data_5IR3
# 
_entry.id   5IR3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5IR3         
WWPDB D_1000211439 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 3BDX unspecified 
PDB . 3B5G unspecified 
PDB . 5C9K unspecified 
PDB . 2W0K unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5IR3 
_pdbx_database_status.recvd_initial_deposition_date   2016-03-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hernandez-Santoyo, A.' 1 
'Rodriguez-Romero, A.'  2 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? UK ? ? primary 'FEBS J.'       ?      ?    1742-4658 ? ? 284 ? 3702 3717 
'Stabilizing an amyloidogenic lambda 6 light chain variable domain.'                                                           
2017 ? 10.1111/febs.14265   28898537 ? 
? ? ? ? ? ? ? UK ? ? 1       'J. Mol. Biol.' JMOBAK 0070 1089-8638 ? ? 396 ? 280  292  
'A single mutation at the sheet switch region results in conformational changes favoring lambda6 light-chain fibrillogenesis.' 
2010 ? 10.1016/J.JMB.2009.1 19941869 ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Luna-Martinez, O.D.'      1  
primary 'Hernandez-Santoyo, A.'    2  
primary 'Villalba-Velazquez, M.I.' 3  
primary 'Sanchez-Alcala, R.'       4  
primary 'Fernandez-Velasco, D.A.'  5  
primary 'Becerril, B.'             6  
1       'Hernandez-Santoyo, A.'    7  
1       'Del Pozo-Yauner, L.'      8  
1       'Fuentes-Silva, D.'        9  
1       'Ortiz, E.'                10 
1       'Rudino-Pinera, E.'        11 
1       'Sanchez-Lopez, R.'        12 
1       'Horjales, E.'             13 
1       'Becerril, B.'             14 
1       'Rodriguez-Romero, A.'     15 
# 
_cell.entry_id           5IR3 
_cell.length_a           71.121 
_cell.length_b           71.121 
_cell.length_c           96.453 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5IR3 
_symmetry.space_group_name_H-M             'I 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                98 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ig lambda chain V-VI region AR' 11926.821 1   ? ? ? ? 
2 non-polymer syn 'ACETATE ION'                    59.044    1   ? ? ? ? 
3 water       nat water                            18.015    156 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DFMLTQPHSVSESPGKTVTFSCTGSGGSIADSFVQWYQQRPGSAPTTVIYDDNQRPSGVPDRFSGSIDDSANSASLTISG
LKTEDEADYYCQSYNSNHHVVFGGGTKVTVLG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DFMLTQPHSVSESPGKTVTFSCTGSGGSIADSFVQWYQQRPGSAPTTVIYDDNQRPSGVPDRFSGSIDDSANSASLTISG
LKTEDEADYYCQSYNSNHHVVFGGGTKVTVLG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   PHE n 
1 3   MET n 
1 4   LEU n 
1 5   THR n 
1 6   GLN n 
1 7   PRO n 
1 8   HIS n 
1 9   SER n 
1 10  VAL n 
1 11  SER n 
1 12  GLU n 
1 13  SER n 
1 14  PRO n 
1 15  GLY n 
1 16  LYS n 
1 17  THR n 
1 18  VAL n 
1 19  THR n 
1 20  PHE n 
1 21  SER n 
1 22  CYS n 
1 23  THR n 
1 24  GLY n 
1 25  SER n 
1 26  GLY n 
1 27  GLY n 
1 28  SER n 
1 29  ILE n 
1 30  ALA n 
1 31  ASP n 
1 32  SER n 
1 33  PHE n 
1 34  VAL n 
1 35  GLN n 
1 36  TRP n 
1 37  TYR n 
1 38  GLN n 
1 39  GLN n 
1 40  ARG n 
1 41  PRO n 
1 42  GLY n 
1 43  SER n 
1 44  ALA n 
1 45  PRO n 
1 46  THR n 
1 47  THR n 
1 48  VAL n 
1 49  ILE n 
1 50  TYR n 
1 51  ASP n 
1 52  ASP n 
1 53  ASN n 
1 54  GLN n 
1 55  ARG n 
1 56  PRO n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  PRO n 
1 61  ASP n 
1 62  ARG n 
1 63  PHE n 
1 64  SER n 
1 65  GLY n 
1 66  SER n 
1 67  ILE n 
1 68  ASP n 
1 69  ASP n 
1 70  SER n 
1 71  ALA n 
1 72  ASN n 
1 73  SER n 
1 74  ALA n 
1 75  SER n 
1 76  LEU n 
1 77  THR n 
1 78  ILE n 
1 79  SER n 
1 80  GLY n 
1 81  LEU n 
1 82  LYS n 
1 83  THR n 
1 84  GLU n 
1 85  ASP n 
1 86  GLU n 
1 87  ALA n 
1 88  ASP n 
1 89  TYR n 
1 90  TYR n 
1 91  CYS n 
1 92  GLN n 
1 93  SER n 
1 94  TYR n 
1 95  ASN n 
1 96  SER n 
1 97  ASN n 
1 98  HIS n 
1 99  HIS n 
1 100 VAL n 
1 101 VAL n 
1 102 PHE n 
1 103 GLY n 
1 104 GLY n 
1 105 GLY n 
1 106 THR n 
1 107 LYS n 
1 108 VAL n 
1 109 THR n 
1 110 VAL n 
1 111 LEU n 
1 112 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   112 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               W3110 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PSYN1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LV601_HUMAN 
_struct_ref.pdbx_db_accession          P01721 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DFMLTQPHSVSESPGKTVTFSCTGSGGSIADSFVQWYQQRPGSAPTTVIYDDNQRPSGVPDRFSGSIDDSANSASLTISG
LKTEDEADYYCQSYNSNHHVVFGGGTKVTVLG
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5IR3 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 112 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P01721 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  112 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       112 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'   ? 'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5IR3 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.43 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.5 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M Sodium cacodylate pH 6.5; 1.4M Sodium acetate' 
_exptl_crystal_grow.pdbx_pH_range   6.5-7.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           105 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU RAXIS IV++' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-03-28 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5IR3 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             34.810 
_reflns.d_resolution_high            1.700 
_reflns.number_obs                   13830 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.08900 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.3000 
_reflns.B_iso_Wilson_estimate        12.20 
_reflns.pdbx_redundancy              4.300 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.77 
_reflns_shell.percent_possible_all   99.4 
_reflns_shell.Rmerge_I_obs           0.48600 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.300 
_reflns_shell.pdbx_redundancy        4.30 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5IR3 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     13829 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.250 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.81 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    99.1 
_refine.ls_R_factor_obs                          0.176 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.174 
_refine.ls_R_factor_R_free                       0.207 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.710 
_refine.ls_number_reflns_R_free                  651 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3B5G 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.190 
_refine.pdbx_overall_phase_error                 20.790 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        834 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             156 
_refine_hist.number_atoms_total               994 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        34.81 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.006  ? ? 918  'X-RAY DIFFRACTION' ? 
f_angle_d          0.971  ? ? 1267 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.451 ? ? 340  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.098  ? ? 140  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 170  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.7003 1.8316  2587 0.2413 100.00 0.2782 . . 135 . . 
'X-RAY DIFFRACTION' . 1.8316 2.0159  2598 0.1991 99.00  0.2217 . . 133 . . 
'X-RAY DIFFRACTION' . 2.0159 2.3076  2618 0.1746 100.00 0.2519 . . 128 . . 
'X-RAY DIFFRACTION' . 2.3076 2.9071  2656 0.1732 100.00 0.2079 . . 127 . . 
'X-RAY DIFFRACTION' . 2.9071 34.8153 2719 0.1528 97.00  0.1708 . . 128 . . 
# 
_struct.entry_id                     5IR3 
_struct.title                        
;Crystal structure of the recombinant highest fibrillogenic natural mutant (obtained from patient AR) derived from lambda 6 light chain variable domain
;
_struct.pdbx_descriptor              'Ig lambda chain V-VI region AR' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5IR3 
_struct_keywords.text            'BETA-SANDWICH, IMMUNOGLOBULIN, AL AMYLOIDOSIS, IMMUNE SYSTEM' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 28 ? SER A 32 ? SER A 28 SER A 32 5 ? 5 
HELX_P HELX_P2 AA2 LYS A 82 ? GLU A 86 ? LYS A 82 GLU A 86 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 22 SG A ? ? 1_555 A CYS 91 SG A ? A CYS 22 A CYS 91 1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf2 disulf ? ? A CYS 22 SG B ? ? 1_555 A CYS 91 SG B ? A CYS 22 A CYS 91 1_555 ? ? ? ? ? ? ? 2.034 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 5 ? 
AA3 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 3   ? THR A 5   ? MET A 3   THR A 5   
AA1 2 VAL A 18  ? SER A 25  ? VAL A 18  SER A 25  
AA1 3 SER A 73  ? ILE A 78  ? SER A 73  ILE A 78  
AA1 4 PHE A 63  ? ASP A 68  ? PHE A 63  ASP A 68  
AA2 1 SER A 9   ? GLU A 12  ? SER A 9   GLU A 12  
AA2 2 THR A 106 ? VAL A 110 ? THR A 106 VAL A 110 
AA2 3 ALA A 87  ? TYR A 94  ? ALA A 87  TYR A 94  
AA2 4 GLN A 35  ? GLN A 39  ? GLN A 35  GLN A 39  
AA2 5 THR A 46  ? ILE A 49  ? THR A 46  ILE A 49  
AA3 1 SER A 9   ? GLU A 12  ? SER A 9   GLU A 12  
AA3 2 THR A 106 ? VAL A 110 ? THR A 106 VAL A 110 
AA3 3 ALA A 87  ? TYR A 94  ? ALA A 87  TYR A 94  
AA3 4 VAL A 100 ? PHE A 102 ? VAL A 100 PHE A 102 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N MET A 3   ? N MET A 3   O SER A 25  ? O SER A 25  
AA1 2 3 N VAL A 18  ? N VAL A 18  O ILE A 78  ? O ILE A 78  
AA1 3 4 O SER A 73  ? O SER A 73  N ASP A 68  ? N ASP A 68  
AA2 1 2 N VAL A 10  ? N VAL A 10  O THR A 109 ? O THR A 109 
AA2 2 3 O VAL A 108 ? O VAL A 108 N ALA A 87  ? N ALA A 87  
AA2 3 4 O GLN A 92  ? O GLN A 92  N GLN A 35  ? N GLN A 35  
AA2 4 5 N TRP A 36  ? N TRP A 36  O VAL A 48  ? O VAL A 48  
AA3 1 2 N VAL A 10  ? N VAL A 10  O THR A 109 ? O THR A 109 
AA3 2 3 O VAL A 108 ? O VAL A 108 N ALA A 87  ? N ALA A 87  
AA3 3 4 N SER A 93  ? N SER A 93  O VAL A 101 ? O VAL A 101 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    ACT 
_struct_site.pdbx_auth_seq_id     201 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'binding site for residue ACT A 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 SER A 32 ? SER A 32  . ? 1_555 ? 
2 AC1 5 TYR A 94 ? TYR A 94  . ? 1_555 ? 
3 AC1 5 ASN A 95 ? ASN A 95  . ? 1_555 ? 
4 AC1 5 HIS A 98 ? HIS A 98  . ? 1_555 ? 
5 AC1 5 HOH C .  ? HOH A 331 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5IR3 
_atom_sites.fract_transf_matrix[1][1]   0.014061 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014061 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010368 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 27.491 35.015 2.906   1.00 28.43 ?  1   ASP A N   1 
ATOM   2    C CA  . ASP A 1 1   ? 26.802 34.868 1.629   1.00 35.25 ?  1   ASP A CA  1 
ATOM   3    C C   . ASP A 1 1   ? 25.328 34.573 1.862   1.00 27.31 ?  1   ASP A C   1 
ATOM   4    O O   . ASP A 1 1   ? 24.965 33.980 2.875   1.00 33.92 ?  1   ASP A O   1 
ATOM   5    C CB  . ASP A 1 1   ? 27.418 33.726 0.827   1.00 39.51 ?  1   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 28.925 33.845 0.707   1.00 58.14 ?  1   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 29.516 34.719 1.384   1.00 46.99 ?  1   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 29.519 33.055 -0.059  1.00 63.30 -1 1   ASP A OD2 1 
ATOM   9    N N   . PHE A 1 2   ? 24.482 34.976 0.919   1.00 17.99 ?  2   PHE A N   1 
ATOM   10   C CA  . PHE A 1 2   ? 23.052 34.693 1.017   1.00 21.22 ?  2   PHE A CA  1 
ATOM   11   C C   . PHE A 1 2   ? 22.772 33.267 0.553   1.00 19.28 ?  2   PHE A C   1 
ATOM   12   O O   . PHE A 1 2   ? 23.195 32.864 -0.534  1.00 18.15 ?  2   PHE A O   1 
ATOM   13   C CB  . PHE A 1 2   ? 22.272 35.687 0.157   1.00 16.86 ?  2   PHE A CB  1 
ATOM   14   C CG  . PHE A 1 2   ? 20.784 35.515 0.230   1.00 16.17 ?  2   PHE A CG  1 
ATOM   15   C CD1 . PHE A 1 2   ? 20.123 35.598 1.447   1.00 17.27 ?  2   PHE A CD1 1 
ATOM   16   C CD2 . PHE A 1 2   ? 20.045 35.285 -0.918  1.00 16.87 ?  2   PHE A CD2 1 
ATOM   17   C CE1 . PHE A 1 2   ? 18.741 35.449 1.520   1.00 14.37 ?  2   PHE A CE1 1 
ATOM   18   C CE2 . PHE A 1 2   ? 18.666 35.135 -0.857  1.00 17.82 ?  2   PHE A CE2 1 
ATOM   19   C CZ  . PHE A 1 2   ? 18.013 35.215 0.360   1.00 17.03 ?  2   PHE A CZ  1 
ATOM   20   N N   . MET A 1 3   ? 22.070 32.498 1.380   1.00 13.77 ?  3   MET A N   1 
ATOM   21   C CA  . MET A 1 3   ? 21.736 31.122 1.057   1.00 18.85 ?  3   MET A CA  1 
ATOM   22   C C   . MET A 1 3   ? 20.260 30.881 1.337   1.00 13.58 ?  3   MET A C   1 
ATOM   23   O O   . MET A 1 3   ? 19.619 31.613 2.096   1.00 15.30 ?  3   MET A O   1 
ATOM   24   C CB  . MET A 1 3   ? 22.572 30.108 1.856   1.00 23.54 ?  3   MET A CB  1 
ATOM   25   C CG  . MET A 1 3   ? 24.069 30.355 1.818   1.00 38.84 ?  3   MET A CG  1 
ATOM   26   S SD  . MET A 1 3   ? 24.973 28.946 2.481   1.00 50.44 ?  3   MET A SD  1 
ATOM   27   C CE  . MET A 1 3   ? 23.909 28.472 3.847   1.00 32.86 ?  3   MET A CE  1 
ATOM   28   N N   . LEU A 1 4   ? 19.731 29.835 0.711   1.00 11.82 ?  4   LEU A N   1 
ATOM   29   C CA  . LEU A 1 4   ? 18.343 29.427 0.886   1.00 8.23  ?  4   LEU A CA  1 
ATOM   30   C C   . LEU A 1 4   ? 18.331 28.000 1.418   1.00 11.77 ?  4   LEU A C   1 
ATOM   31   O O   . LEU A 1 4   ? 18.858 27.088 0.774   1.00 12.42 ?  4   LEU A O   1 
ATOM   32   C CB  . LEU A 1 4   ? 17.592 29.533 -0.450  1.00 7.61  ?  4   LEU A CB  1 
ATOM   33   C CG  . LEU A 1 4   ? 17.369 30.967 -0.943  1.00 9.18  ?  4   LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 4   ? 16.811 30.991 -2.383  1.00 11.25 ?  4   LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 4   ? 16.438 31.719 -0.005  1.00 11.37 ?  4   LEU A CD2 1 
ATOM   36   N N   . THR A 1 5   ? 17.740 27.814 2.598   1.00 12.55 ?  5   THR A N   1 
ATOM   37   C CA  . THR A 1 5   ? 17.692 26.526 3.273   1.00 11.81 ?  5   THR A CA  1 
ATOM   38   C C   . THR A 1 5   ? 16.337 25.877 3.031   1.00 12.63 ?  5   THR A C   1 
ATOM   39   O O   . THR A 1 5   ? 15.298 26.443 3.391   1.00 16.04 ?  5   THR A O   1 
ATOM   40   C CB  . THR A 1 5   ? 17.938 26.730 4.769   1.00 14.48 ?  5   THR A CB  1 
ATOM   41   O OG1 . THR A 1 5   ? 19.084 27.582 4.946   1.00 20.05 ?  5   THR A OG1 1 
ATOM   42   C CG2 . THR A 1 5   ? 18.201 25.400 5.430   1.00 18.48 ?  5   THR A CG2 1 
ATOM   43   N N   . GLN A 1 6   ? 16.352 24.684 2.440   1.00 11.78 ?  6   GLN A N   1 
ATOM   44   C CA  . GLN A 1 6   ? 15.153 23.975 2.038   1.00 11.62 ?  6   GLN A CA  1 
ATOM   45   C C   . GLN A 1 6   ? 15.194 22.543 2.568   1.00 11.84 ?  6   GLN A C   1 
ATOM   46   O O   . GLN A 1 6   ? 16.248 21.901 2.497   1.00 16.30 ?  6   GLN A O   1 
ATOM   47   C CB  . GLN A 1 6   ? 15.146 23.957 0.496   1.00 17.51 ?  6   GLN A CB  1 
ATOM   48   C CG  . GLN A 1 6   ? 13.810 23.674 -0.080  1.00 9.80  ?  6   GLN A CG  1 
ATOM   49   C CD  . GLN A 1 6   ? 13.757 23.764 -1.615  1.00 7.61  ?  6   GLN A CD  1 
ATOM   50   O OE1 . GLN A 1 6   ? 14.625 24.361 -2.279  1.00 9.21  ?  6   GLN A OE1 1 
ATOM   51   N NE2 . GLN A 1 6   ? 12.735 23.160 -2.167  1.00 10.04 ?  6   GLN A NE2 1 
ATOM   52   N N   . PRO A 1 7   ? 14.087 22.010 3.098   1.00 11.55 ?  7   PRO A N   1 
ATOM   53   C CA  . PRO A 1 7   ? 14.081 20.603 3.532   1.00 12.99 ?  7   PRO A CA  1 
ATOM   54   C C   . PRO A 1 7   ? 14.101 19.690 2.315   1.00 15.76 ?  7   PRO A C   1 
ATOM   55   O O   . PRO A 1 7   ? 13.742 20.092 1.210   1.00 12.67 ?  7   PRO A O   1 
ATOM   56   C CB  . PRO A 1 7   ? 12.765 20.466 4.295   1.00 11.72 ?  7   PRO A CB  1 
ATOM   57   C CG  . PRO A 1 7   ? 11.854 21.501 3.620   1.00 15.46 ?  7   PRO A CG  1 
ATOM   58   C CD  . PRO A 1 7   ? 12.765 22.649 3.271   1.00 12.34 ?  7   PRO A CD  1 
ATOM   59   N N   A HIS A 1 8   ? 14.521 18.448 2.485   0.51 20.31 ?  8   HIS A N   1 
ATOM   60   N N   B HIS A 1 8   ? 14.509 18.430 2.577   0.49 20.19 ?  8   HIS A N   1 
ATOM   61   C CA  A HIS A 1 8   ? 14.720 17.700 1.246   0.51 14.79 ?  8   HIS A CA  1 
ATOM   62   C CA  B HIS A 1 8   ? 14.814 17.429 1.549   0.49 16.99 ?  8   HIS A CA  1 
ATOM   63   C C   A HIS A 1 8   ? 13.610 16.715 0.877   0.51 13.52 ?  8   HIS A C   1 
ATOM   64   C C   B HIS A 1 8   ? 13.564 16.875 0.906   0.49 13.51 ?  8   HIS A C   1 
ATOM   65   O O   A HIS A 1 8   ? 13.642 16.195 -0.243  0.51 11.43 ?  8   HIS A O   1 
ATOM   66   O O   B HIS A 1 8   ? 13.494 16.734 -0.320  0.49 13.93 ?  8   HIS A O   1 
ATOM   67   C CB  A HIS A 1 8   ? 16.118 17.071 1.166   0.51 16.12 ?  8   HIS A CB  1 
ATOM   68   C CB  B HIS A 1 8   ? 15.482 16.192 2.162   0.49 11.46 ?  8   HIS A CB  1 
ATOM   69   C CG  A HIS A 1 8   ? 16.563 16.469 2.450   0.51 11.02 ?  8   HIS A CG  1 
ATOM   70   C CG  B HIS A 1 8   ? 16.535 16.479 3.175   0.49 10.93 ?  8   HIS A CG  1 
ATOM   71   N ND1 A HIS A 1 8   ? 16.071 15.268 2.906   0.51 12.23 ?  8   HIS A ND1 1 
ATOM   72   N ND1 B HIS A 1 8   ? 17.566 17.365 2.958   0.49 14.26 ?  8   HIS A ND1 1 
ATOM   73   C CD2 A HIS A 1 8   ? 17.420 16.915 3.397   0.51 13.89 ?  8   HIS A CD2 1 
ATOM   74   C CD2 B HIS A 1 8   ? 16.741 15.947 4.401   0.49 8.69  ?  8   HIS A CD2 1 
ATOM   75   C CE1 A HIS A 1 8   ? 16.622 14.991 4.073   0.51 12.12 ?  8   HIS A CE1 1 
ATOM   76   C CE1 B HIS A 1 8   ? 18.343 17.388 4.025   0.49 10.14 ?  8   HIS A CE1 1 
ATOM   77   N NE2 A HIS A 1 8   ? 17.441 15.976 4.395   0.51 10.48 ?  8   HIS A NE2 1 
ATOM   78   N NE2 B HIS A 1 8   ? 17.870 16.533 4.911   0.49 16.66 ?  8   HIS A NE2 1 
ATOM   79   N N   . SER A 1 9   ? 12.615 16.457 1.732   1.00 13.91 ?  9   SER A N   1 
ATOM   80   C CA  . SER A 1 9   ? 11.548 15.560 1.310   1.00 15.27 ?  9   SER A CA  1 
ATOM   81   C C   . SER A 1 9   ? 10.254 15.829 2.052   1.00 24.32 ?  9   SER A C   1 
ATOM   82   O O   . SER A 1 9   ? 10.256 16.156 3.241   1.00 25.51 ?  9   SER A O   1 
ATOM   83   C CB  . SER A 1 9   ? 11.925 14.080 1.499   1.00 18.47 ?  9   SER A CB  1 
ATOM   84   O OG  . SER A 1 9   ? 13.278 13.847 1.142   1.00 28.80 ?  9   SER A OG  1 
ATOM   85   N N   . VAL A 1 10  ? 9.152  15.675 1.322   1.00 13.56 ?  10  VAL A N   1 
ATOM   86   C CA  . VAL A 1 10  ? 7.808  15.584 1.863   1.00 14.41 ?  10  VAL A CA  1 
ATOM   87   C C   . VAL A 1 10  ? 7.108  14.453 1.121   1.00 28.88 ?  10  VAL A C   1 
ATOM   88   O O   . VAL A 1 10  ? 7.494  14.074 0.010   1.00 24.23 ?  10  VAL A O   1 
ATOM   89   C CB  . VAL A 1 10  ? 7.016  16.904 1.711   1.00 18.09 ?  10  VAL A CB  1 
ATOM   90   C CG1 . VAL A 1 10  ? 7.714  18.038 2.452   1.00 17.48 ?  10  VAL A CG1 1 
ATOM   91   C CG2 . VAL A 1 10  ? 6.851  17.255 0.244   1.00 16.53 ?  10  VAL A CG2 1 
ATOM   92   N N   . SER A 1 11  ? 6.070  13.907 1.751   1.00 25.51 ?  11  SER A N   1 
ATOM   93   C CA  . SER A 1 11  ? 5.290  12.827 1.163   1.00 26.50 ?  11  SER A CA  1 
ATOM   94   C C   . SER A 1 11  ? 3.851  12.901 1.652   1.00 34.38 ?  11  SER A C   1 
ATOM   95   O O   . SER A 1 11  ? 3.602  13.195 2.824   1.00 35.04 ?  11  SER A O   1 
ATOM   96   C CB  . SER A 1 11  ? 5.901  11.454 1.487   1.00 35.35 ?  11  SER A CB  1 
ATOM   97   O OG  . SER A 1 11  ? 6.204  11.327 2.870   1.00 35.36 ?  11  SER A OG  1 
ATOM   98   N N   . GLU A 1 12  ? 2.906  12.651 0.745   1.00 23.78 ?  12  GLU A N   1 
ATOM   99   C CA  . GLU A 1 12  ? 1.492  12.557 1.093   1.00 27.91 ?  12  GLU A CA  1 
ATOM   100  C C   . GLU A 1 12  ? 0.765  11.689 0.078   1.00 32.26 ?  12  GLU A C   1 
ATOM   101  O O   . GLU A 1 12  ? 1.281  11.377 -0.999  1.00 29.79 ?  12  GLU A O   1 
ATOM   102  C CB  . GLU A 1 12  ? 0.786  13.920 1.148   1.00 20.90 ?  12  GLU A CB  1 
ATOM   103  C CG  . GLU A 1 12  ? 0.719  14.546 2.530   1.00 34.68 ?  12  GLU A CG  1 
ATOM   104  C CD  . GLU A 1 12  ? -0.152 13.772 3.496   1.00 39.89 ?  12  GLU A CD  1 
ATOM   105  O OE1 . GLU A 1 12  ? -1.034 13.000 3.046   1.00 35.37 ?  12  GLU A OE1 1 
ATOM   106  O OE2 . GLU A 1 12  ? 0.050  13.945 4.717   1.00 47.39 -1 12  GLU A OE2 1 
ATOM   107  N N   . SER A 1 13  ? -0.462 11.332 0.434   1.00 31.27 ?  13  SER A N   1 
ATOM   108  C CA  . SER A 1 13  ? -1.351 10.590 -0.433  1.00 31.76 ?  13  SER A CA  1 
ATOM   109  C C   . SER A 1 13  ? -2.017 11.540 -1.413  1.00 30.87 ?  13  SER A C   1 
ATOM   110  O O   . SER A 1 13  ? -2.076 12.751 -1.178  1.00 22.01 ?  13  SER A O   1 
ATOM   111  C CB  . SER A 1 13  ? -2.440 9.923  0.402   1.00 29.65 ?  13  SER A CB  1 
ATOM   112  O OG  . SER A 1 13  ? -1.883 9.264  1.521   1.00 42.88 ?  13  SER A OG  1 
ATOM   113  N N   . PRO A 1 14  ? -2.529 11.014 -2.521  1.00 30.22 ?  14  PRO A N   1 
ATOM   114  C CA  . PRO A 1 14  ? -3.274 11.854 -3.461  1.00 26.75 ?  14  PRO A CA  1 
ATOM   115  C C   . PRO A 1 14  ? -4.418 12.587 -2.776  1.00 36.01 ?  14  PRO A C   1 
ATOM   116  O O   . PRO A 1 14  ? -5.051 12.073 -1.851  1.00 25.25 ?  14  PRO A O   1 
ATOM   117  C CB  . PRO A 1 14  ? -3.794 10.846 -4.488  1.00 31.49 ?  14  PRO A CB  1 
ATOM   118  C CG  . PRO A 1 14  ? -2.750 9.785  -4.491  1.00 25.83 ?  14  PRO A CG  1 
ATOM   119  C CD  . PRO A 1 14  ? -2.279 9.668  -3.066  1.00 26.78 ?  14  PRO A CD  1 
ATOM   120  N N   . GLY A 1 15  ? -4.670 13.809 -3.241  1.00 24.81 ?  15  GLY A N   1 
ATOM   121  C CA  . GLY A 1 15  ? -5.746 14.623 -2.740  1.00 27.26 ?  15  GLY A CA  1 
ATOM   122  C C   . GLY A 1 15  ? -5.395 15.468 -1.535  1.00 18.36 ?  15  GLY A C   1 
ATOM   123  O O   . GLY A 1 15  ? -6.123 16.422 -1.236  1.00 24.83 ?  15  GLY A O   1 
ATOM   124  N N   . LYS A 1 16  ? -4.305 15.155 -0.843  1.00 18.09 ?  16  LYS A N   1 
ATOM   125  C CA  . LYS A 1 16  ? -3.914 15.907 0.339   1.00 24.26 ?  16  LYS A CA  1 
ATOM   126  C C   . LYS A 1 16  ? -3.082 17.129 -0.045  1.00 27.93 ?  16  LYS A C   1 
ATOM   127  O O   . LYS A 1 16  ? -2.839 17.411 -1.221  1.00 20.13 ?  16  LYS A O   1 
ATOM   128  C CB  . LYS A 1 16  ? -3.147 15.009 1.305   1.00 29.37 ?  16  LYS A CB  1 
ATOM   129  C CG  . LYS A 1 16  ? -3.860 13.710 1.580   1.00 33.07 ?  16  LYS A CG  1 
ATOM   130  C CD  . LYS A 1 16  ? -5.258 13.974 2.098   1.00 29.71 ?  16  LYS A CD  1 
ATOM   131  C CE  . LYS A 1 16  ? -5.268 13.913 3.604   1.00 55.08 ?  16  LYS A CE  1 
ATOM   132  N NZ  . LYS A 1 16  ? -4.599 12.661 4.061   1.00 56.35 ?  16  LYS A NZ  1 
ATOM   133  N N   . THR A 1 17  ? -2.617 17.852 0.970   1.00 19.61 ?  17  THR A N   1 
ATOM   134  C CA  . THR A 1 17  ? -1.862 19.080 0.785   1.00 14.67 ?  17  THR A CA  1 
ATOM   135  C C   . THR A 1 17  ? -0.488 18.930 1.422   1.00 25.45 ?  17  THR A C   1 
ATOM   136  O O   . THR A 1 17  ? -0.356 18.390 2.527   1.00 20.97 ?  17  THR A O   1 
ATOM   137  C CB  . THR A 1 17  ? -2.625 20.265 1.395   1.00 15.78 ?  17  THR A CB  1 
ATOM   138  O OG1 . THR A 1 17  ? -3.860 20.447 0.685   1.00 18.66 ?  17  THR A OG1 1 
ATOM   139  C CG2 . THR A 1 17  ? -1.802 21.553 1.304   1.00 18.32 ?  17  THR A CG2 1 
ATOM   140  N N   . VAL A 1 18  ? 0.536  19.382 0.703   1.00 17.06 ?  18  VAL A N   1 
ATOM   141  C CA  . VAL A 1 18  ? 1.890  19.463 1.224   1.00 17.14 ?  18  VAL A CA  1 
ATOM   142  C C   . VAL A 1 18  ? 2.352  20.905 1.110   1.00 15.54 ?  18  VAL A C   1 
ATOM   143  O O   . VAL A 1 18  ? 1.928  21.655 0.222   1.00 14.43 ?  18  VAL A O   1 
ATOM   144  C CB  . VAL A 1 18  ? 2.892  18.530 0.509   1.00 17.09 ?  18  VAL A CB  1 
ATOM   145  C CG1 . VAL A 1 18  ? 2.477  17.079 0.647   1.00 21.24 ?  18  VAL A CG1 1 
ATOM   146  C CG2 . VAL A 1 18  ? 3.010  18.904 -0.958  1.00 14.15 ?  18  VAL A CG2 1 
ATOM   147  N N   . THR A 1 19  ? 3.206  21.298 2.046   1.00 16.96 ?  19  THR A N   1 
ATOM   148  C CA  A THR A 1 19  ? 3.862  22.586 1.977   0.69 15.43 ?  19  THR A CA  1 
ATOM   149  C CA  B THR A 1 19  ? 3.849  22.604 2.027   0.31 15.41 ?  19  THR A CA  1 
ATOM   150  C C   . THR A 1 19  ? 5.292  22.428 2.465   1.00 15.63 ?  19  THR A C   1 
ATOM   151  O O   . THR A 1 19  ? 5.594  21.587 3.313   1.00 17.89 ?  19  THR A O   1 
ATOM   152  C CB  A THR A 1 19  ? 3.077  23.663 2.749   0.69 15.76 ?  19  THR A CB  1 
ATOM   153  C CB  B THR A 1 19  ? 3.198  23.607 2.997   0.31 15.71 ?  19  THR A CB  1 
ATOM   154  O OG1 A THR A 1 19  ? 3.824  24.881 2.767   0.69 11.90 ?  19  THR A OG1 1 
ATOM   155  O OG1 B THR A 1 19  ? 3.577  23.284 4.339   0.31 21.27 ?  19  THR A OG1 1 
ATOM   156  C CG2 A THR A 1 19  ? 2.795  23.210 4.167   0.69 21.63 ?  19  THR A CG2 1 
ATOM   157  C CG2 B THR A 1 19  ? 1.686  23.578 2.894   0.31 9.23  ?  19  THR A CG2 1 
ATOM   158  N N   . PHE A 1 20  ? 6.185  23.219 1.884   1.00 8.77  ?  20  PHE A N   1 
ATOM   159  C CA  . PHE A 1 20  ? 7.569  23.192 2.324   1.00 9.64  ?  20  PHE A CA  1 
ATOM   160  C C   . PHE A 1 20  ? 8.139  24.579 2.121   1.00 11.69 ?  20  PHE A C   1 
ATOM   161  O O   . PHE A 1 20  ? 7.663  25.337 1.270   1.00 12.01 ?  20  PHE A O   1 
ATOM   162  C CB  . PHE A 1 20  ? 8.400  22.110 1.628   1.00 11.13 ?  20  PHE A CB  1 
ATOM   163  C CG  . PHE A 1 20  ? 8.109  21.971 0.170   1.00 9.69  ?  20  PHE A CG  1 
ATOM   164  C CD1 . PHE A 1 20  ? 8.880  22.645 -0.776  1.00 12.04 ?  20  PHE A CD1 1 
ATOM   165  C CD2 . PHE A 1 20  ? 7.067  21.171 -0.261  1.00 9.54  ?  20  PHE A CD2 1 
ATOM   166  C CE1 . PHE A 1 20  ? 8.610  22.519 -2.145  1.00 12.39 ?  20  PHE A CE1 1 
ATOM   167  C CE2 . PHE A 1 20  ? 6.785  21.044 -1.632  1.00 13.79 ?  20  PHE A CE2 1 
ATOM   168  C CZ  . PHE A 1 20  ? 7.568  21.717 -2.565  1.00 10.07 ?  20  PHE A CZ  1 
ATOM   169  N N   . SER A 1 21  ? 9.158  24.909 2.906   1.00 11.64 ?  21  SER A N   1 
ATOM   170  C CA  A SER A 1 21  ? 9.632  26.277 2.934   0.58 15.34 ?  21  SER A CA  1 
ATOM   171  C CA  B SER A 1 21  ? 9.657  26.268 3.013   0.42 15.38 ?  21  SER A CA  1 
ATOM   172  C C   . SER A 1 21  ? 11.080 26.394 2.483   1.00 15.11 ?  21  SER A C   1 
ATOM   173  O O   . SER A 1 21  ? 11.799 25.411 2.287   1.00 20.78 ?  21  SER A O   1 
ATOM   174  C CB  A SER A 1 21  ? 9.427  26.915 4.313   0.58 12.96 ?  21  SER A CB  1 
ATOM   175  C CB  B SER A 1 21  ? 9.611  26.737 4.472   0.42 13.86 ?  21  SER A CB  1 
ATOM   176  O OG  A SER A 1 21  ? 8.046  27.047 4.583   0.58 17.68 ?  21  SER A OG  1 
ATOM   177  O OG  B SER A 1 21  ? 10.476 25.952 5.279   0.42 12.42 ?  21  SER A OG  1 
ATOM   178  N N   . CYS A 1 22  ? 11.466 27.642 2.293   1.00 12.10 ?  22  CYS A N   1 
ATOM   179  C CA  A CYS A 1 22  ? 12.779 28.062 1.827   0.47 10.38 ?  22  CYS A CA  1 
ATOM   180  C CA  B CYS A 1 22  ? 12.813 28.019 1.890   0.53 10.35 ?  22  CYS A CA  1 
ATOM   181  C C   . CYS A 1 22  ? 13.169 29.212 2.753   1.00 13.23 ?  22  CYS A C   1 
ATOM   182  O O   . CYS A 1 22  ? 12.536 30.266 2.685   1.00 14.01 ?  22  CYS A O   1 
ATOM   183  C CB  A CYS A 1 22  ? 12.549 28.576 0.405   0.47 19.92 ?  22  CYS A CB  1 
ATOM   184  C CB  B CYS A 1 22  ? 12.907 28.368 0.406   0.53 21.48 ?  22  CYS A CB  1 
ATOM   185  S SG  A CYS A 1 22  ? 13.895 29.149 -0.593  0.47 17.79 ?  22  CYS A SG  1 
ATOM   186  S SG  B CYS A 1 22  ? 13.783 27.098 -0.508  0.53 13.37 ?  22  CYS A SG  1 
ATOM   187  N N   . THR A 1 23  ? 14.162 29.031 3.622   1.00 10.27 ?  23  THR A N   1 
ATOM   188  C CA  . THR A 1 23  ? 14.487 30.051 4.616   1.00 9.11  ?  23  THR A CA  1 
ATOM   189  C C   . THR A 1 23  ? 15.770 30.779 4.236   1.00 14.64 ?  23  THR A C   1 
ATOM   190  O O   . THR A 1 23  ? 16.783 30.143 3.920   1.00 12.11 ?  23  THR A O   1 
ATOM   191  C CB  . THR A 1 23  ? 14.619 29.451 6.025   1.00 12.65 ?  23  THR A CB  1 
ATOM   192  O OG1 . THR A 1 23  ? 13.431 28.709 6.352   1.00 15.31 ?  23  THR A OG1 1 
ATOM   193  C CG2 . THR A 1 23  ? 14.788 30.568 7.035   1.00 13.54 ?  23  THR A CG2 1 
ATOM   194  N N   . GLY A 1 24  ? 15.720 32.108 4.264   1.00 10.60 ?  24  GLY A N   1 
ATOM   195  C CA  . GLY A 1 24  ? 16.901 32.897 3.958   1.00 9.60  ?  24  GLY A CA  1 
ATOM   196  C C   . GLY A 1 24  ? 17.925 32.835 5.080   1.00 16.41 ?  24  GLY A C   1 
ATOM   197  O O   . GLY A 1 24  ? 17.589 32.855 6.265   1.00 14.43 ?  24  GLY A O   1 
ATOM   198  N N   . SER A 1 25  ? 19.193 32.755 4.685   1.00 13.55 ?  25  SER A N   1 
ATOM   199  C CA  . SER A 1 25  ? 20.338 32.787 5.586   1.00 15.25 ?  25  SER A CA  1 
ATOM   200  C C   . SER A 1 25  ? 21.322 33.804 5.037   1.00 22.04 ?  25  SER A C   1 
ATOM   201  O O   . SER A 1 25  ? 21.673 33.744 3.856   1.00 18.49 ?  25  SER A O   1 
ATOM   202  C CB  . SER A 1 25  ? 21.013 31.413 5.627   1.00 20.60 ?  25  SER A CB  1 
ATOM   203  O OG  . SER A 1 25  ? 22.192 31.455 6.412   1.00 36.07 ?  25  SER A OG  1 
ATOM   204  N N   . GLY A 1 26  ? 21.765 34.737 5.880   1.00 18.05 ?  26  GLY A N   1 
ATOM   205  C CA  . GLY A 1 26  ? 22.672 35.766 5.407   1.00 17.52 ?  26  GLY A CA  1 
ATOM   206  C C   . GLY A 1 26  ? 22.020 36.869 4.609   1.00 19.04 ?  26  GLY A C   1 
ATOM   207  O O   . GLY A 1 26  ? 22.702 37.557 3.844   1.00 24.82 ?  26  GLY A O   1 
ATOM   208  N N   . GLY A 1 27  ? 20.716 37.055 4.757   1.00 18.48 ?  27  GLY A N   1 
ATOM   209  C CA  . GLY A 1 27  ? 20.006 38.102 4.053   1.00 18.01 ?  27  GLY A CA  1 
ATOM   210  C C   . GLY A 1 27  ? 18.524 37.943 4.295   1.00 17.98 ?  27  GLY A C   1 
ATOM   211  O O   . GLY A 1 27  ? 18.065 36.932 4.833   1.00 17.00 ?  27  GLY A O   1 
ATOM   212  N N   . SER A 1 28  ? 17.774 38.960 3.881   1.00 14.99 ?  28  SER A N   1 
ATOM   213  C CA  . SER A 1 28  ? 16.328 38.970 4.071   1.00 17.79 ?  28  SER A CA  1 
ATOM   214  C C   . SER A 1 28  ? 15.639 38.415 2.832   1.00 13.41 ?  28  SER A C   1 
ATOM   215  O O   . SER A 1 28  ? 15.887 38.889 1.723   1.00 13.74 ?  28  SER A O   1 
ATOM   216  C CB  . SER A 1 28  ? 15.825 40.391 4.322   1.00 21.93 ?  28  SER A CB  1 
ATOM   217  O OG  . SER A 1 28  ? 14.405 40.402 4.379   1.00 28.12 ?  28  SER A OG  1 
ATOM   218  N N   . ILE A 1 29  ? 14.765 37.426 3.039   1.00 15.02 ?  29  ILE A N   1 
ATOM   219  C CA  . ILE A 1 29  ? 13.988 36.818 1.955   1.00 12.87 ?  29  ILE A CA  1 
ATOM   220  C C   . ILE A 1 29  ? 13.188 37.862 1.179   1.00 15.96 ?  29  ILE A C   1 
ATOM   221  O O   . ILE A 1 29  ? 12.917 37.688 -0.015  1.00 16.06 ?  29  ILE A O   1 
ATOM   222  C CB  . ILE A 1 29  ? 13.068 35.726 2.550   1.00 13.06 ?  29  ILE A CB  1 
ATOM   223  C CG1 . ILE A 1 29  ? 12.526 34.795 1.468   1.00 17.45 ?  29  ILE A CG1 1 
ATOM   224  C CG2 . ILE A 1 29  ? 11.889 36.351 3.285   1.00 18.96 ?  29  ILE A CG2 1 
ATOM   225  C CD1 . ILE A 1 29  ? 13.536 33.787 0.974   1.00 14.18 ?  29  ILE A CD1 1 
ATOM   226  N N   . ALA A 1 30  ? 12.781 38.952 1.833   1.00 15.35 ?  30  ALA A N   1 
ATOM   227  C CA  . ALA A 1 30  ? 11.884 39.915 1.202   1.00 18.16 ?  30  ALA A CA  1 
ATOM   228  C C   . ALA A 1 30  ? 12.591 40.878 0.255   1.00 16.63 ?  30  ALA A C   1 
ATOM   229  O O   . ALA A 1 30  ? 11.916 41.620 -0.465  1.00 15.90 ?  30  ALA A O   1 
ATOM   230  C CB  . ALA A 1 30  ? 11.134 40.714 2.270   1.00 17.95 ?  30  ALA A CB  1 
ATOM   231  N N   . ASP A 1 31  ? 13.922 40.886 0.222   1.00 12.38 ?  31  ASP A N   1 
ATOM   232  C CA  . ASP A 1 31  ? 14.633 41.851 -0.607  1.00 16.34 ?  31  ASP A CA  1 
ATOM   233  C C   . ASP A 1 31  ? 14.600 41.513 -2.094  1.00 14.26 ?  31  ASP A C   1 
ATOM   234  O O   . ASP A 1 31  ? 14.831 42.403 -2.921  1.00 15.90 ?  31  ASP A O   1 
ATOM   235  C CB  . ASP A 1 31  ? 16.084 41.952 -0.150  1.00 12.49 ?  31  ASP A CB  1 
ATOM   236  C CG  . ASP A 1 31  ? 16.238 42.770 1.114   1.00 29.53 ?  31  ASP A CG  1 
ATOM   237  O OD1 . ASP A 1 31  ? 15.257 43.425 1.524   1.00 27.58 ?  31  ASP A OD1 1 
ATOM   238  O OD2 . ASP A 1 31  ? 17.346 42.764 1.684   1.00 26.88 -1 31  ASP A OD2 1 
ATOM   239  N N   . SER A 1 32  ? 14.332 40.261 -2.446  1.00 11.43 ?  32  SER A N   1 
ATOM   240  C CA  . SER A 1 32  ? 14.360 39.807 -3.827  1.00 9.92  ?  32  SER A CA  1 
ATOM   241  C C   . SER A 1 32  ? 13.191 38.858 -4.060  1.00 9.91  ?  32  SER A C   1 
ATOM   242  O O   . SER A 1 32  ? 12.718 38.193 -3.136  1.00 11.16 ?  32  SER A O   1 
ATOM   243  C CB  . SER A 1 32  ? 15.680 39.076 -4.125  1.00 16.18 ?  32  SER A CB  1 
ATOM   244  O OG  . SER A 1 32  ? 16.794 39.961 -4.049  1.00 18.04 ?  32  SER A OG  1 
ATOM   245  N N   . PHE A 1 33  ? 12.736 38.797 -5.307  1.00 10.88 ?  33  PHE A N   1 
ATOM   246  C CA  . PHE A 1 33  ? 11.658 37.886 -5.675  1.00 9.58  ?  33  PHE A CA  1 
ATOM   247  C C   . PHE A 1 33  ? 12.101 36.430 -5.574  1.00 9.59  ?  33  PHE A C   1 
ATOM   248  O O   . PHE A 1 33  ? 13.237 36.083 -5.919  1.00 11.70 ?  33  PHE A O   1 
ATOM   249  C CB  . PHE A 1 33  ? 11.234 38.162 -7.112  1.00 12.99 ?  33  PHE A CB  1 
ATOM   250  C CG  . PHE A 1 33  ? 10.310 39.325 -7.254  1.00 15.09 ?  33  PHE A CG  1 
ATOM   251  C CD1 . PHE A 1 33  ? 9.193  39.437 -6.445  1.00 14.77 ?  33  PHE A CD1 1 
ATOM   252  C CD2 . PHE A 1 33  ? 10.552 40.301 -8.215  1.00 15.60 ?  33  PHE A CD2 1 
ATOM   253  C CE1 . PHE A 1 33  ? 8.325  40.508 -6.592  1.00 17.06 ?  33  PHE A CE1 1 
ATOM   254  C CE2 . PHE A 1 33  ? 9.688  41.380 -8.364  1.00 17.09 ?  33  PHE A CE2 1 
ATOM   255  C CZ  . PHE A 1 33  ? 8.576  41.477 -7.554  1.00 17.31 ?  33  PHE A CZ  1 
ATOM   256  N N   . VAL A 1 34  ? 11.185 35.570 -5.126  1.00 9.13  ?  34  VAL A N   1 
ATOM   257  C CA  . VAL A 1 34  ? 11.425 34.134 -5.003  1.00 9.21  ?  34  VAL A CA  1 
ATOM   258  C C   . VAL A 1 34  ? 10.654 33.389 -6.092  1.00 11.93 ?  34  VAL A C   1 
ATOM   259  O O   . VAL A 1 34  ? 9.462  33.645 -6.316  1.00 8.04  ?  34  VAL A O   1 
ATOM   260  C CB  . VAL A 1 34  ? 11.037 33.615 -3.609  1.00 8.53  ?  34  VAL A CB  1 
ATOM   261  C CG1 . VAL A 1 34  ? 11.220 32.095 -3.536  1.00 8.77  ?  34  VAL A CG1 1 
ATOM   262  C CG2 . VAL A 1 34  ? 11.873 34.338 -2.529  1.00 9.69  ?  34  VAL A CG2 1 
ATOM   263  N N   . GLN A 1 35  ? 11.336 32.450 -6.743  1.00 8.45  ?  35  GLN A N   1 
ATOM   264  C CA  . GLN A 1 35  ? 10.777 31.587 -7.771  1.00 8.49  ?  35  GLN A CA  1 
ATOM   265  C C   . GLN A 1 35  ? 10.793 30.149 -7.267  1.00 5.96  ?  35  GLN A C   1 
ATOM   266  O O   . GLN A 1 35  ? 11.617 29.778 -6.425  1.00 8.54  ?  35  GLN A O   1 
ATOM   267  C CB  . GLN A 1 35  ? 11.626 31.655 -9.053  1.00 9.10  ?  35  GLN A CB  1 
ATOM   268  C CG  . GLN A 1 35  ? 11.525 32.967 -9.850  1.00 8.26  ?  35  GLN A CG  1 
ATOM   269  C CD  . GLN A 1 35  ? 11.829 34.200 -9.026  1.00 15.11 ?  35  GLN A CD  1 
ATOM   270  O OE1 . GLN A 1 35  ? 10.956 35.041 -8.813  1.00 10.84 ?  35  GLN A OE1 1 
ATOM   271  N NE2 . GLN A 1 35  ? 13.070 34.317 -8.553  1.00 13.78 ?  35  GLN A NE2 1 
ATOM   272  N N   . TRP A 1 36  ? 9.891  29.326 -7.800  1.00 7.42  ?  36  TRP A N   1 
ATOM   273  C CA  . TRP A 1 36  ? 9.891  27.897 -7.520  1.00 7.56  ?  36  TRP A CA  1 
ATOM   274  C C   . TRP A 1 36  ? 9.842  27.141 -8.836  1.00 6.94  ?  36  TRP A C   1 
ATOM   275  O O   . TRP A 1 36  ? 9.046  27.481 -9.721  1.00 8.30  ?  36  TRP A O   1 
ATOM   276  C CB  . TRP A 1 36  ? 8.681  27.485 -6.690  1.00 5.30  ?  36  TRP A CB  1 
ATOM   277  C CG  . TRP A 1 36  ? 8.701  28.062 -5.304  1.00 7.61  ?  36  TRP A CG  1 
ATOM   278  C CD1 . TRP A 1 36  ? 8.250  29.295 -4.916  1.00 6.52  ?  36  TRP A CD1 1 
ATOM   279  C CD2 . TRP A 1 36  ? 9.200  27.421 -4.124  1.00 6.86  ?  36  TRP A CD2 1 
ATOM   280  N NE1 . TRP A 1 36  ? 8.428  29.452 -3.548  1.00 7.82  ?  36  TRP A NE1 1 
ATOM   281  C CE2 . TRP A 1 36  ? 9.015  28.315 -3.049  1.00 8.42  ?  36  TRP A CE2 1 
ATOM   282  C CE3 . TRP A 1 36  ? 9.769  26.168 -3.870  1.00 8.35  ?  36  TRP A CE3 1 
ATOM   283  C CZ2 . TRP A 1 36  ? 9.388  27.994 -1.734  1.00 10.47 ?  36  TRP A CZ2 1 
ATOM   284  C CZ3 . TRP A 1 36  ? 10.143 25.852 -2.558  1.00 9.36  ?  36  TRP A CZ3 1 
ATOM   285  C CH2 . TRP A 1 36  ? 9.944  26.763 -1.514  1.00 8.36  ?  36  TRP A CH2 1 
ATOM   286  N N   . TYR A 1 37  ? 10.683 26.119 -8.959  1.00 5.66  ?  37  TYR A N   1 
ATOM   287  C CA  . TYR A 1 37  ? 10.735 25.303 -10.169 1.00 4.63  ?  37  TYR A CA  1 
ATOM   288  C C   . TYR A 1 37  ? 10.371 23.865 -9.845  1.00 6.05  ?  37  TYR A C   1 
ATOM   289  O O   . TYR A 1 37  ? 10.727 23.351 -8.783  1.00 9.09  ?  37  TYR A O   1 
ATOM   290  C CB  . TYR A 1 37  ? 12.133 25.330 -10.828 1.00 7.30  ?  37  TYR A CB  1 
ATOM   291  C CG  . TYR A 1 37  ? 12.563 26.734 -11.118 1.00 5.52  ?  37  TYR A CG  1 
ATOM   292  C CD1 . TYR A 1 37  ? 12.097 27.401 -12.251 1.00 11.13 ?  37  TYR A CD1 1 
ATOM   293  C CD2 . TYR A 1 37  ? 13.390 27.416 -10.244 1.00 7.64  ?  37  TYR A CD2 1 
ATOM   294  C CE1 . TYR A 1 37  ? 12.452 28.704 -12.500 1.00 8.63  ?  37  TYR A CE1 1 
ATOM   295  C CE2 . TYR A 1 37  ? 13.757 28.731 -10.485 1.00 8.48  ?  37  TYR A CE2 1 
ATOM   296  C CZ  . TYR A 1 37  ? 13.285 29.370 -11.612 1.00 10.40 ?  37  TYR A CZ  1 
ATOM   297  O OH  . TYR A 1 37  ? 13.649 30.679 -11.835 1.00 9.24  ?  37  TYR A OH  1 
ATOM   298  N N   . GLN A 1 38  ? 9.682  23.217 -10.778 1.00 6.18  ?  38  GLN A N   1 
ATOM   299  C CA  . GLN A 1 38  ? 9.509  21.773 -10.743 1.00 7.44  ?  38  GLN A CA  1 
ATOM   300  C C   . GLN A 1 38  ? 10.522 21.180 -11.710 1.00 8.15  ?  38  GLN A C   1 
ATOM   301  O O   . GLN A 1 38  ? 10.795 21.763 -12.760 1.00 8.85  ?  38  GLN A O   1 
ATOM   302  C CB  . GLN A 1 38  ? 8.108  21.403 -11.228 1.00 7.02  ?  38  GLN A CB  1 
ATOM   303  C CG  . GLN A 1 38  ? 7.819  19.909 -11.242 1.00 9.44  ?  38  GLN A CG  1 
ATOM   304  C CD  . GLN A 1 38  ? 6.496  19.612 -11.924 1.00 13.38 ?  38  GLN A CD  1 
ATOM   305  O OE1 . GLN A 1 38  ? 6.373  19.770 -13.141 1.00 11.59 ?  38  GLN A OE1 1 
ATOM   306  N NE2 . GLN A 1 38  ? 5.486  19.231 -11.141 1.00 10.80 ?  38  GLN A NE2 1 
ATOM   307  N N   . GLN A 1 39  ? 11.086 20.027 -11.360 1.00 9.71  ?  39  GLN A N   1 
ATOM   308  C CA  A GLN A 1 39  ? 12.068 19.398 -12.232 0.41 7.15  ?  39  GLN A CA  1 
ATOM   309  C CA  B GLN A 1 39  ? 12.074 19.401 -12.227 0.59 7.07  ?  39  GLN A CA  1 
ATOM   310  C C   . GLN A 1 39  ? 11.911 17.890 -12.200 1.00 9.07  ?  39  GLN A C   1 
ATOM   311  O O   . GLN A 1 39  ? 11.860 17.278 -11.126 1.00 10.65 ?  39  GLN A O   1 
ATOM   312  C CB  A GLN A 1 39  ? 13.506 19.770 -11.864 0.41 9.90  ?  39  GLN A CB  1 
ATOM   313  C CB  B GLN A 1 39  ? 13.498 19.813 -11.831 0.59 9.88  ?  39  GLN A CB  1 
ATOM   314  C CG  A GLN A 1 39  ? 14.506 19.217 -12.876 0.41 10.65 ?  39  GLN A CG  1 
ATOM   315  C CG  B GLN A 1 39  ? 14.528 19.600 -12.942 0.59 10.55 ?  39  GLN A CG  1 
ATOM   316  C CD  A GLN A 1 39  ? 15.944 19.372 -12.447 0.41 11.45 ?  39  GLN A CD  1 
ATOM   317  C CD  B GLN A 1 39  ? 15.837 20.326 -12.693 0.59 9.11  ?  39  GLN A CD  1 
ATOM   318  O OE1 A GLN A 1 39  ? 16.248 19.430 -11.258 0.41 9.01  ?  39  GLN A OE1 1 
ATOM   319  O OE1 B GLN A 1 39  ? 16.040 20.937 -11.637 0.59 10.80 ?  39  GLN A OE1 1 
ATOM   320  N NE2 A GLN A 1 39  ? 16.847 19.419 -13.423 0.41 8.45  ?  39  GLN A NE2 1 
ATOM   321  N NE2 B GLN A 1 39  ? 16.742 20.257 -13.669 0.59 9.39  ?  39  GLN A NE2 1 
ATOM   322  N N   . ARG A 1 40  ? 11.840 17.316 -13.348 1.00 10.94 ?  40  ARG A N   1 
ATOM   323  C CA  . ARG A 1 40  ? 11.731 15.880 -13.510 1.00 15.22 ?  40  ARG A CA  1 
ATOM   324  C C   . ARG A 1 40  ? 13.084 15.323 -13.914 1.00 14.86 ?  40  ARG A C   1 
ATOM   325  O O   . ARG A 1 40  ? 13.965 16.074 -14.343 1.00 11.33 ?  40  ARG A O   1 
ATOM   326  C CB  . ARG A 1 40  ? 10.677 15.587 -14.577 1.00 15.40 ?  40  ARG A CB  1 
ATOM   327  C CG  . ARG A 1 40  ? 9.373  16.350 -14.298 1.00 20.91 ?  40  ARG A CG  1 
ATOM   328  C CD  . ARG A 1 40  ? 8.203  15.717 -14.999 1.00 21.60 ?  40  ARG A CD  1 
ATOM   329  N NE  . ARG A 1 40  ? 6.938  16.394 -14.730 1.00 15.47 ?  40  ARG A NE  1 
ATOM   330  C CZ  . ARG A 1 40  ? 6.111  16.093 -13.733 1.00 14.70 ?  40  ARG A CZ  1 
ATOM   331  N NH1 . ARG A 1 40  ? 6.420  15.127 -12.868 1.00 16.22 ?  40  ARG A NH1 1 
ATOM   332  N NH2 . ARG A 1 40  ? 4.972  16.766 -13.601 1.00 13.06 ?  40  ARG A NH2 1 
ATOM   333  N N   . PRO A 1 41  ? 13.310 14.019 -13.753 1.00 14.70 ?  41  PRO A N   1 
ATOM   334  C CA  . PRO A 1 41  ? 14.676 13.501 -13.898 1.00 16.35 ?  41  PRO A CA  1 
ATOM   335  C C   . PRO A 1 41  ? 15.221 13.755 -15.296 1.00 12.53 ?  41  PRO A C   1 
ATOM   336  O O   . PRO A 1 41  ? 14.548 13.513 -16.303 1.00 17.37 ?  41  PRO A O   1 
ATOM   337  C CB  . PRO A 1 41  ? 14.525 12.005 -13.597 1.00 19.23 ?  41  PRO A CB  1 
ATOM   338  C CG  . PRO A 1 41  ? 13.324 11.931 -12.698 1.00 20.44 ?  41  PRO A CG  1 
ATOM   339  C CD  . PRO A 1 41  ? 12.387 12.999 -13.224 1.00 19.26 ?  41  PRO A CD  1 
ATOM   340  N N   . GLY A 1 42  ? 16.440 14.284 -15.339 1.00 12.42 ?  42  GLY A N   1 
ATOM   341  C CA  . GLY A 1 42  ? 17.144 14.536 -16.577 1.00 14.38 ?  42  GLY A CA  1 
ATOM   342  C C   . GLY A 1 42  ? 16.552 15.622 -17.444 1.00 12.30 ?  42  GLY A C   1 
ATOM   343  O O   . GLY A 1 42  ? 16.920 15.710 -18.616 1.00 9.04  ?  42  GLY A O   1 
ATOM   344  N N   . SER A 1 43  ? 15.653 16.452 -16.906 1.00 12.18 ?  43  SER A N   1 
ATOM   345  C CA  . SER A 1 43  ? 14.960 17.469 -17.684 1.00 11.22 ?  43  SER A CA  1 
ATOM   346  C C   . SER A 1 43  ? 15.178 18.847 -17.070 1.00 8.41  ?  43  SER A C   1 
ATOM   347  O O   . SER A 1 43  ? 15.421 18.980 -15.868 1.00 10.36 ?  43  SER A O   1 
ATOM   348  C CB  . SER A 1 43  ? 13.458 17.178 -17.729 1.00 14.14 ?  43  SER A CB  1 
ATOM   349  O OG  . SER A 1 43  ? 13.228 15.864 -18.206 1.00 22.62 ?  43  SER A OG  1 
ATOM   350  N N   . ALA A 1 44  ? 15.051 19.877 -17.910 1.00 8.63  ?  44  ALA A N   1 
ATOM   351  C CA  . ALA A 1 44  ? 15.211 21.250 -17.456 1.00 9.54  ?  44  ALA A CA  1 
ATOM   352  C C   . ALA A 1 44  ? 14.111 21.625 -16.461 1.00 11.88 ?  44  ALA A C   1 
ATOM   353  O O   . ALA A 1 44  ? 12.973 21.179 -16.592 1.00 10.68 ?  44  ALA A O   1 
ATOM   354  C CB  . ALA A 1 44  ? 15.146 22.215 -18.641 1.00 11.39 ?  44  ALA A CB  1 
ATOM   355  N N   . PRO A 1 45  ? 14.428 22.469 -15.481 1.00 9.50  ?  45  PRO A N   1 
ATOM   356  C CA  . PRO A 1 45  ? 13.393 22.949 -14.550 1.00 10.76 ?  45  PRO A CA  1 
ATOM   357  C C   . PRO A 1 45  ? 12.335 23.747 -15.294 1.00 14.22 ?  45  PRO A C   1 
ATOM   358  O O   . PRO A 1 45  ? 12.624 24.419 -16.288 1.00 12.58 ?  45  PRO A O   1 
ATOM   359  C CB  . PRO A 1 45  ? 14.161 23.869 -13.594 1.00 11.95 ?  45  PRO A CB  1 
ATOM   360  C CG  . PRO A 1 45  ? 15.634 23.699 -13.911 1.00 17.73 ?  45  PRO A CG  1 
ATOM   361  C CD  . PRO A 1 45  ? 15.727 23.135 -15.289 1.00 7.73  ?  45  PRO A CD  1 
ATOM   362  N N   . THR A 1 46  ? 11.102 23.696 -14.789 1.00 9.54  ?  46  THR A N   1 
ATOM   363  C CA  . THR A 1 46  ? 10.030 24.533 -15.314 1.00 11.12 ?  46  THR A CA  1 
ATOM   364  C C   . THR A 1 46  ? 9.451  25.367 -14.183 1.00 7.88  ?  46  THR A C   1 
ATOM   365  O O   . THR A 1 46  ? 9.335  24.894 -13.048 1.00 7.61  ?  46  THR A O   1 
ATOM   366  C CB  . THR A 1 46  ? 8.924  23.699 -15.956 1.00 18.79 ?  46  THR A CB  1 
ATOM   367  O OG1 . THR A 1 46  ? 8.327  22.856 -14.972 1.00 15.12 ?  46  THR A OG1 1 
ATOM   368  C CG2 . THR A 1 46  ? 9.485  22.834 -17.080 1.00 17.57 ?  46  THR A CG2 1 
ATOM   369  N N   . THR A 1 47  ? 9.083  26.604 -14.500 1.00 8.15  ?  47  THR A N   1 
ATOM   370  C CA  . THR A 1 47  ? 8.599  27.516 -13.473 1.00 7.81  ?  47  THR A CA  1 
ATOM   371  C C   . THR A 1 47  ? 7.208  27.104 -13.017 1.00 10.66 ?  47  THR A C   1 
ATOM   372  O O   . THR A 1 47  ? 6.313  26.879 -13.838 1.00 6.89  ?  47  THR A O   1 
ATOM   373  C CB  . THR A 1 47  ? 8.535  28.932 -14.040 1.00 8.66  ?  47  THR A CB  1 
ATOM   374  O OG1 . THR A 1 47  ? 9.837  29.314 -14.499 1.00 12.02 ?  47  THR A OG1 1 
ATOM   375  C CG2 . THR A 1 47  ? 8.043  29.936 -12.984 1.00 7.77  ?  47  THR A CG2 1 
ATOM   376  N N   . VAL A 1 48  ? 7.032  27.004 -11.705 1.00 9.46  ?  48  VAL A N   1 
ATOM   377  C CA  A VAL A 1 48  ? 5.725  26.863 -11.076 0.35 8.14  ?  48  VAL A CA  1 
ATOM   378  C CA  B VAL A 1 48  ? 5.693  26.901 -11.156 0.65 8.17  ?  48  VAL A CA  1 
ATOM   379  C C   . VAL A 1 48  ? 5.259  28.175 -10.449 1.00 8.26  ?  48  VAL A C   1 
ATOM   380  O O   . VAL A 1 48  ? 4.067  28.500 -10.480 1.00 8.47  ?  48  VAL A O   1 
ATOM   381  C CB  A VAL A 1 48  ? 5.810  25.736 -10.026 0.35 9.36  ?  48  VAL A CB  1 
ATOM   382  C CB  B VAL A 1 48  ? 5.412  25.654 -10.293 0.65 9.44  ?  48  VAL A CB  1 
ATOM   383  C CG1 A VAL A 1 48  ? 4.510  25.599 -9.280  0.35 7.24  ?  48  VAL A CG1 1 
ATOM   384  C CG1 B VAL A 1 48  ? 5.572  24.373 -11.135 0.65 10.27 ?  48  VAL A CG1 1 
ATOM   385  C CG2 A VAL A 1 48  ? 6.205  24.419 -10.692 0.35 10.86 ?  48  VAL A CG2 1 
ATOM   386  C CG2 B VAL A 1 48  ? 6.309  25.640 -9.075  0.65 9.22  ?  48  VAL A CG2 1 
ATOM   387  N N   . ILE A 1 49  ? 6.188  28.924 -9.853  1.00 6.17  ?  49  ILE A N   1 
ATOM   388  C CA  . ILE A 1 49  ? 5.905  30.214 -9.223  1.00 6.70  ?  49  ILE A CA  1 
ATOM   389  C C   . ILE A 1 49  ? 7.040  31.171 -9.562  1.00 9.03  ?  49  ILE A C   1 
ATOM   390  O O   . ILE A 1 49  ? 8.216  30.797 -9.503  1.00 7.83  ?  49  ILE A O   1 
ATOM   391  C CB  . ILE A 1 49  ? 5.804  30.086 -7.684  1.00 7.48  ?  49  ILE A CB  1 
ATOM   392  C CG1 . ILE A 1 49  ? 4.578  29.283 -7.254  1.00 8.28  ?  49  ILE A CG1 1 
ATOM   393  C CG2 . ILE A 1 49  ? 5.854  31.474 -7.030  1.00 7.89  ?  49  ILE A CG2 1 
ATOM   394  C CD1 . ILE A 1 49  ? 3.225  29.976 -7.532  1.00 10.30 ?  49  ILE A CD1 1 
ATOM   395  N N   . TYR A 1 50  ? 6.698  32.417 -9.895  1.00 6.93  ?  50  TYR A N   1 
ATOM   396  C CA  . TYR A 1 50  ? 7.685  33.479 -10.031 1.00 5.95  ?  50  TYR A CA  1 
ATOM   397  C C   . TYR A 1 50  ? 7.182  34.709 -9.280  1.00 7.51  ?  50  TYR A C   1 
ATOM   398  O O   . TYR A 1 50  ? 5.997  34.821 -8.959  1.00 7.22  ?  50  TYR A O   1 
ATOM   399  C CB  . TYR A 1 50  ? 8.009  33.806 -11.513 1.00 7.98  ?  50  TYR A CB  1 
ATOM   400  C CG  . TYR A 1 50  ? 6.824  34.404 -12.251 1.00 6.76  ?  50  TYR A CG  1 
ATOM   401  C CD1 . TYR A 1 50  ? 6.691  35.774 -12.385 1.00 12.16 ?  50  TYR A CD1 1 
ATOM   402  C CD2 . TYR A 1 50  ? 5.830  33.592 -12.764 1.00 8.61  ?  50  TYR A CD2 1 
ATOM   403  C CE1 . TYR A 1 50  ? 5.598  36.332 -13.028 1.00 11.10 ?  50  TYR A CE1 1 
ATOM   404  C CE2 . TYR A 1 50  ? 4.731  34.138 -13.405 1.00 10.61 ?  50  TYR A CE2 1 
ATOM   405  C CZ  . TYR A 1 50  ? 4.625  35.513 -13.532 1.00 11.15 ?  50  TYR A CZ  1 
ATOM   406  O OH  . TYR A 1 50  ? 3.529  36.060 -14.179 1.00 14.41 ?  50  TYR A OH  1 
ATOM   407  N N   . ASP A 1 51  ? 8.104  35.615 -8.963  1.00 9.08  ?  51  ASP A N   1 
ATOM   408  C CA  . ASP A 1 51  ? 7.746  36.854 -8.273  1.00 9.84  ?  51  ASP A CA  1 
ATOM   409  C C   . ASP A 1 51  ? 6.932  36.574 -7.008  1.00 10.31 ?  51  ASP A C   1 
ATOM   410  O O   . ASP A 1 51  ? 5.856  37.149 -6.795  1.00 8.68  ?  51  ASP A O   1 
ATOM   411  C CB  . ASP A 1 51  ? 6.986  37.802 -9.203  1.00 13.37 ?  51  ASP A CB  1 
ATOM   412  C CG  . ASP A 1 51  ? 7.851  38.358 -10.311 1.00 16.01 ?  51  ASP A CG  1 
ATOM   413  O OD1 . ASP A 1 51  ? 9.077  38.093 -10.307 1.00 15.10 ?  51  ASP A OD1 1 
ATOM   414  O OD2 . ASP A 1 51  ? 7.288  39.059 -11.183 1.00 12.93 -1 51  ASP A OD2 1 
ATOM   415  N N   . ASP A 1 52  ? 7.436  35.630 -6.201  1.00 9.64  ?  52  ASP A N   1 
ATOM   416  C CA  . ASP A 1 52  ? 6.897  35.256 -4.891  1.00 10.91 ?  52  ASP A CA  1 
ATOM   417  C C   . ASP A 1 52  ? 5.654  34.381 -4.965  1.00 10.11 ?  52  ASP A C   1 
ATOM   418  O O   . ASP A 1 52  ? 5.550  33.383 -4.237  1.00 9.00  ?  52  ASP A O   1 
ATOM   419  C CB  . ASP A 1 52  ? 6.589  36.468 -4.001  1.00 10.02 ?  52  ASP A CB  1 
ATOM   420  C CG  . ASP A 1 52  ? 7.814  37.290 -3.671  1.00 13.64 ?  52  ASP A CG  1 
ATOM   421  O OD1 . ASP A 1 52  ? 8.939  36.758 -3.767  1.00 12.58 ?  52  ASP A OD1 1 
ATOM   422  O OD2 . ASP A 1 52  ? 7.633  38.473 -3.283  1.00 13.99 -1 52  ASP A OD2 1 
ATOM   423  N N   . ASN A 1 53  ? 4.692  34.756 -5.814  1.00 6.88  ?  53  ASN A N   1 
ATOM   424  C CA  . ASN A 1 53  ? 3.411  34.058 -5.761  1.00 6.44  ?  53  ASN A CA  1 
ATOM   425  C C   . ASN A 1 53  ? 2.670  34.013 -7.092  1.00 8.39  ?  53  ASN A C   1 
ATOM   426  O O   . ASN A 1 53  ? 1.480  33.675 -7.086  1.00 7.86  ?  53  ASN A O   1 
ATOM   427  C CB  . ASN A 1 53  ? 2.501  34.654 -4.670  1.00 7.20  ?  53  ASN A CB  1 
ATOM   428  C CG  . ASN A 1 53  ? 2.188  36.125 -4.904  1.00 9.96  ?  53  ASN A CG  1 
ATOM   429  O OD1 . ASN A 1 53  ? 2.560  36.699 -5.926  1.00 9.71  ?  53  ASN A OD1 1 
ATOM   430  N ND2 . ASN A 1 53  ? 1.462  36.730 -3.965  1.00 12.33 ?  53  ASN A ND2 1 
ATOM   431  N N   . GLN A 1 54  ? 3.312  34.318 -8.221  1.00 7.22  ?  54  GLN A N   1 
ATOM   432  C CA  . GLN A 1 54  ? 2.630  34.350 -9.513  1.00 8.34  ?  54  GLN A CA  1 
ATOM   433  C C   . GLN A 1 54  ? 2.797  33.018 -10.235 1.00 9.00  ?  54  GLN A C   1 
ATOM   434  O O   . GLN A 1 54  ? 3.898  32.458 -10.276 1.00 10.13 ?  54  GLN A O   1 
ATOM   435  C CB  . GLN A 1 54  ? 3.206  35.477 -10.381 1.00 7.59  ?  54  GLN A CB  1 
ATOM   436  C CG  . GLN A 1 54  ? 3.057  36.856 -9.749  1.00 6.44  ?  54  GLN A CG  1 
ATOM   437  C CD  . GLN A 1 54  ? 1.605  37.233 -9.569  1.00 5.94  ?  54  GLN A CD  1 
ATOM   438  O OE1 . GLN A 1 54  ? 0.884  37.445 -10.550 1.00 8.49  ?  54  GLN A OE1 1 
ATOM   439  N NE2 . GLN A 1 54  ? 1.166  37.328 -8.315  1.00 8.05  ?  54  GLN A NE2 1 
ATOM   440  N N   . ARG A 1 55  ? 1.680  32.510 -10.830 1.00 9.26  ?  55  ARG A N   1 
ATOM   441  C CA  . ARG A 1 55  ? 1.750  31.289 -11.637 1.00 7.62  ?  55  ARG A CA  1 
ATOM   442  C C   . ARG A 1 55  ? 1.852  31.647 -13.108 1.00 10.81 ?  55  ARG A C   1 
ATOM   443  O O   . ARG A 1 55  ? 1.084  32.497 -13.589 1.00 11.00 ?  55  ARG A O   1 
ATOM   444  C CB  . ARG A 1 55  ? 0.503  30.425 -11.419 1.00 7.60  ?  55  ARG A CB  1 
ATOM   445  C CG  . ARG A 1 55  ? 0.507  29.640 -10.108 1.00 9.89  ?  55  ARG A CG  1 
ATOM   446  C CD  . ARG A 1 55  ? -0.742 28.778 -9.984  1.00 10.93 ?  55  ARG A CD  1 
ATOM   447  N NE  . ARG A 1 55  ? -1.946 29.609 -9.910  1.00 13.27 ?  55  ARG A NE  1 
ATOM   448  C CZ  . ARG A 1 55  ? -2.397 30.172 -8.796  1.00 14.25 ?  55  ARG A CZ  1 
ATOM   449  N NH1 . ARG A 1 55  ? -1.755 29.998 -7.642  1.00 16.36 ?  55  ARG A NH1 1 
ATOM   450  N NH2 . ARG A 1 55  ? -3.500 30.920 -8.833  1.00 22.69 ?  55  ARG A NH2 1 
ATOM   451  N N   . PRO A 1 56  ? 2.792  31.056 -13.841 1.00 7.71  ?  56  PRO A N   1 
ATOM   452  C CA  . PRO A 1 56  ? 2.777  31.176 -15.299 1.00 9.10  ?  56  PRO A CA  1 
ATOM   453  C C   . PRO A 1 56  ? 1.509  30.548 -15.861 1.00 12.37 ?  56  PRO A C   1 
ATOM   454  O O   . PRO A 1 56  ? 0.846  29.744 -15.206 1.00 9.55  ?  56  PRO A O   1 
ATOM   455  C CB  . PRO A 1 56  ? 4.006  30.360 -15.735 1.00 16.25 ?  56  PRO A CB  1 
ATOM   456  C CG  . PRO A 1 56  ? 4.843  30.196 -14.519 1.00 14.37 ?  56  PRO A CG  1 
ATOM   457  C CD  . PRO A 1 56  ? 3.921  30.241 -13.345 1.00 9.62  ?  56  PRO A CD  1 
ATOM   458  N N   . SER A 1 57  ? 1.200  30.897 -17.109 1.00 13.64 ?  57  SER A N   1 
ATOM   459  C CA  . SER A 1 57  ? 0.084  30.272 -17.807 1.00 18.75 ?  57  SER A CA  1 
ATOM   460  C C   . SER A 1 57  ? 0.281  28.763 -17.863 1.00 14.20 ?  57  SER A C   1 
ATOM   461  O O   . SER A 1 57  ? 1.373  28.281 -18.173 1.00 17.41 ?  57  SER A O   1 
ATOM   462  C CB  . SER A 1 57  ? -0.019 30.834 -19.224 1.00 23.99 ?  57  SER A CB  1 
ATOM   463  O OG  . SER A 1 57  ? -0.936 30.073 -19.991 1.00 38.26 ?  57  SER A OG  1 
ATOM   464  N N   . GLY A 1 58  ? -0.773 28.017 -17.528 1.00 15.93 ?  58  GLY A N   1 
ATOM   465  C CA  . GLY A 1 58  ? -0.748 26.571 -17.596 1.00 18.35 ?  58  GLY A CA  1 
ATOM   466  C C   . GLY A 1 58  ? -0.436 25.867 -16.288 1.00 16.41 ?  58  GLY A C   1 
ATOM   467  O O   . GLY A 1 58  ? -0.698 24.661 -16.180 1.00 16.99 ?  58  GLY A O   1 
ATOM   468  N N   . VAL A 1 59  ? 0.112  26.569 -15.298 1.00 9.23  ?  59  VAL A N   1 
ATOM   469  C CA  . VAL A 1 59  ? 0.374  25.952 -13.994 1.00 9.29  ?  59  VAL A CA  1 
ATOM   470  C C   . VAL A 1 59  ? -0.941 25.872 -13.219 1.00 11.03 ?  59  VAL A C   1 
ATOM   471  O O   . VAL A 1 59  ? -1.625 26.895 -13.074 1.00 13.27 ?  59  VAL A O   1 
ATOM   472  C CB  . VAL A 1 59  ? 1.429  26.757 -13.227 1.00 8.10  ?  59  VAL A CB  1 
ATOM   473  C CG1 . VAL A 1 59  ? 1.597  26.236 -11.797 1.00 9.24  ?  59  VAL A CG1 1 
ATOM   474  C CG2 . VAL A 1 59  ? 2.763  26.673 -13.952 1.00 10.56 ?  59  VAL A CG2 1 
ATOM   475  N N   . PRO A 1 60  ? -1.329 24.695 -12.724 1.00 13.74 ?  60  PRO A N   1 
ATOM   476  C CA  . PRO A 1 60  ? -2.631 24.565 -12.051 1.00 12.48 ?  60  PRO A CA  1 
ATOM   477  C C   . PRO A 1 60  ? -2.695 25.401 -10.784 1.00 16.70 ?  60  PRO A C   1 
ATOM   478  O O   . PRO A 1 60  ? -1.695 25.598 -10.091 1.00 9.65  ?  60  PRO A O   1 
ATOM   479  C CB  . PRO A 1 60  ? -2.708 23.071 -11.705 1.00 18.44 ?  60  PRO A CB  1 
ATOM   480  C CG  . PRO A 1 60  ? -1.665 22.405 -12.544 1.00 25.51 ?  60  PRO A CG  1 
ATOM   481  C CD  . PRO A 1 60  ? -0.590 23.424 -12.765 1.00 16.67 ?  60  PRO A CD  1 
ATOM   482  N N   . ASP A 1 61  ? -3.908 25.857 -10.452 1.00 14.13 ?  61  ASP A N   1 
ATOM   483  C CA  . ASP A 1 61  ? -4.021 26.713 -9.278  1.00 11.08 ?  61  ASP A CA  1 
ATOM   484  C C   . ASP A 1 61  ? -3.838 25.972 -7.961  1.00 12.70 ?  61  ASP A C   1 
ATOM   485  O O   . ASP A 1 61  ? -3.878 26.621 -6.913  1.00 14.55 ?  61  ASP A O   1 
ATOM   486  C CB  . ASP A 1 61  ? -5.285 27.577 -9.296  1.00 19.85 ?  61  ASP A CB  1 
ATOM   487  C CG  . ASP A 1 61  ? -6.545 26.778 -9.430  1.00 26.32 ?  61  ASP A CG  1 
ATOM   488  O OD1 . ASP A 1 61  ? -6.594 25.636 -8.918  1.00 21.94 ?  61  ASP A OD1 1 
ATOM   489  O OD2 . ASP A 1 61  ? -7.499 27.316 -10.042 1.00 21.83 -1 61  ASP A OD2 1 
ATOM   490  N N   . ARG A 1 62  ? -3.619 24.654 -7.979  1.00 13.80 ?  62  ARG A N   1 
ATOM   491  C CA  A ARG A 1 62  ? -3.282 23.960 -6.743  0.65 12.63 ?  62  ARG A CA  1 
ATOM   492  C CA  B ARG A 1 62  ? -3.270 23.936 -6.758  0.35 12.73 ?  62  ARG A CA  1 
ATOM   493  C C   . ARG A 1 62  ? -1.862 24.258 -6.260  1.00 13.63 ?  62  ARG A C   1 
ATOM   494  O O   . ARG A 1 62  ? -1.522 23.893 -5.125  1.00 12.61 ?  62  ARG A O   1 
ATOM   495  C CB  A ARG A 1 62  ? -3.542 22.454 -6.870  0.65 18.90 ?  62  ARG A CB  1 
ATOM   496  C CB  B ARG A 1 62  ? -3.452 22.428 -6.959  0.35 18.80 ?  62  ARG A CB  1 
ATOM   497  C CG  A ARG A 1 62  ? -2.732 21.736 -7.934  0.65 19.73 ?  62  ARG A CG  1 
ATOM   498  C CG  B ARG A 1 62  ? -2.253 21.698 -7.552  0.35 18.64 ?  62  ARG A CG  1 
ATOM   499  C CD  A ARG A 1 62  ? -3.002 20.217 -7.918  0.65 24.20 ?  62  ARG A CD  1 
ATOM   500  C CD  B ARG A 1 62  ? -2.595 20.234 -7.847  0.35 22.96 ?  62  ARG A CD  1 
ATOM   501  N NE  A ARG A 1 62  ? -2.026 19.488 -8.727  0.65 12.10 ?  62  ARG A NE  1 
ATOM   502  N NE  B ARG A 1 62  ? -3.319 20.088 -9.107  0.35 16.63 ?  62  ARG A NE  1 
ATOM   503  C CZ  A ARG A 1 62  ? -2.112 19.362 -10.045 0.65 18.81 ?  62  ARG A CZ  1 
ATOM   504  C CZ  B ARG A 1 62  ? -2.771 19.625 -10.225 0.35 22.81 ?  62  ARG A CZ  1 
ATOM   505  N NH1 A ARG A 1 62  ? -3.132 19.908 -10.699 0.65 26.12 ?  62  ARG A NH1 1 
ATOM   506  N NH1 B ARG A 1 62  ? -3.494 19.535 -11.335 0.35 27.07 ?  62  ARG A NH1 1 
ATOM   507  N NH2 A ARG A 1 62  ? -1.180 18.701 -10.714 0.65 21.06 ?  62  ARG A NH2 1 
ATOM   508  N NH2 B ARG A 1 62  ? -1.499 19.246 -10.230 0.35 17.27 ?  62  ARG A NH2 1 
ATOM   509  N N   . PHE A 1 63  ? -1.038 24.918 -7.071  1.00 9.04  ?  63  PHE A N   1 
ATOM   510  C CA  . PHE A 1 63  ? 0.286  25.379 -6.656  1.00 8.57  ?  63  PHE A CA  1 
ATOM   511  C C   . PHE A 1 63  ? 0.173  26.827 -6.200  1.00 6.91  ?  63  PHE A C   1 
ATOM   512  O O   . PHE A 1 63  ? -0.342 27.674 -6.940  1.00 11.39 ?  63  PHE A O   1 
ATOM   513  C CB  . PHE A 1 63  ? 1.284  25.300 -7.817  1.00 8.34  ?  63  PHE A CB  1 
ATOM   514  C CG  . PHE A 1 63  ? 1.609  23.899 -8.228  1.00 9.48  ?  63  PHE A CG  1 
ATOM   515  C CD1 . PHE A 1 63  ? 2.688  23.230 -7.670  1.00 9.64  ?  63  PHE A CD1 1 
ATOM   516  C CD2 . PHE A 1 63  ? 0.811  23.235 -9.152  1.00 8.10  ?  63  PHE A CD2 1 
ATOM   517  C CE1 . PHE A 1 63  ? 2.973  21.915 -8.038  1.00 14.51 ?  63  PHE A CE1 1 
ATOM   518  C CE2 . PHE A 1 63  ? 1.092  21.920 -9.527  1.00 14.81 ?  63  PHE A CE2 1 
ATOM   519  C CZ  . PHE A 1 63  ? 2.170  21.265 -8.972  1.00 15.17 ?  63  PHE A CZ  1 
ATOM   520  N N   . SER A 1 64  ? 0.677  27.119 -5.001  1.00 9.34  ?  64  SER A N   1 
ATOM   521  C CA  . SER A 1 64  ? 0.640  28.487 -4.496  1.00 12.96 ?  64  SER A CA  1 
ATOM   522  C C   . SER A 1 64  ? 1.919  28.821 -3.745  1.00 9.04  ?  64  SER A C   1 
ATOM   523  O O   . SER A 1 64  ? 2.444  27.996 -2.988  1.00 10.88 ?  64  SER A O   1 
ATOM   524  C CB  . SER A 1 64  ? -0.579 28.762 -3.599  1.00 15.51 ?  64  SER A CB  1 
ATOM   525  O OG  . SER A 1 64  ? -0.552 27.948 -2.447  1.00 15.57 ?  64  SER A OG  1 
ATOM   526  N N   . GLY A 1 65  ? 2.401  30.047 -3.952  1.00 9.65  ?  65  GLY A N   1 
ATOM   527  C CA  . GLY A 1 65  ? 3.583  30.553 -3.275  1.00 8.67  ?  65  GLY A CA  1 
ATOM   528  C C   . GLY A 1 65  ? 3.220  31.597 -2.234  1.00 13.14 ?  65  GLY A C   1 
ATOM   529  O O   . GLY A 1 65  ? 2.231  32.329 -2.378  1.00 10.92 ?  65  GLY A O   1 
ATOM   530  N N   . SER A 1 66  ? 4.017  31.655 -1.171  1.00 9.79  ?  66  SER A N   1 
ATOM   531  C CA  . SER A 1 66  ? 3.812  32.650 -0.124  1.00 9.45  ?  66  SER A CA  1 
ATOM   532  C C   . SER A 1 66  ? 5.159  33.062 0.452   1.00 10.98 ?  66  SER A C   1 
ATOM   533  O O   . SER A 1 66  ? 6.180  32.406 0.241   1.00 10.93 ?  66  SER A O   1 
ATOM   534  C CB  . SER A 1 66  ? 2.916  32.117 0.990   1.00 12.78 ?  66  SER A CB  1 
ATOM   535  O OG  . SER A 1 66  ? 3.440  30.906 1.514   1.00 14.88 ?  66  SER A OG  1 
ATOM   536  N N   . ILE A 1 67  ? 5.140  34.160 1.201   1.00 12.40 ?  67  ILE A N   1 
ATOM   537  C CA  . ILE A 1 67  ? 6.312  34.691 1.887   1.00 13.69 ?  67  ILE A CA  1 
ATOM   538  C C   . ILE A 1 67  ? 5.895  34.958 3.324   1.00 17.60 ?  67  ILE A C   1 
ATOM   539  O O   . ILE A 1 67  ? 4.833  35.547 3.557   1.00 12.41 ?  67  ILE A O   1 
ATOM   540  C CB  . ILE A 1 67  ? 6.783  36.007 1.244   1.00 12.47 ?  67  ILE A CB  1 
ATOM   541  C CG1 . ILE A 1 67  ? 7.122  35.807 -0.236  1.00 15.69 ?  67  ILE A CG1 1 
ATOM   542  C CG2 . ILE A 1 67  ? 7.945  36.620 2.046   1.00 13.85 ?  67  ILE A CG2 1 
ATOM   543  C CD1 . ILE A 1 67  ? 8.407  35.069 -0.468  1.00 14.66 ?  67  ILE A CD1 1 
ATOM   544  N N   . ASP A 1 68  ? 6.719  34.519 4.278   1.00 14.54 ?  68  ASP A N   1 
ATOM   545  C CA  . ASP A 1 68  ? 6.519  34.761 5.711   1.00 15.91 ?  68  ASP A CA  1 
ATOM   546  C C   . ASP A 1 68  ? 7.682  35.627 6.182   1.00 18.79 ?  68  ASP A C   1 
ATOM   547  O O   . ASP A 1 68  ? 8.756  35.107 6.497   1.00 17.18 ?  68  ASP A O   1 
ATOM   548  C CB  . ASP A 1 68  ? 6.489  33.434 6.468   1.00 17.68 ?  68  ASP A CB  1 
ATOM   549  C CG  . ASP A 1 68  ? 6.139  33.595 7.952   1.00 24.57 ?  68  ASP A CG  1 
ATOM   550  O OD1 . ASP A 1 68  ? 6.297  34.707 8.500   1.00 20.59 ?  68  ASP A OD1 1 
ATOM   551  O OD2 . ASP A 1 68  ? 5.709  32.589 8.568   1.00 25.24 -1 68  ASP A OD2 1 
ATOM   552  N N   . ASP A 1 69  ? 7.464  36.945 6.226   1.00 16.05 ?  69  ASP A N   1 
ATOM   553  C CA  . ASP A 1 69  ? 8.519  37.876 6.624   1.00 26.55 ?  69  ASP A CA  1 
ATOM   554  C C   . ASP A 1 69  ? 9.085  37.534 7.994   1.00 22.22 ?  69  ASP A C   1 
ATOM   555  O O   . ASP A 1 69  ? 10.307 37.534 8.190   1.00 20.66 ?  69  ASP A O   1 
ATOM   556  C CB  . ASP A 1 69  ? 7.971  39.299 6.641   1.00 35.95 ?  69  ASP A CB  1 
ATOM   557  C CG  . ASP A 1 69  ? 8.064  39.962 5.302   1.00 40.76 ?  69  ASP A CG  1 
ATOM   558  O OD1 . ASP A 1 69  ? 9.113  40.586 5.031   1.00 56.56 ?  69  ASP A OD1 1 
ATOM   559  O OD2 . ASP A 1 69  ? 7.093  39.859 4.523   1.00 62.14 -1 69  ASP A OD2 1 
ATOM   560  N N   . SER A 1 70  ? 8.209  37.264 8.964   1.00 18.11 ?  70  SER A N   1 
ATOM   561  C CA  . SER A 1 70  ? 8.674  37.032 10.328  1.00 26.98 ?  70  SER A CA  1 
ATOM   562  C C   . SER A 1 70  ? 9.611  35.838 10.405  1.00 29.24 ?  70  SER A C   1 
ATOM   563  O O   . SER A 1 70  ? 10.552 35.836 11.211  1.00 19.97 ?  70  SER A O   1 
ATOM   564  C CB  . SER A 1 70  ? 7.484  36.838 11.276  1.00 28.89 ?  70  SER A CB  1 
ATOM   565  O OG  . SER A 1 70  ? 6.836  35.592 11.051  1.00 43.65 ?  70  SER A OG  1 
ATOM   566  N N   . ALA A 1 71  ? 9.372  34.817 9.585   1.00 18.09 ?  71  ALA A N   1 
ATOM   567  C CA  . ALA A 1 71  ? 10.217 33.633 9.565   1.00 16.86 ?  71  ALA A CA  1 
ATOM   568  C C   . ALA A 1 71  ? 11.361 33.746 8.568   1.00 13.74 ?  71  ALA A C   1 
ATOM   569  O O   . ALA A 1 71  ? 12.181 32.824 8.487   1.00 15.63 ?  71  ALA A O   1 
ATOM   570  C CB  . ALA A 1 71  ? 9.380  32.391 9.244   1.00 20.76 ?  71  ALA A CB  1 
ATOM   571  N N   . ASN A 1 72  ? 11.423 34.839 7.803   1.00 13.00 ?  72  ASN A N   1 
ATOM   572  C CA  . ASN A 1 72  ? 12.428 35.005 6.755   1.00 15.01 ?  72  ASN A CA  1 
ATOM   573  C C   . ASN A 1 72  ? 12.361 33.876 5.732   1.00 13.29 ?  72  ASN A C   1 
ATOM   574  O O   . ASN A 1 72  ? 13.393 33.385 5.262   1.00 11.36 ?  72  ASN A O   1 
ATOM   575  C CB  . ASN A 1 72  ? 13.844 35.110 7.326   1.00 10.55 ?  72  ASN A CB  1 
ATOM   576  C CG  . ASN A 1 72  ? 14.775 35.831 6.397   1.00 12.50 ?  72  ASN A CG  1 
ATOM   577  O OD1 . ASN A 1 72  ? 14.378 36.803 5.758   1.00 15.12 ?  72  ASN A OD1 1 
ATOM   578  N ND2 . ASN A 1 72  ? 16.014 35.361 6.295   1.00 11.19 ?  72  ASN A ND2 1 
ATOM   579  N N   . SER A 1 73  ? 11.149 33.461 5.371   1.00 11.42 ?  73  SER A N   1 
ATOM   580  C CA  . SER A 1 73  ? 11.006 32.271 4.545   1.00 11.95 ?  73  SER A CA  1 
ATOM   581  C C   . SER A 1 73  ? 10.011 32.484 3.414   1.00 14.73 ?  73  SER A C   1 
ATOM   582  O O   . SER A 1 73  ? 9.181  33.396 3.432   1.00 11.96 ?  73  SER A O   1 
ATOM   583  C CB  . SER A 1 73  ? 10.589 31.048 5.374   1.00 12.21 ?  73  SER A CB  1 
ATOM   584  O OG  . SER A 1 73  ? 9.263  31.196 5.859   1.00 15.46 ?  73  SER A OG  1 
ATOM   585  N N   . ALA A 1 74  ? 10.126 31.618 2.415   1.00 10.08 ?  74  ALA A N   1 
ATOM   586  C CA  . ALA A 1 74  ? 9.150  31.499 1.346   1.00 8.30  ?  74  ALA A CA  1 
ATOM   587  C C   . ALA A 1 74  ? 8.645  30.070 1.368   1.00 10.32 ?  74  ALA A C   1 
ATOM   588  O O   . ALA A 1 74  ? 9.373  29.158 1.767   1.00 11.80 ?  74  ALA A O   1 
ATOM   589  C CB  . ALA A 1 74  ? 9.814  31.779 -0.013  1.00 8.65  ?  74  ALA A CB  1 
ATOM   590  N N   . SER A 1 75  ? 7.396  29.864 0.957   1.00 6.03  ?  75  SER A N   1 
ATOM   591  C CA  . SER A 1 75  ? 6.829  28.524 0.957   1.00 8.37  ?  75  SER A CA  1 
ATOM   592  C C   . SER A 1 75  ? 6.143  28.229 -0.363  1.00 11.40 ?  75  SER A C   1 
ATOM   593  O O   . SER A 1 75  ? 5.601  29.124 -1.017  1.00 10.01 ?  75  SER A O   1 
ATOM   594  C CB  . SER A 1 75  ? 5.797  28.326 2.066   1.00 14.76 ?  75  SER A CB  1 
ATOM   595  O OG  . SER A 1 75  ? 6.410  28.431 3.333   1.00 18.22 ?  75  SER A OG  1 
ATOM   596  N N   . LEU A 1 76  ? 6.174  26.953 -0.739  1.00 8.66  ?  76  LEU A N   1 
ATOM   597  C CA  . LEU A 1 76  ? 5.362  26.423 -1.823  1.00 7.16  ?  76  LEU A CA  1 
ATOM   598  C C   . LEU A 1 76  ? 4.363  25.445 -1.225  1.00 10.55 ?  76  LEU A C   1 
ATOM   599  O O   . LEU A 1 76  ? 4.738  24.571 -0.432  1.00 10.70 ?  76  LEU A O   1 
ATOM   600  C CB  . LEU A 1 76  ? 6.231  25.688 -2.842  1.00 9.47  ?  76  LEU A CB  1 
ATOM   601  C CG  . LEU A 1 76  ? 5.496  25.181 -4.083  1.00 8.83  ?  76  LEU A CG  1 
ATOM   602  C CD1 . LEU A 1 76  ? 4.938  26.348 -4.895  1.00 10.45 ?  76  LEU A CD1 1 
ATOM   603  C CD2 . LEU A 1 76  ? 6.427  24.318 -4.937  1.00 11.28 ?  76  LEU A CD2 1 
ATOM   604  N N   . THR A 1 77  ? 3.106  25.579 -1.619  1.00 7.18  ?  77  THR A N   1 
ATOM   605  C CA  . THR A 1 77  ? 2.041  24.685 -1.182  1.00 6.94  ?  77  THR A CA  1 
ATOM   606  C C   . THR A 1 77  ? 1.396  24.044 -2.402  1.00 12.42 ?  77  THR A C   1 
ATOM   607  O O   . THR A 1 77  ? 1.133  24.719 -3.407  1.00 12.64 ?  77  THR A O   1 
ATOM   608  C CB  . THR A 1 77  ? 0.980  25.462 -0.384  1.00 11.30 ?  77  THR A CB  1 
ATOM   609  O OG1 . THR A 1 77  ? 1.596  26.038 0.776   1.00 13.09 ?  77  THR A OG1 1 
ATOM   610  C CG2 . THR A 1 77  ? -0.149 24.519 0.057   1.00 13.51 ?  77  THR A CG2 1 
ATOM   611  N N   . ILE A 1 78  ? 1.168  22.736 -2.327  1.00 10.27 ?  78  ILE A N   1 
ATOM   612  C CA  . ILE A 1 78  ? 0.517  21.993 -3.392  1.00 11.11 ?  78  ILE A CA  1 
ATOM   613  C C   . ILE A 1 78  ? -0.715 21.367 -2.766  1.00 11.18 ?  78  ILE A C   1 
ATOM   614  O O   . ILE A 1 78  ? -0.593 20.473 -1.921  1.00 14.62 ?  78  ILE A O   1 
ATOM   615  C CB  . ILE A 1 78  ? 1.426  20.906 -3.976  1.00 10.03 ?  78  ILE A CB  1 
ATOM   616  C CG1 . ILE A 1 78  ? 2.798  21.468 -4.341  1.00 8.50  ?  78  ILE A CG1 1 
ATOM   617  C CG2 . ILE A 1 78  ? 0.767  20.284 -5.207  1.00 14.26 ?  78  ILE A CG2 1 
ATOM   618  C CD1 . ILE A 1 78  ? 3.748  20.378 -4.878  1.00 15.02 ?  78  ILE A CD1 1 
ATOM   619  N N   . SER A 1 79  ? -1.891 21.858 -3.130  1.00 12.81 ?  79  SER A N   1 
ATOM   620  C CA  A SER A 1 79  ? -3.128 21.257 -2.655  0.59 18.61 ?  79  SER A CA  1 
ATOM   621  C CA  B SER A 1 79  ? -3.123 21.252 -2.652  0.41 18.61 ?  79  SER A CA  1 
ATOM   622  C C   . SER A 1 79  ? -3.596 20.200 -3.647  1.00 27.61 ?  79  SER A C   1 
ATOM   623  O O   . SER A 1 79  ? -3.157 20.163 -4.799  1.00 23.44 ?  79  SER A O   1 
ATOM   624  C CB  A SER A 1 79  ? -4.209 22.320 -2.479  0.59 21.37 ?  79  SER A CB  1 
ATOM   625  C CB  B SER A 1 79  ? -4.198 22.318 -2.445  0.41 21.33 ?  79  SER A CB  1 
ATOM   626  O OG  A SER A 1 79  ? -4.476 22.977 -3.704  0.59 19.48 ?  79  SER A OG  1 
ATOM   627  O OG  B SER A 1 79  ? -3.761 23.294 -1.512  0.41 17.23 ?  79  SER A OG  1 
ATOM   628  N N   . GLY A 1 80  ? -4.488 19.326 -3.180  1.00 19.30 ?  80  GLY A N   1 
ATOM   629  C CA  . GLY A 1 80  ? -5.015 18.270 -4.027  1.00 21.35 ?  80  GLY A CA  1 
ATOM   630  C C   . GLY A 1 80  ? -3.944 17.524 -4.799  1.00 12.96 ?  80  GLY A C   1 
ATOM   631  O O   . GLY A 1 80  ? -4.009 17.439 -6.029  1.00 21.45 ?  80  GLY A O   1 
ATOM   632  N N   . LEU A 1 81  ? -2.947 17.003 -4.080  1.00 17.09 ?  81  LEU A N   1 
ATOM   633  C CA  . LEU A 1 81  ? -1.785 16.381 -4.703  1.00 17.72 ?  81  LEU A CA  1 
ATOM   634  C C   . LEU A 1 81  ? -2.205 15.337 -5.734  1.00 24.69 ?  81  LEU A C   1 
ATOM   635  O O   . LEU A 1 81  ? -3.149 14.570 -5.524  1.00 20.61 ?  81  LEU A O   1 
ATOM   636  C CB  . LEU A 1 81  ? -0.938 15.729 -3.611  1.00 18.19 ?  81  LEU A CB  1 
ATOM   637  C CG  . LEU A 1 81  ? 0.538  15.427 -3.838  1.00 25.29 ?  81  LEU A CG  1 
ATOM   638  C CD1 . LEU A 1 81  ? 1.341  16.687 -4.230  1.00 14.50 ?  81  LEU A CD1 1 
ATOM   639  C CD2 . LEU A 1 81  ? 1.092  14.801 -2.560  1.00 27.97 ?  81  LEU A CD2 1 
ATOM   640  N N   . LYS A 1 82  ? -1.514 15.335 -6.871  1.00 19.72 ?  82  LYS A N   1 
ATOM   641  C CA  . LYS A 1 82  ? -1.728 14.342 -7.912  1.00 19.56 ?  82  LYS A CA  1 
ATOM   642  C C   . LYS A 1 82  ? -0.470 13.512 -8.088  1.00 18.68 ?  82  LYS A C   1 
ATOM   643  O O   . LYS A 1 82  ? 0.638  13.950 -7.773  1.00 15.42 ?  82  LYS A O   1 
ATOM   644  C CB  . LYS A 1 82  ? -2.083 14.994 -9.251  1.00 18.25 ?  82  LYS A CB  1 
ATOM   645  C CG  . LYS A 1 82  ? -3.416 15.676 -9.255  1.00 22.13 ?  82  LYS A CG  1 
ATOM   646  C CD  . LYS A 1 82  ? -3.750 16.154 -10.637 1.00 25.34 ?  82  LYS A CD  1 
ATOM   647  C CE  . LYS A 1 82  ? -5.150 16.720 -10.687 1.00 28.82 ?  82  LYS A CE  1 
ATOM   648  N NZ  . LYS A 1 82  ? -5.520 17.063 -12.093 1.00 47.90 ?  82  LYS A NZ  1 
ATOM   649  N N   . THR A 1 83  ? -0.658 12.291 -8.598  1.00 18.90 ?  83  THR A N   1 
ATOM   650  C CA  A THR A 1 83  ? 0.490  11.428 -8.839  0.49 19.45 ?  83  THR A CA  1 
ATOM   651  C CA  B THR A 1 83  ? 0.472  11.409 -8.876  0.51 19.47 ?  83  THR A CA  1 
ATOM   652  C C   . THR A 1 83  ? 1.529  12.113 -9.718  1.00 11.89 ?  83  THR A C   1 
ATOM   653  O O   . THR A 1 83  ? 2.734  11.959 -9.487  1.00 14.77 ?  83  THR A O   1 
ATOM   654  C CB  A THR A 1 83  ? 0.047  10.091 -9.432  0.49 21.32 ?  83  THR A CB  1 
ATOM   655  C CB  B THR A 1 83  ? -0.037 10.165 -9.607  0.51 20.67 ?  83  THR A CB  1 
ATOM   656  O OG1 A THR A 1 83  ? -1.027 10.307 -10.352 0.49 21.43 ?  83  THR A OG1 1 
ATOM   657  O OG1 B THR A 1 83  ? -0.979 9.478  -8.773  0.51 27.97 ?  83  THR A OG1 1 
ATOM   658  C CG2 A THR A 1 83  ? -0.407 9.155  -8.317  0.49 23.25 ?  83  THR A CG2 1 
ATOM   659  C CG2 B THR A 1 83  ? 1.113  9.236  -9.953  0.51 20.46 ?  83  THR A CG2 1 
ATOM   660  N N   . GLU A 1 84  ? 1.088  12.908 -10.696 1.00 16.52 ?  84  GLU A N   1 
ATOM   661  C CA  . GLU A 1 84  ? 2.016  13.582 -11.597 1.00 13.38 ?  84  GLU A CA  1 
ATOM   662  C C   . GLU A 1 84  ? 2.818  14.686 -10.910 1.00 16.23 ?  84  GLU A C   1 
ATOM   663  O O   . GLU A 1 84  ? 3.818  15.144 -11.475 1.00 13.08 ?  84  GLU A O   1 
ATOM   664  C CB  . GLU A 1 84  ? 1.261  14.137 -12.811 1.00 13.63 ?  84  GLU A CB  1 
ATOM   665  C CG  . GLU A 1 84  ? 0.338  15.278 -12.452 1.00 18.07 ?  84  GLU A CG  1 
ATOM   666  C CD  . GLU A 1 84  ? -0.803 15.454 -13.440 1.00 33.69 ?  84  GLU A CD  1 
ATOM   667  O OE1 . GLU A 1 84  ? -0.705 16.338 -14.317 1.00 36.97 ?  84  GLU A OE1 1 
ATOM   668  O OE2 . GLU A 1 84  ? -1.797 14.703 -13.335 1.00 35.07 -1 84  GLU A OE2 1 
ATOM   669  N N   . ASP A 1 85  ? 2.425  15.104 -9.700  1.00 13.46 ?  85  ASP A N   1 
ATOM   670  C CA  . ASP A 1 85  ? 3.172  16.118 -8.960  1.00 12.47 ?  85  ASP A CA  1 
ATOM   671  C C   . ASP A 1 85  ? 4.445  15.586 -8.329  1.00 15.48 ?  85  ASP A C   1 
ATOM   672  O O   . ASP A 1 85  ? 5.260  16.381 -7.834  1.00 13.40 ?  85  ASP A O   1 
ATOM   673  C CB  . ASP A 1 85  ? 2.281  16.747 -7.883  1.00 12.49 ?  85  ASP A CB  1 
ATOM   674  C CG  . ASP A 1 85  ? 1.086  17.469 -8.472  1.00 17.69 ?  85  ASP A CG  1 
ATOM   675  O OD1 . ASP A 1 85  ? 1.189  17.930 -9.627  1.00 14.35 ?  85  ASP A OD1 1 
ATOM   676  O OD2 . ASP A 1 85  ? 0.043  17.574 -7.782  1.00 16.67 -1 85  ASP A OD2 1 
ATOM   677  N N   . GLU A 1 86  ? 4.642  14.271 -8.331  1.00 13.92 ?  86  GLU A N   1 
ATOM   678  C CA  . GLU A 1 86  ? 5.856  13.702 -7.774  1.00 12.79 ?  86  GLU A CA  1 
ATOM   679  C C   . GLU A 1 86  ? 7.048  14.123 -8.623  1.00 13.95 ?  86  GLU A C   1 
ATOM   680  O O   . GLU A 1 86  ? 7.143  13.768 -9.809  1.00 17.15 ?  86  GLU A O   1 
ATOM   681  C CB  . GLU A 1 86  ? 5.737  12.181 -7.709  1.00 12.63 ?  86  GLU A CB  1 
ATOM   682  C CG  . GLU A 1 86  ? 7.032  11.536 -7.296  1.00 13.72 ?  86  GLU A CG  1 
ATOM   683  C CD  . GLU A 1 86  ? 6.861  10.105 -6.807  1.00 23.09 ?  86  GLU A CD  1 
ATOM   684  O OE1 . GLU A 1 86  ? 5.871  9.819  -6.095  1.00 22.25 ?  86  GLU A OE1 1 
ATOM   685  O OE2 . GLU A 1 86  ? 7.730  9.266  -7.144  1.00 34.47 -1 86  GLU A OE2 1 
ATOM   686  N N   . ALA A 1 87  ? 7.942  14.905 -8.019  1.00 10.38 ?  87  ALA A N   1 
ATOM   687  C CA  . ALA A 1 87  ? 9.067  15.532 -8.698  1.00 9.33  ?  87  ALA A CA  1 
ATOM   688  C C   . ALA A 1 87  ? 9.868  16.302 -7.666  1.00 14.42 ?  87  ALA A C   1 
ATOM   689  O O   . ALA A 1 87  ? 9.470  16.360 -6.496  1.00 11.27 ?  87  ALA A O   1 
ATOM   690  C CB  . ALA A 1 87  ? 8.575  16.526 -9.757  1.00 12.58 ?  87  ALA A CB  1 
ATOM   691  N N   . ASP A 1 88  ? 10.970 16.910 -8.100  1.00 10.32 ?  88  ASP A N   1 
ATOM   692  C CA  . ASP A 1 88  ? 11.787 17.782 -7.271  1.00 9.87  ?  88  ASP A CA  1 
ATOM   693  C C   . ASP A 1 88  ? 11.355 19.224 -7.474  1.00 12.30 ?  88  ASP A C   1 
ATOM   694  O O   . ASP A 1 88  ? 10.986 19.619 -8.583  1.00 10.85 ?  88  ASP A O   1 
ATOM   695  C CB  . ASP A 1 88  ? 13.260 17.662 -7.667  1.00 12.55 ?  88  ASP A CB  1 
ATOM   696  C CG  . ASP A 1 88  ? 13.858 16.327 -7.272  1.00 21.23 ?  88  ASP A CG  1 
ATOM   697  O OD1 . ASP A 1 88  ? 13.522 15.838 -6.184  1.00 21.97 ?  88  ASP A OD1 1 
ATOM   698  O OD2 . ASP A 1 88  ? 14.639 15.753 -8.057  1.00 16.56 -1 88  ASP A OD2 1 
ATOM   699  N N   . TYR A 1 89  ? 11.391 20.003 -6.390  1.00 7.80  ?  89  TYR A N   1 
ATOM   700  C CA  . TYR A 1 89  ? 11.015 21.410 -6.426  1.00 8.18  ?  89  TYR A CA  1 
ATOM   701  C C   . TYR A 1 89  ? 12.137 22.230 -5.811  1.00 8.84  ?  89  TYR A C   1 
ATOM   702  O O   . TYR A 1 89  ? 12.592 21.919 -4.704  1.00 11.62 ?  89  TYR A O   1 
ATOM   703  C CB  . TYR A 1 89  ? 9.698  21.645 -5.660  1.00 7.09  ?  89  TYR A CB  1 
ATOM   704  C CG  . TYR A 1 89  ? 8.528  20.952 -6.337  1.00 6.22  ?  89  TYR A CG  1 
ATOM   705  C CD1 . TYR A 1 89  ? 7.714  21.632 -7.235  1.00 6.76  ?  89  TYR A CD1 1 
ATOM   706  C CD2 . TYR A 1 89  ? 8.258  19.611 -6.098  1.00 7.69  ?  89  TYR A CD2 1 
ATOM   707  C CE1 . TYR A 1 89  ? 6.664  20.988 -7.879  1.00 5.76  ?  89  TYR A CE1 1 
ATOM   708  C CE2 . TYR A 1 89  ? 7.208  18.965 -6.732  1.00 9.53  ?  89  TYR A CE2 1 
ATOM   709  C CZ  . TYR A 1 89  ? 6.416  19.660 -7.615  1.00 6.43  ?  89  TYR A CZ  1 
ATOM   710  O OH  . TYR A 1 89  ? 5.375  19.009 -8.240  1.00 7.44  ?  89  TYR A OH  1 
ATOM   711  N N   . TYR A 1 90  ? 12.575 23.273 -6.516  1.00 7.97  ?  90  TYR A N   1 
ATOM   712  C CA  . TYR A 1 90  ? 13.648 24.149 -6.048  1.00 7.23  ?  90  TYR A CA  1 
ATOM   713  C C   . TYR A 1 90  ? 13.146 25.577 -5.901  1.00 7.56  ?  90  TYR A C   1 
ATOM   714  O O   . TYR A 1 90  ? 12.525 26.116 -6.821  1.00 9.06  ?  90  TYR A O   1 
ATOM   715  C CB  . TYR A 1 90  ? 14.833 24.143 -7.041  1.00 8.73  ?  90  TYR A CB  1 
ATOM   716  C CG  . TYR A 1 90  ? 15.417 22.771 -7.180  1.00 10.30 ?  90  TYR A CG  1 
ATOM   717  C CD1 . TYR A 1 90  ? 16.378 22.325 -6.284  1.00 10.38 ?  90  TYR A CD1 1 
ATOM   718  C CD2 . TYR A 1 90  ? 14.985 21.896 -8.175  1.00 8.38  ?  90  TYR A CD2 1 
ATOM   719  C CE1 . TYR A 1 90  ? 16.892 21.056 -6.363  1.00 10.07 ?  90  TYR A CE1 1 
ATOM   720  C CE2 . TYR A 1 90  ? 15.502 20.603 -8.259  1.00 11.70 ?  90  TYR A CE2 1 
ATOM   721  C CZ  . TYR A 1 90  ? 16.467 20.199 -7.340  1.00 8.76  ?  90  TYR A CZ  1 
ATOM   722  O OH  . TYR A 1 90  ? 16.999 18.930 -7.401  1.00 11.92 ?  90  TYR A OH  1 
ATOM   723  N N   . CYS A 1 91  ? 13.419 26.198 -4.753  1.00 8.21  ?  91  CYS A N   1 
ATOM   724  C CA  A CYS A 1 91  ? 13.266 27.639 -4.671  0.34 8.27  ?  91  CYS A CA  1 
ATOM   725  C CA  B CYS A 1 91  ? 13.266 27.641 -4.673  0.66 8.26  ?  91  CYS A CA  1 
ATOM   726  C C   . CYS A 1 91  ? 14.526 28.326 -5.187  1.00 9.10  ?  91  CYS A C   1 
ATOM   727  O O   . CYS A 1 91  ? 15.616 27.740 -5.228  1.00 9.94  ?  91  CYS A O   1 
ATOM   728  C CB  A CYS A 1 91  ? 12.946 28.087 -3.243  0.34 11.51 ?  91  CYS A CB  1 
ATOM   729  C CB  B CYS A 1 91  ? 13.003 28.094 -3.240  0.66 11.55 ?  91  CYS A CB  1 
ATOM   730  S SG  A CYS A 1 91  ? 14.168 27.664 -1.979  0.34 9.84  ?  91  CYS A SG  1 
ATOM   731  S SG  B CYS A 1 91  ? 14.460 27.993 -2.205  0.66 13.18 ?  91  CYS A SG  1 
ATOM   732  N N   . GLN A 1 92  ? 14.371 29.586 -5.577  1.00 8.14  ?  92  GLN A N   1 
ATOM   733  C CA  . GLN A 1 92  ? 15.472 30.322 -6.188  1.00 9.21  ?  92  GLN A CA  1 
ATOM   734  C C   . GLN A 1 92  ? 15.249 31.809 -5.980  1.00 9.81  ?  92  GLN A C   1 
ATOM   735  O O   . GLN A 1 92  ? 14.119 32.291 -6.083  1.00 8.67  ?  92  GLN A O   1 
ATOM   736  C CB  . GLN A 1 92  ? 15.549 30.033 -7.696  1.00 7.98  ?  92  GLN A CB  1 
ATOM   737  C CG  . GLN A 1 92  ? 16.596 30.868 -8.454  1.00 8.12  ?  92  GLN A CG  1 
ATOM   738  C CD  . GLN A 1 92  ? 15.996 32.068 -9.148  1.00 7.03  ?  92  GLN A CD  1 
ATOM   739  O OE1 . GLN A 1 92  ? 14.959 31.954 -9.781  1.00 9.49  ?  92  GLN A OE1 1 
ATOM   740  N NE2 . GLN A 1 92  ? 16.633 33.233 -9.010  1.00 9.17  ?  92  GLN A NE2 1 
ATOM   741  N N   . SER A 1 93  ? 16.327 32.530 -5.681  1.00 7.96  ?  93  SER A N   1 
ATOM   742  C CA  . SER A 1 93  ? 16.240 33.977 -5.587  1.00 6.97  ?  93  SER A CA  1 
ATOM   743  C C   . SER A 1 93  ? 17.593 34.583 -5.934  1.00 11.40 ?  93  SER A C   1 
ATOM   744  O O   . SER A 1 93  ? 18.354 33.987 -6.711  1.00 10.64 ?  93  SER A O   1 
ATOM   745  C CB  . SER A 1 93  ? 15.741 34.399 -4.199  1.00 10.05 ?  93  SER A CB  1 
ATOM   746  O OG  . SER A 1 93  ? 15.364 35.760 -4.202  1.00 10.03 ?  93  SER A OG  1 
ATOM   747  N N   . TYR A 1 94  ? 17.910 35.750 -5.373  1.00 8.66  ?  94  TYR A N   1 
ATOM   748  C CA  . TYR A 1 94  ? 19.104 36.490 -5.752  1.00 8.17  ?  94  TYR A CA  1 
ATOM   749  C C   . TYR A 1 94  ? 19.769 37.051 -4.510  1.00 16.26 ?  94  TYR A C   1 
ATOM   750  O O   . TYR A 1 94  ? 19.097 37.414 -3.539  1.00 12.61 ?  94  TYR A O   1 
ATOM   751  C CB  . TYR A 1 94  ? 18.782 37.672 -6.667  1.00 9.16  ?  94  TYR A CB  1 
ATOM   752  C CG  . TYR A 1 94  ? 18.006 37.233 -7.874  1.00 11.83 ?  94  TYR A CG  1 
ATOM   753  C CD1 . TYR A 1 94  ? 18.655 36.693 -8.976  1.00 13.87 ?  94  TYR A CD1 1 
ATOM   754  C CD2 . TYR A 1 94  ? 16.617 37.329 -7.898  1.00 11.97 ?  94  TYR A CD2 1 
ATOM   755  C CE1 . TYR A 1 94  ? 17.939 36.263 -10.093 1.00 11.71 ?  94  TYR A CE1 1 
ATOM   756  C CE2 . TYR A 1 94  ? 15.887 36.885 -9.011  1.00 14.45 ?  94  TYR A CE2 1 
ATOM   757  C CZ  . TYR A 1 94  ? 16.553 36.364 -10.099 1.00 14.75 ?  94  TYR A CZ  1 
ATOM   758  O OH  . TYR A 1 94  ? 15.832 35.938 -11.201 1.00 13.82 ?  94  TYR A OH  1 
ATOM   759  N N   . ASN A 1 95  ? 21.096 37.120 -4.562  1.00 13.07 ?  95  ASN A N   1 
ATOM   760  C CA  . ASN A 1 95  ? 21.865 37.783 -3.519  1.00 14.27 ?  95  ASN A CA  1 
ATOM   761  C C   . ASN A 1 95  ? 22.004 39.276 -3.828  1.00 15.27 ?  95  ASN A C   1 
ATOM   762  O O   . ASN A 1 95  ? 21.505 39.779 -4.840  1.00 16.23 ?  95  ASN A O   1 
ATOM   763  C CB  . ASN A 1 95  ? 23.198 37.066 -3.289  1.00 12.09 ?  95  ASN A CB  1 
ATOM   764  C CG  . ASN A 1 95  ? 24.186 37.250 -4.438  1.00 11.57 ?  95  ASN A CG  1 
ATOM   765  O OD1 . ASN A 1 95  ? 24.039 38.137 -5.278  1.00 14.55 ?  95  ASN A OD1 1 
ATOM   766  N ND2 . ASN A 1 95  ? 25.221 36.420 -4.451  1.00 18.08 ?  95  ASN A ND2 1 
ATOM   767  N N   . SER A 1 96  ? 22.713 39.997 -2.950  1.00 18.65 ?  96  SER A N   1 
ATOM   768  C CA  . SER A 1 96  ? 22.810 41.450 -3.079  1.00 18.82 ?  96  SER A CA  1 
ATOM   769  C C   . SER A 1 96  ? 23.544 41.881 -4.341  1.00 19.06 ?  96  SER A C   1 
ATOM   770  O O   . SER A 1 96  ? 23.418 43.041 -4.751  1.00 28.07 ?  96  SER A O   1 
ATOM   771  C CB  . SER A 1 96  ? 23.495 42.054 -1.848  1.00 22.09 ?  96  SER A CB  1 
ATOM   772  O OG  . SER A 1 96  ? 24.826 41.588 -1.732  1.00 34.68 ?  96  SER A OG  1 
ATOM   773  N N   . ASN A 1 97  ? 24.297 40.981 -4.969  1.00 20.55 ?  97  ASN A N   1 
ATOM   774  C CA  . ASN A 1 97  ? 24.961 41.259 -6.238  1.00 20.62 ?  97  ASN A CA  1 
ATOM   775  C C   . ASN A 1 97  ? 24.151 40.807 -7.453  1.00 21.92 ?  97  ASN A C   1 
ATOM   776  O O   . ASN A 1 97  ? 24.702 40.736 -8.559  1.00 18.64 ?  97  ASN A O   1 
ATOM   777  C CB  . ASN A 1 97  ? 26.353 40.621 -6.263  1.00 24.28 ?  97  ASN A CB  1 
ATOM   778  C CG  . ASN A 1 97  ? 27.285 41.237 -5.240  1.00 30.76 ?  97  ASN A CG  1 
ATOM   779  O OD1 . ASN A 1 97  ? 27.889 40.532 -4.433  1.00 31.70 ?  97  ASN A OD1 1 
ATOM   780  N ND2 . ASN A 1 97  ? 27.386 42.566 -5.253  1.00 29.86 ?  97  ASN A ND2 1 
ATOM   781  N N   . HIS A 1 98  ? 22.865 40.507 -7.266  1.00 18.30 ?  98  HIS A N   1 
ATOM   782  C CA  . HIS A 1 98  ? 21.952 40.095 -8.322  1.00 19.82 ?  98  HIS A CA  1 
ATOM   783  C C   . HIS A 1 98  ? 22.289 38.724 -8.897  1.00 17.93 ?  98  HIS A C   1 
ATOM   784  O O   . HIS A 1 98  ? 21.842 38.387 -9.994  1.00 13.94 ?  98  HIS A O   1 
ATOM   785  C CB  . HIS A 1 98  ? 21.811 41.165 -9.415  1.00 27.71 ?  98  HIS A CB  1 
ATOM   786  C CG  . HIS A 1 98  ? 21.763 42.559 -8.870  1.00 35.42 ?  98  HIS A CG  1 
ATOM   787  N ND1 . HIS A 1 98  ? 20.751 42.999 -8.044  1.00 38.54 ?  98  HIS A ND1 1 
ATOM   788  C CD2 . HIS A 1 98  ? 22.616 43.602 -9.007  1.00 36.35 ?  98  HIS A CD2 1 
ATOM   789  C CE1 . HIS A 1 98  ? 20.976 44.256 -7.702  1.00 35.87 ?  98  HIS A CE1 1 
ATOM   790  N NE2 . HIS A 1 98  ? 22.101 44.646 -8.276  1.00 44.31 ?  98  HIS A NE2 1 
ATOM   791  N N   . HIS A 1 99  ? 23.049 37.913 -8.170  1.00 13.13 ?  99  HIS A N   1 
ATOM   792  C CA  . HIS A 1 99  ? 23.418 36.588 -8.642  1.00 13.63 ?  99  HIS A CA  1 
ATOM   793  C C   . HIS A 1 99  ? 22.469 35.538 -8.085  1.00 15.36 ?  99  HIS A C   1 
ATOM   794  O O   . HIS A 1 99  ? 21.918 35.694 -6.995  1.00 14.25 ?  99  HIS A O   1 
ATOM   795  C CB  . HIS A 1 99  ? 24.868 36.268 -8.279  1.00 15.05 ?  99  HIS A CB  1 
ATOM   796  C CG  . HIS A 1 99  ? 25.849 37.152 -8.983  1.00 14.35 ?  99  HIS A CG  1 
ATOM   797  N ND1 . HIS A 1 99  ? 26.948 37.701 -8.361  1.00 19.20 ?  99  HIS A ND1 1 
ATOM   798  C CD2 . HIS A 1 99  ? 25.872 37.603 -10.260 1.00 17.97 ?  99  HIS A CD2 1 
ATOM   799  C CE1 . HIS A 1 99  ? 27.618 38.440 -9.229  1.00 20.18 ?  99  HIS A CE1 1 
ATOM   800  N NE2 . HIS A 1 99  ? 26.987 38.397 -10.390 1.00 17.11 ?  99  HIS A NE2 1 
ATOM   801  N N   . VAL A 1 100 ? 22.299 34.454 -8.845  1.00 10.31 ?  100 VAL A N   1 
ATOM   802  C CA  . VAL A 1 100 ? 21.261 33.462 -8.573  1.00 9.51  ?  100 VAL A CA  1 
ATOM   803  C C   . VAL A 1 100 ? 21.660 32.595 -7.389  1.00 15.96 ?  100 VAL A C   1 
ATOM   804  O O   . VAL A 1 100 ? 22.820 32.180 -7.264  1.00 14.97 ?  100 VAL A O   1 
ATOM   805  C CB  . VAL A 1 100 ? 21.023 32.608 -9.834  1.00 9.32  ?  100 VAL A CB  1 
ATOM   806  C CG1 . VAL A 1 100 ? 20.112 31.420 -9.548  1.00 8.36  ?  100 VAL A CG1 1 
ATOM   807  C CG2 . VAL A 1 100 ? 20.438 33.476 -10.956 1.00 10.12 ?  100 VAL A CG2 1 
ATOM   808  N N   . VAL A 1 101 ? 20.689 32.302 -6.518  1.00 9.83  ?  101 VAL A N   1 
ATOM   809  C CA  . VAL A 1 101 ? 20.864 31.390 -5.392  1.00 9.22  ?  101 VAL A CA  1 
ATOM   810  C C   . VAL A 1 101 ? 19.725 30.377 -5.415  1.00 10.22 ?  101 VAL A C   1 
ATOM   811  O O   . VAL A 1 101 ? 18.556 30.761 -5.548  1.00 10.78 ?  101 VAL A O   1 
ATOM   812  C CB  . VAL A 1 101 ? 20.875 32.155 -4.056  1.00 14.02 ?  101 VAL A CB  1 
ATOM   813  C CG1 . VAL A 1 101 ? 20.945 31.184 -2.885  1.00 15.04 ?  101 VAL A CG1 1 
ATOM   814  C CG2 . VAL A 1 101 ? 22.038 33.139 -4.030  1.00 14.90 ?  101 VAL A CG2 1 
ATOM   815  N N   . PHE A 1 102 ? 20.064 29.095 -5.311  1.00 9.89  ?  102 PHE A N   1 
ATOM   816  C CA  . PHE A 1 102 ? 19.086 28.014 -5.273  1.00 9.24  ?  102 PHE A CA  1 
ATOM   817  C C   . PHE A 1 102 ? 18.977 27.417 -3.879  1.00 12.76 ?  102 PHE A C   1 
ATOM   818  O O   . PHE A 1 102 ? 19.988 27.201 -3.196  1.00 12.69 ?  102 PHE A O   1 
ATOM   819  C CB  . PHE A 1 102 ? 19.467 26.866 -6.217  1.00 10.19 ?  102 PHE A CB  1 
ATOM   820  C CG  . PHE A 1 102 ? 19.171 27.142 -7.659  1.00 10.44 ?  102 PHE A CG  1 
ATOM   821  C CD1 . PHE A 1 102 ? 17.873 27.049 -8.143  1.00 8.92  ?  102 PHE A CD1 1 
ATOM   822  C CD2 . PHE A 1 102 ? 20.189 27.457 -8.539  1.00 14.02 ?  102 PHE A CD2 1 
ATOM   823  C CE1 . PHE A 1 102 ? 17.598 27.284 -9.481  1.00 9.57  ?  102 PHE A CE1 1 
ATOM   824  C CE2 . PHE A 1 102 ? 19.929 27.703 -9.877  1.00 13.71 ?  102 PHE A CE2 1 
ATOM   825  C CZ  . PHE A 1 102 ? 18.625 27.626 -10.349 1.00 11.60 ?  102 PHE A CZ  1 
ATOM   826  N N   . GLY A 1 103 ? 17.751 27.102 -3.483  1.00 8.41  ?  103 GLY A N   1 
ATOM   827  C CA  . GLY A 1 103 ? 17.558 26.184 -2.383  1.00 7.23  ?  103 GLY A CA  1 
ATOM   828  C C   . GLY A 1 103 ? 18.029 24.787 -2.738  1.00 11.26 ?  103 GLY A C   1 
ATOM   829  O O   . GLY A 1 103 ? 18.203 24.432 -3.906  1.00 12.05 ?  103 GLY A O   1 
ATOM   830  N N   . GLY A 1 104 ? 18.214 23.964 -1.705  1.00 10.01 ?  104 GLY A N   1 
ATOM   831  C CA  . GLY A 1 104 ? 18.739 22.633 -1.921  1.00 10.30 ?  104 GLY A CA  1 
ATOM   832  C C   . GLY A 1 104 ? 17.775 21.682 -2.594  1.00 14.46 ?  104 GLY A C   1 
ATOM   833  O O   . GLY A 1 104 ? 18.206 20.633 -3.062  1.00 11.50 ?  104 GLY A O   1 
ATOM   834  N N   . GLY A 1 105 ? 16.492 22.011 -2.631  1.00 10.54 ?  105 GLY A N   1 
ATOM   835  C CA  . GLY A 1 105 ? 15.484 21.210 -3.298  1.00 8.20  ?  105 GLY A CA  1 
ATOM   836  C C   . GLY A 1 105 ? 14.719 20.293 -2.363  1.00 13.72 ?  105 GLY A C   1 
ATOM   837  O O   . GLY A 1 105 ? 15.250 19.775 -1.374  1.00 14.39 ?  105 GLY A O   1 
ATOM   838  N N   . THR A 1 106 ? 13.450 20.051 -2.709  1.00 8.34  ?  106 THR A N   1 
ATOM   839  C CA  . THR A 1 106 ? 12.584 19.126 -1.994  1.00 8.83  ?  106 THR A CA  1 
ATOM   840  C C   . THR A 1 106 ? 11.993 18.126 -2.972  1.00 13.72 ?  106 THR A C   1 
ATOM   841  O O   . THR A 1 106 ? 11.420 18.519 -3.997  1.00 9.29  ?  106 THR A O   1 
ATOM   842  C CB  . THR A 1 106 ? 11.427 19.878 -1.331  1.00 6.42  ?  106 THR A CB  1 
ATOM   843  O OG1 . THR A 1 106 ? 11.961 20.911 -0.494  1.00 10.02 ?  106 THR A OG1 1 
ATOM   844  C CG2 . THR A 1 106 ? 10.567 18.934 -0.518  1.00 10.42 ?  106 THR A CG2 1 
ATOM   845  N N   . LYS A 1 107 ? 12.094 16.845 -2.646  1.00 13.49 ?  107 LYS A N   1 
ATOM   846  C CA  . LYS A 1 107 ? 11.410 15.825 -3.427  1.00 13.96 ?  107 LYS A CA  1 
ATOM   847  C C   . LYS A 1 107 ? 10.028 15.588 -2.833  1.00 14.93 ?  107 LYS A C   1 
ATOM   848  O O   . LYS A 1 107 ? 9.901  15.243 -1.652  1.00 17.92 ?  107 LYS A O   1 
ATOM   849  C CB  . LYS A 1 107 ? 12.213 14.523 -3.473  1.00 18.06 ?  107 LYS A CB  1 
ATOM   850  C CG  . LYS A 1 107 ? 11.494 13.375 -4.190  1.00 20.09 ?  107 LYS A CG  1 
ATOM   851  C CD  . LYS A 1 107 ? 11.225 13.717 -5.650  1.00 19.13 ?  107 LYS A CD  1 
ATOM   852  C CE  . LYS A 1 107 ? 11.279 12.477 -6.534  1.00 29.97 ?  107 LYS A CE  1 
ATOM   853  N NZ  . LYS A 1 107 ? 10.306 11.438 -6.097  1.00 30.55 ?  107 LYS A NZ  1 
ATOM   854  N N   . VAL A 1 108 ? 8.999  15.803 -3.640  1.00 9.94  ?  108 VAL A N   1 
ATOM   855  C CA  . VAL A 1 108 ? 7.633  15.457 -3.270  1.00 12.10 ?  108 VAL A CA  1 
ATOM   856  C C   . VAL A 1 108 ? 7.366  14.030 -3.728  1.00 21.88 ?  108 VAL A C   1 
ATOM   857  O O   . VAL A 1 108 ? 7.418  13.729 -4.926  1.00 14.59 ?  108 VAL A O   1 
ATOM   858  C CB  . VAL A 1 108 ? 6.624  16.433 -3.892  1.00 11.04 ?  108 VAL A CB  1 
ATOM   859  C CG1 . VAL A 1 108 ? 5.189  15.962 -3.639  1.00 15.81 ?  108 VAL A CG1 1 
ATOM   860  C CG2 . VAL A 1 108 ? 6.857  17.838 -3.329  1.00 10.93 ?  108 VAL A CG2 1 
ATOM   861  N N   . THR A 1 109 ? 7.087  13.147 -2.777  1.00 20.59 ?  109 THR A N   1 
ATOM   862  C CA  . THR A 1 109 ? 6.706  11.775 -3.073  1.00 21.37 ?  109 THR A CA  1 
ATOM   863  C C   . THR A 1 109 ? 5.209  11.630 -2.846  1.00 27.12 ?  109 THR A C   1 
ATOM   864  O O   . THR A 1 109 ? 4.696  11.998 -1.784  1.00 26.69 ?  109 THR A O   1 
ATOM   865  C CB  . THR A 1 109 ? 7.482  10.797 -2.183  1.00 17.69 ?  109 THR A CB  1 
ATOM   866  O OG1 . THR A 1 109 ? 8.887  10.892 -2.459  1.00 28.58 ?  109 THR A OG1 1 
ATOM   867  C CG2 . THR A 1 109 ? 7.011  9.372  -2.423  1.00 25.78 ?  109 THR A CG2 1 
ATOM   868  N N   . VAL A 1 110 ? 4.506  11.108 -3.845  1.00 19.56 ?  110 VAL A N   1 
ATOM   869  C CA  . VAL A 1 110 ? 3.069  10.894 -3.767  1.00 24.88 ?  110 VAL A CA  1 
ATOM   870  C C   . VAL A 1 110 ? 2.838  9.427  -3.437  1.00 38.52 ?  110 VAL A C   1 
ATOM   871  O O   . VAL A 1 110 ? 3.384  8.543  -4.107  1.00 28.93 ?  110 VAL A O   1 
ATOM   872  C CB  . VAL A 1 110 ? 2.383  11.304 -5.082  1.00 28.64 ?  110 VAL A CB  1 
ATOM   873  C CG1 . VAL A 1 110 ? 0.892  11.148 -4.978  1.00 23.16 ?  110 VAL A CG1 1 
ATOM   874  C CG2 . VAL A 1 110 ? 2.747  12.757 -5.433  1.00 22.39 ?  110 VAL A CG2 1 
ATOM   875  N N   . LEU A 1 111 ? 2.052  9.170  -2.392  1.00 34.04 ?  111 LEU A N   1 
ATOM   876  C CA  . LEU A 1 111 ? 1.903  7.821  -1.834  1.00 34.96 ?  111 LEU A CA  1 
ATOM   877  C C   . LEU A 1 111 ? 0.600  7.157  -2.255  1.00 30.46 ?  111 LEU A C   1 
ATOM   878  O O   . LEU A 1 111 ? 0.214  7.203  -3.425  1.00 42.70 ?  111 LEU A O   1 
ATOM   879  C CB  . LEU A 1 111 ? 1.967  7.881  -0.306  1.00 34.93 ?  111 LEU A CB  1 
ATOM   880  C CG  . LEU A 1 111 ? 3.235  8.473  0.310   1.00 30.25 ?  111 LEU A CG  1 
ATOM   881  C CD1 . LEU A 1 111 ? 3.021  8.795  1.781   1.00 41.37 ?  111 LEU A CD1 1 
ATOM   882  C CD2 . LEU A 1 111 ? 4.420  7.532  0.129   1.00 35.70 ?  111 LEU A CD2 1 
HETATM 883  C C   . ACT B 2 .   ? 17.962 41.081 -7.131  1.00 36.00 ?  201 ACT A C   1 
HETATM 884  O O   . ACT B 2 .   ? 18.242 40.931 -8.352  1.00 39.66 ?  201 ACT A O   1 
HETATM 885  O OXT . ACT B 2 .   ? 16.748 41.019 -6.824  1.00 28.14 ?  201 ACT A OXT 1 
HETATM 886  C CH3 . ACT B 2 .   ? 19.011 41.320 -6.083  1.00 31.94 ?  201 ACT A CH3 1 
HETATM 887  O O   . HOH C 3 .   ? -4.095 19.648 -13.570 1.00 39.33 ?  301 HOH A O   1 
HETATM 888  O O   . HOH C 3 .   ? 18.377 39.334 -2.234  1.00 15.46 ?  302 HOH A O   1 
HETATM 889  O O   . HOH C 3 .   ? -1.581 12.754 -11.877 1.00 23.36 ?  303 HOH A O   1 
HETATM 890  O O   . HOH C 3 .   ? 13.397 38.885 6.718   1.00 36.93 ?  304 HOH A O   1 
HETATM 891  O O   . HOH C 3 .   ? -5.994 17.245 -7.542  1.00 39.41 ?  305 HOH A O   1 
HETATM 892  O O   . HOH C 3 .   ? 5.567  25.678 4.401   1.00 32.54 ?  306 HOH A O   1 
HETATM 893  O O   . HOH C 3 .   ? -6.520 22.076 -4.874  1.00 39.05 ?  307 HOH A O   1 
HETATM 894  O O   . HOH C 3 .   ? 7.395  40.744 2.171   1.00 40.47 ?  308 HOH A O   1 
HETATM 895  O O   . HOH C 3 .   ? -1.951 18.413 -13.550 1.00 37.29 ?  309 HOH A O   1 
HETATM 896  O O   . HOH C 3 .   ? 13.597 37.061 -11.687 1.00 24.40 ?  310 HOH A O   1 
HETATM 897  O O   . HOH C 3 .   ? 13.286 26.325 5.405   1.00 18.16 ?  311 HOH A O   1 
HETATM 898  O O   . HOH C 3 .   ? 9.976  9.656  -8.331  1.00 35.55 ?  312 HOH A O   1 
HETATM 899  O O   . HOH C 3 .   ? -4.470 31.586 -6.546  1.00 25.36 ?  313 HOH A O   1 
HETATM 900  O O   . HOH C 3 .   ? 16.327 17.437 -9.389  1.00 17.50 ?  314 HOH A O   1 
HETATM 901  O O   . HOH C 3 .   ? 24.598 32.380 4.874   1.00 31.57 ?  315 HOH A O   1 
HETATM 902  O O   . HOH C 3 .   ? -5.030 13.115 -6.574  1.00 31.99 ?  316 HOH A O   1 
HETATM 903  O O   A HOH C 3 .   ? 27.692 37.131 -5.928  0.58 20.58 ?  317 HOH A O   1 
HETATM 904  O O   B HOH C 3 .   ? 28.805 36.326 -5.316  0.42 23.10 ?  317 HOH A O   1 
HETATM 905  O O   . HOH C 3 .   ? 10.445 31.755 -15.226 1.00 25.92 ?  318 HOH A O   1 
HETATM 906  O O   . HOH C 3 .   ? 3.625  7.743  -6.590  1.00 33.89 ?  319 HOH A O   1 
HETATM 907  O O   . HOH C 3 .   ? 14.637 13.131 -7.953  1.00 65.84 ?  320 HOH A O   1 
HETATM 908  O O   . HOH C 3 .   ? 5.385  39.698 -2.660  1.00 41.38 ?  321 HOH A O   1 
HETATM 909  O O   . HOH C 3 .   ? -5.770 18.954 -0.570  1.00 25.93 ?  322 HOH A O   1 
HETATM 910  O O   . HOH C 3 .   ? 5.827  26.523 -16.419 1.00 27.88 ?  323 HOH A O   1 
HETATM 911  O O   . HOH C 3 .   ? 4.735  39.716 -11.458 1.00 18.37 ?  324 HOH A O   1 
HETATM 912  O O   . HOH C 3 .   ? 10.358 12.703 -1.002  1.00 23.68 ?  325 HOH A O   1 
HETATM 913  O O   . HOH C 3 .   ? -7.919 29.313 -11.768 1.00 18.04 ?  326 HOH A O   1 
HETATM 914  O O   . HOH C 3 .   ? 14.934 36.490 -1.333  1.00 15.77 ?  327 HOH A O   1 
HETATM 915  O O   . HOH C 3 .   ? 0.014  29.423 -0.258  1.00 29.88 ?  328 HOH A O   1 
HETATM 916  O O   . HOH C 3 .   ? 1.490  34.771 -15.403 1.00 27.91 ?  329 HOH A O   1 
HETATM 917  O O   . HOH C 3 .   ? 17.194 20.326 0.426   1.00 16.13 ?  330 HOH A O   1 
HETATM 918  O O   . HOH C 3 .   ? 14.210 40.270 -7.395  1.00 14.19 ?  331 HOH A O   1 
HETATM 919  O O   . HOH C 3 .   ? -3.077 29.074 -12.375 1.00 20.11 ?  332 HOH A O   1 
HETATM 920  O O   . HOH C 3 .   ? 13.371 44.668 -2.620  1.00 47.76 ?  333 HOH A O   1 
HETATM 921  O O   . HOH C 3 .   ? 11.875 28.667 8.576   1.00 22.45 ?  334 HOH A O   1 
HETATM 922  O O   . HOH C 3 .   ? -0.446 32.179 -1.936  1.00 33.44 ?  335 HOH A O   1 
HETATM 923  O O   . HOH C 3 .   ? 11.093 39.537 -11.451 1.00 27.08 ?  336 HOH A O   1 
HETATM 924  O O   . HOH C 3 .   ? 5.954  24.159 -14.609 1.00 28.72 ?  337 HOH A O   1 
HETATM 925  O O   . HOH C 3 .   ? 5.207  37.211 8.649   1.00 42.82 ?  338 HOH A O   1 
HETATM 926  O O   . HOH C 3 .   ? 25.383 37.249 3.389   1.00 33.32 ?  339 HOH A O   1 
HETATM 927  O O   . HOH C 3 .   ? 4.516  31.697 3.906   1.00 21.38 ?  340 HOH A O   1 
HETATM 928  O O   . HOH C 3 .   ? 24.043 34.439 -10.961 1.00 22.13 ?  341 HOH A O   1 
HETATM 929  O O   . HOH C 3 .   ? -1.889 25.575 -2.836  1.00 16.23 ?  342 HOH A O   1 
HETATM 930  O O   . HOH C 3 .   ? 11.137 36.384 -11.220 1.00 27.12 ?  343 HOH A O   1 
HETATM 931  O O   . HOH C 3 .   ? 12.869 38.379 8.787   1.00 32.88 ?  344 HOH A O   1 
HETATM 932  O O   . HOH C 3 .   ? 7.089  30.994 4.129   1.00 20.66 ?  345 HOH A O   1 
HETATM 933  O O   . HOH C 3 .   ? 13.572 15.093 -10.530 1.00 28.09 ?  346 HOH A O   1 
HETATM 934  O O   . HOH C 3 .   ? 18.625 28.659 7.467   1.00 19.13 ?  347 HOH A O   1 
HETATM 935  O O   . HOH C 3 .   ? 4.081  18.504 -15.592 1.00 19.19 ?  348 HOH A O   1 
HETATM 936  O O   . HOH C 3 .   ? -5.955 25.472 -12.307 1.00 23.32 ?  349 HOH A O   1 
HETATM 937  O O   . HOH C 3 .   ? -5.680 9.399  -1.342  1.00 39.43 ?  350 HOH A O   1 
HETATM 938  O O   . HOH C 3 .   ? 2.414  38.253 -12.855 1.00 16.82 ?  351 HOH A O   1 
HETATM 939  O O   . HOH C 3 .   ? -4.128 26.147 -4.169  1.00 33.88 ?  352 HOH A O   1 
HETATM 940  O O   . HOH C 3 .   ? 2.535  28.650 0.130   1.00 12.07 ?  353 HOH A O   1 
HETATM 941  O O   . HOH C 3 .   ? -1.565 30.960 -14.471 1.00 21.61 ?  354 HOH A O   1 
HETATM 942  O O   . HOH C 3 .   ? 7.260  31.983 -2.511  1.00 9.65  ?  355 HOH A O   1 
HETATM 943  O O   . HOH C 3 .   ? 16.685 38.526 -0.942  1.00 20.43 ?  356 HOH A O   1 
HETATM 944  O O   . HOH C 3 .   ? 19.191 40.534 2.028   1.00 36.80 ?  357 HOH A O   1 
HETATM 945  O O   . HOH C 3 .   ? -5.358 22.713 1.444   1.00 44.41 ?  358 HOH A O   1 
HETATM 946  O O   . HOH C 3 .   ? 2.631  18.663 -11.943 1.00 15.65 ?  359 HOH A O   1 
HETATM 947  O O   . HOH C 3 .   ? 0.518  31.572 -5.461  1.00 9.74  ?  360 HOH A O   1 
HETATM 948  O O   . HOH C 3 .   ? 12.414 30.721 10.369  1.00 21.83 ?  361 HOH A O   1 
HETATM 949  O O   . HOH C 3 .   ? 9.119  27.265 -17.255 1.00 22.90 ?  362 HOH A O   1 
HETATM 950  O O   . HOH C 3 .   ? -3.330 23.614 -16.093 1.00 33.77 ?  363 HOH A O   1 
HETATM 951  O O   . HOH C 3 .   ? 11.336 19.121 -15.529 1.00 10.99 ?  364 HOH A O   1 
HETATM 952  O O   . HOH C 3 .   ? 9.036  13.608 -11.916 1.00 23.70 ?  365 HOH A O   1 
HETATM 953  O O   . HOH C 3 .   ? 8.572  20.007 -14.919 1.00 15.55 ?  366 HOH A O   1 
HETATM 954  O O   . HOH C 3 .   ? 19.066 24.265 1.058   1.00 16.95 ?  367 HOH A O   1 
HETATM 955  O O   . HOH C 3 .   ? 12.163 24.720 -19.082 1.00 31.54 ?  368 HOH A O   1 
HETATM 956  O O   . HOH C 3 .   ? 21.484 28.222 -0.985  1.00 13.39 ?  369 HOH A O   1 
HETATM 957  O O   . HOH C 3 .   ? -3.635 9.170  -10.663 1.00 41.44 ?  370 HOH A O   1 
HETATM 958  O O   . HOH C 3 .   ? 24.765 30.824 -1.804  1.00 30.27 ?  371 HOH A O   1 
HETATM 959  O O   . HOH C 3 .   ? 16.930 16.598 -12.872 1.00 31.15 ?  372 HOH A O   1 
HETATM 960  O O   . HOH C 3 .   ? 22.825 28.305 -5.114  1.00 17.07 ?  373 HOH A O   1 
HETATM 961  O O   . HOH C 3 .   ? 9.294  23.326 5.358   1.00 17.94 ?  374 HOH A O   1 
HETATM 962  O O   . HOH C 3 .   ? 13.419 16.888 4.758   1.00 21.55 ?  375 HOH A O   1 
HETATM 963  O O   . HOH C 3 .   ? 5.335  6.878  -5.439  1.00 42.74 ?  376 HOH A O   1 
HETATM 964  O O   . HOH C 3 .   ? 10.323 37.825 -1.454  1.00 16.42 ?  377 HOH A O   1 
HETATM 965  O O   . HOH C 3 .   ? -3.458 11.584 -8.878  1.00 34.14 ?  378 HOH A O   1 
HETATM 966  O O   . HOH C 3 .   ? 9.263  29.049 7.815   1.00 31.43 ?  379 HOH A O   1 
HETATM 967  O O   . HOH C 3 .   ? 21.617 26.168 0.891   1.00 25.73 ?  380 HOH A O   1 
HETATM 968  O O   . HOH C 3 .   ? 2.701  35.694 0.776   1.00 20.32 ?  381 HOH A O   1 
HETATM 969  O O   . HOH C 3 .   ? 25.092 34.062 -2.399  1.00 26.77 ?  382 HOH A O   1 
HETATM 970  O O   . HOH C 3 .   ? 11.063 31.748 -12.694 1.00 20.32 ?  383 HOH A O   1 
HETATM 971  O O   . HOH C 3 .   ? 5.564  11.902 -11.422 1.00 32.73 ?  384 HOH A O   1 
HETATM 972  O O   . HOH C 3 .   ? 2.879  32.922 -18.398 1.00 34.16 ?  385 HOH A O   1 
HETATM 973  O O   . HOH C 3 .   ? 4.793  12.155 5.304   1.00 47.60 ?  386 HOH A O   1 
HETATM 974  O O   . HOH C 3 .   ? 11.730 21.197 -19.254 1.00 21.63 ?  387 HOH A O   1 
HETATM 975  O O   . HOH C 3 .   ? 21.479 26.351 3.699   1.00 25.61 ?  388 HOH A O   1 
HETATM 976  O O   . HOH C 3 .   ? 11.786 12.680 -17.012 1.00 38.79 ?  389 HOH A O   1 
HETATM 977  O O   . HOH C 3 .   ? 14.557 19.049 -20.722 1.00 17.81 ?  390 HOH A O   1 
HETATM 978  O O   . HOH C 3 .   ? 2.727  39.558 -5.124  1.00 30.05 ?  391 HOH A O   1 
HETATM 979  O O   . HOH C 3 .   ? 6.959  24.675 6.026   1.00 29.32 ?  392 HOH A O   1 
HETATM 980  O O   . HOH C 3 .   ? 4.800  38.196 5.743   1.00 37.87 ?  393 HOH A O   1 
HETATM 981  O O   . HOH C 3 .   ? 22.466 39.323 1.452   1.00 39.02 ?  394 HOH A O   1 
HETATM 982  O O   . HOH C 3 .   ? 24.834 41.612 -11.413 1.00 32.61 ?  395 HOH A O   1 
HETATM 983  O O   . HOH C 3 .   ? -0.717 33.971 -15.466 1.00 29.60 ?  396 HOH A O   1 
HETATM 984  O O   . HOH C 3 .   ? 20.652 35.135 8.629   1.00 33.87 ?  397 HOH A O   1 
HETATM 985  O O   . HOH C 3 .   ? 3.689  29.552 -19.579 1.00 38.20 ?  398 HOH A O   1 
HETATM 986  O O   . HOH C 3 .   ? 11.785 28.663 -16.677 1.00 36.29 ?  399 HOH A O   1 
HETATM 987  O O   . HOH C 3 .   ? -3.798 17.574 3.714   1.00 27.53 ?  400 HOH A O   1 
HETATM 988  O O   . HOH C 3 .   ? 8.860  16.202 5.897   1.00 44.58 ?  401 HOH A O   1 
HETATM 989  O O   . HOH C 3 .   ? 10.432 14.018 5.340   1.00 32.71 ?  402 HOH A O   1 
HETATM 990  O O   . HOH C 3 .   ? 21.739 24.771 -3.000  1.00 27.39 ?  403 HOH A O   1 
HETATM 991  O O   . HOH C 3 .   ? 18.519 14.594 -13.196 1.00 32.67 ?  404 HOH A O   1 
HETATM 992  O O   . HOH C 3 .   ? 1.127  34.982 -1.501  1.00 19.76 ?  405 HOH A O   1 
HETATM 993  O O   . HOH C 3 .   ? 0.000  35.561 -12.720 0.50 16.15 ?  406 HOH A O   1 
HETATM 994  O O   . HOH C 3 .   ? 25.890 37.038 -0.763  1.00 40.17 ?  407 HOH A O   1 
HETATM 995  O O   . HOH C 3 .   ? 3.469  19.306 4.289   1.00 24.45 ?  408 HOH A O   1 
HETATM 996  O O   . HOH C 3 .   ? 7.747  20.573 5.201   1.00 38.39 ?  409 HOH A O   1 
HETATM 997  O O   . HOH C 3 .   ? 9.008  42.057 -1.281  1.00 34.31 ?  410 HOH A O   1 
HETATM 998  O O   . HOH C 3 .   ? -5.651 22.837 -9.694  1.00 26.90 ?  411 HOH A O   1 
HETATM 999  O O   . HOH C 3 .   ? 6.159  14.776 4.692   1.00 26.47 ?  412 HOH A O   1 
HETATM 1000 O O   . HOH C 3 .   ? 4.389  21.848 -14.222 1.00 33.68 ?  413 HOH A O   1 
HETATM 1001 O O   . HOH C 3 .   ? 11.515 9.518  -1.609  1.00 31.80 ?  414 HOH A O   1 
HETATM 1002 O O   . HOH C 3 .   ? -7.348 24.415 -6.156  1.00 36.96 ?  415 HOH A O   1 
HETATM 1003 O O   . HOH C 3 .   ? 16.918 43.886 4.563   1.00 46.18 ?  416 HOH A O   1 
HETATM 1004 O O   . HOH C 3 .   ? 9.918  40.615 -3.185  1.00 28.44 ?  417 HOH A O   1 
HETATM 1005 O O   . HOH C 3 .   ? 24.208 38.740 -0.455  1.00 26.95 ?  418 HOH A O   1 
HETATM 1006 O O   . HOH C 3 .   ? -5.366 14.135 -13.311 1.00 56.09 ?  419 HOH A O   1 
HETATM 1007 O O   . HOH C 3 .   ? 22.877 33.260 9.027   1.00 39.61 ?  420 HOH A O   1 
HETATM 1008 O O   . HOH C 3 .   ? 14.715 12.889 -5.487  1.00 33.85 ?  421 HOH A O   1 
HETATM 1009 O O   . HOH C 3 .   ? 17.912 38.612 7.657   1.00 45.77 ?  422 HOH A O   1 
HETATM 1010 O O   . HOH C 3 .   ? 2.477  33.539 4.751   1.00 37.61 ?  423 HOH A O   1 
HETATM 1011 O O   . HOH C 3 .   ? 10.825 17.948 5.989   1.00 37.17 ?  424 HOH A O   1 
HETATM 1012 O O   . HOH C 3 .   ? 7.526  6.672  -4.982  1.00 38.64 ?  425 HOH A O   1 
HETATM 1013 O O   . HOH C 3 .   ? 8.577  39.610 -0.187  1.00 22.96 ?  426 HOH A O   1 
HETATM 1014 O O   . HOH C 3 .   ? 9.240  12.750 3.658   1.00 31.51 ?  427 HOH A O   1 
HETATM 1015 O O   . HOH C 3 .   ? -3.954 25.243 1.335   1.00 37.75 ?  428 HOH A O   1 
HETATM 1016 O O   . HOH C 3 .   ? 18.864 40.100 -11.662 1.00 43.33 ?  429 HOH A O   1 
HETATM 1017 O O   . HOH C 3 .   ? -4.014 11.739 -11.411 1.00 38.87 ?  430 HOH A O   1 
HETATM 1018 O O   . HOH C 3 .   ? 19.820 39.050 -0.501  1.00 29.27 ?  431 HOH A O   1 
HETATM 1019 O O   . HOH C 3 .   ? 19.366 41.335 -2.058  1.00 31.81 ?  432 HOH A O   1 
HETATM 1020 O O   . HOH C 3 .   ? 15.531 39.341 7.938   1.00 41.85 ?  433 HOH A O   1 
HETATM 1021 O O   . HOH C 3 .   ? 19.624 40.876 6.275   1.00 49.01 ?  434 HOH A O   1 
HETATM 1022 O O   . HOH C 3 .   ? 10.137 43.580 -2.955  1.00 42.19 ?  435 HOH A O   1 
HETATM 1023 O O   . HOH C 3 .   ? 8.835  12.197 -13.805 1.00 34.88 ?  436 HOH A O   1 
HETATM 1024 O O   . HOH C 3 .   ? 19.457 11.758 -15.203 1.00 45.08 ?  437 HOH A O   1 
HETATM 1025 O O   . HOH C 3 .   ? 11.008 42.248 -4.463  1.00 32.41 ?  438 HOH A O   1 
HETATM 1026 O O   . HOH C 3 .   ? 11.906 13.207 -9.548  1.00 32.53 ?  439 HOH A O   1 
HETATM 1027 O O   . HOH C 3 .   ? 5.477  42.111 -13.090 1.00 33.35 ?  440 HOH A O   1 
HETATM 1028 O O   . HOH C 3 .   ? 7.262  29.690 -17.628 1.00 37.39 ?  441 HOH A O   1 
HETATM 1029 O O   . HOH C 3 .   ? 23.727 28.610 -2.293  1.00 23.50 ?  442 HOH A O   1 
HETATM 1030 O O   . HOH C 3 .   ? 26.109 32.454 -3.829  1.00 35.44 ?  443 HOH A O   1 
HETATM 1031 O O   . HOH C 3 .   ? 2.360  20.739 -13.366 1.00 37.76 ?  444 HOH A O   1 
HETATM 1032 O O   . HOH C 3 .   ? -6.722 17.597 2.672   1.00 48.34 ?  445 HOH A O   1 
HETATM 1033 O O   . HOH C 3 .   ? 3.293  13.999 7.317   1.00 51.14 ?  446 HOH A O   1 
HETATM 1034 O O   . HOH C 3 .   ? 21.809 39.659 -13.953 1.00 22.51 ?  447 HOH A O   1 
HETATM 1035 O O   . HOH C 3 .   ? 3.500  37.950 0.099   1.00 37.00 ?  448 HOH A O   1 
HETATM 1036 O O   . HOH C 3 .   ? 6.845  9.728  -11.347 1.00 42.13 ?  449 HOH A O   1 
HETATM 1037 O O   . HOH C 3 .   ? 22.692 24.616 -0.976  1.00 43.44 ?  450 HOH A O   1 
HETATM 1038 O O   . HOH C 3 .   ? 22.355 20.808 -1.657  1.00 36.48 ?  451 HOH A O   1 
HETATM 1039 O O   . HOH C 3 .   ? 9.702  25.809 -19.301 1.00 40.34 ?  452 HOH A O   1 
HETATM 1040 O O   . HOH C 3 .   ? 7.777  32.804 -16.469 1.00 41.10 ?  453 HOH A O   1 
HETATM 1041 O O   . HOH C 3 .   ? 7.930  29.430 10.987  1.00 46.95 ?  454 HOH A O   1 
HETATM 1042 O O   . HOH C 3 .   ? 6.932  43.136 -3.090  1.00 46.99 ?  455 HOH A O   1 
HETATM 1043 O O   . HOH C 3 .   ? 22.998 42.614 -12.992 1.00 43.48 ?  456 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP A . n 
A 1 2   PHE 2   2   2   PHE PHE A . n 
A 1 3   MET 3   3   3   MET MET A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   HIS 8   8   8   HIS HIS A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  GLU 12  12  12  GLU GLU A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  THR 17  17  17  THR THR A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  THR 19  19  19  THR THR A . n 
A 1 20  PHE 20  20  20  PHE PHE A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  PHE 33  33  33  PHE PHE A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  GLN 35  35  35  GLN GLN A . n 
A 1 36  TRP 36  36  36  TRP TRP A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  ARG 40  40  40  ARG ARG A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  PRO 45  45  45  PRO PRO A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  ILE 49  49  49  ILE ILE A . n 
A 1 50  TYR 50  50  50  TYR TYR A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  GLN 54  54  54  GLN GLN A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ARG 62  62  62  ARG ARG A . n 
A 1 63  PHE 63  63  63  PHE PHE A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  SER 73  73  73  SER SER A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  CYS 91  91  91  CYS CYS A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  HIS 98  98  98  HIS HIS A . n 
A 1 99  HIS 99  99  99  HIS HIS A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PHE 102 102 102 PHE PHE A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 GLY 112 112 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ACT 1   201 201 ACT ACT A . 
C 3 HOH 1   301 301 HOH HOH A . 
C 3 HOH 2   302 302 HOH HOH A . 
C 3 HOH 3   303 303 HOH HOH A . 
C 3 HOH 4   304 304 HOH HOH A . 
C 3 HOH 5   305 305 HOH HOH A . 
C 3 HOH 6   306 306 HOH HOH A . 
C 3 HOH 7   307 307 HOH HOH A . 
C 3 HOH 8   308 308 HOH HOH A . 
C 3 HOH 9   309 309 HOH HOH A . 
C 3 HOH 10  310 310 HOH HOH A . 
C 3 HOH 11  311 311 HOH HOH A . 
C 3 HOH 12  312 312 HOH HOH A . 
C 3 HOH 13  313 313 HOH HOH A . 
C 3 HOH 14  314 314 HOH HOH A . 
C 3 HOH 15  315 315 HOH HOH A . 
C 3 HOH 16  316 316 HOH HOH A . 
C 3 HOH 17  317 317 HOH HOH A . 
C 3 HOH 18  318 318 HOH HOH A . 
C 3 HOH 19  319 319 HOH HOH A . 
C 3 HOH 20  320 320 HOH HOH A . 
C 3 HOH 21  321 321 HOH HOH A . 
C 3 HOH 22  322 322 HOH HOH A . 
C 3 HOH 23  323 323 HOH HOH A . 
C 3 HOH 24  324 324 HOH HOH A . 
C 3 HOH 25  325 325 HOH HOH A . 
C 3 HOH 26  326 326 HOH HOH A . 
C 3 HOH 27  327 327 HOH HOH A . 
C 3 HOH 28  328 328 HOH HOH A . 
C 3 HOH 29  329 329 HOH HOH A . 
C 3 HOH 30  330 330 HOH HOH A . 
C 3 HOH 31  331 331 HOH HOH A . 
C 3 HOH 32  332 332 HOH HOH A . 
C 3 HOH 33  333 333 HOH HOH A . 
C 3 HOH 34  334 334 HOH HOH A . 
C 3 HOH 35  335 335 HOH HOH A . 
C 3 HOH 36  336 336 HOH HOH A . 
C 3 HOH 37  337 337 HOH HOH A . 
C 3 HOH 38  338 338 HOH HOH A . 
C 3 HOH 39  339 339 HOH HOH A . 
C 3 HOH 40  340 340 HOH HOH A . 
C 3 HOH 41  341 341 HOH HOH A . 
C 3 HOH 42  342 342 HOH HOH A . 
C 3 HOH 43  343 343 HOH HOH A . 
C 3 HOH 44  344 344 HOH HOH A . 
C 3 HOH 45  345 345 HOH HOH A . 
C 3 HOH 46  346 346 HOH HOH A . 
C 3 HOH 47  347 347 HOH HOH A . 
C 3 HOH 48  348 348 HOH HOH A . 
C 3 HOH 49  349 349 HOH HOH A . 
C 3 HOH 50  350 350 HOH HOH A . 
C 3 HOH 51  351 351 HOH HOH A . 
C 3 HOH 52  352 352 HOH HOH A . 
C 3 HOH 53  353 353 HOH HOH A . 
C 3 HOH 54  354 354 HOH HOH A . 
C 3 HOH 55  355 355 HOH HOH A . 
C 3 HOH 56  356 356 HOH HOH A . 
C 3 HOH 57  357 357 HOH HOH A . 
C 3 HOH 58  358 358 HOH HOH A . 
C 3 HOH 59  359 359 HOH HOH A . 
C 3 HOH 60  360 360 HOH HOH A . 
C 3 HOH 61  361 361 HOH HOH A . 
C 3 HOH 62  362 362 HOH HOH A . 
C 3 HOH 63  363 363 HOH HOH A . 
C 3 HOH 64  364 364 HOH HOH A . 
C 3 HOH 65  365 365 HOH HOH A . 
C 3 HOH 66  366 366 HOH HOH A . 
C 3 HOH 67  367 367 HOH HOH A . 
C 3 HOH 68  368 368 HOH HOH A . 
C 3 HOH 69  369 369 HOH HOH A . 
C 3 HOH 70  370 370 HOH HOH A . 
C 3 HOH 71  371 371 HOH HOH A . 
C 3 HOH 72  372 372 HOH HOH A . 
C 3 HOH 73  373 373 HOH HOH A . 
C 3 HOH 74  374 374 HOH HOH A . 
C 3 HOH 75  375 375 HOH HOH A . 
C 3 HOH 76  376 376 HOH HOH A . 
C 3 HOH 77  377 377 HOH HOH A . 
C 3 HOH 78  378 378 HOH HOH A . 
C 3 HOH 79  379 379 HOH HOH A . 
C 3 HOH 80  380 380 HOH HOH A . 
C 3 HOH 81  381 381 HOH HOH A . 
C 3 HOH 82  382 382 HOH HOH A . 
C 3 HOH 83  383 383 HOH HOH A . 
C 3 HOH 84  384 384 HOH HOH A . 
C 3 HOH 85  385 385 HOH HOH A . 
C 3 HOH 86  386 386 HOH HOH A . 
C 3 HOH 87  387 387 HOH HOH A . 
C 3 HOH 88  388 388 HOH HOH A . 
C 3 HOH 89  389 389 HOH HOH A . 
C 3 HOH 90  390 390 HOH HOH A . 
C 3 HOH 91  391 391 HOH HOH A . 
C 3 HOH 92  392 392 HOH HOH A . 
C 3 HOH 93  393 393 HOH HOH A . 
C 3 HOH 94  394 394 HOH HOH A . 
C 3 HOH 95  395 395 HOH HOH A . 
C 3 HOH 96  396 396 HOH HOH A . 
C 3 HOH 97  397 397 HOH HOH A . 
C 3 HOH 98  398 398 HOH HOH A . 
C 3 HOH 99  399 399 HOH HOH A . 
C 3 HOH 100 400 400 HOH HOH A . 
C 3 HOH 101 401 401 HOH HOH A . 
C 3 HOH 102 402 402 HOH HOH A . 
C 3 HOH 103 403 403 HOH HOH A . 
C 3 HOH 104 404 404 HOH HOH A . 
C 3 HOH 105 405 405 HOH HOH A . 
C 3 HOH 106 406 406 HOH HOH A . 
C 3 HOH 107 407 407 HOH HOH A . 
C 3 HOH 108 408 408 HOH HOH A . 
C 3 HOH 109 409 409 HOH HOH A . 
C 3 HOH 110 410 410 HOH HOH A . 
C 3 HOH 111 411 411 HOH HOH A . 
C 3 HOH 112 412 412 HOH HOH A . 
C 3 HOH 113 413 413 HOH HOH A . 
C 3 HOH 114 414 414 HOH HOH A . 
C 3 HOH 115 415 415 HOH HOH A . 
C 3 HOH 116 416 416 HOH HOH A . 
C 3 HOH 117 417 417 HOH HOH A . 
C 3 HOH 118 418 418 HOH HOH A . 
C 3 HOH 119 419 419 HOH HOH A . 
C 3 HOH 120 420 420 HOH HOH A . 
C 3 HOH 121 421 421 HOH HOH A . 
C 3 HOH 122 422 422 HOH HOH A . 
C 3 HOH 123 423 423 HOH HOH A . 
C 3 HOH 124 424 424 HOH HOH A . 
C 3 HOH 125 425 425 HOH HOH A . 
C 3 HOH 126 426 426 HOH HOH A . 
C 3 HOH 127 427 427 HOH HOH A . 
C 3 HOH 128 428 428 HOH HOH A . 
C 3 HOH 129 429 429 HOH HOH A . 
C 3 HOH 130 430 430 HOH HOH A . 
C 3 HOH 131 431 431 HOH HOH A . 
C 3 HOH 132 432 432 HOH HOH A . 
C 3 HOH 133 433 433 HOH HOH A . 
C 3 HOH 134 434 434 HOH HOH A . 
C 3 HOH 135 435 435 HOH HOH A . 
C 3 HOH 136 436 436 HOH HOH A . 
C 3 HOH 137 437 437 HOH HOH A . 
C 3 HOH 138 438 438 HOH HOH A . 
C 3 HOH 139 439 439 HOH HOH A . 
C 3 HOH 140 440 440 HOH HOH A . 
C 3 HOH 141 441 441 HOH HOH A . 
C 3 HOH 142 442 442 HOH HOH A . 
C 3 HOH 143 443 443 HOH HOH A . 
C 3 HOH 144 444 444 HOH HOH A . 
C 3 HOH 145 445 445 HOH HOH A . 
C 3 HOH 146 446 446 HOH HOH A . 
C 3 HOH 147 447 447 HOH HOH A . 
C 3 HOH 148 448 448 HOH HOH A . 
C 3 HOH 149 449 449 HOH HOH A . 
C 3 HOH 150 450 450 HOH HOH A . 
C 3 HOH 151 451 451 HOH HOH A . 
C 3 HOH 152 452 452 HOH HOH A . 
C 3 HOH 153 453 453 HOH HOH A . 
C 3 HOH 154 454 454 HOH HOH A . 
C 3 HOH 155 455 455 HOH HOH A . 
C 3 HOH 156 456 456 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     406 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-06-14 
2 'Structure model' 1 1 2017-09-27 
3 'Structure model' 1 2 2017-11-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_CSD'          
4  2 'Structure model' '_citation.journal_id_ISSN'         
5  2 'Structure model' '_citation.pdbx_database_id_DOI'    
6  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
7  2 'Structure model' '_citation.title'                   
8  2 'Structure model' '_citation.year'                    
9  3 'Structure model' '_citation.journal_volume'          
10 3 'Structure model' '_citation.page_first'              
11 3 'Structure model' '_citation.page_last'               
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(DEV_2313)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .            2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA  ? ? ? .            3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .            4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 435 ? ? O A HOH 438 ? ? 2.19 
2 1 O A HOH 304 ? ? O A HOH 344 ? ? 2.19 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_1              22 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             A 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_2              22 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             A 
_pdbx_validate_rmsd_angle.auth_atom_id_3             SG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_3              22 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             A 
_pdbx_validate_rmsd_angle.angle_value                121.23 
_pdbx_validate_rmsd_angle.angle_target_value         114.20 
_pdbx_validate_rmsd_angle.angle_deviation            7.03 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.10 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 52 ? ? 77.17   -46.56  
2 1 ASN A 53 ? ? -150.95 14.42   
3 1 SER A 93 ? ? -151.79 -151.11 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     GLY 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      112 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    GLY 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     112 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ACETATE ION' ACT 
3 water         HOH 
#