.753 806.747 1.00 0.00 ? 352  GLU A C  1 
ATOM 1389   O O  . GLU A 1 352  ? 1124.713 724.639 807.255 1.00 0.00 ? 352  GLU A O  1 
ATOM 1390   C CB . GLU A 1 352  ? 1122.904 727.240 806.321 1.00 0.00 ? 352  GLU A CB 1 
ATOM 1391   N N  . SER A 1 353  ? 1125.625 725.985 805.689 1.00 0.00 ? 353  SER A N  1 
ATOM 1392   C CA . SER A 1 353  ? 1126.417 724.925 805.131 1.00 0.00 ? 353  SER A CA 1 
ATOM 1393   C C  . SER A 1 353  ? 1127.691 725.549 804.671 1.00 0.00 ? 353  SER A C  1 
ATOM 1394   O O  . SER A 1 353  ? 1127.682 726.565 803.978 1.00 0.00 ? 353  SER A O  1 
ATOM 1395   C CB . SER A 1 353  ? 1125.772 724.260 803.901 1.00 0.00 ? 353  SER A CB 1 
ATOM 1396   N N  . LEU A 1 354  ? 1128.838 724.959 805.054 1.00 0.00 ? 354  LEU A N  1 
ATOM 1397   C CA . LEU A 1 354  ? 1130.091 725.540 804.678 1.00 0.00 ? 354  LEU A CA 1 
ATOM 1398   C C  . LEU A 1 354  ? 1130.238 725.428 803.191 1.00 0.00 ? 354  LEU A C  1 
ATOM 1399   O O  . LEU A 1 354  ? 1130.563 726.401 802.511 1.00 0.00 ? 354  LEU A O  1 
ATOM 1400   C CB . LEU A 1 354  ? 1131.276 724.816 805.358 1.00 0.00 ? 354  LEU A CB 1 
ATOM 1401   N N  . ASP A 1 355  ? 1129.992 724.218 802.657 1.00 0.00 ? 355  ASP A N  1 
ATOM 1402   C CA . ASP A 1 355  ? 1130.217 723.909 801.273 1.00 0.00 ? 355  ASP A CA 1 
ATOM 1403   C C  . ASP A 1 355  ? 1129.240 724.534 800.314 1.00 0.00 ? 355  ASP A C  1 
ATOM 1404   O O  . ASP A 1 355  ? 1129.653 725.071 799.287 1.00 0.00 ? 355  ASP A O  1 
ATOM 1405   C CB . ASP A 1 355  ? 1130.208 722.395 801.007 1.00 0.00 ? 355  ASP A CB 1 
ATOM 1406   N N  . CYS A 1 356  ? 1127.927 724.519 800.619 1.00 0.00 ? 356  CYS A N  1 
ATOM 1407   C CA . CYS A 1 356  ? 1126.984 724.878 799.589 1.00 0.00 ? 356  CYS A CA 1 
ATOM 1408   C C  . CYS A 1 356  ? 1126.761 726.353 799.482 1.00 0.00 ? 356  CYS A C  1 
ATOM 1409   O O  . CYS A 1 356  ? 1126.234 726.979 800.399 1.00 0.00 ? 356  CYS A O  1 
ATOM 1410   C CB . CYS A 1 356  ? 1125.607 724.221 799.776 1.00 0.00 ? 356  CYS A CB 1 
ATOM 1411   N N  . GLN A 1 357  ? 1127.218 726.947 798.355 1.00 0.00 ? 357  GLN A N  1 
ATOM 1412   C CA . GLN A 1 357  ? 1126.995 728.338 798.066 1.00 0.00 ? 357  GLN A CA 1 
ATOM 1413   C C  . GLN A 1 357  ? 1125.619 728.682 797.573 1.00 0.00 ? 357  GLN A C  1 
ATOM 1414   O O  . GLN A 1 357  ? 1125.029 729.650 798.045 1.00 0.00 ? 357  GLN A O  1 
ATOM 1415   C CB . GLN A 1 357  ? 1127.941 728.950 797.025 1.00 0.00 ? 357  GLN A CB 1 
ATOM 1416   N N  . LEU A 1 358  ? 1125.054 727.915 796.617 1.00 0.00 ? 358  LEU A N  1 
ATOM 1417   C CA . LEU A 1 358  ? 1123.861 728.442 796.006 1.00 0.00 ? 358  LEU A CA 1 
ATOM 1418   C C  . LEU A 1 358  ? 1122.869 727.350 795.742 1.00 0.00 ? 358  LEU A C  1 
ATOM 1419   O O  . LEU A 1 358  ? 1123.227 726.181 795.621 1.00 0.00 ? 358  LEU A O  1 
ATOM 1420   C CB . LEU A 1 358  ? 1124.182 729.098 794.650 1.00 0.00 ? 358  LEU A CB 1 
ATOM 1421   N N  . LEU A 1 359  ? 1121.571 727.725 795.667 1.00 0.00 ? 359  LEU A N  1 
ATOM 1422   C CA . LEU A 1 359  ? 1120.543 726.779 795.340 1.00 0.00 ? 359  LEU A CA 1 
ATOM 1423   C C  . LEU A 1 359  ? 1119.825 727.358 794.159 1.00 0.00 ? 359  LEU A C  1 
ATOM 1424   O O  . LEU A 1 359  ? 1119.476 728.537 794.164 1.00 0.00 ? 359  LEU A O  1 
ATOM 1425   C CB . LEU A 1 359  ? 1119.506 726.590 796.468 1.00 0.00 ? 359  LEU A CB 1 
ATOM 1426   N N  . ALA A 1 360  ? 1119.603 726.557 793.097 1.00 0.00 ? 360  ALA A N  1 
ATOM 1427   C CA . ALA A 1 360  ? 1118.909 727.085 791.959 1.00 0.00 ? 360  ALA A CA 1 
ATOM 1428   C C  . ALA A 1 360  ? 1117.570 726.422 791.867 1.00 0.00 ? 360  ALA A C  1 
ATOM 1429   O O  . ALA A 1 360  ? 1117.444 725.214 792.060 1.00 0.00 ? 360  ALA A O  1 
ATOM 1430   C CB . ALA A 1 360  ? 1119.634 726.839 790.624 1.00 0.00 ? 360  ALA A CB 1 
ATOM 1431   N N  . VAL A 1 361  ? 1116.518 727.217 791.583 1.00 0.00 ? 361  VAL A N  1 
ATOM 1432   C CA . VAL A 1 361  ? 1115.205 726.665 791.425 1.00 0.00 ? 361  VAL A CA 1 
ATOM 1433   C C  . VAL A 1 361  ? 1114.842 726.810 789.983 1.00 0.00 ? 361  VAL A C  1 
ATOM 1434   O O  . VAL A 1 361  ? 1114.934 727.895 789.411 1.00 0.00 ? 361  VAL A O  1 
ATOM 1435   C CB . VAL A 1 361  ? 1114.150 727.351 792.245 1.00 0.00 ? 361  VAL A CB 1 
ATOM 1436   N N  . THR A 1 362  ? 1114.431 725.696 789.353 1.00 0.00 ? 362  THR A N  1 
ATOM 1437   C CA . THR A 1 362  ? 1114.099 725.716 787.960 1.00 0.00 ? 362  THR A CA 1 
ATOM 1438   C C  . THR A 1 362  ? 1112.626 725.933 787.825 1.00 0.00 ? 362  THR A C  1 
ATOM 1439   O O  . THR A 1 362  ? 1111.881 725.945 788.803 1.00 0.00 ? 362  THR A O  1 
ATOM 1440   C CB . THR A 1 362  ? 1114.416 724.427 787.260 1.00 0.00 ? 362  THR A CB 1 
ATOM 1441   N N  . HIS A 1 363  ? 1112.182 726.116 786.571 1.00 0.00 ? 363  HIS A N  1 
ATOM 1442   C CA . HIS A 1 363  ? 1110.803 726.333 786.244 1.00 0.00 ? 363  HIS A CA 1 
ATOM 1443   C C  . HIS A 1 363  ? 1110.069 725.079 786.607 1.00 0.00 ? 363  HIS A C  1 
ATOM 1444   O O  . HIS A 1 363  ? 1108.919 725.114 787.037 1.00 0.00 ? 363  HIS A O  1 
ATOM 1445   C CB . HIS A 1 363  ? 1110.622 726.609 784.743 1.00 0.00 ? 363  HIS A CB 1 
ATOM 1446   N N  . ALA A 1 364  ? 1110.740 723.928 786.427 1.00 0.00 ? 364  ALA A N  1 
ATOM 1447   C CA . ALA A 1 364  ? 1110.215 722.625 786.727 1.00 0.00 ? 364  ALA A CA 1 
ATOM 1448   C C  . ALA A 1 364  ? 1109.961 722.541 788.199 1.00 0.00 ? 364  ALA A C  1 
ATOM 1449   O O  . ALA A 1 364  ? 1109.076 721.814 788.642 1.00 0.00 ? 364  ALA A O  1 
ATOM 1450   C CB . ALA A 1 364  ? 1111.183 721.488 786.352 1.00 0.00 ? 364  ALA A CB 1 
ATOM 1451   N N  . GLY A 1 365  ? 1110.754 723.264 789.012 1.00 0.00 ? 365  GLY A N  1 
ATOM 1452   C CA . GLY A 1 365  ? 1110.545 723.201 790.427 1.00 0.00 ? 365  GLY A CA 1 
ATOM 1453   C C  . GLY A 1 365  ? 1111.613 722.338 791.024 1.00 0.00 ? 365  GLY A C  1 
ATOM 1454   O O  . GLY A 1 365  ? 1111.548 721.986 792.201 1.00 0.00 ? 365  GLY A O  1 
ATOM 1455   N N  . VAL A 1 366  ? 1112.619 721.959 790.213 1.00 0.00 ? 366  VAL A N  1 
ATOM 1456   C CA . VAL A 1 366  ? 1113.708 721.163 790.703 1.00 0.00 ? 366  VAL A CA 1 
ATOM 1457   C C  . VAL A 1 366  ? 1114.642 722.075 791.445 1.00 0.00 ? 366  VAL A C  1 
ATOM 1458   O O  . VAL A 1 366  ? 1114.803 723.242 791.089 1.00 0.00 ? 366  VAL A O  1 
ATOM 1459   C CB . VAL A 1 366  ? 1114.488 720.498 789.607 1.00 0.00 ? 366  VAL A CB 1 
ATOM 1460   N N  . ARG A 1 367  ? 1115.275 721.558 792.518 1.00 0.00 ? 367  ARG A N  1 
ATOM 1461   C CA . ARG A 1 367  ? 1116.163 722.354 793.322 1.00 0.00 ? 367  ARG A CA 1 
ATOM 1462   C C  . ARG A 1 367  ? 1117.546 721.827 793.107 1.00 0.00 ? 367  ARG A C  1 
ATOM 1463   O O  . ARG A 1 367  ? 1117.797 720.633 793.261 1.00 0.00 ? 367  ARG A O  1 
ATOM 1464   C CB . ARG A 1 367  ? 1115.810 722.236 794.812 1.00 0.00 ? 367  ARG A CB 1 
ATOM 1465   N N  . LEU A 1 368  ? 1118.485 722.718 792.730 1.00 0.00 ? 368  LEU A N  1 
ATOM 1466   C CA . LEU A 1 368  ? 1119.832 722.298 792.466 1.00 0.00 ? 368  LEU A CA 1 
ATOM 1467   C C  . LEU A 1 368  ? 1120.714 722.926 793.501 1.00 0.00 ? 368  LEU A C  1 
ATOM 1468   O O  . LEU A 1 368  ? 1120.556 724.100 793.829 1.00 0.00 ? 368  LEU A O  1 
ATOM 1469   C CB . LEU A 1 368  ? 1120.343 722.769 791.096 1.00 0.00 ? 368  LEU A CB 1 
ATOM 1470   N N  . TYR A 1 369  ? 1121.676 722.154 794.047 1.00 0.00 ? 369  TYR A N  1 
ATOM 1471   C CA . TYR A 1 369  ? 1122.545 722.693 795.056 1.00 0.00 ? 369  TYR A CA 1 
ATOM 1472   C C  . TYR A 1 369  ? 1123.951 722.623 794.546 1.00 0.00 ? 369  TYR A C  1 
ATOM 1473   O O  . TYR A 1 369  ? 1124.368 721.604 793.996 1.00 0.00 ? 369  TYR A O  1 
ATOM 1474   C CB . TYR A 1 369  ? 1122.502 721.916 796.384 1.00 0.00 ? 369  TYR A CB 1 
ATOM 1475   N N  . PHE A 1 370  ? 1124.722 723.722 794.713 1.00 0.00 ? 370  PHE A N  1 
ATOM 1476   C CA . PHE A 1 370  ? 1126.072 723.751 794.215 1.00 0.00 ? 370  PHE A CA 1 
ATOM 1477   C C  . PHE A 1 370  ? 1127.010 724.096 795.336 1.00 0.00 ? 370  PHE A C  1 
ATOM 1478   O O  . PHE A 1 370  ? 1126.695 724.915 796.200 1.00 0.00 ? 370  PHE A O  1 
ATOM 1479   C CB . PHE A 1 370  ? 1126.302 724.826 793.137 1.00 0.00 ? 370  PHE A CB 1 
ATOM 1480   N N  . SER A 1 371  ? 1128.199 723.454 795.350 1.00 0.00 ? 371  SER A N  1 
ATOM 1481   C CA . SER A 1 371  ? 1129.215 723.718 796.337 1.00 0.00 ? 371  SER A CA 1 
ATOM 1482   C C  . SER A 1 371  ? 1130.245 724.616 795.716 1.00 0.00 ? 371  SER A C  1 
ATOM 1483   O O  . SER A 1 371  ? 1130.287 724.761 794.496 1.00 0.00 ? 371  SER A O  1 
ATOM 1484   C CB . SER A 1 371  ? 1129.945 722.447 796.807 1.00 0.00 ? 371  SER A CB 1 
ATOM 1485   N N  . THR A 1 372  ? 1131.099 725.259 796.546 1.00 0.00 ? 372  THR A N  1 
ATOM 1486   C CA . THR A 1 372  ? 1132.128 726.109 795.999 1.00 0.00 ? 372  THR A CA 1 
ATOM 1487   C C  . THR A 1 372  ? 1133.271 726.160 796.973 1.00 0.00 ? 372  THR A C  1 
ATOM 1488   O O  . THR A 1 372  ? 1133.233 725.525 798.025 1.00 0.00 ? 372  THR A O  1 
ATOM 1489   C CB . THR A 1 372  ? 1131.738 727.541 795.879 1.00 0.00 ? 372  THR A CB 1 
ATOM 1490   N N  . CYS A 1 373  ? 1134.338 726.915 796.612 1.00 0.00 ? 373  CYS A N  1 
ATOM 1491   C CA . CYS A 1 373  ? 1135.433 727.139 797.520 1.00 0.00 ? 373  CYS A CA 1 
ATOM 1492   C C  . CYS A 1 373  ? 1136.060 728.465 797.180 1.00 0.00 ? 373  CYS A C  1 
ATOM 1493   O O  . CYS A 1 373  ? 1136.590 728.659 796.086 1.00 0.00 ? 373  CYS A O  1 
ATOM 1494   C CB . CYS A 1 373  ? 1136.542 726.076 797.437 1.00 0.00 ? 373  CYS A CB 1 
ATOM 1495   N N  . PRO A 1 374  ? 1135.966 729.399 798.095 1.00 0.00 ? 374  PRO A N  1 
ATOM 1496   C CA . PRO A 1 374  ? 1136.564 730.699 797.901 1.00 0.00 ? 374  PRO A CA 1 
ATOM 1497   C C  . PRO A 1 374  ? 1137.956 730.774 798.453 1.00 0.00 ? 374  PRO A C  1 
ATOM 1498   O O  . PRO A 1 374  ? 1138.383 729.847 799.142 1.00 0.00 ? 374  PRO A O  1 
ATOM 1499   C CB . PRO A 1 374  ? 1135.631 731.707 798.575 1.00 0.00 ? 374  PRO A CB 1 
ATOM 1500   N N  . PHE A 1 375  ? 1138.672 731.875 798.148 1.00 0.00 ? 375  PHE A N  1 
ATOM 1501   C CA . PHE A 1 375  ? 1139.972 732.157 798.691 1.00 0.00 ? 375  PHE A CA 1 
ATOM 1502   C C  . PHE A 1 375  ? 1139.984 733.647 798.837 1.00 0.00 ? 375  PHE A C  1 
ATOM 1503   O O  . PHE A 1 375  ? 1139.009 734.287 798.443 1.00 0.00 ? 375  PHE A O  1 
ATOM 1504   C CB . PHE A 1 375  ? 1141.140 731.736 797.779 1.00 0.00 ? 375  PHE A CB 1 
ATOM 1505   N N  . ARG A 1 376  ? 1141.050 734.238 799.426 1.00 0.00 ? 376  ARG A N  1 
ATOM 1506   C CA . ARG A 1 376  ? 1141.047 735.669 799.589 1.00 0.00 ? 376  ARG A CA 1 
ATOM 1507   C C  . ARG A 1 376  ? 1140.885 736.244 798.227 1.00 0.00 ? 376  ARG A C  1 
ATOM 1508   O O  . ARG A 1 376  ? 1139.858 736.840 797.910 1.00 0.00 ? 376  ARG A O  1 
ATOM 1509   C CB . ARG A 1 376  ? 1142.371 736.217 800.156 1.00 0.00 ? 376  ARG A CB 1 
ATOM 1510   N N  . ALA A 1 380  ? 1142.562 735.855 795.988 1.00 0.00 ? 380  ALA A N  1 
ATOM 1511   C CA . ALA A 1 380  ? 1141.446 736.482 795.354 1.00 0.00 ? 380  ALA A CA 1 
ATOM 1512   C C  . ALA A 1 380  ? 1141.076 735.510 794.288 1.00 0.00 ? 380  ALA A C  1 
ATOM 1513   O O  . ALA A 1 380  ? 1141.689 735.490 793.220 1.00 0.00 ? 380  ALA A O  1 
ATOM 1514   C CB . ALA A 1 380  ? 1141.777 737.827 794.684 1.00 0.00 ? 380  ALA A CB 1 
ATOM 1515   N N  . ARG A 1 381  ? 1140.072 734.654 794.551 1.00 0.00 ? 381  ARG A N  1 
ATOM 1516   C CA . ARG A 1 381  ? 1139.734 733.708 793.533 1.00 0.00 ? 381  ARG A CA 1 
ATOM 1517   C C  . ARG A 1 381  ? 1138.579 732.883 793.991 1.00 0.00 ? 381  ARG A C  1 
ATOM 1518   O O  . ARG A 1 381  ? 1138.540 732.371 795.109 1.00 0.00 ? 381  ARG A O  1 
ATOM 1519   C CB . ARG A 1 381  ? 1140.882 732.734 793.215 1.00 0.00 ? 381  ARG A CB 1 
ATOM 1520   N N  . PRO A 1 382  ? 1137.624 732.797 793.116 1.00 0.00 ? 382  PRO A N  1 
ATOM 1521   C CA . PRO A 1 382  ? 1136.476 731.962 793.339 1.00 0.00 ? 382  PRO A CA 1 
ATOM 1522   C C  . PRO A 1 382  ? 1136.756 730.609 792.776 1.00 0.00 ? 382  PRO A C  1 
ATOM 1523   O O  . PRO A 1 382  ? 1137.750 730.449 792.068 1.00 0.00 ? 382  PRO A O  1 
ATOM 1524   C CB . PRO A 1 382  ? 1135.299 732.658 792.651 1.00 0.00 ? 382  PRO A CB 1 
ATOM 1525   N N  . ASN A 1 383  ? 1135.900 729.619 793.076 1.00 0.00 ? 383  ASN A N  1 
ATOM 1526   C CA . ASN A 1 383  ? 1136.087 728.321 792.501 1.00 0.00 ? 383  ASN A CA 1 
ATOM 1527   C C  . ASN A 1 383  ? 1134.864 728.066 791.687 1.00 0.00 ? 383  ASN A C  1 
ATOM 1528   O O  . ASN A 1 383  ? 1133.799 728.612 791.975 1.00 0.00 ? 383  ASN A O  1 
ATOM 1529   C CB . ASN A 1 383  ? 1136.192 727.198 793.544 1.00 0.00 ? 383  ASN A CB 1 
ATOM 1530   N N  . THR A 1 384  ? 1134.980 727.243 790.631 1.00 0.00 ? 384  THR A N  1 
ATOM 1531   C CA . THR A 1 384  ? 1133.813 726.994 789.836 1.00 0.00 ? 384  THR A CA 1 
ATOM 1532   C C  . THR A 1 384  ? 1132.877 726.193 790.678 1.00 0.00 ? 384  THR A C  1 
ATOM 1533   O O  . THR A 1 384  ? 1133.299 725.355 791.473 1.00 0.00 ? 384  THR A O  1 
ATOM 1534   C CB . THR A 1 384  ? 1134.077 726.225 788.574 1.00 0.00 ? 384  THR A CB 1 
ATOM 1535   N N  . LEU A 1 385  ? 1131.565 726.453 790.531 1.00 0.00 ? 385  LEU A N  1 
ATOM 1536   C CA . LEU A 1 385  ? 1130.590 725.785 791.342 1.00 0.00 ? 385  LEU A CA 1 
ATOM 1537   C C  . LEU A 1 385  ? 1130.393 724.396 790.823 1.00 0.00 ? 385  LEU A C  1 
ATOM 1538   O O  . LEU A 1 385  ? 1130.534 724.135 789.629 1.00 0.00 ? 385  LEU A O  1 
ATOM 1539   C CB . LEU A 1 385  ? 1129.216 726.478 791.338 1.00 0.00 ? 385  LEU A CB 1 
ATOM 1540   N N  . THR A 1 386  ? 1130.071 723.454 791.732 1.00 0.00 ? 386  THR A N  1 
ATOM 1541   C CA . THR A 1 386  ? 1129.822 722.104 791.320 1.00 0.00 ? 386  THR A CA 1 
ATOM 1542   C C  . THR A 1 386  ? 1128.443 721.760 791.777 1.00 0.00 ? 386  THR A C  1 
ATOM 1543   O O  . THR A 1 386  ? 1127.937 722.337 792.738 1.00 0.00 ? 386  THR A O  1 
ATOM 1544   C CB . THR A 1 386  ? 1130.760 721.102 791.926 1.00 0.00 ? 386  THR A CB 1 
ATOM 1545   N N  . LEU A 1 387  ? 1127.784 720.808 791.085 1.00 0.00 ? 387  LEU A N  1 
ATOM 1546   C CA . LEU A 1 387  ? 1126.443 720.463 791.468 1.00 0.00 ? 387  LEU A CA 1 
ATOM 1547   C C  . LEU A 1 387  ? 1126.509 719.388 792.502 1.00 0.00 ? 387  LEU A C  1 
ATOM 1548   O O  . LEU A 1 387  ? 1126.779 718.227 792.195 1.00 0.00 ? 387  LEU A O  1 
ATOM 1549   C CB . LEU A 1 387  ? 1125.588 719.927 790.310 1.00 0.00 ? 387  LEU A CB 1 
ATOM 1550   N N  . VAL A 1 388  ? 1126.293 719.776 793.774 1.00 0.00 ? 388  VAL A N  1 
ATOM 1551   C CA . VAL A 1 388  ? 1126.318 718.857 794.873 1.00 0.00 ? 388  VAL A CA 1 
ATOM 1552   C C  . VAL A 1 388  ? 1125.127 717.944 794.862 1.00 0.00 ? 388  VAL A C  1 
ATOM 1553   O O  . VAL A 1 388  ? 1125.279 716.728 794.958 1.00 0.00 ? 388  VAL A O  1 
ATOM 1554   C CB . VAL A 1 388  ? 1126.321 719.547 796.205 1.00 0.00 ? 388  VAL A CB 1 
ATOM 1555   N N  . HIS A 1 389  ? 1123.900 718.498 794.727 1.00 0.00 ? 389  HIS A N  1 
ATOM 1556   C CA . HIS A 1 389  ? 1122.766 717.625 794.867 1.00 0.00 ? 389  HIS A CA 1 
ATOM 1557   C C  . HIS A 1 389  ? 1121.588 718.199 794.139 1.00 0.00 ? 389  HIS A C  1 
ATOM 1558   O O  . HIS A 1 389  ? 1121.590 719.365 793.747 1.00 0.00 ? 389  HIS A O  1 
ATOM 1559   C CB . HIS A 1 389  ? 1122.366 717.455 796.345 1.00 0.00 ? 389  HIS A CB 1 
ATOM 1560   N N  . VAL A 1 390  ? 1120.547 717.361 793.922 1.00 0.00 ? 390  VAL A N  1 
ATOM 1561   C CA . VAL A 1 390  ? 1119.351 717.798 793.260 1.00 0.00 ? 390  VAL A CA 1 
ATOM 1562   C C  . VAL A 1 390  ? 1118.169 717.222 793.977 1.00 0.00 ? 390  VAL A C  1 
ATOM 1563   O O  . VAL A 1 390  ? 1118.247 716.147 794.568 1.00 0.00 ? 390  VAL A O  1 
ATOM 1564   C CB . VAL A 1 390  ? 1119.265 717.344 791.832 1.00 0.00 ? 390  VAL A CB 1 
ATOM 1565   N N  . ARG A 1 391  ? 1117.033 717.950 793.956 1.00 0.00 ? 391  ARG A N  1 
ATOM 1566   C CA . ARG A 1 391  ? 1115.836 717.469 794.587 1.00 0.00 ? 391  ARG A CA 1 
ATOM 1567   C C  . ARG A 1 391  ? 1114.738 717.621 793.583 1.00 0.00 ? 391  ARG A C  1 
ATOM 1568   O O  . ARG A 1 391  ? 1114.727 718.578 792.808 1.00 0.00 ? 391  ARG A O  1 
ATOM 1569   C CB . ARG A 1 391  ? 1115.446 718.278 795.839 1.00 0.00 ? 391  ARG A CB 1 
ATOM 1570   N N  . LEU A 1 392  ? 1113.785 716.668 793.561 1.00 0.00 ? 392  LEU A N  1 
ATOM 1571   C CA . LEU A 1 392  ? 1112.721 716.724 792.597 1.00 0.00 ? 392  LEU A CA 1 
ATOM 1572   C C  . LEU A 1 392  ? 1111.434 717.010 793.303 1.00 0.00 ? 392  LEU A C  1 
ATOM 1573   O O  . LEU A 1 392  ? 1111.272 716.769 794.499 1.00 0.00 ? 392  LEU A O  1 
ATOM 1574   C CB . LEU A 1 392  ? 1112.528 715.423 791.801 1.00 0.00 ? 392  LEU A CB 1 
ATOM 1575   N N  . PRO A 1 393  ? 1110.526 717.566 792.546 1.00 0.00 ? 393  PRO A N  1 
ATOM 1576   C CA . PRO A 1 393  ? 1109.224 717.904 793.061 1.00 0.00 ? 393  PRO A CA 1 
ATOM 1577   C C  . PRO A 1 393  ? 1108.400 716.695 793.322 1.00 0.00 ? 393  PRO A C  1 
ATOM 1578   O O  . PRO A 1 393  ? 1108.512 715.737 792.559 1.00 0.00 ? 393  PRO A O  1 
ATOM 1579   C CB . PRO A 1 393  ? 1108.592 718.794 792.000 1.00 0.00 ? 393  PRO A CB 1 
ATOM 1580   N N  . PRO A 1 394  ? 1107.620 716.683 794.365 1.00 0.00 ? 394  PRO A N  1 
ATOM 1581   C CA . PRO A 1 394  ? 1106.725 715.594 794.602 1.00 0.00 ? 394  PRO A CA 1 
ATOM 1582   C C  . PRO A 1 394  ? 1105.537 715.754 793.709 1.00 0.00 ? 394  PRO A C  1 
ATOM 1583   O O  . PRO A 1 394  ? 1104.698 716.602 794.008 1.00 0.00 ? 394  PRO A O  1 
ATOM 1584   C CB . PRO A 1 394  ? 1106.310 715.688 796.065 1.00 0.00 ? 394  PRO A CB 1 
ATOM 1585   N N  . GLY A 1 395  ? 1105.418 715.001 792.606 1.00 0.00 ? 395  GLY A N  1 
ATOM 1586   C CA . GLY A 1 395  ? 1104.126 714.995 791.991 1.00 0.00 ? 395  GLY A CA 1 
ATOM 1587   C C  . GLY A 1 395  ? 1103.455 714.158 792.995 1.00 0.00 ? 395  GLY A C  1 
ATOM 1588   O O  . GLY A 1 395  ? 1102.309 714.323 793.412 1.00 0.00 ? 395  GLY A O  1 
ATOM 1589   N N  . PHE A 1 396  ? 1104.314 713.207 793.363 1.00 0.00 ? 396  PHE A N  1 
ATOM 1590   C CA . PHE A 1 396  ? 1104.335 712.179 794.332 1.00 0.00 ? 396  PHE A CA 1 
ATOM 1591   C C  . PHE A 1 396  ? 1105.809 712.019 794.488 1.00 0.00 ? 396  PHE A C  1 
ATOM 1592   O O  . PHE A 1 396  ? 1106.340 712.237 795.577 1.00 0.00 ? 396  PHE A O  1 
ATOM 1593   C CB . PHE A 1 396  ? 1103.768 710.839 793.837 1.00 0.00 ? 396  PHE A CB 1 
ATOM 1594   N N  . SER A 1 397  ? 1106.480 711.701 793.343 1.00 0.00 ? 397  SER A N  1 
ATOM 1595   C CA . SER A 1 397  ? 1107.893 711.439 793.223 1.00 0.00 ? 397  SER A CA 1 
ATOM 1596   C C  . SER A 1 397  ? 1108.483 712.252 792.088 1.00 0.00 ? 397  SER A C  1 
ATOM 1597   O O  . SER A 1 397  ? 1108.030 713.358 791.794 1.00 0.00 ? 397  SER A O  1 
ATOM 1598   C CB . SER A 1 397  ? 1108.194 709.943 792.974 1.00 0.00 ? 397  SER A CB 1 
ATOM 1599   N N  . ALA A 1 398  ? 1109.538 711.703 791.439 1.00 0.00 ? 398  ALA A N  1 
ATOM 1600   C CA . ALA A 1 398  ? 1110.438 712.331 790.494 1.00 0.00 ? 398  ALA A CA 1 
ATOM 1601   C C  . ALA A 1 398  ? 1109.883 712.859 789.192 1.00 0.00 ? 398  ALA A C  1 
ATOM 1602   O O  . ALA A 1 398  ? 1110.202 713.986 788.824 1.00 0.00 ? 398  ALA A O  1 
ATOM 1603   C CB . ALA A 1 398  ? 1111.591 711.388 790.112 1.00 0.00 ? 398  ALA A CB 1 
ATOM 1604   N N  . SER A 1 399  ? 1109.052 712.107 788.445 1.00 0.00 ? 399  SER A N  1 
ATOM 1605   C CA . SER A 1 399  ? 1108.700 712.574 787.122 1.00 0.00 ? 399  SER A CA 1 
ATOM 1606   C C  . SER A 1 399  ? 1107.748 713.728 787.194 1.00 0.00 ? 399  SER A C  1 
ATOM 1607   O O  . SER A 1 399  ? 1107.410 714.338 786.181 1.00 0.00 ? 399  SER A O  1 
ATOM 1608   C CB . SER A 1 399  ? 1108.071 711.494 786.223 1.00 0.00 ? 399  SER A CB 1 
ATOM 1609   N N  . SER A 1 400  ? 1107.338 714.072 788.418 1.00 0.00 ? 400  SER A N  1 
ATOM 1610   C CA . SER A 1 400  ? 1106.344 715.050 788.753 1.00 0.00 ? 400  SER A CA 1 
ATOM 1611   C C  . SER A 1 400  ? 1106.327 716.248 787.860 1.00 0.00 ? 400  SER A C  1 
ATOM 1612   O O  . SER A 1 400  ? 1107.360 716.763 787.436 1.00 0.00 ? 400  SER A O  1 
ATOM 1613   C CB . SER A 1 400  ? 1106.583 715.631 790.140 1.00 0.00 ? 400  SER A CB 1 
ATOM 1614   N N  . THR A 1 401  ? 1105.093 716.703 787.545 1.00 0.00 ? 401  THR A N  1 
ATOM 1615   C CA . THR A 1 401  ? 1104.874 717.928 786.838 1.00 0.00 ? 401  THR A CA 1 
ATOM 1616   C C  . THR A 1 401  ? 1104.021 718.773 787.740 1.00 0.00 ? 401  THR A C  1 
ATOM 1617   O O  . THR A 1 401  ? 1103.375 719.720 787.291 1.00 0.00 ? 401  THR A O  1 
ATOM 1618   C CB . THR A 1 401  ? 1104.092 717.756 785.567 1.00 0.00 ? 401  THR A CB 1 
ATOM 1619   N N  . VAL A 1 402  ? 1104.011 718.460 789.052 1.00 0.00 ? 402  VAL A N  1 
ATOM 1620   C CA . VAL A 1 402  ? 1103.172 719.181 789.967 1.00 0.00 ? 402  VAL A CA 1 
ATOM 1621   C C  . VAL A 1 402  ? 1103.628 720.606 790.049 1.00 0.00 ? 402  VAL A C  1 
ATOM 1622   O O  . VAL A 1 402  ? 1102.820 721.532 790.018 1.00 0.00 ? 402  VAL A O  1 
ATOM 1623   C CB . VAL A 1 402  ? 1103.154 718.588 791.355 1.00 0.00 ? 402  VAL A CB 1 
ATOM 1624   N N  . GLU A 1 403  ? 1104.955 720.798 790.153 1.00 0.00 ? 403  GLU A N  1 
ATOM 1625   C CA . GLU A 1 403  ? 1105.594 722.075 790.296 1.00 0.00 ? 403  GLU A CA 1 
ATOM 1626   C C  . GLU A 1 403  ? 1105.581 722.819 789.003 1.00 0.00 ? 403  GLU A C  1 
ATOM 1627   O O  . GLU A 1 403  ? 1105.848 724.015 788.970 1.00 0.00 ? 403  GLU A O  1 
ATOM 1628   C CB . GLU A 1 403  ? 1107.015 721.972 790.867 1.00 0.00 ? 403  GLU A CB 1 
ATOM 1629   N N  . LYS A 1 404  ? 1105.362 722.119 787.881 1.00 0.00 ? 404  LYS A N  1 
ATOM 1630   C CA . LYS A 1 404  ? 1105.346 722.797 786.619 1.00 0.00 ? 404  LYS A CA 1 
ATOM 1631   C C  . LYS A 1 404  ? 1104.066 723.552 786.468 1.00 0.00 ? 404  LYS A C  1 
ATOM 1632   O O  . LYS A 1 404  ? 1102.988 723.012 786.711 1.00 0.00 ? 404  LYS A O  1 
ATOM 1633   C CB . LYS A 1 404  ? 1105.402 721.805 785.445 1.00 0.00 ? 404  LYS A CB 1 
ATOM 1634   N N  . PRO A 1 405  ? 1104.125 724.802 786.084 1.00 0.00 ? 405  PRO A N  1 
ATOM 1635   C CA . PRO A 1 405  ? 1105.380 725.521 786.038 1.00 0.00 ? 405  PRO A CA 1 
ATOM 1636   C C  . PRO A 1 405  ? 1105.639 726.200 787.354 1.00 0.00 ? 405  PRO A C  1 
ATOM 1637   O O  . PRO A 1 405  ? 1104.706 726.323 788.149 1.00 0.00 ? 405  PRO A O  1 
ATOM 1638   C CB . PRO A 1 405  ? 1105.263 726.515 784.888 1.00 0.00 ? 405  PRO A CB 1 
ATOM 1639   N N  . SER A 1 406  ? 1106.885 726.655 787.611 1.00 0.00 ? 406  SER A N  1 
ATOM 1640   C CA . SER A 1 406  ? 1107.188 727.298 788.858 1.00 0.00 ? 406  SER A CA 1 
ATOM 1641   C C  . SER A 1 406  ? 1107.644 728.687 788.534 1.00 0.00 ? 406  SER A C  1 
ATOM 1642   O O  . SER A 1 406  ? 1108.425 728.890 787.605 1.00 0.00 ? 406  SER A O  1 
ATOM 1643   C CB . SER A 1 406  ? 1108.294 726.583 789.650 1.00 0.00 ? 406  SER A CB 1 
ATOM 1644   N N  . LYS A 1 407  ? 1107.146 729.687 789.297 1.00 0.00 ? 407  LYS A N  1 
ATOM 1645   C CA . LYS A 1 407  ? 1107.469 731.063 789.034 1.00 0.00 ? 407  LYS A CA 1 
ATOM 1646   C C  . LYS A 1 407  ? 1108.630 731.492 789.881 1.00 0.00 ? 407  LYS A C  1 
ATOM 1647   O O  . LYS A 1 407  ? 1108.989 730.839 790.858 1.00 0.00 ? 407  LYS A O  1 
ATOM 1648   C CB . LYS A 1 407  ? 1106.321 732.055 789.318 1.00 0.00 ? 407  LYS A CB 1 
ATOM 1649   N N  . VAL A 1 408  ? 1109.227 732.640 789.490 1.00 0.00 ? 408  VAL A N  1 
ATOM 1650   C CA . VAL A 1 408  ? 1110.368 733.309 790.054 1.00 0.00 ? 408  VAL A CA 1 
ATOM 1651   C C  . VAL A 1 408  ? 1110.049 733.733 791.451 1.00 0.00 ? 408  VAL A C  1 
ATOM 1652   O O  . VAL A 1 408  ? 1110.940 733.895 792.285 1.00 0.00 ? 408  VAL A O  1 
ATOM 1653   C CB . VAL A 1 408  ? 1110.736 734.544 789.283 1.00 0.00 ? 408  VAL A CB 1 
ATOM 1654   N N  . HIS A 1 409  ? 1108.751 733.922 791.728 1.00 0.00 ? 409  HIS A N  1 
ATOM 1655   C CA . HIS A 1 409  ? 1108.229 734.360 792.988 1.00 0.00 ? 409  HIS A CA 1 
ATOM 1656   C C  . HIS A 1 409  ? 1108.738 733.439 794.055 1.00 0.00 ? 409  HIS A C  1 
ATOM 1657   O O  . HIS A 1 409  ? 1109.028 733.871 795.171 1.00 0.00 ? 409  HIS A O  1 
ATOM 1658   C CB . HIS A 1 409  ? 1106.702 734.253 792.957 1.00 0.00 ? 409  HIS A CB 1 
ATOM 1659   N N  . ARG A 1 410  ? 1108.863 732.141 793.726 1.00 0.00 ? 410  ARG A N  1 
ATOM 1660   C CA . ARG A 1 410  ? 1109.310 731.117 794.627 1.00 0.00 ? 410  ARG A CA 1 
ATOM 1661   C C  . ARG A 1 410  ? 1110.613 731.526 795.245 1.00 0.00 ? 410  ARG A C  1 
ATOM 1662   O O  . ARG A 1 410  ? 1111.448 732.160 794.601 1.00 0.00 ? 410  ARG A O  1 
ATOM 1663   C CB . ARG A 1 410  ? 1109.514 729.795 793.870 1.00 0.00 ? 410  ARG A CB 1 
ATOM 1664   N N  . ALA A 1 411  ? 1110.802 731.190 796.542 1.00 0.00 ? 411  ALA A N  1 
ATOM 1665   C CA . ALA A 1 411  ? 1112.015 731.554 797.218 1.00 0.00 ? 411  ALA A CA 1 
ATOM 1666   C C  . ALA A 1 411  ? 1112.271 730.559 798.305 1.00 0.00 ? 411  ALA A C  1 
ATOM 1667   O O  . ALA A 1 411  ? 1111.383 729.798 798.688 1.00 0.00 ? 411  ALA A O  1 
ATOM 1668   C CB . ALA A 1 411  ? 1111.960 732.941 797.880 1.00 0.00 ? 411  ALA A CB 1 
ATOM 1669   N N  . LEU A 1 412  ? 1113.521 730.532 798.817 1.00 0.00 ? 412  LEU A N  1 
ATOM 1670   C CA . LEU A 1 412  ? 1113.861 729.601 799.852 1.00 0.00 ? 412  LEU A CA 1 
ATOM 1671   C C  . LEU A 1 412  ? 1114.144 730.442 801.068 1.00 0.00 ? 412  LEU A C  1 
ATOM 1672   O O  . LEU A 1 412  ? 1114.811 731.474 800.986 1.00 0.00 ? 412  LEU A O  1 
ATOM 1673   C CB . LEU A 1 412  ? 1115.097 728.761 799.472 1.00 0.00 ? 412  LEU A CB 1 
ATOM 1674   N N  . TYR A 1 413  ? 1113.619 730.009 802.230 1.00 0.00 ? 413  TYR A N  1 
ATOM 1675   C CA . TYR A 1 413  ? 1113.632 730.704 803.492 1.00 0.00 ? 413  TYR A CA 1 
ATOM 1676   C C  . TYR A 1 413  ? 1114.816 730.152 804.218 1.00 0.00 ? 413  TYR A C  1 
ATOM 1677   O O  . TYR A 1 413  ? 1115.074 728.957 804.113 1.00 0.00 ? 413  TYR A O  1 
ATOM 1678   C CB . TYR A 1 413  ? 1112.416 730.252 804.311 1.00 0.00 ? 413  TYR A CB 1 
ATOM 1679   N N  . SER A 1 414  ? 1115.569 730.988 804.965 1.00 0.00 ? 414  SER A N  1 
ATOM 1680   C CA . SER A 1 414  ? 1116.715 730.460 805.653 1.00 0.00 ? 414  SER A CA 1 
ATOM 1681   C C  . SER A 1 414  ? 1116.263 729.350 806.527 1.00 0.00 ? 414  SER A C  1 
ATOM 1682   O O  . SER A 1 414  ? 1115.322 729.512 807.301 1.00 0.00 ? 414  SER A O  1 
ATOM 1683   C CB . SER A 1 414  ? 1117.458 731.466 806.545 1.00 0.00 ? 414  SER A CB 1 
ATOM 1684   N N  . LYS A 1 415  ? 1116.990 728.226 806.357 1.00 0.00 ? 415  LYS A N  1 
ATOM 1685   C CA . LYS A 1 415  ? 1116.960 726.866 806.818 1.00 0.00 ? 415  LYS A CA 1 
ATOM 1686   C C  . LYS A 1 415  ? 1116.053 726.051 805.949 1.00 0.00 ? 415  LYS A C  1 
ATOM 1687   O O  . LYS A 1 415  ? 1115.144 725.368 806.419 1.00 0.00 ? 415  LYS A O  1 
ATOM 1688   C CB . LYS A 1 415  ? 1116.749 726.509 808.318 1.00 0.00 ? 415  LYS A CB 1 
ATOM 1689   N N  . GLY A 1 416  ? 1116.311 726.136 804.626 1.00 0.00 ? 416  GLY A N  1 
ATOM 1690   C CA . GLY A 1 416  ? 1115.755 725.306 803.594 1.00 0.00 ? 416  GLY A CA 1 
ATOM 1691   C C  . GLY A 1 416  ? 1114.258 725.272 803.556 1.00 0.00 ? 416  GLY A C  1 
ATOM 1692   O O  . GLY A 1 416  ? 1113.685 724.248 803.183 1.00 0.00 ? 416  GLY A O  1 
ATOM 1693   N N  . ILE A 1 417  ? 1113.554 726.361 803.897 1.00 0.00 ? 417  ILE A N  1 
ATOM 1694   C CA . ILE A 1 417  ? 1112.132 726.223 803.794 1.00 0.00 ? 417  ILE A CA 1 
ATOM 1695   C C  . ILE A 1 417  ? 1111.751 726.764 802.460 1.00 0.00 ? 417  ILE A C  1 
ATOM 1696   O O  . ILE A 1 417  ? 1112.070 727.899 802.103 1.00 0.00 ? 417  ILE A O  1 
ATOM 1697   C CB . ILE A 1 417  ? 1111.370 726.893 804.903 1.00 0.00 ? 417  ILE A CB 1 
ATOM 1698   N N  . LEU A 1 418  ? 1111.069 725.917 801.670 1.00 0.00 ? 418  LEU A N  1 
ATOM 1699   C CA . LEU A 1 418  ? 1110.784 726.201 800.297 1.00 0.00 ? 418  LEU A CA 1 
ATOM 1700   C C  . LEU A 1 418  ? 1109.372 726.665 800.131 1.00 0.00 ? 418  LEU A C  1 
ATOM 1701   O O  . LEU A 1 418  ? 1108.428 726.007 800.568 1.00 0.00 ? 418  LEU A O  1 
ATOM 1702   C CB . LEU A 1 418  ? 1110.948 724.934 799.445 1.00 0.00 ? 418  LEU A CB 1 
ATOM 1703   N N  . LEU A 1 419  ? 1109.195 727.837 799.493 1.00 0.00 ? 419  LEU A N  1 
ATOM 1704   C CA . LEU A 1 419  ? 1107.880 728.299 799.162 1.00 0.00 ? 419  LEU A CA 1 
ATOM 1705   C C  . LEU A 1 419  ? 1107.811 728.243 797.678 1.00 0.00 ? 419  LEU A C  1 
ATOM 1706   O O  . LEU A 1 419  ? 1108.591 728.892 796.983 1.00 0.00 ? 419  LEU A O  1 
ATOM 1707   C CB . LEU A 1 419  ? 1107.581 729.742 799.602 1.00 0.00 ? 419  LEU A CB 1 
ATOM 1708   N N  . MET A 1 420  ? 1106.866 727.450 797.145 1.00 0.00 ? 420  MET A N  1 
ATOM 1709   C CA . MET A 1 420  ? 1106.818 727.291 795.726 1.00 0.00 ? 420  MET A CA 1 
ATOM 1710   C C  . MET A 1 420  ? 1105.590 727.936 795.188 1.00 0.00 ? 420  MET A C  1 
ATOM 1711   O O  . MET A 1 420  ? 1104.475 727.671 795.634 1.00 0.00 ? 420  MET A O  1 
ATOM 1712   C CB . MET A 1 420  ? 1106.748 725.830 795.296 1.00 0.00 ? 420  MET A CB 1 
ATOM 1713   N N  . ALA A 1 421  ? 1105.775 728.821 794.194 1.00 0.00 ? 421  ALA A N  1 
ATOM 1714   C CA . ALA A 1 421  ? 1104.630 729.387 793.559 1.00 0.00 ? 421  ALA A CA 1 
ATOM 1715   C C  . ALA A 1 421  ? 1104.518 728.661 792.268 1.00 0.00 ? 421  ALA A C  1 
ATOM 1716   O O  . ALA A 1 421  ? 1105.453 728.648 791.466 1.00 0.00 ? 421  ALA A O  1 
ATOM 1717   C CB . ALA A 1 421  ? 1104.774 730.884 793.236 1.00 0.00 ? 421  ALA A CB 1 
ATOM 1718   N N  . ALA A 1 422  ? 1103.371 728.010 792.031 1.00 0.00 ? 422  ALA A N  1 
ATOM 1719   C CA . ALA A 1 422  ? 1103.289 727.307 790.792 1.00 0.00 ? 422  ALA A CA 1 
ATOM 1720   C C  . ALA A 1 422  ? 1102.157 727.875 790.026 1.00 0.00 ? 422  ALA A C  1 
ATOM 1721   O O  . ALA A 1 422  ? 1101.082 728.130 790.569 1.00 0.00 ? 422  ALA A O  1 
ATOM 1722   C CB . ALA A 1 422  ? 1103.006 725.807 790.929 1.00 0.00 ? 422  ALA A CB 1 
ATOM 1723   N N  . SER A 1 423  ? 1102.387 728.111 788.726 1.00 0.00 ? 423  SER A N  1 
ATOM 1724   C CA . SER A 1 423  ? 1101.306 728.565 787.922 1.00 0.00 ? 423  SER A CA 1 
ATOM 1725   C C  . SER A 1 423  ? 1101.071 727.467 786.959 1.00 0.00 ? 423  SER A C  1 
ATOM 1726   O O  . SER A 1 423  ? 1101.940 727.163 786.148 1.00 0.00 ? 423  SER A O  1 
ATOM 1727   C CB . SER A 1 423  ? 1101.618 729.828 787.102 1.00 0.00 ? 423  SER A CB 1 
ATOM 1728   N N  . GLU A 1 424  ? 1099.885 726.840 787.023 1.00 0.00 ? 424  GLU A N  1 
ATOM 1729   C CA . GLU A 1 424  ? 1099.589 725.775 786.119 1.00 0.00 ? 424  GLU A CA 1 
ATOM 1730   C C  . GLU A 1 424  ? 1099.353 726.460 784.822 1.00 0.00 ? 424  GLU A C  1 
ATOM 1731   O O  . GLU A 1 424  ? 1099.194 727.676 784.789 1.00 0.00 ? 424  GLU A O  1 
ATOM 1732   C CB . GLU A 1 424  ? 1098.312 725.003 786.489 1.00 0.00 ? 424  GLU A CB 1 
ATOM 1733   N N  . ASN A 1 425  ? 1099.335 725.699 783.715 1.00 0.00 ? 425  ASN A N  1 
ATOM 1734   C CA . ASN A 1 425  ? 1099.140 726.309 782.437 1.00 0.00 ? 425  ASN A CA 1 
ATOM 1735   C C  . ASN A 1 425  ? 1097.829 727.016 782.502 1.00 0.00 ? 425  ASN A C  1 
ATOM 1736   O O  . ASN A 1 425  ? 1096.779 726.418 782.266 1.00 0.00 ? 425  ASN A O  1 
ATOM 1737   C CB . ASN A 1 425  ? 1099.120 725.317 781.260 1.00 0.00 ? 425  ASN A CB 1 
ATOM 1738   N N  . ASP A 1 427  ? 1095.747 725.010 785.071 1.00 0.00 ? 427  ASP A N  1 
ATOM 1739   C CA . ASP A 1 427  ? 1094.502 725.707 785.165 1.00 0.00 ? 427  ASP A CA 1 
ATOM 1740   C C  . ASP A 1 427  ? 1094.663 726.956 785.994 1.00 0.00 ? 427  ASP A C  1 
ATOM 1741   O O  . ASP A 1 427  ? 1094.118 727.999 785.635 1.00 0.00 ? 427  ASP A O  1 
ATOM 1742   C CB . ASP A 1 427  ? 1093.377 724.851 785.755 1.00 0.00 ? 427  ASP A CB 1 
ATOM 1743   N N  . ASN A 1 428  ? 1095.428 726.904 787.116 1.00 0.00 ? 428  ASN A N  1 
ATOM 1744   C CA . ASN A 1 428  ? 1095.489 728.070 787.972 1.00 0.00 ? 428  ASN A CA 1 
ATOM 1745   C C  . ASN A 1 428  ? 1096.746 728.094 788.800 1.00 0.00 ? 428  ASN A C  1 
ATOM 1746   O O  . ASN A 1 428  ? 1097.658 727.288 788.614 1.00 0.00 ? 428  ASN A O  1 
ATOM 1747   C CB . ASN A 1 428  ? 1094.315 728.156 788.960 1.00 0.00 ? 428  ASN A CB 1 
ATOM 1748   N N  . ASP A 1 429  ? 1096.806 729.067 789.744 1.00 0.00 ? 429  ASP A N  1 
ATOM 1749   C CA . ASP A 1 429  ? 1097.936 729.308 790.608 1.00 0.00 ? 429  ASP A CA 1 
ATOM 1750   C C  . ASP A 1 429  ? 1097.772 728.517 791.869 1.00 0.00 ? 429  ASP A C  1 
ATOM 1751   O O  . ASP A 1 429  ? 1096.702 728.497 792.474 1.00 0.00 ? 429  ASP A O  1 
ATOM 1752   C CB . ASP A 1 429  ? 1098.082 730.788 790.999 1.00 0.00 ? 429  ASP A CB 1 
ATOM 1753   N N  . ILE A 1 430  ? 1098.857 727.828 792.287 1.00 0.00 ? 430  ILE A N  1 
ATOM 1754   C CA . ILE A 1 430  ? 1098.838 727.028 793.479 1.00 0.00 ? 430  ILE A CA 1 
ATOM 1755   C C  . ILE A 1 430  ? 1100.051 727.359 794.286 1.00 0.00 ? 430  ILE A C  1 
ATOM 1756   O O  . ILE A 1 430  ? 1101.078 727.762 793.742 1.00 0.00 ? 430  ILE A O  1 
ATOM 1757   C CB . ILE A 1 430  ? 1098.885 725.556 793.201 1.00 0.00 ? 430  ILE A CB 1 
ATOM 1758   N N  . LEU A 1 431  ? 1099.958 727.219 795.625 1.00 0.00 ? 431  LEU A N  1 
ATOM 1759   C CA . LEU A 1 431  ? 1101.096 727.517 796.445 1.00 0.00 ? 431  LEU A CA 1 
ATOM 1760   C C  . LEU A 1 431  ? 1101.424 726.305 797.263 1.00 0.00 ? 431  LEU A C  1 
ATOM 1761   O O  . LEU A 1 431  ? 1100.537 725.651 797.809 1.00 0.00 ? 431  LEU A O  1 
ATOM 1762   C CB . LEU A 1 431  ? 1100.849 728.680 797.420 1.00 0.00 ? 431  LEU A CB 1 
ATOM 1763   N N  . TRP A 1 432  ? 1102.728 725.963 797.351 1.00 0.00 ? 432  TRP A N  1 
ATOM 1764   C CA . TRP A 1 432  ? 1103.113 724.845 798.162 1.00 0.00 ? 432  TRP A CA 1 
ATOM 1765   C C  . TRP A 1 432  ? 1104.218 725.282 799.063 1.00 0.00 ? 432  TRP A C  1 
ATOM 1766   O O  . TRP A 1 432  ? 1104.906 726.266 798.794 1.00 0.00 ? 432  TRP A O  1 
ATOM 1767   C CB . TRP A 1 432  ? 1103.661 723.627 797.403 1.00 0.00 ? 432  TRP A CB 1 
ATOM 1768   N N  . CYS A 1 433  ? 1104.392 724.563 800.189 1.00 0.00 ? 433  CYS A N  1 
ATOM 1769   C CA . CYS A 1 433  ? 1105.474 724.890 801.068 1.00 0.00 ? 433  CYS A CA 1 
ATOM 1770   C C  . CYS A 1 433  ? 1106.088 723.609 801.521 1.00 0.00 ? 433  CYS A C  1 
ATOM 1771   O O  . CYS A 1 433  ? 1105.389 722.634 801.800 1.00 0.00 ? 433  CYS A O  1 
ATOM 1772   C CB . CYS A 1 433  ? 1105.039 725.660 802.327 1.00 0.00 ? 433  CYS A CB 1 
ATOM 1773   N N  . VAL A 1 434  ? 1107.434 723.575 801.583 1.00 0.00 ? 434  VAL A N  1 
ATOM 1774   C CA . VAL A 1 434  ? 1108.102 722.400 802.052 1.00 0.00 ? 434  VAL A CA 1 
ATOM 1775   C C  . VAL A 1 434  ? 1108.953 722.817 803.205 1.00 0.00 ? 434  VAL A C  1 
ATOM 1776   O O  . VAL A 1 434  ? 1109.719 723.774 803.116 1.00 0.00 ? 434  VAL A O  1 
ATOM 1777   C CB . VAL A 1 434  ? 1109.028 721.786 801.052 1.00 0.00 ? 434  VAL A CB 1 
ATOM 1778   N N  . ASN A 1 435  ? 1108.827 722.103 804.337 1.00 0.00 ? 435  ASN A N  1 
ATOM 1779   C CA . ASN A 1 435  ? 1109.644 722.402 805.471 1.00 0.00 ? 435  ASN A CA 1 
ATOM 1780   C C  . ASN A 1 435  ? 1110.271 721.106 805.849 1.00 0.00 ? 435  ASN A C  1 
ATOM 1781   O O  . ASN A 1 435  ? 1109.597 720.079 805.904 1.00 0.00 ? 435  ASN A O  1 
ATOM 1782   C CB . ASN A 1 435  ? 1108.834 722.892 806.689 1.00 0.00 ? 435  ASN A CB 1 
ATOM 1783   N N  . HIS A 1 436  ? 1111.589 721.103 806.116 1.00 0.00 ? 436  HIS A N  1 
ATOM 1784   C CA . HIS A 1 436  ? 1112.182 719.844 806.449 1.00 0.00 ? 436  HIS A CA 1 
ATOM 1785   C C  . HIS A 1 436  ? 1111.696 719.536 807.817 1.00 0.00 ? 436  HIS A C  1 
ATOM 1786   O O  . HIS A 1 436  ? 1111.470 720.444 808.615 1.00 0.00 ? 436  HIS A O  1 
ATOM 1787   C CB . HIS A 1 436  ? 1113.699 719.857 806.588 1.00 0.00 ? 436  HIS A CB 1 
ATOM 1788   N N  . ASP A 1 437  ? 1111.498 718.247 808.134 1.00 0.00 ? 437  ASP A N  1 
ATOM 1789   C CA . ASP A 1 437  ? 1111.120 717.989 809.483 1.00 0.00 ? 437  ASP A CA 1 
ATOM 1790   C C  . ASP A 1 437  ? 1112.425 717.929 810.207 1.00 0.00 ? 437  ASP A C  1 
ATOM 1791   O O  . ASP A 1 437  ? 1113.195 716.982 810.054 1.00 0.00 ? 437  ASP A O  1 
ATOM 1792   C CB . ASP A 1 437  ? 1110.341 716.674 809.670 1.00 0.00 ? 437  ASP A CB 1 
ATOM 1793   N N  . THR A 1 438  ? 1112.722 718.988 810.981 1.00 0.00 ? 438  THR A N  1 
ATOM 1794   C CA . THR A 1 438  ? 1113.970 719.081 811.669 1.00 0.00 ? 438  THR A CA 1 
ATOM 1795   C C  . THR A 1 438  ? 1114.040 717.984 812.665 1.00 0.00 ? 438  THR A C  1 
ATOM 1796   O O  . THR A 1 438  ? 1115.093 717.381 812.866 1.00 0.00 ? 438  THR A O  1 
ATOM 1797   C CB . THR A 1 438  ? 1114.139 720.390 812.390 1.00 0.00 ? 438  THR A CB 1 
ATOM 1798   N N  . PHE A 1 439  ? 1112.902 717.676 813.306 1.00 0.00 ? 439  PHE A N  1 
ATOM 1799   C CA . PHE A 1 439  ? 1112.962 716.735 814.376 1.00 0.00 ? 439  PHE A CA 1 
ATOM 1800   C C  . PHE A 1 439  ? 1113.487 715.403 813.892 1.00 0.00 ? 439  PHE A C  1 
ATOM 1801   O O  . PHE A 1 439  ? 1114.489 714.941 814.435 1.00 0.00 ? 439  PHE A O  1 
ATOM 1802   C CB . PHE A 1 439  ? 1111.603 716.460 815.013 1.00 0.00 ? 439  PHE A CB 1 
ATOM 1803   N N  . PRO A 1 440  ? 1112.908 714.738 812.913 1.00 0.00 ? 440  PRO A N  1 
ATOM 1804   C CA . PRO A 1 440  ? 1113.401 713.467 812.456 1.00 0.00 ? 440  PRO A CA 1 
ATOM 1805   C C  . PRO A 1 440  ? 1114.749 713.713 811.862 1.00 0.00 ? 440  PRO A C  1 
ATOM 1806   O O  . PRO A 1 440  ? 1115.516 712.768 811.687 1.00 0.00 ? 440  PRO A O  1 
ATOM 1807   C CB . PRO A 1 440  ? 1112.429 713.015 811.374 1.00 0.00 ? 440  PRO A CB 1 
ATOM 1808   N N  . PHE A 1 441  ? 1115.035 714.984 811.540 1.00 0.00 ? 441  PHE A N  1 
ATOM 1809   C CA . PHE A 1 441  ? 1116.244 715.384 810.893 1.00 0.00 ? 441  PHE A CA 1 
ATOM 1810   C C  . PHE A 1 441  ? 1117.394 715.243 811.840 1.00 0.00 ? 441  PHE A C  1 
ATOM 1811   O O  . PHE A 1 441  ? 1118.546 715.468 811.476 1.00 0.00 ? 441  PHE A O  1 
ATOM 1812   C CB . PHE A 1 441  ? 1116.202 716.743 810.150 1.00 0.00 ? 441  PHE A CB 1 
ATOM 1813   N N  . GLN A 1 442  ? 1117.132 714.937 813.130 1.00 0.00 ? 442  GLN A N  1 
ATOM 1814   C CA . GLN A 1 442  ? 1118.247 714.681 814.011 1.00 0.00 ? 442  GLN A CA 1 
ATOM 1815   C C  . GLN A 1 442  ? 1118.906 713.341 813.630 1.00 0.00 ? 442  GLN A C  1 
ATOM 1816   O O  . GLN A 1 442  ? 1119.285 712.560 814.495 1.00 0.00 ? 442  GLN A O  1 
ATOM 1817   C CB . GLN A 1 442  ? 1117.822 714.566 815.492 1.00 0.00 ? 442  GLN A CB 1 
ATOM 1818   N N  . LYS A 1 443  ? 1119.050 713.080 812.301 1.00 0.00 ? 443  LYS A N  1 
ATOM 1819   C CA . LYS A 1 443  ? 1119.701 712.063 811.520 1.00 0.00 ? 443  LYS A CA 1 
ATOM 1820   C C  . LYS A 1 443  ? 1119.028 711.907 810.170 1.00 0.00 ? 443  LYS A C  1 
ATOM 1821   O O  . LYS A 1 443  ? 1119.548 712.489 809.221 1.00 0.00 ? 443  LYS A O  1 
ATOM 1822   C CB . LYS A 1 443  ? 1120.111 710.729 812.171 1.00 0.00 ? 443  LYS A CB 1 
ATOM 1823   N N  . PRO A 1 444  ? 1117.937 711.199 809.947 1.00 0.00 ? 444  PRO A N  1 
ATOM 1824   C CA . PRO A 1 444  ? 1117.437 711.131 808.590 1.00 0.00 ? 444  PRO A CA 1 
ATOM 1825   C C  . PRO A 1 444  ? 1116.807 712.410 808.131 1.00 0.00 ? 444  PRO A C  1 
ATOM 1826   O O  . PRO A 1 444  ? 1116.466 713.242 808.972 1.00 0.00 ? 444  PRO A O  1 
ATOM 1827   C CB . PRO A 1 444  ? 1116.480 709.943 808.539 1.00 0.00 ? 444  PRO A CB 1 
ATOM 1828   N N  . MET A 1 445  ? 1116.656 712.589 806.799 1.00 0.00 ? 445  MET A N  1 
ATOM 1829   C CA . MET A 1 445  ? 1116.084 713.798 806.273 1.00 0.00 ? 445  MET A CA 1 
ATOM 1830   C C  . MET A 1 445  ? 1114.716 713.499 805.746 1.00 0.00 ? 445  MET A C  1 
ATOM 1831   O O  . MET A 1 445  ? 1114.484 712.452 805.143 1.00 0.00 ? 445  MET A O  1 
ATOM 1832   C CB . MET A 1 445  ? 1116.906 714.406 805.126 1.00 0.00 ? 445  MET A CB 1 
ATOM 1833   N N  . MET A 1 446  ? 1113.760 714.418 805.998 1.00 0.00 ? 446  MET A N  1 
ATOM 1834   C CA . MET A 1 446  ? 1112.412 714.264 805.525 1.00 0.00 ? 446  MET A CA 1 
ATOM 1835   C C  . MET A 1 446  ? 1111.848 715.638 805.343 1.00 0.00 ? 446  MET A C  1 
ATOM 1836   O O  . MET A 1 446  ? 1112.175 716.552 806.100 1.00 0.00 ? 446  MET A O  1 
ATOM 1837   C CB . MET A 1 446  ? 1111.512 713.533 806.538 1.00 0.00 ? 446  MET A CB 1 
ATOM 1838   N N  . GLU A 1 447  ? 1110.993 715.835 804.318 1.00 0.00 ? 447  GLU A N  1 
ATOM 1839   C CA . GLU A 1 447  ? 1110.409 717.134 804.148 1.00 0.00 ? 447  GLU A CA 1 
ATOM 1840   C C  . GLU A 1 447  ? 1108.924 717.000 804.132 1.00 0.00 ? 447  GLU A C  1 
ATOM 1841   O O  . GLU A 1 447  ? 1108.366 716.098 803.510 1.00 0.00 ? 447  GLU A O  1 
ATOM 1842   C CB . GLU A 1 447  ? 1110.859 717.885 802.883 1.00 0.00 ? 447  GLU A CB 1 
ATOM 1843   N N  . THR A 1 448  ? 1108.249 717.916 804.851 1.00 0.00 ? 448  THR A N  1 
ATOM 1844   C CA . THR A 1 448  ? 1106.819 717.925 804.915 1.00 0.00 ? 448  THR A CA 1 
ATOM 1845   C C  . THR A 1 448  ? 1106.365 718.961 803.941 1.00 0.00 ? 448  THR A C  1 
ATOM 1846   O O  . THR A 1 448  ? 1106.689 720.141 804.060 1.00 0.00 ? 448  THR A O  1 
ATOM 1847   C CB . THR A 1 448  ? 1106.305 718.252 806.288 1.00 0.00 ? 448  THR A CB 1 
ATOM 1848   N N  . GLN A 1 449  ? 1105.609 718.524 802.917 1.00 0.00 ? 449  GLN A N  1 
ATOM 1849   C CA . GLN A 1 449  ? 1105.197 719.449 801.911 1.00 0.00 ? 449  GLN A CA 1 
ATOM 1850   C C  . GLN A 1 449  ? 1103.705 719.437 801.863 1.00 0.00 ? 449  GLN A C  1 
ATOM 1851   O O  . GLN A 1 449  ? 1103.077 718.378 801.878 1.00 0.00 ? 449  GLN A O  1 
ATOM 1852   C CB . GLN A 1 449  ? 1105.756 719.072 800.528 1.00 0.00 ? 449  GLN A CB 1 
ATOM 1853   N N  . MET A 1 450  ? 1103.092 720.636 801.819 1.00 0.00 ? 450  MET A N  1 
ATOM 1854   C CA . MET A 1 450  ? 1101.661 720.679 801.806 1.00 0.00 ? 450  MET A CA 1 
ATOM 1855   C C  . MET A 1 450  ? 1101.228 721.812 800.941 1.00 0.00 ? 450  MET A C  1 
ATOM 1856   O O  . MET A 1 450  ? 1101.996 722.724 800.635 1.00 0.00 ? 450  MET A O  1 
ATOM 1857   C CB . MET A 1 450  ? 1101.048 720.928 803.195 1.00 0.00 ? 450  MET A CB 1 
ATOM 1858   N N  . THR A 1 451  ? 1099.957 721.761 800.512 1.00 0.00 ? 451  THR A N  1 
ATOM 1859   C CA . THR A 1 451  ? 1099.400 722.800 799.701 1.00 0.00 ? 451  THR A CA 1 
ATOM 1860   C C  . THR A 1 451  ? 1099.021 723.905 800.627 1.00 0.00 ? 451  THR A C  1 
ATOM 1861   O O  . THR A 1 451  ? 1098.799 723.679 801.817 1.00 0.00 ? 451  THR A O  1 
ATOM 1862   C CB . THR A 1 451  ? 1098.152 722.402 798.971 1.00 0.00 ? 451  THR A CB 1 
ATOM 1863   N N  . ALA A 1 452  ? 1098.931 725.136 800.089 1.00 0.00 ? 452  ALA A N  1 
ATOM 1864   C CA . ALA A 1 452  ? 1098.611 726.270 800.905 1.00 0.00 ? 452  ALA A CA 1 
ATOM 1865   C C  . ALA A 1 452  ? 1097.368 726.902 800.359 1.00 0.00 ? 452  ALA A C  1 
ATOM 1866   O O  . ALA A 1 452  ? 1096.964 726.652 799.223 1.00 0.00 ? 452  ALA A O  1 
ATOM 1867   C CB . ALA A 1 452  ? 1099.707 727.350 800.916 1.00 0.00 ? 452  ALA A CB 1 
ATOM 1868   N N  . GLY A 1 453  ? 1096.726 727.737 801.197 1.00 0.00 ? 453  GLY A N  1 
ATOM 1869   C CA . GLY A 1 453  ? 1095.469 728.370 800.921 1.00 0.00 ? 453  GLY A CA 1 
ATOM 1870   C C  . GLY A 1 453  ? 1095.531 729.324 799.763 1.00 0.00 ? 453  GLY A C  1 
ATOM 1871   O O  . GLY A 1 453  ? 1094.581 729.398 798.986 1.00 0.00 ? 453  GLY A O  1 
ATOM 1872   N N  . VAL A 1 454  ? 1096.635 730.081 799.606 1.00 0.00 ? 454  VAL A N  1 
ATOM 1873   C CA . VAL A 1 454  ? 1096.654 731.121 798.608 1.00 0.00 ? 454  VAL A CA 1 
ATOM 1874   C C  . VAL A 1 454  ? 1096.357 730.566 797.254 1.00 0.00 ? 454  VAL A C  1 
ATOM 1875   O O  . VAL A 1 454  ? 1096.846 729.504 796.869 1.00 0.00 ? 454  VAL A O  1 
ATOM 1876   C CB . VAL A 1 454  ? 1097.947 731.879 798.536 1.00 0.00 ? 454  VAL A CB 1 
ATOM 1877   N N  . ASP A 1 455  ? 1095.508 731.301 796.501 1.00 0.00 ? 455  ASP A N  1 
ATOM 1878   C CA . ASP A 1 455  ? 1095.070 730.878 795.204 1.00 0.00 ? 455  ASP A CA 1 
ATOM 1879   C C  . ASP A 1 455  ? 1095.377 731.963 794.216 1.00 0.00 ? 455  ASP A C  1 
ATOM 1880   O O  . ASP A 1 455  ? 1095.446 731.716 793.013 1.00 0.00 ? 455  ASP A O  1 
ATOM 1881   C CB . ASP A 1 455  ? 1093.545 730.671 795.174 1.00 0.00 ? 455  ASP A CB 1 
ATOM 1882   N N  . GLY A 1 456  ? 1095.604 733.197 794.701 1.00 0.00 ? 456  GLY A N  1 
ATOM 1883   C CA . GLY A 1 456  ? 1095.808 734.293 793.796 1.00 0.00 ? 456  GLY A CA 1 
ATOM 1884   C C  . GLY A 1 456  ? 1097.215 734.266 793.303 1.00 0.00 ? 456  GLY A C  1 
ATOM 1885   O O  . GLY A 1 456  ? 1098.030 733.449 793.725 1.00 0.00 ? 456  GLY A O  1 
ATOM 1886   N N  . HIS A 1 457  ? 1097.526 735.192 792.373 1.00 0.00 ? 457  HIS A N  1 
ATOM 1887   C CA . HIS A 1 457  ? 1098.851 735.278 791.843 1.00 0.00 ? 457  HIS A CA 1 
ATOM 1888   C C  . HIS A 1 457  ? 1099.712 735.667 792.994 1.00 0.00 ? 457  HIS A C  1 
ATOM 1889   O O  . HIS A 1 457  ? 1099.271 736.390 793.888 1.00 0.00 ? 457  HIS A O  1 
ATOM 1890   C CB . HIS A 1 457  ? 1098.998 736.350 790.749 1.00 0.00 ? 457  HIS A CB 1 
ATOM 1891   N N  . SER A 1 458  ? 1100.963 735.180 793.024 1.00 0.00 ? 458  SER A N  1 
ATOM 1892   C CA . SER A 1 458  ? 1101.748 735.491 794.178 1.00 0.00 ? 458  SER A CA 1 
ATOM 1893   C C  . SER A 1 458  ? 1102.857 736.390 793.718 1.00 0.00 ? 458  SER A C  1 
ATOM 1894   O O  . SER A 1 458  ? 1103.752 735.962 792.988 1.00 0.00 ? 458  SER A O  1 
ATOM 1895   C CB . SER A 1 458  ? 1102.321 734.202 794.794 1.00 0.00 ? 458  SER A CB 1 
ATOM 1896   N N  . TRP A 1 459  ? 1102.791 737.682 794.107 1.00 0.00 ? 459  TRP A N  1 
ATOM 1897   C CA . TRP A 1 459  ? 1103.752 738.657 793.667 1.00 0.00 ? 459  TRP A CA 1 
ATOM 1898   C C  . TRP A 1 459  ? 1105.104 738.430 794.279 1.00 0.00 ? 459  TRP A C  1 
ATOM 1899   O O  . TRP A 1 459  ? 1106.091 738.295 793.557 1.00 0.00 ? 459  TRP A O  1 
ATOM 1900   C CB . TRP A 1 459  ? 1103.325 740.101 793.981 1.00 0.00 ? 459  TRP A CB 1 
ATOM 1901   N N  . ALA A 1 460  ? 1105.201 738.364 795.629 1.00 0.00 ? 460  ALA A N  1 
ATOM 1902   C CA . ALA A 1 460  ? 1106.507 738.196 796.210 1.00 0.00 ? 460  ALA A CA 1 
ATOM 1903   C C  . ALA A 1 460  ? 1106.378 737.650 797.601 1.00 0.00 ? 460  ALA A C  1 
ATOM 1904   O O  . ALA A 1 460  ? 1105.387 737.884 798.291 1.00 0.00 ? 460  ALA A O  1 
ATOM 1905   C CB . ALA A 1 460  ? 1107.311 739.503 796.310 1.00 0.00 ? 460  ALA A CB 1 
ATOM 1906   N N  . LEU A 1 461  ? 1107.397 736.873 798.025 1.00 0.00 ? 461  LEU A N  1 
ATOM 1907   C CA . LEU A 1 461  ? 1107.410 736.261 799.321 1.00 0.00 ? 461  LEU A CA 1 
ATOM 1908   C C  . LEU A 1 461  ? 1108.536 736.837 800.111 1.00 0.00 ? 461  LEU A C  1 
ATOM 1909   O O  . LEU A 1 461  ? 1109.575 737.209 799.563 1.00 0.00 ? 461  LEU A O  1 
ATOM 1910   C CB . LEU A 1 461  ? 1107.627 734.743 799.286 1.00 0.00 ? 461  LEU A CB 1 
ATOM 1911   N N  . SER A 1 462  ? 1108.344 736.954 801.439 1.00 0.00 ? 462  SER A N  1 
ATOM 1912   C CA . SER A 1 462  ? 1109.402 737.458 802.260 1.00 0.00 ? 462  SER A CA 1 
ATOM 1913   C C  . SER A 1 462  ? 1109.200 736.941 803.647 1.00 0.00 ? 462  SER A C  1 
ATOM 1914   O O  . SER A 1 462  ? 1108.130 736.448 804.001 1.00 0.00 ? 462  SER A O  1 
ATOM 1915   C CB . SER A 1 462  ? 1109.439 738.993 802.340 1.00 0.00 ? 462  SER A CB 1 
ATOM 1916   N N  . ALA A 1 463  ? 1110.257 737.038 804.474 1.00 0.00 ? 463  ALA A N  1 
ATOM 1917   C CA . ALA A 1 463  ? 1110.201 736.590 805.835 1.00 0.00 ? 463  ALA A CA 1 
ATOM 1918   C C  . ALA A 1 463  ? 1110.024 737.822 806.662 1.00 0.00 ? 463  ALA A C  1 
ATOM 1919   O O  . ALA A 1 463  ? 1110.861 738.722 806.624 1.00 0.00 ? 463  ALA A O  1 
ATOM 1920   C CB . ALA A 1 463  ? 1111.540 735.975 806.279 1.00 0.00 ? 463  ALA A CB 1 
ATOM 1921   N N  . ILE A 1 464  ? 1108.914 737.916 807.415 1.00 0.00 ? 464  ILE A N  1 
ATOM 1922   C CA . ILE A 1 464  ? 1108.743 739.077 808.241 1.00 0.00 ? 464  ILE A CA 1 
ATOM 1923   C C  . ILE A 1 464  ? 1109.753 739.021 809.343 1.00 0.00 ? 464  ILE A C  1 
ATOM 1924   O O  . ILE A 1 464  ? 1110.427 740.007 809.641 1.00 0.00 ? 464  ILE A O  1 
ATOM 1925   C CB . ILE A 1 464  ? 1107.350 739.201 808.800 1.00 0.00 ? 464  ILE A CB 1 
ATOM 1926   N N  . ASP A 1 465  ? 1109.889 737.838 809.968 1.00 0.00 ? 465  ASP A N  1 
ATOM 1927   C CA . ASP A 1 465  ? 1110.818 737.625 811.037 1.00 0.00 ? 465  ASP A CA 1 
ATOM 1928   C C  . ASP A 1 465  ? 1111.929 736.831 810.438 1.00 0.00 ? 465  ASP A C  1 
ATOM 1929   O O  . ASP A 1 465  ? 1112.794 737.357 809.737 1.00 0.00 ? 465  ASP A O  1 
ATOM 1930   C CB . ASP A 1 465  ? 1110.216 736.791 812.182 1.00 0.00 ? 465  ASP A CB 1 
ATOM 1931   N N  . THR A 1 474  ? 1113.778 737.331 812.492 1.00 0.00 ? 474  THR A N  1 
ATOM 1932   C CA . THR A 1 474  ? 1114.960 736.660 812.057 1.00 0.00 ? 474  THR A CA 1 
ATOM 1933   C C  . THR A 1 474  ? 1114.642 735.207 811.919 1.00 0.00 ? 474  THR A C  1 
ATOM 1934   O O  . THR A 1 474  ? 1113.625 734.718 812.409 1.00 0.00 ? 474  THR A O  1 
ATOM 1935   C CB . THR A 1 474  ? 1116.085 736.807 813.041 1.00 0.00 ? 474  THR A CB 1 
ATOM 1936   N N  . PRO A 1 475  ? 1115.496 734.521 811.210 1.00 0.00 ? 475  PRO A N  1 
ATOM 1937   C CA . PRO A 1 475  ? 1115.322 733.113 811.012 1.00 0.00 ? 475  PRO A CA 1 
ATOM 1938   C C  . PRO A 1 475  ? 1115.527 732.382 812.298 1.00 0.00 ? 475  PRO A C  1 
ATOM 1939   O O  . PRO A 1 475  ? 1116.285 732.841 813.151 1.00 0.00 ? 475  PRO A O  1 
ATOM 1940   C CB . PRO A 1 475  ? 1116.274 732.717 809.879 1.00 0.00 ? 475  PRO A CB 1 
ATOM 1941   N N  . LEU A 1 476  ? 1114.833 731.241 812.439 1.00 0.00 ? 476  LEU A N  1 
ATOM 1942   C CA . LEU A 1 476  ? 1114.797 730.428 813.618 1.00 0.00 ? 476  LEU A CA 1 
ATOM 1943   C C  . LEU A 1 476  ? 1116.083 729.702 813.887 1.00 0.00 ? 476  LEU A C  1 
ATOM 1944   O O  . LEU A 1 476  ? 1116.246 729.183 814.991 1.00 0.00 ? 476  LEU A O  1 
ATOM 1945   C CB . LEU A 1 476  ? 1113.574 729.492 813.690 1.00 0.00 ? 476  LEU A CB 1 
ATOM 1946   N N  . ASN A 1 477  ? 1116.998 729.597 812.895 1.00 0.00 ? 477  ASN A N  1 
ATOM 1947   C CA . ASN A 1 477  ? 1118.226 728.847 813.026 1.00 0.00 ? 477  ASN A CA 1 
ATOM 1948   C C  . ASN A 1 477  ? 1118.897 729.126 814.341 1.00 0.00 ? 477  ASN A C  1 
ATOM 1949   O O  . ASN A 1 477  ? 1119.103 730.274 814.734 1.00 0.00 ? 477  ASN A O  1 
ATOM 1950   C CB . ASN A 1 477  ? 1119.257 729.150 811.918 1.00 0.00 ? 477  ASN A CB 1 
ATOM 1951   N N  . LYS A 1 478  ? 1119.210 728.030 815.065 1.00 0.00 ? 478  LYS A N  1 
ATOM 1952   C CA . LYS A 1 478  ? 1119.783 728.036 816.383 1.00 0.00 ? 478  LYS A CA 1 
ATOM 1953   C C  . LYS A 1 478  ? 1121.210 728.512 816.421 1.00 0.00 ? 478  LYS A C  1 
ATOM 1954   O O  . LYS A 1 478  ? 1121.542 729.403 817.200 1.00 0.00 ? 478  LYS A O  1 
ATOM 1955   C CB . LYS A 1 478  ? 1119.777 726.640 817.009 1.00 0.00 ? 478  LYS A CB 1 
ATOM 1956   N N  . ASP A 1 479  ? 1122.090 727.948 815.570 1.00 0.00 ? 479  ASP A N  1 
ATOM 1957   C CA . ASP A 1 479  ? 1123.493 728.235 815.721 1.00 0.00 ? 479  ASP A CA 1 
ATOM 1958   C C  . ASP A 1 479  ? 1123.987 728.923 814.482 1.00 0.00 ? 479  ASP A C  1 
ATOM 1959   O O  . ASP A 1 479  ? 1123.291 728.983 813.470 1.00 0.00 ? 479  ASP A O  1 
ATOM 1960   C CB . ASP A 1 479  ? 1124.322 726.949 815.920 1.00 0.00 ? 479  ASP A CB 1 
ATOM 1961   N N  . HIS A 1 480  ? 1125.210 729.494 814.555 1.00 0.00 ? 480  HIS A N  1 
ATOM 1962   C CA . HIS A 1 480  ? 1125.797 730.177 813.437 1.00 0.00 ? 480  HIS A CA 1 
ATOM 1963   C C  . HIS A 1 480  ? 1126.857 729.283 812.862 1.00 0.00 ? 480  HIS A C  1 
ATOM 1964   O O  . HIS A 1 480  ? 1127.824 729.746 812.260 1.00 0.00 ? 480  HIS A O  1 
ATOM 1965   C CB . HIS A 1 480  ? 1126.482 731.495 813.852 1.00 0.00 ? 480  HIS A CB 1 
ATOM 1966   N N  . ILE A 1 481  ? 1126.675 727.961 813.021 1.00 0.00 ? 481  ILE A N  1 
ATOM 1967   C CA . ILE A 1 481  ? 1127.577 726.982 812.490 1.00 0.00 ? 481  ILE A CA 1 
ATOM 1968   C C  . ILE A 1 481  ? 1126.728 725.939 811.852 1.00 0.00 ? 481  ILE A C  1 
ATOM 1969   O O  . ILE A 1 481  ? 1125.541 725.826 812.159 1.00 0.00 ? 481  ILE A O  1 
ATOM 1970   C CB . ILE A 1 481  ? 1128.452 726.338 813.534 1.00 0.00 ? 481  ILE A CB 1 
ATOM 1971   N N  . PRO A 1 482  ? 1127.282 725.177 810.948 1.00 0.00 ? 482  PRO A N  1 
ATOM 1972   C CA . PRO A 1 482  ? 1126.488 724.172 810.309 1.00 0.00 ? 482  PRO A CA 1 
ATOM 1973   C C  . PRO A 1 482  ? 1126.023 723.180 811.322 1.00 0.00 ? 482  PRO A C  1 
ATOM 1974   O O  . PRO A 1 482  ? 1125.031 722.497 811.074 1.00 0.00 ? 482  PRO A O  1 
ATOM 1975   C CB . PRO A 1 482  ? 1127.357 723.619 809.183 1.00 0.00 ? 482  PRO A CB 1 
ATOM 1976   N N  . ILE A 1 483  ? 1126.721 723.078 812.467 1.00 0.00 ? 483  ILE A N  1 
ATOM 1977   C CA . ILE A 1 483  ? 1126.306 722.155 813.480 1.00 0.00 ? 483  ILE A CA 1 
ATOM 1978   C C  . ILE A 1 483  ? 1125.254 722.848 814.298 1.00 0.00 ? 483  ILE A C  1 
ATOM 1979   O O  . ILE A 1 483  ? 1125.446 723.980 814.738 1.00 0.00 ? 483  ILE A O  1 
ATOM 1980   C CB . ILE A 1 483  ? 1127.450 721.731 814.365 1.00 0.00 ? 483  ILE A CB 1 
ATOM 1981   N N  . THR A 1 484  ? 1124.097 722.174 814.481 1.00 0.00 ? 484  THR A N  1 
ATOM 1982   C CA . THR A 1 484  ? 1122.914 722.606 815.191 1.00 0.00 ? 484  THR A CA 1 
ATOM 1983   C C  . THR A 1 484  ? 1122.345 723.840 814.573 1.00 0.00 ? 484  THR A C  1 
ATOM 1984   O O  . THR A 1 484  ? 1121.582 724.559 815.215 1.00 0.00 ? 484  THR A O  1 
ATOM 1985   C CB . THR A 1 484  ? 1123.045 722.883 816.670 1.00 0.00 ? 484  THR A CB 1 
ATOM 1986   N N  . ASP A 1 485  ? 1122.636 724.099 813.291 1.00 0.00 ? 485  ASP A N  1 
ATOM 1987   C CA . ASP A 1 485  ? 1122.077 725.277 812.699 1.00 0.00 ? 485  ASP A CA 1 
ATOM 1988   C C  . ASP A 1 485  ? 1120.581 725.146 812.662 1.00 0.00 ? 485  ASP A C  1 
ATOM 1989   O O  . ASP A 1 485  ? 1119.845 726.022 813.113 1.00 0.00 ? 485  ASP A O  1 
ATOM 1990   C CB . ASP A 1 485  ? 1122.562 725.465 811.250 1.00 0.00 ? 485  ASP A CB 1 
ATOM 1991   N N  . SER A 1 486  ? 1120.104 724.007 812.130 1.00 0.00 ? 486  SER A N  1 
ATOM 1992   C CA . SER A 1 486  ? 1118.711 723.708 811.933 1.00 0.00 ? 486  SER A CA 1 
ATOM 1993   C C  . SER A 1 486  ? 1117.980 723.346 813.198 1.00 0.00 ? 486  SER A C  1 
ATOM 1994   O O  . SER A 1 486  ? 1116.753 723.328 813.117 1.00 0.00 ? 486  SER A O  1 
ATOM 1995   C CB . SER A 1 486  ? 1118.508 722.543 810.948 1.00 0.00 ? 486  SER A CB 1 
ATOM 1996   N N  . PRO A 1 487  ? 1118.559 723.029 814.341 1.00 0.00 ? 487  PRO A N  1 
ATOM 1997   C CA . PRO A 1 487  ? 1117.698 722.659 815.431 1.00 0.00 ? 487  PRO A CA 1 
ATOM 1998   C C  . PRO A 1 487  ? 1116.703 723.684 815.850 1.00 0.00 ? 487  PRO A C  1 
ATOM 1999   O O  . PRO A 1 487  ? 1117.027 724.577 816.632 1.00 0.00 ? 487  PRO A O  1 
ATOM 2000   C CB . PRO A 1 487  ? 1118.611 722.185 816.549 1.00 0.00 ? 487  PRO A CB 1 
ATOM 2001   N N  . VAL A 1 488  ? 1115.463 723.518 815.372 1.00 0.00 ? 488  VAL A N  1 
ATOM 2002   C CA . VAL A 1 488  ? 1114.361 724.361 815.687 1.00 0.00 ? 488  VAL A CA 1 
ATOM 2003   C C  . VAL A 1 488  ? 1113.948 724.057 817.086 1.00 0.00 ? 488  VAL A C  1 
ATOM 2004   O O  . VAL A 1 488  ? 1113.519 724.937 817.830 1.00 0.00 ? 488  VAL A O  1 
ATOM 2005   C CB . VAL A 1 488  ? 1113.185 724.124 814.790 1.00 0.00 ? 488  VAL A CB 1 
ATOM 2006   N N  . VAL A 1 489  ? 1114.088 722.775 817.469 1.00 0.00 ? 489  VAL A N  1 
ATOM 2007   C CA . VAL A 1 489  ? 1113.629 722.299 818.737 1.00 0.00 ? 489  VAL A CA 1 
ATOM 2008   C C  . VAL A 1 489  ? 1114.326 723.071 819.808 1.00 0.00 ? 489  VAL A C  1 
ATOM 2009   O O  . VAL A 1 489  ? 1113.711 723.462 820.798 1.00 0.00 ? 489  VAL A O  1 
ATOM 2010   C CB . VAL A 1 489  ? 1113.942 720.852 818.948 1.00 0.00 ? 489  VAL A CB 1 
ATOM 2011   N N  . VAL A 1 490  ? 1115.646 723.294 819.652 1.00 0.00 ? 490  VAL A N  1 
ATOM 2012   C CA . VAL A 1 490  ? 1116.377 724.007 820.657 1.00 0.00 ? 490  VAL A CA 1 
ATOM 2013   C C  . VAL A 1 490  ? 1115.950 725.444 820.713 1.00 0.00 ? 490  VAL A C  1 
ATOM 2014   O O  . VAL A 1 490  ? 1115.780 725.984 821.805 1.00 0.00 ? 490  VAL A O  1 
ATOM 2015   C CB . VAL A 1 490  ? 1117.862 723.979 820.449 1.00 0.00 ? 490  VAL A CB 1 
ATOM 2016   N N  . GLN A 1 491  ? 1115.754 726.112 819.553 1.00 0.00 ? 491  GLN A N  1 
ATOM 2017   C CA . GLN A 1 491  ? 1115.456 727.515 819.652 1.00 0.00 ? 491  GLN A CA 1 
ATOM 2018   C C  . GLN A 1 491  ? 1113.984 727.773 819.482 1.00 0.00 ? 491  GLN A C  1 
ATOM 2019   O O  . GLN A 1 491  ? 1113.572 728.854 819.067 1.00 0.00 ? 491  GLN A O  1 
ATOM 2020   C CB . GLN A 1 491  ? 1116.206 728.376 818.615 1.00 0.00 ? 491  GLN A CB 1 
ATOM 2021   N N  . GLN A 1 492  ? 1113.122 726.808 819.841 1.00 0.00 ? 492  GLN A N  1 
ATOM 2022   C CA . GLN A 1 492  ? 1111.720 727.064 819.699 1.00 0.00 ? 492  GLN A CA 1 
ATOM 2023   C C  . GLN A 1 492  ? 1111.318 728.129 820.674 1.00 0.00 ? 492  GLN A C  1 
ATOM 2024   O O  . GLN A 1 492  ? 1110.507 728.995 820.348 1.00 0.00 ? 492  GLN A O  1 
ATOM 2025   C CB . GLN A 1 492  ? 1110.853 725.800 819.875 1.00 0.00 ? 492  GLN A CB 1 
ATOM 2026   N N  . HIS A 1 493  ? 1111.861 728.081 821.908 1.00 0.00 ? 493  HIS A N  1 
ATOM 2027   C CA . HIS A 1 493  ? 1111.506 729.045 822.913 1.00 0.00 ? 493  HIS A CA 1 
ATOM 2028   C C  . HIS A 1 493  ? 1112.010 730.412 822.554 1.00 0.00 ? 493  HIS A C  1 
ATOM 2029   O O  . HIS A 1 493  ? 1111.233 731.359 822.428 1.00 0.00 ? 493  HIS A O  1 
ATOM 2030   C CB . HIS A 1 493  ? 1112.144 728.741 824.281 1.00 0.00 ? 493  HIS A CB 1 
ATOM 2031   N N  . MET A 1 494  ? 1113.344 730.528 822.369 1.00 0.00 ? 494  MET A N  1 
ATOM 2032   C CA . MET A 1 494  ? 1114.006 731.793 822.175 1.00 0.00 ? 494  MET A CA 1 
ATOM 2033   C C  . MET A 1 494  ? 1113.643 732.471 820.894 1.00 0.00 ? 494  MET A C  1 
ATOM 2034   O O  . MET A 1 494  ? 1113.314 733.656 820.886 1.00 0.00 ? 494  MET A O  1 
ATOM 2035   C CB . MET A 1 494  ? 1115.534 731.673 822.108 1.00 0.00 ? 494  MET A CB 1 
ATOM 2036   N N  . LEU A 1 495  ? 1113.671 731.727 819.776 1.00 0.00 ? 495  LEU A N  1 
ATOM 2037   C CA . LEU A 1 495  ? 1113.534 732.367 818.504 1.00 0.00 ? 495  LEU A CA 1 
ATOM 2038   C C  . LEU A 1 495  ? 1112.128 732.857 818.375 1.00 0.00 ? 495  LEU A C  1 
ATOM 2039   O O  . LEU A 1 495  ? 1111.175 732.229 818.834 1.00 0.00 ? 495  LEU A O  1 
ATOM 2040   C CB . LEU A 1 495  ? 1113.952 731.421 817.357 1.00 0.00 ? 495  LEU A CB 1 
ATOM 2041   N N  . PRO A 1 496  ? 1112.001 734.006 817.771 1.00 0.00 ? 496  PRO A N  1 
ATOM 2042   C CA . PRO A 1 496  ? 1110.704 734.602 817.642 1.00 0.00 ? 496  PRO A CA 1 
ATOM 2043   C C  . PRO A 1 496  ? 1109.852 733.790 816.734 1.00 0.00 ? 496  PRO A C  1 
ATOM 2044   O O  . PRO A 1 496  ? 1110.391 733.052 815.918 1.00 0.00 ? 496  PRO A O  1 
ATOM 2045   C CB . PRO A 1 496  ? 1110.949 736.044 817.208 1.00 0.00 ? 496  PRO A CB 1 
ATOM 2046   N N  . PRO A 1 497  ? 1108.568 733.869 816.840 1.00 0.00 ? 497  PRO A N  1 
ATOM 2047   C CA . PRO A 1 497  ? 1107.799 733.031 815.978 1.00 0.00 ? 497  PRO A CA 1 
ATOM 2048   C C  . PRO A 1 497  ? 1108.026 733.422 814.561 1.00 0.00 ? 497  PRO A C  1 
ATOM 2049   O O  . PRO A 1 497  ? 1108.078 734.614 814.261 1.00 0.00 ? 497  PRO A O  1 
ATOM 2050   C CB . PRO A 1 497  ? 1106.366 733.126 816.487 1.00 0.00 ? 497  PRO A CB 1 
ATOM 2051   N N  . LYS A 1 498  ? 1108.179 732.421 813.678 1.00 0.00 ? 498  LYS A N  1 
ATOM 2052   C CA . LYS A 1 498  ? 1108.421 732.687 812.295 1.00 0.00 ? 498  LYS A CA 1 
ATOM 2053   C C  . LYS A 1 498  ? 1107.131 733.090 811.672 1.00 0.00 ? 498  LYS A C  1 
ATOM 2054   O O  . LYS A 1 498  ? 1106.093 732.467 811.894 1.00 0.00 ? 498  LYS A O  1 
ATOM 2055   C CB . LYS A 1 498  ? 1108.934 731.457 811.535 1.00 0.00 ? 498  LYS A CB 1 
ATOM 2056   N N  . LYS A 1 499  ? 1107.172 734.171 810.872 1.00 0.00 ? 499  LYS A N  1 
ATOM 2057   C CA . LYS A 1 499  ? 1106.002 734.616 810.182 1.00 0.00 ? 499  LYS A CA 1 
ATOM 2058   C C  . LYS A 1 499  ? 1106.439 734.881 808.775 1.00 0.00 ? 499  LYS A C  1 
ATOM 2059   O O  . LYS A 1 499  ? 1107.543 735.364 808.536 1.00 0.00 ? 499  LYS A O  1 
ATOM 2060   C CB . LYS A 1 499  ? 1105.391 735.879 810.813 1.00 0.00 ? 499  LYS A CB 1 
ATOM 2061   N N  . PHE A 1 500  ? 1105.579 734.546 807.800 1.00 0.00 ? 500  PHE A N  1 
ATOM 2062   C CA . PHE A 1 500  ? 1105.977 734.636 806.425 1.00 0.00 ? 500  PHE A CA 1 
ATOM 2063   C C  . PHE A 1 500  ? 1104.989 735.498 805.714 1.00 0.00 ? 500  PHE A C  1 
ATOM 2064   O O  . PHE A 1 500  ? 1103.808 735.536 806.053 1.00 0.00 ? 500  PHE A O  1 
ATOM 2065   C CB . PHE A 1 500  ? 1106.008 733.224 805.812 1.00 0.00 ? 500  PHE A CB 1 
ATOM 2066   N N  . VAL A 1 501  ? 1105.482 736.236 804.703 1.00 0.00 ? 501  VAL A N  1 
ATOM 2067   C CA . VAL A 1 501  ? 1104.688 737.152 803.943 1.00 0.00 ? 501  VAL A CA 1 
ATOM 2068   C C  . VAL A 1 501  ? 1104.494 736.614 802.571 1.00 0.00 ? 501  VAL A C  1 
ATOM 2069   O O  . VAL A 1 501  ? 1105.431 736.135 801.931 1.00 0.00 ? 501  VAL A O  1 
ATOM 2070   C CB . VAL A 1 501  ? 1105.393 738.453 803.708 1.00 0.00 ? 501  VAL A CB 1 
ATOM 2071   N N  . LEU A 1 502  ? 1103.240 736.674 802.098 1.00 0.00 ? 502  LEU A N  1 
ATOM 2072   C CA . LEU A 1 502  ? 1102.965 736.341 800.739 1.00 0.00 ? 502  LEU A CA 1 
ATOM 2073   C C  . LEU A 1 502  ? 1102.266 737.550 800.218 1.00 0.00 ? 502  LEU A C  1 
ATOM 2074   O O  . LEU A 1 502  ? 1101.215 737.936 800.725 1.00 0.00 ? 502  LEU A O  1 
ATOM 2075   C CB . LEU A 1 502  ? 1102.042 735.110 800.585 1.00 0.00 ? 502  LEU A CB 1 
ATOM 2076   N N  . LEU A 1 503  ? 1102.838 738.195 799.190 1.00 0.00 ? 503  LEU A N  1 
ATOM 2077   C CA . LEU A 1 503  ? 1102.187 739.365 798.694 1.00 0.00 ? 503  LEU A CA 1 
ATOM 2078   C C  . LEU A 1 503  ? 1101.525 738.975 797.418 1.00 0.00 ? 503  LEU A C  1 
ATOM 2079   O O  . LEU A 1 503  ? 1102.122 738.319 796.565 1.00 0.00 ? 503  LEU A O  1 
ATOM 2080   C CB . LEU A 1 503  ? 1103.153 740.523 798.395 1.00 0.00 ? 503  LEU A CB 1 
ATOM 2081   N N  . SER A 1 504  ? 1100.242 739.353 797.286 1.00 0.00 ? 504  SER A N  1 
ATOM 2082   C CA . SER A 1 504  ? 1099.474 739.098 796.106 1.00 0.00 ? 504  SER A CA 1 
ATOM 2083   C C  . SER A 1 504  ? 1099.047 740.449 795.650 1.00 0.00 ? 504  SER A C  1 
ATOM 2084   O O  . SER A 1 504  ? 1099.238 741.436 796.356 1.00 0.00 ? 504  SER A O  1 
ATOM 2085   C CB . SER A 1 504  ? 1098.198 738.279 796.373 1.00 0.00 ? 504  SER A CB 1 
ATOM 2086   N N  . ALA A 1 505  ? 1098.491 740.548 794.432 1.00 0.00 ? 505  ALA A N  1 
ATOM 2087   C CA . ALA A 1 505  ? 1098.106 741.857 794.004 1.00 0.00 ? 505  ALA A CA 1 
ATOM 2088   C C  . ALA A 1 505  ? 1097.044 742.359 794.932 1.00 0.00 ? 505  ALA A C  1 
ATOM 2089   O O  . ALA A 1 505  ? 1097.098 743.499 795.392 1.00 0.00 ? 505  ALA A O  1 
ATOM 2090   C CB . ALA A 1 505  ? 1097.535 741.872 792.576 1.00 0.00 ? 505  ALA A CB 1 
ATOM 2091   N N  . GLN A 1 506  ? 1096.057 741.496 795.242 1.00 0.00 ? 506  GLN A N  1 
ATOM 2092   C CA . GLN A 1 506  ? 1094.925 741.868 796.045 1.00 0.00 ? 506  GLN A CA 1 
ATOM 2093   C C  . GLN A 1 506  ? 1095.273 742.113 797.483 1.00 0.00 ? 506  GLN A C  1 
ATOM 2094   O O  . GLN A 1 506  ? 1094.831 743.108 798.052 1.00 0.00 ? 506  GLN A O  1 
ATOM 2095   C CB . GLN A 1 506  ? 1093.800 740.822 795.974 1.00 0.00 ? 506  GLN A CB 1 
ATOM 2096   N N  . GLY A 1 507  ? 1096.086 741.248 798.124 1.00 0.00 ? 507  GLY A N  1 
ATOM 2097   C CA . GLY A 1 507  ? 1096.305 741.508 799.521 1.00 0.00 ? 507  GLY A CA 1 
ATOM 2098   C C  . GLY A 1 507  ? 1097.545 740.823 799.988 1.00 0.00 ? 507  GLY A C  1 
ATOM 2099   O O  . GLY A 1 507  ? 1098.239 740.151 799.227 1.00 0.00 ? 507  GLY A O  1 
ATOM 2100   N N  . SER A 1 508  ? 1097.839 740.998 801.293 1.00 0.00 ? 508  SER A N  1 
ATOM 2101   C CA . SER A 1 508  ? 1098.989 740.406 801.902 1.00 0.00 ? 508  SER A CA 1 
ATOM 2102   C C  . SER A 1 508  ? 1098.502 739.251 802.707 1.00 0.00 ? 508  SER A C  1 
ATOM 2103   O O  . SER A 1 508  ? 1097.467 739.328 803.367 1.00 0.00 ? 508  SER A O  1 
ATOM 2104   C CB . SER A 1 508  ? 1099.708 741.352 802.869 1.00 0.00 ? 508  SER A CB 1 
ATOM 2105   N N  . LEU A 1 509  ? 1099.237 738.127 802.654 1.00 0.00 ? 509  LEU A N  1 
ATOM 2106   C CA . LEU A 1 509  ? 1098.833 736.973 803.394 1.00 0.00 ? 509  LEU A CA 1 
ATOM 2107   C C  . LEU A 1 509  ? 1099.926 736.683 804.364 1.00 0.00 ? 509  LEU A C  1 
ATOM 2108   O O  . LEU A 1 509  ? 1101.107 736.865 804.067 1.00 0.00 ? 509  LEU A O  1 
ATOM 2109   C CB . LEU A 1 509  ? 1098.635 735.735 802.507 1.00 0.00 ? 509  LEU A CB 1 
ATOM 2110   N N  . MET A 1 510  ? 1099.550 736.235 805.573 1.00 0.00 ? 510  MET A N  1 
ATOM 2111   C CA . MET A 1 510  ? 1100.539 735.974 806.571 1.00 0.00 ? 510  MET A CA 1 
ATOM 2112   C C  . MET A 1 510  ? 1100.455 734.525 806.919 1.00 0.00 ? 510  MET A C  1 
ATOM 2113   O O  . MET A 1 510  ? 1099.369 733.992 807.146 1.00 0.00 ? 510  MET A O  1 
ATOM 2114   C CB . MET A 1 510  ? 1100.266 736.787 807.844 1.00 0.00 ? 510  MET A CB 1 
ATOM 2115   N N  . PHE A 1 511  ? 1101.615 733.841 806.952 1.00 0.00 ? 511  PHE A N  1 
ATOM 2116   C CA . PHE A 1 511  ? 1101.633 732.449 807.302 1.00 0.00 ? 511  PHE A CA 1 
ATOM 2117   C C  . PHE A 1 511  ? 1102.452 732.313 808.546 1.00 0.00 ? 511  PHE A C  1 
ATOM 2118   O O  . PHE A 1 511  ? 1103.396 733.071 808.766 1.00 0.00 ? 511  PHE A O  1 
ATOM 2119   C CB . PHE A 1 511  ? 1102.248 731.539 806.224 1.00 0.00 ? 511  PHE A CB 1 
ATOM 2120   N N  . HIS A 1 512  ? 1102.094 731.343 809.411 1.00 0.00 ? 512  HIS A N  1 
ATOM 2121   C CA . HIS A 1 512  ? 1102.813 731.179 810.641 1.00 0.00 ? 512  HIS A CA 1 
ATOM 2122   C C  . HIS A 1 512  ? 1103.342 729.781 810.698 1.00 0.00 ? 512  HIS A C  1 
ATOM 2123   O O  . HIS A 1 512  ? 1102.668 728.832 810.299 1.00 0.00 ? 512  HIS A O  1 
ATOM 2124   C CB . HIS A 1 512  ? 1101.924 731.406 811.881 1.00 0.00 ? 512  HIS A CB 1 
ATOM 2125   N N  . LYS A 1 513  ? 1104.592 729.629 811.179 1.00 0.00 ? 513  LYS A N  1 
ATOM 2126   C CA . LYS A 1 513  ? 1105.187 728.328 811.294 1.00 0.00 ? 513  LYS A CA 1 
ATOM 2127   C C  . LYS A 1 513  ? 1104.578 727.654 812.474 1.00 0.00 ? 513  LYS A C  1 
ATOM 2128   O O  . LYS A 1 513  ? 1104.170 728.311 813.429 1.00 0.00 ? 513  LYS A O  1 
ATOM 2129   C CB . LYS A 1 513  ? 1106.710 728.354 811.525 1.00 0.00 ? 513  LYS A CB 1 
ATOM 2130   N N  . LEU A 1 514  ? 1104.480 726.311 812.433 1.00 0.00 ? 514  LEU A N  1 
ATOM 2131   C CA . LEU A 1 514  ? 1103.894 725.633 813.549 1.00 0.00 ? 514  LEU A CA 1 
ATOM 2132   C C  . LEU A 1 514  ? 1104.998 725.031 814.356 1.00 0.00 ? 514  LEU A C  1 
ATOM 2133   O O  . LEU A 1 514  ? 1105.817 724.263 813.854 1.00 0.00 ? 514  LEU A O  1 
ATOM 2134   C CB . LEU A 1 514  ? 1102.906 724.531 813.138 1.00 0.00 ? 514  LEU A CB 1 
ATOM 2135   N N  . ARG A 1 515  ? 1105.035 725.390 815.653 1.00 0.00 ? 515  ARG A N  1 
ATOM 2136   C CA . ARG A 1 515  ? 1106.032 724.962 816.593 1.00 0.00 ? 515  ARG A CA 1 
ATOM 2137   C C  . ARG A 1 515  ? 1105.682 723.574 817.038 1.00 0.00 ? 515  ARG A C  1 
ATOM 2138   O O  . ARG A 1 515  ? 1104.569 723.096 816.825 1.00 0.00 ? 515  ARG A O  1 
ATOM 2139   C CB . ARG A 1 515  ? 1106.081 725.892 817.819 1.00 0.00 ? 515  ARG A CB 1 
ATOM 2140   N N  . PRO A 1 516  ? 1106.639 722.903 817.623 1.00 0.00 ? 516  PRO A N  1 
ATOM 2141   C CA . PRO A 1 516  ? 1106.428 721.558 818.087 1.00 0.00 ? 516  PRO A CA 1 
ATOM 2142   C C  . PRO A 1 516  ? 1105.379 721.502 819.152 1.00 0.00 ? 516  PRO A C  1 
ATOM 2143   O O  . PRO A 1 516  ? 1104.745 720.458 819.308 1.00 0.00 ? 516  PRO A O  1 
ATOM 2144   C CB . PRO A 1 516  ? 1107.803 721.046 818.507 1.00 0.00 ? 516  PRO A CB 1 
ATOM 2145   N N  . VAL A 1 517  ? 1105.187 722.601 819.898 1.00 0.00 ? 517  VAL A N  1 
ATOM 2146   C CA . VAL A 1 517  ? 1104.201 722.637 820.937 1.00 0.00 ? 517  VAL A CA 1 
ATOM 2147   C C  . VAL A 1 517  ? 1102.854 722.476 820.302 1.00 0.00 ? 517  VAL A C  1 
ATOM 2148   O O  . VAL A 1 517  ? 1102.002 721.747 820.808 1.00 0.00 ? 517  VAL A O  1 
ATOM 2149   C CB . VAL A 1 517  ? 1104.204 723.947 821.664 1.00 0.00 ? 517  VAL A CB 1 
ATOM 2150   N N  . ASP A 1 518  ? 1102.636 723.164 819.166 1.00 0.00 ? 518  ASP A N  1 
ATOM 2151   C CA . ASP A 1 518  ? 1101.375 723.141 818.481 1.00 0.00 ? 518  ASP A CA 1 
ATOM 2152   C C  . ASP A 1 518  ? 1101.121 721.758 817.976 1.00 0.00 ? 518  ASP A C  1 
ATOM 2153   O O  . ASP A 1 518  ? 1099.998 721.261 818.040 1.00 0.00 ? 518  ASP A O  1 
ATOM 2154   C CB . ASP A 1 518  ? 1101.352 724.085 817.268 1.00 0.00 ? 518  ASP A CB 1 
ATOM 2155   N N  . GLN A 1 519  ? 1102.175 721.099 817.459 1.00 0.00 ? 519  GLN A N  1 
ATOM 2156   C CA . GLN A 1 519  ? 1102.048 719.782 816.911 1.00 0.00 ? 519  GLN A CA 1 
ATOM 2157   C C  . GLN A 1 519  ? 1101.611 718.863 818.010 1.00 0.00 ? 519  GLN A C  1 
ATOM 2158   O O  . GLN A 1 519  ? 1100.716 718.037 817.844 1.00 0.00 ? 519  GLN A O  1 
ATOM 2159   C CB . GLN A 1 519  ? 1103.396 719.260 816.383 1.00 0.00 ? 519  GLN A CB 1 
ATOM 2160   N N  . LEU A 1 520  ? 1102.213 719.004 819.198 1.00 0.00 ? 520  LEU A N  1 
ATOM 2161   C CA . LEU A 1 520  ? 1101.874 718.125 820.276 1.00 0.00 ? 520  LEU A CA 1 
ATOM 2162   C C  . LEU A 1 520  ? 1100.433 718.352 820.608 1.00 0.00 ? 520  LEU A C  1 
ATOM 2163   O O  . LEU A 1 520  ? 1099.696 717.413 820.898 1.00 0.00 ? 520  LEU A O  1 
ATOM 2164   C CB . LEU A 1 520  ? 1102.706 718.420 821.540 1.00 0.00 ? 520  LEU A CB 1 
ATOM 2165   N N  . ARG A 1 521  ? 1099.997 719.623 820.550 1.00 0.00 ? 521  ARG A N  1 
ATOM 2166   C CA . ARG A 1 521  ? 1098.668 720.010 820.932 1.00 0.00 ? 521  ARG A CA 1 
ATOM 2167   C C  . ARG A 1 521  ? 1097.666 719.311 820.068 1.00 0.00 ? 521  ARG A C  1 
ATOM 2168   O O  . ARG A 1 521  ? 1096.640 718.843 820.558 1.00 0.00 ? 521  ARG A O  1 
ATOM 2169   C CB . ARG A 1 521  ? 1098.451 721.529 820.798 1.00 0.00 ? 521  ARG A CB 1 
ATOM 2170   N N  . HIS A 1 522  ? 1097.936 719.211 818.755 1.00 0.00 ? 522  HIS A N  1 
ATOM 2171   C CA . HIS A 1 522  ? 1097.019 718.574 817.851 1.00 0.00 ? 522  HIS A CA 1 
ATOM 2172   C C  . HIS A 1 522  ? 1096.887 717.139 818.270 1.00 0.00 ? 522  HIS A C  1 
ATOM 2173   O O  . HIS A 1 522  ? 1095.797 716.573 818.290 1.00 0.00 ? 522  HIS A O  1 
ATOM 2174   C CB . HIS A 1 522  ? 1097.534 718.612 816.402 1.00 0.00 ? 522  HIS A CB 1 
ATOM 2175   N N  . LEU A 1 523  ? 1098.036 716.535 818.622 1.00 0.00 ? 523  LEU A N  1 
ATOM 2176   C CA . LEU A 1 523  ? 1098.262 715.177 819.031 1.00 0.00 ? 523  LEU A CA 1 
ATOM 2177   C C  . LEU A 1 523  ? 1097.789 714.866 820.420 1.00 0.00 ? 523  LEU A C  1 
ATOM 2178   O O  . LEU A 1 523  ? 1097.898 713.722 820.859 1.00 0.00 ? 523  LEU A O  1 
ATOM 2179   C CB . LEU A 1 523  ? 1099.716 714.715 818.876 1.00 0.00 ? 523  LEU A CB 1 
ATOM 2180   N N  . LEU A 1 524  ? 1097.307 715.865 821.177 1.00 0.00 ? 524  LEU A N  1 
ATOM 2181   C CA . LEU A 1 524  ? 1097.009 715.693 822.570 1.00 0.00 ? 524  LEU A CA 1 
ATOM 2182   C C  . LEU A 1 524  ? 1096.155 714.484 822.831 1.00 0.00 ? 524  LEU A C  1 
ATOM 2183   O O  . LEU A 1 524  ? 1096.479 713.717 823.736 1.00 0.00 ? 524  LEU A O  1 
ATOM 2184   C CB . LEU A 1 524  ? 1096.264 716.915 823.143 1.00 0.00 ? 524  LEU A CB 1 
ATOM 2185   N N  . VAL A 1 525  ? 1095.075 714.248 822.060 1.00 0.00 ? 525  VAL A N  1 
ATOM 2186   C CA . VAL A 1 525  ? 1094.242 713.110 822.347 1.00 0.00 ? 525  VAL A CA 1 
ATOM 2187   C C  . VAL A 1 525  ? 1095.091 711.888 822.262 1.00 0.00 ? 525  VAL A C  1 
ATOM 2188   O O  . VAL A 1 525  ? 1094.833 710.880 822.917 1.00 0.00 ? 525  VAL A O  1 
ATOM 2189   C CB . VAL A 1 525  ? 1093.139 712.942 821.349 1.00 0.00 ? 525  VAL A CB 1 
ATOM 2190   N N  . GLU A 1 534  ? 1096.525 711.738 819.856 1.00 0.00 ? 534  GLU A N  1 
ATOM 2191   C CA . GLU A 1 534  ? 1097.269 710.571 820.197 1.00 0.00 ? 534  GLU A CA 1 
ATOM 2192   C C  . GLU A 1 534  ? 1098.686 711.032 820.074 1.00 0.00 ? 534  GLU A C  1 
ATOM 2193   O O  . GLU A 1 534  ? 1099.077 711.540 819.026 1.00 0.00 ? 534  GLU A O  1 
ATOM 2194   C CB . GLU A 1 534  ? 1096.998 709.429 819.207 1.00 0.00 ? 534  GLU A CB 1 
ATOM 2195   N N  . ILE A 1 535  ? 1099.499 710.888 821.139 1.00 0.00 ? 535  ILE A N  1 
ATOM 2196   C CA . ILE A 1 535  ? 1100.802 711.487 821.075 1.00 0.00 ? 535  ILE A CA 1 
ATOM 2197   C C  . ILE A 1 535  ? 1101.834 710.465 820.688 1.00 0.00 ? 535  ILE A C  1 
ATOM 2198   O O  . ILE A 1 535  ? 1103.030 710.711 820.830 1.00 0.00 ? 535  ILE A O  1 
ATOM 2199   C CB . ILE A 1 535  ? 1101.222 711.996 822.424 1.00 0.00 ? 535  ILE A CB 1 
ATOM 2200   N N  . GLU A 1 536  ? 1101.432 709.301 820.143 1.00 0.00 ? 536  GLU A N  1 
ATOM 2201   C CA . GLU A 1 536  ? 1102.459 708.364 819.789 1.00 0.00 ? 536  GLU A CA 1 
ATOM 2202   C C  . GLU A 1 536  ? 1103.216 708.875 818.612 1.00 0.00 ? 536  GLU A C  1 
ATOM 2203   O O  . GLU A 1 536  ? 1104.427 708.702 818.504 1.00 0.00 ? 536  GLU A O  1 
ATOM 2204   C CB . GLU A 1 536  ? 1101.982 706.954 819.409 1.00 0.00 ? 536  GLU A CB 1 
ATOM 2205   N N  . ARG A 1 537  ? 1102.491 709.531 817.700 1.00 0.00 ? 537  ARG A N  1 
ATOM 2206   C CA . ARG A 1 537  ? 1102.993 709.992 816.446 1.00 0.00 ? 537  ARG A CA 1 
ATOM 2207   C C  . ARG A 1 537  ? 1104.095 710.971 816.710 1.00 0.00 ? 537  ARG A C  1 
ATOM 2208   O O  . ARG A 1 537  ? 1105.126 710.953 816.038 1.00 0.00 ? 537  ARG A O  1 
ATOM 2209   C CB . ARG A 1 537  ? 1101.842 710.644 815.656 1.00 0.00 ? 537  ARG A CB 1 
ATOM 2210   N N  . PHE A 1 538  ? 1103.908 711.847 817.715 1.00 0.00 ? 538  PHE A N  1 
ATOM 2211   C CA . PHE A 1 538  ? 1104.895 712.822 818.087 1.00 0.00 ? 538  PHE A CA 1 
ATOM 2212   C C  . PHE A 1 538  ? 1106.082 712.076 818.616 1.00 0.00 ? 538  PHE A C  1 
ATOM 2213   O O  . PHE A 1 538  ? 1107.227 712.375 818.285 1.00 0.00 ? 538  PHE A O  1 
ATOM 2214   C CB . PHE A 1 538  ? 1104.366 713.730 819.216 1.00 0.00 ? 538  PHE A CB 1 
ATOM 2215   N N  . PHE A 1 539  ? 1105.800 711.054 819.440 1.00 0.00 ? 539  PHE A N  1 
ATOM 2216   C CA . PHE A 1 539  ? 1106.761 710.244 820.132 1.00 0.00 ? 539  PHE A CA 1 
ATOM 2217   C C  . PHE A 1 539  ? 1107.633 709.591 819.105 1.00 0.00 ? 539  PHE A C  1 
ATOM 2218   O O  . PHE A 1 539  ? 1108.858 709.623 819.192 1.00 0.00 ? 539  PHE A O  1 
ATOM 2219   C CB . PHE A 1 539  ? 1106.012 709.114 820.863 1.00 0.00 ? 539  PHE A CB 1 
ATOM 2220   N N  . LYS A 1 540  ? 1106.997 709.000 818.077 1.00 0.00 ? 540  LYS A N  1 
ATOM 2221   C CA . LYS A 1 540  ? 1107.694 708.253 817.077 1.00 0.00 ? 540  LYS A CA 1 
ATOM 2222   C C  . LYS A 1 540  ? 1108.693 709.122 816.386 1.00 0.00 ? 540  LYS A C  1 
ATOM 2223   O O  . LYS A 1 540  ? 1109.882 708.816 816.353 1.00 0.00 ? 540  LYS A O  1 
ATOM 2224   C CB . LYS A 1 540  ? 1106.722 707.756 815.994 1.00 0.00 ? 540  LYS A CB 1 
ATOM 2225   N N  . LEU A 1 541  ? 1108.222 710.246 815.821 1.00 0.00 ? 541  LEU A N  1 
ATOM 2226   C CA . LEU A 1 541  ? 1109.087 711.084 815.046 1.00 0.00 ? 541  LEU A CA 1 
ATOM 2227   C C  . LEU A 1 541  ? 1110.120 711.741 815.918 1.00 0.00 ? 541  LEU A C  1 
ATOM 2228   O O  . LEU A 1 541  ? 1111.322 711.584 815.710 1.00 0.00 ? 541  LEU A O  1 
ATOM 2229   C CB . LEU A 1 541  ? 1108.246 712.167 814.333 1.00 0.00 ? 541  LEU A CB 1 
ATOM 2230   N N  . HIS A 1 542  ? 1109.642 712.503 816.919 1.00 0.00 ? 542  HIS A N  1 
ATOM 2231   C CA . HIS A 1 542  ? 1110.443 713.345 817.765 1.00 0.00 ? 542  HIS A CA 1 
ATOM 2232   C C  . HIS A 1 542  ? 1111.283 712.593 818.757 1.00 0.00 ? 542  HIS A C  1 
ATOM 2233   O O  . HIS A 1 542  ? 1112.446 712.945 818.926 1.00 0.00 ? 542  HIS A O  1 
ATOM 2234   C CB . HIS A 1 542  ? 1109.563 714.350 818.519 1.00 0.00 ? 542  HIS A CB 1 
ATOM 2235   N N  . GLN A 1 543  ? 1110.706 711.585 819.455 1.00 0.00 ? 543  GLN A N  1 
ATOM 2236   C CA . GLN A 1 543  ? 1111.340 710.759 820.462 1.00 0.00 ? 543  GLN A CA 1 
ATOM 2237   C C  . GLN A 1 543  ? 1110.621 711.007 821.753 1.00 0.00 ? 543  GLN A C  1 
ATOM 2238   O O  . GLN A 1 543  ? 1109.867 711.972 821.879 1.00 0.00 ? 543  GLN A O  1 
ATOM 2239   C CB . GLN A 1 543  ? 1112.847 710.972 820.716 1.00 0.00 ? 543  GLN A CB 1 
ATOM 2240   N N  . GLU A 1 544  ? 1110.829 710.116 822.740 1.00 0.00 ? 544  GLU A N  1 
ATOM 2241   C CA . GLU A 1 544  ? 1110.159 710.173 824.009 1.00 0.00 ? 544  GLU A CA 1 
ATOM 2242   C C  . GLU A 1 544  ? 1110.560 711.378 824.797 1.00 0.00 ? 544  GLU A C  1 
ATOM 2243   O O  . GLU A 1 544  ? 1109.709 712.065 825.361 1.00 0.00 ? 544  GLU A O  1 
ATOM 2244   C CB . GLU A 1 544  ? 1110.470 708.953 824.888 1.00 0.00 ? 544  GLU A CB 1 
ATOM 2245   N N  . ASP A 1 545  ? 1111.868 711.680 824.843 1.00 0.00 ? 545  ASP A N  1 
ATOM 2246   C CA . ASP A 1 545  ? 1112.359 712.740 825.674 1.00 0.00 ? 545  ASP A CA 1 
ATOM 2247   C C  . ASP A 1 545  ? 1111.732 714.026 825.244 1.00 0.00 ? 545  ASP A C  1 
ATOM 2248   O O  . ASP A 1 545  ? 1111.245 714.799 826.065 1.00 0.00 ? 545  ASP A O  1 
ATOM 2249   C CB . ASP A 1 545  ? 1113.886 712.896 825.531 1.00 0.00 ? 545  ASP A CB 1 
ATOM 2250   N N  . GLN A 1 546  ? 1111.720 714.272 823.927 1.00 0.00 ? 546  GLN A N  1 
ATOM 2251   C CA . GLN A 1 546  ? 1111.229 715.508 823.406 1.00 0.00 ? 546  GLN A CA 1 
ATOM 2252   C C  . GLN A 1 546  ? 1109.764 715.612 823.679 1.00 0.00 ? 546  GLN A C  1 
ATOM 2253   O O  . GLN A 1 546  ? 1109.255 716.697 823.959 1.00 0.00 ? 546  GLN A O  1 
ATOM 2254   C CB . GLN A 1 546  ? 1111.547 715.605 821.921 1.00 0.00 ? 546  GLN A CB 1 
ATOM 2255   N N  . ALA A 1 547  ? 1109.047 714.479 823.610 1.00 0.00 ? 547  ALA A N  1 
ATOM 2256   C CA . ALA A 1 547  ? 1107.637 714.494 823.866 1.00 0.00 ? 547  ALA A CA 1 
ATOM 2257   C C  . ALA A 1 547  ? 1107.404 714.930 825.280 1.00 0.00 ? 547  ALA A C  1 
ATOM 2258   O O  . ALA A 1 547  ? 1106.489 715.705 825.553 1.00 0.00 ? 547  ALA A O  1 
ATOM 2259   C CB . ALA A 1 547  ? 1106.983 713.112 823.695 1.00 0.00 ? 547  ALA A CB 1 
ATOM 2260   N N  . CYS A 1 548  ? 1108.233 714.435 826.217 1.00 0.00 ? 548  CYS A N  1 
ATOM 2261   C CA . CYS A 1 548  ? 1108.087 714.745 827.611 1.00 0.00 ? 548  CYS A CA 1 
ATOM 2262   C C  . CYS A 1 548  ? 1108.301 716.214 827.802 1.00 0.00 ? 548  CYS A C  1 
ATOM 2263   O O  . CYS A 1 548  ? 1107.565 716.865 828.540 1.00 0.00 ? 548  CYS A O  1 
ATOM 2264   C CB . CYS A 1 548  ? 1109.145 714.025 828.461 1.00 0.00 ? 548  CYS A CB 1 
ATOM 2265   N N  . ALA A 1 549  ? 1109.326 716.776 827.132 1.00 0.00 ? 549  ALA A N  1 
ATOM 2266   C CA . ALA A 1 549  ? 1109.657 718.161 827.307 1.00 0.00 ? 549  ALA A CA 1 
ATOM 2267   C C  . ALA A 1 549  ? 1108.522 719.030 826.850 1.00 0.00 ? 549  ALA A C  1 
ATOM 2268   O O  . ALA A 1 549  ? 1108.142 719.975 827.537 1.00 0.00 ? 549  ALA A O  1 
ATOM 2269   C CB . ALA A 1 549  ? 1110.903 718.580 826.505 1.00 0.00 ? 549  ALA A CB 1 
ATOM 2270   N N  . THR A 1 550  ? 1107.943 718.720 825.676 1.00 0.00 ? 550  THR A N  1 
ATOM 2271   C CA . THR A 1 550  ? 1106.871 719.502 825.121 1.00 0.00 ? 550  THR A CA 1 
ATOM 2272   C C  . THR A 1 550  ? 1105.673 719.364 826.007 1.00 0.00 ? 550  THR A C  1 
ATOM 2273   O O  . THR A 1 550  ? 1104.871 720.282 826.159 1.00 0.00 ? 550  THR A O  1 
ATOM 2274   C CB . THR A 1 550  ? 1106.468 719.047 823.749 1.00 0.00 ? 550  THR A CB 1 
ATOM 2275   N N  . CYS A 1 551  ? 1105.504 718.171 826.585 1.00 0.00 ? 551  CYS A N  1 
ATOM 2276   C CA . CYS A 1 551  ? 1104.374 717.878 827.407 1.00 0.00 ? 551  CYS A CA 1 
ATOM 2277   C C  . CYS A 1 551  ? 1104.476 718.772 828.616 1.00 0.00 ? 551  CYS A C  1 
ATOM 2278   O O  . CYS A 1 551  ? 1103.494 719.352 829.078 1.00 0.00 ? 551  CYS A O  1 
ATOM 2279   C CB . CYS A 1 551  ? 1104.444 716.397 827.807 1.00 0.00 ? 551  CYS A CB 1 
ATOM 2280   N N  . LEU A 1 552  ? 1105.696 718.930 829.158 1.00 0.00 ? 552  LEU A N  1 
ATOM 2281   C CA . LEU A 1 552  ? 1105.877 719.769 830.309 1.00 0.00 ? 552  LEU A CA 1 
ATOM 2282   C C  . LEU A 1 552  ? 1105.525 721.178 829.947 1.00 0.00 ? 552  LEU A C  1 
ATOM 2283   O O  . LEU A 1 552  ? 1104.822 721.856 830.695 1.00 0.00 ? 552  LEU A O  1 
ATOM 2284   C CB . LEU A 1 552  ? 1107.330 719.778 830.811 1.00 0.00 ? 552  LEU A CB 1 
ATOM 2285   N N  . ILE A 1 553  ? 1105.990 721.660 828.777 1.00 0.00 ? 553  ILE A N  1 
ATOM 2286   C CA . ILE A 1 553  ? 1105.698 723.015 828.409 1.00 0.00 ? 553  ILE A CA 1 
ATOM 2287   C C  . ILE A 1 553  ? 1104.227 723.227 828.261 1.00 0.00 ? 553  ILE A C  1 
ATOM 2288   O O  . ILE A 1 553  ? 1103.707 724.243 828.722 1.00 0.00 ? 553  ILE A O  1 
ATOM 2289   C CB . ILE A 1 553  ? 1106.422 723.531 827.190 1.00 0.00 ? 553  ILE A CB 1 
ATOM 2290   N N  . LEU A 1 554  ? 1103.496 722.290 827.637 1.00 0.00 ? 554  LEU A N  1 
ATOM 2291   C CA . LEU A 1 554  ? 1102.084 722.498 827.488 1.00 0.00 ? 554  LEU A CA 1 
ATOM 2292   C C  . LEU A 1 554  ? 1101.437 722.558 828.833 1.00 0.00 ? 554  LEU A C  1 
ATOM 2293   O O  . LEU A 1 554  ? 1100.520 723.351 829.047 1.00 0.00 ? 554  LEU A O  1 
ATOM 2294   C CB . LEU A 1 554  ? 1101.366 721.390 826.696 1.00 0.00 ? 554  LEU A CB 1 
ATOM 2295   N N  . ALA A 1 555  ? 1101.884 721.719 829.782 1.00 0.00 ? 555  ALA A N  1 
ATOM 2296   C CA . ALA A 1 555  ? 1101.221 721.713 831.052 1.00 0.00 ? 555  ALA A CA 1 
ATOM 2297   C C  . ALA A 1 555  ? 1101.348 723.065 831.683 1.00 0.00 ? 555  ALA A C  1 
ATOM 2298   O O  . ALA A 1 555  ? 1100.367 723.630 832.163 1.00 0.00 ? 555  ALA A O  1 
ATOM 2299   C CB . ALA A 1 555  ? 1101.821 720.685 832.029 1.00 0.00 ? 555  ALA A CB 1 
ATOM 2300   N N  . CYS A 1 556  ? 1102.573 723.621 831.684 1.00 0.00 ? 556  CYS A N  1 
ATOM 2301   C CA . CYS A 1 556  ? 1102.840 724.898 832.285 1.00 0.00 ? 556  CYS A CA 1 
ATOM 2302   C C  . CYS A 1 556  ? 1102.244 726.016 831.483 1.00 0.00 ? 556  CYS A C  1 
ATOM 2303   O O  . CYS A 1 556  ? 1101.785 727.012 832.040 1.00 0.00 ? 556  CYS A O  1 
ATOM 2304   C CB . CYS A 1 556  ? 1104.345 725.174 832.431 1.00 0.00 ? 556  CYS A CB 1 
ATOM 2305   N N  . SER A 1 557  ? 1102.218 725.862 830.148 1.00 0.00 ? 557  SER A N  1 
ATOM 2306   C CA . SER A 1 557  ? 1101.863 726.912 829.234 1.00 0.00 ? 557  SER A CA 1 
ATOM 2307   C C  . SER A 1 557  ? 1100.608 727.610 829.631 1.00 0.00 ? 557  SER A C  1 
ATOM 2308   O O  . SER A 1 557  ? 1099.612 727.003 830.029 1.00 0.00 ? 557  SER A O  1 
ATOM 2309   C CB . SER A 1 557  ? 1101.681 726.421 827.788 1.00 0.00 ? 557  SER A CB 1 
ATOM 2310   N N  . THR A 1 558  ? 1100.661 728.952 829.531 1.00 0.00 ? 558  THR A N  1 
ATOM 2311   C CA . THR A 1 558  ? 1099.534 729.783 829.803 1.00 0.00 ? 558  THR A CA 1 
ATOM 2312   C C  . THR A 1 558  ? 1098.798 729.920 828.517 1.00 0.00 ? 558  THR A C  1 
ATOM 2313   O O  . THR A 1 558  ? 1098.963 729.115 827.600 1.00 0.00 ? 558  THR A O  1 
ATOM 2314   C CB . THR A 1 558  ? 1099.920 731.164 830.251 1.00 0.00 ? 558  THR A CB 1 
ATOM 2315   N N  . CYS A 1 561  ? 1096.217 730.318 829.580 1.00 0.00 ? 561  CYS A N  1 
ATOM 2316   C CA . CYS A 1 561  ? 1095.432 730.525 828.403 1.00 0.00 ? 561  CYS A CA 1 
ATOM 2317   C C  . CYS A 1 561  ? 1095.247 729.213 827.700 1.00 0.00 ? 561  CYS A C  1 
ATOM 2318   O O  . CYS A 1 561  ? 1094.710 729.163 826.595 1.00 0.00 ? 561  CYS A O  1 
ATOM 2319   C CB . CYS A 1 561  ? 1096.128 731.501 827.433 1.00 0.00 ? 561  CYS A CB 1 
ATOM 2320   N N  . ASP A 1 562  ? 1095.661 728.098 828.331 1.00 0.00 ? 562  ASP A N  1 
ATOM 2321   C CA . ASP A 1 562  ? 1095.417 726.832 827.702 1.00 0.00 ? 562  ASP A CA 1 
ATOM 2322   C C  . ASP A 1 562  ? 1094.198 726.246 828.335 1.00 0.00 ? 562  ASP A C  1 
ATOM 2323   O O  . ASP A 1 562  ? 1093.855 726.572 829.471 1.00 0.00 ? 562  ASP A O  1 
ATOM 2324   C CB . ASP A 1 562  ? 1096.560 725.814 827.850 1.00 0.00 ? 562  ASP A CB 1 
ATOM 2325   N N  . ARG A 1 563  ? 1093.496 725.369 827.592 1.00 0.00 ? 563  ARG A N  1 
ATOM 2326   C CA . ARG A 1 563  ? 1092.312 724.758 828.113 1.00 0.00 ? 563  ARG A CA 1 
ATOM 2327   C C  . ARG A 1 563  ? 1092.752 723.807 829.173 1.00 0.00 ? 563  ARG A C  1 
ATOM 2328   O O  . ARG A 1 563  ? 1093.881 723.318 829.157 1.00 0.00 ? 563  ARG A O  1 
ATOM 2329   C CB . ARG A 1 563  ? 1091.507 723.971 827.063 1.00 0.00 ? 563  ARG A CB 1 
ATOM 2330   N N  . GLU A 1 564  ? 1091.864 723.542 830.146 1.00 0.00 ? 564  GLU A N  1 
ATOM 2331   C CA . GLU A 1 564  ? 1092.190 722.673 831.237 1.00 0.00 ? 564  GLU A CA 1 
ATOM 2332   C C  . GLU A 1 564  ? 1092.437 721.308 830.688 1.00 0.00 ? 564  GLU A C  1 
ATOM 2333   O O  . GLU A 1 564  ? 1093.316 720.588 831.163 1.00 0.00 ? 564  GLU A O  1 
ATOM 2334   C CB . GLU A 1 564  ? 1091.062 722.565 832.275 1.00 0.00 ? 564  GLU A CB 1 
ATOM 2335   N N  . VAL A 1 565  ? 1091.668 720.920 829.657 1.00 0.00 ? 565  VAL A N  1 
ATOM 2336   C CA . VAL A 1 565  ? 1091.796 719.602 829.110 1.00 0.00 ? 565  VAL A CA 1 
ATOM 2337   C C  . VAL A 1 565  ? 1093.195 719.416 828.609 1.00 0.00 ? 565  VAL A C  1 
ATOM 2338   O O  . VAL A 1 565  ? 1093.826 718.398 828.885 1.00 0.00 ? 565  VAL A O  1 
ATOM 2339   C CB . VAL A 1 565  ? 1090.875 719.371 827.948 1.00 0.00 ? 565  VAL A CB 1 
ATOM 2340   N N  . SER A 1 566  ? 1093.723 720.408 827.870 1.00 0.00 ? 566  SER A N  1 
ATOM 2341   C CA . SER A 1 566  ? 1095.032 720.277 827.295 1.00 0.00 ? 566  SER A CA 1 
ATOM 2342   C C  . SER A 1 566  ? 1096.059 720.161 828.376 1.00 0.00 ? 566  SER A C  1 
ATOM 2343   O O  . SER A 1 566  ? 1096.907 719.271 828.342 1.00 0.00 ? 566  SER A O  1 
ATOM 2344   C CB . SER A 1 566  ? 1095.421 721.484 826.423 1.00 0.00 ? 566  SER A CB 1 
ATOM 2345   N N  . ALA A 1 567  ? 1096.004 721.058 829.380 1.00 0.00 ? 567  ALA A N  1 
ATOM 2346   C CA . ALA A 1 567  ? 1097.000 721.071 830.410 1.00 0.00 ? 567  ALA A CA 1 
ATOM 2347   C C  . ALA A 1 567  ? 1096.962 719.785 831.172 1.00 0.00 ? 567  ALA A C  1 
ATOM 2348   O O  . ALA A 1 567  ? 1098.004 719.201 831.465 1.00 0.00 ? 567  ALA A O  1 
ATOM 2349   C CB . ALA A 1 567  ? 1096.790 722.211 831.423 1.00 0.00 ? 567  ALA A CB 1 
ATOM 2350   N N  . TRP A 1 568  ? 1095.753 719.300 831.507 1.00 0.00 ? 568  TRP A N  1 
ATOM 2351   C CA . TRP A 1 568  ? 1095.644 718.115 832.303 1.00 0.00 ? 568  TRP A CA 1 
ATOM 2352   C C  . TRP A 1 568  ? 1096.178 716.946 831.538 1.00 0.00 ? 568  TRP A C  1 
ATOM 2353   O O  . TRP A 1 568  ? 1096.897 716.114 832.089 1.00 0.00 ? 568  TRP A O  1 
ATOM 2354   C CB . TRP A 1 568  ? 1094.197 717.786 832.710 1.00 0.00 ? 568  TRP A CB 1 
ATOM 2355   N N  . ALA A 1 569  ? 1095.831 716.852 830.242 1.00 0.00 ? 569  ALA A N  1 
ATOM 2356   C CA . ALA A 1 569  ? 1096.250 715.733 829.447 1.00 0.00 ? 569  ALA A CA 1 
ATOM 2357   C C  . ALA A 1 569  ? 1097.742 715.715 829.359 1.00 0.00 ? 569  ALA A C  1 
ATOM 2358   O O  . ALA A 1 569  ? 1098.366 714.665 829.499 1.00 0.00 ? 569  ALA A O  1 
ATOM 2359   C CB . ALA A 1 569  ? 1095.707 715.786 828.008 1.00 0.00 ? 569  ALA A CB 1 
ATOM 2360   N N  . THR A 1 570  ? 1098.355 716.890 829.131 1.00 0.00 ? 570  THR A N  1 
ATOM 2361   C CA . THR A 1 570  ? 1099.778 716.960 828.985 1.00 0.00 ? 570  THR A CA 1 
ATOM 2362   C C  . THR A 1 570  ? 1100.394 716.612 830.308 1.00 0.00 ? 570  THR A C  1 
ATOM 2363   O O  . THR A 1 570  ? 1101.420 715.943 830.384 1.00 0.00 ? 570  THR A O  1 
ATOM 2364   C CB . THR A 1 570  ? 1100.230 718.310 828.525 1.00 0.00 ? 570  THR A CB 1 
ATOM 2365   N N  . ARG A 1 571  ? 1099.777 717.048 831.414 1.00 0.00 ? 571  ARG A N  1 
ATOM 2366   C CA . ARG A 1 571  ? 1100.323 716.718 832.698 1.00 0.00 ? 571  ARG A CA 1 
ATOM 2367   C C  . ARG A 1 571  ? 1100.293 715.228 832.845 1.00 0.00 ? 571  ARG A C  1 
ATOM 2368   O O  . ARG A 1 571  ? 1101.252 714.623 833.319 1.00 0.00 ? 571  ARG A O  1 
ATOM 2369   C CB . ARG A 1 571  ? 1099.496 717.311 833.850 1.00 0.00 ? 571  ARG A CB 1 
ATOM 2370   N N  . ALA A 1 572  ? 1099.180 714.596 832.423 1.00 0.00 ? 572  ALA A N  1 
ATOM 2371   C CA . ALA A 1 572  ? 1099.004 713.180 832.568 1.00 0.00 ? 572  ALA A CA 1 
ATOM 2372   C C  . ALA A 1 572  ? 1100.051 712.450 831.785 1.00 0.00 ? 572  ALA A C  1 
ATOM 2373   O O  . ALA A 1 572  ? 1100.611 711.467 832.264 1.00 0.00 ? 572  ALA A O  1 
ATOM 2374   C CB . ALA A 1 572  ? 1097.633 712.697 832.062 1.00 0.00 ? 572  ALA A CB 1 
ATOM 2375   N N  . PHE A 1 573  ? 1100.344 712.906 830.553 1.00 0.00 ? 573  PHE A N  1 
ATOM 2376   C CA . PHE A 1 573  ? 1101.322 712.259 829.723 1.00 0.00 ? 573  PHE A CA 1 
ATOM 2377   C C  . PHE A 1 573  ? 1102.664 712.379 830.370 1.00 0.00 ? 573  PHE A C  1 
ATOM 2378   O O  . PHE A 1 573  ? 1103.436 711.422 830.417 1.00 0.00 ? 573  PHE A O  1 
ATOM 2379   C CB . PHE A 1 573  ? 1101.425 712.900 828.331 1.00 0.00 ? 573  PHE A CB 1 
ATOM 2380   N N  . PHE A 1 574  ? 1102.980 713.574 830.888 1.00 0.00 ? 574  PHE A N  1 
ATOM 2381   C CA . PHE A 1 574  ? 1104.262 713.832 831.475 1.00 0.00 ? 574  PHE A CA 1 
ATOM 2382   C C  . PHE A 1 574  ? 1104.443 712.912 832.645 1.00 0.00 ? 574  PHE A C  1 
ATOM 2383   O O  . PHE A 1 574  ? 1105.461 712.234 832.762 1.00 0.00 ? 574  PHE A O  1 
ATOM 2384   C CB . PHE A 1 574  ? 1104.320 715.297 831.953 1.00 0.00 ? 574  PHE A CB 1 
ATOM 2385   N N  . ARG A 1 575  ? 1103.442 712.877 833.546 1.00 0.00 ? 575  ARG A N  1 
ATOM 2386   C CA . ARG A 1 575  ? 1103.480 712.093 834.747 1.00 0.00 ? 575  ARG A CA 1 
ATOM 2387   C C  . ARG A 1 575  ? 1103.362 710.612 834.500 1.00 0.00 ? 575  ARG A C  1 
ATOM 2388   O O  . ARG A 1 575  ? 1104.126 709.835 835.070 1.00 0.00 ? 575  ARG A O  1 
ATOM 2389   C CB . ARG A 1 575  ? 1102.351 712.490 835.716 1.00 0.00 ? 575  ARG A CB 1 
ATOM 2390   N N  . TYR A 1 576  ? 1102.421 710.171 833.637 1.00 0.00 ? 576  TYR A N  1 
ATOM 2391   C CA . TYR A 1 576  ? 1102.167 708.756 833.574 1.00 0.00 ? 576  TYR A CA 1 
ATOM 2392   C C  . TYR A 1 576  ? 1102.439 708.199 832.206 1.00 0.00 ? 576  TYR A C  1 
ATOM 2393   O O  . TYR A 1 576  ? 1102.505 706.982 832.038 1.00 0.00 ? 576  TYR A O  1 
ATOM 2394   C CB . TYR A 1 576  ? 1100.690 708.450 833.893 1.00 0.00 ? 576  TYR A CB 1 
ATOM 2395   N N  . GLY A 1 577  ? 1102.638 709.054 831.190 1.00 0.00 ? 577  GLY A N  1 
ATOM 2396   C CA . GLY A 1 577  ? 1102.869 708.520 829.880 1.00 0.00 ? 577  GLY A CA 1 
ATOM 2397   C C  . GLY A 1 577  ? 1101.559 708.022 829.369 1.00 0.00 ? 577  GLY A C  1 
ATOM 2398   O O  . GLY A 1 577  ? 1100.504 708.519 829.764 1.00 0.00 ? 577  GLY A O  1 
ATOM 2399   N N  . GLY A 1 578  ? 1101.597 707.023 828.464 1.00 0.00 ? 578  GLY A N  1 
ATOM 2400   C CA . GLY A 1 578  ? 1100.386 706.467 827.937 1.00 0.00 ? 578  GLY A CA 1 
ATOM 2401   C C  . GLY A 1 578  ? 1100.155 705.192 828.678 1.00 0.00 ? 578  GLY A C  1 
ATOM 2402   O O  . GLY A 1 578  ? 1101.062 704.374 828.835 1.00 0.00 ? 578  GLY A O  1 
ATOM 2403   N N  . GLU A 1 579  ? 1098.910 704.985 829.137 1.00 0.00 ? 579  GLU A N  1 
ATOM 2404   C CA . GLU A 1 579  ? 1098.607 703.840 829.940 1.00 0.00 ? 579  GLU A CA 1 
ATOM 2405   C C  . GLU A 1 579  ? 1098.633 702.612 829.092 1.00 0.00 ? 579  GLU A C  1 
ATOM 2406   O O  . GLU A 1 579  ? 1098.083 702.584 827.993 1.00 0.00 ? 579  GLU A O  1 
ATOM 2407   C CB . GLU A 1 579  ? 1097.220 703.918 830.595 1.00 0.00 ? 579  GLU A CB 1 
ATOM 2408   N N  . ALA A 1 580  ? 1099.286 701.555 829.616 1.00 0.00 ? 580  ALA A N  1 
ATOM 2409   C CA . ALA A 1 580  ? 1099.359 700.282 828.963 1.00 0.00 ? 580  ALA A CA 1 
ATOM 2410   C C  . ALA A 1 580  ? 1099.802 700.490 827.557 1.00 0.00 ? 580  ALA A C  1 
ATOM 2411   O O  . ALA A 1 580  ? 1099.281 699.871 826.631 1.00 0.00 ? 580  ALA A O  1 
ATOM 2412   C CB . ALA A 1 580  ? 1098.021 699.522 828.951 1.00 0.00 ? 580  ALA A CB 1 
ATOM 2413   N N  . GLN A 1 581  ? 1100.791 701.376 827.367 1.00 0.00 ? 581  GLN A N  1 
ATOM 2414   C CA . GLN A 1 581  ? 1101.278 701.644 826.050 1.00 0.00 ? 581  GLN A CA 1 
ATOM 2415   C C  . GLN A 1 581  ? 1102.690 702.066 826.250 1.00 0.00 ? 581  GLN A C  1 
ATOM 2416   O O  . GLN A 1 581  ? 1103.586 701.235 826.388 1.00 0.00 ? 581  GLN A O  1 
ATOM 2417   C CB . GLN A 1 581  ? 1100.504 702.775 825.352 1.00 0.00 ? 581  GLN A CB 1 
ATOM 2418   N N  . MET A 1 582  ? 1102.916 703.390 826.264 1.00 0.00 ? 582  MET A N  1 
ATOM 2419   C CA . MET A 1 582  ? 1104.226 703.921 826.482 1.00 0.00 ? 582  MET A CA 1 
ATOM 2420   C C  . MET A 1 582  ? 1104.384 704.139 827.951 1.00 0.00 ? 582  MET A C  1 
ATOM 2421   O O  . MET A 1 582  ? 1103.555 704.795 828.584 1.00 0.00 ? 582  MET A O  1 
ATOM 2422   C CB . MET A 1 582  ? 1104.429 705.259 825.744 1.00 0.00 ? 582  MET A CB 1 
ATOM 2423   N N  . ARG A 1 583  ? 1105.464 703.581 828.537 1.00 0.00 ? 583  ARG A N  1 
ATOM 2424   C CA . ARG A 1 583  ? 1105.669 703.736 829.946 1.00 0.00 ? 583  ARG A CA 1 
ATOM 2425   C C  . ARG A 1 583  ? 1106.778 704.701 830.168 1.00 0.00 ? 583  ARG A C  1 
ATOM 2426   O O  . ARG A 1 583  ? 1107.677 704.858 829.342 1.00 0.00 ? 583  ARG A O  1 
ATOM 2427   C CB . ARG A 1 583  ? 1105.904 702.420 830.717 1.00 0.00 ? 583  ARG A CB 1 
ATOM 2428   N N  . PHE A 1 584  ? 1106.696 705.399 831.312 1.00 0.00 ? 584  PHE A N  1 
ATOM 2429   C CA . PHE A 1 584  ? 1107.563 706.492 831.615 1.00 0.00 ? 584  PHE A CA 1 
ATOM 2430   C C  . PHE A 1 584  ? 1108.438 706.026 832.717 1.00 0.00 ? 584  PHE A C  1 
ATOM 2431   O O  . PHE A 1 584  ? 1108.419 706.572 833.819 1.00 0.00 ? 584  PHE A O  1 
ATOM 2432   C CB . PHE A 1 584  ? 1106.693 707.597 832.213 1.00 0.00 ? 584  PHE A CB 1 
ATOM 2433   N N  . THR A 1 586  ? 1110.875 705.235 831.550 1.00 0.00 ? 586  THR A N  1 
ATOM 2434   C CA . THR A 1 586  ? 1111.184 705.026 832.932 1.00 0.00 ? 586  THR A CA 1 
ATOM 2435   C C  . THR A 1 586  ? 1112.660 704.896 833.003 1.00 0.00 ? 586  THR A C  1 
ATOM 2436   O O  . THR A 1 586  ? 1113.329 704.798 831.975 1.00 0.00 ? 586  THR A O  1 
ATOM 2437   C CB . THR A 1 586  ? 1110.562 703.797 833.529 1.00 0.00 ? 586  THR A CB 1 
ATOM 2438   N N  . THR A 1 587  ? 1113.217 704.923 834.225 1.00 0.00 ? 587  THR A N  1 
ATOM 2439   C CA . THR A 1 587  ? 1114.627 704.736 834.316 1.00 0.00 ? 587  THR A CA 1 
ATOM 2440   C C  . THR A 1 587  ? 1114.855 703.281 834.077 1.00 0.00 ? 587  THR A C  1 
ATOM 2441   O O  . THR A 1 587  ? 1114.115 702.439 834.582 1.00 0.00 ? 587  THR A O  1 
ATOM 2442   C CB . THR A 1 587  ? 1115.199 705.077 835.662 1.00 0.00 ? 587  THR A CB 1 
ATOM 2443   N N  . LEU A 1 588  ? 1115.874 702.948 833.266 1.00 0.00 ? 588  LEU A N  1 
ATOM 2444   C CA . LEU A 1 588  ? 1116.142 701.569 832.972 1.00 0.00 ? 588  LEU A CA 1 
ATOM 2445   C C  . LEU A 1 588  ? 1117.583 701.351 833.276 1.00 0.00 ? 588  LEU A C  1 
ATOM 2446   O O  . LEU A 1 588  ? 1118.389 702.249 833.067 1.00 0.00 ? 588  LEU A O  1 
ATOM 2447   C CB . LEU A 1 588  ? 1115.926 701.228 831.488 1.00 0.00 ? 588  LEU A CB 1 
ATOM 2448   N N  . PRO A 1 589  ? 1117.962 700.218 833.797 1.00 0.00 ? 589  PRO A N  1 
ATOM 2449   C CA . PRO A 1 589  ? 1119.356 700.046 834.056 1.00 0.00 ? 589  PRO A CA 1 
ATOM 2450   C C  . PRO A 1 589  ? 1120.127 699.998 832.783 1.00 0.00 ? 589  PRO A C  1 
ATOM 2451   O O  . PRO A 1 589  ? 1119.981 699.018 832.054 1.00 0.00 ? 589  PRO A O  1 
ATOM 2452   C CB . PRO A 1 589  ? 1119.471 698.803 834.946 1.00 0.00 ? 589  PRO A CB 1 
ATOM 2453   N N  . VAL A 1 658  ? 1119.793 704.349 832.361 1.00 0.00 ? 658  VAL A N  1 
ATOM 2454   C CA . VAL A 1 658  ? 1119.797 705.739 832.044 1.00 0.00 ? 658  VAL A CA 1 
ATOM 2455   C C  . VAL A 1 658  ? 1118.667 706.345 832.814 1.00 0.00 ? 658  VAL A C  1 
ATOM 2456   O O  . VAL A 1 658  ? 1117.980 705.659 833.566 1.00 0.00 ? 658  VAL A O  1 
ATOM 2457   C CB . VAL A 1 658  ? 1119.585 706.001 830.585 1.00 0.00 ? 658  VAL A CB 1 
ATOM 2458   N N  . TYR A 1 659  ? 1118.457 707.663 832.629 1.00 0.00 ? 659  TYR A N  1 
ATOM 2459   C CA . TYR A 1 659  ? 1117.419 708.363 833.325 1.00 0.00 ? 659  TYR A CA 1 
ATOM 2460   C C  . TYR A 1 659  ? 1116.204 708.392 832.452 1.00 0.00 ? 659  TYR A C  1 
ATOM 2461   O O  . TYR A 1 659  ? 1116.297 708.302 831.228 1.00 0.00 ? 659  TYR A O  1 
ATOM 2462   C CB . TYR A 1 659  ? 1117.763 709.823 833.676 1.00 0.00 ? 659  TYR A CB 1 
ATOM 2463   N N  . SER A 1 660  ? 1115.018 708.486 833.081 1.00 0.00 ? 660  SER A N  1 
ATOM 2464   C CA . SER A 1 660  ? 1113.772 708.485 832.372 1.00 0.00 ? 660  SER A CA 1 
ATOM 2465   C C  . SER A 1 660  ? 1113.690 709.701 831.503 1.00 0.00 ? 660  SER A C  1 
ATOM 2466   O O  . SER A 1 660  ? 1114.461 710.650 831.640 1.00 0.00 ? 660  SER A O  1 
ATOM 2467   C CB . SER A 1 660  ? 1112.540 708.486 833.294 1.00 0.00 ? 660  SER A CB 1 
ATOM 2468   N N  . GLY A 1 661  ? 1112.730 709.661 830.561 1.00 0.00 ? 661  GLY A N  1 
ATOM 2469   C CA . GLY A 1 661  ? 1112.469 710.690 829.599 1.00 0.00 ? 661  GLY A CA 1 
ATOM 2470   C C  . GLY A 1 661  ? 1112.034 711.924 830.316 1.00 0.00 ? 661  GLY A C  1 
ATOM 2471   O O  . GLY A 1 661  ? 1112.204 713.033 829.809 1.00 0.00 ? 661  GLY A O  1 
ATOM 2472   N N  . LYS A 1 662  ? 1111.394 711.747 831.487 1.00 0.00 ? 662  LYS A N  1 
ATOM 2473   C CA . LYS A 1 662  ? 1110.879 712.844 832.257 1.00 0.00 ? 662  LYS A CA 1 
ATOM 2474   C C  . LYS A 1 662  ? 1112.024 713.719 832.636 1.00 0.00 ? 662  LYS A C  1 
ATOM 2475   O O  . LYS A 1 662  ? 1111.962 714.937 832.489 1.00 0.00 ? 662  LYS A O  1 
ATOM 2476   C CB . LYS A 1 662  ? 1110.290 712.416 833.614 1.00 0.00 ? 662  LYS A CB 1 
ATOM 2477   N N  . HIS A 1 663  ? 1113.111 713.107 833.141 1.00 0.00 ? 663  HIS A N  1 
ATOM 2478   C CA . HIS A 1 663  ? 1114.228 713.889 833.573 1.00 0.00 ? 663  HIS A CA 1 
ATOM 2479   C C  . HIS A 1 663  ? 1114.816 714.615 832.417 1.00 0.00 ? 663  HIS A C  1 
ATOM 2480   O O  . HIS A 1 663  ? 1115.077 715.815 832.494 1.00 0.00 ? 663  HIS A O  1 
ATOM 2481   C CB . HIS A 1 663  ? 1115.368 713.065 834.191 1.00 0.00 ? 663  HIS A CB 1 
ATOM 2482   N N  . ASN A 1 664  ? 1115.032 713.902 831.301 1.00 0.00 ? 664  ASN A N  1 
ATOM 2483   C CA . ASN A 1 664  ? 1115.649 714.520 830.171 1.00 0.00 ? 664  ASN A CA 1 
ATOM 2484   C C  . ASN A 1 664  ? 1114.757 715.605 829.666 1.00 0.00 ? 664  ASN A C  1 
ATOM 2485   O O  . ASN A 1 664  ? 1115.232 716.667 829.269 1.00 0.00 ? 664  ASN A O  1 
ATOM 2486   C CB . ASN A 1 664  ? 1115.918 713.539 829.017 1.00 0.00 ? 664  ASN A CB 1 
ATOM 2487   N N  . GLY A 1 665  ? 1113.434 715.368 829.666 1.00 0.00 ? 665  GLY A N  1 
ATOM 2488   C CA . GLY A 1 665  ? 1112.525 716.340 829.137 1.00 0.00 ? 665  GLY A CA 1 
ATOM 2489   C C  . GLY A 1 665  ? 1112.574 717.587 829.965 1.00 0.00 ? 665  GLY A C  1 
ATOM 2490   O O  . GLY A 1 665  ? 1112.609 718.694 829.433 1.00 0.00 ? 665  GLY A O  1 
ATOM 2491   N N  . ILE A 1 666  ? 1112.572 717.446 831.301 1.00 0.00 ? 666  ILE A N  1 
ATOM 2492   C CA . ILE A 1 666  ? 1112.571 718.620 832.119 1.00 0.00 ? 666  ILE A CA 1 
ATOM 2493   C C  . ILE A 1 666  ? 1113.854 719.366 831.925 1.00 0.00 ? 666  ILE A C  1 
ATOM 2494   O O  . ILE A 1 666  ? 1113.855 720.586 831.763 1.00 0.00 ? 666  ILE A O  1 
ATOM 2495   C CB . ILE A 1 666  ? 1112.403 718.335 833.589 1.00 0.00 ? 666  ILE A CB 1 
ATOM 2496   N N  . CYS A 1 667  ? 1114.986 718.637 831.912 1.00 0.00 ? 667  CYS A N  1 
ATOM 2497   C CA . CYS A 1 667  ? 1116.279 719.245 831.815 1.00 0.00 ? 667  CYS A CA 1 
ATOM 2498   C C  . CYS A 1 667  ? 1116.407 719.943 830.495 1.00 0.00 ? 667  CYS A C  1 
ATOM 2499   O O  . CYS A 1 667  ? 1116.975 721.030 830.423 1.00 0.00 ? 667  CYS A O  1 
ATOM 2500   C CB . CYS A 1 667  ? 1117.428 718.228 831.915 1.00 0.00 ? 667  CYS A CB 1 
ATOM 2501   N N  . ILE A 1 668  ? 1115.874 719.338 829.417 1.00 0.00 ? 668  ILE A N  1 
ATOM 2502   C CA . ILE A 1 668  ? 1116.014 719.912 828.110 1.00 0.00 ? 668  ILE A CA 1 
ATOM 2503   C C  . ILE A 1 668  ? 1115.316 721.234 828.092 1.00 0.00 ? 668  ILE A C  1 
ATOM 2504   O O  . ILE A 1 668  ? 1115.803 722.205 827.515 1.00 0.00 ? 668  ILE A O  1 
ATOM 2505   C CB . ILE A 1 668  ? 1115.474 719.036 827.009 1.00 0.00 ? 668  ILE A CB 1 
ATOM 2506   N N  . TYR A 1 669  ? 1114.151 721.297 828.757 1.00 0.00 ? 669  TYR A N  1 
ATOM 2507   C CA . TYR A 1 669  ? 1113.320 722.464 828.812 1.00 0.00 ? 669  TYR A CA 1 
ATOM 2508   C C  . TYR A 1 669  ? 1114.123 723.556 829.449 1.00 0.00 ? 669  TYR A C  1 
ATOM 2509   O O  . TYR A 1 669  ? 1114.222 724.670 828.932 1.00 0.00 ? 669  TYR A O  1 
ATOM 2510   C CB . TYR A 1 669  ? 1112.157 722.204 829.784 1.00 0.00 ? 669  TYR A CB 1 
ATOM 2511   N N  . PHE A 1 670  ? 1114.748 723.227 830.594 1.00 0.00 ? 670  PHE A N  1 
ATOM 2512   C CA . PHE A 1 670  ? 1115.459 724.167 831.411 1.00 0.00 ? 670  PHE A CA 1 
ATOM 2513   C C  . PHE A 1 670  ? 1116.634 724.682 830.639 1.00 0.00 ? 670  PHE A C  1 
ATOM 2514   O O  . PHE A 1 670  ? 1116.894 725.883 830.609 1.00 0.00 ? 670  PHE A O  1 
ATOM 2515   C CB . PHE A 1 670  ? 1115.976 723.485 832.693 1.00 0.00 ? 670  PHE A CB 1 
ATOM 2516   N N  . SER A 1 671  ? 1117.371 723.771 829.976 1.00 0.00 ? 671  SER A N  1 
ATOM 2517   C CA . SER A 1 671  ? 1118.566 724.124 829.266 1.00 0.00 ? 671  SER A CA 1 
ATOM 2518   C C  . SER A 1 671  ? 1118.240 725.059 828.145 1.00 0.00 ? 671  SER A C  1 
ATOM 2519   O O  . SER A 1 671  ? 1118.940 726.045 827.929 1.00 0.00 ? 671  SER A O  1 
ATOM 2520   C CB . SER A 1 671  ? 1119.271 722.897 828.664 1.00 0.00 ? 671  SER A CB 1 
ATOM 2521   N N  . ARG A 1 672  ? 1117.155 724.771 827.406 1.00 0.00 ? 672  ARG A N  1 
ATOM 2522   C CA . ARG A 1 672  ? 1116.803 725.552 826.258 1.00 0.00 ? 672  ARG A CA 1 
ATOM 2523   C C  . ARG A 1 672  ? 1116.414 726.945 826.641 1.00 0.00 ? 672  ARG A C  1 
ATOM 2524   O O  . ARG A 1 672  ? 1116.762 727.895 825.943 1.00 0.00 ? 672  ARG A O  1 
ATOM 2525   C CB . ARG A 1 672  ? 1115.684 724.903 825.425 1.00 0.00 ? 672  ARG A CB 1 
ATOM 2526   N N  . ILE A 1 673  ? 1115.681 727.126 827.756 1.00 0.00 ? 673  ILE A N  1 
ATOM 2527   C CA . ILE A 1 673  ? 1115.267 728.465 828.068 1.00 0.00 ? 673  ILE A CA 1 
ATOM 2528   C C  . ILE A 1 673  ? 1116.453 729.338 828.346 1.00 0.00 ? 673  ILE A C  1 
ATOM 2529   O O  . ILE A 1 673  ? 1116.560 730.443 827.815 1.00 0.00 ? 673  ILE A O  1 
ATOM 2530   C CB . ILE A 1 673  ? 1114.354 728.562 829.253 1.00 0.00 ? 673  ILE A CB 1 
ATOM 2531   N N  . MET A 1 674  ? 1117.366 728.845 829.195 1.00 0.00 ? 674  MET A N  1 
ATOM 2532   C CA . MET A 1 674  ? 1118.544 729.504 829.685 1.00 0.00 ? 674  MET A CA 1 
ATOM 2533   C C  . MET A 1 674  ? 1119.666 729.593 828.693 1.00 0.00 ? 674  MET A C  1 
ATOM 2534   O O  . MET A 1 674  ? 1120.609 730.352 828.905 1.00 0.00 ? 674  MET A O  1 
ATOM 2535   C CB . MET A 1 674  ? 1119.038 728.929 831.023 1.00 0.00 ? 674  MET A CB 1 
ATOM 2536   N N  . GLY A 1 675  ? 1119.613 728.823 827.592 1.00 0.00 ? 675  GLY A N  1 
ATOM 2537   C CA . GLY A 1 675  ? 1120.737 728.650 826.713 1.00 0.00 ? 675  GLY A CA 1 
ATOM 2538   C C  . GLY A 1 675  ? 1121.372 729.949 826.283 1.00 0.00 ? 675  GLY A C  1 
ATOM 2539   O O  . GLY A 1 675  ? 1122.598 730.025 826.224 1.00 0.00 ? 675  GLY A O  1 
ATOM 2540   N N  . ASN A 1 676  ? 1120.602 731.001 825.954 1.00 0.00 ? 676  ASN A N  1 
ATOM 2541   C CA . ASN A 1 676  ? 1121.236 732.195 825.452 1.00 0.00 ? 676  ASN A CA 1 
ATOM 2542   C C  . ASN A 1 676  ? 1122.148 732.806 826.481 1.00 0.00 ? 676  ASN A C  1 
ATOM 2543   O O  . ASN A 1 676  ? 1123.326 733.042 826.221 1.00 0.00 ? 676  ASN A O  1 
ATOM 2544   C CB . ASN A 1 676  ? 1120.212 733.285 825.106 1.00 0.00 ? 676  ASN A CB 1 
ATOM 2545   N N  . ILE A 1 677  ? 1121.592 733.080 827.674 1.00 0.00 ? 677  ILE A N  1 
ATOM 2546   C CA . ILE A 1 677  ? 1122.197 733.747 828.799 1.00 0.00 ? 677  ILE A CA 1 
ATOM 2547   C C  . ILE A 1 677  ? 1123.237 732.933 829.506 1.00 0.00 ? 677  ILE A C  1 
ATOM 2548   O O  . ILE A 1 677  ? 1124.161 733.494 830.091 1.00 0.00 ? 677  ILE A O  1 
ATOM 2549   C CB . ILE A 1 677  ? 1121.196 734.198 829.824 1.00 0.00 ? 677  ILE A CB 1 
ATOM 2550   N N  . TRP A 1 678  ? 1123.111 731.593 829.482 1.00 0.00 ? 678  TRP A N  1 
ATOM 2551   C CA . TRP A 1 678  ? 1123.862 730.740 830.360 1.00 0.00 ? 678  TRP A CA 1 
ATOM 2552   C C  . TRP A 1 678  ? 1125.336 731.035 830.332 1.00 0.00 ? 678  TRP A C  1 
ATOM 2553   O O  . TRP A 1 678  ? 1125.916 731.265 831.388 1.00 0.00 ? 678  TRP A O  1 
ATOM 2554   C CB . TRP A 1 678  ? 1123.669 729.248 830.027 1.00 0.00 ? 678  TRP A CB 1 
ATOM 2555   N N  . ASP A 1 679  ? 1125.992 731.028 829.157 1.00 0.00 ? 679  ASP A N  1 
ATOM 2556   C CA . ASP A 1 679  ? 1127.411 731.271 829.077 1.00 0.00 ? 679  ASP A CA 1 
ATOM 2557   C C  . ASP A 1 679  ? 1127.800 732.714 829.266 1.00 0.00 ? 679  ASP A C  1 
ATOM 2558   O O  . ASP A 1 679  ? 1128.895 732.998 829.747 1.00 0.00 ? 679  ASP A O  1 
ATOM 2559   C CB . ASP A 1 679  ? 1128.033 730.774 827.764 1.00 0.00 ? 679  ASP A CB 1 
ATOM 2560   N N  . ALA A 1 680  ? 1126.927 733.667 828.882 1.00 0.00 ? 680  ALA A N  1 
ATOM 2561   C CA . ALA A 1 680  ? 1127.271 735.068 828.856 1.00 0.00 ? 680  ALA A CA 1 
ATOM 2562   C C  . ALA A 1 680  ? 1127.600 735.611 830.214 1.00 0.00 ? 680  ALA A C  1 
ATOM 2563   O O  . ALA A 1 680  ? 1127.132 735.118 831.238 1.00 0.00 ? 680  ALA A O  1 
ATOM 2564   C CB . ALA A 1 680  ? 1126.162 735.955 828.263 1.00 0.00 ? 680  ALA A CB 1 
ATOM 2565   N N  . SER A 1 681  ? 1128.463 736.656 830.226 1.00 0.00 ? 681  SER A N  1 
ATOM 2566   C CA . SER A 1 681  ? 1128.879 737.330 831.424 1.00 0.00 ? 681  SER A CA 1 
ATOM 2567   C C  . SER A 1 681  ? 1127.728 738.150 831.918 1.00 0.00 ? 681  SER A C  1 
ATOM 2568   O O  . SER A 1 681  ? 1127.019 738.794 831.148 1.00 0.00 ? 681  SER A O  1 
ATOM 2569   C CB . SER A 1 681  ? 1130.069 738.281 831.208 1.00 0.00 ? 681  SER A CB 1 
ATOM 2570   N N  . LEU A 1 682  ? 1127.515 738.105 833.245 1.00 0.00 ? 682  LEU A N  1 
ATOM 2571   C CA . LEU A 1 682  ? 1126.434 738.767 833.915 1.00 0.00 ? 682  LEU A CA 1 
ATOM 2572   C C  . LEU A 1 682  ? 1126.633 740.254 833.915 1.00 0.00 ? 682  LEU A C  1 
ATOM 2573   O O  . LEU A 1 682  ? 1125.724 741.007 833.571 1.00 0.00 ? 682  LEU A O  1 
ATOM 2574   C CB . LEU A 1 682  ? 1126.376 738.328 835.380 1.00 0.00 ? 682  LEU A CB 1 
ATOM 2575   N N  . VAL A 1 683  ? 1127.841 740.718 834.293 1.00 0.00 ? 683  VAL A N  1 
ATOM 2576   C CA . VAL A 1 683  ? 1128.022 742.131 834.455 1.00 0.00 ? 683  VAL A CA 1 
ATOM 2577   C C  . VAL A 1 683  ? 1129.019 742.614 833.465 1.00 0.00 ? 683  VAL A C  1 
ATOM 2578   O O  . VAL A 1 683  ? 1129.973 741.920 833.120 1.00 0.00 ? 683  VAL A O  1 
ATOM 2579   C CB . VAL A 1 683  ? 1128.518 742.515 835.818 1.00 0.00 ? 683  VAL A CB 1 
ATOM 2580   N N  . VAL A 1 684  ? 1128.785 743.843 832.969 1.00 0.00 ? 684  VAL A N  1 
ATOM 2581   C CA . VAL A 1 684  ? 1129.674 744.463 832.037 1.00 0.00 ? 684  VAL A CA 1 
ATOM 2582   C C  . VAL A 1 684  ? 1130.065 745.754 832.669 1.00 0.00 ? 684  VAL A C  1 
ATOM 2583   O O  . VAL A 1 684  ? 1130.746 746.576 832.059 1.00 0.00 ? 684  VAL A O  1 
ATOM 2584   C CB . VAL A 1 684  ? 1129.030 744.771 830.718 1.00 0.00 ? 684  VAL A CB 1 
ATOM 2585   N N  . GLU A 1 699  ? 1127.036 747.725 833.957 1.00 0.00 ? 699  GLU A N  1 
ATOM 2586   C CA . GLU A 1 699  ? 1125.631 747.454 833.920 1.00 0.00 ? 699  GLU A CA 1 
ATOM 2587   C C  . GLU A 1 699  ? 1125.457 746.001 833.620 1.00 0.00 ? 699  GLU A C  1 
ATOM 2588   O O  . GLU A 1 699  ? 1126.392 745.322 833.196 1.00 0.00 ? 699  GLU A O  1 
ATOM 2589   C CB . GLU A 1 699  ? 1124.901 748.249 832.821 1.00 0.00 ? 699  GLU A CB 1 
ATOM 2590   N N  . SER A 1 700  ? 1124.243 745.477 833.880 1.00 0.00 ? 700  SER A N  1 
ATOM 2591   C CA . SER A 1 700  ? 1123.954 744.093 833.641 1.00 0.00 ? 700  SER A CA 1 
ATOM 2592   C C  . SER A 1 700  ? 1123.904 743.875 832.161 1.00 0.00 ? 700  SER A C  1 
ATOM 2593   O O  . SER A 1 700  ? 1123.493 744.746 831.395 1.00 0.00 ? 700  SER A O  1 
ATOM 2594   C CB . SER A 1 700  ? 1122.603 743.655 834.231 1.00 0.00 ? 700  SER A CB 1 
ATOM 2595   N N  . SER A 1 701  ? 1124.327 742.672 831.729 1.00 0.00 ? 701  SER A N  1 
ATOM 2596   C CA . SER A 1 701  ? 1124.388 742.339 830.338 1.00 0.00 ? 701  SER A CA 1 
ATOM 2597   C C  . SER A 1 701  ? 1123.006 742.293 829.773 1.00 0.00 ? 701  SER A C  1 
ATOM 2598   O O  . SER A 1 701  ? 1122.792 742.673 828.623 1.00 0.00 ? 701  SER A O  1 
ATOM 2599   C CB . SER A 1 701  ? 1125.054 740.973 830.087 1.00 0.00 ? 701  SER A CB 1 
ATOM 2600   N N  . VAL A 1 702  ? 1122.019 741.846 830.573 1.00 0.00 ? 702  VAL A N  1 
ATOM 2601   C CA . VAL A 1 702  ? 1120.693 741.703 830.045 1.00 0.00 ? 702  VAL A CA 1 
ATOM 2602   C C  . VAL A 1 702  ? 1119.832 742.799 830.584 1.00 0.00 ? 702  VAL A C  1 
ATOM 2603   O O  . VAL A 1 702  ? 1120.049 743.330 831.672 1.00 0.00 ? 702  VAL A O  1 
ATOM 2604   C CB . VAL A 1 702  ? 1120.058 740.394 830.411 1.00 0.00 ? 702  VAL A CB 1 
ATOM 2605   N N  . PRO A 1 703  ? 1118.861 743.155 829.792 1.00 0.00 ? 703  PRO A N  1 
ATOM 2606   C CA . PRO A 1 703  ? 1117.941 744.204 830.141 1.00 0.00 ? 703  PRO A CA 1 
ATOM 2607   C C  . PRO A 1 703  ? 1116.959 743.751 831.174 1.00 0.00 ? 703  PRO A C  1 
ATOM 2608   O O  . PRO A 1 703  ? 1116.846 742.551 831.410 1.00 0.00 ? 703  PRO A O  1 
ATOM 2609   C CB . PRO A 1 703  ? 1117.294 744.664 828.832 1.00 0.00 ? 703  PRO A CB 1 
ATOM 2610   N N  . CYS A 1 704  ? 1116.265 744.714 831.809 1.00 0.00 ? 704  CYS A N  1 
ATOM 2611   C CA . CYS A 1 704  ? 1115.313 744.452 832.850 1.00 0.00 ? 704  CYS A CA 1 
ATOM 2612   C C  . CYS A 1 704  ? 1114.157 743.664 832.332 1.00 0.00 ? 704  CYS A C  1 
ATOM 2613   O O  . CYS A 1 704  ? 1113.683 742.745 832.996 1.00 0.00 ? 704  CYS A O  1 
ATOM 2614   C CB . CYS A 1 704  ? 1114.725 745.726 833.473 1.00 0.00 ? 704  CYS A CB 1 
ATOM 2615   N N  . GLN A 1 705  ? 1113.671 743.996 831.123 1.00 0.00 ? 705  GLN A N  1 
ATOM 2616   C CA . GLN A 1 705  ? 1112.503 743.328 830.629 1.00 0.00 ? 705  GLN A CA 1 
ATOM 2617   C C  . GLN A 1 705  ? 1112.825 741.877 830.528 1.00 0.00 ? 705  GLN A C  1 
ATOM 2618   O O  . GLN A 1 705  ? 1112.022 741.020 830.895 1.00 0.00 ? 705  GLN A O  1 
ATOM 2619   C CB . GLN A 1 705  ? 1112.111 743.796 829.217 1.00 0.00 ? 705  GLN A CB 1 
ATOM 2620   N N  . LEU A 1 706  ? 1114.036 741.570 830.031 1.00 0.00 ? 706  LEU A N  1 
ATOM 2621   C CA . LEU A 1 706  ? 1114.457 740.215 829.830 1.00 0.00 ? 706  LEU A CA 1 
ATOM 2622   C C  . LEU A 1 706  ? 1114.560 739.525 831.157 1.00 0.00 ? 706  LEU A C  1 
ATOM 2623   O O  . LEU A 1 706  ? 1114.161 738.372 831.297 1.00 0.00 ? 706  LEU A O  1 
ATOM 2624   C CB . LEU A 1 706  ? 1115.825 740.133 829.135 1.00 0.00 ? 706  LEU A CB 1 
ATOM 2625   N N  . LEU A 1 707  ? 1115.087 740.229 832.178 1.00 0.00 ? 707  LEU A N  1 
ATOM 2626   C CA . LEU A 1 707  ? 1115.277 739.632 833.470 1.00 0.00 ? 707  LEU A CA 1 
ATOM 2627   C C  . LEU A 1 707  ? 1113.935 739.222 833.986 1.00 0.00 ? 707  LEU A C  1 
ATOM 2628   O O  . LEU A 1 707  ? 1113.778 738.127 834.523 1.00 0.00 ? 707  LEU A O  1 
ATOM 2629   C CB . LEU A 1 707  ? 1115.911 740.628 834.469 1.00 0.00 ? 707  LEU A CB 1 
ATOM 2630   N N  . GLU A 1 708  ? 1112.928 740.094 833.826 1.00 0.00 ? 708  GLU A N  1 
ATOM 2631   C CA . GLU A 1 708  ? 1111.619 739.806 834.332 1.00 0.00 ? 708  GLU A CA 1 
ATOM 2632   C C  . GLU A 1 708  ? 1111.069 738.617 833.613 1.00 0.00 ? 708  GLU A C  1 
ATOM 2633   O O  . GLU A 1 708  ? 1110.417 737.765 834.216 1.00 0.00 ? 708  GLU A O  1 
ATOM 2634   C CB . GLU A 1 708  ? 1110.639 740.974 834.150 1.00 0.00 ? 708  GLU A CB 1 
ATOM 2635   N N  . SER A 1 709  ? 1111.327 738.527 832.296 1.00 0.00 ? 709  SER A N  1 
ATOM 2636   C CA . SER A 1 709  ? 1110.793 737.450 831.518 1.00 0.00 ? 709  SER A CA 1 
ATOM 2637   C C  . SER A 1 709  ? 1111.322 736.147 832.034 1.00 0.00 ? 709  SER A C  1 
ATOM 2638   O O  . SER A 1 709  ? 1110.557 735.221 832.300 1.00 0.00 ? 709  SER A O  1 
ATOM 2639   C CB . SER A 1 709  ? 1111.179 737.545 830.033 1.00 0.00 ? 709  SER A CB 1 
ATOM 2640   N N  . VAL A 1 710  ? 1112.653 736.048 832.214 1.00 0.00 ? 710  VAL A N  1 
ATOM 2641   C CA . VAL A 1 710  ? 1113.264 734.823 832.642 1.00 0.00 ? 710  VAL A CA 1 
ATOM 2642   C C  . VAL A 1 710  ? 1112.769 734.477 834.009 1.00 0.00 ? 710  VAL A C  1 
ATOM 2643   O O  . VAL A 1 710  ? 1112.451 733.323 834.289 1.00 0.00 ? 710  VAL A O  1 
ATOM 2644   C CB . VAL A 1 710  ? 1114.759 734.917 832.724 1.00 0.00 ? 710  VAL A CB 1 
ATOM 2645   N N  . LEU A 1 711  ? 1112.678 735.483 834.896 1.00 0.00 ? 711  LEU A N  1 
ATOM 2646   C CA . LEU A 1 711  ? 1112.281 735.243 836.252 1.00 0.00 ? 711  LEU A CA 1 
ATOM 2647   C C  . LEU A 1 711  ? 1110.893 734.688 836.268 1.00 0.00 ? 711  LEU A C  1 
ATOM 2648   O O  . LEU A 1 711  ? 1110.606 733.740 836.996 1.00 0.00 ? 711  LEU A O  1 
ATOM 2649   C CB . LEU A 1 711  ? 1112.271 736.530 837.096 1.00 0.00 ? 711  LEU A CB 1 
ATOM 2650   N N  . GLN A 1 712  ? 1109.996 735.265 835.449 1.00 0.00 ? 712  GLN A N  1 
ATOM 2651   C CA . GLN A 1 712  ? 1108.627 734.840 835.438 1.00 0.00 ? 712  GLN A CA 1 
ATOM 2652   C C  . GLN A 1 712  ? 1108.544 733.419 834.976 1.00 0.00 ? 712  GLN A C  1 
ATOM 2653   O O  . GLN A 1 712  ? 1107.845 732.603 835.571 1.00 0.00 ? 712  GLN A O  1 
ATOM 2654   C CB . GLN A 1 712  ? 1107.768 735.679 834.478 1.00 0.00 ? 712  GLN A CB 1 
ATOM 2655   N N  . GLU A 1 713  ? 1109.282 733.085 833.900 1.00 0.00 ? 713  GLU A N  1 
ATOM 2656   C CA . GLU A 1 713  ? 1109.194 731.773 833.330 1.00 0.00 ? 713  GLU A CA 1 
ATOM 2657   C C  . GLU A 1 713  ? 1109.681 730.753 834.307 1.00 0.00 ? 713  GLU A C  1 
ATOM 2658   O O  . GLU A 1 713  ? 1109.027 729.735 834.536 1.00 0.00 ? 713  GLU A O  1 
ATOM 2659   C CB . GLU A 1 713  ? 1110.033 731.640 832.052 1.00 0.00 ? 713  GLU A CB 1 
ATOM 2660   N N  . LEU A 1 714  ? 1110.834 731.019 834.941 1.00 0.00 ? 714  LEU A N  1 
ATOM 2661   C CA . LEU A 1 714  ? 1111.405 730.064 835.842 1.00 0.00 ? 714  LEU A CA 1 
ATOM 2662   C C  . LEU A 1 714  ? 1110.496 729.917 837.014 1.00 0.00 ? 714  LEU A C  1 
ATOM 2663   O O  . LEU A 1 714  ? 1110.429 728.852 837.624 1.00 0.00 ? 714  LEU A O  1 
ATOM 2664   C CB . LEU A 1 714  ? 1112.780 730.453 836.376 1.00 0.00 ? 714  LEU A CB 1 
ATOM 2665   N N  . LYS A 1 715  ? 1109.803 731.008 837.382 1.00 0.00 ? 715  LYS A N  1 
ATOM 2666   C CA . LYS A 1 715  ? 1108.915 730.984 838.507 1.00 0.00 ? 715  LYS A CA 1 
ATOM 2667   C C  . LYS A 1 715  ? 1107.834 729.989 838.239 1.00 0.00 ? 715  LYS A C  1 
ATOM 2668   O O  . LYS A 1 715  ? 1107.461 729.218 839.121 1.00 0.00 ? 715  LYS A O  1 
ATOM 2669   C CB . LYS A 1 715  ? 1108.240 732.347 838.741 1.00 0.00 ? 715  LYS A CB 1 
ATOM 2670   N N  . GLY A 1 716  ? 1107.303 729.972 837.001 1.00 0.00 ? 716  GLY A N  1 
ATOM 2671   C CA . GLY A 1 716  ? 1106.235 729.066 836.696 1.00 0.00 ? 716  GLY A CA 1 
ATOM 2672   C C  . GLY A 1 716  ? 1106.731 727.664 836.857 1.00 0.00 ? 716  GLY A C  1 
ATOM 2673   O O  . GLY A 1 716  ? 1106.048 726.813 837.423 1.00 0.00 ? 716  GLY A O  1 
ATOM 2674   N N  . LEU A 1 717  ? 1107.948 727.389 836.352 1.00 0.00 ? 717  LEU A N  1 
ATOM 2675   C CA . LEU A 1 717  ? 1108.503 726.070 836.433 1.00 0.00 ? 717  LEU A CA 1 
ATOM 2676   C C  . LEU A 1 717  ? 1108.734 725.719 837.868 1.00 0.00 ? 717  LEU A C  1 
ATOM 2677   O O  . LEU A 1 717  ? 1108.456 724.600 838.293 1.00 0.00 ? 717  LEU A O  1 
ATOM 2678   C CB . LEU A 1 717  ? 1109.850 725.933 835.706 1.00 0.00 ? 717  LEU A CB 1 
ATOM 2679   N N  . GLN A 1 718  ? 1109.228 726.682 838.668 1.00 0.00 ? 718  GLN A N  1 
ATOM 2680   C CA . GLN A 1 718  ? 1109.562 726.396 840.032 1.00 0.00 ? 718  GLN A CA 1 
ATOM 2681   C C  . GLN A 1 718  ? 1108.330 725.949 840.747 1.00 0.00 ? 718  GLN A C  1 
ATOM 2682   O O  . GLN A 1 718  ? 1108.354 724.961 841.481 1.00 0.00 ? 718  GLN A O  1 
ATOM 2683   C CB . GLN A 1 718  ? 1110.083 727.629 840.789 1.00 0.00 ? 718  GLN A CB 1 
ATOM 2684   N N  . GLU A 1 719  ? 1107.211 726.661 840.534 1.00 0.00 ? 719  GLU A N  1 
ATOM 2685   C CA . GLU A 1 719  ? 1105.992 726.342 841.215 1.00 0.00 ? 719  GLU A CA 1 
ATOM 2686   C C  . GLU A 1 719  ? 1105.522 724.992 840.773 1.00 0.00 ? 719  GLU A C  1 
ATOM 2687   O O  . GLU A 1 719  ? 1105.052 724.193 841.581 1.00 0.00 ? 719  GLU A O  1 
ATOM 2688   C CB . GLU A 1 719  ? 1104.885 727.367 840.928 1.00 0.00 ? 719  GLU A CB 1 
ATOM 2689   N N  . PHE A 1 720  ? 1105.660 724.695 839.467 1.00 0.00 ? 720  PHE A N  1 
ATOM 2690   C CA . PHE A 1 720  ? 1105.183 723.454 838.925 1.00 0.00 ? 720  PHE A CA 1 
ATOM 2691   C C  . PHE A 1 720  ? 1105.871 722.311 839.602 1.00 0.00 ? 720  PHE A C  1 
ATOM 2692   O O  . PHE A 1 720  ? 1105.222 721.401 840.112 1.00 0.00 ? 720  PHE A O  1 
ATOM 2693   C CB . PHE A 1 720  ? 1105.485 723.344 837.421 1.00 0.00 ? 720  PHE A CB 1 
ATOM 2694   N N  . LEU A 1 721  ? 1107.215 722.342 839.641 1.00 0.00 ? 721  LEU A N  1 
ATOM 2695   C CA . LEU A 1 721  ? 1107.968 721.268 840.217 1.00 0.00 ? 721  LEU A CA 1 
ATOM 2696   C C  . LEU A 1 721  ? 1107.723 721.196 841.687 1.00 0.00 ? 721  LEU A C  1 
ATOM 2697   O O  . LEU A 1 721  ? 1107.648 720.107 842.252 1.00 0.00 ? 721  LEU A O  1 
ATOM 2698   C CB . LEU A 1 721  ? 1109.483 721.391 839.980 1.00 0.00 ? 721  LEU A CB 1 
ATOM 2699   N N  . ASP A 1 722  ? 1107.593 722.355 842.354 1.00 0.00 ? 722  ASP A N  1 
ATOM 2700   C CA . ASP A 1 722  ? 1107.410 722.336 843.775 1.00 0.00 ? 722  ASP A CA 1 
ATOM 2701   C C  . ASP A 1 722  ? 1106.146 721.600 844.071 1.00 0.00 ? 722  ASP A C  1 
ATOM 2702   O O  . ASP A 1 722  ? 1106.092 720.791 844.995 1.00 0.00 ? 722  ASP A O  1 
ATOM 2703   C CB . ASP A 1 722  ? 1107.261 723.744 844.378 1.00 0.00 ? 722  ASP A CB 1 
ATOM 2704   N N  . ARG A 1 723  ? 1105.086 721.873 843.287 1.00 0.00 ? 723  ARG A N  1 
ATOM 2705   C CA . ARG A 1 723  ? 1103.811 721.262 843.527 1.00 0.00 ? 723  ARG A CA 1 
ATOM 2706   C C  . ARG A 1 723  ? 1103.876 719.781 843.306 1.00 0.00 ? 723  ARG A C  1 
ATOM 2707   O O  . ARG A 1 723  ? 1103.426 719.009 844.150 1.00 0.00 ? 723  ARG A O  1 
ATOM 2708   C CB . ARG A 1 723  ? 1102.713 721.816 842.603 1.00 0.00 ? 723  ARG A CB 1 
ATOM 2709   N N  . ASN A 1 724  ? 1104.460 719.331 842.176 1.00 0.00 ? 724  ASN A N  1 
ATOM 2710   C CA . ASN A 1 724  ? 1104.430 717.920 841.914 1.00 0.00 ? 724  ASN A CA 1 
ATOM 2711   C C  . ASN A 1 724  ? 1105.773 717.335 842.215 1.00 0.00 ? 724  ASN A C  1 
ATOM 2712   O O  . ASN A 1 724  ? 1106.267 716.486 841.475 1.00 0.00 ? 724  ASN A O  1 
ATOM 2713   C CB . ASN A 1 724  ? 1104.140 717.608 840.437 1.00 0.00 ? 724  ASN A CB 1 
ATOM 2714   N N  . SER A 1 725  ? 1106.398 717.762 843.324 1.00 0.00 ? 725  SER A N  1 
ATOM 2715   C CA . SER A 1 725  ? 1107.691 717.244 843.670 1.00 0.00 ? 725  SER A CA 1 
ATOM 2716   C C  . SER A 1 725  ? 1107.551 715.864 844.235 1.00 0.00 ? 725  SER A C  1 
ATOM 2717   O O  . SER A 1 725  ? 1108.410 715.008 844.034 1.00 0.00 ? 725  SER A O  1 
ATOM 2718   C CB . SER A 1 725  ? 1108.424 718.102 844.714 1.00 0.00 ? 725  SER A CB 1 
ATOM 2719   N N  . GLN A 1 726  ? 1106.428 715.600 844.925 1.00 0.00 ? 726  GLN A N  1 
ATOM 2720   C CA . GLN A 1 726  ? 1106.252 714.364 845.631 1.00 0.00 ? 726  GLN A CA 1 
ATOM 2721   C C  . GLN A 1 726  ? 1106.321 713.236 844.659 1.00 0.00 ? 726  GLN A C  1 
ATOM 2722   O O  . GLN A 1 726  ? 1106.875 712.180 844.958 1.00 0.00 ? 726  GLN A O  1 
ATOM 2723   C CB . GLN A 1 726  ? 1104.885 714.267 846.330 1.00 0.00 ? 726  GLN A CB 1 
ATOM 2724   N N  . PHE A 1 727  ? 1105.743 713.428 843.462 1.00 0.00 ? 727  PHE A N  1 
ATOM 2725   C CA . PHE A 1 727  ? 1105.694 712.364 842.507 1.00 0.00 ? 727  PHE A CA 1 
ATOM 2726   C C  . PHE A 1 727  ? 1107.088 711.979 842.093 1.00 0.00 ? 727  PHE A C  1 
ATOM 2727   O O  . PHE A 1 727  ? 1107.448 710.803 842.122 1.00 0.00 ? 727  PHE A O  1 
ATOM 2728   C CB . PHE A 1 727  ? 1104.906 712.792 841.256 1.00 0.00 ? 727  PHE A CB 1 
ATOM 2729   N N  . ALA A 1 728  ? 1107.906 712.979 841.705 1.00 0.00 ? 728  ALA A N  1 
ATOM 2730   C CA . ALA A 1 728  ? 1109.223 712.776 841.159 1.00 0.00 ? 728  ALA A CA 1 
ATOM 2731   C C  . ALA A 1 728  ? 1110.244 712.234 842.125 1.00 0.00 ? 728  ALA A C  1 
ATOM 2732   O O  . ALA A 1 728  ? 1111.033 711.364 841.758 1.00 0.00 ? 728  ALA A O  1 
ATOM 2733   C CB . ALA A 1 728  ? 1109.810 714.062 840.555 1.00 0.00 ? 728  ALA A CB 1 
ATOM 2734   N N  . GLY A 1 729  ? 1110.281 712.731 843.377 1.00 0.00 ? 729  GLY A N  1 
ATOM 2735   C CA . GLY A 1 729  ? 1111.326 712.320 844.279 1.00 0.00 ? 729  GLY A CA 1 
ATOM 2736   C C  . GLY A 1 729  ? 1110.871 711.144 845.071 1.00 0.00 ? 729  GLY A C  1 
ATOM 2737   O O  . GLY A 1 729  ? 1109.975 710.406 844.659 1.00 0.00 ? 729  GLY A O  1 
ATOM 2738   N N  . GLY A 1 730  ? 1111.497 710.933 846.249 1.00 0.00 ? 730  GLY A N  1 
ATOM 2739   C CA . GLY A 1 730  ? 1111.098 709.819 847.054 1.00 0.00 ? 730  GLY A CA 1 
ATOM 2740   C C  . GLY A 1 730  ? 1111.459 708.580 846.309 1.00 0.00 ? 730  GLY A C  1 
ATOM 2741   O O  . GLY A 1 730  ? 1112.209 707.741 846.806 1.00 0.00 ? 730  GLY A O  1 
ATOM 2742   N N  . GLU A 1 769  ? 1120.759 702.165 841.879 1.00 0.00 ? 769  GLU A N  1 
ATOM 2743   C CA . GLU A 1 769  ? 1119.413 701.742 841.647 1.00 0.00 ? 769  GLU A CA 1 
ATOM 2744   C C  . GLU A 1 769  ? 1118.843 702.750 840.702 1.00 0.00 ? 769  GLU A C  1 
ATOM 2745   O O  . GLU A 1 769  ? 1119.093 703.947 840.836 1.00 0.00 ? 769  GLU A O  1 
ATOM 2746   C CB . GLU A 1 769  ? 1118.545 701.702 842.915 1.00 0.00 ? 769  GLU A CB 1 
ATOM 2747   N N  . ALA A 1 770  ? 1118.086 702.281 839.694 1.00 0.00 ? 770  ALA A N  1 
ATOM 2748   C CA . ALA A 1 770  ? 1117.551 703.158 838.695 1.00 0.00 ? 770  ALA A CA 1 
ATOM 2749   C C  . ALA A 1 770  ? 1116.572 704.116 839.298 1.00 0.00 ? 770  ALA A C  1 
ATOM 2750   O O  . ALA A 1 770  ? 1116.607 705.310 839.006 1.00 0.00 ? 770  ALA A O  1 
ATOM 2751   C CB . ALA A 1 770  ? 1116.821 702.399 837.574 1.00 0.00 ? 770  ALA A CB 1 
ATOM 2752   N N  . GLN A 1 771  ? 1115.680 703.619 840.174 1.00 0.00 ? 771  GLN A N  1 
ATOM 2753   C CA . GLN A 1 771  ? 1114.651 704.460 840.718 1.00 0.00 ? 771  GLN A CA 1 
ATOM 2754   C C  . GLN A 1 771  ? 1115.263 705.544 841.545 1.00 0.00 ? 771  GLN A C  1 
ATOM 2755   O O  . GLN A 1 771  ? 1114.901 706.712 841.417 1.00 0.00 ? 771  GLN A O  1 
ATOM 2756   C CB . GLN A 1 771  ? 1113.690 703.689 841.638 1.00 0.00 ? 771  GLN A CB 1 
ATOM 2757   N N  . LEU A 1 772  ? 1116.225 705.179 842.410 1.00 0.00 ? 772  LEU A N  1 
ATOM 2758   C CA . LEU A 1 772  ? 1116.833 706.134 843.290 1.00 0.00 ? 772  LEU A CA 1 
ATOM 2759   C C  . LEU A 1 772  ? 1117.607 707.124 842.485 1.00 0.00 ? 772  LEU A C  1 
ATOM 2760   O O  . LEU A 1 772  ? 1117.610 708.314 842.792 1.00 0.00 ? 772  LEU A O  1 
ATOM 2761   C CB . LEU A 1 772  ? 1117.782 705.484 844.309 1.00 0.00 ? 772  LEU A CB 1 
ATOM 2762   N N  . SER A 1 773  ? 1118.288 706.655 841.424 1.00 0.00 ? 773  SER A N  1 
ATOM 2763   C CA . SER A 1 773  ? 1119.093 707.533 840.627 1.00 0.00 ? 773  SER A CA 1 
ATOM 2764   C C  . SER A 1 773  ? 1118.198 708.567 840.024 1.00 0.00 ? 773  SER A C  1 
ATOM 2765   O O  . SER A 1 773  ? 1118.553 709.741 839.950 1.00 0.00 ? 773  SER A O  1 
ATOM 2766   C CB . SER A 1 773  ? 1119.818 706.807 839.481 1.00 0.00 ? 773  SER A CB 1 
ATOM 2767   N N  . GLU A 1 774  ? 1116.993 708.152 839.589 1.00 0.00 ? 774  GLU A N  1 
ATOM 2768   C CA . GLU A 1 774  ? 1116.062 709.069 839.003 1.00 0.00 ? 774  GLU A CA 1 
ATOM 2769   C C  . GLU A 1 774  ? 1115.708 710.082 840.043 1.00 0.00 ? 774  GLU A C  1 
ATOM 2770   O O  . GLU A 1 774  ? 1115.601 711.273 839.755 1.00 0.00 ? 774  GLU A O  1 
ATOM 2771   C CB . GLU A 1 774  ? 1114.755 708.389 838.565 1.00 0.00 ? 774  GLU A CB 1 
ATOM 2772   N N  . LYS A 1 775  ? 1115.536 709.619 841.295 1.00 0.00 ? 775  LYS A N  1 
ATOM 2773   C CA . LYS A 1 775  ? 1115.153 710.473 842.381 1.00 0.00 ? 775  LYS A CA 1 
ATOM 2774   C C  . LYS A 1 775  ? 1116.200 711.519 842.588 1.00 0.00 ? 775  LYS A C  1 
ATOM 2775   O O  . LYS A 1 775  ? 1115.886 712.697 842.745 1.00 0.00 ? 775  LYS A O  1 
ATOM 2776   C CB . LYS A 1 775  ? 1115.049 709.699 843.706 1.00 0.00 ? 775  LYS A CB 1 
ATOM 2777   N N  . ILE A 1 776  ? 1117.483 711.112 842.588 1.00 0.00 ? 776  ILE A N  1 
ATOM 2778   C CA . ILE A 1 776  ? 1118.545 712.036 842.856 1.00 0.00 ? 776  ILE A CA 1 
ATOM 2779   C C  . ILE A 1 776  ? 1118.609 713.060 841.769 1.00 0.00 ? 776  ILE A C  1 
ATOM 2780   O O  . ILE A 1 776  ? 1118.716 714.256 842.036 1.00 0.00 ? 776  ILE A O  1 
ATOM 2781   C CB . ILE A 1 776  ? 1119.892 711.376 842.911 1.00 0.00 ? 776  ILE A CB 1 
ATOM 2782   N N  . SER A 1 777  ? 1118.527 712.611 840.505 1.00 0.00 ? 777  SER A N  1 
ATOM 2783   C CA . SER A 1 777  ? 1118.676 713.498 839.392 1.00 0.00 ? 777  SER A CA 1 
ATOM 2784   C C  . SER A 1 777  ? 1117.585 714.524 839.421 1.00 0.00 ? 777  SER A C  1 
ATOM 2785   O O  . SER A 1 777  ? 1117.844 715.715 839.252 1.00 0.00 ? 777  SER A O  1 
ATOM 2786   C CB . SER A 1 777  ? 1118.605 712.755 838.049 1.00 0.00 ? 777  SER A CB 1 
ATOM 2787   N N  . LEU A 1 778  ? 1116.330 714.092 839.651 1.00 0.00 ? 778  LEU A N  1 
ATOM 2788   C CA . LEU A 1 778  ? 1115.240 715.025 839.665 1.00 0.00 ? 778  LEU A CA 1 
ATOM 2789   C C  . LEU A 1 778  ? 1115.402 715.973 840.809 1.00 0.00 ? 778  LEU A C  1 
ATOM 2790   O O  . LEU A 1 778  ? 1115.101 717.158 840.690 1.00 0.00 ? 778  LEU A O  1 
ATOM 2791   C CB . LEU A 1 778  ? 1113.854 714.368 839.785 1.00 0.00 ? 778  LEU A CB 1 
ATOM 2792   N N  . GLN A 1 779  ? 1115.880 715.483 841.965 1.00 0.00 ? 779  GLN A N  1 
ATOM 2793   C CA . GLN A 1 779  ? 1116.019 716.365 843.086 1.00 0.00 ? 779  GLN A CA 1 
ATOM 2794   C C  . GLN A 1 779  ? 1116.991 717.439 842.713 1.00 0.00 ? 779  GLN A C  1 
ATOM 2795   O O  . GLN A 1 779  ? 1116.770 718.617 842.994 1.00 0.00 ? 779  GLN A O  1 
ATOM 2796   C CB . GLN A 1 779  ? 1116.584 715.659 844.333 1.00 0.00 ? 779  GLN A CB 1 
ATOM 2797   N N  . ALA A 1 780  ? 1118.092 717.058 842.040 1.00 0.00 ? 780  ALA A N  1 
ATOM 2798   C CA . ALA A 1 780  ? 1119.116 717.998 841.690 1.00 0.00 ? 780  ALA A CA 1 
ATOM 2799   C C  . ALA A 1 780  ? 1118.564 719.037 840.766 1.00 0.00 ? 780  ALA A C  1 
ATOM 2800   O O  . ALA A 1 780  ? 1118.853 720.222 840.924 1.00 0.00 ? 780  ALA A O  1 
ATOM 2801   C CB . ALA A 1 780  ? 1120.305 717.334 840.975 1.00 0.00 ? 780  ALA A CB 1 
ATOM 2802   N N  . ILE A 1 781  ? 1117.751 718.627 839.775 1.00 0.00 ? 781  ILE A N  1 
ATOM 2803   C CA . ILE A 1 781  ? 1117.250 719.575 838.820 1.00 0.00 ? 781  ILE A CA 1 
ATOM 2804   C C  . ILE A 1 781  ? 1116.348 720.561 839.487 1.00 0.00 ? 781  ILE A C  1 
ATOM 2805   O O  . ILE A 1 781  ? 1116.417 721.756 839.210 1.00 0.00 ? 781  ILE A O  1 
ATOM 2806   C CB . ILE A 1 781  ? 1116.499 718.963 837.669 1.00 0.00 ? 781  ILE A CB 1 
ATOM 2807   N N  . GLN A 1 782  ? 1115.472 720.085 840.391 1.00 0.00 ? 782  GLN A N  1 
ATOM 2808   C CA . GLN A 1 782  ? 1114.531 720.958 841.031 1.00 0.00 ? 782  GLN A CA 1 
ATOM 2809   C C  . GLN A 1 782  ? 1115.274 721.958 841.859 1.00 0.00 ? 782  GLN A C  1 
ATOM 2810   O O  . GLN A 1 782  ? 1114.906 723.129 841.919 1.00 0.00 ? 782  GLN A O  1 
ATOM 2811   C CB . GLN A 1 782  ? 1113.549 720.205 841.944 1.00 0.00 ? 782  GLN A CB 1 
ATOM 2812   N N  . GLN A 1 783  ? 1116.355 721.527 842.528 1.00 0.00 ? 783  GLN A N  1 
ATOM 2813   C CA . GLN A 1 783  ? 1117.087 722.459 843.333 1.00 0.00 ? 783  GLN A CA 1 
ATOM 2814   C C  . GLN A 1 783  ? 1117.652 723.500 842.420 1.00 0.00 ? 783  GLN A C  1 
ATOM 2815   O O  . GLN A 1 783  ? 1117.676 724.684 842.752 1.00 0.00 ? 783  GLN A O  1 
ATOM 2816   C CB . GLN A 1 783  ? 1118.237 721.797 844.110 1.00 0.00 ? 783  GLN A CB 1 
ATOM 2817   N N  . LEU A 1 784  ? 1118.107 723.076 841.228 1.00 0.00 ? 784  LEU A N  1 
ATOM 2818   C CA . LEU A 1 784  ? 1118.711 723.969 840.282 1.00 0.00 ? 784  LEU A CA 1 
ATOM 2819   C C  . LEU A 1 784  ? 1117.713 725.003 839.855 1.00 0.00 ? 784  LEU A C  1 
ATOM 2820   O O  . LEU A 1 784  ? 1118.039 726.187 839.773 1.00 0.00 ? 784  LEU A O  1 
ATOM 2821   C CB . LEU A 1 784  ? 1119.187 723.242 839.013 1.00 0.00 ? 784  LEU A CB 1 
ATOM 2822   N N  . VAL A 1 785  ? 1116.457 724.598 839.581 1.00 0.00 ? 785  VAL A N  1 
ATOM 2823   C CA . VAL A 1 785  ? 1115.497 725.552 839.094 1.00 0.00 ? 785  VAL A CA 1 
ATOM 2824   C C  . VAL A 1 785  ? 1115.270 726.595 840.143 1.00 0.00 ? 785  VAL A C  1 
ATOM 2825   O O  . VAL A 1 785  ? 1115.178 727.782 839.833 1.00 0.00 ? 785  VAL A O  1 
ATOM 2826   C CB . VAL A 1 785  ? 1114.170 724.953 838.709 1.00 0.00 ? 785  VAL A CB 1 
ATOM 2827   N N  . ARG A 1 786  ? 1115.178 726.181 841.421 1.00 0.00 ? 786  ARG A N  1 
ATOM 2828   C CA . ARG A 1 786  ? 1114.942 727.124 842.474 1.00 0.00 ? 786  ARG A CA 1 
ATOM 2829   C C  . ARG A 1 786  ? 1116.103 728.067 842.578 1.00 0.00 ? 786  ARG A C  1 
ATOM 2830   O O  . ARG A 1 786  ? 1115.912 729.267 842.771 1.00 0.00 ? 786  ARG A O  1 
ATOM 2831   C CB . ARG A 1 786  ? 1114.743 726.458 843.850 1.00 0.00 ? 786  ARG A CB 1 
ATOM 2832   N N  . LYS A 1 787  ? 1117.339 727.550 842.441 1.00 0.00 ? 787  LYS A N  1 
ATOM 2833   C CA . LYS A 1 787  ? 1118.518 728.354 842.598 1.00 0.00 ? 787  LYS A CA 1 
ATOM 2834   C C  . LYS A 1 787  ? 1118.536 729.421 841.549 1.00 0.00 ? 787  LYS A C  1 
ATOM 2835   O O  . LYS A 1 787  ? 1118.885 730.568 841.828 1.00 0.00 ? 787  LYS A O  1 
ATOM 2836   C CB . LYS A 1 787  ? 1119.814 727.526 842.494 1.00 0.00 ? 787  LYS A CB 1 
ATOM 2837   N N  . SER A 1 788  ? 1118.153 729.077 840.306 1.00 0.00 ? 788  SER A N  1 
ATOM 2838   C CA . SER A 1 788  ? 1118.157 730.061 839.265 1.00 0.00 ? 788  SER A CA 1 
ATOM 2839   C C  . SER A 1 788  ? 1117.144 731.106 839.602 1.00 0.00 ? 788  SER A C  1 
ATOM 2840   O O  . SER A 1 788  ? 1117.323 732.283 839.299 1.00 0.00 ? 788  SER A O  1 
ATOM 2841   C CB . SER A 1 788  ? 1117.784 729.504 837.882 1.00 0.00 ? 788  SER A CB 1 
ATOM 2842   N N  . TYR A 1 789  ? 1116.050 730.692 840.263 1.00 0.00 ? 789  TYR A N  1 
ATOM 2843   C CA . TYR A 1 789  ? 1114.982 731.593 840.581 1.00 0.00 ? 789  TYR A CA 1 
ATOM 2844   C C  . TYR A 1 789  ? 1115.538 732.624 841.510 1.00 0.00 ? 789  TYR A C  1 
ATOM 2845   O O  . TYR A 1 789  ? 1115.259 733.814 841.377 1.00 0.00 ? 789  TYR A O  1 
ATOM 2846   C CB . TYR A 1 789  ? 1113.823 730.887 841.309 1.00 0.00 ? 789  TYR A CB 1 
ATOM 2847   N N  . GLN A 1 790  ? 1116.356 732.174 842.479 1.00 0.00 ? 790  GLN A N  1 
ATOM 2848   C CA . GLN A 1 790  ? 1116.903 733.049 843.472 1.00 0.00 ? 790  GLN A CA 1 
ATOM 2849   C C  . GLN A 1 790  ? 1117.820 734.056 842.842 1.00 0.00 ? 790  GLN A C  1 
ATOM 2850   O O  . GLN A 1 790  ? 1117.749 735.242 843.159 1.00 0.00 ? 790  GLN A O  1 
ATOM 2851   C CB . GLN A 1 790  ? 1117.697 732.282 844.543 1.00 0.00 ? 790  GLN A CB 1 
ATOM 2852   N N  . ALA A 1 791  ? 1118.700 733.619 841.921 1.00 0.00 ? 791  ALA A N  1 
ATOM 2853   C CA . ALA A 1 791  ? 1119.638 734.536 841.336 1.00 0.00 ? 791  ALA A CA 1 
ATOM 2854   C C  . ALA A 1 791  ? 1118.893 735.580 840.567 1.00 0.00 ? 791  ALA A C  1 
ATOM 2855   O O  . ALA A 1 791  ? 1119.172 736.774 840.680 1.00 0.00 ? 791  ALA A O  1 
ATOM 2856   C CB . ALA A 1 791  ? 1120.608 733.851 840.358 1.00 0.00 ? 791  ALA A CB 1 
ATOM 2857   N N  . LEU A 1 792  ? 1117.892 735.149 839.785 1.00 0.00 ? 792  LEU A N  1 
ATOM 2858   C CA . LEU A 1 792  ? 1117.145 736.050 838.956 1.00 0.00 ? 792  LEU A CA 1 
ATOM 2859   C C  . LEU A 1 792  ? 1116.418 737.010 839.838 1.00 0.00 ? 792  LEU A C  1 
ATOM 2860   O O  . LEU A 1 792  ? 1116.244 738.174 839.486 1.00 0.00 ? 792  LEU A O  1 
ATOM 2861   C CB . LEU A 1 792  ? 1116.109 735.332 838.076 1.00 0.00 ? 792  LEU A CB 1 
ATOM 2862   N N  . ALA A 1 793  ? 1115.946 736.533 841.006 1.00 0.00 ? 793  ALA A N  1 
ATOM 2863   C CA . ALA A 1 793  ? 1115.211 737.368 841.909 1.00 0.00 ? 793  ALA A CA 1 
ATOM 2864   C C  . ALA A 1 793  ? 1116.094 738.479 842.377 1.00 0.00 ? 793  ALA A C  1 
ATOM 2865   O O  . ALA A 1 793  ? 1115.666 739.629 842.451 1.00 0.00 ? 793  ALA A O  1 
ATOM 2866   C CB . ALA A 1 793  ? 1114.718 736.607 843.154 1.00 0.00 ? 793  ALA A CB 1 
ATOM 2867   N N  . LEU A 1 794  ? 1117.365 738.167 842.695 1.00 0.00 ? 794  LEU A N  1 
ATOM 2868   C CA . LEU A 1 794  ? 1118.242 739.196 843.174 1.00 0.00 ? 794  LEU A CA 1 
ATOM 2869   C C  . LEU A 1 794  ? 1118.399 740.206 842.084 1.00 0.00 ? 794  LEU A C  1 
ATOM 2870   O O  . LEU A 1 794  ? 1118.317 741.406 842.326 1.00 0.00 ? 794  LEU A O  1 
ATOM 2871   C CB . LEU A 1 794  ? 1119.650 738.684 843.523 1.00 0.00 ? 794  LEU A CB 1 
ATOM 2872   N N  . TRP A 1 795  ? 1118.594 739.753 840.836 1.00 0.00 ? 795  TRP A N  1 
ATOM 2873   C CA . TRP A 1 795  ? 1118.775 740.681 839.759 1.00 0.00 ? 795  TRP A CA 1 
ATOM 2874   C C  . TRP A 1 795  ? 1117.561 741.523 839.566 1.00 0.00 ? 795  TRP A C  1 
ATOM 2875   O O  . TRP A 1 795  ? 1117.672 742.695 839.211 1.00 0.00 ? 795  TRP A O  1 
ATOM 2876   C CB . TRP A 1 795  ? 1119.187 740.037 838.431 1.00 0.00 ? 795  TRP A CB 1 
ATOM 2877   N N  . LYS A 1 796  ? 1116.364 740.958 839.789 1.00 0.00 ? 796  LYS A N  1 
ATOM 2878   C CA . LYS A 1 796  ? 1115.176 741.738 839.605 1.00 0.00 ? 796  LYS A CA 1 
ATOM 2879   C C  . LYS A 1 796  ? 1115.277 742.915 840.525 1.00 0.00 ? 796  LYS A C  1 
ATOM 2880   O O  . LYS A 1 796  ? 1114.924 744.037 840.171 1.00 0.00 ? 796  LYS A O  1 
ATOM 2881   C CB . LYS A 1 796  ? 1113.902 740.949 839.963 1.00 0.00 ? 796  LYS A CB 1 
ATOM 2882   N N  . LEU A 1 797  ? 1115.798 742.663 841.735 1.00 0.00 ? 797  LEU A N  1 
ATOM 2883   C CA . LEU A 1 797  ? 1115.989 743.628 842.779 1.00 0.00 ? 797  LEU A CA 1 
ATOM 2884   C C  . LEU A 1 797  ? 1116.925 744.689 842.285 1.00 0.00 ? 797  LEU A C  1 
ATOM 2885   O O  . LEU A 1 797  ? 1116.620 745.880 842.348 1.00 0.00 ? 797  LEU A O  1 
ATOM 2886   C CB . LEU A 1 797  ? 1116.713 742.923 843.931 1.00 0.00 ? 797  LEU A CB 1 
ATOM 2887   N N  . LEU A 1 798  ? 1118.087 744.274 841.750 1.00 0.00 ? 798  LEU A N  1 
ATOM 2888   C CA . LEU A 1 798  ? 1119.134 745.194 841.406 1.00 0.00 ? 798  LEU A CA 1 
ATOM 2889   C C  . LEU A 1 798  ? 1118.668 746.143 840.358 1.00 0.00 ? 798  LEU A C  1 
ATOM 2890   O O  . LEU A 1 798  ? 1119.065 747.306 840.346 1.00 0.00 ? 798  LEU A O  1 
ATOM 2891   C CB . LEU A 1 798  ? 1120.415 744.506 840.896 1.00 0.00 ? 798  LEU A CB 1 
ATOM 2892   N N  . CYS A 1 799  ? 1117.791 745.680 839.459 1.00 0.00 ? 799  CYS A N  1 
ATOM 2893   C CA . CYS A 1 799  ? 1117.365 746.504 838.372 1.00 0.00 ? 799  CYS A CA 1 
ATOM 2894   C C  . CYS A 1 799  ? 1116.693 747.736 838.881 1.00 0.00 ? 799  CYS A C  1 
ATOM 2895   O O  . CYS A 1 799  ? 1116.765 748.779 838.234 1.00 0.00 ? 799  CYS A O  1 
ATOM 2896   C CB . CYS A 1 799  ? 1116.362 745.826 837.434 1.00 0.00 ? 799  CYS A CB 1 
ATOM 2897   N N  . GLU A 1 800  ? 1116.039 747.654 840.053 1.00 0.00 ? 800  GLU A N  1 
ATOM 2898   C CA . GLU A 1 800  ? 1115.245 748.755 840.512 1.00 0.00 ? 800  GLU A CA 1 
ATOM 2899   C C  . GLU A 1 800  ? 1116.059 750.009 840.573 1.00 0.00 ? 800  GLU A C  1 
ATOM 2900   O O  . GLU A 1 800  ? 1115.606 751.043 840.085 1.00 0.00 ? 800  GLU A O  1 
ATOM 2901   C CB . GLU A 1 800  ? 1114.643 748.535 841.908 1.00 0.00 ? 800  GLU A CB 1 
ATOM 2902   N N  . HIS A 1 801  ? 1117.282 749.991 841.136 1.00 0.00 ? 801  HIS A N  1 
ATOM 2903   C CA . HIS A 1 801  ? 1117.895 751.286 841.143 1.00 0.00 ? 801  HIS A CA 1 
ATOM 2904   C C  . HIS A 1 801  ? 1119.339 751.186 841.541 1.00 0.00 ? 801  HIS A C  1 
ATOM 2905   O O  . HIS A 1 801  ? 1119.838 750.113 841.879 1.00 0.00 ? 801  HIS A O  1 
ATOM 2906   C CB . HIS A 1 801  ? 1117.200 752.235 842.139 1.00 0.00 ? 801  HIS A CB 1 
ATOM 2907   N N  . GLN A 1 802  ? 1119.997 752.368 841.512 1.00 0.00 ? 802  GLN A N  1 
ATOM 2908   C CA . GLN A 1 802  ? 1121.343 752.762 841.855 1.00 0.00 ? 802  GLN A CA 1 
ATOM 2909   C C  . GLN A 1 802  ? 1122.280 751.596 842.009 1.00 0.00 ? 802  GLN A C  1 
ATOM 2910   O O  . GLN A 1 802  ? 1123.051 751.530 842.966 1.00 0.00 ? 802  GLN A O  1 
ATOM 2911   C CB . GLN A 1 802  ? 1121.252 753.515 843.195 1.00 0.00 ? 802  GLN A CB 1 
ATOM 2912   N N  . PHE A 1 803  ? 1122.255 750.638 841.067 1.00 0.00 ? 803  PHE A N  1 
ATOM 2913   C CA . PHE A 1 803  ? 1123.164 749.531 841.128 1.00 0.00 ? 803  PHE A CA 1 
ATOM 2914   C C  . PHE A 1 803  ? 1124.518 749.919 840.606 1.00 0.00 ? 803  PHE A C  1 
ATOM 2915   O O  . PHE A 1 803  ? 1125.548 749.550 841.167 1.00 0.00 ? 803  PHE A O  1 
ATOM 2916   C CB . PHE A 1 803  ? 1122.670 748.320 840.320 1.00 0.00 ? 803  PHE A CB 1 
ATOM 2917   N N  . THR A 1 804  ? 1124.538 750.704 839.510 1.00 0.00 ? 804  THR A N  1 
ATOM 2918   C CA . THR A 1 804  ? 1125.745 750.996 838.784 1.00 0.00 ? 804  THR A CA 1 
ATOM 2919   C C  . THR A 1 804  ? 1126.737 751.737 839.624 1.00 0.00 ? 804  THR A C  1 
ATOM 2920   O O  . THR A 1 804  ? 1127.927 751.426 839.594 1.00 0.00 ? 804  THR A O  1 
ATOM 2921   C CB . THR A 1 804  ? 1125.494 751.809 837.543 1.00 0.00 ? 804  THR A CB 1 
ATOM 2922   N N  . ILE A 1 805  ? 1126.284 752.728 840.406 1.00 0.00 ? 805  ILE A N  1 
ATOM 2923   C CA . ILE A 1 805  ? 1127.220 753.526 841.140 1.00 0.00 ? 805  ILE A CA 1 
ATOM 2924   C C  . ILE A 1 805  ? 1127.964 752.679 842.125 1.00 0.00 ? 805  ILE A C  1 
ATOM 2925   O O  . ILE A 1 805  ? 1129.185 752.776 842.233 1.00 0.00 ? 805  ILE A O  1 
ATOM 2926   C CB . ILE A 1 805  ? 1126.566 754.660 841.881 1.00 0.00 ? 805  ILE A CB 1 
ATOM 2927   N N  . ILE A 1 806  ? 1127.253 751.803 842.856 1.00 0.00 ? 806  ILE A N  1 
ATOM 2928   C CA . ILE A 1 806  ? 1127.908 751.020 843.860 1.00 0.00 ? 806  ILE A CA 1 
ATOM 2929   C C  . ILE A 1 806  ? 1128.913 750.124 843.218 1.00 0.00 ? 806  ILE A C  1 
ATOM 2930   O O  . ILE A 1 806  ? 1130.015 749.944 843.734 1.00 0.00 ? 806  ILE A O  1 
ATOM 2931   C CB . ILE A 1 806  ? 1126.973 750.169 844.675 1.00 0.00 ? 806  ILE A CB 1 
ATOM 2932   N N  . VAL A 1 807  ? 1128.565 749.548 842.055 1.00 0.00 ? 807  VAL A N  1 
ATOM 2933   C CA . VAL A 1 807  ? 1129.428 748.603 841.410 1.00 0.00 ? 807  VAL A CA 1 
ATOM 2934   C C  . VAL A 1 807  ? 1130.757 749.230 841.132 1.00 0.00 ? 807  VAL A C  1 
ATOM 2935   O O  . VAL A 1 807  ? 1131.798 748.638 841.417 1.00 0.00 ? 807  VAL A O  1 
ATOM 2936   C CB . VAL A 1 807  ? 1128.874 748.150 840.093 1.00 0.00 ? 807  VAL A CB 1 
ATOM 2937   N N  . ALA A 1 808  ? 1130.761 750.457 840.587 1.00 0.00 ? 808  ALA A N  1 
ATOM 2938   C CA . ALA A 1 808  ? 1132.003 751.061 840.209 1.00 0.00 ? 808  ALA A CA 1 
ATOM 2939   C C  . ALA A 1 808  ? 1132.871 751.262 841.412 1.00 0.00 ? 808  ALA A C  1 
ATOM 2940   O O  . ALA A 1 808  ? 1134.056 750.930 841.391 1.00 0.00 ? 808  ALA A O  1 
ATOM 2941   C CB . ALA A 1 808  ? 1131.813 752.439 839.552 1.00 0.00 ? 808  ALA A CB 1 
ATOM 2942   N N  . GLU A 1 809  ? 1132.295 751.795 842.502 1.00 0.00 ? 809  GLU A N  1 
ATOM 2943   C CA . GLU A 1 809  ? 1133.072 752.108 843.667 1.00 0.00 ? 809  GLU A CA 1 
ATOM 2944   C C  . GLU A 1 809  ? 1133.582 750.867 844.332 1.00 0.00 ? 809  GLU A C  1 
ATOM 2945   O O  . GLU A 1 809  ? 1134.723 750.831 844.783 1.00 0.00 ? 809  GLU A O  1 
ATOM 2946   C CB . GLU A 1 809  ? 1132.282 752.895 844.727 1.00 0.00 ? 809  GLU A CB 1 
ATOM 2947   N N  . LEU A 1 810  ? 1132.742 749.823 844.414 1.00 0.00 ? 810  LEU A N  1 
ATOM 2948   C CA . LEU A 1 810  ? 1133.061 748.629 845.152 1.00 0.00 ? 810  LEU A CA 1 
ATOM 2949   C C  . LEU A 1 810  ? 1134.200 747.845 844.578 1.00 0.00 ? 810  LEU A C  1 
ATOM 2950   O O  . LEU A 1 810  ? 1135.068 747.386 845.319 1.00 0.00 ? 810  LEU A O  1 
ATOM 2951   C CB . LEU A 1 810  ? 1131.889 747.637 845.221 1.00 0.00 ? 810  LEU A CB 1 
ATOM 2952   N N  . GLN A 1 811  ? 1134.254 747.685 843.244 1.00 0.00 ? 811  GLN A N  1 
ATOM 2953   C CA . GLN A 1 811  ? 1135.150 746.702 842.698 1.00 0.00 ? 811  GLN A CA 1 
ATOM 2954   C C  . GLN A 1 811  ? 1136.606 747.009 842.927 1.00 0.00 ? 811  GLN A C  1 
ATOM 2955   O O  . GLN A 1 811  ? 1137.091 748.092 842.608 1.00 0.00 ? 811  GLN A O  1 
ATOM 2956   C CB . GLN A 1 811  ? 1134.859 746.409 841.219 1.00 0.00 ? 811  GLN A CB 1 
ATOM 2957   N N  . LYS A 1 812  ? 1137.315 745.990 843.491 1.00 0.00 ? 812  LYS A N  1 
ATOM 2958   C CA . LYS A 1 812  ? 1138.705 745.961 843.897 1.00 0.00 ? 812  LYS A CA 1 
ATOM 2959   C C  . LYS A 1 812  ? 1139.442 744.913 843.122 1.00 0.00 ? 812  LYS A C  1 
ATOM 2960   O O  . LYS A 1 812  ? 1139.150 744.660 841.957 1.00 0.00 ? 812  LYS A O  1 
ATOM 2961   C CB . LYS A 1 812  ? 1138.907 745.596 845.381 1.00 0.00 ? 812  LYS A CB 1 
ATOM 2962   N N  . GLU A 1 813  ? 1140.441 744.280 843.766 1.00 0.00 ? 813  GLU A N  1 
ATOM 2963   C CA . GLU A 1 813  ? 1141.294 743.297 843.152 1.00 0.00 ? 813  GLU A CA 1 
ATOM 2964   C C  . GLU A 1 813  ? 1140.472 742.137 842.683 1.00 0.00 ? 813  GLU A C  1 
ATOM 2965   O O  . GLU A 1 813  ? 1140.740 741.552 841.635 1.00 0.00 ? 813  GLU A O  1 
ATOM 2966   C CB . GLU A 1 813  ? 1142.340 742.714 844.120 1.00 0.00 ? 813  GLU A CB 1 
ATOM 2967   N N  . LEU A 1 814  ? 1139.432 741.783 843.454 1.00 0.00 ? 814  LEU A N  1 
ATOM 2968   C CA . LEU A 1 814  ? 1138.595 740.648 843.189 1.00 0.00 ? 814  LEU A CA 1 
ATOM 2969   C C  . LEU A 1 814  ? 1137.903 740.918 841.882 1.00 0.00 ? 814  LEU A C  1 
ATOM 2970   O O  . LEU A 1 814  ? 1137.534 740.000 841.154 1.00 0.00 ? 814  LEU A O  1 
ATOM 2971   C CB . LEU A 1 814  ? 1137.547 740.445 844.310 1.00 0.00 ? 814  LEU A CB 1 
ATOM 2972   N N  . GLN A 1 815  ? 1137.807 742.207 841.504 1.00 0.00 ? 815  GLN A N  1 
ATOM 2973   C CA . GLN A 1 815  ? 1136.989 742.683 840.417 1.00 0.00 ? 815  GLN A CA 1 
ATOM 2974   C C  . GLN A 1 815  ? 1137.181 741.866 839.179 1.00 0.00 ? 815  GLN A C  1 
ATOM 2975   O O  . GLN A 1 815  ? 1136.200 741.596 838.487 1.00 0.00 ? 815  GLN A O  1 
ATOM 2976   C CB . GLN A 1 815  ? 1137.342 744.119 839.981 1.00 0.00 ? 815  GLN A CB 1 
ATOM 2977   N N  . GLU A 1 816  ? 1138.415 741.447 838.846 1.00 0.00 ? 816  GLU A N  1 
ATOM 2978   C CA . GLU A 1 816  ? 1138.574 740.755 837.598 1.00 0.00 ? 816  GLU A CA 1 
ATOM 2979   C C  . GLU A 1 816  ? 1137.751 739.511 837.631 1.00 0.00 ? 816  GLU A C  1 
ATOM 2980   O O  . GLU A 1 816  ? 1137.112 739.156 836.643 1.00 0.00 ? 816  GLU A O  1 
ATOM 2981   C CB . GLU A 1 816  ? 1140.029 740.371 837.275 1.00 0.00 ? 816  GLU A CB 1 
ATOM 2982   N N  . GLN A 1 817  ? 1137.723 738.826 838.785 1.00 0.00 ? 817  GLN A N  1 
ATOM 2983   C CA . GLN A 1 817  ? 1136.970 737.614 838.891 1.00 0.00 ? 817  GLN A CA 1 
ATOM 2984   C C  . GLN A 1 817  ? 1135.515 737.918 838.713 1.00 0.00 ? 817  GLN A C  1 
ATOM 2985   O O  . GLN A 1 817  ? 1134.794 737.169 838.056 1.00 0.00 ? 817  GLN A O  1 
ATOM 2986   C CB . GLN A 1 817  ? 1137.143 736.931 840.258 1.00 0.00 ? 817  GLN A CB 1 
ATOM 2987   N N  . LEU A 1 818  ? 1135.045 739.041 839.288 1.00 0.00 ? 818  LEU A N  1 
ATOM 2988   C CA . LEU A 1 818  ? 1133.645 739.373 839.245 1.00 0.00 ? 818  LEU A CA 1 
ATOM 2989   C C  . LEU A 1 818  ? 1133.182 739.576 837.841 1.00 0.00 ? 818  LEU A C  1 
ATOM 2990   O O  . LEU A 1 818  ? 1132.152 739.040 837.436 1.00 0.00 ? 818  LEU A O  1 
ATOM 2991   C CB . LEU A 1 818  ? 1133.315 740.704 839.935 1.00 0.00 ? 818  LEU A CB 1 
ATOM 2992   N N  . LYS A 1 819  ? 1133.940 740.357 837.054 1.00 0.00 ? 819  LYS A N  1 
ATOM 2993   C CA . LYS A 1 819  ? 1133.487 740.704 835.742 1.00 0.00 ? 819  LYS A CA 1 
ATOM 2994   C C  . LYS A 1 819  ? 1133.387 739.500 834.871 1.00 0.00 ? 819  LYS A C  1 
ATOM 2995   O O  . LYS A 1 819  ? 1132.515 739.445 834.010 1.00 0.00 ? 819  LYS A O  1 
ATOM 2996   C CB . LYS A 1 819  ? 1134.324 741.795 835.056 1.00 0.00 ? 819  LYS A CB 1 
ATOM 2997   N N  . ILE A 1 820  ? 1134.275 738.504 835.034 1.00 0.00 ? 820  ILE A N  1 
ATOM 2998   C CA . ILE A 1 820  ? 1134.088 737.372 834.180 1.00 0.00 ? 820  ILE A CA 1 
ATOM 2999   C C  . ILE A 1 820  ? 1133.287 736.353 834.928 1.00 0.00 ? 820  ILE A C  1 
ATOM 3000   O O  . ILE A 1 820  ? 1133.699 735.211 835.116 1.00 0.00 ? 820  ILE A O  1 
ATOM 3001   C CB . ILE A 1 820  ? 1135.390 736.754 833.747 1.00 0.00 ? 820  ILE A CB 1 
ATOM 3002   N N  . THR A 1 821  ? 1132.062 736.735 835.329 1.00 0.00 ? 821  THR A N  1 
ATOM 3003   C CA . THR A 1 821  ? 1131.207 735.813 836.005 1.00 0.00 ? 821  THR A CA 1 
ATOM 3004   C C  . THR A 1 821  ? 1130.068 735.587 835.077 1.00 0.00 ? 821  THR A C  1 
ATOM 3005   O O  . THR A 1 821  ? 1129.486 736.526 834.534 1.00 0.00 ? 821  THR A O  1 
ATOM 3006   C CB . THR A 1 821  ? 1130.669 736.330 837.314 1.00 0.00 ? 821  THR A CB 1 
ATOM 3007   N N  . THR A 1 822  ? 1129.746 734.311 834.832 1.00 0.00 ? 822  THR A N  1 
ATOM 3008   C CA . THR A 1 822  ? 1128.688 734.018 833.917 1.00 0.00 ? 822  THR A CA 1 
ATOM 3009   C C  . THR A 1 822  ? 1127.428 733.829 834.704 1.00 0.00 ? 822  THR A C  1 
ATOM 3010   O O  . THR A 1 822  ? 1127.453 733.745 835.931 1.00 0.00 ? 822  THR A O  1 
ATOM 3011   C CB . THR A 1 822  ? 1128.952 732.772 833.143 1.00 0.00 ? 822  THR A CB 1 
ATOM 3012   N N  . PHE A 1 823  ? 1126.283 733.760 833.998 1.00 0.00 ? 823  PHE A N  1 
ATOM 3013   C CA . PHE A 1 823  ? 1125.019 733.552 834.642 1.00 0.00 ? 823  PHE A CA 1 
ATOM 3014   C C  . PHE A 1 823  ? 1125.040 732.217 835.305 1.00 0.00 ? 823  PHE A C  1 
ATOM 3015   O O  . PHE A 1 823  ? 1124.518 732.064 836.407 1.00 0.00 ? 823  PHE A O  1 
ATOM 3016   C CB . PHE A 1 823  ? 1123.807 733.594 833.693 1.00 0.00 ? 823  PHE A CB 1 
ATOM 3017   N N  . LYS A 1 824  ? 1125.642 731.207 834.651 1.00 0.00 ? 824  LYS A N  1 
ATOM 3018   C CA . LYS A 1 824  ? 1125.675 729.902 835.242 1.00 0.00 ? 824  LYS A CA 1 
ATOM 3019   C C  . LYS A 1 824  ? 1126.456 729.983 836.511 1.00 0.00 ? 824  LYS A C  1 
ATOM 3020   O O  . LYS A 1 824  ? 1126.184 729.251 837.460 1.00 0.00 ? 824  LYS A O  1 
ATOM 3021   C CB . LYS A 1 824  ? 1126.252 728.798 834.328 1.00 0.00 ? 824  LYS A CB 1 
ATOM 3022   N N  . ASP A 1 825  ? 1127.456 730.882 836.569 1.00 0.00 ? 825  ASP A N  1 
ATOM 3023   C CA . ASP A 1 825  ? 1128.211 731.003 837.779 1.00 0.00 ? 825  ASP A CA 1 
ATOM 3024   C C  . ASP A 1 825  ? 1127.254 731.381 838.868 1.00 0.00 ? 825  ASP A C  1 
ATOM 3025   O O  . ASP A 1 825  ? 1127.356 730.888 839.988 1.00 0.00 ? 825  ASP A O  1 
ATOM 3026   C CB . ASP A 1 825  ? 1129.306 732.085 837.698 1.00 0.00 ? 825  ASP A CB 1 
ATOM 3027   N N  . LEU A 1 826  ? 1126.301 732.287 838.593 1.00 0.00 ? 826  LEU A N  1 
ATOM 3028   C CA . LEU A 1 826  ? 1125.329 732.604 839.600 1.00 0.00 ? 826  LEU A CA 1 
ATOM 3029   C C  . LEU A 1 826  ? 1124.422 731.426 839.812 1.00 0.00 ? 826  LEU A C  1 
ATOM 3030   O O  . LEU A 1 826  ? 1124.024 731.146 840.942 1.00 0.00 ? 826  LEU A O  1 
ATOM 3031   C CB . LEU A 1 826  ? 1124.454 733.826 839.272 1.00 0.00 ? 826  LEU A CB 1 
ATOM 3032   N N  . VAL A 1 827  ? 1124.075 730.705 838.727 1.00 0.00 ? 827  VAL A N  1 
ATOM 3033   C CA . VAL A 1 827  ? 1123.163 729.603 838.826 1.00 0.00 ? 827  VAL A CA 1 
ATOM 3034   C C  . VAL A 1 827  ? 1123.754 728.644 839.794 1.00 0.00 ? 827  VAL A C  1 
ATOM 3035   O O  . VAL A 1 827  ? 1123.049 728.169 840.682 1.00 0.00 ? 827  VAL A O  1 
ATOM 3036   C CB . VAL A 1 827  ? 1123.016 728.871 837.529 1.00 0.00 ? 827  VAL A CB 1 
ATOM 3037   N N  . ILE A 1 828  ? 1125.051 728.314 839.626 1.00 0.00 ? 828  ILE A N  1 
ATOM 3038   C CA . ILE A 1 828  ? 1125.753 727.513 840.585 1.00 0.00 ? 828  ILE A CA 1 
ATOM 3039   C C  . ILE A 1 828  ? 1126.714 728.490 841.208 1.00 0.00 ? 828  ILE A C  1 
ATOM 3040   O O  . ILE A 1 828  ? 1127.886 728.583 840.849 1.00 0.00 ? 828  ILE A O  1 
ATOM 3041   C CB . ILE A 1 828  ? 1126.470 726.356 839.940 1.00 0.00 ? 828  ILE A CB 1 
ATOM 3042   N N  . ARG A 1 829  ? 1126.198 729.171 842.244 1.00 0.00 ? 829  ARG A N  1 
ATOM 3043   C CA . ARG A 1 829  ? 1126.652 730.354 842.930 1.00 0.00 ? 829  ARG A CA 1 
ATOM 3044   C C  . ARG A 1 829  ? 1128.073 730.414 843.382 1.00 0.00 ? 829  ARG A C  1 
ATOM 3045   O O  . ARG A 1 829  ? 1128.732 729.411 843.661 1.00 0.00 ? 829  ARG A O  1 
ATOM 3046   C CB . ARG A 1 829  ? 1125.808 730.614 844.182 1.00 0.00 ? 829  ARG A CB 1 
ATOM 3047   N N  . ASP A 1 830  ? 1128.549 731.682 843.405 1.00 0.00 ? 830  ASP A N  1 
ATOM 3048   C CA . ASP A 1 830  ? 1129.765 732.175 843.986 1.00 0.00 ? 830  ASP A CA 1 
ATOM 3049   C C  . ASP A 1 830  ? 1129.265 733.071 845.084 1.00 0.00 ? 830  ASP A C  1 
ATOM 3050   O O  . ASP A 1 830  ? 1129.050 734.271 844.918 1.00 0.00 ? 830  ASP A O  1 
ATOM 3051   C CB . ASP A 1 830  ? 1130.662 732.946 842.993 1.00 0.00 ? 830  ASP A CB 1 
ATOM 3052   N N  . LYS A 1 831  ? 1129.053 732.450 846.255 1.00 0.00 ? 831  LYS A N  1 
ATOM 3053   C CA . LYS A 1 831  ? 1128.361 732.991 847.388 1.00 0.00 ? 831  LYS A CA 1 
ATOM 3054   C C  . LYS A 1 831  ? 1129.007 734.174 848.050 1.00 0.00 ? 831  LYS A C  1 
ATOM 3055   O O  . LYS A 1 831  ? 1128.322 735.150 848.357 1.00 0.00 ? 831  LYS A O  1 
ATOM 3056   C CB . LYS A 1 831  ? 1128.162 731.897 848.444 1.00 0.00 ? 831  LYS A CB 1 
ATOM 3057   N N  . GLU A 1 832  ? 1130.329 734.157 848.294 1.00 0.00 ? 832  GLU A N  1 
ATOM 3058   C CA . GLU A 1 832  ? 1130.850 735.214 849.120 1.00 0.00 ? 832  GLU A CA 1 
ATOM 3059   C C  . GLU A 1 832  ? 1130.757 736.571 848.489 1.00 0.00 ? 832  GLU A C  1 
ATOM 3060   O O  . GLU A 1 832  ? 1130.384 737.531 849.162 1.00 0.00 ? 832  GLU A O  1 
ATOM 3061   C CB . GLU A 1 832  ? 1132.289 734.970 849.618 1.00 0.00 ? 832  GLU A CB 1 
ATOM 3062   N N  . LEU A 1 833  ? 1131.070 736.712 847.187 1.00 0.00 ? 833  LEU A N  1 
ATOM 3063   C CA . LEU A 1 833  ? 1131.050 738.038 846.632 1.00 0.00 ? 833  LEU A CA 1 
ATOM 3064   C C  . LEU A 1 833  ? 1129.672 738.603 846.676 1.00 0.00 ? 833  LEU A C  1 
ATOM 3065   O O  . LEU A 1 833  ? 1129.484 739.764 847.037 1.00 0.00 ? 833  LEU A O  1 
ATOM 3066   C CB . LEU A 1 833  ? 1131.505 738.129 845.168 1.00 0.00 ? 833  LEU A CB 1 
ATOM 3067   N N  . THR A 1 834  ? 1128.659 737.792 846.328 1.00 0.00 ? 834  THR A N  1 
ATOM 3068   C CA . THR A 1 834  ? 1127.327 738.314 846.287 1.00 0.00 ? 834  THR A CA 1 
ATOM 3069   C C  . THR A 1 834  ? 1126.934 738.770 847.651 1.00 0.00 ? 834  THR A C  1 
ATOM 3070   O O  . THR A 1 834  ? 1126.287 739.806 847.799 1.00 0.00 ? 834  THR A O  1 
ATOM 3071   C CB . THR A 1 834  ? 1126.306 737.320 845.817 1.00 0.00 ? 834  THR A CB 1 
ATOM 3072   N N  . GLY A 1 835  ? 1127.325 738.019 848.693 1.00 0.00 ? 835  GLY A N  1 
ATOM 3073   C CA . GLY A 1 835  ? 1126.917 738.386 850.016 1.00 0.00 ? 835  GLY A CA 1 
ATOM 3074   C C  . GLY A 1 835  ? 1127.449 739.748 850.339 1.00 0.00 ? 835  GLY A C  1 
ATOM 3075   O O  . GLY A 1 835  ? 1126.744 740.577 850.912 1.00 0.00 ? 835  GLY A O  1 
ATOM 3076   N N  . ALA A 1 836  ? 1128.717 740.020 849.991 1.00 0.00 ? 836  ALA A N  1 
ATOM 3077   C CA . ALA A 1 836  ? 1129.281 741.294 850.321 1.00 0.00 ? 836  ALA A CA 1 
ATOM 3078   C C  . ALA A 1 836  ? 1128.541 742.372 849.592 1.00 0.00 ? 836  ALA A C  1 
ATOM 3079   O O  . ALA A 1 836  ? 1128.212 743.411 850.166 1.00 0.00 ? 836  ALA A O  1 
ATOM 3080   C CB . ALA A 1 836  ? 1130.766 741.408 849.932 1.00 0.00 ? 836  ALA A CB 1 
ATOM 3081   N N  . LEU A 1 837  ? 1128.240 742.139 848.300 1.00 0.00 ? 837  LEU A N  1 
ATOM 3082   C CA . LEU A 1 837  ? 1127.613 743.137 847.481 1.00 0.00 ? 837  LEU A CA 1 
ATOM 3083   C C  . LEU A 1 837  ? 1126.249 743.431 848.021 1.00 0.00 ? 837  LEU A C  1 
ATOM 3084   O O  . LEU A 1 837  ? 1125.852 744.590 848.124 1.00 0.00 ? 837  LEU A O  1 
ATOM 3085   C CB . LEU A 1 837  ? 1127.482 742.677 846.010 1.00 0.00 ? 837  LEU A CB 1 
ATOM 3086   N N  . ILE A 1 838  ? 1125.502 742.377 848.391 1.00 0.00 ? 838  ILE A N  1 
ATOM 3087   C CA . ILE A 1 838  ? 1124.148 742.526 848.836 1.00 0.00 ? 838  ILE A CA 1 
ATOM 3088   C C  . ILE A 1 838  ? 1124.158 743.334 850.093 1.00 0.00 ? 838  ILE A C  1 
ATOM 3089   O O  . ILE A 1 838  ? 1123.308 744.202 850.288 1.00 0.00 ? 838  ILE A O  1 
ATOM 3090   C CB . ILE A 1 838  ? 1123.491 741.193 849.059 1.00 0.00 ? 838  ILE A CB 1 
ATOM 3091   N N  . ALA A 1 839  ? 1125.147 743.083 850.969 1.00 0.00 ? 839  ALA A N  1 
ATOM 3092   C CA . ALA A 1 839  ? 1125.238 743.788 852.211 1.00 0.00 ? 839  ALA A CA 1 
ATOM 3093   C C  . ALA A 1 839  ? 1125.395 745.242 851.905 1.00 0.00 ? 839  ALA A C  1 
ATOM 3094   O O  . ALA A 1 839  ? 1124.836 746.092 852.598 1.00 0.00 ? 839  ALA A O  1 
ATOM 3095   C CB . ALA A 1 839  ? 1126.449 743.355 853.054 1.00 0.00 ? 839  ALA A CB 1 
ATOM 3096   N N  . SER A 1 840  ? 1126.180 745.576 850.865 1.00 0.00 ? 840  SER A N  1 
ATOM 3097   C CA . SER A 1 840  ? 1126.380 746.953 850.521 1.00 0.00 ? 840  SER A CA 1 
ATOM 3098   C C  . SER A 1 840  ? 1125.095 747.533 850.009 1.00 0.00 ? 840  SER A C  1 
ATOM 3099   O O  . SER A 1 840  ? 1124.799 748.702 850.251 1.00 0.00 ? 840  SER A O  1 
ATOM 3100   C CB . SER A 1 840  ? 1127.451 747.143 849.435 1.00 0.00 ? 840  SER A CB 1 
ATOM 3101   N N  . LEU A 1 841  ? 1124.288 746.727 849.291 1.00 0.00 ? 841  LEU A N  1 
ATOM 3102   C CA . LEU A 1 841  ? 1123.075 747.245 848.729 1.00 0.00 ? 841  LEU A CA 1 
ATOM 3103   C C  . LEU A 1 841  ? 1122.214 747.666 849.881 1.00 0.00 ? 841  LEU A C  1 
ATOM 3104   O O  . LEU A 1 841  ? 1121.608 748.737 849.847 1.00 0.00 ? 841  LEU A O  1 
ATOM 3105   C CB . LEU A 1 841  ? 1122.319 746.180 847.904 1.00 0.00 ? 841  LEU A CB 1 
ATOM 3106   N N  . ILE A 1 842  ? 1122.119 746.817 850.927 1.00 0.00 ? 842  ILE A N  1 
ATOM 3107   C CA . ILE A 1 842  ? 1121.309 747.151 852.066 1.00 0.00 ? 842  ILE A CA 1 
ATOM 3108   C C  . ILE A 1 842  ? 1121.916 748.267 852.862 1.00 0.00 ? 842  ILE A C  1 
ATOM 3109   O O  . ILE A 1 842  ? 1121.224 749.222 853.212 1.00 0.00 ? 842  ILE A O  1 
ATOM 3110   C CB . ILE A 1 842  ? 1121.045 746.003 853.007 1.00 0.00 ? 842  ILE A CB 1 
ATOM 3111   N N  . ASN A 1 843  ? 1123.233 748.197 853.147 1.00 0.00 ? 843  ASN A N  1 
ATOM 3112   C CA . ASN A 1 843  ? 1123.829 749.199 853.988 1.00 0.00 ? 843  ASN A CA 1 
ATOM 3113   C C  . ASN A 1 843  ? 1123.637 750.521 853.335 1.00 0.00 ? 843  ASN A C  1 
ATOM 3114   O O  . ASN A 1 843  ? 1123.214 751.483 853.975 1.00 0.00 ? 843  ASN A O  1 
ATOM 3115   C CB . ASN A 1 843  ? 1125.337 748.997 854.216 1.00 0.00 ? 843  ASN A CB 1 
ATOM 3116   N N  . CYS A 1 844  ? 1123.926 750.603 852.027 1.00 0.00 ? 844  CYS A N  1 
ATOM 3117   C CA . CYS A 1 844  ? 1123.706 751.853 851.376 1.00 0.00 ? 844  CYS A CA 1 
ATOM 3118   C C  . CYS A 1 844  ? 1122.232 751.960 851.162 1.00 0.00 ? 844  CYS A C  1 
ATOM 3119   O O  . CYS A 1 844  ? 1121.485 750.993 851.299 1.00 0.00 ? 844  CYS A O  1 
ATOM 3120   C CB . CYS A 1 844  ? 1124.421 752.009 850.022 1.00 0.00 ? 844  CYS A CB 1 
ATOM 3121   N N  . TYR A 1 845  ? 1121.799 753.177 850.814 1.00 0.00 ? 845  TYR A N  1 
ATOM 3122   C CA . TYR A 1 845  ? 1120.448 753.620 850.656 1.00 0.00 ? 845  TYR A CA 1 
ATOM 3123   C C  . TYR A 1 845  ? 1119.741 752.976 849.500 1.00 0.00 ? 845  TYR A C  1 
ATOM 3124   O O  . TYR A 1 845  ? 1118.513 753.004 849.454 1.00 0.00 ? 845  TYR A O  1 
ATOM 3125   C CB . TYR A 1 845  ? 1120.342 755.149 850.559 1.00 0.00 ? 845  TYR A CB 1 
ATOM 3126   N N  . ILE A 1 846  ? 1120.479 752.388 848.536 1.00 0.00 ? 846  ILE A N  1 
ATOM 3127   C CA . ILE A 1 846  ? 1119.913 752.000 847.270 1.00 0.00 ? 846  ILE A CA 1 
ATOM 3128   C C  . ILE A 1 846  ? 1118.656 751.191 847.404 1.00 0.00 ? 846  ILE A C  1 
ATOM 3129   O O  . ILE A 1 846  ? 1117.660 751.509 846.757 1.00 0.00 ? 846  ILE A O  1 
ATOM 3130   C CB . ILE A 1 846  ? 1120.824 751.134 846.443 1.00 0.00 ? 846  ILE A CB 1 
ATOM 3131   N N  . ARG A 1 847  ? 1118.632 750.144 848.243 1.00 0.00 ? 847  ARG A N  1 
ATOM 3132   C CA . ARG A 1 847  ? 1117.446 749.335 848.266 1.00 0.00 ? 847  ARG A CA 1 
ATOM 3133   C C  . ARG A 1 847  ? 1116.341 750.118 848.894 1.00 0.00 ? 847  ARG A C  1 
ATOM 3134   O O  . ARG A 1 847  ? 1116.533 750.777 849.912 1.00 0.00 ? 847  ARG A O  1 
ATOM 3135   C CB . ARG A 1 847  ? 1117.665 748.076 849.076 1.00 0.00 ? 847  ARG A CB 1 
ATOM 3136   N N  . ASP A 1 848  ? 1115.134 750.051 848.301 1.00 0.00 ? 848  ASP A N  1 
ATOM 3137   C CA . ASP A 1 848  ? 1114.072 750.857 848.821 1.00 0.00 ? 848  ASP A CA 1 
ATOM 3138   C C  . ASP A 1 848  ? 1112.991 750.002 849.402 1.00 0.00 ? 848  ASP A C  1 
ATOM 3139   O O  . ASP A 1 848  ? 1112.459 749.109 848.743 1.00 0.00 ? 848  ASP A O  1 
ATOM 3140   C CB . ASP A 1 848  ? 1113.400 751.741 847.753 1.00 0.00 ? 848  ASP A CB 1 
ATOM 3141   N N  . ASN A 1 849  ? 1112.674 750.251 850.685 1.00 0.00 ? 849  ASN A N  1 
ATOM 3142   C CA . ASN A 1 849  ? 1111.524 749.669 851.310 1.00 0.00 ? 849  ASN A CA 1 
ATOM 3143   C C  . ASN A 1 849  ? 1111.591 748.178 851.333 1.00 0.00 ? 849  ASN A C  1 
ATOM 3144   O O  . ASN A 1 849  ? 1112.503 747.573 851.892 1.00 0.00 ? 849  ASN A O  1 
ATOM 3145   C CB . ASN A 1 849  ? 1110.202 750.092 850.643 1.00 0.00 ? 849  ASN A CB 1 
ATOM 3146   N N  . ALA A 1 850  ? 1110.576 747.572 850.695 1.00 0.00 ? 850  ALA A N  1 
ATOM 3147   C CA . ALA A 1 850  ? 1110.314 746.166 850.687 1.00 0.00 ? 850  ALA A CA 1 
ATOM 3148   C C  . ALA A 1 850  ? 1111.485 745.430 850.145 1.00 0.00 ? 850  ALA A C  1 
ATOM 3149   O O  . ALA A 1 850  ? 1111.738 744.307 850.581 1.00 0.00 ? 850  ALA A O  1 
ATOM 3150   C CB . ALA A 1 850  ? 1109.098 745.792 849.823 1.00 0.00 ? 850  ALA A CB 1 
ATOM 3151   N N  . ALA A 1 851  ? 1112.206 746.020 849.167 1.00 0.00 ? 851  ALA A N  1 
ATOM 3152   C CA . ALA A 1 851  ? 1113.300 745.286 848.608 1.00 0.00 ? 851  ALA A CA 1 
ATOM 3153   C C  . ALA A 1 851  ? 1114.234 744.964 849.723 1.00 0.00 ? 851  ALA A C  1 
ATOM 3154   O O  . ALA A 1 851  ? 1114.400 743.790 850.030 1.00 0.00 ? 851  ALA A O  1 
ATOM 3155   C CB . ALA A 1 851  ? 1114.083 746.084 847.552 1.00 0.00 ? 851  ALA A CB 1 
ATOM 3156   N N  . VAL A 1 852  ? 1114.657 745.985 850.495 1.00 0.00 ? 852  VAL A N  1 
ATOM 3157   C CA . VAL A 1 852  ? 1115.692 745.849 851.485 1.00 0.00 ? 852  VAL A CA 1 
ATOM 3158   C C  . VAL A 1 852  ? 1115.347 744.736 852.422 1.00 0.00 ? 852  VAL A C  1 
ATOM 3159   O O  . VAL A 1 852  ? 1116.205 743.930 852.779 1.00 0.00 ? 852  VAL A O  1 
ATOM 3160   C CB . VAL A 1 852  ? 1115.803 747.068 852.352 1.00 0.00 ? 852  VAL A CB 1 
ATOM 3161   N N  . ASP A 1 853  ? 1114.072 744.656 852.838 1.00 0.00 ? 853  ASP A N  1 
ATOM 3162   C CA . ASP A 1 853  ? 1113.679 743.663 853.792 1.00 0.00 ? 853  ASP A CA 1 
ATOM 3163   C C  . ASP A 1 853  ? 1113.992 742.316 853.222 1.00 0.00 ? 853  ASP A C  1 
ATOM 3164   O O  . ASP A 1 853  ? 1114.492 741.434 853.917 1.00 0.00 ? 853  ASP A O  1 
ATOM 3165   C CB . ASP A 1 853  ? 1112.168 743.691 854.072 1.00 0.00 ? 853  ASP A CB 1 
ATOM 3166   N N  . GLY A 1 854  ? 1113.720 742.141 851.919 1.00 0.00 ? 854  GLY A N  1 
ATOM 3167   C CA . GLY A 1 854  ? 1113.917 740.902 851.228 1.00 0.00 ? 854  GLY A CA 1 
ATOM 3168   C C  . GLY A 1 854  ? 1115.361 740.485 851.261 1.00 0.00 ? 854  GLY A C  1 
ATOM 3169   O O  . GLY A 1 854  ? 1115.640 739.311 851.493 1.00 0.00 ? 854  GLY A O  1 
ATOM 3170   N N  . ILE A 1 855  ? 1116.330 741.397 851.018 1.00 0.00 ? 855  ILE A N  1 
ATOM 3171   C CA . ILE A 1 855  ? 1117.684 740.897 851.058 1.00 0.00 ? 855  ILE A CA 1 
ATOM 3172   C C  . ILE A 1 855  ? 1118.034 740.440 852.428 1.00 0.00 ? 855  ILE A C  1 
ATOM 3173   O O  . ILE A 1 855  ? 1118.656 739.390 852.584 1.00 0.00 ? 855  ILE A O  1 
ATOM 3174   C CB . ILE A 1 855  ? 1118.808 741.805 850.636 1.00 0.00 ? 855  ILE A CB 1 
ATOM 3175   N N  . SER A 1 856  ? 1117.641 741.204 853.463 1.00 0.00 ? 856  SER A N  1 
ATOM 3176   C CA . SER A 1 856  ? 1118.024 740.839 854.795 1.00 0.00 ? 856  SER A CA 1 
ATOM 3177   C C  . SER A 1 856  ? 1117.488 739.469 855.059 1.00 0.00 ? 856  SER A C  1 
ATOM 3178   O O  . SER A 1 856  ? 1118.125 738.664 855.734 1.00 0.00 ? 856  SER A O  1 
ATOM 3179   C CB . SER A 1 856  ? 1117.447 741.787 855.860 1.00 0.00 ? 856  SER A CB 1 
ATOM 3180   N N  . LEU A 1 857  ? 1116.297 739.175 854.513 1.00 0.00 ? 857  LEU A N  1 
ATOM 3181   C CA . LEU A 1 857  ? 1115.708 737.884 854.684 1.00 0.00 ? 857  LEU A CA 1 
ATOM 3182   C C  . LEU A 1 857  ? 1116.609 736.896 854.000 1.00 0.00 ? 857  LEU A C  1 
ATOM 3183   O O  . LEU A 1 857  ? 1116.905 735.830 854.538 1.00 0.00 ? 857  LEU A O  1 
ATOM 3184   C CB . LEU A 1 857  ? 1114.317 737.807 854.020 1.00 0.00 ? 857  LEU A CB 1 
ATOM 3185   N N  . HIS A 1 858  ? 1117.082 737.250 852.789 1.00 0.00 ? 858  HIS A N  1 
ATOM 3186   C CA . HIS A 1 858  ? 1117.894 736.386 851.974 1.00 0.00 ? 858  HIS A CA 1 
ATOM 3187   C C  . HIS A 1 858  ? 1119.190 736.092 852.659 1.00 0.00 ? 858  HIS A C  1 
ATOM 3188   O O  . HIS A 1 858  ? 1119.619 734.939 852.715 1.00 0.00 ? 858  HIS A O  1 
ATOM 3189   C CB . HIS A 1 858  ? 1118.233 737.017 850.613 1.00 0.00 ? 858  HIS A CB 1 
ATOM 3190   N N  . LEU A 1 859  ? 1119.850 737.124 853.215 1.00 0.00 ? 859  LEU A N  1 
ATOM 3191   C CA . LEU A 1 859  ? 1121.123 736.897 853.831 1.00 0.00 ? 859  LEU A CA 1 
ATOM 3192   C C  . LEU A 1 859  ? 1120.901 735.941 854.952 1.00 0.00 ? 859  LEU A C  1 
ATOM 3193   O O  . LEU A 1 859  ? 1121.682 735.014 855.156 1.00 0.00 ? 859  LEU A O  1 
ATOM 3194   C CB . LEU A 1 859  ? 1121.753 738.171 854.418 1.00 0.00 ? 859  LEU A CB 1 
ATOM 3195   N N  . GLN A 1 860  ? 1119.809 736.140 855.706 1.00 0.00 ? 860  GLN A N  1 
ATOM 3196   C CA . GLN A 1 860  ? 1119.542 735.267 856.807 1.00 0.00 ? 860  GLN A CA 1 
ATOM 3197   C C  . GLN A 1 860  ? 1119.329 733.878 856.297 1.00 0.00 ? 860  GLN A C  1 
ATOM 3198   O O  . GLN A 1 860  ? 1119.956 732.937 856.780 1.00 0.00 ? 860  GLN A O  1 
ATOM 3199   C CB . GLN A 1 860  ? 1118.258 735.665 857.557 1.00 0.00 ? 860  GLN A CB 1 
ATOM 3200   N N  . ASP A 1 861  ? 1118.452 733.712 855.290 1.00 0.00 ? 861  ASP A N  1 
ATOM 3201   C CA . ASP A 1 861  ? 1118.140 732.379 854.865 1.00 0.00 ? 861  ASP A CA 1 
ATOM 3202   C C  . ASP A 1 861  ? 1119.310 731.693 854.240 1.00 0.00 ? 861  ASP A C  1 
ATOM 3203   O O  . ASP A 1 861  ? 1119.748 730.652 854.725 1.00 0.00 ? 861  ASP A O  1 
ATOM 3204   C CB . ASP A 1 861  ? 1116.992 732.324 853.845 1.00 0.00 ? 861  ASP A CB 1 
ATOM 3205   N N  . ILE A 1 862  ? 1119.872 732.262 853.154 1.00 0.00 ? 862  ILE A N  1 
ATOM 3206   C CA . ILE A 1 862  ? 1120.924 731.529 852.518 1.00 0.00 ? 862  ILE A CA 1 
ATOM 3207   C C  . ILE A 1 862  ? 1122.172 732.353 852.482 1.00 0.00 ? 862  ILE A C  1 
ATOM 3208   O O  . ILE A 1 862  ? 1122.703 732.663 851.416 1.00 0.00 ? 862  ILE A O  1 
ATOM 3209   C CB . ILE A 1 862  ? 1120.522 731.121 851.120 1.00 0.00 ? 862  ILE A CB 1 
ATOM 3210   N N  . CYS A 1 863  ? 1122.732 732.681 853.658 1.00 0.00 ? 863  CYS A N  1 
ATOM 3211   C CA . CYS A 1 863  ? 1123.935 733.451 853.606 1.00 0.00 ? 863  CYS A CA 1 
ATOM 3212   C C  . CYS A 1 863  ? 1124.587 733.358 854.977 1.00 0.00 ? 863  CYS A C  1 
ATOM 3213   O O  . CYS A 1 863  ? 1123.997 733.896 855.952 1.00 0.00 ? 863  CYS A O  1 
ATOM 3214   C CB . CYS A 1 863  ? 1123.703 734.942 853.301 1.00 0.00 ? 863  CYS A CB 1 
ATOM 3215   N N  . GLN B 1 20   ? 1130.249 700.831 584.081 1.00 0.00 ? 20   GLN B N  1 
ATOM 3216   C CA . GLN B 1 20   ? 1129.475 701.251 582.893 1.00 0.00 ? 20   GLN B CA 1 
ATOM 3217   C C  . GLN B 1 20   ? 1128.583 700.136 582.464 1.00 0.00 ? 20   GLN B C  1 
ATOM 3218   O O  . GLN B 1 20   ? 1127.401 700.344 582.192 1.00 0.00 ? 20   GLN B O  1 
ATOM 3219   C CB . GLN B 1 20   ? 1130.431 701.616 581.744 1.00 0.00 ? 20   GLN B CB 1 
ATOM 3220   N N  . GLU B 1 21   ? 1129.126 698.906 582.413 1.00 0.00 ? 21   GLU B N  1 
ATOM 3221   C CA . GLU B 1 21   ? 1128.302 697.803 582.024 1.00 0.00 ? 21   GLU B CA 1 
ATOM 3222   C C  . GLU B 1 21   ? 1127.253 697.678 583.079 1.00 0.00 ? 21   GLU B C  1 
ATOM 3223   O O  . GLU B 1 21   ? 1127.530 697.821 584.269 1.00 0.00 ? 21   GLU B O  1 
ATOM 3224   C CB . GLU B 1 21   ? 1129.052 696.461 581.944 1.00 0.00 ? 21   GLU B CB 1 
ATOM 3225   N N  . ALA B 1 22   ? 1126.003 697.429 582.652 1.00 0.00 ? 22   ALA B N  1 
ATOM 3226   C CA . ALA B 1 22   ? 1124.900 697.342 583.559 1.00 0.00 ? 22   ALA B CA 1 
ATOM 3227   C C  . ALA B 1 22   ? 1125.067 696.173 584.475 1.00 0.00 ? 22   ALA B C  1 
ATOM 3228   O O  . ALA B 1 22   ? 1124.803 696.275 585.673 1.00 0.00 ? 22   ALA B O  1 
ATOM 3229   C CB . ALA B 1 22   ? 1123.548 697.181 582.843 1.00 0.00 ? 22   ALA B CB 1 
ATOM 3230   N N  . LEU B 1 23   ? 1125.530 695.029 583.939 1.00 0.00 ? 23   LEU B N  1 
ATOM 3231   C CA . LEU B 1 23   ? 1125.604 693.826 584.717 1.00 0.00 ? 23   LEU B CA 1 
ATOM 3232   C C  . LEU B 1 23   ? 1126.540 694.011 585.870 1.00 0.00 ? 23   LEU B C  1 
ATOM 3233   O O  . LEU B 1 23   ? 1126.200 693.679 587.006 1.00 0.00 ? 23   LEU B O  1 
ATOM 3234   C CB . LEU B 1 23   ? 1126.102 692.629 583.889 1.00 0.00 ? 23   LEU B CB 1 
ATOM 3235   N N  . GLU B 1 24   ? 1127.740 694.565 585.621 1.00 0.00 ? 24   GLU B N  1 
ATOM 3236   C CA . GLU B 1 24   ? 1128.667 694.755 586.699 1.00 0.00 ? 24   GLU B CA 1 
ATOM 3237   C C  . GLU B 1 24   ? 1128.077 695.754 587.633 1.00 0.00 ? 24   GLU B C  1 
ATOM 3238   O O  . GLU B 1 24   ? 1128.204 695.639 588.850 1.00 0.00 ? 24   GLU B O  1 
ATOM 3239   C CB . GLU B 1 24   ? 1130.030 695.306 586.246 1.00 0.00 ? 24   GLU B CB 1 
ATOM 3240   N N  . ASN B 1 25   ? 1127.396 696.760 587.061 1.00 0.00 ? 25   ASN B N  1 
ATOM 3241   C CA . ASN B 1 25   ? 1126.841 697.831 587.832 1.00 0.00 ? 25   ASN B CA 1 
ATOM 3242   C C  . ASN B 1 25   ? 1125.864 697.270 588.816 1.00 0.00 ? 25   ASN B C  1 
ATOM 3243   O O  . ASN B 1 25   ? 1125.947 697.554 590.009 1.00 0.00 ? 25   ASN B O  1 
ATOM 3244   C CB . ASN B 1 25   ? 1126.081 698.823 586.932 1.00 0.00 ? 25   ASN B CB 1 
ATOM 3245   N N  . ALA B 1 26   ? 1124.940 696.413 588.348 1.00 0.00 ? 26   ALA B N  1 
ATOM 3246   C CA . ALA B 1 26   ? 1123.913 695.890 589.203 1.00 0.00 ? 26   ALA B CA 1 
ATOM 3247   C C  . ALA B 1 26   ? 1124.540 695.096 590.298 1.00 0.00 ? 26   ALA B C  1 
ATOM 3248   O O  . ALA B 1 26   ? 1124.116 695.175 591.451 1.00 0.00 ? 26   ALA B O  1 
ATOM 3249   C CB . ALA B 1 26   ? 1122.938 694.960 588.458 1.00 0.00 ? 26   ALA B CB 1 
ATOM 3250   N N  . GLY B 1 27   ? 1125.579 694.312 589.969 1.00 0.00 ? 27   GLY B N  1 
ATOM 3251   C CA . GLY B 1 27   ? 1126.192 693.486 590.964 1.00 0.00 ? 27   GLY B CA 1 
ATOM 3252   C C  . GLY B 1 27   ? 1126.747 694.360 592.039 1.00 0.00 ? 27   GLY B C  1 
ATOM 3253   O O  . GLY B 1 27   ? 1126.643 694.044 593.222 1.00 0.00 ? 27   GLY B O  1 
ATOM 3254   N N  . ARG B 1 28   ? 1127.362 695.490 591.649 1.00 0.00 ? 28   ARG B N  1 
ATOM 3255   C CA . ARG B 1 28   ? 1127.962 696.358 592.617 1.00 0.00 ? 28   ARG B CA 1 
ATOM 3256   C C  . ARG B 1 28   ? 1126.905 696.897 593.525 1.00 0.00 ? 28   ARG B C  1 
ATOM 3257   O O  . ARG B 1 28   ? 1127.108 696.974 594.736 1.00 0.00 ? 28   ARG B O  1 
ATOM 3258   C CB . ARG B 1 28   ? 1128.722 697.535 591.980 1.00 0.00 ? 28   ARG B CB 1 
ATOM 3259   N N  . LEU B 1 29   ? 1125.735 697.275 592.976 1.00 0.00 ? 29   LEU B N  1 
ATOM 3260   C CA . LEU B 1 29   ? 1124.715 697.823 593.822 1.00 0.00 ? 29   LEU B CA 1 
ATOM 3261   C C  . LEU B 1 29   ? 1124.283 696.808 594.830 1.00 0.00 ? 29   LEU B C  1 
ATOM 3262   O O  . LEU B 1 29   ? 1124.162 697.125 596.013 1.00 0.00 ? 29   LEU B O  1 
ATOM 3263   C CB . LEU B 1 29   ? 1123.444 698.280 593.080 1.00 0.00 ? 29   LEU B CB 1 
ATOM 3264   N N  . ILE B 1 30   ? 1124.055 695.549 594.412 1.00 0.00 ? 30   ILE B N  1 
ATOM 3265   C CA . ILE B 1 30   ? 1123.553 694.626 595.386 1.00 0.00 ? 30   ILE B CA 1 
ATOM 3266   C C  . ILE B 1 30   ? 1124.572 694.407 596.454 1.00 0.00 ? 30   ILE B C  1 
ATOM 3267   O O  . ILE B 1 30   ? 1124.227 694.329 597.631 1.00 0.00 ? 30   ILE B O  1 
ATOM 3268   C CB . ILE B 1 30   ? 1123.185 693.260 594.894 1.00 0.00 ? 30   ILE B CB 1 
ATOM 3269   N N  . ASP B 1 31   ? 1125.856 694.289 596.072 1.00 0.00 ? 31   ASP B N  1 
ATOM 3270   C CA . ASP B 1 31   ? 1126.880 693.992 597.032 1.00 0.00 ? 31   ASP B CA 1 
ATOM 3271   C C  . ASP B 1 31   ? 1126.945 695.086 598.046 1.00 0.00 ? 31   ASP B C  1 
ATOM 3272   O O  . ASP B 1 31   ? 1127.078 694.824 599.240 1.00 0.00 ? 31   ASP B O  1 
ATOM 3273   C CB . ASP B 1 31   ? 1128.273 693.861 596.395 1.00 0.00 ? 31   ASP B CB 1 
ATOM 3274   N N  . ARG B 1 32   ? 1126.840 696.351 597.600 1.00 0.00 ? 32   ARG B N  1 
ATOM 3275   C CA . ARG B 1 32   ? 1126.938 697.454 598.510 1.00 0.00 ? 32   ARG B CA 1 
ATOM 3276   C C  . ARG B 1 32   ? 1125.824 697.364 599.503 1.00 0.00 ? 32   ARG B C  1 
ATOM 3277   O O  . ARG B 1 32   ? 1126.036 697.536 600.703 1.00 0.00 ? 32   ARG B O  1 
ATOM 3278   C CB . ARG B 1 32   ? 1126.806 698.808 597.796 1.00 0.00 ? 32   ARG B CB 1 
ATOM 3279   N N  . GLN B 1 33   ? 1124.602 697.070 599.021 1.00 0.00 ? 33   GLN B N  1 
ATOM 3280   C CA . GLN B 1 33   ? 1123.450 697.002 599.874 1.00 0.00 ? 33   GLN B CA 1 
ATOM 3281   C C  . GLN B 1 33   ? 1123.612 695.875 600.843 1.00 0.00 ? 33   GLN B C  1 
ATOM 3282   O O  . GLN B 1 33   ? 1123.242 695.996 602.010 1.00 0.00 ? 33   GLN B O  1 
ATOM 3283   C CB . GLN B 1 33   ? 1122.146 696.765 599.093 1.00 0.00 ? 33   GLN B CB 1 
ATOM 3284   N N  . LEU B 1 34   ? 1124.177 694.744 600.385 1.00 0.00 ? 34   LEU B N  1 
ATOM 3285   C CA . LEU B 1 34   ? 1124.320 693.593 601.228 1.00 0.00 ? 34   LEU B CA 1 
ATOM 3286   C C  . LEU B 1 34   ? 1125.209 694.001 602.357 1.00 0.00 ? 34   LEU B C  1 
ATOM 3287   O O  . LEU B 1 34   ? 1124.956 693.672 603.515 1.00 0.00 ? 34   LEU B O  1 
ATOM 3288   C CB . LEU B 1 34   ? 1124.989 692.415 600.489 1.00 0.00 ? 34   LEU B CB 1 
ATOM 3289   N N  . GLN B 1 35   ? 1126.271 694.764 602.042 1.00 0.00 ? 35   GLN B N  1 
ATOM 3290   C CA . GLN B 1 35   ? 1127.203 695.173 603.048 1.00 0.00 ? 35   GLN B CA 1 
ATOM 3291   C C  . GLN B 1 35   ? 1126.470 695.992 604.059 1.00 0.00 ? 35   GLN B C  1 
ATOM 3292   O O  . GLN B 1 35   ? 1126.672 695.831 605.262 1.00 0.00 ? 35   GLN B O  1 
ATOM 3293   C CB . GLN B 1 35   ? 1128.328 696.058 602.486 1.00 0.00 ? 35   GLN B CB 1 
ATOM 3294   N N  . GLU B 1 36   ? 1125.581 696.886 603.594 1.00 0.00 ? 36   GLU B N  1 
ATOM 3295   C CA . GLU B 1 36   ? 1124.877 697.748 604.498 1.00 0.00 ? 36   GLU B CA 1 
ATOM 3296   C C  . GLU B 1 36   ? 1124.011 696.927 605.399 1.00 0.00 ? 36   GLU B C  1 
ATOM 3297   O O  . GLU B 1 36   ? 1123.906 697.215 606.589 1.00 0.00 ? 36   GLU B O  1 
ATOM 3298   C CB . GLU B 1 36   ? 1123.987 698.784 603.789 1.00 0.00 ? 36   GLU B CB 1 
ATOM 3299   N N  . ASP B 1 37   ? 1123.377 695.871 604.861 1.00 0.00 ? 37   ASP B N  1 
ATOM 3300   C CA . ASP B 1 37   ? 1122.493 695.079 605.668 1.00 0.00 ? 37   ASP B CA 1 
ATOM 3301   C C  . ASP B 1 37   ? 1123.276 694.473 606.793 1.00 0.00 ? 37   ASP B C  1 
ATOM 3302   O O  . ASP B 1 37   ? 1122.822 694.487 607.933 1.00 0.00 ? 37   ASP B O  1 
ATOM 3303   C CB . ASP B 1 37   ? 1121.799 693.966 604.868 1.00 0.00 ? 37   ASP B CB 1 
ATOM 3304   N N  . ARG B 1 38   ? 1124.491 693.962 606.505 1.00 0.00 ? 38   ARG B N  1 
ATOM 3305   C CA . ARG B 1 38   ? 1125.334 693.283 607.460 1.00 0.00 ? 38   ARG B CA 1 
ATOM 3306   C C  . ARG B 1 38   ? 1125.824 694.218 608.541 1.00 0.00 ? 38   ARG B C  1 
ATOM 3307   O O  . ARG B 1 38   ? 1126.075 693.801 609.668 1.00 0.00 ? 38   ARG B O  1 
ATOM 3308   C CB . ARG B 1 38   ? 1126.592 692.663 606.823 1.00 0.00 ? 38   ARG B CB 1 
ATOM 3309   N N  . MET B 1 39   ? 1126.061 695.496 608.208 1.00 0.00 ? 39   MET B N  1 
ATOM 3310   C CA . MET B 1 39   ? 1126.618 696.442 609.139 1.00 0.00 ? 39   MET B CA 1 
ATOM 3311   C C  . MET B 1 39   ? 1125.701 696.917 610.231 1.00 0.00 ? 39   MET B C  1 
ATOM 3312   O O  . MET B 1 39   ? 1126.201 697.414 611.240 1.00 0.00 ? 39   MET B O  1 
ATOM 3313   C CB . MET B 1 39   ? 1127.351 697.615 608.470 1.00 0.00 ? 39   MET B CB 1 
ATOM 3314   N N  . TYR B 1 40   ? 1124.367 696.856 610.018 1.00 0.00 ? 40   TYR B N  1 
ATOM 3315   C CA . TYR B 1 40   ? 1123.288 697.224 610.914 1.00 0.00 ? 40   TYR B CA 1 
ATOM 3316   C C  . TYR B 1 40   ? 1123.729 697.159 612.346 1.00 0.00 ? 40   TYR B C  1 
ATOM 3317   O O  . TYR B 1 40   ? 1124.507 696.296 612.755 1.00 0.00 ? 40   TYR B O  1 
ATOM 3318   C CB . TYR B 1 40   ? 1122.104 696.281 610.707 1.00 0.00 ? 40   TYR B CB 1 
ATOM 3319   N N  . PRO B 1 41   ? 1123.222 698.091 613.108 1.00 0.00 ? 41   PRO B N  1 
ATOM 3320   C CA . PRO B 1 41   ? 1123.639 698.277 614.475 1.00 0.00 ? 41   PRO B CA 1 
ATOM 3321   C C  . PRO B 1 41   ? 1123.370 697.125 615.387 1.00 0.00 ? 41   PRO B C  1 
ATOM 3322   O O  . PRO B 1 41   ? 1122.471 696.330 615.119 1.00 0.00 ? 41   PRO B O  1 
ATOM 3323   C CB . PRO B 1 41   ? 1122.994 699.586 614.924 1.00 0.00 ? 41   PRO B CB 1 
ATOM 3324   N N  . ASP B 1 42   ? 1124.177 697.024 616.465 1.00 0.00 ? 42   ASP B N  1 
ATOM 3325   C CA . ASP B 1 42   ? 1124.079 695.976 617.438 1.00 0.00 ? 42   ASP B CA 1 
ATOM 3326   C C  . ASP B 1 42   ? 1122.766 696.148 618.137 1.00 0.00 ? 42   ASP B C  1 
ATOM 3327   O O  . ASP B 1 42   ? 1122.306 697.268 618.349 1.00 0.00 ? 42   ASP B O  1 
ATOM 3328   C CB . ASP B 1 42   ? 1125.202 696.044 618.490 1.00 0.00 ? 42   ASP B CB 1 
ATOM 3329   N N  . LEU B 1 43   ? 1122.133 695.019 618.514 1.00 0.00 ? 43   LEU B N  1 
ATOM 3330   C CA . LEU B 1 43   ? 1120.822 695.023 619.097 1.00 0.00 ? 43   LEU B CA 1 
ATOM 3331   C C  . LEU B 1 43   ? 1120.806 695.720 620.417 1.00 0.00 ? 43   LEU B C  1 
ATOM 3332   O O  . LEU B 1 43   ? 1119.931 696.549 620.663 1.00 0.00 ? 43   LEU B O  1 
ATOM 3333   C CB . LEU B 1 43   ? 1120.270 693.606 619.318 1.00 0.00 ? 43   LEU B CB 1 
ATOM 3334   N N  . SER B 1 44   ? 1121.777 695.436 621.305 1.00 0.00 ? 44   SER B N  1 
ATOM 3335   C CA . SER B 1 44   ? 1121.644 696.035 622.600 1.00 0.00 ? 44   SER B CA 1 
ATOM 3336   C C  . SER B 1 44   ? 1122.797 696.936 622.864 1.00 0.00 ? 44   SER B C  1 
ATOM 3337   O O  . SER B 1 44   ? 1123.952 696.607 622.591 1.00 0.00 ? 44   SER B O  1 
ATOM 3338   C CB . SER B 1 44   ? 1121.602 695.008 623.743 1.00 0.00 ? 44   SER B CB 1 
ATOM 3339   N N  . GLU B 1 45   ? 1122.477 698.131 623.394 1.00 0.00 ? 45   GLU B N  1 
ATOM 3340   C CA . GLU B 1 45   ? 1123.469 699.075 623.796 1.00 0.00 ? 45   GLU B CA 1 
ATOM 3341   C C  . GLU B 1 45   ? 1122.891 699.765 624.991 1.00 0.00 ? 45   GLU B C  1 
ATOM 3342   O O  . GLU B 1 45   ? 1121.702 700.078 625.026 1.00 0.00 ? 45   GLU B O  1 
ATOM 3343   C CB . GLU B 1 45   ? 1123.781 700.133 622.721 1.00 0.00 ? 45   GLU B CB 1 
ATOM 3344   N N  . LEU B 1 46   ? 1123.728 700.013 626.010 1.00 0.00 ? 46   LEU B N  1 
ATOM 3345   C CA . LEU B 1 46   ? 1123.294 700.636 627.224 1.00 0.00 ? 46   LEU B CA 1 
ATOM 3346   C C  . LEU B 1 46   ? 1122.834 702.024 626.922 1.00 0.00 ? 46   LEU B C  1 
ATOM 3347   O O  . LEU B 1 46   ? 1121.891 702.528 627.532 1.00 0.00 ? 46   LEU B O  1 
ATOM 3348   C CB . LEU B 1 46   ? 1124.376 700.686 628.326 1.00 0.00 ? 46   LEU B CB 1 
ATOM 3349   N N  . LEU B 1 47   ? 1123.489 702.671 625.947 1.00 0.00 ? 47   LEU B N  1 
ATOM 3350   C CA . LEU B 1 47   ? 1123.200 704.027 625.582 1.00 0.00 ? 47   LEU B CA 1 
ATOM 3351   C C  . LEU B 1 47   ? 1121.789 704.125 625.093 1.00 0.00 ? 47   LEU B C  1 
ATOM 3352   O O  . LEU B 1 47   ? 1121.145 705.161 625.254 1.00 0.00 ? 47   LEU B O  1 
ATOM 3353   C CB . LEU B 1 47   ? 1124.115 704.558 624.466 1.00 0.00 ? 47   LEU B CB 1 
ATOM 3354   N N  . MET B 1 48   ? 1121.265 703.047 624.479 1.00 0.00 ? 48   MET B N  1 
ATOM 3355   C CA . MET B 1 48   ? 1119.968 703.102 623.864 1.00 0.00 ? 48   MET B CA 1 
ATOM 3356   C C  . MET B 1 48   ? 1118.912 703.472 624.865 1.00 0.00 ? 48   MET B C  1 
ATOM 3357   O O  . MET B 1 48   ? 1118.071 704.312 624.568 1.00 0.00 ? 48   MET B O  1 
ATOM 3358   C CB . MET B 1 48   ? 1119.560 701.750 623.261 1.00 0.00 ? 48   MET B CB 1 
ATOM 3359   N N  . VAL B 1 49   ? 1118.907 702.860 626.074 1.00 0.00 ? 49   VAL B N  1 
ATOM 3360   C CA . VAL B 1 49   ? 1117.854 703.191 626.998 1.00 0.00 ? 49   VAL B CA 1 
ATOM 3361   C C  . VAL B 1 49   ? 1118.493 703.556 628.321 1.00 0.00 ? 49   VAL B C  1 
ATOM 3362   O O  . VAL B 1 49   ? 1118.032 703.167 629.391 1.00 0.00 ? 49   VAL B O  1 
ATOM 3363   C CB . VAL B 1 49   ? 1116.954 701.986 627.168 1.00 0.00 ? 49   VAL B CB 1 
ATOM 3364   N N  . SER B 1 50   ? 1119.542 704.398 628.300 1.00 0.00 ? 50   SER B N  1 
ATOM 3365   C CA . SER B 1 50   ? 1120.212 704.711 629.533 1.00 0.00 ? 50   SER B CA 1 
ATOM 3366   C C  . SER B 1 50   ? 1119.246 705.405 630.423 1.00 0.00 ? 50   SER B C  1 
ATOM 3367   O O  . SER B 1 50   ? 1118.852 704.883 631.465 1.00 0.00 ? 50   SER B O  1 
ATOM 3368   C CB . SER B 1 50   ? 1121.434 705.626 629.342 1.00 0.00 ? 50   SER B CB 1 
ATOM 3369   N N  . SER B 1 58   ? 1117.859 707.251 628.596 1.00 0.00 ? 58   SER B N  1 
ATOM 3370   C CA . SER B 1 58   ? 1117.227 707.463 629.860 1.00 0.00 ? 58   SER B CA 1 
ATOM 3371   C C  . SER B 1 58   ? 1115.839 706.942 629.726 1.00 0.00 ? 58   SER B C  1 
ATOM 3372   O O  . SER B 1 58   ? 1114.979 707.579 629.122 1.00 0.00 ? 58   SER B O  1 
ATOM 3373   C CB . SER B 1 58   ? 1117.136 708.945 630.255 1.00 0.00 ? 58   SER B CB 1 
ATOM 3374   N N  . GLY B 1 59   ? 1115.600 705.743 630.285 1.00 0.00 ? 59   GLY B N  1 
ATOM 3375   C CA . GLY B 1 59   ? 1114.281 705.193 630.276 1.00 0.00 ? 59   GLY B CA 1 
ATOM 3376   C C  . GLY B 1 59   ? 1114.057 704.472 628.997 1.00 0.00 ? 59   GLY B C  1 
ATOM 3377   O O  . GLY B 1 59   ? 1114.687 704.748 627.978 1.00 0.00 ? 59   GLY B O  1 
ATOM 3378   N N  . MET B 1 60   ? 1113.102 703.527 629.037 1.00 0.00 ? 60   MET B N  1 
ATOM 3379   C CA . MET B 1 60   ? 1112.764 702.738 627.895 1.00 0.00 ? 60   MET B CA 1 
ATOM 3380   C C  . MET B 1 60   ? 1111.460 703.281 627.409 1.00 0.00 ? 60   MET B C  1 
ATOM 3381   O O  . MET B 1 60   ? 1110.390 702.936 627.906 1.00 0.00 ? 60   MET B O  1 
ATOM 3382   C CB . MET B 1 60   ? 1112.535 701.269 628.269 1.00 0.00 ? 60   MET B CB 1 
ATOM 3383   N N  . ASP B 1 62   ? 1112.346 703.325 624.747 1.00 0.00 ? 62   ASP B N  1 
ATOM 3384   C CA . ASP B 1 62   ? 1111.095 703.851 624.295 1.00 0.00 ? 62   ASP B CA 1 
ATOM 3385   C C  . ASP B 1 62   ? 1110.159 702.689 624.195 1.00 0.00 ? 62   ASP B C  1 
ATOM 3386   O O  . ASP B 1 62   ? 1110.506 701.658 623.621 1.00 0.00 ? 62   ASP B O  1 
ATOM 3387   C CB . ASP B 1 62   ? 1111.225 704.502 622.909 1.00 0.00 ? 62   ASP B CB 1 
ATOM 3388   N N  . MET B 1 63   ? 1108.943 702.813 624.764 1.00 0.00 ? 63   MET B N  1 
ATOM 3389   C CA . MET B 1 63   ? 1108.050 701.689 624.731 1.00 0.00 ? 63   MET B CA 1 
ATOM 3390   C C  . MET B 1 63   ? 1106.803 702.031 623.986 1.00 0.00 ? 63   MET B C  1 
ATOM 3391   O O  . MET B 1 63   ? 1106.254 703.126 624.112 1.00 0.00 ? 63   MET B O  1 
ATOM 3392   C CB . MET B 1 63   ? 1107.622 701.216 626.128 1.00 0.00 ? 63   MET B CB 1 
ATOM 3393   N N  . ASP B 1 64   ? 1106.355 701.076 623.146 1.00 0.00 ? 64   ASP B N  1 
ATOM 3394   C CA . ASP B 1 64   ? 1105.099 701.141 622.456 1.00 0.00 ? 64   ASP B CA 1 
ATOM 3395   C C  . ASP B 1 64   ? 1104.324 700.066 623.142 1.00 0.00 ? 64   ASP B C  1 
ATOM 3396   O O  . ASP B 1 64   ? 1104.280 698.929 622.673 1.00 0.00 ? 64   ASP B O  1 
ATOM 3397   C CB . ASP B 1 64   ? 1105.217 700.755 620.971 1.00 0.00 ? 64   ASP B CB 1 
ATOM 3398   N N  . TYR B 1 65   ? 1103.699 700.402 624.289 1.00 0.00 ? 65   TYR B N  1 
ATOM 3399   C CA . TYR B 1 65   ? 1103.127 699.379 625.112 1.00 0.00 ? 65   TYR B CA 1 
ATOM 3400   C C  . TYR B 1 65   ? 1101.662 699.537 625.340 1.00 0.00 ? 65   TYR B C  1 
ATOM 3401   O O  . TYR B 1 65   ? 1101.211 700.457 626.018 1.00 0.00 ? 65   TYR B O  1 
ATOM 3402   C CB . TYR B 1 65   ? 1103.808 699.380 626.488 1.00 0.00 ? 65   TYR B CB 1 
ATOM 3403   N N  . PRO B 1 66   ? 1100.906 698.677 624.717 1.00 0.00 ? 66   PRO B N  1 
ATOM 3404   C CA . PRO B 1 66   ? 1099.507 698.641 625.060 1.00 0.00 ? 66   PRO B CA 1 
ATOM 3405   C C  . PRO B 1 66   ? 1099.140 697.488 625.953 1.00 0.00 ? 66   PRO B C  1 
ATOM 3406   O O  . PRO B 1 66   ? 1099.637 696.382 625.731 1.00 0.00 ? 66   PRO B O  1 
ATOM 3407   C CB . PRO B 1 66   ? 1098.728 698.667 623.757 1.00 0.00 ? 66   PRO B CB 1 
ATOM 3408   N N  . LEU B 1 67   ? 1098.246 697.710 626.941 1.00 0.00 ? 67   LEU B N  1 
ATOM 3409   C CA . LEU B 1 67   ? 1097.701 696.634 627.730 1.00 0.00 ? 67   LEU B CA 1 
ATOM 3410   C C  . LEU B 1 67   ? 1096.805 695.816 626.872 1.00 0.00 ? 67   LEU B C  1 
ATOM 3411   O O  . LEU B 1 67   ? 1096.730 694.596 627.012 1.00 0.00 ? 67   LEU B O  1 
ATOM 3412   C CB . LEU B 1 67   ? 1096.850 697.082 628.934 1.00 0.00 ? 67   LEU B CB 1 
ATOM 3413   N N  . GLN B 1 68   ? 1096.067 696.481 625.972 1.00 0.00 ? 68   GLN B N  1 
ATOM 3414   C CA . GLN B 1 68   ? 1095.149 695.781 625.131 1.00 0.00 ? 68   GLN B CA 1 
ATOM 3415   C C  . GLN B 1 68   ? 1095.935 695.222 623.997 1.00 0.00 ? 68   GLN B C  1 
ATOM 3416   O O  . GLN B 1 68   ? 1097.087 694.823 624.131 1.00 0.00 ? 68   GLN B O  1 
ATOM 3417   C CB . GLN B 1 68   ? 1094.078 696.711 624.543 1.00 0.00 ? 68   GLN B CB 1 
ATOM 3418   N N  . LEU B 1 72   ? 1094.424 692.878 623.724 1.00 0.00 ? 72   LEU B N  1 
ATOM 3419   C CA . LEU B 1 72   ? 1095.104 692.175 622.683 1.00 0.00 ? 72   LEU B CA 1 
ATOM 3420   C C  . LEU B 1 72   ? 1094.866 692.930 621.412 1.00 0.00 ? 72   LEU B C  1 
ATOM 3421   O O  . LEU B 1 72   ? 1093.798 693.505 621.210 1.00 0.00 ? 72   LEU B O  1 
ATOM 3422   C CB . LEU B 1 72   ? 1094.563 690.732 622.551 1.00 0.00 ? 72   LEU B CB 1 
ATOM 3423   N N  . LEU B 1 73   ? 1095.886 692.956 620.530 1.00 0.00 ? 73   LEU B N  1 
ATOM 3424   C CA . LEU B 1 73   ? 1095.775 693.567 619.236 1.00 0.00 ? 73   LEU B CA 1 
ATOM 3425   C C  . LEU B 1 73   ? 1095.691 695.052 619.457 1.00 0.00 ? 73   LEU B C  1 
ATOM 3426   O O  . LEU B 1 73   ? 1095.250 695.810 618.596 1.00 0.00 ? 73   LEU B O  1 
ATOM 3427   C CB . LEU B 1 73   ? 1094.489 693.085 618.513 1.00 0.00 ? 73   LEU B CB 1 
ATOM 3428   N N  . SER B 1 74   ? 1096.135 695.539 620.632 1.00 0.00 ? 74   SER B N  1 
ATOM 3429   C CA . SER B 1 74   ? 1096.042 696.957 620.807 1.00 0.00 ? 74   SER B CA 1 
ATOM 3430   C C  . SER B 1 74   ? 1096.938 697.608 619.814 1.00 0.00 ? 74   SER B C  1 
ATOM 3431   O O  . SER B 1 74   ? 1096.590 698.648 619.256 1.00 0.00 ? 74   SER B O  1 
ATOM 3432   C CB . SER B 1 74   ? 1096.448 697.468 622.188 1.00 0.00 ? 74   SER B CB 1 
ATOM 3433   N N  . VAL B 1 75   ? 1098.120 697.018 619.550 1.00 0.00 ? 75   VAL B N  1 
ATOM 3434   C CA . VAL B 1 75   ? 1098.941 697.667 618.574 1.00 0.00 ? 75   VAL B CA 1 
ATOM 3435   C C  . VAL B 1 75   ? 1098.468 697.089 617.275 1.00 0.00 ? 75   VAL B C  1 
ATOM 3436   O O  . VAL B 1 75   ? 1098.929 696.034 616.858 1.00 0.00 ? 75   VAL B O  1 
ATOM 3437   C CB . VAL B 1 75   ? 1100.388 697.308 618.641 1.00 0.00 ? 75   VAL B CB 1 
ATOM 3438   N N  . PRO B 1 76   ? 1097.552 697.730 616.616 1.00 0.00 ? 76   PRO B N  1 
ATOM 3439   C CA . PRO B 1 76   ? 1096.961 697.170 615.427 1.00 0.00 ? 76   PRO B CA 1 
ATOM 3440   C C  . PRO B 1 76   ? 1097.893 696.668 614.361 1.00 0.00 ? 76   PRO B C  1 
ATOM 3441   O O  . PRO B 1 76   ? 1097.938 695.463 614.124 1.00 0.00 ? 76   PRO B O  1 
ATOM 3442   C CB . PRO B 1 76   ? 1096.079 698.283 614.869 1.00 0.00 ? 76   PRO B CB 1 
ATOM 3443   N N  . ASN B 1 77   ? 1098.627 697.584 613.704 1.00 0.00 ? 77   ASN B N  1 
ATOM 3444   C CA . ASN B 1 77   ? 1099.490 697.277 612.593 1.00 0.00 ? 77   ASN B CA 1 
ATOM 3445   C C  . ASN B 1 77   ? 1100.726 696.581 613.043 1.00 0.00 ? 77   ASN B C  1 
ATOM 3446   O O  . ASN B 1 77   ? 1101.166 695.598 612.450 1.00 0.00 ? 77   ASN B O  1 
ATOM 3447   C CB . ASN B 1 77   ? 1099.942 698.544 611.854 1.00 0.00 ? 77   ASN B CB 1 
ATOM 3448   N N  . LEU B 1 78   ? 1101.295 697.067 614.159 1.00 0.00 ? 78   LEU B N  1 
ATOM 3449   C CA . LEU B 1 78   ? 1102.555 696.644 614.707 1.00 0.00 ? 78   LEU B CA 1 
ATOM 3450   C C  . LEU B 1 78   ? 1102.591 695.319 615.423 1.00 0.00 ? 78   LEU B C  1 
ATOM 3451   O O  . LEU B 1 78   ? 1103.721 694.849 615.542 1.00 0.00 ? 78   LEU B O  1 
ATOM 3452   C CB . LEU B 1 78   ? 1103.221 697.680 615.635 1.00 0.00 ? 78   LEU B CB 1 
ATOM 3453   N N  . PRO B 1 79   ? 1101.509 694.706 615.922 1.00 0.00 ? 79   PRO B N  1 
ATOM 3454   C CA . PRO B 1 79   ? 1101.604 693.624 616.873 1.00 0.00 ? 79   PRO B CA 1 
ATOM 3455   C C  . PRO B 1 79   ? 1102.597 692.597 616.462 1.00 0.00 ? 79   PRO B C  1 
ATOM 3456   O O  . PRO B 1 79   ? 1102.501 692.057 615.360 1.00 0.00 ? 79   PRO B O  1 
ATOM 3457   C CB . PRO B 1 79   ? 1100.224 692.990 616.966 1.00 0.00 ? 79   PRO B CB 1 
ATOM 3458   N N  . GLU B 1 80   ? 1103.570 692.350 617.346 1.00 0.00 ? 80   GLU B N  1 
ATOM 3459   C CA . GLU B 1 80   ? 1104.659 691.479 617.067 1.00 0.00 ? 80   GLU B CA 1 
ATOM 3460   C C  . GLU B 1 80   ? 1104.188 690.068 616.925 1.00 0.00 ? 80   GLU B C  1 
ATOM 3461   O O  . GLU B 1 80   ? 1104.629 689.358 616.022 1.00 0.00 ? 80   GLU B O  1 
ATOM 3462   C CB . GLU B 1 80   ? 1105.733 691.542 618.171 1.00 0.00 ? 80   GLU B CB 1 
ATOM 3463   N N  . ILE B 1 81   ? 1103.258 689.623 617.789 1.00 0.00 ? 81   ILE B N  1 
ATOM 3464   C CA . ILE B 1 81   ? 1102.898 688.236 617.738 1.00 0.00 ? 81   ILE B CA 1 
ATOM 3465   C C  . ILE B 1 81   ? 1101.410 688.108 617.652 1.00 0.00 ? 81   ILE B C  1 
ATOM 3466   O O  . ILE B 1 81   ? 1100.667 688.986 618.084 1.00 0.00 ? 81   ILE B O  1 
ATOM 3467   C CB . ILE B 1 81   ? 1103.306 687.504 618.981 1.00 0.00 ? 81   ILE B CB 1 
ATOM 3468   N N  . SER B 1 82   ? 1100.948 686.990 617.054 1.00 0.00 ? 82   SER B N  1 
ATOM 3469   C CA . SER B 1 82   ? 1099.546 686.704 616.961 1.00 0.00 ? 82   SER B CA 1 
ATOM 3470   C C  . SER B 1 82   ? 1099.400 685.272 617.366 1.00 0.00 ? 82   SER B C  1 
ATOM 3471   O O  . SER B 1 82   ? 1100.368 684.515 617.331 1.00 0.00 ? 82   SER B O  1 
ATOM 3472   C CB . SER B 1 82   ? 1098.983 686.834 615.536 1.00 0.00 ? 82   SER B CB 1 
ATOM 3473   N N  . SER B 1 83   ? 1098.189 684.856 617.786 1.00 0.00 ? 83   SER B N  1 
ATOM 3474   C CA . SER B 1 83   ? 1098.042 683.485 618.188 1.00 0.00 ? 83   SER B CA 1 
ATOM 3475   C C  . SER B 1 83   ? 1097.393 682.753 617.057 1.00 0.00 ? 83   SER B C  1 
ATOM 3476   O O  . SER B 1 83   ? 1096.213 682.950 616.770 1.00 0.00 ? 83   SER B O  1 
ATOM 3477   C CB . SER B 1 83   ? 1097.149 683.303 619.426 1.00 0.00 ? 83   SER B CB 1 
ATOM 3478   N N  . ILE B 1 84   ? 1098.175 681.903 616.365 1.00 0.00 ? 84   ILE B N  1 
ATOM 3479   C CA . ILE B 1 84   ? 1097.668 681.160 615.248 1.00 0.00 ? 84   ILE B CA 1 
ATOM 3480   C C  . ILE B 1 84   ? 1096.723 680.075 615.671 1.00 0.00 ? 84   ILE B C  1 
ATOM 3481   O O  . ILE B 1 84   ? 1095.627 679.968 615.124 1.00 0.00 ? 84   ILE B O  1 
ATOM 3482   C CB . ILE B 1 84   ? 1098.754 680.542 614.408 1.00 0.00 ? 84   ILE B CB 1 
ATOM 3483   N N  . ARG B 1 85   ? 1097.097 679.247 616.672 1.00 0.00 ? 85   ARG B N  1 
ATOM 3484   C CA . ARG B 1 85   ? 1096.227 678.147 616.978 1.00 0.00 ? 85   ARG B CA 1 
ATOM 3485   C C  . ARG B 1 85   ? 1096.447 677.687 618.381 1.00 0.00 ? 85   ARG B C  1 
ATOM 3486   O O  . ARG B 1 85   ? 1097.427 678.042 619.033 1.00 0.00 ? 85   ARG B O  1 
ATOM 3487   C CB . ARG B 1 85   ? 1096.470 676.932 616.068 1.00 0.00 ? 85   ARG B CB 1 
ATOM 3488   N N  . ARG B 1 86   ? 1095.489 676.878 618.877 1.00 0.00 ? 86   ARG B N  1 
ATOM 3489   C CA . ARG B 1 86   ? 1095.542 676.317 620.195 1.00 0.00 ? 86   ARG B CA 1 
ATOM 3490   C C  . ARG B 1 86   ? 1095.288 674.852 620.044 1.00 0.00 ? 86   ARG B C  1 
ATOM 3491   O O  . ARG B 1 86   ? 1094.309 674.451 619.418 1.00 0.00 ? 86   ARG B O  1 
ATOM 3492   C CB . ARG B 1 86   ? 1094.434 676.886 621.095 1.00 0.00 ? 86   ARG B CB 1 
ATOM 3493   N N  . VAL B 1 87   ? 1096.174 674.002 620.601 1.00 0.00 ? 87   VAL B N  1 
ATOM 3494   C CA . VAL B 1 87   ? 1095.917 672.597 620.498 1.00 0.00 ? 87   VAL B CA 1 
ATOM 3495   C C  . VAL B 1 87   ? 1095.814 672.048 621.884 1.00 0.00 ? 87   VAL B C  1 
ATOM 3496   O O  . VAL B 1 87   ? 1096.700 672.224 622.720 1.00 0.00 ? 87   VAL B O  1 
ATOM 3497   C CB . VAL B 1 87   ? 1096.976 671.827 619.764 1.00 0.00 ? 87   VAL B CB 1 
ATOM 3498   N N  . PRO B 1 88   ? 1094.714 671.400 622.140 1.00 0.00 ? 88   PRO B N  1 
ATOM 3499   C CA . PRO B 1 88   ? 1094.528 670.828 623.443 1.00 0.00 ? 88   PRO B CA 1 
ATOM 3500   C C  . PRO B 1 88   ? 1095.280 669.550 623.583 1.00 0.00 ? 88   PRO B C  1 
ATOM 3501   O O  . PRO B 1 88   ? 1095.601 668.932 622.569 1.00 0.00 ? 88   PRO B O  1 
ATOM 3502   C CB . PRO B 1 88   ? 1093.021 670.648 623.617 1.00 0.00 ? 88   PRO B CB 1 
ATOM 3503   N N  . LEU B 1 89   ? 1095.592 669.135 624.825 1.00 0.00 ? 89   LEU B N  1 
ATOM 3504   C CA . LEU B 1 89   ? 1096.232 667.865 624.969 1.00 0.00 ? 89   LEU B CA 1 
ATOM 3505   C C  . LEU B 1 89   ? 1095.186 666.861 624.598 1.00 0.00 ? 89   LEU B C  1 
ATOM 3506   O O  . LEU B 1 89   ? 1094.041 666.959 625.033 1.00 0.00 ? 89   LEU B O  1 
ATOM 3507   C CB . LEU B 1 89   ? 1096.647 667.507 626.407 1.00 0.00 ? 89   LEU B CB 1 
ATOM 3508   N N  . PRO B 1 90   ? 1095.549 665.900 623.801 1.00 0.00 ? 90   PRO B N  1 
ATOM 3509   C CA . PRO B 1 90   ? 1094.636 664.879 623.367 1.00 0.00 ? 90   PRO B CA 1 
ATOM 3510   C C  . PRO B 1 90   ? 1094.093 664.153 624.560 1.00 0.00 ? 90   PRO B C  1 
ATOM 3511   O O  . PRO B 1 90   ? 1094.834 663.947 625.519 1.00 0.00 ? 90   PRO B O  1 
ATOM 3512   C CB . PRO B 1 90   ? 1095.464 663.960 622.474 1.00 0.00 ? 90   PRO B CB 1 
ATOM 3513   N N  . PRO B 1 91   ? 1092.840 663.786 624.534 1.00 0.00 ? 91   PRO B N  1 
ATOM 3514   C CA . PRO B 1 91   ? 1092.281 663.065 625.644 1.00 0.00 ? 91   PRO B CA 1 
ATOM 3515   C C  . PRO B 1 91   ? 1092.872 661.701 625.774 1.00 0.00 ? 91   PRO B C  1 
ATOM 3516   O O  . PRO B 1 91   ? 1092.897 661.167 626.882 1.00 0.00 ? 91   PRO B O  1 
ATOM 3517   C CB . PRO B 1 91   ? 1090.770 663.081 625.433 1.00 0.00 ? 91   PRO B CB 1 
ATOM 3518   N N  . GLU B 1 92   ? 1093.344 661.114 624.662 1.00 0.00 ? 92   GLU B N  1 
ATOM 3519   C CA . GLU B 1 92   ? 1093.905 659.803 624.725 1.00 0.00 ? 92   GLU B CA 1 
ATOM 3520   C C  . GLU B 1 92   ? 1095.138 659.867 625.566 1.00 0.00 ? 92   GLU B C  1 
ATOM 3521   O O  . GLU B 1 92   ? 1095.413 658.956 626.346 1.00 0.00 ? 92   GLU B O  1 
ATOM 3522   C CB . GLU B 1 92   ? 1094.257 659.224 623.340 1.00 0.00 ? 92   GLU B CB 1 
ATOM 3523   N N  . LEU B 1 93   ? 1095.929 660.948 625.408 1.00 0.00 ? 93   LEU B N  1 
ATOM 3524   C CA . LEU B 1 93   ? 1097.140 661.127 626.158 1.00 0.00 ? 93   LEU B CA 1 
ATOM 3525   C C  . LEU B 1 93   ? 1096.797 661.368 627.600 1.00 0.00 ? 93   LEU B C  1 
ATOM 3526   O O  . LEU B 1 93   ? 1097.409 660.792 628.498 1.00 0.00 ? 93   LEU B O  1 
ATOM 3527   C CB . LEU B 1 93   ? 1097.947 662.338 625.638 1.00 0.00 ? 93   LEU B CB 1 
ATOM 3528   N N  . VAL B 1 94   ? 1095.785 662.219 627.848 1.00 0.00 ? 94   VAL B N  1 
ATOM 3529   C CA . VAL B 1 94   ? 1095.422 662.631 629.176 1.00 0.00 ? 94   VAL B CA 1 
ATOM 3530   C C  . VAL B 1 94   ? 1094.973 661.449 629.969 1.00 0.00 ? 94   VAL B C  1 
ATOM 3531   O O  . VAL B 1 94   ? 1095.225 661.362 631.170 1.00 0.00 ? 94   VAL B O  1 
ATOM 3532   C CB . VAL B 1 94   ? 1094.303 663.630 629.186 1.00 0.00 ? 94   VAL B CB 1 
ATOM 3533   N N  . GLU B 1 95   ? 1094.300 660.496 629.305 1.00 0.00 ? 95   GLU B N  1 
ATOM 3534   C CA . GLU B 1 95   ? 1093.739 659.365 629.979 1.00 0.00 ? 95   GLU B CA 1 
ATOM 3535   C C  . GLU B 1 95   ? 1094.829 658.605 630.669 1.00 0.00 ? 95   GLU B C  1 
ATOM 3536   O O  . GLU B 1 95   ? 1094.617 658.084 631.764 1.00 0.00 ? 95   GLU B O  1 
ATOM 3537   C CB . GLU B 1 95   ? 1093.021 658.402 629.017 1.00 0.00 ? 95   GLU B CB 1 
ATOM 3538   N N  . GLN B 1 96   ? 1096.026 658.508 630.058 1.00 0.00 ? 96   GLN B N  1 
ATOM 3539   C CA . GLN B 1 96   ? 1097.063 657.751 630.698 1.00 0.00 ? 96   GLN B CA 1 
ATOM 3540   C C  . GLN B 1 96   ? 1097.841 658.667 631.592 1.00 0.00 ? 96   GLN B C  1 
ATOM 3541   O O  . GLN B 1 96   ? 1099.039 658.479 631.799 1.00 0.00 ? 96   GLN B O  1 
ATOM 3542   C CB . GLN B 1 96   ? 1098.032 657.131 629.676 1.00 0.00 ? 96   GLN B CB 1 
ATOM 3543   N N  . PHE B 1 97   ? 1097.163 659.678 632.161 1.00 0.00 ? 97   PHE B N  1 
ATOM 3544   C CA . PHE B 1 97   ? 1097.762 660.595 633.088 1.00 0.00 ? 97   PHE B CA 1 
ATOM 3545   C C  . PHE B 1 97   ? 1096.760 660.740 634.194 1.00 0.00 ? 97   PHE B C  1 
ATOM 3546   O O  . PHE B 1 97   ? 1096.976 661.431 635.189 1.00 0.00 ? 97   PHE B O  1 
ATOM 3547   C CB . PHE B 1 97   ? 1097.975 661.980 632.441 1.00 0.00 ? 97   PHE B CB 1 
ATOM 3548   N N  . GLY B 1 98   ? 1095.646 660.004 634.070 1.00 0.00 ? 98   GLY B N  1 
ATOM 3549   C CA . GLY B 1 98   ? 1094.555 660.155 634.986 1.00 0.00 ? 98   GLY B CA 1 
ATOM 3550   C C  . GLY B 1 98   ? 1094.979 659.833 636.382 1.00 0.00 ? 98   GLY B C  1 
ATOM 3551   O O  . GLY B 1 98   ? 1094.607 660.539 637.317 1.00 0.00 ? 98   GLY B O  1 
ATOM 3552   N N  . HIS B 1 99   ? 1095.769 658.761 636.579 1.00 0.00 ? 99   HIS B N  1 
ATOM 3553   C CA . HIS B 1 99   ? 1096.071 658.405 637.936 1.00 0.00 ? 99   HIS B CA 1 
ATOM 3554   C C  . HIS B 1 99   ? 1097.482 658.791 638.236 1.00 0.00 ? 99   HIS B C  1 
ATOM 3555   O O  . HIS B 1 99   ? 1098.420 658.245 637.658 1.00 0.00 ? 99   HIS B O  1 
ATOM 3556   C CB . HIS B 1 99   ? 1095.928 656.894 638.189 1.00 0.00 ? 99   HIS B CB 1 
ATOM 3557   N N  . MET B 1 100  ? 1097.664 659.761 639.157 1.00 0.00 ? 100  MET B N  1 
ATOM 3558   C CA . MET B 1 100  ? 1098.989 660.201 639.492 1.00 0.00 ? 100  MET B CA 1 
ATOM 3559   C C  . MET B 1 100  ? 1099.019 660.540 640.943 1.00 0.00 ? 100  MET B C  1 
ATOM 3560   O O  . MET B 1 100  ? 1098.550 661.610 641.332 1.00 0.00 ? 100  MET B O  1 
ATOM 3561   C CB . MET B 1 100  ? 1099.314 661.517 638.806 1.00 0.00 ? 100  MET B CB 1 
ATOM 3562   N N  . GLN B 1 101  ? 1099.544 659.655 641.809 1.00 0.00 ? 101  GLN B N  1 
ATOM 3563   C CA . GLN B 1 101  ? 1099.556 660.093 643.170 1.00 0.00 ? 101  GLN B CA 1 
ATOM 3564   C C  . GLN B 1 101  ? 1100.608 661.144 643.398 1.00 0.00 ? 101  GLN B C  1 
ATOM 3565   O O  . GLN B 1 101  ? 1100.307 662.277 643.770 1.00 0.00 ? 101  GLN B O  1 
ATOM 3566   C CB . GLN B 1 101  ? 1099.890 658.969 644.168 1.00 0.00 ? 101  GLN B CB 1 
ATOM 3567   N N  . CYS B 1 102  ? 1101.881 660.762 643.150 1.00 0.00 ? 102  CYS B N  1 
ATOM 3568   C CA . CYS B 1 102  ? 1103.034 661.547 643.519 1.00 0.00 ? 102  CYS B CA 1 
ATOM 3569   C C  . CYS B 1 102  ? 1103.375 662.772 642.716 1.00 0.00 ? 102  CYS B C  1 
ATOM 3570   O O  . CYS B 1 102  ? 1103.414 663.870 643.269 1.00 0.00 ? 102  CYS B O  1 
ATOM 3571   C CB . CYS B 1 102  ? 1104.317 660.704 643.588 1.00 0.00 ? 102  CYS B CB 1 
ATOM 3572   N N  . ASN B 1 103  ? 1103.610 662.652 641.389 1.00 0.00 ? 103  ASN B N  1 
ATOM 3573   C CA . ASN B 1 103  ? 1104.220 663.808 640.781 1.00 0.00 ? 103  ASN B CA 1 
ATOM 3574   C C  . ASN B 1 103  ? 1103.829 663.953 639.341 1.00 0.00 ? 103  ASN B C  1 
ATOM 3575   O O  . ASN B 1 103  ? 1103.716 662.968 638.613 1.00 0.00 ? 103  ASN B O  1 
ATOM 3576   C CB . ASN B 1 103  ? 1105.759 663.708 640.827 1.00 0.00 ? 103  ASN B CB 1 
ATOM 3577   N N  . CYS B 1 104  ? 1103.654 665.222 638.906 1.00 0.00 ? 104  CYS B N  1 
ATOM 3578   C CA . CYS B 1 104  ? 1103.291 665.589 637.562 1.00 0.00 ? 104  CYS B CA 1 
ATOM 3579   C C  . CYS B 1 104  ? 1104.297 666.582 637.067 1.00 0.00 ? 104  CYS B C  1 
ATOM 3580   O O  . CYS B 1 104  ? 1104.942 667.272 637.852 1.00 0.00 ? 104  CYS B O  1 
ATOM 3581   C CB . CYS B 1 104  ? 1101.973 666.382 637.480 1.00 0.00 ? 104  CYS B CB 1 
ATOM 3582   N N  . MET B 1 105  ? 1104.467 666.650 635.731 1.00 0.00 ? 105  MET B N  1 
ATOM 3583   C CA . MET B 1 105  ? 1105.281 667.670 635.133 1.00 0.00 ? 105  MET B CA 1 
ATOM 3584   C C  . MET B 1 105  ? 1105.168 667.516 633.650 1.00 0.00 ? 105  MET B C  1 
ATOM 3585   O O  . MET B 1 105  ? 1104.878 666.427 633.158 1.00 0.00 ? 105  MET B O  1 
ATOM 3586   C CB . MET B 1 105  ? 1106.770 667.606 635.505 1.00 0.00 ? 105  MET B CB 1 
ATOM 3587   N N  . MET B 1 106  ? 1105.374 668.609 632.888 1.00 0.00 ? 106  MET B N  1 
ATOM 3588   C CA . MET B 1 106  ? 1105.283 668.491 631.460 1.00 0.00 ? 106  MET B CA 1 
ATOM 3589   C C  . MET B 1 106  ? 1106.156 669.536 630.844 1.00 0.00 ? 106  MET B C  1 
ATOM 3590   O O  . MET B 1 106  ? 1106.631 670.438 631.527 1.00 0.00 ? 106  MET B O  1 
ATOM 3591   C CB . MET B 1 106  ? 1103.846 668.639 630.924 1.00 0.00 ? 106  MET B CB 1 
ATOM 3592   N N  . GLY B 1 107  ? 1106.421 669.427 629.525 1.00 0.00 ? 107  GLY B N  1 
ATOM 3593   C CA . GLY B 1 107  ? 1107.263 670.409 628.906 1.00 0.00 ? 107  GLY B CA 1 
ATOM 3594   C C  . GLY B 1 107  ? 1107.291 670.160 627.434 1.00 0.00 ? 107  GLY B C  1 
ATOM 3595   O O  . GLY B 1 107  ? 1106.669 669.226 626.934 1.00 0.00 ? 107  GLY B O  1 
ATOM 3596   N N  . VAL B 1 108  ? 1108.026 671.017 626.696 1.00 0.00 ? 108  VAL B N  1 
ATOM 3597   C CA . VAL B 1 108  ? 1108.105 670.866 625.273 1.00 0.00 ? 108  VAL B CA 1 
ATOM 3598   C C  . VAL B 1 108  ? 1109.540 670.639 624.912 1.00 0.00 ? 108  VAL B C  1 
ATOM 3599   O O  . VAL B 1 108  ? 1110.433 671.236 625.511 1.00 0.00 ? 108  VAL B O  1 
ATOM 3600   C CB . VAL B 1 108  ? 1107.649 672.084 624.521 1.00 0.00 ? 108  VAL B CB 1 
ATOM 3601   N N  . PHE B 1 109  ? 1109.811 669.745 623.936 1.00 0.00 ? 109  PHE B N  1 
ATOM 3602   C CA . PHE B 1 109  ? 1111.184 669.604 623.548 1.00 0.00 ? 109  PHE B CA 1 
ATOM 3603   C C  . PHE B 1 109  ? 1111.349 670.416 622.303 1.00 0.00 ? 109  PHE B C  1 
ATOM 3604   O O  . PHE B 1 109  ? 1110.685 670.184 621.293 1.00 0.00 ? 109  PHE B O  1 
ATOM 3605   C CB . PHE B 1 109  ? 1111.659 668.179 623.219 1.00 0.00 ? 109  PHE B CB 1 
ATOM 3606   N N  . PRO B 1 110  ? 1112.221 671.379 622.362 1.00 0.00 ? 110  PRO B N  1 
ATOM 3607   C CA . PRO B 1 110  ? 1112.388 672.266 621.250 1.00 0.00 ? 110  PRO B CA 1 
ATOM 3608   C C  . PRO B 1 110  ? 1112.815 671.660 619.948 1.00 0.00 ? 110  PRO B C  1 
ATOM 3609   O O  . PRO B 1 110  ? 1112.235 672.040 618.931 1.00 0.00 ? 110  PRO B O  1 
ATOM 3610   C CB . PRO B 1 110  ? 1113.282 673.399 621.754 1.00 0.00 ? 110  PRO B CB 1 
ATOM 3611   N N  . PRO B 1 111  ? 1113.790 670.793 619.909 1.00 0.00 ? 111  PRO B N  1 
ATOM 3612   C CA . PRO B 1 111  ? 1114.169 670.242 618.634 1.00 0.00 ? 111  PRO B CA 1 
ATOM 3613   C C  . PRO B 1 111  ? 1113.176 669.290 618.044 1.00 0.00 ? 111  PRO B C  1 
ATOM 3614   O O  . PRO B 1 111  ? 1112.994 669.282 616.827 1.00 0.00 ? 111  PRO B O  1 
ATOM 3615   C CB . PRO B 1 111  ? 1115.560 669.647 618.829 1.00 0.00 ? 111  PRO B CB 1 
ATOM 3616   N N  . ILE B 1 112  ? 1112.544 668.478 618.904 1.00 0.00 ? 112  ILE B N  1 
ATOM 3617   C CA . ILE B 1 112  ? 1111.632 667.433 618.548 1.00 0.00 ? 112  ILE B CA 1 
ATOM 3618   C C  . ILE B 1 112  ? 1110.348 668.000 618.019 1.00 0.00 ? 112  ILE B C  1 
ATOM 3619   O O  . ILE B 1 112  ? 1109.746 667.435 617.105 1.00 0.00 ? 112  ILE B O  1 
ATOM 3620   C CB . ILE B 1 112  ? 1111.340 666.559 619.726 1.00 0.00 ? 112  ILE B CB 1 
ATOM 3621   N N  . SER B 1 113  ? 1109.900 669.151 618.561 1.00 0.00 ? 113  SER B N  1 
ATOM 3622   C CA . SER B 1 113  ? 1108.616 669.677 618.194 1.00 0.00 ? 113  SER B CA 1 
ATOM 3623   C C  . SER B 1 113  ? 1107.587 668.734 618.724 1.00 0.00 ? 113  SER B C  1 
ATOM 3624   O O  . SER B 1 113  ? 1106.544 668.495 618.115 1.00 0.00 ? 113  SER B O  1 
ATOM 3625   C CB . SER B 1 113  ? 1108.422 669.802 616.671 1.00 0.00 ? 113  SER B CB 1 
ATOM 3626   N N  . ARG B 1 114  ? 1107.893 668.175 619.907 1.00 0.00 ? 114  ARG B N  1 
ATOM 3627   C CA . ARG B 1 114  ? 1107.056 667.261 620.621 1.00 0.00 ? 114  ARG B CA 1 
ATOM 3628   C C  . ARG B 1 114  ? 1106.923 667.757 622.022 1.00 0.00 ? 114  ARG B C  1 
ATOM 3629   O O  . ARG B 1 114  ? 1107.743 668.539 622.499 1.00 0.00 ? 114  ARG B O  1 
ATOM 3630   C CB . ARG B 1 114  ? 1107.613 665.828 620.689 1.00 0.00 ? 114  ARG B CB 1 
ATOM 3631   N N  . ALA B 1 115  ? 1105.852 667.313 622.708 1.00 0.00 ? 115  ALA B N  1 
ATOM 3632   C CA . ALA B 1 115  ? 1105.613 667.706 624.064 1.00 0.00 ? 115  ALA B CA 1 
ATOM 3633   C C  . ALA B 1 115  ? 1105.706 666.466 624.894 1.00 0.00 ? 115  ALA B C  1 
ATOM 3634   O O  . ALA B 1 115  ? 1105.483 665.365 624.396 1.00 0.00 ? 115  ALA B O  1 
ATOM 3635   C CB . ALA B 1 115  ? 1104.219 668.314 624.295 1.00 0.00 ? 115  ALA B CB 1 
ATOM 3636   N N  . TRP B 1 116  ? 1106.076 666.613 626.182 1.00 0.00 ? 116  TRP B N  1 
ATOM 3637   C CA . TRP B 1 116  ? 1106.215 665.464 627.030 1.00 0.00 ? 116  TRP B CA 1 
ATOM 3638   C C  . TRP B 1 116  ? 1105.434 665.680 628.288 1.00 0.00 ? 116  TRP B C  1 
ATOM 3639   O O  . TRP B 1 116  ? 1105.268 666.808 628.747 1.00 0.00 ? 116  TRP B O  1 
ATOM 3640   C CB . TRP B 1 116  ? 1107.675 665.191 627.426 1.00 0.00 ? 116  TRP B CB 1 
ATOM 3641   N N  . LEU B 1 117  ? 1104.904 664.578 628.863 1.00 0.00 ? 117  LEU B N  1 
ATOM 3642   C CA . LEU B 1 117  ? 1104.154 664.653 630.084 1.00 0.00 ? 117  LEU B CA 1 
ATOM 3643   C C  . LEU B 1 117  ? 1104.697 663.577 630.971 1.00 0.00 ? 117  LEU B C  1 
ATOM 3644   O O  . LEU B 1 117  ? 1104.927 662.455 630.523 1.00 0.00 ? 117  LEU B O  1 
ATOM 3645   C CB . LEU B 1 117  ? 1102.649 664.381 629.862 1.00 0.00 ? 117  LEU B CB 1 
ATOM 3646   N N  . THR B 1 118  ? 1104.933 663.905 632.260 1.00 0.00 ? 118  THR B N  1 
ATOM 3647   C CA . THR B 1 118  ? 1105.409 662.916 633.182 1.00 0.00 ? 118  THR B CA 1 
ATOM 3648   C C  . THR B 1 118  ? 1104.467 662.866 634.335 1.00 0.00 ? 118  THR B C  1 
ATOM 3649   O O  . THR B 1 118  ? 1104.192 663.875 634.984 1.00 0.00 ? 118  THR B O  1 
ATOM 3650   C CB . THR B 1 118  ? 1106.747 663.231 633.785 1.00 0.00 ? 118  THR B CB 1 
ATOM 3651   N N  . ILE B 1 119  ? 1103.920 661.669 634.591 1.00 0.00 ? 119  ILE B N  1 
ATOM 3652   C CA . ILE B 1 119  ? 1103.107 661.417 635.736 1.00 0.00 ? 119  ILE B CA 1 
ATOM 3653   C C  . ILE B 1 119  ? 1103.715 660.234 636.412 1.00 0.00 ? 119  ILE B C  1 
ATOM 3654   O O  . ILE B 1 119  ? 1103.740 659.131 635.871 1.00 0.00 ? 119  ILE B O  1 
ATOM 3655   C CB . ILE B 1 119  ? 1101.661 661.179 635.371 1.00 0.00 ? 119  ILE B CB 1 
ATOM 3656   N N  . ASP B 1 120  ? 1104.233 660.436 637.636 1.00 0.00 ? 120  ASP B N  1 
ATOM 3657   C CA . ASP B 1 120  ? 1104.867 659.353 638.322 1.00 0.00 ? 120  ASP B CA 1 
ATOM 3658   C C  . ASP B 1 120  ? 1105.948 658.784 637.457 1.00 0.00 ? 120  ASP B C  1 
ATOM 3659   O O  . ASP B 1 120  ? 1106.808 659.501 636.945 1.00 0.00 ? 120  ASP B O  1 
ATOM 3660   C CB . ASP B 1 120  ? 1103.892 658.218 638.681 1.00 0.00 ? 120  ASP B CB 1 
ATOM 3661   N N  . SER B 1 121  ? 1105.938 657.445 637.329 1.00 0.00 ? 121  SER B N  1 
ATOM 3662   C CA . SER B 1 121  ? 1106.928 656.686 636.621 1.00 0.00 ? 121  SER B CA 1 
ATOM 3663   C C  . SER B 1 121  ? 1106.849 656.842 635.130 1.00 0.00 ? 121  SER B C  1 
ATOM 3664   O O  . SER B 1 121  ? 1107.879 656.803 634.457 1.00 0.00 ? 121  SER B O  1 
ATOM 3665   C CB . SER B 1 121  ? 1106.821 655.180 636.925 1.00 0.00 ? 121  SER B CB 1 
ATOM 3666   N N  . ASP B 1 122  ? 1105.642 657.017 634.560 1.00 0.00 ? 122  ASP B N  1 
ATOM 3667   C CA . ASP B 1 122  ? 1105.532 656.978 633.125 1.00 0.00 ? 122  ASP B CA 1 
ATOM 3668   C C  . ASP B 1 122  ? 1105.802 658.296 632.461 1.00 0.00 ? 122  ASP B C  1 
ATOM 3669   O O  . ASP B 1 122  ? 1105.676 659.359 633.069 1.00 0.00 ? 122  ASP B O  1 
ATOM 3670   C CB . ASP B 1 122  ? 1104.185 656.405 632.657 1.00 0.00 ? 122  ASP B CB 1 
ATOM 3671   N N  . ILE B 1 123  ? 1106.206 658.232 631.171 1.00 0.00 ? 123  ILE B N  1 
ATOM 3672   C CA . ILE B 1 123  ? 1106.456 659.405 630.379 1.00 0.00 ? 123  ILE B CA 1 
ATOM 3673   C C  . ILE B 1 123  ? 1105.812 659.239 629.040 1.00 0.00 ? 123  ILE B C  1 
ATOM 3674   O O  . ILE B 1 123  ? 1105.794 658.150 628.464 1.00 0.00 ? 123  ILE B O  1 
ATOM 3675   C CB . ILE B 1 123  ? 1107.911 659.684 630.137 1.00 0.00 ? 123  ILE B CB 1 
ATOM 3676   N N  . PHE B 1 124  ? 1105.248 660.345 628.521 1.00 0.00 ? 124  PHE B N  1 
ATOM 3677   C CA . PHE B 1 124  ? 1104.639 660.379 627.223 1.00 0.00 ? 124  PHE B CA 1 
ATOM 3678   C C  . PHE B 1 124  ? 1105.334 661.404 626.397 1.00 0.00 ? 124  PHE B C  1 
ATOM 3679   O O  . PHE B 1 124  ? 1105.831 662.409 626.903 1.00 0.00 ? 124  PHE B O  1 
ATOM 3680   C CB . PHE B 1 124  ? 1103.187 660.882 627.190 1.00 0.00 ? 124  PHE B CB 1 
ATOM 3681   N N  . MET B 1 125  ? 1105.393 661.149 625.079 1.00 0.00 ? 125  MET B N  1 
ATOM 3682   C CA . MET B 1 125  ? 1105.855 662.138 624.153 1.00 0.00 ? 125  MET B CA 1 
ATOM 3683   C C  . MET B 1 125  ? 1104.787 662.201 623.110 1.00 0.00 ? 125  MET B C  1 
ATOM 3684   O O  . MET B 1 125  ? 1104.297 661.168 622.658 1.00 0.00 ? 125  MET B O  1 
ATOM 3685   C CB . MET B 1 125  ? 1107.167 661.792 623.424 1.00 0.00 ? 125  MET B CB 1 
ATOM 3686   N N  . TRP B 1 126  ? 1104.367 663.416 622.711 1.00 0.00 ? 126  TRP B N  1 
ATOM 3687   C CA . TRP B 1 126  ? 1103.326 663.468 621.725 1.00 0.00 ? 126  TRP B CA 1 
ATOM 3688   C C  . TRP B 1 126  ? 1103.695 664.457 620.665 1.00 0.00 ? 126  TRP B C  1 
ATOM 3689   O O  . TRP B 1 126  ? 1104.334 665.474 620.932 1.00 0.00 ? 126  TRP B O  1 
ATOM 3690   C CB . TRP B 1 126  ? 1101.946 663.795 622.326 1.00 0.00 ? 126  TRP B CB 1 
ATOM 3691   N N  . ASN B 1 127  ? 1103.301 664.148 619.411 1.00 0.00 ? 127  ASN B N  1 
ATOM 3692   C CA . ASN B 1 127  ? 1103.624 664.955 618.271 1.00 0.00 ? 127  ASN B CA 1 
ATOM 3693   C C  . ASN B 1 127  ? 1102.817 666.208 618.339 1.00 0.00 ? 127  ASN B C  1 
ATOM 3694   O O  . ASN B 1 127  ? 1101.609 666.187 618.572 1.00 0.00 ? 127  ASN B O  1 
ATOM 3695   C CB . ASN B 1 127  ? 1103.305 664.243 616.941 1.00 0.00 ? 127  ASN B CB 1 
ATOM 3696   N N  . TYR B 1 128  ? 1103.506 667.342 618.140 1.00 0.00 ? 128  TYR B N  1 
ATOM 3697   C CA . TYR B 1 128  ? 1102.954 668.660 618.233 1.00 0.00 ? 128  TYR B CA 1 
ATOM 3698   C C  . TYR B 1 128  ? 1101.957 668.800 617.128 1.00 0.00 ? 128  TYR B C  1 
ATOM 3699   O O  . TYR B 1 128  ? 1100.807 669.183 617.335 1.00 0.00 ? 128  TYR B O  1 
ATOM 3700   C CB . TYR B 1 128  ? 1104.070 669.661 617.920 1.00 0.00 ? 128  TYR B CB 1 
ATOM 3701   N N  . GLU B 1 129  ? 1102.405 668.461 615.905 1.00 0.00 ? 129  GLU B N  1 
ATOM 3702   C CA . GLU B 1 129  ? 1101.631 668.609 614.709 1.00 0.00 ? 129  GLU B CA 1 
ATOM 3703   C C  . GLU B 1 129  ? 1100.505 667.627 614.669 1.00 0.00 ? 129  GLU B C  1 
ATOM 3704   O O  . GLU B 1 129  ? 1099.406 667.961 614.227 1.00 0.00 ? 129  GLU B O  1 
ATOM 3705   C CB . GLU B 1 129  ? 1102.498 668.459 613.447 1.00 0.00 ? 129  GLU B CB 1 
ATOM 3706   N N  . ASP B 1 130  ? 1100.736 666.389 615.138 1.00 0.00 ? 130  ASP B N  1 
ATOM 3707   C CA . ASP B 1 130  ? 1099.707 665.395 615.024 1.00 0.00 ? 130  ASP B CA 1 
ATOM 3708   C C  . ASP B 1 130  ? 1098.872 665.427 616.267 1.00 0.00 ? 130  ASP B C  1 
ATOM 3709   O O  . ASP B 1 130  ? 1097.814 666.049 616.298 1.00 0.00 ? 130  ASP B O  1 
ATOM 3710   C CB . ASP B 1 130  ? 1100.277 663.977 614.840 1.00 0.00 ? 130  ASP B CB 1 
ATOM 3711   N N  . GLY B 1 131  ? 1099.337 664.751 617.336 1.00 0.00 ? 131  GLY B N  1 
ATOM 3712   C CA . GLY B 1 131  ? 1098.613 664.716 618.576 1.00 0.00 ? 131  GLY B CA 1 
ATOM 3713   C C  . GLY B 1 131  ? 1098.094 663.329 618.742 1.00 0.00 ? 131  GLY B C  1 
ATOM 3714   O O  . GLY B 1 131  ? 1098.021 662.815 619.859 1.00 0.00 ? 131  GLY B O  1 
ATOM 3715   N N  . GLY B 1 132  ? 1097.699 662.699 617.622 1.00 0.00 ? 132  GLY B N  1 
ATOM 3716   C CA . GLY B 1 132  ? 1097.261 661.336 617.655 1.00 0.00 ? 132  GLY B CA 1 
ATOM 3717   C C  . GLY B 1 132  ? 1098.452 660.490 617.967 1.00 0.00 ? 132  GLY B C  1 
ATOM 3718   O O  . GLY B 1 132  ? 1098.369 659.525 618.725 1.00 0.00 ? 132  GLY B O  1 
ATOM 3719   N N  . ASP B 1 133  ? 1099.604 660.853 617.368 1.00 0.00 ? 133  ASP B N  1 
ATOM 3720   C CA . ASP B 1 133  ? 1100.821 660.111 617.502 1.00 0.00 ? 133  ASP B CA 1 
ATOM 3721   C C  . ASP B 1 133  ? 1101.424 660.403 618.841 1.00 0.00 ? 133  ASP B C  1 
ATOM 3722   O O  . ASP B 1 133  ? 1101.766 661.544 619.145 1.00 0.00 ? 133  ASP B O  1 
ATOM 3723   C CB . ASP B 1 133  ? 1101.855 660.504 616.428 1.00 0.00 ? 133  ASP B CB 1 
ATOM 3724   N N  . LEU B 1 134  ? 1101.550 659.361 619.689 1.00 0.00 ? 134  LEU B N  1 
ATOM 3725   C CA . LEU B 1 134  ? 1102.171 659.544 620.966 1.00 0.00 ? 134  LEU B CA 1 
ATOM 3726   C C  . LEU B 1 134  ? 1103.022 658.343 621.247 1.00 0.00 ? 134  LEU B C  1 
ATOM 3727   O O  . LEU B 1 134  ? 1102.741 657.248 620.766 1.00 0.00 ? 134  LEU B O  1 
ATOM 3728   C CB . LEU B 1 134  ? 1101.173 659.758 622.124 1.00 0.00 ? 134  LEU B CB 1 
ATOM 3729   N N  . ALA B 1 135  ? 1104.106 658.534 622.026 1.00 0.00 ? 135  ALA B N  1 
ATOM 3730   C CA . ALA B 1 135  ? 1104.987 657.450 622.359 1.00 0.00 ? 135  ALA B CA 1 
ATOM 3731   C C  . ALA B 1 135  ? 1104.988 657.334 623.847 1.00 0.00 ? 135  ALA B C  1 
ATOM 3732   O O  . ALA B 1 135  ? 1104.785 658.316 624.559 1.00 0.00 ? 135  ALA B O  1 
ATOM 3733   C CB . ALA B 1 135  ? 1106.442 657.679 621.918 1.00 0.00 ? 135  ALA B CB 1 
ATOM 3734   N N  . TYR B 1 136  ? 1105.197 656.108 624.357 1.00 0.00 ? 136  TYR B N  1 
ATOM 3735   C CA . TYR B 1 136  ? 1105.148 655.921 625.775 1.00 0.00 ? 136  TYR B CA 1 
ATOM 3736   C C  . TYR B 1 136  ? 1106.342 655.127 626.213 1.00 0.00 ? 136  TYR B C  1 
ATOM 3737   O O  . TYR B 1 136  ? 1106.763 654.188 625.537 1.00 0.00 ? 136  TYR B O  1 
ATOM 3738   C CB . TYR B 1 136  ? 1103.871 655.169 626.182 1.00 0.00 ? 136  TYR B CB 1 
ATOM 3739   N N  . PHE B 1 137  ? 1106.930 655.508 627.365 1.00 0.00 ? 137  PHE B N  1 
ATOM 3740   C CA . PHE B 1 137  ? 1108.041 654.786 627.925 1.00 0.00 ? 137  PHE B CA 1 
ATOM 3741   C C  . PHE B 1 137  ? 1107.511 653.856 628.962 1.00 0.00 ? 137  PHE B C  1 
ATOM 3742   O O  . PHE B 1 137  ? 1106.805 654.270 629.880 1.00 0.00 ? 137  PHE B O  1 
ATOM 3743   C CB . PHE B 1 137  ? 1109.047 655.642 628.709 1.00 0.00 ? 137  PHE B CB 1 
ATOM 3744   N N  . ASP B 1 138  ? 1107.855 652.563 628.838 1.00 0.00 ? 138  ASP B N  1 
ATOM 3745   C CA . ASP B 1 138  ? 1107.439 651.586 629.803 1.00 0.00 ? 138  ASP B CA 1 
ATOM 3746   C C  . ASP B 1 138  ? 1108.663 651.156 630.545 1.00 0.00 ? 138  ASP B C  1 
ATOM 3747   O O  . ASP B 1 138  ? 1108.584 650.405 631.516 1.00 0.00 ? 138  ASP B O  1 
ATOM 3748   C CB . ASP B 1 138  ? 1106.909 650.299 629.142 1.00 0.00 ? 138  ASP B CB 1 
ATOM 3749   N N  . GLY B 1 139  ? 1109.833 651.651 630.111 1.00 0.00 ? 139  GLY B N  1 
ATOM 3750   C CA . GLY B 1 139  ? 1111.085 651.219 630.660 1.00 0.00 ? 139  GLY B CA 1 
ATOM 3751   C C  . GLY B 1 139  ? 1111.213 651.578 632.107 1.00 0.00 ? 139  GLY B C  1 
ATOM 3752   O O  . GLY B 1 139  ? 1111.716 650.778 632.895 1.00 0.00 ? 139  GLY B O  1 
ATOM 3753   N N  . LEU B 1 140  ? 1110.762 652.782 632.516 1.00 0.00 ? 140  LEU B N  1 
ATOM 3754   C CA . LEU B 1 140  ? 1111.065 653.191 633.860 1.00 0.00 ? 140  LEU B CA 1 
ATOM 3755   C C  . LEU B 1 140  ? 1110.219 652.535 634.898 1.00 0.00 ? 140  LEU B C  1 
ATOM 3756   O O  . LEU B 1 140  ? 1108.993 652.481 634.801 1.00 0.00 ? 140  LEU B O  1 
ATOM 3757   C CB . LEU B 1 140  ? 1110.932 654.696 634.146 1.00 0.00 ? 140  LEU B CB 1 
ATOM 3758   N N  . SER B 1 141  ? 1110.910 651.994 635.922 1.00 0.00 ? 141  SER B N  1 
ATOM 3759   C CA . SER B 1 141  ? 1110.337 651.370 637.078 1.00 0.00 ? 141  SER B CA 1 
ATOM 3760   C C  . SER B 1 141  ? 1109.895 652.390 638.090 1.00 0.00 ? 141  SER B C  1 
ATOM 3761   O O  . SER B 1 141  ? 1108.890 652.189 638.769 1.00 0.00 ? 141  SER B O  1 
ATOM 3762   C CB . SER B 1 141  ? 1111.333 650.435 637.785 1.00 0.00 ? 141  SER B CB 1 
ATOM 3763   N N  . GLU B 1 142  ? 1110.617 653.527 638.212 1.00 0.00 ? 142  GLU B N  1 
ATOM 3764   C CA . GLU B 1 142  ? 1110.351 654.411 639.320 1.00 0.00 ? 142  GLU B CA 1 
ATOM 3765   C C  . GLU B 1 142  ? 1109.948 655.777 638.850 1.00 0.00 ? 142  GLU B C  1 
ATOM 3766   O O  . GLU B 1 142  ? 1109.900 656.066 637.656 1.00 0.00 ? 142  GLU B O  1 
ATOM 3767   C CB . GLU B 1 142  ? 1111.570 654.568 640.243 1.00 0.00 ? 142  GLU B CB 1 
ATOM 3768   N N  . THR B 1 143  ? 1109.644 656.657 639.830 1.00 0.00 ? 143  THR B N  1 
ATOM 3769   C CA . THR B 1 143  ? 1109.180 657.991 639.585 1.00 0.00 ? 143  THR B CA 1 
ATOM 3770   C C  . THR B 1 143  ? 1110.193 658.695 638.749 1.00 0.00 ? 143  THR B C  1 
ATOM 3771   O O  . THR B 1 143  ? 1111.388 658.413 638.823 1.00 0.00 ? 143  THR B O  1 
ATOM 3772   C CB . THR B 1 143  ? 1108.985 658.792 640.842 1.00 0.00 ? 143  THR B CB 1 
ATOM 3773   N N  . ILE B 1 144  ? 1109.731 659.632 637.899 1.00 0.00 ? 144  ILE B N  1 
ATOM 3774   C CA . ILE B 1 144  ? 1110.656 660.316 637.045 1.00 0.00 ? 144  ILE B CA 1 
ATOM 3775   C C  . ILE B 1 144  ? 1110.835 661.699 637.573 1.00 0.00 ? 144  ILE B C  1 
ATOM 3776   O O  . ILE B 1 144  ? 1109.910 662.509 637.556 1.00 0.00 ? 144  ILE B O  1 
ATOM 3777   C CB . ILE B 1 144  ? 1110.156 660.460 635.636 1.00 0.00 ? 144  ILE B CB 1 
ATOM 3778   N N  . LEU B 1 145  ? 1112.042 661.980 638.099 1.00 0.00 ? 145  LEU B N  1 
ATOM 3779   C CA . LEU B 1 145  ? 1112.345 663.276 638.630 1.00 0.00 ? 145  LEU B CA 1 
ATOM 3780   C C  . LEU B 1 145  ? 1112.482 664.298 637.540 1.00 0.00 ? 145  LEU B C  1 
ATOM 3781   O O  . LEU B 1 145  ? 1111.877 665.366 637.617 1.00 0.00 ? 145  LEU B O  1 
ATOM 3782   C CB . LEU B 1 145  ? 1113.641 663.276 639.457 1.00 0.00 ? 145  LEU B CB 1 
ATOM 3783   N N  . ALA B 1 146  ? 1113.262 664.001 636.476 1.00 0.00 ? 146  ALA B N  1 
ATOM 3784   C CA . ALA B 1 146  ? 1113.458 665.019 635.480 1.00 0.00 ? 146  ALA B CA 1 
ATOM 3785   C C  . ALA B 1 146  ? 1113.742 664.382 634.154 1.00 0.00 ? 146  ALA B C  1 
ATOM 3786   O O  . ALA B 1 146  ? 1114.168 663.232 634.078 1.00 0.00 ? 146  ALA B O  1 
ATOM 3787   C CB . ALA B 1 146  ? 1114.640 665.954 635.790 1.00 0.00 ? 146  ALA B CB 1 
ATOM 3788   N N  . VAL B 1 147  ? 1113.484 665.137 633.067 1.00 0.00 ? 147  VAL B N  1 
ATOM 3789   C CA . VAL B 1 147  ? 1113.755 664.676 631.735 1.00 0.00 ? 147  VAL B CA 1 
ATOM 3790   C C  . VAL B 1 147  ? 1114.430 665.801 631.016 1.00 0.00 ? 147  VAL B C  1 
ATOM 3791   O O  . VAL B 1 147  ? 1114.278 666.962 631.391 1.00 0.00 ? 147  VAL B O  1 
ATOM 3792   C CB . VAL B 1 147  ? 1112.524 664.317 630.955 1.00 0.00 ? 147  VAL B CB 1 
ATOM 3793   N N  . GLY B 1 148  ? 1115.218 665.485 629.969 1.00 0.00 ? 148  GLY B N  1 
ATOM 3794   C CA . GLY B 1 148  ? 1115.875 666.547 629.260 1.00 0.00 ? 148  GLY B CA 1 
ATOM 3795   C C  . GLY B 1 148  ? 1116.293 666.039 627.920 1.00 0.00 ? 148  GLY B C  1 
ATOM 3796   O O  . GLY B 1 148  ? 1116.461 664.838 627.716 1.00 0.00 ? 148  GLY B O  1 
ATOM 3797   N N  . LEU B 1 149  ? 1116.475 666.967 626.959 1.00 0.00 ? 149  LEU B N  1 
ATOM 3798   C CA . LEU B 1 149  ? 1116.902 666.581 625.648 1.00 0.00 ? 149  LEU B CA 1 
ATOM 3799   C C  . LEU B 1 149  ? 1118.310 667.080 625.535 1.00 0.00 ? 149  LEU B C  1 
ATOM 3800   O O  . LEU B 1 149  ? 1118.594 668.224 625.884 1.00 0.00 ? 149  LEU B O  1 
ATOM 3801   C CB . LEU B 1 149  ? 1116.062 667.221 624.531 1.00 0.00 ? 149  LEU B CB 1 
ATOM 3802   N N  . VAL B 1 150  ? 1119.241 666.225 625.059 1.00 0.00 ? 150  VAL B N  1 
ATOM 3803   C CA . VAL B 1 150  ? 1120.618 666.633 625.020 1.00 0.00 ? 150  VAL B CA 1 
ATOM 3804   C C  . VAL B 1 150  ? 1121.225 666.150 623.732 1.00 0.00 ? 150  VAL B C  1 
ATOM 3805   O O  . VAL B 1 150  ? 1120.681 665.273 623.066 1.00 0.00 ? 150  VAL B O  1 
ATOM 3806   C CB . VAL B 1 150  ? 1121.406 666.035 626.161 1.00 0.00 ? 150  VAL B CB 1 
ATOM 3807   N N  . LYS B 1 151  ? 1122.371 666.748 623.339 1.00 0.00 ? 151  LYS B N  1 
ATOM 3808   C CA . LYS B 1 151  ? 1123.075 666.358 622.154 1.00 0.00 ? 151  LYS B CA 1 
ATOM 3809   C C  . LYS B 1 151  ? 1124.043 665.279 622.538 1.00 0.00 ? 151  LYS B C  1 
ATOM 3810   O O  . LYS B 1 151  ? 1124.485 665.193 623.683 1.00 0.00 ? 151  LYS B O  1 
ATOM 3811   C CB . LYS B 1 151  ? 1123.895 667.498 621.524 1.00 0.00 ? 151  LYS B CB 1 
ATOM 3812   N N  . PRO B 1 152  ? 1124.355 664.432 621.596 1.00 0.00 ? 152  PRO B N  1 
ATOM 3813   C CA . PRO B 1 152  ? 1125.279 663.356 621.831 1.00 0.00 ? 152  PRO B CA 1 
ATOM 3814   C C  . PRO B 1 152  ? 1126.689 663.841 621.814 1.00 0.00 ? 152  PRO B C  1 
ATOM 3815   O O  . PRO B 1 152  ? 1126.953 664.920 621.286 1.00 0.00 ? 152  PRO B O  1 
ATOM 3816   C CB . PRO B 1 152  ? 1124.986 662.296 620.766 1.00 0.00 ? 152  PRO B CB 1 
ATOM 3817   N N  . LYS B 1 153  ? 1127.610 663.046 622.392 1.00 0.00 ? 153  LYS B N  1 
ATOM 3818   C CA . LYS B 1 153  ? 1128.995 663.401 622.458 1.00 0.00 ? 153  LYS B CA 1 
ATOM 3819   C C  . LYS B 1 153  ? 1129.578 663.260 621.091 1.00 0.00 ? 153  LYS B C  1 
ATOM 3820   O O  . LYS B 1 153  ? 1129.027 662.587 620.217 1.00 0.00 ? 153  LYS B O  1 
ATOM 3821   C CB . LYS B 1 153  ? 1129.818 662.518 623.409 1.00 0.00 ? 153  LYS B CB 1 
ATOM 3822   N N  . ALA B 1 154  ? 1130.736 663.912 620.896 1.00 0.00 ? 154  ALA B N  1 
ATOM 3823   C CA . ALA B 1 154  ? 1131.456 663.980 619.660 1.00 0.00 ? 154  ALA B CA 1 
ATOM 3824   C C  . ALA B 1 154  ? 1131.865 662.614 619.244 1.00 0.00 ? 154  ALA B C  1 
ATOM 3825   O O  . ALA B 1 154  ? 1131.890 662.308 618.053 1.00 0.00 ? 154  ALA B O  1 
ATOM 3826   C CB . ALA B 1 154  ? 1132.733 664.831 619.758 1.00 0.00 ? 154  ALA B CB 1 
ATOM 3827   N N  . GLY B 1 155  ? 1132.164 661.724 620.199 1.00 0.00 ? 155  GLY B N  1 
ATOM 3828   C CA . GLY B 1 155  ? 1132.622 660.475 619.688 1.00 0.00 ? 155  GLY B CA 1 
ATOM 3829   C C  . GLY B 1 155  ? 1132.413 659.431 620.720 1.00 0.00 ? 155  GLY B C  1 
ATOM 3830   O O  . GLY B 1 155  ? 1133.208 659.214 621.631 1.00 0.00 ? 155  GLY B O  1 
ATOM 3831   N N  . ILE B 1 156  ? 1131.268 658.757 620.525 1.00 0.00 ? 156  ILE B N  1 
ATOM 3832   C CA . ILE B 1 156  ? 1130.786 657.624 621.243 1.00 0.00 ? 156  ILE B CA 1 
ATOM 3833   C C  . ILE B 1 156  ? 1130.164 656.775 620.190 1.00 0.00 ? 156  ILE B C  1 
ATOM 3834   O O  . ILE B 1 156  ? 1130.183 657.129 619.011 1.00 0.00 ? 156  ILE B O  1 
ATOM 3835   C CB . ILE B 1 156  ? 1129.730 657.911 622.271 1.00 0.00 ? 156  ILE B CB 1 
ATOM 3836   N N  . PHE B 1 157  ? 1129.618 655.614 620.576 1.00 0.00 ? 157  PHE B N  1 
ATOM 3837   C CA . PHE B 1 157  ? 1129.020 654.751 619.605 1.00 0.00 ? 157  PHE B CA 1 
ATOM 3838   C C  . PHE B 1 157  ? 1127.803 655.391 619.012 1.00 0.00 ? 157  PHE B C  1 
ATOM 3839   O O  . PHE B 1 157  ? 1127.497 655.150 617.845 1.00 0.00 ? 157  PHE B O  1 
ATOM 3840   C CB . PHE B 1 157  ? 1128.747 653.316 620.109 1.00 0.00 ? 157  PHE B CB 1 
ATOM 3841   N N  . GLN B 1 158  ? 1127.070 656.239 619.770 1.00 0.00 ? 158  GLN B N  1 
ATOM 3842   C CA . GLN B 1 158  ? 1125.881 656.850 619.222 1.00 0.00 ? 158  GLN B CA 1 
ATOM 3843   C C  . GLN B 1 158  ? 1126.127 658.303 618.855 1.00 0.00 ? 158  GLN B C  1 
ATOM 3844   O O  . GLN B 1 158  ? 1125.237 659.125 619.067 1.00 0.00 ? 158  GLN B O  1 
ATOM 3845   C CB . GLN B 1 158  ? 1124.748 656.828 620.268 1.00 0.00 ? 158  GLN B CB 1 
ATOM 3846   N N  . PRO B 1 159  ? 1127.245 658.708 618.303 1.00 0.00 ? 159  PRO B N  1 
ATOM 3847   C CA . PRO B 1 159  ? 1127.419 660.103 617.998 1.00 0.00 ? 159  PRO B CA 1 
ATOM 3848   C C  . PRO B 1 159  ? 1126.422 660.516 616.959 1.00 0.00 ? 159  PRO B C  1 
ATOM 3849   O O  . PRO B 1 159  ? 1126.055 661.689 616.911 1.00 0.00 ? 159  PRO B O  1 
ATOM 3850   C CB . PRO B 1 159  ? 1128.807 660.193 617.384 1.00 0.00 ? 159  PRO B CB 1 
ATOM 3851   N N  . HIS B 1 160  ? 1126.005 659.561 616.106 1.00 0.00 ? 160  HIS B N  1 
ATOM 3852   C CA . HIS B 1 160  ? 1125.194 659.797 614.945 1.00 0.00 ? 160  HIS B CA 1 
ATOM 3853   C C  . HIS B 1 160  ? 1123.837 660.309 615.309 1.00 0.00 ? 160  HIS B C  1 
ATOM 3854   O O  . HIS B 1 160  ? 1123.327 661.218 614.656 1.00 0.00 ? 160  HIS B O  1 
ATOM 3855   C CB . HIS B 1 160  ? 1125.002 658.523 614.103 1.00 0.00 ? 160  HIS B CB 1 
ATOM 3856   N N  . VAL B 1 161  ? 1123.220 659.762 616.372 1.00 0.00 ? 161  VAL B N  1 
ATOM 3857   C CA . VAL B 1 161  ? 1121.861 660.118 616.668 1.00 0.00 ? 161  VAL B CA 1 
ATOM 3858   C C  . VAL B 1 161  ? 1121.747 661.597 616.870 1.00 0.00 ? 161  VAL B C  1 
ATOM 3859   O O  . VAL B 1 161  ? 1122.655 662.246 617.385 1.00 0.00 ? 161  VAL B O  1 
ATOM 3860   C CB . VAL B 1 161  ? 1121.307 659.438 617.885 1.00 0.00 ? 161  VAL B CB 1 
ATOM 3861   N N  . ARG B 1 162  ? 1120.607 662.160 616.417 1.00 0.00 ? 162  ARG B N  1 
ATOM 3862   C CA . ARG B 1 162  ? 1120.339 663.568 616.473 1.00 0.00 ? 162  ARG B CA 1 
ATOM 3863   C C  . ARG B 1 162  ? 1120.250 664.029 617.897 1.00 0.00 ? 162  ARG B C  1 
ATOM 3864   O O  . ARG B 1 162  ? 1120.875 665.023 618.266 1.00 0.00 ? 162  ARG B O  1 
ATOM 3865   C CB . ARG B 1 162  ? 1119.009 663.939 615.790 1.00 0.00 ? 162  ARG B CB 1 
ATOM 3866   N N  . HIS B 1 163  ? 1119.489 663.312 618.751 1.00 0.00 ? 163  HIS B N  1 
ATOM 3867   C CA . HIS B 1 163  ? 1119.344 663.788 620.098 1.00 0.00 ? 163  HIS B CA 1 
ATOM 3868   C C  . HIS B 1 163  ? 1119.299 662.622 621.032 1.00 0.00 ? 163  HIS B C  1 
ATOM 3869   O O  . HIS B 1 163  ? 1119.090 661.481 620.623 1.00 0.00 ? 163  HIS B O  1 
ATOM 3870   C CB . HIS B 1 163  ? 1118.055 664.596 620.328 1.00 0.00 ? 163  HIS B CB 1 
ATOM 3871   N N  . LEU B 1 164  ? 1119.524 662.903 622.330 1.00 0.00 ? 164  LEU B N  1 
ATOM 3872   C CA . LEU B 1 164  ? 1119.494 661.908 623.365 1.00 0.00 ? 164  LEU B CA 1 
ATOM 3873   C C  . LEU B 1 164  ? 1118.465 662.352 624.354 1.00 0.00 ? 164  LEU B C  1 
ATOM 3874   O O  . LEU B 1 164  ? 1118.244 663.550 624.536 1.00 0.00 ? 164  LEU B O  1 
ATOM 3875   C CB . LEU B 1 164  ? 1120.822 661.795 624.137 1.00 0.00 ? 164  LEU B CB 1 
ATOM 3876   N N  . LEU B 1 165  ? 1117.781 661.393 625.006 1.00 0.00 ? 165  LEU B N  1 
ATOM 3877   C CA . LEU B 1 165  ? 1116.810 661.768 625.991 1.00 0.00 ? 165  LEU B CA 1 
ATOM 3878   C C  . LEU B 1 165  ? 1117.330 661.310 627.315 1.00 0.00 ? 165  LEU B C  1 
ATOM 3879   O O  . LEU B 1 165  ? 1117.557 660.118 627.521 1.00 0.00 ? 165  LEU B O  1 
ATOM 3880   C CB . LEU B 1 165  ? 1115.440 661.101 625.779 1.00 0.00 ? 165  LEU B CB 1 
ATOM 3881   N N  . VAL B 1 166  ? 1117.546 662.251 628.256 1.00 0.00 ? 166  VAL B N  1 
ATOM 3882   C CA . VAL B 1 166  ? 1118.038 661.852 629.543 1.00 0.00 ? 166  VAL B CA 1 
ATOM 3883   C C  . VAL B 1 166  ? 1116.872 661.812 630.474 1.00 0.00 ? 166  VAL B C  1 
ATOM 3884   O O  . VAL B 1 166  ? 1116.049 662.727 630.494 1.00 0.00 ? 166  VAL B O  1 
ATOM 3885   C CB . VAL B 1 166  ? 1119.060 662.797 630.116 1.00 0.00 ? 166  VAL B CB 1 
ATOM 3886   N N  . LEU B 1 167  ? 1116.746 660.725 631.259 1.00 0.00 ? 167  LEU B N  1 
ATOM 3887   C CA . LEU B 1 167  ? 1115.653 660.690 632.178 1.00 0.00 ? 167  LEU B CA 1 
ATOM 3888   C C  . LEU B 1 167  ? 1116.218 660.320 633.510 1.00 0.00 ? 167  LEU B C  1 
ATOM 3889   O O  . LEU B 1 167  ? 1117.012 659.390 633.624 1.00 0.00 ? 167  LEU B O  1 
ATOM 3890   C CB . LEU B 1 167  ? 1114.545 659.701 631.768 1.00 0.00 ? 167  LEU B CB 1 
ATOM 3891   N N  . ALA B 1 168  ? 1115.829 661.067 634.560 1.00 0.00 ? 168  ALA B N  1 
ATOM 3892   C CA . ALA B 1 168  ? 1116.353 660.769 635.858 1.00 0.00 ? 168  ALA B CA 1 
ATOM 3893   C C  . ALA B 1 168  ? 1115.210 660.435 636.758 1.00 0.00 ? 168  ALA B C  1 
ATOM 3894   O O  . ALA B 1 168  ? 1114.181 661.112 636.759 1.00 0.00 ? 168  ALA B O  1 
ATOM 3895   C CB . ALA B 1 168  ? 1117.101 661.948 636.502 1.00 0.00 ? 168  ALA B CB 1 
ATOM 3896   N N  . THR B 1 169  ? 1115.369 659.343 637.526 1.00 0.00 ? 169  THR B N  1 
ATOM 3897   C CA . THR B 1 169  ? 1114.400 658.948 638.504 1.00 0.00 ? 169  THR B CA 1 
ATOM 3898   C C  . THR B 1 169  ? 1115.099 659.071 639.810 1.00 0.00 ? 169  THR B C  1 
ATOM 3899   O O  . THR B 1 169  ? 1116.196 659.620 639.881 1.00 0.00 ? 169  THR B O  1 
ATOM 3900   C CB . THR B 1 169  ? 1113.960 657.519 638.384 1.00 0.00 ? 169  THR B CB 1 
ATOM 3901   N N  . PRO B 1 170  ? 1114.497 658.618 640.870 1.00 0.00 ? 170  PRO B N  1 
ATOM 3902   C CA . PRO B 1 170  ? 1115.210 658.680 642.102 1.00 0.00 ? 170  PRO B CA 1 
ATOM 3903   C C  . PRO B 1 170  ? 1116.455 657.854 642.051 1.00 0.00 ? 170  PRO B C  1 
ATOM 3904   O O  . PRO B 1 170  ? 1117.518 658.360 642.408 1.00 0.00 ? 170  PRO B O  1 
ATOM 3905   C CB . PRO B 1 170  ? 1114.205 658.296 643.183 1.00 0.00 ? 170  PRO B CB 1 
ATOM 3906   N N  . VAL B 1 171  ? 1116.336 656.579 641.628 1.00 0.00 ? 171  VAL B N  1 
ATOM 3907   C CA . VAL B 1 171  ? 1117.445 655.667 641.580 1.00 0.00 ? 171  VAL B CA 1 
ATOM 3908   C C  . VAL B 1 171  ? 1118.375 655.860 640.418 1.00 0.00 ? 171  VAL B C  1 
ATOM 3909   O O  . VAL B 1 171  ? 1119.588 655.914 640.605 1.00 0.00 ? 171  VAL B O  1 
ATOM 3910   C CB . VAL B 1 171  ? 1117.007 654.232 641.542 1.00 0.00 ? 171  VAL B CB 1 
ATOM 3911   N N  . ASP B 1 172  ? 1117.846 655.983 639.179 1.00 0.00 ? 172  ASP B N  1 
ATOM 3912   C CA . ASP B 1 172  ? 1118.770 655.897 638.079 1.00 0.00 ? 172  ASP B CA 1 
ATOM 3913   C C  . ASP B 1 172  ? 1118.566 656.978 637.072 1.00 0.00 ? 172  ASP B C  1 
ATOM 3914   O O  . ASP B 1 172  ? 1117.550 657.673 637.055 1.00 0.00 ? 172  ASP B O  1 
ATOM 3915   C CB . ASP B 1 172  ? 1118.628 654.577 637.303 1.00 0.00 ? 172  ASP B CB 1 
ATOM 3916   N N  . ILE B 1 173  ? 1119.587 657.138 636.203 1.00 0.00 ? 173  ILE B N  1 
ATOM 3917   C CA . ILE B 1 173  ? 1119.537 658.038 635.091 1.00 0.00 ? 173  ILE B CA 1 
ATOM 3918   C C  . ILE B 1 173  ? 1119.647 657.165 633.884 1.00 0.00 ? 173  ILE B C  1 
ATOM 3919   O O  . ILE B 1 173  ? 1120.558 656.343 633.779 1.00 0.00 ? 173  ILE B O  1 
ATOM 3920   C CB . ILE B 1 173  ? 1120.670 659.021 635.049 1.00 0.00 ? 173  ILE B CB 1 
ATOM 3921   N N  . VAL B 1 174  ? 1118.695 657.310 632.944 1.00 0.00 ? 174  VAL B N  1 
ATOM 3922   C CA . VAL B 1 174  ? 1118.716 656.477 631.780 1.00 0.00 ? 174  VAL B CA 1 
ATOM 3923   C C  . VAL B 1 174  ? 1118.928 657.357 630.595 1.00 0.00 ? 174  VAL B C  1 
ATOM 3924   O O  . VAL B 1 174  ? 1118.481 658.503 630.567 1.00 0.00 ? 174  VAL B O  1 
ATOM 3925   C CB . VAL B 1 174  ? 1117.429 655.742 631.548 1.00 0.00 ? 174  VAL B CB 1 
ATOM 3926   N N  . ILE B 1 175  ? 1119.649 656.840 629.579 1.00 0.00 ? 175  ILE B N  1 
ATOM 3927   C CA . ILE B 1 175  ? 1119.886 657.632 628.410 1.00 0.00 ? 175  ILE B CA 1 
ATOM 3928   C C  . ILE B 1 175  ? 1119.335 656.889 627.232 1.00 0.00 ? 175  ILE B C  1 
ATOM 3929   O O  . ILE B 1 175  ? 1119.660 655.722 627.018 1.00 0.00 ? 175  ILE B O  1 
ATOM 3930   C CB . ILE B 1 175  ? 1121.350 657.858 628.150 1.00 0.00 ? 175  ILE B CB 1 
ATOM 3931   N N  . LEU B 1 176  ? 1118.464 657.545 626.437 1.00 0.00 ? 176  LEU B N  1 
ATOM 3932   C CA . LEU B 1 176  ? 1117.931 656.877 625.285 1.00 0.00 ? 176  LEU B CA 1 
ATOM 3933   C C  . LEU B 1 176  ? 1118.182 657.719 624.080 1.00 0.00 ? 176  LEU B C  1 
ATOM 3934   O O  . LEU B 1 176  ? 1118.592 658.873 624.182 1.00 0.00 ? 176  LEU B O  1 
ATOM 3935   C CB . LEU B 1 176  ? 1116.430 656.558 625.341 1.00 0.00 ? 176  LEU B CB 1 
ATOM 3936   N N  . GLY B 1 177  ? 1117.956 657.135 622.885 1.00 0.00 ? 177  GLY B N  1 
ATOM 3937   C CA . GLY B 1 177  ? 1118.188 657.871 621.681 1.00 0.00 ? 177  GLY B CA 1 
ATOM 3938   C C  . GLY B 1 177  ? 1116.873 658.134 621.029 1.00 0.00 ? 177  GLY B C  1 
ATOM 3939   O O  . GLY B 1 177  ? 1115.980 657.287 621.027 1.00 0.00 ? 177  GLY B O  1 
ATOM 3940   N N  . LEU B 1 178  ? 1116.738 659.346 620.456 1.00 0.00 ? 178  LEU B N  1 
ATOM 3941   C CA . LEU B 1 178  ? 1115.562 659.766 619.749 1.00 0.00 ? 178  LEU B CA 1 
ATOM 3942   C C  . LEU B 1 178  ? 1115.970 659.910 618.325 1.00 0.00 ? 178  LEU B C  1 
ATOM 3943   O O  . LEU B 1 178  ? 1117.070 660.374 618.030 1.00 0.00 ? 178  LEU B O  1 
ATOM 3944   C CB . LEU B 1 178  ? 1115.086 661.180 620.130 1.00 0.00 ? 178  LEU B CB 1 
ATOM 3945   N N  . SER B 1 179  ? 1115.088 659.496 617.399 1.00 0.00 ? 179  SER B N  1 
ATOM 3946   C CA . SER B 1 179  ? 1115.391 659.666 616.013 1.00 0.00 ? 179  SER B CA 1 
ATOM 3947   C C  . SER B 1 179  ? 1114.094 659.605 615.275 1.00 0.00 ? 179  SER B C  1 
ATOM 3948   O O  . SER B 1 179  ? 1113.060 659.251 615.839 1.00 0.00 ? 179  SER B O  1 
ATOM 3949   C CB . SER B 1 179  ? 1116.312 658.576 615.438 1.00 0.00 ? 179  SER B CB 1 
ATOM 3950   N N  . TYR B 1 180  ? 1114.119 659.974 613.983 1.00 0.00 ? 180  TYR B N  1 
ATOM 3951   C CA . TYR B 1 180  ? 1112.934 659.908 613.184 1.00 0.00 ? 180  TYR B CA 1 
ATOM 3952   C C  . TYR B 1 180  ? 1113.119 658.857 612.150 1.00 0.00 ? 180  TYR B C  1 
ATOM 3953   O O  . TYR B 1 180  ? 1114.163 658.781 611.504 1.00 0.00 ? 180  TYR B O  1 
ATOM 3954   C CB . TYR B 1 180  ? 1112.603 661.182 612.387 1.00 0.00 ? 180  TYR B CB 1 
ATOM 3955   N N  . ALA B 1 181  ? 1112.101 657.994 611.988 1.00 0.00 ? 181  ALA B N  1 
ATOM 3956   C CA . ALA B 1 181  ? 1112.197 657.034 610.938 1.00 0.00 ? 181  ALA B CA 1 
ATOM 3957   C C  . ALA B 1 181  ? 1112.115 657.843 609.689 1.00 0.00 ? 181  ALA B C  1 
ATOM 3958   O O  . ALA B 1 181  ? 1111.325 658.780 609.594 1.00 0.00 ? 181  ALA B O  1 
ATOM 3959   C CB . ALA B 1 181  ? 1111.042 656.020 610.921 1.00 0.00 ? 181  ALA B CB 1 
ATOM 3960   N N  . ASN B 1 182  ? 1112.953 657.517 608.698 1.00 0.00 ? 182  ASN B N  1 
ATOM 3961   C CA . ASN B 1 182  ? 1112.965 658.298 607.501 1.00 0.00 ? 182  ASN B CA 1 
ATOM 3962   C C  . ASN B 1 182  ? 1111.673 658.100 606.781 1.00 0.00 ? 182  ASN B C  1 
ATOM 3963   O O  . ASN B 1 182  ? 1111.654 657.729 605.609 1.00 0.00 ? 182  ASN B O  1 
ATOM 3964   C CB . ASN B 1 182  ? 1114.099 657.903 606.548 1.00 0.00 ? 182  ASN B CB 1 
ATOM 3965   N N  . LEU B 1 194  ? 1111.245 655.347 607.230 1.00 0.00 ? 194  LEU B N  1 
ATOM 3966   C CA . LEU B 1 194  ? 1110.133 655.042 606.382 1.00 0.00 ? 194  LEU B CA 1 
ATOM 3967   C C  . LEU B 1 194  ? 1108.867 655.685 606.851 1.00 0.00 ? 194  LEU B C  1 
ATOM 3968   O O  . LEU B 1 194  ? 1108.252 656.466 606.128 1.00 0.00 ? 194  LEU B O  1 
ATOM 3969   C CB . LEU B 1 194  ? 1109.870 653.530 606.320 1.00 0.00 ? 194  LEU B CB 1 
ATOM 3970   N N  . SER B 1 195  ? 1108.457 655.390 608.099 1.00 0.00 ? 195  SER B N  1 
ATOM 3971   C CA . SER B 1 195  ? 1107.191 655.868 608.576 1.00 0.00 ? 195  SER B CA 1 
ATOM 3972   C C  . SER B 1 195  ? 1107.265 657.322 608.885 1.00 0.00 ? 195  SER B C  1 
ATOM 3973   O O  . SER B 1 195  ? 1106.298 658.058 608.686 1.00 0.00 ? 195  SER B O  1 
ATOM 3974   C CB . SER B 1 195  ? 1106.708 655.160 609.851 1.00 0.00 ? 195  SER B CB 1 
ATOM 3975   N N  . GLY B 1 196  ? 1108.425 657.792 609.367 1.00 0.00 ? 196  GLY B N  1 
ATOM 3976   C CA . GLY B 1 196  ? 1108.473 659.164 609.767 1.00 0.00 ? 196  GLY B CA 1 
ATOM 3977   C C  . GLY B 1 196  ? 1107.983 659.199 611.180 1.00 0.00 ? 196  GLY B C  1 
ATOM 3978   O O  . GLY B 1 196  ? 1107.620 660.252 611.703 1.00 0.00 ? 196  GLY B O  1 
ATOM 3979   N N  . GLY B 1 197  ? 1107.958 658.018 611.827 1.00 0.00 ? 197  GLY B N  1 
ATOM 3980   C CA . GLY B 1 197  ? 1107.523 657.918 613.189 1.00 0.00 ? 197  GLY B CA 1 
ATOM 3981   C C  . GLY B 1 197  ? 1108.697 658.246 614.053 1.00 0.00 ? 197  GLY B C  1 
ATOM 3982   O O  . GLY B 1 197  ? 1109.743 658.676 613.570 1.00 0.00 ? 197  GLY B O  1 
ATOM 3983   N N  . MET B 1 198  ? 1108.542 658.038 615.373 1.00 0.00 ? 198  MET B N  1 
ATOM 3984   C CA . MET B 1 198  ? 1109.566 658.382 616.312 1.00 0.00 ? 198  MET B CA 1 
ATOM 3985   C C  . MET B 1 198  ? 1110.206 657.111 616.765 1.00 0.00 ? 198  MET B C  1 
ATOM 3986   O O  . MET B 1 198  ? 1109.526 656.124 617.040 1.00 0.00 ? 198  MET B O  1 
ATOM 3987   C CB . MET B 1 198  ? 1108.965 659.068 617.545 1.00 0.00 ? 198  MET B CB 1 
ATOM 3988   N N  . GLN B 1 199  ? 1111.550 657.096 616.834 1.00 0.00 ? 199  GLN B N  1 
ATOM 3989   C CA . GLN B 1 199  ? 1112.194 655.900 617.286 1.00 0.00 ? 199  GLN B CA 1 
ATOM 3990   C C  . GLN B 1 199  ? 1112.947 656.201 618.535 1.00 0.00 ? 199  GLN B C  1 
ATOM 3991   O O  . GLN B 1 199  ? 1113.753 657.130 618.595 1.00 0.00 ? 199  GLN B O  1 
ATOM 3992   C CB . GLN B 1 199  ? 1113.184 655.288 616.281 1.00 0.00 ? 199  GLN B CB 1 
ATOM 3993   N N  . LEU B 1 200  ? 1112.669 655.404 619.581 1.00 0.00 ? 200  LEU B N  1 
ATOM 3994   C CA . LEU B 1 200  ? 1113.329 655.509 620.846 1.00 0.00 ? 200  LEU B CA 1 
ATOM 3995   C C  . LEU B 1 200  ? 1113.996 654.208 621.122 1.00 0.00 ? 200  LEU B C  1 
ATOM 3996   O O  . LEU B 1 200  ? 1113.374 653.149 621.062 1.00 0.00 ? 200  LEU B O  1 
ATOM 3997   C CB . LEU B 1 200  ? 1112.364 655.799 622.001 1.00 0.00 ? 200  LEU B CB 1 
ATOM 3998   N N  . LEU B 1 201  ? 1115.306 654.261 621.414 1.00 0.00 ? 201  LEU B N  1 
ATOM 3999   C CA . LEU B 1 201  ? 1115.985 653.044 621.721 1.00 0.00 ? 201  LEU B CA 1 
ATOM 4000   C C  . LEU B 1 201  ? 1116.766 653.273 622.965 1.00 0.00 ? 201  LEU B C  1 
ATOM 4001   O O  . LEU B 1 201  ? 1117.374 654.324 623.157 1.00 0.00 ? 201  LEU B O  1 
ATOM 4002   C CB . LEU B 1 201  ? 1116.959 652.583 620.628 1.00 0.00 ? 201  LEU B CB 1 
ATOM 4003   N N  . PRO B 1 202  ? 1116.726 652.314 623.838 1.00 0.00 ? 202  PRO B N  1 
ATOM 4004   C CA . PRO B 1 202  ? 1117.475 652.380 625.049 1.00 0.00 ? 202  PRO B CA 1 
ATOM 4005   C C  . PRO B 1 202  ? 1118.908 652.234 624.681 1.00 0.00 ? 202  PRO B C  1 
ATOM 4006   O O  . PRO B 1 202  ? 1119.248 651.324 623.925 1.00 0.00 ? 202  PRO B O  1 
ATOM 4007   C CB . PRO B 1 202  ? 1116.950 651.250 625.935 1.00 0.00 ? 202  PRO B CB 1 
ATOM 4008   N N  . ASP B 1 203  ? 1119.761 653.122 625.203 1.00 0.00 ? 203  ASP B N  1 
ATOM 4009   C CA . ASP B 1 203  ? 1121.166 652.998 624.984 1.00 0.00 ? 203  ASP B CA 1 
ATOM 4010   C C  . ASP B 1 203  ? 1121.593 652.650 626.348 1.00 0.00 ? 203  ASP B C  1 
ATOM 4011   O O  . ASP B 1 203  ? 1122.113 653.523 627.038 1.00 0.00 ? 203  ASP B O  1 
ATOM 4012   C CB . ASP B 1 203  ? 1121.802 654.360 624.654 1.00 0.00 ? 203  ASP B CB 1 
ATOM 4013   N N  . PRO B 1 204  ? 1121.380 651.390 626.695 1.00 0.00 ? 204  PRO B N  1 
ATOM 4014   C CA . PRO B 1 204  ? 1121.491 650.910 628.051 1.00 0.00 ? 204  PRO B CA 1 
ATOM 4015   C C  . PRO B 1 204  ? 1122.634 651.507 628.780 1.00 0.00 ? 204  PRO B C  1 
ATOM 4016   O O  . PRO B 1 204  ? 1123.750 650.992 628.750 1.00 0.00 ? 204  PRO B O  1 
ATOM 4017   C CB . PRO B 1 204  ? 1121.538 649.386 627.966 1.00 0.00 ? 204  PRO B CB 1 
ATOM 4018   N N  . LEU B 1 205  ? 1122.307 652.611 629.464 1.00 0.00 ? 205  LEU B N  1 
ATOM 4019   C CA . LEU B 1 205  ? 1123.195 653.423 630.215 1.00 0.00 ? 205  LEU B CA 1 
ATOM 4020   C C  . LEU B 1 205  ? 1122.278 654.227 631.068 1.00 0.00 ? 205  LEU B C  1 
ATOM 4021   O O  . LEU B 1 205  ? 1121.148 653.816 631.333 1.00 0.00 ? 205  LEU B O  1 
ATOM 4022   C CB . LEU B 1 205  ? 1123.950 654.475 629.380 1.00 0.00 ? 205  LEU B CB 1 
ATOM 4023   N N  . SER B 1 207  ? 1123.263 652.358 632.931 1.00 0.00 ? 207  SER B N  1 
ATOM 4024   C CA . SER B 1 207  ? 1122.421 653.139 633.783 1.00 0.00 ? 207  SER B CA 1 
ATOM 4025   C C  . SER B 1 207  ? 1123.329 653.762 634.783 1.00 0.00 ? 207  SER B C  1 
ATOM 4026   O O  . SER B 1 207  ? 1124.391 653.219 635.092 1.00 0.00 ? 207  SER B O  1 
ATOM 4027   C CB . SER B 1 207  ? 1121.364 652.317 634.537 1.00 0.00 ? 207  SER B CB 1 
ATOM 4028   N N  . LEU B 1 208  ? 1122.951 654.947 635.289 1.00 0.00 ? 208  LEU B N  1 
ATOM 4029   C CA . LEU B 1 208  ? 1123.815 655.604 636.219 1.00 0.00 ? 208  LEU B CA 1 
ATOM 4030   C C  . LEU B 1 208  ? 1123.096 655.625 637.527 1.00 0.00 ? 208  LEU B C  1 
ATOM 4031   O O  . LEU B 1 208  ? 1121.975 656.125 637.623 1.00 0.00 ? 208  LEU B O  1 
ATOM 4032   C CB . LEU B 1 208  ? 1124.116 657.051 635.781 1.00 0.00 ? 208  LEU B CB 1 
ATOM 4033   N N  . PRO B 1 209  ? 1123.695 655.045 638.530 1.00 0.00 ? 209  PRO B N  1 
ATOM 4034   C CA . PRO B 1 209  ? 1123.066 655.070 639.817 1.00 0.00 ? 209  PRO B CA 1 
ATOM 4035   C C  . PRO B 1 209  ? 1123.153 656.437 640.397 1.00 0.00 ? 209  PRO B C  1 
ATOM 4036   O O  . PRO B 1 209  ? 1124.263 656.951 640.534 1.00 0.00 ? 209  PRO B O  1 
ATOM 4037   C CB . PRO B 1 209  ? 1123.758 653.994 640.650 1.00 0.00 ? 209  PRO B CB 1 
ATOM 4038   N N  . THR B 1 210  ? 1122.015 657.045 640.766 1.00 0.00 ? 210  THR B N  1 
ATOM 4039   C CA . THR B 1 210  ? 1122.114 658.341 641.364 1.00 0.00 ? 210  THR B CA 1 
ATOM 4040   C C  . THR B 1 210  ? 1121.057 658.394 642.433 1.00 0.00 ? 210  THR B C  1 
ATOM 4041   O O  . THR B 1 210  ? 1120.215 659.288 642.490 1.00 0.00 ? 210  THR B O  1 
ATOM 4042   C CB . THR B 1 210  ? 1121.978 659.408 640.305 1.00 0.00 ? 210  THR B CB 1 
ATOM 4043   N N  . ASP B 1 211  ? 1121.135 657.425 643.364 1.00 0.00 ? 211  ASP B N  1 
ATOM 4044   C CA . ASP B 1 211  ? 1120.135 657.214 644.374 1.00 0.00 ? 211  ASP B CA 1 
ATOM 4045   C C  . ASP B 1 211  ? 1120.002 658.395 645.285 1.00 0.00 ? 211  ASP B C  1 
ATOM 4046   O O  . ASP B 1 211  ? 1118.904 658.898 645.507 1.00 0.00 ? 211  ASP B O  1 
ATOM 4047   C CB . ASP B 1 211  ? 1120.486 655.997 645.251 1.00 0.00 ? 211  ASP B CB 1 
ATOM 4048   N N  . ASN B 1 212  ? 1121.130 658.878 645.830 1.00 0.00 ? 212  ASN B N  1 
ATOM 4049   C CA . ASN B 1 212  ? 1121.111 659.919 646.815 1.00 0.00 ? 212  ASN B CA 1 
ATOM 4050   C C  . ASN B 1 212  ? 1120.713 661.235 646.210 1.00 0.00 ? 212  ASN B C  1 
ATOM 4051   O O  . ASN B 1 212  ? 1120.057 662.052 646.854 1.00 0.00 ? 212  ASN B O  1 
ATOM 4052   C CB . ASN B 1 212  ? 1122.482 660.103 647.496 1.00 0.00 ? 212  ASN B CB 1 
ATOM 4053   N N  . THR B 1 213  ? 1121.069 661.454 644.930 1.00 0.00 ? 213  THR B N  1 
ATOM 4054   C CA . THR B 1 213  ? 1121.009 662.758 644.327 1.00 0.00 ? 213  THR B CA 1 
ATOM 4055   C C  . THR B 1 213  ? 1119.658 663.425 644.308 1.00 0.00 ? 213  THR B C  1 
ATOM 4056   O O  . THR B 1 213  ? 1119.577 664.593 644.687 1.00 0.00 ? 213  THR B O  1 
ATOM 4057   C CB . THR B 1 213  ? 1121.521 662.787 642.915 1.00 0.00 ? 213  THR B CB 1 
ATOM 4058   N N  . TYR B 1 214  ? 1118.555 662.742 643.935 1.00 0.00 ? 214  TYR B N  1 
ATOM 4059   C CA . TYR B 1 214  ? 1117.341 663.488 643.736 1.00 0.00 ? 214  TYR B CA 1 
ATOM 4060   C C  . TYR B 1 214  ? 1117.644 664.576 642.742 1.00 0.00 ? 214  TYR B C  1 
ATOM 4061   O O  . TYR B 1 214  ? 1117.574 665.762 643.062 1.00 0.00 ? 214  TYR B O  1 
ATOM 4062   C CB . TYR B 1 214  ? 1116.791 664.146 645.017 1.00 0.00 ? 214  TYR B CB 1 
ATOM 4063   N N  . LEU B 1 215  ? 1118.007 664.172 641.503 1.00 0.00 ? 215  LEU B N  1 
ATOM 4064   C CA . LEU B 1 215  ? 1118.425 665.047 640.439 1.00 0.00 ? 215  LEU B CA 1 
ATOM 4065   C C  . LEU B 1 215  ? 1117.332 666.020 640.119 1.00 0.00 ? 215  LEU B C  1 
ATOM 4066   O O  . LEU B 1 215  ? 1116.305 665.650 639.557 1.00 0.00 ? 215  LEU B O  1 
ATOM 4067   C CB . LEU B 1 215  ? 1118.781 664.237 639.168 1.00 0.00 ? 215  LEU B CB 1 
ATOM 4068   N N  . LEU B 1 216  ? 1117.530 667.296 640.522 1.00 0.00 ? 216  LEU B N  1 
ATOM 4069   C CA . LEU B 1 216  ? 1116.606 668.362 640.247 1.00 0.00 ? 216  LEU B CA 1 
ATOM 4070   C C  . LEU B 1 216  ? 1116.703 668.829 638.821 1.00 0.00 ? 216  LEU B C  1 
ATOM 4071   O O  . LEU B 1 216  ? 1115.687 668.924 638.133 1.00 0.00 ? 216  LEU B O  1 
ATOM 4072   C CB . LEU B 1 216  ? 1116.839 669.569 641.184 1.00 0.00 ? 216  LEU B CB 1 
ATOM 4073   N N  . THR B 1 217  ? 1117.930 669.114 638.325 1.00 0.00 ? 217  THR B N  1 
ATOM 4074   C CA . THR B 1 217  ? 1118.024 669.751 637.036 1.00 0.00 ? 217  THR B CA 1 
ATOM 4075   C C  . THR B 1 217  ? 1119.055 669.079 636.183 1.00 0.00 ? 217  THR B C  1 
ATOM 4076   O O  . THR B 1 217  ? 1120.001 668.471 636.679 1.00 0.00 ? 217  THR B O  1 
ATOM 4077   C CB . THR B 1 217  ? 1118.417 671.196 637.133 1.00 0.00 ? 217  THR B CB 1 
ATOM 4078   N N  . ILE B 1 218  ? 1118.861 669.165 634.848 1.00 0.00 ? 218  ILE B N  1 
ATOM 4079   C CA . ILE B 1 218  ? 1119.793 668.605 633.913 1.00 0.00 ? 218  ILE B CA 1 
ATOM 4080   C C  . ILE B 1 218  ? 1119.985 669.601 632.811 1.00 0.00 ? 218  ILE B C  1 
ATOM 4081   O O  . ILE B 1 218  ? 1119.037 670.263 632.391 1.00 0.00 ? 218  ILE B O  1 
ATOM 4082   C CB . ILE B 1 218  ? 1119.296 667.339 633.275 1.00 0.00 ? 218  ILE B CB 1 
ATOM 4083   N N  . THR B 1 219  ? 1121.236 669.752 632.333 1.00 0.00 ? 219  THR B N  1 
ATOM 4084   C CA . THR B 1 219  ? 1121.500 670.626 631.225 1.00 0.00 ? 219  THR B CA 1 
ATOM 4085   C C  . THR B 1 219  ? 1122.653 670.028 630.488 1.00 0.00 ? 219  THR B C  1 
ATOM 4086   O O  . THR B 1 219  ? 1123.244 669.049 630.939 1.00 0.00 ? 219  THR B O  1 
ATOM 4087   C CB . THR B 1 219  ? 1121.916 672.012 631.611 1.00 0.00 ? 219  THR B CB 1 
ATOM 4088   N N  . SER B 1 220  ? 1122.998 670.591 629.316 1.00 0.00 ? 220  SER B N  1 
ATOM 4089   C CA . SER B 1 220  ? 1124.108 670.021 628.616 1.00 0.00 ? 220  SER B CA 1 
ATOM 4090   C C  . SER B 1 220  ? 1124.840 671.102 627.901 1.00 0.00 ? 220  SER B C  1 
ATOM 4091   O O  . SER B 1 220  ? 1124.309 672.181 627.644 1.00 0.00 ? 220  SER B O  1 
ATOM 4092   C CB . SER B 1 220  ? 1123.698 668.996 627.548 1.00 0.00 ? 220  SER B CB 1 
ATOM 4093   N N  . THR B 1 221  ? 1126.117 670.821 627.590 1.00 0.00 ? 221  THR B N  1 
ATOM 4094   C CA . THR B 1 221  ? 1126.912 671.690 626.781 1.00 0.00 ? 221  THR B CA 1 
ATOM 4095   C C  . THR B 1 221  ? 1126.966 670.938 625.501 1.00 0.00 ? 221  THR B C  1 
ATOM 4096   O O  . THR B 1 221  ? 1126.940 669.708 625.510 1.00 0.00 ? 221  THR B O  1 
ATOM 4097   C CB . THR B 1 221  ? 1128.318 671.864 627.278 1.00 0.00 ? 221  THR B CB 1 
ATOM 4098   N N  . ASP B 1 222  ? 1127.030 671.626 624.347 1.00 0.00 ? 222  ASP B N  1 
ATOM 4099   C CA . ASP B 1 222  ? 1126.961 670.846 623.149 1.00 0.00 ? 222  ASP B CA 1 
ATOM 4100   C C  . ASP B 1 222  ? 1128.273 670.174 622.895 1.00 0.00 ? 222  ASP B C  1 
ATOM 4101   O O  . ASP B 1 222  ? 1128.521 669.675 621.800 1.00 0.00 ? 222  ASP B O  1 
ATOM 4102   C CB . ASP B 1 222  ? 1126.541 671.654 621.913 1.00 0.00 ? 222  ASP B CB 1 
ATOM 4103   N N  . ASN B 1 223  ? 1129.147 670.136 623.917 1.00 0.00 ? 223  ASN B N  1 
ATOM 4104   C CA . ASN B 1 223  ? 1130.338 669.344 623.848 1.00 0.00 ? 223  ASN B CA 1 
ATOM 4105   C C  . ASN B 1 223  ? 1129.796 667.962 623.897 1.00 0.00 ? 223  ASN B C  1 
ATOM 4106   O O  . ASN B 1 223  ? 1130.387 667.010 623.389 1.00 0.00 ? 223  ASN B O  1 
ATOM 4107   C CB . ASN B 1 223  ? 1131.266 669.528 625.060 1.00 0.00 ? 223  ASN B CB 1 
ATOM 4108   N N  . GLY B 1 224  ? 1128.607 667.848 624.517 1.00 0.00 ? 224  GLY B N  1 
ATOM 4109   C CA . GLY B 1 224  ? 1127.966 666.586 624.693 1.00 0.00 ? 224  GLY B CA 1 
ATOM 4110   C C  . GLY B 1 224  ? 1128.056 666.262 626.141 1.00 0.00 ? 224  GLY B C  1 
ATOM 4111   O O  . GLY B 1 224  ? 1127.525 665.252 626.598 1.00 0.00 ? 224  GLY B O  1 
ATOM 4112   N N  . ARG B 1 225  ? 1128.747 667.133 626.900 1.00 0.00 ? 225  ARG B N  1 
ATOM 4113   C CA . ARG B 1 225  ? 1128.872 666.940 628.309 1.00 0.00 ? 225  ARG B CA 1 
ATOM 4114   C C  . ARG B 1 225  ? 1127.545 667.248 628.914 1.00 0.00 ? 225  ARG B C  1 
ATOM 4115   O O  . ARG B 1 225  ? 1126.813 668.110 628.429 1.00 0.00 ? 225  ARG B O  1 
ATOM 4116   C CB . ARG B 1 225  ? 1129.919 667.860 628.956 1.00 0.00 ? 225  ARG B CB 1 
ATOM 4117   N N  . ILE B 1 226  ? 1127.187 666.517 629.987 1.00 0.00 ? 226  ILE B N  1 
ATOM 4118   C CA . ILE B 1 226  ? 1125.923 666.754 630.616 1.00 0.00 ? 226  ILE B CA 1 
ATOM 4119   C C  . ILE B 1 226  ? 1126.193 667.131 632.036 1.00 0.00 ? 226  ILE B C  1 
ATOM 4120   O O  . ILE B 1 226  ? 1126.956 666.464 632.732 1.00 0.00 ? 226  ILE B O  1 
ATOM 4121   C CB . ILE B 1 226  ? 1125.038 665.543 630.624 1.00 0.00 ? 226  ILE B CB 1 
ATOM 4122   N N  . PHE B 1 227  ? 1125.575 668.237 632.493 1.00 0.00 ? 227  PHE B N  1 
ATOM 4123   C CA . PHE B 1 227  ? 1125.766 668.670 633.845 1.00 0.00 ? 227  PHE B CA 1 
ATOM 4124   C C  . PHE B 1 227  ? 1124.426 668.587 634.493 1.00 0.00 ? 227  PHE B C  1 
ATOM 4125   O O  . PHE B 1 227  ? 1123.426 668.995 633.907 1.00 0.00 ? 227  PHE B O  1 
ATOM 4126   C CB . PHE B 1 227  ? 1126.179 670.147 633.961 1.00 0.00 ? 227  PHE B CB 1 
ATOM 4127   N N  . LEU B 1 228  ? 1124.353 668.031 635.717 1.00 0.00 ? 228  LEU B N  1 
ATOM 4128   C CA . LEU B 1 228  ? 1123.071 668.017 636.348 1.00 0.00 ? 228  LEU B CA 1 
ATOM 4129   C C  . LEU B 1 228  ? 1123.265 668.331 637.790 1.00 0.00 ? 228  LEU B C  1 
ATOM 4130   O O  . LEU B 1 228  ? 1124.365 668.199 638.320 1.00 0.00 ? 228  LEU B O  1 
ATOM 4131   C CB . LEU B 1 228  ? 1122.264 666.712 636.108 1.00 0.00 ? 228  LEU B CB 1 
ATOM 4132   N N  . ALA B 1 229  ? 1122.196 668.787 638.463 1.00 0.00 ? 229  ALA B N  1 
ATOM 4133   C CA . ALA B 1 229  ? 1122.339 669.077 639.853 1.00 0.00 ? 229  ALA B CA 1 
ATOM 4134   C C  . ALA B 1 229  ? 1121.316 668.281 640.579 1.00 0.00 ? 229  ALA B C  1 
ATOM 4135   O O  . ALA B 1 229  ? 1120.211 668.057 640.092 1.00 0.00 ? 229  ALA B O  1 
ATOM 4136   C CB . ALA B 1 229  ? 1122.097 670.555 640.204 1.00 0.00 ? 229  ALA B CB 1 
ATOM 4137   N N  . GLY B 1 230  ? 1121.686 667.784 641.768 1.00 0.00 ? 230  GLY B N  1 
ATOM 4138   C CA . GLY B 1 230  ? 1120.723 667.086 642.552 1.00 0.00 ? 230  GLY B CA 1 
ATOM 4139   C C  . GLY B 1 230  ? 1120.260 668.075 643.554 1.00 0.00 ? 230  GLY B C  1 
ATOM 4140   O O  . GLY B 1 230  ? 1120.614 669.251 643.490 1.00 0.00 ? 230  GLY B O  1 
ATOM 4141   N N  . LYS B 1 231  ? 1119.458 667.624 644.530 1.00 0.00 ? 231  LYS B N  1 
ATOM 4142   C CA . LYS B 1 231  ? 1119.086 668.535 645.563 1.00 0.00 ? 231  LYS B CA 1 
ATOM 4143   C C  . LYS B 1 231  ? 1120.210 668.387 646.541 1.00 0.00 ? 231  LYS B C  1 
ATOM 4144   O O  . LYS B 1 231  ? 1120.009 668.075 647.713 1.00 0.00 ? 231  LYS B O  1 
ATOM 4145   C CB . LYS B 1 231  ? 1117.769 668.095 646.228 1.00 0.00 ? 231  LYS B CB 1 
ATOM 4146   N N  . ASP B 1 232  ? 1121.445 668.616 646.042 1.00 0.00 ? 232  ASP B N  1 
ATOM 4147   C CA . ASP B 1 232  ? 1122.652 668.433 646.789 1.00 0.00 ? 232  ASP B CA 1 
ATOM 4148   C C  . ASP B 1 232  ? 1123.572 669.543 646.407 1.00 0.00 ? 232  ASP B C  1 
ATOM 4149   O O  . ASP B 1 232  ? 1124.636 669.312 645.832 1.00 0.00 ? 232  ASP B O  1 
ATOM 4150   C CB . ASP B 1 232  ? 1123.358 667.125 646.391 1.00 0.00 ? 232  ASP B CB 1 
ATOM 4151   N N  . GLY B 1 233  ? 1123.188 670.793 646.712 1.00 0.00 ? 233  GLY B N  1 
ATOM 4152   C CA . GLY B 1 233  ? 1124.071 671.877 646.412 1.00 0.00 ? 233  GLY B CA 1 
ATOM 4153   C C  . GLY B 1 233  ? 1124.018 672.179 644.948 1.00 0.00 ? 233  GLY B C  1 
ATOM 4154   O O  . GLY B 1 233  ? 1123.078 671.810 644.244 1.00 0.00 ? 233  GLY B O  1 
ATOM 4155   N N  . CYS B 1 234  ? 1125.036 672.936 644.493 1.00 0.00 ? 234  CYS B N  1 
ATOM 4156   C CA . CYS B 1 234  ? 1125.179 673.463 643.164 1.00 0.00 ? 234  CYS B CA 1 
ATOM 4157   C C  . CYS B 1 234  ? 1125.451 672.487 642.013 1.00 0.00 ? 234  CYS B C  1 
ATOM 4158   O O  . CYS B 1 234  ? 1124.627 672.401 641.104 1.00 0.00 ? 234  CYS B O  1 
ATOM 4159   C CB . CYS B 1 234  ? 1126.319 674.489 643.105 1.00 0.00 ? 234  CYS B CB 1 
ATOM 4160   N N  . LEU B 1 235  ? 1126.572 671.700 641.994 1.00 0.00 ? 235  LEU B N  1 
ATOM 4161   C CA . LEU B 1 235  ? 1126.883 671.011 640.741 1.00 0.00 ? 235  LEU B CA 1 
ATOM 4162   C C  . LEU B 1 235  ? 1127.561 669.674 640.750 1.00 0.00 ? 235  LEU B C  1 
ATOM 4163   O O  . LEU B 1 235  ? 1128.363 669.324 641.616 1.00 0.00 ? 235  LEU B O  1 
ATOM 4164   C CB . LEU B 1 235  ? 1127.709 671.803 639.731 1.00 0.00 ? 235  LEU B CB 1 
ATOM 4165   N N  . TYR B 1 236  ? 1127.237 668.925 639.662 1.00 0.00 ? 236  TYR B N  1 
ATOM 4166   C CA . TYR B 1 236  ? 1127.696 667.606 639.315 1.00 0.00 ? 236  TYR B CA 1 
ATOM 4167   C C  . TYR B 1 236  ? 1127.744 667.455 637.789 1.00 0.00 ? 236  TYR B C  1 
ATOM 4168   O O  . TYR B 1 236  ? 1126.992 668.136 637.093 1.00 0.00 ? 236  TYR B O  1 
ATOM 4169   C CB . TYR B 1 236  ? 1126.750 666.565 639.929 1.00 0.00 ? 236  TYR B CB 1 
ATOM 4170   N N  . GLU B 1 237  ? 1128.633 666.581 637.219 1.00 0.00 ? 237  GLU B N  1 
ATOM 4171   C CA . GLU B 1 237  ? 1128.679 666.339 635.783 1.00 0.00 ? 237  GLU B CA 1 
ATOM 4172   C C  . GLU B 1 237  ? 1128.758 664.858 635.477 1.00 0.00 ? 237  GLU B C  1 
ATOM 4173   O O  . GLU B 1 237  ? 1129.505 664.121 636.117 1.00 0.00 ? 237  GLU B O  1 
ATOM 4174   C CB . GLU B 1 237  ? 1129.891 666.961 635.062 1.00 0.00 ? 237  GLU B CB 1 
ATOM 4175   N N  . VAL B 1 238  ? 1128.027 664.398 634.428 1.00 0.00 ? 238  VAL B N  1 
ATOM 4176   C CA . VAL B 1 238  ? 1127.977 662.996 634.072 1.00 0.00 ? 238  VAL B CA 1 
ATOM 4177   C C  . VAL B 1 238  ? 1128.807 662.755 632.846 1.00 0.00 ? 238  VAL B C  1 
ATOM 4178   O O  . VAL B 1 238  ? 1128.892 663.605 631.958 1.00 0.00 ? 238  VAL B O  1 
ATOM 4179   C CB . VAL B 1 238  ? 1126.620 662.511 633.641 1.00 0.00 ? 238  VAL B CB 1 
ATOM 4180   N N  . ALA B 1 239  ? 1129.467 661.577 632.775 1.00 0.00 ? 239  ALA B N  1 
ATOM 4181   C CA . ALA B 1 239  ? 1130.165 661.217 631.575 1.00 0.00 ? 239  ALA B CA 1 
ATOM 4182   C C  . ALA B 1 239  ? 1129.809 659.794 631.239 1.00 0.00 ? 239  ALA B C  1 
ATOM 4183   O O  . ALA B 1 239  ? 1130.002 658.883 632.043 1.00 0.00 ? 239  ALA B O  1 
ATOM 4184   C CB . ALA B 1 239  ? 1131.696 661.283 631.702 1.00 0.00 ? 239  ALA B CB 1 
ATOM 4185   N N  . TYR B 1 240  ? 1129.239 659.598 630.035 1.00 0.00 ? 240  TYR B N  1 
ATOM 4186   C CA . TYR B 1 240  ? 1128.865 658.349 629.422 1.00 0.00 ? 240  TYR B CA 1 
ATOM 4187   C C  . TYR B 1 240  ? 1130.016 657.617 628.810 1.00 0.00 ? 240  TYR B C  1 
ATOM 4188   O O  . TYR B 1 240  ? 1129.875 656.460 628.415 1.00 0.00 ? 240  TYR B O  1 
ATOM 4189   C CB . TYR B 1 240  ? 1127.606 658.359 628.528 1.00 0.00 ? 240  TYR B CB 1 
ATOM 4190   N N  . GLN B 1 241  ? 1131.189 658.274 628.746 1.00 0.00 ? 241  GLN B N  1 
ATOM 4191   C CA . GLN B 1 241  ? 1132.372 657.919 628.009 1.00 0.00 ? 241  GLN B CA 1 
ATOM 4192   C C  . GLN B 1 241  ? 1132.331 658.721 626.754 1.00 0.00 ? 241  GLN B C  1 
ATOM 4193   O O  . GLN B 1 241  ? 1133.318 659.334 626.353 1.00 0.00 ? 241  GLN B O  1 
ATOM 4194   C CB . GLN B 1 241  ? 1132.521 656.414 627.713 1.00 0.00 ? 241  GLN B CB 1 
ATOM 4195   N N  . LYS B 1 253  ? 1129.497 655.814 633.232 1.00 0.00 ? 253  LYS B N  1 
ATOM 4196   C CA . LYS B 1 253  ? 1128.302 656.064 633.973 1.00 0.00 ? 253  LYS B CA 1 
ATOM 4197   C C  . LYS B 1 253  ? 1128.593 657.090 635.013 1.00 0.00 ? 253  LYS B C  1 
ATOM 4198   O O  . LYS B 1 253  ? 1127.772 657.942 635.344 1.00 0.00 ? 253  LYS B O  1 
ATOM 4199   C CB . LYS B 1 253  ? 1127.709 654.828 634.668 1.00 0.00 ? 253  LYS B CB 1 
ATOM 4200   N N  . ILE B 1 254  ? 1129.835 656.996 635.520 1.00 0.00 ? 254  ILE B N  1 
ATOM 4201   C CA . ILE B 1 254  ? 1130.347 657.656 636.680 1.00 0.00 ? 254  ILE B CA 1 
ATOM 4202   C C  . ILE B 1 254  ? 1129.965 659.089 636.770 1.00 0.00 ? 254  ILE B C  1 
ATOM 4203   O O  . ILE B 1 254  ? 1129.876 659.815 635.779 1.00 0.00 ? 254  ILE B O  1 
ATOM 4204   C CB . ILE B 1 254  ? 1131.834 657.538 636.827 1.00 0.00 ? 254  ILE B CB 1 
ATOM 4205   N N  . ASN B 1 255  ? 1129.700 659.494 638.025 1.00 0.00 ? 255  ASN B N  1 
ATOM 4206   C CA . ASN B 1 255  ? 1129.344 660.821 638.412 1.00 0.00 ? 255  ASN B CA 1 
ATOM 4207   C C  . ASN B 1 255  ? 1130.604 661.405 638.981 1.00 0.00 ? 255  ASN B C  1 
ATOM 4208   O O  . ASN B 1 255  ? 1131.345 660.718 639.684 1.00 0.00 ? 255  ASN B O  1 
ATOM 4209   C CB . ASN B 1 255  ? 1128.398 660.863 639.638 1.00 0.00 ? 255  ASN B CB 1 
ATOM 4210   N N  . HIS B 1 256  ? 1130.906 662.678 638.668 1.00 0.00 ? 256  HIS B N  1 
ATOM 4211   C CA . HIS B 1 256  ? 1132.008 663.338 639.306 1.00 0.00 ? 256  HIS B CA 1 
ATOM 4212   C C  . HIS B 1 256  ? 1131.554 664.726 639.631 1.00 0.00 ? 256  HIS B C  1 
ATOM 4213   O O  . HIS B 1 256  ? 1131.002 665.422 638.778 1.00 0.00 ? 256  HIS B O  1 
ATOM 4214   C CB . HIS B 1 256  ? 1133.287 663.417 638.452 1.00 0.00 ? 256  HIS B CB 1 
ATOM 4215   N N  . SER B 1 257  ? 1131.748 665.156 640.895 1.00 0.00 ? 257  SER B N  1 
ATOM 4216   C CA . SER B 1 257  ? 1131.316 666.466 641.283 1.00 0.00 ? 257  SER B CA 1 
ATOM 4217   C C  . SER B 1 257  ? 1132.338 667.435 640.792 1.00 0.00 ? 257  SER B C  1 
ATOM 4218   O O  . SER B 1 257  ? 1133.539 667.230 640.963 1.00 0.00 ? 257  SER B O  1 
ATOM 4219   C CB . SER B 1 257  ? 1131.176 666.630 642.804 1.00 0.00 ? 257  SER B CB 1 
ATOM 4220   N N  . LYS B 1 258  ? 1131.881 668.491 640.093 1.00 0.00 ? 258  LYS B N  1 
ATOM 4221   C CA . LYS B 1 258  ? 1132.807 669.471 639.606 1.00 0.00 ? 258  LYS B CA 1 
ATOM 4222   C C  . LYS B 1 258  ? 1133.261 670.377 640.708 1.00 0.00 ? 258  LYS B C  1 
ATOM 4223   O O  . LYS B 1 258  ? 1134.446 670.679 640.835 1.00 0.00 ? 258  LYS B O  1 
ATOM 4224   C CB . LYS B 1 258  ? 1132.208 670.326 638.482 1.00 0.00 ? 258  LYS B CB 1 
ATOM 4225   N N  . SER B 1 259  ? 1132.289 670.830 641.523 1.00 0.00 ? 259  SER B N  1 
ATOM 4226   C CA . SER B 1 259  ? 1132.472 671.823 642.543 1.00 0.00 ? 259  SER B CA 1 
ATOM 4227   C C  . SER B 1 259  ? 1133.190 671.337 643.766 1.00 0.00 ? 259  SER B C  1 
ATOM 4228   O O  . SER B 1 259  ? 1133.887 672.123 644.408 1.00 0.00 ? 259  SER B O  1 
ATOM 4229   C CB . SER B 1 259  ? 1131.129 672.415 643.002 1.00 0.00 ? 259  SER B CB 1 
ATOM 4230   N N  . SER B 1 260  ? 1133.878 670.221 643.665 1.00 0.00 ? 260  SER B N  1 
ATOM 4231   C CA . SER B 1 260  ? 1134.575 669.261 644.460 1.00 0.00 ? 260  SER B CA 1 
ATOM 4232   C C  . SER B 1 260  ? 1133.613 668.741 645.470 1.00 0.00 ? 260  SER B C  1 
ATOM 4233   O O  . SER B 1 260  ? 1132.735 669.468 645.935 1.00 0.00 ? 260  SER B O  1 
ATOM 4234   C CB . SER B 1 260  ? 1135.775 669.845 645.220 1.00 0.00 ? 260  SER B CB 1 
ATOM 4235   N N  . LEU B 1 261  ? 1133.732 667.446 645.808 1.00 0.00 ? 261  LEU B N  1 
ATOM 4236   C CA . LEU B 1 261  ? 1132.876 666.919 646.825 1.00 0.00 ? 261  LEU B CA 1 
ATOM 4237   C C  . LEU B 1 261  ? 1133.275 667.659 648.052 1.00 0.00 ? 261  LEU B C  1 
ATOM 4238   O O  . LEU B 1 261  ? 1132.439 668.145 648.814 1.00 0.00 ? 261  LEU B O  1 
ATOM 4239   C CB . LEU B 1 261  ? 1133.113 665.421 647.084 1.00 0.00 ? 261  LEU B CB 1 
ATOM 4240   N N  . ASP B 1 276  ? 1123.705 679.745 647.800 1.00 0.00 ? 276  ASP B N  1 
ATOM 4241   C CA . ASP B 1 276  ? 1122.480 679.079 648.075 1.00 0.00 ? 276  ASP B CA 1 
ATOM 4242   C C  . ASP B 1 276  ? 1122.766 677.619 648.045 1.00 0.00 ? 276  ASP B C  1 
ATOM 4243   O O  . ASP B 1 276  ? 1123.684 677.149 647.371 1.00 0.00 ? 276  ASP B O  1 
ATOM 4244   C CB . ASP B 1 276  ? 1121.314 679.352 647.122 1.00 0.00 ? 276  ASP B CB 1 
ATOM 4245   N N  . ASP B 1 277  ? 1121.516 677.682 648.629 1.00 0.00 ? 277  ASP B N  1 
ATOM 4246   C CA . ASP B 1 277  ? 1121.030 676.442 649.147 1.00 0.00 ? 277  ASP B CA 1 
ATOM 4247   C C  . ASP B 1 277  ? 1120.737 675.468 648.019 1.00 0.00 ? 277  ASP B C  1 
ATOM 4248   O O  . ASP B 1 277  ? 1121.483 674.494 647.913 1.00 0.00 ? 277  ASP B O  1 
ATOM 4249   C CB . ASP B 1 277  ? 1119.834 676.699 650.101 1.00 0.00 ? 277  ASP B CB 1 
ATOM 4250   N N  . PRO B 1 278  ? 1119.756 675.618 647.141 1.00 0.00 ? 278  PRO B N  1 
ATOM 4251   C CA . PRO B 1 278  ? 1119.697 674.647 646.076 1.00 0.00 ? 278  PRO B CA 1 
ATOM 4252   C C  . PRO B 1 278  ? 1119.998 675.342 644.791 1.00 0.00 ? 278  PRO B C  1 
ATOM 4253   O O  . PRO B 1 278  ? 1120.141 676.562 644.788 1.00 0.00 ? 278  PRO B O  1 
ATOM 4254   C CB . PRO B 1 278  ? 1118.275 674.089 646.062 1.00 0.00 ? 278  PRO B CB 1 
ATOM 4255   N N  . ILE B 1 279  ? 1120.054 674.587 643.676 1.00 0.00 ? 279  ILE B N  1 
ATOM 4256   C CA . ILE B 1 279  ? 1120.193 675.213 642.398 1.00 0.00 ? 279  ILE B CA 1 
ATOM 4257   C C  . ILE B 1 279  ? 1118.879 675.051 641.713 1.00 0.00 ? 279  ILE B C  1 
ATOM 4258   O O  . ILE B 1 279  ? 1118.522 673.953 641.291 1.00 0.00 ? 279  ILE B O  1 
ATOM 4259   C CB . ILE B 1 279  ? 1121.222 674.558 641.522 1.00 0.00 ? 279  ILE B CB 1 
ATOM 4260   N N  . LEU B 1 280  ? 1118.099 676.145 641.622 1.00 0.00 ? 280  LEU B N  1 
ATOM 4261   C CA . LEU B 1 280  ? 1116.812 676.077 640.998 1.00 0.00 ? 280  LEU B CA 1 
ATOM 4262   C C  . LEU B 1 280  ? 1116.987 675.879 639.526 1.00 0.00 ? 280  LEU B C  1 
ATOM 4263   O O  . LEU B 1 280  ? 1116.338 675.019 638.933 1.00 0.00 ? 280  LEU B O  1 
ATOM 4264   C CB . LEU B 1 280  ? 1115.976 677.356 641.230 1.00 0.00 ? 280  LEU B CB 1 
ATOM 4265   N N  . GLN B 1 281  ? 1117.890 676.655 638.890 1.00 0.00 ? 281  GLN B N  1 
ATOM 4266   C CA . GLN B 1 281  ? 1117.962 676.571 637.459 1.00 0.00 ? 281  GLN B CA 1 
ATOM 4267   C C  . GLN B 1 281  ? 1119.377 676.426 637.014 1.00 0.00 ? 281  GLN B C  1 
ATOM 4268   O O  . GLN B 1 281  ? 1120.316 676.818 637.703 1.00 0.00 ? 281  GLN B O  1 
ATOM 4269   C CB . GLN B 1 281  ? 1117.411 677.822 636.758 1.00 0.00 ? 281  GLN B CB 1 
ATOM 4270   N N  . ILE B 1 282  ? 1119.546 675.822 635.819 1.00 0.00 ? 282  ILE B N  1 
ATOM 4271   C CA . ILE B 1 282  ? 1120.833 675.647 635.220 1.00 0.00 ? 282  ILE B CA 1 
ATOM 4272   C C  . ILE B 1 282  ? 1120.741 676.185 633.830 1.00 0.00 ? 282  ILE B C  1 
ATOM 4273   O O  . ILE B 1 282  ? 1119.755 675.951 633.131 1.00 0.00 ? 282  ILE B O  1 
ATOM 4274   C CB . ILE B 1 282  ? 1121.247 674.208 635.142 1.00 0.00 ? 282  ILE B CB 1 
ATOM 4275   N N  . ALA B 1 283  ? 1121.758 676.954 633.390 1.00 0.00 ? 283  ALA B N  1 
ATOM 4276   C CA . ALA B 1 283  ? 1121.714 677.471 632.053 1.00 0.00 ? 283  ALA B CA 1 
ATOM 4277   C C  . ALA B 1 283  ? 1123.083 677.352 631.466 1.00 0.00 ? 283  ALA B C  1 
ATOM 4278   O O  . ALA B 1 283  ? 1124.085 677.422 632.177 1.00 0.00 ? 283  ALA B O  1 
ATOM 4279   C CB . ALA B 1 283  ? 1121.326 678.951 631.963 1.00 0.00 ? 283  ALA B CB 1 
ATOM 4280   N N  . ILE B 1 284  ? 1123.155 677.147 630.136 1.00 0.00 ? 284  ILE B N  1 
ATOM 4281   C CA . ILE B 1 284  ? 1124.444 677.057 629.520 1.00 0.00 ? 284  ILE B CA 1 
ATOM 4282   C C  . ILE B 1 284  ? 1124.527 678.038 628.404 1.00 0.00 ? 284  ILE B C  1 
ATOM 4283   O O  . ILE B 1 284  ? 1123.595 678.193 627.616 1.00 0.00 ? 284  ILE B O  1 
ATOM 4284   C CB . ILE B 1 284  ? 1124.771 675.720 628.929 1.00 0.00 ? 284  ILE B CB 1 
ATOM 4285   N N  . ASP B 1 285  ? 1125.668 678.745 628.339 1.00 0.00 ? 285  ASP B N  1 
ATOM 4286   C CA . ASP B 1 285  ? 1125.936 679.643 627.262 1.00 0.00 ? 285  ASP B CA 1 
ATOM 4287   C C  . ASP B 1 285  ? 1126.691 678.820 626.277 1.00 0.00 ? 285  ASP B C  1 
ATOM 4288   O O  . ASP B 1 285  ? 1127.865 678.506 626.471 1.00 0.00 ? 285  ASP B O  1 
ATOM 4289   C CB . ASP B 1 285  ? 1126.801 680.832 627.703 1.00 0.00 ? 285  ASP B CB 1 
ATOM 4290   N N  . ASN B 1 286  ? 1125.998 678.430 625.196 1.00 0.00 ? 286  ASN B N  1 
ATOM 4291   C CA . ASN B 1 286  ? 1126.541 677.554 624.202 1.00 0.00 ? 286  ASN B CA 1 
ATOM 4292   C C  . ASN B 1 286  ? 1127.684 678.215 623.500 1.00 0.00 ? 286  ASN B C  1 
ATOM 4293   O O  . ASN B 1 286  ? 1128.698 677.579 623.217 1.00 0.00 ? 286  ASN B O  1 
ATOM 4294   C CB . ASN B 1 286  ? 1125.504 677.179 623.131 1.00 0.00 ? 286  ASN B CB 1 
ATOM 4295   N N  . SER B 1 287  ? 1127.545 679.518 623.198 1.00 0.00 ? 287  SER B N  1 
ATOM 4296   C CA . SER B 1 287  ? 1128.541 680.209 622.427 1.00 0.00 ? 287  SER B CA 1 
ATOM 4297   C C  . SER B 1 287  ? 1129.836 680.312 623.172 1.00 0.00 ? 287  SER B C  1 
ATOM 4298   O O  . SER B 1 287  ? 1130.898 680.211 622.560 1.00 0.00 ? 287  SER B O  1 
ATOM 4299   C CB . SER B 1 287  ? 1128.117 681.635 622.034 1.00 0.00 ? 287  SER B CB 1 
ATOM 4300   N N  . ARG B 1 288  ? 1129.808 680.517 624.506 1.00 0.00 ? 288  ARG B N  1 
ATOM 4301   C CA . ARG B 1 288  ? 1131.073 680.725 625.154 1.00 0.00 ? 288  ARG B CA 1 
ATOM 4302   C C  . ARG B 1 288  ? 1131.400 679.592 626.080 1.00 0.00 ? 288  ARG B C  1 
ATOM 4303   O O  . ARG B 1 288  ? 1132.365 679.693 626.834 1.00 0.00 ? 288  ARG B O  1 
ATOM 4304   C CB . ARG B 1 288  ? 1131.080 681.978 626.046 1.00 0.00 ? 288  ARG B CB 1 
ATOM 4305   N N  . ASN B 1 289  ? 1130.653 678.472 626.023 1.00 0.00 ? 289  ASN B N  1 
ATOM 4306   C CA . ASN B 1 289  ? 1130.939 677.352 626.878 1.00 0.00 ? 289  ASN B CA 1 
ATOM 4307   C C  . ASN B 1 289  ? 1131.004 677.817 628.299 1.00 0.00 ? 289  ASN B C  1 
ATOM 4308   O O  . ASN B 1 289  ? 1131.973 677.553 629.010 1.00 0.00 ? 289  ASN B O  1 
ATOM 4309   C CB . ASN B 1 289  ? 1132.269 676.663 626.535 1.00 0.00 ? 289  ASN B CB 1 
ATOM 4310   N N  . ILE B 1 290  ? 1129.956 678.528 628.742 1.00 0.00 ? 290  ILE B N  1 
ATOM 4311   C CA . ILE B 1 290  ? 1129.897 679.069 630.066 1.00 0.00 ? 290  ILE B CA 1 
ATOM 4312   C C  . ILE B 1 290  ? 1128.684 678.547 630.754 1.00 0.00 ? 290  ILE B C  1 
ATOM 4313   O O  . ILE B 1 290  ? 1127.601 678.460 630.175 1.00 0.00 ? 290  ILE B O  1 
ATOM 4314   C CB . ILE B 1 290  ? 1129.914 680.570 630.022 1.00 0.00 ? 290  ILE B CB 1 
ATOM 4315   N N  . LEU B 1 291  ? 1128.856 678.155 632.031 1.00 0.00 ? 291  LEU B N  1 
ATOM 4316   C CA . LEU B 1 291  ? 1127.774 677.575 632.763 1.00 0.00 ? 291  LEU B CA 1 
ATOM 4317   C C  . LEU B 1 291  ? 1127.280 678.591 633.736 1.00 0.00 ? 291  LEU B C  1 
ATOM 4318   O O  . LEU B 1 291  ? 1128.042 679.394 634.270 1.00 0.00 ? 291  LEU B O  1 
ATOM 4319   C CB . LEU B 1 291  ? 1128.179 676.320 633.533 1.00 0.00 ? 291  LEU B CB 1 
ATOM 4320   N N  . TYR B 1 292  ? 1125.957 678.593 633.959 1.00 0.00 ? 292  TYR B N  1 
ATOM 4321   C CA . TYR B 1 292  ? 1125.345 679.507 634.868 1.00 0.00 ? 292  TYR B CA 1 
ATOM 4322   C C  . TYR B 1 292  ? 1124.502 678.685 635.778 1.00 0.00 ? 292  TYR B C  1 
ATOM 4323   O O  . TYR B 1 292  ? 1123.896 677.698 635.359 1.00 0.00 ? 292  TYR B O  1 
ATOM 4324   C CB . TYR B 1 292  ? 1124.402 680.484 634.136 1.00 0.00 ? 292  TYR B CB 1 
ATOM 4325   N N  . THR B 1 293  ? 1124.450 679.070 637.064 1.00 0.00 ? 293  THR B N  1 
ATOM 4326   C CA . THR B 1 293  ? 1123.575 678.373 637.952 1.00 0.00 ? 293  THR B CA 1 
ATOM 4327   C C  . THR B 1 293  ? 1122.845 679.398 638.749 1.00 0.00 ? 293  THR B C  1 
ATOM 4328   O O  . THR B 1 293  ? 1123.428 680.384 639.198 1.00 0.00 ? 293  THR B O  1 
ATOM 4329   C CB . THR B 1 293  ? 1124.280 677.477 638.928 1.00 0.00 ? 293  THR B CB 1 
ATOM 4330   N N  . ARG B 1 294  ? 1121.526 679.198 638.930 1.00 0.00 ? 294  ARG B N  1 
ATOM 4331   C CA . ARG B 1 294  ? 1120.796 680.117 639.747 1.00 0.00 ? 294  ARG B CA 1 
ATOM 4332   C C  . ARG B 1 294  ? 1120.357 679.330 640.935 1.00 0.00 ? 294  ARG B C  1 
ATOM 4333   O O  . ARG B 1 294  ? 1119.896 678.197 640.799 1.00 0.00 ? 294  ARG B O  1 
ATOM 4334   C CB . ARG B 1 294  ? 1119.545 680.714 639.079 1.00 0.00 ? 294  ARG B CB 1 
ATOM 4335   N N  . SER B 1 295  ? 1120.520 679.897 642.144 1.00 0.00 ? 295  SER B N  1 
ATOM 4336   C CA . SER B 1 295  ? 1120.142 679.174 643.321 1.00 0.00 ? 295  SER B CA 1 
ATOM 4337   C C  . SER B 1 295  ? 1118.825 679.706 643.782 1.00 0.00 ? 295  SER B C  1 
ATOM 4338   O O  . SER B 1 295  ? 1118.322 680.705 643.270 1.00 0.00 ? 295  SER B O  1 
ATOM 4339   C CB . SER B 1 295  ? 1121.115 679.333 644.500 1.00 0.00 ? 295  SER B CB 1 
ATOM 4340   N N  . GLU B 1 296  ? 1118.243 679.038 644.794 1.00 0.00 ? 296  GLU B N  1 
ATOM 4341   C CA . GLU B 1 296  ? 1116.955 679.410 645.297 1.00 0.00 ? 296  GLU B CA 1 
ATOM 4342   C C  . GLU B 1 296  ? 1117.027 680.801 645.841 1.00 0.00 ? 296  GLU B C  1 
ATOM 4343   O O  . GLU B 1 296  ? 1116.104 681.594 645.657 1.00 0.00 ? 296  GLU B O  1 
ATOM 4344   C CB . GLU B 1 296  ? 1116.464 678.477 646.420 1.00 0.00 ? 296  GLU B CB 1 
ATOM 4345   N N  . LYS B 1 297  ? 1118.141 681.137 646.518 1.00 0.00 ? 297  LYS B N  1 
ATOM 4346   C CA . LYS B 1 297  ? 1118.287 682.430 647.125 1.00 0.00 ? 297  LYS B CA 1 
ATOM 4347   C C  . LYS B 1 297  ? 1118.406 683.529 646.114 1.00 0.00 ? 297  LYS B C  1 
ATOM 4348   O O  . LYS B 1 297  ? 1118.110 684.678 646.433 1.00 0.00 ? 297  LYS B O  1 
ATOM 4349   C CB . LYS B 1 297  ? 1119.391 682.541 648.190 1.00 0.00 ? 297  LYS B CB 1 
ATOM 4350   N N  . GLY B 1 298  ? 1118.840 683.247 644.870 1.00 0.00 ? 298  GLY B N  1 
ATOM 4351   C CA . GLY B 1 298  ? 1118.916 684.356 643.956 1.00 0.00 ? 298  GLY B CA 1 
ATOM 4352   C C  . GLY B 1 298  ? 1120.352 684.699 643.707 1.00 0.00 ? 298  GLY B C  1 
ATOM 4353   O O  . GLY B 1 298  ? 1120.667 685.809 643.276 1.00 0.00 ? 298  GLY B O  1 
ATOM 4354   N N  . VAL B 1 299  ? 1121.274 683.760 643.994 1.00 0.00 ? 299  VAL B N  1 
ATOM 4355   C CA . VAL B 1 299  ? 1122.654 684.019 643.694 1.00 0.00 ? 299  VAL B CA 1 
ATOM 4356   C C  . VAL B 1 299  ? 1122.960 683.355 642.386 1.00 0.00 ? 299  VAL B C  1 
ATOM 4357   O O  . VAL B 1 299  ? 1122.393 682.309 642.068 1.00 0.00 ? 299  VAL B O  1 
ATOM 4358   C CB . VAL B 1 299  ? 1123.617 683.475 644.713 1.00 0.00 ? 299  VAL B CB 1 
ATOM 4359   N N  . ILE B 1 300  ? 1123.861 683.953 641.576 1.00 0.00 ? 300  ILE B N  1 
ATOM 4360   C CA . ILE B 1 300  ? 1124.145 683.355 640.302 1.00 0.00 ? 300  ILE B CA 1 
ATOM 4361   C C  . ILE B 1 300  ? 1125.592 682.991 640.344 1.00 0.00 ? 300  ILE B C  1 
ATOM 4362   O O  . ILE B 1 300  ? 1126.392 683.644 641.014 1.00 0.00 ? 300  ILE B O  1 
ATOM 4363   C CB . ILE B 1 300  ? 1124.052 684.273 639.124 1.00 0.00 ? 300  ILE B CB 1 
ATOM 4364   N N  . GLN B 1 301  ? 1125.959 681.901 639.653 1.00 0.00 ? 301  GLN B N  1 
ATOM 4365   C CA . GLN B 1 301  ? 1127.340 681.534 639.605 1.00 0.00 ? 301  GLN B CA 1 
ATOM 4366   C C  . GLN B 1 301  ? 1127.622 681.144 638.188 1.00 0.00 ? 301  GLN B C  1 
ATOM 4367   O O  . GLN B 1 301  ? 1126.906 680.327 637.611 1.00 0.00 ? 301  GLN B O  1 
ATOM 4368   C CB . GLN B 1 301  ? 1127.642 680.337 640.518 1.00 0.00 ? 301  GLN B CB 1 
ATOM 4369   N N  . VAL B 1 302  ? 1128.664 681.744 637.574 1.00 0.00 ? 302  VAL B N  1 
ATOM 4370   C CA . VAL B 1 302  ? 1128.992 681.422 636.208 1.00 0.00 ? 302  VAL B CA 1 
ATOM 4371   C C  . VAL B 1 302  ? 1130.322 680.718 636.032 1.00 0.00 ? 302  VAL B C  1 
ATOM 4372   O O  . VAL B 1 302  ? 1131.388 681.333 636.014 1.00 0.00 ? 302  VAL B O  1 
ATOM 4373   C CB . VAL B 1 302  ? 1129.043 682.626 635.325 1.00 0.00 ? 302  VAL B CB 1 
ATOM 4374   N N  . TYR B 1 303  ? 1130.316 679.395 635.823 1.00 0.00 ? 303  TYR B N  1 
ATOM 4375   C CA . TYR B 1 303  ? 1131.568 678.689 635.757 1.00 0.00 ? 303  TYR B CA 1 
ATOM 4376   C C  . TYR B 1 303  ? 1132.038 678.655 634.337 1.00 0.00 ? 303  TYR B C  1 
ATOM 4377   O O  . TYR B 1 303  ? 1131.242 678.589 633.403 1.00 0.00 ? 303  TYR B O  1 
ATOM 4378   C CB . TYR B 1 303  ? 1131.454 677.215 636.159 1.00 0.00 ? 303  TYR B CB 1 
ATOM 4379   N N  . ASP B 1 304  ? 1133.372 678.736 634.146 1.00 0.00 ? 304  ASP B N  1 
ATOM 4380   C CA . ASP B 1 304  ? 1133.935 678.617 632.837 1.00 0.00 ? 304  ASP B CA 1 
ATOM 4381   C C  . ASP B 1 304  ? 1134.056 677.149 632.602 1.00 0.00 ? 304  ASP B C  1 
ATOM 4382   O O  . ASP B 1 304  ? 1134.667 676.436 633.395 1.00 0.00 ? 304  ASP B O  1 
ATOM 4383   C CB . ASP B 1 304  ? 1135.345 679.229 632.733 1.00 0.00 ? 304  ASP B CB 1 
ATOM 4384   N N  . LEU B 1 305  ? 1133.455 676.645 631.510 1.00 0.00 ? 305  LEU B N  1 
ATOM 4385   C CA . LEU B 1 305  ? 1133.540 675.235 631.286 1.00 0.00 ? 305  LEU B CA 1 
ATOM 4386   C C  . LEU B 1 305  ? 1134.800 675.024 630.525 1.00 0.00 ? 305  LEU B C  1 
ATOM 4387   O O  . LEU B 1 305  ? 1135.015 675.616 629.467 1.00 0.00 ? 305  LEU B O  1 
ATOM 4388   C CB . LEU B 1 305  ? 1132.341 674.668 630.494 1.00 0.00 ? 305  LEU B CB 1 
ATOM 4389   N N  . GLY B 1 306  ? 1135.678 674.167 631.074 1.00 0.00 ? 306  GLY B N  1 
ATOM 4390   C CA . GLY B 1 306  ? 1136.929 673.898 630.441 1.00 0.00 ? 306  GLY B CA 1 
ATOM 4391   C C  . GLY B 1 306  ? 1137.031 672.420 630.332 1.00 0.00 ? 306  GLY B C  1 
ATOM 4392   O O  . GLY B 1 306  ? 1136.210 671.680 630.870 1.00 0.00 ? 306  GLY B O  1 
ATOM 4393   N N  . GLN B 1 307  ? 1138.059 671.955 629.605 1.00 0.00 ? 307  GLN B N  1 
ATOM 4394   C CA . GLN B 1 307  ? 1138.251 670.553 629.415 1.00 0.00 ? 307  GLN B CA 1 
ATOM 4395   C C  . GLN B 1 307  ? 1138.575 669.939 630.739 1.00 0.00 ? 307  GLN B C  1 
ATOM 4396   O O  . GLN B 1 307  ? 1138.137 668.828 631.035 1.00 0.00 ? 307  GLN B O  1 
ATOM 4397   C CB . GLN B 1 307  ? 1139.402 670.248 628.442 1.00 0.00 ? 307  GLN B CB 1 
ATOM 4398   N N  . ASP B 1 308  ? 1139.345 670.654 631.584 1.00 0.00 ? 308  ASP B N  1 
ATOM 4399   C CA . ASP B 1 308  ? 1139.770 670.065 632.820 1.00 0.00 ? 308  ASP B CA 1 
ATOM 4400   C C  . ASP B 1 308  ? 1138.823 670.388 633.935 1.00 0.00 ? 308  ASP B C  1 
ATOM 4401   O O  . ASP B 1 308  ? 1139.164 670.193 635.098 1.00 0.00 ? 308  ASP B O  1 
ATOM 4402   C CB . ASP B 1 308  ? 1141.159 670.554 633.263 1.00 0.00 ? 308  ASP B CB 1 
ATOM 4403   N N  . GLY B 1 309  ? 1137.599 670.871 633.639 1.00 0.00 ? 309  GLY B N  1 
ATOM 4404   C CA . GLY B 1 309  ? 1136.718 671.082 634.752 1.00 0.00 ? 309  GLY B CA 1 
ATOM 4405   C C  . GLY B 1 309  ? 1136.084 672.429 634.662 1.00 0.00 ? 309  GLY B C  1 
ATOM 4406   O O  . GLY B 1 309  ? 1136.147 673.104 633.634 1.00 0.00 ? 309  GLY B O  1 
ATOM 4407   N N  . GLN B 1 310  ? 1135.445 672.845 635.774 1.00 0.00 ? 310  GLN B N  1 
ATOM 4408   C CA . GLN B 1 310  ? 1134.769 674.107 635.828 1.00 0.00 ? 310  GLN B CA 1 
ATOM 4409   C C  . GLN B 1 310  ? 1135.684 675.062 636.512 1.00 0.00 ? 310  GLN B C  1 
ATOM 4410   O O  . GLN B 1 310  ? 1136.425 674.688 637.421 1.00 0.00 ? 310  GLN B O  1 
ATOM 4411   C CB . GLN B 1 310  ? 1133.455 674.043 636.619 1.00 0.00 ? 310  GLN B CB 1 
ATOM 4412   N N  . GLY B 1 311  ? 1135.679 676.335 636.070 1.00 0.00 ? 311  GLY B N  1 
ATOM 4413   C CA . GLY B 1 311  ? 1136.540 677.288 636.701 1.00 0.00 ? 311  GLY B CA 1 
ATOM 4414   C C  . GLY B 1 311  ? 1135.690 678.410 637.180 1.00 0.00 ? 311  GLY B C  1 
ATOM 4415   O O  . GLY B 1 311  ? 1135.058 679.117 636.398 1.00 0.00 ? 311  GLY B O  1 
ATOM 4416   N N  . MET B 1 312  ? 1135.664 678.591 638.509 1.00 0.00 ? 312  MET B N  1 
ATOM 4417   C CA . MET B 1 312  ? 1134.905 679.640 639.106 1.00 0.00 ? 312  MET B CA 1 
ATOM 4418   C C  . MET B 1 312  ? 1134.949 679.281 640.571 1.00 0.00 ? 312  MET B C  1 
ATOM 4419   O O  . MET B 1 312  ? 1135.908 678.626 640.975 1.00 0.00 ? 312  MET B O  1 
ATOM 4420   C CB . MET B 1 312  ? 1133.475 679.704 638.556 1.00 0.00 ? 312  MET B CB 1 
ATOM 4421   N N  . SER B 1 313  ? 1133.986 679.657 641.453 1.00 0.00 ? 313  SER B N  1 
ATOM 4422   C CA . SER B 1 313  ? 1132.787 680.418 641.290 1.00 0.00 ? 313  SER B CA 1 
ATOM 4423   C C  . SER B 1 313  ? 1132.641 681.299 642.487 1.00 0.00 ? 313  SER B C  1 
ATOM 4424   O O  . SER B 1 313  ? 1133.421 682.222 642.705 1.00 0.00 ? 313  SER B O  1 
ATOM 4425   C CB . SER B 1 313  ? 1131.528 679.534 641.296 1.00 0.00 ? 313  SER B CB 1 
ATOM 4426   N N  . ALA B 1 316  ? 1132.575 683.274 640.473 1.00 0.00 ? 316  ALA B N  1 
ATOM 4427   C CA . ALA B 1 316  ? 1132.233 684.645 640.505 1.00 0.00 ? 316  ALA B CA 1 
ATOM 4428   C C  . ALA B 1 316  ? 1130.765 684.613 640.784 1.00 0.00 ? 316  ALA B C  1 
ATOM 4429   O O  . ALA B 1 316  ? 1130.082 683.626 640.520 1.00 0.00 ? 316  ALA B O  1 
ATOM 4430   C CB . ALA B 1 316  ? 1132.477 685.392 639.185 1.00 0.00 ? 316  ALA B CB 1 
ATOM 4431   N N  . SER B 1 317  ? 1130.220 685.667 641.396 1.00 0.00 ? 317  SER B N  1 
ATOM 4432   C CA . SER B 1 317  ? 1128.827 685.505 641.637 1.00 0.00 ? 317  SER B CA 1 
ATOM 4433   C C  . SER B 1 317  ? 1128.158 686.820 641.525 1.00 0.00 ? 317  SER B C  1 
ATOM 4434   O O  . SER B 1 317  ? 1128.778 687.868 641.700 1.00 0.00 ? 317  SER B O  1 
ATOM 4435   C CB . SER B 1 317  ? 1128.509 684.961 643.042 1.00 0.00 ? 317  SER B CB 1 
ATOM 4436   N N  . VAL B 1 318  ? 1126.856 686.794 641.177 1.00 0.00 ? 318  VAL B N  1 
ATOM 4437   C CA . VAL B 1 318  ? 1126.154 688.034 641.238 1.00 0.00 ? 318  VAL B CA 1 
ATOM 4438   C C  . VAL B 1 318  ? 1125.119 687.816 642.274 1.00 0.00 ? 318  VAL B C  1 
ATOM 4439   O O  . VAL B 1 318  ? 1124.537 686.735 642.373 1.00 0.00 ? 318  VAL B O  1 
ATOM 4440   C CB . VAL B 1 318  ? 1125.428 688.494 640.000 1.00 0.00 ? 318  VAL B CB 1 
ATOM 4441   N N  . SER B 1 319  ? 1124.881 688.844 643.097 1.00 0.00 ? 319  SER B N  1 
ATOM 4442   C CA . SER B 1 319  ? 1123.925 688.698 644.140 1.00 0.00 ? 319  SER B CA 1 
ATOM 4443   C C  . SER B 1 319  ? 1123.172 689.980 644.173 1.00 0.00 ? 319  SER B C  1 
ATOM 4444   O O  . SER B 1 319  ? 1123.386 690.868 643.350 1.00 0.00 ? 319  SER B O  1 
ATOM 4445   C CB . SER B 1 319  ? 1124.572 688.468 645.521 1.00 0.00 ? 319  SER B CB 1 
ATOM 4446   N N  . GLN B 1 320  ? 1122.247 690.089 645.133 1.00 0.00 ? 320  GLN B N  1 
ATOM 4447   C CA . GLN B 1 320  ? 1121.430 691.249 645.283 1.00 0.00 ? 320  GLN B CA 1 
ATOM 4448   C C  . GLN B 1 320  ? 1122.329 692.410 645.563 1.00 0.00 ? 320  GLN B C  1 
ATOM 4449   O O  . GLN B 1 320  ? 1122.110 693.513 645.062 1.00 0.00 ? 320  GLN B O  1 
ATOM 4450   C CB . GLN B 1 320  ? 1120.484 691.086 646.470 1.00 0.00 ? 320  GLN B CB 1 
ATOM 4451   N N  . ASN B 1 321  ? 1123.379 692.182 646.372 1.00 0.00 ? 321  ASN B N  1 
ATOM 4452   C CA . ASN B 1 321  ? 1124.279 693.231 646.754 1.00 0.00 ? 321  ASN B CA 1 
ATOM 4453   C C  . ASN B 1 321  ? 1124.960 693.766 645.530 1.00 0.00 ? 321  ASN B C  1 
ATOM 4454   O O  . ASN B 1 321  ? 1125.065 694.978 645.350 1.00 0.00 ? 321  ASN B O  1 
ATOM 4455   C CB . ASN B 1 321  ? 1125.379 692.730 647.709 1.00 0.00 ? 321  ASN B CB 1 
ATOM 4456   N N  . ALA B 1 322  ? 1125.423 692.869 644.641 1.00 0.00 ? 322  ALA B N  1 
ATOM 4457   C CA . ALA B 1 322  ? 1126.139 693.295 643.474 1.00 0.00 ? 322  ALA B CA 1 
ATOM 4458   C C  . ALA B 1 322  ? 1125.237 694.141 642.635 1.00 0.00 ? 322  ALA B C  1 
ATOM 4459   O O  . ALA B 1 322  ? 1125.655 695.165 642.097 1.00 0.00 ? 322  ALA B O  1 
ATOM 4460   C CB . ALA B 1 322  ? 1126.613 692.120 642.605 1.00 0.00 ? 322  ALA B CB 1 
ATOM 4461   N N  . ILE B 1 323  ? 1123.962 693.733 642.512 1.00 0.00 ? 323  ILE B N  1 
ATOM 4462   C CA . ILE B 1 323  ? 1123.030 694.442 641.684 1.00 0.00 ? 323  ILE B CA 1 
ATOM 4463   C C  . ILE B 1 323  ? 1122.829 695.819 642.227 1.00 0.00 ? 323  ILE B C  1 
ATOM 4464   O O  . ILE B 1 323  ? 1122.792 696.790 641.473 1.00 0.00 ? 323  ILE B O  1 
ATOM 4465   C CB . ILE B 1 323  ? 1121.683 693.785 641.620 1.00 0.00 ? 323  ILE B CB 1 
ATOM 4466   N N  . VAL B 1 324  ? 1122.699 695.943 643.561 1.00 0.00 ? 324  VAL B N  1 
ATOM 4467   C CA . VAL B 1 324  ? 1122.442 697.227 644.146 1.00 0.00 ? 324  VAL B CA 1 
ATOM 4468   C C  . VAL B 1 324  ? 1123.564 698.141 643.788 1.00 0.00 ? 324  VAL B C  1 
ATOM 4469   O O  . VAL B 1 324  ? 1123.345 699.278 643.374 1.00 0.00 ? 324  VAL B O  1 
ATOM 4470   C CB . VAL B 1 324  ? 1122.369 697.173 645.644 1.00 0.00 ? 324  VAL B CB 1 
ATOM 4471   N N  . SER B 1 325  ? 1124.810 697.655 643.921 1.00 0.00 ? 325  SER B N  1 
ATOM 4472   C CA . SER B 1 325  ? 1125.935 698.485 643.612 1.00 0.00 ? 325  SER B CA 1 
ATOM 4473   C C  . SER B 1 325  ? 1125.867 698.823 642.157 1.00 0.00 ? 325  SER B C  1 
ATOM 4474   O O  . SER B 1 325  ? 1126.208 699.931 641.749 1.00 0.00 ? 325  SER B O  1 
ATOM 4475   C CB . SER B 1 325  ? 1127.275 697.770 643.858 1.00 0.00 ? 325  SER B CB 1 
ATOM 4476   N N  . ALA B 1 326  ? 1125.398 697.863 641.342 1.00 0.00 ? 326  ALA B N  1 
ATOM 4477   C CA . ALA B 1 326  ? 1125.366 698.022 639.920 1.00 0.00 ? 326  ALA B CA 1 
ATOM 4478   C C  . ALA B 1 326  ? 1124.474 699.152 639.515 1.00 0.00 ? 326  ALA B C  1 
ATOM 4479   O O  . ALA B 1 326  ? 1124.861 699.956 638.670 1.00 0.00 ? 326  ALA B O  1 
ATOM 4480   C CB . ALA B 1 326  ? 1124.853 696.760 639.208 1.00 0.00 ? 326  ALA B CB 1 
ATOM 4481   N N  . ALA B 1 327  ? 1123.263 699.264 640.103 1.00 0.00 ? 327  ALA B N  1 
ATOM 4482   C CA . ALA B 1 327  ? 1122.391 700.295 639.611 1.00 0.00 ? 327  ALA B CA 1 
ATOM 4483   C C  . ALA B 1 327  ? 1123.030 701.625 639.839 1.00 0.00 ? 327  ALA B C  1 
ATOM 4484   O O  . ALA B 1 327  ? 1123.233 702.396 638.905 1.00 0.00 ? 327  ALA B O  1 
ATOM 4485   C CB . ALA B 1 327  ? 1121.030 700.308 640.329 1.00 0.00 ? 327  ALA B CB 1 
ATOM 4486   N N  . GLY B 1 328  ? 1123.386 701.917 641.102 1.00 0.00 ? 328  GLY B N  1 
ATOM 4487   C CA . GLY B 1 328  ? 1124.097 703.118 641.425 1.00 0.00 ? 328  GLY B CA 1 
ATOM 4488   C C  . GLY B 1 328  ? 1123.378 704.324 640.896 1.00 0.00 ? 328  GLY B C  1 
ATOM 4489   O O  . GLY B 1 328  ? 1123.964 705.402 640.835 1.00 0.00 ? 328  GLY B O  1 
ATOM 4490   N N  . ASN B 1 329  ? 1122.098 704.204 640.485 1.00 0.00 ? 329  ASN B N  1 
ATOM 4491   C CA . ASN B 1 329  ? 1121.486 705.396 639.971 1.00 0.00 ? 329  ASN B CA 1 
ATOM 4492   C C  . ASN B 1 329  ? 1119.999 705.246 640.079 1.00 0.00 ? 329  ASN B C  1 
ATOM 4493   O O  . ASN B 1 329  ? 1119.280 706.232 640.239 1.00 0.00 ? 329  ASN B O  1 
ATOM 4494   C CB . ASN B 1 329  ? 1121.855 705.661 638.499 1.00 0.00 ? 329  ASN B CB 1 
ATOM 4495   N N  . ILE B 1 330  ? 1119.495 703.996 639.996 1.00 0.00 ? 330  ILE B N  1 
ATOM 4496   C CA . ILE B 1 330  ? 1118.077 703.755 640.054 1.00 0.00 ? 330  ILE B CA 1 
ATOM 4497   C C  . ILE B 1 330  ? 1117.817 702.714 641.104 1.00 0.00 ? 330  ILE B C  1 
ATOM 4498   O O  . ILE B 1 330  ? 1118.678 701.876 641.367 1.00 0.00 ? 330  ILE B O  1 
ATOM 4499   C CB . ILE B 1 330  ? 1117.525 703.175 638.789 1.00 0.00 ? 330  ILE B CB 1 
ATOM 4500   N N  . ALA B 1 331  ? 1116.636 702.754 641.771 1.00 0.00 ? 331  ALA B N  1 
ATOM 4501   C CA . ALA B 1 331  ? 1116.354 701.685 642.692 1.00 0.00 ? 331  ALA B CA 1 
ATOM 4502   C C  . ALA B 1 331  ? 1114.985 701.824 643.309 1.00 0.00 ? 331  ALA B C  1 
ATOM 4503   O O  . ALA B 1 331  ? 1114.476 702.928 643.498 1.00 0.00 ? 331  ALA B O  1 
ATOM 4504   C CB . ALA B 1 331  ? 1117.357 701.597 643.854 1.00 0.00 ? 331  ALA B CB 1 
ATOM 4505   N N  . ARG B 1 332  ? 1114.355 700.662 643.614 1.00 0.00 ? 332  ARG B N  1 
ATOM 4506   C CA . ARG B 1 332  ? 1113.114 700.552 644.339 1.00 0.00 ? 332  ARG B CA 1 
ATOM 4507   C C  . ARG B 1 332  ? 1112.518 699.211 644.037 1.00 0.00 ? 332  ARG B C  1 
ATOM 4508   O O  . ARG B 1 332  ? 1112.365 698.377 644.930 1.00 0.00 ? 332  ARG B O  1 
ATOM 4509   C CB . ARG B 1 332  ? 1112.056 701.652 644.114 1.00 0.00 ? 332  ARG B CB 1 
ATOM 4510   N N  . THR B 1 333  ? 1112.176 698.971 642.754 1.00 0.00 ? 333  THR B N  1 
ATOM 4511   C CA . THR B 1 333  ? 1111.616 697.716 642.335 1.00 0.00 ? 333  THR B CA 1 
ATOM 4512   C C  . THR B 1 333  ? 1112.646 696.696 642.680 1.00 0.00 ? 333  THR B C  1 
ATOM 4513   O O  . THR B 1 333  ? 1112.320 695.567 643.043 1.00 0.00 ? 333  THR B O  1 
ATOM 4514   C CB . THR B 1 333  ? 1111.336 697.667 640.860 1.00 0.00 ? 333  THR B CB 1 
ATOM 4515   N N  . ILE B 1 334  ? 1113.929 697.088 642.567 1.00 0.00 ? 334  ILE B N  1 
ATOM 4516   C CA . ILE B 1 334  ? 1114.987 696.201 642.937 1.00 0.00 ? 334  ILE B CA 1 
ATOM 4517   C C  . ILE B 1 334  ? 1115.236 696.448 644.396 1.00 0.00 ? 334  ILE B C  1 
ATOM 4518   O O  . ILE B 1 334  ? 1116.356 696.712 644.829 1.00 0.00 ? 334  ILE B O  1 
ATOM 4519   C CB . ILE B 1 334  ? 1116.242 696.510 642.150 1.00 0.00 ? 334  ILE B CB 1 
ATOM 4520   N N  . ASP B 1 335  ? 1114.173 696.315 645.217 1.00 0.00 ? 335  ASP B N  1 
ATOM 4521   C CA . ASP B 1 335  ? 1114.332 696.565 646.619 1.00 0.00 ? 335  ASP B CA 1 
ATOM 4522   C C  . ASP B 1 335  ? 1114.826 695.305 647.241 1.00 0.00 ? 335  ASP B C  1 
ATOM 4523   O O  . ASP B 1 335  ? 1114.803 694.244 646.618 1.00 0.00 ? 335  ASP B O  1 
ATOM 4524   C CB . ASP B 1 335  ? 1113.035 696.967 647.341 1.00 0.00 ? 335  ASP B CB 1 
ATOM 4525   N N  . ARG B 1 336  ? 1115.311 695.392 648.492 1.00 0.00 ? 336  ARG B N  1 
ATOM 4526   C CA . ARG B 1 336  ? 1115.827 694.213 649.110 1.00 0.00 ? 336  ARG B CA 1 
ATOM 4527   C C  . ARG B 1 336  ? 1114.730 693.221 649.326 1.00 0.00 ? 336  ARG B C  1 
ATOM 4528   O O  . ARG B 1 336  ? 1114.882 692.041 649.017 1.00 0.00 ? 336  ARG B O  1 
ATOM 4529   C CB . ARG B 1 336  ? 1116.509 694.454 650.469 1.00 0.00 ? 336  ARG B CB 1 
ATOM 4530   N N  . SER B 1 337  ? 1113.586 693.682 649.861 1.00 0.00 ? 337  SER B N  1 
ATOM 4531   C CA . SER B 1 337  ? 1112.511 692.775 650.140 1.00 0.00 ? 337  SER B CA 1 
ATOM 4532   C C  . SER B 1 337  ? 1111.956 692.254 648.855 1.00 0.00 ? 337  SER B C  1 
ATOM 4533   O O  . SER B 1 337  ? 1111.774 691.050 648.683 1.00 0.00 ? 337  SER B O  1 
ATOM 4534   C CB . SER B 1 337  ? 1111.353 693.442 650.907 1.00 0.00 ? 337  SER B CB 1 
ATOM 4535   N N  . VAL B 1 338  ? 1111.695 693.171 647.907 1.00 0.00 ? 338  VAL B N  1 
ATOM 4536   C CA . VAL B 1 338  ? 1111.074 692.850 646.657 1.00 0.00 ? 338  VAL B CA 1 
ATOM 4537   C C  . VAL B 1 338  ? 1111.966 691.982 645.823 1.00 0.00 ? 338  VAL B C  1 
ATOM 4538   O O  . VAL B 1 338  ? 1111.488 691.098 645.114 1.00 0.00 ? 338  VAL B O  1 
ATOM 4539   C CB . VAL B 1 338  ? 1110.751 694.066 645.841 1.00 0.00 ? 338  VAL B CB 1 
ATOM 4540   N N  . PHE B 1 339  ? 1113.289 692.205 645.892 1.00 0.00 ? 339  PHE B N  1 
ATOM 4541   C CA . PHE B 1 339  ? 1114.203 691.556 644.994 1.00 0.00 ? 339  PHE B CA 1 
ATOM 4542   C C  . PHE B 1 339  ? 1114.113 690.068 645.034 1.00 0.00 ? 339  PHE B C  1 
ATOM 4543   O O  . PHE B 1 339  ? 1114.337 689.417 646.053 1.00 0.00 ? 339  PHE B O  1 
ATOM 4544   C CB . PHE B 1 339  ? 1115.671 691.931 645.251 1.00 0.00 ? 339  PHE B CB 1 
ATOM 4545   N N  . LYS B 1 340  ? 1113.780 689.491 643.866 1.00 0.00 ? 340  LYS B N  1 
ATOM 4546   C CA . LYS B 1 340  ? 1113.791 688.077 643.672 1.00 0.00 ? 340  LYS B CA 1 
ATOM 4547   C C  . LYS B 1 340  ? 1113.977 687.909 642.206 1.00 0.00 ? 340  LYS B C  1 
ATOM 4548   O O  . LYS B 1 340  ? 1113.956 688.866 641.435 1.00 0.00 ? 340  LYS B O  1 
ATOM 4549   C CB . LYS B 1 340  ? 1112.493 687.348 644.054 1.00 0.00 ? 340  LYS B CB 1 
ATOM 4550   N N  . ILE B 1 342  ? 1115.513 685.611 641.766 1.00 0.00 ? 342  ILE B N  1 
ATOM 4551   C CA . ILE B 1 342  ? 1115.415 686.028 640.399 1.00 0.00 ? 342  ILE B CA 1 
ATOM 4552   C C  . ILE B 1 342  ? 1114.520 685.050 639.725 1.00 0.00 ? 342  ILE B C  1 
ATOM 4553   O O  . ILE B 1 342  ? 1114.607 683.847 639.960 1.00 0.00 ? 342  ILE B O  1 
ATOM 4554   C CB . ILE B 1 342  ? 1116.737 685.974 639.691 1.00 0.00 ? 342  ILE B CB 1 
ATOM 4555   N N  . VAL B 1 343  ? 1113.590 685.566 638.907 1.00 0.00 ? 343  VAL B N  1 
ATOM 4556   C CA . VAL B 1 343  ? 1112.662 684.725 638.216 1.00 0.00 ? 343  VAL B CA 1 
ATOM 4557   C C  . VAL B 1 343  ? 1113.362 683.815 637.256 1.00 0.00 ? 343  VAL B C  1 
ATOM 4558   O O  . VAL B 1 343  ? 1113.207 682.598 637.325 1.00 0.00 ? 343  VAL B O  1 
ATOM 4559   C CB . VAL B 1 343  ? 1111.712 685.517 637.386 1.00 0.00 ? 343  VAL B CB 1 
ATOM 4560   N N  . GLN B 1 344  ? 1114.168 684.382 636.337 1.00 0.00 ? 344  GLN B N  1 
ATOM 4561   C CA . GLN B 1 344  ? 1114.765 683.544 635.340 1.00 0.00 ? 344  GLN B CA 1 
ATOM 4562   C C  . GLN B 1 344  ? 1116.044 684.173 634.901 1.00 0.00 ? 344  GLN B C  1 
ATOM 4563   O O  . GLN B 1 344  ? 1116.276 685.365 635.098 1.00 0.00 ? 344  GLN B O  1 
ATOM 4564   C CB . GLN B 1 344  ? 1113.888 683.400 634.081 1.00 0.00 ? 344  GLN B CB 1 
ATOM 4565   N N  . ILE B 1 345  ? 1116.925 683.353 634.303 1.00 0.00 ? 345  ILE B N  1 
ATOM 4566   C CA . ILE B 1 345  ? 1118.179 683.821 633.798 1.00 0.00 ? 345  ILE B CA 1 
ATOM 4567   C C  . ILE B 1 345  ? 1118.295 683.309 632.399 1.00 0.00 ? 345  ILE B C  1 
ATOM 4568   O O  . ILE B 1 345  ? 1117.871 682.192 632.099 1.00 0.00 ? 345  ILE B O  1 
ATOM 4569   C CB . ILE B 1 345  ? 1119.329 683.325 634.621 1.00 0.00 ? 345  ILE B CB 1 
ATOM 4570   N N  . ALA B 1 346  ? 1118.838 684.130 631.481 1.00 0.00 ? 346  ALA B N  1 
ATOM 4571   C CA . ALA B 1 346  ? 1118.998 683.655 630.139 1.00 0.00 ? 346  ALA B CA 1 
ATOM 4572   C C  . ALA B 1 346  ? 1120.348 684.090 629.673 1.00 0.00 ? 346  ALA B C  1 
ATOM 4573   O O  . ALA B 1 346  ? 1120.785 685.207 629.944 1.00 0.00 ? 346  ALA B O  1 
ATOM 4574   C CB . ALA B 1 346  ? 1117.963 684.227 629.155 1.00 0.00 ? 346  ALA B CB 1 
ATOM 4575   N N  . VAL B 1 347  ? 1121.046 683.198 628.948 1.00 0.00 ? 347  VAL B N  1 
ATOM 4576   C CA . VAL B 1 347  ? 1122.355 683.514 628.461 1.00 0.00 ? 347  VAL B CA 1 
ATOM 4577   C C  . VAL B 1 347  ? 1122.206 684.205 627.147 1.00 0.00 ? 347  VAL B C  1 
ATOM 4578   O O  . VAL B 1 347  ? 1121.230 683.995 626.427 1.00 0.00 ? 347  VAL B O  1 
ATOM 4579   C CB . VAL B 1 347  ? 1123.216 682.305 628.243 1.00 0.00 ? 347  VAL B CB 1 
ATOM 4580   N N  . ILE B 1 348  ? 1123.176 685.077 626.813 1.00 0.00 ? 348  ILE B N  1 
ATOM 4581   C CA . ILE B 1 348  ? 1123.158 685.777 625.564 1.00 0.00 ? 348  ILE B CA 1 
ATOM 4582   C C  . ILE B 1 348  ? 1124.357 685.327 624.792 1.00 0.00 ? 348  ILE B C  1 
ATOM 4583   O O  . ILE B 1 348  ? 1125.456 685.217 625.333 1.00 0.00 ? 348  ILE B O  1 
ATOM 4584   C CB . ILE B 1 348  ? 1123.229 687.270 625.713 1.00 0.00 ? 348  ILE B CB 1 
ATOM 4585   N N  . GLU B 1 349  ? 1124.156 685.030 623.493 1.00 0.00 ? 349  GLU B N  1 
ATOM 4586   C CA . GLU B 1 349  ? 1125.219 684.546 622.661 1.00 0.00 ? 349  GLU B CA 1 
ATOM 4587   C C  . GLU B 1 349  ? 1126.153 685.669 622.361 1.00 0.00 ? 349  GLU B C  1 
ATOM 4588   O O  . GLU B 1 349  ? 1125.756 686.829 622.282 1.00 0.00 ? 349  GLU B O  1 
ATOM 4589   C CB . GLU B 1 349  ? 1124.729 683.980 621.318 1.00 0.00 ? 349  GLU B CB 1 
ATOM 4590   N N  . ASN B 1 350  ? 1127.444 685.328 622.196 1.00 0.00 ? 350  ASN B N  1 
ATOM 4591   C CA . ASN B 1 350  ? 1128.448 686.297 621.872 1.00 0.00 ? 350  ASN B CA 1 
ATOM 4592   C C  . ASN B 1 350  ? 1128.146 686.821 620.508 1.00 0.00 ? 350  ASN B C  1 
ATOM 4593   O O  . ASN B 1 350  ? 1128.446 687.970 620.189 1.00 0.00 ? 350  ASN B O  1 
ATOM 4594   C CB . ASN B 1 350  ? 1129.896 685.756 621.935 1.00 0.00 ? 350  ASN B CB 1 
ATOM 4595   N N  . SER B 1 351  ? 1127.537 685.976 619.659 1.00 0.00 ? 351  SER B N  1 
ATOM 4596   C CA . SER B 1 351  ? 1127.192 686.381 618.332 1.00 0.00 ? 351  SER B CA 1 
ATOM 4597   C C  . SER B 1 351  ? 1126.286 687.567 618.433 1.00 0.00 ? 351  SER B C  1 
ATOM 4598   O O  . SER B 1 351  ? 1126.457 688.547 617.709 1.00 0.00 ? 351  SER B O  1 
ATOM 4599   C CB . SER B 1 351  ? 1126.425 685.285 617.575 1.00 0.00 ? 351  SER B CB 1 
ATOM 4600   N N  . GLU B 1 352  ? 1125.278 687.499 619.325 1.00 0.00 ? 352  GLU B N  1 
ATOM 4601   C CA . GLU B 1 352  ? 1124.356 688.588 619.460 1.00 0.00 ? 352  GLU B CA 1 
ATOM 4602   C C  . GLU B 1 352  ? 1125.052 689.783 620.038 1.00 0.00 ? 352  GLU B C  1 
ATOM 4603   O O  . GLU B 1 352  ? 1124.930 690.891 619.519 1.00 0.00 ? 352  GLU B O  1 
ATOM 4604   C CB . GLU B 1 352  ? 1123.170 688.229 620.373 1.00 0.00 ? 352  GLU B CB 1 
ATOM 4605   N N  . SER B 1 353  ? 1125.808 689.583 621.136 1.00 0.00 ? 353  SER B N  1 
ATOM 4606   C CA . SER B 1 353  ? 1126.533 690.672 621.729 1.00 0.00 ? 353  SER B CA 1 
ATOM 4607   C C  . SER B 1 353  ? 1127.803 690.096 622.256 1.00 0.00 ? 353  SER B C  1 
ATOM 4608   O O  . SER B 1 353  ? 1127.795 689.082 622.952 1.00 0.00 ? 353  SER B O  1 
ATOM 4609   C CB . SER B 1 353  ? 1125.802 691.317 622.921 1.00 0.00 ? 353  SER B CB 1 
ATOM 4610   N N  . LEU B 1 354  ? 1128.946 690.725 621.929 1.00 0.00 ? 354  LEU B N  1 
ATOM 4611   C CA . LEU B 1 354  ? 1130.198 690.191 622.371 1.00 0.00 ? 354  LEU B CA 1 
ATOM 4612   C C  . LEU B 1 354  ? 1130.266 690.313 623.863 1.00 0.00 ? 354  LEU B C  1 
ATOM 4613   O O  . LEU B 1 354  ? 1130.589 689.354 624.562 1.00 0.00 ? 354  LEU B O  1 
ATOM 4614   C CB . LEU B 1 354  ? 1131.390 690.956 621.748 1.00 0.00 ? 354  LEU B CB 1 
ATOM 4615   N N  . ASP B 1 355  ? 1129.950 691.514 624.377 1.00 0.00 ? 355  ASP B N  1 
ATOM 4616   C CA . ASP B 1 355  ? 1130.092 691.835 625.770 1.00 0.00 ? 355  ASP B CA 1 
ATOM 4617   C C  . ASP B 1 355  ? 1129.090 691.178 626.681 1.00 0.00 ? 355  ASP B C  1 
ATOM 4618   O O  . ASP B 1 355  ? 1129.470 690.659 627.730 1.00 0.00 ? 355  ASP B O  1 
ATOM 4619   C CB . ASP B 1 355  ? 1130.016 693.349 626.028 1.00 0.00 ? 355  ASP B CB 1 
ATOM 4620   N N  . CYS B 1 356  ? 1127.795 691.144 626.310 1.00 0.00 ? 356  CYS B N  1 
ATOM 4621   C CA . CYS B 1 356  ? 1126.814 690.755 627.292 1.00 0.00 ? 356  CYS B CA 1 
ATOM 4622   C C  . CYS B 1 356  ? 1126.639 689.273 627.395 1.00 0.00 ? 356  CYS B C  1 
ATOM 4623   O O  . CYS B 1 356  ? 1126.182 688.626 626.455 1.00 0.00 ? 356  CYS B O  1 
ATOM 4624   C CB . CYS B 1 356  ? 1125.426 691.361 627.032 1.00 0.00 ? 356  CYS B CB 1 
ATOM 4625   N N  . GLN B 1 357  ? 1127.059 688.700 628.546 1.00 0.00 ? 357  GLN B N  1 
ATOM 4626   C CA . GLN B 1 357  ? 1126.872 687.302 628.829 1.00 0.00 ? 357  GLN B CA 1 
ATOM 4627   C C  . GLN B 1 357  ? 1125.486 686.910 629.254 1.00 0.00 ? 357  GLN B C  1 
ATOM 4628   O O  . GLN B 1 357  ? 1124.956 685.920 628.757 1.00 0.00 ? 357  GLN B O  1 
ATOM 4629   C CB . GLN B 1 357  ? 1127.785 686.727 629.920 1.00 0.00 ? 357  GLN B CB 1 
ATOM 4630   N N  . LEU B 1 358  ? 1124.846 687.659 630.176 1.00 0.00 ? 358  LEU B N  1 
ATOM 4631   C CA . LEU B 1 358  ? 1123.643 687.091 630.728 1.00 0.00 ? 358  LEU B CA 1 
ATOM 4632   C C  . LEU B 1 358  ? 1122.601 688.147 630.937 1.00 0.00 ? 358  LEU B C  1 
ATOM 4633   O O  . LEU B 1 358  ? 1122.909 689.329 631.070 1.00 0.00 ? 358  LEU B O  1 
ATOM 4634   C CB . LEU B 1 358  ? 1123.918 686.450 632.102 1.00 0.00 ? 358  LEU B CB 1 
ATOM 4635   N N  . LEU B 1 359  ? 1121.315 687.726 630.947 1.00 0.00 ? 359  LEU B N  1 
ATOM 4636   C CA . LEU B 1 359  ? 1120.238 688.635 631.218 1.00 0.00 ? 359  LEU B CA 1 
ATOM 4637   C C  . LEU B 1 359  ? 1119.482 688.034 632.363 1.00 0.00 ? 359  LEU B C  1 
ATOM 4638   O O  . LEU B 1 359  ? 1119.177 686.843 632.346 1.00 0.00 ? 359  LEU B O  1 
ATOM 4639   C CB . LEU B 1 359  ? 1119.254 688.784 630.038 1.00 0.00 ? 359  LEU B CB 1 
ATOM 4640   N N  . ALA B 1 360  ? 1119.178 688.830 633.409 1.00 0.00 ? 360  ALA B N  1 
ATOM 4641   C CA . ALA B 1 360  ? 1118.446 688.279 634.512 1.00 0.00 ? 360  ALA B CA 1 
ATOM 4642   C C  . ALA B 1 360  ? 1117.081 688.894 634.533 1.00 0.00 ? 360  ALA B C  1 
ATOM 4643   O O  . ALA B 1 360  ? 1116.922 690.097 634.328 1.00 0.00 ? 360  ALA B O  1 
ATOM 4644   C CB . ALA B 1 360  ? 1119.093 688.555 635.881 1.00 0.00 ? 360  ALA B CB 1 
ATOM 4645   N N  . VAL B 1 361  ? 1116.045 688.062 634.768 1.00 0.00 ? 361  VAL B N  1 
ATOM 4646   C CA . VAL B 1 361  ? 1114.707 688.567 634.856 1.00 0.00 ? 361  VAL B CA 1 
ATOM 4647   C C  . VAL B 1 361  ? 1114.277 688.413 636.278 1.00 0.00 ? 361  VAL B C  1 
ATOM 4648   O O  . VAL B 1 361  ? 1114.378 687.334 636.859 1.00 0.00 ? 361  VAL B O  1 
ATOM 4649   C CB . VAL B 1 361  ? 1113.720 687.841 633.987 1.00 0.00 ? 361  VAL B CB 1 
ATOM 4650   N N  . THR B 1 362  ? 1113.795 689.514 636.881 1.00 0.00 ? 362  THR B N  1 
ATOM 4651   C CA . THR B 1 362  ? 1113.393 689.486 638.256 1.00 0.00 ? 362  THR B CA 1 
ATOM 4652   C C  . THR B 1 362  ? 1111.924 689.216 638.318 1.00 0.00 ? 362  THR B C  1 
ATOM 4653   O O  . THR B 1 362  ? 1111.231 689.174 637.303 1.00 0.00 ? 362  THR B O  1 
ATOM 4654   C CB . THR B 1 362  ? 1113.628 690.787 638.965 1.00 0.00 ? 362  THR B CB 1 
ATOM 4655   N N  . HIS B 1 363  ? 1111.424 689.021 639.548 1.00 0.00 ? 363  HIS B N  1 
ATOM 4656   C CA . HIS B 1 363  ? 1110.039 688.755 639.805 1.00 0.00 ? 363  HIS B CA 1 
ATOM 4657   C C  . HIS B 1 363  ? 1109.279 689.981 639.400 1.00 0.00 ? 363  HIS B C  1 
ATOM 4658   O O  . HIS B 1 363  ? 1108.154 689.904 638.912 1.00 0.00 ? 363  HIS B O  1 
ATOM 4659   C CB . HIS B 1 363  ? 1109.791 688.477 641.297 1.00 0.00 ? 363  HIS B CB 1 
ATOM 4660   N N  . ALA B 1 364  ? 1109.898 691.155 639.608 1.00 0.00 ? 364  ALA B N  1 
ATOM 4661   C CA . ALA B 1 364  ? 1109.343 692.438 639.276 1.00 0.00 ? 364  ALA B CA 1 
ATOM 4662   C C  . ALA B 1 364  ? 1109.161 692.508 637.793 1.00 0.00 ? 364  ALA B C  1 
ATOM 4663   O O  . ALA B 1 364  ? 1108.274 693.202 637.302 1.00 0.00 ? 364  ALA B O  1 
ATOM 4664   C CB . ALA B 1 364  ? 1110.250 693.610 639.694 1.00 0.00 ? 364  ALA B CB 1 
ATOM 4665   N N  . GLY B 1 365  ? 1110.021 691.812 637.024 1.00 0.00 ? 365  GLY B N  1 
ATOM 4666   C CA . GLY B 1 365  ? 1109.881 691.864 635.601 1.00 0.00 ? 365  GLY B CA 1 
ATOM 4667   C C  . GLY B 1 365  ? 1110.947 692.764 635.054 1.00 0.00 ? 365  GLY B C  1 
ATOM 4668   O O  . GLY B 1 365  ? 1110.929 693.110 633.874 1.00 0.00 ? 365  GLY B O  1 
ATOM 4669   N N  . VAL B 1 366  ? 1111.896 693.180 635.914 1.00 0.00 ? 366  VAL B N  1 
ATOM 4670   C CA . VAL B 1 366  ? 1112.979 694.014 635.476 1.00 0.00 ? 366  VAL B CA 1 
ATOM 4671   C C  . VAL B 1 366  ? 1113.981 693.134 634.786 1.00 0.00 ? 366  VAL B C  1 
ATOM 4672   O O  . VAL B 1 366  ? 1114.166 691.974 635.155 1.00 0.00 ? 366  VAL B O  1 
ATOM 4673   C CB . VAL B 1 366  ? 1113.678 694.710 636.607 1.00 0.00 ? 366  VAL B CB 1 
ATOM 4674   N N  . ARG B 1 367  ? 1114.649 693.670 633.744 1.00 0.00 ? 367  ARG B N  1 
ATOM 4675   C CA . ARG B 1 367  ? 1115.605 692.905 632.991 1.00 0.00 ? 367  ARG B CA 1 
ATOM 4676   C C  . ARG B 1 367  ? 1116.955 693.482 633.273 1.00 0.00 ? 367  ARG B C  1 
ATOM 4677   O O  . ARG B 1 367  ? 1117.172 694.684 633.126 1.00 0.00 ? 367  ARG B O  1 
ATOM 4678   C CB . ARG B 1 367  ? 1115.325 693.006 631.483 1.00 0.00 ? 367  ARG B CB 1 
ATOM 4679   N N  . LEU B 1 368  ? 1117.906 692.627 633.701 1.00 0.00 ? 368  LEU B N  1 
ATOM 4680   C CA . LEU B 1 368  ? 1119.221 693.096 634.031 1.00 0.00 ? 368  LEU B CA 1 
ATOM 4681   C C  . LEU B 1 368  ? 1120.177 692.497 633.045 1.00 0.00 ? 368  LEU B C  1 
ATOM 4682   O O  . LEU B 1 368  ? 1120.079 691.317 632.714 1.00 0.00 ? 368  LEU B O  1 
ATOM 4683   C CB . LEU B 1 368  ? 1119.679 692.647 635.428 1.00 0.00 ? 368  LEU B CB 1 
ATOM 4684   N N  . TYR B 1 369  ? 1121.137 693.302 632.545 1.00 0.00 ? 369  TYR B N  1 
ATOM 4685   C CA . TYR B 1 369  ? 1122.076 692.791 631.584 1.00 0.00 ? 369  TYR B CA 1 
ATOM 4686   C C  . TYR B 1 369  ? 1123.450 692.913 632.164 1.00 0.00 ? 369  TYR B C  1 
ATOM 4687   O O  . TYR B 1 369  ? 1123.802 693.948 632.730 1.00 0.00 ? 369  TYR B O  1 
ATOM 4688   C CB . TYR B 1 369  ? 1122.072 693.563 630.251 1.00 0.00 ? 369  TYR B CB 1 
ATOM 4689   N N  . PHE B 1 370  ? 1124.267 691.842 632.042 1.00 0.00 ? 370  PHE B N  1 
ATOM 4690   C CA . PHE B 1 370  ? 1125.591 691.863 632.608 1.00 0.00 ? 370  PHE B CA 1 
ATOM 4691   C C  . PHE B 1 370  ? 1126.596 691.549 631.537 1.00 0.00 ? 370  PHE B C  1 
ATOM 4692   O O  . PHE B 1 370  ? 1126.355 690.717 630.662 1.00 0.00 ? 370  PHE B O  1 
ATOM 4693   C CB . PHE B 1 370  ? 1125.804 690.800 633.701 1.00 0.00 ? 370  PHE B CB 1 
ATOM 4694   N N  . SER B 1 371  ? 1127.760 692.234 631.581 1.00 0.00 ? 371  SER B N  1 
ATOM 4695   C CA . SER B 1 371  ? 1128.834 692.004 630.648 1.00 0.00 ? 371  SER B CA 1 
ATOM 4696   C C  . SER B 1 371  ? 1129.862 691.145 631.324 1.00 0.00 ? 371  SER B C  1 
ATOM 4697   O O  . SER B 1 371  ? 1129.848 691.005 632.545 1.00 0.00 ? 371  SER B O  1 
ATOM 4698   C CB . SER B 1 371  ? 1129.541 693.298 630.210 1.00 0.00 ? 371  SER B CB 1 
ATOM 4699   N N  . THR B 1 372  ? 1130.781 690.531 630.542 1.00 0.00 ? 372  THR B N  1 
ATOM 4700   C CA . THR B 1 372  ? 1131.810 689.720 631.144 1.00 0.00 ? 372  THR B CA 1 
ATOM 4701   C C  . THR B 1 372  ? 1133.002 689.707 630.230 1.00 0.00 ? 372  THR B C  1 
ATOM 4702   O O  . THR B 1 372  ? 1132.995 690.338 629.174 1.00 0.00 ? 372  THR B O  1 
ATOM 4703   C CB . THR B 1 372  ? 1131.466 688.275 631.251 1.00 0.00 ? 372  THR B CB 1 
ATOM 4704   N N  . CYS B 1 373  ? 1134.076 688.992 630.647 1.00 0.00 ? 373  CYS B N  1 
ATOM 4705   C CA . CYS B 1 373  ? 1135.223 688.806 629.797 1.00 0.00 ? 373  CYS B CA 1 
ATOM 4706   C C  . CYS B 1 373  ? 1135.879 687.504 630.175 1.00 0.00 ? 373  CYS B C  1 
ATOM 4707   O O  . CYS B 1 373  ? 1136.360 687.333 631.295 1.00 0.00 ? 373  CYS B O  1 
ATOM 4708   C CB . CYS B 1 373  ? 1136.287 689.908 629.932 1.00 0.00 ? 373  CYS B CB 1 
ATOM 4709   N N  . PRO B 1 374  ? 1135.865 686.565 629.261 1.00 0.00 ? 374  PRO B N  1 
ATOM 4710   C CA . PRO B 1 374  ? 1136.499 685.287 629.491 1.00 0.00 ? 374  PRO B CA 1 
ATOM 4711   C C  . PRO B 1 374  ? 1137.919 685.262 629.010 1.00 0.00 ? 374  PRO B C  1 
ATOM 4712   O O  . PRO B 1 374  ? 1138.346 686.201 628.340 1.00 0.00 ? 374  PRO B O  1 
ATOM 4713   C CB . PRO B 1 374  ? 1135.638 684.245 628.775 1.00 0.00 ? 374  PRO B CB 1 
ATOM 4714   N N  . PHE B 1 375  ? 1138.658 684.187 629.356 1.00 0.00 ? 375  PHE B N  1 
ATOM 4715   C CA . PHE B 1 375  ? 1139.992 683.951 628.882 1.00 0.00 ? 375  PHE B CA 1 
ATOM 4716   C C  . PHE B 1 375  ? 1140.065 682.463 628.743 1.00 0.00 ? 375  PHE B C  1 
ATOM 4717   O O  . PHE B 1 375  ? 1139.095 681.789 629.090 1.00 0.00 ? 375  PHE B O  1 
ATOM 4718   C CB . PHE B 1 375  ? 1141.097 684.416 629.850 1.00 0.00 ? 375  PHE B CB 1 
ATOM 4719   N N  . ARG B 1 376  ? 1141.180 681.908 628.212 1.00 0.00 ? 376  ARG B N  1 
ATOM 4720   C CA . ARG B 1 376  ? 1141.237 680.478 628.056 1.00 0.00 ? 376  ARG B CA 1 
ATOM 4721   C C  . ARG B 1 376  ? 1141.026 679.901 629.410 1.00 0.00 ? 376  ARG B C  1 
ATOM 4722   O O  . ARG B 1 376  ? 1140.007 679.269 629.677 1.00 0.00 ? 376  ARG B O  1 
ATOM 4723   C CB . ARG B 1 376  ? 1142.607 679.976 627.559 1.00 0.00 ? 376  ARG B CB 1 
ATOM 4724   N N  . ALA B 1 380  ? 1142.573 680.356 631.730 1.00 0.00 ? 380  ALA B N  1 
ATOM 4725   C CA . ALA B 1 380  ? 1141.449 679.691 632.309 1.00 0.00 ? 380  ALA B CA 1 
ATOM 4726   C C  . ALA B 1 380  ? 1140.991 680.652 633.350 1.00 0.00 ? 380  ALA B C  1 
ATOM 4727   O O  . ALA B 1 380  ? 1141.548 680.697 634.447 1.00 0.00 ? 380  ALA B O  1 
ATOM 4728   C CB . ALA B 1 380  ? 1141.794 678.361 633.001 1.00 0.00 ? 380  ALA B CB 1 
ATOM 4729   N N  . ARG B 1 381  ? 1139.971 681.471 633.032 1.00 0.00 ? 381  ARG B N  1 
ATOM 4730   C CA . ARG B 1 381  ? 1139.548 682.407 634.027 1.00 0.00 ? 381  ARG B CA 1 
ATOM 4731   C C  . ARG B 1 381  ? 1138.389 683.189 633.508 1.00 0.00 ? 381  ARG B C  1 
ATOM 4732   O O  . ARG B 1 381  ? 1138.389 683.695 632.387 1.00 0.00 ? 381  ARG B O  1 
ATOM 4733   C CB . ARG B 1 381  ? 1140.643 683.423 634.399 1.00 0.00 ? 381  ARG B CB 1 
ATOM 4734   N N  . PRO B 1 382  ? 1137.388 683.242 634.333 1.00 0.00 ? 382  PRO B N  1 
ATOM 4735   C CA . PRO B 1 382  ? 1136.224 684.034 634.048 1.00 0.00 ? 382  PRO B CA 1 
ATOM 4736   C C  . PRO B 1 382  ? 1136.427 685.398 634.619 1.00 0.00 ? 382  PRO B C  1 
ATOM 4737   O O  . PRO B 1 382  ? 1137.376 685.596 635.375 1.00 0.00 ? 382  PRO B O  1 
ATOM 4738   C CB . PRO B 1 382  ? 1135.039 683.298 634.678 1.00 0.00 ? 382  PRO B CB 1 
ATOM 4739   N N  . ASN B 1 383  ? 1135.552 686.356 634.270 1.00 0.00 ? 383  ASN B N  1 
ATOM 4740   C CA . ASN B 1 383  ? 1135.663 687.661 634.849 1.00 0.00 ? 383  ASN B CA 1 
ATOM 4741   C C  . ASN B 1 383  ? 1134.391 687.875 635.599 1.00 0.00 ? 383  ASN B C  1 
ATOM 4742   O O  . ASN B 1 383  ? 1133.363 687.290 635.259 1.00 0.00 ? 383  ASN B O  1 
ATOM 4743   C CB . ASN B 1 383  ? 1135.780 688.785 633.807 1.00 0.00 ? 383  ASN B CB 1 
ATOM 4744   N N  . THR B 1 384  ? 1134.424 688.705 636.655 1.00 0.00 ? 384  THR B N  1 
ATOM 4745   C CA . THR B 1 384  ? 1133.210 688.914 637.389 1.00 0.00 ? 384  THR B CA 1 
ATOM 4746   C C  . THR B 1 384  ? 1132.290 689.678 636.497 1.00 0.00 ? 384  THR B C  1 
ATOM 4747   O O  . THR B 1 384  ? 1132.721 690.529 635.720 1.00 0.00 ? 384  THR B O  1 
ATOM 4748   C CB . THR B 1 384  ? 1133.382 689.695 638.659 1.00 0.00 ? 384  THR B CB 1 
ATOM 4749   N N  . LEU B 1 385  ? 1130.982 689.371 636.578 1.00 0.00 ? 385  LEU B N  1 
ATOM 4750   C CA . LEU B 1 385  ? 1130.026 690.002 635.716 1.00 0.00 ? 385  LEU B CA 1 
ATOM 4751   C C  . LEU B 1 385  ? 1129.753 691.384 636.218 1.00 0.00 ? 385  LEU B C  1 
ATOM 4752   O O  . LEU B 1 385  ? 1129.825 691.653 637.416 1.00 0.00 ? 385  LEU B O  1 
ATOM 4753   C CB . LEU B 1 385  ? 1128.679 689.259 635.653 1.00 0.00 ? 385  LEU B CB 1 
ATOM 4754   N N  . THR B 1 386  ? 1129.445 692.311 635.289 1.00 0.00 ? 386  THR B N  1 
ATOM 4755   C CA . THR B 1 386  ? 1129.127 693.652 635.682 1.00 0.00 ? 386  THR B CA 1 
ATOM 4756   C C  . THR B 1 386  ? 1127.761 693.945 635.154 1.00 0.00 ? 386  THR B C  1 
ATOM 4757   O O  . THR B 1 386  ? 1127.326 693.348 634.171 1.00 0.00 ? 386  THR B O  1 
ATOM 4758   C CB . THR B 1 386  ? 1130.058 694.686 635.119 1.00 0.00 ? 386  THR B CB 1 
ATOM 4759   N N  . LEU B 1 387  ? 1127.034 694.875 635.807 1.00 0.00 ? 387  LEU B N  1 
ATOM 4760   C CA . LEU B 1 387  ? 1125.704 695.170 635.354 1.00 0.00 ? 387  LEU B CA 1 
ATOM 4761   C C  . LEU B 1 387  ? 1125.783 696.244 634.321 1.00 0.00 ? 387  LEU B C  1 
ATOM 4762   O O  . LEU B 1 387  ? 1125.996 697.414 634.635 1.00 0.00 ? 387  LEU B O  1 
ATOM 4763   C CB . LEU B 1 387  ? 1124.771 695.678 636.466 1.00 0.00 ? 387  LEU B CB 1 
ATOM 4764   N N  . VAL B 1 388  ? 1125.646 695.845 633.041 1.00 0.00 ? 388  VAL B N  1 
ATOM 4765   C CA . VAL B 1 388  ? 1125.695 696.761 631.941 1.00 0.00 ? 388  VAL B CA 1 
ATOM 4766   C C  . VAL B 1 388  ? 1124.473 697.630 631.887 1.00 0.00 ? 388  VAL B C  1 
ATOM 4767   O O  . VAL B 1 388  ? 1124.585 698.851 631.793 1.00 0.00 ? 388  VAL B O  1 
ATOM 4768   C CB . VAL B 1 388  ? 1125.790 696.068 630.614 1.00 0.00 ? 388  VAL B CB 1 
ATOM 4769   N N  . HIS B 1 389  ? 1123.261 697.034 631.962 1.00 0.00 ? 389  HIS B N  1 
ATOM 4770   C CA . HIS B 1 389  ? 1122.105 697.865 631.761 1.00 0.00 ? 389  HIS B CA 1 
ATOM 4771   C C  . HIS B 1 389  ? 1120.912 697.250 632.430 1.00 0.00 ? 389  HIS B C  1 
ATOM 4772   O O  . HIS B 1 389  ? 1120.936 696.086 632.827 1.00 0.00 ? 389  HIS B O  1 
ATOM 4773   C CB . HIS B 1 389  ? 1121.775 698.016 630.264 1.00 0.00 ? 389  HIS B CB 1 
ATOM 4774   N N  . VAL B 1 390  ? 1119.833 698.051 632.591 1.00 0.00 ? 390  VAL B N  1 
ATOM 4775   C CA . VAL B 1 390  ? 1118.621 697.573 633.193 1.00 0.00 ? 390  VAL B CA 1 
ATOM 4776   C C  . VAL B 1 390  ? 1117.457 698.104 632.414 1.00 0.00 ? 390  VAL B C  1 
ATOM 4777   O O  . VAL B 1 390  ? 1117.526 699.180 631.823 1.00 0.00 ? 390  VAL B O  1 
ATOM 4778   C CB . VAL B 1 390  ? 1118.446 698.028 634.613 1.00 0.00 ? 390  VAL B CB 1 
ATOM 4779   N N  . ARG B 1 391  ? 1116.348 697.336 632.381 1.00 0.00 ? 391  ARG B N  1 
ATOM 4780   C CA . ARG B 1 391  ? 1115.168 697.771 631.687 1.00 0.00 ? 391  ARG B CA 1 
ATOM 4781   C C  . ARG B 1 391  ? 1114.027 697.582 632.636 1.00 0.00 ? 391  ARG B C  1 
ATOM 4782   O O  . ARG B 1 391  ? 1114.010 696.628 633.413 1.00 0.00 ? 391  ARG B O  1 
ATOM 4783   C CB . ARG B 1 391  ? 1114.872 696.946 630.422 1.00 0.00 ? 391  ARG B CB 1 
ATOM 4784   N N  . LEU B 1 392  ? 1113.041 698.501 632.605 1.00 0.00 ? 392  LEU B N  1 
ATOM 4785   C CA . LEU B 1 392  ? 1111.932 698.409 633.514 1.00 0.00 ? 392  LEU B CA 1 
ATOM 4786   C C  . LEU B 1 392  ? 1110.693 698.075 632.745 1.00 0.00 ? 392  LEU B C  1 
ATOM 4787   O O  . LEU B 1 392  ? 1110.584 698.307 631.541 1.00 0.00 ? 392  LEU B O  1 
ATOM 4788   C CB . LEU B 1 392  ? 1111.651 699.704 634.293 1.00 0.00 ? 392  LEU B CB 1 
ATOM 4789   N N  . PRO B 1 393  ? 1109.768 697.489 633.458 1.00 0.00 ? 393  PRO B N  1 
ATOM 4790   C CA . PRO B 1 393  ? 1108.507 697.103 632.879 1.00 0.00 ? 393  PRO B CA 1 
ATOM 4791   C C  . PRO B 1 393  ? 1107.655 698.281 632.570 1.00 0.00 ? 393  PRO B C  1 
ATOM 4792   O O  . PRO B 1 393  ? 1107.693 699.244 633.333 1.00 0.00 ? 393  PRO B O  1 
ATOM 4793   C CB . PRO B 1 393  ? 1107.854 696.193 633.910 1.00 0.00 ? 393  PRO B CB 1 
ATOM 4794   N N  . PRO B 1 394  ? 1106.929 698.262 631.489 1.00 0.00 ? 394  PRO B N  1 
ATOM 4795   C CA . PRO B 1 394  ? 1106.008 699.317 631.202 1.00 0.00 ? 394  PRO B CA 1 
ATOM 4796   C C  . PRO B 1 394  ? 1104.783 699.117 632.034 1.00 0.00 ? 394  PRO B C  1 
ATOM 4797   O O  . PRO B 1 394  ? 1103.991 698.238 631.697 1.00 0.00 ? 394  PRO B O  1 
ATOM 4798   C CB . PRO B 1 394  ? 1105.673 699.204 629.720 1.00 0.00 ? 394  PRO B CB 1 
ATOM 4799   N N  . GLY B 1 395  ? 1104.581 699.868 633.126 1.00 0.00 ? 395  GLY B N  1 
ATOM 4800   C CA . GLY B 1 395  ? 1103.260 699.829 633.674 1.00 0.00 ? 395  GLY B CA 1 
ATOM 4801   C C  . GLY B 1 395  ? 1102.612 700.639 632.635 1.00 0.00 ? 395  GLY B C  1 
ATOM 4802   O O  . GLY B 1 395  ? 1101.495 700.432 632.161 1.00 0.00 ? 395  GLY B O  1 
ATOM 4803   N N  . PHE B 1 396  ? 1103.453 701.619 632.306 1.00 0.00 ? 396  PHE B N  1 
ATOM 4804   C CA . PHE B 1 396  ? 1103.487 702.645 631.335 1.00 0.00 ? 396  PHE B CA 1 
ATOM 4805   C C  . PHE B 1 396  ? 1104.960 702.857 631.253 1.00 0.00 ? 396  PHE B C  1 
ATOM 4806   O O  . PHE B 1 396  ? 1105.553 702.655 630.194 1.00 0.00 ? 396  PHE B O  1 
ATOM 4807   C CB . PHE B 1 396  ? 1102.848 703.965 631.794 1.00 0.00 ? 396  PHE B CB 1 
ATOM 4808   N N  . SER B 1 397  ? 1105.560 703.203 632.429 1.00 0.00 ? 397  SER B N  1 
ATOM 4809   C CA . SER B 1 397  ? 1106.955 703.515 632.620 1.00 0.00 ? 397  SER B CA 1 
ATOM 4810   C C  . SER B 1 397  ? 1107.515 702.727 633.787 1.00 0.00 ? 397  SER B C  1 
ATOM 4811   O O  . SER B 1 397  ? 1107.088 701.606 634.062 1.00 0.00 ? 397  SER B O  1 
ATOM 4812   C CB . SER B 1 397  ? 1107.190 705.021 632.876 1.00 0.00 ? 397  SER B CB 1 
ATOM 4813   N N  . ALA B 1 398  ? 1108.515 703.316 634.486 1.00 0.00 ? 398  ALA B N  1 
ATOM 4814   C CA . ALA B 1 398  ? 1109.388 702.723 635.478 1.00 0.00 ? 398  ALA B CA 1 
ATOM 4815   C C  . ALA B 1 398  ? 1108.787 702.179 636.753 1.00 0.00 ? 398  ALA B C  1 
ATOM 4816   O O  . ALA B 1 398  ? 1109.127 701.065 637.142 1.00 0.00 ? 398  ALA B O  1 
ATOM 4817   C CB . ALA B 1 398  ? 1110.486 703.708 635.913 1.00 0.00 ? 398  ALA B CB 1 
ATOM 4818   N N  . SER B 1 399  ? 1107.893 702.903 637.453 1.00 0.00 ? 399  SER B N  1 
ATOM 4819   C CA . SER B 1 399  ? 1107.491 702.427 638.758 1.00 0.00 ? 399  SER B CA 1 
ATOM 4820   C C  . SER B 1 399  ? 1106.586 701.239 638.644 1.00 0.00 ? 399  SER B C  1 
ATOM 4821   O O  . SER B 1 399  ? 1106.219 700.620 639.641 1.00 0.00 ? 399  SER B O  1 
ATOM 4822   C CB . SER B 1 399  ? 1106.778 703.486 639.619 1.00 0.00 ? 399  SER B CB 1 
ATOM 4823   N N  . SER B 1 400  ? 1106.251 700.877 637.402 1.00 0.00 ? 400  SER B N  1 
ATOM 4824   C CA . SER B 1 400  ? 1105.311 699.863 637.022 1.00 0.00 ? 400  SER B CA 1 
ATOM 4825   C C  . SER B 1 400  ? 1105.292 698.667 637.918 1.00 0.00 ? 400  SER B C  1 
ATOM 4826   O O  . SER B 1 400  ? 1106.320 698.192 638.396 1.00 0.00 ? 400  SER B O  1 
ATOM 4827   C CB . SER B 1 400  ? 1105.641 699.287 635.651 1.00 0.00 ? 400  SER B CB 1 
ATOM 4828   N N  . THR B 1 401  ? 1104.060 698.169 638.172 1.00 0.00 ? 401  THR B N  1 
ATOM 4829   C CA . THR B 1 401  ? 1103.850 696.939 638.872 1.00 0.00 ? 401  THR B CA 1 
ATOM 4830   C C  . THR B 1 401  ? 1103.075 696.061 637.932 1.00 0.00 ? 401  THR B C  1 
ATOM 4831   O O  . THR B 1 401  ? 1102.441 695.094 638.352 1.00 0.00 ? 401  THR B O  1 
ATOM 4832   C CB . THR B 1 401  ? 1102.999 697.086 640.102 1.00 0.00 ? 401  THR B CB 1 
ATOM 4833   N N  . VAL B 1 402  ? 1103.120 696.371 636.620 1.00 0.00 ? 402  VAL B N  1 
ATOM 4834   C CA . VAL B 1 402  ? 1102.355 695.617 635.668 1.00 0.00 ? 402  VAL B CA 1 
ATOM 4835   C C  . VAL B 1 402  ? 1102.865 694.209 635.615 1.00 0.00 ? 402  VAL B C  1 
ATOM 4836   O O  . VAL B 1 402  ? 1102.090 693.255 635.609 1.00 0.00 ? 402  VAL B O  1 
ATOM 4837   C CB . VAL B 1 402  ? 1102.386 696.205 634.278 1.00 0.00 ? 402  VAL B CB 1 
ATOM 4838   N N  . GLU B 1 403  ? 1104.202 694.065 635.579 1.00 0.00 ? 403  GLU B N  1 
ATOM 4839   C CA . GLU B 1 403  ? 1104.893 692.812 635.475 1.00 0.00 ? 403  GLU B CA 1 
ATOM 4840   C C  . GLU B 1 403  ? 1104.840 692.071 636.769 1.00 0.00 ? 403  GLU B C  1 
ATOM 4841   O O  . GLU B 1 403  ? 1105.149 690.886 636.821 1.00 0.00 ? 403  GLU B O  1 
ATOM 4842   C CB . GLU B 1 403  ? 1106.337 692.964 634.976 1.00 0.00 ? 403  GLU B CB 1 
ATOM 4843   N N  . LYS B 1 404  ? 1104.540 692.766 637.875 1.00 0.00 ? 404  LYS B N  1 
ATOM 4844   C CA . LYS B 1 404  ? 1104.484 692.091 639.138 1.00 0.00 ? 404  LYS B CA 1 
ATOM 4845   C C  . LYS B 1 404  ? 1103.226 691.291 639.227 1.00 0.00 ? 404  LYS B C  1 
ATOM 4846   O O  . LYS B 1 404  ? 1102.143 691.791 638.928 1.00 0.00 ? 404  LYS B O  1 
ATOM 4847   C CB . LYS B 1 404  ? 1104.445 693.088 640.308 1.00 0.00 ? 404  LYS B CB 1 
ATOM 4848   N N  . PRO B 1 405  ? 1103.310 690.045 639.619 1.00 0.00 ? 405  PRO B N  1 
ATOM 4849   C CA . PRO B 1 405  ? 1104.586 689.371 639.733 1.00 0.00 ? 405  PRO B CA 1 
ATOM 4850   C C  . PRO B 1 405  ? 1104.936 688.699 638.434 1.00 0.00 ? 405  PRO B C  1 
ATOM 4851   O O  . PRO B 1 405  ? 1104.049 688.540 637.594 1.00 0.00 ? 405  PRO B O  1 
ATOM 4852   C CB . PRO B 1 405  ? 1104.446 688.378 640.879 1.00 0.00 ? 405  PRO B CB 1 
ATOM 4853   N N  . SER B 1 406  ? 1106.208 688.289 638.243 1.00 0.00 ? 406  SER B N  1 
ATOM 4854   C CA . SER B 1 406  ? 1106.597 687.653 637.015 1.00 0.00 ? 406  SER B CA 1 
ATOM 4855   C C  . SER B 1 406  ? 1107.087 686.282 637.368 1.00 0.00 ? 406  SER B C  1 
ATOM 4856   O O  . SER B 1 406  ? 1107.825 686.110 638.338 1.00 0.00 ? 406  SER B O  1 
ATOM 4857   C CB . SER B 1 406  ? 1107.716 688.405 636.277 1.00 0.00 ? 406  SER B CB 1 
ATOM 4858   N N  . LYS B 1 407  ? 1106.664 685.263 636.586 1.00 0.00 ? 407  LYS B N  1 
ATOM 4859   C CA . LYS B 1 407  ? 1107.022 683.900 636.872 1.00 0.00 ? 407  LYS B CA 1 
ATOM 4860   C C  . LYS B 1 407  ? 1108.239 683.511 636.087 1.00 0.00 ? 407  LYS B C  1 
ATOM 4861   O O  . LYS B 1 407  ? 1108.624 684.174 635.126 1.00 0.00 ? 407  LYS B O  1 
ATOM 4862   C CB . LYS B 1 407  ? 1105.927 682.867 636.534 1.00 0.00 ? 407  LYS B CB 1 
ATOM 4863   N N  . VAL B 1 408  ? 1108.857 682.387 636.513 1.00 0.00 ? 408  VAL B N  1 
ATOM 4864   C CA . VAL B 1 408  ? 1110.048 681.757 636.010 1.00 0.00 ? 408  VAL B CA 1 
ATOM 4865   C C  . VAL B 1 408  ? 1109.816 681.319 634.601 1.00 0.00 ? 408  VAL B C  1 
ATOM 4866   O O  . VAL B 1 408  ? 1110.753 681.186 633.814 1.00 0.00 ? 408  VAL B O  1 
ATOM 4867   C CB . VAL B 1 408  ? 1110.420 680.539 636.805 1.00 0.00 ? 408  VAL B CB 1 
ATOM 4868   N N  . HIS B 1 409  ? 1108.541 681.082 634.259 1.00 0.00 ? 409  HIS B N  1 
ATOM 4869   C CA . HIS B 1 409  ? 1108.100 680.622 632.976 1.00 0.00 ? 409  HIS B CA 1 
ATOM 4870   C C  . HIS B 1 409  ? 1108.630 681.558 631.933 1.00 0.00 ? 409  HIS B C  1 
ATOM 4871   O O  . HIS B 1 409  ? 1108.991 681.134 630.834 1.00 0.00 ? 409  HIS B O  1 
ATOM 4872   C CB . HIS B 1 409  ? 1106.570 680.674 632.930 1.00 0.00 ? 409  HIS B CB 1 
ATOM 4873   N N  . ARG B 1 410  ? 1108.691 682.860 632.261 1.00 0.00 ? 410  ARG B N  1 
ATOM 4874   C CA . ARG B 1 410  ? 1109.146 683.897 631.380 1.00 0.00 ? 410  ARG B CA 1 
ATOM 4875   C C  . ARG B 1 410  ? 1110.492 683.534 630.831 1.00 0.00 ? 410  ARG B C  1 
ATOM 4876   O O  . ARG B 1 410  ? 1111.316 682.932 631.519 1.00 0.00 ? 410  ARG B O  1 
ATOM 4877   C CB . ARG B 1 410  ? 1109.264 685.228 632.139 1.00 0.00 ? 410  ARG B CB 1 
ATOM 4878   N N  . ALA B 1 411  ? 1110.735 683.873 629.543 1.00 0.00 ? 411  ALA B N  1 
ATOM 4879   C CA . ALA B 1 411  ? 1111.993 683.551 628.931 1.00 0.00 ? 411  ALA B CA 1 
ATOM 4880   C C  . ALA B 1 411  ? 1112.268 684.551 627.854 1.00 0.00 ? 411  ALA B C  1 
ATOM 4881   O O  . ALA B 1 411  ? 1111.374 685.279 627.423 1.00 0.00 ? 411  ALA B O  1 
ATOM 4882   C CB . ALA B 1 411  ? 1112.021 682.160 628.274 1.00 0.00 ? 411  ALA B CB 1 
ATOM 4883   N N  . LEU B 1 412  ? 1113.541 684.622 627.406 1.00 0.00 ? 412  LEU B N  1 
ATOM 4884   C CA . LEU B 1 412  ? 1113.900 685.562 626.386 1.00 0.00 ? 412  LEU B CA 1 
ATOM 4885   C C  . LEU B 1 412  ? 1114.274 684.728 625.189 1.00 0.00 ? 412  LEU B C  1 
ATOM 4886   O O  . LEU B 1 412  ? 1114.973 683.721 625.309 1.00 0.00 ? 412  LEU B O  1 
ATOM 4887   C CB . LEU B 1 412  ? 1115.084 686.447 626.823 1.00 0.00 ? 412  LEU B CB 1 
ATOM 4888   N N  . TYR B 1 413  ? 1113.794 685.139 624.000 1.00 0.00 ? 413  TYR B N  1 
ATOM 4889   C CA . TYR B 1 413  ? 1113.896 684.441 622.743 1.00 0.00 ? 413  TYR B CA 1 
ATOM 4890   C C  . TYR B 1 413  ? 1115.094 685.034 622.076 1.00 0.00 ? 413  TYR B C  1 
ATOM 4891   O O  . TYR B 1 413  ? 1115.304 686.237 622.189 1.00 0.00 ? 413  TYR B O  1 
ATOM 4892   C CB . TYR B 1 413  ? 1112.708 684.846 621.862 1.00 0.00 ? 413  TYR B CB 1 
ATOM 4893   N N  . SER B 1 414  ? 1115.914 684.223 621.372 1.00 0.00 ? 414  SER B N  1 
ATOM 4894   C CA . SER B 1 414  ? 1117.074 684.790 620.741 1.00 0.00 ? 414  SER B CA 1 
ATOM 4895   C C  . SER B 1 414  ? 1116.628 685.881 619.840 1.00 0.00 ? 414  SER B C  1 
ATOM 4896   O O  . SER B 1 414  ? 1115.734 685.683 619.020 1.00 0.00 ? 414  SER B O  1 
ATOM 4897   C CB . SER B 1 414  ? 1117.897 683.809 619.892 1.00 0.00 ? 414  SER B CB 1 
ATOM 4898   N N  . LYS B 1 415  ? 1117.304 687.030 620.041 1.00 0.00 ? 415  LYS B N  1 
ATOM 4899   C CA . LYS B 1 415  ? 1117.249 688.388 619.573 1.00 0.00 ? 415  LYS B CA 1 
ATOM 4900   C C  . LYS B 1 415  ? 1116.271 689.171 620.391 1.00 0.00 ? 415  LYS B C  1 
ATOM 4901   O O  . LYS B 1 415  ? 1115.363 689.820 619.872 1.00 0.00 ? 415  LYS B O  1 
ATOM 4902   C CB . LYS B 1 415  ? 1117.102 688.732 618.062 1.00 0.00 ? 415  LYS B CB 1 
ATOM 4903   N N  . GLY B 1 416  ? 1116.464 689.099 621.726 1.00 0.00 ? 416  GLY B N  1 
ATOM 4904   C CA . GLY B 1 416  ? 1115.826 689.911 622.724 1.00 0.00 ? 416  GLY B CA 1 
ATOM 4905   C C  . GLY B 1 416  ? 1114.330 689.892 622.687 1.00 0.00 ? 416  GLY B C  1 
ATOM 4906   O O  . GLY B 1 416  ? 1113.702 690.896 623.025 1.00 0.00 ? 416  GLY B O  1 
ATOM 4907   N N  . ILE B 1 417  ? 1113.683 688.777 622.315 1.00 0.00 ? 417  ILE B N  1 
ATOM 4908   C CA . ILE B 1 417  ? 1112.254 688.864 622.345 1.00 0.00 ? 417  ILE B CA 1 
ATOM 4909   C C  . ILE B 1 417  ? 1111.824 688.314 623.661 1.00 0.00 ? 417  ILE B C  1 
ATOM 4910   O O  . ILE B 1 417  ? 1112.165 687.191 624.038 1.00 0.00 ? 417  ILE B O  1 
ATOM 4911   C CB . ILE B 1 417  ? 1111.574 688.164 621.202 1.00 0.00 ? 417  ILE B CB 1 
ATOM 4912   N N  . LEU B 1 418  ? 1111.073 689.137 624.411 1.00 0.00 ? 418  LEU B N  1 
ATOM 4913   C CA . LEU B 1 418  ? 1110.730 688.848 625.769 1.00 0.00 ? 418  LEU B CA 1 
ATOM 4914   C C  . LEU B 1 418  ? 1109.328 688.333 625.865 1.00 0.00 ? 418  LEU B C  1 
ATOM 4915   O O  . LEU B 1 418  ? 1108.384 688.956 625.378 1.00 0.00 ? 418  LEU B O  1 
ATOM 4916   C CB . LEU B 1 418  ? 1110.804 690.122 626.622 1.00 0.00 ? 418  LEU B CB 1 
ATOM 4917   N N  . LEU B 1 419  ? 1109.162 687.157 626.499 1.00 0.00 ? 419  LEU B N  1 
ATOM 4918   C CA . LEU B 1 419  ? 1107.849 686.649 626.765 1.00 0.00 ? 419  LEU B CA 1 
ATOM 4919   C C  . LEU B 1 419  ? 1107.702 686.707 628.243 1.00 0.00 ? 419  LEU B C  1 
ATOM 4920   O O  . LEU B 1 419  ? 1108.469 686.088 628.980 1.00 0.00 ? 419  LEU B O  1 
ATOM 4921   C CB . LEU B 1 419  ? 1107.624 685.195 626.317 1.00 0.00 ? 419  LEU B CB 1 
ATOM 4922   N N  . MET B 1 420  ? 1106.703 687.467 628.724 1.00 0.00 ? 420  MET B N  1 
ATOM 4923   C CA . MET B 1 420  ? 1106.578 687.628 630.138 1.00 0.00 ? 420  MET B CA 1 
ATOM 4924   C C  . MET B 1 420  ? 1105.348 686.940 630.616 1.00 0.00 ? 420  MET B C  1 
ATOM 4925   O O  . MET B 1 420  ? 1104.248 687.164 630.113 1.00 0.00 ? 420  MET B O  1 
ATOM 4926   C CB . MET B 1 420  ? 1106.434 689.087 630.557 1.00 0.00 ? 420  MET B CB 1 
ATOM 4927   N N  . ALA B 1 421  ? 1105.514 686.066 631.622 1.00 0.00 ? 421  ALA B N  1 
ATOM 4928   C CA . ALA B 1 421  ? 1104.359 685.460 632.201 1.00 0.00 ? 421  ALA B CA 1 
ATOM 4929   C C  . ALA B 1 421  ? 1104.156 686.186 633.481 1.00 0.00 ? 421  ALA B C  1 
ATOM 4930   O O  . ALA B 1 421  ? 1105.048 686.234 634.329 1.00 0.00 ? 421  ALA B O  1 
ATOM 4931   C CB . ALA B 1 421  ? 1104.540 683.971 632.537 1.00 0.00 ? 421  ALA B CB 1 
ATOM 4932   N N  . ALA B 1 422  ? 1102.975 686.796 633.656 1.00 0.00 ? 422  ALA B N  1 
ATOM 4933   C CA . ALA B 1 422  ? 1102.805 687.498 634.887 1.00 0.00 ? 422  ALA B CA 1 
ATOM 4934   C C  . ALA B 1 422  ? 1101.657 686.892 635.597 1.00 0.00 ? 422  ALA B C  1 
ATOM 4935   O O  . ALA B 1 422  ? 1100.621 686.597 635.001 1.00 0.00 ? 422  ALA B O  1 
ATOM 4936   C CB . ALA B 1 422  ? 1102.476 688.987 634.729 1.00 0.00 ? 422  ALA B CB 1 
ATOM 4937   N N  . SER B 1 423  ? 1101.828 686.668 636.908 1.00 0.00 ? 423  SER B N  1 
ATOM 4938   C CA . SER B 1 423  ? 1100.725 686.178 637.658 1.00 0.00 ? 423  SER B CA 1 
ATOM 4939   C C  . SER B 1 423  ? 1100.402 687.269 638.603 1.00 0.00 ? 423  SER B C  1 
ATOM 4940   O O  . SER B 1 423  ? 1101.218 687.607 639.455 1.00 0.00 ? 423  SER B O  1 
ATOM 4941   C CB . SER B 1 423  ? 1101.040 684.929 638.499 1.00 0.00 ? 423  SER B CB 1 
ATOM 4942   N N  . GLU B 1 424  ? 1099.199 687.853 638.476 1.00 0.00 ? 424  GLU B N  1 
ATOM 4943   C CA . GLU B 1 424  ? 1098.820 688.909 639.359 1.00 0.00 ? 424  GLU B CA 1 
ATOM 4944   C C  . GLU B 1 424  ? 1098.543 688.220 640.645 1.00 0.00 ? 424  GLU B C  1 
ATOM 4945   O O  . GLU B 1 424  ? 1098.425 686.999 640.675 1.00 0.00 ? 424  GLU B O  1 
ATOM 4946   C CB . GLU B 1 424  ? 1097.536 689.634 638.921 1.00 0.00 ? 424  GLU B CB 1 
ATOM 4947   N N  . ASN B 1 425  ? 1098.441 688.983 641.746 1.00 0.00 ? 425  ASN B N  1 
ATOM 4948   C CA . ASN B 1 425  ? 1098.203 688.369 643.016 1.00 0.00 ? 425  ASN B CA 1 
ATOM 4949   C C  . ASN B 1 425  ? 1096.923 687.616 642.887 1.00 0.00 ? 425  ASN B C  1 
ATOM 4950   O O  . ASN B 1 425  ? 1095.842 688.176 643.067 1.00 0.00 ? 425  ASN B O  1 
ATOM 4951   C CB . ASN B 1 425  ? 1098.088 689.363 644.185 1.00 0.00 ? 425  ASN B CB 1 
ATOM 4952   N N  . ASP B 1 427  ? 1094.904 689.538 640.207 1.00 0.00 ? 427  ASP B N  1 
ATOM 4953   C CA . ASP B 1 427  ? 1093.692 688.797 640.053 1.00 0.00 ? 427  ASP B CA 1 
ATOM 4954   C C  . ASP B 1 427  ? 1093.940 687.552 639.239 1.00 0.00 ? 427  ASP B C  1 
ATOM 4955   O O  . ASP B 1 427  ? 1093.415 686.491 639.575 1.00 0.00 ? 427  ASP B O  1 
ATOM 4956   C CB . ASP B 1 427  ? 1092.568 689.610 639.402 1.00 0.00 ? 427  ASP B CB 1 
ATOM 4957   N N  . ASN B 1 428  ? 1094.758 687.628 638.157 1.00 0.00 ? 428  ASN B N  1 
ATOM 4958   C CA . ASN B 1 428  ? 1094.905 686.463 637.310 1.00 0.00 ? 428  ASN B CA 1 
ATOM 4959   C C  . ASN B 1 428  ? 1096.201 686.481 636.548 1.00 0.00 ? 428  ASN B C  1 
ATOM 4960   O O  . ASN B 1 428  ? 1097.073 687.321 636.776 1.00 0.00 ? 428  ASN B O  1 
ATOM 4961   C CB . ASN B 1 428  ? 1093.786 686.332 636.264 1.00 0.00 ? 428  ASN B CB 1 
ATOM 4962   N N  . ASP B 1 429  ? 1096.344 685.509 635.612 1.00 0.00 ? 429  ASP B N  1 
ATOM 4963   C CA . ASP B 1 429  ? 1097.525 685.306 634.808 1.00 0.00 ? 429  ASP B CA 1 
ATOM 4964   C C  . ASP B 1 429  ? 1097.397 686.087 633.537 1.00 0.00 ? 429  ASP B C  1 
ATOM 4965   O O  . ASP B 1 429  ? 1096.359 686.068 632.878 1.00 0.00 ? 429  ASP B O  1 
ATOM 4966   C CB . ASP B 1 429  ? 1097.744 683.832 634.432 1.00 0.00 ? 429  ASP B CB 1 
ATOM 4967   N N  . ILE B 1 430  ? 1098.476 686.814 633.171 1.00 0.00 ? 430  ILE B N  1 
ATOM 4968   C CA . ILE B 1 430  ? 1098.489 687.610 631.976 1.00 0.00 ? 430  ILE B CA 1 
ATOM 4969   C C  . ILE B 1 430  ? 1099.753 687.320 631.233 1.00 0.00 ? 430  ILE B C  1 
ATOM 4970   O O  . ILE B 1 430  ? 1100.765 686.955 631.830 1.00 0.00 ? 430  ILE B O  1 
ATOM 4971   C CB . ILE B 1 430  ? 1098.469 689.083 632.250 1.00 0.00 ? 430  ILE B CB 1 
ATOM 4972   N N  . LEU B 1 431  ? 1099.723 687.452 629.890 1.00 0.00 ? 431  LEU B N  1 
ATOM 4973   C CA . LEU B 1 431  ? 1100.912 687.194 629.130 1.00 0.00 ? 431  LEU B CA 1 
ATOM 4974   C C  . LEU B 1 431  ? 1101.237 688.415 628.325 1.00 0.00 ? 431  LEU B C  1 
ATOM 4975   O O  . LEU B 1 431  ? 1100.356 689.035 627.731 1.00 0.00 ? 431  LEU B O  1 
ATOM 4976   C CB . LEU B 1 431  ? 1100.757 686.020 628.149 1.00 0.00 ? 431  LEU B CB 1 
ATOM 4977   N N  . TRP B 1 432  ? 1102.530 688.804 628.301 1.00 0.00 ? 432  TRP B N  1 
ATOM 4978   C CA . TRP B 1 432  ? 1102.916 689.932 627.505 1.00 0.00 ? 432  TRP B CA 1 
ATOM 4979   C C  . TRP B 1 432  ? 1104.080 689.532 626.665 1.00 0.00 ? 432  TRP B C  1 
ATOM 4980   O O  . TRP B 1 432  ? 1104.788 688.575 626.973 1.00 0.00 ? 432  TRP B O  1 
ATOM 4981   C CB . TRP B 1 432  ? 1103.381 691.171 628.286 1.00 0.00 ? 432  TRP B CB 1 
ATOM 4982   N N  . CYS B 1 433  ? 1104.285 690.254 625.545 1.00 0.00 ? 433  CYS B N  1 
ATOM 4983   C CA . CYS B 1 433  ? 1105.422 689.964 624.724 1.00 0.00 ? 433  CYS B CA 1 
ATOM 4984   C C  . CYS B 1 433  ? 1106.012 691.265 624.296 1.00 0.00 ? 433  CYS B C  1 
ATOM 4985   O O  . CYS B 1 433  ? 1105.294 692.214 623.978 1.00 0.00 ? 433  CYS B O  1 
ATOM 4986   C CB . CYS B 1 433  ? 1105.079 689.176 623.448 1.00 0.00 ? 433  CYS B CB 1 
ATOM 4987   N N  . VAL B 1 434  ? 1107.357 691.347 624.303 1.00 0.00 ? 434  VAL B N  1 
ATOM 4988   C CA . VAL B 1 434  ? 1108.006 692.544 623.862 1.00 0.00 ? 434  VAL B CA 1 
ATOM 4989   C C  . VAL B 1 434  ? 1108.929 692.155 622.756 1.00 0.00 ? 434  VAL B C  1 
ATOM 4990   O O  . VAL B 1 434  ? 1109.723 691.226 622.889 1.00 0.00 ? 434  VAL B O  1 
ATOM 4991   C CB . VAL B 1 434  ? 1108.857 693.194 624.906 1.00 0.00 ? 434  VAL B CB 1 
ATOM 4992   N N  . ASN B 1 435  ? 1108.834 692.861 621.616 1.00 0.00 ? 435  ASN B N  1 
ATOM 4993   C CA . ASN B 1 435  ? 1109.718 692.589 620.527 1.00 0.00 ? 435  ASN B CA 1 
ATOM 4994   C C  . ASN B 1 435  ? 1110.318 693.905 620.174 1.00 0.00 ? 435  ASN B C  1 
ATOM 4995   O O  . ASN B 1 435  ? 1109.610 694.907 620.081 1.00 0.00 ? 435  ASN B O  1 
ATOM 4996   C CB . ASN B 1 435  ? 1108.989 692.067 619.271 1.00 0.00 ? 435  ASN B CB 1 
ATOM 4997   N N  . HIS B 1 436  ? 1111.646 693.955 619.975 1.00 0.00 ? 436  HIS B N  1 
ATOM 4998   C CA . HIS B 1 436  ? 1112.209 695.234 619.667 1.00 0.00 ? 436  HIS B CA 1 
ATOM 4999   C C  . HIS B 1 436  ? 1111.784 695.520 618.274 1.00 0.00 ? 436  HIS B C  1 
ATOM 5000   O O  . HIS B 1 436  ? 1111.631 694.602 617.470 1.00 0.00 ? 436  HIS B O  1 
ATOM 5001   C CB . HIS B 1 436  ? 1113.731 695.275 619.605 1.00 0.00 ? 436  HIS B CB 1 
ATOM 5002   N N  . ASP B 1 437  ? 1111.556 696.800 617.942 1.00 0.00 ? 437  ASP B N  1 
ATOM 5003   C CA . ASP B 1 437  ? 1111.238 697.040 616.574 1.00 0.00 ? 437  ASP B CA 1 
ATOM 5004   C C  . ASP B 1 437  ? 1112.575 697.146 615.917 1.00 0.00 ? 437  ASP B C  1 
ATOM 5005   O O  . ASP B 1 437  ? 1113.302 698.120 616.104 1.00 0.00 ? 437  ASP B O  1 
ATOM 5006   C CB . ASP B 1 437  ? 1110.423 698.326 616.342 1.00 0.00 ? 437  ASP B CB 1 
ATOM 5007   N N  . THR B 1 438  ? 1112.948 696.096 615.164 1.00 0.00 ? 438  THR B N  1 
ATOM 5008   C CA . THR B 1 438  ? 1114.232 696.046 614.541 1.00 0.00 ? 438  THR B CA 1 
ATOM 5009   C C  . THR B 1 438  ? 1114.314 697.142 613.544 1.00 0.00 ? 438  THR B C  1 
ATOM 5010   O O  . THR B 1 438  ? 1115.353 697.782 613.395 1.00 0.00 ? 438  THR B O  1 
ATOM 5011   C CB . THR B 1 438  ? 1114.484 694.742 613.835 1.00 0.00 ? 438  THR B CB 1 
ATOM 5012   N N  . PHE B 1 439  ? 1113.200 697.407 612.845 1.00 0.00 ? 439  PHE B N  1 
ATOM 5013   C CA . PHE B 1 439  ? 1113.280 698.346 611.775 1.00 0.00 ? 439  PHE B CA 1 
ATOM 5014   C C  . PHE B 1 439  ? 1113.732 699.698 612.279 1.00 0.00 ? 439  PHE B C  1 
ATOM 5015   O O  . PHE B 1 439  ? 1114.743 700.194 611.785 1.00 0.00 ? 439  PHE B O  1 
ATOM 5016   C CB . PHE B 1 439  ? 1111.947 698.571 611.069 1.00 0.00 ? 439  PHE B CB 1 
ATOM 5017   N N  . PRO B 1 440  ? 1113.080 700.344 613.225 1.00 0.00 ? 440  PRO B N  1 
ATOM 5018   C CA . PRO B 1 440  ? 1113.504 701.634 613.700 1.00 0.00 ? 440  PRO B CA 1 
ATOM 5019   C C  . PRO B 1 440  ? 1114.827 701.438 614.363 1.00 0.00 ? 440  PRO B C  1 
ATOM 5020   O O  . PRO B 1 440  ? 1115.550 702.410 614.572 1.00 0.00 ? 440  PRO B O  1 
ATOM 5021   C CB . PRO B 1 440  ? 1112.462 702.053 614.729 1.00 0.00 ? 440  PRO B CB 1 
ATOM 5022   N N  . PHE B 1 441  ? 1115.142 700.179 614.705 1.00 0.00 ? 441  PHE B N  1 
ATOM 5023   C CA . PHE B 1 441  ? 1116.330 699.825 615.414 1.00 0.00 ? 441  PHE B CA 1 
ATOM 5024   C C  . PHE B 1 441  ? 1117.521 700.005 614.526 1.00 0.00 ? 441  PHE B C  1 
ATOM 5025   O O  . PHE B 1 441  ? 1118.660 699.822 614.949 1.00 0.00 ? 441  PHE B O  1 
ATOM 5026   C CB . PHE B 1 441  ? 1116.299 698.467 616.160 1.00 0.00 ? 441  PHE B CB 1 
ATOM 5027   N N  . GLN B 1 442  ? 1117.315 700.297 613.223 1.00 0.00 ? 442  GLN B N  1 
ATOM 5028   C CA . GLN B 1 442  ? 1118.463 700.591 612.398 1.00 0.00 ? 442  GLN B CA 1 
ATOM 5029   C C  . GLN B 1 442  ? 1119.053 701.955 612.806 1.00 0.00 ? 442  GLN B C  1 
ATOM 5030   O O  . GLN B 1 442  ? 1119.448 702.746 611.959 1.00 0.00 ? 442  GLN B O  1 
ATOM 5031   C CB . GLN B 1 442  ? 1118.110 700.686 610.897 1.00 0.00 ? 442  GLN B CB 1 
ATOM 5032   N N  . LYS B 1 443  ? 1119.120 702.225 614.140 1.00 0.00 ? 443  LYS B N  1 
ATOM 5033   C CA . LYS B 1 443  ? 1119.693 703.266 614.948 1.00 0.00 ? 443  LYS B CA 1 
ATOM 5034   C C  . LYS B 1 443  ? 1118.948 703.402 616.262 1.00 0.00 ? 443  LYS B C  1 
ATOM 5035   O O  . LYS B 1 443  ? 1119.439 702.841 617.239 1.00 0.00 ? 443  LYS B O  1 
ATOM 5036   C CB . LYS B 1 443  ? 1120.088 704.612 614.313 1.00 0.00 ? 443  LYS B CB 1 
ATOM 5037   N N  . PRO B 1 444  ? 1117.821 704.070 616.426 1.00 0.00 ? 444  PRO B N  1 
ATOM 5038   C CA . PRO B 1 444  ? 1117.251 704.124 617.755 1.00 0.00 ? 444  PRO B CA 1 
ATOM 5039   C C  . PRO B 1 444  ? 1116.645 702.825 618.188 1.00 0.00 ? 444  PRO B C  1 
ATOM 5040   O O  . PRO B 1 444  ? 1116.377 701.978 617.335 1.00 0.00 ? 444  PRO B O  1 
ATOM 5041   C CB . PRO B 1 444  ? 1116.251 705.277 617.752 1.00 0.00 ? 444  PRO B CB 1 
ATOM 5042   N N  . MET B 1 445  ? 1116.433 702.644 619.511 1.00 0.00 ? 445  MET B N  1 
ATOM 5043   C CA . MET B 1 445  ? 1115.879 701.417 620.013 1.00 0.00 ? 445  MET B CA 1 
ATOM 5044   C C  . MET B 1 445  ? 1114.476 701.668 620.469 1.00 0.00 ? 445  MET B C  1 
ATOM 5045   O O  . MET B 1 445  ? 1114.176 702.707 621.054 1.00 0.00 ? 445  MET B O  1 
ATOM 5046   C CB . MET B 1 445  ? 1116.662 700.842 621.203 1.00 0.00 ? 445  MET B CB 1 
ATOM 5047   N N  . MET B 1 446  ? 1113.567 700.714 620.173 1.00 0.00 ? 446  MET B N  1 
ATOM 5048   C CA . MET B 1 446  ? 1112.193 700.821 620.576 1.00 0.00 ? 446  MET B CA 1 
ATOM 5049   C C  . MET B 1 446  ? 1111.670 699.427 620.735 1.00 0.00 ? 446  MET B C  1 
ATOM 5050   O O  . MET B 1 446  ? 1112.067 698.525 620.000 1.00 0.00 ? 446  MET B O  1 
ATOM 5051   C CB . MET B 1 446  ? 1111.320 701.516 619.515 1.00 0.00 ? 446  MET B CB 1 
ATOM 5052   N N  . GLU B 1 447  ? 1110.771 699.203 621.716 1.00 0.00 ? 447  GLU B N  1 
ATOM 5053   C CA . GLU B 1 447  ? 1110.226 697.884 621.862 1.00 0.00 ? 447  GLU B CA 1 
ATOM 5054   C C  . GLU B 1 447  ? 1108.738 697.965 621.802 1.00 0.00 ? 447  GLU B C  1 
ATOM 5055   O O  . GLU B 1 447  ? 1108.118 698.848 622.391 1.00 0.00 ? 447  GLU B O  1 
ATOM 5056   C CB . GLU B 1 447  ? 1110.637 697.153 623.152 1.00 0.00 ? 447  GLU B CB 1 
ATOM 5057   N N  . THR B 1 448  ? 1108.134 697.023 621.055 1.00 0.00 ? 448  THR B N  1 
ATOM 5058   C CA . THR B 1 448  ? 1106.710 696.962 620.918 1.00 0.00 ? 448  THR B CA 1 
ATOM 5059   C C  . THR B 1 448  ? 1106.245 695.914 621.872 1.00 0.00 ? 448  THR B C  1 
ATOM 5060   O O  . THR B 1 448  ? 1106.617 694.746 621.776 1.00 0.00 ? 448  THR B O  1 
ATOM 5061   C CB . THR B 1 448  ? 1106.279 696.613 619.522 1.00 0.00 ? 448  THR B CB 1 
ATOM 5062   N N  . GLN B 1 449  ? 1105.423 696.326 622.855 1.00 0.00 ? 449  GLN B N  1 
ATOM 5063   C CA . GLN B 1 449  ? 1104.993 695.389 623.843 1.00 0.00 ? 449  GLN B CA 1 
ATOM 5064   C C  . GLN B 1 449  ? 1103.502 695.348 623.815 1.00 0.00 ? 449  GLN B C  1 
ATOM 5065   O O  . GLN B 1 449  ? 1102.838 696.383 623.763 1.00 0.00 ? 449  GLN B O  1 
ATOM 5066   C CB . GLN B 1 449  ? 1105.467 695.790 625.250 1.00 0.00 ? 449  GLN B CB 1 
ATOM 5067   N N  . MET B 1 450  ? 1102.930 694.128 623.834 1.00 0.00 ? 450  MET B N  1 
ATOM 5068   C CA . MET B 1 450  ? 1101.503 694.033 623.773 1.00 0.00 ? 450  MET B CA 1 
ATOM 5069   C C  . MET B 1 450  ? 1101.067 692.887 624.621 1.00 0.00 ? 450  MET B C  1 
ATOM 5070   O O  . MET B 1 450  ? 1101.851 692.004 624.970 1.00 0.00 ? 450  MET B O  1 
ATOM 5071   C CB . MET B 1 450  ? 1100.970 693.758 622.357 1.00 0.00 ? 450  MET B CB 1 
ATOM 5072   N N  . THR B 1 451  ? 1099.775 692.894 624.985 1.00 0.00 ? 451  THR B N  1 
ATOM 5073   C CA . THR B 1 451  ? 1099.215 691.838 625.771 1.00 0.00 ? 451  THR B CA 1 
ATOM 5074   C C  . THR B 1 451  ? 1098.923 690.718 624.832 1.00 0.00 ? 451  THR B C  1 
ATOM 5075   O O  . THR B 1 451  ? 1098.755 690.932 623.631 1.00 0.00 ? 451  THR B O  1 
ATOM 5076   C CB . THR B 1 451  ? 1097.918 692.192 626.435 1.00 0.00 ? 451  THR B CB 1 
ATOM 5077   N N  . ALA B 1 452  ? 1098.851 689.485 625.370 1.00 0.00 ? 452  ALA B N  1 
ATOM 5078   C CA . ALA B 1 452  ? 1098.613 688.339 624.544 1.00 0.00 ? 452  ALA B CA 1 
ATOM 5079   C C  . ALA B 1 452  ? 1097.367 687.663 625.030 1.00 0.00 ? 452  ALA B C  1 
ATOM 5080   O O  . ALA B 1 452  ? 1096.897 687.901 626.142 1.00 0.00 ? 452  ALA B O  1 
ATOM 5081   C CB . ALA B 1 452  ? 1099.747 687.299 624.594 1.00 0.00 ? 452  ALA B CB 1 
ATOM 5082   N N  . GLY B 1 453  ? 1096.799 686.804 624.164 1.00 0.00 ? 453  GLY B N  1 
ATOM 5083   C CA . GLY B 1 453  ? 1095.554 686.127 624.379 1.00 0.00 ? 453  GLY B CA 1 
ATOM 5084   C C  . GLY B 1 453  ? 1095.591 685.178 625.542 1.00 0.00 ? 453  GLY B C  1 
ATOM 5085   O O  . GLY B 1 453  ? 1094.606 685.072 626.271 1.00 0.00 ? 453  GLY B O  1 
ATOM 5086   N N  . VAL B 1 454  ? 1096.712 684.462 625.759 1.00 0.00 ? 454  VAL B N  1 
ATOM 5087   C CA . VAL B 1 454  ? 1096.718 683.426 626.762 1.00 0.00 ? 454  VAL B CA 1 
ATOM 5088   C C  . VAL B 1 454  ? 1096.332 683.974 628.096 1.00 0.00 ? 454  VAL B C  1 
ATOM 5089   O O  . VAL B 1 454  ? 1096.762 685.054 628.501 1.00 0.00 ? 454  VAL B O  1 
ATOM 5090   C CB . VAL B 1 454  ? 1098.031 682.716 626.903 1.00 0.00 ? 454  VAL B CB 1 
ATOM 5091   N N  . ASP B 1 455  ? 1095.472 683.211 628.808 1.00 0.00 ? 455  ASP B N  1 
ATOM 5092   C CA . ASP B 1 455  ? 1094.955 683.622 630.080 1.00 0.00 ? 455  ASP B CA 1 
ATOM 5093   C C  . ASP B 1 455  ? 1095.249 682.551 631.087 1.00 0.00 ? 455  ASP B C  1 
ATOM 5094   O O  . ASP B 1 455  ? 1095.249 682.803 632.291 1.00 0.00 ? 455  ASP B O  1 
ATOM 5095   C CB . ASP B 1 455  ? 1093.424 683.773 630.032 1.00 0.00 ? 455  ASP B CB 1 
ATOM 5096   N N  . GLY B 1 456  ? 1095.545 681.325 630.620 1.00 0.00 ? 456  GLY B N  1 
ATOM 5097   C CA . GLY B 1 456  ? 1095.742 680.239 631.539 1.00 0.00 ? 456  GLY B CA 1 
ATOM 5098   C C  . GLY B 1 456  ? 1097.120 680.318 632.103 1.00 0.00 ? 456  GLY B C  1 
ATOM 5099   O O  . GLY B 1 456  ? 1097.926 681.163 631.719 1.00 0.00 ? 456  GLY B O  1 
ATOM 5100   N N  . HIS B 1 457  ? 1097.417 679.406 633.051 1.00 0.00 ? 457  HIS B N  1 
ATOM 5101   C CA . HIS B 1 457  ? 1098.715 679.370 633.648 1.00 0.00 ? 457  HIS B CA 1 
ATOM 5102   C C  . HIS B 1 457  ? 1099.647 679.009 632.544 1.00 0.00 ? 457  HIS B C  1 
ATOM 5103   O O  . HIS B 1 457  ? 1099.278 678.268 631.632 1.00 0.00 ? 457  HIS B O  1 
ATOM 5104   C CB . HIS B 1 457  ? 1098.844 678.307 634.753 1.00 0.00 ? 457  HIS B CB 1 
ATOM 5105   N N  . SER B 1 458  ? 1100.879 679.541 632.576 1.00 0.00 ? 458  SER B N  1 
ATOM 5106   C CA . SER B 1 458  ? 1101.733 679.255 631.464 1.00 0.00 ? 458  SER B CA 1 
ATOM 5107   C C  . SER B 1 458  ? 1102.849 678.398 631.985 1.00 0.00 ? 458  SER B C  1 
ATOM 5108   O O  . SER B 1 458  ? 1103.689 678.860 632.757 1.00 0.00 ? 458  SER B O  1 
ATOM 5109   C CB . SER B 1 458  ? 1102.290 680.562 630.872 1.00 0.00 ? 458  SER B CB 1 
ATOM 5110   N N  . TRP B 1 459  ? 1102.849 677.103 631.598 1.00 0.00 ? 459  TRP B N  1 
ATOM 5111   C CA . TRP B 1 459  ? 1103.820 676.165 632.091 1.00 0.00 ? 459  TRP B CA 1 
ATOM 5112   C C  . TRP B 1 459  ? 1105.192 676.439 631.547 1.00 0.00 ? 459  TRP B C  1 
ATOM 5113   O O  . TRP B 1 459  ? 1106.136 676.611 632.318 1.00 0.00 ? 459  TRP B O  1 
ATOM 5114   C CB . TRP B 1 459  ? 1103.462 674.706 631.762 1.00 0.00 ? 459  TRP B CB 1 
ATOM 5115   N N  . ALA B 1 460  ? 1105.355 676.504 630.204 1.00 0.00 ? 460  ALA B N  1 
ATOM 5116   C CA . ALA B 1 460  ? 1106.683 676.718 629.688 1.00 0.00 ? 460  ALA B CA 1 
ATOM 5117   C C  . ALA B 1 460  ? 1106.606 677.254 628.290 1.00 0.00 ? 460  ALA B C  1 
ATOM 5118   O O  . ALA B 1 460  ? 1105.660 676.983 627.552 1.00 0.00 ? 460  ALA B O  1 
ATOM 5119   C CB . ALA B 1 460  ? 1107.537 675.440 629.636 1.00 0.00 ? 460  ALA B CB 1 
ATOM 5120   N N  . LEU B 1 461  ? 1107.616 678.067 627.915 1.00 0.00 ? 461  LEU B N  1 
ATOM 5121   C CA . LEU B 1 461  ? 1107.672 678.675 626.619 1.00 0.00 ? 461  LEU B CA 1 
ATOM 5122   C C  . LEU B 1 461  ? 1108.858 678.137 625.889 1.00 0.00 ? 461  LEU B C  1 
ATOM 5123   O O  . LEU B 1 461  ? 1109.880 677.805 626.491 1.00 0.00 ? 461  LEU B O  1 
ATOM 5124   C CB . LEU B 1 461  ? 1107.834 680.200 626.658 1.00 0.00 ? 461  LEU B CB 1 
ATOM 5125   N N  . SER B 1 462  ? 1108.737 678.011 624.555 1.00 0.00 ? 462  SER B N  1 
ATOM 5126   C CA . SER B 1 462  ? 1109.853 677.542 623.791 1.00 0.00 ? 462  SER B CA 1 
ATOM 5127   C C  . SER B 1 462  ? 1109.703 678.048 622.392 1.00 0.00 ? 462  SER B C  1 
ATOM 5128   O O  . SER B 1 462  ? 1108.636 678.501 621.982 1.00 0.00 ? 462  SER B O  1 
ATOM 5129   C CB . SER B 1 462  ? 1109.950 676.010 623.719 1.00 0.00 ? 462  SER B CB 1 
ATOM 5130   N N  . ALA B 1 463  ? 1110.804 677.987 621.620 1.00 0.00 ? 463  ALA B N  1 
ATOM 5131   C CA . ALA B 1 463  ? 1110.802 678.429 620.256 1.00 0.00 ? 463  ALA B CA 1 
ATOM 5132   C C  . ALA B 1 463  ? 1110.712 677.189 619.427 1.00 0.00 ? 463  ALA B C  1 
ATOM 5133   O O  . ALA B 1 463  ? 1111.577 676.320 619.512 1.00 0.00 ? 463  ALA B O  1 
ATOM 5134   C CB . ALA B 1 463  ? 1112.139 679.090 619.878 1.00 0.00 ? 463  ALA B CB 1 
ATOM 5135   N N  . ILE B 1 464  ? 1109.645 677.053 618.619 1.00 0.00 ? 464  ILE B N  1 
ATOM 5136   C CA . ILE B 1 464  ? 1109.558 675.885 617.791 1.00 0.00 ? 464  ILE B CA 1 
ATOM 5137   C C  . ILE B 1 464  ? 1110.620 675.973 616.741 1.00 0.00 ? 464  ILE B C  1 
ATOM 5138   O O  . ILE B 1 464  ? 1111.343 675.012 616.483 1.00 0.00 ? 464  ILE B O  1 
ATOM 5139   C CB . ILE B 1 464  ? 1108.200 675.708 617.162 1.00 0.00 ? 464  ILE B CB 1 
ATOM 5140   N N  . ASP B 1 465  ? 1110.745 677.159 616.118 1.00 0.00 ? 465  ASP B N  1 
ATOM 5141   C CA . ASP B 1 465  ? 1111.719 677.402 615.097 1.00 0.00 ? 465  ASP B CA 1 
ATOM 5142   C C  . ASP B 1 465  ? 1112.769 678.237 615.749 1.00 0.00 ? 465  ASP B C  1 
ATOM 5143   O O  . ASP B 1 465  ? 1113.615 677.745 616.494 1.00 0.00 ? 465  ASP B O  1 
ATOM 5144   C CB . ASP B 1 465  ? 1111.147 678.211 613.919 1.00 0.00 ? 465  ASP B CB 1 
ATOM 5145   N N  . THR B 1 474  ? 1114.737 677.799 613.793 1.00 0.00 ? 474  THR B N  1 
ATOM 5146   C CA . THR B 1 474  ? 1115.871 678.513 614.284 1.00 0.00 ? 474  THR B CA 1 
ATOM 5147   C C  . THR B 1 474  ? 1115.494 679.954 614.399 1.00 0.00 ? 474  THR B C  1 
ATOM 5148   O O  . THR B 1 474  ? 1114.487 680.405 613.856 1.00 0.00 ? 474  THR B O  1 
ATOM 5149   C CB . THR B 1 474  ? 1117.048 678.404 613.360 1.00 0.00 ? 474  THR B CB 1 
ATOM 5150   N N  . PRO B 1 475  ? 1116.286 680.672 615.147 1.00 0.00 ? 475  PRO B N  1 
ATOM 5151   C CA . PRO B 1 475  ? 1116.051 682.073 615.330 1.00 0.00 ? 475  PRO B CA 1 
ATOM 5152   C C  . PRO B 1 475  ? 1116.295 682.808 614.053 1.00 0.00 ? 475  PRO B C  1 
ATOM 5153   O O  . PRO B 1 475  ? 1117.112 682.375 613.241 1.00 0.00 ? 475  PRO B O  1 
ATOM 5154   C CB . PRO B 1 475  ? 1116.930 682.506 616.508 1.00 0.00 ? 475  PRO B CB 1 
ATOM 5155   N N  . LEU B 1 476  ? 1115.569 683.923 613.872 1.00 0.00 ? 476  LEU B N  1 
ATOM 5156   C CA . LEU B 1 476  ? 1115.564 684.730 612.688 1.00 0.00 ? 476  LEU B CA 1 
ATOM 5157   C C  . LEU B 1 476  ? 1116.835 685.502 612.482 1.00 0.00 ? 476  LEU B C  1 
ATOM 5158   O O  . LEU B 1 476  ? 1117.035 686.023 611.385 1.00 0.00 ? 476  LEU B O  1 
ATOM 5159   C CB . LEU B 1 476  ? 1114.313 685.622 612.550 1.00 0.00 ? 476  LEU B CB 1 
ATOM 5160   N N  . ASN B 1 477  ? 1117.694 685.643 613.519 1.00 0.00 ? 477  ASN B N  1 
ATOM 5161   C CA . ASN B 1 477  ? 1118.899 686.436 613.447 1.00 0.00 ? 477  ASN B CA 1 
ATOM 5162   C C  . ASN B 1 477  ? 1119.646 686.178 612.169 1.00 0.00 ? 477  ASN B C  1 
ATOM 5163   O O  . ASN B 1 477  ? 1119.913 685.036 611.791 1.00 0.00 ? 477  ASN B O  1 
ATOM 5164   C CB . ASN B 1 477  ? 1119.882 686.173 614.606 1.00 0.00 ? 477  ASN B CB 1 
ATOM 5165   N N  . LYS B 1 478  ? 1119.956 687.282 611.456 1.00 0.00 ? 478  LYS B N  1 
ATOM 5166   C CA . LYS B 1 478  ? 1120.595 687.293 610.169 1.00 0.00 ? 478  LYS B CA 1 
ATOM 5167   C C  . LYS B 1 478  ? 1122.038 686.869 610.205 1.00 0.00 ? 478  LYS B C  1 
ATOM 5168   O O  . LYS B 1 478  ? 1122.442 685.988 609.449 1.00 0.00 ? 478  LYS B O  1 
ATOM 5169   C CB . LYS B 1 478  ? 1120.571 688.686 609.537 1.00 0.00 ? 478  LYS B CB 1 
ATOM 5170   N N  . ASP B 1 479  ? 1122.854 687.466 611.097 1.00 0.00 ? 479  ASP B N  1 
ATOM 5171   C CA . ASP B 1 479  ? 1124.271 687.230 611.020 1.00 0.00 ? 479  ASP B CA 1 
ATOM 5172   C C  . ASP B 1 479  ? 1124.726 686.564 612.285 1.00 0.00 ? 479  ASP B C  1 
ATOM 5173   O O  . ASP B 1 479  ? 1123.982 686.481 613.261 1.00 0.00 ? 479  ASP B O  1 
ATOM 5174   C CB . ASP B 1 479  ? 1125.062 688.544 610.857 1.00 0.00 ? 479  ASP B CB 1 
ATOM 5175   N N  . HIS B 1 480  ? 1125.971 686.037 612.276 1.00 0.00 ? 480  HIS B N  1 
ATOM 5176   C CA . HIS B 1 480  ? 1126.524 685.378 613.426 1.00 0.00 ? 480  HIS B CA 1 
ATOM 5177   C C  . HIS B 1 480  ? 1127.521 686.311 614.050 1.00 0.00 ? 480  HIS B C  1 
ATOM 5178   O O  . HIS B 1 480  ? 1128.472 685.886 614.702 1.00 0.00 ? 480  HIS B O  1 
ATOM 5179   C CB . HIS B 1 480  ? 1127.276 684.085 613.053 1.00 0.00 ? 480  HIS B CB 1 
ATOM 5180   N N  . ILE B 1 481  ? 1127.300 687.626 613.876 1.00 0.00 ? 481  ILE B N  1 
ATOM 5181   C CA . ILE B 1 481  ? 1128.138 688.638 614.447 1.00 0.00 ? 481  ILE B CA 1 
ATOM 5182   C C  . ILE B 1 481  ? 1127.221 689.652 615.037 1.00 0.00 ? 481  ILE B C  1 
ATOM 5183   O O  . ILE B 1 481  ? 1126.048 689.721 614.670 1.00 0.00 ? 481  ILE B O  1 
ATOM 5184   C CB . ILE B 1 481  ? 1129.042 689.311 613.447 1.00 0.00 ? 481  ILE B CB 1 
ATOM 5185   N N  . PRO B 1 482  ? 1127.700 690.435 615.964 1.00 0.00 ? 482  PRO B N  1 
ATOM 5186   C CA . PRO B 1 482  ? 1126.839 691.413 616.558 1.00 0.00 ? 482  PRO B CA 1 
ATOM 5187   C C  . PRO B 1 482  ? 1126.392 692.385 615.518 1.00 0.00 ? 482  PRO B C  1 
ATOM 5188   O O  . PRO B 1 482  ? 1125.365 693.032 615.712 1.00 0.00 ? 482  PRO B O  1 
ATOM 5189   C CB . PRO B 1 482  ? 1127.630 692.000 617.723 1.00 0.00 ? 482  PRO B CB 1 
ATOM 5190   N N  . ILE B 1 483  ? 1127.142 692.509 614.409 1.00 0.00 ? 483  ILE B N  1 
ATOM 5191   C CA . ILE B 1 483  ? 1126.747 693.414 613.372 1.00 0.00 ? 483  ILE B CA 1 
ATOM 5192   C C  . ILE B 1 483  ? 1125.763 692.680 612.505 1.00 0.00 ? 483  ILE B C  1 
ATOM 5193   O O  . ILE B 1 483  ? 1126.018 691.556 612.081 1.00 0.00 ? 483  ILE B O  1 
ATOM 5194   C CB . ILE B 1 483  ? 1127.918 693.876 612.544 1.00 0.00 ? 483  ILE B CB 1 
ATOM 5195   N N  . THR B 1 484  ? 1124.593 693.312 612.261 1.00 0.00 ? 484  THR B N  1 
ATOM 5196   C CA . THR B 1 484  ? 1123.464 692.836 611.493 1.00 0.00 ? 484  THR B CA 1 
ATOM 5197   C C  . THR B 1 484  ? 1122.910 691.584 612.087 1.00 0.00 ? 484  THR B C  1 
ATOM 5198   O O  . THR B 1 484  ? 1122.207 690.836 611.411 1.00 0.00 ? 484  THR B O  1 
ATOM 5199   C CB . THR B 1 484  ? 1123.680 692.560 610.024 1.00 0.00 ? 484  THR B CB 1 
ATOM 5200   N N  . ASP B 1 485  ? 1123.145 691.339 613.384 1.00 0.00 ? 485  ASP B N  1 
ATOM 5201   C CA . ASP B 1 485  ? 1122.598 690.144 613.952 1.00 0.00 ? 485  ASP B CA 1 
ATOM 5202   C C  . ASP B 1 485  ? 1121.098 690.220 613.912 1.00 0.00 ? 485  ASP B C  1 
ATOM 5203   O O  . ASP B 1 485  ? 1120.419 689.317 613.428 1.00 0.00 ? 485  ASP B O  1 
ATOM 5204   C CB . ASP B 1 485  ? 1123.016 689.977 615.424 1.00 0.00 ? 485  ASP B CB 1 
ATOM 5205   N N  . SER B 1 486  ? 1120.554 691.343 614.414 1.00 0.00 ? 486  SER B N  1 
ATOM 5206   C CA . SER B 1 486  ? 1119.144 691.592 614.539 1.00 0.00 ? 486  SER B CA 1 
ATOM 5207   C C  . SER B 1 486  ? 1118.466 691.924 613.237 1.00 0.00 ? 486  SER B C  1 
ATOM 5208   O O  . SER B 1 486  ? 1117.237 691.898 613.255 1.00 0.00 ? 486  SER B O  1 
ATOM 5209   C CB . SER B 1 486  ? 1118.849 692.751 615.507 1.00 0.00 ? 486  SER B CB 1 
ATOM 5210   N N  . PRO B 1 487  ? 1119.090 692.258 612.123 1.00 0.00 ? 487  PRO B N  1 
ATOM 5211   C CA . PRO B 1 487  ? 1118.273 692.594 610.989 1.00 0.00 ? 487  PRO B CA 1 
ATOM 5212   C C  . PRO B 1 487  ? 1117.338 691.533 610.525 1.00 0.00 ? 487  PRO B C  1 
ATOM 5213   O O  . PRO B 1 487  ? 1117.733 690.650 609.765 1.00 0.00 ? 487  PRO B O  1 
ATOM 5214   C CB . PRO B 1 487  ? 1119.224 693.097 609.917 1.00 0.00 ? 487  PRO B CB 1 
ATOM 5215   N N  . VAL B 1 488  ? 1116.070 691.655 610.939 1.00 0.00 ? 488  VAL B N  1 
ATOM 5216   C CA . VAL B 1 488  ? 1115.017 690.772 610.572 1.00 0.00 ? 488  VAL B CA 1 
ATOM 5217   C C  . VAL B 1 488  ? 1114.665 691.057 609.153 1.00 0.00 ? 488  VAL B C  1 
ATOM 5218   O O  . VAL B 1 488  ? 1114.306 690.161 608.392 1.00 0.00 ? 488  VAL B O  1 
ATOM 5219   C CB . VAL B 1 488  ? 1113.789 690.970 611.407 1.00 0.00 ? 488  VAL B CB 1 
ATOM 5220   N N  . VAL B 1 489  ? 1114.778 692.342 608.771 1.00 0.00 ? 489  VAL B N  1 
ATOM 5221   C CA . VAL B 1 489  ? 1114.367 692.798 607.479 1.00 0.00 ? 489  VAL B CA 1 
ATOM 5222   C C  . VAL B 1 489  ? 1115.145 692.049 606.448 1.00 0.00 ? 489  VAL B C  1 
ATOM 5223   O O  . VAL B 1 489  ? 1114.596 691.634 605.430 1.00 0.00 ? 489  VAL B O  1 
ATOM 5224   C CB . VAL B 1 489  ? 1114.638 694.255 607.278 1.00 0.00 ? 489  VAL B CB 1 
ATOM 5225   N N  . VAL B 1 490  ? 1116.462 691.874 606.673 1.00 0.00 ? 490  VAL B N  1 
ATOM 5226   C CA . VAL B 1 490  ? 1117.269 691.185 605.709 1.00 0.00 ? 490  VAL B CA 1 
ATOM 5227   C C  . VAL B 1 490  ? 1116.897 689.733 605.638 1.00 0.00 ? 490  VAL B C  1 
ATOM 5228   O O  . VAL B 1 490  ? 1116.802 689.185 604.541 1.00 0.00 ? 490  VAL B O  1 
ATOM 5229   C CB . VAL B 1 490  ? 1118.740 691.267 605.993 1.00 0.00 ? 490  VAL B CB 1 
ATOM 5230   N N  . GLN B 1 491  ? 1116.666 689.062 606.790 1.00 0.00 ? 491  GLN B N  1 
ATOM 5231   C CA . GLN B 1 491  ? 1116.424 687.649 606.683 1.00 0.00 ? 491  GLN B CA 1 
ATOM 5232   C C  . GLN B 1 491  ? 1114.955 687.338 606.778 1.00 0.00 ? 491  GLN B C  1 
ATOM 5233   O O  . GLN B 1 491  ? 1114.562 686.244 607.177 1.00 0.00 ? 491  GLN B O  1 
ATOM 5234   C CB . GLN B 1 491  ? 1117.151 686.818 607.760 1.00 0.00 ? 491  GLN B CB 1 
ATOM 5235   N N  . GLN B 1 492  ? 1114.079 688.271 606.372 1.00 0.00 ? 492  GLN B N  1 
ATOM 5236   C CA . GLN B 1 492  ? 1112.681 687.965 606.444 1.00 0.00 ? 492  GLN B CA 1 
ATOM 5237   C C  . GLN B 1 492  ? 1112.368 686.884 605.454 1.00 0.00 ? 492  GLN B C  1 
ATOM 5238   O O  . GLN B 1 492  ? 1111.573 685.990 605.743 1.00 0.00 ? 492  GLN B O  1 
ATOM 5239   C CB . GLN B 1 492  ? 1111.780 689.197 606.219 1.00 0.00 ? 492  GLN B CB 1 
ATOM 5240   N N  . HIS B 1 493  ? 1112.971 686.947 604.249 1.00 0.00 ? 493  HIS B N  1 
ATOM 5241   C CA . HIS B 1 493  ? 1112.703 685.969 603.232 1.00 0.00 ? 493  HIS B CA 1 
ATOM 5242   C C  . HIS B 1 493  ? 1113.236 684.622 603.622 1.00 0.00 ? 493  HIS B C  1 
ATOM 5243   O O  . HIS B 1 493  ? 1112.488 683.648 603.714 1.00 0.00 ? 493  HIS B O  1 
ATOM 5244   C CB . HIS B 1 493  ? 1113.398 686.291 601.897 1.00 0.00 ? 493  HIS B CB 1 
ATOM 5245   N N  . MET B 1 494  ? 1114.562 684.554 603.876 1.00 0.00 ? 494  MET B N  1 
ATOM 5246   C CA . MET B 1 494  ? 1115.259 683.315 604.109 1.00 0.00 ? 494  MET B CA 1 
ATOM 5247   C C  . MET B 1 494  ? 1114.855 682.627 605.373 1.00 0.00 ? 494  MET B C  1 
ATOM 5248   O O  . MET B 1 494  ? 1114.569 681.432 605.369 1.00 0.00 ? 494  MET B O  1 
ATOM 5249   C CB . MET B 1 494  ? 1116.776 683.489 604.253 1.00 0.00 ? 494  MET B CB 1 
ATOM 5250   N N  . LEU B 1 495  ? 1114.800 683.375 606.488 1.00 0.00 ? 495  LEU B N  1 
ATOM 5251   C CA . LEU B 1 495  ? 1114.621 682.734 607.753 1.00 0.00 ? 495  LEU B CA 1 
ATOM 5252   C C  . LEU B 1 495  ? 1113.229 682.194 607.813 1.00 0.00 ? 495  LEU B C  1 
ATOM 5253   O O  . LEU B 1 495  ? 1112.279 682.786 607.303 1.00 0.00 ? 495  LEU B O  1 
ATOM 5254   C CB . LEU B 1 495  ? 1114.946 683.698 608.916 1.00 0.00 ? 495  LEU B CB 1 
ATOM 5255   N N  . PRO B 1 496  ? 1113.113 681.043 608.416 1.00 0.00 ? 496  PRO B N  1 
ATOM 5256   C CA . PRO B 1 496  ? 1111.833 680.401 608.481 1.00 0.00 ? 496  PRO B CA 1 
ATOM 5257   C C  . PRO B 1 496  ? 1110.908 681.185 609.341 1.00 0.00 ? 496  PRO B C  1 
ATOM 5258   O O  . PRO B 1 496  ? 1111.377 681.943 610.180 1.00 0.00 ? 496  PRO B O  1 
ATOM 5259   C CB . PRO B 1 496  ? 1112.107 678.970 608.934 1.00 0.00 ? 496  PRO B CB 1 
ATOM 5260   N N  . PRO B 1 497  ? 1109.634 681.059 609.170 1.00 0.00 ? 497  PRO B N  1 
ATOM 5261   C CA . PRO B 1 497  ? 1108.793 681.871 609.988 1.00 0.00 ? 497  PRO B CA 1 
ATOM 5262   C C  . PRO B 1 497  ? 1108.962 681.493 611.417 1.00 0.00 ? 497  PRO B C  1 
ATOM 5263   O O  . PRO B 1 497  ? 1109.040 680.304 611.725 1.00 0.00 ? 497  PRO B O  1 
ATOM 5264   C CB . PRO B 1 497  ? 1107.392 681.723 609.407 1.00 0.00 ? 497  PRO B CB 1 
ATOM 5265   N N  . LYS B 1 498  ? 1109.033 682.501 612.302 1.00 0.00 ? 498  LYS B N  1 
ATOM 5266   C CA . LYS B 1 498  ? 1109.214 682.247 613.696 1.00 0.00 ? 498  LYS B CA 1 
ATOM 5267   C C  . LYS B 1 498  ? 1107.909 681.800 614.255 1.00 0.00 ? 498  LYS B C  1 
ATOM 5268   O O  . LYS B 1 498  ? 1106.862 682.384 613.978 1.00 0.00 ? 498  LYS B O  1 
ATOM 5269   C CB . LYS B 1 498  ? 1109.643 683.497 614.476 1.00 0.00 ? 498  LYS B CB 1 
ATOM 5270   N N  . LYS B 1 499  ? 1107.948 680.723 615.061 1.00 0.00 ? 499  LYS B N  1 
ATOM 5271   C CA . LYS B 1 499  ? 1106.761 680.238 615.693 1.00 0.00 ? 499  LYS B CA 1 
ATOM 5272   C C  . LYS B 1 499  ? 1107.135 679.993 617.121 1.00 0.00 ? 499  LYS B C  1 
ATOM 5273   O O  . LYS B 1 499  ? 1108.243 679.550 617.418 1.00 0.00 ? 499  LYS B O  1 
ATOM 5274   C CB . LYS B 1 499  ? 1106.229 678.952 615.038 1.00 0.00 ? 499  LYS B CB 1 
ATOM 5275   N N  . PHE B 1 500  ? 1106.215 680.299 618.050 1.00 0.00 ? 500  PHE B N  1 
ATOM 5276   C CA . PHE B 1 500  ? 1106.545 680.228 619.444 1.00 0.00 ? 500  PHE B CA 1 
ATOM 5277   C C  . PHE B 1 500  ? 1105.555 679.333 620.108 1.00 0.00 ? 500  PHE B C  1 
ATOM 5278   O O  . PHE B 1 500  ? 1104.394 679.252 619.709 1.00 0.00 ? 500  PHE B O  1 
ATOM 5279   C CB . PHE B 1 500  ? 1106.495 681.641 620.051 1.00 0.00 ? 500  PHE B CB 1 
ATOM 5280   N N  . VAL B 1 501  ? 1106.021 678.616 621.146 1.00 0.00 ? 501  VAL B N  1 
ATOM 5281   C CA . VAL B 1 501  ? 1105.223 677.674 621.869 1.00 0.00 ? 501  VAL B CA 1 
ATOM 5282   C C  . VAL B 1 501  ? 1104.941 678.209 623.226 1.00 0.00 ? 501  VAL B C  1 
ATOM 5283   O O  . VAL B 1 501  ? 1105.826 678.722 623.911 1.00 0.00 ? 501  VAL B O  1 
ATOM 5284   C CB . VAL B 1 501  ? 1105.962 676.400 622.145 1.00 0.00 ? 501  VAL B CB 1 
ATOM 5285   N N  . LEU B 1 502  ? 1103.667 678.105 623.636 1.00 0.00 ? 502  LEU B N  1 
ATOM 5286   C CA . LEU B 1 502  ? 1103.312 678.431 624.977 1.00 0.00 ? 502  LEU B CA 1 
ATOM 5287   C C  . LEU B 1 502  ? 1102.630 677.200 625.468 1.00 0.00 ? 502  LEU B C  1 
ATOM 5288   O O  . LEU B 1 502  ? 1101.621 676.774 624.910 1.00 0.00 ? 502  LEU B O  1 
ATOM 5289   C CB . LEU B 1 502  ? 1102.338 679.628 625.079 1.00 0.00 ? 502  LEU B CB 1 
ATOM 5290   N N  . LEU B 1 503  ? 1103.172 676.578 626.527 1.00 0.00 ? 503  LEU B N  1 
ATOM 5291   C CA . LEU B 1 503  ? 1102.539 675.386 626.994 1.00 0.00 ? 503  LEU B CA 1 
ATOM 5292   C C  . LEU B 1 503  ? 1101.800 675.756 628.233 1.00 0.00 ? 503  LEU B C  1 
ATOM 5293   O O  . LEU B 1 503  ? 1102.329 676.436 629.113 1.00 0.00 ? 503  LEU B O  1 
ATOM 5294   C CB . LEU B 1 503  ? 1103.530 674.265 627.347 1.00 0.00 ? 503  LEU B CB 1 
ATOM 5295   N N  . SER B 1 504  ? 1100.526 675.332 628.302 1.00 0.00 ? 504  SER B N  1 
ATOM 5296   C CA . SER B 1 504  ? 1099.690 675.563 629.440 1.00 0.00 ? 504  SER B CA 1 
ATOM 5297   C C  . SER B 1 504  ? 1099.289 674.199 629.880 1.00 0.00 ? 504  SER B C  1 
ATOM 5298   O O  . SER B 1 504  ? 1099.551 673.218 629.189 1.00 0.00 ? 504  SER B O  1 
ATOM 5299   C CB . SER B 1 504  ? 1098.401 676.335 629.105 1.00 0.00 ? 504  SER B CB 1 
ATOM 5300   N N  . ALA B 1 505  ? 1098.676 674.083 631.069 1.00 0.00 ? 505  ALA B N  1 
ATOM 5301   C CA . ALA B 1 505  ? 1098.316 672.762 631.483 1.00 0.00 ? 505  ALA B CA 1 
ATOM 5302   C C  . ALA B 1 505  ? 1097.322 672.220 630.504 1.00 0.00 ? 505  ALA B C  1 
ATOM 5303   O O  . ALA B 1 505  ? 1097.440 671.081 630.052 1.00 0.00 ? 505  ALA B O  1 
ATOM 5304   C CB . ALA B 1 505  ? 1097.675 672.731 632.880 1.00 0.00 ? 505  ALA B CB 1 
ATOM 5305   N N  . GLN B 1 506  ? 1096.322 673.046 630.141 1.00 0.00 ? 506  GLN B N  1 
ATOM 5306   C CA . GLN B 1 506  ? 1095.247 672.631 629.283 1.00 0.00 ? 506  GLN B CA 1 
ATOM 5307   C C  . GLN B 1 506  ? 1095.676 672.395 627.865 1.00 0.00 ? 506  GLN B C  1 
ATOM 5308   O O  . GLN B 1 506  ? 1095.299 671.383 627.279 1.00 0.00 ? 506  GLN B O  1 
ATOM 5309   C CB . GLN B 1 506  ? 1094.083 673.636 629.292 1.00 0.00 ? 506  GLN B CB 1 
ATOM 5310   N N  . GLY B 1 507  ? 1096.489 673.287 627.263 1.00 0.00 ? 507  GLY B N  1 
ATOM 5311   C CA . GLY B 1 507  ? 1096.788 673.031 625.880 1.00 0.00 ? 507  GLY B CA 1 
ATOM 5312   C C  . GLY B 1 507  ? 1098.024 673.759 625.473 1.00 0.00 ? 507  GLY B C  1 
ATOM 5313   O O  . GLY B 1 507  ? 1098.654 674.457 626.265 1.00 0.00 ? 507  GLY B O  1 
ATOM 5314   N N  . SER B 1 508  ? 1098.391 673.591 624.186 1.00 0.00 ? 508  SER B N  1 
ATOM 5315   C CA . SER B 1 508  ? 1099.548 674.222 623.633 1.00 0.00 ? 508  SER B CA 1 
ATOM 5316   C C  . SER B 1 508  ? 1099.061 675.357 622.799 1.00 0.00 ? 508  SER B C  1 
ATOM 5317   O O  . SER B 1 508  ? 1098.065 675.240 622.087 1.00 0.00 ? 508  SER B O  1 
ATOM 5318   C CB . SER B 1 508  ? 1100.348 673.300 622.708 1.00 0.00 ? 508  SER B CB 1 
ATOM 5319   N N  . LEU B 1 509  ? 1099.752 676.507 622.884 1.00 0.00 ? 509  LEU B N  1 
ATOM 5320   C CA . LEU B 1 509  ? 1099.345 677.643 622.119 1.00 0.00 ? 509  LEU B CA 1 
ATOM 5321   C C  . LEU B 1 509  ? 1100.475 677.970 621.204 1.00 0.00 ? 509  LEU B C  1 
ATOM 5322   O O  . LEU B 1 509  ? 1101.645 677.831 621.562 1.00 0.00 ? 509  LEU B O  1 
ATOM 5323   C CB . LEU B 1 509  ? 1099.058 678.875 622.990 1.00 0.00 ? 509  LEU B CB 1 
ATOM 5324   N N  . MET B 1 510  ? 1100.145 678.400 619.976 1.00 0.00 ? 510  MET B N  1 
ATOM 5325   C CA . MET B 1 510  ? 1101.174 678.694 619.028 1.00 0.00 ? 510  MET B CA 1 
ATOM 5326   C C  . MET B 1 510  ? 1101.055 680.139 618.670 1.00 0.00 ? 510  MET B C  1 
ATOM 5327   O O  . MET B 1 510  ? 1099.964 680.631 618.386 1.00 0.00 ? 510  MET B O  1 
ATOM 5328   C CB . MET B 1 510  ? 1100.995 677.868 617.747 1.00 0.00 ? 510  MET B CB 1 
ATOM 5329   N N  . PHE B 1 511  ? 1102.190 680.864 618.693 1.00 0.00 ? 511  PHE B N  1 
ATOM 5330   C CA . PHE B 1 511  ? 1102.176 682.255 618.338 1.00 0.00 ? 511  PHE B CA 1 
ATOM 5331   C C  . PHE B 1 511  ? 1103.052 682.417 617.136 1.00 0.00 ? 511  PHE B C  1 
ATOM 5332   O O  . PHE B 1 511  ? 1104.032 681.693 616.968 1.00 0.00 ? 511  PHE B O  1 
ATOM 5333   C CB . PHE B 1 511  ? 1102.703 683.189 619.441 1.00 0.00 ? 511  PHE B CB 1 
ATOM 5334   N N  . HIS B 1 512  ? 1102.705 683.370 616.250 1.00 0.00 ? 512  HIS B N  1 
ATOM 5335   C CA . HIS B 1 512  ? 1103.478 683.556 615.057 1.00 0.00 ? 512  HIS B CA 1 
ATOM 5336   C C  . HIS B 1 512  ? 1103.960 684.973 615.021 1.00 0.00 ? 512  HIS B C  1 
ATOM 5337   O O  . HIS B 1 512  ? 1103.233 685.898 615.381 1.00 0.00 ? 512  HIS B O  1 
ATOM 5338   C CB . HIS B 1 512  ? 1102.662 683.294 613.774 1.00 0.00 ? 512  HIS B CB 1 
ATOM 5339   N N  . LYS B 1 513  ? 1105.226 685.169 614.602 1.00 0.00 ? 513  LYS B N  1 
ATOM 5340   C CA . LYS B 1 513  ? 1105.779 686.489 614.513 1.00 0.00 ? 513  LYS B CA 1 
ATOM 5341   C C  . LYS B 1 513  ? 1105.207 687.138 613.299 1.00 0.00 ? 513  LYS B C  1 
ATOM 5342   O O  . LYS B 1 513  ? 1104.872 686.464 612.328 1.00 0.00 ? 513  LYS B O  1 
ATOM 5343   C CB . LYS B 1 513  ? 1107.311 686.517 614.359 1.00 0.00 ? 513  LYS B CB 1 
ATOM 5344   N N  . LEU B 1 514  ? 1105.059 688.476 613.330 1.00 0.00 ? 514  LEU B N  1 
ATOM 5345   C CA . LEU B 1 514  ? 1104.507 689.130 612.182 1.00 0.00 ? 514  LEU B CA 1 
ATOM 5346   C C  . LEU B 1 514  ? 1105.628 689.769 611.429 1.00 0.00 ? 514  LEU B C  1 
ATOM 5347   O O  . LEU B 1 514  ? 1106.392 690.568 611.969 1.00 0.00 ? 514  LEU B O  1 
ATOM 5348   C CB . LEU B 1 514  ? 1103.460 690.197 612.537 1.00 0.00 ? 514  LEU B CB 1 
ATOM 5349   N N  . ARG B 1 515  ? 1105.743 689.408 610.138 1.00 0.00 ? 515  ARG B N  1 
ATOM 5350   C CA . ARG B 1 515  ? 1106.771 689.870 609.248 1.00 0.00 ? 515  ARG B CA 1 
ATOM 5351   C C  . ARG B 1 515  ? 1106.395 691.243 608.779 1.00 0.00 ? 515  ARG B C  1 
ATOM 5352   O O  . ARG B 1 515  ? 1105.256 691.681 608.932 1.00 0.00 ? 515  ARG B O  1 
ATOM 5353   C CB . ARG B 1 515  ? 1106.916 688.938 608.030 1.00 0.00 ? 515  ARG B CB 1 
ATOM 5354   N N  . PRO B 1 516  ? 1107.356 691.946 608.240 1.00 0.00 ? 516  PRO B N  1 
ATOM 5355   C CA . PRO B 1 516  ? 1107.120 693.282 607.759 1.00 0.00 ? 516  PRO B CA 1 
ATOM 5356   C C  . PRO B 1 516  ? 1106.126 693.297 606.643 1.00 0.00 ? 516  PRO B C  1 
ATOM 5357   O O  . PRO B 1 516  ? 1105.464 694.316 606.450 1.00 0.00 ? 516  PRO B O  1 
ATOM 5358   C CB . PRO B 1 516  ? 1108.496 693.841 607.408 1.00 0.00 ? 516  PRO B CB 1 
ATOM 5359   N N  . VAL B 1 517  ? 1106.011 692.189 605.893 1.00 0.00 ? 517  VAL B N  1 
ATOM 5360   C CA . VAL B 1 517  ? 1105.082 692.115 604.806 1.00 0.00 ? 517  VAL B CA 1 
ATOM 5361   C C  . VAL B 1 517  ? 1103.699 692.229 605.371 1.00 0.00 ? 517  VAL B C  1 
ATOM 5362   O O  . VAL B 1 517  ? 1102.849 692.926 604.819 1.00 0.00 ? 517  VAL B O  1 
ATOM 5363   C CB . VAL B 1 517  ? 1105.168 690.804 604.085 1.00 0.00 ? 517  VAL B CB 1 
ATOM 5364   N N  . ASP B 1 518  ? 1103.448 691.537 606.497 1.00 0.00 ? 518  ASP B N  1 
ATOM 5365   C CA . ASP B 1 518  ? 1102.154 691.516 607.117 1.00 0.00 ? 518  ASP B CA 1 
ATOM 5366   C C  . ASP B 1 518  ? 1101.825 692.891 607.602 1.00 0.00 ? 518  ASP B C  1 
ATOM 5367   O O  . ASP B 1 518  ? 1100.690 693.346 607.479 1.00 0.00 ? 518  ASP B O  1 
ATOM 5368   C CB . ASP B 1 518  ? 1102.103 690.575 608.332 1.00 0.00 ? 518  ASP B CB 1 
ATOM 5369   N N  . GLN B 1 519  ? 1102.827 693.588 608.169 1.00 0.00 ? 519  GLN B N  1 
ATOM 5370   C CA . GLN B 1 519  ? 1102.626 694.901 608.704 1.00 0.00 ? 519  GLN B CA 1 
ATOM 5371   C C  . GLN B 1 519  ? 1102.212 695.801 607.580 1.00 0.00 ? 519  GLN B C  1 
ATOM 5372   O O  . GLN B 1 519  ? 1101.281 696.595 607.697 1.00 0.00 ? 519  GLN B O  1 
ATOM 5373   C CB . GLN B 1 519  ? 1103.926 695.473 609.297 1.00 0.00 ? 519  GLN B CB 1 
ATOM 5374   N N  . LEU B 1 520  ? 1102.879 695.678 606.425 1.00 0.00 ? 520  LEU B N  1 
ATOM 5375   C CA . LEU B 1 520  ? 1102.564 696.542 605.327 1.00 0.00 ? 520  LEU B CA 1 
ATOM 5376   C C  . LEU B 1 520  ? 1101.150 696.262 604.923 1.00 0.00 ? 520  LEU B C  1 
ATOM 5377   O O  . LEU B 1 520  ? 1100.396 697.173 604.592 1.00 0.00 ? 520  LEU B O  1 
ATOM 5378   C CB . LEU B 1 520  ? 1103.469 696.274 604.108 1.00 0.00 ? 520  LEU B CB 1 
ATOM 5379   N N  . ARG B 1 521  ? 1100.758 694.976 604.965 1.00 0.00 ? 521  ARG B N  1 
ATOM 5380   C CA . ARG B 1 521  ? 1099.465 694.541 604.518 1.00 0.00 ? 521  ARG B CA 1 
ATOM 5381   C C  . ARG B 1 521  ? 1098.396 695.206 605.327 1.00 0.00 ? 521  ARG B C  1 
ATOM 5382   O O  . ARG B 1 521  ? 1097.379 695.635 604.782 1.00 0.00 ? 521  ARG B O  1 
ATOM 5383   C CB . ARG B 1 521  ? 1099.296 693.016 604.648 1.00 0.00 ? 521  ARG B CB 1 
ATOM 5384   N N  . HIS B 1 522  ? 1098.595 695.319 606.651 1.00 0.00 ? 522  HIS B N  1 
ATOM 5385   C CA . HIS B 1 522  ? 1097.610 695.925 607.504 1.00 0.00 ? 522  HIS B CA 1 
ATOM 5386   C C  . HIS B 1 522  ? 1097.449 697.353 607.072 1.00 0.00 ? 522  HIS B C  1 
ATOM 5387   O O  . HIS B 1 522  ? 1096.341 697.879 606.995 1.00 0.00 ? 522  HIS B O  1 
ATOM 5388   C CB . HIS B 1 522  ? 1098.052 695.909 608.978 1.00 0.00 ? 522  HIS B CB 1 
ATOM 5389   N N  . LEU B 1 523  ? 1098.592 697.997 606.777 1.00 0.00 ? 523  LEU B N  1 
ATOM 5390   C CA . LEU B 1 523  ? 1098.789 699.362 606.373 1.00 0.00 ? 523  LEU B CA 1 
ATOM 5391   C C  . LEU B 1 523  ? 1098.378 699.651 604.960 1.00 0.00 ? 523  LEU B C  1 
ATOM 5392   O O  . LEU B 1 523  ? 1098.467 700.797 604.523 1.00 0.00 ? 523  LEU B O  1 
ATOM 5393   C CB . LEU B 1 523  ? 1100.216 699.876 606.600 1.00 0.00 ? 523  LEU B CB 1 
ATOM 5394   N N  . LEU B 1 524  ? 1097.970 698.634 604.185 1.00 0.00 ? 524  LEU B N  1 
ATOM 5395   C CA . LEU B 1 524  ? 1097.737 698.791 602.778 1.00 0.00 ? 524  LEU B CA 1 
ATOM 5396   C C  . LEU B 1 524  ? 1096.855 699.967 602.468 1.00 0.00 ? 524  LEU B C  1 
ATOM 5397   O O  . LEU B 1 524  ? 1097.197 700.743 601.577 1.00 0.00 ? 524  LEU B O  1 
ATOM 5398   C CB . LEU B 1 524  ? 1097.067 697.541 602.173 1.00 0.00 ? 524  LEU B CB 1 
ATOM 5399   N N  . VAL B 1 525  ? 1095.730 700.166 603.182 1.00 0.00 ? 525  VAL B N  1 
ATOM 5400   C CA . VAL B 1 525  ? 1094.872 701.273 602.849 1.00 0.00 ? 525  VAL B CA 1 
ATOM 5401   C C  . VAL B 1 525  ? 1095.671 702.525 602.971 1.00 0.00 ? 525  VAL B C  1 
ATOM 5402   O O  . VAL B 1 525  ? 1095.411 703.521 602.299 1.00 0.00 ? 525  VAL B O  1 
ATOM 5403   C CB . VAL B 1 525  ? 1093.714 701.403 603.788 1.00 0.00 ? 525  VAL B CB 1 
ATOM 5404   N N  . GLU B 1 534  ? 1096.974 702.733 605.445 1.00 0.00 ? 534  GLU B N  1 
ATOM 5405   C CA . GLU B 1 534  ? 1097.693 703.926 605.137 1.00 0.00 ? 534  GLU B CA 1 
ATOM 5406   C C  . GLU B 1 534  ? 1099.117 703.516 605.334 1.00 0.00 ? 534  GLU B C  1 
ATOM 5407   O O  . GLU B 1 534  ? 1099.473 703.026 606.403 1.00 0.00 ? 534  GLU B O  1 
ATOM 5408   C CB . GLU B 1 534  ? 1097.331 705.059 606.107 1.00 0.00 ? 534  GLU B CB 1 
ATOM 5409   N N  . ILE B 1 535  ? 1099.978 703.687 604.311 1.00 0.00 ? 535  ILE B N  1 
ATOM 5410   C CA . ILE B 1 535  ? 1101.296 703.135 604.444 1.00 0.00 ? 535  ILE B CA 1 
ATOM 5411   C C  . ILE B 1 535  ? 1102.270 704.195 604.878 1.00 0.00 ? 535  ILE B C  1 
ATOM 5412   O O  . ILE B 1 535  ? 1103.480 703.991 604.798 1.00 0.00 ? 535  ILE B O  1 
ATOM 5413   C CB . ILE B 1 535  ? 1101.803 702.638 603.120 1.00 0.00 ? 535  ILE B CB 1 
ATOM 5414   N N  . GLU B 1 536  ? 1101.799 705.344 605.396 1.00 0.00 ? 536  GLU B N  1 
ATOM 5415   C CA . GLU B 1 536  ? 1102.773 706.319 605.798 1.00 0.00 ? 536  GLU B CA 1 
ATOM 5416   C C  . GLU B 1 536  ? 1103.487 705.839 607.014 1.00 0.00 ? 536  GLU B C  1 
ATOM 5417   O O  . GLU B 1 536  ? 1104.684 706.056 607.183 1.00 0.00 ? 536  GLU B O  1 
ATOM 5418   C CB . GLU B 1 536  ? 1102.227 707.712 606.147 1.00 0.00 ? 536  GLU B CB 1 
ATOM 5419   N N  . ARG B 1 537  ? 1102.741 705.160 607.891 1.00 0.00 ? 537  ARG B N  1 
ATOM 5420   C CA . ARG B 1 537  ? 1103.194 704.720 609.171 1.00 0.00 ? 537  ARG B CA 1 
ATOM 5421   C C  . ARG B 1 537  ? 1104.343 703.781 608.968 1.00 0.00 ? 537  ARG B C  1 
ATOM 5422   O O  . ARG B 1 537  ? 1105.337 703.838 609.691 1.00 0.00 ? 537  ARG B O  1 
ATOM 5423   C CB . ARG B 1 537  ? 1102.029 704.029 609.905 1.00 0.00 ? 537  ARG B CB 1 
ATOM 5424   N N  . PHE B 1 538  ? 1104.238 702.896 607.959 1.00 0.00 ? 538  PHE B N  1 
ATOM 5425   C CA . PHE B 1 538  ? 1105.277 701.957 607.642 1.00 0.00 ? 538  PHE B CA 1 
ATOM 5426   C C  . PHE B 1 538  ? 1106.462 702.743 607.170 1.00 0.00 ? 538  PHE B C  1 
ATOM 5427   O O  . PHE B 1 538  ? 1107.599 702.487 607.560 1.00 0.00 ? 538  PHE B O  1 
ATOM 5428   C CB . PHE B 1 538  ? 1104.839 701.027 606.492 1.00 0.00 ? 538  PHE B CB 1 
ATOM 5429   N N  . PHE B 1 539  ? 1106.186 703.752 606.329 1.00 0.00 ? 539  PHE B N  1 
ATOM 5430   C CA . PHE B 1 539  ? 1107.152 704.594 605.682 1.00 0.00 ? 539  PHE B CA 1 
ATOM 5431   C C  . PHE B 1 539  ? 1107.946 705.280 606.749 1.00 0.00 ? 539  PHE B C  1 
ATOM 5432   O O  . PHE B 1 539  ? 1109.174 705.293 606.724 1.00 0.00 ? 539  PHE B O  1 
ATOM 5433   C CB . PHE B 1 539  ? 1106.401 705.694 604.909 1.00 0.00 ? 539  PHE B CB 1 
ATOM 5434   N N  . LYS B 1 540  ? 1107.238 705.852 607.741 1.00 0.00 ? 540  LYS B N  1 
ATOM 5435   C CA . LYS B 1 540  ? 1107.856 706.626 608.772 1.00 0.00 ? 540  LYS B CA 1 
ATOM 5436   C C  . LYS B 1 540  ? 1108.849 705.796 609.516 1.00 0.00 ? 540  LYS B C  1 
ATOM 5437   O O  . LYS B 1 540  ? 1110.023 706.144 609.608 1.00 0.00 ? 540  LYS B O  1 
ATOM 5438   C CB . LYS B 1 540  ? 1106.812 707.090 609.802 1.00 0.00 ? 540  LYS B CB 1 
ATOM 5439   N N  . LEU B 1 541  ? 1108.391 704.656 610.062 1.00 0.00 ? 541  LEU B N  1 
ATOM 5440   C CA . LEU B 1 541  ? 1109.245 703.852 610.884 1.00 0.00 ? 541  LEU B CA 1 
ATOM 5441   C C  . LEU B 1 541  ? 1110.343 703.231 610.068 1.00 0.00 ? 541  LEU B C  1 
ATOM 5442   O O  . LEU B 1 541  ? 1111.526 703.432 610.337 1.00 0.00 ? 541  LEU B O  1 
ATOM 5443   C CB . LEU B 1 541  ? 1108.407 702.741 611.558 1.00 0.00 ? 541  LEU B CB 1 
ATOM 5444   N N  . HIS B 1 542  ? 1109.944 702.449 609.048 1.00 0.00 ? 542  HIS B N  1 
ATOM 5445   C CA . HIS B 1 542  ? 1110.817 701.634 608.248 1.00 0.00 ? 542  HIS B CA 1 
ATOM 5446   C C  . HIS B 1 542  ? 1111.679 702.413 607.296 1.00 0.00 ? 542  HIS B C  1 
ATOM 5447   O O  . HIS B 1 542  ? 1112.861 702.103 607.188 1.00 0.00 ? 542  HIS B O  1 
ATOM 5448   C CB . HIS B 1 542  ? 1110.013 700.596 607.454 1.00 0.00 ? 542  HIS B CB 1 
ATOM 5449   N N  . GLN B 1 543  ? 1111.103 703.398 606.564 1.00 0.00 ? 543  GLN B N  1 
ATOM 5450   C CA . GLN B 1 543  ? 1111.757 704.243 605.587 1.00 0.00 ? 543  GLN B CA 1 
ATOM 5451   C C  . GLN B 1 543  ? 1111.114 703.966 604.263 1.00 0.00 ? 543  GLN B C  1 
ATOM 5452   O O  . GLN B 1 543  ? 1110.403 702.974 604.103 1.00 0.00 ? 543  GLN B O  1 
ATOM 5453   C CB . GLN B 1 543  ? 1113.282 704.084 605.411 1.00 0.00 ? 543  GLN B CB 1 
ATOM 5454   N N  . GLU B 1 544  ? 1111.340 704.861 603.283 1.00 0.00 ? 544  GLU B N  1 
ATOM 5455   C CA . GLU B 1 544  ? 1110.737 704.777 601.983 1.00 0.00 ? 544  GLU B CA 1 
ATOM 5456   C C  . GLU B 1 544  ? 1111.221 703.585 601.222 1.00 0.00 ? 544  GLU B C  1 
ATOM 5457   O O  . GLU B 1 544  ? 1110.425 702.866 600.618 1.00 0.00 ? 544  GLU B O  1 
ATOM 5458   C CB . GLU B 1 544  ? 1111.049 706.004 601.114 1.00 0.00 ? 544  GLU B CB 1 
ATOM 5459   N N  . ASP B 1 545  ? 1112.540 703.330 601.244 1.00 0.00 ? 545  ASP B N  1 
ATOM 5460   C CA . ASP B 1 545  ? 1113.110 702.286 600.443 1.00 0.00 ? 545  ASP B CA 1 
ATOM 5461   C C  . ASP B 1 545  ? 1112.509 700.980 600.847 1.00 0.00 ? 545  ASP B C  1 
ATOM 5462   O O  . ASP B 1 545  ? 1112.092 700.187 600.005 1.00 0.00 ? 545  ASP B O  1 
ATOM 5463   C CB . ASP B 1 545  ? 1114.633 702.185 600.664 1.00 0.00 ? 545  ASP B CB 1 
ATOM 5464   N N  . GLN B 1 546  ? 1112.438 700.737 602.163 1.00 0.00 ? 546  GLN B N  1 
ATOM 5465   C CA . GLN B 1 546  ? 1111.966 699.486 602.663 1.00 0.00 ? 546  GLN B CA 1 
ATOM 5466   C C  . GLN B 1 546  ? 1110.522 699.328 602.317 1.00 0.00 ? 546  GLN B C  1 
ATOM 5467   O O  . GLN B 1 546  ? 1110.067 698.225 602.016 1.00 0.00 ? 546  GLN B O  1 
ATOM 5468   C CB . GLN B 1 546  ? 1112.211 699.404 604.164 1.00 0.00 ? 546  GLN B CB 1 
ATOM 5469   N N  . ALA B 1 547  ? 1109.761 700.435 602.344 1.00 0.00 ? 547  ALA B N  1 
ATOM 5470   C CA . ALA B 1 547  ? 1108.368 700.368 602.017 1.00 0.00 ? 547  ALA B CA 1 
ATOM 5471   C C  . ALA B 1 547  ? 1108.223 699.920 600.596 1.00 0.00 ? 547  ALA B C  1 
ATOM 5472   O O  . ALA B 1 547  ? 1107.352 699.112 600.280 1.00 0.00 ? 547  ALA B O  1 
ATOM 5473   C CB . ALA B 1 547  ? 1107.657 701.726 602.149 1.00 0.00 ? 547  ALA B CB 1 
ATOM 5474   N N  . CYS B 1 548  ? 1109.081 700.442 599.699 1.00 0.00 ? 548  CYS B N  1 
ATOM 5475   C CA . CYS B 1 548  ? 1109.017 700.123 598.301 1.00 0.00 ? 548  CYS B CA 1 
ATOM 5476   C C  . CYS B 1 548  ? 1109.293 698.662 598.128 1.00 0.00 ? 548  CYS B C  1 
ATOM 5477   O O  . CYS B 1 548  ? 1108.619 697.983 597.356 1.00 0.00 ? 548  CYS B O  1 
ATOM 5478   C CB . CYS B 1 548  ? 1110.090 700.879 597.503 1.00 0.00 ? 548  CYS B CB 1 
ATOM 5479   N N  . ALA B 1 549  ? 1110.302 698.139 598.851 1.00 0.00 ? 549  ALA B N  1 
ATOM 5480   C CA . ALA B 1 549  ? 1110.691 696.766 598.700 1.00 0.00 ? 549  ALA B CA 1 
ATOM 5481   C C  . ALA B 1 549  ? 1109.566 695.858 599.103 1.00 0.00 ? 549  ALA B C  1 
ATOM 5482   O O  . ALA B 1 549  ? 1109.255 694.899 598.401 1.00 0.00 ? 549  ALA B O  1 
ATOM 5483   C CB . ALA B 1 549  ? 1111.909 696.395 599.566 1.00 0.00 ? 549  ALA B CB 1 
ATOM 5484   N N  . THR B 1 550  ? 1108.917 696.151 600.244 1.00 0.00 ? 550  THR B N  1 
ATOM 5485   C CA . THR B 1 550  ? 1107.847 695.332 600.748 1.00 0.00 ? 550  THR B CA 1 
ATOM 5486   C C  . THR B 1 550  ? 1106.691 695.424 599.802 1.00 0.00 ? 550  THR B C  1 
ATOM 5487   O O  . THR B 1 550  ? 1105.931 694.478 599.613 1.00 0.00 ? 550  THR B O  1 
ATOM 5488   C CB . THR B 1 550  ? 1107.358 695.777 602.095 1.00 0.00 ? 550  THR B CB 1 
ATOM 5489   N N  . CYS B 1 551  ? 1106.510 696.609 599.211 1.00 0.00 ? 551  CYS B N  1 
ATOM 5490   C CA . CYS B 1 551  ? 1105.413 696.859 598.331 1.00 0.00 ? 551  CYS B CA 1 
ATOM 5491   C C  . CYS B 1 551  ? 1105.608 695.966 597.132 1.00 0.00 ? 551  CYS B C  1 
ATOM 5492   O O  . CYS B 1 551  ? 1104.672 695.349 596.624 1.00 0.00 ? 551  CYS B O  1 
ATOM 5493   C CB . CYS B 1 551  ? 1105.450 698.341 597.928 1.00 0.00 ? 551  CYS B CB 1 
ATOM 5494   N N  . LEU B 1 552  ? 1106.859 695.850 596.654 1.00 0.00 ? 552  LEU B N  1 
ATOM 5495   C CA . LEU B 1 552  ? 1107.128 695.016 595.518 1.00 0.00 ? 552  LEU B CA 1 
ATOM 5496   C C  . LEU B 1 552  ? 1106.809 693.596 595.867 1.00 0.00 ? 552  LEU B C  1 
ATOM 5497   O O  . LEU B 1 552  ? 1106.170 692.891 595.088 1.00 0.00 ? 552  LEU B O  1 
ATOM 5498   C CB . LEU B 1 552  ? 1108.604 695.058 595.090 1.00 0.00 ? 552  LEU B CB 1 
ATOM 5499   N N  . ILE B 1 553  ? 1107.231 693.134 597.062 1.00 0.00 ? 553  ILE B N  1 
ATOM 5500   C CA . ILE B 1 553  ? 1106.970 691.770 597.421 1.00 0.00 ? 553  ILE B CA 1 
ATOM 5501   C C  . ILE B 1 553  ? 1105.501 691.505 597.495 1.00 0.00 ? 553  ILE B C  1 
ATOM 5502   O O  . ILE B 1 553  ? 1105.042 690.470 597.013 1.00 0.00 ? 553  ILE B O  1 
ATOM 5503   C CB . ILE B 1 553  ? 1107.648 691.285 598.678 1.00 0.00 ? 553  ILE B CB 1 
ATOM 5504   N N  . LEU B 1 554  ? 1104.707 692.418 598.077 1.00 0.00 ? 554  LEU B N  1 
ATOM 5505   C CA . LEU B 1 554  ? 1103.297 692.159 598.155 1.00 0.00 ? 554  LEU B CA 1 
ATOM 5506   C C  . LEU B 1 554  ? 1102.722 692.072 596.779 1.00 0.00 ? 554  LEU B C  1 
ATOM 5507   O O  . LEU B 1 554  ? 1101.846 691.246 596.523 1.00 0.00 ? 554  LEU B O  1 
ATOM 5508   C CB . LEU B 1 554  ? 1102.500 693.243 598.904 1.00 0.00 ? 554  LEU B CB 1 
ATOM 5509   N N  . ALA B 1 555  ? 1103.186 692.925 595.850 1.00 0.00 ? 555  ALA B N  1 
ATOM 5510   C CA . ALA B 1 555  ? 1102.589 692.903 594.548 1.00 0.00 ? 555  ALA B CA 1 
ATOM 5511   C C  . ALA B 1 555  ? 1102.796 691.555 593.931 1.00 0.00 ? 555  ALA B C  1 
ATOM 5512   O O  . ALA B 1 555  ? 1101.862 690.954 593.404 1.00 0.00 ? 555  ALA B O  1 
ATOM 5513   C CB . ALA B 1 555  ? 1103.201 693.949 593.598 1.00 0.00 ? 555  ALA B CB 1 
ATOM 5514   N N  . CYS B 1 556  ? 1104.038 691.043 593.994 1.00 0.00 ? 556  CYS B N  1 
ATOM 5515   C CA . CYS B 1 556  ? 1104.382 689.775 593.413 1.00 0.00 ? 556  CYS B CA 1 
ATOM 5516   C C  . CYS B 1 556  ? 1103.786 688.638 594.189 1.00 0.00 ? 556  CYS B C  1 
ATOM 5517   O O  . CYS B 1 556  ? 1103.392 687.625 593.615 1.00 0.00 ? 556  CYS B O  1 
ATOM 5518   C CB . CYS B 1 556  ? 1105.901 689.553 593.345 1.00 0.00 ? 556  CYS B CB 1 
ATOM 5519   N N  . SER B 1 557  ? 1103.687 688.794 595.521 1.00 0.00 ? 557  SER B N  1 
ATOM 5520   C CA . SER B 1 557  ? 1103.323 687.735 596.420 1.00 0.00 ? 557  SER B CA 1 
ATOM 5521   C C  . SER B 1 557  ? 1102.116 686.992 595.963 1.00 0.00 ? 557  SER B C  1 
ATOM 5522   O O  . SER B 1 557  ? 1101.120 687.561 595.512 1.00 0.00 ? 557  SER B O  1 
ATOM 5523   C CB . SER B 1 557  ? 1103.051 688.224 597.853 1.00 0.00 ? 557  SER B CB 1 
ATOM 5524   N N  . THR B 1 558  ? 1102.212 685.653 596.072 1.00 0.00 ? 558  THR B N  1 
ATOM 5525   C CA . THR B 1 558  ? 1101.131 684.781 595.747 1.00 0.00 ? 558  THR B CA 1 
ATOM 5526   C C  . THR B 1 558  ? 1100.335 684.621 596.995 1.00 0.00 ? 558  THR B C  1 
ATOM 5527   O O  . THR B 1 558  ? 1100.425 685.434 597.915 1.00 0.00 ? 558  THR B O  1 
ATOM 5528   C CB . THR B 1 558  ? 1101.588 683.413 595.326 1.00 0.00 ? 558  THR B CB 1 
ATOM 5529   N N  . CYS B 1 561  ? 1097.828 684.128 595.804 1.00 0.00 ? 561  CYS B N  1 
ATOM 5530   C CA . CYS B 1 561  ? 1096.992 683.896 596.940 1.00 0.00 ? 561  CYS B CA 1 
ATOM 5531   C C  . CYS B 1 561  ? 1096.725 685.202 597.627 1.00 0.00 ? 561  CYS B C  1 
ATOM 5532   O O  . CYS B 1 561  ? 1096.131 685.235 598.703 1.00 0.00 ? 561  CYS B O  1 
ATOM 5533   C CB . CYS B 1 561  ? 1097.672 682.948 597.949 1.00 0.00 ? 561  CYS B CB 1 
ATOM 5534   N N  . ASP B 1 562  ? 1097.130 686.329 597.013 1.00 0.00 ? 562  ASP B N  1 
ATOM 5535   C CA . ASP B 1 562  ? 1096.809 687.588 597.623 1.00 0.00 ? 562  ASP B CA 1 
ATOM 5536   C C  . ASP B 1 562  ? 1095.603 688.127 596.926 1.00 0.00 ? 562  ASP B C  1 
ATOM 5537   O O  . ASP B 1 562  ? 1095.330 687.786 595.775 1.00 0.00 ? 562  ASP B O  1 
ATOM 5538   C CB . ASP B 1 562  ? 1097.921 688.645 597.528 1.00 0.00 ? 562  ASP B CB 1 
ATOM 5539   N N  . ARG B 1 563  ? 1094.834 688.981 597.628 1.00 0.00 ? 563  ARG B N  1 
ATOM 5540   C CA . ARG B 1 563  ? 1093.657 689.547 597.045 1.00 0.00 ? 563  ARG B CA 1 
ATOM 5541   C C  . ARG B 1 563  ? 1094.116 690.511 596.004 1.00 0.00 ? 563  ARG B C  1 
ATOM 5542   O O  . ARG B 1 563  ? 1095.224 691.039 596.075 1.00 0.00 ? 563  ARG B O  1 
ATOM 5543   C CB . ARG B 1 563  ? 1092.771 690.308 598.049 1.00 0.00 ? 563  ARG B CB 1 
ATOM 5544   N N  . GLU B 1 564  ? 1093.270 690.741 594.987 1.00 0.00 ? 564  GLU B N  1 
ATOM 5545   C CA . GLU B 1 564  ? 1093.619 691.618 593.910 1.00 0.00 ? 564  GLU B CA 1 
ATOM 5546   C C  . GLU B 1 564  ? 1093.789 692.992 594.464 1.00 0.00 ? 564  GLU B C  1 
ATOM 5547   O O  . GLU B 1 564  ? 1094.664 693.742 594.031 1.00 0.00 ? 564  GLU B O  1 
ATOM 5548   C CB . GLU B 1 564  ? 1092.542 691.682 592.815 1.00 0.00 ? 564  GLU B CB 1 
ATOM 5549   N N  . VAL B 1 565  ? 1092.955 693.355 595.453 1.00 0.00 ? 565  VAL B N  1 
ATOM 5550   C CA . VAL B 1 565  ? 1093.007 694.678 596.000 1.00 0.00 ? 565  VAL B CA 1 
ATOM 5551   C C  . VAL B 1 565  ? 1094.372 694.916 596.570 1.00 0.00 ? 565  VAL B C  1 
ATOM 5552   O O  . VAL B 1 565  ? 1094.979 695.956 596.322 1.00 0.00 ? 565  VAL B O  1 
ATOM 5553   C CB . VAL B 1 565  ? 1092.021 694.879 597.113 1.00 0.00 ? 565  VAL B CB 1 
ATOM 5554   N N  . SER B 1 566  ? 1094.897 693.946 597.340 1.00 0.00 ? 566  SER B N  1 
ATOM 5555   C CA . SER B 1 566  ? 1096.169 694.125 597.980 1.00 0.00 ? 566  SER B CA 1 
ATOM 5556   C C  . SER B 1 566  ? 1097.245 694.275 596.952 1.00 0.00 ? 566  SER B C  1 
ATOM 5557   O O  . SER B 1 566  ? 1098.058 695.196 597.025 1.00 0.00 ? 566  SER B O  1 
ATOM 5558   C CB . SER B 1 566  ? 1096.556 692.935 598.876 1.00 0.00 ? 566  SER B CB 1 
ATOM 5559   N N  . ALA B 1 567  ? 1097.273 693.374 595.951 1.00 0.00 ? 567  ALA B N  1 
ATOM 5560   C CA . ALA B 1 567  ? 1098.320 693.394 594.972 1.00 0.00 ? 567  ALA B CA 1 
ATOM 5561   C C  . ALA B 1 567  ? 1098.275 694.676 594.203 1.00 0.00 ? 567  ALA B C  1 
ATOM 5562   O O  . ALA B 1 567  ? 1099.309 695.296 593.961 1.00 0.00 ? 567  ALA B O  1 
ATOM 5563   C CB . ALA B 1 567  ? 1098.203 692.245 593.955 1.00 0.00 ? 567  ALA B CB 1 
ATOM 5564   N N  . TRP B 1 568  ? 1097.068 695.116 593.805 1.00 0.00 ? 568  TRP B N  1 
ATOM 5565   C CA . TRP B 1 568  ? 1096.957 696.295 593.000 1.00 0.00 ? 568  TRP B CA 1 
ATOM 5566   C C  . TRP B 1 568  ? 1097.409 697.484 593.785 1.00 0.00 ? 568  TRP B C  1 
ATOM 5567   O O  . TRP B 1 568  ? 1098.125 698.339 593.268 1.00 0.00 ? 568  TRP B O  1 
ATOM 5568   C CB . TRP B 1 568  ? 1095.522 696.570 592.518 1.00 0.00 ? 568  TRP B CB 1 
ATOM 5569   N N  . ALA B 1 569  ? 1096.994 697.569 595.062 1.00 0.00 ? 569  ALA B N  1 
ATOM 5570   C CA . ALA B 1 569  ? 1097.331 698.705 595.871 1.00 0.00 ? 569  ALA B CA 1 
ATOM 5571   C C  . ALA B 1 569  ? 1098.815 698.776 596.035 1.00 0.00 ? 569  ALA B C  1 
ATOM 5572   O O  . ALA B 1 569  ? 1099.408 699.848 595.921 1.00 0.00 ? 569  ALA B O  1 
ATOM 5573   C CB . ALA B 1 569  ? 1096.718 698.636 597.282 1.00 0.00 ? 569  ALA B CB 1 
ATOM 5574   N N  . THR B 1 570  ? 1099.458 697.625 596.299 1.00 0.00 ? 570  THR B N  1 
ATOM 5575   C CA . THR B 1 570  ? 1100.873 697.606 596.518 1.00 0.00 ? 570  THR B CA 1 
ATOM 5576   C C  . THR B 1 570  ? 1101.542 697.972 595.226 1.00 0.00 ? 570  THR B C  1 
ATOM 5577   O O  . THR B 1 570  ? 1102.546 698.678 595.199 1.00 0.00 ? 570  THR B O  1 
ATOM 5578   C CB . THR B 1 570  ? 1101.349 696.275 597.006 1.00 0.00 ? 570  THR B CB 1 
ATOM 5579   N N  . ARG B 1 571  ? 1100.998 697.511 594.092 1.00 0.00 ? 571  ARG B N  1 
ATOM 5580   C CA . ARG B 1 571  ? 1101.597 697.858 592.836 1.00 0.00 ? 571  ARG B CA 1 
ATOM 5581   C C  . ARG B 1 571  ? 1101.521 699.345 592.681 1.00 0.00 ? 571  ARG B C  1 
ATOM 5582   O O  . ARG B 1 571  ? 1102.481 699.983 592.254 1.00 0.00 ? 571  ARG B O  1 
ATOM 5583   C CB . ARG B 1 571  ? 1100.852 697.232 591.646 1.00 0.00 ? 571  ARG B CB 1 
ATOM 5584   N N  . ALA B 1 572  ? 1100.367 699.938 593.043 1.00 0.00 ? 572  ALA B N  1 
ATOM 5585   C CA . ALA B 1 572  ? 1100.147 701.346 592.882 1.00 0.00 ? 572  ALA B CA 1 
ATOM 5586   C C  . ALA B 1 572  ? 1101.127 702.115 593.714 1.00 0.00 ? 572  ALA B C  1 
ATOM 5587   O O  . ALA B 1 572  ? 1101.674 703.117 593.260 1.00 0.00 ? 572  ALA B O  1 
ATOM 5588   C CB . ALA B 1 572  ? 1098.736 701.780 593.316 1.00 0.00 ? 572  ALA B CB 1 
ATOM 5589   N N  . PHE B 1 573  ? 1101.373 701.674 594.961 1.00 0.00 ? 573  PHE B N  1 
ATOM 5590   C CA . PHE B 1 573  ? 1102.283 702.358 595.837 1.00 0.00 ? 573  PHE B CA 1 
ATOM 5591   C C  . PHE B 1 573  ? 1103.660 702.285 595.260 1.00 0.00 ? 573  PHE B C  1 
ATOM 5592   O O  . PHE B 1 573  ? 1104.398 703.268 595.248 1.00 0.00 ? 573  PHE B O  1 
ATOM 5593   C CB . PHE B 1 573  ? 1102.338 701.725 597.236 1.00 0.00 ? 573  PHE B CB 1 
ATOM 5594   N N  . PHE B 1 574  ? 1104.044 701.100 594.764 1.00 0.00 ? 574  PHE B N  1 
ATOM 5595   C CA . PHE B 1 574  ? 1105.363 700.887 594.244 1.00 0.00 ? 574  PHE B CA 1 
ATOM 5596   C C  . PHE B 1 574  ? 1105.570 701.809 593.080 1.00 0.00 ? 574  PHE B C  1 
ATOM 5597   O O  . PHE B 1 574  ? 1106.568 702.524 593.012 1.00 0.00 ? 574  PHE B O  1 
ATOM 5598   C CB . PHE B 1 574  ? 1105.498 699.424 593.776 1.00 0.00 ? 574  PHE B CB 1 
ATOM 5599   N N  . ARG B 1 575  ? 1104.616 701.806 592.130 1.00 0.00 ? 575  ARG B N  1 
ATOM 5600   C CA . ARG B 1 575  ? 1104.687 702.588 590.928 1.00 0.00 ? 575  ARG B CA 1 
ATOM 5601   C C  . ARG B 1 575  ? 1104.503 704.064 591.162 1.00 0.00 ? 575  ARG B C  1 
ATOM 5602   O O  . ARG B 1 575  ? 1105.267 704.867 590.629 1.00 0.00 ? 575  ARG B O  1 
ATOM 5603   C CB . ARG B 1 575  ? 1103.623 702.148 589.905 1.00 0.00 ? 575  ARG B CB 1 
ATOM 5604   N N  . TYR B 1 576  ? 1103.505 704.473 591.974 1.00 0.00 ? 576  TYR B N  1 
ATOM 5605   C CA . TYR B 1 576  ? 1103.196 705.878 592.018 1.00 0.00 ? 576  TYR B CA 1 
ATOM 5606   C C  . TYR B 1 576  ? 1103.378 706.448 593.396 1.00 0.00 ? 576  TYR B C  1 
ATOM 5607   O O  . TYR B 1 576  ? 1103.393 707.667 593.561 1.00 0.00 ? 576  TYR B O  1 
ATOM 5608   C CB . TYR B 1 576  ? 1101.728 706.130 591.623 1.00 0.00 ? 576  TYR B CB 1 
ATOM 5609   N N  . GLY B 1 577  ? 1103.556 705.604 594.424 1.00 0.00 ? 577  GLY B N  1 
ATOM 5610   C CA . GLY B 1 577  ? 1103.701 706.149 595.742 1.00 0.00 ? 577  GLY B CA 1 
ATOM 5611   C C  . GLY B 1 577  ? 1102.349 706.602 596.183 1.00 0.00 ? 577  GLY B C  1 
ATOM 5612   O O  . GLY B 1 577  ? 1101.335 706.066 595.738 1.00 0.00 ? 577  GLY B O  1 
ATOM 5613   N N  . GLY B 1 578  ? 1102.306 707.604 597.084 1.00 0.00 ? 578  GLY B N  1 
ATOM 5614   C CA . GLY B 1 578  ? 1101.050 708.117 597.547 1.00 0.00 ? 578  GLY B CA 1 
ATOM 5615   C C  . GLY B 1 578  ? 1100.812 709.381 596.789 1.00 0.00 ? 578  GLY B C  1 
ATOM 5616   O O  . GLY B 1 578  ? 1101.696 710.231 596.675 1.00 0.00 ? 578  GLY B O  1 
ATOM 5617   N N  . GLU B 1 579  ? 1099.585 709.542 596.267 1.00 0.00 ? 579  GLU B N  1 
ATOM 5618   C CA . GLU B 1 579  ? 1099.283 710.673 595.444 1.00 0.00 ? 579  GLU B CA 1 
ATOM 5619   C C  . GLU B 1 579  ? 1099.222 711.904 596.286 1.00 0.00 ? 579  GLU B C  1 
ATOM 5620   O O  . GLU B 1 579  ? 1098.615 711.915 597.356 1.00 0.00 ? 579  GLU B O  1 
ATOM 5621   C CB . GLU B 1 579  ? 1097.935 710.544 594.720 1.00 0.00 ? 579  GLU B CB 1 
ATOM 5622   N N  . ALA B 1 580  ? 1099.862 712.981 595.791 1.00 0.00 ? 580  ALA B N  1 
ATOM 5623   C CA . ALA B 1 580  ? 1099.856 714.259 596.442 1.00 0.00 ? 580  ALA B CA 1 
ATOM 5624   C C  . ALA B 1 580  ? 1100.234 714.070 597.869 1.00 0.00 ? 580  ALA B C  1 
ATOM 5625   O O  . ALA B 1 580  ? 1099.645 714.673 598.765 1.00 0.00 ? 580  ALA B O  1 
ATOM 5626   C CB . ALA B 1 580  ? 1098.493 714.970 596.382 1.00 0.00 ? 580  ALA B CB 1 
ATOM 5627   N N  . GLN B 1 581  ? 1101.243 713.222 598.114 1.00 0.00 ? 581  GLN B N  1 
ATOM 5628   C CA . GLN B 1 581  ? 1101.672 712.975 599.454 1.00 0.00 ? 581  GLN B CA 1 
ATOM 5629   C C  . GLN B 1 581  ? 1103.106 712.603 599.328 1.00 0.00 ? 581  GLN B C  1 
ATOM 5630   O O  . GLN B 1 581  ? 1103.978 713.466 599.232 1.00 0.00 ? 581  GLN B O  1 
ATOM 5631   C CB . GLN B 1 581  ? 1100.904 711.818 600.117 1.00 0.00 ? 581  GLN B CB 1 
ATOM 5632   N N  . MET B 1 582  ? 1103.381 711.288 599.332 1.00 0.00 ? 582  MET B N  1 
ATOM 5633   C CA . MET B 1 582  ? 1104.718 710.804 599.183 1.00 0.00 ? 582  MET B CA 1 
ATOM 5634   C C  . MET B 1 582  ? 1104.958 710.588 597.725 1.00 0.00 ? 582  MET B C  1 
ATOM 5635   O O  . MET B 1 582  ? 1104.186 709.900 597.053 1.00 0.00 ? 582  MET B O  1 
ATOM 5636   C CB . MET B 1 582  ? 1104.931 709.476 599.936 1.00 0.00 ? 582  MET B CB 1 
ATOM 5637   N N  . ARG B 1 583  ? 1106.046 711.183 597.192 1.00 0.00 ? 583  ARG B N  1 
ATOM 5638   C CA . ARG B 1 583  ? 1106.328 711.031 595.796 1.00 0.00 ? 583  ARG B CA 1 
ATOM 5639   C C  . ARG B 1 583  ? 1107.480 710.106 595.635 1.00 0.00 ? 583  ARG B C  1 
ATOM 5640   O O  . ARG B 1 583  ? 1108.341 709.984 596.506 1.00 0.00 ? 583  ARG B O  1 
ATOM 5641   C CB . ARG B 1 583  ? 1106.554 712.352 595.032 1.00 0.00 ? 583  ARG B CB 1 
ATOM 5642   N N  . PHE B 1 584  ? 1107.481 709.403 594.491 1.00 0.00 ? 584  PHE B N  1 
ATOM 5643   C CA . PHE B 1 584  ? 1108.401 708.341 594.237 1.00 0.00 ? 584  PHE B CA 1 
ATOM 5644   C C  . PHE B 1 584  ? 1109.315 708.835 593.180 1.00 0.00 ? 584  PHE B C  1 
ATOM 5645   O O  . PHE B 1 584  ? 1109.371 708.285 592.080 1.00 0.00 ? 584  PHE B O  1 
ATOM 5646   C CB . PHE B 1 584  ? 1107.603 707.204 593.602 1.00 0.00 ? 584  PHE B CB 1 
ATOM 5647   N N  . THR B 1 586  ? 1111.659 709.716 594.465 1.00 0.00 ? 586  THR B N  1 
ATOM 5648   C CA . THR B 1 586  ? 1112.030 709.933 593.100 1.00 0.00 ? 586  THR B CA 1 
ATOM 5649   C C  . THR B 1 586  ? 1113.502 710.116 593.103 1.00 0.00 ? 586  THR B C  1 
ATOM 5650   O O  . THR B 1 586  ? 1114.114 710.241 594.163 1.00 0.00 ? 586  THR B O  1 
ATOM 5651   C CB . THR B 1 586  ? 1111.395 711.136 592.466 1.00 0.00 ? 586  THR B CB 1 
ATOM 5652   N N  . THR B 1 587  ? 1114.121 710.105 591.911 1.00 0.00 ? 587  THR B N  1 
ATOM 5653   C CA . THR B 1 587  ? 1115.526 710.343 591.890 1.00 0.00 ? 587  THR B CA 1 
ATOM 5654   C C  . THR B 1 587  ? 1115.689 711.805 592.135 1.00 0.00 ? 587  THR B C  1 
ATOM 5655   O O  . THR B 1 587  ? 1114.946 712.619 591.588 1.00 0.00 ? 587  THR B O  1 
ATOM 5656   C CB . THR B 1 587  ? 1116.178 710.018 590.577 1.00 0.00 ? 587  THR B CB 1 
ATOM 5657   N N  . LEU B 1 588  ? 1116.653 712.178 592.994 1.00 0.00 ? 588  LEU B N  1 
ATOM 5658   C CA . LEU B 1 588  ? 1116.856 713.566 593.295 1.00 0.00 ? 588  LEU B CA 1 
ATOM 5659   C C  . LEU B 1 588  ? 1118.303 713.834 593.064 1.00 0.00 ? 588  LEU B C  1 
ATOM 5660   O O  . LEU B 1 588  ? 1119.129 712.967 593.318 1.00 0.00 ? 588  LEU B O  1 
ATOM 5661   C CB . LEU B 1 588  ? 1116.554 713.903 594.765 1.00 0.00 ? 588  LEU B CB 1 
ATOM 5662   N N  . PRO B 1 589  ? 1118.667 714.979 592.558 1.00 0.00 ? 589  PRO B N  1 
ATOM 5663   C CA . PRO B 1 589  ? 1120.065 715.201 592.369 1.00 0.00 ? 589  PRO B CA 1 
ATOM 5664   C C  . PRO B 1 589  ? 1120.768 715.279 593.679 1.00 0.00 ? 589  PRO B C  1 
ATOM 5665   O O  . PRO B 1 589  ? 1120.550 716.256 594.395 1.00 0.00 ? 589  PRO B O  1 
ATOM 5666   C CB . PRO B 1 589  ? 1120.180 716.444 591.480 1.00 0.00 ? 589  PRO B CB 1 
ATOM 5667   N N  . VAL B 1 658  ? 1120.569 710.921 594.104 1.00 0.00 ? 658  VAL B N  1 
ATOM 5668   C CA . VAL B 1 658  ? 1120.607 709.533 594.427 1.00 0.00 ? 658  VAL B CA 1 
ATOM 5669   C C  . VAL B 1 658  ? 1119.540 708.885 593.603 1.00 0.00 ? 658  VAL B C  1 
ATOM 5670   O O  . VAL B 1 658  ? 1118.868 709.543 592.814 1.00 0.00 ? 658  VAL B O  1 
ATOM 5671   C CB . VAL B 1 658  ? 1120.330 709.267 595.874 1.00 0.00 ? 658  VAL B CB 1 
ATOM 5672   N N  . TYR B 1 659  ? 1119.368 707.560 593.783 1.00 0.00 ? 659  TYR B N  1 
ATOM 5673   C CA . TYR B 1 659  ? 1118.393 706.821 593.039 1.00 0.00 ? 659  TYR B CA 1 
ATOM 5674   C C  . TYR B 1 659  ? 1117.137 706.751 593.849 1.00 0.00 ? 659  TYR B C  1 
ATOM 5675   O O  . TYR B 1 659  ? 1117.164 706.847 595.076 1.00 0.00 ? 659  TYR B O  1 
ATOM 5676   C CB . TYR B 1 659  ? 1118.806 705.374 592.712 1.00 0.00 ? 659  TYR B CB 1 
ATOM 5677   N N  . SER B 1 660  ? 1115.988 706.612 593.161 1.00 0.00 ? 660  SER B N  1 
ATOM 5678   C CA . SER B 1 660  ? 1114.709 706.571 593.806 1.00 0.00 ? 660  SER B CA 1 
ATOM 5679   C C  . SER B 1 660  ? 1114.626 705.355 594.675 1.00 0.00 ? 660  SER B C  1 
ATOM 5680   O O  . SER B 1 660  ? 1115.437 704.434 594.582 1.00 0.00 ? 660  SER B O  1 
ATOM 5681   C CB . SER B 1 660  ? 1113.526 706.522 592.823 1.00 0.00 ? 660  SER B CB 1 
ATOM 5682   N N  . GLY B 1 661  ? 1113.618 705.363 595.567 1.00 0.00 ? 661  GLY B N  1 
ATOM 5683   C CA . GLY B 1 661  ? 1113.346 704.327 596.520 1.00 0.00 ? 661  GLY B CA 1 
ATOM 5684   C C  . GLY B 1 661  ? 1112.992 703.076 595.787 1.00 0.00 ? 661  GLY B C  1 
ATOM 5685   O O  . GLY B 1 661  ? 1113.177 701.976 596.307 1.00 0.00 ? 661  GLY B O  1 
ATOM 5686   N N  . LYS B 1 662  ? 1112.407 703.227 594.584 1.00 0.00 ? 662  LYS B N  1 
ATOM 5687   C CA . LYS B 1 662  ? 1111.972 702.110 593.794 1.00 0.00 ? 662  LYS B CA 1 
ATOM 5688   C C  . LYS B 1 662  ? 1113.165 701.277 593.478 1.00 0.00 ? 662  LYS B C  1 
ATOM 5689   O O  . LYS B 1 662  ? 1113.139 700.057 593.627 1.00 0.00 ? 662  LYS B O  1 
ATOM 5690   C CB . LYS B 1 662  ? 1111.438 702.513 592.407 1.00 0.00 ? 662  LYS B CB 1 
ATOM 5691   N N  . HIS B 1 663  ? 1114.254 701.925 593.026 1.00 0.00 ? 663  HIS B N  1 
ATOM 5692   C CA . HIS B 1 663  ? 1115.418 701.183 592.654 1.00 0.00 ? 663  HIS B CA 1 
ATOM 5693   C C  . HIS B 1 663  ? 1115.972 700.482 593.843 1.00 0.00 ? 663  HIS B C  1 
ATOM 5694   O O  . HIS B 1 663  ? 1116.280 699.292 593.784 1.00 0.00 ? 663  HIS B O  1 
ATOM 5695   C CB . HIS B 1 663  ? 1116.558 702.046 592.091 1.00 0.00 ? 663  HIS B CB 1 
ATOM 5696   N N  . ASN B 1 664  ? 1116.106 701.206 594.964 1.00 0.00 ? 664  ASN B N  1 
ATOM 5697   C CA . ASN B 1 664  ? 1116.687 700.613 596.127 1.00 0.00 ? 664  ASN B CA 1 
ATOM 5698   C C  . ASN B 1 664  ? 1115.809 699.499 596.591 1.00 0.00 ? 664  ASN B C  1 
ATOM 5699   O O  . ASN B 1 664  ? 1116.301 698.455 597.017 1.00 0.00 ? 664  ASN B O  1 
ATOM 5700   C CB . ASN B 1 664  ? 1116.861 701.607 597.289 1.00 0.00 ? 664  ASN B CB 1 
ATOM 5701   N N  . GLY B 1 665  ? 1114.480 699.687 596.523 1.00 0.00 ? 665  GLY B N  1 
ATOM 5702   C CA . GLY B 1 665  ? 1113.581 698.684 597.009 1.00 0.00 ? 665  GLY B CA 1 
ATOM 5703   C C  . GLY B 1 665  ? 1113.717 697.438 596.191 1.00 0.00 ? 665  GLY B C  1 
ATOM 5704   O O  . GLY B 1 665  ? 1113.765 696.334 596.729 1.00 0.00 ? 665  GLY B O  1 
ATOM 5705   N N  . ILE B 1 666  ? 1113.778 697.576 594.856 1.00 0.00 ? 666  ILE B N  1 
ATOM 5706   C CA . ILE B 1 666  ? 1113.860 696.399 594.044 1.00 0.00 ? 666  ILE B CA 1 
ATOM 5707   C C  . ILE B 1 666  ? 1115.157 695.701 594.307 1.00 0.00 ? 666  ILE B C  1 
ATOM 5708   O O  . ILE B 1 666  ? 1115.194 694.483 594.474 1.00 0.00 ? 666  ILE B O  1 
ATOM 5709   C CB . ILE B 1 666  ? 1113.757 696.675 592.566 1.00 0.00 ? 666  ILE B CB 1 
ATOM 5710   N N  . CYS B 1 667  ? 1116.260 696.470 594.373 1.00 0.00 ? 667  CYS B N  1 
ATOM 5711   C CA . CYS B 1 667  ? 1117.568 695.910 594.539 1.00 0.00 ? 667  CYS B CA 1 
ATOM 5712   C C  . CYS B 1 667  ? 1117.653 695.220 595.866 1.00 0.00 ? 667  CYS B C  1 
ATOM 5713   O O  . CYS B 1 667  ? 1118.256 694.155 595.973 1.00 0.00 ? 667  CYS B O  1 
ATOM 5714   C CB . CYS B 1 667  ? 1118.684 696.967 594.493 1.00 0.00 ? 667  CYS B CB 1 
ATOM 5715   N N  . ILE B 1 668  ? 1117.045 695.809 596.914 1.00 0.00 ? 668  ILE B N  1 
ATOM 5716   C CA . ILE B 1 668  ? 1117.139 695.243 598.229 1.00 0.00 ? 668  ILE B CA 1 
ATOM 5717   C C  . ILE B 1 668  ? 1116.489 693.897 598.217 1.00 0.00 ? 668  ILE B C  1 
ATOM 5718   O O  . ILE B 1 668  ? 1116.980 692.946 598.823 1.00 0.00 ? 668  ILE B O  1 
ATOM 5719   C CB . ILE B 1 668  ? 1116.512 696.103 599.296 1.00 0.00 ? 668  ILE B CB 1 
ATOM 5720   N N  . TYR B 1 669  ? 1115.362 693.790 597.495 1.00 0.00 ? 669  TYR B N  1 
ATOM 5721   C CA . TYR B 1 669  ? 1114.577 692.594 597.403 1.00 0.00 ? 669  TYR B CA 1 
ATOM 5722   C C  . TYR B 1 669  ? 1115.450 691.530 596.812 1.00 0.00 ? 669  TYR B C  1 
ATOM 5723   O O  . TYR B 1 669  ? 1115.563 690.422 597.339 1.00 0.00 ? 669  TYR B O  1 
ATOM 5724   C CB . TYR B 1 669  ? 1113.457 692.810 596.372 1.00 0.00 ? 669  TYR B CB 1 
ATOM 5725   N N  . PHE B 1 670  ? 1116.121 691.878 595.699 1.00 0.00 ? 670  PHE B N  1 
ATOM 5726   C CA . PHE B 1 670  ? 1116.906 690.963 594.923 1.00 0.00 ? 670  PHE B CA 1 
ATOM 5727   C C  . PHE B 1 670  ? 1118.058 690.492 595.757 1.00 0.00 ? 670  PHE B C  1 
ATOM 5728   O O  . PHE B 1 670  ? 1118.358 689.301 595.805 1.00 0.00 ? 670  PHE B O  1 
ATOM 5729   C CB . PHE B 1 670  ? 1117.463 691.659 593.666 1.00 0.00 ? 670  PHE B CB 1 
ATOM 5730   N N  . SER B 1 671  ? 1118.726 691.431 596.452 1.00 0.00 ? 671  SER B N  1 
ATOM 5731   C CA . SER B 1 671  ? 1119.896 691.123 597.223 1.00 0.00 ? 671  SER B CA 1 
ATOM 5732   C C  . SER B 1 671  ? 1119.546 690.180 598.330 1.00 0.00 ? 671  SER B C  1 
ATOM 5733   O O  . SER B 1 671  ? 1120.269 689.221 598.586 1.00 0.00 ? 671  SER B O  1 
ATOM 5734   C CB . SER B 1 671  ? 1120.524 692.377 597.855 1.00 0.00 ? 671  SER B CB 1 
ATOM 5735   N N  . ARG B 1 672  ? 1118.416 690.431 599.012 1.00 0.00 ? 672  ARG B N  1 
ATOM 5736   C CA . ARG B 1 672  ? 1118.035 689.641 600.144 1.00 0.00 ? 672  ARG B CA 1 
ATOM 5737   C C  . ARG B 1 672  ? 1117.716 688.234 599.748 1.00 0.00 ? 672  ARG B C  1 
ATOM 5738   O O  . ARG B 1 672  ? 1118.062 687.298 600.468 1.00 0.00 ? 672  ARG B O  1 
ATOM 5739   C CB . ARG B 1 672  ? 1116.852 690.251 600.916 1.00 0.00 ? 672  ARG B CB 1 
ATOM 5740   N N  . ILE B 1 673  ? 1117.047 688.023 598.599 1.00 0.00 ? 673  ILE B N  1 
ATOM 5741   C CA . ILE B 1 673  ? 1116.698 686.669 598.272 1.00 0.00 ? 673  ILE B CA 1 
ATOM 5742   C C  . ILE B 1 673  ? 1117.927 685.839 598.059 1.00 0.00 ? 673  ILE B C  1 
ATOM 5743   O O  . ILE B 1 673  ? 1118.046 684.739 598.600 1.00 0.00 ? 673  ILE B O  1 
ATOM 5744   C CB . ILE B 1 673  ? 1115.850 686.537 597.043 1.00 0.00 ? 673  ILE B CB 1 
ATOM 5745   N N  . MET B 1 674  ? 1118.863 686.362 597.255 1.00 0.00 ? 674  MET B N  1 
ATOM 5746   C CA . MET B 1 674  ? 1120.088 685.744 596.828 1.00 0.00 ? 674  MET B CA 1 
ATOM 5747   C C  . MET B 1 674  ? 1121.160 685.699 597.876 1.00 0.00 ? 674  MET B C  1 
ATOM 5748   O O  . MET B 1 674  ? 1122.140 684.974 597.716 1.00 0.00 ? 674  MET B O  1 
ATOM 5749   C CB . MET B 1 674  ? 1120.628 686.334 595.514 1.00 0.00 ? 674  MET B CB 1 
ATOM 5750   N N  . GLY B 1 675  ? 1121.024 686.470 598.969 1.00 0.00 ? 675  GLY B N  1 
ATOM 5751   C CA . GLY B 1 675  ? 1122.095 686.685 599.904 1.00 0.00 ? 675  GLY B CA 1 
ATOM 5752   C C  . GLY B 1 675  ? 1122.753 685.411 600.371 1.00 0.00 ? 675  GLY B C  1 
ATOM 5753   O O  . GLY B 1 675  ? 1123.976 685.379 600.493 1.00 0.00 ? 675  GLY B O  1 
ATOM 5754   N N  . ASN B 1 676  ? 1122.006 684.334 600.666 1.00 0.00 ? 676  ASN B N  1 
ATOM 5755   C CA . ASN B 1 676  ? 1122.655 683.164 601.205 1.00 0.00 ? 676  ASN B CA 1 
ATOM 5756   C C  . ASN B 1 676  ? 1123.640 682.583 600.226 1.00 0.00 ? 676  ASN B C  1 
ATOM 5757   O O  . ASN B 1 676  ? 1124.811 682.391 600.547 1.00 0.00 ? 676  ASN B O  1 
ATOM 5758   C CB . ASN B 1 676  ? 1121.655 682.039 601.503 1.00 0.00 ? 676  ASN B CB 1 
ATOM 5759   N N  . ILE B 1 677  ? 1123.155 682.286 599.008 1.00 0.00 ? 677  ILE B N  1 
ATOM 5760   C CA . ILE B 1 677  ? 1123.840 681.639 597.918 1.00 0.00 ? 677  ILE B CA 1 
ATOM 5761   C C  . ILE B 1 677  ? 1124.886 682.488 597.261 1.00 0.00 ? 677  ILE B C  1 
ATOM 5762   O O  . ILE B 1 677  ? 1125.858 681.958 596.726 1.00 0.00 ? 677  ILE B O  1 
ATOM 5763   C CB . ILE B 1 677  ? 1122.910 681.148 596.846 1.00 0.00 ? 677  ILE B CB 1 
ATOM 5764   N N  . TRP B 1 678  ? 1124.711 683.822 597.272 1.00 0.00 ? 678  TRP B N  1 
ATOM 5765   C CA . TRP B 1 678  ? 1125.474 684.699 596.429 1.00 0.00 ? 678  TRP B CA 1 
ATOM 5766   C C  . TRP B 1 678  ? 1126.954 684.458 596.534 1.00 0.00 ? 678  TRP B C  1 
ATOM 5767   O O  . TRP B 1 678  ? 1127.595 684.246 595.510 1.00 0.00 ? 678  TRP B O  1 
ATOM 5768   C CB . TRP B 1 678  ? 1125.212 686.185 596.745 1.00 0.00 ? 678  TRP B CB 1 
ATOM 5769   N N  . ASP B 1 679  ? 1127.549 684.492 597.740 1.00 0.00 ? 679  ASP B N  1 
ATOM 5770   C CA . ASP B 1 679  ? 1128.970 684.300 597.893 1.00 0.00 ? 679  ASP B CA 1 
ATOM 5771   C C  . ASP B 1 679  ? 1129.420 682.871 597.732 1.00 0.00 ? 679  ASP B C  1 
ATOM 5772   O O  . ASP B 1 679  ? 1130.548 682.626 597.308 1.00 0.00 ? 679  ASP B O  1 
ATOM 5773   C CB . ASP B 1 679  ? 1129.506 684.823 599.234 1.00 0.00 ? 679  ASP B CB 1 
ATOM 5774   N N  . ALA B 1 680  ? 1128.563 681.889 598.075 1.00 0.00 ? 680  ALA B N  1 
ATOM 5775   C CA . ALA B 1 680  ? 1128.955 680.501 598.124 1.00 0.00 ? 680  ALA B CA 1 
ATOM 5776   C C  . ALA B 1 680  ? 1129.372 679.966 596.787 1.00 0.00 ? 680  ALA B C  1 
ATOM 5777   O O  . ALA B 1 680  ? 1128.939 680.440 595.739 1.00 0.00 ? 680  ALA B O  1 
ATOM 5778   C CB . ALA B 1 680  ? 1127.849 679.577 598.665 1.00 0.00 ? 680  ALA B CB 1 
ATOM 5779   N N  . SER B 1 681  ? 1130.272 678.953 596.824 1.00 0.00 ? 681  SER B N  1 
ATOM 5780   C CA . SER B 1 681  ? 1130.772 678.291 595.652 1.00 0.00 ? 681  SER B CA 1 
ATOM 5781   C C  . SER B 1 681  ? 1129.678 677.429 595.104 1.00 0.00 ? 681  SER B C  1 
ATOM 5782   O O  . SER B 1 681  ? 1128.954 676.762 595.840 1.00 0.00 ? 681  SER B O  1 
ATOM 5783   C CB . SER B 1 681  ? 1131.982 677.385 595.933 1.00 0.00 ? 681  SER B CB 1 
ATOM 5784   N N  . LEU B 1 682  ? 1129.531 677.463 593.767 1.00 0.00 ? 682  LEU B N  1 
ATOM 5785   C CA . LEU B 1 682  ? 1128.510 676.760 593.046 1.00 0.00 ? 682  LEU B CA 1 
ATOM 5786   C C  . LEU B 1 682  ? 1128.762 675.282 593.064 1.00 0.00 ? 682  LEU B C  1 
ATOM 5787   O O  . LEU B 1 682  ? 1127.864 674.497 593.364 1.00 0.00 ? 682  LEU B O  1 
ATOM 5788   C CB . LEU B 1 682  ? 1128.511 677.193 591.578 1.00 0.00 ? 682  LEU B CB 1 
ATOM 5789   N N  . VAL B 1 683  ? 1130.003 674.860 592.749 1.00 0.00 ? 683  VAL B N  1 
ATOM 5790   C CA . VAL B 1 683  ? 1130.242 673.454 592.603 1.00 0.00 ? 683  VAL B CA 1 
ATOM 5791   C C  . VAL B 1 683  ? 1131.205 673.010 593.645 1.00 0.00 ? 683  VAL B C  1 
ATOM 5792   O O  . VAL B 1 683  ? 1132.114 673.739 594.035 1.00 0.00 ? 683  VAL B O  1 
ATOM 5793   C CB . VAL B 1 683  ? 1130.821 673.084 591.269 1.00 0.00 ? 683  VAL B CB 1 
ATOM 5794   N N  . VAL B 1 684  ? 1130.990 671.775 594.134 1.00 0.00 ? 684  VAL B N  1 
ATOM 5795   C CA . VAL B 1 684  ? 1131.852 671.190 595.113 1.00 0.00 ? 684  VAL B CA 1 
ATOM 5796   C C  . VAL B 1 684  ? 1132.320 669.912 594.508 1.00 0.00 ? 684  VAL B C  1 
ATOM 5797   O O  . VAL B 1 684  ? 1132.999 669.117 595.155 1.00 0.00 ? 684  VAL B O  1 
ATOM 5798   C CB . VAL B 1 684  ? 1131.153 670.862 596.399 1.00 0.00 ? 684  VAL B CB 1 
ATOM 5799   N N  . GLU B 1 699  ? 1129.433 667.830 593.076 1.00 0.00 ? 699  GLU B N  1 
ATOM 5800   C CA . GLU B 1 699  ? 1128.020 668.050 593.041 1.00 0.00 ? 699  GLU B CA 1 
ATOM 5801   C C  . GLU B 1 699  ? 1127.779 669.496 593.325 1.00 0.00 ? 699  GLU B C  1 
ATOM 5802   O O  . GLU B 1 699  ? 1128.666 670.210 593.793 1.00 0.00 ? 699  GLU B O  1 
ATOM 5803   C CB . GLU B 1 699  ? 1127.264 667.232 594.105 1.00 0.00 ? 699  GLU B CB 1 
ATOM 5804   N N  . SER B 1 700  ? 1126.562 669.976 593.002 1.00 0.00 ? 700  SER B N  1 
ATOM 5805   C CA . SER B 1 700  ? 1126.212 671.349 593.219 1.00 0.00 ? 700  SER B CA 1 
ATOM 5806   C C  . SER B 1 700  ? 1126.078 671.570 594.693 1.00 0.00 ? 700  SER B C  1 
ATOM 5807   O O  . SER B 1 700  ? 1125.661 670.686 595.442 1.00 0.00 ? 700  SER B O  1 
ATOM 5808   C CB . SER B 1 700  ? 1124.877 671.736 592.559 1.00 0.00 ? 700  SER B CB 1 
ATOM 5809   N N  . SER B 1 701  ? 1126.436 672.788 595.140 1.00 0.00 ? 701  SER B N  1 
ATOM 5810   C CA . SER B 1 701  ? 1126.413 673.127 596.532 1.00 0.00 ? 701  SER B CA 1 
ATOM 5811   C C  . SER B 1 701  ? 1125.004 673.125 597.026 1.00 0.00 ? 701  SER B C  1 
ATOM 5812   O O  . SER B 1 701  ? 1124.745 672.741 598.165 1.00 0.00 ? 701  SER B O  1 
ATOM 5813   C CB . SER B 1 701  ? 1127.017 674.517 596.810 1.00 0.00 ? 701  SER B CB 1 
ATOM 5814   N N  . VAL B 1 702  ? 1124.044 673.533 596.175 1.00 0.00 ? 702  VAL B N  1 
ATOM 5815   C CA . VAL B 1 702  ? 1122.688 673.630 596.633 1.00 0.00 ? 702  VAL B CA 1 
ATOM 5816   C C  . VAL B 1 702  ? 1121.896 672.502 596.057 1.00 0.00 ? 702  VAL B C  1 
ATOM 5817   O O  . VAL B 1 702  ? 1122.187 671.977 594.984 1.00 0.00 ? 702  VAL B O  1 
ATOM 5818   C CB . VAL B 1 702  ? 1122.026 674.914 596.230 1.00 0.00 ? 702  VAL B CB 1 
ATOM 5819   N N  . PRO B 1 703  ? 1120.899 672.114 596.800 1.00 0.00 ? 703  PRO B N  1 
ATOM 5820   C CA . PRO B 1 703  ? 1120.036 671.032 596.410 1.00 0.00 ? 703  PRO B CA 1 
ATOM 5821   C C  . PRO B 1 703  ? 1119.092 671.446 595.327 1.00 0.00 ? 703  PRO B C  1 
ATOM 5822   O O  . PRO B 1 703  ? 1118.948 672.641 595.079 1.00 0.00 ? 703  PRO B O  1 
ATOM 5823   C CB . PRO B 1 703  ? 1119.341 670.552 597.686 1.00 0.00 ? 703  PRO B CB 1 
ATOM 5824   N N  . CYS B 1 704  ? 1118.466 670.457 594.661 1.00 0.00 ? 704  CYS B N  1 
ATOM 5825   C CA . CYS B 1 704  ? 1117.560 670.681 593.572 1.00 0.00 ? 704  CYS B CA 1 
ATOM 5826   C C  . CYS B 1 704  ? 1116.352 671.428 594.027 1.00 0.00 ? 704  CYS B C  1 
ATOM 5827   O O  . CYS B 1 704  ? 1115.879 672.328 593.336 1.00 0.00 ? 704  CYS B O  1 
ATOM 5828   C CB . CYS B 1 704  ? 1117.051 669.385 592.925 1.00 0.00 ? 704  CYS B CB 1 
ATOM 5829   N N  . GLN B 1 705  ? 1115.817 671.083 595.211 1.00 0.00 ? 705  GLN B N  1 
ATOM 5830   C CA . GLN B 1 705  ? 1114.602 671.709 595.642 1.00 0.00 ? 705  GLN B CA 1 
ATOM 5831   C C  . GLN B 1 705  ? 1114.866 673.172 595.753 1.00 0.00 ? 705  GLN B C  1 
ATOM 5832   O O  . GLN B 1 705  ? 1114.053 673.998 595.342 1.00 0.00 ? 705  GLN B O  1 
ATOM 5833   C CB . GLN B 1 705  ? 1114.156 671.231 597.035 1.00 0.00 ? 705  GLN B CB 1 
ATOM 5834   N N  . LEU B 1 706  ? 1116.039 673.523 596.309 1.00 0.00 ? 706  LEU B N  1 
ATOM 5835   C CA . LEU B 1 706  ? 1116.400 674.893 596.525 1.00 0.00 ? 706  LEU B CA 1 
ATOM 5836   C C  . LEU B 1 706  ? 1116.546 675.583 595.202 1.00 0.00 ? 706  LEU B C  1 
ATOM 5837   O O  . LEU B 1 706  ? 1116.113 676.720 595.037 1.00 0.00 ? 706  LEU B O  1 
ATOM 5838   C CB . LEU B 1 706  ? 1117.727 675.026 597.288 1.00 0.00 ? 706  LEU B CB 1 
ATOM 5839   N N  . LEU B 1 707  ? 1117.148 674.896 594.213 1.00 0.00 ? 707  LEU B N  1 
ATOM 5840   C CA . LEU B 1 707  ? 1117.383 675.495 592.929 1.00 0.00 ? 707  LEU B CA 1 
ATOM 5841   C C  . LEU B 1 707  ? 1116.055 675.855 592.344 1.00 0.00 ? 707  LEU B C  1 
ATOM 5842   O O  . LEU B 1 707  ? 1115.886 676.942 591.795 1.00 0.00 ? 707  LEU B O  1 
ATOM 5843   C CB . LEU B 1 707  ? 1118.102 674.520 591.968 1.00 0.00 ? 707  LEU B CB 1 
ATOM 5844   N N  . GLU B 1 708  ? 1115.073 674.948 592.456 1.00 0.00 ? 708  GLU B N  1 
ATOM 5845   C CA . GLU B 1 708  ? 1113.782 675.188 591.883 1.00 0.00 ? 708  GLU B CA 1 
ATOM 5846   C C  . GLU B 1 708  ? 1113.154 676.357 592.568 1.00 0.00 ? 708  GLU B C  1 
ATOM 5847   O O  . GLU B 1 708  ? 1112.503 677.183 591.929 1.00 0.00 ? 708  GLU B O  1 
ATOM 5848   C CB . GLU B 1 708  ? 1112.836 673.985 592.021 1.00 0.00 ? 708  GLU B CB 1 
ATOM 5849   N N  . SER B 1 709  ? 1113.340 676.461 593.896 1.00 0.00 ? 709  SER B N  1 
ATOM 5850   C CA . SER B 1 709  ? 1112.729 677.519 594.641 1.00 0.00 ? 709  SER B CA 1 
ATOM 5851   C C  . SER B 1 709  ? 1113.238 678.840 594.146 1.00 0.00 ? 709  SER B C  1 
ATOM 5852   O O  . SER B 1 709  ? 1112.454 679.736 593.838 1.00 0.00 ? 709  SER B O  1 
ATOM 5853   C CB . SER B 1 709  ? 1113.043 677.443 596.144 1.00 0.00 ? 709  SER B CB 1 
ATOM 5854   N N  . VAL B 1 710  ? 1114.572 678.986 594.034 1.00 0.00 ? 710  VAL B N  1 
ATOM 5855   C CA . VAL B 1 710  ? 1115.159 680.231 593.632 1.00 0.00 ? 710  VAL B CA 1 
ATOM 5856   C C  . VAL B 1 710  ? 1114.722 680.555 592.240 1.00 0.00 ? 710  VAL B C  1 
ATOM 5857   O O  . VAL B 1 710  ? 1114.377 681.696 591.938 1.00 0.00 ? 710  VAL B O  1 
ATOM 5858   C CB . VAL B 1 710  ? 1116.658 680.190 593.626 1.00 0.00 ? 710  VAL B CB 1 
ATOM 5859   N N  . LEU B 1 711  ? 1114.712 679.544 591.354 1.00 0.00 ? 711  LEU B N  1 
ATOM 5860   C CA . LEU B 1 711  ? 1114.376 679.765 589.978 1.00 0.00 ? 711  LEU B CA 1 
ATOM 5861   C C  . LEU B 1 711  ? 1112.972 680.270 589.889 1.00 0.00 ? 711  LEU B C  1 
ATOM 5862   O O  . LEU B 1 711  ? 1112.689 681.205 589.143 1.00 0.00 ? 711  LEU B O  1 
ATOM 5863   C CB . LEU B 1 711  ? 1114.456 678.477 589.141 1.00 0.00 ? 711  LEU B CB 1 
ATOM 5864   N N  . GLN B 1 712  ? 1112.056 679.664 590.664 1.00 0.00 ? 712  GLN B N  1 
ATOM 5865   C CA . GLN B 1 712  ? 1110.673 680.039 590.604 1.00 0.00 ? 712  GLN B CA 1 
ATOM 5866   C C  . GLN B 1 712  ? 1110.517 681.457 591.055 1.00 0.00 ? 712  GLN B C  1 
ATOM 5867   O O  . GLN B 1 712  ? 1109.820 682.246 590.421 1.00 0.00 ? 712  GLN B O  1 
ATOM 5868   C CB . GLN B 1 712  ? 1109.797 679.172 591.523 1.00 0.00 ? 712  GLN B CB 1 
ATOM 5869   N N  . GLU B 1 713  ? 1111.186 681.821 592.165 1.00 0.00 ? 713  GLU B N  1 
ATOM 5870   C CA . GLU B 1 713  ? 1111.022 683.131 592.724 1.00 0.00 ? 713  GLU B CA 1 
ATOM 5871   C C  . GLU B 1 713  ? 1111.522 684.164 591.768 1.00 0.00 ? 713  GLU B C  1 
ATOM 5872   O O  . GLU B 1 713  ? 1110.845 685.157 591.502 1.00 0.00 ? 713  GLU B O  1 
ATOM 5873   C CB . GLU B 1 713  ? 1111.791 683.297 594.043 1.00 0.00 ? 713  GLU B CB 1 
ATOM 5874   N N  . LEU B 1 714  ? 1112.715 683.938 591.195 1.00 0.00 ? 714  LEU B N  1 
ATOM 5875   C CA . LEU B 1 714  ? 1113.296 684.911 590.320 1.00 0.00 ? 714  LEU B CA 1 
ATOM 5876   C C  . LEU B 1 714  ? 1112.443 685.022 589.102 1.00 0.00 ? 714  LEU B C  1 
ATOM 5877   O O  . LEU B 1 714  ? 1112.369 686.082 588.485 1.00 0.00 ? 714  LEU B O  1 
ATOM 5878   C CB . LEU B 1 714  ? 1114.709 684.570 589.857 1.00 0.00 ? 714  LEU B CB 1 
ATOM 5879   N N  . LYS B 1 715  ? 1111.809 683.905 588.704 1.00 0.00 ? 715  LYS B N  1 
ATOM 5880   C CA . LYS B 1 715  ? 1110.980 683.894 587.536 1.00 0.00 ? 715  LYS B CA 1 
ATOM 5881   C C  . LYS B 1 715  ? 1109.851 684.850 587.744 1.00 0.00 ? 715  LYS B C  1 
ATOM 5882   O O  . LYS B 1 715  ? 1109.496 685.605 586.841 1.00 0.00 ? 715  LYS B O  1 
ATOM 5883   C CB . LYS B 1 715  ? 1110.367 682.507 587.274 1.00 0.00 ? 715  LYS B CB 1 
ATOM 5884   N N  . GLY B 1 716  ? 1109.257 684.852 588.953 1.00 0.00 ? 716  GLY B N  1 
ATOM 5885   C CA . GLY B 1 716  ? 1108.144 685.720 589.200 1.00 0.00 ? 716  GLY B CA 1 
ATOM 5886   C C  . GLY B 1 716  ? 1108.597 687.138 589.058 1.00 0.00 ? 716  GLY B C  1 
ATOM 5887   O O  . GLY B 1 716  ? 1107.913 687.962 588.454 1.00 0.00 ? 716  GLY B O  1 
ATOM 5888   N N  . LEU B 1 717  ? 1109.776 687.458 589.622 1.00 0.00 ? 717  LEU B N  1 
ATOM 5889   C CA . LEU B 1 717  ? 1110.286 688.796 589.564 1.00 0.00 ? 717  LEU B CA 1 
ATOM 5890   C C  . LEU B 1 717  ? 1110.577 689.151 588.141 1.00 0.00 ? 717  LEU B C  1 
ATOM 5891   O O  . LEU B 1 717  ? 1110.281 690.258 587.697 1.00 0.00 ? 717  LEU B O  1 
ATOM 5892   C CB . LEU B 1 717  ? 1111.589 688.984 590.358 1.00 0.00 ? 717  LEU B CB 1 
ATOM 5893   N N  . GLN B 1 718  ? 1111.146 688.204 587.371 1.00 0.00 ? 718  GLN B N  1 
ATOM 5894   C CA . GLN B 1 718  ? 1111.538 688.498 586.025 1.00 0.00 ? 718  GLN B CA 1 
ATOM 5895   C C  . GLN B 1 718  ? 1110.329 688.899 585.246 1.00 0.00 ? 718  GLN B C  1 
ATOM 5896   O O  . GLN B 1 718  ? 1110.355 689.885 584.510 1.00 0.00 ? 718  GLN B O  1 
ATOM 5897   C CB . GLN B 1 718  ? 1112.141 687.283 585.300 1.00 0.00 ? 718  GLN B CB 1 
ATOM 5898   N N  . GLU B 1 719  ? 1109.227 688.147 585.405 1.00 0.00 ? 719  GLU B N  1 
ATOM 5899   C CA . GLU B 1 719  ? 1108.033 688.420 584.661 1.00 0.00 ? 719  GLU B CA 1 
ATOM 5900   C C  . GLU B 1 719  ? 1107.494 689.754 585.073 1.00 0.00 ? 719  GLU B C  1 
ATOM 5901   O O  . GLU B 1 719  ? 1107.037 690.533 584.238 1.00 0.00 ? 719  GLU B O  1 
ATOM 5902   C CB . GLU B 1 719  ? 1106.950 687.357 584.897 1.00 0.00 ? 719  GLU B CB 1 
ATOM 5903   N N  . PHE B 1 720  ? 1107.554 690.060 586.383 1.00 0.00 ? 720  PHE B N  1 
ATOM 5904   C CA . PHE B 1 720  ? 1107.006 691.284 586.894 1.00 0.00 ? 720  PHE B CA 1 
ATOM 5905   C C  . PHE B 1 720  ? 1107.686 692.449 586.248 1.00 0.00 ? 720  PHE B C  1 
ATOM 5906   O O  . PHE B 1 720  ? 1107.032 693.334 585.701 1.00 0.00 ? 720  PHE B O  1 
ATOM 5907   C CB . PHE B 1 720  ? 1107.227 691.409 588.411 1.00 0.00 ? 720  PHE B CB 1 
ATOM 5908   N N  . LEU B 1 721  ? 1109.031 692.466 586.277 1.00 0.00 ? 721  LEU B N  1 
ATOM 5909   C CA . LEU B 1 721  ? 1109.773 693.565 585.736 1.00 0.00 ? 721  LEU B CA 1 
ATOM 5910   C C  . LEU B 1 721  ? 1109.600 693.625 584.254 1.00 0.00 ? 721  LEU B C  1 
ATOM 5911   O O  . LEU B 1 721  ? 1109.516 694.708 583.681 1.00 0.00 ? 721  LEU B O  1 
ATOM 5912   C CB . LEU B 1 721  ? 1111.278 693.497 586.049 1.00 0.00 ? 721  LEU B CB 1 
ATOM 5913   N N  . ASP B 1 722  ? 1109.547 692.460 583.587 1.00 0.00 ? 722  ASP B N  1 
ATOM 5914   C CA . ASP B 1 722  ? 1109.436 692.467 582.159 1.00 0.00 ? 722  ASP B CA 1 
ATOM 5915   C C  . ASP B 1 722  ? 1108.162 693.157 581.796 1.00 0.00 ? 722  ASP B C  1 
ATOM 5916   O O  . ASP B 1 722  ? 1108.127 693.961 580.867 1.00 0.00 ? 722  ASP B O  1 
ATOM 5917   C CB . ASP B 1 722  ? 1109.367 691.054 581.555 1.00 0.00 ? 722  ASP B CB 1 
ATOM 5918   N N  . ARG B 1 723  ? 1107.074 692.848 582.526 1.00 0.00 ? 723  ARG B N  1 
ATOM 5919   C CA . ARG B 1 723  ? 1105.792 693.412 582.219 1.00 0.00 ? 723  ARG B CA 1 
ATOM 5920   C C  . ARG B 1 723  ? 1105.793 694.895 582.436 1.00 0.00 ? 723  ARG B C  1 
ATOM 5921   O O  . ARG B 1 723  ? 1105.359 695.648 581.566 1.00 0.00 ? 723  ARG B O  1 
ATOM 5922   C CB . ARG B 1 723  ? 1104.670 692.822 583.088 1.00 0.00 ? 723  ARG B CB 1 
ATOM 5923   N N  . ASN B 1 724  ? 1106.302 695.369 583.592 1.00 0.00 ? 724  ASN B N  1 
ATOM 5924   C CA . ASN B 1 724  ? 1106.208 696.778 583.846 1.00 0.00 ? 724  ASN B CA 1 
ATOM 5925   C C  . ASN B 1 724  ? 1107.542 697.411 583.610 1.00 0.00 ? 724  ASN B C  1 
ATOM 5926   O O  . ASN B 1 724  ? 1107.967 698.279 584.371 1.00 0.00 ? 724  ASN B O  1 
ATOM 5927   C CB . ASN B 1 724  ? 1105.832 697.084 585.305 1.00 0.00 ? 724  ASN B CB 1 
ATOM 5928   N N  . SER B 1 725  ? 1108.239 697.004 582.536 1.00 0.00 ? 725  SER B N  1 
ATOM 5929   C CA . SER B 1 725  ? 1109.528 697.567 582.254 1.00 0.00 ? 725  SER B CA 1 
ATOM 5930   C C  . SER B 1 725  ? 1109.367 698.940 581.677 1.00 0.00 ? 725  SER B C  1 
ATOM 5931   O O  . SER B 1 725  ? 1110.184 699.826 581.917 1.00 0.00 ? 725  SER B O  1 
ATOM 5932   C CB . SER B 1 725  ? 1110.343 696.733 581.253 1.00 0.00 ? 725  SER B CB 1 
ATOM 5933   N N  . GLN B 1 726  ? 1108.273 699.161 580.929 1.00 0.00 ? 726  GLN B N  1 
ATOM 5934   C CA . GLN B 1 726  ? 1108.089 700.388 580.210 1.00 0.00 ? 726  GLN B CA 1 
ATOM 5935   C C  . GLN B 1 726  ? 1108.067 701.520 581.178 1.00 0.00 ? 726  GLN B C  1 
ATOM 5936   O O  . GLN B 1 726  ? 1108.597 702.594 580.903 1.00 0.00 ? 726  GLN B O  1 
ATOM 5937   C CB . GLN B 1 726  ? 1106.756 700.434 579.442 1.00 0.00 ? 726  GLN B CB 1 
ATOM 5938   N N  . PHE B 1 727  ? 1107.437 701.311 582.345 1.00 0.00 ? 727  PHE B N  1 
ATOM 5939   C CA . PHE B 1 727  ? 1107.300 702.375 583.292 1.00 0.00 ? 727  PHE B CA 1 
ATOM 5940   C C  . PHE B 1 727  ? 1108.657 702.811 583.775 1.00 0.00 ? 727  PHE B C  1 
ATOM 5941   O O  . PHE B 1 727  ? 1108.976 703.999 583.759 1.00 0.00 ? 727  PHE B O  1 
ATOM 5942   C CB . PHE B 1 727  ? 1106.466 701.922 584.504 1.00 0.00 ? 727  PHE B CB 1 
ATOM 5943   N N  . ALA B 1 728  ? 1109.490 701.842 584.208 1.00 0.00 ? 728  ALA B N  1 
ATOM 5944   C CA . ALA B 1 728  ? 1110.769 702.094 584.819 1.00 0.00 ? 728  ALA B CA 1 
ATOM 5945   C C  . ALA B 1 728  ? 1111.817 702.670 583.904 1.00 0.00 ? 728  ALA B C  1 
ATOM 5946   O O  . ALA B 1 728  ? 1112.555 703.569 584.307 1.00 0.00 ? 728  ALA B O  1 
ATOM 5947   C CB . ALA B 1 728  ? 1111.371 700.832 585.458 1.00 0.00 ? 728  ALA B CB 1 
ATOM 5948   N N  . GLY B 1 729  ? 1111.936 702.171 582.658 1.00 0.00 ? 729  GLY B N  1 
ATOM 5949   C CA . GLY B 1 729  ? 1113.011 702.617 581.808 1.00 0.00 ? 729  GLY B CA 1 
ATOM 5950   C C  . GLY B 1 729  ? 1112.554 703.774 580.988 1.00 0.00 ? 729  GLY B C  1 
ATOM 5951   O O  . GLY B 1 729  ? 1111.613 704.480 581.351 1.00 0.00 ? 729  GLY B O  1 
ATOM 5952   N N  . GLY B 1 730  ? 1113.231 704.004 579.843 1.00 0.00 ? 730  GLY B N  1 
ATOM 5953   C CA . GLY B 1 730  ? 1112.835 705.101 579.014 1.00 0.00 ? 730  GLY B CA 1 
ATOM 5954   C C  . GLY B 1 730  ? 1113.112 706.353 579.770 1.00 0.00 ? 730  GLY B C  1 
ATOM 5955   O O  . GLY B 1 730  ? 1113.856 707.217 579.308 1.00 0.00 ? 730  GLY B O  1 
ATOM 5956   N N  . GLU B 1 769  ? 1121.939 713.112 584.636 1.00 0.00 ? 769  GLU B N  1 
ATOM 5957   C CA . GLU B 1 769  ? 1120.569 713.486 584.799 1.00 0.00 ? 769  GLU B CA 1 
ATOM 5958   C C  . GLU B 1 769  ? 1119.987 712.461 585.718 1.00 0.00 ? 769  GLU B C  1 
ATOM 5959   O O  . GLU B 1 769  ? 1120.287 711.274 585.602 1.00 0.00 ? 769  GLU B O  1 
ATOM 5960   C CB . GLU B 1 769  ? 1119.765 713.492 583.488 1.00 0.00 ? 769  GLU B CB 1 
ATOM 5961   N N  . ALA B 1 770  ? 1119.164 712.906 586.684 1.00 0.00 ? 770  ALA B N  1 
ATOM 5962   C CA . ALA B 1 770  ? 1118.611 712.013 587.659 1.00 0.00 ? 770  ALA B CA 1 
ATOM 5963   C C  . ALA B 1 770  ? 1117.699 711.018 587.011 1.00 0.00 ? 770  ALA B C  1 
ATOM 5964   O O  . ALA B 1 770  ? 1117.761 709.827 587.309 1.00 0.00 ? 770  ALA B O  1 
ATOM 5965   C CB . ALA B 1 770  ? 1117.798 712.748 588.737 1.00 0.00 ? 770  ALA B CB 1 
ATOM 5966   N N  . GLN B 1 771  ? 1116.835 711.480 586.089 1.00 0.00 ? 771  GLN B N  1 
ATOM 5967   C CA . GLN B 1 771  ? 1115.866 710.601 585.497 1.00 0.00 ? 771  GLN B CA 1 
ATOM 5968   C C  . GLN B 1 771  ? 1116.558 709.538 584.707 1.00 0.00 ? 771  GLN B C  1 
ATOM 5969   O O  . GLN B 1 771  ? 1116.232 708.358 584.822 1.00 0.00 ? 771  GLN B O  1 
ATOM 5970   C CB . GLN B 1 771  ? 1114.926 711.335 584.526 1.00 0.00 ? 771  GLN B CB 1 
ATOM 5971   N N  . LEU B 1 772  ? 1117.549 709.935 583.890 1.00 0.00 ? 772  LEU B N  1 
ATOM 5972   C CA . LEU B 1 772  ? 1118.235 709.000 583.047 1.00 0.00 ? 772  LEU B CA 1 
ATOM 5973   C C  . LEU B 1 772  ? 1119.002 708.040 583.895 1.00 0.00 ? 772  LEU B C  1 
ATOM 5974   O O  . LEU B 1 772  ? 1119.063 706.850 583.593 1.00 0.00 ? 772  LEU B O  1 
ATOM 5975   C CB . LEU B 1 772  ? 1119.211 709.682 582.074 1.00 0.00 ? 772  LEU B CB 1 
ATOM 5976   N N  . SER B 1 773  ? 1119.611 708.537 584.987 1.00 0.00 ? 773  SER B N  1 
ATOM 5977   C CA . SER B 1 773  ? 1120.405 707.691 585.827 1.00 0.00 ? 773  SER B CA 1 
ATOM 5978   C C  . SER B 1 773  ? 1119.518 706.627 586.389 1.00 0.00 ? 773  SER B C  1 
ATOM 5979   O O  . SER B 1 773  ? 1119.911 705.466 586.486 1.00 0.00 ? 773  SER B O  1 
ATOM 5980   C CB . SER B 1 773  ? 1121.044 708.446 587.005 1.00 0.00 ? 773  SER B CB 1 
ATOM 5981   N N  . GLU B 1 774  ? 1118.279 706.999 586.760 1.00 0.00 ? 774  GLU B N  1 
ATOM 5982   C CA . GLU B 1 774  ? 1117.352 706.051 587.302 1.00 0.00 ? 774  GLU B CA 1 
ATOM 5983   C C  . GLU B 1 774  ? 1117.089 705.023 586.251 1.00 0.00 ? 774  GLU B C  1 
ATOM 5984   O O  . GLU B 1 774  ? 1117.009 703.830 586.538 1.00 0.00 ? 774  GLU B O  1 
ATOM 5985   C CB . GLU B 1 774  ? 1116.001 706.685 587.671 1.00 0.00 ? 774  GLU B CB 1 
ATOM 5986   N N  . LYS B 1 775  ? 1116.964 705.476 584.989 1.00 0.00 ? 775  LYS B N  1 
ATOM 5987   C CA . LYS B 1 775  ? 1116.667 704.606 583.889 1.00 0.00 ? 775  LYS B CA 1 
ATOM 5988   C C  . LYS B 1 775  ? 1117.761 703.598 583.740 1.00 0.00 ? 775  LYS B C  1 
ATOM 5989   O O  . LYS B 1 775  ? 1117.497 702.409 583.573 1.00 0.00 ? 775  LYS B O  1 
ATOM 5990   C CB . LYS B 1 775  ? 1116.603 705.372 582.557 1.00 0.00 ? 775  LYS B CB 1 
ATOM 5991   N N  . ILE B 1 776  ? 1119.026 704.051 583.803 1.00 0.00 ? 776  ILE B N  1 
ATOM 5992   C CA . ILE B 1 776  ? 1120.133 703.165 583.594 1.00 0.00 ? 776  ILE B CA 1 
ATOM 5993   C C  . ILE B 1 776  ? 1120.178 702.147 584.687 1.00 0.00 ? 776  ILE B C  1 
ATOM 5994   O O  . ILE B 1 776  ? 1120.341 700.955 584.432 1.00 0.00 ? 776  ILE B O  1 
ATOM 5995   C CB . ILE B 1 776  ? 1121.457 703.873 583.604 1.00 0.00 ? 776  ILE B CB 1 
ATOM 5996   N N  . SER B 1 777  ? 1120.016 702.596 585.944 1.00 0.00 ? 777  SER B N  1 
ATOM 5997   C CA . SER B 1 777  ? 1120.140 701.718 587.067 1.00 0.00 ? 777  SER B CA 1 
ATOM 5998   C C  . SER B 1 777  ? 1119.089 700.653 586.987 1.00 0.00 ? 777  SER B C  1 
ATOM 5999   O O  . SER B 1 777  ? 1119.382 699.473 587.175 1.00 0.00 ? 777  SER B O  1 
ATOM 6000   C CB . SER B 1 777  ? 1119.974 702.462 588.401 1.00 0.00 ? 777  SER B CB 1 
ATOM 6001   N N  . LEU B 1 778  ? 1117.833 701.039 586.692 1.00 0.00 ? 778  LEU B N  1 
ATOM 6002   C CA . LEU B 1 778  ? 1116.779 700.067 586.627 1.00 0.00 ? 778  LEU B CA 1 
ATOM 6003   C C  . LEU B 1 778  ? 1117.032 699.123 585.497 1.00 0.00 ? 778  LEU B C  1 
ATOM 6004   O O  . LEU B 1 778  ? 1116.769 697.928 585.606 1.00 0.00 ? 778  LEU B O  1 
ATOM 6005   C CB . LEU B 1 778  ? 1115.378 700.674 586.434 1.00 0.00 ? 778  LEU B CB 1 
ATOM 6006   N N  . GLN B 1 779  ? 1117.552 699.627 584.365 1.00 0.00 ? 779  GLN B N  1 
ATOM 6007   C CA . GLN B 1 779  ? 1117.779 698.747 583.256 1.00 0.00 ? 779  GLN B CA 1 
ATOM 6008   C C  . GLN B 1 779  ? 1118.768 697.710 583.683 1.00 0.00 ? 779  GLN B C  1 
ATOM 6009   O O  . GLN B 1 779  ? 1118.604 696.524 583.397 1.00 0.00 ? 779  GLN B O  1 
ATOM 6010   C CB . GLN B 1 779  ? 1118.380 699.470 582.036 1.00 0.00 ? 779  GLN B CB 1 
ATOM 6011   N N  . ALA B 1 780  ? 1119.819 698.132 584.409 1.00 0.00 ? 780  ALA B N  1 
ATOM 6012   C CA . ALA B 1 780  ? 1120.857 697.231 584.815 1.00 0.00 ? 780  ALA B CA 1 
ATOM 6013   C C  . ALA B 1 780  ? 1120.297 696.175 585.714 1.00 0.00 ? 780  ALA B C  1 
ATOM 6014   O O  . ALA B 1 780  ? 1120.636 695.001 585.577 1.00 0.00 ? 780  ALA B O  1 
ATOM 6015   C CB . ALA B 1 780  ? 1121.984 697.939 585.586 1.00 0.00 ? 780  ALA B CB 1 
ATOM 6016   N N  . ILE B 1 781  ? 1119.420 696.558 586.661 1.00 0.00 ? 781  ILE B N  1 
ATOM 6017   C CA . ILE B 1 781  ? 1118.905 695.595 587.594 1.00 0.00 ? 781  ILE B CA 1 
ATOM 6018   C C  . ILE B 1 781  ? 1118.074 694.575 586.887 1.00 0.00 ? 781  ILE B C  1 
ATOM 6019   O O  . ILE B 1 781  ? 1118.172 693.384 587.172 1.00 0.00 ? 781  ILE B O  1 
ATOM 6020   C CB . ILE B 1 781  ? 1118.075 696.183 588.703 1.00 0.00 ? 781  ILE B CB 1 
ATOM 6021   N N  . GLN B 1 782  ? 1117.229 695.017 585.937 1.00 0.00 ? 782  GLN B N  1 
ATOM 6022   C CA . GLN B 1 782  ? 1116.353 694.109 585.254 1.00 0.00 ? 782  GLN B CA 1 
ATOM 6023   C C  . GLN B 1 782  ? 1117.173 693.134 584.469 1.00 0.00 ? 782  GLN B C  1 
ATOM 6024   O O  . GLN B 1 782  ? 1116.851 691.951 584.396 1.00 0.00 ? 782  GLN B O  1 
ATOM 6025   C CB . GLN B 1 782  ? 1115.393 694.824 584.289 1.00 0.00 ? 782  GLN B CB 1 
ATOM 6026   N N  . GLN B 1 783  ? 1118.271 693.602 583.854 1.00 0.00 ? 783  GLN B N  1 
ATOM 6027   C CA . GLN B 1 783  ? 1119.076 692.694 583.092 1.00 0.00 ? 783  GLN B CA 1 
ATOM 6028   C C  . GLN B 1 783  ? 1119.630 691.677 584.037 1.00 0.00 ? 783  GLN B C  1 
ATOM 6029   O O  . GLN B 1 783  ? 1119.713 690.494 583.712 1.00 0.00 ? 783  GLN B O  1 
ATOM 6030   C CB . GLN B 1 783  ? 1120.239 693.396 582.371 1.00 0.00 ? 783  GLN B CB 1 
ATOM 6031   N N  . LEU B 1 784  ? 1120.008 692.120 585.248 1.00 0.00 ? 784  LEU B N  1 
ATOM 6032   C CA . LEU B 1 784  ? 1120.595 691.253 586.228 1.00 0.00 ? 784  LEU B CA 1 
ATOM 6033   C C  . LEU B 1 784  ? 1119.614 690.184 586.609 1.00 0.00 ? 784  LEU B C  1 
ATOM 6034   O O  . LEU B 1 784  ? 1119.979 689.014 586.713 1.00 0.00 ? 784  LEU B O  1 
ATOM 6035   C CB . LEU B 1 784  ? 1120.980 692.000 587.516 1.00 0.00 ? 784  LEU B CB 1 
ATOM 6036   N N  . VAL B 1 785  ? 1118.332 690.545 586.817 1.00 0.00 ? 785  VAL B N  1 
ATOM 6037   C CA . VAL B 1 785  ? 1117.384 689.558 587.258 1.00 0.00 ? 785  VAL B CA 1 
ATOM 6038   C C  . VAL B 1 785  ? 1117.248 688.505 586.204 1.00 0.00 ? 785  VAL B C  1 
ATOM 6039   O O  . VAL B 1 785  ? 1117.183 687.316 586.515 1.00 0.00 ? 785  VAL B O  1 
ATOM 6040   C CB . VAL B 1 785  ? 1116.018 690.110 587.573 1.00 0.00 ? 785  VAL B CB 1 
ATOM 6041   N N  . ARG B 1 786  ? 1117.206 688.912 584.922 1.00 0.00 ? 786  ARG B N  1 
ATOM 6042   C CA . ARG B 1 786  ? 1117.058 687.958 583.862 1.00 0.00 ? 786  ARG B CA 1 
ATOM 6043   C C  . ARG B 1 786  ? 1118.256 687.057 583.822 1.00 0.00 ? 786  ARG B C  1 
ATOM 6044   O O  . ARG B 1 786  ? 1118.118 685.850 583.625 1.00 0.00 ? 786  ARG B O  1 
ATOM 6045   C CB . ARG B 1 786  ? 1116.906 688.612 582.475 1.00 0.00 ? 786  ARG B CB 1 
ATOM 6046   N N  . LYS B 1 787  ? 1119.464 687.619 584.019 1.00 0.00 ? 787  LYS B N  1 
ATOM 6047   C CA . LYS B 1 787  ? 1120.677 686.857 583.925 1.00 0.00 ? 787  LYS B CA 1 
ATOM 6048   C C  . LYS B 1 787  ? 1120.680 685.794 584.979 1.00 0.00 ? 787  LYS B C  1 
ATOM 6049   O O  . LYS B 1 787  ? 1121.084 684.660 584.723 1.00 0.00 ? 787  LYS B O  1 
ATOM 6050   C CB . LYS B 1 787  ? 1121.936 687.732 584.091 1.00 0.00 ? 787  LYS B CB 1 
ATOM 6051   N N  . SER B 1 788  ? 1120.222 686.128 586.199 1.00 0.00 ? 788  SER B N  1 
ATOM 6052   C CA . SER B 1 788  ? 1120.209 685.148 587.244 1.00 0.00 ? 788  SER B CA 1 
ATOM 6053   C C  . SER B 1 788  ? 1119.253 684.066 586.861 1.00 0.00 ? 788  SER B C  1 
ATOM 6054   O O  . SER B 1 788  ? 1119.458 682.897 587.178 1.00 0.00 ? 788  SER B O  1 
ATOM 6055   C CB . SER B 1 788  ? 1119.746 685.695 588.603 1.00 0.00 ? 788  SER B CB 1 
ATOM 6056   N N  . TYR B 1 789  ? 1118.179 684.438 586.142 1.00 0.00 ? 789  TYR B N  1 
ATOM 6057   C CA . TYR B 1 789  ? 1117.162 683.498 585.775 1.00 0.00 ? 789  TYR B CA 1 
ATOM 6058   C C  . TYR B 1 789  ? 1117.801 682.486 584.881 1.00 0.00 ? 789  TYR B C  1 
ATOM 6059   O O  . TYR B 1 789  ? 1117.559 681.286 585.004 1.00 0.00 ? 789  TYR B O  1 
ATOM 6060   C CB . TYR B 1 789  ? 1116.017 684.160 584.987 1.00 0.00 ? 789  TYR B CB 1 
ATOM 6061   N N  . GLN B 1 790  ? 1118.651 682.962 583.953 1.00 0.00 ? 790  GLN B N  1 
ATOM 6062   C CA . GLN B 1 790  ? 1119.279 682.105 582.992 1.00 0.00 ? 790  GLN B CA 1 
ATOM 6063   C C  . GLN B 1 790  ? 1120.198 681.133 583.673 1.00 0.00 ? 790  GLN B C  1 
ATOM 6064   O O  . GLN B 1 790  ? 1120.185 679.944 583.357 1.00 0.00 ? 790  GLN B O  1 
ATOM 6065   C CB . GLN B 1 790  ? 1120.097 682.897 581.960 1.00 0.00 ? 790  GLN B CB 1 
ATOM 6066   N N  . ALA B 1 791  ? 1121.013 681.604 584.635 1.00 0.00 ? 791  ALA B N  1 
ATOM 6067   C CA . ALA B 1 791  ? 1121.953 680.723 585.271 1.00 0.00 ? 791  ALA B CA 1 
ATOM 6068   C C  . ALA B 1 791  ? 1121.207 679.655 586.006 1.00 0.00 ? 791  ALA B C  1 
ATOM 6069   O O  . ALA B 1 791  ? 1121.535 678.471 585.913 1.00 0.00 ? 791  ALA B O  1 
ATOM 6070   C CB . ALA B 1 791  ? 1122.847 681.445 586.294 1.00 0.00 ? 791  ALA B CB 1 
ATOM 6071   N N  . LEU B 1 792  ? 1120.153 680.052 586.735 1.00 0.00 ? 792  LEU B N  1 
ATOM 6072   C CA . LEU B 1 792  ? 1119.397 679.127 587.528 1.00 0.00 ? 792  LEU B CA 1 
ATOM 6073   C C  . LEU B 1 792  ? 1118.751 678.139 586.615 1.00 0.00 ? 792  LEU B C  1 
ATOM 6074   O O  . LEU B 1 792  ? 1118.601 676.970 586.963 1.00 0.00 ? 792  LEU B O  1 
ATOM 6075   C CB . LEU B 1 792  ? 1118.294 679.809 588.351 1.00 0.00 ? 792  LEU B CB 1 
ATOM 6076   N N  . ALA B 1 793  ? 1118.322 678.596 585.423 1.00 0.00 ? 793  ALA B N  1 
ATOM 6077   C CA . ALA B 1 793  ? 1117.664 677.732 584.487 1.00 0.00 ? 793  ALA B CA 1 
ATOM 6078   C C  . ALA B 1 793  ? 1118.610 676.653 584.070 1.00 0.00 ? 793  ALA B C  1 
ATOM 6079   O O  . ALA B 1 793  ? 1118.227 675.487 583.979 1.00 0.00 ? 793  ALA B O  1 
ATOM 6080   C CB . ALA B 1 793  ? 1117.209 678.471 583.215 1.00 0.00 ? 793  ALA B CB 1 
ATOM 6081   N N  . LEU B 1 794  ? 1119.884 677.008 583.815 1.00 0.00 ? 794  LEU B N  1 
ATOM 6082   C CA . LEU B 1 794  ? 1120.820 676.010 583.386 1.00 0.00 ? 794  LEU B CA 1 
ATOM 6083   C C  . LEU B 1 794  ? 1120.957 675.010 584.487 1.00 0.00 ? 794  LEU B C  1 
ATOM 6084   O O  . LEU B 1 794  ? 1120.931 673.807 584.247 1.00 0.00 ? 794  LEU B O  1 
ATOM 6085   C CB . LEU B 1 794  ? 1122.225 676.572 583.107 1.00 0.00 ? 794  LEU B CB 1 
ATOM 6086   N N  . TRP B 1 795  ? 1121.072 675.474 585.741 1.00 0.00 ? 795  TRP B N  1 
ATOM 6087   C CA . TRP B 1 795  ? 1121.232 674.555 586.830 1.00 0.00 ? 795  TRP B CA 1 
ATOM 6088   C C  . TRP B 1 795  ? 1120.040 673.671 586.965 1.00 0.00 ? 795  TRP B C  1 
ATOM 6089   O O  . TRP B 1 795  ? 1120.175 672.504 587.331 1.00 0.00 ? 795  TRP B O  1 
ATOM 6090   C CB . TRP B 1 795  ? 1121.552 675.217 588.175 1.00 0.00 ? 795  TRP B CB 1 
ATOM 6091   N N  . LYS B 1 796  ? 1118.836 674.192 586.679 1.00 0.00 ? 796  LYS B N  1 
ATOM 6092   C CA . LYS B 1 796  ? 1117.669 673.369 586.806 1.00 0.00 ? 796  LYS B CA 1 
ATOM 6093   C C  . LYS B 1 796  ? 1117.860 672.195 585.898 1.00 0.00 ? 796  LYS B C  1 
ATOM 6094   O O  . LYS B 1 796  ? 1117.529 671.062 586.239 1.00 0.00 ? 796  LYS B O  1 
ATOM 6095   C CB . LYS B 1 796  ? 1116.388 674.111 586.381 1.00 0.00 ? 796  LYS B CB 1 
ATOM 6096   N N  . LEU B 1 797  ? 1118.432 672.462 584.715 1.00 0.00 ? 797  LEU B N  1 
ATOM 6097   C CA . LEU B 1 797  ? 1118.710 671.501 583.686 1.00 0.00 ? 797  LEU B CA 1 
ATOM 6098   C C  . LEU B 1 797  ? 1119.657 670.476 584.232 1.00 0.00 ? 797  LEU B C  1 
ATOM 6099   O O  . LEU B 1 797  ? 1119.399 669.275 584.159 1.00 0.00 ? 797  LEU B O  1 
ATOM 6100   C CB . LEU B 1 797  ? 1119.466 672.229 582.569 1.00 0.00 ? 797  LEU B CB 1 
ATOM 6101   N N  . LEU B 1 798  ? 1120.775 670.935 584.823 1.00 0.00 ? 798  LEU B N  1 
ATOM 6102   C CA . LEU B 1 798  ? 1121.835 670.054 585.225 1.00 0.00 ? 798  LEU B CA 1 
ATOM 6103   C C  . LEU B 1 798  ? 1121.350 669.092 586.251 1.00 0.00 ? 798  LEU B C  1 
ATOM 6104   O O  . LEU B 1 798  ? 1121.789 667.944 586.289 1.00 0.00 ? 798  LEU B O  1 
ATOM 6105   C CB . LEU B 1 798  ? 1123.063 670.789 585.796 1.00 0.00 ? 798  LEU B CB 1 
ATOM 6106   N N  . CYS B 1 799  ? 1120.413 669.525 587.103 1.00 0.00 ? 799  CYS B N  1 
ATOM 6107   C CA . CYS B 1 799  ? 1119.963 668.689 588.170 1.00 0.00 ? 799  CYS B CA 1 
ATOM 6108   C C  . CYS B 1 799  ? 1119.362 667.432 587.634 1.00 0.00 ? 799  CYS B C  1 
ATOM 6109   O O  . CYS B 1 799  ? 1119.438 666.394 588.289 1.00 0.00 ? 799  CYS B O  1 
ATOM 6110   C CB . CYS B 1 799  ? 1118.889 669.334 589.053 1.00 0.00 ? 799  CYS B CB 1 
ATOM 6111   N N  . GLU B 1 800  ? 1118.766 667.488 586.430 1.00 0.00 ? 800  GLU B N  1 
ATOM 6112   C CA . GLU B 1 800  ? 1118.036 666.358 585.936 1.00 0.00 ? 800  GLU B CA 1 
ATOM 6113   C C  . GLU B 1 800  ? 1118.896 665.134 585.922 1.00 0.00 ? 800  GLU B C  1 
ATOM 6114   O O  . GLU B 1 800  ? 1118.457 664.085 586.392 1.00 0.00 ? 800  GLU B O  1 
ATOM 6115   C CB . GLU B 1 800  ? 1117.498 666.552 584.511 1.00 0.00 ? 800  GLU B CB 1 
ATOM 6116   N N  . HIS B 1 801  ? 1120.145 665.194 585.422 1.00 0.00 ? 801  HIS B N  1 
ATOM 6117   C CA . HIS B 1 801  ? 1120.803 663.922 585.452 1.00 0.00 ? 801  HIS B CA 1 
ATOM 6118   C C  . HIS B 1 801  ? 1122.262 664.072 585.128 1.00 0.00 ? 801  HIS B C  1 
ATOM 6119   O O  . HIS B 1 801  ? 1122.738 665.162 584.811 1.00 0.00 ? 801  HIS B O  1 
ATOM 6120   C CB . HIS B 1 801  ? 1120.194 662.946 584.427 1.00 0.00 ? 801  HIS B CB 1 
ATOM 6121   N N  . GLN B 1 802  ? 1122.959 662.915 585.196 1.00 0.00 ? 802  GLN B N  1 
ATOM 6122   C CA . GLN B 1 802  ? 1124.334 662.569 584.923 1.00 0.00 ? 802  GLN B CA 1 
ATOM 6123   C C  . GLN B 1 802  ? 1125.236 663.768 584.812 1.00 0.00 ? 802  GLN B C  1 
ATOM 6124   O O  . GLN B 1 802  ? 1126.051 663.858 583.894 1.00 0.00 ? 802  GLN B O  1 
ATOM 6125   C CB . GLN B 1 802  ? 1124.339 661.809 583.583 1.00 0.00 ? 802  GLN B CB 1 
ATOM 6126   N N  . PHE B 1 803  ? 1125.128 664.726 585.747 1.00 0.00 ? 803  PHE B N  1 
ATOM 6127   C CA . PHE B 1 803  ? 1125.999 665.866 585.726 1.00 0.00 ? 803  PHE B CA 1 
ATOM 6128   C C  . PHE B 1 803  ? 1127.338 665.528 586.318 1.00 0.00 ? 803  PHE B C  1 
ATOM 6129   O O  . PHE B 1 803  ? 1128.381 665.932 585.809 1.00 0.00 ? 803  PHE B O  1 
ATOM 6130   C CB . PHE B 1 803  ? 1125.421 667.061 586.503 1.00 0.00 ? 803  PHE B CB 1 
ATOM 6131   N N  . THR B 1 804  ? 1127.329 664.747 587.418 1.00 0.00 ? 804  THR B N  1 
ATOM 6132   C CA . THR B 1 804  ? 1128.508 664.501 588.205 1.00 0.00 ? 804  THR B CA 1 
ATOM 6133   C C  . THR B 1 804  ? 1129.568 663.794 587.420 1.00 0.00 ? 804  THR B C  1 
ATOM 6134   O O  . THR B 1 804  ? 1130.742 664.148 587.509 1.00 0.00 ? 804  THR B O  1 
ATOM 6135   C CB . THR B 1 804  ? 1128.223 663.682 589.436 1.00 0.00 ? 804  THR B CB 1 
ATOM 6136   N N  . ILE B 1 805  ? 1129.190 662.785 586.620 1.00 0.00 ? 805  ILE B N  1 
ATOM 6137   C CA . ILE B 1 805  ? 1130.191 662.019 585.939 1.00 0.00 ? 805  ILE B CA 1 
ATOM 6138   C C  . ILE B 1 805  ? 1130.953 662.890 584.989 1.00 0.00 ? 805  ILE B C  1 
ATOM 6139   O O  . ILE B 1 805  ? 1132.181 662.836 584.943 1.00 0.00 ? 805  ILE B O  1 
ATOM 6140   C CB . ILE B 1 805  ? 1129.616 660.860 585.171 1.00 0.00 ? 805  ILE B CB 1 
ATOM 6141   N N  . ILE B 1 806  ? 1130.249 663.737 584.219 1.00 0.00 ? 806  ILE B N  1 
ATOM 6142   C CA . ILE B 1 806  ? 1130.925 664.541 583.245 1.00 0.00 ? 806  ILE B CA 1 
ATOM 6143   C C  . ILE B 1 806  ? 1131.864 665.474 583.934 1.00 0.00 ? 806  ILE B C  1 
ATOM 6144   O O  . ILE B 1 806  ? 1132.984 665.692 583.473 1.00 0.00 ? 806  ILE B O  1 
ATOM 6145   C CB . ILE B 1 806  ? 1130.004 665.355 582.381 1.00 0.00 ? 806  ILE B CB 1 
ATOM 6146   N N  . VAL B 1 807  ? 1131.437 666.040 585.075 1.00 0.00 ? 807  VAL B N  1 
ATOM 6147   C CA . VAL B 1 807  ? 1132.232 667.018 585.758 1.00 0.00 ? 807  VAL B CA 1 
ATOM 6148   C C  . VAL B 1 807  ? 1133.566 666.439 586.106 1.00 0.00 ? 807  VAL B C  1 
ATOM 6149   O O  . VAL B 1 807  ? 1134.599 667.068 585.872 1.00 0.00 ? 807  VAL B O  1 
ATOM 6150   C CB . VAL B 1 807  ? 1131.596 667.454 587.043 1.00 0.00 ? 807  VAL B CB 1 
ATOM 6151   N N  . ALA B 1 808  ? 1133.586 665.215 586.657 1.00 0.00 ? 808  ALA B N  1 
ATOM 6152   C CA . ALA B 1 808  ? 1134.829 664.657 587.100 1.00 0.00 ? 808  ALA B CA 1 
ATOM 6153   C C  . ALA B 1 808  ? 1135.763 664.485 585.943 1.00 0.00 ? 808  ALA B C  1 
ATOM 6154   O O  . ALA B 1 808  ? 1136.933 664.860 586.023 1.00 0.00 ? 808  ALA B O  1 
ATOM 6155   C CB . ALA B 1 808  ? 1134.655 663.275 587.753 1.00 0.00 ? 808  ALA B CB 1 
ATOM 6156   N N  . GLU B 1 809  ? 1135.263 663.928 584.828 1.00 0.00 ? 809  GLU B N  1 
ATOM 6157   C CA . GLU B 1 809  ? 1136.109 663.640 583.705 1.00 0.00 ? 809  GLU B CA 1 
ATOM 6158   C C  . GLU B 1 809  ? 1136.607 664.896 583.062 1.00 0.00 ? 809  GLU B C  1 
ATOM 6159   O O  . GLU B 1 809  ? 1137.767 664.972 582.669 1.00 0.00 ? 809  GLU B O  1 
ATOM 6160   C CB . GLU B 1 809  ? 1135.402 662.822 582.610 1.00 0.00 ? 809  GLU B CB 1 
ATOM 6161   N N  . LEU B 1 810  ? 1135.736 665.910 582.932 1.00 0.00 ? 810  LEU B N  1 
ATOM 6162   C CA . LEU B 1 810  ? 1136.049 667.112 582.206 1.00 0.00 ? 810  LEU B CA 1 
ATOM 6163   C C  . LEU B 1 810  ? 1137.129 667.938 582.834 1.00 0.00 ? 810  LEU B C  1 
ATOM 6164   O O  . LEU B 1 810  ? 1138.015 668.426 582.135 1.00 0.00 ? 810  LEU B O  1 
ATOM 6165   C CB . LEU B 1 810  ? 1134.847 668.062 582.073 1.00 0.00 ? 810  LEU B CB 1 
ATOM 6166   N N  . GLN B 1 811  ? 1137.109 668.104 584.168 1.00 0.00 ? 811  GLN B N  1 
ATOM 6167   C CA . GLN B 1 811  ? 1137.940 669.120 584.754 1.00 0.00 ? 811  GLN B CA 1 
ATOM 6168   C C  . GLN B 1 811  ? 1139.416 668.865 584.601 1.00 0.00 ? 811  GLN B C  1 
ATOM 6169   O O  . GLN B 1 811  ? 1139.923 667.802 584.948 1.00 0.00 ? 811  GLN B O  1 
ATOM 6170   C CB . GLN B 1 811  ? 1137.564 669.406 586.215 1.00 0.00 ? 811  GLN B CB 1 
ATOM 6171   N N  . LYS B 1 812  ? 1140.116 669.907 584.068 1.00 0.00 ? 812  LYS B N  1 
ATOM 6172   C CA . LYS B 1 812  ? 1141.523 669.985 583.733 1.00 0.00 ? 812  LYS B CA 1 
ATOM 6173   C C  . LYS B 1 812  ? 1142.181 671.062 584.540 1.00 0.00 ? 812  LYS B C  1 
ATOM 6174   O O  . LYS B 1 812  ? 1141.822 671.306 585.687 1.00 0.00 ? 812  LYS B O  1 
ATOM 6175   C CB . LYS B 1 812  ? 1141.787 670.353 582.259 1.00 0.00 ? 812  LYS B CB 1 
ATOM 6176   N N  . GLU B 1 813  ? 1143.188 671.728 583.944 1.00 0.00 ? 813  GLU B N  1 
ATOM 6177   C CA . GLU B 1 813  ? 1143.973 672.743 584.597 1.00 0.00 ? 813  GLU B CA 1 
ATOM 6178   C C  . GLU B 1 813  ? 1143.087 673.874 585.017 1.00 0.00 ? 813  GLU B C  1 
ATOM 6179   O O  . GLU B 1 813  ? 1143.281 674.471 586.075 1.00 0.00 ? 813  GLU B O  1 
ATOM 6180   C CB . GLU B 1 813  ? 1145.045 673.360 583.680 1.00 0.00 ? 813  GLU B CB 1 
ATOM 6181   N N  . LEU B 1 814  ? 1142.075 674.188 584.194 1.00 0.00 ? 814  LEU B N  1 
ATOM 6182   C CA . LEU B 1 814  ? 1141.187 675.293 584.410 1.00 0.00 ? 814  LEU B CA 1 
ATOM 6183   C C  . LEU B 1 814  ? 1140.439 675.001 585.682 1.00 0.00 ? 814  LEU B C  1 
ATOM 6184   O O  . LEU B 1 814  ? 1140.000 675.908 586.386 1.00 0.00 ? 814  LEU B O  1 
ATOM 6185   C CB . LEU B 1 814  ? 1140.190 675.455 583.237 1.00 0.00 ? 814  LEU B CB 1 
ATOM 6186   N N  . GLN B 1 815  ? 1140.370 673.711 586.060 1.00 0.00 ? 815  GLN B N  1 
ATOM 6187   C CA . GLN B 1 815  ? 1139.516 673.209 587.107 1.00 0.00 ? 815  GLN B CA 1 
ATOM 6188   C C  . GLN B 1 815  ? 1139.615 674.036 588.349 1.00 0.00 ? 815  GLN B C  1 
ATOM 6189   O O  . GLN B 1 815  ? 1138.590 674.272 588.989 1.00 0.00 ? 815  GLN B O  1 
ATOM 6190   C CB . GLN B 1 815  ? 1139.897 671.788 587.566 1.00 0.00 ? 815  GLN B CB 1 
ATOM 6191   N N  . GLU B 1 816  ? 1140.814 674.500 588.742 1.00 0.00 ? 816  GLU B N  1 
ATOM 6192   C CA . GLU B 1 816  ? 1140.885 675.200 589.993 1.00 0.00 ? 816  GLU B CA 1 
ATOM 6193   C C  . GLU B 1 816  ? 1140.020 676.414 589.913 1.00 0.00 ? 816  GLU B C  1 
ATOM 6194   O O  . GLU B 1 816  ? 1139.320 676.749 590.866 1.00 0.00 ? 816  GLU B O  1 
ATOM 6195   C CB . GLU B 1 816  ? 1142.307 675.638 590.388 1.00 0.00 ? 816  GLU B CB 1 
ATOM 6196   N N  . GLN B 1 817  ? 1140.027 677.095 588.756 1.00 0.00 ? 817  GLN B N  1 
ATOM 6197   C CA . GLN B 1 817  ? 1139.237 678.278 588.607 1.00 0.00 ? 817  GLN B CA 1 
ATOM 6198   C C  . GLN B 1 817  ? 1137.787 677.922 588.711 1.00 0.00 ? 817  GLN B C  1 
ATOM 6199   O O  . GLN B 1 817  ? 1137.007 678.647 589.328 1.00 0.00 ? 817  GLN B O  1 
ATOM 6200   C CB . GLN B 1 817  ? 1139.454 678.963 587.247 1.00 0.00 ? 817  GLN B CB 1 
ATOM 6201   N N  . LEU B 1 818  ? 1137.387 676.781 588.119 1.00 0.00 ? 818  LEU B N  1 
ATOM 6202   C CA . LEU B 1 818  ? 1135.999 676.399 588.092 1.00 0.00 ? 818  LEU B CA 1 
ATOM 6203   C C  . LEU B 1 818  ? 1135.473 676.183 589.472 1.00 0.00 ? 818  LEU B C  1 
ATOM 6204   O O  . LEU B 1 818  ? 1134.406 676.684 589.822 1.00 0.00 ? 818  LEU B O  1 
ATOM 6205   C CB . LEU B 1 818  ? 1135.753 675.056 587.393 1.00 0.00 ? 818  LEU B CB 1 
ATOM 6206   N N  . LYS B 1 819  ? 1136.218 675.433 590.300 1.00 0.00 ? 819  LYS B N  1 
ATOM 6207   C CA . LYS B 1 819  ? 1135.712 675.073 591.589 1.00 0.00 ? 819  LYS B CA 1 
ATOM 6208   C C  . LYS B 1 819  ? 1135.524 676.275 592.448 1.00 0.00 ? 819  LYS B C  1 
ATOM 6209   O O  . LYS B 1 819  ? 1134.608 676.301 593.264 1.00 0.00 ? 819  LYS B O  1 
ATOM 6210   C CB . LYS B 1 819  ? 1136.551 674.016 592.321 1.00 0.00 ? 819  LYS B CB 1 
ATOM 6211   N N  . ILE B 1 820  ? 1136.383 677.303 592.326 1.00 0.00 ? 820  ILE B N  1 
ATOM 6212   C CA . ILE B 1 820  ? 1136.112 678.429 593.164 1.00 0.00 ? 820  ILE B CA 1 
ATOM 6213   C C  . ILE B 1 820  ? 1135.314 679.417 592.371 1.00 0.00 ? 820  ILE B C  1 
ATOM 6214   O O  . ILE B 1 820  ? 1135.694 680.572 592.200 1.00 0.00 ? 820  ILE B O  1 
ATOM 6215   C CB . ILE B 1 820  ? 1137.368 679.095 593.659 1.00 0.00 ? 820  ILE B CB 1 
ATOM 6216   N N  . THR B 1 821  ? 1134.126 678.990 591.911 1.00 0.00 ? 821  THR B N  1 
ATOM 6217   C CA . THR B 1 821  ? 1133.274 679.878 591.188 1.00 0.00 ? 821  THR B CA 1 
ATOM 6218   C C  . THR B 1 821  ? 1132.082 680.065 592.056 1.00 0.00 ? 821  THR B C  1 
ATOM 6219   O O  . THR B 1 821  ? 1131.507 679.108 592.573 1.00 0.00 ? 821  THR B O  1 
ATOM 6220   C CB . THR B 1 821  ? 1132.822 679.339 589.856 1.00 0.00 ? 821  THR B CB 1 
ATOM 6221   N N  . THR B 1 822  ? 1131.702 681.330 592.278 1.00 0.00 ? 822  THR B N  1 
ATOM 6222   C CA . THR B 1 822  ? 1130.589 681.587 593.137 1.00 0.00 ? 822  THR B CA 1 
ATOM 6223   C C  . THR B 1 822  ? 1129.365 681.729 592.287 1.00 0.00 ? 822  THR B C  1 
ATOM 6224   O O  . THR B 1 822  ? 1129.449 681.810 591.062 1.00 0.00 ? 822  THR B O  1 
ATOM 6225   C CB . THR B 1 822  ? 1130.769 682.844 593.918 1.00 0.00 ? 822  THR B CB 1 
ATOM 6226   N N  . PHE B 1 823  ? 1128.183 681.759 592.933 1.00 0.00 ? 823  PHE B N  1 
ATOM 6227   C CA . PHE B 1 823  ? 1126.947 681.919 592.225 1.00 0.00 ? 823  PHE B CA 1 
ATOM 6228   C C  . PHE B 1 823  ? 1126.954 683.252 591.557 1.00 0.00 ? 823  PHE B C  1 
ATOM 6229   O O  . PHE B 1 823  ? 1126.484 683.383 590.430 1.00 0.00 ? 823  PHE B O  1 
ATOM 6230   C CB . PHE B 1 823  ? 1125.691 681.835 593.111 1.00 0.00 ? 823  PHE B CB 1 
ATOM 6231   N N  . LYS B 1 824  ? 1127.486 684.285 592.237 1.00 0.00 ? 824  LYS B N  1 
ATOM 6232   C CA . LYS B 1 824  ? 1127.502 685.588 591.642 1.00 0.00 ? 824  LYS B CA 1 
ATOM 6233   C C  . LYS B 1 824  ? 1128.349 685.533 590.415 1.00 0.00 ? 824  LYS B C  1 
ATOM 6234   O O  . LYS B 1 824  ? 1128.100 686.251 589.450 1.00 0.00 ? 824  LYS B O  1 
ATOM 6235   C CB . LYS B 1 824  ? 1127.992 686.715 592.580 1.00 0.00 ? 824  LYS B CB 1 
ATOM 6236   N N  . ASP B 1 825  ? 1129.382 684.670 590.411 1.00 0.00 ? 825  ASP B N  1 
ATOM 6237   C CA . ASP B 1 825  ? 1130.202 684.573 589.242 1.00 0.00 ? 825  ASP B CA 1 
ATOM 6238   C C  . ASP B 1 825  ? 1129.316 684.158 588.108 1.00 0.00 ? 825  ASP B C  1 
ATOM 6239   O O  . ASP B 1 825  ? 1129.457 684.650 586.992 1.00 0.00 ? 825  ASP B O  1 
ATOM 6240   C CB . ASP B 1 825  ? 1131.329 683.531 589.383 1.00 0.00 ? 825  ASP B CB 1 
ATOM 6241   N N  . LEU B 1 826  ? 1128.382 683.218 588.338 1.00 0.00 ? 826  LEU B N  1 
ATOM 6242   C CA . LEU B 1 826  ? 1127.475 682.863 587.284 1.00 0.00 ? 826  LEU B CA 1 
ATOM 6243   C C  . LEU B 1 826  ? 1126.539 684.007 587.021 1.00 0.00 ? 826  LEU B C  1 
ATOM 6244   O O  . LEU B 1 826  ? 1126.188 684.270 585.871 1.00 0.00 ? 826  LEU B O  1 
ATOM 6245   C CB . LEU B 1 826  ? 1126.629 681.612 587.574 1.00 0.00 ? 826  LEU B CB 1 
ATOM 6246   N N  . VAL B 1 827  ? 1126.111 684.718 588.084 1.00 0.00 ? 827  VAL B N  1 
ATOM 6247   C CA . VAL B 1 827  ? 1125.166 685.786 587.934 1.00 0.00 ? 827  VAL B CA 1 
ATOM 6248   C C  . VAL B 1 827  ? 1125.771 686.764 586.992 1.00 0.00 ? 827  VAL B C  1 
ATOM 6249   O O  . VAL B 1 827  ? 1125.096 687.211 586.068 1.00 0.00 ? 827  VAL B O  1 
ATOM 6250   C CB . VAL B 1 827  ? 1124.927 686.517 589.219 1.00 0.00 ? 827  VAL B CB 1 
ATOM 6251   N N  . ILE B 1 828  ? 1127.045 687.141 587.225 1.00 0.00 ? 828  ILE B N  1 
ATOM 6252   C CA . ILE B 1 828  ? 1127.766 687.963 586.298 1.00 0.00 ? 828  ILE B CA 1 
ATOM 6253   C C  . ILE B 1 828  ? 1128.792 687.020 585.730 1.00 0.00 ? 828  ILE B C  1 
ATOM 6254   O O  . ILE B 1 828  ? 1129.947 686.971 586.148 1.00 0.00 ? 828  ILE B O  1 
ATOM 6255   C CB . ILE B 1 828  ? 1128.408 689.148 586.974 1.00 0.00 ? 828  ILE B CB 1 
ATOM 6256   N N  . ARG B 1 829  ? 1128.354 686.318 584.672 1.00 0.00 ? 829  ARG B N  1 
ATOM 6257   C CA . ARG B 1 829  ? 1128.885 685.151 584.015 1.00 0.00 ? 829  ARG B CA 1 
ATOM 6258   C C  . ARG B 1 829  ? 1130.327 685.140 583.636 1.00 0.00 ? 829  ARG B C  1 
ATOM 6259   O O  . ARG B 1 829  ? 1130.964 686.165 583.387 1.00 0.00 ? 829  ARG B O  1 
ATOM 6260   C CB . ARG B 1 829  ? 1128.115 684.857 582.723 1.00 0.00 ? 829  ARG B CB 1 
ATOM 6261   N N  . ASP B 1 830  ? 1130.849 683.890 583.644 1.00 0.00 ? 830  ASP B N  1 
ATOM 6262   C CA . ASP B 1 830  ? 1132.110 683.441 583.128 1.00 0.00 ? 830  ASP B CA 1 
ATOM 6263   C C  . ASP B 1 830  ? 1131.699 682.523 582.010 1.00 0.00 ? 830  ASP B C  1 
ATOM 6264   O O  . ASP B 1 830  ? 1131.519 681.317 582.170 1.00 0.00 ? 830  ASP B O  1 
ATOM 6265   C CB . ASP B 1 830  ? 1132.982 682.704 584.168 1.00 0.00 ? 830  ASP B CB 1 
ATOM 6266   N N  . LYS B 1 831  ? 1131.525 683.133 580.827 1.00 0.00 ? 831  LYS B N  1 
ATOM 6267   C CA . LYS B 1 831  ? 1130.911 682.564 579.662 1.00 0.00 ? 831  LYS B CA 1 
ATOM 6268   C C  . LYS B 1 831  ? 1131.632 681.403 579.039 1.00 0.00 ? 831  LYS B C  1 
ATOM 6269   O O  . LYS B 1 831  ? 1130.999 680.403 578.702 1.00 0.00 ? 831  LYS B O  1 
ATOM 6270   C CB . LYS B 1 831  ? 1130.727 683.648 578.592 1.00 0.00 ? 831  LYS B CB 1 
ATOM 6271   N N  . GLU B 1 832  ? 1132.963 681.468 578.863 1.00 0.00 ? 832  GLU B N  1 
ATOM 6272   C CA . GLU B 1 832  ? 1133.563 680.428 578.069 1.00 0.00 ? 832  GLU B CA 1 
ATOM 6273   C C  . GLU B 1 832  ? 1133.487 679.070 578.701 1.00 0.00 ? 832  GLU B C  1 
ATOM 6274   O O  . GLU B 1 832  ? 1133.184 678.095 578.014 1.00 0.00 ? 832  GLU B O  1 
ATOM 6275   C CB . GLU B 1 832  ? 1135.016 680.722 577.643 1.00 0.00 ? 832  GLU B CB 1 
ATOM 6276   N N  . LEU B 1 833  ? 1133.738 678.944 580.018 1.00 0.00 ? 833  LEU B N  1 
ATOM 6277   C CA . LEU B 1 833  ? 1133.737 677.620 580.577 1.00 0.00 ? 833  LEU B CA 1 
ATOM 6278   C C  . LEU B 1 833  ? 1132.384 677.005 580.466 1.00 0.00 ? 833  LEU B C  1 
ATOM 6279   O O  . LEU B 1 833  ? 1132.257 675.837 580.101 1.00 0.00 ? 833  LEU B O  1 
ATOM 6280   C CB . LEU B 1 833  ? 1134.121 677.549 582.062 1.00 0.00 ? 833  LEU B CB 1 
ATOM 6281   N N  . THR B 1 834  ? 1131.327 677.780 580.758 1.00 0.00 ? 834  THR B N  1 
ATOM 6282   C CA . THR B 1 834  ? 1130.014 677.211 580.734 1.00 0.00 ? 834  THR B CA 1 
ATOM 6283   C C  . THR B 1 834  ? 1129.707 676.738 579.354 1.00 0.00 ? 834  THR B C  1 
ATOM 6284   O O  . THR B 1 834  ? 1129.106 675.679 579.178 1.00 0.00 ? 834  THR B O  1 
ATOM 6285   C CB . THR B 1 834  ? 1128.935 678.169 581.147 1.00 0.00 ? 834  THR B CB 1 
ATOM 6286   N N  . GLY B 1 835  ? 1130.124 677.499 578.329 1.00 0.00 ? 835  GLY B N  1 
ATOM 6287   C CA . GLY B 1 835  ? 1129.797 677.114 576.990 1.00 0.00 ? 835  GLY B CA 1 
ATOM 6288   C C  . GLY B 1 835  ? 1130.393 675.771 576.700 1.00 0.00 ? 835  GLY B C  1 
ATOM 6289   O O  . GLY B 1 835  ? 1129.749 674.916 576.095 1.00 0.00 ? 835  GLY B O  1 
ATOM 6290   N N  . ALA B 1 836  ? 1131.651 675.546 577.114 1.00 0.00 ? 836  ALA B N  1 
ATOM 6291   C CA . ALA B 1 836  ? 1132.277 674.292 576.818 1.00 0.00 ? 836  ALA B CA 1 
ATOM 6292   C C  . ALA B 1 836  ? 1131.539 673.190 577.514 1.00 0.00 ? 836  ALA B C  1 
ATOM 6293   O O  . ALA B 1 836  ? 1131.278 672.138 576.929 1.00 0.00 ? 836  ALA B O  1 
ATOM 6294   C CB . ALA B 1 836  ? 1133.742 674.233 577.282 1.00 0.00 ? 836  ALA B CB 1 
ATOM 6295   N N  . LEU B 1 837  ? 1131.165 673.416 578.787 1.00 0.00 ? 837  LEU B N  1 
ATOM 6296   C CA . LEU B 1 837  ? 1130.533 672.398 579.579 1.00 0.00 ? 837  LEU B CA 1 
ATOM 6297   C C  . LEU B 1 837  ? 1129.209 672.054 578.971 1.00 0.00 ? 837  LEU B C  1 
ATOM 6298   O O  . LEU B 1 837  ? 1128.861 670.881 578.853 1.00 0.00 ? 837  LEU B O  1 
ATOM 6299   C CB . LEU B 1 837  ? 1130.311 672.857 581.039 1.00 0.00 ? 837  LEU B CB 1 
ATOM 6300   N N  . ILE B 1 838  ? 1128.445 673.079 578.559 1.00 0.00 ? 838  ILE B N  1 
ATOM 6301   C CA . ILE B 1 838  ? 1127.122 672.880 578.046 1.00 0.00 ? 838  ILE B CA 1 
ATOM 6302   C C  . ILE B 1 838  ? 1127.224 672.070 576.795 1.00 0.00 ? 838  ILE B C  1 
ATOM 6303   O O  . ILE B 1 838  ? 1126.418 671.171 576.561 1.00 0.00 ? 838  ILE B O  1 
ATOM 6304   C CB . ILE B 1 838  ? 1126.430 674.188 577.784 1.00 0.00 ? 838  ILE B CB 1 
ATOM 6305   N N  . ALA B 1 839  ? 1128.248 672.353 575.970 1.00 0.00 ? 839  ALA B N  1 
ATOM 6306   C CA . ALA B 1 839  ? 1128.427 671.649 574.737 1.00 0.00 ? 839  ALA B CA 1 
ATOM 6307   C C  . ALA B 1 839  ? 1128.620 670.202 575.057 1.00 0.00 ? 839  ALA B C  1 
ATOM 6308   O O  . ALA B 1 839  ? 1128.128 669.331 574.340 1.00 0.00 ? 839  ALA B O  1 
ATOM 6309   C CB . ALA B 1 839  ? 1129.662 672.122 573.955 1.00 0.00 ? 839  ALA B CB 1 
ATOM 6310   N N  . SER B 1 840  ? 1129.363 669.900 576.137 1.00 0.00 ? 840  SER B N  1 
ATOM 6311   C CA . SER B 1 840  ? 1129.594 668.532 576.497 1.00 0.00 ? 840  SER B CA 1 
ATOM 6312   C C  . SER B 1 840  ? 1128.306 667.907 576.945 1.00 0.00 ? 840  SER B C  1 
ATOM 6313   O O  . SER B 1 840  ? 1128.065 666.728 576.695 1.00 0.00 ? 840  SER B O  1 
ATOM 6314   C CB . SER B 1 840  ? 1130.614 668.383 577.636 1.00 0.00 ? 840  SER B CB 1 
ATOM 6315   N N  . LEU B 1 841  ? 1127.435 668.685 577.618 1.00 0.00 ? 841  LEU B N  1 
ATOM 6316   C CA . LEU B 1 841  ? 1126.214 668.126 578.121 1.00 0.00 ? 841  LEU B CA 1 
ATOM 6317   C C  . LEU B 1 841  ? 1125.429 667.671 576.928 1.00 0.00 ? 841  LEU B C  1 
ATOM 6318   O O  . LEU B 1 841  ? 1124.861 666.579 576.937 1.00 0.00 ? 841  LEU B O  1 
ATOM 6319   C CB . LEU B 1 841  ? 1125.380 669.165 578.901 1.00 0.00 ? 841  LEU B CB 1 
ATOM 6320   N N  . ILE B 1 842  ? 1125.357 668.513 575.875 1.00 0.00 ? 842  ILE B N  1 
ATOM 6321   C CA . ILE B 1 842  ? 1124.618 668.147 574.698 1.00 0.00 ? 842  ILE B CA 1 
ATOM 6322   C C  . ILE B 1 842  ? 1125.305 667.052 573.939 1.00 0.00 ? 842  ILE B C  1 
ATOM 6323   O O  . ILE B 1 842  ? 1124.666 666.071 573.559 1.00 0.00 ? 842  ILE B O  1 
ATOM 6324   C CB . ILE B 1 842  ? 1124.362 669.282 573.739 1.00 0.00 ? 842  ILE B CB 1 
ATOM 6325   N N  . ASN B 1 843  ? 1126.631 667.168 573.721 1.00 0.00 ? 843  ASN B N  1 
ATOM 6326   C CA . ASN B 1 843  ? 1127.305 666.186 572.915 1.00 0.00 ? 843  ASN B CA 1 
ATOM 6327   C C  . ASN B 1 843  ? 1127.128 664.860 573.564 1.00 0.00 ? 843  ASN B C  1 
ATOM 6328   O O  . ASN B 1 843  ? 1126.772 663.881 572.908 1.00 0.00 ? 843  ASN B O  1 
ATOM 6329   C CB . ASN B 1 843  ? 1128.814 666.441 572.763 1.00 0.00 ? 843  ASN B CB 1 
ATOM 6330   N N  . CYS B 1 844  ? 1127.352 664.791 574.885 1.00 0.00 ? 844  CYS B N  1 
ATOM 6331   C CA . CYS B 1 844  ? 1127.145 663.536 575.530 1.00 0.00 ? 844  CYS B CA 1 
ATOM 6332   C C  . CYS B 1 844  ? 1125.665 663.377 575.670 1.00 0.00 ? 844  CYS B C  1 
ATOM 6333   O O  . CYS B 1 844  ? 1124.892 664.316 575.490 1.00 0.00 ? 844  CYS B O  1 
ATOM 6334   C CB . CYS B 1 844  ? 1127.794 663.410 576.920 1.00 0.00 ? 844  CYS B CB 1 
ATOM 6335   N N  . TYR B 1 845  ? 1125.260 662.146 576.001 1.00 0.00 ? 845  TYR B N  1 
ATOM 6336   C CA . TYR B 1 845  ? 1123.919 661.654 576.092 1.00 0.00 ? 845  TYR B CA 1 
ATOM 6337   C C  . TYR B 1 845  ? 1123.132 662.276 577.208 1.00 0.00 ? 845  TYR B C  1 
ATOM 6338   O O  . TYR B 1 845  ? 1121.904 662.205 577.191 1.00 0.00 ? 845  TYR B O  1 
ATOM 6339   C CB . TYR B 1 845  ? 1123.863 660.123 576.190 1.00 0.00 ? 845  TYR B CB 1 
ATOM 6340   N N  . ILE B 1 846  ? 1123.798 662.893 578.205 1.00 0.00 ? 846  ILE B N  1 
ATOM 6341   C CA . ILE B 1 846  ? 1123.155 663.263 579.439 1.00 0.00 ? 846  ILE B CA 1 
ATOM 6342   C C  . ILE B 1 846  ? 1121.878 664.026 579.237 1.00 0.00 ? 846  ILE B C  1 
ATOM 6343   O O  . ILE B 1 846  ? 1120.863 663.675 579.835 1.00 0.00 ? 846  ILE B O  1 
ATOM 6344   C CB . ILE B 1 846  ? 1123.991 664.165 580.307 1.00 0.00 ? 846  ILE B CB 1 
ATOM 6345   N N  . ARG B 1 847  ? 1121.859 665.069 578.394 1.00 0.00 ? 847  ARG B N  1 
ATOM 6346   C CA . ARG B 1 847  ? 1120.648 665.836 578.306 1.00 0.00 ? 847  ARG B CA 1 
ATOM 6347   C C  . ARG B 1 847  ? 1119.605 665.012 577.627 1.00 0.00 ? 847  ARG B C  1 
ATOM 6348   O O  . ARG B 1 847  ? 1119.872 664.357 576.623 1.00 0.00 ? 847  ARG B O  1 
ATOM 6349   C CB . ARG B 1 847  ? 1120.862 667.099 577.503 1.00 0.00 ? 847  ARG B CB 1 
ATOM 6350   N N  . ASP B 1 848  ? 1118.368 665.036 578.158 1.00 0.00 ? 848  ASP B N  1 
ATOM 6351   C CA . ASP B 1 848  ? 1117.363 664.192 577.588 1.00 0.00 ? 848  ASP B CA 1 
ATOM 6352   C C  . ASP B 1 848  ? 1116.283 665.005 576.950 1.00 0.00 ? 848  ASP B C  1 
ATOM 6353   O O  . ASP B 1 848  ? 1115.687 665.881 577.576 1.00 0.00 ? 848  ASP B O  1 
ATOM 6354   C CB . ASP B 1 848  ? 1116.670 663.286 578.625 1.00 0.00 ? 848  ASP B CB 1 
ATOM 6355   N N  . ASN B 1 849  ? 1116.041 664.741 575.653 1.00 0.00 ? 849  ASN B N  1 
ATOM 6356   C CA . ASN B 1 849  ? 1114.904 665.280 574.968 1.00 0.00 ? 849  ASN B CA 1 
ATOM 6357   C C  . ASN B 1 849  ? 1114.919 666.772 574.942 1.00 0.00 ? 849  ASN B C  1 
ATOM 6358   O O  . ASN B 1 849  ? 1115.836 667.409 574.427 1.00 0.00 ? 849  ASN B O  1 
ATOM 6359   C CB . ASN B 1 849  ? 1113.566 664.812 575.569 1.00 0.00 ? 849  ASN B CB 1 
ATOM 6360   N N  . ALA B 1 850  ? 1113.852 667.344 575.525 1.00 0.00 ? 850  ALA B N  1 
ATOM 6361   C CA . ALA B 1 850  ? 1113.539 668.739 575.512 1.00 0.00 ? 850  ALA B CA 1 
ATOM 6362   C C  . ALA B 1 850  ? 1114.654 669.518 576.109 1.00 0.00 ? 850  ALA B C  1 
ATOM 6363   O O  . ALA B 1 850  ? 1114.889 670.648 575.682 1.00 0.00 ? 850  ALA B O  1 
ATOM 6364   C CB . ALA B 1 850  ? 1112.268 669.072 576.312 1.00 0.00 ? 850  ALA B CB 1 
ATOM 6365   N N  . ALA B 1 851  ? 1115.345 668.957 577.126 1.00 0.00 ? 851  ALA B N  1 
ATOM 6366   C CA . ALA B 1 851  ? 1116.382 669.732 577.736 1.00 0.00 ? 851  ALA B CA 1 
ATOM 6367   C C  . ALA B 1 851  ? 1117.359 670.084 576.668 1.00 0.00 ? 851  ALA B C  1 
ATOM 6368   O O  . ALA B 1 851  ? 1117.499 671.263 576.365 1.00 0.00 ? 851  ALA B O  1 
ATOM 6369   C CB . ALA B 1 851  ? 1117.138 668.966 578.834 1.00 0.00 ? 851  ALA B CB 1 
ATOM 6370   N N  . VAL B 1 852  ? 1117.858 669.076 575.924 1.00 0.00 ? 852  VAL B N  1 
ATOM 6371   C CA . VAL B 1 852  ? 1118.936 669.247 574.987 1.00 0.00 ? 852  VAL B CA 1 
ATOM 6372   C C  . VAL B 1 852  ? 1118.600 670.344 574.028 1.00 0.00 ? 852  VAL B C  1 
ATOM 6373   O O  . VAL B 1 852  ? 1119.445 671.180 573.712 1.00 0.00 ? 852  VAL B O  1 
ATOM 6374   C CB . VAL B 1 852  ? 1119.134 668.031 574.132 1.00 0.00 ? 852  VAL B CB 1 
ATOM 6375   N N  . ASP B 1 853  ? 1117.345 670.378 573.548 1.00 0.00 ? 853  ASP B N  1 
ATOM 6376   C CA . ASP B 1 853  ? 1116.967 671.353 572.570 1.00 0.00 ? 853  ASP B CA 1 
ATOM 6377   C C  . ASP B 1 853  ? 1117.201 672.712 573.150 1.00 0.00 ? 853  ASP B C  1 
ATOM 6378   O O  . ASP B 1 853  ? 1117.704 673.609 572.477 1.00 0.00 ? 853  ASP B O  1 
ATOM 6379   C CB . ASP B 1 853  ? 1115.473 671.269 572.214 1.00 0.00 ? 853  ASP B CB 1 
ATOM 6380   N N  . GLY B 1 854  ? 1116.857 672.880 574.437 1.00 0.00 ? 854  GLY B N  1 
ATOM 6381   C CA . GLY B 1 854  ? 1116.974 674.128 575.131 1.00 0.00 ? 854  GLY B CA 1 
ATOM 6382   C C  . GLY B 1 854  ? 1118.402 674.596 575.169 1.00 0.00 ? 854  GLY B C  1 
ATOM 6383   O O  . GLY B 1 854  ? 1118.650 675.779 574.946 1.00 0.00 ? 854  GLY B O  1 
ATOM 6384   N N  . ILE B 1 855  ? 1119.390 673.721 575.466 1.00 0.00 ? 855  ILE B N  1 
ATOM 6385   C CA . ILE B 1 855  ? 1120.725 674.269 575.492 1.00 0.00 ? 855  ILE B CA 1 
ATOM 6386   C C  . ILE B 1 855  ? 1121.128 674.734 574.139 1.00 0.00 ? 855  ILE B C  1 
ATOM 6387   O O  . ILE B 1 855  ? 1121.719 675.806 574.010 1.00 0.00 ? 855  ILE B O  1 
ATOM 6388   C CB . ILE B 1 855  ? 1121.858 673.404 575.974 1.00 0.00 ? 855  ILE B CB 1 
ATOM 6389   N N  . SER B 1 856  ? 1120.816 673.954 573.089 1.00 0.00 ? 856  SER B N  1 
ATOM 6390   C CA . SER B 1 856  ? 1121.252 674.329 571.777 1.00 0.00 ? 856  SER B CA 1 
ATOM 6391   C C  . SER B 1 856  ? 1120.682 675.678 571.480 1.00 0.00 ? 856  SER B C  1 
ATOM 6392   O O  . SER B 1 856  ? 1121.323 676.504 570.833 1.00 0.00 ? 856  SER B O  1 
ATOM 6393   C CB . SER B 1 856  ? 1120.765 673.358 570.688 1.00 0.00 ? 856  SER B CB 1 
ATOM 6394   N N  . LEU B 1 857  ? 1119.455 675.931 571.963 1.00 0.00 ? 857  LEU B N  1 
ATOM 6395   C CA . LEU B 1 857  ? 1118.830 677.199 571.756 1.00 0.00 ? 857  LEU B CA 1 
ATOM 6396   C C  . LEU B 1 857  ? 1119.659 678.221 572.481 1.00 0.00 ? 857  LEU B C  1 
ATOM 6397   O O  . LEU B 1 857  ? 1119.943 679.294 571.954 1.00 0.00 ? 857  LEU B O  1 
ATOM 6398   C CB . LEU B 1 857  ? 1117.404 677.228 572.349 1.00 0.00 ? 857  LEU B CB 1 
ATOM 6399   N N  . HIS B 1 858  ? 1120.081 677.887 573.716 1.00 0.00 ? 858  HIS B N  1 
ATOM 6400   C CA . HIS B 1 858  ? 1120.820 678.782 574.566 1.00 0.00 ? 858  HIS B CA 1 
ATOM 6401   C C  . HIS B 1 858  ? 1122.138 679.121 573.947 1.00 0.00 ? 858  HIS B C  1 
ATOM 6402   O O  . HIS B 1 858  ? 1122.527 680.288 573.908 1.00 0.00 ? 858  HIS B O  1 
ATOM 6403   C CB . HIS B 1 858  ? 1121.111 678.167 575.946 1.00 0.00 ? 858  HIS B CB 1 
ATOM 6404   N N  . LEU B 1 859  ? 1122.862 678.111 573.430 1.00 0.00 ? 859  LEU B N  1 
ATOM 6405   C CA . LEU B 1 859  ? 1124.155 678.383 572.879 1.00 0.00 ? 859  LEU B CA 1 
ATOM 6406   C C  . LEU B 1 859  ? 1123.956 679.327 571.744 1.00 0.00 ? 859  LEU B C  1 
ATOM 6407   O O  . LEU B 1 859  ? 1124.713 680.281 571.575 1.00 0.00 ? 859  LEU B O  1 
ATOM 6408   C CB . LEU B 1 859  ? 1124.860 677.130 572.330 1.00 0.00 ? 859  LEU B CB 1 
ATOM 6409   N N  . GLN B 1 860  ? 1122.912 679.086 570.936 1.00 0.00 ? 860  GLN B N  1 
ATOM 6410   C CA . GLN B 1 860  ? 1122.670 679.947 569.819 1.00 0.00 ? 860  GLN B CA 1 
ATOM 6411   C C  . GLN B 1 860  ? 1122.382 681.328 570.310 1.00 0.00 ? 860  GLN B C  1 
ATOM 6412   O O  . GLN B 1 860  ? 1122.998 682.290 569.855 1.00 0.00 ? 860  GLN B O  1 
ATOM 6413   C CB . GLN B 1 860  ? 1121.441 679.501 569.006 1.00 0.00 ? 860  GLN B CB 1 
ATOM 6414   N N  . ASP B 1 861  ? 1121.449 681.465 571.271 1.00 0.00 ? 861  ASP B N  1 
ATOM 6415   C CA . ASP B 1 861  ? 1121.068 682.787 571.673 1.00 0.00 ? 861  ASP B CA 1 
ATOM 6416   C C  . ASP B 1 861  ? 1122.180 683.516 572.354 1.00 0.00 ? 861  ASP B C  1 
ATOM 6417   O O  . ASP B 1 861  ? 1122.604 684.572 571.887 1.00 0.00 ? 861  ASP B O  1 
ATOM 6418   C CB . ASP B 1 861  ? 1119.869 682.803 572.633 1.00 0.00 ? 861  ASP B CB 1 
ATOM 6419   N N  . ILE B 1 862  ? 1122.706 682.971 573.469 1.00 0.00 ? 862  ILE B N  1 
ATOM 6420   C CA . ILE B 1 862  ? 1123.697 683.744 574.155 1.00 0.00 ? 862  ILE B CA 1 
ATOM 6421   C C  . ILE B 1 862  ? 1124.971 682.965 574.258 1.00 0.00 ? 862  ILE B C  1 
ATOM 6422   O O  . ILE B 1 862  ? 1125.458 682.677 575.351 1.00 0.00 ? 862  ILE B O  1 
ATOM 6423   C CB . ILE B 1 862  ? 1123.211 684.140 575.529 1.00 0.00 ? 862  ILE B CB 1 
ATOM 6424   N N  . CYS B 1 863  ? 1125.601 682.655 573.114 1.00 0.00 ? 863  CYS B N  1 
ATOM 6425   C CA . CYS B 1 863  ? 1126.827 681.928 573.229 1.00 0.00 ? 863  CYS B CA 1 
ATOM 6426   C C  . CYS B 1 863  ? 1127.543 682.041 571.894 1.00 0.00 ? 863  CYS B C  1 
ATOM 6427   O O  . CYS B 1 863  ? 1127.024 681.479 570.893 1.00 0.00 ? 863  CYS B O  1 
ATOM 6428   C CB . CYS B 1 863  ? 1126.633 680.431 573.529 1.00 0.00 ? 863  CYS B CB 1 
ATOM 6429   N N  . MET C 2 1    ? 977.676  667.001 729.916 1.00 0.00 ? 1    MET C N  1 
ATOM 6430   C CA . MET C 2 1    ? 976.397  666.536 729.429 1.00 0.00 ? 1    MET C CA 1 
ATOM 6431   C C  . MET C 2 1    ? 976.618  665.044 729.262 1.00 0.00 ? 1    MET C C  1 
ATOM 6432   O O  . MET C 2 1    ? 977.737  664.589 729.392 1.00 0.00 ? 1    MET C O  1 
ATOM 6433   C CB . MET C 2 1    ? 976.120  666.924 727.941 1.00 0.00 ? 1    MET C CB 1 
ATOM 6434   N N  . ASP C 2 2    ? 975.507  664.406 728.881 1.00 0.00 ? 2    ASP C N  1 
ATOM 6435   C CA . ASP C 2 2    ? 975.454  663.016 728.775 1.00 0.00 ? 2    ASP C CA 1 
ATOM 6436   C C  . ASP C 2 2    ? 975.793  662.547 727.453 1.00 0.00 ? 2    ASP C C  1 
ATOM 6437   O O  . ASP C 2 2    ? 974.904  662.372 726.669 1.00 0.00 ? 2    ASP C O  1 
ATOM 6438   C CB . ASP C 2 2    ? 974.075  662.445 729.085 1.00 0.00 ? 2    ASP C CB 1 
ATOM 6439   N N  . THR C 2 3    ? 977.037  662.212 727.168 1.00 0.00 ? 3    THR C N  1 
ATOM 6440   C CA . THR C 2 3    ? 977.294  661.820 725.820 1.00 0.00 ? 3    THR C CA 1 
ATOM 6441   C C  . THR C 2 3    ? 977.877  660.451 725.824 1.00 0.00 ? 3    THR C C  1 
ATOM 6442   O O  . THR C 2 3    ? 978.516  659.831 726.696 1.00 0.00 ? 3    THR C O  1 
ATOM 6443   C CB . THR C 2 3    ? 978.360  662.623 725.036 1.00 0.00 ? 3    THR C CB 1 
ATOM 6444   N N  . GLU C 2 4    ? 977.513  659.997 724.632 1.00 0.00 ? 4    GLU C N  1 
ATOM 6445   C CA . GLU C 2 4    ? 977.939  658.549 724.505 1.00 0.00 ? 4    GLU C CA 1 
ATOM 6446   C C  . GLU C 2 4    ? 978.780  658.254 723.129 1.00 0.00 ? 4    GLU C C  1 
ATOM 6447   O O  . GLU C 2 4    ? 979.020  657.120 722.922 1.00 0.00 ? 4    GLU C O  1 
ATOM 6448   C CB . GLU C 2 4    ? 976.857  657.402 724.849 1.00 0.00 ? 4    GLU C CB 1 
ATOM 6449   N N  . GLY C 2 5    ? 978.604  659.172 722.147 1.00 0.00 ? 5    GLY C N  1 
ATOM 6450   C CA . GLY C 2 5    ? 979.721  659.055 721.259 1.00 0.00 ? 5    GLY C CA 1 
ATOM 6451   C C  . GLY C 2 5    ? 981.105  658.826 721.413 1.00 0.00 ? 5    GLY C C  1 
ATOM 6452   O O  . GLY C 2 5    ? 981.754  658.033 720.699 1.00 0.00 ? 5    GLY C O  1 
ATOM 6453   N N  . PHE C 2 6    ? 981.897  659.427 722.144 1.00 0.00 ? 6    PHE C N  1 
ATOM 6454   C CA . PHE C 2 6    ? 983.287  659.212 722.093 1.00 0.00 ? 6    PHE C CA 1 
ATOM 6455   C C  . PHE C 2 6    ? 983.819  658.094 723.002 1.00 0.00 ? 6    PHE C C  1 
ATOM 6456   O O  . PHE C 2 6    ? 984.680  657.433 722.604 1.00 0.00 ? 6    PHE C O  1 
ATOM 6457   C CB . PHE C 2 6    ? 983.673  660.341 721.887 1.00 0.00 ? 6    PHE C CB 1 
ATOM 6458   N N  . GLY C 2 7    ? 982.909  657.605 723.676 1.00 0.00 ? 7    GLY C N  1 
ATOM 6459   C CA . GLY C 2 7    ? 982.801  656.558 724.435 1.00 0.00 ? 7    GLY C CA 1 
ATOM 6460   C C  . GLY C 2 7    ? 982.408  655.636 723.217 1.00 0.00 ? 7    GLY C C  1 
ATOM 6461   O O  . GLY C 2 7    ? 983.095  654.719 723.388 1.00 0.00 ? 7    GLY C O  1 
ATOM 6462   N N  . GLU C 2 8    ? 981.866  655.863 722.242 1.00 0.00 ? 8    GLU C N  1 
ATOM 6463   C CA . GLU C 2 8    ? 981.784  654.793 721.351 1.00 0.00 ? 8    GLU C CA 1 
ATOM 6464   C C  . GLU C 2 8    ? 983.132  654.634 720.681 1.00 0.00 ? 8    GLU C C  1 
ATOM 6465   O O  . GLU C 2 8    ? 983.545  653.508 720.747 1.00 0.00 ? 8    GLU C O  1 
ATOM 6466   C CB . GLU C 2 8    ? 980.626  654.616 720.506 1.00 0.00 ? 8    GLU C CB 1 
ATOM 6467   N N  . LEU C 2 9    ? 983.673  655.777 720.279 1.00 0.00 ? 9    LEU C N  1 
ATOM 6468   C CA . LEU C 2 9    ? 984.754  656.000 719.498 1.00 0.00 ? 9    LEU C CA 1 
ATOM 6469   C C  . LEU C 2 9    ? 985.789  655.233 720.159 1.00 0.00 ? 9    LEU C C  1 
ATOM 6470   O O  . LEU C 2 9    ? 986.572  654.667 719.427 1.00 0.00 ? 9    LEU C O  1 
ATOM 6471   C CB . LEU C 2 9    ? 985.318  657.353 719.538 1.00 0.00 ? 9    LEU C CB 1 
ATOM 6472   N N  . LEU C 2 10   ? 985.984  655.536 721.531 1.00 0.00 ? 10   LEU C N  1 
ATOM 6473   C CA . LEU C 2 10   ? 987.172  655.145 722.369 1.00 0.00 ? 10   LEU C CA 1 
ATOM 6474   C C  . LEU C 2 10   ? 987.100  653.719 722.536 1.00 0.00 ? 10   LEU C C  1 
ATOM 6475   O O  . LEU C 2 10   ? 988.133  652.980 722.544 1.00 0.00 ? 10   LEU C O  1 
ATOM 6476   C CB . LEU C 2 10   ? 987.112  655.764 723.825 1.00 0.00 ? 10   LEU C CB 1 
ATOM 6477   N N  . GLN C 2 11   ? 985.809  653.410 722.515 1.00 0.00 ? 11   GLN C N  1 
ATOM 6478   C CA . GLN C 2 11   ? 985.277  652.073 722.646 1.00 0.00 ? 11   GLN C CA 1 
ATOM 6479   C C  . GLN C 2 11   ? 985.791  651.213 721.622 1.00 0.00 ? 11   GLN C C  1 
ATOM 6480   O O  . GLN C 2 11   ? 986.060  650.050 721.869 1.00 0.00 ? 11   GLN C O  1 
ATOM 6481   C CB . GLN C 2 11   ? 984.734  651.801 723.911 1.00 0.00 ? 11   GLN C CB 1 
ATOM 6482   N N  . GLN C 2 12   ? 985.495  651.717 720.382 1.00 0.00 ? 12   GLN C N  1 
ATOM 6483   C CA . GLN C 2 12   ? 985.914  651.201 719.071 1.00 0.00 ? 12   GLN C CA 1 
ATOM 6484   C C  . GLN C 2 12   ? 987.165  651.002 718.899 1.00 0.00 ? 12   GLN C C  1 
ATOM 6485   O O  . GLN C 2 12   ? 987.648  650.002 718.389 1.00 0.00 ? 12   GLN C O  1 
ATOM 6486   C CB . GLN C 2 12   ? 985.430  652.240 718.035 1.00 0.00 ? 12   GLN C CB 1 
ATOM 6487   N N  . ALA C 2 13   ? 987.920  652.047 719.255 1.00 0.00 ? 13   ALA C N  1 
ATOM 6488   C CA . ALA C 2 13   ? 989.388  652.189 719.111 1.00 0.00 ? 13   ALA C CA 1 
ATOM 6489   C C  . ALA C 2 13   ? 990.080  651.252 720.125 1.00 0.00 ? 13   ALA C C  1 
ATOM 6490   O O  . ALA C 2 13   ? 991.215  650.833 719.788 1.00 0.00 ? 13   ALA C O  1 
ATOM 6491   C CB . ALA C 2 13   ? 989.941  653.587 719.416 1.00 0.00 ? 13   ALA C CB 1 
ATOM 6492   N N  . GLU C 2 14   ? 989.444  651.037 721.332 1.00 0.00 ? 14   GLU C N  1 
ATOM 6493   C CA . GLU C 2 14   ? 989.822  650.146 722.437 1.00 0.00 ? 14   GLU C CA 1 
ATOM 6494   C C  . GLU C 2 14   ? 989.722  648.678 721.943 1.00 0.00 ? 14   GLU C C  1 
ATOM 6495   O O  . GLU C 2 14   ? 990.644  647.891 721.992 1.00 0.00 ? 14   GLU C O  1 
ATOM 6496   C CB . GLU C 2 14   ? 988.957  650.243 723.651 1.00 0.00 ? 14   GLU C CB 1 
ATOM 6497   N N  . GLN C 2 15   ? 988.557  648.286 721.354 1.00 0.00 ? 15   GLN C N  1 
ATOM 6498   C CA . GLN C 2 15   ? 987.996  647.149 721.039 1.00 0.00 ? 15   GLN C CA 1 
ATOM 6499   C C  . GLN C 2 15   ? 989.152  646.757 719.659 1.00 0.00 ? 15   GLN C C  1 
ATOM 6500   O O  . GLN C 2 15   ? 989.572  645.614 719.396 1.00 0.00 ? 15   GLN C O  1 
ATOM 6501   C CB . GLN C 2 15   ? 986.801  646.951 720.011 1.00 0.00 ? 15   GLN C CB 1 
ATOM 6502   N N  . LEU C 2 16   ? 989.596  647.910 718.989 1.00 0.00 ? 16   LEU C N  1 
ATOM 6503   C CA . LEU C 2 16   ? 990.404  647.931 717.773 1.00 0.00 ? 16   LEU C CA 1 
ATOM 6504   C C  . LEU C 2 16   ? 991.710  647.236 718.068 1.00 0.00 ? 16   LEU C C  1 
ATOM 6505   O O  . LEU C 2 16   ? 992.069  646.256 717.424 1.00 0.00 ? 16   LEU C O  1 
ATOM 6506   C CB . LEU C 2 16   ? 990.734  649.271 717.302 1.00 0.00 ? 16   LEU C CB 1 
ATOM 6507   N N  . ALA C 2 17   ? 992.463  647.824 718.987 1.00 0.00 ? 17   ALA C N  1 
ATOM 6508   C CA . ALA C 2 17   ? 993.842  647.533 719.402 1.00 0.00 ? 17   ALA C CA 1 
ATOM 6509   C C  . ALA C 2 17   ? 993.963  646.235 720.120 1.00 0.00 ? 17   ALA C C  1 
ATOM 6510   O O  . ALA C 2 17   ? 995.033  645.957 720.630 1.00 0.00 ? 17   ALA C O  1 
ATOM 6511   C CB . ALA C 2 17   ? 994.417  648.588 720.343 1.00 0.00 ? 17   ALA C CB 1 
ATOM 6512   N N  . ALA C 2 18   ? 992.848  645.540 720.447 1.00 0.00 ? 18   ALA C N  1 
ATOM 6513   C CA . ALA C 2 18   ? 993.074  644.284 721.200 1.00 0.00 ? 18   ALA C CA 1 
ATOM 6514   C C  . ALA C 2 18   ? 992.601  643.103 720.321 1.00 0.00 ? 18   ALA C C  1 
ATOM 6515   O O  . ALA C 2 18   ? 991.452  642.670 720.303 1.00 0.00 ? 18   ALA C O  1 
ATOM 6516   C CB . ALA C 2 18   ? 992.215  644.266 722.514 1.00 0.00 ? 18   ALA C CB 1 
ATOM 6517   N N  . GLU C 2 19   ? 993.607  642.467 719.649 1.00 0.00 ? 19   GLU C N  1 
ATOM 6518   C CA . GLU C 2 19   ? 993.427  641.168 718.962 1.00 0.00 ? 19   GLU C CA 1 
ATOM 6519   C C  . GLU C 2 19   ? 992.661  641.282 717.651 1.00 0.00 ? 19   GLU C C  1 
ATOM 6520   O O  . GLU C 2 19   ? 992.481  642.388 717.130 1.00 0.00 ? 19   GLU C O  1 
ATOM 6521   C CB . GLU C 2 19   ? 992.808  640.200 719.982 1.00 0.00 ? 19   GLU C CB 1 
ATOM 6522   N N  . THR C 2 20   ? 992.242  640.154 717.037 1.00 0.00 ? 20   THR C N  1 
ATOM 6523   C CA . THR C 2 20   ? 992.334  638.783 717.474 1.00 0.00 ? 20   THR C CA 1 
ATOM 6524   C C  . THR C 2 20   ? 992.658  637.932 716.286 1.00 0.00 ? 20   THR C C  1 
ATOM 6525   O O  . THR C 2 20   ? 993.389  638.347 715.389 1.00 0.00 ? 20   THR C O  1 
ATOM 6526   C CB . THR C 2 20   ? 990.976  638.234 717.885 1.00 0.00 ? 20   THR C CB 1 
ATOM 6527   N N  . GLU C 2 21   ? 992.153  636.676 716.295 1.00 0.00 ? 21   GLU C N  1 
ATOM 6528   C CA . GLU C 2 21   ? 992.280  635.807 715.161 1.00 0.00 ? 21   GLU C CA 1 
ATOM 6529   C C  . GLU C 2 21   ? 991.270  636.365 714.191 1.00 0.00 ? 21   GLU C C  1 
ATOM 6530   O O  . GLU C 2 21   ? 990.074  636.329 714.464 1.00 0.00 ? 21   GLU C O  1 
ATOM 6531   C CB . GLU C 2 21   ? 991.906  634.343 715.470 1.00 0.00 ? 21   GLU C CB 1 
ATOM 6532   N N  . GLY C 2 22   ? 991.700  636.708 712.971 1.00 0.00 ? 22   GLY C N  1 
ATOM 6533   C CA . GLY C 2 22   ? 990.877  637.490 712.110 1.00 0.00 ? 22   GLY C CA 1 
ATOM 6534   C C  . GLY C 2 22   ? 991.539  637.454 710.772 1.00 0.00 ? 22   GLY C C  1 
ATOM 6535   O O  . GLY C 2 22   ? 991.134  638.130 709.825 1.00 0.00 ? 22   GLY C O  1 
ATOM 6536   N N  . ILE C 2 23   ? 992.572  636.593 710.678 1.00 0.00 ? 23   ILE C N  1 
ATOM 6537   C CA . ILE C 2 23   ? 993.434  636.392 709.541 1.00 0.00 ? 23   ILE C CA 1 
ATOM 6538   C C  . ILE C 2 23   ? 993.664  637.695 708.857 1.00 0.00 ? 23   ILE C C  1 
ATOM 6539   O O  . ILE C 2 23   ? 993.052  637.978 707.831 1.00 0.00 ? 23   ILE C O  1 
ATOM 6540   C CB . ILE C 2 23   ? 992.910  635.369 708.581 1.00 0.00 ? 23   ILE C CB 1 
ATOM 6541   N N  . SER C 2 24   ? 994.647  638.478 709.393 1.00 0.00 ? 24   SER C N  1 
ATOM 6542   C CA . SER C 2 24   ? 995.106  639.751 708.902 1.00 0.00 ? 24   SER C CA 1 
ATOM 6543   C C  . SER C 2 24   ? 995.249  640.766 710.006 1.00 0.00 ? 24   SER C C  1 
ATOM 6544   O O  . SER C 2 24   ? 996.357  641.110 710.409 1.00 0.00 ? 24   SER C O  1 
ATOM 6545   C CB . SER C 2 24   ? 994.208  640.439 707.853 1.00 0.00 ? 24   SER C CB 1 
ATOM 6546   N N  . GLU C 2 25   ? 994.098  641.312 710.474 1.00 0.00 ? 25   GLU C N  1 
ATOM 6547   C CA . GLU C 2 25   ? 993.990  642.429 711.389 1.00 0.00 ? 25   GLU C CA 1 
ATOM 6548   C C  . GLU C 2 25   ? 994.550  642.128 712.737 1.00 0.00 ? 25   GLU C C  1 
ATOM 6549   O O  . GLU C 2 25   ? 993.863  641.565 713.584 1.00 0.00 ? 25   GLU C O  1 
ATOM 6550   C CB . GLU C 2 25   ? 992.549  642.879 711.588 1.00 0.00 ? 25   GLU C CB 1 
ATOM 6551   N N  . LEU C 2 26   ? 995.809  642.553 712.988 1.00 0.00 ? 26   LEU C N  1 
ATOM 6552   C CA . LEU C 2 26   ? 996.418  642.397 714.267 1.00 0.00 ? 26   LEU C CA 1 
ATOM 6553   C C  . LEU C 2 26   ? 996.320  643.747 714.949 1.00 0.00 ? 26   LEU C C  1 
ATOM 6554   O O  . LEU C 2 26   ? 996.293  644.795 714.309 1.00 0.00 ? 26   LEU C O  1 
ATOM 6555   C CB . LEU C 2 26   ? 997.915  642.003 714.219 1.00 0.00 ? 26   LEU C CB 1 
ATOM 6556   N N  . PRO C 2 27   ? 996.289  643.755 716.262 1.00 0.00 ? 27   PRO C N  1 
ATOM 6557   C CA . PRO C 2 27   ? 996.124  644.944 717.058 1.00 0.00 ? 27   PRO C CA 1 
ATOM 6558   C C  . PRO C 2 27   ? 997.226  645.889 716.775 1.00 0.00 ? 27   PRO C C  1 
ATOM 6559   O O  . PRO C 2 27   ? 998.375  645.481 716.590 1.00 0.00 ? 27   PRO C O  1 
ATOM 6560   C CB . PRO C 2 27   ? 996.244  644.475 718.500 1.00 0.00 ? 27   PRO C CB 1 
ATOM 6561   N N  . HIS C 2 28   ? 996.886  647.209 716.798 1.00 0.00 ? 28   HIS C N  1 
ATOM 6562   C CA . HIS C 2 28   ? 998.029  648.309 716.667 1.00 0.00 ? 28   HIS C CA 1 
ATOM 6563   C C  . HIS C 2 28   ? 998.240  649.066 717.634 1.00 0.00 ? 28   HIS C C  1 
ATOM 6564   O O  . HIS C 2 28   ? 997.463  649.377 718.510 1.00 0.00 ? 28   HIS C O  1 
ATOM 6565   C CB . HIS C 2 28   ? 997.828  648.725 715.118 1.00 0.00 ? 28   HIS C CB 1 
ATOM 6566   N N  . VAL C 2 29   ? 999.565  649.309 717.614 1.00 0.00 ? 29   VAL C N  1 
ATOM 6567   C CA . VAL C 2 29   ? 1000.223 650.066 718.664 1.00 0.00 ? 29   VAL C CA 1 
ATOM 6568   C C  . VAL C 2 29   ? 999.851  651.494 718.525 1.00 0.00 ? 29   VAL C C  1 
ATOM 6569   O O  . VAL C 2 29   ? 999.754  652.025 717.426 1.00 0.00 ? 29   VAL C O  1 
ATOM 6570   C CB . VAL C 2 29   ? 1001.715 649.948 718.597 1.00 0.00 ? 29   VAL C CB 1 
ATOM 6571   N N  . GLU C 2 30   ? 999.645  652.181 719.656 1.00 0.00 ? 30   GLU C N  1 
ATOM 6572   C CA . GLU C 2 30   ? 999.215  653.556 719.587 1.00 0.00 ? 30   GLU C CA 1 
ATOM 6573   C C  . GLU C 2 30   ? 1000.357 654.477 719.984 1.00 0.00 ? 30   GLU C C  1 
ATOM 6574   O O  . GLU C 2 30   ? 1001.095 654.220 720.945 1.00 0.00 ? 30   GLU C O  1 
ATOM 6575   C CB . GLU C 2 30   ? 998.018  653.865 720.528 1.00 0.00 ? 30   GLU C CB 1 
ATOM 6576   N N  . ARG C 2 31   ? 1000.636 655.473 719.096 1.00 0.00 ? 31   ARG C N  1 
ATOM 6577   C CA . ARG C 2 31   ? 1001.684 656.475 719.279 1.00 0.00 ? 31   ARG C CA 1 
ATOM 6578   C C  . ARG C 2 31   ? 1001.454 657.622 720.237 1.00 0.00 ? 31   ARG C C  1 
ATOM 6579   O O  . ARG C 2 31   ? 1001.741 657.525 721.428 1.00 0.00 ? 31   ARG C O  1 
ATOM 6580   C CB . ARG C 2 31   ? 1002.128 657.039 717.919 1.00 0.00 ? 31   ARG C CB 1 
ATOM 6581   N N  . ASN C 2 32   ? 1000.830 658.713 719.722 1.00 0.00 ? 32   ASN C N  1 
ATOM 6582   C CA . ASN C 2 32   ? 1000.468 659.992 720.319 1.00 0.00 ? 32   ASN C CA 1 
ATOM 6583   C C  . ASN C 2 32   ? 1001.540 661.057 720.478 1.00 0.00 ? 32   ASN C C  1 
ATOM 6584   O O  . ASN C 2 32   ? 1002.739 660.798 720.599 1.00 0.00 ? 32   ASN C O  1 
ATOM 6585   C CB . ASN C 2 32   ? 999.604  659.948 721.597 1.00 0.00 ? 32   ASN C CB 1 
ATOM 6586   N N  . LEU C 2 33   ? 1001.071 662.334 720.449 1.00 0.00 ? 33   LEU C N  1 
ATOM 6587   C CA . LEU C 2 33   ? 1001.746 663.591 720.675 1.00 0.00 ? 33   LEU C CA 1 
ATOM 6588   C C  . LEU C 2 33   ? 1002.972 663.784 719.816 1.00 0.00 ? 33   LEU C C  1 
ATOM 6589   O O  . LEU C 2 33   ? 1002.833 664.148 718.648 1.00 0.00 ? 33   LEU C O  1 
ATOM 6590   C CB . LEU C 2 33   ? 1002.122 663.760 722.154 1.00 0.00 ? 33   LEU C CB 1 
ATOM 6591   N N  . GLN C 2 34   ? 1004.185 663.608 720.406 1.00 0.00 ? 34   GLN C N  1 
ATOM 6592   C CA . GLN C 2 34   ? 1005.410 663.963 719.730 1.00 0.00 ? 34   GLN C CA 1 
ATOM 6593   C C  . GLN C 2 34   ? 1005.651 663.148 718.493 1.00 0.00 ? 34   GLN C C  1 
ATOM 6594   O O  . GLN C 2 34   ? 1005.808 663.703 717.408 1.00 0.00 ? 34   GLN C O  1 
ATOM 6595   C CB . GLN C 2 34   ? 1006.628 663.852 720.646 1.00 0.00 ? 34   GLN C CB 1 
ATOM 6596   N N  . GLU C 2 35   ? 1005.641 661.812 718.599 1.00 0.00 ? 35   GLU C N  1 
ATOM 6597   C CA . GLU C 2 35   ? 1005.908 660.987 717.453 1.00 0.00 ? 35   GLU C CA 1 
ATOM 6598   C C  . GLU C 2 35   ? 1004.771 661.158 716.459 1.00 0.00 ? 35   GLU C C  1 
ATOM 6599   O O  . GLU C 2 35   ? 1004.997 661.207 715.249 1.00 0.00 ? 35   GLU C O  1 
ATOM 6600   C CB . GLU C 2 35   ? 1006.028 659.485 717.813 1.00 0.00 ? 35   GLU C CB 1 
ATOM 6601   N N  . ILE C 2 36   ? 1003.498 661.273 716.949 1.00 0.00 ? 36   ILE C N  1 
ATOM 6602   C CA . ILE C 2 36   ? 1002.306 661.345 716.117 1.00 0.00 ? 36   ILE C CA 1 
ATOM 6603   C C  . ILE C 2 36   ? 1002.289 662.571 715.254 1.00 0.00 ? 36   ILE C C  1 
ATOM 6604   O O  . ILE C 2 36   ? 1001.923 662.474 714.090 1.00 0.00 ? 36   ILE C O  1 
ATOM 6605   C CB . ILE C 2 36   ? 1000.996 661.300 716.877 1.00 0.00 ? 36   ILE C CB 1 
ATOM 6606   N N  . GLN C 2 37   ? 1002.665 663.747 715.784 1.00 0.00 ? 37   GLN C N  1 
ATOM 6607   C CA . GLN C 2 37   ? 1002.596 664.952 715.003 1.00 0.00 ? 37   GLN C CA 1 
ATOM 6608   C C  . GLN C 2 37   ? 1003.464 664.793 713.822 1.00 0.00 ? 37   GLN C C  1 
ATOM 6609   O O  . GLN C 2 37   ? 1003.075 665.065 712.681 1.00 0.00 ? 37   GLN C O  1 
ATOM 6610   C CB . GLN C 2 37   ? 1003.085 666.179 715.786 1.00 0.00 ? 37   GLN C CB 1 
ATOM 6611   N N  . GLN C 2 38   ? 1004.675 664.296 714.067 1.00 0.00 ? 38   GLN C N  1 
ATOM 6612   C CA . GLN C 2 38   ? 1005.585 664.096 712.975 1.00 0.00 ? 38   GLN C CA 1 
ATOM 6613   C C  . GLN C 2 38   ? 1004.976 663.087 712.048 1.00 0.00 ? 38   GLN C C  1 
ATOM 6614   O O  . GLN C 2 38   ? 1005.007 663.268 710.828 1.00 0.00 ? 38   GLN C O  1 
ATOM 6615   C CB . GLN C 2 38   ? 1006.934 663.620 713.451 1.00 0.00 ? 38   GLN C CB 1 
ATOM 6616   N N  . ALA C 2 39   ? 1004.362 662.023 712.605 1.00 0.00 ? 39   ALA C N  1 
ATOM 6617   C CA . ALA C 2 39   ? 1003.784 660.949 711.836 1.00 0.00 ? 39   ALA C CA 1 
ATOM 6618   C C  . ALA C 2 39   ? 1002.724 661.537 710.937 1.00 0.00 ? 39   ALA C C  1 
ATOM 6619   O O  . ALA C 2 39   ? 1002.557 661.117 709.791 1.00 0.00 ? 39   ALA C O  1 
ATOM 6620   C CB . ALA C 2 39   ? 1003.062 659.937 712.721 1.00 0.00 ? 39   ALA C CB 1 
ATOM 6621   N N  . GLY C 2 40   ? 1001.962 662.516 711.456 1.00 0.00 ? 40   GLY C N  1 
ATOM 6622   C CA . GLY C 2 40   ? 1000.932 663.173 710.696 1.00 0.00 ? 40   GLY C CA 1 
ATOM 6623   C C  . GLY C 2 40   ? 1001.557 663.925 709.539 1.00 0.00 ? 40   GLY C C  1 
ATOM 6624   O O  . GLY C 2 40   ? 1001.034 663.925 708.424 1.00 0.00 ? 40   GLY C O  1 
ATOM 6625   N N  . GLU C 2 41   ? 1002.714 664.581 709.792 1.00 0.00 ? 41   GLU C N  1 
ATOM 6626   C CA . GLU C 2 41   ? 1003.412 665.443 708.854 1.00 0.00 ? 41   GLU C CA 1 
ATOM 6627   C C  . GLU C 2 41   ? 1003.886 664.677 707.625 1.00 0.00 ? 41   GLU C C  1 
ATOM 6628   O O  . GLU C 2 41   ? 1003.842 665.196 706.509 1.00 0.00 ? 41   GLU C O  1 
ATOM 6629   C CB . GLU C 2 41   ? 1004.677 666.109 709.453 1.00 0.00 ? 41   GLU C CB 1 
ATOM 6630   N N  . ARG C 2 42   ? 1004.343 663.413 707.802 1.00 0.00 ? 42   ARG C N  1 
ATOM 6631   C CA . ARG C 2 42   ? 1004.961 662.574 706.792 1.00 0.00 ? 42   ARG C CA 1 
ATOM 6632   C C  . ARG C 2 42   ? 1004.027 662.281 705.583 1.00 0.00 ? 42   ARG C C  1 
ATOM 6633   O O  . ARG C 2 42   ? 1004.526 662.083 704.478 1.00 0.00 ? 42   ARG C O  1 
ATOM 6634   C CB . ARG C 2 42   ? 1005.445 661.198 707.306 1.00 0.00 ? 42   ARG C CB 1 
ATOM 6635   N N  . PRO C 2 173  ? 1044.891 740.003 726.197 1.00 0.00 ? 173  PRO C N  1 
ATOM 6636   C CA . PRO C 2 173  ? 1045.745 740.525 727.269 1.00 0.00 ? 173  PRO C CA 1 
ATOM 6637   C C  . PRO C 2 173  ? 1046.747 739.555 727.809 1.00 0.00 ? 173  PRO C C  1 
ATOM 6638   O O  . PRO C 2 173  ? 1047.169 738.640 727.104 1.00 0.00 ? 173  PRO C O  1 
ATOM 6639   C CB . PRO C 2 173  ? 1044.661 740.979 728.279 1.00 0.00 ? 173  PRO C CB 1 
ATOM 6640   N N  . GLY C 2 174  ? 1047.171 739.740 729.076 1.00 0.00 ? 174  GLY C N  1 
ATOM 6641   C CA . GLY C 2 174  ? 1048.151 738.847 729.625 1.00 0.00 ? 174  GLY C CA 1 
ATOM 6642   C C  . GLY C 2 174  ? 1048.552 739.369 730.967 1.00 0.00 ? 174  GLY C C  1 
ATOM 6643   O O  . GLY C 2 174  ? 1048.833 738.606 731.890 1.00 0.00 ? 174  GLY C O  1 
ATOM 6644   N N  . ARG C 2 175  ? 1048.579 740.706 731.103 1.00 0.00 ? 175  ARG C N  1 
ATOM 6645   C CA . ARG C 2 175  ? 1048.962 741.331 732.332 1.00 0.00 ? 175  ARG C CA 1 
ATOM 6646   C C  . ARG C 2 175  ? 1050.290 740.864 732.822 1.00 0.00 ? 175  ARG C C  1 
ATOM 6647   O O  . ARG C 2 175  ? 1050.388 740.182 733.840 1.00 0.00 ? 175  ARG C O  1 
ATOM 6648   C CB . ARG C 2 175  ? 1047.960 741.163 733.481 1.00 0.00 ? 175  ARG C CB 1 
ATOM 6649   N N  . SER C 2 176  ? 1051.356 741.211 732.081 1.00 0.00 ? 176  SER C N  1 
ATOM 6650   C CA . SER C 2 176  ? 1052.675 740.959 732.571 1.00 0.00 ? 176  SER C CA 1 
ATOM 6651   C C  . SER C 2 176  ? 1052.840 741.898 733.722 1.00 0.00 ? 176  SER C C  1 
ATOM 6652   O O  . SER C 2 176  ? 1053.700 741.719 734.583 1.00 0.00 ? 176  SER C O  1 
ATOM 6653   C CB . SER C 2 176  ? 1053.771 741.297 731.549 1.00 0.00 ? 176  SER C CB 1 
ATOM 6654   N N  . SER C 2 177  ? 1051.970 742.929 733.765 1.00 0.00 ? 177  SER C N  1 
ATOM 6655   C CA . SER C 2 177  ? 1052.030 743.946 734.772 1.00 0.00 ? 177  SER C CA 1 
ATOM 6656   C C  . SER C 2 177  ? 1052.021 743.277 736.105 1.00 0.00 ? 177  SER C C  1 
ATOM 6657   O O  . SER C 2 177  ? 1052.956 743.458 736.881 1.00 0.00 ? 177  SER C O  1 
ATOM 6658   C CB . SER C 2 177  ? 1050.835 744.913 734.696 1.00 0.00 ? 177  SER C CB 1 
ATOM 6659   N N  . LEU C 2 178  ? 1050.977 742.483 736.426 1.00 0.00 ? 178  LEU C N  1 
ATOM 6660   C CA . LEU C 2 178  ? 1051.108 741.793 737.672 1.00 0.00 ? 178  LEU C CA 1 
ATOM 6661   C C  . LEU C 2 178  ? 1051.585 740.414 737.354 1.00 0.00 ? 178  LEU C C  1 
ATOM 6662   O O  . LEU C 2 178  ? 1051.009 739.673 736.559 1.00 0.00 ? 178  LEU C O  1 
ATOM 6663   C CB . LEU C 2 178  ? 1049.875 741.785 738.612 1.00 0.00 ? 178  LEU C CB 1 
ATOM 6664   N N  . ASP C 2 179  ? 1052.731 740.094 737.969 1.00 0.00 ? 179  ASP C N  1 
ATOM 6665   C CA . ASP C 2 179  ? 1053.498 738.906 737.796 1.00 0.00 ? 179  ASP C CA 1 
ATOM 6666   C C  . ASP C 2 179  ? 1054.860 739.484 737.932 1.00 0.00 ? 179  ASP C C  1 
ATOM 6667   O O  . ASP C 2 179  ? 1055.731 738.973 738.636 1.00 0.00 ? 179  ASP C O  1 
ATOM 6668   C CB . ASP C 2 179  ? 1053.374 738.307 736.387 1.00 0.00 ? 179  ASP C CB 1 
ATOM 6669   N N  . ASN C 2 180  ? 1055.031 740.614 737.221 1.00 0.00 ? 180  ASN C N  1 
ATOM 6670   C CA . ASN C 2 180  ? 1056.183 741.447 737.330 1.00 0.00 ? 180  ASN C CA 1 
ATOM 6671   C C  . ASN C 2 180  ? 1056.103 741.989 738.721 1.00 0.00 ? 180  ASN C C  1 
ATOM 6672   O O  . ASN C 2 180  ? 1057.071 741.961 739.478 1.00 0.00 ? 180  ASN C O  1 
ATOM 6673   C CB . ASN C 2 180  ? 1056.097 742.638 736.356 1.00 0.00 ? 180  ASN C CB 1 
ATOM 6674   N N  . ILE C 2 181  ? 1054.900 742.475 739.085 1.00 0.00 ? 181  ILE C N  1 
ATOM 6675   C CA . ILE C 2 181  ? 1054.667 743.014 740.388 1.00 0.00 ? 181  ILE C CA 1 
ATOM 6676   C C  . ILE C 2 181  ? 1054.791 741.904 741.375 1.00 0.00 ? 181  ILE C C  1 
ATOM 6677   O O  . ILE C 2 181  ? 1055.383 742.069 742.441 1.00 0.00 ? 181  ILE C O  1 
ATOM 6678   C CB . ILE C 2 181  ? 1053.307 743.638 740.558 1.00 0.00 ? 181  ILE C CB 1 
ATOM 6679   N N  . GLU C 2 182  ? 1054.244 740.727 741.027 1.00 0.00 ? 182  GLU C N  1 
ATOM 6680   C CA . GLU C 2 182  ? 1054.276 739.613 741.922 1.00 0.00 ? 182  GLU C CA 1 
ATOM 6681   C C  . GLU C 2 182  ? 1055.706 739.293 742.203 1.00 0.00 ? 182  GLU C C  1 
ATOM 6682   O O  . GLU C 2 182  ? 1056.090 739.081 743.352 1.00 0.00 ? 182  GLU C O  1 
ATOM 6683   C CB . GLU C 2 182  ? 1053.656 738.347 741.307 1.00 0.00 ? 182  GLU C CB 1 
ATOM 6684   N N  . MET C 2 183  ? 1056.533 739.261 741.145 1.00 0.00 ? 183  MET C N  1 
ATOM 6685   C CA . MET C 2 183  ? 1057.914 738.911 741.280 1.00 0.00 ? 183  MET C CA 1 
ATOM 6686   C C  . MET C 2 183  ? 1058.653 739.948 742.068 1.00 0.00 ? 183  MET C C  1 
ATOM 6687   O O  . MET C 2 183  ? 1059.520 739.610 742.872 1.00 0.00 ? 183  MET C O  1 
ATOM 6688   C CB . MET C 2 183  ? 1058.613 738.712 739.926 1.00 0.00 ? 183  MET C CB 1 
ATOM 6689   N N  . ALA C 2 184  ? 1058.342 741.242 741.862 1.00 0.00 ? 184  ALA C N  1 
ATOM 6690   C CA . ALA C 2 184  ? 1059.064 742.272 742.555 1.00 0.00 ? 184  ALA C CA 1 
ATOM 6691   C C  . ALA C 2 184  ? 1058.846 742.125 744.028 1.00 0.00 ? 184  ALA C C  1 
ATOM 6692   O O  . ALA C 2 184  ? 1059.788 742.209 744.813 1.00 0.00 ? 184  ALA C O  1 
ATOM 6693   C CB . ALA C 2 184  ? 1058.603 743.686 742.160 1.00 0.00 ? 184  ALA C CB 1 
ATOM 6694   N N  . TYR C 2 185  ? 1057.585 741.894 744.437 1.00 0.00 ? 185  TYR C N  1 
ATOM 6695   C CA . TYR C 2 185  ? 1057.228 741.735 745.818 1.00 0.00 ? 185  TYR C CA 1 
ATOM 6696   C C  . TYR C 2 185  ? 1057.863 740.499 746.369 1.00 0.00 ? 185  TYR C C  1 
ATOM 6697   O O  . TYR C 2 185  ? 1058.391 740.507 747.479 1.00 0.00 ? 185  TYR C O  1 
ATOM 6698   C CB . TYR C 2 185  ? 1055.705 741.646 746.008 1.00 0.00 ? 185  TYR C CB 1 
ATOM 6699   N N  . ALA C 2 186  ? 1057.838 739.401 745.593 1.00 0.00 ? 186  ALA C N  1 
ATOM 6700   C CA . ALA C 2 186  ? 1058.388 738.155 746.042 1.00 0.00 ? 186  ALA C CA 1 
ATOM 6701   C C  . ALA C 2 186  ? 1059.847 738.352 746.284 1.00 0.00 ? 186  ALA C C  1 
ATOM 6702   O O  . ALA C 2 186  ? 1060.412 737.802 747.228 1.00 0.00 ? 186  ALA C O  1 
ATOM 6703   C CB . ALA C 2 186  ? 1058.242 737.030 745.003 1.00 0.00 ? 186  ALA C CB 1 
ATOM 6704   N N  . ARG C 2 187  ? 1060.493 739.155 745.423 1.00 0.00 ? 187  ARG C N  1 
ATOM 6705   C CA . ARG C 2 187  ? 1061.904 739.376 745.500 1.00 0.00 ? 187  ARG C CA 1 
ATOM 6706   C C  . ARG C 2 187  ? 1062.208 739.987 746.835 1.00 0.00 ? 187  ARG C C  1 
ATOM 6707   O O  . ARG C 2 187  ? 1063.142 739.572 747.520 1.00 0.00 ? 187  ARG C O  1 
ATOM 6708   C CB . ARG C 2 187  ? 1062.370 740.362 744.413 1.00 0.00 ? 187  ARG C CB 1 
ATOM 6709   N N  . GLN C 2 188  ? 1061.399 740.981 747.247 1.00 0.00 ? 188  GLN C N  1 
ATOM 6710   C CA . GLN C 2 188  ? 1061.617 741.694 748.471 1.00 0.00 ? 188  GLN C CA 1 
ATOM 6711   C C  . GLN C 2 188  ? 1061.439 740.793 749.659 1.00 0.00 ? 188  GLN C C  1 
ATOM 6712   O O  . GLN C 2 188  ? 1062.192 740.878 750.627 1.00 0.00 ? 188  GLN C O  1 
ATOM 6713   C CB . GLN C 2 188  ? 1060.664 742.881 748.627 1.00 0.00 ? 188  GLN C CB 1 
ATOM 6714   N N  . ILE C 2 189  ? 1060.432 739.903 749.652 1.00 0.00 ? 189  ILE C N  1 
ATOM 6715   C CA . ILE C 2 189  ? 1060.291 739.073 750.813 1.00 0.00 ? 189  ILE C CA 1 
ATOM 6716   C C  . ILE C 2 189  ? 1061.498 738.196 750.896 1.00 0.00 ? 189  ILE C C  1 
ATOM 6717   O O  . ILE C 2 189  ? 1062.035 737.953 751.975 1.00 0.00 ? 189  ILE C O  1 
ATOM 6718   C CB . ILE C 2 189  ? 1059.092 738.170 750.821 1.00 0.00 ? 189  ILE C CB 1 
ATOM 6719   N N  . TYR C 2 190  ? 1061.963 737.720 749.726 1.00 0.00 ? 190  TYR C N  1 
ATOM 6720   C CA . TYR C 2 190  ? 1063.057 736.800 749.618 1.00 0.00 ? 190  TYR C CA 1 
ATOM 6721   C C  . TYR C 2 190  ? 1064.273 737.408 750.243 1.00 0.00 ? 190  TYR C C  1 
ATOM 6722   O O  . TYR C 2 190  ? 1064.980 736.739 750.993 1.00 0.00 ? 190  TYR C O  1 
ATOM 6723   C CB . TYR C 2 190  ? 1063.342 736.489 748.135 1.00 0.00 ? 190  TYR C CB 1 
ATOM 6724   N N  . ILE C 2 191  ? 1064.557 738.692 749.951 1.00 0.00 ? 191  ILE C N  1 
ATOM 6725   C CA . ILE C 2 191  ? 1065.697 739.339 750.538 1.00 0.00 ? 191  ILE C CA 1 
ATOM 6726   C C  . ILE C 2 191  ? 1065.500 739.440 752.015 1.00 0.00 ? 191  ILE C C  1 
ATOM 6727   O O  . ILE C 2 191  ? 1066.445 739.269 752.783 1.00 0.00 ? 191  ILE C O  1 
ATOM 6728   C CB . ILE C 2 191  ? 1066.006 740.695 749.954 1.00 0.00 ? 191  ILE C CB 1 
ATOM 6729   N N  . TYR C 2 192  ? 1064.260 739.715 752.454 1.00 0.00 ? 192  TYR C N  1 
ATOM 6730   C CA . TYR C 2 192  ? 1063.942 739.847 753.850 1.00 0.00 ? 192  TYR C CA 1 
ATOM 6731   C C  . TYR C 2 192  ? 1064.241 738.540 754.537 1.00 0.00 ? 192  TYR C C  1 
ATOM 6732   O O  . TYR C 2 192  ? 1064.833 738.530 755.615 1.00 0.00 ? 192  TYR C O  1 
ATOM 6733   C CB . TYR C 2 192  ? 1062.467 740.277 754.026 1.00 0.00 ? 192  TYR C CB 1 
ATOM 6734   N N  . ASN C 2 193  ? 1063.871 737.394 753.927 1.00 0.00 ? 193  ASN C N  1 
ATOM 6735   C CA . ASN C 2 193  ? 1064.138 736.103 754.512 1.00 0.00 ? 193  ASN C CA 1 
ATOM 6736   C C  . ASN C 2 193  ? 1065.618 735.878 754.562 1.00 0.00 ? 193  ASN C C  1 
ATOM 6737   O O  . ASN C 2 193  ? 1066.132 735.222 755.466 1.00 0.00 ? 193  ASN C O  1 
ATOM 6738   C CB . ASN C 2 193  ? 1063.499 734.945 753.732 1.00 0.00 ? 193  ASN C CB 1 
ATOM 6739   N N  . GLU C 2 194  ? 1066.362 736.381 753.567 1.00 0.00 ? 194  GLU C N  1 
ATOM 6740   C CA . GLU C 2 194  ? 1067.776 736.164 753.622 1.00 0.00 ? 194  GLU C CA 1 
ATOM 6741   C C  . GLU C 2 194  ? 1068.337 736.884 754.811 1.00 0.00 ? 194  GLU C C  1 
ATOM 6742   O O  . GLU C 2 194  ? 1069.183 736.339 755.518 1.00 0.00 ? 194  GLU C O  1 
ATOM 6743   C CB . GLU C 2 194  ? 1068.513 736.666 752.367 1.00 0.00 ? 194  GLU C CB 1 
ATOM 6744   N N  . LYS C 2 195  ? 1067.873 738.128 755.065 1.00 0.00 ? 195  LYS C N  1 
ATOM 6745   C CA . LYS C 2 195  ? 1068.367 738.918 756.159 1.00 0.00 ? 195  LYS C CA 1 
ATOM 6746   C C  . LYS C 2 195  ? 1068.066 738.252 757.452 1.00 0.00 ? 195  LYS C C  1 
ATOM 6747   O O  . LYS C 2 195  ? 1068.929 738.174 758.319 1.00 0.00 ? 195  LYS C O  1 
ATOM 6748   C CB . LYS C 2 195  ? 1067.694 740.280 756.305 1.00 0.00 ? 195  LYS C CB 1 
ATOM 6749   N N  . ILE C 2 196  ? 1066.835 737.742 757.630 1.00 0.00 ? 196  ILE C N  1 
ATOM 6750   C CA . ILE C 2 196  ? 1066.496 737.167 758.899 1.00 0.00 ? 196  ILE C CA 1 
ATOM 6751   C C  . ILE C 2 196  ? 1067.425 736.024 759.149 1.00 0.00 ? 196  ILE C C  1 
ATOM 6752   O O  . ILE C 2 196  ? 1067.925 735.843 760.258 1.00 0.00 ? 196  ILE C O  1 
ATOM 6753   C CB . ILE C 2 196  ? 1065.076 736.670 758.961 1.00 0.00 ? 196  ILE C CB 1 
ATOM 6754   N N  . VAL C 2 197  ? 1067.684 735.217 758.106 1.00 0.00 ? 197  VAL C N  1 
ATOM 6755   C CA . VAL C 2 197  ? 1068.566 734.096 758.235 1.00 0.00 ? 197  VAL C CA 1 
ATOM 6756   C C  . VAL C 2 197  ? 1069.950 734.599 758.536 1.00 0.00 ? 197  VAL C C  1 
ATOM 6757   O O  . VAL C 2 197  ? 1070.659 734.014 759.353 1.00 0.00 ? 197  VAL C O  1 
ATOM 6758   C CB . VAL C 2 197  ? 1068.649 733.280 756.979 1.00 0.00 ? 197  VAL C CB 1 
ATOM 6759   N N  . ASN C 2 198  ? 1070.372 735.712 757.894 1.00 0.00 ? 198  ASN C N  1 
ATOM 6760   C CA . ASN C 2 198  ? 1071.737 736.151 758.028 1.00 0.00 ? 198  ASN C CA 1 
ATOM 6761   C C  . ASN C 2 198  ? 1071.878 737.222 759.074 1.00 0.00 ? 198  ASN C C  1 
ATOM 6762   O O  . ASN C 2 198  ? 1072.931 737.851 759.170 1.00 0.00 ? 198  ASN C O  1 
ATOM 6763   C CB . ASN C 2 198  ? 1072.255 736.752 756.708 1.00 0.00 ? 198  ASN C CB 1 
ATOM 6764   N N  . GLY C 2 199  ? 1070.850 737.446 759.912 1.00 0.00 ? 199  GLY C N  1 
ATOM 6765   C CA . GLY C 2 199  ? 1070.979 738.428 760.953 1.00 0.00 ? 199  GLY C CA 1 
ATOM 6766   C C  . GLY C 2 199  ? 1071.349 739.761 760.365 1.00 0.00 ? 199  GLY C C  1 
ATOM 6767   O O  . GLY C 2 199  ? 1072.337 740.365 760.784 1.00 0.00 ? 199  GLY C O  1 
ATOM 6768   N N  . HIS C 2 200  ? 1070.561 740.251 759.383 1.00 0.00 ? 200  HIS C N  1 
ATOM 6769   C CA . HIS C 2 200  ? 1070.864 741.501 758.744 1.00 0.00 ? 200  HIS C CA 1 
ATOM 6770   C C  . HIS C 2 200  ? 1069.915 742.562 759.240 1.00 0.00 ? 200  HIS C C  1 
ATOM 6771   O O  . HIS C 2 200  ? 1069.077 742.303 760.105 1.00 0.00 ? 200  HIS C O  1 
ATOM 6772   C CB . HIS C 2 200  ? 1070.804 741.419 757.207 1.00 0.00 ? 200  HIS C CB 1 
ATOM 6773   N N  . LEU C 2 201  ? 1070.092 743.812 758.747 1.00 0.00 ? 201  LEU C N  1 
ATOM 6774   C CA . LEU C 2 201  ? 1069.327 744.947 759.170 1.00 0.00 ? 201  LEU C CA 1 
ATOM 6775   C C  . LEU C 2 201  ? 1068.540 745.549 758.020 1.00 0.00 ? 201  LEU C C  1 
ATOM 6776   O O  . LEU C 2 201  ? 1068.249 746.743 757.979 1.00 0.00 ? 201  LEU C O  1 
ATOM 6777   C CB . LEU C 2 201  ? 1070.287 745.964 759.844 1.00 0.00 ? 201  LEU C CB 1 
ATOM 6778   N N  . GLN C 2 202  ? 1068.076 744.701 757.082 1.00 0.00 ? 202  GLN C N  1 
ATOM 6779   C CA . GLN C 2 202  ? 1067.297 745.083 755.938 1.00 0.00 ? 202  GLN C CA 1 
ATOM 6780   C C  . GLN C 2 202  ? 1065.928 745.570 756.358 1.00 0.00 ? 202  GLN C C  1 
ATOM 6781   O O  . GLN C 2 202  ? 1065.184 744.844 757.017 1.00 0.00 ? 202  GLN C O  1 
ATOM 6782   C CB . GLN C 2 202  ? 1067.064 743.888 755.015 1.00 0.00 ? 202  GLN C CB 1 
ATOM 6783   N N  . PRO C 2 203  ? 1065.573 746.800 756.020 1.00 0.00 ? 203  PRO C N  1 
ATOM 6784   C CA . PRO C 2 203  ? 1064.226 747.248 756.297 1.00 0.00 ? 203  PRO C CA 1 
ATOM 6785   C C  . PRO C 2 203  ? 1063.244 746.870 755.225 1.00 0.00 ? 203  PRO C C  1 
ATOM 6786   O O  . PRO C 2 203  ? 1063.503 747.122 754.049 1.00 0.00 ? 203  PRO C O  1 
ATOM 6787   C CB . PRO C 2 203  ? 1064.295 748.764 756.533 1.00 0.00 ? 203  PRO C CB 1 
ATOM 6788   N N  . ASN C 2 204  ? 1062.090 746.306 755.615 1.00 0.00 ? 204  ASN C N  1 
ATOM 6789   C CA . ASN C 2 204  ? 1061.071 745.909 754.685 1.00 0.00 ? 204  ASN C CA 1 
ATOM 6790   C C  . ASN C 2 204  ? 1060.446 747.128 754.094 1.00 0.00 ? 204  ASN C C  1 
ATOM 6791   O O  . ASN C 2 204  ? 1060.295 747.245 752.880 1.00 0.00 ? 204  ASN C O  1 
ATOM 6792   C CB . ASN C 2 204  ? 1059.944 745.122 755.396 1.00 0.00 ? 204  ASN C CB 1 
ATOM 6793   N N  . LEU C 2 205  ? 1060.088 748.071 754.977 1.00 0.00 ? 205  LEU C N  1 
ATOM 6794   C CA . LEU C 2 205  ? 1059.278 749.194 754.628 1.00 0.00 ? 205  LEU C CA 1 
ATOM 6795   C C  . LEU C 2 205  ? 1060.000 750.158 753.743 1.00 0.00 ? 205  LEU C C  1 
ATOM 6796   O O  . LEU C 2 205  ? 1059.403 750.723 752.828 1.00 0.00 ? 205  LEU C O  1 
ATOM 6797   C CB . LEU C 2 205  ? 1058.725 749.844 755.881 1.00 0.00 ? 205  LEU C CB 1 
ATOM 6798   N N  . VAL C 2 206  ? 1061.307 750.376 753.969 1.00 0.00 ? 206  VAL C N  1 
ATOM 6799   C CA . VAL C 2 206  ? 1062.004 751.301 753.121 1.00 0.00 ? 206  VAL C CA 1 
ATOM 6800   C C  . VAL C 2 206  ? 1061.938 750.751 751.738 1.00 0.00 ? 206  VAL C C  1 
ATOM 6801   O O  . VAL C 2 206  ? 1061.801 751.487 750.762 1.00 0.00 ? 206  VAL C O  1 
ATOM 6802   C CB . VAL C 2 206  ? 1063.459 751.444 753.460 1.00 0.00 ? 206  VAL C CB 1 
ATOM 6803   N N  . ASP C 2 207  ? 1062.031 749.415 751.641 1.00 0.00 ? 207  ASP C N  1 
ATOM 6804   C CA . ASP C 2 207  ? 1062.054 748.745 750.380 1.00 0.00 ? 207  ASP C CA 1 
ATOM 6805   C C  . ASP C 2 207  ? 1060.764 749.010 749.639 1.00 0.00 ? 207  ASP C C  1 
ATOM 6806   O O  . ASP C 2 207  ? 1060.799 749.338 748.454 1.00 0.00 ? 207  ASP C O  1 
ATOM 6807   C CB . ASP C 2 207  ? 1062.254 747.235 750.583 1.00 0.00 ? 207  ASP C CB 1 
ATOM 6808   N N  . LEU C 2 208  ? 1059.588 748.891 750.299 1.00 0.00 ? 208  LEU C N  1 
ATOM 6809   C CA . LEU C 2 208  ? 1058.357 749.185 749.602 1.00 0.00 ? 208  LEU C CA 1 
ATOM 6810   C C  . LEU C 2 208  ? 1058.288 750.633 749.259 1.00 0.00 ? 208  LEU C C  1 
ATOM 6811   O O  . LEU C 2 208  ? 1057.866 750.997 748.162 1.00 0.00 ? 208  LEU C O  1 
ATOM 6812   C CB . LEU C 2 208  ? 1057.050 748.888 750.357 1.00 0.00 ? 208  LEU C CB 1 
ATOM 6813   N N  . CYS C 2 209  ? 1058.735 751.503 750.180 1.00 0.00 ? 209  CYS C N  1 
ATOM 6814   C CA . CYS C 2 209  ? 1058.608 752.914 749.968 1.00 0.00 ? 209  CYS C CA 1 
ATOM 6815   C C  . CYS C 2 209  ? 1059.333 753.243 748.706 1.00 0.00 ? 209  CYS C C  1 
ATOM 6816   O O  . CYS C 2 209  ? 1058.870 754.057 747.906 1.00 0.00 ? 209  CYS C O  1 
ATOM 6817   C CB . CYS C 2 209  ? 1059.241 753.744 751.096 1.00 0.00 ? 209  CYS C CB 1 
ATOM 6818   N N  . ALA C 2 210  ? 1060.487 752.591 748.479 1.00 0.00 ? 210  ALA C N  1 
ATOM 6819   C CA . ALA C 2 210  ? 1061.242 752.901 747.305 1.00 0.00 ? 210  ALA C CA 1 
ATOM 6820   C C  . ALA C 2 210  ? 1060.439 752.588 746.074 1.00 0.00 ? 210  ALA C C  1 
ATOM 6821   O O  . ALA C 2 210  ? 1060.353 753.409 745.165 1.00 0.00 ? 210  ALA C O  1 
ATOM 6822   C CB . ALA C 2 210  ? 1062.542 752.084 747.223 1.00 0.00 ? 210  ALA C CB 1 
ATOM 6823   N N  . SER C 2 211  ? 1059.821 751.394 746.015 1.00 0.00 ? 211  SER C N  1 
ATOM 6824   C CA . SER C 2 211  ? 1059.084 750.972 744.849 1.00 0.00 ? 211  SER C CA 1 
ATOM 6825   C C  . SER C 2 211  ? 1057.784 751.710 744.704 1.00 0.00 ? 211  SER C C  1 
ATOM 6826   O O  . SER C 2 211  ? 1057.380 752.062 743.598 1.00 0.00 ? 211  SER C O  1 
ATOM 6827   C CB . SER C 2 211  ? 1058.736 749.475 744.875 1.00 0.00 ? 211  SER C CB 1 
ATOM 6828   N N  . VAL C 2 212  ? 1057.120 751.989 745.836 1.00 0.00 ? 212  VAL C N  1 
ATOM 6829   C CA . VAL C 2 212  ? 1055.785 752.525 745.906 1.00 0.00 ? 212  VAL C CA 1 
ATOM 6830   C C  . VAL C 2 212  ? 1055.710 753.896 745.314 1.00 0.00 ? 212  VAL C C  1 
ATOM 6831   O O  . VAL C 2 212  ? 1054.637 754.366 744.938 1.00 0.00 ? 212  VAL C O  1 
ATOM 6832   C CB . VAL C 2 212  ? 1055.243 752.553 747.315 1.00 0.00 ? 212  VAL C CB 1 
ATOM 6833   N N  . ALA C 2 213  ? 1056.860 754.567 745.186 1.00 0.00 ? 213  ALA C N  1 
ATOM 6834   C CA . ALA C 2 213  ? 1056.898 755.934 744.764 1.00 0.00 ? 213  ALA C CA 1 
ATOM 6835   C C  . ALA C 2 213  ? 1056.173 756.100 743.459 1.00 0.00 ? 213  ALA C C  1 
ATOM 6836   O O  . ALA C 2 213  ? 1055.609 757.162 743.204 1.00 0.00 ? 213  ALA C O  1 
ATOM 6837   C CB . ALA C 2 213  ? 1058.338 756.430 744.528 1.00 0.00 ? 213  ALA C CB 1 
ATOM 6838   N N  . GLU C 2 214  ? 1056.164 755.065 742.599 1.00 0.00 ? 214  GLU C N  1 
ATOM 6839   C CA . GLU C 2 214  ? 1055.744 755.261 741.243 1.00 0.00 ? 214  GLU C CA 1 
ATOM 6840   C C  . GLU C 2 214  ? 1054.339 755.757 740.973 1.00 0.00 ? 214  GLU C C  1 
ATOM 6841   O O  . GLU C 2 214  ? 1054.293 756.696 740.182 1.00 0.00 ? 214  GLU C O  1 
ATOM 6842   C CB . GLU C 2 214  ? 1056.245 754.141 740.327 1.00 0.00 ? 214  GLU C CB 1 
ATOM 6843   N N  . LEU C 2 215  ? 1053.202 755.214 741.525 1.00 0.00 ? 215  LEU C N  1 
ATOM 6844   C CA . LEU C 2 215  ? 1051.873 755.857 741.398 1.00 0.00 ? 215  LEU C CA 1 
ATOM 6845   C C  . LEU C 2 215  ? 1050.660 754.977 741.642 1.00 0.00 ? 215  LEU C C  1 
ATOM 6846   O O  . LEU C 2 215  ? 1050.651 753.791 741.339 1.00 0.00 ? 215  LEU C O  1 
ATOM 6847   C CB . LEU C 2 215  ? 1051.613 756.776 740.173 1.00 0.00 ? 215  LEU C CB 1 
ATOM 6848   N N  . ASP C 2 216  ? 1049.583 755.608 742.201 1.00 0.00 ? 216  ASP C N  1 
ATOM 6849   C CA . ASP C 2 216  ? 1048.320 755.104 742.738 1.00 0.00 ? 216  ASP C CA 1 
ATOM 6850   C C  . ASP C 2 216  ? 1048.640 754.650 744.124 1.00 0.00 ? 216  ASP C C  1 
ATOM 6851   O O  . ASP C 2 216  ? 1047.850 754.678 745.068 1.00 0.00 ? 216  ASP C O  1 
ATOM 6852   C CB . ASP C 2 216  ? 1047.700 753.886 742.035 1.00 0.00 ? 216  ASP C CB 1 
ATOM 6853   N N  . ASP C 2 217  ? 1049.895 754.231 744.216 1.00 0.00 ? 217  ASP C N  1 
ATOM 6854   C CA . ASP C 2 217  ? 1050.640 753.792 745.321 1.00 0.00 ? 217  ASP C CA 1 
ATOM 6855   C C  . ASP C 2 217  ? 1050.841 755.037 746.129 1.00 0.00 ? 217  ASP C C  1 
ATOM 6856   O O  . ASP C 2 217  ? 1051.341 755.000 747.246 1.00 0.00 ? 217  ASP C O  1 
ATOM 6857   C CB . ASP C 2 217  ? 1051.951 753.199 744.814 1.00 0.00 ? 217  ASP C CB 1 
ATOM 6858   N N  . LYS C 2 218  ? 1050.533 756.214 745.549 1.00 0.00 ? 218  LYS C N  1 
ATOM 6859   C CA . LYS C 2 218  ? 1050.617 757.417 746.333 1.00 0.00 ? 218  LYS C CA 1 
ATOM 6860   C C  . LYS C 2 218  ? 1049.437 757.421 747.251 1.00 0.00 ? 218  LYS C C  1 
ATOM 6861   O O  . LYS C 2 218  ? 1048.472 758.154 747.044 1.00 0.00 ? 218  LYS C O  1 
ATOM 6862   C CB . LYS C 2 218  ? 1050.508 758.696 745.489 1.00 0.00 ? 218  LYS C CB 1 
ATOM 6863   N N  . SER C 2 219  ? 1049.514 756.604 748.314 1.00 0.00 ? 219  SER C N  1 
ATOM 6864   C CA . SER C 2 219  ? 1048.469 756.442 749.284 1.00 0.00 ? 219  SER C CA 1 
ATOM 6865   C C  . SER C 2 219  ? 1048.972 755.325 750.107 1.00 0.00 ? 219  SER C C  1 
ATOM 6866   O O  . SER C 2 219  ? 1049.089 755.396 751.330 1.00 0.00 ? 219  SER C O  1 
ATOM 6867   C CB . SER C 2 219  ? 1047.141 755.949 748.693 1.00 0.00 ? 219  SER C CB 1 
ATOM 6868   N N  . ILE C 2 220  ? 1049.263 754.243 749.373 1.00 0.00 ? 220  ILE C N  1 
ATOM 6869   C CA . ILE C 2 220  ? 1049.810 753.035 749.875 1.00 0.00 ? 220  ILE C CA 1 
ATOM 6870   C C  . ILE C 2 220  ? 1051.155 753.427 750.424 1.00 0.00 ? 220  ILE C C  1 
ATOM 6871   O O  . ILE C 2 220  ? 1051.547 753.010 751.509 1.00 0.00 ? 220  ILE C O  1 
ATOM 6872   C CB . ILE C 2 220  ? 1049.893 752.039 748.743 1.00 0.00 ? 220  ILE C CB 1 
ATOM 6873   N N  . SER C 2 221  ? 1051.854 754.316 749.689 1.00 0.00 ? 221  SER C N  1 
ATOM 6874   C CA . SER C 2 221  ? 1053.166 754.843 749.932 1.00 0.00 ? 221  SER C CA 1 
ATOM 6875   C C  . SER C 2 221  ? 1053.176 755.622 751.206 1.00 0.00 ? 221  SER C C  1 
ATOM 6876   O O  . SER C 2 221  ? 1054.086 755.470 752.020 1.00 0.00 ? 221  SER C O  1 
ATOM 6877   C CB . SER C 2 221  ? 1053.617 755.811 748.821 1.00 0.00 ? 221  SER C CB 1 
ATOM 6878   N N  . ASP C 2 222  ? 1052.163 756.487 751.401 1.00 0.00 ? 222  ASP C N  1 
ATOM 6879   C CA . ASP C 2 222  ? 1052.094 757.310 752.568 1.00 0.00 ? 222  ASP C CA 1 
ATOM 6880   C C  . ASP C 2 222  ? 1051.887 756.403 753.740 1.00 0.00 ? 222  ASP C C  1 
ATOM 6881   O O  . ASP C 2 222  ? 1052.383 756.641 754.839 1.00 0.00 ? 222  ASP C O  1 
ATOM 6882   C CB . ASP C 2 222  ? 1050.927 758.309 752.522 1.00 0.00 ? 222  ASP C CB 1 
ATOM 6883   N N  . MET C 2 223  ? 1051.132 755.321 753.515 1.00 0.00 ? 223  MET C N  1 
ATOM 6884   C CA . MET C 2 223  ? 1050.812 754.320 754.490 1.00 0.00 ? 223  MET C CA 1 
ATOM 6885   C C  . MET C 2 223  ? 1052.092 753.701 754.967 1.00 0.00 ? 223  MET C C  1 
ATOM 6886   O O  . MET C 2 223  ? 1052.293 753.518 756.166 1.00 0.00 ? 223  MET C O  1 
ATOM 6887   C CB . MET C 2 223  ? 1049.988 753.248 753.772 1.00 0.00 ? 223  MET C CB 1 
ATOM 6888   N N  . TRP C 2 224  ? 1052.998 753.370 754.025 1.00 0.00 ? 224  TRP C N  1 
ATOM 6889   C CA . TRP C 2 224  ? 1054.262 752.764 754.335 1.00 0.00 ? 224  TRP C CA 1 
ATOM 6890   C C  . TRP C 2 224  ? 1055.091 753.731 755.120 1.00 0.00 ? 224  TRP C C  1 
ATOM 6891   O O  . TRP C 2 224  ? 1055.752 753.345 756.077 1.00 0.00 ? 224  TRP C O  1 
ATOM 6892   C CB . TRP C 2 224  ? 1055.041 752.344 753.076 1.00 0.00 ? 224  TRP C CB 1 
ATOM 6893   N N  . THR C 2 225  ? 1055.086 755.026 754.763 1.00 0.00 ? 225  THR C N  1 
ATOM 6894   C CA . THR C 2 225  ? 1055.921 755.908 755.525 1.00 0.00 ? 225  THR C CA 1 
ATOM 6895   C C  . THR C 2 225  ? 1055.420 755.951 756.937 1.00 0.00 ? 225  THR C C  1 
ATOM 6896   O O  . THR C 2 225  ? 1056.209 756.040 757.877 1.00 0.00 ? 225  THR C O  1 
ATOM 6897   C CB . THR C 2 225  ? 1056.029 757.309 754.985 1.00 0.00 ? 225  THR C CB 1 
ATOM 6898   N N  . MET C 2 226  ? 1054.086 755.884 757.123 1.00 0.00 ? 226  MET C N  1 
ATOM 6899   C CA . MET C 2 226  ? 1053.525 755.912 758.442 1.00 0.00 ? 226  MET C CA 1 
ATOM 6900   C C  . MET C 2 226  ? 1054.048 754.746 759.220 1.00 0.00 ? 226  MET C C  1 
ATOM 6901   O O  . MET C 2 226  ? 1054.458 754.901 760.368 1.00 0.00 ? 226  MET C O  1 
ATOM 6902   C CB . MET C 2 226  ? 1051.991 755.814 758.441 1.00 0.00 ? 226  MET C CB 1 
ATOM 6903   N N  . VAL C 2 227  ? 1054.069 753.547 758.606 1.00 0.00 ? 227  VAL C N  1 
ATOM 6904   C CA . VAL C 2 227  ? 1054.530 752.377 759.294 1.00 0.00 ? 227  VAL C CA 1 
ATOM 6905   C C  . VAL C 2 227  ? 1055.981 752.533 759.635 1.00 0.00 ? 227  VAL C C  1 
ATOM 6906   O O  . VAL C 2 227  ? 1056.406 752.161 760.725 1.00 0.00 ? 227  VAL C O  1 
ATOM 6907   C CB . VAL C 2 227  ? 1054.361 751.113 758.502 1.00 0.00 ? 227  VAL C CB 1 
ATOM 6908   N N  . LYS C 2 228  ? 1056.776 753.100 758.705 1.00 0.00 ? 228  LYS C N  1 
ATOM 6909   C CA . LYS C 2 228  ? 1058.200 753.157 758.864 1.00 0.00 ? 228  LYS C CA 1 
ATOM 6910   C C  . LYS C 2 228  ? 1058.553 754.067 759.987 1.00 0.00 ? 228  LYS C C  1 
ATOM 6911   O O  . LYS C 2 228  ? 1059.534 753.823 760.686 1.00 0.00 ? 228  LYS C O  1 
ATOM 6912   C CB . LYS C 2 228  ? 1058.984 753.653 757.641 1.00 0.00 ? 228  LYS C CB 1 
ATOM 6913   N N  . GLN C 2 229  ? 1057.778 755.149 760.196 1.00 0.00 ? 229  GLN C N  1 
ATOM 6914   C CA . GLN C 2 229  ? 1058.138 756.069 761.239 1.00 0.00 ? 229  GLN C CA 1 
ATOM 6915   C C  . GLN C 2 229  ? 1058.099 755.292 762.515 1.00 0.00 ? 229  GLN C C  1 
ATOM 6916   O O  . GLN C 2 229  ? 1058.880 755.528 763.431 1.00 0.00 ? 229  GLN C O  1 
ATOM 6917   C CB . GLN C 2 229  ? 1057.236 757.326 761.308 1.00 0.00 ? 229  GLN C CB 1 
ATOM 6918   N N  . MET C 2 230  ? 1057.190 754.305 762.533 1.00 0.00 ? 230  MET C N  1 
ATOM 6919   C CA . MET C 2 230  ? 1056.879 753.365 763.568 1.00 0.00 ? 230  MET C CA 1 
ATOM 6920   C C  . MET C 2 230  ? 1058.032 752.412 763.741 1.00 0.00 ? 230  MET C C  1 
ATOM 6921   O O  . MET C 2 230  ? 1058.018 751.611 764.672 1.00 0.00 ? 230  MET C O  1 
ATOM 6922   C CB . MET C 2 230  ? 1055.594 752.554 763.300 1.00 0.00 ? 230  MET C CB 1 
ATOM 6923   N N  . THR C 2 231  ? 1058.990 752.348 762.786 1.00 0.00 ? 231  THR C N  1 
ATOM 6924   C CA . THR C 2 231  ? 1060.119 751.450 762.903 1.00 0.00 ? 231  THR C CA 1 
ATOM 6925   C C  . THR C 2 231  ? 1060.836 751.737 764.184 1.00 0.00 ? 231  THR C C  1 
ATOM 6926   O O  . THR C 2 231  ? 1061.350 752.825 764.421 1.00 0.00 ? 231  THR C O  1 
ATOM 6927   C CB . THR C 2 231  ? 1061.133 751.506 761.781 1.00 0.00 ? 231  THR C CB 1 
ATOM 6928   N N  . ASP C 2 232  ? 1060.800 750.754 765.110 1.00 0.00 ? 232  ASP C N  1 
ATOM 6929   C CA . ASP C 2 232  ? 1061.369 750.818 766.429 1.00 0.00 ? 232  ASP C CA 1 
ATOM 6930   C C  . ASP C 2 232  ? 1060.643 751.890 767.183 1.00 0.00 ? 232  ASP C C  1 
ATOM 6931   O O  . ASP C 2 232  ? 1060.976 752.197 768.326 1.00 0.00 ? 232  ASP C O  1 
ATOM 6932   C CB . ASP C 2 232  ? 1062.855 751.175 766.454 1.00 0.00 ? 232  ASP C CB 1 
ATOM 6933   N N  . VAL C 2 233  ? 1059.617 752.474 766.540 1.00 0.00 ? 233  VAL C N  1 
ATOM 6934   C CA . VAL C 2 233  ? 1058.795 753.408 767.166 1.00 0.00 ? 233  VAL C CA 1 
ATOM 6935   C C  . VAL C 2 233  ? 1057.909 752.557 767.840 1.00 0.00 ? 233  VAL C C  1 
ATOM 6936   O O  . VAL C 2 233  ? 1056.947 751.965 767.340 1.00 0.00 ? 233  VAL C O  1 
ATOM 6937   C CB . VAL C 2 233  ? 1058.000 754.432 766.424 1.00 0.00 ? 233  VAL C CB 1 
ATOM 6938   N N  . LEU C 2 234  ? 1058.414 752.392 769.023 1.00 0.00 ? 234  LEU C N  1 
ATOM 6939   C CA . LEU C 2 234  ? 1057.679 751.759 769.969 1.00 0.00 ? 234  LEU C CA 1 
ATOM 6940   C C  . LEU C 2 234  ? 1057.128 753.107 770.361 1.00 0.00 ? 234  LEU C C  1 
ATOM 6941   O O  . LEU C 2 234  ? 1057.812 754.061 770.755 1.00 0.00 ? 234  LEU C O  1 
ATOM 6942   C CB . LEU C 2 234  ? 1058.681 751.183 770.957 1.00 0.00 ? 234  LEU C CB 1 
ATOM 6943   N N  . VAL C 2 250  ? 1061.797 754.300 772.892 1.00 0.00 ? 250  VAL C N  1 
ATOM 6944   C CA . VAL C 2 250  ? 1060.517 754.507 772.283 1.00 0.00 ? 250  VAL C CA 1 
ATOM 6945   C C  . VAL C 2 250  ? 1059.728 753.295 772.724 1.00 0.00 ? 250  VAL C C  1 
ATOM 6946   O O  . VAL C 2 250  ? 1060.329 752.246 772.735 1.00 0.00 ? 250  VAL C O  1 
ATOM 6947   C CB . VAL C 2 250  ? 1061.111 754.605 770.888 1.00 0.00 ? 250  VAL C CB 1 
ATOM 6948   N N  . ARG C 2 251  ? 1058.535 753.575 773.393 1.00 0.00 ? 251  ARG C N  1 
ATOM 6949   C CA . ARG C 2 251  ? 1057.596 752.634 774.014 1.00 0.00 ? 251  ARG C CA 1 
ATOM 6950   C C  . ARG C 2 251  ? 1056.473 751.979 773.221 1.00 0.00 ? 251  ARG C C  1 
ATOM 6951   O O  . ARG C 2 251  ? 1056.305 750.766 773.229 1.00 0.00 ? 251  ARG C O  1 
ATOM 6952   C CB . ARG C 2 251  ? 1056.923 753.253 775.255 1.00 0.00 ? 251  ARG C CB 1 
ATOM 6953   N N  . MET C 2 252  ? 1055.609 752.810 772.616 1.00 0.00 ? 252  MET C N  1 
ATOM 6954   C CA . MET C 2 252  ? 1054.578 752.531 771.616 1.00 0.00 ? 252  MET C CA 1 
ATOM 6955   C C  . MET C 2 252  ? 1053.274 752.819 772.189 1.00 0.00 ? 252  MET C C  1 
ATOM 6956   O O  . MET C 2 252  ? 1052.621 751.952 772.756 1.00 0.00 ? 252  MET C O  1 
ATOM 6957   C CB . MET C 2 252  ? 1054.489 751.121 770.933 1.00 0.00 ? 252  MET C CB 1 
ATOM 6958   N N  . GLU C 2 253  ? 1052.873 754.062 772.003 1.00 0.00 ? 253  GLU C N  1 
ATOM 6959   C CA . GLU C 2 253  ? 1051.659 754.538 772.513 1.00 0.00 ? 253  GLU C CA 1 
ATOM 6960   C C  . GLU C 2 253  ? 1050.927 754.895 771.288 1.00 0.00 ? 253  GLU C C  1 
ATOM 6961   O O  . GLU C 2 253  ? 1051.484 755.492 770.371 1.00 0.00 ? 253  GLU C O  1 
ATOM 6962   C CB . GLU C 2 253  ? 1051.825 755.765 773.411 1.00 0.00 ? 253  GLU C CB 1 
ATOM 6963   N N  . PHE C 2 254  ? 1049.662 754.469 771.222 1.00 0.00 ? 254  PHE C N  1 
ATOM 6964   C CA . PHE C 2 254  ? 1048.970 754.567 769.985 1.00 0.00 ? 254  PHE C CA 1 
ATOM 6965   C C  . PHE C 2 254  ? 1048.818 755.992 769.574 1.00 0.00 ? 254  PHE C C  1 
ATOM 6966   O O  . PHE C 2 254  ? 1049.278 756.388 768.504 1.00 0.00 ? 254  PHE C O  1 
ATOM 6967   C CB . PHE C 2 254  ? 1047.570 753.961 770.089 1.00 0.00 ? 254  PHE C CB 1 
ATOM 6968   N N  . VAL C 2 255  ? 1048.180 756.813 770.431 1.00 0.00 ? 255  VAL C N  1 
ATOM 6969   C CA . VAL C 2 255  ? 1047.917 758.173 770.058 1.00 0.00 ? 255  VAL C CA 1 
ATOM 6970   C C  . VAL C 2 255  ? 1049.170 758.991 770.005 1.00 0.00 ? 255  VAL C C  1 
ATOM 6971   O O  . VAL C 2 255  ? 1049.287 759.897 769.180 1.00 0.00 ? 255  VAL C O  1 
ATOM 6972   C CB . VAL C 2 255  ? 1046.881 758.856 770.888 1.00 0.00 ? 255  VAL C CB 1 
ATOM 6973   N N  . ARG C 2 256  ? 1050.142 758.721 770.890 1.00 0.00 ? 256  ARG C N  1 
ATOM 6974   C CA . ARG C 2 256  ? 1051.325 759.530 770.852 1.00 0.00 ? 256  ARG C CA 1 
ATOM 6975   C C  . ARG C 2 256  ? 1052.018 759.404 769.535 1.00 0.00 ? 256  ARG C C  1 
ATOM 6976   O O  . ARG C 2 256  ? 1052.440 760.412 768.972 1.00 0.00 ? 256  ARG C O  1 
ATOM 6977   C CB . ARG C 2 256  ? 1052.342 759.222 771.963 1.00 0.00 ? 256  ARG C CB 1 
ATOM 6978   N N  . GLN C 2 257  ? 1052.169 758.180 768.994 1.00 0.00 ? 257  GLN C N  1 
ATOM 6979   C CA . GLN C 2 257  ? 1052.859 758.072 767.739 1.00 0.00 ? 257  GLN C CA 1 
ATOM 6980   C C  . GLN C 2 257  ? 1052.071 758.684 766.626 1.00 0.00 ? 257  GLN C C  1 
ATOM 6981   O O  . GLN C 2 257  ? 1052.646 759.323 765.746 1.00 0.00 ? 257  GLN C O  1 
ATOM 6982   C CB . GLN C 2 257  ? 1053.203 756.652 767.285 1.00 0.00 ? 257  GLN C CB 1 
ATOM 6983   N N  . ALA C 2 258  ? 1050.736 758.502 766.620 1.00 0.00 ? 258  ALA C N  1 
ATOM 6984   C CA . ALA C 2 258  ? 1049.938 759.024 765.547 1.00 0.00 ? 258  ALA C CA 1 
ATOM 6985   C C  . ALA C 2 258  ? 1050.114 760.511 765.540 1.00 0.00 ? 258  ALA C C  1 
ATOM 6986   O O  . ALA C 2 258  ? 1050.261 761.125 764.484 1.00 0.00 ? 258  ALA C O  1 
ATOM 6987   C CB . ALA C 2 258  ? 1048.437 758.733 765.729 1.00 0.00 ? 258  ALA C CB 1 
ATOM 6988   N N  . LEU C 2 259  ? 1050.129 761.122 766.740 1.00 0.00 ? 259  LEU C N  1 
ATOM 6989   C CA . LEU C 2 259  ? 1050.279 762.540 766.874 1.00 0.00 ? 259  LEU C CA 1 
ATOM 6990   C C  . LEU C 2 259  ? 1051.594 762.964 766.301 1.00 0.00 ? 259  LEU C C  1 
ATOM 6991   O O  . LEU C 2 259  ? 1051.669 763.950 765.571 1.00 0.00 ? 259  LEU C O  1 
ATOM 6992   C CB . LEU C 2 259  ? 1050.308 763.014 768.335 1.00 0.00 ? 259  LEU C CB 1 
ATOM 6993   N N  . ALA C 2 260  ? 1052.666 762.215 766.617 1.00 0.00 ? 260  ALA C N  1 
ATOM 6994   C CA . ALA C 2 260  ? 1053.992 762.572 766.203 1.00 0.00 ? 260  ALA C CA 1 
ATOM 6995   C C  . ALA C 2 260  ? 1054.076 762.567 764.711 1.00 0.00 ? 260  ALA C C  1 
ATOM 6996   O O  . ALA C 2 260  ? 1054.658 763.471 764.113 1.00 0.00 ? 260  ALA C O  1 
ATOM 6997   C CB . ALA C 2 260  ? 1055.055 761.594 766.729 1.00 0.00 ? 260  ALA C CB 1 
ATOM 6998   N N  . TYR C 2 261  ? 1053.475 761.553 764.067 1.00 0.00 ? 261  TYR C N  1 
ATOM 6999   C CA . TYR C 2 261  ? 1053.551 761.449 762.641 1.00 0.00 ? 261  TYR C CA 1 
ATOM 7000   C C  . TYR C 2 261  ? 1052.911 762.649 762.032 1.00 0.00 ? 261  TYR C C  1 
ATOM 7001   O O  . TYR C 2 261  ? 1053.477 763.280 761.140 1.00 0.00 ? 261  TYR C O  1 
ATOM 7002   C CB . TYR C 2 261  ? 1052.805 760.207 762.118 1.00 0.00 ? 261  TYR C CB 1 
ATOM 7003   N N  . LEU C 2 262  ? 1051.711 763.011 762.519 1.00 0.00 ? 262  LEU C N  1 
ATOM 7004   C CA . LEU C 2 262  ? 1051.006 764.129 761.961 1.00 0.00 ? 262  LEU C CA 1 
ATOM 7005   C C  . LEU C 2 262  ? 1051.775 765.388 762.206 1.00 0.00 ? 262  LEU C C  1 
ATOM 7006   O O  . LEU C 2 262  ? 1051.874 766.240 761.326 1.00 0.00 ? 262  LEU C O  1 
ATOM 7007   C CB . LEU C 2 262  ? 1049.596 764.289 762.545 1.00 0.00 ? 262  LEU C CB 1 
ATOM 7008   N N  . GLU C 2 263  ? 1052.336 765.535 763.419 1.00 0.00 ? 263  GLU C N  1 
ATOM 7009   C CA . GLU C 2 263  ? 1053.039 766.733 763.783 1.00 0.00 ? 263  GLU C CA 1 
ATOM 7010   C C  . GLU C 2 263  ? 1054.284 766.881 762.964 1.00 0.00 ? 263  GLU C C  1 
ATOM 7011   O O  . GLU C 2 263  ? 1054.586 767.974 762.488 1.00 0.00 ? 263  GLU C O  1 
ATOM 7012   C CB . GLU C 2 263  ? 1053.408 766.749 765.276 1.00 0.00 ? 263  GLU C CB 1 
ATOM 7013   N N  . GLN C 2 264  ? 1055.042 765.784 762.770 1.00 0.00 ? 264  GLN C N  1 
ATOM 7014   C CA . GLN C 2 264  ? 1056.262 765.868 762.020 1.00 0.00 ? 264  GLN C CA 1 
ATOM 7015   C C  . GLN C 2 264  ? 1055.953 766.178 760.591 1.00 0.00 ? 264  GLN C C  1 
ATOM 7016   O O  . GLN C 2 264  ? 1056.668 766.947 759.949 1.00 0.00 ? 264  GLN C O  1 
ATOM 7017   C CB . GLN C 2 264  ? 1057.109 764.587 762.069 1.00 0.00 ? 264  GLN C CB 1 
ATOM 7018   N N  . SER C 2 265  ? 1054.864 765.600 760.057 1.00 0.00 ? 265  SER C N  1 
ATOM 7019   C CA . SER C 2 265  ? 1054.528 765.796 758.677 1.00 0.00 ? 265  SER C CA 1 
ATOM 7020   C C  . SER C 2 265  ? 1054.323 767.259 758.435 1.00 0.00 ? 265  SER C C  1 
ATOM 7021   O O  . SER C 2 265  ? 1054.787 767.800 757.433 1.00 0.00 ? 265  SER C O  1 
ATOM 7022   C CB . SER C 2 265  ? 1053.230 765.073 758.277 1.00 0.00 ? 265  SER C CB 1 
ATOM 7023   N N  . TYR C 2 266  ? 1053.624 767.937 759.364 1.00 0.00 ? 266  TYR C N  1 
ATOM 7024   C CA . TYR C 2 266  ? 1053.322 769.333 759.250 1.00 0.00 ? 266  TYR C CA 1 
ATOM 7025   C C  . TYR C 2 266  ? 1054.594 770.117 759.289 1.00 0.00 ? 266  TYR C C  1 
ATOM 7026   O O  . TYR C 2 266  ? 1054.775 771.063 758.524 1.00 0.00 ? 266  TYR C O  1 
ATOM 7027   C CB . TYR C 2 266  ? 1052.406 769.793 760.400 1.00 0.00 ? 266  TYR C CB 1 
ATOM 7028   N N  . LYS C 2 267  ? 1055.514 769.731 760.189 1.00 0.00 ? 267  LYS C N  1 
ATOM 7029   C CA . LYS C 2 267  ? 1056.765 770.413 760.362 1.00 0.00 ? 267  LYS C CA 1 
ATOM 7030   C C  . LYS C 2 267  ? 1057.534 770.333 759.078 1.00 0.00 ? 267  LYS C C  1 
ATOM 7031   O O  . LYS C 2 267  ? 1058.079 771.330 758.606 1.00 0.00 ? 267  LYS C O  1 
ATOM 7032   C CB . LYS C 2 267  ? 1057.601 769.726 761.455 1.00 0.00 ? 267  LYS C CB 1 
ATOM 7033   N N  . ASN C 2 268  ? 1057.564 769.137 758.460 1.00 0.00 ? 268  ASN C N  1 
ATOM 7034   C CA . ASN C 2 268  ? 1058.313 768.905 757.257 1.00 0.00 ? 268  ASN C CA 1 
ATOM 7035   C C  . ASN C 2 268  ? 1057.771 769.803 756.192 1.00 0.00 ? 268  ASN C C  1 
ATOM 7036   O O  . ASN C 2 268  ? 1058.517 770.438 755.448 1.00 0.00 ? 268  ASN C O  1 
ATOM 7037   C CB . ASN C 2 268  ? 1058.164 767.452 756.770 1.00 0.00 ? 268  ASN C CB 1 
ATOM 7038   N N  . TYR C 2 269  ? 1056.434 769.897 756.126 1.00 0.00 ? 269  TYR C N  1 
ATOM 7039   C CA . TYR C 2 269  ? 1055.742 770.699 755.164 1.00 0.00 ? 269  TYR C CA 1 
ATOM 7040   C C  . TYR C 2 269  ? 1056.172 772.115 755.364 1.00 0.00 ? 269  TYR C C  1 
ATOM 7041   O O  . TYR C 2 269  ? 1056.441 772.834 754.402 1.00 0.00 ? 269  TYR C O  1 
ATOM 7042   C CB . TYR C 2 269  ? 1054.221 770.568 755.381 1.00 0.00 ? 269  TYR C CB 1 
ATOM 7043   N N  . THR C 2 270  ? 1056.257 772.549 756.634 1.00 0.00 ? 270  THR C N  1 
ATOM 7044   C CA . THR C 2 270  ? 1056.639 773.897 756.944 1.00 0.00 ? 270  THR C CA 1 
ATOM 7045   C C  . THR C 2 270  ? 1058.055 774.154 756.546 1.00 0.00 ? 270  THR C C  1 
ATOM 7046   O O  . THR C 2 270  ? 1058.369 775.210 756.003 1.00 0.00 ? 270  THR C O  1 
ATOM 7047   C CB . THR C 2 270  ? 1056.535 774.227 758.403 1.00 0.00 ? 270  THR C CB 1 
ATOM 7048   N N  . LEU C 2 271  ? 1058.962 773.197 756.810 1.00 0.00 ? 271  LEU C N  1 
ATOM 7049   C CA . LEU C 2 271  ? 1060.344 773.454 756.535 1.00 0.00 ? 271  LEU C CA 1 
ATOM 7050   C C  . LEU C 2 271  ? 1060.520 773.642 755.063 1.00 0.00 ? 271  LEU C C  1 
ATOM 7051   O O  . LEU C 2 271  ? 1061.243 774.535 754.622 1.00 0.00 ? 271  LEU C O  1 
ATOM 7052   C CB . LEU C 2 271  ? 1061.266 772.308 756.984 1.00 0.00 ? 271  LEU C CB 1 
ATOM 7053   N N  . VAL C 2 272  ? 1059.833 772.809 754.262 1.00 0.00 ? 272  VAL C N  1 
ATOM 7054   C CA . VAL C 2 272  ? 1059.992 772.842 752.839 1.00 0.00 ? 272  VAL C CA 1 
ATOM 7055   C C  . VAL C 2 272  ? 1059.577 774.175 752.300 1.00 0.00 ? 272  VAL C C  1 
ATOM 7056   O O  . VAL C 2 272  ? 1060.259 774.736 751.444 1.00 0.00 ? 272  VAL C O  1 
ATOM 7057   C CB . VAL C 2 272  ? 1059.178 771.791 752.143 1.00 0.00 ? 272  VAL C CB 1 
ATOM 7058   N N  . THR C 2 273  ? 1058.452 774.733 752.788 1.00 0.00 ? 273  THR C N  1 
ATOM 7059   C CA . THR C 2 273  ? 1057.998 775.978 752.235 1.00 0.00 ? 273  THR C CA 1 
ATOM 7060   C C  . THR C 2 273  ? 1059.042 777.020 752.471 1.00 0.00 ? 273  THR C C  1 
ATOM 7061   O O  . THR C 2 273  ? 1059.400 777.772 751.566 1.00 0.00 ? 273  THR C O  1 
ATOM 7062   C CB . THR C 2 273  ? 1056.693 776.452 752.814 1.00 0.00 ? 273  THR C CB 1 
ATOM 7063   N N  . VAL C 2 274  ? 1059.587 777.064 753.697 1.00 0.00 ? 274  VAL C N  1 
ATOM 7064   C CA . VAL C 2 274  ? 1060.587 778.028 754.037 1.00 0.00 ? 274  VAL C CA 1 
ATOM 7065   C C  . VAL C 2 274  ? 1061.780 777.789 753.181 1.00 0.00 ? 274  VAL C C  1 
ATOM 7066   O O  . VAL C 2 274  ? 1062.404 778.744 752.718 1.00 0.00 ? 274  VAL C O  1 
ATOM 7067   C CB . VAL C 2 274  ? 1061.038 777.914 755.467 1.00 0.00 ? 274  VAL C CB 1 
ATOM 7068   N N  . PHE C 2 275  ? 1062.113 776.499 752.965 1.00 0.00 ? 275  PHE C N  1 
ATOM 7069   C CA . PHE C 2 275  ? 1063.276 776.145 752.214 1.00 0.00 ? 275  PHE C CA 1 
ATOM 7070   C C  . PHE C 2 275  ? 1062.936 776.365 750.782 1.00 0.00 ? 275  PHE C C  1 
ATOM 7071   O O  . PHE C 2 275  ? 1062.706 775.432 750.015 1.00 0.00 ? 275  PHE C O  1 
ATOM 7072   C CB . PHE C 2 275  ? 1063.602 774.652 752.413 1.00 0.00 ? 275  PHE C CB 1 
ATOM 7073   N N  . GLY C 2 276  ? 1062.880 777.649 750.384 1.00 0.00 ? 276  GLY C N  1 
ATOM 7074   C CA . GLY C 2 276  ? 1062.676 777.970 749.002 1.00 0.00 ? 276  GLY C CA 1 
ATOM 7075   C C  . GLY C 2 276  ? 1062.349 779.409 748.821 1.00 0.00 ? 276  GLY C C  1 
ATOM 7076   O O  . GLY C 2 276  ? 1061.190 779.820 748.841 1.00 0.00 ? 276  GLY C O  1 
ATOM 7077   N N  . ASN C 2 277  ? 1063.389 780.224 748.562 1.00 0.00 ? 277  ASN C N  1 
ATOM 7078   C CA . ASN C 2 277  ? 1063.242 781.601 748.262 1.00 0.00 ? 277  ASN C CA 1 
ATOM 7079   C C  . ASN C 2 277  ? 1062.594 782.330 749.369 1.00 0.00 ? 277  ASN C C  1 
ATOM 7080   O O  . ASN C 2 277  ? 1062.295 781.804 750.435 1.00 0.00 ? 277  ASN C O  1 
ATOM 7081   C CB . ASN C 2 277  ? 1062.417 781.854 747.015 1.00 0.00 ? 277  ASN C CB 1 
ATOM 7082   N N  . LEU C 2 278  ? 1062.542 783.680 749.137 1.00 0.00 ? 278  LEU C N  1 
ATOM 7083   C CA . LEU C 2 278  ? 1061.843 784.653 749.923 1.00 0.00 ? 278  LEU C CA 1 
ATOM 7084   C C  . LEU C 2 278  ? 1062.801 785.631 750.501 1.00 0.00 ? 278  LEU C C  1 
ATOM 7085   O O  . LEU C 2 278  ? 1063.824 785.999 749.924 1.00 0.00 ? 278  LEU C O  1 
ATOM 7086   C CB . LEU C 2 278  ? 1060.911 784.109 751.042 1.00 0.00 ? 278  LEU C CB 1 
ATOM 7087   N N  . HIS C 2 279  ? 1062.421 786.129 751.716 1.00 0.00 ? 279  HIS C N  1 
ATOM 7088   C CA . HIS C 2 279  ? 1063.255 786.922 752.629 1.00 0.00 ? 279  HIS C CA 1 
ATOM 7089   C C  . HIS C 2 279  ? 1062.614 788.251 752.778 1.00 0.00 ? 279  HIS C C  1 
ATOM 7090   O O  . HIS C 2 279  ? 1061.596 788.496 752.221 1.00 0.00 ? 279  HIS C O  1 
ATOM 7091   C CB . HIS C 2 279  ? 1064.762 787.090 752.225 1.00 0.00 ? 279  HIS C CB 1 
ATOM 7092   N N  . GLN C 2 282  ? 1065.745 781.764 752.051 1.00 0.00 ? 282  GLN C N  1 
ATOM 7093   C CA . GLN C 2 282  ? 1065.730 783.168 752.313 1.00 0.00 ? 282  GLN C CA 1 
ATOM 7094   C C  . GLN C 2 282  ? 1064.440 783.629 752.931 1.00 0.00 ? 282  GLN C C  1 
ATOM 7095   O O  . GLN C 2 282  ? 1063.379 783.693 752.342 1.00 0.00 ? 282  GLN C O  1 
ATOM 7096   C CB . GLN C 2 282  ? 1066.177 783.925 751.005 1.00 0.00 ? 282  GLN C CB 1 
ATOM 7097   N N  . LEU C 2 283  ? 1064.528 783.838 754.252 1.00 0.00 ? 283  LEU C N  1 
ATOM 7098   C CA . LEU C 2 283  ? 1063.652 784.524 755.131 1.00 0.00 ? 283  LEU C CA 1 
ATOM 7099   C C  . LEU C 2 283  ? 1064.585 785.532 755.733 1.00 0.00 ? 283  LEU C C  1 
ATOM 7100   O O  . LEU C 2 283  ? 1065.796 785.343 755.747 1.00 0.00 ? 283  LEU C O  1 
ATOM 7101   C CB . LEU C 2 283  ? 1063.053 783.687 756.308 1.00 0.00 ? 283  LEU C CB 1 
ATOM 7102   N N  . GLY C 2 284  ? 1064.085 786.663 756.203 1.00 0.00 ? 284  GLY C N  1 
ATOM 7103   C CA . GLY C 2 284  ? 1065.005 787.663 756.650 1.00 0.00 ? 284  GLY C CA 1 
ATOM 7104   C C  . GLY C 2 284  ? 1065.815 787.177 757.814 1.00 0.00 ? 284  GLY C C  1 
ATOM 7105   O O  . GLY C 2 284  ? 1067.035 787.351 757.835 1.00 0.00 ? 284  GLY C O  1 
ATOM 7106   N N  . GLY C 2 285  ? 1065.166 786.514 758.790 1.00 0.00 ? 285  GLY C N  1 
ATOM 7107   C CA . GLY C 2 285  ? 1065.870 786.181 759.993 1.00 0.00 ? 285  GLY C CA 1 
ATOM 7108   C C  . GLY C 2 285  ? 1066.424 784.802 759.930 1.00 0.00 ? 285  GLY C C  1 
ATOM 7109   O O  . GLY C 2 285  ? 1066.485 784.187 758.868 1.00 0.00 ? 285  GLY C O  1 
ATOM 7110   N N  . VAL C 2 286  ? 1066.826 784.308 761.119 1.00 0.00 ? 286  VAL C N  1 
ATOM 7111   C CA . VAL C 2 286  ? 1067.426 783.030 761.356 1.00 0.00 ? 286  VAL C CA 1 
ATOM 7112   C C  . VAL C 2 286  ? 1066.381 781.973 761.145 1.00 0.00 ? 286  VAL C C  1 
ATOM 7113   O O  . VAL C 2 286  ? 1065.178 782.212 761.219 1.00 0.00 ? 286  VAL C O  1 
ATOM 7114   C CB . VAL C 2 286  ? 1067.960 782.943 762.757 1.00 0.00 ? 286  VAL C CB 1 
ATOM 7115   N N  . PRO C 2 287  ? 1066.876 780.806 760.857 1.00 0.00 ? 287  PRO C N  1 
ATOM 7116   C CA . PRO C 2 287  ? 1066.063 779.654 760.557 1.00 0.00 ? 287  PRO C CA 1 
ATOM 7117   C C  . PRO C 2 287  ? 1065.288 779.041 761.686 1.00 0.00 ? 287  PRO C C  1 
ATOM 7118   O O  . PRO C 2 287  ? 1064.743 777.961 761.471 1.00 0.00 ? 287  PRO C O  1 
ATOM 7119   C CB . PRO C 2 287  ? 1066.979 778.653 759.844 1.00 0.00 ? 287  PRO C CB 1 
ATOM 7120   N N  . GLY C 2 288  ? 1065.215 779.682 762.871 1.00 0.00 ? 288  GLY C N  1 
ATOM 7121   C CA . GLY C 2 288  ? 1064.542 779.100 764.004 1.00 0.00 ? 288  GLY C CA 1 
ATOM 7122   C C  . GLY C 2 288  ? 1063.172 778.642 763.604 1.00 0.00 ? 288  GLY C C  1 
ATOM 7123   O O  . GLY C 2 288  ? 1062.568 779.153 762.662 1.00 0.00 ? 288  GLY C O  1 
ATOM 7124   N N  . THR C 2 289  ? 1062.664 777.646 764.357 1.00 0.00 ? 289  THR C N  1 
ATOM 7125   C CA . THR C 2 289  ? 1061.421 776.974 764.110 1.00 0.00 ? 289  THR C CA 1 
ATOM 7126   C C  . THR C 2 289  ? 1060.292 777.954 764.178 1.00 0.00 ? 289  THR C C  1 
ATOM 7127   O O  . THR C 2 289  ? 1059.361 777.892 763.379 1.00 0.00 ? 289  THR C O  1 
ATOM 7128   C CB . THR C 2 289  ? 1061.161 775.886 765.116 1.00 0.00 ? 289  THR C CB 1 
ATOM 7129   N N  . TYR C 2 290  ? 1060.357 778.892 765.132 1.00 0.00 ? 290  TYR C N  1 
ATOM 7130   C CA . TYR C 2 290  ? 1059.332 779.867 765.344 1.00 0.00 ? 290  TYR C CA 1 
ATOM 7131   C C  . TYR C 2 290  ? 1059.181 780.668 764.099 1.00 0.00 ? 290  TYR C C  1 
ATOM 7132   O O  . TYR C 2 290  ? 1058.073 780.884 763.613 1.00 0.00 ? 290  TYR C O  1 
ATOM 7133   C CB . TYR C 2 290  ? 1059.789 780.842 766.447 1.00 0.00 ? 290  TYR C CB 1 
ATOM 7134   N N  . GLN C 2 291  ? 1060.307 781.127 763.541 1.00 0.00 ? 291  GLN C N  1 
ATOM 7135   C CA . GLN C 2 291  ? 1060.234 781.971 762.394 1.00 0.00 ? 291  GLN C CA 1 
ATOM 7136   C C  . GLN C 2 291  ? 1059.726 781.196 761.225 1.00 0.00 ? 291  GLN C C  1 
ATOM 7137   O O  . GLN C 2 291  ? 1059.039 781.753 760.372 1.00 0.00 ? 291  GLN C O  1 
ATOM 7138   C CB . GLN C 2 291  ? 1061.563 782.658 762.054 1.00 0.00 ? 291  GLN C CB 1 
ATOM 7139   N N  . LEU C 2 292  ? 1060.041 779.892 761.145 1.00 0.00 ? 292  LEU C N  1 
ATOM 7140   C CA . LEU C 2 292  ? 1059.601 779.130 760.014 1.00 0.00 ? 292  LEU C CA 1 
ATOM 7141   C C  . LEU C 2 292  ? 1058.108 779.151 759.998 1.00 0.00 ? 292  LEU C C  1 
ATOM 7142   O O  . LEU C 2 292  ? 1057.501 779.310 758.941 1.00 0.00 ? 292  LEU C O  1 
ATOM 7143   C CB . LEU C 2 292  ? 1060.037 777.657 760.072 1.00 0.00 ? 292  LEU C CB 1 
ATOM 7144   N N  . VAL C 2 293  ? 1057.483 778.969 761.181 1.00 0.00 ? 293  VAL C N  1 
ATOM 7145   C CA . VAL C 2 293  ? 1056.051 778.983 761.298 1.00 0.00 ? 293  VAL C CA 1 
ATOM 7146   C C  . VAL C 2 293  ? 1055.494 780.355 761.053 1.00 0.00 ? 293  VAL C C  1 
ATOM 7147   O O  . VAL C 2 293  ? 1054.420 780.479 760.465 1.00 0.00 ? 293  VAL C O  1 
ATOM 7148   C CB . VAL C 2 293  ? 1055.508 778.382 762.569 1.00 0.00 ? 293  VAL C CB 1 
ATOM 7149   N N  . ARG C 2 294  ? 1056.197 781.429 761.472 1.00 0.00 ? 294  ARG C N  1 
ATOM 7150   C CA . ARG C 2 294  ? 1055.680 782.742 761.195 1.00 0.00 ? 294  ARG C CA 1 
ATOM 7151   C C  . ARG C 2 294  ? 1055.554 782.851 759.712 1.00 0.00 ? 294  ARG C C  1 
ATOM 7152   O O  . ARG C 2 294  ? 1054.588 783.415 759.203 1.00 0.00 ? 294  ARG C O  1 
ATOM 7153   C CB . ARG C 2 294  ? 1056.610 783.903 761.597 1.00 0.00 ? 294  ARG C CB 1 
ATOM 7154   N N  . SER C 2 295  ? 1056.548 782.309 758.987 1.00 0.00 ? 295  SER C N  1 
ATOM 7155   C CA . SER C 2 295  ? 1056.563 782.368 757.557 1.00 0.00 ? 295  SER C CA 1 
ATOM 7156   C C  . SER C 2 295  ? 1055.374 781.637 757.025 1.00 0.00 ? 295  SER C C  1 
ATOM 7157   O O  . SER C 2 295  ? 1054.658 782.150 756.176 1.00 0.00 ? 295  SER C O  1 
ATOM 7158   C CB . SER C 2 295  ? 1057.820 781.716 756.955 1.00 0.00 ? 295  SER C CB 1 
ATOM 7159   N N  . PHE C 2 296  ? 1055.092 780.427 757.530 1.00 0.00 ? 296  PHE C N  1 
ATOM 7160   C CA . PHE C 2 296  ? 1053.982 779.660 757.037 1.00 0.00 ? 296  PHE C CA 1 
ATOM 7161   C C  . PHE C 2 296  ? 1052.731 780.452 757.207 1.00 0.00 ? 296  PHE C C  1 
ATOM 7162   O O  . PHE C 2 296  ? 1051.923 780.569 756.288 1.00 0.00 ? 296  PHE C O  1 
ATOM 7163   C CB . PHE C 2 296  ? 1053.858 778.341 757.827 1.00 0.00 ? 296  PHE C CB 1 
ATOM 7164   N N  . LEU C 2 297  ? 1052.542 781.022 758.399 1.00 0.00 ? 297  LEU C N  1 
ATOM 7165   C CA . LEU C 2 297  ? 1051.332 781.727 758.665 1.00 0.00 ? 297  LEU C CA 1 
ATOM 7166   C C  . LEU C 2 297  ? 1051.289 782.950 757.783 1.00 0.00 ? 297  LEU C C  1 
ATOM 7167   O O  . LEU C 2 297  ? 1050.306 783.187 757.087 1.00 0.00 ? 297  LEU C O  1 
ATOM 7168   C CB . LEU C 2 297  ? 1051.296 782.118 760.155 1.00 0.00 ? 297  LEU C CB 1 
ATOM 7169   N N  . ASN C 2 298  ? 1052.372 783.765 757.755 1.00 0.00 ? 298  ASN C N  1 
ATOM 7170   C CA . ASN C 2 298  ? 1052.341 784.978 756.977 1.00 0.00 ? 298  ASN C CA 1 
ATOM 7171   C C  . ASN C 2 298  ? 1052.318 784.714 755.495 1.00 0.00 ? 298  ASN C C  1 
ATOM 7172   O O  . ASN C 2 298  ? 1051.379 785.127 754.818 1.00 0.00 ? 298  ASN C O  1 
ATOM 7173   C CB . ASN C 2 298  ? 1053.530 785.912 757.265 1.00 0.00 ? 298  ASN C CB 1 
ATOM 7174   N N  . ILE C 2 299  ? 1053.335 784.010 754.948 1.00 0.00 ? 299  ILE C N  1 
ATOM 7175   C CA . ILE C 2 299  ? 1053.382 783.776 753.528 1.00 0.00 ? 299  ILE C CA 1 
ATOM 7176   C C  . ILE C 2 299  ? 1052.325 782.835 753.081 1.00 0.00 ? 299  ILE C C  1 
ATOM 7177   O O  . ILE C 2 299  ? 1051.654 783.087 752.081 1.00 0.00 ? 299  ILE C O  1 
ATOM 7178   C CB . ILE C 2 299  ? 1054.650 783.213 752.947 1.00 0.00 ? 299  ILE C CB 1 
ATOM 7179   N N  . LYS C 2 300  ? 1052.122 781.728 753.817 1.00 0.00 ? 300  LYS C N  1 
ATOM 7180   C CA . LYS C 2 300  ? 1051.180 780.788 753.307 1.00 0.00 ? 300  LYS C CA 1 
ATOM 7181   C C  . LYS C 2 300  ? 1049.827 781.410 753.404 1.00 0.00 ? 300  LYS C C  1 
ATOM 7182   O O  . LYS C 2 300  ? 1049.681 782.592 753.711 1.00 0.00 ? 300  LYS C O  1 
ATOM 7183   C CB . LYS C 2 300  ? 1051.190 779.382 753.936 1.00 0.00 ? 300  LYS C CB 1 
ATOM 7184   N N  . LEU C 2 301  ? 1048.781 780.611 753.154 1.00 0.00 ? 301  LEU C N  1 
ATOM 7185   C CA . LEU C 2 301  ? 1047.488 781.164 752.914 1.00 0.00 ? 301  LEU C CA 1 
ATOM 7186   C C  . LEU C 2 301  ? 1046.787 781.789 754.080 1.00 0.00 ? 301  LEU C C  1 
ATOM 7187   O O  . LEU C 2 301  ? 1045.557 781.795 754.055 1.00 0.00 ? 301  LEU C O  1 
ATOM 7188   C CB . LEU C 2 301  ? 1046.532 780.145 752.279 1.00 0.00 ? 301  LEU C CB 1 
ATOM 7189   N N  . PRO C 2 302  ? 1047.398 782.319 755.103 1.00 0.00 ? 302  PRO C N  1 
ATOM 7190   C CA . PRO C 2 302  ? 1046.529 783.136 755.895 1.00 0.00 ? 302  PRO C CA 1 
ATOM 7191   C C  . PRO C 2 302  ? 1046.212 784.435 755.198 1.00 0.00 ? 302  PRO C C  1 
ATOM 7192   O O  . PRO C 2 302  ? 1045.263 785.100 755.612 1.00 0.00 ? 302  PRO C O  1 
ATOM 7193   C CB . PRO C 2 302  ? 1047.163 783.249 757.275 1.00 0.00 ? 302  PRO C CB 1 
ATOM 7194   N N  . ALA C 2 303  ? 1046.984 784.851 754.164 1.00 0.00 ? 303  ALA C N  1 
ATOM 7195   C CA . ALA C 2 303  ? 1046.637 786.096 753.531 1.00 0.00 ? 303  ALA C CA 1 
ATOM 7196   C C  . ALA C 2 303  ? 1046.783 785.995 752.039 1.00 0.00 ? 303  ALA C C  1 
ATOM 7197   O O  . ALA C 2 303  ? 1047.812 785.564 751.525 1.00 0.00 ? 303  ALA C O  1 
ATOM 7198   C CB . ALA C 2 303  ? 1047.541 787.265 753.955 1.00 0.00 ? 303  ALA C CB 1 
ATOM 7199   N N  . PRO C 2 304  ? 1045.730 786.320 751.332 1.00 0.00 ? 304  PRO C N  1 
ATOM 7200   C CA . PRO C 2 304  ? 1045.740 786.469 749.892 1.00 0.00 ? 304  PRO C CA 1 
ATOM 7201   C C  . PRO C 2 304  ? 1046.457 787.742 749.616 1.00 0.00 ? 304  PRO C C  1 
ATOM 7202   O O  . PRO C 2 304  ? 1047.196 787.899 748.647 1.00 0.00 ? 304  PRO C O  1 
ATOM 7203   C CB . PRO C 2 304  ? 1044.268 786.574 749.498 1.00 0.00 ? 304  PRO C CB 1 
ATOM 7204   N N  . LEU C 2 305  ? 1046.125 788.685 750.490 1.00 0.00 ? 305  LEU C N  1 
ATOM 7205   C CA . LEU C 2 305  ? 1046.579 790.015 750.648 1.00 0.00 ? 305  LEU C CA 1 
ATOM 7206   C C  . LEU C 2 305  ? 1045.827 790.349 751.892 1.00 0.00 ? 305  LEU C C  1 
ATOM 7207   O O  . LEU C 2 305  ? 1044.640 790.628 751.941 1.00 0.00 ? 305  LEU C O  1 
ATOM 7208   C CB . LEU C 2 305  ? 1046.396 790.874 749.357 1.00 0.00 ? 305  LEU C CB 1 
ATOM 7209   N N  . PRO C 2 306  ? 1046.637 790.350 752.889 1.00 0.00 ? 306  PRO C N  1 
ATOM 7210   C CA . PRO C 2 306  ? 1046.290 790.190 754.289 1.00 0.00 ? 306  PRO C CA 1 
ATOM 7211   C C  . PRO C 2 306  ? 1045.045 790.724 754.940 1.00 0.00 ? 306  PRO C C  1 
ATOM 7212   O O  . PRO C 2 306  ? 1044.600 791.818 754.607 1.00 0.00 ? 306  PRO C O  1 
ATOM 7213   C CB . PRO C 2 306  ? 1047.494 790.735 755.051 1.00 0.00 ? 306  PRO C CB 1 
ATOM 7214   N N  . GLY C 2 307  ? 1044.478 789.913 755.879 1.00 0.00 ? 307  GLY C N  1 
ATOM 7215   C CA . GLY C 2 307  ? 1043.400 790.366 756.711 1.00 0.00 ? 307  GLY C CA 1 
ATOM 7216   C C  . GLY C 2 307  ? 1042.467 789.272 757.205 1.00 0.00 ? 307  GLY C C  1 
ATOM 7217   O O  . GLY C 2 307  ? 1042.507 788.129 756.742 1.00 0.00 ? 307  GLY C O  1 
ATOM 7218   N N  . LEU C 2 308  ? 1041.673 789.667 758.234 1.00 0.00 ? 308  LEU C N  1 
ATOM 7219   C CA . LEU C 2 308  ? 1040.471 789.137 758.853 1.00 0.00 ? 308  LEU C CA 1 
ATOM 7220   C C  . LEU C 2 308  ? 1040.584 788.267 760.081 1.00 0.00 ? 308  LEU C C  1 
ATOM 7221   O O  . LEU C 2 308  ? 1041.273 787.248 760.140 1.00 0.00 ? 308  LEU C O  1 
ATOM 7222   C CB . LEU C 2 308  ? 1039.420 788.544 757.905 1.00 0.00 ? 308  LEU C CB 1 
ATOM 7223   N N  . GLN C 2 309  ? 1039.876 788.782 761.119 1.00 0.00 ? 309  GLN C N  1 
ATOM 7224   C CA . GLN C 2 309  ? 1039.457 788.338 762.429 1.00 0.00 ? 309  GLN C CA 1 
ATOM 7225   C C  . GLN C 2 309  ? 1040.515 787.670 763.239 1.00 0.00 ? 309  GLN C C  1 
ATOM 7226   O O  . GLN C 2 309  ? 1040.210 786.823 764.074 1.00 0.00 ? 309  GLN C O  1 
ATOM 7227   C CB . GLN C 2 309  ? 1038.199 787.448 762.492 1.00 0.00 ? 309  GLN C CB 1 
ATOM 7228   N N  . ASP C 2 310  ? 1041.800 787.992 763.062 1.00 0.00 ? 310  ASP C N  1 
ATOM 7229   C CA . ASP C 2 310  ? 1042.692 787.348 763.981 1.00 0.00 ? 310  ASP C CA 1 
ATOM 7230   C C  . ASP C 2 310  ? 1043.029 788.379 765.013 1.00 0.00 ? 310  ASP C C  1 
ATOM 7231   O O  . ASP C 2 310  ? 1042.644 789.537 764.874 1.00 0.00 ? 310  ASP C O  1 
ATOM 7232   C CB . ASP C 2 310  ? 1043.988 786.836 763.331 1.00 0.00 ? 310  ASP C CB 1 
ATOM 7233   N N  . GLY C 2 311  ? 1043.730 787.992 766.098 1.00 0.00 ? 311  GLY C N  1 
ATOM 7234   C CA . GLY C 2 311  ? 1044.181 788.986 767.028 1.00 0.00 ? 311  GLY C CA 1 
ATOM 7235   C C  . GLY C 2 311  ? 1045.601 789.164 766.633 1.00 0.00 ? 311  GLY C C  1 
ATOM 7236   O O  . GLY C 2 311  ? 1046.361 788.200 766.598 1.00 0.00 ? 311  GLY C O  1 
ATOM 7237   N N  . GLU C 2 312  ? 1046.005 790.402 766.315 1.00 0.00 ? 312  GLU C N  1 
ATOM 7238   C CA . GLU C 2 312  ? 1047.322 790.559 765.786 1.00 0.00 ? 312  GLU C CA 1 
ATOM 7239   C C  . GLU C 2 312  ? 1048.038 791.618 766.542 1.00 0.00 ? 312  GLU C C  1 
ATOM 7240   O O  . GLU C 2 312  ? 1047.474 792.667 766.847 1.00 0.00 ? 312  GLU C O  1 
ATOM 7241   C CB . GLU C 2 312  ? 1047.281 791.006 764.317 1.00 0.00 ? 312  GLU C CB 1 
ATOM 7242   N N  . VAL C 2 313  ? 1049.308 791.344 766.890 1.00 0.00 ? 313  VAL C N  1 
ATOM 7243   C CA . VAL C 2 313  ? 1050.103 792.367 767.490 1.00 0.00 ? 313  VAL C CA 1 
ATOM 7244   C C  . VAL C 2 313  ? 1051.364 792.425 766.691 1.00 0.00 ? 313  VAL C C  1 
ATOM 7245   O O  . VAL C 2 313  ? 1051.975 791.400 766.386 1.00 0.00 ? 313  VAL C O  1 
ATOM 7246   C CB . VAL C 2 313  ? 1050.487 792.127 768.929 1.00 0.00 ? 313  VAL C CB 1 
ATOM 7247   N N  . GLU C 2 314  ? 1051.764 793.645 766.305 1.00 0.00 ? 314  GLU C N  1 
ATOM 7248   C CA . GLU C 2 314  ? 1052.975 793.848 765.572 1.00 0.00 ? 314  GLU C CA 1 
ATOM 7249   C C  . GLU C 2 314  ? 1053.020 792.947 764.373 1.00 0.00 ? 314  GLU C C  1 
ATOM 7250   O O  . GLU C 2 314  ? 1054.053 792.349 764.073 1.00 0.00 ? 314  GLU C O  1 
ATOM 7251   C CB . GLU C 2 314  ? 1054.235 793.667 766.437 1.00 0.00 ? 314  GLU C CB 1 
ATOM 7252   N N  . GLY C 2 315  ? 1051.882 792.830 763.660 1.00 0.00 ? 315  GLY C N  1 
ATOM 7253   C CA . GLY C 2 315  ? 1051.838 792.124 762.411 1.00 0.00 ? 315  GLY C CA 1 
ATOM 7254   C C  . GLY C 2 315  ? 1051.837 790.639 762.589 1.00 0.00 ? 315  GLY C C  1 
ATOM 7255   O O  . GLY C 2 315  ? 1052.180 789.914 761.656 1.00 0.00 ? 315  GLY C O  1 
ATOM 7256   N N  . HIS C 2 316  ? 1051.453 790.116 763.767 1.00 0.00 ? 316  HIS C N  1 
ATOM 7257   C CA . HIS C 2 316  ? 1051.523 788.686 763.857 1.00 0.00 ? 316  HIS C CA 1 
ATOM 7258   C C  . HIS C 2 316  ? 1050.361 788.131 764.622 1.00 0.00 ? 316  HIS C C  1 
ATOM 7259   O O  . HIS C 2 316  ? 1050.050 788.586 765.721 1.00 0.00 ? 316  HIS C O  1 
ATOM 7260   C CB . HIS C 2 316  ? 1052.797 788.222 764.559 1.00 0.00 ? 316  HIS C CB 1 
ATOM 7261   N N  . PRO C 2 317  ? 1049.683 787.163 764.048 1.00 0.00 ? 317  PRO C N  1 
ATOM 7262   C CA . PRO C 2 317  ? 1048.623 786.487 764.749 1.00 0.00 ? 317  PRO C CA 1 
ATOM 7263   C C  . PRO C 2 317  ? 1049.236 785.593 765.781 1.00 0.00 ? 317  PRO C C  1 
ATOM 7264   O O  . PRO C 2 317  ? 1049.734 784.522 765.432 1.00 0.00 ? 317  PRO C O  1 
ATOM 7265   C CB . PRO C 2 317  ? 1047.806 785.751 763.682 1.00 0.00 ? 317  PRO C CB 1 
ATOM 7266   N N  . VAL C 2 318  ? 1049.145 785.976 767.065 1.00 0.00 ? 318  VAL C N  1 
ATOM 7267   C CA . VAL C 2 318  ? 1049.788 785.229 768.104 1.00 0.00 ? 318  VAL C CA 1 
ATOM 7268   C C  . VAL C 2 318  ? 1049.133 783.903 768.312 1.00 0.00 ? 318  VAL C C  1 
ATOM 7269   O O  . VAL C 2 318  ? 1049.813 782.890 768.460 1.00 0.00 ? 318  VAL C O  1 
ATOM 7270   C CB . VAL C 2 318  ? 1049.772 785.948 769.423 1.00 0.00 ? 318  VAL C CB 1 
ATOM 7271   N N  . TRP C 2 319  ? 1047.788 783.883 768.346 1.00 0.00 ? 319  TRP C N  1 
ATOM 7272   C CA . TRP C 2 319  ? 1047.077 782.671 768.632 1.00 0.00 ? 319  TRP C CA 1 
ATOM 7273   C C  . TRP C 2 319  ? 1047.254 781.688 767.523 1.00 0.00 ? 319  TRP C C  1 
ATOM 7274   O O  . TRP C 2 319  ? 1047.350 780.487 767.767 1.00 0.00 ? 319  TRP C O  1 
ATOM 7275   C CB . TRP C 2 319  ? 1045.579 782.884 768.925 1.00 0.00 ? 319  TRP C CB 1 
ATOM 7276   N N  . ALA C 2 320  ? 1047.282 782.170 766.266 1.00 0.00 ? 320  ALA C N  1 
ATOM 7277   C CA . ALA C 2 320  ? 1047.449 781.270 765.163 1.00 0.00 ? 320  ALA C CA 1 
ATOM 7278   C C  . ALA C 2 320  ? 1048.788 780.620 765.298 1.00 0.00 ? 320  ALA C C  1 
ATOM 7279   O O  . ALA C 2 320  ? 1048.939 779.422 765.062 1.00 0.00 ? 320  ALA C O  1 
ATOM 7280   C CB . ALA C 2 320  ? 1047.412 781.983 763.802 1.00 0.00 ? 320  ALA C CB 1 
ATOM 7281   N N  . LEU C 2 321  ? 1049.794 781.417 765.705 1.00 0.00 ? 321  LEU C N  1 
ATOM 7282   C CA . LEU C 2 321  ? 1051.150 780.977 765.858 1.00 0.00 ? 321  LEU C CA 1 
ATOM 7283   C C  . LEU C 2 321  ? 1051.230 779.894 766.878 1.00 0.00 ? 321  LEU C C  1 
ATOM 7284   O O  . LEU C 2 321  ? 1051.868 778.868 766.651 1.00 0.00 ? 321  LEU C O  1 
ATOM 7285   C CB . LEU C 2 321  ? 1052.022 782.074 766.427 1.00 0.00 ? 321  LEU C CB 1 
ATOM 7286   N N  . ILE C 2 322  ? 1050.580 780.099 768.036 1.00 0.00 ? 322  ILE C N  1 
ATOM 7287   C CA . ILE C 2 322  ? 1050.646 779.140 769.094 1.00 0.00 ? 322  ILE C CA 1 
ATOM 7288   C C  . ILE C 2 322  ? 1050.022 777.873 768.600 1.00 0.00 ? 322  ILE C C  1 
ATOM 7289   O O  . ILE C 2 322  ? 1050.539 776.782 768.834 1.00 0.00 ? 322  ILE C O  1 
ATOM 7290   C CB . ILE C 2 322  ? 1049.912 779.594 770.322 1.00 0.00 ? 322  ILE C CB 1 
ATOM 7291   N N  . TYR C 2 323  ? 1048.891 777.993 767.876 1.00 0.00 ? 323  TYR C N  1 
ATOM 7292   C CA . TYR C 2 323  ? 1048.185 776.842 767.393 1.00 0.00 ? 323  TYR C CA 1 
ATOM 7293   C C  . TYR C 2 323  ? 1049.055 776.038 766.467 1.00 0.00 ? 323  TYR C C  1 
ATOM 7294   O O  . TYR C 2 323  ? 1049.196 774.827 766.637 1.00 0.00 ? 323  TYR C O  1 
ATOM 7295   C CB . TYR C 2 323  ? 1046.915 777.250 766.626 1.00 0.00 ? 323  TYR C CB 1 
ATOM 7296   N N  . TYR C 2 324  ? 1049.685 776.692 765.474 1.00 0.00 ? 324  TYR C N  1 
ATOM 7297   C CA . TYR C 2 324  ? 1050.490 775.998 764.506 1.00 0.00 ? 324  TYR C CA 1 
ATOM 7298   C C  . TYR C 2 324  ? 1051.724 775.421 765.120 1.00 0.00 ? 324  TYR C C  1 
ATOM 7299   O O  . TYR C 2 324  ? 1052.150 774.334 764.736 1.00 0.00 ? 324  TYR C O  1 
ATOM 7300   C CB . TYR C 2 324  ? 1050.868 776.847 763.282 1.00 0.00 ? 324  TYR C CB 1 
ATOM 7301   N N  . CYS C 2 325  ? 1052.350 776.136 766.072 1.00 0.00 ? 325  CYS C N  1 
ATOM 7302   C CA . CYS C 2 325  ? 1053.557 775.652 766.682 1.00 0.00 ? 325  CYS C CA 1 
ATOM 7303   C C  . CYS C 2 325  ? 1053.210 774.371 767.373 1.00 0.00 ? 325  CYS C C  1 
ATOM 7304   O O  . CYS C 2 325  ? 1053.957 773.395 767.325 1.00 0.00 ? 325  CYS C O  1 
ATOM 7305   C CB . CYS C 2 325  ? 1054.110 776.650 767.713 1.00 0.00 ? 325  CYS C CB 1 
ATOM 7306   N N  . MET C 2 326  ? 1052.030 774.360 768.017 1.00 0.00 ? 326  MET C N  1 
ATOM 7307   C CA . MET C 2 326  ? 1051.475 773.256 768.743 1.00 0.00 ? 326  MET C CA 1 
ATOM 7308   C C  . MET C 2 326  ? 1051.243 772.139 767.768 1.00 0.00 ? 326  MET C C  1 
ATOM 7309   O O  . MET C 2 326  ? 1051.505 770.974 768.062 1.00 0.00 ? 326  MET C O  1 
ATOM 7310   C CB . MET C 2 326  ? 1050.126 773.690 769.347 1.00 0.00 ? 326  MET C CB 1 
ATOM 7311   N N  . ARG C 2 327  ? 1050.759 772.488 766.562 1.00 0.00 ? 327  ARG C N  1 
ATOM 7312   C CA . ARG C 2 327  ? 1050.450 771.549 765.519 1.00 0.00 ? 327  ARG C CA 1 
ATOM 7313   C C  . ARG C 2 327  ? 1051.703 770.835 765.108 1.00 0.00 ? 327  ARG C C  1 
ATOM 7314   O O  . ARG C 2 327  ? 1051.698 769.633 764.846 1.00 0.00 ? 327  ARG C O  1 
ATOM 7315   C CB . ARG C 2 327  ? 1049.872 772.259 764.281 1.00 0.00 ? 327  ARG C CB 1 
ATOM 7316   N N  . CYS C 2 328  ? 1052.814 771.583 765.035 1.00 0.00 ? 328  CYS C N  1 
ATOM 7317   C CA . CYS C 2 328  ? 1054.110 771.103 764.641 1.00 0.00 ? 328  CYS C CA 1 
ATOM 7318   C C  . CYS C 2 328  ? 1054.646 770.186 765.702 1.00 0.00 ? 328  CYS C C  1 
ATOM 7319   O O  . CYS C 2 328  ? 1055.490 769.336 765.425 1.00 0.00 ? 328  CYS C O  1 
ATOM 7320   C CB . CYS C 2 328  ? 1055.095 772.267 764.455 1.00 0.00 ? 328  CYS C CB 1 
ATOM 7321   N N  . GLY C 2 329  ? 1054.197 770.346 766.961 1.00 0.00 ? 329  GLY C N  1 
ATOM 7322   C CA . GLY C 2 329  ? 1054.709 769.510 768.009 1.00 0.00 ? 329  GLY C CA 1 
ATOM 7323   C C  . GLY C 2 329  ? 1055.667 770.324 768.819 1.00 0.00 ? 329  GLY C C  1 
ATOM 7324   O O  . GLY C 2 329  ? 1056.279 769.823 769.762 1.00 0.00 ? 329  GLY C O  1 
ATOM 7325   N N  . ASP C 2 330  ? 1055.818 771.616 768.471 1.00 0.00 ? 330  ASP C N  1 
ATOM 7326   C CA . ASP C 2 330  ? 1056.730 772.453 769.196 1.00 0.00 ? 330  ASP C CA 1 
ATOM 7327   C C  . ASP C 2 330  ? 1055.951 773.097 770.302 1.00 0.00 ? 330  ASP C C  1 
ATOM 7328   O O  . ASP C 2 330  ? 1055.598 774.272 770.226 1.00 0.00 ? 330  ASP C O  1 
ATOM 7329   C CB . ASP C 2 330  ? 1057.289 773.584 768.319 1.00 0.00 ? 330  ASP C CB 1 
ATOM 7330   N N  . LEU C 2 331  ? 1055.654 772.333 771.368 1.00 0.00 ? 331  LEU C N  1 
ATOM 7331   C CA . LEU C 2 331  ? 1054.863 772.850 772.451 1.00 0.00 ? 331  LEU C CA 1 
ATOM 7332   C C  . LEU C 2 331  ? 1055.653 773.883 773.199 1.00 0.00 ? 331  LEU C C  1 
ATOM 7333   O O  . LEU C 2 331  ? 1055.137 774.943 773.551 1.00 0.00 ? 331  LEU C O  1 
ATOM 7334   C CB . LEU C 2 331  ? 1054.443 771.742 773.439 1.00 0.00 ? 331  LEU C CB 1 
ATOM 7335   N N  . LEU C 2 332  ? 1056.954 773.622 773.428 1.00 0.00 ? 332  LEU C N  1 
ATOM 7336   C CA . LEU C 2 332  ? 1057.714 774.489 774.283 1.00 0.00 ? 332  LEU C CA 1 
ATOM 7337   C C  . LEU C 2 332  ? 1057.721 775.865 773.700 1.00 0.00 ? 332  LEU C C  1 
ATOM 7338   O O  . LEU C 2 332  ? 1057.507 776.849 774.405 1.00 0.00 ? 332  LEU C O  1 
ATOM 7339   C CB . LEU C 2 332  ? 1059.192 774.072 774.421 1.00 0.00 ? 332  LEU C CB 1 
ATOM 7340   N N  . ALA C 2 333  ? 1057.959 775.961 772.379 1.00 0.00 ? 333  ALA C N  1 
ATOM 7341   C CA . ALA C 2 333  ? 1058.040 777.232 771.721 1.00 0.00 ? 333  ALA C CA 1 
ATOM 7342   C C  . ALA C 2 333  ? 1056.716 777.916 771.810 1.00 0.00 ? 333  ALA C C  1 
ATOM 7343   O O  . ALA C 2 333  ? 1056.648 779.126 772.018 1.00 0.00 ? 333  ALA C O  1 
ATOM 7344   C CB . ALA C 2 333  ? 1058.402 777.107 770.232 1.00 0.00 ? 333  ALA C CB 1 
ATOM 7345   N N  . ALA C 2 334  ? 1055.621 777.148 771.661 1.00 0.00 ? 334  ALA C N  1 
ATOM 7346   C CA . ALA C 2 334  ? 1054.308 777.722 771.698 1.00 0.00 ? 334  ALA C CA 1 
ATOM 7347   C C  . ALA C 2 334  ? 1054.125 778.356 773.041 1.00 0.00 ? 334  ALA C C  1 
ATOM 7348   O O  . ALA C 2 334  ? 1053.577 779.452 773.149 1.00 0.00 ? 334  ALA C O  1 
ATOM 7349   C CB . ALA C 2 334  ? 1053.200 776.669 771.529 1.00 0.00 ? 334  ALA C CB 1 
ATOM 7350   N N  . SER C 2 335  ? 1054.599 777.679 774.104 1.00 0.00 ? 335  SER C N  1 
ATOM 7351   C CA . SER C 2 335  ? 1054.450 778.174 775.442 1.00 0.00 ? 335  SER C CA 1 
ATOM 7352   C C  . SER C 2 335  ? 1055.173 779.478 775.563 1.00 0.00 ? 335  SER C C  1 
ATOM 7353   O O  . SER C 2 335  ? 1054.665 780.428 776.157 1.00 0.00 ? 335  SER C O  1 
ATOM 7354   C CB . SER C 2 335  ? 1055.055 777.226 776.491 1.00 0.00 ? 335  SER C CB 1 
ATOM 7355   N N  . GLN C 2 336  ? 1056.378 779.558 774.983 1.00 0.00 ? 336  GLN C N  1 
ATOM 7356   C CA . GLN C 2 336  ? 1057.175 780.742 775.097 1.00 0.00 ? 336  GLN C CA 1 
ATOM 7357   C C  . GLN C 2 336  ? 1056.474 781.883 774.427 1.00 0.00 ? 336  GLN C C  1 
ATOM 7358   O O  . GLN C 2 336  ? 1056.496 783.008 774.925 1.00 0.00 ? 336  GLN C O  1 
ATOM 7359   C CB . GLN C 2 336  ? 1058.578 780.562 774.484 1.00 0.00 ? 336  GLN C CB 1 
ATOM 7360   N N  . VAL C 2 337  ? 1055.809 781.622 773.287 1.00 0.00 ? 337  VAL C N  1 
ATOM 7361   C CA . VAL C 2 337  ? 1055.145 782.673 772.570 1.00 0.00 ? 337  VAL C CA 1 
ATOM 7362   C C  . VAL C 2 337  ? 1054.096 783.272 773.454 1.00 0.00 ? 337  VAL C C  1 
ATOM 7363   O O  . VAL C 2 337  ? 1053.950 784.492 773.527 1.00 0.00 ? 337  VAL C O  1 
ATOM 7364   C CB . VAL C 2 337  ? 1054.456 782.180 771.329 1.00 0.00 ? 337  VAL C CB 1 
ATOM 7365   N N  . VAL C 2 338  ? 1053.345 782.418 774.170 1.00 0.00 ? 338  VAL C N  1 
ATOM 7366   C CA . VAL C 2 338  ? 1052.273 782.869 775.010 1.00 0.00 ? 338  VAL C CA 1 
ATOM 7367   C C  . VAL C 2 338  ? 1052.826 783.737 776.099 1.00 0.00 ? 338  VAL C C  1 
ATOM 7368   O O  . VAL C 2 338  ? 1052.219 784.739 776.474 1.00 0.00 ? 338  VAL C O  1 
ATOM 7369   C CB . VAL C 2 338  ? 1051.541 781.733 775.667 1.00 0.00 ? 338  VAL C CB 1 
ATOM 7370   N N  . ASN C 2 339  ? 1054.008 783.373 776.626 1.00 0.00 ? 339  ASN C N  1 
ATOM 7371   C CA . ASN C 2 339  ? 1054.608 784.040 777.751 1.00 0.00 ? 339  ASN C CA 1 
ATOM 7372   C C  . ASN C 2 339  ? 1054.826 785.488 777.405 1.00 0.00 ? 339  ASN C C  1 
ATOM 7373   O O  . ASN C 2 339  ? 1054.503 786.388 778.178 1.00 0.00 ? 339  ASN C O  1 
ATOM 7374   C CB . ASN C 2 339  ? 1055.975 783.406 778.091 1.00 0.00 ? 339  ASN C CB 1 
ATOM 7375   N N  . ARG C 2 340  ? 1055.385 785.731 776.207 1.00 0.00 ? 340  ARG C N  1 
ATOM 7376   C CA . ARG C 2 340  ? 1055.738 786.996 775.612 1.00 0.00 ? 340  ARG C CA 1 
ATOM 7377   C C  . ARG C 2 340  ? 1054.529 787.763 775.123 1.00 0.00 ? 340  ARG C C  1 
ATOM 7378   O O  . ARG C 2 340  ? 1054.616 788.955 774.839 1.00 0.00 ? 340  ARG C O  1 
ATOM 7379   C CB . ARG C 2 340  ? 1056.705 786.816 774.426 1.00 0.00 ? 340  ARG C CB 1 
ATOM 7380   N N  . ALA C 2 341  ? 1053.371 787.096 775.048 1.00 0.00 ? 341  ALA C N  1 
ATOM 7381   C CA . ALA C 2 341  ? 1052.186 787.433 774.317 1.00 0.00 ? 341  ALA C CA 1 
ATOM 7382   C C  . ALA C 2 341  ? 1051.559 788.806 774.451 1.00 0.00 ? 341  ALA C C  1 
ATOM 7383   O O  . ALA C 2 341  ? 1051.248 789.327 773.404 1.00 0.00 ? 341  ALA C O  1 
ATOM 7384   C CB . ALA C 2 341  ? 1051.091 786.378 774.571 1.00 0.00 ? 341  ALA C CB 1 
ATOM 7385   N N  . GLN C 2 342  ? 1051.404 789.424 775.659 1.00 0.00 ? 342  GLN C N  1 
ATOM 7386   C CA . GLN C 2 342  ? 1050.629 790.645 775.785 1.00 0.00 ? 342  GLN C CA 1 
ATOM 7387   C C  . GLN C 2 342  ? 1049.253 790.141 775.513 1.00 0.00 ? 342  GLN C C  1 
ATOM 7388   O O  . GLN C 2 342  ? 1048.809 790.092 774.370 1.00 0.00 ? 342  GLN C O  1 
ATOM 7389   C CB . GLN C 2 342  ? 1050.919 791.702 774.700 1.00 0.00 ? 342  GLN C CB 1 
ATOM 7390   N N  . HIS C 2 343  ? 1048.533 789.756 776.579 1.00 0.00 ? 343  HIS C N  1 
ATOM 7391   C CA . HIS C 2 343  ? 1047.257 789.116 776.447 1.00 0.00 ? 343  HIS C CA 1 
ATOM 7392   C C  . HIS C 2 343  ? 1046.565 789.358 777.745 1.00 0.00 ? 343  HIS C C  1 
ATOM 7393   O O  . HIS C 2 343  ? 1047.141 790.017 778.606 1.00 0.00 ? 343  HIS C O  1 
ATOM 7394   C CB . HIS C 2 343  ? 1047.479 787.609 776.239 1.00 0.00 ? 343  HIS C CB 1 
ATOM 7395   N N  . GLN C 2 344  ? 1045.301 788.905 777.939 1.00 0.00 ? 344  GLN C N  1 
ATOM 7396   C CA . GLN C 2 344  ? 1044.802 789.203 779.258 1.00 0.00 ? 344  GLN C CA 1 
ATOM 7397   C C  . GLN C 2 344  ? 1043.929 788.104 779.828 1.00 0.00 ? 344  GLN C C  1 
ATOM 7398   O O  . GLN C 2 344  ? 1043.250 788.292 780.832 1.00 0.00 ? 344  GLN C O  1 
ATOM 7399   C CB . GLN C 2 344  ? 1044.080 790.563 779.338 1.00 0.00 ? 344  GLN C CB 1 
ATOM 7400   N N  . LEU C 2 345  ? 1043.905 786.934 779.173 1.00 0.00 ? 345  LEU C N  1 
ATOM 7401   C CA . LEU C 2 345  ? 1043.331 785.695 779.635 1.00 0.00 ? 345  LEU C CA 1 
ATOM 7402   C C  . LEU C 2 345  ? 1044.302 784.949 780.496 1.00 0.00 ? 345  LEU C C  1 
ATOM 7403   O O  . LEU C 2 345  ? 1044.146 783.748 780.703 1.00 0.00 ? 345  LEU C O  1 
ATOM 7404   C CB . LEU C 2 345  ? 1042.685 784.749 778.614 1.00 0.00 ? 345  LEU C CB 1 
ATOM 7405   N N  . GLY C 2 346  ? 1045.337 785.646 781.002 1.00 0.00 ? 346  GLY C N  1 
ATOM 7406   C CA . GLY C 2 346  ? 1046.562 785.154 781.587 1.00 0.00 ? 346  GLY C CA 1 
ATOM 7407   C C  . GLY C 2 346  ? 1046.380 783.950 782.469 1.00 0.00 ? 346  GLY C C  1 
ATOM 7408   O O  . GLY C 2 346  ? 1047.345 783.208 782.653 1.00 0.00 ? 346  GLY C O  1 
ATOM 7409   N N  . GLU C 2 347  ? 1045.207 783.720 783.086 1.00 0.00 ? 347  GLU C N  1 
ATOM 7410   C CA . GLU C 2 347  ? 1045.058 782.509 783.859 1.00 0.00 ? 347  GLU C CA 1 
ATOM 7411   C C  . GLU C 2 347  ? 1045.369 781.330 782.974 1.00 0.00 ? 347  GLU C C  1 
ATOM 7412   O O  . GLU C 2 347  ? 1045.990 780.362 783.412 1.00 0.00 ? 347  GLU C O  1 
ATOM 7413   C CB . GLU C 2 347  ? 1043.622 782.278 784.368 1.00 0.00 ? 347  GLU C CB 1 
ATOM 7414   N N  . PHE C 2 348  ? 1044.958 781.395 781.695 1.00 0.00 ? 348  PHE C N  1 
ATOM 7415   C CA . PHE C 2 348  ? 1045.157 780.334 780.744 1.00 0.00 ? 348  PHE C CA 1 
ATOM 7416   C C  . PHE C 2 348  ? 1046.624 780.087 780.609 1.00 0.00 ? 348  PHE C C  1 
ATOM 7417   O O  . PHE C 2 348  ? 1047.064 778.945 780.491 1.00 0.00 ? 348  PHE C O  1 
ATOM 7418   C CB . PHE C 2 348  ? 1044.621 780.695 779.345 1.00 0.00 ? 348  PHE C CB 1 
ATOM 7419   N N  . LYS C 2 349  ? 1047.421 781.165 780.656 1.00 0.00 ? 349  LYS C N  1 
ATOM 7420   C CA . LYS C 2 349  ? 1048.840 781.091 780.469 1.00 0.00 ? 349  LYS C CA 1 
ATOM 7421   C C  . LYS C 2 349  ? 1049.384 780.126 781.474 1.00 0.00 ? 349  LYS C C  1 
ATOM 7422   O O  . LYS C 2 349  ? 1050.290 779.348 781.179 1.00 0.00 ? 349  LYS C O  1 
ATOM 7423   C CB . LYS C 2 349  ? 1049.483 782.464 780.721 1.00 0.00 ? 349  LYS C CB 1 
ATOM 7424   N N  . THR C 2 350  ? 1048.830 780.162 782.697 1.00 0.00 ? 350  THR C N  1 
ATOM 7425   C CA . THR C 2 350  ? 1049.262 779.304 783.760 1.00 0.00 ? 350  THR C CA 1 
ATOM 7426   C C  . THR C 2 350  ? 1049.000 777.879 783.381 1.00 0.00 ? 350  THR C C  1 
ATOM 7427   O O  . THR C 2 350  ? 1049.858 777.016 783.546 1.00 0.00 ? 350  THR C O  1 
ATOM 7428   C CB . THR C 2 350  ? 1048.495 779.556 785.023 1.00 0.00 ? 350  THR C CB 1 
ATOM 7429   N N  . TRP C 2 351  ? 1047.793 777.608 782.855 1.00 0.00 ? 351  TRP C N  1 
ATOM 7430   C CA . TRP C 2 351  ? 1047.336 776.283 782.533 1.00 0.00 ? 351  TRP C CA 1 
ATOM 7431   C C  . TRP C 2 351  ? 1048.058 775.750 781.325 1.00 0.00 ? 351  TRP C C  1 
ATOM 7432   O O  . TRP C 2 351  ? 1048.016 774.556 781.021 1.00 0.00 ? 351  TRP C O  1 
ATOM 7433   C CB . TRP C 2 351  ? 1045.823 776.201 782.312 1.00 0.00 ? 351  TRP C CB 1 
ATOM 7434   N N  . PHE C 2 352  ? 1048.629 776.629 780.498 1.00 0.00 ? 352  PHE C N  1 
ATOM 7435   C CA . PHE C 2 352  ? 1049.409 776.092 779.426 1.00 0.00 ? 352  PHE C CA 1 
ATOM 7436   C C  . PHE C 2 352  ? 1050.665 775.508 780.024 1.00 0.00 ? 352  PHE C C  1 
ATOM 7437   O O  . PHE C 2 352  ? 1051.054 774.381 779.718 1.00 0.00 ? 352  PHE C O  1 
ATOM 7438   C CB . PHE C 2 352  ? 1049.738 777.195 778.400 1.00 0.00 ? 352  PHE C CB 1 
ATOM 7439   N N  . GLN C 2 353  ? 1051.304 776.257 780.953 1.00 0.00 ? 353  GLN C N  1 
ATOM 7440   C CA . GLN C 2 353  ? 1052.550 775.819 781.520 1.00 0.00 ? 353  GLN C CA 1 
ATOM 7441   C C  . GLN C 2 353  ? 1052.286 774.997 782.743 1.00 0.00 ? 353  GLN C C  1 
ATOM 7442   O O  . GLN C 2 353  ? 1051.997 775.510 783.822 1.00 0.00 ? 353  GLN C O  1 
ATOM 7443   C CB . GLN C 2 353  ? 1053.477 776.979 781.926 1.00 0.00 ? 353  GLN C CB 1 
ATOM 7444   N N  . GLU C 2 354  ? 1052.357 773.668 782.546 1.00 0.00 ? 354  GLU C N  1 
ATOM 7445   C CA . GLU C 2 354  ? 1052.201 772.571 783.463 1.00 0.00 ? 354  GLU C CA 1 
ATOM 7446   C C  . GLU C 2 354  ? 1051.584 771.522 782.604 1.00 0.00 ? 354  GLU C C  1 
ATOM 7447   O O  . GLU C 2 354  ? 1051.794 770.327 782.795 1.00 0.00 ? 354  GLU C O  1 
ATOM 7448   C CB . GLU C 2 354  ? 1051.393 772.816 784.759 1.00 0.00 ? 354  GLU C CB 1 
ATOM 7449   N N  . TYR C 2 355  ? 1050.800 771.978 781.604 1.00 0.00 ? 355  TYR C N  1 
ATOM 7450   C CA . TYR C 2 355  ? 1050.342 771.077 780.594 1.00 0.00 ? 355  TYR C CA 1 
ATOM 7451   C C  . TYR C 2 355  ? 1051.607 770.622 779.937 1.00 0.00 ? 355  TYR C C  1 
ATOM 7452   O O  . TYR C 2 355  ? 1051.813 769.436 779.691 1.00 0.00 ? 355  TYR C O  1 
ATOM 7453   C CB . TYR C 2 355  ? 1049.515 771.801 779.514 1.00 0.00 ? 355  TYR C CB 1 
ATOM 7454   N N  . MET C 2 356  ? 1052.484 771.604 779.639 1.00 0.00 ? 356  MET C N  1 
ATOM 7455   C CA . MET C 2 356  ? 1053.767 771.412 779.016 1.00 0.00 ? 356  MET C CA 1 
ATOM 7456   C C  . MET C 2 356  ? 1054.723 770.692 779.928 1.00 0.00 ? 356  MET C C  1 
ATOM 7457   O O  . MET C 2 356  ? 1055.465 769.813 779.492 1.00 0.00 ? 356  MET C O  1 
ATOM 7458   C CB . MET C 2 356  ? 1054.396 772.766 778.637 1.00 0.00 ? 356  MET C CB 1 
ATOM 7459   N N  . ASN C 2 357  ? 1054.718 771.046 781.228 1.00 0.00 ? 357  ASN C N  1 
ATOM 7460   C CA . ASN C 2 357  ? 1055.668 770.538 782.183 1.00 0.00 ? 357  ASN C CA 1 
ATOM 7461   C C  . ASN C 2 357  ? 1055.517 769.055 782.332 1.00 0.00 ? 357  ASN C C  1 
ATOM 7462   O O  . ASN C 2 357  ? 1056.501 768.318 782.347 1.00 0.00 ? 357  ASN C O  1 
ATOM 7463   C CB . ASN C 2 357  ? 1055.463 771.173 783.572 1.00 0.00 ? 357  ASN C CB 1 
ATOM 7464   N N  . SER C 2 358  ? 1054.268 768.569 782.418 1.00 0.00 ? 358  SER C N  1 
ATOM 7465   C CA . SER C 2 358  ? 1054.023 767.174 782.642 1.00 0.00 ? 358  SER C CA 1 
ATOM 7466   C C  . SER C 2 358  ? 1054.164 766.425 781.354 1.00 0.00 ? 358  SER C C  1 
ATOM 7467   O O  . SER C 2 358  ? 1054.794 766.884 780.402 1.00 0.00 ? 358  SER C O  1 
ATOM 7468   C CB . SER C 2 358  ? 1052.617 766.886 783.198 1.00 0.00 ? 358  SER C CB 1 
ATOM 7469   N N  . LYS C 2 359  ? 1053.598 765.204 781.346 1.00 0.00 ? 359  LYS C N  1 
ATOM 7470   C CA . LYS C 2 359  ? 1053.567 764.267 780.262 1.00 0.00 ? 359  LYS C CA 1 
ATOM 7471   C C  . LYS C 2 359  ? 1052.667 764.764 779.175 1.00 0.00 ? 359  LYS C C  1 
ATOM 7472   O O  . LYS C 2 359  ? 1052.441 764.080 778.182 1.00 0.00 ? 359  LYS C O  1 
ATOM 7473   C CB . LYS C 2 359  ? 1053.226 762.831 780.674 1.00 0.00 ? 359  LYS C CB 1 
ATOM 7474   N N  . ASP C 2 360  ? 1052.101 765.968 779.369 1.00 0.00 ? 360  ASP C N  1 
ATOM 7475   C CA . ASP C 2 360  ? 1051.191 766.607 778.459 1.00 0.00 ? 360  ASP C CA 1 
ATOM 7476   C C  . ASP C 2 360  ? 1049.810 766.143 778.732 1.00 0.00 ? 360  ASP C C  1 
ATOM 7477   O O  . ASP C 2 360  ? 1048.871 766.539 778.045 1.00 0.00 ? 360  ASP C O  1 
ATOM 7478   C CB . ASP C 2 360  ? 1051.474 766.343 776.969 1.00 0.00 ? 360  ASP C CB 1 
ATOM 7479   N N  . ARG C 2 361  ? 1049.631 765.296 779.753 1.00 0.00 ? 361  ARG C N  1 
ATOM 7480   C CA . ARG C 2 361  ? 1048.276 765.133 780.159 1.00 0.00 ? 361  ARG C CA 1 
ATOM 7481   C C  . ARG C 2 361  ? 1048.260 765.918 781.426 1.00 0.00 ? 361  ARG C C  1 
ATOM 7482   O O  . ARG C 2 361  ? 1048.346 765.378 782.528 1.00 0.00 ? 361  ARG C O  1 
ATOM 7483   C CB . ARG C 2 361  ? 1047.867 763.670 780.394 1.00 0.00 ? 361  ARG C CB 1 
ATOM 7484   N N  . ARG C 2 362  ? 1048.163 767.253 781.270 1.00 0.00 ? 362  ARG C N  1 
ATOM 7485   C CA . ARG C 2 362  ? 1048.258 768.154 782.379 1.00 0.00 ? 362  ARG C CA 1 
ATOM 7486   C C  . ARG C 2 362  ? 1047.097 767.887 783.261 1.00 0.00 ? 362  ARG C C  1 
ATOM 7487   O O  . ARG C 2 362  ? 1045.989 768.351 783.003 1.00 0.00 ? 362  ARG C O  1 
ATOM 7488   C CB . ARG C 2 362  ? 1048.164 769.625 781.947 1.00 0.00 ? 362  ARG C CB 1 
ATOM 7489   N N  . LEU C 2 363  ? 1047.336 767.135 784.348 1.00 0.00 ? 363  LEU C N  1 
ATOM 7490   C CA . LEU C 2 363  ? 1046.260 766.852 785.238 1.00 0.00 ? 363  LEU C CA 1 
ATOM 7491   C C  . LEU C 2 363  ? 1046.623 767.367 786.578 1.00 0.00 ? 363  LEU C C  1 
ATOM 7492   O O  . LEU C 2 363  ? 1047.427 766.778 787.297 1.00 0.00 ? 363  LEU C O  1 
ATOM 7493   C CB . LEU C 2 363  ? 1045.949 765.342 785.344 1.00 0.00 ? 363  LEU C CB 1 
ATOM 7494   N N  . SER C 2 364  ? 1046.038 768.521 786.931 1.00 0.00 ? 364  SER C N  1 
ATOM 7495   C CA . SER C 2 364  ? 1046.224 769.010 788.254 1.00 0.00 ? 364  SER C CA 1 
ATOM 7496   C C  . SER C 2 364  ? 1044.988 768.576 788.959 1.00 0.00 ? 364  SER C C  1 
ATOM 7497   O O  . SER C 2 364  ? 1043.903 768.614 788.383 1.00 0.00 ? 364  SER C O  1 
ATOM 7498   C CB . SER C 2 364  ? 1046.311 770.543 788.347 1.00 0.00 ? 364  SER C CB 1 
ATOM 7499   N N  . PRO C 2 365  ? 1045.100 768.135 790.176 1.00 0.00 ? 365  PRO C N  1 
ATOM 7500   C CA . PRO C 2 365  ? 1043.946 767.754 790.938 1.00 0.00 ? 365  PRO C CA 1 
ATOM 7501   C C  . PRO C 2 365  ? 1043.191 769.019 791.148 1.00 0.00 ? 365  PRO C C  1 
ATOM 7502   O O  . PRO C 2 365  ? 1041.991 768.982 791.413 1.00 0.00 ? 365  PRO C O  1 
ATOM 7503   C CB . PRO C 2 365  ? 1044.485 767.102 792.214 1.00 0.00 ? 365  PRO C CB 1 
ATOM 7504   N N  . ALA C 2 366  ? 1043.919 770.142 791.034 1.00 0.00 ? 366  ALA C N  1 
ATOM 7505   C CA . ALA C 2 366  ? 1043.444 771.479 791.163 1.00 0.00 ? 366  ALA C CA 1 
ATOM 7506   C C  . ALA C 2 366  ? 1042.899 771.898 789.838 1.00 0.00 ? 366  ALA C C  1 
ATOM 7507   O O  . ALA C 2 366  ? 1042.430 771.083 789.044 1.00 0.00 ? 366  ALA C O  1 
ATOM 7508   C CB . ALA C 2 366  ? 1044.535 772.487 791.558 1.00 0.00 ? 366  ALA C CB 1 
ATOM 7509   N N  . THR C 2 367  ? 1042.937 773.221 789.607 1.00 0.00 ? 367  THR C N  1 
ATOM 7510   C CA . THR C 2 367  ? 1042.389 773.894 788.468 1.00 0.00 ? 367  THR C CA 1 
ATOM 7511   C C  . THR C 2 367  ? 1042.578 773.119 787.208 1.00 0.00 ? 367  THR C C  1 
ATOM 7512   O O  . THR C 2 367  ? 1043.663 772.647 786.869 1.00 0.00 ? 367  THR C O  1 
ATOM 7513   C CB . THR C 2 367  ? 1042.979 775.256 788.252 1.00 0.00 ? 367  THR C CB 1 
ATOM 7514   N N  . GLU C 2 368  ? 1041.437 772.967 786.512 1.00 0.00 ? 368  GLU C N  1 
ATOM 7515   C CA . GLU C 2 368  ? 1041.207 772.333 785.251 1.00 0.00 ? 368  GLU C CA 1 
ATOM 7516   C C  . GLU C 2 368  ? 1039.751 772.589 785.112 1.00 0.00 ? 368  GLU C C  1 
ATOM 7517   O O  . GLU C 2 368  ? 1039.219 772.854 784.035 1.00 0.00 ? 368  GLU C O  1 
ATOM 7518   C CB . GLU C 2 368  ? 1041.417 770.809 785.299 1.00 0.00 ? 368  GLU C CB 1 
ATOM 7519   N N  . ASN C 2 369  ? 1039.096 772.500 786.285 1.00 0.00 ? 369  ASN C N  1 
ATOM 7520   C CA . ASN C 2 369  ? 1037.712 772.772 786.519 1.00 0.00 ? 369  ASN C CA 1 
ATOM 7521   C C  . ASN C 2 369  ? 1037.507 774.239 786.291 1.00 0.00 ? 369  ASN C C  1 
ATOM 7522   O O  . ASN C 2 369  ? 1036.561 774.649 785.619 1.00 0.00 ? 369  ASN C O  1 
ATOM 7523   C CB . ASN C 2 369  ? 1037.356 772.485 787.992 1.00 0.00 ? 369  ASN C CB 1 
ATOM 7524   N N  . LYS C 2 370  ? 1038.413 775.069 786.849 1.00 0.00 ? 370  LYS C N  1 
ATOM 7525   C CA . LYS C 2 370  ? 1038.256 776.491 786.777 1.00 0.00 ? 370  LYS C CA 1 
ATOM 7526   C C  . LYS C 2 370  ? 1038.407 776.937 785.356 1.00 0.00 ? 370  LYS C C  1 
ATOM 7527   O O  . LYS C 2 370  ? 1037.671 777.802 784.887 1.00 0.00 ? 370  LYS C O  1 
ATOM 7528   C CB . LYS C 2 370  ? 1039.269 777.247 787.650 1.00 0.00 ? 370  LYS C CB 1 
ATOM 7529   N N  . LEU C 2 371  ? 1039.374 776.341 784.632 1.00 0.00 ? 371  LEU C N  1 
ATOM 7530   C CA . LEU C 2 371  ? 1039.653 776.677 783.264 1.00 0.00 ? 371  LEU C CA 1 
ATOM 7531   C C  . LEU C 2 371  ? 1038.451 776.353 782.442 1.00 0.00 ? 371  LEU C C  1 
ATOM 7532   O O  . LEU C 2 371  ? 1038.097 777.097 781.529 1.00 0.00 ? 371  LEU C O  1 
ATOM 7533   C CB . LEU C 2 371  ? 1040.858 775.880 782.717 1.00 0.00 ? 371  LEU C CB 1 
ATOM 7534   N N  . ARG C 2 372  ? 1037.793 775.222 782.750 1.00 0.00 ? 372  ARG C N  1 
ATOM 7535   C CA . ARG C 2 372  ? 1036.662 774.787 781.988 1.00 0.00 ? 372  ARG C CA 1 
ATOM 7536   C C  . ARG C 2 372  ? 1035.531 775.759 782.102 1.00 0.00 ? 372  ARG C C  1 
ATOM 7537   O O  . ARG C 2 372  ? 1034.851 776.027 781.114 1.00 0.00 ? 372  ARG C O  1 
ATOM 7538   C CB . ARG C 2 372  ? 1036.141 773.406 782.417 1.00 0.00 ? 372  ARG C CB 1 
ATOM 7539   N N  . LEU C 2 373  ? 1035.287 776.307 783.307 1.00 0.00 ? 373  LEU C N  1 
ATOM 7540   C CA . LEU C 2 373  ? 1034.158 777.172 783.487 1.00 0.00 ? 373  LEU C CA 1 
ATOM 7541   C C  . LEU C 2 373  ? 1034.375 778.402 782.651 1.00 0.00 ? 373  LEU C C  1 
ATOM 7542   O O  . LEU C 2 373  ? 1033.475 778.847 781.939 1.00 0.00 ? 373  LEU C O  1 
ATOM 7543   C CB . LEU C 2 373  ? 1033.992 777.609 784.957 1.00 0.00 ? 373  LEU C CB 1 
ATOM 7544   N N  . HIS C 2 374  ? 1035.602 778.957 782.677 1.00 0.00 ? 374  HIS C N  1 
ATOM 7545   C CA . HIS C 2 374  ? 1035.880 780.175 781.968 1.00 0.00 ? 374  HIS C CA 1 
ATOM 7546   C C  . HIS C 2 374  ? 1035.645 779.961 780.510 1.00 0.00 ? 374  HIS C C  1 
ATOM 7547   O O  . HIS C 2 374  ? 1035.099 780.829 779.830 1.00 0.00 ? 374  HIS C O  1 
ATOM 7548   C CB . HIS C 2 374  ? 1037.329 780.662 782.137 1.00 0.00 ? 374  HIS C CB 1 
ATOM 7549   N N  . TYR C 2 375  ? 1036.045 778.789 779.991 1.00 0.00 ? 375  TYR C N  1 
ATOM 7550   C CA . TYR C 2 375  ? 1035.898 778.501 778.595 1.00 0.00 ? 375  TYR C CA 1 
ATOM 7551   C C  . TYR C 2 375  ? 1034.448 778.580 778.255 1.00 0.00 ? 375  TYR C C  1 
ATOM 7552   O O  . TYR C 2 375  ? 1034.053 779.292 777.333 1.00 0.00 ? 375  TYR C O  1 
ATOM 7553   C CB . TYR C 2 375  ? 1036.366 777.064 778.289 1.00 0.00 ? 375  TYR C CB 1 
ATOM 7554   N N  . ARG C 2 376  ? 1033.603 777.888 779.036 1.00 0.00 ? 376  ARG C N  1 
ATOM 7555   C CA . ARG C 2 376  ? 1032.218 777.861 778.693 1.00 0.00 ? 376  ARG C CA 1 
ATOM 7556   C C  . ARG C 2 376  ? 1031.667 779.243 778.722 1.00 0.00 ? 376  ARG C C  1 
ATOM 7557   O O  . ARG C 2 376  ? 1031.034 779.687 777.766 1.00 0.00 ? 376  ARG C O  1 
ATOM 7558   C CB . ARG C 2 376  ? 1031.379 777.040 779.688 1.00 0.00 ? 376  ARG C CB 1 
ATOM 7559   N N  . ARG C 2 377  ? 1031.877 779.967 779.831 1.00 0.00 ? 377  ARG C N  1 
ATOM 7560   C CA . ARG C 2 377  ? 1031.242 781.244 779.879 1.00 0.00 ? 377  ARG C CA 1 
ATOM 7561   C C  . ARG C 2 377  ? 1031.835 782.221 778.904 1.00 0.00 ? 377  ARG C C  1 
ATOM 7562   O O  . ARG C 2 377  ? 1031.145 782.690 777.999 1.00 0.00 ? 377  ARG C O  1 
ATOM 7563   C CB . ARG C 2 377  ? 1031.248 781.825 781.309 1.00 0.00 ? 377  ARG C CB 1 
ATOM 7564   N N  . ALA C 2 378  ? 1033.134 782.553 779.056 1.00 0.00 ? 378  ALA C N  1 
ATOM 7565   C CA . ALA C 2 378  ? 1033.712 783.575 778.223 1.00 0.00 ? 378  ALA C CA 1 
ATOM 7566   C C  . ALA C 2 378  ? 1034.027 783.191 776.802 1.00 0.00 ? 378  ALA C C  1 
ATOM 7567   O O  . ALA C 2 378  ? 1033.518 783.798 775.860 1.00 0.00 ? 378  ALA C O  1 
ATOM 7568   C CB . ALA C 2 378  ? 1035.015 784.131 778.819 1.00 0.00 ? 378  ALA C CB 1 
ATOM 7569   N N  . LEU C 2 379  ? 1034.869 782.149 776.628 1.00 0.00 ? 379  LEU C N  1 
ATOM 7570   C CA . LEU C 2 379  ? 1035.460 781.830 775.350 1.00 0.00 ? 379  LEU C CA 1 
ATOM 7571   C C  . LEU C 2 379  ? 1034.536 781.183 774.364 1.00 0.00 ? 379  LEU C C  1 
ATOM 7572   O O  . LEU C 2 379  ? 1034.528 781.530 773.184 1.00 0.00 ? 379  LEU C O  1 
ATOM 7573   C CB . LEU C 2 379  ? 1036.670 780.892 775.466 1.00 0.00 ? 379  LEU C CB 1 
ATOM 7574   N N  . ARG C 2 380  ? 1033.710 780.240 774.842 1.00 0.00 ? 380  ARG C N  1 
ATOM 7575   C CA . ARG C 2 380  ? 1032.951 779.350 774.007 1.00 0.00 ? 380  ARG C CA 1 
ATOM 7576   C C  . ARG C 2 380  ? 1032.058 780.100 773.069 1.00 0.00 ? 380  ARG C C  1 
ATOM 7577   O O  . ARG C 2 380  ? 1031.960 779.748 771.893 1.00 0.00 ? 380  ARG C O  1 
ATOM 7578   C CB . ARG C 2 380  ? 1032.102 778.399 774.871 1.00 0.00 ? 380  ARG C CB 1 
ATOM 7579   N N  . ASN C 2 381  ? 1031.390 781.161 773.550 1.00 0.00 ? 381  ASN C N  1 
ATOM 7580   C CA . ASN C 2 381  ? 1030.461 781.831 772.684 1.00 0.00 ? 381  ASN C CA 1 
ATOM 7581   C C  . ASN C 2 381  ? 1031.095 783.100 772.192 1.00 0.00 ? 381  ASN C C  1 
ATOM 7582   O O  . ASN C 2 381  ? 1030.763 784.155 772.731 1.00 0.00 ? 381  ASN C O  1 
ATOM 7583   C CB . ASN C 2 381  ? 1029.219 782.236 773.520 1.00 0.00 ? 381  ASN C CB 1 
ATOM 7584   N N  . ASN C 2 382  ? 1031.969 783.060 771.154 1.00 0.00 ? 382  ASN C N  1 
ATOM 7585   C CA . ASN C 2 382  ? 1032.559 784.315 770.765 1.00 0.00 ? 382  ASN C CA 1 
ATOM 7586   C C  . ASN C 2 382  ? 1033.662 784.178 769.744 1.00 0.00 ? 382  ASN C C  1 
ATOM 7587   O O  . ASN C 2 382  ? 1033.480 783.908 768.547 1.00 0.00 ? 382  ASN C O  1 
ATOM 7588   C CB . ASN C 2 382  ? 1033.204 785.075 771.933 1.00 0.00 ? 382  ASN C CB 1 
ATOM 7589   N N  . THR C 2 383  ? 1034.864 784.396 770.320 1.00 0.00 ? 383  THR C N  1 
ATOM 7590   C CA . THR C 2 383  ? 1036.265 784.582 770.019 1.00 0.00 ? 383  THR C CA 1 
ATOM 7591   C C  . THR C 2 383  ? 1036.826 784.036 768.733 1.00 0.00 ? 383  THR C C  1 
ATOM 7592   O O  . THR C 2 383  ? 1036.200 783.330 767.955 1.00 0.00 ? 383  THR C O  1 
ATOM 7593   C CB . THR C 2 383  ? 1037.069 783.996 771.153 1.00 0.00 ? 383  THR C CB 1 
ATOM 7594   N N  . ASP C 2 384  ? 1038.094 784.482 768.536 1.00 0.00 ? 384  ASP C N  1 
ATOM 7595   C CA . ASP C 2 384  ? 1039.097 784.218 767.543 1.00 0.00 ? 384  ASP C CA 1 
ATOM 7596   C C  . ASP C 2 384  ? 1039.252 782.737 767.501 1.00 0.00 ? 384  ASP C C  1 
ATOM 7597   O O  . ASP C 2 384  ? 1039.499 782.093 768.517 1.00 0.00 ? 384  ASP C O  1 
ATOM 7598   C CB . ASP C 2 384  ? 1040.423 784.864 768.016 1.00 0.00 ? 384  ASP C CB 1 
ATOM 7599   N N  . PRO C 2 385  ? 1039.100 782.196 766.324 1.00 0.00 ? 385  PRO C N  1 
ATOM 7600   C CA . PRO C 2 385  ? 1039.116 780.774 766.129 1.00 0.00 ? 385  PRO C CA 1 
ATOM 7601   C C  . PRO C 2 385  ? 1040.315 780.083 766.699 1.00 0.00 ? 385  PRO C C  1 
ATOM 7602   O O  . PRO C 2 385  ? 1040.140 779.030 767.307 1.00 0.00 ? 385  PRO C O  1 
ATOM 7603   C CB . PRO C 2 385  ? 1039.038 780.577 764.617 1.00 0.00 ? 385  PRO C CB 1 
ATOM 7604   N N  . TYR C 2 386  ? 1041.531 780.627 766.504 1.00 0.00 ? 386  TYR C N  1 
ATOM 7605   C CA . TYR C 2 386  ? 1042.718 779.966 766.972 1.00 0.00 ? 386  TYR C CA 1 
ATOM 7606   C C  . TYR C 2 386  ? 1042.757 779.945 768.464 1.00 0.00 ? 386  TYR C C  1 
ATOM 7607   O O  . TYR C 2 386  ? 1043.214 778.972 769.064 1.00 0.00 ? 386  TYR C O  1 
ATOM 7608   C CB . TYR C 2 386  ? 1044.035 780.573 766.455 1.00 0.00 ? 386  TYR C CB 1 
ATOM 7609   N N  . LYS C 2 387  ? 1042.306 781.038 769.102 1.00 0.00 ? 387  LYS C N  1 
ATOM 7610   C CA . LYS C 2 387  ? 1042.321 781.126 770.532 1.00 0.00 ? 387  LYS C CA 1 
ATOM 7611   C C  . LYS C 2 387  ? 1041.464 780.026 771.068 1.00 0.00 ? 387  LYS C C  1 
ATOM 7612   O O  . LYS C 2 387  ? 1041.821 779.356 772.037 1.00 0.00 ? 387  LYS C O  1 
ATOM 7613   C CB . LYS C 2 387  ? 1041.731 782.457 771.024 1.00 0.00 ? 387  LYS C CB 1 
ATOM 7614   N N  . ARG C 2 388  ? 1040.301 779.811 770.431 1.00 0.00 ? 388  ARG C N  1 
ATOM 7615   C CA . ARG C 2 388  ? 1039.373 778.805 770.849 1.00 0.00 ? 388  ARG C CA 1 
ATOM 7616   C C  . ARG C 2 388  ? 1040.035 777.470 770.703 1.00 0.00 ? 388  ARG C C  1 
ATOM 7617   O O  . ARG C 2 388  ? 1039.919 776.610 771.575 1.00 0.00 ? 388  ARG C O  1 
ATOM 7618   C CB . ARG C 2 388  ? 1038.102 778.819 769.980 1.00 0.00 ? 388  ARG C CB 1 
ATOM 7619   N N  . ALA C 2 389  ? 1040.774 777.273 769.596 1.00 0.00 ? 389  ALA C N  1 
ATOM 7620   C CA . ALA C 2 389  ? 1041.397 776.007 769.356 1.00 0.00 ? 389  ALA C CA 1 
ATOM 7621   C C  . ALA C 2 389  ? 1042.363 775.723 770.460 1.00 0.00 ? 389  ALA C C  1 
ATOM 7622   O O  . ALA C 2 389  ? 1042.370 774.628 771.016 1.00 0.00 ? 389  ALA C O  1 
ATOM 7623   C CB . ALA C 2 389  ? 1042.269 775.991 768.098 1.00 0.00 ? 389  ALA C CB 1 
ATOM 7624   N N  . VAL C 2 390  ? 1043.197 776.714 770.824 1.00 0.00 ? 390  VAL C N  1 
ATOM 7625   C CA . VAL C 2 390  ? 1044.206 776.455 771.808 1.00 0.00 ? 390  VAL C CA 1 
ATOM 7626   C C  . VAL C 2 390  ? 1043.548 776.089 773.099 1.00 0.00 ? 390  VAL C C  1 
ATOM 7627   O O  . VAL C 2 390  ? 1043.939 775.118 773.744 1.00 0.00 ? 390  VAL C O  1 
ATOM 7628   C CB . VAL C 2 390  ? 1045.115 777.623 772.061 1.00 0.00 ? 390  VAL C CB 1 
ATOM 7629   N N  . TYR C 2 391  ? 1042.509 776.839 773.508 1.00 0.00 ? 391  TYR C N  1 
ATOM 7630   C CA . TYR C 2 391  ? 1041.860 776.535 774.752 1.00 0.00 ? 391  TYR C CA 1 
ATOM 7631   C C  . TYR C 2 391  ? 1041.264 775.166 774.704 1.00 0.00 ? 391  TYR C C  1 
ATOM 7632   O O  . TYR C 2 391  ? 1041.476 774.353 775.602 1.00 0.00 ? 391  TYR C O  1 
ATOM 7633   C CB . TYR C 2 391  ? 1040.687 777.482 775.066 1.00 0.00 ? 391  TYR C CB 1 
ATOM 7634   N N  . CYS C 2 392  ? 1040.513 774.870 773.631 1.00 0.00 ? 392  CYS C N  1 
ATOM 7635   C CA . CYS C 2 392  ? 1039.795 773.634 773.582 1.00 0.00 ? 392  CYS C CA 1 
ATOM 7636   C C  . CYS C 2 392  ? 1040.742 772.480 773.604 1.00 0.00 ? 392  CYS C C  1 
ATOM 7637   O O  . CYS C 2 392  ? 1040.597 771.558 774.402 1.00 0.00 ? 392  CYS C O  1 
ATOM 7638   C CB . CYS C 2 392  ? 1038.938 773.513 772.312 1.00 0.00 ? 392  CYS C CB 1 
ATOM 7639   N N  . ILE C 2 393  ? 1041.768 772.521 772.742 1.00 0.00 ? 393  ILE C N  1 
ATOM 7640   C CA . ILE C 2 393  ? 1042.671 771.419 772.594 1.00 0.00 ? 393  ILE C CA 1 
ATOM 7641   C C  . ILE C 2 393  ? 1043.463 771.193 773.845 1.00 0.00 ? 393  ILE C C  1 
ATOM 7642   O O  . ILE C 2 393  ? 1043.544 770.071 774.343 1.00 0.00 ? 393  ILE C O  1 
ATOM 7643   C CB . ILE C 2 393  ? 1043.592 771.666 771.424 1.00 0.00 ? 393  ILE C CB 1 
ATOM 7644   N N  . ILE C 2 394  ? 1044.043 772.258 774.419 1.00 0.00 ? 394  ILE C N  1 
ATOM 7645   C CA . ILE C 2 394  ? 1044.893 772.053 775.550 1.00 0.00 ? 394  ILE C CA 1 
ATOM 7646   C C  . ILE C 2 394  ? 1044.058 771.548 776.692 1.00 0.00 ? 394  ILE C C  1 
ATOM 7647   O O  . ILE C 2 394  ? 1044.384 770.532 777.303 1.00 0.00 ? 394  ILE C O  1 
ATOM 7648   C CB . ILE C 2 394  ? 1045.638 773.325 775.883 1.00 0.00 ? 394  ILE C CB 1 
ATOM 7649   N N  . GLY C 2 395  ? 1042.920 772.230 776.946 1.00 0.00 ? 395  GLY C N  1 
ATOM 7650   C CA . GLY C 2 395  ? 1041.995 772.008 778.022 1.00 0.00 ? 395  GLY C CA 1 
ATOM 7651   C C  . GLY C 2 395  ? 1041.229 770.724 777.889 1.00 0.00 ? 395  GLY C C  1 
ATOM 7652   O O  . GLY C 2 395  ? 1040.918 770.094 778.898 1.00 0.00 ? 395  GLY C O  1 
ATOM 7653   N N  . ARG C 2 396  ? 1040.902 770.286 776.656 1.00 0.00 ? 396  ARG C N  1 
ATOM 7654   C CA . ARG C 2 396  ? 1039.961 769.207 776.524 1.00 0.00 ? 396  ARG C CA 1 
ATOM 7655   C C  . ARG C 2 396  ? 1038.693 769.745 777.108 1.00 0.00 ? 396  ARG C C  1 
ATOM 7656   O O  . ARG C 2 396  ? 1037.947 769.050 777.796 1.00 0.00 ? 396  ARG C O  1 
ATOM 7657   C CB . ARG C 2 396  ? 1040.325 767.921 777.296 1.00 0.00 ? 396  ARG C CB 1 
ATOM 7658   N N  . CYS C 2 397  ? 1038.439 771.037 776.819 1.00 0.00 ? 397  CYS C N  1 
ATOM 7659   C CA . CYS C 2 397  ? 1037.358 771.788 777.383 1.00 0.00 ? 397  CYS C CA 1 
ATOM 7660   C C  . CYS C 2 397  ? 1035.996 771.264 777.034 1.00 0.00 ? 397  CYS C C  1 
ATOM 7661   O O  . CYS C 2 397  ? 1035.209 770.948 777.925 1.00 0.00 ? 397  CYS C O  1 
ATOM 7662   C CB . CYS C 2 397  ? 1037.405 773.263 776.955 1.00 0.00 ? 397  CYS C CB 1 
ATOM 7663   N N  . ASP C 2 398  ? 1035.671 771.139 775.734 1.00 0.00 ? 398  ASP C N  1 
ATOM 7664   C CA . ASP C 2 398  ? 1034.337 770.719 775.404 1.00 0.00 ? 398  ASP C CA 1 
ATOM 7665   C C  . ASP C 2 398  ? 1034.470 769.487 774.570 1.00 0.00 ? 398  ASP C C  1 
ATOM 7666   O O  . ASP C 2 398  ? 1034.925 769.539 773.429 1.00 0.00 ? 398  ASP C O  1 
ATOM 7667   C CB . ASP C 2 398  ? 1033.569 771.780 774.592 1.00 0.00 ? 398  ASP C CB 1 
ATOM 7668   N N  . VAL C 2 399  ? 1034.061 768.337 775.133 1.00 0.00 ? 399  VAL C N  1 
ATOM 7669   C CA . VAL C 2 399  ? 1034.218 767.067 774.489 1.00 0.00 ? 399  VAL C CA 1 
ATOM 7670   C C  . VAL C 2 399  ? 1033.381 766.960 773.251 1.00 0.00 ? 399  VAL C C  1 
ATOM 7671   O O  . VAL C 2 399  ? 1033.716 766.168 772.374 1.00 0.00 ? 399  VAL C O  1 
ATOM 7672   C CB . VAL C 2 399  ? 1034.012 765.893 775.398 1.00 0.00 ? 399  VAL C CB 1 
ATOM 7673   N N  . THR C 2 400  ? 1032.237 767.670 773.148 1.00 0.00 ? 400  THR C N  1 
ATOM 7674   C CA . THR C 2 400  ? 1031.607 767.637 771.854 1.00 0.00 ? 400  THR C CA 1 
ATOM 7675   C C  . THR C 2 400  ? 1032.648 768.228 770.940 1.00 0.00 ? 400  THR C C  1 
ATOM 7676   O O  . THR C 2 400  ? 1033.213 769.279 771.237 1.00 0.00 ? 400  THR C O  1 
ATOM 7677   C CB . THR C 2 400  ? 1030.316 768.401 771.791 1.00 0.00 ? 400  THR C CB 1 
ATOM 7678   N N  . ASP C 2 401  ? 1032.945 767.559 769.803 1.00 0.00 ? 401  ASP C N  1 
ATOM 7679   C CA . ASP C 2 401  ? 1034.180 767.900 769.143 1.00 0.00 ? 401  ASP C CA 1 
ATOM 7680   C C  . ASP C 2 401  ? 1034.065 768.498 767.775 1.00 0.00 ? 401  ASP C C  1 
ATOM 7681   O O  . ASP C 2 401  ? 1033.339 768.008 766.914 1.00 0.00 ? 401  ASP C O  1 
ATOM 7682   C CB . ASP C 2 401  ? 1035.068 766.667 768.915 1.00 0.00 ? 401  ASP C CB 1 
ATOM 7683   N N  . ASN C 2 402  ? 1034.803 769.612 767.576 1.00 0.00 ? 402  ASN C N  1 
ATOM 7684   C CA . ASN C 2 402  ? 1035.118 770.154 766.282 1.00 0.00 ? 402  ASN C CA 1 
ATOM 7685   C C  . ASN C 2 402  ? 1035.500 771.587 766.442 1.00 0.00 ? 402  ASN C C  1 
ATOM 7686   O O  . ASN C 2 402  ? 1034.967 772.287 767.304 1.00 0.00 ? 402  ASN C O  1 
ATOM 7687   C CB . ASN C 2 402  ? 1034.074 769.968 765.150 1.00 0.00 ? 402  ASN C CB 1 
ATOM 7688   N N  . GLN C 2 403  ? 1036.465 772.052 765.619 1.00 0.00 ? 403  GLN C N  1 
ATOM 7689   C CA . GLN C 2 403  ? 1036.883 773.421 765.704 1.00 0.00 ? 403  GLN C CA 1 
ATOM 7690   C C  . GLN C 2 403  ? 1036.371 774.111 764.483 1.00 0.00 ? 403  GLN C C  1 
ATOM 7691   O O  . GLN C 2 403  ? 1036.641 773.706 763.352 1.00 0.00 ? 403  GLN C O  1 
ATOM 7692   C CB . GLN C 2 403  ? 1038.398 773.635 765.750 1.00 0.00 ? 403  GLN C CB 1 
ATOM 7693   N N  . SER C 2 404  ? 1035.641 775.216 764.705 1.00 0.00 ? 404  SER C N  1 
ATOM 7694   C CA . SER C 2 404  ? 1034.930 775.871 763.653 1.00 0.00 ? 404  SER C CA 1 
ATOM 7695   C C  . SER C 2 404  ? 1035.796 776.230 762.489 1.00 0.00 ? 404  SER C C  1 
ATOM 7696   O O  . SER C 2 404  ? 1035.877 775.493 761.508 1.00 0.00 ? 404  SER C O  1 
ATOM 7697   C CB . SER C 2 404  ? 1034.264 777.173 764.132 1.00 0.00 ? 404  SER C CB 1 
ATOM 7698   N N  . GLU C 2 405  ? 1036.469 777.392 762.578 1.00 0.00 ? 405  GLU C N  1 
ATOM 7699   C CA . GLU C 2 405  ? 1037.156 777.932 761.440 1.00 0.00 ? 405  GLU C CA 1 
ATOM 7700   C C  . GLU C 2 405  ? 1038.440 777.263 761.058 1.00 0.00 ? 405  GLU C C  1 
ATOM 7701   O O  . GLU C 2 405  ? 1038.710 777.150 759.863 1.00 0.00 ? 405  GLU C O  1 
ATOM 7702   C CB . GLU C 2 405  ? 1037.396 779.454 761.519 1.00 0.00 ? 405  GLU C CB 1 
ATOM 7703   N N  . VAL C 2 406  ? 1039.285 776.794 762.003 1.00 0.00 ? 406  VAL C N  1 
ATOM 7704   C CA . VAL C 2 406  ? 1040.547 776.426 761.422 1.00 0.00 ? 406  VAL C CA 1 
ATOM 7705   C C  . VAL C 2 406  ? 1040.854 774.960 761.426 1.00 0.00 ? 406  VAL C C  1 
ATOM 7706   O O  . VAL C 2 406  ? 1041.916 774.540 761.881 1.00 0.00 ? 406  VAL C O  1 
ATOM 7707   C CB . VAL C 2 406  ? 1041.710 777.159 762.033 1.00 0.00 ? 406  VAL C CB 1 
ATOM 7708   N N  . ALA C 2 407  ? 1039.963 774.129 760.861 1.00 0.00 ? 407  ALA C N  1 
ATOM 7709   C CA . ALA C 2 407  ? 1040.369 772.776 760.619 1.00 0.00 ? 407  ALA C CA 1 
ATOM 7710   C C  . ALA C 2 407  ? 1040.463 772.790 759.131 1.00 0.00 ? 407  ALA C C  1 
ATOM 7711   O O  . ALA C 2 407  ? 1039.446 772.884 758.448 1.00 0.00 ? 407  ALA C O  1 
ATOM 7712   C CB . ALA C 2 407  ? 1039.320 771.726 761.018 1.00 0.00 ? 407  ALA C CB 1 
ATOM 7713   N N  . ASP C 2 408  ? 1041.684 772.700 758.573 1.00 0.00 ? 408  ASP C N  1 
ATOM 7714   C CA . ASP C 2 408  ? 1041.744 772.889 757.154 1.00 0.00 ? 408  ASP C CA 1 
ATOM 7715   C C  . ASP C 2 408  ? 1042.114 771.616 756.478 1.00 0.00 ? 408  ASP C C  1 
ATOM 7716   O O  . ASP C 2 408  ? 1042.020 771.519 755.254 1.00 0.00 ? 408  ASP C O  1 
ATOM 7717   C CB . ASP C 2 408  ? 1042.806 773.919 756.735 1.00 0.00 ? 408  ASP C CB 1 
ATOM 7718   N N  . LYS C 2 409  ? 1042.532 770.589 757.233 1.00 0.00 ? 409  LYS C N  1 
ATOM 7719   C CA . LYS C 2 409  ? 1042.926 769.423 756.505 1.00 0.00 ? 409  LYS C CA 1 
ATOM 7720   C C  . LYS C 2 409  ? 1042.414 768.217 757.220 1.00 0.00 ? 409  LYS C C  1 
ATOM 7721   O O  . LYS C 2 409  ? 1042.034 768.281 758.389 1.00 0.00 ? 409  LYS C O  1 
ATOM 7722   C CB . LYS C 2 409  ? 1044.450 769.282 756.370 1.00 0.00 ? 409  LYS C CB 1 
ATOM 7723   N N  . THR C 2 410  ? 1042.375 767.075 756.507 1.00 0.00 ? 410  THR C N  1 
ATOM 7724   C CA . THR C 2 410  ? 1041.908 765.852 757.085 1.00 0.00 ? 410  THR C CA 1 
ATOM 7725   C C  . THR C 2 410  ? 1042.844 765.477 758.189 1.00 0.00 ? 410  THR C C  1 
ATOM 7726   O O  . THR C 2 410  ? 1042.401 765.042 759.252 1.00 0.00 ? 410  THR C O  1 
ATOM 7727   C CB . THR C 2 410  ? 1041.831 764.729 756.092 1.00 0.00 ? 410  THR C CB 1 
ATOM 7728   N N  . GLU C 2 411  ? 1044.166 765.628 757.970 1.00 0.00 ? 411  GLU C N  1 
ATOM 7729   C CA . GLU C 2 411  ? 1045.104 765.328 759.016 1.00 0.00 ? 411  GLU C CA 1 
ATOM 7730   C C  . GLU C 2 411  ? 1044.946 766.314 760.130 1.00 0.00 ? 411  GLU C C  1 
ATOM 7731   O O  . GLU C 2 411  ? 1045.134 765.965 761.295 1.00 0.00 ? 411  GLU C O  1 
ATOM 7732   C CB . GLU C 2 411  ? 1046.576 765.233 758.571 1.00 0.00 ? 411  GLU C CB 1 
ATOM 7733   N N  . ASP C 2 412  ? 1044.595 767.575 759.814 1.00 0.00 ? 412  ASP C N  1 
ATOM 7734   C CA . ASP C 2 412  ? 1044.369 768.515 760.875 1.00 0.00 ? 412  ASP C CA 1 
ATOM 7735   C C  . ASP C 2 412  ? 1043.253 767.948 761.688 1.00 0.00 ? 412  ASP C C  1 
ATOM 7736   O O  . ASP C 2 412  ? 1043.253 768.030 762.915 1.00 0.00 ? 412  ASP C O  1 
ATOM 7737   C CB . ASP C 2 412  ? 1043.901 769.900 760.387 1.00 0.00 ? 412  ASP C CB 1 
ATOM 7738   N N  . TYR C 2 413  ? 1042.271 767.339 761.002 1.00 0.00 ? 413  TYR C N  1 
ATOM 7739   C CA . TYR C 2 413  ? 1041.117 766.777 761.635 1.00 0.00 ? 413  TYR C CA 1 
ATOM 7740   C C  . TYR C 2 413  ? 1041.552 765.669 762.553 1.00 0.00 ? 413  TYR C C  1 
ATOM 7741   O O  . TYR C 2 413  ? 1041.103 765.605 763.697 1.00 0.00 ? 413  TYR C O  1 
ATOM 7742   C CB . TYR C 2 413  ? 1040.154 766.181 760.592 1.00 0.00 ? 413  TYR C CB 1 
ATOM 7743   N N  . LEU C 2 414  ? 1042.437 764.761 762.084 1.00 0.00 ? 414  LEU C N  1 
ATOM 7744   C CA . LEU C 2 414  ? 1042.864 763.671 762.924 1.00 0.00 ? 414  LEU C CA 1 
ATOM 7745   C C  . LEU C 2 414  ? 1043.649 764.167 764.089 1.00 0.00 ? 414  LEU C C  1 
ATOM 7746   O O  . LEU C 2 414  ? 1043.432 763.740 765.222 1.00 0.00 ? 414  LEU C O  1 
ATOM 7747   C CB . LEU C 2 414  ? 1043.812 762.642 762.274 1.00 0.00 ? 414  LEU C CB 1 
ATOM 7748   N N  . TRP C 2 415  ? 1044.579 765.101 763.840 1.00 0.00 ? 415  TRP C N  1 
ATOM 7749   C CA . TRP C 2 415  ? 1045.468 765.532 764.874 1.00 0.00 ? 415  TRP C CA 1 
ATOM 7750   C C  . TRP C 2 415  ? 1044.653 766.096 765.988 1.00 0.00 ? 415  TRP C C  1 
ATOM 7751   O O  . TRP C 2 415  ? 1044.914 765.824 767.159 1.00 0.00 ? 415  TRP C O  1 
ATOM 7752   C CB . TRP C 2 415  ? 1046.445 766.617 764.389 1.00 0.00 ? 415  TRP C CB 1 
ATOM 7753   N N  . LEU C 2 416  ? 1043.620 766.882 765.648 1.00 0.00 ? 416  LEU C N  1 
ATOM 7754   C CA . LEU C 2 416  ? 1042.844 767.508 766.671 1.00 0.00 ? 416  LEU C CA 1 
ATOM 7755   C C  . LEU C 2 416  ? 1042.232 766.442 767.516 1.00 0.00 ? 416  LEU C C  1 
ATOM 7756   O O  . LEU C 2 416  ? 1042.284 766.503 768.744 1.00 0.00 ? 416  LEU C O  1 
ATOM 7757   C CB . LEU C 2 416  ? 1041.689 768.353 766.106 1.00 0.00 ? 416  LEU C CB 1 
ATOM 7758   N N  . LYS C 2 417  ? 1041.657 765.408 766.876 1.00 0.00 ? 417  LYS C N  1 
ATOM 7759   C CA . LYS C 2 417  ? 1040.993 764.384 767.626 1.00 0.00 ? 417  LYS C CA 1 
ATOM 7760   C C  . LYS C 2 417  ? 1041.966 763.677 768.513 1.00 0.00 ? 417  LYS C C  1 
ATOM 7761   O O  . LYS C 2 417  ? 1041.658 763.384 769.667 1.00 0.00 ? 417  LYS C O  1 
ATOM 7762   C CB . LYS C 2 417  ? 1040.287 763.331 766.754 1.00 0.00 ? 417  LYS C CB 1 
ATOM 7763   N N  . LEU C 2 418  ? 1043.180 763.396 768.012 1.00 0.00 ? 418  LEU C N  1 
ATOM 7764   C CA . LEU C 2 418  ? 1044.131 762.665 768.797 1.00 0.00 ? 418  LEU C CA 1 
ATOM 7765   C C  . LEU C 2 418  ? 1044.507 763.455 770.012 1.00 0.00 ? 418  LEU C C  1 
ATOM 7766   O O  . LEU C 2 418  ? 1044.720 762.887 771.082 1.00 0.00 ? 418  LEU C O  1 
ATOM 7767   C CB . LEU C 2 418  ? 1045.401 762.291 768.021 1.00 0.00 ? 418  LEU C CB 1 
ATOM 7768   N N  . ASN C 2 419  ? 1044.598 764.791 769.885 1.00 0.00 ? 419  ASN C N  1 
ATOM 7769   C CA . ASN C 2 419  ? 1045.001 765.608 770.995 1.00 0.00 ? 419  ASN C CA 1 
ATOM 7770   C C  . ASN C 2 419  ? 1044.005 765.472 772.099 1.00 0.00 ? 419  ASN C C  1 
ATOM 7771   O O  . ASN C 2 419  ? 1044.366 765.427 773.273 1.00 0.00 ? 419  ASN C O  1 
ATOM 7772   C CB . ASN C 2 419  ? 1045.101 767.099 770.633 1.00 0.00 ? 419  ASN C CB 1 
ATOM 7773   N N  . GLN C 2 420  ? 1042.715 765.391 771.734 1.00 0.00 ? 420  GLN C N  1 
ATOM 7774   C CA . GLN C 2 420  ? 1041.627 765.390 772.668 1.00 0.00 ? 420  GLN C CA 1 
ATOM 7775   C C  . GLN C 2 420  ? 1041.573 764.169 773.552 1.00 0.00 ? 420  GLN C C  1 
ATOM 7776   O O  . GLN C 2 420  ? 1041.196 764.288 774.717 1.00 0.00 ? 420  GLN C O  1 
ATOM 7777   C CB . GLN C 2 420  ? 1040.279 765.607 771.961 1.00 0.00 ? 420  GLN C CB 1 
ATOM 7778   N N  . VAL C 2 421  ? 1041.949 762.971 773.057 1.00 0.00 ? 421  VAL C N  1 
ATOM 7779   C CA . VAL C 2 421  ? 1041.763 761.786 773.856 1.00 0.00 ? 421  VAL C CA 1 
ATOM 7780   C C  . VAL C 2 421  ? 1042.680 761.838 775.049 1.00 0.00 ? 421  VAL C C  1 
ATOM 7781   O O  . VAL C 2 421  ? 1043.770 762.406 774.983 1.00 0.00 ? 421  VAL C O  1 
ATOM 7782   C CB . VAL C 2 421  ? 1042.118 760.491 773.181 1.00 0.00 ? 421  VAL C CB 1 
ATOM 7783   N N  . CYS C 2 422  ? 1042.236 761.273 776.197 1.00 0.00 ? 422  CYS C N  1 
ATOM 7784   C CA . CYS C 2 422  ? 1043.096 761.216 777.351 1.00 0.00 ? 422  CYS C CA 1 
ATOM 7785   C C  . CYS C 2 422  ? 1043.135 759.788 777.812 1.00 0.00 ? 422  CYS C C  1 
ATOM 7786   O O  . CYS C 2 422  ? 1042.187 759.303 778.425 1.00 0.00 ? 422  CYS C O  1 
ATOM 7787   C CB . CYS C 2 422  ? 1042.599 762.057 778.537 1.00 0.00 ? 422  CYS C CB 1 
ATOM 7788   N N  . PHE C 2 423  ? 1044.223 759.061 777.474 1.00 0.00 ? 423  PHE C N  1 
ATOM 7789   C CA . PHE C 2 423  ? 1044.383 757.676 777.832 1.00 0.00 ? 423  PHE C CA 1 
ATOM 7790   C C  . PHE C 2 423  ? 1044.669 757.453 779.289 1.00 0.00 ? 423  PHE C C  1 
ATOM 7791   O O  . PHE C 2 423  ? 1043.988 756.674 779.956 1.00 0.00 ? 423  PHE C O  1 
ATOM 7792   C CB . PHE C 2 423  ? 1045.570 756.996 777.134 1.00 0.00 ? 423  PHE C CB 1 
ATOM 7793   N N  . ASP C 2 424  ? 1045.680 758.161 779.832 1.00 0.00 ? 424  ASP C N  1 
ATOM 7794   C CA . ASP C 2 424  ? 1046.193 757.787 781.121 1.00 0.00 ? 424  ASP C CA 1 
ATOM 7795   C C  . ASP C 2 424  ? 1045.424 758.434 782.221 1.00 0.00 ? 424  ASP C C  1 
ATOM 7796   O O  . ASP C 2 424  ? 1045.107 759.623 782.177 1.00 0.00 ? 424  ASP C O  1 
ATOM 7797   C CB . ASP C 2 424  ? 1047.684 758.134 781.295 1.00 0.00 ? 424  ASP C CB 1 
ATOM 7798   N N  . ASP C 2 425  ? 1045.110 757.615 783.244 1.00 0.00 ? 425  ASP C N  1 
ATOM 7799   C CA . ASP C 2 425  ? 1044.401 758.025 784.417 1.00 0.00 ? 425  ASP C CA 1 
ATOM 7800   C C  . ASP C 2 425  ? 1043.099 758.610 783.993 1.00 0.00 ? 425  ASP C C  1 
ATOM 7801   O O  . ASP C 2 425  ? 1042.540 759.485 784.652 1.00 0.00 ? 425  ASP C O  1 
ATOM 7802   C CB . ASP C 2 425  ? 1045.174 759.045 785.268 1.00 0.00 ? 425  ASP C CB 1 
ATOM 7803   N N  . ASP C 2 426  ? 1042.596 758.151 782.838 1.00 0.00 ? 426  ASP C N  1 
ATOM 7804   C CA . ASP C 2 426  ? 1041.321 758.588 782.376 1.00 0.00 ? 426  ASP C CA 1 
ATOM 7805   C C  . ASP C 2 426  ? 1040.291 757.958 783.249 1.00 0.00 ? 426  ASP C C  1 
ATOM 7806   O O  . ASP C 2 426  ? 1039.347 758.607 783.698 1.00 0.00 ? 426  ASP C O  1 
ATOM 7807   C CB . ASP C 2 426  ? 1041.054 758.142 780.935 1.00 0.00 ? 426  ASP C CB 1 
ATOM 7808   N N  . GLY C 2 427  ? 1040.488 756.659 783.543 1.00 0.00 ? 427  GLY C N  1 
ATOM 7809   C CA . GLY C 2 427  ? 1039.540 755.925 784.323 1.00 0.00 ? 427  GLY C CA 1 
ATOM 7810   C C  . GLY C 2 427  ? 1039.463 756.587 785.650 1.00 0.00 ? 427  GLY C C  1 
ATOM 7811   O O  . GLY C 2 427  ? 1038.382 756.716 786.223 1.00 0.00 ? 427  GLY C O  1 
ATOM 7812   N N  . THR C 2 428  ? 1040.620 757.020 786.182 1.00 0.00 ? 428  THR C N  1 
ATOM 7813   C CA . THR C 2 428  ? 1040.569 757.682 787.447 1.00 0.00 ? 428  THR C CA 1 
ATOM 7814   C C  . THR C 2 428  ? 1039.958 759.021 787.210 1.00 0.00 ? 428  THR C C  1 
ATOM 7815   O O  . THR C 2 428  ? 1039.981 759.535 786.091 1.00 0.00 ? 428  THR C O  1 
ATOM 7816   C CB . THR C 2 428  ? 1041.906 757.844 788.124 1.00 0.00 ? 428  THR C CB 1 
ATOM 7817   N N  . SER C 2 429  ? 1039.365 759.592 788.276 1.00 0.00 ? 429  SER C N  1 
ATOM 7818   C CA . SER C 2 429  ? 1038.650 760.834 788.230 1.00 0.00 ? 429  SER C CA 1 
ATOM 7819   C C  . SER C 2 429  ? 1037.296 760.465 787.724 1.00 0.00 ? 429  SER C C  1 
ATOM 7820   O O  . SER C 2 429  ? 1037.175 759.788 786.704 1.00 0.00 ? 429  SER C O  1 
ATOM 7821   C CB . SER C 2 429  ? 1039.294 761.889 787.308 1.00 0.00 ? 429  SER C CB 1 
ATOM 7822   N N  . SER C 2 430  ? 1036.219 760.887 788.409 1.00 0.00 ? 430  SER C N  1 
ATOM 7823   C CA . SER C 2 430  ? 1034.969 760.399 787.912 1.00 0.00 ? 430  SER C CA 1 
ATOM 7824   C C  . SER C 2 430  ? 1034.196 761.435 787.125 1.00 0.00 ? 430  SER C C  1 
ATOM 7825   O O  . SER C 2 430  ? 1033.004 761.592 787.383 1.00 0.00 ? 430  SER C O  1 
ATOM 7826   C CB . SER C 2 430  ? 1034.067 759.913 789.060 1.00 0.00 ? 430  SER C CB 1 
ATOM 7827   N N  . PRO C 2 431  ? 1034.741 762.173 786.183 1.00 0.00 ? 431  PRO C N  1 
ATOM 7828   C CA . PRO C 2 431  ? 1033.832 762.951 785.387 1.00 0.00 ? 431  PRO C CA 1 
ATOM 7829   C C  . PRO C 2 431  ? 1033.618 762.200 784.118 1.00 0.00 ? 431  PRO C C  1 
ATOM 7830   O O  . PRO C 2 431  ? 1034.396 761.292 783.835 1.00 0.00 ? 431  PRO C O  1 
ATOM 7831   C CB . PRO C 2 431  ? 1034.479 764.308 785.136 1.00 0.00 ? 431  PRO C CB 1 
ATOM 7832   N N  . GLN C 2 432  ? 1032.594 762.551 783.323 1.00 0.00 ? 432  GLN C N  1 
ATOM 7833   C CA . GLN C 2 432  ? 1032.520 761.882 782.063 1.00 0.00 ? 432  GLN C CA 1 
ATOM 7834   C C  . GLN C 2 432  ? 1032.936 762.867 781.023 1.00 0.00 ? 432  GLN C C  1 
ATOM 7835   O O  . GLN C 2 432  ? 1032.151 763.242 780.153 1.00 0.00 ? 432  GLN C O  1 
ATOM 7836   C CB . GLN C 2 432  ? 1031.118 761.371 781.686 1.00 0.00 ? 432  GLN C CB 1 
ATOM 7837   N N  . ASP C 2 433  ? 1034.201 763.321 781.105 1.00 0.00 ? 433  ASP C N  1 
ATOM 7838   C CA . ASP C 2 433  ? 1034.735 764.176 780.091 1.00 0.00 ? 433  ASP C CA 1 
ATOM 7839   C C  . ASP C 2 433  ? 1035.857 763.403 779.503 1.00 0.00 ? 433  ASP C C  1 
ATOM 7840   O O  . ASP C 2 433  ? 1036.822 763.971 778.993 1.00 0.00 ? 433  ASP C O  1 
ATOM 7841   C CB . ASP C 2 433  ? 1035.332 765.495 780.613 1.00 0.00 ? 433  ASP C CB 1 
ATOM 7842   N N  . ARG C 2 434  ? 1035.749 762.065 779.568 1.00 0.00 ? 434  ARG C N  1 
ATOM 7843   C CA . ARG C 2 434  ? 1036.783 761.259 779.010 1.00 0.00 ? 434  ARG C CA 1 
ATOM 7844   C C  . ARG C 2 434  ? 1036.436 760.916 777.603 1.00 0.00 ? 434  ARG C C  1 
ATOM 7845   O O  . ARG C 2 434  ? 1035.287 760.632 777.271 1.00 0.00 ? 434  ARG C O  1 
ATOM 7846   C CB . ARG C 2 434  ? 1037.078 759.977 779.799 1.00 0.00 ? 434  ARG C CB 1 
ATOM 7847   N N  . LEU C 2 435  ? 1037.461 760.976 776.737 1.00 0.00 ? 435  LEU C N  1 
ATOM 7848   C CA . LEU C 2 435  ? 1037.343 760.676 775.346 1.00 0.00 ? 435  LEU C CA 1 
ATOM 7849   C C  . LEU C 2 435  ? 1038.429 759.678 775.083 1.00 0.00 ? 435  LEU C C  1 
ATOM 7850   O O  . LEU C 2 435  ? 1039.596 759.930 775.377 1.00 0.00 ? 435  LEU C O  1 
ATOM 7851   C CB . LEU C 2 435  ? 1037.523 761.975 774.522 1.00 0.00 ? 435  LEU C CB 1 
ATOM 7852   N N  . THR C 2 436  ? 1038.070 758.509 774.520 1.00 0.00 ? 436  THR C N  1 
ATOM 7853   C CA . THR C 2 436  ? 1039.036 757.457 774.400 1.00 0.00 ? 436  THR C CA 1 
ATOM 7854   C C  . THR C 2 436  ? 1039.336 757.198 772.964 1.00 0.00 ? 436  THR C C  1 
ATOM 7855   O O  . THR C 2 436  ? 1038.671 757.707 772.063 1.00 0.00 ? 436  THR C O  1 
ATOM 7856   C CB . THR C 2 436  ? 1038.576 756.157 774.996 1.00 0.00 ? 436  THR C CB 1 
ATOM 7857   N N  . LEU C 2 437  ? 1040.396 756.399 772.739 1.00 0.00 ? 437  LEU C N  1 
ATOM 7858   C CA . LEU C 2 437  ? 1040.842 756.034 771.429 1.00 0.00 ? 437  LEU C CA 1 
ATOM 7859   C C  . LEU C 2 437  ? 1039.715 755.251 770.836 1.00 0.00 ? 437  LEU C C  1 
ATOM 7860   O O  . LEU C 2 437  ? 1039.363 755.413 769.668 1.00 0.00 ? 437  LEU C O  1 
ATOM 7861   C CB . LEU C 2 437  ? 1042.080 755.116 771.491 1.00 0.00 ? 437  LEU C CB 1 
ATOM 7862   N N  . SER C 2 438  ? 1039.090 754.396 771.667 1.00 0.00 ? 438  SER C N  1 
ATOM 7863   C CA . SER C 2 438  ? 1038.020 753.552 771.225 1.00 0.00 ? 438  SER C CA 1 
ATOM 7864   C C  . SER C 2 438  ? 1036.923 754.414 770.701 1.00 0.00 ? 438  SER C C  1 
ATOM 7865   O O  . SER C 2 438  ? 1036.379 754.155 769.630 1.00 0.00 ? 438  SER C O  1 
ATOM 7866   C CB . SER C 2 438  ? 1037.432 752.694 772.361 1.00 0.00 ? 438  SER C CB 1 
ATOM 7867   N N  . GLN C 2 439  ? 1036.583 755.484 771.439 1.00 0.00 ? 439  GLN C N  1 
ATOM 7868   C CA . GLN C 2 439  ? 1035.512 756.345 771.031 1.00 0.00 ? 439  GLN C CA 1 
ATOM 7869   C C  . GLN C 2 439  ? 1035.893 756.978 769.730 1.00 0.00 ? 439  GLN C C  1 
ATOM 7870   O O  . GLN C 2 439  ? 1035.074 757.094 768.822 1.00 0.00 ? 439  GLN C O  1 
ATOM 7871   C CB . GLN C 2 439  ? 1035.247 757.455 772.064 1.00 0.00 ? 439  GLN C CB 1 
ATOM 7872   N N  . PHE C 2 440  ? 1037.168 757.384 769.603 1.00 0.00 ? 440  PHE C N  1 
ATOM 7873   C CA . PHE C 2 440  ? 1037.649 758.018 768.411 1.00 0.00 ? 440  PHE C CA 1 
ATOM 7874   C C  . PHE C 2 440  ? 1037.554 757.056 767.272 1.00 0.00 ? 440  PHE C C  1 
ATOM 7875   O O  . PHE C 2 440  ? 1037.133 757.418 766.174 1.00 0.00 ? 440  PHE C O  1 
ATOM 7876   C CB . PHE C 2 440  ? 1039.101 758.515 768.583 1.00 0.00 ? 440  PHE C CB 1 
ATOM 7877   N N  . GLN C 2 441  ? 1037.919 755.787 767.511 1.00 0.00 ? 441  GLN C N  1 
ATOM 7878   C CA . GLN C 2 441  ? 1037.917 754.810 766.465 1.00 0.00 ? 441  GLN C CA 1 
ATOM 7879   C C  . GLN C 2 441  ? 1036.523 754.614 765.955 1.00 0.00 ? 441  GLN C C  1 
ATOM 7880   O O  . GLN C 2 441  ? 1036.313 754.518 764.748 1.00 0.00 ? 441  GLN C O  1 
ATOM 7881   C CB . GLN C 2 441  ? 1038.457 753.449 766.941 1.00 0.00 ? 441  GLN C CB 1 
ATOM 7882   N N  . LYS C 2 442  ? 1035.526 754.560 766.858 1.00 0.00 ? 442  LYS C N  1 
ATOM 7883   C CA . LYS C 2 442  ? 1034.178 754.314 766.427 1.00 0.00 ? 442  LYS C CA 1 
ATOM 7884   C C  . LYS C 2 442  ? 1033.670 755.432 765.572 1.00 0.00 ? 442  LYS C C  1 
ATOM 7885   O O  . LYS C 2 442  ? 1032.980 755.190 764.584 1.00 0.00 ? 442  LYS C O  1 
ATOM 7886   C CB . LYS C 2 442  ? 1033.179 754.102 767.578 1.00 0.00 ? 442  LYS C CB 1 
ATOM 7887   N N  . GLN C 2 443  ? 1033.999 756.690 765.912 1.00 0.00 ? 443  GLN C N  1 
ATOM 7888   C CA . GLN C 2 443  ? 1033.471 757.791 765.158 1.00 0.00 ? 443  GLN C CA 1 
ATOM 7889   C C  . GLN C 2 443  ? 1033.942 757.674 763.744 1.00 0.00 ? 443  GLN C C  1 
ATOM 7890   O O  . GLN C 2 443  ? 1033.195 757.947 762.805 1.00 0.00 ? 443  GLN C O  1 
ATOM 7891   C CB . GLN C 2 443  ? 1033.919 759.159 765.701 1.00 0.00 ? 443  GLN C CB 1 
ATOM 7892   N N  . LEU C 2 444  ? 1035.200 757.238 763.559 1.00 0.00 ? 444  LEU C N  1 
ATOM 7893   C CA . LEU C 2 444  ? 1035.824 757.129 762.272 1.00 0.00 ? 444  LEU C CA 1 
ATOM 7894   C C  . LEU C 2 444  ? 1035.064 756.102 761.477 1.00 0.00 ? 444  LEU C C  1 
ATOM 7895   O O  . LEU C 2 444  ? 1034.984 756.194 760.255 1.00 0.00 ? 444  LEU C O  1 
ATOM 7896   C CB . LEU C 2 444  ? 1037.309 756.722 762.406 1.00 0.00 ? 444  LEU C CB 1 
ATOM 7897   N N  . LEU C 2 445  ? 1034.538 755.058 762.153 1.00 0.00 ? 445  LEU C N  1 
ATOM 7898   C CA . LEU C 2 445  ? 1033.717 754.045 761.537 1.00 0.00 ? 445  LEU C CA 1 
ATOM 7899   C C  . LEU C 2 445  ? 1032.341 754.494 761.128 1.00 0.00 ? 445  LEU C C  1 
ATOM 7900   O O  . LEU C 2 445  ? 1031.888 754.121 760.049 1.00 0.00 ? 445  LEU C O  1 
ATOM 7901   C CB . LEU C 2 445  ? 1033.485 752.805 762.421 1.00 0.00 ? 445  LEU C CB 1 
ATOM 7902   N N  . GLU C 2 446  ? 1031.642 755.317 761.937 1.00 0.00 ? 446  GLU C N  1 
ATOM 7903   C CA . GLU C 2 446  ? 1030.212 755.441 761.744 1.00 0.00 ? 446  GLU C CA 1 
ATOM 7904   C C  . GLU C 2 446  ? 1029.784 755.820 760.349 1.00 0.00 ? 446  GLU C C  1 
ATOM 7905   O O  . GLU C 2 446  ? 1029.385 754.936 759.592 1.00 0.00 ? 446  GLU C O  1 
ATOM 7906   C CB . GLU C 2 446  ? 1029.645 756.476 762.705 1.00 0.00 ? 446  GLU C CB 1 
ATOM 7907   N N  . ASP C 2 447  ? 1029.921 757.093 759.920 1.00 0.00 ? 447  ASP C N  1 
ATOM 7908   C CA . ASP C 2 447  ? 1029.616 757.306 758.536 1.00 0.00 ? 447  ASP C CA 1 
ATOM 7909   C C  . ASP C 2 447  ? 1029.812 758.708 758.070 1.00 0.00 ? 447  ASP C C  1 
ATOM 7910   O O  . ASP C 2 447  ? 1029.736 759.671 758.829 1.00 0.00 ? 447  ASP C O  1 
ATOM 7911   C CB . ASP C 2 447  ? 1028.229 756.920 758.008 1.00 0.00 ? 447  ASP C CB 1 
ATOM 7912   N N  . TYR C 2 448  ? 1032.634 757.251 759.824 1.00 0.00 ? 448  TYR C N  1 
ATOM 7913   C CA . TYR C 2 448  ? 1032.593 758.410 758.990 1.00 0.00 ? 448  TYR C CA 1 
ATOM 7914   C C  . TYR C 2 448  ? 1032.584 757.839 757.612 1.00 0.00 ? 448  TYR C C  1 
ATOM 7915   O O  . TYR C 2 448  ? 1032.118 758.440 756.644 1.00 0.00 ? 448  TYR C O  1 
ATOM 7916   C CB . TYR C 2 448  ? 1033.702 759.451 759.172 1.00 0.00 ? 448  TYR C CB 1 
ATOM 7917   N N  . GLY C 2 449  ? 1033.207 756.659 757.493 1.00 0.00 ? 449  GLY C N  1 
ATOM 7918   C CA . GLY C 2 449  ? 1033.165 755.968 756.254 1.00 0.00 ? 449  GLY C CA 1 
ATOM 7919   C C  . GLY C 2 449  ? 1034.350 756.373 755.459 1.00 0.00 ? 449  GLY C C  1 
ATOM 7920   O O  . GLY C 2 449  ? 1034.918 757.452 755.623 1.00 0.00 ? 449  GLY C O  1 
ATOM 7921   N N  . GLU C 2 450  ? 1034.734 755.474 754.551 1.00 0.00 ? 450  GLU C N  1 
ATOM 7922   C CA . GLU C 2 450  ? 1035.833 755.650 753.666 1.00 0.00 ? 450  GLU C CA 1 
ATOM 7923   C C  . GLU C 2 450  ? 1035.515 756.790 752.763 1.00 0.00 ? 450  GLU C C  1 
ATOM 7924   O O  . GLU C 2 450  ? 1036.390 757.579 752.411 1.00 0.00 ? 450  GLU C O  1 
ATOM 7925   C CB . GLU C 2 450  ? 1036.081 754.378 752.839 1.00 0.00 ? 450  GLU C CB 1 
ATOM 7926   N N  . SER C 2 451  ? 1034.235 756.917 752.376 1.00 0.00 ? 451  SER C N  1 
ATOM 7927   C CA . SER C 2 451  ? 1033.855 757.965 751.482 1.00 0.00 ? 451  SER C CA 1 
ATOM 7928   C C  . SER C 2 451  ? 1034.148 759.276 752.134 1.00 0.00 ? 451  SER C C  1 
ATOM 7929   O O  . SER C 2 451  ? 1034.680 760.188 751.504 1.00 0.00 ? 451  SER C O  1 
ATOM 7930   C CB . SER C 2 451  ? 1032.350 757.951 751.170 1.00 0.00 ? 451  SER C CB 1 
ATOM 7931   N N  . HIS C 2 452  ? 1033.826 759.394 753.436 1.00 0.00 ? 452  HIS C N  1 
ATOM 7932   C CA . HIS C 2 452  ? 1033.976 760.661 754.085 1.00 0.00 ? 452  HIS C CA 1 
ATOM 7933   C C  . HIS C 2 452  ? 1035.413 761.046 754.132 1.00 0.00 ? 452  HIS C C  1 
ATOM 7934   O O  . HIS C 2 452  ? 1035.743 762.211 753.913 1.00 0.00 ? 452  HIS C O  1 
ATOM 7935   C CB . HIS C 2 452  ? 1033.441 760.712 755.520 1.00 0.00 ? 452  HIS C CB 1 
ATOM 7936   N N  . PHE C 2 453  ? 1036.310 760.087 754.434 1.00 0.00 ? 453  PHE C N  1 
ATOM 7937   C CA . PHE C 2 453  ? 1037.689 760.462 754.440 1.00 0.00 ? 453  PHE C CA 1 
ATOM 7938   C C  . PHE C 2 453  ? 1038.092 760.518 753.012 1.00 0.00 ? 453  PHE C C  1 
ATOM 7939   O O  . PHE C 2 453  ? 1038.746 759.614 752.497 1.00 0.00 ? 453  PHE C O  1 
ATOM 7940   C CB . PHE C 2 453  ? 1038.596 759.435 755.138 1.00 0.00 ? 453  PHE C CB 1 
ATOM 7941   N N  . THR C 2 454  ? 1037.739 761.617 752.328 1.00 0.00 ? 454  THR C N  1 
ATOM 7942   C CA . THR C 2 454  ? 1038.099 761.673 750.962 1.00 0.00 ? 454  THR C CA 1 
ATOM 7943   C C  . THR C 2 454  ? 1039.359 762.455 750.811 1.00 0.00 ? 454  THR C C  1 
ATOM 7944   O O  . THR C 2 454  ? 1039.658 763.450 751.453 1.00 0.00 ? 454  THR C O  1 
ATOM 7945   C CB . THR C 2 454  ? 1037.070 762.238 750.040 1.00 0.00 ? 454  THR C CB 1 
ATOM 7946   N N  . VAL C 2 455  ? 1040.142 761.870 749.934 1.00 0.00 ? 455  VAL C N  1 
ATOM 7947   C CA . VAL C 2 455  ? 1041.411 762.016 749.360 1.00 0.00 ? 455  VAL C CA 1 
ATOM 7948   C C  . VAL C 2 455  ? 1041.558 760.575 749.333 1.00 0.00 ? 455  VAL C C  1 
ATOM 7949   O O  . VAL C 2 455  ? 1040.817 759.960 748.573 1.00 0.00 ? 455  VAL C O  1 
ATOM 7950   C CB . VAL C 2 455  ? 1042.499 762.411 750.269 1.00 0.00 ? 455  VAL C CB 1 
ATOM 7951   N N  . PRO C 2 459  ? 1038.043 758.525 748.807 1.00 0.00 ? 459  PRO C N  1 
ATOM 7952   C CA . PRO C 2 459  ? 1038.853 757.423 749.225 1.00 0.00 ? 459  PRO C CA 1 
ATOM 7953   C C  . PRO C 2 459  ? 1040.173 757.283 748.544 1.00 0.00 ? 459  PRO C C  1 
ATOM 7954   O O  . PRO C 2 459  ? 1040.207 756.905 747.376 1.00 0.00 ? 459  PRO C O  1 
ATOM 7955   C CB . PRO C 2 459  ? 1037.937 756.182 749.240 1.00 0.00 ? 459  PRO C CB 1 
ATOM 7956   N N  . PHE C 2 460  ? 1041.223 757.516 749.369 1.00 0.00 ? 460  PHE C N  1 
ATOM 7957   C CA . PHE C 2 460  ? 1042.611 757.341 749.107 1.00 0.00 ? 460  PHE C CA 1 
ATOM 7958   C C  . PHE C 2 460  ? 1043.233 757.339 750.482 1.00 0.00 ? 460  PHE C C  1 
ATOM 7959   O O  . PHE C 2 460  ? 1043.944 756.426 750.900 1.00 0.00 ? 460  PHE C O  1 
ATOM 7960   C CB . PHE C 2 460  ? 1043.363 758.458 748.359 1.00 0.00 ? 460  PHE C CB 1 
ATOM 7961   N N  . LEU C 2 461  ? 1042.920 758.434 751.211 1.00 0.00 ? 461  LEU C N  1 
ATOM 7962   C CA . LEU C 2 461  ? 1043.411 758.764 752.512 1.00 0.00 ? 461  LEU C CA 1 
ATOM 7963   C C  . LEU C 2 461  ? 1042.914 757.845 753.592 1.00 0.00 ? 461  LEU C C  1 
ATOM 7964   O O  . LEU C 2 461  ? 1043.596 757.671 754.600 1.00 0.00 ? 461  LEU C O  1 
ATOM 7965   C CB . LEU C 2 461  ? 1043.048 760.166 752.990 1.00 0.00 ? 461  LEU C CB 1 
ATOM 7966   N N  . TYR C 2 462  ? 1041.733 757.226 753.427 1.00 0.00 ? 462  TYR C N  1 
ATOM 7967   C CA . TYR C 2 462  ? 1041.062 756.495 754.477 1.00 0.00 ? 462  TYR C CA 1 
ATOM 7968   C C  . TYR C 2 462  ? 1042.004 755.489 755.058 1.00 0.00 ? 462  TYR C C  1 
ATOM 7969   O O  . TYR C 2 462  ? 1041.973 755.189 756.251 1.00 0.00 ? 462  TYR C O  1 
ATOM 7970   C CB . TYR C 2 462  ? 1039.813 755.771 753.929 1.00 0.00 ? 462  TYR C CB 1 
ATOM 7971   N N  . PHE C 2 463  ? 1042.885 754.947 754.215 1.00 0.00 ? 463  PHE C N  1 
ATOM 7972   C CA . PHE C 2 463  ? 1043.797 753.919 754.612 1.00 0.00 ? 463  PHE C CA 1 
ATOM 7973   C C  . PHE C 2 463  ? 1044.596 754.418 755.778 1.00 0.00 ? 463  PHE C C  1 
ATOM 7974   O O  . PHE C 2 463  ? 1044.691 753.777 756.825 1.00 0.00 ? 463  PHE C O  1 
ATOM 7975   C CB . PHE C 2 463  ? 1044.860 753.738 753.536 1.00 0.00 ? 463  PHE C CB 1 
ATOM 7976   N N  . GLN C 2 464  ? 1045.179 755.615 755.605 1.00 0.00 ? 464  GLN C N  1 
ATOM 7977   C CA . GLN C 2 464  ? 1046.081 756.222 756.532 1.00 0.00 ? 464  GLN C CA 1 
ATOM 7978   C C  . GLN C 2 464  ? 1045.361 756.487 757.810 1.00 0.00 ? 464  GLN C C  1 
ATOM 7979   O O  . GLN C 2 464  ? 1045.921 756.307 758.892 1.00 0.00 ? 464  GLN C O  1 
ATOM 7980   C CB . GLN C 2 464  ? 1046.650 757.552 755.997 1.00 0.00 ? 464  GLN C CB 1 
ATOM 7981   N N  . VAL C 2 465  ? 1044.090 756.914 757.726 1.00 0.00 ? 465  VAL C N  1 
ATOM 7982   C CA . VAL C 2 465  ? 1043.400 757.225 758.939 1.00 0.00 ? 465  VAL C CA 1 
ATOM 7983   C C  . VAL C 2 465  ? 1043.295 755.966 759.742 1.00 0.00 ? 465  VAL C C  1 
ATOM 7984   O O  . VAL C 2 465  ? 1043.422 755.987 760.964 1.00 0.00 ? 465  VAL C O  1 
ATOM 7985   C CB . VAL C 2 465  ? 1042.018 757.789 758.735 1.00 0.00 ? 465  VAL C CB 1 
ATOM 7986   N N  . LEU C 2 466  ? 1043.069 754.821 759.070 1.00 0.00 ? 466  LEU C N  1 
ATOM 7987   C CA . LEU C 2 466  ? 1042.918 753.577 759.767 1.00 0.00 ? 466  LEU C CA 1 
ATOM 7988   C C  . LEU C 2 466  ? 1044.187 753.244 760.491 1.00 0.00 ? 466  LEU C C  1 
ATOM 7989   O O  . LEU C 2 466  ? 1044.138 752.840 761.653 1.00 0.00 ? 466  LEU C O  1 
ATOM 7990   C CB . LEU C 2 466  ? 1042.575 752.402 758.835 1.00 0.00 ? 466  LEU C CB 1 
ATOM 7991   N N  . PHE C 2 467  ? 1045.363 753.405 759.844 1.00 0.00 ? 467  PHE C N  1 
ATOM 7992   C CA . PHE C 2 467  ? 1046.568 753.056 760.553 1.00 0.00 ? 467  PHE C CA 1 
ATOM 7993   C C  . PHE C 2 467  ? 1046.780 753.936 761.737 1.00 0.00 ? 467  PHE C C  1 
ATOM 7994   O O  . PHE C 2 467  ? 1047.141 753.457 762.811 1.00 0.00 ? 467  PHE C O  1 
ATOM 7995   C CB . PHE C 2 467  ? 1047.897 753.146 759.786 1.00 0.00 ? 467  PHE C CB 1 
ATOM 7996   N N  . LEU C 2 468  ? 1046.582 755.252 761.565 1.00 0.00 ? 468  LEU C N  1 
ATOM 7997   C CA . LEU C 2 468  ? 1046.855 756.186 762.620 1.00 0.00 ? 468  LEU C CA 1 
ATOM 7998   C C  . LEU C 2 468  ? 1045.948 755.919 763.789 1.00 0.00 ? 468  LEU C C  1 
ATOM 7999   O O  . LEU C 2 468  ? 1046.373 755.984 764.943 1.00 0.00 ? 468  LEU C O  1 
ATOM 8000   C CB . LEU C 2 468  ? 1046.632 757.634 762.157 1.00 0.00 ? 468  LEU C CB 1 
ATOM 8001   N N  . THR C 2 469  ? 1044.673 755.601 763.498 1.00 0.00 ? 469  THR C N  1 
ATOM 8002   C CA . THR C 2 469  ? 1043.615 755.376 764.446 1.00 0.00 ? 469  THR C CA 1 
ATOM 8003   C C  . THR C 2 469  ? 1043.794 754.089 765.195 1.00 0.00 ? 469  THR C C  1 
ATOM 8004   O O  . THR C 2 469  ? 1043.084 753.871 766.176 1.00 0.00 ? 469  THR C O  1 
ATOM 8005   C CB . THR C 2 469  ? 1042.244 755.386 763.822 1.00 0.00 ? 469  THR C CB 1 
ATOM 8006   N N  . ALA C 2 470  ? 1044.726 753.213 764.751 1.00 0.00 ? 470  ALA C N  1 
ATOM 8007   C CA . ALA C 2 470  ? 1044.957 751.914 765.347 1.00 0.00 ? 470  ALA C CA 1 
ATOM 8008   C C  . ALA C 2 470  ? 1044.008 750.879 764.845 1.00 0.00 ? 470  ALA C C  1 
ATOM 8009   O O  . ALA C 2 470  ? 1043.901 749.821 765.457 1.00 0.00 ? 470  ALA C O  1 
ATOM 8010   C CB . ALA C 2 470  ? 1044.773 751.871 766.880 1.00 0.00 ? 470  ALA C CB 1 
ATOM 8011   N N  . GLN C 2 471  ? 1043.300 751.123 763.733 1.00 0.00 ? 471  GLN C N  1 
ATOM 8012   C CA . GLN C 2 471  ? 1042.476 750.050 763.259 1.00 0.00 ? 471  GLN C CA 1 
ATOM 8013   C C  . GLN C 2 471  ? 1043.261 749.304 762.220 1.00 0.00 ? 471  GLN C C  1 
ATOM 8014   O O  . GLN C 2 471  ? 1043.030 749.444 761.020 1.00 0.00 ? 471  GLN C O  1 
ATOM 8015   C CB . GLN C 2 471  ? 1041.158 750.546 762.638 1.00 0.00 ? 471  GLN C CB 1 
ATOM 8016   N N  . PHE C 2 472  ? 1044.214 748.468 762.686 1.00 0.00 ? 472  PHE C N  1 
ATOM 8017   C CA . PHE C 2 472  ? 1045.094 747.724 761.829 1.00 0.00 ? 472  PHE C CA 1 
ATOM 8018   C C  . PHE C 2 472  ? 1044.298 746.715 761.089 1.00 0.00 ? 472  PHE C C  1 
ATOM 8019   O O  . PHE C 2 472  ? 1044.470 746.527 759.886 1.00 0.00 ? 472  PHE C O  1 
ATOM 8020   C CB . PHE C 2 472  ? 1046.161 746.915 762.580 1.00 0.00 ? 472  PHE C CB 1 
ATOM 8021   N N  . GLU C 2 473  ? 1043.398 746.039 761.820 1.00 0.00 ? 473  GLU C N  1 
ATOM 8022   C CA . GLU C 2 473  ? 1042.638 744.985 761.237 1.00 0.00 ? 473  GLU C CA 1 
ATOM 8023   C C  . GLU C 2 473  ? 1041.824 745.553 760.133 1.00 0.00 ? 473  GLU C C  1 
ATOM 8024   O O  . GLU C 2 473  ? 1041.799 745.024 759.022 1.00 0.00 ? 473  GLU C O  1 
ATOM 8025   C CB . GLU C 2 473  ? 1041.694 744.315 762.251 1.00 0.00 ? 473  GLU C CB 1 
ATOM 8026   N N  . ALA C 2 474  ? 1041.161 746.679 760.423 1.00 0.00 ? 474  ALA C N  1 
ATOM 8027   C CA . ALA C 2 474  ? 1040.332 747.320 759.458 1.00 0.00 ? 474  ALA C CA 1 
ATOM 8028   C C  . ALA C 2 474  ? 1041.203 747.782 758.338 1.00 0.00 ? 474  ALA C C  1 
ATOM 8029   O O  . ALA C 2 474  ? 1040.804 747.728 757.178 1.00 0.00 ? 474  ALA C O  1 
ATOM 8030   C CB . ALA C 2 474  ? 1039.604 748.545 760.028 1.00 0.00 ? 474  ALA C CB 1 
ATOM 8031   N N  . ALA C 2 475  ? 1042.421 748.259 758.658 1.00 0.00 ? 475  ALA C N  1 
ATOM 8032   C CA . ALA C 2 475  ? 1043.296 748.803 757.658 1.00 0.00 ? 475  ALA C CA 1 
ATOM 8033   C C  . ALA C 2 475  ? 1043.638 747.748 756.651 1.00 0.00 ? 475  ALA C C  1 
ATOM 8034   O O  . ALA C 2 475  ? 1043.625 748.020 755.454 1.00 0.00 ? 475  ALA C O  1 
ATOM 8035   C CB . ALA C 2 475  ? 1044.625 749.322 758.235 1.00 0.00 ? 475  ALA C CB 1 
ATOM 8036   N N  . VAL C 2 476  ? 1043.961 746.518 757.096 1.00 0.00 ? 476  VAL C N  1 
ATOM 8037   C CA . VAL C 2 476  ? 1044.314 745.479 756.164 1.00 0.00 ? 476  VAL C CA 1 
ATOM 8038   C C  . VAL C 2 476  ? 1043.096 745.171 755.352 1.00 0.00 ? 476  VAL C C  1 
ATOM 8039   O O  . VAL C 2 476  ? 1043.165 744.995 754.137 1.00 0.00 ? 476  VAL C O  1 
ATOM 8040   C CB . VAL C 2 476  ? 1044.742 744.211 756.848 1.00 0.00 ? 476  VAL C CB 1 
ATOM 8041   N N  . ALA C 2 477  ? 1041.929 745.121 756.019 1.00 0.00 ? 477  ALA C N  1 
ATOM 8042   C CA . ALA C 2 477  ? 1040.697 744.791 755.363 1.00 0.00 ? 477  ALA C CA 1 
ATOM 8043   C C  . ALA C 2 477  ? 1040.389 745.821 754.324 1.00 0.00 ? 477  ALA C C  1 
ATOM 8044   O O  . ALA C 2 477  ? 1039.936 745.489 753.231 1.00 0.00 ? 477  ALA C O  1 
ATOM 8045   C CB . ALA C 2 477  ? 1039.496 744.744 756.322 1.00 0.00 ? 477  ALA C CB 1 
ATOM 8046   N N  . PHE C 2 478  ? 1040.606 747.108 754.650 1.00 0.00 ? 478  PHE C N  1 
ATOM 8047   C CA . PHE C 2 478  ? 1040.343 748.178 753.732 1.00 0.00 ? 478  PHE C CA 1 
ATOM 8048   C C  . PHE C 2 478  ? 1041.292 748.082 752.579 1.00 0.00 ? 478  PHE C C  1 
ATOM 8049   O O  . PHE C 2 478  ? 1040.903 748.254 751.426 1.00 0.00 ? 478  PHE C O  1 
ATOM 8050   C CB . PHE C 2 478  ? 1040.481 749.569 754.361 1.00 0.00 ? 478  PHE C CB 1 
ATOM 8051   N N  . LEU C 2 479  ? 1042.575 747.775 752.844 1.00 0.00 ? 479  LEU C N  1 
ATOM 8052   C CA . LEU C 2 479  ? 1043.529 747.671 751.772 1.00 0.00 ? 479  LEU C CA 1 
ATOM 8053   C C  . LEU C 2 479  ? 1043.045 746.506 750.985 1.00 0.00 ? 479  LEU C C  1 
ATOM 8054   O O  . LEU C 2 479  ? 1043.293 746.372 749.789 1.00 0.00 ? 479  LEU C O  1 
ATOM 8055   C CB . LEU C 2 479  ? 1044.951 747.274 752.209 1.00 0.00 ? 479  LEU C CB 1 
ATOM 8056   N N  . PHE C 2 480  ? 1042.334 745.618 751.685 1.00 0.00 ? 480  PHE C N  1 
ATOM 8057   C CA . PHE C 2 480  ? 1041.823 744.444 751.077 1.00 0.00 ? 480  PHE C CA 1 
ATOM 8058   C C  . PHE C 2 480  ? 1040.866 744.735 749.969 1.00 0.00 ? 480  PHE C C  1 
ATOM 8059   O O  . PHE C 2 480  ? 1040.566 743.771 749.298 1.00 0.00 ? 480  PHE C O  1 
ATOM 8060   C CB . PHE C 2 480  ? 1041.181 743.380 752.021 1.00 0.00 ? 480  PHE C CB 1 
ATOM 8061   N N  . ARG C 2 481  ? 1040.223 745.916 749.836 1.00 0.00 ? 481  ARG C N  1 
ATOM 8062   C CA . ARG C 2 481  ? 1039.243 746.226 748.782 1.00 0.00 ? 481  ARG C CA 1 
ATOM 8063   C C  . ARG C 2 481  ? 1039.481 746.572 747.264 1.00 0.00 ? 481  ARG C C  1 
ATOM 8064   O O  . ARG C 2 481  ? 1038.886 745.886 746.424 1.00 0.00 ? 481  ARG C O  1 
ATOM 8065   C CB . ARG C 2 481  ? 1038.296 747.310 749.277 1.00 0.00 ? 481  ARG C CB 1 
ATOM 8066   N N  . MET C 2 482  ? 1040.242 747.625 746.813 1.00 0.00 ? 482  MET C N  1 
ATOM 8067   C CA . MET C 2 482  ? 1040.170 748.059 745.375 1.00 0.00 ? 482  MET C CA 1 
ATOM 8068   C C  . MET C 2 482  ? 1040.709 747.217 744.234 1.00 0.00 ? 482  MET C C  1 
ATOM 8069   O O  . MET C 2 482  ? 1040.009 746.410 743.634 1.00 0.00 ? 482  MET C O  1 
ATOM 8070   C CB . MET C 2 482  ? 1040.799 749.441 745.220 1.00 0.00 ? 482  MET C CB 1 
ATOM 8071   N N  . GLU C 2 483  ? 1042.043 747.377 743.969 1.00 0.00 ? 483  GLU C N  1 
ATOM 8072   C CA . GLU C 2 483  ? 1042.990 746.576 743.182 1.00 0.00 ? 483  GLU C CA 1 
ATOM 8073   C C  . GLU C 2 483  ? 1044.028 747.508 742.634 1.00 0.00 ? 483  GLU C C  1 
ATOM 8074   O O  . GLU C 2 483  ? 1043.864 748.715 742.653 1.00 0.00 ? 483  GLU C O  1 
ATOM 8075   C CB . GLU C 2 483  ? 1042.471 745.746 741.985 1.00 0.00 ? 483  GLU C CB 1 
ATOM 8076   N N  . ARG C 2 484  ? 1042.436 745.679 745.838 1.00 0.00 ? 484  ARG C N  1 
ATOM 8077   C CA . ARG C 2 484  ? 1042.802 745.880 747.171 1.00 0.00 ? 484  ARG C CA 1 
ATOM 8078   C C  . ARG C 2 484  ? 1044.221 745.837 746.994 1.00 0.00 ? 484  ARG C C  1 
ATOM 8079   O O  . ARG C 2 484  ? 1045.069 746.615 747.480 1.00 0.00 ? 484  ARG C O  1 
ATOM 8080   C CB . ARG C 2 484  ? 1042.567 744.490 747.667 1.00 0.00 ? 484  ARG C CB 1 
ATOM 8081   N N  . LEU C 2 485  ? 1044.415 744.872 746.137 1.00 0.00 ? 485  LEU C N  1 
ATOM 8082   C CA . LEU C 2 485  ? 1045.586 744.257 745.723 1.00 0.00 ? 485  LEU C CA 1 
ATOM 8083   C C  . LEU C 2 485  ? 1045.755 743.408 746.910 1.00 0.00 ? 485  LEU C C  1 
ATOM 8084   O O  . LEU C 2 485  ? 1046.187 743.845 747.974 1.00 0.00 ? 485  LEU C O  1 
ATOM 8085   C CB . LEU C 2 485  ? 1046.803 745.134 745.516 1.00 0.00 ? 485  LEU C CB 1 
ATOM 8086   N N  . ARG C 2 486  ? 1045.373 742.143 746.728 1.00 0.00 ? 486  ARG C N  1 
ATOM 8087   C CA . ARG C 2 486  ? 1045.432 741.180 747.769 1.00 0.00 ? 486  ARG C CA 1 
ATOM 8088   C C  . ARG C 2 486  ? 1046.866 741.188 748.145 1.00 0.00 ? 486  ARG C C  1 
ATOM 8089   O O  . ARG C 2 486  ? 1047.245 741.070 749.310 1.00 0.00 ? 486  ARG C O  1 
ATOM 8090   C CB . ARG C 2 486  ? 1045.082 739.793 747.229 1.00 0.00 ? 486  ARG C CB 1 
ATOM 8091   N N  . CYS C 2 487  ? 1047.695 741.371 747.109 1.00 0.00 ? 487  CYS C N  1 
ATOM 8092   C CA . CYS C 2 487  ? 1049.107 741.432 747.240 1.00 0.00 ? 487  CYS C CA 1 
ATOM 8093   C C  . CYS C 2 487  ? 1049.456 742.547 748.177 1.00 0.00 ? 487  CYS C C  1 
ATOM 8094   O O  . CYS C 2 487  ? 1050.231 742.341 749.106 1.00 0.00 ? 487  CYS C O  1 
ATOM 8095   C CB . CYS C 2 487  ? 1049.772 741.730 745.888 1.00 0.00 ? 487  CYS C CB 1 
ATOM 8096   N N  . HIS C 2 488  ? 1048.888 743.754 747.997 1.00 0.00 ? 488  HIS C N  1 
ATOM 8097   C CA . HIS C 2 488  ? 1049.278 744.830 748.863 1.00 0.00 ? 488  HIS C CA 1 
ATOM 8098   C C  . HIS C 2 488  ? 1048.865 744.561 750.275 1.00 0.00 ? 488  HIS C C  1 
ATOM 8099   O O  . HIS C 2 488  ? 1049.634 744.792 751.208 1.00 0.00 ? 488  HIS C O  1 
ATOM 8100   C CB . HIS C 2 488  ? 1048.720 746.198 748.446 1.00 0.00 ? 488  HIS C CB 1 
ATOM 8101   N N  . ALA C 2 489  ? 1047.635 744.060 750.483 1.00 0.00 ? 489  ALA C N  1 
ATOM 8102   C CA . ALA C 2 489  ? 1047.160 743.856 751.821 1.00 0.00 ? 489  ALA C CA 1 
ATOM 8103   C C  . ALA C 2 489  ? 1048.072 742.883 752.499 1.00 0.00 ? 489  ALA C C  1 
ATOM 8104   O O  . ALA C 2 489  ? 1048.432 743.064 753.661 1.00 0.00 ? 489  ALA C O  1 
ATOM 8105   C CB . ALA C 2 489  ? 1045.740 743.274 751.856 1.00 0.00 ? 489  ALA C CB 1 
ATOM 8106   N N  . VAL C 2 490  ? 1048.491 741.832 751.772 1.00 0.00 ? 490  VAL C N  1 
ATOM 8107   C CA . VAL C 2 490  ? 1049.308 740.804 752.349 1.00 0.00 ? 490  VAL C CA 1 
ATOM 8108   C C  . VAL C 2 490  ? 1050.590 741.393 752.860 1.00 0.00 ? 490  VAL C C  1 
ATOM 8109   O O  . VAL C 2 490  ? 1050.986 741.140 753.995 1.00 0.00 ? 490  VAL C O  1 
ATOM 8110   C CB . VAL C 2 490  ? 1049.690 739.755 751.342 1.00 0.00 ? 490  VAL C CB 1 
ATOM 8111   N N  . HIS C 2 491  ? 1051.275 742.199 752.029 1.00 0.00 ? 491  HIS C N  1 
ATOM 8112   C CA . HIS C 2 491  ? 1052.556 742.740 752.390 1.00 0.00 ? 491  HIS C CA 1 
ATOM 8113   C C  . HIS C 2 491  ? 1052.440 743.741 753.493 1.00 0.00 ? 491  HIS C C  1 
ATOM 8114   O O  . HIS C 2 491  ? 1053.285 743.786 754.387 1.00 0.00 ? 491  HIS C O  1 
ATOM 8115   C CB . HIS C 2 491  ? 1053.291 743.355 751.191 1.00 0.00 ? 491  HIS C CB 1 
ATOM 8116   N N  . VAL C 2 492  ? 1051.390 744.579 753.465 1.00 0.00 ? 492  VAL C N  1 
ATOM 8117   C CA . VAL C 2 492  ? 1051.245 745.532 754.522 1.00 0.00 ? 492  VAL C CA 1 
ATOM 8118   C C  . VAL C 2 492  ? 1051.136 744.777 755.797 1.00 0.00 ? 492  VAL C C  1 
ATOM 8119   O O  . VAL C 2 492  ? 1051.768 745.132 756.789 1.00 0.00 ? 492  VAL C O  1 
ATOM 8120   C CB . VAL C 2 492  ? 1049.988 746.317 754.448 1.00 0.00 ? 492  VAL C CB 1 
ATOM 8121   N N  . ALA C 2 493  ? 1050.346 743.691 755.785 1.00 0.00 ? 493  ALA C N  1 
ATOM 8122   C CA . ALA C 2 493  ? 1050.131 742.920 756.970 1.00 0.00 ? 493  ALA C CA 1 
ATOM 8123   C C  . ALA C 2 493  ? 1051.461 742.424 757.431 1.00 0.00 ? 493  ALA C C  1 
ATOM 8124   O O  . ALA C 2 493  ? 1051.737 742.355 758.629 1.00 0.00 ? 493  ALA C O  1 
ATOM 8125   C CB . ALA C 2 493  ? 1049.227 741.698 756.734 1.00 0.00 ? 493  ALA C CB 1 
ATOM 8126   N N  . LEU C 2 494  ? 1052.326 742.073 756.468 1.00 0.00 ? 494  LEU C N  1 
ATOM 8127   C CA . LEU C 2 494  ? 1053.615 741.526 756.756 1.00 0.00 ? 494  LEU C CA 1 
ATOM 8128   C C  . LEU C 2 494  ? 1054.374 742.581 757.515 1.00 0.00 ? 494  LEU C C  1 
ATOM 8129   O O  . LEU C 2 494  ? 1055.030 742.298 758.516 1.00 0.00 ? 494  LEU C O  1 
ATOM 8130   C CB . LEU C 2 494  ? 1054.331 741.176 755.438 1.00 0.00 ? 494  LEU C CB 1 
ATOM 8131   N N  . VAL C 2 495  ? 1054.271 743.845 757.061 1.00 0.00 ? 495  VAL C N  1 
ATOM 8132   C CA . VAL C 2 495  ? 1054.941 744.970 757.662 1.00 0.00 ? 495  VAL C CA 1 
ATOM 8133   C C  . VAL C 2 495  ? 1054.428 745.259 759.045 1.00 0.00 ? 495  VAL C C  1 
ATOM 8134   O O  . VAL C 2 495  ? 1055.218 745.545 759.943 1.00 0.00 ? 495  VAL C O  1 
ATOM 8135   C CB . VAL C 2 495  ? 1054.814 746.182 756.826 1.00 0.00 ? 495  VAL C CB 1 
ATOM 8136   N N  . LEU C 2 496  ? 1053.100 745.199 759.272 1.00 0.00 ? 496  LEU C N  1 
ATOM 8137   C CA . LEU C 2 496  ? 1052.572 745.447 760.592 1.00 0.00 ? 496  LEU C CA 1 
ATOM 8138   C C  . LEU C 2 496  ? 1053.127 744.398 761.493 1.00 0.00 ? 496  LEU C C  1 
ATOM 8139   O O  . LEU C 2 496  ? 1053.471 744.640 762.650 1.00 0.00 ? 496  LEU C O  1 
ATOM 8140   C CB . LEU C 2 496  ? 1051.038 745.308 760.688 1.00 0.00 ? 496  LEU C CB 1 
ATOM 8141   N N  . PHE C 2 497  ? 1053.232 743.196 760.921 1.00 0.00 ? 497  PHE C N  1 
ATOM 8142   C CA . PHE C 2 497  ? 1053.649 741.964 761.512 1.00 0.00 ? 497  PHE C CA 1 
ATOM 8143   C C  . PHE C 2 497  ? 1055.059 742.098 762.014 1.00 0.00 ? 497  PHE C C  1 
ATOM 8144   O O  . PHE C 2 497  ? 1055.382 741.632 763.107 1.00 0.00 ? 497  PHE C O  1 
ATOM 8145   C CB . PHE C 2 497  ? 1053.606 740.922 760.403 1.00 0.00 ? 497  PHE C CB 1 
ATOM 8146   N N  . GLU C 2 498  ? 1055.948 742.722 761.218 1.00 0.00 ? 498  GLU C N  1 
ATOM 8147   C CA . GLU C 2 498  ? 1057.325 742.883 761.596 1.00 0.00 ? 498  GLU C CA 1 
ATOM 8148   C C  . GLU C 2 498  ? 1057.371 743.780 762.799 1.00 0.00 ? 498  GLU C C  1 
ATOM 8149   O O  . GLU C 2 498  ? 1058.223 743.634 763.672 1.00 0.00 ? 498  GLU C O  1 
ATOM 8150   C CB . GLU C 2 498  ? 1058.176 743.505 760.472 1.00 0.00 ? 498  GLU C CB 1 
ATOM 8151   N N  . LEU C 2 499  ? 1056.434 744.743 762.851 1.00 0.00 ? 499  LEU C N  1 
ATOM 8152   C CA . LEU C 2 499  ? 1056.259 745.707 763.902 1.00 0.00 ? 499  LEU C CA 1 
ATOM 8153   C C  . LEU C 2 499  ? 1055.816 745.052 765.172 1.00 0.00 ? 499  LEU C C  1 
ATOM 8154   O O  . LEU C 2 499  ? 1055.843 745.681 766.229 1.00 0.00 ? 499  LEU C O  1 
ATOM 8155   C CB . LEU C 2 499  ? 1055.323 746.873 763.539 1.00 0.00 ? 499  LEU C CB 1 
ATOM 8156   N N  . LYS C 2 500  ? 1055.378 743.778 765.102 1.00 0.00 ? 500  LYS C N  1 
ATOM 8157   C CA . LYS C 2 500  ? 1054.913 743.043 766.252 1.00 0.00 ? 500  LYS C CA 1 
ATOM 8158   C C  . LYS C 2 500  ? 1053.506 743.420 766.601 1.00 0.00 ? 500  LYS C C  1 
ATOM 8159   O O  . LYS C 2 500  ? 1053.106 743.334 767.760 1.00 0.00 ? 500  LYS C O  1 
ATOM 8160   C CB . LYS C 2 500  ? 1055.755 743.272 767.525 1.00 0.00 ? 500  LYS C CB 1 
ATOM 8161   N N  . LEU C 2 501  ? 1052.710 743.839 765.599 1.00 0.00 ? 501  LEU C N  1 
ATOM 8162   C CA . LEU C 2 501  ? 1051.303 744.051 765.811 1.00 0.00 ? 501  LEU C CA 1 
ATOM 8163   C C  . LEU C 2 501  ? 1050.660 742.710 765.570 1.00 0.00 ? 501  LEU C C  1 
ATOM 8164   O O  . LEU C 2 501  ? 1051.330 741.690 765.719 1.00 0.00 ? 501  LEU C O  1 
ATOM 8165   C CB . LEU C 2 501  ? 1050.677 745.098 764.870 1.00 0.00 ? 501  LEU C CB 1 
ATOM 8166   N N  . LEU C 2 502  ? 1049.357 742.667 765.194 1.00 0.00 ? 502  LEU C N  1 
ATOM 8167   C CA . LEU C 2 502  ? 1048.657 741.419 764.988 1.00 0.00 ? 502  LEU C CA 1 
ATOM 8168   C C  . LEU C 2 502  ? 1048.449 740.709 766.294 1.00 0.00 ? 502  LEU C C  1 
ATOM 8169   O O  . LEU C 2 502  ? 1048.281 739.495 766.346 1.00 0.00 ? 502  LEU C O  1 
ATOM 8170   C CB . LEU C 2 502  ? 1049.376 740.454 764.047 1.00 0.00 ? 502  LEU C CB 1 
ATOM 8171   N N  . LEU C 2 503  ? 1048.330 741.503 767.372 1.00 0.00 ? 503  LEU C N  1 
ATOM 8172   C CA . LEU C 2 503  ? 1048.200 741.098 768.752 1.00 0.00 ? 503  LEU C CA 1 
ATOM 8173   C C  . LEU C 2 503  ? 1046.837 740.575 769.196 1.00 0.00 ? 503  LEU C C  1 
ATOM 8174   O O  . LEU C 2 503  ? 1046.356 741.018 770.244 1.00 0.00 ? 503  LEU C O  1 
ATOM 8175   C CB . LEU C 2 503  ? 1048.855 741.977 769.830 1.00 0.00 ? 503  LEU C CB 1 
ATOM 8176   N N  . LYS C 2 504  ? 1046.105 739.958 768.217 1.00 0.00 ? 504  LYS C N  1 
ATOM 8177   C CA . LYS C 2 504  ? 1044.892 739.251 768.523 1.00 0.00 ? 504  LYS C CA 1 
ATOM 8178   C C  . LYS C 2 504  ? 1043.807 740.088 767.952 1.00 0.00 ? 504  LYS C C  1 
ATOM 8179   O O  . LYS C 2 504  ? 1043.480 739.992 766.773 1.00 0.00 ? 504  LYS C O  1 
ATOM 8180   C CB . LYS C 2 504  ? 1044.603 739.052 770.052 1.00 0.00 ? 504  LYS C CB 1 
ATOM 8181   N N  . CYS C 2 522  ? 1040.799 735.255 750.517 1.00 0.00 ? 522  CYS C N  1 
ATOM 8182   C CA . CYS C 2 522  ? 1040.811 735.848 751.817 1.00 0.00 ? 522  CYS C CA 1 
ATOM 8183   C C  . CYS C 2 522  ? 1040.533 737.291 751.712 1.00 0.00 ? 522  CYS C C  1 
ATOM 8184   O O  . CYS C 2 522  ? 1041.437 738.111 751.764 1.00 0.00 ? 522  CYS C O  1 
ATOM 8185   C CB . CYS C 2 522  ? 1042.156 735.676 752.523 1.00 0.00 ? 522  CYS C CB 1 
ATOM 8186   N N  . LEU C 2 523  ? 1039.281 737.663 751.481 1.00 0.00 ? 523  LEU C N  1 
ATOM 8187   C CA . LEU C 2 523  ? 1038.946 739.047 751.496 1.00 0.00 ? 523  LEU C CA 1 
ATOM 8188   C C  . LEU C 2 523  ? 1038.818 739.577 752.892 1.00 0.00 ? 523  LEU C C  1 
ATOM 8189   O O  . LEU C 2 523  ? 1039.287 740.675 753.182 1.00 0.00 ? 523  LEU C O  1 
ATOM 8190   C CB . LEU C 2 523  ? 1037.713 739.394 750.639 1.00 0.00 ? 523  LEU C CB 1 
ATOM 8191   N N  . ARG C 2 524  ? 1038.201 738.806 753.813 1.00 0.00 ? 524  ARG C N  1 
ATOM 8192   C CA . ARG C 2 524  ? 1037.993 739.336 755.135 1.00 0.00 ? 524  ARG C CA 1 
ATOM 8193   C C  . ARG C 2 524  ? 1038.650 738.472 756.173 1.00 0.00 ? 524  ARG C C  1 
ATOM 8194   O O  . ARG C 2 524  ? 1038.142 738.389 757.290 1.00 0.00 ? 524  ARG C O  1 
ATOM 8195   C CB . ARG C 2 524  ? 1036.508 739.312 755.554 1.00 0.00 ? 524  ARG C CB 1 
ATOM 8196   N N  . ARG C 2 525  ? 1039.805 737.830 755.899 1.00 0.00 ? 525  ARG C N  1 
ATOM 8197   C CA . ARG C 2 525  ? 1040.299 736.955 756.934 1.00 0.00 ? 525  ARG C CA 1 
ATOM 8198   C C  . ARG C 2 525  ? 1041.617 737.453 757.461 1.00 0.00 ? 525  ARG C C  1 
ATOM 8199   O O  . ARG C 2 525  ? 1042.678 737.215 756.886 1.00 0.00 ? 525  ARG C O  1 
ATOM 8200   C CB . ARG C 2 525  ? 1040.398 735.487 756.460 1.00 0.00 ? 525  ARG C CB 1 
ATOM 8201   N N  . LEU C 2 526  ? 1041.583 738.127 758.626 1.00 0.00 ? 526  LEU C N  1 
ATOM 8202   C CA . LEU C 2 526  ? 1042.762 738.774 759.121 1.00 0.00 ? 526  LEU C CA 1 
ATOM 8203   C C  . LEU C 2 526  ? 1043.916 737.993 759.654 1.00 0.00 ? 526  LEU C C  1 
ATOM 8204   O O  . LEU C 2 526  ? 1045.018 738.530 759.554 1.00 0.00 ? 526  LEU C O  1 
ATOM 8205   C CB . LEU C 2 526  ? 1042.563 739.967 760.041 1.00 0.00 ? 526  LEU C CB 1 
ATOM 8206   N N  . ASN C 2 527  ? 1043.744 736.794 760.261 1.00 0.00 ? 527  ASN C N  1 
ATOM 8207   C CA . ASN C 2 527  ? 1044.880 736.153 760.889 1.00 0.00 ? 527  ASN C CA 1 
ATOM 8208   C C  . ASN C 2 527  ? 1046.025 736.056 759.930 1.00 0.00 ? 527  ASN C C  1 
ATOM 8209   O O  . ASN C 2 527  ? 1045.850 735.798 758.742 1.00 0.00 ? 527  ASN C O  1 
ATOM 8210   C CB . ASN C 2 527  ? 1044.608 734.764 761.492 1.00 0.00 ? 527  ASN C CB 1 
ATOM 8211   N N  . PHE C 2 528  ? 1047.235 736.325 760.456 1.00 0.00 ? 528  PHE C N  1 
ATOM 8212   C CA . PHE C 2 528  ? 1048.429 736.467 759.674 1.00 0.00 ? 528  PHE C CA 1 
ATOM 8213   C C  . PHE C 2 528  ? 1048.740 735.191 758.958 1.00 0.00 ? 528  PHE C C  1 
ATOM 8214   O O  . PHE C 2 528  ? 1049.053 735.204 757.768 1.00 0.00 ? 528  PHE C O  1 
ATOM 8215   C CB . PHE C 2 528  ? 1049.630 736.897 760.535 1.00 0.00 ? 528  PHE C CB 1 
ATOM 8216   N N  . VAL C 2 529  ? 1048.640 734.050 759.660 1.00 0.00 ? 529  VAL C N  1 
ATOM 8217   C CA . VAL C 2 529  ? 1049.003 732.798 759.064 1.00 0.00 ? 529  VAL C CA 1 
ATOM 8218   C C  . VAL C 2 529  ? 1048.163 732.567 757.860 1.00 0.00 ? 529  VAL C C  1 
ATOM 8219   O O  . VAL C 2 529  ? 1048.677 732.329 756.769 1.00 0.00 ? 529  VAL C O  1 
ATOM 8220   C CB . VAL C 2 529  ? 1048.739 731.649 759.984 1.00 0.00 ? 529  VAL C CB 1 
ATOM 8221   N N  . ARG C 2 530  ? 1046.837 732.667 758.043 1.00 0.00 ? 530  ARG C N  1 
ATOM 8222   C CA . ARG C 2 530  ? 1045.863 732.425 757.024 1.00 0.00 ? 530  ARG C CA 1 
ATOM 8223   C C  . ARG C 2 530  ? 1045.930 733.463 755.949 1.00 0.00 ? 530  ARG C C  1 
ATOM 8224   O O  . ARG C 2 530  ? 1045.709 733.143 754.784 1.00 0.00 ? 530  ARG C O  1 
ATOM 8225   C CB . ARG C 2 530  ? 1044.474 732.260 757.642 1.00 0.00 ? 530  ARG C CB 1 
ATOM 8226   N N  . LEU C 2 531  ? 1046.246 734.726 756.284 1.00 0.00 ? 531  LEU C N  1 
ATOM 8227   C CA . LEU C 2 531  ? 1046.331 735.746 755.274 1.00 0.00 ? 531  LEU C CA 1 
ATOM 8228   C C  . LEU C 2 531  ? 1047.428 735.339 754.327 1.00 0.00 ? 531  LEU C C  1 
ATOM 8229   O O  . LEU C 2 531  ? 1047.294 735.455 753.110 1.00 0.00 ? 531  LEU C O  1 
ATOM 8230   C CB . LEU C 2 531  ? 1046.648 737.115 755.920 1.00 0.00 ? 531  LEU C CB 1 
ATOM 8231   N N  . LEU C 2 532  ? 1048.565 734.863 754.870 1.00 0.00 ? 532  LEU C N  1 
ATOM 8232   C CA . LEU C 2 532  ? 1049.688 734.433 754.074 1.00 0.00 ? 532  LEU C CA 1 
ATOM 8233   C C  . LEU C 2 532  ? 1049.353 733.204 753.291 1.00 0.00 ? 532  LEU C C  1 
ATOM 8234   O O  . LEU C 2 532  ? 1049.671 733.108 752.106 1.00 0.00 ? 532  LEU C O  1 
ATOM 8235   C CB . LEU C 2 532  ? 1050.909 734.050 754.919 1.00 0.00 ? 532  LEU C CB 1 
ATOM 8236   N N  . MET C 2 533  ? 1048.695 732.233 753.949 1.00 0.00 ? 533  MET C N  1 
ATOM 8237   C CA . MET C 2 533  ? 1048.401 730.951 753.374 1.00 0.00 ? 533  MET C CA 1 
ATOM 8238   C C  . MET C 2 533  ? 1047.508 731.120 752.192 1.00 0.00 ? 533  MET C C  1 
ATOM 8239   O O  . MET C 2 533  ? 1047.734 730.527 751.138 1.00 0.00 ? 533  MET C O  1 
ATOM 8240   C CB . MET C 2 533  ? 1047.662 730.057 754.383 1.00 0.00 ? 533  MET C CB 1 
ATOM 8241   N N  . LEU C 2 534  ? 1046.471 731.957 752.329 1.00 0.00 ? 534  LEU C N  1 
ATOM 8242   C CA . LEU C 2 534  ? 1045.525 732.116 751.270 1.00 0.00 ? 534  LEU C CA 1 
ATOM 8243   C C  . LEU C 2 534  ? 1046.192 732.779 750.097 1.00 0.00 ? 534  LEU C C  1 
ATOM 8244   O O  . LEU C 2 534  ? 1045.867 732.488 748.947 1.00 0.00 ? 534  LEU C O  1 
ATOM 8245   C CB . LEU C 2 534  ? 1044.285 732.902 751.714 1.00 0.00 ? 534  LEU C CB 1 
ATOM 8246   N N  . TYR C 2 535  ? 1047.147 733.692 750.362 1.00 0.00 ? 535  TYR C N  1 
ATOM 8247   C CA . TYR C 2 535  ? 1047.848 734.417 749.336 1.00 0.00 ? 535  TYR C CA 1 
ATOM 8248   C C  . TYR C 2 535  ? 1048.575 733.409 748.510 1.00 0.00 ? 535  TYR C C  1 
ATOM 8249   O O  . TYR C 2 535  ? 1048.619 733.493 747.282 1.00 0.00 ? 535  TYR C O  1 
ATOM 8250   C CB . TYR C 2 535  ? 1048.860 735.411 749.947 1.00 0.00 ? 535  TYR C CB 1 
ATOM 8251   N N  . THR C 2 536  ? 1049.138 732.391 749.185 1.00 0.00 ? 536  THR C N  1 
ATOM 8252   C CA . THR C 2 536  ? 1049.906 731.362 748.550 1.00 0.00 ? 536  THR C CA 1 
ATOM 8253   C C  . THR C 2 536  ? 1049.062 730.580 747.597 1.00 0.00 ? 536  THR C C  1 
ATOM 8254   O O  . THR C 2 536  ? 1049.564 730.086 746.590 1.00 0.00 ? 536  THR C O  1 
ATOM 8255   C CB . THR C 2 536  ? 1050.506 730.391 749.515 1.00 0.00 ? 536  THR C CB 1 
ATOM 8256   N N  . ARG C 2 537  ? 1047.754 730.459 747.872 1.00 0.00 ? 537  ARG C N  1 
ATOM 8257   C CA . ARG C 2 537  ? 1046.905 729.621 747.074 1.00 0.00 ? 537  ARG C CA 1 
ATOM 8258   C C  . ARG C 2 537  ? 1046.990 730.039 745.641 1.00 0.00 ? 537  ARG C C  1 
ATOM 8259   O O  . ARG C 2 537  ? 1046.952 729.201 744.743 1.00 0.00 ? 537  ARG C O  1 
ATOM 8260   C CB . ARG C 2 537  ? 1045.427 729.692 747.501 1.00 0.00 ? 537  ARG C CB 1 
ATOM 8261   N N  . LYS C 2 538  ? 1047.114 731.348 745.378 1.00 0.00 ? 538  LYS C N  1 
ATOM 8262   C CA . LYS C 2 538  ? 1047.125 731.788 744.015 1.00 0.00 ? 538  LYS C CA 1 
ATOM 8263   C C  . LYS C 2 538  ? 1048.244 731.117 743.255 1.00 0.00 ? 538  LYS C C  1 
ATOM 8264   O O  . LYS C 2 538  ? 1048.000 730.385 742.298 1.00 0.00 ? 538  LYS C O  1 
ATOM 8265   C CB . LYS C 2 538  ? 1047.368 733.310 743.967 1.00 0.00 ? 538  LYS C CB 1 
ATOM 8266   N N  . PHE C 2 539  ? 1049.500 731.357 743.681 1.00 0.00 ? 539  PHE C N  1 
ATOM 8267   C CA . PHE C 2 539  ? 1050.720 730.900 743.053 1.00 0.00 ? 539  PHE C CA 1 
ATOM 8268   C C  . PHE C 2 539  ? 1051.263 729.535 743.405 1.00 0.00 ? 539  PHE C C  1 
ATOM 8269   O O  . PHE C 2 539  ? 1052.127 729.046 742.681 1.00 0.00 ? 539  PHE C O  1 
ATOM 8270   C CB . PHE C 2 539  ? 1051.853 731.944 743.031 1.00 0.00 ? 539  PHE C CB 1 
ATOM 8271   N N  . GLU C 2 540  ? 1050.830 728.880 744.502 1.00 0.00 ? 540  GLU C N  1 
ATOM 8272   C CA . GLU C 2 540  ? 1051.524 727.720 745.024 1.00 0.00 ? 540  GLU C CA 1 
ATOM 8273   C C  . GLU C 2 540  ? 1051.826 726.669 743.997 1.00 0.00 ? 540  GLU C C  1 
ATOM 8274   O O  . GLU C 2 540  ? 1052.957 726.186 743.952 1.00 0.00 ? 540  GLU C O  1 
ATOM 8275   C CB . GLU C 2 540  ? 1050.742 727.023 746.153 1.00 0.00 ? 540  GLU C CB 1 
ATOM 8276   N N  . SER C 2 541  ? 1050.870 726.275 743.137 1.00 0.00 ? 541  SER C N  1 
ATOM 8277   C CA . SER C 2 541  ? 1051.210 725.228 742.214 1.00 0.00 ? 541  SER C CA 1 
ATOM 8278   C C  . SER C 2 541  ? 1052.329 725.680 741.325 1.00 0.00 ? 541  SER C C  1 
ATOM 8279   O O  . SER C 2 541  ? 1053.331 724.981 741.177 1.00 0.00 ? 541  SER C O  1 
ATOM 8280   C CB . SER C 2 541  ? 1050.043 724.814 741.303 1.00 0.00 ? 541  SER C CB 1 
ATOM 8281   N N  . THR C 2 542  ? 1052.177 726.867 740.711 1.00 0.00 ? 542  THR C N  1 
ATOM 8282   C CA . THR C 2 542  ? 1053.145 727.373 739.784 1.00 0.00 ? 542  THR C CA 1 
ATOM 8283   C C  . THR C 2 542  ? 1054.449 727.718 740.449 1.00 0.00 ? 542  THR C C  1 
ATOM 8284   O O  . THR C 2 542  ? 1055.508 727.372 739.929 1.00 0.00 ? 542  THR C O  1 
ATOM 8285   C CB . THR C 2 542  ? 1052.652 728.584 739.032 1.00 0.00 ? 542  THR C CB 1 
ATOM 8286   N N  . ASP C 2 543  ? 1054.427 728.394 741.619 1.00 0.00 ? 543  ASP C N  1 
ATOM 8287   C CA . ASP C 2 543  ? 1055.681 728.803 742.196 1.00 0.00 ? 543  ASP C CA 1 
ATOM 8288   C C  . ASP C 2 543  ? 1055.772 728.332 743.618 1.00 0.00 ? 543  ASP C C  1 
ATOM 8289   O O  . ASP C 2 543  ? 1055.653 729.132 744.545 1.00 0.00 ? 543  ASP C O  1 
ATOM 8290   C CB . ASP C 2 543  ? 1055.811 730.333 742.259 1.00 0.00 ? 543  ASP C CB 1 
ATOM 8291   N N  . PRO C 2 544  ? 1056.020 727.074 743.839 1.00 0.00 ? 544  PRO C N  1 
ATOM 8292   C CA . PRO C 2 544  ? 1056.121 726.521 745.159 1.00 0.00 ? 544  PRO C CA 1 
ATOM 8293   C C  . PRO C 2 544  ? 1057.227 727.145 745.966 1.00 0.00 ? 544  PRO C C  1 
ATOM 8294   O O  . PRO C 2 544  ? 1057.090 727.219 747.187 1.00 0.00 ? 544  PRO C O  1 
ATOM 8295   C CB . PRO C 2 544  ? 1056.273 725.012 744.960 1.00 0.00 ? 544  PRO C CB 1 
ATOM 8296   N N  . ARG C 2 545  ? 1058.333 727.587 745.331 1.00 0.00 ? 545  ARG C N  1 
ATOM 8297   C CA . ARG C 2 545  ? 1059.416 728.163 746.087 1.00 0.00 ? 545  ARG C CA 1 
ATOM 8298   C C  . ARG C 2 545  ? 1058.926 729.412 746.737 1.00 0.00 ? 545  ARG C C  1 
ATOM 8299   O O  . ARG C 2 545  ? 1059.171 729.647 747.919 1.00 0.00 ? 545  ARG C O  1 
ATOM 8300   C CB . ARG C 2 545  ? 1060.616 728.605 745.226 1.00 0.00 ? 545  ARG C CB 1 
ATOM 8301   N N  . GLU C 2 546  ? 1058.195 730.240 745.971 1.00 0.00 ? 546  GLU C N  1 
ATOM 8302   C CA . GLU C 2 546  ? 1057.752 731.503 746.478 1.00 0.00 ? 546  GLU C CA 1 
ATOM 8303   C C  . GLU C 2 546  ? 1056.820 731.254 747.613 1.00 0.00 ? 546  GLU C C  1 
ATOM 8304   O O  . GLU C 2 546  ? 1056.823 731.986 748.602 1.00 0.00 ? 546  GLU C O  1 
ATOM 8305   C CB . GLU C 2 546  ? 1057.017 732.347 745.422 1.00 0.00 ? 546  GLU C CB 1 
ATOM 8306   N N  . ALA C 2 547  ? 1056.003 730.193 747.504 1.00 0.00 ? 547  ALA C N  1 
ATOM 8307   C CA . ALA C 2 547  ? 1055.054 729.905 748.533 1.00 0.00 ? 547  ALA C CA 1 
ATOM 8308   C C  . ALA C 2 547  ? 1055.795 729.664 749.808 1.00 0.00 ? 547  ALA C C  1 
ATOM 8309   O O  . ALA C 2 547  ? 1055.367 730.108 750.873 1.00 0.00 ? 547  ALA C O  1 
ATOM 8310   C CB . ALA C 2 547  ? 1054.221 728.646 748.235 1.00 0.00 ? 547  ALA C CB 1 
ATOM 8311   N N  . LEU C 2 548  ? 1056.942 728.966 749.736 1.00 0.00 ? 548  LEU C N  1 
ATOM 8312   C CA . LEU C 2 548  ? 1057.660 728.631 750.933 1.00 0.00 ? 548  LEU C CA 1 
ATOM 8313   C C  . LEU C 2 548  ? 1058.093 729.915 751.575 1.00 0.00 ? 548  LEU C C  1 
ATOM 8314   O O  . LEU C 2 548  ? 1057.955 730.099 752.784 1.00 0.00 ? 548  LEU C O  1 
ATOM 8315   C CB . LEU C 2 548  ? 1058.923 727.795 750.647 1.00 0.00 ? 548  LEU C CB 1 
ATOM 8316   N N  . GLN C 2 549  ? 1058.578 730.874 750.765 1.00 0.00 ? 549  GLN C N  1 
ATOM 8317   C CA . GLN C 2 549  ? 1059.115 732.087 751.309 1.00 0.00 ? 549  GLN C CA 1 
ATOM 8318   C C  . GLN C 2 549  ? 1058.056 732.788 752.102 1.00 0.00 ? 549  GLN C C  1 
ATOM 8319   O O  . GLN C 2 549  ? 1058.338 733.319 753.175 1.00 0.00 ? 549  GLN C O  1 
ATOM 8320   C CB . GLN C 2 549  ? 1059.590 733.062 750.220 1.00 0.00 ? 549  GLN C CB 1 
ATOM 8321   N N  . TYR C 2 550  ? 1056.815 732.833 751.584 1.00 0.00 ? 550  TYR C N  1 
ATOM 8322   C CA . TYR C 2 550  ? 1055.736 733.484 752.274 1.00 0.00 ? 550  TYR C CA 1 
ATOM 8323   C C  . TYR C 2 550  ? 1055.338 732.742 753.516 1.00 0.00 ? 550  TYR C C  1 
ATOM 8324   O O  . TYR C 2 550  ? 1055.083 733.362 754.547 1.00 0.00 ? 550  TYR C O  1 
ATOM 8325   C CB . TYR C 2 550  ? 1054.499 733.725 751.389 1.00 0.00 ? 550  TYR C CB 1 
ATOM 8326   N N  . PHE C 2 551  ? 1055.288 731.397 753.473 1.00 0.00 ? 551  PHE C N  1 
ATOM 8327   C CA . PHE C 2 551  ? 1054.833 730.676 754.630 1.00 0.00 ? 551  PHE C CA 1 
ATOM 8328   C C  . PHE C 2 551  ? 1055.762 730.927 755.768 1.00 0.00 ? 551  PHE C C  1 
ATOM 8329   O O  . PHE C 2 551  ? 1055.327 731.012 756.913 1.00 0.00 ? 551  PHE C O  1 
ATOM 8330   C CB . PHE C 2 551  ? 1054.720 729.150 754.474 1.00 0.00 ? 551  PHE C CB 1 
ATOM 8331   N N  . TYR C 2 552  ? 1057.061 731.073 755.462 1.00 0.00 ? 552  TYR C N  1 
ATOM 8332   C CA . TYR C 2 552  ? 1058.125 731.217 756.415 1.00 0.00 ? 552  TYR C CA 1 
ATOM 8333   C C  . TYR C 2 552  ? 1057.891 732.432 757.270 1.00 0.00 ? 552  TYR C C  1 
ATOM 8334   O O  . TYR C 2 552  ? 1058.320 732.453 758.420 1.00 0.00 ? 552  TYR C O  1 
ATOM 8335   C CB . TYR C 2 552  ? 1059.506 731.344 755.750 1.00 0.00 ? 552  TYR C CB 1 
ATOM 8336   N N  . PHE C 2 553  ? 1057.232 733.480 756.732 1.00 0.00 ? 553  PHE C N  1 
ATOM 8337   C CA . PHE C 2 553  ? 1056.992 734.708 757.451 1.00 0.00 ? 553  PHE C CA 1 
ATOM 8338   C C  . PHE C 2 553  ? 1056.159 734.454 758.664 1.00 0.00 ? 553  PHE C C  1 
ATOM 8339   O O  . PHE C 2 553  ? 1056.209 735.224 759.620 1.00 0.00 ? 553  PHE C O  1 
ATOM 8340   C CB . PHE C 2 553  ? 1056.234 735.815 756.691 1.00 0.00 ? 553  PHE C CB 1 
ATOM 8341   N N  . LEU C 2 554  ? 1055.352 733.382 758.651 1.00 0.00 ? 554  LEU C N  1 
ATOM 8342   C CA . LEU C 2 554  ? 1054.412 733.082 759.694 1.00 0.00 ? 554  LEU C CA 1 
ATOM 8343   C C  . LEU C 2 554  ? 1055.157 733.028 761.003 1.00 0.00 ? 554  LEU C C  1 
ATOM 8344   O O  . LEU C 2 554  ? 1054.633 733.459 762.028 1.00 0.00 ? 554  LEU C O  1 
ATOM 8345   C CB . LEU C 2 554  ? 1053.703 731.737 759.412 1.00 0.00 ? 554  LEU C CB 1 
ATOM 8346   N N  . ARG C 2 555  ? 1056.412 732.532 761.003 1.00 0.00 ? 555  ARG C N  1 
ATOM 8347   C CA . ARG C 2 555  ? 1057.223 732.415 762.190 1.00 0.00 ? 555  ARG C CA 1 
ATOM 8348   C C  . ARG C 2 555  ? 1057.544 733.764 762.741 1.00 0.00 ? 555  ARG C C  1 
ATOM 8349   O O  . ARG C 2 555  ? 1057.876 733.876 763.919 1.00 0.00 ? 555  ARG C O  1 
ATOM 8350   C CB . ARG C 2 555  ? 1058.558 731.678 761.998 1.00 0.00 ? 555  ARG C CB 1 
ATOM 8351   N N  . ASP C 2 556  ? 1057.472 734.808 761.903 1.00 0.00 ? 556  ASP C N  1 
ATOM 8352   C CA . ASP C 2 556  ? 1057.836 736.138 762.279 1.00 0.00 ? 556  ASP C CA 1 
ATOM 8353   C C  . ASP C 2 556  ? 1057.055 736.454 763.529 1.00 0.00 ? 556  ASP C C  1 
ATOM 8354   O O  . ASP C 2 556  ? 1057.536 737.179 764.399 1.00 0.00 ? 556  ASP C O  1 
ATOM 8355   C CB . ASP C 2 556  ? 1057.548 737.106 761.114 1.00 0.00 ? 556  ASP C CB 1 
ATOM 8356   N N  . GLU C 2 557  ? 1055.827 735.906 763.673 1.00 0.00 ? 557  GLU C N  1 
ATOM 8357   C CA . GLU C 2 557  ? 1055.125 736.077 764.915 1.00 0.00 ? 557  GLU C CA 1 
ATOM 8358   C C  . GLU C 2 557  ? 1055.649 734.964 765.755 1.00 0.00 ? 557  GLU C C  1 
ATOM 8359   O O  . GLU C 2 557  ? 1055.256 733.812 765.589 1.00 0.00 ? 557  GLU C O  1 
ATOM 8360   C CB . GLU C 2 557  ? 1053.606 735.857 764.811 1.00 0.00 ? 557  GLU C CB 1 
ATOM 8361   N N  . LYS C 2 558  ? 1056.561 735.295 766.682 1.00 0.00 ? 558  LYS C N  1 
ATOM 8362   C CA . LYS C 2 558  ? 1057.235 734.291 767.445 1.00 0.00 ? 558  LYS C CA 1 
ATOM 8363   C C  . LYS C 2 558  ? 1056.329 733.847 768.548 1.00 0.00 ? 558  LYS C C  1 
ATOM 8364   O O  . LYS C 2 558  ? 1055.762 734.680 769.253 1.00 0.00 ? 558  LYS C O  1 
ATOM 8365   C CB . LYS C 2 558  ? 1058.516 734.877 768.060 1.00 0.00 ? 558  LYS C CB 1 
ATOM 8366   N N  . ASP C 2 559  ? 1056.164 732.511 768.698 1.00 0.00 ? 559  ASP C N  1 
ATOM 8367   C CA . ASP C 2 559  ? 1055.361 731.913 769.731 1.00 0.00 ? 559  ASP C CA 1 
ATOM 8368   C C  . ASP C 2 559  ? 1054.896 730.605 769.179 1.00 0.00 ? 559  ASP C C  1 
ATOM 8369   O O  . ASP C 2 559  ? 1054.882 730.405 767.966 1.00 0.00 ? 559  ASP C O  1 
ATOM 8370   C CB . ASP C 2 559  ? 1054.091 732.704 770.113 1.00 0.00 ? 559  ASP C CB 1 
ATOM 8371   N N  . SER C 2 560  ? 1054.512 729.664 770.062 1.00 0.00 ? 560  SER C N  1 
ATOM 8372   C CA . SER C 2 560  ? 1053.972 728.425 769.587 1.00 0.00 ? 560  SER C CA 1 
ATOM 8373   C C  . SER C 2 560  ? 1052.637 728.780 769.030 1.00 0.00 ? 560  SER C C  1 
ATOM 8374   O O  . SER C 2 560  ? 1052.238 729.941 769.109 1.00 0.00 ? 560  SER C O  1 
ATOM 8375   C CB . SER C 2 560  ? 1053.762 727.374 770.689 1.00 0.00 ? 560  SER C CB 1 
ATOM 8376   N N  . GLN C 2 561  ? 1051.939 727.791 768.419 1.00 0.00 ? 561  GLN C N  1 
ATOM 8377   C CA . GLN C 2 561  ? 1050.670 728.011 767.782 1.00 0.00 ? 561  GLN C CA 1 
ATOM 8378   C C  . GLN C 2 561  ? 1050.994 728.470 766.404 1.00 0.00 ? 561  GLN C C  1 
ATOM 8379   O O  . GLN C 2 561  ? 1050.762 727.763 765.424 1.00 0.00 ? 561  GLN C O  1 
ATOM 8380   C CB . GLN C 2 561  ? 1049.759 729.056 768.462 1.00 0.00 ? 561  GLN C CB 1 
ATOM 8381   N N  . GLY C 2 562  ? 1051.560 729.688 766.301 1.00 0.00 ? 562  GLY C N  1 
ATOM 8382   C CA . GLY C 2 562  ? 1051.924 730.224 765.026 1.00 0.00 ? 562  GLY C CA 1 
ATOM 8383   C C  . GLY C 2 562  ? 1052.958 729.327 764.429 1.00 0.00 ? 562  GLY C C  1 
ATOM 8384   O O  . GLY C 2 562  ? 1052.937 729.052 763.229 1.00 0.00 ? 562  GLY C O  1 
ATOM 8385   N N  . GLU C 2 563  ? 1053.900 728.838 765.259 1.00 0.00 ? 563  GLU C N  1 
ATOM 8386   C CA . GLU C 2 563  ? 1054.952 728.011 764.745 1.00 0.00 ? 563  GLU C CA 1 
ATOM 8387   C C  . GLU C 2 563  ? 1054.346 726.779 764.149 1.00 0.00 ? 563  GLU C C  1 
ATOM 8388   O O  . GLU C 2 563  ? 1054.706 726.378 763.044 1.00 0.00 ? 563  GLU C O  1 
ATOM 8389   C CB . GLU C 2 563  ? 1055.954 727.571 765.829 1.00 0.00 ? 563  GLU C CB 1 
ATOM 8390   N N  . ASN C 2 564  ? 1053.386 726.153 764.857 1.00 0.00 ? 564  ASN C N  1 
ATOM 8391   C CA . ASN C 2 564  ? 1052.769 724.962 764.344 1.00 0.00 ? 564  ASN C CA 1 
ATOM 8392   C C  . ASN C 2 564  ? 1051.999 725.299 763.110 1.00 0.00 ? 564  ASN C C  1 
ATOM 8393   O O  . ASN C 2 564  ? 1051.964 724.519 762.160 1.00 0.00 ? 564  ASN C O  1 
ATOM 8394   C CB . ASN C 2 564  ? 1051.812 724.268 765.329 1.00 0.00 ? 564  ASN C CB 1 
ATOM 8395   N N  . MET C 2 565  ? 1051.371 726.487 763.083 1.00 0.00 ? 565  MET C N  1 
ATOM 8396   C CA . MET C 2 565  ? 1050.578 726.862 761.950 1.00 0.00 ? 565  MET C CA 1 
ATOM 8397   C C  . MET C 2 565  ? 1051.481 726.885 760.759 1.00 0.00 ? 565  MET C C  1 
ATOM 8398   O O  . MET C 2 565  ? 1051.106 726.445 759.674 1.00 0.00 ? 565  MET C O  1 
ATOM 8399   C CB . MET C 2 565  ? 1049.968 728.267 762.097 1.00 0.00 ? 565  MET C CB 1 
ATOM 8400   N N  . PHE C 2 566  ? 1052.709 727.399 760.946 1.00 0.00 ? 566  PHE C N  1 
ATOM 8401   C CA . PHE C 2 566  ? 1053.679 727.475 759.897 1.00 0.00 ? 566  PHE C CA 1 
ATOM 8402   C C  . PHE C 2 566  ? 1053.988 726.090 759.429 1.00 0.00 ? 566  PHE C C  1 
ATOM 8403   O O  . PHE C 2 566  ? 1053.976 725.810 758.231 1.00 0.00 ? 566  PHE C O  1 
ATOM 8404   C CB . PHE C 2 566  ? 1054.993 728.080 760.412 1.00 0.00 ? 566  PHE C CB 1 
ATOM 8405   N N  . LEU C 2 567  ? 1054.249 725.179 760.383 1.00 0.00 ? 567  LEU C N  1 
ATOM 8406   C CA . LEU C 2 567  ? 1054.654 723.843 760.060 1.00 0.00 ? 567  LEU C CA 1 
ATOM 8407   C C  . LEU C 2 567  ? 1053.554 723.163 759.316 1.00 0.00 ? 567  LEU C C  1 
ATOM 8408   O O  . LEU C 2 567  ? 1053.798 722.473 758.327 1.00 0.00 ? 567  LEU C O  1 
ATOM 8409   C CB . LEU C 2 567  ? 1054.948 723.009 761.317 1.00 0.00 ? 567  LEU C CB 1 
ATOM 8410   N N  . ARG C 2 568  ? 1052.303 723.347 759.771 1.00 0.00 ? 568  ARG C N  1 
ATOM 8411   C CA . ARG C 2 568  ? 1051.198 722.688 759.146 1.00 0.00 ? 568  ARG C CA 1 
ATOM 8412   C C  . ARG C 2 568  ? 1051.069 723.195 757.748 1.00 0.00 ? 568  ARG C C  1 
ATOM 8413   O O  . ARG C 2 568  ? 1050.788 722.432 756.825 1.00 0.00 ? 568  ARG C O  1 
ATOM 8414   C CB . ARG C 2 568  ? 1049.858 722.944 759.857 1.00 0.00 ? 568  ARG C CB 1 
ATOM 8415   N N  . CYS C 2 569  ? 1051.279 724.509 757.558 1.00 0.00 ? 569  CYS C N  1 
ATOM 8416   C CA . CYS C 2 569  ? 1051.110 725.104 756.266 1.00 0.00 ? 569  CYS C CA 1 
ATOM 8417   C C  . CYS C 2 569  ? 1052.104 724.511 755.316 1.00 0.00 ? 569  CYS C C  1 
ATOM 8418   O O  . CYS C 2 569  ? 1051.759 724.165 754.188 1.00 0.00 ? 569  CYS C O  1 
ATOM 8419   C CB . CYS C 2 569  ? 1051.308 726.623 756.295 1.00 0.00 ? 569  CYS C CB 1 
ATOM 8420   N N  . VAL C 2 570  ? 1053.371 724.370 755.754 1.00 0.00 ? 570  VAL C N  1 
ATOM 8421   C CA . VAL C 2 570  ? 1054.388 723.817 754.904 1.00 0.00 ? 570  VAL C CA 1 
ATOM 8422   C C  . VAL C 2 570  ? 1054.023 722.402 754.596 1.00 0.00 ? 570  VAL C C  1 
ATOM 8423   O O  . VAL C 2 570  ? 1054.108 721.964 753.451 1.00 0.00 ? 570  VAL C O  1 
ATOM 8424   C CB . VAL C 2 570  ? 1055.743 723.798 755.545 1.00 0.00 ? 570  VAL C CB 1 
ATOM 8425   N N  . SER C 2 571  ? 1053.575 721.655 755.622 1.00 0.00 ? 571  SER C N  1 
ATOM 8426   C CA . SER C 2 571  ? 1053.241 720.272 755.449 1.00 0.00 ? 571  SER C CA 1 
ATOM 8427   C C  . SER C 2 571  ? 1052.154 720.196 754.427 1.00 0.00 ? 571  SER C C  1 
ATOM 8428   O O  . SER C 2 571  ? 1052.182 719.348 753.536 1.00 0.00 ? 571  SER C O  1 
ATOM 8429   C CB . SER C 2 571  ? 1052.699 719.633 756.739 1.00 0.00 ? 571  SER C CB 1 
ATOM 8430   N N  . GLU C 2 572  ? 1051.168 721.104 754.527 1.00 0.00 ? 572  GLU C N  1 
ATOM 8431   C CA . GLU C 2 572  ? 1050.068 721.115 753.613 1.00 0.00 ? 572  GLU C CA 1 
ATOM 8432   C C  . GLU C 2 572  ? 1050.566 721.452 752.247 1.00 0.00 ? 572  GLU C C  1 
ATOM 8433   O O  . GLU C 2 572  ? 1049.998 720.998 751.260 1.00 0.00 ? 572  GLU C O  1 
ATOM 8434   C CB . GLU C 2 572  ? 1048.976 722.146 753.947 1.00 0.00 ? 572  GLU C CB 1 
ATOM 8435   N N  . LEU C 2 573  ? 1051.600 722.305 752.144 1.00 0.00 ? 573  LEU C N  1 
ATOM 8436   C CA . LEU C 2 573  ? 1052.098 722.705 750.857 1.00 0.00 ? 573  LEU C CA 1 
ATOM 8437   C C  . LEU C 2 573  ? 1052.708 721.510 750.176 1.00 0.00 ? 573  LEU C C  1 
ATOM 8438   O O  . LEU C 2 573  ? 1052.435 721.250 749.004 1.00 0.00 ? 573  LEU C O  1 
ATOM 8439   C CB . LEU C 2 573  ? 1053.190 723.789 750.982 1.00 0.00 ? 573  LEU C CB 1 
ATOM 8440   N N  . VAL C 2 574  ? 1053.541 720.738 750.908 1.00 0.00 ? 574  VAL C N  1 
ATOM 8441   C CA . VAL C 2 574  ? 1054.243 719.634 750.310 1.00 0.00 ? 574  VAL C CA 1 
ATOM 8442   C C  . VAL C 2 574  ? 1053.247 718.658 749.800 1.00 0.00 ? 574  VAL C C  1 
ATOM 8443   O O  . VAL C 2 574  ? 1053.298 718.234 748.647 1.00 0.00 ? 574  VAL C O  1 
ATOM 8444   C CB . VAL C 2 574  ? 1055.113 718.889 751.283 1.00 0.00 ? 574  VAL C CB 1 
ATOM 8445   N N  . ILE C 2 575  ? 1052.295 718.296 750.668 1.00 0.00 ? 575  ILE C N  1 
ATOM 8446   C CA . ILE C 2 575  ? 1051.260 717.395 750.293 1.00 0.00 ? 575  ILE C CA 1 
ATOM 8447   C C  . ILE C 2 575  ? 1050.441 718.165 749.305 1.00 0.00 ? 575  ILE C C  1 
ATOM 8448   O O  . ILE C 2 575  ? 1050.380 719.386 749.375 1.00 0.00 ? 575  ILE C O  1 
ATOM 8449   C CB . ILE C 2 575  ? 1050.406 717.022 751.472 1.00 0.00 ? 575  ILE C CB 1 
ATOM 8450   N N  . GLU C 2 576  ? 1049.911 717.470 748.287 1.00 0.00 ? 576  GLU C N  1 
ATOM 8451   C CA . GLU C 2 576  ? 1049.003 717.939 747.274 1.00 0.00 ? 576  GLU C CA 1 
ATOM 8452   C C  . GLU C 2 576  ? 1049.670 718.824 746.263 1.00 0.00 ? 576  GLU C C  1 
ATOM 8453   O O  . GLU C 2 576  ? 1049.177 718.931 745.142 1.00 0.00 ? 576  GLU C O  1 
ATOM 8454   C CB . GLU C 2 576  ? 1047.764 718.691 747.834 1.00 0.00 ? 576  GLU C CB 1 
ATOM 8455   N N  . SER C 2 577  ? 1050.804 719.474 746.587 1.00 0.00 ? 577  SER C N  1 
ATOM 8456   C CA . SER C 2 577  ? 1051.500 720.175 745.543 1.00 0.00 ? 577  SER C CA 1 
ATOM 8457   C C  . SER C 2 577  ? 1052.334 719.131 744.872 1.00 0.00 ? 577  SER C C  1 
ATOM 8458   O O  . SER C 2 577  ? 1052.531 719.130 743.659 1.00 0.00 ? 577  SER C O  1 
ATOM 8459   C CB . SER C 2 577  ? 1052.446 721.269 746.053 1.00 0.00 ? 577  SER C CB 1 
ATOM 8460   N N  . ARG C 2 578  ? 1052.834 718.197 745.705 1.00 0.00 ? 578  ARG C N  1 
ATOM 8461   C CA . ARG C 2 578  ? 1053.666 717.103 745.301 1.00 0.00 ? 578  ARG C CA 1 
ATOM 8462   C C  . ARG C 2 578  ? 1054.922 717.585 744.641 1.00 0.00 ? 578  ARG C C  1 
ATOM 8463   O O  . ARG C 2 578  ? 1055.499 716.873 743.821 1.00 0.00 ? 578  ARG C O  1 
ATOM 8464   C CB . ARG C 2 578  ? 1052.968 716.091 744.366 1.00 0.00 ? 578  ARG C CB 1 
ATOM 8465   N N  . GLU C 2 579  ? 1055.408 718.793 744.991 1.00 0.00 ? 579  GLU C N  1 
ATOM 8466   C CA . GLU C 2 579  ? 1056.651 719.213 744.405 1.00 0.00 ? 579  GLU C CA 1 
ATOM 8467   C C  . GLU C 2 579  ? 1057.720 718.762 745.350 1.00 0.00 ? 579  GLU C C  1 
ATOM 8468   O O  . GLU C 2 579  ? 1058.330 719.577 746.039 1.00 0.00 ? 579  GLU C O  1 
ATOM 8469   C CB . GLU C 2 579  ? 1056.773 720.743 744.292 1.00 0.00 ? 579  GLU C CB 1 
ATOM 8470   N N  . PHE C 2 580  ? 1057.994 717.441 745.375 1.00 0.00 ? 580  PHE C N  1 
ATOM 8471   C CA . PHE C 2 580  ? 1058.906 716.879 746.333 1.00 0.00 ? 580  PHE C CA 1 
ATOM 8472   C C  . PHE C 2 580  ? 1060.320 717.308 746.112 1.00 0.00 ? 580  PHE C C  1 
ATOM 8473   O O  . PHE C 2 580  ? 1061.008 717.679 747.060 1.00 0.00 ? 580  PHE C O  1 
ATOM 8474   C CB . PHE C 2 580  ? 1058.917 715.345 746.345 1.00 0.00 ? 580  PHE C CB 1 
ATOM 8475   N N  . ASP C 2 581  ? 1060.806 717.268 744.858 1.00 0.00 ? 581  ASP C N  1 
ATOM 8476   C CA . ASP C 2 581  ? 1062.202 717.532 744.651 1.00 0.00 ? 581  ASP C CA 1 
ATOM 8477   C C  . ASP C 2 581  ? 1062.511 718.924 745.075 1.00 0.00 ? 581  ASP C C  1 
ATOM 8478   O O  . ASP C 2 581  ? 1063.491 719.175 745.774 1.00 0.00 ? 581  ASP C O  1 
ATOM 8479   C CB . ASP C 2 581  ? 1062.623 717.416 743.175 1.00 0.00 ? 581  ASP C CB 1 
ATOM 8480   N N  . MET C 2 582  ? 1061.674 719.871 744.635 1.00 0.00 ? 582  MET C N  1 
ATOM 8481   C CA . MET C 2 582  ? 1061.878 721.258 744.903 1.00 0.00 ? 582  MET C CA 1 
ATOM 8482   C C  . MET C 2 582  ? 1061.771 721.491 746.378 1.00 0.00 ? 582  MET C C  1 
ATOM 8483   O O  . MET C 2 582  ? 1062.652 722.081 747.001 1.00 0.00 ? 582  MET C O  1 
ATOM 8484   C CB . MET C 2 582  ? 1060.777 722.035 744.159 1.00 0.00 ? 582  MET C CB 1 
ATOM 8485   N N  . ILE C 2 583  ? 1060.676 720.998 746.982 1.00 0.00 ? 583  ILE C N  1 
ATOM 8486   C CA . ILE C 2 583  ? 1060.432 721.278 748.363 1.00 0.00 ? 583  ILE C CA 1 
ATOM 8487   C C  . ILE C 2 583  ? 1061.339 720.509 749.300 1.00 0.00 ? 583  ILE C C  1 
ATOM 8488   O O  . ILE C 2 583  ? 1061.984 721.103 750.158 1.00 0.00 ? 583  ILE C O  1 
ATOM 8489   C CB . ILE C 2 583  ? 1058.966 721.057 748.671 1.00 0.00 ? 583  ILE C CB 1 
ATOM 8490   N N  . LEU C 2 584  ? 1061.391 719.164 749.182 1.00 0.00 ? 584  LEU C N  1 
ATOM 8491   C CA . LEU C 2 584  ? 1062.130 718.289 750.056 1.00 0.00 ? 584  LEU C CA 1 
ATOM 8492   C C  . LEU C 2 584  ? 1063.604 718.130 749.801 1.00 0.00 ? 584  LEU C C  1 
ATOM 8493   O O  . LEU C 2 584  ? 1064.387 718.110 750.749 1.00 0.00 ? 584  LEU C O  1 
ATOM 8494   C CB . LEU C 2 584  ? 1061.473 716.905 750.164 1.00 0.00 ? 584  LEU C CB 1 
ATOM 8495   N N  . GLY C 2 585  ? 1064.035 717.984 748.529 1.00 0.00 ? 585  GLY C N  1 
ATOM 8496   C CA . GLY C 2 585  ? 1065.432 717.734 748.282 1.00 0.00 ? 585  GLY C CA 1 
ATOM 8497   C C  . GLY C 2 585  ? 1065.558 716.805 747.095 1.00 0.00 ? 585  GLY C C  1 
ATOM 8498   O O  . GLY C 2 585  ? 1064.611 716.651 746.322 1.00 0.00 ? 585  GLY C O  1 
ATOM 8499   N N  . LYS C 2 586  ? 1066.751 716.165 746.924 1.00 0.00 ? 586  LYS C N  1 
ATOM 8500   C CA . LYS C 2 586  ? 1067.020 715.337 745.765 1.00 0.00 ? 586  LYS C CA 1 
ATOM 8501   C C  . LYS C 2 586  ? 1068.383 714.672 745.850 1.00 0.00 ? 586  LYS C C  1 
ATOM 8502   O O  . LYS C 2 586  ? 1069.234 715.088 746.638 1.00 0.00 ? 586  LYS C O  1 
ATOM 8503   C CB . LYS C 2 586  ? 1067.019 716.198 744.486 1.00 0.00 ? 586  LYS C CB 1 
ATOM 8504   N N  . LEU C 2 587  ? 1068.569 713.630 744.985 1.00 0.00 ? 587  LEU C N  1 
ATOM 8505   C CA . LEU C 2 587  ? 1069.721 712.796 744.671 1.00 0.00 ? 587  LEU C CA 1 
ATOM 8506   C C  . LEU C 2 587  ? 1070.855 712.855 745.668 1.00 0.00 ? 587  LEU C C  1 
ATOM 8507   O O  . LEU C 2 587  ? 1071.381 713.906 746.003 1.00 0.00 ? 587  LEU C O  1 
ATOM 8508   C CB . LEU C 2 587  ? 1070.261 713.205 743.265 1.00 0.00 ? 587  LEU C CB 1 
ATOM 8509   N N  . GLU C 2 588  ? 1071.293 711.669 746.123 1.00 0.00 ? 588  GLU C N  1 
ATOM 8510   C CA . GLU C 2 588  ? 1072.400 711.673 747.018 1.00 0.00 ? 588  GLU C CA 1 
ATOM 8511   C C  . GLU C 2 588  ? 1073.761 711.837 746.365 1.00 0.00 ? 588  GLU C C  1 
ATOM 8512   O O  . GLU C 2 588  ? 1074.484 712.786 746.702 1.00 0.00 ? 588  GLU C O  1 
ATOM 8513   C CB . GLU C 2 588  ? 1072.455 710.447 747.925 1.00 0.00 ? 588  GLU C CB 1 
ATOM 8514   N N  . ASN C 2 589  ? 1074.153 710.970 745.387 1.00 0.00 ? 589  ASN C N  1 
ATOM 8515   C CA . ASN C 2 589  ? 1075.567 710.820 745.037 1.00 0.00 ? 589  ASN C CA 1 
ATOM 8516   C C  . ASN C 2 589  ? 1076.366 710.844 746.315 1.00 0.00 ? 589  ASN C C  1 
ATOM 8517   O O  . ASN C 2 589  ? 1077.211 711.723 746.519 1.00 0.00 ? 589  ASN C O  1 
ATOM 8518   C CB . ASN C 2 589  ? 1076.112 711.857 744.048 1.00 0.00 ? 589  ASN C CB 1 
ATOM 8519   N N  . ASP C 2 590  ? 1076.126 709.832 747.179 1.00 0.00 ? 590  ASP C N  1 
ATOM 8520   C CA . ASP C 2 590  ? 1076.578 709.945 748.538 1.00 0.00 ? 590  ASP C CA 1 
ATOM 8521   C C  . ASP C 2 590  ? 1076.045 711.282 748.969 1.00 0.00 ? 590  ASP C C  1 
ATOM 8522   O O  . ASP C 2 590  ? 1074.852 711.521 748.835 1.00 0.00 ? 590  ASP C O  1 
ATOM 8523   C CB . ASP C 2 590  ? 1078.101 709.910 748.715 1.00 0.00 ? 590  ASP C CB 1 
ATOM 8524   N N  . GLY C 2 591  ? 1076.879 712.152 749.556 1.00 0.00 ? 591  GLY C N  1 
ATOM 8525   C CA . GLY C 2 591  ? 1076.639 713.552 749.806 1.00 0.00 ? 591  GLY C CA 1 
ATOM 8526   C C  . GLY C 2 591  ? 1075.218 713.848 750.172 1.00 0.00 ? 591  GLY C C  1 
ATOM 8527   O O  . GLY C 2 591  ? 1074.634 714.750 749.564 1.00 0.00 ? 591  GLY C O  1 
ATOM 8528   N N  . SER C 2 592  ? 1074.637 713.063 751.112 1.00 0.00 ? 592  SER C N  1 
ATOM 8529   C CA . SER C 2 592  ? 1073.305 713.199 751.657 1.00 0.00 ? 592  SER C CA 1 
ATOM 8530   C C  . SER C 2 592  ? 1072.357 713.793 750.651 1.00 0.00 ? 592  SER C C  1 
ATOM 8531   O O  . SER C 2 592  ? 1072.417 713.496 749.456 1.00 0.00 ? 592  SER C O  1 
ATOM 8532   C CB . SER C 2 592  ? 1073.261 714.020 752.960 1.00 0.00 ? 592  SER C CB 1 
ATOM 8533   N N  . ARG C 2 593  ? 1071.430 714.638 751.132 1.00 0.00 ? 593  ARG C N  1 
ATOM 8534   C CA . ARG C 2 593  ? 1070.478 715.294 750.286 1.00 0.00 ? 593  ARG C CA 1 
ATOM 8535   C C  . ARG C 2 593  ? 1071.099 716.527 749.728 1.00 0.00 ? 593  ARG C C  1 
ATOM 8536   O O  . ARG C 2 593  ? 1072.056 717.067 750.281 1.00 0.00 ? 593  ARG C O  1 
ATOM 8537   C CB . ARG C 2 593  ? 1069.232 715.825 751.013 1.00 0.00 ? 593  ARG C CB 1 
ATOM 8538   N N  . LYS C 2 594  ? 1070.582 716.971 748.567 1.00 0.00 ? 594  LYS C N  1 
ATOM 8539   C CA . LYS C 2 594  ? 1070.890 718.284 748.096 1.00 0.00 ? 594  LYS C CA 1 
ATOM 8540   C C  . LYS C 2 594  ? 1069.680 718.995 748.591 1.00 0.00 ? 594  LYS C C  1 
ATOM 8541   O O  . LYS C 2 594  ? 1068.553 718.622 748.268 1.00 0.00 ? 594  LYS C O  1 
ATOM 8542   C CB . LYS C 2 594  ? 1070.965 718.431 746.564 1.00 0.00 ? 594  LYS C CB 1 
ATOM 8543   N N  . PRO C 2 595  ? 1069.875 720.003 749.376 1.00 0.00 ? 595  PRO C N  1 
ATOM 8544   C CA . PRO C 2 595  ? 1068.754 720.544 750.084 1.00 0.00 ? 595  PRO C CA 1 
ATOM 8545   C C  . PRO C 2 595  ? 1067.669 721.125 749.250 1.00 0.00 ? 595  PRO C C  1 
ATOM 8546   O O  . PRO C 2 595  ? 1067.941 721.715 748.208 1.00 0.00 ? 595  PRO C O  1 
ATOM 8547   C CB . PRO C 2 595  ? 1069.348 721.504 751.111 1.00 0.00 ? 595  PRO C CB 1 
ATOM 8548   N N  . GLY C 2 596  ? 1066.419 720.928 749.708 1.00 0.00 ? 596  GLY C N  1 
ATOM 8549   C CA . GLY C 2 596  ? 1065.262 721.483 749.076 1.00 0.00 ? 596  GLY C CA 1 
ATOM 8550   C C  . GLY C 2 596  ? 1065.139 722.845 749.667 1.00 0.00 ? 596  GLY C C  1 
ATOM 8551   O O  . GLY C 2 596  ? 1065.884 723.198 750.579 1.00 0.00 ? 596  GLY C O  1 
ATOM 8552   N N  . VAL C 2 597  ? 1064.173 723.643 749.181 1.00 0.00 ? 597  VAL C N  1 
ATOM 8553   C CA . VAL C 2 597  ? 1064.029 724.987 749.653 1.00 0.00 ? 597  VAL C CA 1 
ATOM 8554   C C  . VAL C 2 597  ? 1063.695 724.991 751.115 1.00 0.00 ? 597  VAL C C  1 
ATOM 8555   O O  . VAL C 2 597  ? 1064.246 725.783 751.880 1.00 0.00 ? 597  VAL C O  1 
ATOM 8556   C CB . VAL C 2 597  ? 1062.971 725.743 748.905 1.00 0.00 ? 597  VAL C CB 1 
ATOM 8557   N N  . ILE C 2 598  ? 1062.797 724.085 751.554 1.00 0.00 ? 598  ILE C N  1 
ATOM 8558   C CA . ILE C 2 598  ? 1062.379 724.058 752.928 1.00 0.00 ? 598  ILE C CA 1 
ATOM 8559   C C  . ILE C 2 598  ? 1063.545 723.736 753.808 1.00 0.00 ? 598  ILE C C  1 
ATOM 8560   O O  . ILE C 2 598  ? 1063.699 724.334 754.870 1.00 0.00 ? 598  ILE C O  1 
ATOM 8561   C CB . ILE C 2 598  ? 1061.340 723.022 753.242 1.00 0.00 ? 598  ILE C CB 1 
ATOM 8562   N N  . ASP C 2 599  ? 1064.404 722.790 753.387 1.00 0.00 ? 599  ASP C N  1 
ATOM 8563   C CA . ASP C 2 599  ? 1065.498 722.342 754.202 1.00 0.00 ? 599  ASP C CA 1 
ATOM 8564   C C  . ASP C 2 599  ? 1066.362 723.509 754.498 1.00 0.00 ? 599  ASP C C  1 
ATOM 8565   O O  . ASP C 2 599  ? 1066.979 723.587 755.554 1.00 0.00 ? 599  ASP C O  1 
ATOM 8566   C CB . ASP C 2 599  ? 1066.395 721.289 753.511 1.00 0.00 ? 599  ASP C CB 1 
ATOM 8567   N N  . LYS C 2 600  ? 1066.459 724.445 753.551 1.00 0.00 ? 600  LYS C N  1 
ATOM 8568   C CA . LYS C 2 600  ? 1067.284 725.581 753.800 1.00 0.00 ? 600  LYS C CA 1 
ATOM 8569   C C  . LYS C 2 600  ? 1066.728 726.247 755.027 1.00 0.00 ? 600  LYS C C  1 
ATOM 8570   O O  . LYS C 2 600  ? 1067.468 726.719 755.886 1.00 0.00 ? 600  LYS C O  1 
ATOM 8571   C CB . LYS C 2 600  ? 1067.315 726.537 752.589 1.00 0.00 ? 600  LYS C CB 1 
ATOM 8572   N N  . PHE C 2 601  ? 1065.390 726.299 755.154 1.00 0.00 ? 601  PHE C N  1 
ATOM 8573   C CA . PHE C 2 601  ? 1064.752 726.843 756.323 1.00 0.00 ? 601  PHE C CA 1 
ATOM 8574   C C  . PHE C 2 601  ? 1064.959 725.875 757.496 1.00 0.00 ? 601  PHE C C  1 
ATOM 8575   O O  . PHE C 2 601  ? 1065.344 726.291 758.590 1.00 0.00 ? 601  PHE C O  1 
ATOM 8576   C CB . PHE C 2 601  ? 1063.311 727.209 755.981 1.00 0.00 ? 601  PHE C CB 1 
ATOM 8577   N N  . THR C 2 602  ? 1064.671 724.554 757.311 1.00 0.00 ? 602  THR C N  1 
ATOM 8578   C CA . THR C 2 602  ? 1065.142 723.450 758.162 1.00 0.00 ? 602  THR C CA 1 
ATOM 8579   C C  . THR C 2 602  ? 1064.143 722.905 759.163 1.00 0.00 ? 602  THR C C  1 
ATOM 8580   O O  . THR C 2 602  ? 1063.111 723.486 759.478 1.00 0.00 ? 602  THR C O  1 
ATOM 8581   C CB . THR C 2 602  ? 1066.373 723.657 759.024 1.00 0.00 ? 602  THR C CB 1 
ATOM 8582   N N  . SER C 2 603  ? 1064.535 721.719 759.691 1.00 0.00 ? 603  SER C N  1 
ATOM 8583   C CA . SER C 2 603  ? 1064.022 720.963 760.809 1.00 0.00 ? 603  SER C CA 1 
ATOM 8584   C C  . SER C 2 603  ? 1063.097 719.843 760.433 1.00 0.00 ? 603  SER C C  1 
ATOM 8585   O O  . SER C 2 603  ? 1063.484 718.964 759.663 1.00 0.00 ? 603  SER C O  1 
ATOM 8586   C CB . SER C 2 603  ? 1063.448 721.774 761.965 1.00 0.00 ? 603  SER C CB 1 
ATOM 8587   N N  . ASP C 2 604  ? 1061.871 719.816 761.028 1.00 0.00 ? 604  ASP C N  1 
ATOM 8588   C CA . ASP C 2 604  ? 1060.918 718.761 760.766 1.00 0.00 ? 604  ASP C CA 1 
ATOM 8589   C C  . ASP C 2 604  ? 1060.813 718.625 759.293 1.00 0.00 ? 604  ASP C C  1 
ATOM 8590   O O  . ASP C 2 604  ? 1060.333 719.499 758.579 1.00 0.00 ? 604  ASP C O  1 
ATOM 8591   C CB . ASP C 2 604  ? 1059.504 718.975 761.365 1.00 0.00 ? 604  ASP C CB 1 
ATOM 8592   N N  . THR C 2 605  ? 1061.352 717.504 758.810 1.00 0.00 ? 605  THR C N  1 
ATOM 8593   C CA . THR C 2 605  ? 1061.405 717.300 757.407 1.00 0.00 ? 605  THR C CA 1 
ATOM 8594   C C  . THR C 2 605  ? 1061.381 715.825 757.210 1.00 0.00 ? 605  THR C C  1 
ATOM 8595   O O  . THR C 2 605  ? 1060.916 715.313 756.193 1.00 0.00 ? 605  THR C O  1 
ATOM 8596   C CB . THR C 2 605  ? 1062.681 717.855 756.827 1.00 0.00 ? 605  THR C CB 1 
ATOM 8597   N N  . LYS C 2 606  ? 1061.969 715.098 758.172 1.00 0.00 ? 606  LYS C N  1 
ATOM 8598   C CA . LYS C 2 606  ? 1061.913 713.667 758.147 1.00 0.00 ? 606  LYS C CA 1 
ATOM 8599   C C  . LYS C 2 606  ? 1060.494 713.209 758.368 1.00 0.00 ? 606  LYS C C  1 
ATOM 8600   O O  . LYS C 2 606  ? 1060.015 712.379 757.597 1.00 0.00 ? 606  LYS C O  1 
ATOM 8601   C CB . LYS C 2 606  ? 1062.781 713.019 759.240 1.00 0.00 ? 606  LYS C CB 1 
ATOM 8602   N N  . PRO C 2 607  ? 1059.772 713.686 759.365 1.00 0.00 ? 607  PRO C N  1 
ATOM 8603   C CA . PRO C 2 607  ? 1058.431 713.237 759.615 1.00 0.00 ? 607  PRO C CA 1 
ATOM 8604   C C  . PRO C 2 607  ? 1057.517 713.571 758.490 1.00 0.00 ? 607  PRO C C  1 
ATOM 8605   O O  . PRO C 2 607  ? 1056.603 712.793 758.227 1.00 0.00 ? 607  PRO C O  1 
ATOM 8606   C CB . PRO C 2 607  ? 1058.001 713.867 760.941 1.00 0.00 ? 607  PRO C CB 1 
ATOM 8607   N N  . ILE C 2 608  ? 1057.724 714.723 757.826 1.00 0.00 ? 608  ILE C N  1 
ATOM 8608   C CA . ILE C 2 608  ? 1056.868 715.079 756.735 1.00 0.00 ? 608  ILE C CA 1 
ATOM 8609   C C  . ILE C 2 608  ? 1057.077 714.094 755.629 1.00 0.00 ? 608  ILE C C  1 
ATOM 8610   O O  . ILE C 2 608  ? 1056.127 713.696 754.957 1.00 0.00 ? 608  ILE C O  1 
ATOM 8611   C CB . ILE C 2 608  ? 1057.084 716.472 756.208 1.00 0.00 ? 608  ILE C CB 1 
ATOM 8612   N N  . ILE C 2 609  ? 1058.338 713.677 755.417 1.00 0.00 ? 609  ILE C N  1 
ATOM 8613   C CA . ILE C 2 609  ? 1058.644 712.762 754.358 1.00 0.00 ? 609  ILE C CA 1 
ATOM 8614   C C  . ILE C 2 609  ? 1057.947 711.459 754.558 1.00 0.00 ? 609  ILE C C  1 
ATOM 8615   O O  . ILE C 2 609  ? 1057.438 710.886 753.599 1.00 0.00 ? 609  ILE C O  1 
ATOM 8616   C CB . ILE C 2 609  ? 1060.098 712.421 754.198 1.00 0.00 ? 609  ILE C CB 1 
ATOM 8617   N N  . ASN C 2 610  ? 1057.925 710.933 755.795 1.00 0.00 ? 610  ASN C N  1 
ATOM 8618   C CA . ASN C 2 610  ? 1057.305 709.661 756.007 1.00 0.00 ? 610  ASN C CA 1 
ATOM 8619   C C  . ASN C 2 610  ? 1055.852 709.788 755.674 1.00 0.00 ? 610  ASN C C  1 
ATOM 8620   O O  . ASN C 2 610  ? 1055.268 708.904 755.049 1.00 0.00 ? 610  ASN C O  1 
ATOM 8621   C CB . ASN C 2 610  ? 1057.417 709.181 757.464 1.00 0.00 ? 610  ASN C CB 1 
ATOM 8622   N N  . LYS C 2 611  ? 1055.241 710.914 756.080 1.00 0.00 ? 611  LYS C N  1 
ATOM 8623   C CA . LYS C 2 611  ? 1053.841 711.143 755.881 1.00 0.00 ? 611  LYS C CA 1 
ATOM 8624   C C  . LYS C 2 611  ? 1053.542 711.154 754.413 1.00 0.00 ? 611  LYS C C  1 
ATOM 8625   O O  . LYS C 2 611  ? 1052.616 710.487 753.957 1.00 0.00 ? 611  LYS C O  1 
ATOM 8626   C CB . LYS C 2 611  ? 1053.406 712.497 756.471 1.00 0.00 ? 611  LYS C CB 1 
ATOM 8627   N N  . VAL C 2 612  ? 1054.342 711.899 753.630 1.00 0.00 ? 612  VAL C N  1 
ATOM 8628   C CA . VAL C 2 612  ? 1054.116 712.014 752.219 1.00 0.00 ? 612  VAL C CA 1 
ATOM 8629   C C  . VAL C 2 612  ? 1054.293 710.677 751.569 1.00 0.00 ? 612  VAL C C  1 
ATOM 8630   O O  . VAL C 2 612  ? 1053.494 710.270 750.727 1.00 0.00 ? 612  VAL C O  1 
ATOM 8631   C CB . VAL C 2 612  ? 1055.087 712.935 751.554 1.00 0.00 ? 612  VAL C CB 1 
ATOM 8632   N N  . ALA C 2 613  ? 1055.356 709.951 751.959 1.00 0.00 ? 613  ALA C N  1 
ATOM 8633   C CA . ALA C 2 613  ? 1055.714 708.705 751.345 1.00 0.00 ? 613  ALA C CA 1 
ATOM 8634   C C  . ALA C 2 613  ? 1054.644 707.685 751.551 1.00 0.00 ? 613  ALA C C  1 
ATOM 8635   O O  . ALA C 2 613  ? 1054.338 706.913 750.643 1.00 0.00 ? 613  ALA C O  1 
ATOM 8636   C CB . ALA C 2 613  ? 1057.022 708.130 751.910 1.00 0.00 ? 613  ALA C CB 1 
ATOM 8637   N N  . SER C 2 614  ? 1054.050 707.645 752.758 1.00 0.00 ? 614  SER C N  1 
ATOM 8638   C CA . SER C 2 614  ? 1053.047 706.657 753.026 1.00 0.00 ? 614  SER C CA 1 
ATOM 8639   C C  . SER C 2 614  ? 1051.889 706.929 752.124 1.00 0.00 ? 614  SER C C  1 
ATOM 8640   O O  . SER C 2 614  ? 1051.301 706.007 751.565 1.00 0.00 ? 614  SER C O  1 
ATOM 8641   C CB . SER C 2 614  ? 1052.547 706.707 754.483 1.00 0.00 ? 614  SER C CB 1 
ATOM 8642   N N  . VAL C 2 615  ? 1051.562 708.226 751.943 1.00 0.00 ? 615  VAL C N  1 
ATOM 8643   C CA . VAL C 2 615  ? 1050.458 708.658 751.136 1.00 0.00 ? 615  VAL C CA 1 
ATOM 8644   C C  . VAL C 2 615  ? 1050.708 708.228 749.730 1.00 0.00 ? 615  VAL C C  1 
ATOM 8645   O O  . VAL C 2 615  ? 1049.792 707.795 749.033 1.00 0.00 ? 615  VAL C O  1 
ATOM 8646   C CB . VAL C 2 615  ? 1050.304 710.147 751.134 1.00 0.00 ? 615  VAL C CB 1 
ATOM 8647   N N  . ALA C 2 616  ? 1051.973 708.329 749.287 1.00 0.00 ? 616  ALA C N  1 
ATOM 8648   C CA . ALA C 2 616  ? 1052.328 707.957 747.951 1.00 0.00 ? 616  ALA C CA 1 
ATOM 8649   C C  . ALA C 2 616  ? 1051.960 706.519 747.805 1.00 0.00 ? 616  ALA C C  1 
ATOM 8650   O O  . ALA C 2 616  ? 1051.489 706.094 746.753 1.00 0.00 ? 616  ALA C O  1 
ATOM 8651   C CB . ALA C 2 616  ? 1053.837 708.080 747.675 1.00 0.00 ? 616  ALA C CB 1 
ATOM 8652   N N  . GLU C 2 617  ? 1052.168 705.734 748.876 1.00 0.00 ? 617  GLU C N  1 
ATOM 8653   C CA . GLU C 2 617  ? 1051.883 704.330 748.859 1.00 0.00 ? 617  GLU C CA 1 
ATOM 8654   C C  . GLU C 2 617  ? 1050.409 704.109 748.666 1.00 0.00 ? 617  GLU C C  1 
ATOM 8655   O O  . GLU C 2 617  ? 1050.011 703.177 747.969 1.00 0.00 ? 617  GLU C O  1 
ATOM 8656   C CB . GLU C 2 617  ? 1052.338 703.632 750.153 1.00 0.00 ? 617  GLU C CB 1 
ATOM 8657   N N  . ASN C 2 618  ? 1049.547 704.949 749.275 1.00 0.00 ? 618  ASN C N  1 
ATOM 8658   C CA . ASN C 2 618  ? 1048.131 704.738 749.124 1.00 0.00 ? 618  ASN C CA 1 
ATOM 8659   C C  . ASN C 2 618  ? 1047.798 704.861 747.677 1.00 0.00 ? 618  ASN C C  1 
ATOM 8660   O O  . ASN C 2 618  ? 1047.218 703.958 747.075 1.00 0.00 ? 618  ASN C O  1 
ATOM 8661   C CB . ASN C 2 618  ? 1047.268 705.840 749.769 1.00 0.00 ? 618  ASN C CB 1 
ATOM 8662   N N  . LYS C 2 619  ? 1048.206 705.999 747.085 1.00 0.00 ? 619  LYS C N  1 
ATOM 8663   C CA . LYS C 2 619  ? 1047.897 706.327 745.729 1.00 0.00 ? 619  LYS C CA 1 
ATOM 8664   C C  . LYS C 2 619  ? 1048.571 705.349 744.831 1.00 0.00 ? 619  LYS C C  1 
ATOM 8665   O O  . LYS C 2 619  ? 1048.065 705.033 743.756 1.00 0.00 ? 619  LYS C O  1 
ATOM 8666   C CB . LYS C 2 619  ? 1048.306 707.759 745.351 1.00 0.00 ? 619  LYS C CB 1 
ATOM 8667   N N  . GLY C 2 620  ? 1049.734 704.831 745.252 1.00 0.00 ? 620  GLY C N  1 
ATOM 8668   C CA . GLY C 2 620  ? 1050.414 703.910 744.399 1.00 0.00 ? 620  GLY C CA 1 
ATOM 8669   C C  . GLY C 2 620  ? 1051.284 704.723 743.508 1.00 0.00 ? 620  GLY C C  1 
ATOM 8670   O O  . GLY C 2 620  ? 1051.643 704.294 742.413 1.00 0.00 ? 620  GLY C O  1 
ATOM 8671   N N  . LEU C 2 621  ? 1051.631 705.943 743.958 1.00 0.00 ? 621  LEU C N  1 
ATOM 8672   C CA . LEU C 2 621  ? 1052.489 706.745 743.147 1.00 0.00 ? 621  LEU C CA 1 
ATOM 8673   C C  . LEU C 2 621  ? 1053.879 706.273 743.413 1.00 0.00 ? 621  LEU C C  1 
ATOM 8674   O O  . LEU C 2 621  ? 1054.623 706.867 744.193 1.00 0.00 ? 621  LEU C O  1 
ATOM 8675   C CB . LEU C 2 621  ? 1052.427 708.242 743.487 1.00 0.00 ? 621  LEU C CB 1 
ATOM 8676   N N  . PHE C 2 622  ? 1054.260 705.172 742.742 1.00 0.00 ? 622  PHE C N  1 
ATOM 8677   C CA . PHE C 2 622  ? 1055.575 704.628 742.884 1.00 0.00 ? 622  PHE C CA 1 
ATOM 8678   C C  . PHE C 2 622  ? 1056.421 705.555 742.080 1.00 0.00 ? 622  PHE C C  1 
ATOM 8679   O O  . PHE C 2 622  ? 1055.935 706.090 741.085 1.00 0.00 ? 622  PHE C O  1 
ATOM 8680   C CB . PHE C 2 622  ? 1055.700 703.227 742.256 1.00 0.00 ? 622  PHE C CB 1 
ATOM 8681   N N  . GLU C 2 623  ? 1057.682 705.768 742.522 1.00 0.00 ? 623  GLU C N  1 
ATOM 8682   C CA . GLU C 2 623  ? 1058.649 706.682 741.969 1.00 0.00 ? 623  GLU C CA 1 
ATOM 8683   C C  . GLU C 2 623  ? 1058.702 707.763 742.998 1.00 0.00 ? 623  GLU C C  1 
ATOM 8684   O O  . GLU C 2 623  ? 1059.768 708.102 743.512 1.00 0.00 ? 623  GLU C O  1 
ATOM 8685   C CB . GLU C 2 623  ? 1058.307 707.309 740.605 1.00 0.00 ? 623  GLU C CB 1 
ATOM 8686   N N  . GLU C 2 624  ? 1057.523 708.330 743.325 1.00 0.00 ? 624  GLU C N  1 
ATOM 8687   C CA . GLU C 2 624  ? 1057.447 709.317 744.360 1.00 0.00 ? 624  GLU C CA 1 
ATOM 8688   C C  . GLU C 2 624  ? 1057.813 708.642 745.642 1.00 0.00 ? 624  GLU C C  1 
ATOM 8689   O O  . GLU C 2 624  ? 1058.563 709.187 746.451 1.00 0.00 ? 624  GLU C O  1 
ATOM 8690   C CB . GLU C 2 624  ? 1056.042 709.921 744.541 1.00 0.00 ? 624  GLU C CB 1 
ATOM 8691   N N  . ALA C 2 625  ? 1057.295 707.417 745.853 1.00 0.00 ? 625  ALA C N  1 
ATOM 8692   C CA . ALA C 2 625  ? 1057.578 706.715 747.070 1.00 0.00 ? 625  ALA C CA 1 
ATOM 8693   C C  . ALA C 2 625  ? 1059.045 706.438 747.140 1.00 0.00 ? 625  ALA C C  1 
ATOM 8694   O O  . ALA C 2 625  ? 1059.681 706.675 748.164 1.00 0.00 ? 625  ALA C O  1 
ATOM 8695   C CB . ALA C 2 625  ? 1056.850 705.363 747.162 1.00 0.00 ? 625  ALA C CB 1 
ATOM 8696   N N  . ALA C 2 626  ? 1059.633 705.965 746.027 1.00 0.00 ? 626  ALA C N  1 
ATOM 8697   C CA . ALA C 2 626  ? 1061.023 705.617 746.025 1.00 0.00 ? 626  ALA C CA 1 
ATOM 8698   C C  . ALA C 2 626  ? 1061.815 706.848 746.323 1.00 0.00 ? 626  ALA C C  1 
ATOM 8699   O O  . ALA C 2 626  ? 1062.767 706.816 747.099 1.00 0.00 ? 626  ALA C O  1 
ATOM 8700   C CB . ALA C 2 626  ? 1061.501 705.077 744.667 1.00 0.00 ? 626  ALA C CB 1 
ATOM 8701   N N  . LYS C 2 627  ? 1061.420 707.976 745.712 1.00 0.00 ? 627  LYS C N  1 
ATOM 8702   C CA . LYS C 2 627  ? 1062.111 709.222 745.872 1.00 0.00 ? 627  LYS C CA 1 
ATOM 8703   C C  . LYS C 2 627  ? 1062.050 709.617 747.313 1.00 0.00 ? 627  LYS C C  1 
ATOM 8704   O O  . LYS C 2 627  ? 1063.050 710.017 747.908 1.00 0.00 ? 627  LYS C O  1 
ATOM 8705   C CB . LYS C 2 627  ? 1061.419 710.322 745.053 1.00 0.00 ? 627  LYS C CB 1 
ATOM 8706   N N  . LEU C 2 628  ? 1060.852 709.491 747.915 1.00 0.00 ? 628  LEU C N  1 
ATOM 8707   C CA . LEU C 2 628  ? 1060.635 709.917 749.269 1.00 0.00 ? 628  LEU C CA 1 
ATOM 8708   C C  . LEU C 2 628  ? 1061.437 709.088 750.223 1.00 0.00 ? 628  LEU C C  1 
ATOM 8709   O O  . LEU C 2 628  ? 1062.029 709.619 751.160 1.00 0.00 ? 628  LEU C O  1 
ATOM 8710   C CB . LEU C 2 628  ? 1059.149 709.867 749.669 1.00 0.00 ? 628  LEU C CB 1 
ATOM 8711   N N  . TYR C 2 629  ? 1061.486 707.763 750.005 1.00 0.00 ? 629  TYR C N  1 
ATOM 8712   C CA . TYR C 2 629  ? 1062.201 706.884 750.885 1.00 0.00 ? 629  TYR C CA 1 
ATOM 8713   C C  . TYR C 2 629  ? 1063.675 707.131 750.810 1.00 0.00 ? 629  TYR C C  1 
ATOM 8714   O O  . TYR C 2 629  ? 1064.384 706.893 751.787 1.00 0.00 ? 629  TYR C O  1 
ATOM 8715   C CB . TYR C 2 629  ? 1061.870 705.392 750.711 1.00 0.00 ? 629  TYR C CB 1 
ATOM 8716   N N  . ASP C 2 630  ? 1064.192 707.555 749.638 1.00 0.00 ? 630  ASP C N  1 
ATOM 8717   C CA . ASP C 2 630  ? 1065.597 707.844 749.543 1.00 0.00 ? 630  ASP C CA 1 
ATOM 8718   C C  . ASP C 2 630  ? 1065.913 708.950 750.506 1.00 0.00 ? 630  ASP C C  1 
ATOM 8719   O O  . ASP C 2 630  ? 1066.900 708.882 751.236 1.00 0.00 ? 630  ASP C O  1 
ATOM 8720   C CB . ASP C 2 630  ? 1066.030 708.332 748.151 1.00 0.00 ? 630  ASP C CB 1 
ATOM 8721   N N  . LEU C 2 631  ? 1065.068 710.000 750.539 1.00 0.00 ? 631  LEU C N  1 
ATOM 8722   C CA . LEU C 2 631  ? 1065.282 711.122 751.412 1.00 0.00 ? 631  LEU C CA 1 
ATOM 8723   C C  . LEU C 2 631  ? 1065.160 710.648 752.828 1.00 0.00 ? 631  LEU C C  1 
ATOM 8724   O O  . LEU C 2 631  ? 1065.915 711.068 753.702 1.00 0.00 ? 631  LEU C O  1 
ATOM 8725   C CB . LEU C 2 631  ? 1064.265 712.250 751.187 1.00 0.00 ? 631  LEU C CB 1 
ATOM 8726   N N  . ALA C 2 632  ? 1064.202 709.736 753.072 1.00 0.00 ? 632  ALA C N  1 
ATOM 8727   C CA . ALA C 2 632  ? 1063.946 709.160 754.362 1.00 0.00 ? 632  ALA C CA 1 
ATOM 8728   C C  . ALA C 2 632  ? 1065.186 708.434 754.768 1.00 0.00 ? 632  ALA C C  1 
ATOM 8729   O O  . ALA C 2 632  ? 1065.487 708.300 755.952 1.00 0.00 ? 632  ALA C O  1 
ATOM 8730   C CB . ALA C 2 632  ? 1062.789 708.147 754.347 1.00 0.00 ? 632  ALA C CB 1 
ATOM 8731   N N  . LYS C 2 633  ? 1065.946 707.952 753.769 1.00 0.00 ? 633  LYS C N  1 
ATOM 8732   C CA . LYS C 2 633  ? 1067.136 707.197 754.010 1.00 0.00 ? 633  LYS C CA 1 
ATOM 8733   C C  . LYS C 2 633  ? 1066.773 705.838 754.505 1.00 0.00 ? 633  LYS C C  1 
ATOM 8734   O O  . LYS C 2 633  ? 1067.493 705.238 755.302 1.00 0.00 ? 633  LYS C O  1 
ATOM 8735   C CB . LYS C 2 633  ? 1068.095 707.867 755.009 1.00 0.00 ? 633  LYS C CB 1 
ATOM 8736   N N  . ASN C 2 634  ? 1065.623 705.318 754.034 1.00 0.00 ? 634  ASN C N  1 
ATOM 8737   C CA . ASN C 2 634  ? 1065.280 703.958 754.327 1.00 0.00 ? 634  ASN C CA 1 
ATOM 8738   C C  . ASN C 2 634  ? 1065.772 703.198 753.132 1.00 0.00 ? 634  ASN C C  1 
ATOM 8739   O O  . ASN C 2 634  ? 1065.010 702.883 752.219 1.00 0.00 ? 634  ASN C O  1 
ATOM 8740   C CB . ASN C 2 634  ? 1063.762 703.729 754.418 1.00 0.00 ? 634  ASN C CB 1 
ATOM 8741   N N  . ALA C 2 635  ? 1067.074 702.858 753.128 1.00 0.00 ? 635  ALA C N  1 
ATOM 8742   C CA . ALA C 2 635  ? 1067.700 702.262 751.982 1.00 0.00 ? 635  ALA C CA 1 
ATOM 8743   C C  . ALA C 2 635  ? 1067.087 700.939 751.665 1.00 0.00 ? 635  ALA C C  1 
ATOM 8744   O O  . ALA C 2 635  ? 1066.832 700.633 750.501 1.00 0.00 ? 635  ALA C O  1 
ATOM 8745   C CB . ALA C 2 635  ? 1069.207 702.034 752.187 1.00 0.00 ? 635  ALA C CB 1 
ATOM 8746   N N  . ASP C 2 636  ? 1066.822 700.113 752.693 1.00 0.00 ? 636  ASP C N  1 
ATOM 8747   C CA . ASP C 2 636  ? 1066.298 698.806 752.427 1.00 0.00 ? 636  ASP C CA 1 
ATOM 8748   C C  . ASP C 2 636  ? 1064.958 698.942 751.774 1.00 0.00 ? 636  ASP C C  1 
ATOM 8749   O O  . ASP C 2 636  ? 1064.646 698.227 750.824 1.00 0.00 ? 636  ASP C O  1 
ATOM 8750   C CB . ASP C 2 636  ? 1066.098 697.971 753.702 1.00 0.00 ? 636  ASP C CB 1 
ATOM 8751   N N  . LYS C 2 637  ? 1064.131 699.884 752.266 1.00 0.00 ? 637  LYS C N  1 
ATOM 8752   C CA . LYS C 2 637  ? 1062.805 700.042 751.746 1.00 0.00 ? 637  LYS C CA 1 
ATOM 8753   C C  . LYS C 2 637  ? 1062.884 700.438 750.310 1.00 0.00 ? 637  LYS C C  1 
ATOM 8754   O O  . LYS C 2 637  ? 1062.119 699.950 749.479 1.00 0.00 ? 637  LYS C O  1 
ATOM 8755   C CB . LYS C 2 637  ? 1062.004 701.127 752.484 1.00 0.00 ? 637  LYS C CB 1 
ATOM 8756   N N  . VAL C 2 638  ? 1063.834 701.331 749.975 1.00 0.00 ? 638  VAL C N  1 
ATOM 8757   C CA . VAL C 2 638  ? 1063.932 701.811 748.631 1.00 0.00 ? 638  VAL C CA 1 
ATOM 8758   C C  . VAL C 2 638  ? 1064.178 700.666 747.703 1.00 0.00 ? 638  VAL C C  1 
ATOM 8759   O O  . VAL C 2 638  ? 1063.478 700.519 746.701 1.00 0.00 ? 638  VAL C O  1 
ATOM 8760   C CB . VAL C 2 638  ? 1065.068 702.777 748.446 1.00 0.00 ? 638  VAL C CB 1 
ATOM 8761   N N  . LEU C 2 639  ? 1065.154 699.797 748.027 1.00 0.00 ? 639  LEU C N  1 
ATOM 8762   C CA . LEU C 2 639  ? 1065.479 698.776 747.075 1.00 0.00 ? 639  LEU C CA 1 
ATOM 8763   C C  . LEU C 2 639  ? 1064.294 697.875 746.909 1.00 0.00 ? 639  LEU C C  1 
ATOM 8764   O O  . LEU C 2 639  ? 1063.982 697.463 745.794 1.00 0.00 ? 639  LEU C O  1 
ATOM 8765   C CB . LEU C 2 639  ? 1066.656 697.860 747.450 1.00 0.00 ? 639  LEU C CB 1 
ATOM 8766   N N  . GLU C 2 640  ? 1063.589 697.549 748.012 1.00 0.00 ? 640  GLU C N  1 
ATOM 8767   C CA . GLU C 2 640  ? 1062.511 696.605 747.909 1.00 0.00 ? 640  GLU C CA 1 
ATOM 8768   C C  . GLU C 2 640  ? 1061.419 697.134 747.028 1.00 0.00 ? 640  GLU C C  1 
ATOM 8769   O O  . GLU C 2 640  ? 1060.870 696.386 746.221 1.00 0.00 ? 640  GLU C O  1 
ATOM 8770   C CB . GLU C 2 640  ? 1061.868 696.207 749.249 1.00 0.00 ? 640  GLU C CB 1 
ATOM 8771   N N  . LEU C 2 641  ? 1061.067 698.431 747.148 1.00 0.00 ? 641  LEU C N  1 
ATOM 8772   C CA . LEU C 2 641  ? 1060.009 698.961 746.328 1.00 0.00 ? 641  LEU C CA 1 
ATOM 8773   C C  . LEU C 2 641  ? 1060.452 698.873 744.909 1.00 0.00 ? 641  LEU C C  1 
ATOM 8774   O O  . LEU C 2 641  ? 1059.693 698.519 744.009 1.00 0.00 ? 641  LEU C O  1 
ATOM 8775   C CB . LEU C 2 641  ? 1059.699 700.444 746.584 1.00 0.00 ? 641  LEU C CB 1 
ATOM 8776   N N  . MET C 2 642  ? 1061.739 699.191 744.723 1.00 0.00 ? 642  MET C N  1 
ATOM 8777   C CA . MET C 2 642  ? 1062.482 699.255 743.504 1.00 0.00 ? 642  MET C CA 1 
ATOM 8778   C C  . MET C 2 642  ? 1062.490 697.919 742.829 1.00 0.00 ? 642  MET C C  1 
ATOM 8779   O O  . MET C 2 642  ? 1062.309 697.838 741.617 1.00 0.00 ? 642  MET C O  1 
ATOM 8780   C CB . MET C 2 642  ? 1063.895 699.587 743.894 1.00 0.00 ? 642  MET C CB 1 
ATOM 8781   N N  . ASN C 2 643  ? 1062.700 696.831 743.589 1.00 0.00 ? 643  ASN C N  1 
ATOM 8782   C CA . ASN C 2 643  ? 1062.759 695.533 742.983 1.00 0.00 ? 643  ASN C CA 1 
ATOM 8783   C C  . ASN C 2 643  ? 1061.415 695.240 742.394 1.00 0.00 ? 643  ASN C C  1 
ATOM 8784   O O  . ASN C 2 643  ? 1061.311 694.667 741.312 1.00 0.00 ? 643  ASN C O  1 
ATOM 8785   C CB . ASN C 2 643  ? 1063.109 694.426 743.992 1.00 0.00 ? 643  ASN C CB 1 
ATOM 8786   N N  . LYS C 2 644  ? 1060.345 695.635 743.105 1.00 0.00 ? 644  LYS C N  1 
ATOM 8787   C CA . LYS C 2 644  ? 1059.004 695.398 742.656 1.00 0.00 ? 644  LYS C CA 1 
ATOM 8788   C C  . LYS C 2 644  ? 1058.786 696.115 741.365 1.00 0.00 ? 644  LYS C C  1 
ATOM 8789   O O  . LYS C 2 644  ? 1058.280 695.541 740.406 1.00 0.00 ? 644  LYS C O  1 
ATOM 8790   C CB . LYS C 2 644  ? 1057.958 695.943 743.642 1.00 0.00 ? 644  LYS C CB 1 
ATOM 8791   N N  . LEU C 2 645  ? 1059.190 697.394 741.283 1.00 0.00 ? 645  LEU C N  1 
ATOM 8792   C CA . LEU C 2 645  ? 1058.936 698.168 740.101 1.00 0.00 ? 645  LEU C CA 1 
ATOM 8793   C C  . LEU C 2 645  ? 1059.630 697.560 738.932 1.00 0.00 ? 645  LEU C C  1 
ATOM 8794   O O  . LEU C 2 645  ? 1059.034 697.420 737.868 1.00 0.00 ? 645  LEU C O  1 
ATOM 8795   C CB . LEU C 2 645  ? 1059.446 699.612 740.232 1.00 0.00 ? 645  LEU C CB 1 
ATOM 8796   N N  . LEU C 2 646  ? 1060.915 697.200 739.091 1.00 0.00 ? 646  LEU C N  1 
ATOM 8797   C CA . LEU C 2 646  ? 1061.661 696.665 737.991 1.00 0.00 ? 646  LEU C CA 1 
ATOM 8798   C C  . LEU C 2 646  ? 1061.125 695.289 737.696 1.00 0.00 ? 646  LEU C C  1 
ATOM 8799   O O  . LEU C 2 646  ? 1061.006 694.898 736.537 1.00 0.00 ? 646  LEU C O  1 
ATOM 8800   C CB . LEU C 2 646  ? 1063.165 696.540 738.314 1.00 0.00 ? 646  LEU C CB 1 
ATOM 8801   N N  . SER C 2 647  ? 1060.779 694.508 738.748 1.00 0.00 ? 647  SER C N  1 
ATOM 8802   C CA . SER C 2 647  ? 1060.335 693.157 738.530 1.00 0.00 ? 647  SER C CA 1 
ATOM 8803   C C  . SER C 2 647  ? 1059.165 693.202 737.616 1.00 0.00 ? 647  SER C C  1 
ATOM 8804   O O  . SER C 2 647  ? 1059.356 692.756 736.492 1.00 0.00 ? 647  SER C O  1 
ATOM 8805   C CB . SER C 2 647  ? 1060.038 692.407 739.848 1.00 0.00 ? 647  SER C CB 1 
ATOM 8806   N N  . PRO C 2 648  ? 1058.004 693.742 737.931 1.00 0.00 ? 648  PRO C N  1 
ATOM 8807   C CA . PRO C 2 648  ? 1057.057 693.852 736.869 1.00 0.00 ? 648  PRO C CA 1 
ATOM 8808   C C  . PRO C 2 648  ? 1057.649 694.813 735.904 1.00 0.00 ? 648  PRO C C  1 
ATOM 8809   O O  . PRO C 2 648  ? 1058.582 695.521 736.266 1.00 0.00 ? 648  PRO C O  1 
ATOM 8810   C CB . PRO C 2 648  ? 1055.744 694.305 737.500 1.00 0.00 ? 648  PRO C CB 1 
ATOM 8811   N N  . VAL C 2 649  ? 1057.114 694.844 734.681 1.00 0.00 ? 649  VAL C N  1 
ATOM 8812   C CA . VAL C 2 649  ? 1057.632 695.582 733.574 1.00 0.00 ? 649  VAL C CA 1 
ATOM 8813   C C  . VAL C 2 649  ? 1058.706 694.729 732.994 1.00 0.00 ? 649  VAL C C  1 
ATOM 8814   O O  . VAL C 2 649  ? 1058.969 694.794 731.796 1.00 0.00 ? 649  VAL C O  1 
ATOM 8815   C CB . VAL C 2 649  ? 1058.239 696.912 733.939 1.00 0.00 ? 649  VAL C CB 1 
ATOM 8816   N N  . VAL C 2 650  ? 1059.368 693.888 733.812 1.00 0.00 ? 650  VAL C N  1 
ATOM 8817   C CA . VAL C 2 650  ? 1060.200 692.908 733.179 1.00 0.00 ? 650  VAL C CA 1 
ATOM 8818   C C  . VAL C 2 650  ? 1059.291 691.895 732.533 1.00 0.00 ? 650  VAL C C  1 
ATOM 8819   O O  . VAL C 2 650  ? 1059.363 691.742 731.314 1.00 0.00 ? 650  VAL C O  1 
ATOM 8820   C CB . VAL C 2 650  ? 1061.130 692.187 734.103 1.00 0.00 ? 650  VAL C CB 1 
ATOM 8821   N N  . PRO C 2 651  ? 1058.409 691.197 733.256 1.00 0.00 ? 651  PRO C N  1 
ATOM 8822   C CA . PRO C 2 651  ? 1057.556 690.250 732.615 1.00 0.00 ? 651  PRO C CA 1 
ATOM 8823   C C  . PRO C 2 651  ? 1056.624 691.076 731.781 1.00 0.00 ? 651  PRO C C  1 
ATOM 8824   O O  . PRO C 2 651  ? 1056.244 692.147 732.251 1.00 0.00 ? 651  PRO C O  1 
ATOM 8825   C CB . PRO C 2 651  ? 1056.757 689.582 733.723 1.00 0.00 ? 651  PRO C CB 1 
ATOM 8826   N N  . GLN C 2 652  ? 1056.236 690.616 730.571 1.00 0.00 ? 652  GLN C N  1 
ATOM 8827   C CA . GLN C 2 652  ? 1055.346 691.368 729.728 1.00 0.00 ? 652  GLN C CA 1 
ATOM 8828   C C  . GLN C 2 652  ? 1055.558 690.882 728.329 1.00 0.00 ? 652  GLN C C  1 
ATOM 8829   O O  . GLN C 2 652  ? 1055.691 689.685 728.081 1.00 0.00 ? 652  GLN C O  1 
ATOM 8830   C CB . GLN C 2 652  ? 1055.601 692.890 729.713 1.00 0.00 ? 652  GLN C CB 1 
ATOM 8831   N N  . ILE C 2 653  ? 1055.548 691.832 727.372 1.00 0.00 ? 653  ILE C N  1 
ATOM 8832   C CA . ILE C 2 653  ? 1055.769 691.576 725.981 1.00 0.00 ? 653  ILE C CA 1 
ATOM 8833   C C  . ILE C 2 653  ? 1056.830 692.544 725.534 1.00 0.00 ? 653  ILE C C  1 
ATOM 8834   O O  . ILE C 2 653  ? 1057.021 693.586 726.156 1.00 0.00 ? 653  ILE C O  1 
ATOM 8835   C CB . ILE C 2 653  ? 1054.522 691.745 725.167 1.00 0.00 ? 653  ILE C CB 1 
ATOM 8836   N N  . SER C 2 654  ? 1057.575 692.203 724.457 1.00 0.00 ? 654  SER C N  1 
ATOM 8837   C CA . SER C 2 654  ? 1058.735 692.964 724.072 1.00 0.00 ? 654  SER C CA 1 
ATOM 8838   C C  . SER C 2 654  ? 1058.451 694.062 723.083 1.00 0.00 ? 654  SER C C  1 
ATOM 8839   O O  . SER C 2 654  ? 1057.414 694.116 722.423 1.00 0.00 ? 654  SER C O  1 
ATOM 8840   C CB . SER C 2 654  ? 1059.846 692.075 723.477 1.00 0.00 ? 654  SER C CB 1 
ATOM 8841   N N  . ALA C 2 655  ? 1059.441 694.977 723.016 1.00 0.00 ? 655  ALA C N  1 
ATOM 8842   C CA . ALA C 2 655  ? 1059.692 696.136 722.191 1.00 0.00 ? 655  ALA C CA 1 
ATOM 8843   C C  . ALA C 2 655  ? 1059.843 697.344 723.088 1.00 0.00 ? 655  ALA C C  1 
ATOM 8844   O O  . ALA C 2 655  ? 1058.971 698.212 723.089 1.00 0.00 ? 655  ALA C O  1 
ATOM 8845   C CB . ALA C 2 655  ? 1058.558 696.440 721.200 1.00 0.00 ? 655  ALA C CB 1 
ATOM 8846   N N  . PRO C 2 656  ? 1060.911 697.463 723.854 1.00 0.00 ? 656  PRO C N  1 
ATOM 8847   C CA . PRO C 2 656  ? 1060.937 698.618 724.698 1.00 0.00 ? 656  PRO C CA 1 
ATOM 8848   C C  . PRO C 2 656  ? 1062.349 699.027 724.896 1.00 0.00 ? 656  PRO C C  1 
ATOM 8849   O O  . PRO C 2 656  ? 1063.212 698.855 724.034 1.00 0.00 ? 656  PRO C O  1 
ATOM 8850   C CB . PRO C 2 656  ? 1060.367 698.122 726.007 1.00 0.00 ? 656  PRO C CB 1 
ATOM 8851   N N  . GLN C 2 657  ? 1062.534 699.521 726.132 1.00 0.00 ? 657  GLN C N  1 
ATOM 8852   C CA . GLN C 2 657  ? 1063.768 699.732 726.817 1.00 0.00 ? 657  GLN C CA 1 
ATOM 8853   C C  . GLN C 2 657  ? 1064.787 700.504 726.056 1.00 0.00 ? 657  GLN C C  1 
ATOM 8854   O O  . GLN C 2 657  ? 1065.812 699.950 725.709 1.00 0.00 ? 657  GLN C O  1 
ATOM 8855   C CB . GLN C 2 657  ? 1064.436 698.380 727.140 1.00 0.00 ? 657  GLN C CB 1 
ATOM 8856   N N  . SER C 2 658  ? 1064.558 701.799 725.774 1.00 0.00 ? 658  SER C N  1 
ATOM 8857   C CA . SER C 2 658  ? 1065.611 702.577 725.175 1.00 0.00 ? 658  SER C CA 1 
ATOM 8858   C C  . SER C 2 658  ? 1066.744 702.554 726.159 1.00 0.00 ? 658  SER C C  1 
ATOM 8859   O O  . SER C 2 658  ? 1066.548 702.250 727.330 1.00 0.00 ? 658  SER C O  1 
ATOM 8860   C CB . SER C 2 658  ? 1065.229 704.050 724.974 1.00 0.00 ? 658  SER C CB 1 
ATOM 8861   N N  . ASN C 2 659  ? 1067.981 702.860 725.724 1.00 0.00 ? 659  ASN C N  1 
ATOM 8862   C CA . ASN C 2 659  ? 1069.042 702.756 726.690 1.00 0.00 ? 659  ASN C CA 1 
ATOM 8863   C C  . ASN C 2 659  ? 1069.144 703.974 727.539 1.00 0.00 ? 659  ASN C C  1 
ATOM 8864   O O  . ASN C 2 659  ? 1070.183 704.148 728.170 1.00 0.00 ? 659  ASN C O  1 
ATOM 8865   C CB . ASN C 2 659  ? 1070.449 702.644 726.071 1.00 0.00 ? 659  ASN C CB 1 
ATOM 8866   N N  . LYS C 2 660  ? 1068.102 704.827 727.660 1.00 0.00 ? 660  LYS C N  1 
ATOM 8867   C CA . LYS C 2 660  ? 1068.408 705.986 728.464 1.00 0.00 ? 660  LYS C CA 1 
ATOM 8868   C C  . LYS C 2 660  ? 1067.196 706.596 729.166 1.00 0.00 ? 660  LYS C C  1 
ATOM 8869   O O  . LYS C 2 660  ? 1066.727 707.638 728.705 1.00 0.00 ? 660  LYS C O  1 
ATOM 8870   C CB . LYS C 2 660  ? 1069.118 707.068 727.605 1.00 0.00 ? 660  LYS C CB 1 
ATOM 8871   N N  . GLU C 2 661  ? 1066.678 705.982 730.273 1.00 0.00 ? 661  GLU C N  1 
ATOM 8872   C CA . GLU C 2 661  ? 1065.734 706.548 731.238 1.00 0.00 ? 661  GLU C CA 1 
ATOM 8873   C C  . GLU C 2 661  ? 1064.514 705.723 731.485 1.00 0.00 ? 661  GLU C C  1 
ATOM 8874   O O  . GLU C 2 661  ? 1063.780 705.358 730.576 1.00 0.00 ? 661  GLU C O  1 
ATOM 8875   C CB . GLU C 2 661  ? 1065.172 707.937 730.918 1.00 0.00 ? 661  GLU C CB 1 
ATOM 8876   N N  . ARG C 2 662  ? 1064.270 705.441 732.784 1.00 0.00 ? 662  ARG C N  1 
ATOM 8877   C CA . ARG C 2 662  ? 1063.075 704.810 733.297 1.00 0.00 ? 662  ARG C CA 1 
ATOM 8878   C C  . ARG C 2 662  ? 1063.423 703.975 734.498 1.00 0.00 ? 662  ARG C C  1 
ATOM 8879   O O  . ARG C 2 662  ? 1064.430 704.196 735.162 1.00 0.00 ? 662  ARG C O  1 
ATOM 8880   C CB . ARG C 2 662  ? 1062.216 703.928 732.350 1.00 0.00 ? 662  ARG C CB 1 
ATOM 8881   N N  . LEU C 2 663  ? 1062.558 702.985 734.801 1.00 0.00 ? 663  LEU C N  1 
ATOM 8882   C CA . LEU C 2 663  ? 1062.639 702.108 735.944 1.00 0.00 ? 663  LEU C CA 1 
ATOM 8883   C C  . LEU C 2 663  ? 1063.906 701.336 735.877 1.00 0.00 ? 663  LEU C C  1 
ATOM 8884   O O  . LEU C 2 663  ? 1064.568 701.160 736.897 1.00 0.00 ? 663  LEU C O  1 
ATOM 8885   C CB . LEU C 2 663  ? 1061.423 701.159 736.093 1.00 0.00 ? 663  LEU C CB 1 
ATOM 8886   N N  . LYS C 2 664  ? 1064.293 700.861 734.678 1.00 0.00 ? 664  LYS C N  1 
ATOM 8887   C CA . LYS C 2 664  ? 1065.531 700.150 734.587 1.00 0.00 ? 664  LYS C CA 1 
ATOM 8888   C C  . LYS C 2 664  ? 1066.638 701.084 734.929 1.00 0.00 ? 664  LYS C C  1 
ATOM 8889   O O  . LYS C 2 664  ? 1067.545 700.750 735.688 1.00 0.00 ? 664  LYS C O  1 
ATOM 8890   C CB . LYS C 2 664  ? 1065.876 699.703 733.169 1.00 0.00 ? 664  LYS C CB 1 
ATOM 8891   N N  . ASN C 2 665  ? 1066.569 702.301 734.371 1.00 0.00 ? 665  ASN C N  1 
ATOM 8892   C CA . ASN C 2 665  ? 1067.603 703.280 734.478 1.00 0.00 ? 665  ASN C CA 1 
ATOM 8893   C C  . ASN C 2 665  ? 1067.706 703.633 735.930 1.00 0.00 ? 665  ASN C C  1 
ATOM 8894   O O  . ASN C 2 665  ? 1068.789 703.873 736.460 1.00 0.00 ? 665  ASN C O  1 
ATOM 8895   C CB . ASN C 2 665  ? 1067.224 704.529 733.661 1.00 0.00 ? 665  ASN C CB 1 
ATOM 8896   N N  . MET C 2 666  ? 1066.542 703.662 736.595 1.00 0.00 ? 666  MET C N  1 
ATOM 8897   C CA . MET C 2 666  ? 1066.368 703.961 737.986 1.00 0.00 ? 666  MET C CA 1 
ATOM 8898   C C  . MET C 2 666  ? 1067.075 702.896 738.752 1.00 0.00 ? 666  MET C C  1 
ATOM 8899   O O  . MET C 2 666  ? 1067.734 703.166 739.754 1.00 0.00 ? 666  MET C O  1 
ATOM 8900   C CB . MET C 2 666  ? 1064.865 703.924 738.340 1.00 0.00 ? 666  MET C CB 1 
ATOM 8901   N N  . ALA C 2 667  ? 1066.956 701.645 738.270 1.00 0.00 ? 667  ALA C N  1 
ATOM 8902   C CA . ALA C 2 667  ? 1067.561 700.515 738.911 1.00 0.00 ? 667  ALA C CA 1 
ATOM 8903   C C  . ALA C 2 667  ? 1069.040 700.674 738.901 1.00 0.00 ? 667  ALA C C  1 
ATOM 8904   O O  . ALA C 2 667  ? 1069.718 700.408 739.891 1.00 0.00 ? 667  ALA C O  1 
ATOM 8905   C CB . ALA C 2 667  ? 1067.230 699.182 738.214 1.00 0.00 ? 667  ALA C CB 1 
ATOM 8906   N N  . LEU C 2 668  ? 1069.574 701.132 737.764 1.00 0.00 ? 668  LEU C N  1 
ATOM 8907   C CA . LEU C 2 668  ? 1070.988 701.253 737.635 1.00 0.00 ? 668  LEU C CA 1 
ATOM 8908   C C  . LEU C 2 668  ? 1071.482 702.300 738.589 1.00 0.00 ? 668  LEU C C  1 
ATOM 8909   O O  . LEU C 2 668  ? 1072.536 702.142 739.202 1.00 0.00 ? 668  LEU C O  1 
ATOM 8910   C CB . LEU C 2 668  ? 1071.403 701.667 736.218 1.00 0.00 ? 668  LEU C CB 1 
ATOM 8911   N N  . SER C 2 669  ? 1070.718 703.401 738.743 1.00 0.00 ? 669  SER C N  1 
ATOM 8912   C CA . SER C 2 669  ? 1071.134 704.525 739.540 1.00 0.00 ? 669  SER C CA 1 
ATOM 8913   C C  . SER C 2 669  ? 1071.364 704.092 740.955 1.00 0.00 ? 669  SER C C  1 
ATOM 8914   O O  . SER C 2 669  ? 1072.438 704.303 741.517 1.00 0.00 ? 669  SER C O  1 
ATOM 8915   C CB . SER C 2 669  ? 1070.073 705.643 739.579 1.00 0.00 ? 669  SER C CB 1 
ATOM 8916   N N  . ILE C 2 670  ? 1070.357 703.427 741.549 1.00 0.00 ? 670  ILE C N  1 
ATOM 8917   C CA . ILE C 2 670  ? 1070.394 703.041 742.929 1.00 0.00 ? 670  ILE C CA 1 
ATOM 8918   C C  . ILE C 2 670  ? 1071.529 702.080 743.200 1.00 0.00 ? 670  ILE C C  1 
ATOM 8919   O O  . ILE C 2 670  ? 1072.267 702.262 744.165 1.00 0.00 ? 670  ILE C O  1 
ATOM 8920   C CB . ILE C 2 670  ? 1069.116 702.389 743.338 1.00 0.00 ? 670  ILE C CB 1 
ATOM 8921   N N  . ALA C 2 671  ? 1071.735 701.053 742.351 1.00 0.00 ? 671  ALA C N  1 
ATOM 8922   C CA . ALA C 2 671  ? 1072.706 700.033 742.649 1.00 0.00 ? 671  ALA C CA 1 
ATOM 8923   C C  . ALA C 2 671  ? 1074.078 700.613 742.721 1.00 0.00 ? 671  ALA C C  1 
ATOM 8924   O O  . ALA C 2 671  ? 1074.811 700.404 743.688 1.00 0.00 ? 671  ALA C O  1 
ATOM 8925   C CB . ALA C 2 671  ? 1072.815 698.986 741.545 1.00 0.00 ? 671  ALA C CB 1 
ATOM 8926   N N  . GLU C 2 672  ? 1074.435 701.406 741.697 1.00 0.00 ? 672  GLU C N  1 
ATOM 8927   C CA . GLU C 2 672  ? 1075.753 701.959 741.571 1.00 0.00 ? 672  GLU C CA 1 
ATOM 8928   C C  . GLU C 2 672  ? 1075.978 702.769 742.793 1.00 0.00 ? 672  GLU C C  1 
ATOM 8929   O O  . GLU C 2 672  ? 1077.016 702.741 743.453 1.00 0.00 ? 672  GLU C O  1 
ATOM 8930   C CB . GLU C 2 672  ? 1075.783 702.965 740.404 1.00 0.00 ? 672  GLU C CB 1 
ATOM 8931   N N  . ARG C 2 673  ? 1074.925 703.519 743.084 1.00 0.00 ? 673  ARG C N  1 
ATOM 8932   C CA . ARG C 2 673  ? 1074.856 704.523 744.074 1.00 0.00 ? 673  ARG C CA 1 
ATOM 8933   C C  . ARG C 2 673  ? 1075.008 704.048 745.497 1.00 0.00 ? 673  ARG C C  1 
ATOM 8934   O O  . ARG C 2 673  ? 1075.849 704.570 746.230 1.00 0.00 ? 673  ARG C O  1 
ATOM 8935   C CB . ARG C 2 673  ? 1073.492 705.100 743.910 1.00 0.00 ? 673  ARG C CB 1 
ATOM 8936   N N  . TYR C 2 674  ? 1074.132 703.115 745.943 1.00 0.00 ? 674  TYR C N  1 
ATOM 8937   C CA . TYR C 2 674  ? 1074.110 702.625 747.302 1.00 0.00 ? 674  TYR C CA 1 
ATOM 8938   C C  . TYR C 2 674  ? 1075.117 701.559 747.598 1.00 0.00 ? 674  TYR C C  1 
ATOM 8939   O O  . TYR C 2 674  ? 1075.833 701.603 748.597 1.00 0.00 ? 674  TYR C O  1 
ATOM 8940   C CB . TYR C 2 674  ? 1072.779 701.981 747.753 1.00 0.00 ? 674  TYR C CB 1 
ATOM 8941   N N  . ARG C 2 675  ? 1075.202 700.570 746.694 1.00 0.00 ? 675  ARG C N  1 
ATOM 8942   C CA . ARG C 2 675  ? 1075.883 699.336 746.958 1.00 0.00 ? 675  ARG C CA 1 
ATOM 8943   C C  . ARG C 2 675  ? 1077.317 699.534 747.303 1.00 0.00 ? 675  ARG C C  1 
ATOM 8944   O O  . ARG C 2 675  ? 1077.829 698.877 748.208 1.00 0.00 ? 675  ARG C O  1 
ATOM 8945   C CB . ARG C 2 675  ? 1075.750 698.379 745.770 1.00 0.00 ? 675  ARG C CB 1 
ATOM 8946   N N  . ALA C 2 676  ? 1078.013 700.436 746.603 1.00 0.00 ? 676  ALA C N  1 
ATOM 8947   C CA . ALA C 2 676  ? 1079.397 700.645 746.892 1.00 0.00 ? 676  ALA C CA 1 
ATOM 8948   C C  . ALA C 2 676  ? 1079.544 701.173 748.289 1.00 0.00 ? 676  ALA C C  1 
ATOM 8949   O O  . ALA C 2 676  ? 1080.469 700.798 749.007 1.00 0.00 ? 676  ALA C O  1 
ATOM 8950   C CB . ALA C 2 676  ? 1080.042 701.679 745.953 1.00 0.00 ? 676  ALA C CB 1 
ATOM 8951   N N  . GLN C 2 677  ? 1078.613 702.049 748.717 1.00 0.00 ? 677  GLN C N  1 
ATOM 8952   C CA . GLN C 2 677  ? 1078.781 702.802 749.932 1.00 0.00 ? 677  GLN C CA 1 
ATOM 8953   C C  . GLN C 2 677  ? 1078.100 702.236 751.152 1.00 0.00 ? 677  GLN C C  1 
ATOM 8954   O O  . GLN C 2 677  ? 1076.907 702.456 751.358 1.00 0.00 ? 677  GLN C O  1 
ATOM 8955   C CB . GLN C 2 677  ? 1078.195 704.208 749.778 1.00 0.00 ? 677  GLN C CB 1 
ATOM 8956   N N  . GLY C 2 678  ? 1078.853 701.495 751.995 1.00 0.00 ? 678  GLY C N  1 
ATOM 8957   C CA . GLY C 2 678  ? 1078.464 701.118 753.337 1.00 0.00 ? 678  GLY C CA 1 
ATOM 8958   C C  . GLY C 2 678  ? 1077.075 700.563 753.387 1.00 0.00 ? 678  GLY C C  1 
ATOM 8959   O O  . GLY C 2 678  ? 1076.425 700.595 754.433 1.00 0.00 ? 678  GLY C O  1 
ATOM 8960   N N  . ILE C 2 679  ? 1076.627 700.004 752.253 1.00 0.00 ? 679  ILE C N  1 
ATOM 8961   C CA . ILE C 2 679  ? 1075.334 699.435 751.984 1.00 0.00 ? 679  ILE C CA 1 
ATOM 8962   C C  . ILE C 2 679  ? 1074.668 698.861 753.217 1.00 0.00 ? 679  ILE C C  1 
ATOM 8963   O O  . ILE C 2 679  ? 1075.133 697.905 753.836 1.00 0.00 ? 679  ILE C O  1 
ATOM 8964   C CB . ILE C 2 679  ? 1075.547 698.388 750.934 1.00 0.00 ? 679  ILE C CB 1 
ATOM 8965   N N  . SER C 2 680  ? 1073.526 699.489 753.591 1.00 0.00 ? 680  SER C N  1 
ATOM 8966   C CA . SER C 2 680  ? 1072.671 699.175 754.710 1.00 0.00 ? 680  SER C CA 1 
ATOM 8967   C C  . SER C 2 680  ? 1071.614 698.171 754.348 1.00 0.00 ? 680  SER C C  1 
ATOM 8968   O O  . SER C 2 680  ? 1070.867 697.725 755.217 1.00 0.00 ? 680  SER C O  1 
ATOM 8969   C CB . SER C 2 680  ? 1071.925 700.407 755.241 1.00 0.00 ? 680  SER C CB 1 
ATOM 8970   N N  . ALA C 2 681  ? 1071.479 697.821 753.056 1.00 0.00 ? 681  ALA C N  1 
ATOM 8971   C CA . ALA C 2 681  ? 1070.398 696.964 752.648 1.00 0.00 ? 681  ALA C CA 1 
ATOM 8972   C C  . ALA C 2 681  ? 1070.684 695.535 752.987 1.00 0.00 ? 681  ALA C C  1 
ATOM 8973   O O  . ALA C 2 681  ? 1071.815 695.166 753.299 1.00 0.00 ? 681  ALA C O  1 
ATOM 8974   C CB . ALA C 2 681  ? 1070.096 697.029 751.143 1.00 0.00 ? 681  ALA C CB 1 
ATOM 8975   N N  . ASN C 2 682  ? 1069.622 694.700 752.959 1.00 0.00 ? 682  ASN C N  1 
ATOM 8976   C CA . ASN C 2 682  ? 1069.748 693.292 753.210 1.00 0.00 ? 682  ASN C CA 1 
ATOM 8977   C C  . ASN C 2 682  ? 1070.422 692.690 752.019 1.00 0.00 ? 682  ASN C C  1 
ATOM 8978   O O  . ASN C 2 682  ? 1070.283 693.177 750.899 1.00 0.00 ? 682  ASN C O  1 
ATOM 8979   C CB . ASN C 2 682  ? 1068.411 692.537 753.365 1.00 0.00 ? 682  ASN C CB 1 
ATOM 8980   N N  . LYS C 2 683  ? 1071.186 691.605 752.251 1.00 0.00 ? 683  LYS C N  1 
ATOM 8981   C CA . LYS C 2 683  ? 1071.903 690.937 751.203 1.00 0.00 ? 683  LYS C CA 1 
ATOM 8982   C C  . LYS C 2 683  ? 1070.910 690.373 750.237 1.00 0.00 ? 683  LYS C C  1 
ATOM 8983   O O  . LYS C 2 683  ? 1071.085 690.457 749.022 1.00 0.00 ? 683  LYS C O  1 
ATOM 8984   C CB . LYS C 2 683  ? 1072.751 689.767 751.732 1.00 0.00 ? 683  LYS C CB 1 
ATOM 8985   N N  . PHE C 2 684  ? 1069.818 689.802 750.770 1.00 0.00 ? 684  PHE C N  1 
ATOM 8986   C CA . PHE C 2 684  ? 1068.799 689.177 749.978 1.00 0.00 ? 684  PHE C CA 1 
ATOM 8987   C C  . PHE C 2 684  ? 1068.234 690.192 749.046 1.00 0.00 ? 684  PHE C C  1 
ATOM 8988   O O  . PHE C 2 684  ? 1068.080 689.944 747.850 1.00 0.00 ? 684  PHE C O  1 
ATOM 8989   C CB . PHE C 2 684  ? 1067.645 688.667 750.864 1.00 0.00 ? 684  PHE C CB 1 
ATOM 8990   N N  . VAL C 2 685  ? 1067.937 691.383 749.583 1.00 0.00 ? 685  VAL C N  1 
ATOM 8991   C CA . VAL C 2 685  ? 1067.293 692.415 748.830 1.00 0.00 ? 685  VAL C CA 1 
ATOM 8992   C C  . VAL C 2 685  ? 1068.195 692.806 747.701 1.00 0.00 ? 685  VAL C C  1 
ATOM 8993   O O  . VAL C 2 685  ? 1067.751 692.978 746.565 1.00 0.00 ? 685  VAL C O  1 
ATOM 8994   C CB . VAL C 2 685  ? 1067.019 693.603 749.710 1.00 0.00 ? 685  VAL C CB 1 
ATOM 8995   N N  . ASP C 2 686  ? 1069.510 692.950 747.978 1.00 0.00 ? 686  ASP C N  1 
ATOM 8996   C CA . ASP C 2 686  ? 1070.448 693.351 746.966 1.00 0.00 ? 686  ASP C CA 1 
ATOM 8997   C C  . ASP C 2 686  ? 1070.569 692.292 745.920 1.00 0.00 ? 686  ASP C C  1 
ATOM 8998   O O  . ASP C 2 686  ? 1070.711 692.591 744.736 1.00 0.00 ? 686  ASP C O  1 
ATOM 8999   C CB . ASP C 2 686  ? 1071.871 693.571 747.503 1.00 0.00 ? 686  ASP C CB 1 
ATOM 9000   N N  . SER C 2 687  ? 1070.522 691.014 746.333 1.00 0.00 ? 687  SER C N  1 
ATOM 9001   C CA . SER C 2 687  ? 1070.729 689.933 745.415 1.00 0.00 ? 687  SER C CA 1 
ATOM 9002   C C  . SER C 2 687  ? 1069.674 689.950 744.358 1.00 0.00 ? 687  SER C C  1 
ATOM 9003   O O  . SER C 2 687  ? 1069.979 689.831 743.172 1.00 0.00 ? 687  SER C O  1 
ATOM 9004   C CB . SER C 2 687  ? 1070.666 688.556 746.091 1.00 0.00 ? 687  SER C CB 1 
ATOM 9005   N N  . THR C 2 688  ? 1068.396 690.124 744.751 1.00 0.00 ? 688  THR C N  1 
ATOM 9006   C CA . THR C 2 688  ? 1067.354 690.084 743.772 1.00 0.00 ? 688  THR C CA 1 
ATOM 9007   C C  . THR C 2 688  ? 1067.570 691.234 742.847 1.00 0.00 ? 688  THR C C  1 
ATOM 9008   O O  . THR C 2 688  ? 1067.318 691.141 741.647 1.00 0.00 ? 688  THR C O  1 
ATOM 9009   C CB . THR C 2 688  ? 1065.959 690.183 744.335 1.00 0.00 ? 688  THR C CB 1 
ATOM 9010   N N  . PHE C 2 689  ? 1068.067 692.352 743.400 1.00 0.00 ? 689  PHE C N  1 
ATOM 9011   C CA . PHE C 2 689  ? 1068.293 693.561 742.668 1.00 0.00 ? 689  PHE C CA 1 
ATOM 9012   C C  . PHE C 2 689  ? 1069.250 693.290 741.546 1.00 0.00 ? 689  PHE C C  1 
ATOM 9013   O O  . PHE C 2 689  ? 1068.989 693.654 740.400 1.00 0.00 ? 689  PHE C O  1 
ATOM 9014   C CB . PHE C 2 689  ? 1068.918 694.626 743.577 1.00 0.00 ? 689  PHE C CB 1 
ATOM 9015   N N  . TYR C 2 690  ? 1070.386 692.633 741.845 1.00 0.00 ? 690  TYR C N  1 
ATOM 9016   C CA . TYR C 2 690  ? 1071.370 692.375 740.835 1.00 0.00 ? 690  TYR C CA 1 
ATOM 9017   C C  . TYR C 2 690  ? 1070.791 691.467 739.797 1.00 0.00 ? 690  TYR C C  1 
ATOM 9018   O O  . TYR C 2 690  ? 1071.037 691.658 738.609 1.00 0.00 ? 690  TYR C O  1 
ATOM 9019   C CB . TYR C 2 690  ? 1072.659 691.720 741.361 1.00 0.00 ? 690  TYR C CB 1 
ATOM 9020   N N  . LEU C 2 691  ? 1070.003 690.456 740.213 1.00 0.00 ? 691  LEU C N  1 
ATOM 9021   C CA . LEU C 2 691  ? 1069.450 689.533 739.269 1.00 0.00 ? 691  LEU C CA 1 
ATOM 9022   C C  . LEU C 2 691  ? 1068.598 690.277 738.293 1.00 0.00 ? 691  LEU C C  1 
ATOM 9023   O O  . LEU C 2 691  ? 1068.660 690.027 737.089 1.00 0.00 ? 691  LEU C O  1 
ATOM 9024   C CB . LEU C 2 691  ? 1068.539 688.463 739.889 1.00 0.00 ? 691  LEU C CB 1 
ATOM 9025   N N  . LEU C 2 692  ? 1067.779 691.222 738.785 1.00 0.00 ? 692  LEU C N  1 
ATOM 9026   C CA . LEU C 2 692  ? 1066.896 691.941 737.915 1.00 0.00 ? 692  LEU C CA 1 
ATOM 9027   C C  . LEU C 2 692  ? 1067.712 692.725 736.936 1.00 0.00 ? 692  LEU C C  1 
ATOM 9028   O O  . LEU C 2 692  ? 1067.342 692.826 735.769 1.00 0.00 ? 692  LEU C O  1 
ATOM 9029   C CB . LEU C 2 692  ? 1065.952 692.886 738.672 1.00 0.00 ? 692  LEU C CB 1 
ATOM 9030   N N  . LEU C 2 693  ? 1068.838 693.317 737.382 1.00 0.00 ? 693  LEU C N  1 
ATOM 9031   C CA . LEU C 2 693  ? 1069.677 694.067 736.487 1.00 0.00 ? 693  LEU C CA 1 
ATOM 9032   C C  . LEU C 2 693  ? 1070.278 693.153 735.457 1.00 0.00 ? 693  LEU C C  1 
ATOM 9033   O O  . LEU C 2 693  ? 1070.397 693.521 734.292 1.00 0.00 ? 693  LEU C O  1 
ATOM 9034   C CB . LEU C 2 693  ? 1070.858 694.771 737.175 1.00 0.00 ? 693  LEU C CB 1 
ATOM 9035   N N  . ASP C 2 694  ? 1070.699 691.937 735.847 1.00 0.00 ? 694  ASP C N  1 
ATOM 9036   C CA . ASP C 2 694  ? 1071.331 691.057 734.899 1.00 0.00 ? 694  ASP C CA 1 
ATOM 9037   C C  . ASP C 2 694  ? 1070.351 690.703 733.825 1.00 0.00 ? 694  ASP C C  1 
ATOM 9038   O O  . ASP C 2 694  ? 1070.689 690.636 732.645 1.00 0.00 ? 694  ASP C O  1 
ATOM 9039   C CB . ASP C 2 694  ? 1071.788 689.725 735.524 1.00 0.00 ? 694  ASP C CB 1 
ATOM 9040   N N  . LEU C 2 695  ? 1069.094 690.469 734.217 1.00 0.00 ? 695  LEU C N  1 
ATOM 9041   C CA . LEU C 2 695  ? 1068.089 690.029 733.303 1.00 0.00 ? 695  LEU C CA 1 
ATOM 9042   C C  . LEU C 2 695  ? 1067.882 691.136 732.307 1.00 0.00 ? 695  LEU C C  1 
ATOM 9043   O O  . LEU C 2 695  ? 1067.667 690.885 731.123 1.00 0.00 ? 695  LEU C O  1 
ATOM 9044   C CB . LEU C 2 695  ? 1066.787 689.729 734.070 1.00 0.00 ? 695  LEU C CB 1 
ATOM 9045   N N  . ILE C 2 696  ? 1067.948 692.403 732.774 1.00 0.00 ? 696  ILE C N  1 
ATOM 9046   C CA . ILE C 2 696  ? 1067.716 693.575 731.967 1.00 0.00 ? 696  ILE C CA 1 
ATOM 9047   C C  . ILE C 2 696  ? 1068.808 693.723 730.942 1.00 0.00 ? 696  ILE C C  1 
ATOM 9048   O O  . ILE C 2 696  ? 1068.532 694.043 729.786 1.00 0.00 ? 696  ILE C O  1 
ATOM 9049   C CB . ILE C 2 696  ? 1067.591 694.822 732.806 1.00 0.00 ? 696  ILE C CB 1 
ATOM 9050   N N  . THR C 2 697  ? 1070.082 693.480 731.324 1.00 0.00 ? 697  THR C N  1 
ATOM 9051   C CA . THR C 2 697  ? 1071.159 693.615 730.380 1.00 0.00 ? 697  THR C CA 1 
ATOM 9052   C C  . THR C 2 697  ? 1070.979 692.578 729.314 1.00 0.00 ? 697  THR C C  1 
ATOM 9053   O O  . THR C 2 697  ? 1071.320 692.802 728.153 1.00 0.00 ? 697  THR C O  1 
ATOM 9054   C CB . THR C 2 697  ? 1072.538 693.515 730.985 1.00 0.00 ? 697  THR C CB 1 
ATOM 9055   N N  . PHE C 2 698  ? 1070.427 691.413 729.696 1.00 0.00 ? 698  PHE C N  1 
ATOM 9056   C CA . PHE C 2 698  ? 1070.143 690.338 728.788 1.00 0.00 ? 698  PHE C CA 1 
ATOM 9057   C C  . PHE C 2 698  ? 1069.164 690.851 727.780 1.00 0.00 ? 698  PHE C C  1 
ATOM 9058   O O  . PHE C 2 698  ? 1069.273 690.542 726.595 1.00 0.00 ? 698  PHE C O  1 
ATOM 9059   C CB . PHE C 2 698  ? 1069.529 689.130 729.522 1.00 0.00 ? 698  PHE C CB 1 
ATOM 9060   N N  . PHE C 2 699  ? 1068.171 691.645 728.230 1.00 0.00 ? 699  PHE C N  1 
ATOM 9061   C CA . PHE C 2 699  ? 1067.187 692.208 727.348 1.00 0.00 ? 699  PHE C CA 1 
ATOM 9062   C C  . PHE C 2 699  ? 1067.828 693.130 726.365 1.00 0.00 ? 699  PHE C C  1 
ATOM 9063   O O  . PHE C 2 699  ? 1067.505 693.071 725.179 1.00 0.00 ? 699  PHE C O  1 
ATOM 9064   C CB . PHE C 2 699  ? 1066.111 693.072 728.033 1.00 0.00 ? 699  PHE C CB 1 
ATOM 9065   N N  . ASP C 2 700  ? 1068.752 693.998 726.827 1.00 0.00 ? 700  ASP C N  1 
ATOM 9066   C CA . ASP C 2 700  ? 1069.322 694.990 725.956 1.00 0.00 ? 700  ASP C CA 1 
ATOM 9067   C C  . ASP C 2 700  ? 1069.921 694.276 724.790 1.00 0.00 ? 700  ASP C C  1 
ATOM 9068   O O  . ASP C 2 700  ? 1069.652 694.600 723.635 1.00 0.00 ? 700  ASP C O  1 
ATOM 9069   C CB . ASP C 2 700  ? 1070.514 695.727 726.586 1.00 0.00 ? 700  ASP C CB 1 
ATOM 9070   N N  . GLU C 2 701  ? 1070.755 693.266 725.082 1.00 0.00 ? 701  GLU C N  1 
ATOM 9071   C CA . GLU C 2 701  ? 1071.406 692.493 724.071 1.00 0.00 ? 701  GLU C CA 1 
ATOM 9072   C C  . GLU C 2 701  ? 1070.496 691.516 723.380 1.00 0.00 ? 701  GLU C C  1 
ATOM 9073   O O  . GLU C 2 701  ? 1070.846 691.017 722.316 1.00 0.00 ? 701  GLU C O  1 
ATOM 9074   C CB . GLU C 2 701  ? 1072.787 691.925 724.476 1.00 0.00 ? 701  GLU C CB 1 
ATOM 9075   N N  . TYR C 2 702  ? 1069.342 691.146 723.971 1.00 0.00 ? 702  TYR C N  1 
ATOM 9076   C CA . TYR C 2 702  ? 1068.436 690.286 723.252 1.00 0.00 ? 702  TYR C CA 1 
ATOM 9077   C C  . TYR C 2 702  ? 1067.708 691.147 722.265 1.00 0.00 ? 702  TYR C C  1 
ATOM 9078   O O  . TYR C 2 702  ? 1066.985 692.074 722.625 1.00 0.00 ? 702  TYR C O  1 
ATOM 9079   C CB . TYR C 2 702  ? 1067.455 689.567 724.199 1.00 0.00 ? 702  TYR C CB 1 
ATOM 9080   N N  . HIS C 2 703  ? 1067.885 690.811 720.970 1.00 0.00 ? 703  HIS C N  1 
ATOM 9081   C CA . HIS C 2 703  ? 1067.474 691.599 719.845 1.00 0.00 ? 703  HIS C CA 1 
ATOM 9082   C C  . HIS C 2 703  ? 1068.567 692.606 719.778 1.00 0.00 ? 703  HIS C C  1 
ATOM 9083   O O  . HIS C 2 703  ? 1069.338 692.711 720.727 1.00 0.00 ? 703  HIS C O  1 
ATOM 9084   C CB . HIS C 2 703  ? 1066.109 692.300 719.926 1.00 0.00 ? 703  HIS C CB 1 
ATOM 9085   N N  . SER C 2 704  ? 1068.660 693.393 718.696 1.00 0.00 ? 704  SER C N  1 
ATOM 9086   C CA . SER C 2 704  ? 1069.833 694.202 718.530 1.00 0.00 ? 704  SER C CA 1 
ATOM 9087   C C  . SER C 2 704  ? 1070.939 693.215 718.327 1.00 0.00 ? 704  SER C C  1 
ATOM 9088   O O  . SER C 2 704  ? 1072.111 693.507 718.562 1.00 0.00 ? 704  SER C O  1 
ATOM 9089   C CB . SER C 2 704  ? 1070.208 695.098 719.733 1.00 0.00 ? 704  SER C CB 1 
ATOM 9090   N N  . GLY C 2 705  ? 1070.556 692.003 717.865 1.00 0.00 ? 705  GLY C N  1 
ATOM 9091   C CA . GLY C 2 705  ? 1071.470 690.949 717.532 1.00 0.00 ? 705  GLY C CA 1 
ATOM 9092   C C  . GLY C 2 705  ? 1072.066 690.390 718.783 1.00 0.00 ? 705  GLY C C  1 
ATOM 9093   O O  . GLY C 2 705  ? 1071.432 690.358 719.837 1.00 0.00 ? 705  GLY C O  1 
ATOM 9094   N N  . HIS C 2 706  ? 1073.333 689.942 718.671 1.00 0.00 ? 706  HIS C N  1 
ATOM 9095   C CA . HIS C 2 706  ? 1074.055 689.392 719.780 1.00 0.00 ? 706  HIS C CA 1 
ATOM 9096   C C  . HIS C 2 706  ? 1073.310 688.243 720.385 1.00 0.00 ? 706  HIS C C  1 
ATOM 9097   O O  . HIS C 2 706  ? 1073.015 688.233 721.580 1.00 0.00 ? 706  HIS C O  1 
ATOM 9098   C CB . HIS C 2 706  ? 1074.350 690.442 720.859 1.00 0.00 ? 706  HIS C CB 1 
ATOM 9099   N N  . ILE C 2 707  ? 1072.978 687.247 719.540 1.00 0.00 ? 707  ILE C N  1 
ATOM 9100   C CA . ILE C 2 707  ? 1072.324 686.031 719.946 1.00 0.00 ? 707  ILE C CA 1 
ATOM 9101   C C  . ILE C 2 707  ? 1073.243 685.276 720.855 1.00 0.00 ? 707  ILE C C  1 
ATOM 9102   O O  . ILE C 2 707  ? 1072.841 684.831 721.924 1.00 0.00 ? 707  ILE C O  1 
ATOM 9103   C CB . ILE C 2 707  ? 1072.056 685.148 718.757 1.00 0.00 ? 707  ILE C CB 1 
ATOM 9104   N N  . ASP C 2 708  ? 1074.527 685.152 720.484 1.00 0.00 ? 708  ASP C N  1 
ATOM 9105   C CA . ASP C 2 708  ? 1075.410 684.314 721.243 1.00 0.00 ? 708  ASP C CA 1 
ATOM 9106   C C  . ASP C 2 708  ? 1075.569 684.857 722.629 1.00 0.00 ? 708  ASP C C  1 
ATOM 9107   O O  . ASP C 2 708  ? 1075.568 684.102 723.602 1.00 0.00 ? 708  ASP C O  1 
ATOM 9108   C CB . ASP C 2 708  ? 1076.800 684.208 720.592 1.00 0.00 ? 708  ASP C CB 1 
ATOM 9109   N N  . ARG C 2 709  ? 1075.675 686.192 722.754 1.00 0.00 ? 709  ARG C N  1 
ATOM 9110   C CA . ARG C 2 709  ? 1075.928 686.804 724.024 1.00 0.00 ? 709  ARG C CA 1 
ATOM 9111   C C  . ARG C 2 709  ? 1074.790 686.542 724.962 1.00 0.00 ? 709  ARG C C  1 
ATOM 9112   O O  . ARG C 2 709  ? 1075.008 686.356 726.157 1.00 0.00 ? 709  ARG C O  1 
ATOM 9113   C CB . ARG C 2 709  ? 1076.136 688.326 723.933 1.00 0.00 ? 709  ARG C CB 1 
ATOM 9114   N N  . ALA C 2 710  ? 1073.541 686.527 724.454 1.00 0.00 ? 710  ALA C N  1 
ATOM 9115   C CA . ALA C 2 710  ? 1072.394 686.338 725.302 1.00 0.00 ? 710  ALA C CA 1 
ATOM 9116   C C  . ALA C 2 710  ? 1072.451 685.002 725.987 1.00 0.00 ? 710  ALA C C  1 
ATOM 9117   O O  . ALA C 2 710  ? 1072.156 684.915 727.178 1.00 0.00 ? 710  ALA C O  1 
ATOM 9118   C CB . ALA C 2 710  ? 1071.066 686.393 724.529 1.00 0.00 ? 710  ALA C CB 1 
ATOM 9119   N N  . PHE C 2 711  ? 1072.836 683.915 725.282 1.00 0.00 ? 711  PHE C N  1 
ATOM 9120   C CA . PHE C 2 711  ? 1072.851 682.653 725.973 1.00 0.00 ? 711  PHE C CA 1 
ATOM 9121   C C  . PHE C 2 711  ? 1073.818 682.702 727.107 1.00 0.00 ? 711  PHE C C  1 
ATOM 9122   O O  . PHE C 2 711  ? 1073.535 682.212 728.198 1.00 0.00 ? 711  PHE C O  1 
ATOM 9123   C CB . PHE C 2 711  ? 1073.318 681.417 725.188 1.00 0.00 ? 711  PHE C CB 1 
ATOM 9124   N N  . ASP C 2 712  ? 1075.000 683.293 726.877 1.00 0.00 ? 712  ASP C N  1 
ATOM 9125   C CA . ASP C 2 712  ? 1076.025 683.259 727.875 1.00 0.00 ? 712  ASP C CA 1 
ATOM 9126   C C  . ASP C 2 712  ? 1075.515 683.879 729.137 1.00 0.00 ? 712  ASP C C  1 
ATOM 9127   O O  . ASP C 2 712  ? 1075.658 683.310 730.217 1.00 0.00 ? 712  ASP C O  1 
ATOM 9128   C CB . ASP C 2 712  ? 1077.272 684.049 727.438 1.00 0.00 ? 712  ASP C CB 1 
ATOM 9129   N N  . ILE C 2 713  ? 1074.886 685.060 729.026 1.00 0.00 ? 713  ILE C N  1 
ATOM 9130   C CA . ILE C 2 713  ? 1074.409 685.765 730.178 1.00 0.00 ? 713  ILE C CA 1 
ATOM 9131   C C  . ILE C 2 713  ? 1073.299 685.015 730.854 1.00 0.00 ? 713  ILE C C  1 
ATOM 9132   O O  . ILE C 2 713  ? 1073.282 684.915 732.080 1.00 0.00 ? 713  ILE C O  1 
ATOM 9133   C CB . ILE C 2 713  ? 1073.926 687.141 729.844 1.00 0.00 ? 713  ILE C CB 1 
ATOM 9134   N N  . ILE C 2 714  ? 1072.343 684.450 730.088 1.00 0.00 ? 714  ILE C N  1 
ATOM 9135   C CA . ILE C 2 714  ? 1071.236 683.780 730.711 1.00 0.00 ? 714  ILE C CA 1 
ATOM 9136   C C  . ILE C 2 714  ? 1071.751 682.647 731.536 1.00 0.00 ? 714  ILE C C  1 
ATOM 9137   O O  . ILE C 2 714  ? 1071.251 682.402 732.634 1.00 0.00 ? 714  ILE C O  1 
ATOM 9138   C CB . ILE C 2 714  ? 1070.203 683.243 729.756 1.00 0.00 ? 714  ILE C CB 1 
ATOM 9139   N N  . GLU C 2 715  ? 1072.763 681.920 731.032 1.00 0.00 ? 715  GLU C N  1 
ATOM 9140   C CA . GLU C 2 715  ? 1073.278 680.795 731.758 1.00 0.00 ? 715  GLU C CA 1 
ATOM 9141   C C  . GLU C 2 715  ? 1073.883 681.258 733.048 1.00 0.00 ? 715  GLU C C  1 
ATOM 9142   O O  . GLU C 2 715  ? 1073.777 680.584 734.072 1.00 0.00 ? 715  GLU C O  1 
ATOM 9143   C CB . GLU C 2 715  ? 1074.354 680.004 730.997 1.00 0.00 ? 715  GLU C CB 1 
ATOM 9144   N N  . ARG C 2 716  ? 1074.519 682.441 733.035 1.00 0.00 ? 716  ARG C N  1 
ATOM 9145   C CA . ARG C 2 716  ? 1075.201 682.970 734.184 1.00 0.00 ? 716  ARG C CA 1 
ATOM 9146   C C  . ARG C 2 716  ? 1074.211 683.161 735.288 1.00 0.00 ? 716  ARG C C  1 
ATOM 9147   O O  . ARG C 2 716  ? 1074.553 683.043 736.464 1.00 0.00 ? 716  ARG C O  1 
ATOM 9148   C CB . ARG C 2 716  ? 1075.869 684.329 733.910 1.00 0.00 ? 716  ARG C CB 1 
ATOM 9149   N N  . LEU C 2 717  ? 1072.946 683.445 734.936 1.00 0.00 ? 717  LEU C N  1 
ATOM 9150   C CA . LEU C 2 717  ? 1071.927 683.715 735.909 1.00 0.00 ? 717  LEU C CA 1 
ATOM 9151   C C  . LEU C 2 717  ? 1071.822 682.545 736.834 1.00 0.00 ? 717  LEU C C  1 
ATOM 9152   O O  . LEU C 2 717  ? 1071.546 682.720 738.021 1.00 0.00 ? 717  LEU C O  1 
ATOM 9153   C CB . LEU C 2 717  ? 1070.546 683.961 735.283 1.00 0.00 ? 717  LEU C CB 1 
ATOM 9154   N N  . LYS C 2 718  ? 1072.040 681.320 736.316 1.00 0.00 ? 718  LYS C N  1 
ATOM 9155   C CA . LYS C 2 718  ? 1072.011 680.145 737.142 1.00 0.00 ? 718  LYS C CA 1 
ATOM 9156   C C  . LYS C 2 718  ? 1070.596 679.837 737.522 1.00 0.00 ? 718  LYS C C  1 
ATOM 9157   O O  . LYS C 2 718  ? 1070.351 679.126 738.493 1.00 0.00 ? 718  LYS C O  1 
ATOM 9158   C CB . LYS C 2 718  ? 1072.848 680.345 738.425 1.00 0.00 ? 718  LYS C CB 1 
ATOM 9159   N N  . LEU C 2 719  ? 1069.626 680.462 736.829 1.00 0.00 ? 719  LEU C N  1 
ATOM 9160   C CA . LEU C 2 719  ? 1068.232 680.133 736.949 1.00 0.00 ? 719  LEU C CA 1 
ATOM 9161   C C  . LEU C 2 719  ? 1067.792 678.955 736.110 1.00 0.00 ? 719  LEU C C  1 
ATOM 9162   O O  . LEU C 2 719  ? 1066.996 678.141 736.576 1.00 0.00 ? 719  LEU C O  1 
ATOM 9163   C CB . LEU C 2 719  ? 1067.317 681.339 736.679 1.00 0.00 ? 719  LEU C CB 1 
ATOM 9164   N N  . VAL C 2 720  ? 1068.298 678.817 734.859 1.00 0.00 ? 720  VAL C N  1 
ATOM 9165   C CA . VAL C 2 720  ? 1067.746 677.846 733.936 1.00 0.00 ? 720  VAL C CA 1 
ATOM 9166   C C  . VAL C 2 720  ? 1068.745 676.764 733.628 1.00 0.00 ? 720  VAL C C  1 
ATOM 9167   O O  . VAL C 2 720  ? 1069.908 677.044 733.347 1.00 0.00 ? 720  VAL C O  1 
ATOM 9168   C CB . VAL C 2 720  ? 1067.375 678.496 732.631 1.00 0.00 ? 720  VAL C CB 1 
ATOM 9169   N N  . PRO C 2 721  ? 1068.306 675.522 733.690 1.00 0.00 ? 721  PRO C N  1 
ATOM 9170   C CA . PRO C 2 721  ? 1069.138 674.365 733.457 1.00 0.00 ? 721  PRO C CA 1 
ATOM 9171   C C  . PRO C 2 721  ? 1069.751 674.300 732.092 1.00 0.00 ? 721  PRO C C  1 
ATOM 9172   O O  . PRO C 2 721  ? 1069.036 673.954 731.155 1.00 0.00 ? 721  PRO C O  1 
ATOM 9173   C CB . PRO C 2 721  ? 1068.219 673.163 733.665 1.00 0.00 ? 721  PRO C CB 1 
ATOM 9174   N N  . LEU C 2 722  ? 1071.044 674.651 731.935 1.00 0.00 ? 722  LEU C N  1 
ATOM 9175   C CA . LEU C 2 722  ? 1071.756 674.435 730.703 1.00 0.00 ? 722  LEU C CA 1 
ATOM 9176   C C  . LEU C 2 722  ? 1072.344 673.056 730.622 1.00 0.00 ? 722  LEU C C  1 
ATOM 9177   O O  . LEU C 2 722  ? 1072.485 672.495 729.537 1.00 0.00 ? 722  LEU C O  1 
ATOM 9178   C CB . LEU C 2 722  ? 1072.822 675.494 730.395 1.00 0.00 ? 722  LEU C CB 1 
ATOM 9179   N N  . ASN C 2 723  ? 1072.705 672.475 731.782 1.00 0.00 ? 723  ASN C N  1 
ATOM 9180   C CA . ASN C 2 723  ? 1073.429 671.234 731.834 1.00 0.00 ? 723  ASN C CA 1 
ATOM 9181   C C  . ASN C 2 723  ? 1072.530 670.120 731.419 1.00 0.00 ? 723  ASN C C  1 
ATOM 9182   O O  . ASN C 2 723  ? 1071.869 670.184 730.387 1.00 0.00 ? 723  ASN C O  1 
ATOM 9183   C CB . ASN C 2 723  ? 1073.972 670.906 733.241 1.00 0.00 ? 723  ASN C CB 1 
ATOM 9184   N N  . GLN C 2 724  ? 1072.521 669.042 732.218 1.00 0.00 ? 724  GLN C N  1 
ATOM 9185   C CA . GLN C 2 724  ? 1071.791 667.855 731.914 1.00 0.00 ? 724  GLN C CA 1 
ATOM 9186   C C  . GLN C 2 724  ? 1070.371 668.024 732.338 1.00 0.00 ? 724  GLN C C  1 
ATOM 9187   O O  . GLN C 2 724  ? 1069.840 669.130 732.414 1.00 0.00 ? 724  GLN C O  1 
ATOM 9188   C CB . GLN C 2 724  ? 1072.389 666.611 732.597 1.00 0.00 ? 724  GLN C CB 1 
ATOM 9189   N N  . GLU C 2 725  ? 1069.726 666.879 732.607 1.00 0.00 ? 725  GLU C N  1 
ATOM 9190   C CA . GLU C 2 725  ? 1068.355 666.755 732.990 1.00 0.00 ? 725  GLU C CA 1 
ATOM 9191   C C  . GLU C 2 725  ? 1068.088 667.334 734.337 1.00 0.00 ? 725  GLU C C  1 
ATOM 9192   O O  . GLU C 2 725  ? 1067.012 667.143 734.902 1.00 0.00 ? 725  GLU C O  1 
ATOM 9193   C CB . GLU C 2 725  ? 1067.682 665.403 732.695 1.00 0.00 ? 725  GLU C CB 1 
ATOM 9194   N N  . SER C 2 726  ? 1069.079 668.071 734.890 1.00 0.00 ? 726  SER C N  1 
ATOM 9195   C CA . SER C 2 726  ? 1069.048 668.793 736.147 1.00 0.00 ? 726  SER C CA 1 
ATOM 9196   C C  . SER C 2 726  ? 1067.913 669.802 736.160 1.00 0.00 ? 726  SER C C  1 
ATOM 9197   O O  . SER C 2 726  ? 1067.799 670.613 737.078 1.00 0.00 ? 726  SER C O  1 
ATOM 9198   C CB . SER C 2 726  ? 1070.333 669.609 736.371 1.00 0.00 ? 726  SER C CB 1 
ATOM 9199   N N  . VAL C 2 727  ? 1067.039 669.753 735.139 1.00 0.00 ? 727  VAL C N  1 
ATOM 9200   C CA . VAL C 2 727  ? 1065.873 670.546 734.920 1.00 0.00 ? 727  VAL C CA 1 
ATOM 9201   C C  . VAL C 2 727  ? 1065.032 670.450 736.149 1.00 0.00 ? 727  VAL C C  1 
ATOM 9202   O O  . VAL C 2 727  ? 1064.451 671.444 736.573 1.00 0.00 ? 727  VAL C O  1 
ATOM 9203   C CB . VAL C 2 727  ? 1065.004 669.934 733.866 1.00 0.00 ? 727  VAL C CB 1 
ATOM 9204   N N  . GLU C 2 728  ? 1064.911 669.233 736.717 1.00 0.00 ? 728  GLU C N  1 
ATOM 9205   C CA . GLU C 2 728  ? 1064.145 668.992 737.910 1.00 0.00 ? 728  GLU C CA 1 
ATOM 9206   C C  . GLU C 2 728  ? 1064.722 669.685 739.099 1.00 0.00 ? 728  GLU C C  1 
ATOM 9207   O O  . GLU C 2 728  ? 1063.975 670.150 739.956 1.00 0.00 ? 728  GLU C O  1 
ATOM 9208   C CB . GLU C 2 728  ? 1063.981 667.511 738.280 1.00 0.00 ? 728  GLU C CB 1 
ATOM 9209   N N  . GLU C 2 729  ? 1066.057 669.762 739.214 1.00 0.00 ? 729  GLU C N  1 
ATOM 9210   C CA . GLU C 2 729  ? 1066.587 670.444 740.358 1.00 0.00 ? 729  GLU C CA 1 
ATOM 9211   C C  . GLU C 2 729  ? 1066.107 671.849 740.247 1.00 0.00 ? 729  GLU C C  1 
ATOM 9212   O O  . GLU C 2 729  ? 1065.826 672.518 741.242 1.00 0.00 ? 729  GLU C O  1 
ATOM 9213   C CB . GLU C 2 729  ? 1068.128 670.394 740.432 1.00 0.00 ? 729  GLU C CB 1 
ATOM 9214   N N  . ARG C 2 730  ? 1065.957 672.317 738.994 1.00 0.00 ? 730  ARG C N  1 
ATOM 9215   C CA . ARG C 2 730  ? 1065.455 673.630 738.692 1.00 0.00 ? 730  ARG C CA 1 
ATOM 9216   C C  . ARG C 2 730  ? 1064.027 673.707 739.133 1.00 0.00 ? 730  ARG C C  1 
ATOM 9217   O O  . ARG C 2 730  ? 1063.487 674.799 739.233 1.00 0.00 ? 730  ARG C O  1 
ATOM 9218   C CB . ARG C 2 730  ? 1065.544 673.982 737.211 1.00 0.00 ? 730  ARG C CB 1 
ATOM 9219   N N  . VAL C 2 731  ? 1063.318 672.575 739.240 1.00 0.00 ? 731  VAL C N  1 
ATOM 9220   C CA . VAL C 2 731  ? 1061.995 672.560 739.805 1.00 0.00 ? 731  VAL C CA 1 
ATOM 9221   C C  . VAL C 2 731  ? 1062.066 672.740 741.285 1.00 0.00 ? 731  VAL C C  1 
ATOM 9222   O O  . VAL C 2 731  ? 1061.337 673.550 741.860 1.00 0.00 ? 731  VAL C O  1 
ATOM 9223   C CB . VAL C 2 731  ? 1061.297 671.250 739.594 1.00 0.00 ? 731  VAL C CB 1 
ATOM 9224   N N  . ALA C 2 732  ? 1062.976 671.984 741.932 1.00 0.00 ? 732  ALA C N  1 
ATOM 9225   C CA . ALA C 2 732  ? 1063.075 672.039 743.357 1.00 0.00 ? 732  ALA C CA 1 
ATOM 9226   C C  . ALA C 2 732  ? 1063.416 673.447 743.688 1.00 0.00 ? 732  ALA C C  1 
ATOM 9227   O O  . ALA C 2 732  ? 1062.844 674.048 744.595 1.00 0.00 ? 732  ALA C O  1 
ATOM 9228   C CB . ALA C 2 732  ? 1064.198 671.142 743.901 1.00 0.00 ? 732  ALA C CB 1 
ATOM 9229   N N  . ALA C 2 733  ? 1064.370 674.024 742.940 1.00 0.00 ? 733  ALA C N  1 
ATOM 9230   C CA . ALA C 2 733  ? 1064.650 675.401 743.177 1.00 0.00 ? 733  ALA C CA 1 
ATOM 9231   C C  . ALA C 2 733  ? 1063.819 676.145 742.196 1.00 0.00 ? 733  ALA C C  1 
ATOM 9232   O O  . ALA C 2 733  ? 1064.230 676.347 741.059 1.00 0.00 ? 733  ALA C O  1 
ATOM 9233   C CB . ALA C 2 733  ? 1066.117 675.776 742.904 1.00 0.00 ? 733  ALA C CB 1 
ATOM 9234   N N  . PHE C 2 734  ? 1062.628 676.596 742.627 1.00 0.00 ? 734  PHE C N  1 
ATOM 9235   C CA . PHE C 2 734  ? 1061.721 677.288 741.758 1.00 0.00 ? 734  PHE C CA 1 
ATOM 9236   C C  . PHE C 2 734  ? 1060.700 677.862 742.679 1.00 0.00 ? 734  PHE C C  1 
ATOM 9237   O O  . PHE C 2 734  ? 1060.416 679.059 742.668 1.00 0.00 ? 734  PHE C O  1 
ATOM 9238   C CB . PHE C 2 734  ? 1060.973 676.385 740.762 1.00 0.00 ? 734  PHE C CB 1 
ATOM 9239   N N  . ARG C 2 735  ? 1060.110 676.969 743.491 1.00 0.00 ? 735  ARG C N  1 
ATOM 9240   C CA . ARG C 2 735  ? 1059.133 677.311 744.478 1.00 0.00 ? 735  ARG C CA 1 
ATOM 9241   C C  . ARG C 2 735  ? 1059.812 678.168 745.505 1.00 0.00 ? 735  ARG C C  1 
ATOM 9242   O O  . ARG C 2 735  ? 1059.210 679.084 746.061 1.00 0.00 ? 735  ARG C O  1 
ATOM 9243   C CB . ARG C 2 735  ? 1058.554 676.060 745.164 1.00 0.00 ? 735  ARG C CB 1 
ATOM 9244   N N  . ASN C 2 736  ? 1061.100 677.876 745.774 1.00 0.00 ? 736  ASN C N  1 
ATOM 9245   C CA . ASN C 2 736  ? 1061.902 678.579 746.738 1.00 0.00 ? 736  ASN C CA 1 
ATOM 9246   C C  . ASN C 2 736  ? 1062.050 680.007 746.298 1.00 0.00 ? 736  ASN C C  1 
ATOM 9247   O O  . ASN C 2 736  ? 1062.028 680.924 747.118 1.00 0.00 ? 736  ASN C O  1 
ATOM 9248   C CB . ASN C 2 736  ? 1063.321 677.992 746.843 1.00 0.00 ? 736  ASN C CB 1 
ATOM 9249   N N  . PHE C 2 737  ? 1062.181 680.221 744.976 1.00 0.00 ? 737  PHE C N  1 
ATOM 9250   C CA . PHE C 2 737  ? 1062.398 681.504 744.362 1.00 0.00 ? 737  PHE C CA 1 
ATOM 9251   C C  . PHE C 2 737  ? 1061.552 682.569 744.970 1.00 0.00 ? 737  PHE C C  1 
ATOM 9252   O O  . PHE C 2 737  ? 1060.422 682.341 745.398 1.00 0.00 ? 737  PHE C O  1 
ATOM 9253   C CB . PHE C 2 737  ? 1062.093 681.495 742.855 1.00 0.00 ? 737  PHE C CB 1 
ATOM 9254   N N  . SER C 2 738  ? 1062.131 683.786 745.032 1.00 0.00 ? 738  SER C N  1 
ATOM 9255   C CA . SER C 2 738  ? 1061.454 684.927 745.558 1.00 0.00 ? 738  SER C CA 1 
ATOM 9256   C C  . SER C 2 738  ? 1060.352 685.251 744.608 1.00 0.00 ? 738  SER C C  1 
ATOM 9257   O O  . SER C 2 738  ? 1060.372 684.858 743.443 1.00 0.00 ? 738  SER C O  1 
ATOM 9258   C CB . SER C 2 738  ? 1062.352 686.170 745.687 1.00 0.00 ? 738  SER C CB 1 
ATOM 9259   N N  . ASP C 2 739  ? 1059.353 686.000 745.101 1.00 0.00 ? 739  ASP C N  1 
ATOM 9260   C CA . ASP C 2 739  ? 1058.180 686.296 744.339 1.00 0.00 ? 739  ASP C CA 1 
ATOM 9261   C C  . ASP C 2 739  ? 1058.548 687.081 743.121 1.00 0.00 ? 739  ASP C C  1 
ATOM 9262   O O  . ASP C 2 739  ? 1057.957 686.891 742.060 1.00 0.00 ? 739  ASP C O  1 
ATOM 9263   C CB . ASP C 2 739  ? 1057.158 687.126 745.138 1.00 0.00 ? 739  ASP C CB 1 
ATOM 9264   N N  . GLU C 2 740  ? 1059.534 687.990 743.237 1.00 0.00 ? 740  GLU C N  1 
ATOM 9265   C CA . GLU C 2 740  ? 1059.861 688.859 742.140 1.00 0.00 ? 740  GLU C CA 1 
ATOM 9266   C C  . GLU C 2 740  ? 1060.382 688.090 740.957 1.00 0.00 ? 740  GLU C C  1 
ATOM 9267   O O  . GLU C 2 740  ? 1059.972 688.362 739.830 1.00 0.00 ? 740  GLU C O  1 
ATOM 9268   C CB . GLU C 2 740  ? 1060.869 689.945 742.548 1.00 0.00 ? 740  GLU C CB 1 
ATOM 9269   N N  . ILE C 2 741  ? 1061.316 687.140 741.174 1.00 0.00 ? 741  ILE C N  1 
ATOM 9270   C CA . ILE C 2 741  ? 1061.877 686.323 740.125 1.00 0.00 ? 741  ILE C CA 1 
ATOM 9271   C C  . ILE C 2 741  ? 1060.912 685.305 739.601 1.00 0.00 ? 741  ILE C C  1 
ATOM 9272   O O  . ILE C 2 741  ? 1060.846 685.071 738.396 1.00 0.00 ? 741  ILE C O  1 
ATOM 9273   C CB . ILE C 2 741  ? 1063.134 685.608 740.520 1.00 0.00 ? 741  ILE C CB 1 
ATOM 9274   N N  . ARG C 2 742  ? 1060.110 684.702 740.496 1.00 0.00 ? 742  ARG C N  1 
ATOM 9275   C CA . ARG C 2 742  ? 1059.249 683.597 740.178 1.00 0.00 ? 742  ARG C CA 1 
ATOM 9276   C C  . ARG C 2 742  ? 1058.397 684.006 739.014 1.00 0.00 ? 742  ARG C C  1 
ATOM 9277   O O  . ARG C 2 742  ? 1058.039 683.185 738.171 1.00 0.00 ? 742  ARG C O  1 
ATOM 9278   C CB . ARG C 2 742  ? 1058.335 683.270 741.376 1.00 0.00 ? 742  ARG C CB 1 
ATOM 9279   N N  . HIS C 2 743  ? 1058.032 685.298 738.984 1.00 0.00 ? 743  HIS C N  1 
ATOM 9280   C CA . HIS C 2 743  ? 1057.222 685.963 738.001 1.00 0.00 ? 743  HIS C CA 1 
ATOM 9281   C C  . HIS C 2 743  ? 1057.922 686.130 736.664 1.00 0.00 ? 743  HIS C C  1 
ATOM 9282   O O  . HIS C 2 743  ? 1057.295 685.997 735.614 1.00 0.00 ? 743  HIS C O  1 
ATOM 9283   C CB . HIS C 2 743  ? 1056.809 687.331 738.568 1.00 0.00 ? 743  HIS C CB 1 
ATOM 9284   N N  . ASN C 2 744  ? 1059.235 686.452 736.675 1.00 0.00 ? 744  ASN C N  1 
ATOM 9285   C CA . ASN C 2 744  ? 1060.060 686.765 735.529 1.00 0.00 ? 744  ASN C CA 1 
ATOM 9286   C C  . ASN C 2 744  ? 1060.429 685.598 734.653 1.00 0.00 ? 744  ASN C C  1 
ATOM 9287   O O  . ASN C 2 744  ? 1060.739 685.803 733.480 1.00 0.00 ? 744  ASN C O  1 
ATOM 9288   C CB . ASN C 2 744  ? 1061.364 687.483 735.911 1.00 0.00 ? 744  ASN C CB 1 
ATOM 9289   N N  . LEU C 2 745  ? 1060.404 684.357 735.173 1.00 0.00 ? 745  LEU C N  1 
ATOM 9290   C CA . LEU C 2 745  ? 1060.936 683.201 734.495 1.00 0.00 ? 745  LEU C CA 1 
ATOM 9291   C C  . LEU C 2 745  ? 1060.329 683.014 733.140 1.00 0.00 ? 745  LEU C C  1 
ATOM 9292   O O  . LEU C 2 745  ? 1061.033 682.580 732.229 1.00 0.00 ? 745  LEU C O  1 
ATOM 9293   C CB . LEU C 2 745  ? 1060.679 681.876 735.223 1.00 0.00 ? 745  LEU C CB 1 
ATOM 9294   N N  . SER C 2 746  ? 1059.033 683.342 732.965 1.00 0.00 ? 746  SER C N  1 
ATOM 9295   C CA . SER C 2 746  ? 1058.327 683.098 731.734 1.00 0.00 ? 746  SER C CA 1 
ATOM 9296   C C  . SER C 2 746  ? 1059.132 683.596 730.568 1.00 0.00 ? 746  SER C C  1 
ATOM 9297   O O  . SER C 2 746  ? 1059.362 682.852 729.619 1.00 0.00 ? 746  SER C O  1 
ATOM 9298   C CB . SER C 2 746  ? 1056.979 683.831 731.681 1.00 0.00 ? 746  SER C CB 1 
ATOM 9299   N N  . GLU C 2 747  ? 1059.586 684.860 730.608 1.00 0.00 ? 747  GLU C N  1 
ATOM 9300   C CA . GLU C 2 747  ? 1060.384 685.414 729.548 1.00 0.00 ? 747  GLU C CA 1 
ATOM 9301   C C  . GLU C 2 747  ? 1061.760 684.841 729.502 1.00 0.00 ? 747  GLU C C  1 
ATOM 9302   O O  . GLU C 2 747  ? 1062.371 684.838 728.434 1.00 0.00 ? 747  GLU C O  1 
ATOM 9303   C CB . GLU C 2 747  ? 1060.503 686.937 729.577 1.00 0.00 ? 747  GLU C CB 1 
ATOM 9304   N N  . VAL C 2 748  ? 1062.321 684.398 730.646 1.00 0.00 ? 748  VAL C N  1 
ATOM 9305   C CA . VAL C 2 748  ? 1063.654 683.864 730.588 1.00 0.00 ? 748  VAL C CA 1 
ATOM 9306   C C  . VAL C 2 748  ? 1063.593 682.710 729.645 1.00 0.00 ? 748  VAL C C  1 
ATOM 9307   O O  . VAL C 2 748  ? 1064.400 682.594 728.724 1.00 0.00 ? 748  VAL C O  1 
ATOM 9308   C CB . VAL C 2 748  ? 1064.147 683.354 731.910 1.00 0.00 ? 748  VAL C CB 1 
ATOM 9309   N N  . LEU C 2 749  ? 1062.592 681.839 729.847 1.00 0.00 ? 749  LEU C N  1 
ATOM 9310   C CA . LEU C 2 749  ? 1062.364 680.782 728.917 1.00 0.00 ? 749  LEU C CA 1 
ATOM 9311   C C  . LEU C 2 749  ? 1061.811 681.539 727.750 1.00 0.00 ? 749  LEU C C  1 
ATOM 9312   O O  . LEU C 2 749  ? 1061.252 682.616 727.947 1.00 0.00 ? 749  LEU C O  1 
ATOM 9313   C CB . LEU C 2 749  ? 1061.233 679.838 729.360 1.00 0.00 ? 749  LEU C CB 1 
ATOM 9314   N N  . LEU C 2 750  ? 1061.968 681.014 726.519 1.00 0.00 ? 750  LEU C N  1 
ATOM 9315   C CA . LEU C 2 750  ? 1061.455 681.601 725.307 1.00 0.00 ? 750  LEU C CA 1 
ATOM 9316   C C  . LEU C 2 750  ? 1062.430 682.647 724.828 1.00 0.00 ? 750  LEU C C  1 
ATOM 9317   O O  . LEU C 2 750  ? 1062.536 682.910 723.633 1.00 0.00 ? 750  LEU C O  1 
ATOM 9318   C CB . LEU C 2 750  ? 1060.058 682.236 725.526 1.00 0.00 ? 750  LEU C CB 1 
ATOM 9319   N N  . ALA C 2 751  ? 1063.175 683.306 725.735 1.00 0.00 ? 751  ALA C N  1 
ATOM 9320   C CA . ALA C 2 751  ? 1064.259 684.129 725.274 1.00 0.00 ? 751  ALA C CA 1 
ATOM 9321   C C  . ALA C 2 751  ? 1065.297 683.154 724.843 1.00 0.00 ? 751  ALA C C  1 
ATOM 9322   O O  . ALA C 2 751  ? 1065.922 683.301 723.798 1.00 0.00 ? 751  ALA C O  1 
ATOM 9323   C CB . ALA C 2 751  ? 1064.856 685.005 726.387 1.00 0.00 ? 751  ALA C CB 1 
ATOM 9324   N N  . THR C 2 752  ? 1065.469 682.114 725.688 1.00 0.00 ? 752  THR C N  1 
ATOM 9325   C CA . THR C 2 752  ? 1066.411 681.055 725.487 1.00 0.00 ? 752  THR C CA 1 
ATOM 9326   C C  . THR C 2 752  ? 1065.997 680.322 724.248 1.00 0.00 ? 752  THR C C  1 
ATOM 9327   O O  . THR C 2 752  ? 1066.803 680.094 723.348 1.00 0.00 ? 752  THR C O  1 
ATOM 9328   C CB . THR C 2 752  ? 1066.369 680.060 726.608 1.00 0.00 ? 752  THR C CB 1 
ATOM 9329   N N  . MET C 2 753  ? 1064.707 679.943 724.158 1.00 0.00 ? 753  MET C N  1 
ATOM 9330   C CA . MET C 2 753  ? 1064.275 679.314 722.946 1.00 0.00 ? 753  MET C CA 1 
ATOM 9331   C C  . MET C 2 753  ? 1063.944 680.458 722.037 1.00 0.00 ? 753  MET C C  1 
ATOM 9332   O O  . MET C 2 753  ? 1062.821 680.960 722.039 1.00 0.00 ? 753  MET C O  1 
ATOM 9333   C CB . MET C 2 753  ? 1062.952 678.543 723.078 1.00 0.00 ? 753  MET C CB 1 
ATOM 9334   N N  . ASN C 2 754  ? 1064.932 680.910 721.247 1.00 0.00 ? 754  ASN C N  1 
ATOM 9335   C CA . ASN C 2 754  ? 1064.737 682.032 720.374 1.00 0.00 ? 754  ASN C CA 1 
ATOM 9336   C C  . ASN C 2 754  ? 1066.078 682.230 719.761 1.00 0.00 ? 754  ASN C C  1 
ATOM 9337   O O  . ASN C 2 754  ? 1066.279 682.066 718.558 1.00 0.00 ? 754  ASN C O  1 
ATOM 9338   C CB . ASN C 2 754  ? 1064.373 683.336 721.105 1.00 0.00 ? 754  ASN C CB 1 
ATOM 9339   N N  . ILE C 2 755  ? 1067.010 682.630 720.643 1.00 0.00 ? 755  ILE C N  1 
ATOM 9340   C CA . ILE C 2 755  ? 1068.410 682.776 720.412 1.00 0.00 ? 755  ILE C CA 1 
ATOM 9341   C C  . ILE C 2 755  ? 1068.852 681.413 720.002 1.00 0.00 ? 755  ILE C C  1 
ATOM 9342   O O  . ILE C 2 755  ? 1069.549 681.225 719.009 1.00 0.00 ? 755  ILE C O  1 
ATOM 9343   C CB . ILE C 2 755  ? 1069.043 683.106 721.730 1.00 0.00 ? 755  ILE C CB 1 
ATOM 9344   N N  . LEU C 2 756  ? 1068.370 680.415 720.751 1.00 0.00 ? 756  LEU C N  1 
ATOM 9345   C CA . LEU C 2 756  ? 1068.693 679.036 720.574 1.00 0.00 ? 756  LEU C CA 1 
ATOM 9346   C C  . LEU C 2 756  ? 1068.251 678.620 719.205 1.00 0.00 ? 756  LEU C C  1 
ATOM 9347   O O  . LEU C 2 756  ? 1068.890 677.775 718.577 1.00 0.00 ? 756  LEU C O  1 
ATOM 9348   C CB . LEU C 2 756  ? 1067.976 678.216 721.673 1.00 0.00 ? 756  LEU C CB 1 
ATOM 9349   N N  . PHE C 2 757  ? 1067.088 679.141 718.765 1.00 0.00 ? 757  PHE C N  1 
ATOM 9350   C CA . PHE C 2 757  ? 1066.504 678.848 717.484 1.00 0.00 ? 757  PHE C CA 1 
ATOM 9351   C C  . PHE C 2 757  ? 1067.223 679.546 716.364 1.00 0.00 ? 757  PHE C C  1 
ATOM 9352   O O  . PHE C 2 757  ? 1067.662 678.919 715.400 1.00 0.00 ? 757  PHE C O  1 
ATOM 9353   C CB . PHE C 2 757  ? 1065.027 679.295 717.466 1.00 0.00 ? 757  PHE C CB 1 
ATOM 9354   N N  . THR C 2 758  ? 1067.371 680.880 716.491 1.00 0.00 ? 758  THR C N  1 
ATOM 9355   C CA . THR C 2 758  ? 1067.948 681.742 715.496 1.00 0.00 ? 758  THR C CA 1 
ATOM 9356   C C  . THR C 2 758  ? 1069.399 681.449 715.301 1.00 0.00 ? 758  THR C C  1 
ATOM 9357   O O  . THR C 2 758  ? 1069.881 681.411 714.170 1.00 0.00 ? 758  THR C O  1 
ATOM 9358   C CB . THR C 2 758  ? 1067.760 683.189 715.833 1.00 0.00 ? 758  THR C CB 1 
ATOM 9359   N N  . GLN C 2 759  ? 1070.128 681.233 716.405 1.00 0.00 ? 759  GLN C N  1 
ATOM 9360   C CA . GLN C 2 759  ? 1071.529 680.951 716.335 1.00 0.00 ? 759  GLN C CA 1 
ATOM 9361   C C  . GLN C 2 759  ? 1071.703 679.640 715.637 1.00 0.00 ? 759  GLN C C  1 
ATOM 9362   O O  . GLN C 2 759  ? 1072.553 679.485 714.759 1.00 0.00 ? 759  GLN C O  1 
ATOM 9363   C CB . GLN C 2 759  ? 1072.114 680.853 717.751 1.00 0.00 ? 759  GLN C CB 1 
ATOM 9364   N N  . PHE C 2 760  ? 1070.862 678.664 716.020 1.00 0.00 ? 760  PHE C N  1 
ATOM 9365   C CA . PHE C 2 760  ? 1070.872 677.354 715.450 1.00 0.00 ? 760  PHE C CA 1 
ATOM 9366   C C  . PHE C 2 760  ? 1069.945 677.354 714.265 1.00 0.00 ? 760  PHE C C  1 
ATOM 9367   O O  . PHE C 2 760  ? 1069.023 676.556 714.101 1.00 0.00 ? 760  PHE C O  1 
ATOM 9368   C CB . PHE C 2 760  ? 1070.586 676.302 716.562 1.00 0.00 ? 760  PHE C CB 1 
ATOM 9369   N N  . LYS C 2 761  ? 1070.197 678.305 713.353 1.00 0.00 ? 761  LYS C N  1 
ATOM 9370   C CA . LYS C 2 761  ? 1069.504 678.259 712.110 1.00 0.00 ? 761  LYS C CA 1 
ATOM 9371   C C  . LYS C 2 761  ? 1070.300 677.240 711.385 1.00 0.00 ? 761  LYS C C  1 
ATOM 9372   O O  . LYS C 2 761  ? 1071.525 677.261 711.472 1.00 0.00 ? 761  LYS C O  1 
ATOM 9373   C CB . LYS C 2 761  ? 1069.541 679.605 711.366 1.00 0.00 ? 761  LYS C CB 1 
ATOM 9374   N N  . ARG C 2 762  ? 1069.646 676.300 710.680 1.00 0.00 ? 762  ARG C N  1 
ATOM 9375   C CA . ARG C 2 762  ? 1070.427 675.255 710.090 1.00 0.00 ? 762  ARG C CA 1 
ATOM 9376   C C  . ARG C 2 762  ? 1071.349 675.900 709.111 1.00 0.00 ? 762  ARG C C  1 
ATOM 9377   O O  . ARG C 2 762  ? 1070.928 676.634 708.220 1.00 0.00 ? 762  ARG C O  1 
ATOM 9378   C CB . ARG C 2 762  ? 1069.566 674.175 709.404 1.00 0.00 ? 762  ARG C CB 1 
ATOM 9379   N N  . LEU C 2 763  ? 1072.657 675.630 709.284 1.00 0.00 ? 763  LEU C N  1 
ATOM 9380   C CA . LEU C 2 763  ? 1073.683 676.266 708.515 1.00 0.00 ? 763  LEU C CA 1 
ATOM 9381   C C  . LEU C 2 763  ? 1073.776 675.673 707.147 1.00 0.00 ? 763  LEU C C  1 
ATOM 9382   O O  . LEU C 2 763  ? 1073.177 674.645 706.840 1.00 0.00 ? 763  LEU C O  1 
ATOM 9383   C CB . LEU C 2 763  ? 1075.080 676.231 709.154 1.00 0.00 ? 763  LEU C CB 1 
ATOM 9384   N N  . LYS C 2 764  ? 1074.544 676.373 706.310 1.00 0.00 ? 764  LYS C N  1 
ATOM 9385   C CA . LYS C 2 764  ? 1074.766 676.057 704.934 1.00 0.00 ? 764  LYS C CA 1 
ATOM 9386   C C  . LYS C 2 764  ? 1075.612 674.824 704.867 1.00 0.00 ? 764  LYS C C  1 
ATOM 9387   O O  . LYS C 2 764  ? 1075.303 673.795 705.470 1.00 0.00 ? 764  LYS C O  1 
ATOM 9388   C CB . LYS C 2 764  ? 1075.524 677.167 704.188 1.00 0.00 ? 764  LYS C CB 1 
ATOM 9389   N N  . GLY C 2 765  ? 1076.721 674.904 704.101 1.00 0.00 ? 765  GLY C N  1 
ATOM 9390   C CA . GLY C 2 765  ? 1077.612 673.787 703.969 1.00 0.00 ? 765  GLY C CA 1 
ATOM 9391   C C  . GLY C 2 765  ? 1078.432 673.681 705.199 1.00 0.00 ? 765  GLY C C  1 
ATOM 9392   O O  . GLY C 2 765  ? 1079.453 672.998 705.220 1.00 0.00 ? 765  GLY C O  1 
ATOM 9393   N N  . ILE C 2 778  ? 1086.173 670.708 709.930 1.00 0.00 ? 778  ILE C N  1 
ATOM 9394   C CA . ILE C 2 778  ? 1084.961 671.412 710.222 1.00 0.00 ? 778  ILE C CA 1 
ATOM 9395   C C  . ILE C 2 778  ? 1084.451 670.894 711.518 1.00 0.00 ? 778  ILE C C  1 
ATOM 9396   O O  . ILE C 2 778  ? 1084.431 669.687 711.749 1.00 0.00 ? 778  ILE C O  1 
ATOM 9397   C CB . ILE C 2 778  ? 1083.871 671.220 709.208 1.00 0.00 ? 778  ILE C CB 1 
ATOM 9398   N N  . GLU C 2 779  ? 1084.072 671.806 712.429 1.00 0.00 ? 779  GLU C N  1 
ATOM 9399   C CA . GLU C 2 779  ? 1083.528 671.357 713.671 1.00 0.00 ? 779  GLU C CA 1 
ATOM 9400   C C  . GLU C 2 779  ? 1082.299 672.170 713.912 1.00 0.00 ? 779  GLU C C  1 
ATOM 9401   O O  . GLU C 2 779  ? 1082.378 673.384 714.088 1.00 0.00 ? 779  GLU C O  1 
ATOM 9402   C CB . GLU C 2 779  ? 1084.502 671.589 714.835 1.00 0.00 ? 779  GLU C CB 1 
ATOM 9403   N N  . ASP C 2 780  ? 1081.118 671.522 713.905 1.00 0.00 ? 780  ASP C N  1 
ATOM 9404   C CA . ASP C 2 780  ? 1079.906 672.250 714.136 1.00 0.00 ? 780  ASP C CA 1 
ATOM 9405   C C  . ASP C 2 780  ? 1079.185 671.522 715.222 1.00 0.00 ? 780  ASP C C  1 
ATOM 9406   O O  . ASP C 2 780  ? 1078.527 670.519 714.950 1.00 0.00 ? 780  ASP C O  1 
ATOM 9407   C CB . ASP C 2 780  ? 1078.953 672.238 712.925 1.00 0.00 ? 780  ASP C CB 1 
ATOM 9408   N N  . ARG C 2 781  ? 1079.267 671.985 716.487 1.00 0.00 ? 781  ARG C N  1 
ATOM 9409   C CA . ARG C 2 781  ? 1078.557 671.209 717.461 1.00 0.00 ? 781  ARG C CA 1 
ATOM 9410   C C  . ARG C 2 781  ? 1077.215 671.836 717.670 1.00 0.00 ? 781  ARG C C  1 
ATOM 9411   O O  . ARG C 2 781  ? 1077.026 672.717 718.506 1.00 0.00 ? 781  ARG C O  1 
ATOM 9412   C CB . ARG C 2 781  ? 1079.276 671.057 718.819 1.00 0.00 ? 781  ARG C CB 1 
ATOM 9413   N N  . ASP C 2 782  ? 1076.247 671.383 716.854 1.00 0.00 ? 782  ASP C N  1 
ATOM 9414   C CA . ASP C 2 782  ? 1074.872 671.782 716.883 1.00 0.00 ? 782  ASP C CA 1 
ATOM 9415   C C  . ASP C 2 782  ? 1074.243 671.141 718.078 1.00 0.00 ? 782  ASP C C  1 
ATOM 9416   O O  . ASP C 2 782  ? 1073.245 671.624 718.611 1.00 0.00 ? 782  ASP C O  1 
ATOM 9417   C CB . ASP C 2 782  ? 1074.118 671.302 715.634 1.00 0.00 ? 782  ASP C CB 1 
ATOM 9418   N N  . SER C 2 783  ? 1074.824 670.008 718.515 1.00 0.00 ? 783  SER C N  1 
ATOM 9419   C CA . SER C 2 783  ? 1074.247 669.220 719.565 1.00 0.00 ? 783  SER C CA 1 
ATOM 9420   C C  . SER C 2 783  ? 1074.036 670.084 720.765 1.00 0.00 ? 783  SER C C  1 
ATOM 9421   O O  . SER C 2 783  ? 1072.970 670.041 721.377 1.00 0.00 ? 783  SER C O  1 
ATOM 9422   C CB . SER C 2 783  ? 1075.127 668.031 719.976 1.00 0.00 ? 783  SER C CB 1 
ATOM 9423   N N  . GLN C 2 784  ? 1075.036 670.896 721.153 1.00 0.00 ? 784  GLN C N  1 
ATOM 9424   C CA . GLN C 2 784  ? 1074.776 671.777 722.251 1.00 0.00 ? 784  GLN C CA 1 
ATOM 9425   C C  . GLN C 2 784  ? 1074.016 672.929 721.663 1.00 0.00 ? 784  GLN C C  1 
ATOM 9426   O O  . GLN C 2 784  ? 1074.069 673.148 720.455 1.00 0.00 ? 784  GLN C O  1 
ATOM 9427   C CB . GLN C 2 784  ? 1076.044 672.271 722.970 1.00 0.00 ? 784  GLN C CB 1 
ATOM 9428   N N  . LEU C 2 785  ? 1073.304 673.705 722.502 1.00 0.00 ? 785  LEU C N  1 
ATOM 9429   C CA . LEU C 2 785  ? 1072.416 674.728 722.022 1.00 0.00 ? 785  LEU C CA 1 
ATOM 9430   C C  . LEU C 2 785  ? 1071.236 674.026 721.436 1.00 0.00 ? 785  LEU C C  1 
ATOM 9431   O O  . LEU C 2 785  ? 1070.390 674.630 720.781 1.00 0.00 ? 785  LEU C O  1 
ATOM 9432   C CB . LEU C 2 785  ? 1072.992 675.627 720.913 1.00 0.00 ? 785  LEU C CB 1 
ATOM 9433   N N  . ARG C 2 786  ? 1071.159 672.712 721.697 1.00 0.00 ? 786  ARG C N  1 
ATOM 9434   C CA . ARG C 2 786  ? 1070.101 671.858 721.254 1.00 0.00 ? 786  ARG C CA 1 
ATOM 9435   C C  . ARG C 2 786  ? 1069.680 671.124 722.480 1.00 0.00 ? 786  ARG C C  1 
ATOM 9436   O O  . ARG C 2 786  ? 1068.493 670.978 722.770 1.00 0.00 ? 786  ARG C O  1 
ATOM 9437   C CB . ARG C 2 786  ? 1070.611 670.831 720.231 1.00 0.00 ? 786  ARG C CB 1 
ATOM 9438   N N  . SER C 2 787  ? 1070.684 670.639 723.233 1.00 0.00 ? 787  SER C N  1 
ATOM 9439   C CA . SER C 2 787  ? 1070.430 669.976 724.472 1.00 0.00 ? 787  SER C CA 1 
ATOM 9440   C C  . SER C 2 787  ? 1069.858 670.999 725.394 1.00 0.00 ? 787  SER C C  1 
ATOM 9441   O O  . SER C 2 787  ? 1069.041 670.687 726.258 1.00 0.00 ? 787  SER C O  1 
ATOM 9442   C CB . SER C 2 787  ? 1071.706 669.421 725.133 1.00 0.00 ? 787  SER C CB 1 
ATOM 9443   N N  . GLN C 2 788  ? 1070.279 672.266 725.218 1.00 0.00 ? 788  GLN C N  1 
ATOM 9444   C CA . GLN C 2 788  ? 1069.839 673.329 726.075 1.00 0.00 ? 788  GLN C CA 1 
ATOM 9445   C C  . GLN C 2 788  ? 1068.362 673.519 725.897 1.00 0.00 ? 788  GLN C C  1 
ATOM 9446   O O  . GLN C 2 788  ? 1067.632 673.736 726.861 1.00 0.00 ? 788  GLN C O  1 
ATOM 9447   C CB . GLN C 2 788  ? 1070.539 674.663 725.773 1.00 0.00 ? 788  GLN C CB 1 
ATOM 9448   N N  . ALA C 2 789  ? 1067.870 673.453 724.649 1.00 0.00 ? 789  ALA C N  1 
ATOM 9449   C CA . ALA C 2 789  ? 1066.464 673.637 724.438 1.00 0.00 ? 789  ALA C CA 1 
ATOM 9450   C C  . ALA C 2 789  ? 1065.730 672.523 725.126 1.00 0.00 ? 789  ALA C C  1 
ATOM 9451   O O  . ALA C 2 789  ? 1064.694 672.745 725.749 1.00 0.00 ? 789  ALA C O  1 
ATOM 9452   C CB . ALA C 2 789  ? 1066.073 673.605 722.950 1.00 0.00 ? 789  ALA C CB 1 
ATOM 9453   N N  . ARG C 2 790  ? 1066.272 671.292 725.038 1.00 0.00 ? 790  ARG C N  1 
ATOM 9454   C CA . ARG C 2 790  ? 1065.625 670.113 725.550 1.00 0.00 ? 790  ARG C CA 1 
ATOM 9455   C C  . ARG C 2 790  ? 1065.428 670.222 727.033 1.00 0.00 ? 790  ARG C C  1 
ATOM 9456   O O  . ARG C 2 790  ? 1064.346 669.972 727.559 1.00 0.00 ? 790  ARG C O  1 
ATOM 9457   C CB . ARG C 2 790  ? 1066.487 668.861 725.347 1.00 0.00 ? 790  ARG C CB 1 
ATOM 9458   N N  . THR C 2 791  ? 1066.485 670.607 727.757 1.00 0.00 ? 791  THR C N  1 
ATOM 9459   C CA . THR C 2 791  ? 1066.416 670.708 729.184 1.00 0.00 ? 791  THR C CA 1 
ATOM 9460   C C  . THR C 2 791  ? 1065.441 671.781 729.537 1.00 0.00 ? 791  THR C C  1 
ATOM 9461   O O  . THR C 2 791  ? 1064.685 671.659 730.500 1.00 0.00 ? 791  THR C O  1 
ATOM 9462   C CB . THR C 2 791  ? 1067.771 671.025 729.752 1.00 0.00 ? 791  THR C CB 1 
ATOM 9463   N N  . LEU C 2 792  ? 1065.436 672.865 728.745 1.00 0.00 ? 792  LEU C N  1 
ATOM 9464   C CA . LEU C 2 792  ? 1064.597 673.995 729.000 1.00 0.00 ? 792  LEU C CA 1 
ATOM 9465   C C  . LEU C 2 792  ? 1063.168 673.556 728.844 1.00 0.00 ? 792  LEU C C  1 
ATOM 9466   O O  . LEU C 2 792  ? 1062.321 673.923 729.654 1.00 0.00 ? 792  LEU C O  1 
ATOM 9467   C CB . LEU C 2 792  ? 1064.869 675.121 727.985 1.00 0.00 ? 792  LEU C CB 1 
ATOM 9468   N N  . ILE C 2 793  ? 1062.856 672.751 727.799 1.00 0.00 ? 793  ILE C N  1 
ATOM 9469   C CA . ILE C 2 793  ? 1061.497 672.335 727.569 1.00 0.00 ? 793  ILE C CA 1 
ATOM 9470   C C  . ILE C 2 793  ? 1061.032 671.444 728.674 1.00 0.00 ? 793  ILE C C  1 
ATOM 9471   O O  . ILE C 2 793  ? 1059.874 671.521 729.077 1.00 0.00 ? 793  ILE C O  1 
ATOM 9472   C CB . ILE C 2 793  ? 1061.234 671.660 726.245 1.00 0.00 ? 793  ILE C CB 1 
ATOM 9473   N N  . THR C 2 794  ? 1061.903 670.554 729.189 1.00 0.00 ? 794  THR C N  1 
ATOM 9474   C CA . THR C 2 794  ? 1061.470 669.698 730.258 1.00 0.00 ? 794  THR C CA 1 
ATOM 9475   C C  . THR C 2 794  ? 1061.104 670.579 731.408 1.00 0.00 ? 794  THR C C  1 
ATOM 9476   O O  . THR C 2 794  ? 1060.125 670.335 732.113 1.00 0.00 ? 794  THR C O  1 
ATOM 9477   C CB . THR C 2 794  ? 1062.520 668.748 730.758 1.00 0.00 ? 794  THR C CB 1 
ATOM 9478   N N  . PHE C 2 795  ? 1061.907 671.638 731.616 1.00 0.00 ? 795  PHE C N  1 
ATOM 9479   C CA . PHE C 2 795  ? 1061.708 672.588 732.666 1.00 0.00 ? 795  PHE C CA 1 
ATOM 9480   C C  . PHE C 2 795  ? 1060.361 673.222 732.505 1.00 0.00 ? 795  PHE C C  1 
ATOM 9481   O O  . PHE C 2 795  ? 1059.543 673.181 733.421 1.00 0.00 ? 795  PHE C O  1 
ATOM 9482   C CB . PHE C 2 795  ? 1062.825 673.647 732.602 1.00 0.00 ? 795  PHE C CB 1 
ATOM 9483   N N  . ALA C 2 796  ? 1060.069 673.758 731.305 1.00 0.00 ? 796  ALA C N  1 
ATOM 9484   C CA . ALA C 2 796  ? 1058.841 674.437 731.003 1.00 0.00 ? 796  ALA C CA 1 
ATOM 9485   C C  . ALA C 2 796  ? 1057.705 673.480 731.151 1.00 0.00 ? 796  ALA C C  1 
ATOM 9486   O O  . ALA C 2 796  ? 1056.603 673.873 731.523 1.00 0.00 ? 796  ALA C O  1 
ATOM 9487   C CB . ALA C 2 796  ? 1058.797 674.976 729.562 1.00 0.00 ? 796  ALA C CB 1 
ATOM 9488   N N  . GLY C 2 797  ? 1057.932 672.204 730.801 1.00 0.00 ? 797  GLY C N  1 
ATOM 9489   C CA . GLY C 2 797  ? 1056.918 671.194 730.882 1.00 0.00 ? 797  GLY C CA 1 
ATOM 9490   C C  . GLY C 2 797  ? 1056.528 670.971 732.309 1.00 0.00 ? 797  GLY C C  1 
ATOM 9491   O O  . GLY C 2 797  ? 1055.360 670.721 732.601 1.00 0.00 ? 797  GLY C O  1 
ATOM 9492   N N  . MET C 2 798  ? 1057.514 670.968 733.225 1.00 0.00 ? 798  MET C N  1 
ATOM 9493   C CA . MET C 2 798  ? 1057.237 670.768 734.615 1.00 0.00 ? 798  MET C CA 1 
ATOM 9494   C C  . MET C 2 798  ? 1056.507 671.936 735.206 1.00 0.00 ? 798  MET C C  1 
ATOM 9495   O O  . MET C 2 798  ? 1055.571 671.724 735.976 1.00 0.00 ? 798  MET C O  1 
ATOM 9496   C CB . MET C 2 798  ? 1058.506 670.439 735.416 1.00 0.00 ? 798  MET C CB 1 
ATOM 9497   N N  . ILE C 2 799  ? 1056.887 673.199 734.890 1.00 0.00 ? 799  ILE C N  1 
ATOM 9498   C CA . ILE C 2 799  ? 1056.100 674.242 735.486 1.00 0.00 ? 799  ILE C CA 1 
ATOM 9499   C C  . ILE C 2 799  ? 1055.367 675.026 734.409 1.00 0.00 ? 799  ILE C C  1 
ATOM 9500   O O  . ILE C 2 799  ? 1055.876 676.012 733.881 1.00 0.00 ? 799  ILE C O  1 
ATOM 9501   C CB . ILE C 2 799  ? 1056.894 675.182 736.391 1.00 0.00 ? 799  ILE C CB 1 
ATOM 9502   N N  . PRO C 2 800  ? 1054.257 674.527 733.920 1.00 0.00 ? 800  PRO C N  1 
ATOM 9503   C CA . PRO C 2 800  ? 1053.407 675.353 733.110 1.00 0.00 ? 800  PRO C CA 1 
ATOM 9504   C C  . PRO C 2 800  ? 1052.264 675.879 733.904 1.00 0.00 ? 800  PRO C C  1 
ATOM 9505   O O  . PRO C 2 800  ? 1051.693 676.906 733.548 1.00 0.00 ? 800  PRO C O  1 
ATOM 9506   C CB . PRO C 2 800  ? 1052.951 674.494 731.940 1.00 0.00 ? 800  PRO C CB 1 
ATOM 9507   N N  . TYR C 2 801  ? 1051.872 675.130 734.948 1.00 0.00 ? 801  TYR C N  1 
ATOM 9508   C CA . TYR C 2 801  ? 1050.742 675.487 735.743 1.00 0.00 ? 801  TYR C CA 1 
ATOM 9509   C C  . TYR C 2 801  ? 1051.111 676.652 736.587 1.00 0.00 ? 801  TYR C C  1 
ATOM 9510   O O  . TYR C 2 801  ? 1050.306 677.554 736.818 1.00 0.00 ? 801  TYR C O  1 
ATOM 9511   C CB . TYR C 2 801  ? 1050.202 674.303 736.557 1.00 0.00 ? 801  T