data_5IVH
# 
_entry.id   5IVH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5IVH         
WWPDB D_1000219496 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5IVK unspecified 
PDB . 5IVD unspecified 
PDB . 5IVI unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5IVH 
_pdbx_database_status.recvd_initial_deposition_date   2016-03-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Correy, G.J.'  1 
'Jackson, C.J.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            24 
_citation.language                  ? 
_citation.page_first                977 
_citation.page_last                 987 
_citation.title                     
;Mapping the Accessible Conformational Landscape of an Insect Carboxylesterase Using Conformational Ensemble Analysis and Kinetic Crystallography.
;
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2016.04.009 
_citation.pdbx_database_id_PubMed   27210287 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Correy, G.J.'  1 
primary 'Carr, P.D.'    2 
primary 'Meirelles, T.' 3 
primary 'Mabbitt, P.D.' 4 
primary 'Fraser, N.J.'  5 
primary 'Weik, M.'      6 
primary 'Jackson, C.J.' 7 
# 
_cell.entry_id           5IVH 
_cell.length_a           48.574 
_cell.length_b           100.472 
_cell.length_c           221.715 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5IVH 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Carboxylic ester hydrolase' 66388.836 1   3.1.1.- ? ? ? 
2 water   nat water                        18.015    234 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHMNFNVSLMEKLKWKIKCIENKFLNYRLTTNETVVAETEYGKVKGVKRLTVYDDSYYSFEGIPYAQPPVGELRF
KAPQRPTPWAGVRDCCNHKDKSVQVDFITGKVCGSEDCLYLSVYTNNLNPETKRPVLVYIHGGGFIIGENHRDMYGPDYF
IKKDVVLINIQYRLGALGFLSLNSEDLNVPGNAGLKDQVMALRWIKNNCANFGGNPDNITVFGESAGAASTHYMMLTEQT
RGLFHRGILMSGNAICPWANTQCQHRAFTLAKLAGYKGEDNDKDVLEFLMKAKPQDLIKLEEKVLTLEERTNKVMFPFGP
TVEPYQTADCVLPKHPREMVKTAWGNSIPTMMGNTSYEGLFFTSILKQMPLLVKELETCVNFVPSELADAERTAPETLEM
GAKIKKAHVTGETPTADNFMDLCSHFYFWFPMHRLLQLRFNHTSGTPVYLYRFDFDSEDLINPYRIMRSGRGVKGVSHTD
ELTYFFWNQLAKRMPKESREYKTIERMTGIWTQFATTGNPYSNEIEGMENVSWDPIEKSDEVYKCLNISDELKMIDVPEM
GKIKQWESMFEKHRDLF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHMNFNVSLMEKLKWKIKCIENKFLNYRLTTNETVVAETEYGKVKGVKRLTVYDDSYYSFEGIPYAQPPVGELRF
KAPQRPTPWAGVRDCCNHKDKSVQVDFITGKVCGSEDCLYLSVYTNNLNPETKRPVLVYIHGGGFIIGENHRDMYGPDYF
IKKDVVLINIQYRLGALGFLSLNSEDLNVPGNAGLKDQVMALRWIKNNCANFGGNPDNITVFGESAGAASTHYMMLTEQT
RGLFHRGILMSGNAICPWANTQCQHRAFTLAKLAGYKGEDNDKDVLEFLMKAKPQDLIKLEEKVLTLEERTNKVMFPFGP
TVEPYQTADCVLPKHPREMVKTAWGNSIPTMMGNTSYEGLFFTSILKQMPLLVKELETCVNFVPSELADAERTAPETLEM
GAKIKKAHVTGETPTADNFMDLCSHFYFWFPMHRLLQLRFNHTSGTPVYLYRFDFDSEDLINPYRIMRSGRGVKGVSHTD
ELTYFFWNQLAKRMPKESREYKTIERMTGIWTQFATTGNPYSNEIEGMENVSWDPIEKSDEVYKCLNISDELKMIDVPEM
GKIKQWESMFEKHRDLF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   MET n 
1 9   ASN n 
1 10  PHE n 
1 11  ASN n 
1 12  VAL n 
1 13  SER n 
1 14  LEU n 
1 15  MET n 
1 16  GLU n 
1 17  LYS n 
1 18  LEU n 
1 19  LYS n 
1 20  TRP n 
1 21  LYS n 
1 22  ILE n 
1 23  LYS n 
1 24  CYS n 
1 25  ILE n 
1 26  GLU n 
1 27  ASN n 
1 28  LYS n 
1 29  PHE n 
1 30  LEU n 
1 31  ASN n 
1 32  TYR n 
1 33  ARG n 
1 34  LEU n 
1 35  THR n 
1 36  THR n 
1 37  ASN n 
1 38  GLU n 
1 39  THR n 
1 40  VAL n 
1 41  VAL n 
1 42  ALA n 
1 43  GLU n 
1 44  THR n 
1 45  GLU n 
1 46  TYR n 
1 47  GLY n 
1 48  LYS n 
1 49  VAL n 
1 50  LYS n 
1 51  GLY n 
1 52  VAL n 
1 53  LYS n 
1 54  ARG n 
1 55  LEU n 
1 56  THR n 
1 57  VAL n 
1 58  TYR n 
1 59  ASP n 
1 60  ASP n 
1 61  SER n 
1 62  TYR n 
1 63  TYR n 
1 64  SER n 
1 65  PHE n 
1 66  GLU n 
1 67  GLY n 
1 68  ILE n 
1 69  PRO n 
1 70  TYR n 
1 71  ALA n 
1 72  GLN n 
1 73  PRO n 
1 74  PRO n 
1 75  VAL n 
1 76  GLY n 
1 77  GLU n 
1 78  LEU n 
1 79  ARG n 
1 80  PHE n 
1 81  LYS n 
1 82  ALA n 
1 83  PRO n 
1 84  GLN n 
1 85  ARG n 
1 86  PRO n 
1 87  THR n 
1 88  PRO n 
1 89  TRP n 
1 90  ALA n 
1 91  GLY n 
1 92  VAL n 
1 93  ARG n 
1 94  ASP n 
1 95  CYS n 
1 96  CYS n 
1 97  ASN n 
1 98  HIS n 
1 99  LYS n 
1 100 ASP n 
1 101 LYS n 
1 102 SER n 
1 103 VAL n 
1 104 GLN n 
1 105 VAL n 
1 106 ASP n 
1 107 PHE n 
1 108 ILE n 
1 109 THR n 
1 110 GLY n 
1 111 LYS n 
1 112 VAL n 
1 113 CYS n 
1 114 GLY n 
1 115 SER n 
1 116 GLU n 
1 117 ASP n 
1 118 CYS n 
1 119 LEU n 
1 120 TYR n 
1 121 LEU n 
1 122 SER n 
1 123 VAL n 
1 124 TYR n 
1 125 THR n 
1 126 ASN n 
1 127 ASN n 
1 128 LEU n 
1 129 ASN n 
1 130 PRO n 
1 131 GLU n 
1 132 THR n 
1 133 LYS n 
1 134 ARG n 
1 135 PRO n 
1 136 VAL n 
1 137 LEU n 
1 138 VAL n 
1 139 TYR n 
1 140 ILE n 
1 141 HIS n 
1 142 GLY n 
1 143 GLY n 
1 144 GLY n 
1 145 PHE n 
1 146 ILE n 
1 147 ILE n 
1 148 GLY n 
1 149 GLU n 
1 150 ASN n 
1 151 HIS n 
1 152 ARG n 
1 153 ASP n 
1 154 MET n 
1 155 TYR n 
1 156 GLY n 
1 157 PRO n 
1 158 ASP n 
1 159 TYR n 
1 160 PHE n 
1 161 ILE n 
1 162 LYS n 
1 163 LYS n 
1 164 ASP n 
1 165 VAL n 
1 166 VAL n 
1 167 LEU n 
1 168 ILE n 
1 169 ASN n 
1 170 ILE n 
1 171 GLN n 
1 172 TYR n 
1 173 ARG n 
1 174 LEU n 
1 175 GLY n 
1 176 ALA n 
1 177 LEU n 
1 178 GLY n 
1 179 PHE n 
1 180 LEU n 
1 181 SER n 
1 182 LEU n 
1 183 ASN n 
1 184 SER n 
1 185 GLU n 
1 186 ASP n 
1 187 LEU n 
1 188 ASN n 
1 189 VAL n 
1 190 PRO n 
1 191 GLY n 
1 192 ASN n 
1 193 ALA n 
1 194 GLY n 
1 195 LEU n 
1 196 LYS n 
1 197 ASP n 
1 198 GLN n 
1 199 VAL n 
1 200 MET n 
1 201 ALA n 
1 202 LEU n 
1 203 ARG n 
1 204 TRP n 
1 205 ILE n 
1 206 LYS n 
1 207 ASN n 
1 208 ASN n 
1 209 CYS n 
1 210 ALA n 
1 211 ASN n 
1 212 PHE n 
1 213 GLY n 
1 214 GLY n 
1 215 ASN n 
1 216 PRO n 
1 217 ASP n 
1 218 ASN n 
1 219 ILE n 
1 220 THR n 
1 221 VAL n 
1 222 PHE n 
1 223 GLY n 
1 224 GLU n 
1 225 SER n 
1 226 ALA n 
1 227 GLY n 
1 228 ALA n 
1 229 ALA n 
1 230 SER n 
1 231 THR n 
1 232 HIS n 
1 233 TYR n 
1 234 MET n 
1 235 MET n 
1 236 LEU n 
1 237 THR n 
1 238 GLU n 
1 239 GLN n 
1 240 THR n 
1 241 ARG n 
1 242 GLY n 
1 243 LEU n 
1 244 PHE n 
1 245 HIS n 
1 246 ARG n 
1 247 GLY n 
1 248 ILE n 
1 249 LEU n 
1 250 MET n 
1 251 SER n 
1 252 GLY n 
1 253 ASN n 
1 254 ALA n 
1 255 ILE n 
1 256 CYS n 
1 257 PRO n 
1 258 TRP n 
1 259 ALA n 
1 260 ASN n 
1 261 THR n 
1 262 GLN n 
1 263 CYS n 
1 264 GLN n 
1 265 HIS n 
1 266 ARG n 
1 267 ALA n 
1 268 PHE n 
1 269 THR n 
1 270 LEU n 
1 271 ALA n 
1 272 LYS n 
1 273 LEU n 
1 274 ALA n 
1 275 GLY n 
1 276 TYR n 
1 277 LYS n 
1 278 GLY n 
1 279 GLU n 
1 280 ASP n 
1 281 ASN n 
1 282 ASP n 
1 283 LYS n 
1 284 ASP n 
1 285 VAL n 
1 286 LEU n 
1 287 GLU n 
1 288 PHE n 
1 289 LEU n 
1 290 MET n 
1 291 LYS n 
1 292 ALA n 
1 293 LYS n 
1 294 PRO n 
1 295 GLN n 
1 296 ASP n 
1 297 LEU n 
1 298 ILE n 
1 299 LYS n 
1 300 LEU n 
1 301 GLU n 
1 302 GLU n 
1 303 LYS n 
1 304 VAL n 
1 305 LEU n 
1 306 THR n 
1 307 LEU n 
1 308 GLU n 
1 309 GLU n 
1 310 ARG n 
1 311 THR n 
1 312 ASN n 
1 313 LYS n 
1 314 VAL n 
1 315 MET n 
1 316 PHE n 
1 317 PRO n 
1 318 PHE n 
1 319 GLY n 
1 320 PRO n 
1 321 THR n 
1 322 VAL n 
1 323 GLU n 
1 324 PRO n 
1 325 TYR n 
1 326 GLN n 
1 327 THR n 
1 328 ALA n 
1 329 ASP n 
1 330 CYS n 
1 331 VAL n 
1 332 LEU n 
1 333 PRO n 
1 334 LYS n 
1 335 HIS n 
1 336 PRO n 
1 337 ARG n 
1 338 GLU n 
1 339 MET n 
1 340 VAL n 
1 341 LYS n 
1 342 THR n 
1 343 ALA n 
1 344 TRP n 
1 345 GLY n 
1 346 ASN n 
1 347 SER n 
1 348 ILE n 
1 349 PRO n 
1 350 THR n 
1 351 MET n 
1 352 MET n 
1 353 GLY n 
1 354 ASN n 
1 355 THR n 
1 356 SER n 
1 357 TYR n 
1 358 GLU n 
1 359 GLY n 
1 360 LEU n 
1 361 PHE n 
1 362 PHE n 
1 363 THR n 
1 364 SER n 
1 365 ILE n 
1 366 LEU n 
1 367 LYS n 
1 368 GLN n 
1 369 MET n 
1 370 PRO n 
1 371 LEU n 
1 372 LEU n 
1 373 VAL n 
1 374 LYS n 
1 375 GLU n 
1 376 LEU n 
1 377 GLU n 
1 378 THR n 
1 379 CYS n 
1 380 VAL n 
1 381 ASN n 
1 382 PHE n 
1 383 VAL n 
1 384 PRO n 
1 385 SER n 
1 386 GLU n 
1 387 LEU n 
1 388 ALA n 
1 389 ASP n 
1 390 ALA n 
1 391 GLU n 
1 392 ARG n 
1 393 THR n 
1 394 ALA n 
1 395 PRO n 
1 396 GLU n 
1 397 THR n 
1 398 LEU n 
1 399 GLU n 
1 400 MET n 
1 401 GLY n 
1 402 ALA n 
1 403 LYS n 
1 404 ILE n 
1 405 LYS n 
1 406 LYS n 
1 407 ALA n 
1 408 HIS n 
1 409 VAL n 
1 410 THR n 
1 411 GLY n 
1 412 GLU n 
1 413 THR n 
1 414 PRO n 
1 415 THR n 
1 416 ALA n 
1 417 ASP n 
1 418 ASN n 
1 419 PHE n 
1 420 MET n 
1 421 ASP n 
1 422 LEU n 
1 423 CYS n 
1 424 SER n 
1 425 HIS n 
1 426 PHE n 
1 427 TYR n 
1 428 PHE n 
1 429 TRP n 
1 430 PHE n 
1 431 PRO n 
1 432 MET n 
1 433 HIS n 
1 434 ARG n 
1 435 LEU n 
1 436 LEU n 
1 437 GLN n 
1 438 LEU n 
1 439 ARG n 
1 440 PHE n 
1 441 ASN n 
1 442 HIS n 
1 443 THR n 
1 444 SER n 
1 445 GLY n 
1 446 THR n 
1 447 PRO n 
1 448 VAL n 
1 449 TYR n 
1 450 LEU n 
1 451 TYR n 
1 452 ARG n 
1 453 PHE n 
1 454 ASP n 
1 455 PHE n 
1 456 ASP n 
1 457 SER n 
1 458 GLU n 
1 459 ASP n 
1 460 LEU n 
1 461 ILE n 
1 462 ASN n 
1 463 PRO n 
1 464 TYR n 
1 465 ARG n 
1 466 ILE n 
1 467 MET n 
1 468 ARG n 
1 469 SER n 
1 470 GLY n 
1 471 ARG n 
1 472 GLY n 
1 473 VAL n 
1 474 LYS n 
1 475 GLY n 
1 476 VAL n 
1 477 SER n 
1 478 HIS n 
1 479 THR n 
1 480 ASP n 
1 481 GLU n 
1 482 LEU n 
1 483 THR n 
1 484 TYR n 
1 485 PHE n 
1 486 PHE n 
1 487 TRP n 
1 488 ASN n 
1 489 GLN n 
1 490 LEU n 
1 491 ALA n 
1 492 LYS n 
1 493 ARG n 
1 494 MET n 
1 495 PRO n 
1 496 LYS n 
1 497 GLU n 
1 498 SER n 
1 499 ARG n 
1 500 GLU n 
1 501 TYR n 
1 502 LYS n 
1 503 THR n 
1 504 ILE n 
1 505 GLU n 
1 506 ARG n 
1 507 MET n 
1 508 THR n 
1 509 GLY n 
1 510 ILE n 
1 511 TRP n 
1 512 THR n 
1 513 GLN n 
1 514 PHE n 
1 515 ALA n 
1 516 THR n 
1 517 THR n 
1 518 GLY n 
1 519 ASN n 
1 520 PRO n 
1 521 TYR n 
1 522 SER n 
1 523 ASN n 
1 524 GLU n 
1 525 ILE n 
1 526 GLU n 
1 527 GLY n 
1 528 MET n 
1 529 GLU n 
1 530 ASN n 
1 531 VAL n 
1 532 SER n 
1 533 TRP n 
1 534 ASP n 
1 535 PRO n 
1 536 ILE n 
1 537 GLU n 
1 538 LYS n 
1 539 SER n 
1 540 ASP n 
1 541 GLU n 
1 542 VAL n 
1 543 TYR n 
1 544 LYS n 
1 545 CYS n 
1 546 LEU n 
1 547 ASN n 
1 548 ILE n 
1 549 SER n 
1 550 ASP n 
1 551 GLU n 
1 552 LEU n 
1 553 LYS n 
1 554 MET n 
1 555 ILE n 
1 556 ASP n 
1 557 VAL n 
1 558 PRO n 
1 559 GLU n 
1 560 MET n 
1 561 GLY n 
1 562 LYS n 
1 563 ILE n 
1 564 LYS n 
1 565 GLN n 
1 566 TRP n 
1 567 GLU n 
1 568 SER n 
1 569 MET n 
1 570 PHE n 
1 571 GLU n 
1 572 LYS n 
1 573 HIS n 
1 574 ARG n 
1 575 ASP n 
1 576 LEU n 
1 577 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   577 
_entity_src_gen.gene_src_common_name               'Green bottle fly' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 LcaE7 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Lucilia cuprina' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7375 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q25252_LUCCU 
_struct_ref.pdbx_db_accession          Q25252 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNFNVSLMEKLKWKIKCIENKFLNYRLTTNETVVAETEYGKVKGVKRLTVYDDSYYSFEGIPYAQPPVGELRFKAPQRPT
PWDGVRDCCNHKDKSVQVDFITGKVCGSEDCLYLSVYTNNLNPETKRPVLVYIHGGGFIIGENHRDMYGPDYFIKKDVVL
INIQYRLGALGFLSLNSEDLNVPGNAGLKDQVMALRWIKNNCANFGGNPDNITVFGESAGAASTHYMMLTEQTRGLFHRG
ILMSGNAICPWANTQCQHRAFTLAKLAGYKGEDNDKDVLEFLMKAKPQDLIKLEEKVLTLEERTNKVMFPFGPTVEPYQT
ADCVLPKHPREMVKTAWGNSIPTMMGNTSYEGLFFTSILKQMPMLVKELETCVNFVPSELADAERTAPETLEMGAKIKKA
HVTGETPTADNFMDLCSHIYFWFPMHRLLQLRFNHTSGTPVYLYRFDFDSEDLINPYRIMRSGRGVKGVSHADELTYFFW
NQLAKRMPKESREYKTIERMTGIWIQFATTGNPYSNEIEGMENVSWDPIKKSDEVYKCLNISDELKMIDVPEMDKIKQWE
SMFEKHRDLF
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5IVH 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 577 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q25252 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  570 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       570 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5IVH MET A 1   ? UNP Q25252 ?   ?   'initiating methionine' -6  1  
1 5IVH HIS A 2   ? UNP Q25252 ?   ?   'expression tag'        -5  2  
1 5IVH HIS A 3   ? UNP Q25252 ?   ?   'expression tag'        -4  3  
1 5IVH HIS A 4   ? UNP Q25252 ?   ?   'expression tag'        -3  4  
1 5IVH HIS A 5   ? UNP Q25252 ?   ?   'expression tag'        -2  5  
1 5IVH HIS A 6   ? UNP Q25252 ?   ?   'expression tag'        -1  6  
1 5IVH HIS A 7   ? UNP Q25252 ?   ?   'expression tag'        0   7  
1 5IVH ALA A 90  ? UNP Q25252 ASP 83  conflict                83  8  
1 5IVH LEU A 371 ? UNP Q25252 MET 364 conflict                364 9  
1 5IVH PHE A 426 ? UNP Q25252 ILE 419 conflict                419 10 
1 5IVH THR A 479 ? UNP Q25252 ALA 472 conflict                472 11 
1 5IVH THR A 512 ? UNP Q25252 ILE 505 conflict                505 12 
1 5IVH GLU A 537 ? UNP Q25252 LYS 530 conflict                530 13 
1 5IVH GLY A 561 ? UNP Q25252 ASP 554 conflict                554 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5IVH 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.07 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         40.50 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100mM sodium acetate pH 4.5, PEG 2K MME' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2010-11-20 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9393 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9393 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5IVH 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.71 
_reflns.d_resolution_low                 45.8 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       59125 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  29 
_reflns.pdbx_Rmerge_I_obs                0.145 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            19.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.71 
_reflns_shell.d_res_low                   1.74 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.1 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        98.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                3.80 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             28.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5IVH 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     59125 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.757 
_refine.ls_d_res_high                            1.710 
_refine.ls_percent_reflns_obs                    99.87 
_refine.ls_R_factor_obs                          0.1695 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1674 
_refine.ls_R_factor_R_free                       0.2079 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.07 
_refine.ls_number_reflns_R_free                  2999 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4FNG 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.19 
_refine.pdbx_overall_phase_error                 24.59 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4557 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             234 
_refine_hist.number_atoms_total               4791 
_refine_hist.d_res_high                       1.710 
_refine_hist.d_res_low                        45.757 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          1.355 ? ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.98 ? ? . 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.107 ? ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 1.7101 1.7381  2660 0.3776 98.00  0.4610 . . 135 . . . . 
'X-RAY DIFFRACTION' . 1.7381 1.7681  2580 0.3359 100.00 0.3893 . . 137 . . . . 
'X-RAY DIFFRACTION' . 1.7681 1.8002  2694 0.3126 100.00 0.3459 . . 157 . . . . 
'X-RAY DIFFRACTION' . 1.8002 1.8349  2555 0.2845 100.00 0.3295 . . 138 . . . . 
'X-RAY DIFFRACTION' . 1.8349 1.8723  2678 0.2623 100.00 0.2792 . . 151 . . . . 
'X-RAY DIFFRACTION' . 1.8723 1.9130  2623 0.2275 100.00 0.2681 . . 139 . . . . 
'X-RAY DIFFRACTION' . 1.9130 1.9575  2666 0.2068 100.00 0.2585 . . 133 . . . . 
'X-RAY DIFFRACTION' . 1.9575 2.0065  2694 0.1884 100.00 0.3023 . . 117 . . . . 
'X-RAY DIFFRACTION' . 2.0065 2.0607  2648 0.1909 100.00 0.2325 . . 153 . . . . 
'X-RAY DIFFRACTION' . 2.0607 2.1214  2675 0.1801 100.00 0.2716 . . 111 . . . . 
'X-RAY DIFFRACTION' . 2.1214 2.1898  2621 0.1682 100.00 0.2255 . . 161 . . . . 
'X-RAY DIFFRACTION' . 2.1898 2.2681  2662 0.1578 100.00 0.2422 . . 136 . . . . 
'X-RAY DIFFRACTION' . 2.2681 2.3589  2646 0.1510 100.00 0.2195 . . 151 . . . . 
'X-RAY DIFFRACTION' . 2.3589 2.4663  2667 0.1505 100.00 0.2153 . . 152 . . . . 
'X-RAY DIFFRACTION' . 2.4663 2.5963  2653 0.1563 100.00 0.2362 . . 149 . . . . 
'X-RAY DIFFRACTION' . 2.5963 2.7589  2688 0.1495 100.00 0.2091 . . 157 . . . . 
'X-RAY DIFFRACTION' . 2.7589 2.9719  2674 0.1602 100.00 0.2084 . . 149 . . . . 
'X-RAY DIFFRACTION' . 2.9719 3.2709  2723 0.1560 100.00 0.2014 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.2709 3.7440  2718 0.1513 100.00 0.1597 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.7440 4.7163  2726 0.1370 100.00 0.1550 . . 144 . . . . 
'X-RAY DIFFRACTION' . 4.7163 45.7734 2875 0.1512 100.00 0.1687 . . 145 . . . . 
# 
_struct.entry_id                     5IVH 
_struct.title                        
'The alpha-esterase-7 carboxylesterase, E3, from the blowfly Lucilia cuprina: apo-enzyme ensemble refinement' 
_struct.pdbx_descriptor              'Carboxylic ester hydrolase (E.C.3.1.1.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5IVH 
_struct_keywords.text            'carboxylesterase, organophosphate, protein dynamics, acetylcholinesterase, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 13  ? LEU A 34  ? SER A 6   LEU A 27  1 ? 22 
HELX_P HELX_P2  AA2 VAL A 75  ? ARG A 79  ? VAL A 68  ARG A 72  5 ? 5  
HELX_P HELX_P3  AA3 TYR A 159 ? LYS A 163 ? TYR A 152 LYS A 156 5 ? 5  
HELX_P HELX_P4  AA4 LEU A 174 ? LEU A 180 ? LEU A 167 LEU A 173 1 ? 7  
HELX_P HELX_P5  AA5 SER A 184 ? ASN A 188 ? SER A 177 ASN A 181 5 ? 5  
HELX_P HELX_P6  AA6 ASN A 192 ? CYS A 209 ? ASN A 185 CYS A 202 1 ? 18 
HELX_P HELX_P7  AA7 ALA A 210 ? PHE A 212 ? ALA A 203 PHE A 205 5 ? 3  
HELX_P HELX_P8  AA8 SER A 225 ? THR A 237 ? SER A 218 THR A 230 1 ? 13 
HELX_P HELX_P9  AA9 GLU A 238 ? ARG A 241 ? GLU A 231 ARG A 234 5 ? 4  
HELX_P HELX_P10 AB1 CYS A 256 ? ASN A 260 ? CYS A 249 ASN A 253 5 ? 5  
HELX_P HELX_P11 AB2 HIS A 265 ? ALA A 274 ? HIS A 258 ALA A 267 1 ? 10 
HELX_P HELX_P12 AB3 ASN A 281 ? MET A 290 ? ASN A 274 MET A 283 1 ? 10 
HELX_P HELX_P13 AB4 LYS A 293 ? GLU A 302 ? LYS A 286 GLU A 295 1 ? 10 
HELX_P HELX_P14 AB5 THR A 306 ? ASN A 312 ? THR A 299 ASN A 305 1 ? 7  
HELX_P HELX_P15 AB6 HIS A 335 ? VAL A 340 ? HIS A 328 VAL A 333 1 ? 6  
HELX_P HELX_P16 AB7 LYS A 341 ? THR A 342 ? LYS A 334 THR A 335 5 ? 2  
HELX_P HELX_P17 AB8 ALA A 343 ? ILE A 348 ? ALA A 336 ILE A 341 5 ? 6  
HELX_P HELX_P18 AB9 TYR A 357 ? PHE A 361 ? TYR A 350 PHE A 354 5 ? 5  
HELX_P HELX_P19 AC1 PHE A 362 ? GLN A 368 ? PHE A 355 GLN A 361 1 ? 7  
HELX_P HELX_P20 AC2 MET A 369 ? THR A 378 ? MET A 362 THR A 371 5 ? 10 
HELX_P HELX_P21 AC3 CYS A 379 ? VAL A 383 ? CYS A 372 VAL A 376 5 ? 5  
HELX_P HELX_P22 AC4 ALA A 394 ? VAL A 409 ? ALA A 387 VAL A 402 1 ? 16 
HELX_P HELX_P23 AC5 THR A 415 ? PHE A 428 ? THR A 408 PHE A 421 1 ? 14 
HELX_P HELX_P24 AC6 PHE A 428 ? ASN A 441 ? PHE A 421 ASN A 434 1 ? 14 
HELX_P HELX_P25 AC7 PRO A 463 ? ARG A 468 ? PRO A 456 ARG A 461 1 ? 6  
HELX_P HELX_P26 AC8 THR A 479 ? PHE A 485 ? THR A 472 PHE A 478 5 ? 7  
HELX_P HELX_P27 AC9 SER A 498 ? GLY A 518 ? SER A 491 GLY A 511 1 ? 21 
HELX_P HELX_P28 AD1 GLU A 559 ? SER A 568 ? GLU A 552 SER A 561 1 ? 10 
HELX_P HELX_P29 AD2 MET A 569 ? GLU A 571 ? MET A 562 GLU A 564 5 ? 3  
HELX_P HELX_P30 AD3 HIS A 573 ? PHE A 577 ? HIS A 566 PHE A 570 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 12 ? 
AA3 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? anti-parallel 
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? parallel      
AA2 11 12 ? anti-parallel 
AA3 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  THR A 35  ? ALA A 42  ? THR A 28  ALA A 35  
AA1 2  LYS A 48  ? LEU A 55  ? LYS A 41  LEU A 48  
AA1 3  VAL A 92  ? ASP A 94  ? VAL A 85  ASP A 87  
AA2 1  THR A 35  ? ALA A 42  ? THR A 28  ALA A 35  
AA2 2  LYS A 48  ? LEU A 55  ? LYS A 41  LEU A 48  
AA2 3  SER A 61  ? PRO A 69  ? SER A 54  PRO A 62  
AA2 4  TYR A 120 ? THR A 125 ? TYR A 113 THR A 118 
AA2 5  VAL A 166 ? ILE A 170 ? VAL A 159 ILE A 163 
AA2 6  ARG A 134 ? ILE A 140 ? ARG A 127 ILE A 133 
AA2 7  GLY A 214 ? GLU A 224 ? GLY A 207 GLU A 217 
AA2 8  ARG A 246 ? MET A 250 ? ARG A 239 MET A 243 
AA2 9  THR A 350 ? THR A 355 ? THR A 343 THR A 348 
AA2 10 VAL A 448 ? PHE A 453 ? VAL A 441 PHE A 446 
AA2 11 LYS A 544 ? ILE A 548 ? LYS A 537 ILE A 541 
AA2 12 LEU A 552 ? ASP A 556 ? LEU A 545 ASP A 549 
AA3 1  GLN A 104 ? VAL A 105 ? GLN A 97  VAL A 98  
AA3 2  VAL A 112 ? CYS A 113 ? VAL A 105 CYS A 106 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N GLU A 38  ? N GLU A 31  O LYS A 53  ? O LYS A 46  
AA1 2  3  N LYS A 50  ? N LYS A 43  O ARG A 93  ? O ARG A 86  
AA2 1  2  N GLU A 38  ? N GLU A 31  O LYS A 53  ? O LYS A 46  
AA2 2  3  N ARG A 54  ? N ARG A 47  O TYR A 62  ? O TYR A 55  
AA2 3  4  N PHE A 65  ? N PHE A 58  O VAL A 123 ? O VAL A 116 
AA2 4  5  N TYR A 124 ? N TYR A 117 O LEU A 167 ? O LEU A 160 
AA2 5  6  O ILE A 168 ? O ILE A 161 N TYR A 139 ? N TYR A 132 
AA2 6  7  N VAL A 138 ? N VAL A 131 O THR A 220 ? O THR A 213 
AA2 7  8  N GLY A 223 ? N GLY A 216 O MET A 250 ? O MET A 243 
AA2 8  9  N LEU A 249 ? N LEU A 242 O MET A 351 ? O MET A 344 
AA2 9  10 N MET A 352 ? N MET A 345 O TYR A 449 ? O TYR A 442 
AA2 10 11 N ARG A 452 ? N ARG A 445 O ILE A 548 ? O ILE A 541 
AA2 11 12 N ASN A 547 ? N ASN A 540 O LYS A 553 ? O LYS A 546 
AA3 1  2  N GLN A 104 ? N GLN A 97  O CYS A 113 ? O CYS A 106 
# 
_atom_sites.entry_id                    5IVH 
_atom_sites.fract_transf_matrix[1][1]   0.020587 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009953 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004510 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N N    . VAL A 1 12  ? 2.501   1.999   -27.973 0.02 35.19 ? 5   VAL A N    1  
ATOM   2      C CA   . VAL A 1 12  ? 1.391   1.652   -27.093 0.02 34.58 ? 5   VAL A CA   1  
ATOM   3      C C    . VAL A 1 12  ? 0.226   2.681   -27.171 0.02 34.28 ? 5   VAL A C    1  
ATOM   4      O O    . VAL A 1 12  ? 0.335   3.802   -26.684 0.02 34.61 ? 5   VAL A O    1  
ATOM   5      C CB   . VAL A 1 12  ? 1.924   1.476   -25.639 0.02 34.83 ? 5   VAL A CB   1  
ATOM   6      C CG1  . VAL A 1 12  ? 0.867   1.797   -24.623 0.02 34.41 ? 5   VAL A CG1  1  
ATOM   7      C CG2  . VAL A 1 12  ? 2.416   0.056   -25.431 0.02 34.79 ? 5   VAL A CG2  1  
ATOM   8      H HA   . VAL A 1 12  ? 1.034   0.795   -27.377 0.02 34.22 ? 5   VAL A HA   1  
ATOM   9      H HB   . VAL A 1 12  ? 2.673   2.078   -25.499 0.02 35.34 ? 5   VAL A HB   1  
ATOM   10     H HG11 . VAL A 1 12  ? 0.844   2.758   -24.497 0.02 34.54 ? 5   VAL A HG11 1  
ATOM   11     H HG12 . VAL A 1 12  ? 0.004   1.479   -24.927 0.02 33.93 ? 5   VAL A HG12 1  
ATOM   12     H HG13 . VAL A 1 12  ? 1.107   1.368   -23.788 0.02 34.55 ? 5   VAL A HG13 1  
ATOM   13     H HG21 . VAL A 1 12  ? 1.668   -0.493  -25.153 0.02 34.32 ? 5   VAL A HG21 1  
ATOM   14     H HG22 . VAL A 1 12  ? 2.781   -0.281  -26.264 0.02 34.90 ? 5   VAL A HG22 1  
ATOM   15     H HG23 . VAL A 1 12  ? 3.101   0.059   -24.744 0.02 35.15 ? 5   VAL A HG23 1  
ATOM   16     N N    . SER A 1 13  ? -0.896  2.270   -27.767 0.02 33.66 ? 6   SER A N    1  
ATOM   17     C CA   . SER A 1 13  ? -2.095  3.108   -27.866 0.02 33.37 ? 6   SER A CA   1  
ATOM   18     C C    . SER A 1 13  ? -1.893  4.302   -28.808 0.02 33.79 ? 6   SER A C    1  
ATOM   19     O O    . SER A 1 13  ? -2.687  4.522   -29.716 0.02 33.54 ? 6   SER A O    1  
ATOM   20     C CB   . SER A 1 13  ? -2.559  3.589   -26.485 0.02 33.29 ? 6   SER A CB   1  
ATOM   21     O OG   . SER A 1 13  ? -3.646  2.811   -26.015 0.02 32.69 ? 6   SER A OG   1  
ATOM   22     H H    . SER A 1 13  ? -0.992  1.494   -28.127 0.02 33.42 ? 6   SER A H    1  
ATOM   23     H HA   . SER A 1 13  ? -2.816  2.573   -28.237 0.02 32.95 ? 6   SER A HA   1  
ATOM   24     H HB2  . SER A 1 13  ? -1.839  3.518   -25.847 0.02 33.63 ? 6   SER A HB2  1  
ATOM   25     H HB3  . SER A 1 13  ? -2.851  4.513   -26.548 0.02 33.32 ? 6   SER A HB3  1  
ATOM   26     H HG   . SER A 1 13  ? -3.470  2.501   -25.254 0.02 32.73 ? 6   SER A HG   1  
ATOM   27     N N    . LEU A 1 14  ? -0.836  5.094   -28.586 0.02 34.46 ? 7   LEU A N    1  
ATOM   28     C CA   . LEU A 1 14  ? -0.634  6.284   -29.421 0.02 34.91 ? 7   LEU A CA   1  
ATOM   29     C C    . LEU A 1 14  ? -0.173  5.874   -30.813 0.02 35.06 ? 7   LEU A C    1  
ATOM   30     O O    . LEU A 1 14  ? -0.531  6.515   -31.808 0.02 35.22 ? 7   LEU A O    1  
ATOM   31     C CB   . LEU A 1 14  ? 0.378   7.257   -28.819 0.02 35.66 ? 7   LEU A CB   1  
ATOM   32     C CG   . LEU A 1 14  ? -0.164  8.439   -27.966 0.02 35.78 ? 7   LEU A CG   1  
ATOM   33     C CD1  . LEU A 1 14  ? 0.738   8.655   -26.746 0.02 36.41 ? 7   LEU A CD1  1  
ATOM   34     C CD2  . LEU A 1 14  ? -0.357  9.793   -28.758 0.02 36.02 ? 7   LEU A CD2  1  
ATOM   35     H H    . LEU A 1 14  ? -0.238  4.964   -27.986 0.02 34.69 ? 7   LEU A H    1  
ATOM   36     H HA   . LEU A 1 14  ? -1.463  6.768   -29.469 0.02 34.67 ? 7   LEU A HA   1  
ATOM   37     H HB2  . LEU A 1 14  ? 0.982   6.740   -28.268 0.02 35.79 ? 7   LEU A HB2  1  
ATOM   38     H HB3  . LEU A 1 14  ? 0.881   7.648   -29.549 0.02 36.03 ? 7   LEU A HB3  1  
ATOM   39     H HG   . LEU A 1 14  ? -1.037  8.185   -27.628 0.02 35.33 ? 7   LEU A HG   1  
ATOM   40     H HD11 . LEU A 1 14  ? 1.478   9.228   -26.997 0.02 36.89 ? 7   LEU A HD11 1  
ATOM   41     H HD12 . LEU A 1 14  ? 0.216   9.080   -26.048 0.02 36.50 ? 7   LEU A HD12 1  
ATOM   42     H HD13 . LEU A 1 14  ? 1.075   7.804   -26.427 0.02 36.26 ? 7   LEU A HD13 1  
ATOM   43     H HD21 . LEU A 1 14  ? -0.060  10.532  -28.207 0.02 36.35 ? 7   LEU A HD21 1  
ATOM   44     H HD22 . LEU A 1 14  ? 0.166   9.767   -29.573 0.02 36.32 ? 7   LEU A HD22 1  
ATOM   45     H HD23 . LEU A 1 14  ? -1.296  9.906   -28.974 0.02 35.58 ? 7   LEU A HD23 1  
ATOM   46     N N    . MET A 1 15  ? 0.697   4.855   -30.863 0.02 35.08 ? 8   MET A N    1  
ATOM   47     C CA   . MET A 1 15  ? 0.899   4.018   -32.044 0.02 35.06 ? 8   MET A CA   1  
ATOM   48     C C    . MET A 1 15  ? -0.385  3.886   -32.853 0.02 34.49 ? 8   MET A C    1  
ATOM   49     O O    . MET A 1 15  ? -0.511  4.434   -33.963 0.02 34.67 ? 8   MET A O    1  
ATOM   50     C CB   . MET A 1 15  ? 1.402   2.634   -31.555 0.02 34.94 ? 8   MET A CB   1  
ATOM   51     C CG   . MET A 1 15  ? 1.839   1.562   -32.603 0.02 34.89 ? 8   MET A CG   1  
ATOM   52     S SD   . MET A 1 15  ? 2.286   -0.083  -31.892 0.02 34.62 ? 8   MET A SD   1  
ATOM   53     C CE   . MET A 1 15  ? 2.670   0.214   -30.166 0.02 34.94 ? 8   MET A CE   1  
ATOM   54     H H    . MET A 1 15  ? 1.192   4.623   -30.199 0.02 35.13 ? 8   MET A H    1  
ATOM   55     H HA   . MET A 1 15  ? 1.588   4.416   -32.598 0.02 35.55 ? 8   MET A HA   1  
ATOM   56     H HB2  . MET A 1 15  ? 2.173   2.790   -30.988 0.02 35.37 ? 8   MET A HB2  1  
ATOM   57     H HB3  . MET A 1 15  ? 0.705   2.240   -31.012 0.02 34.52 ? 8   MET A HB3  1  
ATOM   58     H HG2  . MET A 1 15  ? 1.111   1.419   -33.230 0.02 34.56 ? 8   MET A HG2  1  
ATOM   59     H HG3  . MET A 1 15  ? 2.614   1.896   -33.081 0.02 35.38 ? 8   MET A HG3  1  
ATOM   60     H HE1  . MET A 1 15  ? 3.298   0.942   -30.109 0.02 35.16 ? 8   MET A HE1  1  
ATOM   61     H HE2  . MET A 1 15  ? 1.850   0.459   -29.714 0.02 34.55 ? 8   MET A HE2  1  
ATOM   62     H HE3  . MET A 1 15  ? 3.038   -0.588  -29.762 0.02 35.31 ? 8   MET A HE3  1  
ATOM   63     N N    . GLU A 1 16  ? -1.355  3.152   -32.308 0.02 33.83 ? 9   GLU A N    1  
ATOM   64     C CA   . GLU A 1 16  ? -2.567  2.863   -33.062 0.02 33.27 ? 9   GLU A CA   1  
ATOM   65     C C    . GLU A 1 16  ? -3.596  3.973   -32.946 0.02 33.15 ? 9   GLU A C    1  
ATOM   66     O O    . GLU A 1 16  ? -4.504  4.049   -33.782 0.02 32.93 ? 9   GLU A O    1  
ATOM   67     C CB   . GLU A 1 16  ? -3.184  1.561   -32.606 0.02 32.68 ? 9   GLU A CB   1  
ATOM   68     C CG   . GLU A 1 16  ? -3.120  1.401   -31.141 0.02 32.66 ? 9   GLU A CG   1  
ATOM   69     C CD   . GLU A 1 16  ? -2.057  0.405   -30.764 0.02 32.88 ? 9   GLU A CD   1  
ATOM   70     O OE1  . GLU A 1 16  ? -2.420  -0.651  -30.227 0.02 32.52 ? 9   GLU A OE1  1  
ATOM   71     O OE2  . GLU A 1 16  ? -0.865  0.664   -31.042 0.02 33.43 ? 9   GLU A OE2  1  
ATOM   72     H H    . GLU A 1 16  ? -1.313  2.824   -31.520 0.02 33.73 ? 9   GLU A H    1  
ATOM   73     H HA   . GLU A 1 16  ? -2.317  2.762   -33.979 0.02 33.40 ? 9   GLU A HA   1  
ATOM   74     H HB2  . GLU A 1 16  ? -4.115  1.540   -32.880 0.02 32.32 ? 9   GLU A HB2  1  
ATOM   75     H HB3  . GLU A 1 16  ? -2.701  0.823   -33.010 0.02 32.68 ? 9   GLU A HB3  1  
ATOM   76     H HG2  . GLU A 1 16  ? -2.926  2.244   -30.715 0.02 32.92 ? 9   GLU A HG2  1  
ATOM   77     H HG3  . GLU A 1 16  ? -3.976  1.082   -30.826 0.02 32.24 ? 9   GLU A HG3  1  
ATOM   78     N N    . LYS A 1 17  ? -3.479  4.843   -31.935 0.02 33.30 ? 10  LYS A N    1  
ATOM   79     C CA   . LYS A 1 17  ? -4.303  6.057   -31.931 0.02 33.31 ? 10  LYS A CA   1  
ATOM   80     C C    . LYS A 1 17  ? -4.275  6.730   -33.304 0.02 33.63 ? 10  LYS A C    1  
ATOM   81     O O    . LYS A 1 17  ? -5.329  7.029   -33.883 0.02 33.37 ? 10  LYS A O    1  
ATOM   82     C CB   . LYS A 1 17  ? -3.836  7.037   -30.842 0.02 33.70 ? 10  LYS A CB   1  
ATOM   83     C CG   . LYS A 1 17  ? -4.551  6.914   -29.454 0.02 33.32 ? 10  LYS A CG   1  
ATOM   84     C CD   . LYS A 1 17  ? -4.108  8.009   -28.431 0.02 33.79 ? 10  LYS A CD   1  
ATOM   85     C CE   . LYS A 1 17  ? -4.218  7.569   -26.904 0.02 33.58 ? 10  LYS A CE   1  
ATOM   86     N NZ   . LYS A 1 17  ? -5.009  6.327   -26.581 0.02 32.96 ? 10  LYS A NZ   1  
ATOM   87     H H    . LYS A 1 17  ? -2.944  4.756   -31.270 0.02 33.42 ? 10  LYS A H    1  
ATOM   88     H HA   . LYS A 1 17  ? -5.222  5.817   -31.740 0.02 32.88 ? 10  LYS A HA   1  
ATOM   89     H HB2  . LYS A 1 17  ? -2.897  6.895   -30.723 0.02 34.07 ? 10  LYS A HB2  1  
ATOM   90     H HB3  . LYS A 1 17  ? -3.981  7.942   -31.159 0.02 33.89 ? 10  LYS A HB3  1  
ATOM   91     H HG2  . LYS A 1 17  ? -5.507  7.006   -29.592 0.02 32.96 ? 10  LYS A HG2  1  
ATOM   92     H HG3  . LYS A 1 17  ? -4.357  6.044   -29.076 0.02 33.17 ? 10  LYS A HG3  1  
ATOM   93     H HD2  . LYS A 1 17  ? -3.181  8.234   -28.602 0.02 34.23 ? 10  LYS A HD2  1  
ATOM   94     H HD3  . LYS A 1 17  ? -4.661  8.795   -28.558 0.02 33.86 ? 10  LYS A HD3  1  
ATOM   95     H HE2  . LYS A 1 17  ? -3.322  7.434   -26.557 0.02 33.93 ? 10  LYS A HE2  1  
ATOM   96     H HE3  . LYS A 1 17  ? -4.638  8.293   -26.411 0.02 33.55 ? 10  LYS A HE3  1  
ATOM   97     H HZ1  . LYS A 1 17  ? -4.874  6.097   -25.730 0.02 32.97 ? 10  LYS A HZ1  1  
ATOM   98     H HZ2  . LYS A 1 17  ? -5.876  6.479   -26.703 0.02 32.64 ? 10  LYS A HZ2  1  
ATOM   99     H HZ3  . LYS A 1 17  ? -4.752  5.650   -27.098 0.02 32.92 ? 10  LYS A HZ3  1  
ATOM   100    N N    . LEU A 1 18  ? -3.068  6.988   -33.842 0.02 34.25 ? 11  LEU A N    1  
ATOM   101    C CA   . LEU A 1 18  ? -2.943  7.498   -35.212 0.02 34.63 ? 11  LEU A CA   1  
ATOM   102    C C    . LEU A 1 18  ? -3.379  6.464   -36.242 0.02 34.31 ? 11  LEU A C    1  
ATOM   103    O O    . LEU A 1 18  ? -3.969  6.815   -37.273 0.02 34.31 ? 11  LEU A O    1  
ATOM   104    C CB   . LEU A 1 18  ? -1.505  7.920   -35.508 0.02 35.42 ? 11  LEU A CB   1  
ATOM   105    C CG   . LEU A 1 18  ? -1.250  8.337   -36.971 0.02 35.89 ? 11  LEU A CG   1  
ATOM   106    C CD1  . LEU A 1 18  ? -2.075  9.569   -37.354 0.02 35.95 ? 11  LEU A CD1  1  
ATOM   107    C CD2  . LEU A 1 18  ? 0.228   8.548   -37.280 0.02 36.71 ? 11  LEU A CD2  1  
ATOM   108    H H    . LEU A 1 18  ? -2.318  6.884   -33.434 0.02 34.47 ? 11  LEU A H    1  
ATOM   109    H HA   . LEU A 1 18  ? -3.516  8.275   -35.311 0.02 34.65 ? 11  LEU A HA   1  
ATOM   110    H HB2  . LEU A 1 18  ? -1.271  8.669   -34.939 0.02 35.68 ? 11  LEU A HB2  1  
ATOM   111    H HB3  . LEU A 1 18  ? -0.925  7.168   -35.310 0.02 35.43 ? 11  LEU A HB3  1  
ATOM   112    H HG   . LEU A 1 18  ? -1.539  7.617   -37.553 0.02 35.64 ? 11  LEU A HG   1  
ATOM   113    H HD11 . LEU A 1 18  ? -1.651  10.010  -38.105 0.02 36.42 ? 11  LEU A HD11 1  
ATOM   114    H HD12 . LEU A 1 18  ? -2.972  9.288   -37.597 0.02 35.51 ? 11  LEU A HD12 1  
ATOM   115    H HD13 . LEU A 1 18  ? -2.109  10.175  -36.597 0.02 35.98 ? 11  LEU A HD13 1  
ATOM   116    H HD21 . LEU A 1 18  ? 0.756   8.098   -36.604 0.02 36.74 ? 11  LEU A HD21 1  
ATOM   117    H HD22 . LEU A 1 18  ? 0.423   8.177   -38.153 0.02 36.82 ? 11  LEU A HD22 1  
ATOM   118    H HD23 . LEU A 1 18  ? 0.425   9.497   -37.274 0.02 37.11 ? 11  LEU A HD23 1  
ATOM   119    N N    . LYS A 1 19  ? -3.041  5.191   -36.018 0.02 34.11 ? 12  LYS A N    1  
ATOM   120    C CA   . LYS A 1 19  ? -3.558  4.135   -36.877 0.02 33.72 ? 12  LYS A CA   1  
ATOM   121    C C    . LYS A 1 19  ? -5.078  4.192   -36.912 0.02 33.14 ? 12  LYS A C    1  
ATOM   122    O O    . LYS A 1 19  ? -5.679  4.445   -37.962 0.02 33.14 ? 12  LYS A O    1  
ATOM   123    C CB   . LYS A 1 19  ? -3.068  2.785   -36.346 0.02 33.50 ? 12  LYS A CB   1  
ATOM   124    C CG   . LYS A 1 19  ? -2.812  1.683   -37.333 0.02 33.45 ? 12  LYS A CG   1  
ATOM   125    C CD   . LYS A 1 19  ? -1.591  0.904   -36.814 0.02 33.77 ? 12  LYS A CD   1  
ATOM   126    C CE   . LYS A 1 19  ? -1.149  -0.209  -37.730 0.02 33.81 ? 12  LYS A CE   1  
ATOM   127    N NZ   . LYS A 1 19  ? -0.414  -1.238  -36.928 0.02 33.98 ? 12  LYS A NZ   1  
ATOM   128    H H    . LYS A 1 19  ? -2.520  4.920   -35.390 0.02 34.22 ? 12  LYS A H    1  
ATOM   129    H HA   . LYS A 1 19  ? -3.222  4.259   -37.780 0.02 34.01 ? 12  LYS A HA   1  
ATOM   130    H HB2  . LYS A 1 19  ? -2.210  2.956   -35.933 0.02 33.84 ? 12  LYS A HB2  1  
ATOM   131    H HB3  . LYS A 1 19  ? -3.693  2.455   -35.682 0.02 33.08 ? 12  LYS A HB3  1  
ATOM   132    H HG2  . LYS A 1 19  ? -3.581  1.091   -37.376 0.02 33.01 ? 12  LYS A HG2  1  
ATOM   133    H HG3  . LYS A 1 19  ? -2.605  2.055   -38.207 0.02 33.72 ? 12  LYS A HG3  1  
ATOM   134    H HD2  . LYS A 1 19  ? -0.841  1.512   -36.722 0.02 34.24 ? 12  LYS A HD2  1  
ATOM   135    H HD3  . LYS A 1 19  ? -1.808  0.520   -35.950 0.02 33.52 ? 12  LYS A HD3  1  
ATOM   136    H HE2  . LYS A 1 19  ? -1.922  -0.627  -38.142 0.02 33.39 ? 12  LYS A HE2  1  
ATOM   137    H HE3  . LYS A 1 19  ? -0.553  0.148   -38.407 0.02 34.17 ? 12  LYS A HE3  1  
ATOM   138    H HZ1  . LYS A 1 19  ? -0.102  -1.873  -37.468 0.02 34.15 ? 12  LYS A HZ1  1  
ATOM   139    H HZ2  . LYS A 1 19  ? 0.269   -0.858  -36.504 0.02 34.30 ? 12  LYS A HZ2  1  
ATOM   140    H HZ3  . LYS A 1 19  ? -0.961  -1.609  -36.330 0.02 33.62 ? 12  LYS A HZ3  1  
ATOM   141    N N    . TRP A 1 20  ? -5.710  4.012   -35.754 0.02 32.70 ? 13  TRP A N    1  
ATOM   142    C CA   . TRP A 1 20  ? -7.162  4.059   -35.687 0.02 32.19 ? 13  TRP A CA   1  
ATOM   143    C C    . TRP A 1 20  ? -7.699  5.292   -36.407 0.02 32.41 ? 13  TRP A C    1  
ATOM   144    O O    . TRP A 1 20  ? -8.596  5.181   -37.255 0.02 32.20 ? 13  TRP A O    1  
ATOM   145    C CB   . TRP A 1 20  ? -7.615  4.022   -34.217 0.02 31.86 ? 13  TRP A CB   1  
ATOM   146    C CG   . TRP A 1 20  ? -9.045  3.764   -34.113 0.02 31.33 ? 13  TRP A CG   1  
ATOM   147    C CD1  . TRP A 1 20  ? -10.017 4.637   -33.733 0.02 31.24 ? 13  TRP A CD1  1  
ATOM   148    C CD2  . TRP A 1 20  ? -9.706  2.541   -34.448 0.02 30.87 ? 13  TRP A CD2  1  
ATOM   149    N NE1  . TRP A 1 20  ? -11.250 4.021   -33.799 0.02 30.74 ? 13  TRP A NE1  1  
ATOM   150    C CE2  . TRP A 1 20  ? -11.081 2.737   -34.243 0.02 30.51 ? 13  TRP A CE2  1  
ATOM   151    C CE3  . TRP A 1 20  ? -9.263  1.293   -34.893 0.02 30.76 ? 13  TRP A CE3  1  
ATOM   152    C CZ2  . TRP A 1 20  ? -12.017 1.728   -34.460 0.02 30.06 ? 13  TRP A CZ2  1  
ATOM   153    C CZ3  . TRP A 1 20  ? -10.193 0.305   -35.117 0.02 30.31 ? 13  TRP A CZ3  1  
ATOM   154    C CH2  . TRP A 1 20  ? -11.549 0.523   -34.895 0.02 29.97 ? 13  TRP A CH2  1  
ATOM   155    H H    . TRP A 1 20  ? -5.324  3.863   -35.006 0.02 32.72 ? 13  TRP A H    1  
ATOM   156    H HA   . TRP A 1 20  ? -7.525  3.279   -36.134 0.02 31.93 ? 13  TRP A HA   1  
ATOM   157    H HB2  . TRP A 1 20  ? -7.144  3.319   -33.743 0.02 31.80 ? 13  TRP A HB2  1  
ATOM   158    H HB3  . TRP A 1 20  ? -7.434  4.884   -33.809 0.02 32.11 ? 13  TRP A HB3  1  
ATOM   159    H HD1  . TRP A 1 20  ? -9.870  5.516   -33.472 0.02 31.49 ? 13  TRP A HD1  1  
ATOM   160    H HE1  . TRP A 1 20  ? -12.004 4.383   -33.603 0.02 30.62 ? 13  TRP A HE1  1  
ATOM   161    H HE3  . TRP A 1 20  ? -8.359  1.137   -35.047 0.02 31.02 ? 13  TRP A HE3  1  
ATOM   162    H HZ2  . TRP A 1 20  ? -12.925 1.864   -34.313 0.02 29.85 ? 13  TRP A HZ2  1  
ATOM   163    H HZ3  . TRP A 1 20  ? -9.907  -0.527  -35.416 0.02 30.26 ? 13  TRP A HZ3  1  
ATOM   164    H HH2  . TRP A 1 20  ? -12.154 -0.166  -35.052 0.02 29.70 ? 13  TRP A HH2  1  
ATOM   165    N N    . LYS A 1 21  ? -7.119  6.471   -36.131 0.02 32.89 ? 14  LYS A N    1  
ATOM   166    C CA   . LYS A 1 21  ? -7.472  7.669   -36.890 0.02 33.23 ? 14  LYS A CA   1  
ATOM   167    C C    . LYS A 1 21  ? -7.342  7.447   -38.398 0.02 33.42 ? 14  LYS A C    1  
ATOM   168    O O    . LYS A 1 21  ? -8.278  7.724   -39.159 0.02 33.28 ? 14  LYS A O    1  
ATOM   169    C CB   . LYS A 1 21  ? -6.600  8.832   -36.445 0.02 33.85 ? 14  LYS A CB   1  
ATOM   170    C CG   . LYS A 1 21  ? -7.427  10.036  -36.137 0.02 33.94 ? 14  LYS A CG   1  
ATOM   171    C CD   . LYS A 1 21  ? -6.597  11.122  -35.464 0.02 34.58 ? 14  LYS A CD   1  
ATOM   172    C CE   . LYS A 1 21  ? -5.309  11.449  -36.349 0.02 35.24 ? 14  LYS A CE   1  
ATOM   173    N NZ   . LYS A 1 21  ? -5.569  11.796  -37.788 0.02 35.42 ? 14  LYS A NZ   1  
ATOM   174    H H    . LYS A 1 21  ? -6.530  6.598   -35.518 0.02 33.05 ? 14  LYS A H    1  
ATOM   175    H HA   . LYS A 1 21  ? -8.397  7.895   -36.705 0.02 32.96 ? 14  LYS A HA   1  
ATOM   176    H HB2  . LYS A 1 21  ? -6.103  8.588   -35.648 0.02 33.87 ? 14  LYS A HB2  1  
ATOM   177    H HB3  . LYS A 1 21  ? -5.990  9.051   -37.167 0.02 34.24 ? 14  LYS A HB3  1  
ATOM   178    H HG2  . LYS A 1 21  ? -7.766  10.391  -36.973 0.02 34.00 ? 14  LYS A HG2  1  
ATOM   179    H HG3  . LYS A 1 21  ? -8.160  9.788   -35.554 0.02 33.55 ? 14  LYS A HG3  1  
ATOM   180    H HD2  . LYS A 1 21  ? -7.128  11.928  -35.351 0.02 34.71 ? 14  LYS A HD2  1  
ATOM   181    H HD3  . LYS A 1 21  ? -6.281  10.783  -34.611 0.02 34.49 ? 14  LYS A HD3  1  
ATOM   182    H HE2  . LYS A 1 21  ? -4.777  12.218  -36.040 0.02 35.67 ? 14  LYS A HE2  1  
ATOM   183    H HE3  . LYS A 1 21  ? -4.776  10.640  -36.342 0.02 35.16 ? 14  LYS A HE3  1  
ATOM   184    H HZ1  . LYS A 1 21  ? -5.040  12.445  -38.090 0.02 35.89 ? 14  LYS A HZ1  1  
ATOM   185    H HZ2  . LYS A 1 21  ? -5.445  11.068  -38.285 0.02 35.37 ? 14  LYS A HZ2  1  
ATOM   186    H HZ3  . LYS A 1 21  ? -6.417  12.054  -37.869 0.02 35.12 ? 14  LYS A HZ3  1  
ATOM   187    N N    . ILE A 1 22  ? -6.191  6.947   -38.851 0.02 33.75 ? 15  ILE A N    1  
ATOM   188    C CA   . ILE A 1 22  ? -6.014  6.630   -40.273 0.02 34.00 ? 15  ILE A CA   1  
ATOM   189    C C    . ILE A 1 22  ? -6.556  5.231   -40.579 0.02 33.47 ? 15  ILE A C    1  
ATOM   190    O O    . ILE A 1 22  ? -6.040  4.509   -41.446 0.02 33.64 ? 15  ILE A O    1  
ATOM   191    C CB   . ILE A 1 22  ? -4.527  6.789   -40.655 0.02 34.68 ? 15  ILE A CB   1  
ATOM   192    C CG1  . ILE A 1 22  ? -4.158  8.269   -40.753 0.02 35.32 ? 15  ILE A CG1  1  
ATOM   193    C CG2  . ILE A 1 22  ? -4.178  6.127   -42.000 0.02 34.87 ? 15  ILE A CG2  1  
ATOM   194    C CD1  . ILE A 1 22  ? -2.719  8.567   -40.325 0.02 35.94 ? 15  ILE A CD1  1  
ATOM   195    H H    . ILE A 1 22  ? -5.505  6.784   -38.360 0.02 33.87 ? 15  ILE A H    1  
ATOM   196    H HA   . ILE A 1 22  ? -6.522  7.264   -40.800 0.02 34.12 ? 15  ILE A HA   1  
ATOM   197    H HB   . ILE A 1 22  ? -3.988  6.382   -39.961 0.02 34.64 ? 15  ILE A HB   1  
ATOM   198    H HG12 . ILE A 1 22  ? -4.258  8.553   -41.676 0.02 35.55 ? 15  ILE A HG12 1  
ATOM   199    H HG13 . ILE A 1 22  ? -4.753  8.786   -40.186 0.02 35.16 ? 15  ILE A HG13 1  
ATOM   200    H HG21 . ILE A 1 22  ? -3.447  6.621   -42.404 0.02 35.39 ? 15  ILE A HG21 1  
ATOM   201    H HG22 . ILE A 1 22  ? -3.895  5.214   -41.843 0.02 34.60 ? 15  ILE A HG22 1  
ATOM   202    H HG23 . ILE A 1 22  ? -4.950  6.148   -42.584 0.02 34.79 ? 15  ILE A HG23 1  
ATOM   203    H HD11 . ILE A 1 22  ? -2.628  9.519   -40.166 0.02 36.28 ? 15  ILE A HD11 1  
ATOM   204    H HD12 . ILE A 1 22  ? -2.521  8.077   -39.513 0.02 35.72 ? 15  ILE A HD12 1  
ATOM   205    H HD13 . ILE A 1 22  ? -2.119  8.286   -41.031 0.02 36.23 ? 15  ILE A HD13 1  
ATOM   206    N N    . LYS A 1 23  ? -7.598  4.814   -39.861 0.02 32.86 ? 16  LYS A N    1  
ATOM   207    C CA   . LYS A 1 23  ? -8.409  3.692   -40.319 0.02 32.38 ? 16  LYS A CA   1  
ATOM   208    C C    . LYS A 1 23  ? -9.890  3.968   -40.066 0.02 31.95 ? 16  LYS A C    1  
ATOM   209    O O    . LYS A 1 23  ? -10.758 3.238   -40.569 0.02 31.68 ? 16  LYS A O    1  
ATOM   210    C CB   . LYS A 1 23  ? -7.929  2.394   -39.660 0.02 32.09 ? 16  LYS A CB   1  
ATOM   211    C CG   . LYS A 1 23  ? -6.535  1.927   -40.135 0.02 32.53 ? 16  LYS A CG   1  
ATOM   212    C CD   . LYS A 1 23  ? -6.619  0.820   -41.192 0.02 32.46 ? 16  LYS A CD   1  
ATOM   213    C CE   . LYS A 1 23  ? -5.341  0.716   -42.061 0.02 33.02 ? 16  LYS A CE   1  
ATOM   214    N NZ   . LYS A 1 23  ? -5.628  0.104   -43.381 0.02 33.07 ? 16  LYS A NZ   1  
ATOM   215    H H    . LYS A 1 23  ? -7.848  5.151   -39.113 0.02 32.73 ? 16  LYS A H    1  
ATOM   216    H HA   . LYS A 1 23  ? -8.292  3.590   -41.278 0.02 32.57 ? 16  LYS A HA   1  
ATOM   217    H HB2  . LYS A 1 23  ? -7.873  2.536   -38.704 0.02 31.98 ? 16  LYS A HB2  1  
ATOM   218    H HB3  . LYS A 1 23  ? -8.564  1.688   -39.853 0.02 31.76 ? 16  LYS A HB3  1  
ATOM   219    H HG2  . LYS A 1 23  ? -6.040  2.656   -40.512 0.02 32.95 ? 16  LYS A HG2  1  
ATOM   220    H HG3  . LYS A 1 23  ? -6.045  1.577   -39.375 0.02 32.48 ? 16  LYS A HG3  1  
ATOM   221    H HD2  . LYS A 1 23  ? -6.744  -0.030  -40.741 0.02 32.11 ? 16  LYS A HD2  1  
ATOM   222    H HD3  . LYS A 1 23  ? -7.374  0.997   -41.777 0.02 32.42 ? 16  LYS A HD3  1  
ATOM   223    H HE2  . LYS A 1 23  ? -4.962  1.596   -42.213 0.02 33.41 ? 16  LYS A HE2  1  
ATOM   224    H HE3  . LYS A 1 23  ? -4.696  0.144   -41.629 0.02 32.98 ? 16  LYS A HE3  1  
ATOM   225    H HZ1  . LYS A 1 23  ? -6.192  0.619   -43.838 0.02 33.04 ? 16  LYS A HZ1  1  
ATOM   226    H HZ2  . LYS A 1 23  ? -4.873  0.016   -43.846 0.02 33.45 ? 16  LYS A HZ2  1  
ATOM   227    H HZ3  . LYS A 1 23  ? -5.997  -0.698  -43.269 0.02 32.77 ? 16  LYS A HZ3  1  
ATOM   228    N N    . CYS A 1 24  ? -10.188 5.034   -39.310 0.02 31.93 ? 17  CYS A N    1  
ATOM   229    C CA   . CYS A 1 24  ? -11.535 5.593   -39.288 0.02 31.68 ? 17  CYS A CA   1  
ATOM   230    C C    . CYS A 1 24  ? -11.804 6.392   -40.551 0.02 32.05 ? 17  CYS A C    1  
ATOM   231    O O    . CYS A 1 24  ? -12.925 6.383   -41.067 0.02 31.85 ? 17  CYS A O    1  
ATOM   232    C CB   . CYS A 1 24  ? -11.731 6.493   -38.066 0.02 31.67 ? 17  CYS A CB   1  
ATOM   233    S SG   . CYS A 1 24  ? -11.783 5.719   -36.444 0.02 31.23 ? 17  CYS A SG   1  
ATOM   234    H H    . CYS A 1 24  ? -9.632  5.448   -38.803 0.02 32.07 ? 17  CYS A H    1  
ATOM   235    H HA   . CYS A 1 24  ? -12.181 4.873   -39.242 0.02 31.32 ? 17  CYS A HA   1  
ATOM   236    H HB2  . CYS A 1 24  ? -11.010 7.140   -38.054 0.02 32.06 ? 17  CYS A HB2  1  
ATOM   237    H HB3  . CYS A 1 24  ? -12.573 6.964   -38.176 0.02 31.59 ? 17  CYS A HB3  1  
ATOM   238    H HG   . CYS A 1 24  ? -10.833 4.999   -36.301 0.02 31.31 ? 17  CYS A HG   1  
ATOM   239    N N    . ILE A 1 25  ? -10.776 7.083   -41.069 0.02 32.63 ? 18  ILE A N    1  
ATOM   240    C CA   . ILE A 1 25  ? -10.939 7.890   -42.277 0.02 33.05 ? 18  ILE A CA   1  
ATOM   241    C C    . ILE A 1 25  ? -10.977 6.997   -43.524 0.02 33.03 ? 18  ILE A C    1  
ATOM   242    O O    . ILE A 1 25  ? -11.477 7.422   -44.566 0.02 33.22 ? 18  ILE A O    1  
ATOM   243    C CB   . ILE A 1 25  ? -9.826  8.963   -42.372 0.02 33.75 ? 18  ILE A CB   1  
ATOM   244    C CG1  . ILE A 1 25  ? -9.682  9.754   -41.058 0.02 33.79 ? 18  ILE A CG1  1  
ATOM   245    C CG2  . ILE A 1 25  ? -10.138 9.976   -43.449 0.02 34.21 ? 18  ILE A CG2  1  
ATOM   246    C CD1  . ILE A 1 25  ? -8.611  10.863  -41.128 0.02 34.51 ? 18  ILE A CD1  1  
ATOM   247    H H    . ILE A 1 25  ? -9.978  7.093   -40.748 0.02 32.82 ? 18  ILE A H    1  
ATOM   248    H HA   . ILE A 1 25  ? -11.792 8.354   -42.210 0.02 32.94 ? 18  ILE A HA   1  
ATOM   249    H HB   . ILE A 1 25  ? -8.986  8.527   -42.587 0.02 33.91 ? 18  ILE A HB   1  
ATOM   250    H HG12 . ILE A 1 25  ? -10.530 10.179  -40.855 0.02 33.66 ? 18  ILE A HG12 1  
ATOM   251    H HG13 . ILE A 1 25  ? -9.445  9.157   -40.338 0.02 33.51 ? 18  ILE A HG13 1  
ATOM   252    H HG21 . ILE A 1 25  ? -10.659 10.693  -43.057 0.02 34.17 ? 18  ILE A HG21 1  
ATOM   253    H HG22 . ILE A 1 25  ? -9.304  10.328  -43.799 0.02 34.68 ? 18  ILE A HG22 1  
ATOM   254    H HG23 . ILE A 1 25  ? -10.640 9.556   -44.163 0.02 34.12 ? 18  ILE A HG23 1  
ATOM   255    H HD11 . ILE A 1 25  ? -8.467  11.222  -40.237 0.02 34.51 ? 18  ILE A HD11 1  
ATOM   256    H HD12 . ILE A 1 25  ? -7.787  10.482  -41.469 0.02 34.71 ? 18  ILE A HD12 1  
ATOM   257    H HD13 . ILE A 1 25  ? -8.917  11.565  -41.721 0.02 34.78 ? 18  ILE A HD13 1  
ATOM   258    N N    . GLU A 1 26  ? -10.423 5.764   -43.462 0.02 32.83 ? 19  GLU A N    1  
ATOM   259    C CA   . GLU A 1 26  ? -10.714 4.736   -44.471 0.02 32.77 ? 19  GLU A CA   1  
ATOM   260    C C    . GLU A 1 26  ? -12.183 4.448   -44.524 0.02 32.23 ? 19  GLU A C    1  
ATOM   261    O O    . GLU A 1 26  ? -12.818 4.499   -45.595 0.02 32.26 ? 19  GLU A O    1  
ATOM   262    C CB   . GLU A 1 26  ? -10.084 3.371   -44.211 0.02 32.79 ? 19  GLU A CB   1  
ATOM   263    C CG   . GLU A 1 26  ? -9.889  2.445   -45.488 0.02 32.79 ? 19  GLU A CG   1  
ATOM   264    C CD   . GLU A 1 26  ? -9.504  3.231   -46.817 0.02 33.34 ? 19  GLU A CD   1  
ATOM   265    O OE1  . GLU A 1 26  ? -10.295 4.093   -47.358 0.02 33.36 ? 19  GLU A OE1  1  
ATOM   266    O OE2  . GLU A 1 26  ? -8.350  3.069   -47.273 0.02 33.81 ? 19  GLU A OE2  1  
ATOM   267    H H    . GLU A 1 26  ? -9.853  5.530   -42.863 0.02 32.76 ? 19  GLU A H    1  
ATOM   268    H HA   . GLU A 1 26  ? -10.470 5.055   -45.346 0.02 33.13 ? 19  GLU A HA   1  
ATOM   269    H HB2  . GLU A 1 26  ? -9.029  3.545   -43.986 0.02 33.18 ? 19  GLU A HB2  1  
ATOM   270    H HB3  . GLU A 1 26  ? -10.518 2.877   -43.574 0.02 32.45 ? 19  GLU A HB3  1  
ATOM   271    H HG2  . GLU A 1 26  ? -9.172  1.821   -45.290 0.02 32.83 ? 19  GLU A HG2  1  
ATOM   272    H HG3  . GLU A 1 26  ? -10.695 1.939   -45.687 0.02 32.42 ? 19  GLU A HG3  1  
ATOM   273    N N    . ASN A 1 27  ? -12.681 3.958   -43.398 0.02 31.75 ? 20  ASN A N    1  
ATOM   274    C CA   . ASN A 1 27  ? -14.065 3.572   -43.277 0.02 31.29 ? 20  ASN A CA   1  
ATOM   275    C C    . ASN A 1 27  ? -14.934 4.717   -43.734 0.02 31.46 ? 20  ASN A C    1  
ATOM   276    O O    . ASN A 1 27  ? -16.007 4.498   -44.295 0.02 31.28 ? 20  ASN A O    1  
ATOM   277    C CB   . ASN A 1 27  ? -14.330 3.185   -41.826 0.02 30.84 ? 20  ASN A CB   1  
ATOM   278    C CG   . ASN A 1 27  ? -15.707 2.672   -41.613 0.02 30.39 ? 20  ASN A CG   1  
ATOM   279    O OD1  . ASN A 1 27  ? -16.625 3.441   -41.319 0.02 30.26 ? 20  ASN A OD1  1  
ATOM   280    N ND2  . ASN A 1 27  ? -15.882 1.362   -41.774 0.02 30.20 ? 20  ASN A ND2  1  
ATOM   281    H H    . ASN A 1 27  ? -12.239 3.893   -42.665 0.02 31.71 ? 20  ASN A H    1  
ATOM   282    H HA   . ASN A 1 27  ? -14.246 2.806   -43.845 0.02 31.19 ? 20  ASN A HA   1  
ATOM   283    H HB2  . ASN A 1 27  ? -13.708 2.482   -41.587 0.02 30.80 ? 20  ASN A HB2  1  
ATOM   284    H HB3  . ASN A 1 27  ? -14.199 3.960   -41.257 0.02 30.93 ? 20  ASN A HB3  1  
ATOM   285    H HD21 . ASN A 1 27  ? -15.211 0.859   -41.964 0.02 30.35 ? 20  ASN A HD21 1  
ATOM   286    H HD22 . ASN A 1 27  ? -16.666 1.021   -41.690 0.02 29.94 ? 20  ASN A HD22 1  
ATOM   287    N N    . LYS A 1 28  ? -14.454 5.952   -43.572 0.02 31.85 ? 21  LYS A N    1  
ATOM   288    C CA   . LYS A 1 28  ? -15.194 7.045   -44.184 0.02 32.09 ? 21  LYS A CA   1  
ATOM   289    C C    . LYS A 1 28  ? -15.095 6.985   -45.698 0.02 32.43 ? 21  LYS A C    1  
ATOM   290    O O    . LYS A 1 28  ? -16.099 7.201   -46.379 0.02 32.40 ? 21  LYS A O    1  
ATOM   291    C CB   . LYS A 1 28  ? -14.730 8.429   -43.708 0.02 32.49 ? 21  LYS A CB   1  
ATOM   292    C CG   . LYS A 1 28  ? -15.394 9.557   -44.579 0.02 32.85 ? 21  LYS A CG   1  
ATOM   293    C CD   . LYS A 1 28  ? -15.924 10.765  -43.803 0.02 33.00 ? 21  LYS A CD   1  
ATOM   294    C CE   . LYS A 1 28  ? -17.457 10.989  -44.025 0.02 32.79 ? 21  LYS A CE   1  
ATOM   295    N NZ   . LYS A 1 28  ? -17.792 12.061  -45.046 0.02 33.29 ? 21  LYS A NZ   1  
ATOM   296    H H    . LYS A 1 28  ? -13.736 6.167   -43.153 0.02 32.00 ? 21  LYS A H    1  
ATOM   297    H HA   . LYS A 1 28  ? -16.128 6.947   -43.938 0.02 31.79 ? 21  LYS A HA   1  
ATOM   298    H HB2  . LYS A 1 28  ? -15.000 8.555   -42.782 0.02 32.28 ? 21  LYS A HB2  1  
ATOM   299    H HB3  . LYS A 1 28  ? -13.765 8.494   -43.794 0.02 32.79 ? 21  LYS A HB3  1  
ATOM   300    H HG2  . LYS A 1 28  ? -14.731 9.891   -45.205 0.02 33.25 ? 21  LYS A HG2  1  
ATOM   301    H HG3  . LYS A 1 28  ? -16.145 9.191   -45.066 0.02 32.65 ? 21  LYS A HG3  1  
ATOM   302    H HD2  . LYS A 1 28  ? -15.769 10.633  -42.854 0.02 32.82 ? 21  LYS A HD2  1  
ATOM   303    H HD3  . LYS A 1 28  ? -15.458 11.561  -44.105 0.02 33.44 ? 21  LYS A HD3  1  
ATOM   304    H HE2  . LYS A 1 28  ? -17.869 10.163  -44.319 0.02 32.48 ? 21  LYS A HE2  1  
ATOM   305    H HE3  . LYS A 1 28  ? -17.852 11.260  -43.182 0.02 32.65 ? 21  LYS A HE3  1  
ATOM   306    H HZ1  . LYS A 1 28  ? -17.666 12.867  -44.688 0.02 33.54 ? 21  LYS A HZ1  1  
ATOM   307    H HZ2  . LYS A 1 28  ? -17.272 11.978  -45.764 0.02 33.52 ? 21  LYS A HZ2  1  
ATOM   308    H HZ3  . LYS A 1 28  ? -18.643 11.992  -45.297 0.02 33.15 ? 21  LYS A HZ3  1  
ATOM   309    N N    . PHE A 1 29  ? -13.903 6.711   -46.253 0.02 32.80 ? 22  PHE A N    1  
ATOM   310    C CA   . PHE A 1 29  ? -13.753 6.759   -47.710 0.02 33.21 ? 22  PHE A CA   1  
ATOM   311    C C    . PHE A 1 29  ? -14.299 5.494   -48.358 0.02 32.90 ? 22  PHE A C    1  
ATOM   312    O O    . PHE A 1 29  ? -14.608 5.488   -49.557 0.02 33.16 ? 22  PHE A O    1  
ATOM   313    C CB   . PHE A 1 29  ? -12.285 6.967   -48.114 0.02 33.77 ? 22  PHE A CB   1  
ATOM   314    C CG   . PHE A 1 29  ? -11.876 8.423   -48.255 0.02 34.37 ? 22  PHE A CG   1  
ATOM   315    C CD1  . PHE A 1 29  ? -10.802 8.928   -47.536 0.02 34.64 ? 22  PHE A CD1  1  
ATOM   316    C CD2  . PHE A 1 29  ? -12.547 9.274   -49.118 0.02 34.69 ? 22  PHE A CD2  1  
ATOM   317    C CE1  . PHE A 1 29  ? -10.413 10.261  -47.661 0.02 35.24 ? 22  PHE A CE1  1  
ATOM   318    C CE2  . PHE A 1 29  ? -12.161 10.613  -49.245 0.02 35.29 ? 22  PHE A CE2  1  
ATOM   319    C CZ   . PHE A 1 29  ? -11.088 11.097  -48.517 0.02 35.57 ? 22  PHE A CZ   1  
ATOM   320    H H    . PHE A 1 29  ? -13.191 6.495   -45.823 0.02 32.83 ? 22  PHE A H    1  
ATOM   321    H HA   . PHE A 1 29  ? -14.271 7.504   -48.053 0.02 33.39 ? 22  PHE A HA   1  
ATOM   322    H HB2  . PHE A 1 29  ? -11.711 6.560   -47.447 0.02 33.64 ? 22  PHE A HB2  1  
ATOM   323    H HB3  . PHE A 1 29  ? -12.140 6.540   -48.975 0.02 33.92 ? 22  PHE A HB3  1  
ATOM   324    H HD1  . PHE A 1 29  ? -10.341 8.366   -46.955 0.02 34.45 ? 22  PHE A HD1  1  
ATOM   325    H HD2  . PHE A 1 29  ? -13.268 8.955   -49.610 0.02 34.54 ? 22  PHE A HD2  1  
ATOM   326    H HE1  . PHE A 1 29  ? -9.693  10.585  -47.170 0.02 35.45 ? 22  PHE A HE1  1  
ATOM   327    H HE2  . PHE A 1 29  ? -12.619 11.178  -49.825 0.02 35.53 ? 22  PHE A HE2  1  
ATOM   328    H HZ   . PHE A 1 29  ? -10.827 11.985  -48.599 0.02 35.99 ? 22  PHE A HZ   1  
ATOM   329    N N    . LEU A 1 30  ? -14.430 4.414   -47.587 0.02 32.38 ? 23  LEU A N    1  
ATOM   330    C CA   . LEU A 1 30  ? -14.970 3.183   -48.145 0.02 32.11 ? 23  LEU A CA   1  
ATOM   331    C C    . LEU A 1 30  ? -16.484 3.113   -47.969 0.02 31.71 ? 23  LEU A C    1  
ATOM   332    O O    . LEU A 1 30  ? -17.196 2.634   -48.864 0.02 31.71 ? 23  LEU A O    1  
ATOM   333    C CB   . LEU A 1 30  ? -14.272 1.990   -47.507 0.02 31.86 ? 23  LEU A CB   1  
ATOM   334    C CG   . LEU A 1 30  ? -14.722 0.617   -48.005 0.02 31.61 ? 23  LEU A CG   1  
ATOM   335    C CD1  . LEU A 1 30  ? -14.424 0.434   -49.510 0.02 32.05 ? 23  LEU A CD1  1  
ATOM   336    C CD2  . LEU A 1 30  ? -14.089 -0.480  -47.141 0.02 31.36 ? 23  LEU A CD2  1  
ATOM   337    H H    . LEU A 1 30  ? -14.218 4.368   -46.756 0.02 32.19 ? 23  LEU A H    1  
ATOM   338    H HA   . LEU A 1 30  ? -14.786 3.163   -49.096 0.02 32.41 ? 23  LEU A HA   1  
ATOM   339    H HB2  . LEU A 1 30  ? -13.321 2.066   -47.679 0.02 32.16 ? 23  LEU A HB2  1  
ATOM   340    H HB3  . LEU A 1 30  ? -14.432 2.019   -46.551 0.02 31.59 ? 23  LEU A HB3  1  
ATOM   341    H HG   . LEU A 1 30  ? -15.674 0.560   -47.889 0.02 31.35 ? 23  LEU A HG   1  
ATOM   342    H HD11 . LEU A 1 30  ? -15.211 0.078   -49.947 0.02 31.93 ? 23  LEU A HD11 1  
ATOM   343    H HD12 . LEU A 1 30  ? -14.189 1.288   -49.897 0.02 32.38 ? 23  LEU A HD12 1  
ATOM   344    H HD13 . LEU A 1 30  ? -13.681 -0.180  -49.613 0.02 32.15 ? 23  LEU A HD13 1  
ATOM   345    H HD21 . LEU A 1 30  ? -14.169 -0.225  -46.209 0.02 31.14 ? 23  LEU A HD21 1  
ATOM   346    H HD22 . LEU A 1 30  ? -14.552 -1.317  -47.293 0.02 31.17 ? 23  LEU A HD22 1  
ATOM   347    H HD23 . LEU A 1 30  ? -13.153 -0.567  -47.374 0.02 31.64 ? 23  LEU A HD23 1  
ATOM   348    N N    . ASN A 1 31  ? -16.996 3.606   -46.834 0.02 31.41 ? 24  ASN A N    1  
ATOM   349    C CA   . ASN A 1 31  ? -18.437 3.641   -46.615 0.02 31.12 ? 24  ASN A CA   1  
ATOM   350    C C    . ASN A 1 31  ? -19.136 4.451   -47.700 0.02 31.48 ? 24  ASN A C    1  
ATOM   351    O O    . ASN A 1 31  ? -20.132 4.006   -48.265 0.02 31.39 ? 24  ASN A O    1  
ATOM   352    C CB   . ASN A 1 31  ? -18.747 4.216   -45.226 0.02 30.87 ? 24  ASN A CB   1  
ATOM   353    C CG   . ASN A 1 31  ? -20.211 4.100   -44.852 0.02 30.52 ? 24  ASN A CG   1  
ATOM   354    O OD1  . ASN A 1 31  ? -20.681 3.022   -44.486 0.02 30.16 ? 24  ASN A OD1  1  
ATOM   355    N ND2  . ASN A 1 31  ? -20.942 5.221   -44.928 0.02 30.67 ? 24  ASN A ND2  1  
ATOM   356    H H    . ASN A 1 31  ? -16.532 3.933   -46.192 0.02 31.40 ? 24  ASN A H    1  
ATOM   357    H HA   . ASN A 1 31  ? -18.781 2.736   -46.641 0.02 30.87 ? 24  ASN A HA   1  
ATOM   358    H HB2  . ASN A 1 31  ? -18.231 3.739   -44.560 0.02 30.71 ? 24  ASN A HB2  1  
ATOM   359    H HB3  . ASN A 1 31  ? -18.515 5.157   -45.219 0.02 31.13 ? 24  ASN A HB3  1  
ATOM   360    H HD21 . ASN A 1 31  ? -21.797 5.189   -44.830 0.02 30.51 ? 24  ASN A HD21 1  
ATOM   361    H HD22 . ASN A 1 31  ? -20.557 5.977   -45.069 0.02 30.93 ? 24  ASN A HD22 1  
ATOM   362    N N    . TYR A 1 32  ? -18.644 5.662   -47.986 0.02 31.92 ? 25  TYR A N    1  
ATOM   363    C CA   . TYR A 1 32  ? -19.204 6.450   -49.089 0.02 32.33 ? 25  TYR A CA   1  
ATOM   364    C C    . TYR A 1 32  ? -19.116 5.692   -50.410 0.02 32.54 ? 25  TYR A C    1  
ATOM   365    O O    . TYR A 1 32  ? -20.093 5.617   -51.161 0.02 32.60 ? 25  TYR A O    1  
ATOM   366    C CB   . TYR A 1 32  ? -18.468 7.789   -49.208 0.02 32.86 ? 25  TYR A CB   1  
ATOM   367    C CG   . TYR A 1 32  ? -18.863 8.615   -50.427 0.02 33.34 ? 25  TYR A CG   1  
ATOM   368    C CD1  . TYR A 1 32  ? -19.994 9.428   -50.407 0.02 33.34 ? 25  TYR A CD1  1  
ATOM   369    C CD2  . TYR A 1 32  ? -18.095 8.588   -51.591 0.02 33.84 ? 25  TYR A CD2  1  
ATOM   370    C CE1  . TYR A 1 32  ? -20.349 10.189  -51.505 0.02 33.81 ? 25  TYR A CE1  1  
ATOM   371    C CE2  . TYR A 1 32  ? -18.448 9.338   -52.705 0.02 34.32 ? 25  TYR A CE2  1  
ATOM   372    C CZ   . TYR A 1 32  ? -19.571 10.142  -52.658 0.02 34.30 ? 25  TYR A CZ   1  
ATOM   373    O OH   . TYR A 1 32  ? -19.918 10.883  -53.762 0.02 34.82 ? 25  TYR A OH   1  
ATOM   374    H H    . TYR A 1 32  ? -17.998 6.038   -47.565 0.02 32.01 ? 25  TYR A H    1  
ATOM   375    H HA   . TYR A 1 32  ? -20.139 6.638   -48.909 0.02 32.19 ? 25  TYR A HA   1  
ATOM   376    H HB2  . TYR A 1 32  ? -18.651 8.313   -48.414 0.02 32.75 ? 25  TYR A HB2  1  
ATOM   377    H HB3  . TYR A 1 32  ? -17.516 7.614   -49.270 0.02 33.02 ? 25  TYR A HB3  1  
ATOM   378    H HD1  . TYR A 1 32  ? -20.517 9.466   -49.638 0.02 33.04 ? 25  TYR A HD1  1  
ATOM   379    H HD2  . TYR A 1 32  ? -17.337 8.050   -51.624 0.02 33.87 ? 25  TYR A HD2  1  
ATOM   380    H HE1  . TYR A 1 32  ? -21.109 10.725  -51.474 0.02 33.83 ? 25  TYR A HE1  1  
ATOM   381    H HE2  . TYR A 1 32  ? -17.926 9.309   -53.473 0.02 34.67 ? 25  TYR A HE2  1  
ATOM   382    H HH   . TYR A 1 32  ? -19.533 10.576  -54.442 0.02 35.07 ? 25  TYR A HH   1  
ATOM   383    N N    . ARG A 1 33  ? -17.937 5.141   -50.704 0.02 32.69 ? 26  ARG A N    1  
ATOM   384    C CA   . ARG A 1 33  ? -17.688 4.448   -51.964 0.02 32.95 ? 26  ARG A CA   1  
ATOM   385    C C    . ARG A 1 33  ? -18.604 3.239   -52.126 0.02 32.56 ? 26  ARG A C    1  
ATOM   386    O O    . ARG A 1 33  ? -18.990 2.883   -53.257 0.02 32.77 ? 26  ARG A O    1  
ATOM   387    C CB   . ARG A 1 33  ? -16.215 4.015   -52.023 0.02 33.16 ? 26  ARG A CB   1  
ATOM   388    C CG   . ARG A 1 33  ? -15.259 4.981   -52.734 0.02 33.84 ? 26  ARG A CG   1  
ATOM   389    C CD   . ARG A 1 33  ? -13.885 4.350   -53.090 0.02 34.10 ? 26  ARG A CD   1  
ATOM   390    N NE   . ARG A 1 33  ? -13.788 2.902   -52.836 0.02 33.66 ? 26  ARG A NE   1  
ATOM   391    C CZ   . ARG A 1 33  ? -13.813 1.935   -53.761 0.02 33.72 ? 26  ARG A CZ   1  
ATOM   392    N NH1  . ARG A 1 33  ? -13.947 2.200   -55.058 0.02 34.22 ? 26  ARG A NH1  1  
ATOM   393    N NH2  . ARG A 1 33  ? -13.706 0.665   -53.373 0.02 33.31 ? 26  ARG A NH2  1  
ATOM   394    H H    . ARG A 1 33  ? -17.259 5.146   -50.179 0.02 32.67 ? 26  ARG A H    1  
ATOM   395    H HA   . ARG A 1 33  ? -17.858 5.051   -52.702 0.02 33.30 ? 26  ARG A HA   1  
ATOM   396    H HB2  . ARG A 1 33  ? -15.892 3.907   -51.118 0.02 32.93 ? 26  ARG A HB2  1  
ATOM   397    H HB3  . ARG A 1 33  ? -16.174 3.166   -52.485 0.02 33.11 ? 26  ARG A HB3  1  
ATOM   398    H HG2  . ARG A 1 33  ? -15.668 5.291   -53.556 0.02 34.10 ? 26  ARG A HG2  1  
ATOM   399    H HG3  . ARG A 1 33  ? -15.094 5.732   -52.142 0.02 33.90 ? 26  ARG A HG3  1  
ATOM   400    H HD2  . ARG A 1 33  ? -13.707 4.505   -54.030 0.02 34.49 ? 26  ARG A HD2  1  
ATOM   401    H HD3  . ARG A 1 33  ? -13.202 4.787   -52.556 0.02 34.22 ? 26  ARG A HD3  1  
ATOM   402    H HE   . ARG A 1 33  ? -13.895 2.652   -52.019 0.02 33.31 ? 26  ARG A HE   1  
ATOM   403    H HH11 . ARG A 1 33  ? -14.014 3.011   -55.332 0.02 34.51 ? 26  ARG A HH11 1  
ATOM   404    H HH12 . ARG A 1 33  ? -13.959 1.555   -55.626 0.02 34.27 ? 26  ARG A HH12 1  
ATOM   405    H HH21 . ARG A 1 33  ? -13.623 0.480   -52.537 0.02 33.01 ? 26  ARG A HH21 1  
ATOM   406    H HH22 . ARG A 1 33  ? -13.725 0.030   -53.953 0.02 33.37 ? 26  ARG A HH22 1  
ATOM   407    N N    . LEU A 1 34  ? -18.935 2.571   -51.018 0.02 32.02 ? 27  LEU A N    1  
ATOM   408    C CA   . LEU A 1 34  ? -19.777 1.381   -51.069 0.02 31.66 ? 27  LEU A CA   1  
ATOM   409    C C    . LEU A 1 34  ? -21.247 1.727   -50.965 0.02 31.50 ? 27  LEU A C    1  
ATOM   410    O O    . LEU A 1 34  ? -22.086 0.821   -50.895 0.02 31.22 ? 27  LEU A O    1  
ATOM   411    C CB   . LEU A 1 34  ? -19.446 0.375   -49.954 0.02 31.20 ? 27  LEU A CB   1  
ATOM   412    C CG   . LEU A 1 34  ? -18.060 -0.103  -49.509 0.02 31.22 ? 27  LEU A CG   1  
ATOM   413    C CD1  . LEU A 1 34  ? -18.065 -0.086  -47.974 0.02 30.81 ? 27  LEU A CD1  1  
ATOM   414    C CD2  . LEU A 1 34  ? -17.660 -1.487  -49.967 0.02 31.20 ? 27  LEU A CD2  1  
ATOM   415    H H    . LEU A 1 34  ? -18.684 2.793   -50.228 0.02 31.88 ? 27  LEU A H    1  
ATOM   416    H HA   . LEU A 1 34  ? -19.639 0.933   -51.920 0.02 31.86 ? 27  LEU A HA   1  
ATOM   417    H HB2  . LEU A 1 34  ? -19.850 0.744   -49.153 0.02 31.00 ? 27  LEU A HB2  1  
ATOM   418    H HB3  . LEU A 1 34  ? -19.928 -0.436  -50.179 0.02 31.04 ? 27  LEU A HB3  1  
ATOM   419    H HG   . LEU A 1 34  ? -17.392 0.523   -49.827 0.02 31.54 ? 27  LEU A HG   1  
ATOM   420    H HD11 . LEU A 1 34  ? -17.376 -0.694  -47.661 0.02 30.79 ? 27  LEU A HD11 1  
ATOM   421    H HD12 . LEU A 1 34  ? -17.891 0.812   -47.658 0.02 30.88 ? 27  LEU A HD12 1  
ATOM   422    H HD13 . LEU A 1 34  ? -18.926 -0.386  -47.648 0.02 30.52 ? 27  LEU A HD13 1  
ATOM   423    H HD21 . LEU A 1 34  ? -16.747 -1.654  -49.687 0.02 31.32 ? 27  LEU A HD21 1  
ATOM   424    H HD22 . LEU A 1 34  ? -18.254 -2.138  -49.558 0.02 30.87 ? 27  LEU A HD22 1  
ATOM   425    H HD23 . LEU A 1 34  ? -17.724 -1.528  -50.936 0.02 31.42 ? 27  LEU A HD23 1  
ATOM   426    N N    . THR A 1 35  ? -21.579 3.006   -50.902 0.02 31.70 ? 28  THR A N    1  
ATOM   427    C CA   . THR A 1 35  ? -22.969 3.404   -50.922 0.02 31.64 ? 28  THR A CA   1  
ATOM   428    C C    . THR A 1 35  ? -23.452 3.439   -52.368 0.02 32.04 ? 28  THR A C    1  
ATOM   429    O O    . THR A 1 35  ? -22.685 3.735   -53.281 0.02 32.47 ? 28  THR A O    1  
ATOM   430    C CB   . THR A 1 35  ? -23.149 4.775   -50.275 0.02 31.73 ? 28  THR A CB   1  
ATOM   431    O OG1  . THR A 1 35  ? -22.485 4.803   -48.996 0.02 31.45 ? 28  THR A OG1  1  
ATOM   432    C CG2  . THR A 1 35  ? -24.622 5.076   -50.093 0.02 31.63 ? 28  THR A CG2  1  
ATOM   433    H H    . THR A 1 35  ? -21.021 3.655   -50.851 0.02 31.90 ? 28  THR A H    1  
ATOM   434    H HA   . THR A 1 35  ? -23.500 2.761   -50.432 0.02 31.31 ? 28  THR A HA   1  
ATOM   435    H HB   . THR A 1 35  ? -22.764 5.453   -50.851 0.02 32.10 ? 28  THR A HB   1  
ATOM   436    H HG1  . THR A 1 35  ? -21.650 4.788   -49.097 0.02 31.58 ? 28  THR A HG1  1  
ATOM   437    H HG21 . THR A 1 35  ? -24.800 5.287   -49.163 0.02 31.45 ? 28  THR A HG21 1  
ATOM   438    H HG22 . THR A 1 35  ? -24.882 5.832   -50.641 0.02 31.95 ? 28  THR A HG22 1  
ATOM   439    H HG23 . THR A 1 35  ? -25.152 4.306   -50.346 0.02 31.44 ? 28  THR A HG23 1  
ATOM   440    N N    . THR A 1 36  ? -24.721 3.103   -52.558 0.02 31.92 ? 29  THR A N    1  
ATOM   441    C CA   . THR A 1 36  ? -25.384 3.129   -53.853 0.02 32.30 ? 29  THR A CA   1  
ATOM   442    C C    . THR A 1 36  ? -26.460 4.209   -53.841 0.02 32.47 ? 29  THR A C    1  
ATOM   443    O O    . THR A 1 36  ? -26.718 4.843   -52.815 0.02 32.28 ? 29  THR A O    1  
ATOM   444    C CB   . THR A 1 36  ? -26.006 1.761   -54.199 0.02 32.12 ? 29  THR A CB   1  
ATOM   445    O OG1  . THR A 1 36  ? -27.227 1.553   -53.480 0.02 31.80 ? 29  THR A OG1  1  
ATOM   446    C CG2  . THR A 1 36  ? -25.051 0.636   -53.880 0.02 31.86 ? 29  THR A CG2  1  
ATOM   447    H H    . THR A 1 36  ? -25.239 2.845   -51.922 0.02 31.64 ? 29  THR A H    1  
ATOM   448    H HA   . THR A 1 36  ? -24.736 3.347   -54.530 0.02 32.62 ? 29  THR A HA   1  
ATOM   449    H HB   . THR A 1 36  ? -26.191 1.740   -55.151 0.02 32.43 ? 29  THR A HB   1  
ATOM   450    H HG1  . THR A 1 36  ? -27.407 2.206   -52.991 0.02 31.75 ? 29  THR A HG1  1  
ATOM   451    H HG21 . THR A 1 36  ? -25.319 -0.178  -54.335 0.02 31.87 ? 29  THR A HG21 1  
ATOM   452    H HG22 . THR A 1 36  ? -24.157 0.879   -54.169 0.02 32.06 ? 29  THR A HG22 1  
ATOM   453    H HG23 . THR A 1 36  ? -25.039 0.477   -52.922 0.02 31.53 ? 29  THR A HG23 1  
ATOM   454    N N    . ASN A 1 37  ? -27.097 4.410   -55.000 0.02 32.87 ? 30  ASN A N    1  
ATOM   455    C CA   . ASN A 1 37  ? -28.234 5.314   -55.143 0.02 33.10 ? 30  ASN A CA   1  
ATOM   456    C C    . ASN A 1 37  ? -29.571 4.611   -54.943 0.02 32.87 ? 30  ASN A C    1  
ATOM   457    O O    . ASN A 1 37  ? -30.623 5.252   -55.057 0.02 33.07 ? 30  ASN A O    1  
ATOM   458    C CB   . ASN A 1 37  ? -28.238 5.975   -56.544 0.02 33.75 ? 30  ASN A CB   1  
ATOM   459    C CG   . ASN A 1 37  ? -26.976 6.794   -56.831 0.02 34.09 ? 30  ASN A CG   1  
ATOM   460    O OD1  . ASN A 1 37  ? -26.254 7.221   -55.915 0.02 33.90 ? 30  ASN A OD1  1  
ATOM   461    N ND2  . ASN A 1 37  ? -26.736 7.059   -58.107 0.02 34.65 ? 30  ASN A ND2  1  
ATOM   462    H H    . ASN A 1 37  ? -26.876 4.026   -55.731 0.02 33.04 ? 30  ASN A H    1  
ATOM   463    H HA   . ASN A 1 37  ? -28.165 6.016   -54.477 0.02 33.04 ? 30  ASN A HA   1  
ATOM   464    H HB2  . ASN A 1 37  ? -28.293 5.280   -57.218 0.02 33.83 ? 30  ASN A HB2  1  
ATOM   465    H HB3  . ASN A 1 37  ? -29.008 6.559   -56.623 0.02 33.91 ? 30  ASN A HB3  1  
ATOM   466    H HD21 . ASN A 1 37  ? -25.959 7.333   -58.351 0.02 34.85 ? 30  ASN A HD21 1  
ATOM   467    H HD22 . ASN A 1 37  ? -27.359 6.955   -58.691 0.02 34.82 ? 30  ASN A HD22 1  
ATOM   468    N N    . GLU A 1 38  ? -29.560 3.313   -54.661 0.02 32.50 ? 31  GLU A N    1  
ATOM   469    C CA   . GLU A 1 38  ? -30.790 2.523   -54.614 0.02 32.36 ? 31  GLU A CA   1  
ATOM   470    C C    . GLU A 1 38  ? -31.384 2.647   -53.206 0.02 31.95 ? 31  GLU A C    1  
ATOM   471    O O    . GLU A 1 38  ? -31.021 1.928   -52.277 0.02 31.52 ? 31  GLU A O    1  
ATOM   472    C CB   . GLU A 1 38  ? -30.510 1.074   -55.023 0.02 32.24 ? 31  GLU A CB   1  
ATOM   473    C CG   . GLU A 1 38  ? -31.745 0.170   -55.018 0.02 32.16 ? 31  GLU A CG   1  
ATOM   474    C CD   . GLU A 1 38  ? -31.618 -1.131  -55.847 0.02 32.20 ? 31  GLU A CD   1  
ATOM   475    O OE1  . GLU A 1 38  ? -32.661 -1.798  -56.020 0.02 32.30 ? 31  GLU A OE1  1  
ATOM   476    O OE2  . GLU A 1 38  ? -30.515 -1.492  -56.313 0.02 32.18 ? 31  GLU A OE2  1  
ATOM   477    H H    . GLU A 1 38  ? -28.848 2.862   -54.497 0.02 32.36 ? 31  GLU A H    1  
ATOM   478    H HA   . GLU A 1 38  ? -31.431 2.893   -55.240 0.02 32.66 ? 31  GLU A HA   1  
ATOM   479    H HB2  . GLU A 1 38  ? -30.139 1.069   -55.917 0.02 32.53 ? 31  GLU A HB2  1  
ATOM   480    H HB3  . GLU A 1 38  ? -29.868 0.693   -54.406 0.02 31.95 ? 31  GLU A HB3  1  
ATOM   481    H HG2  . GLU A 1 38  ? -31.927 -0.089  -54.101 0.02 31.85 ? 31  GLU A HG2  1  
ATOM   482    H HG3  . GLU A 1 38  ? -32.496 0.673   -55.372 0.02 32.43 ? 31  GLU A HG3  1  
ATOM   483    N N    . THR A 1 39  ? -32.313 3.585   -53.058 0.02 32.13 ? 32  THR A N    1  
ATOM   484    C CA   . THR A 1 39  ? -33.077 3.740   -51.834 0.02 31.83 ? 32  THR A CA   1  
ATOM   485    C C    . THR A 1 39  ? -34.377 2.952   -51.953 0.02 31.82 ? 32  THR A C    1  
ATOM   486    O O    . THR A 1 39  ? -34.892 2.731   -53.052 0.02 32.16 ? 32  THR A O    1  
ATOM   487    C CB   . THR A 1 39  ? -33.365 5.224   -51.591 0.02 32.09 ? 32  THR A CB   1  
ATOM   488    O OG1  . THR A 1 39  ? -34.001 5.778   -52.755 0.02 32.61 ? 32  THR A OG1  1  
ATOM   489    C CG2  . THR A 1 39  ? -32.076 5.976   -51.321 0.02 32.10 ? 32  THR A CG2  1  
ATOM   490    H H    . THR A 1 39  ? -32.528 4.149   -53.665 0.02 32.44 ? 32  THR A H    1  
ATOM   491    H HA   . THR A 1 39  ? -32.573 3.397   -51.083 0.02 31.51 ? 32  THR A HA   1  
ATOM   492    H HB   . THR A 1 39  ? -33.950 5.325   -50.825 0.02 31.93 ? 32  THR A HB   1  
ATOM   493    H HG1  . THR A 1 39  ? -34.664 5.310   -52.976 0.02 32.63 ? 32  THR A HG1  1  
ATOM   494    H HG21 . THR A 1 39  ? -31.497 5.447   -50.752 0.02 31.80 ? 32  THR A HG21 1  
ATOM   495    H HG22 . THR A 1 39  ? -31.615 6.157   -52.153 0.02 32.38 ? 32  THR A HG22 1  
ATOM   496    H HG23 . THR A 1 39  ? -32.268 6.818   -50.882 0.02 32.18 ? 32  THR A HG23 1  
ATOM   497    N N    . VAL A 1 40  ? -34.893 2.497   -50.814 0.02 31.46 ? 33  VAL A N    1  
ATOM   498    C CA   . VAL A 1 40  ? -36.202 1.858   -50.764 0.02 31.49 ? 33  VAL A CA   1  
ATOM   499    C C    . VAL A 1 40  ? -36.892 2.281   -49.478 0.02 31.32 ? 33  VAL A C    1  
ATOM   500    O O    . VAL A 1 40  ? -36.255 2.737   -48.529 0.02 31.08 ? 33  VAL A O    1  
ATOM   501    C CB   . VAL A 1 40  ? -36.136 0.310   -50.821 0.02 31.26 ? 33  VAL A CB   1  
ATOM   502    C CG1  . VAL A 1 40  ? -35.773 -0.197  -52.217 0.02 31.51 ? 33  VAL A CG1  1  
ATOM   503    C CG2  . VAL A 1 40  ? -35.159 -0.208  -49.774 0.02 30.77 ? 33  VAL A CG2  1  
ATOM   504    H H    . VAL A 1 40  ? -34.499 2.548   -50.056 0.02 31.22 ? 33  VAL A H    1  
ATOM   505    H HA   . VAL A 1 40  ? -36.738 2.161   -51.511 0.02 31.82 ? 33  VAL A HA   1  
ATOM   506    H HB   . VAL A 1 40  ? -37.015 -0.042  -50.610 0.02 31.29 ? 33  VAL A HB   1  
ATOM   507    H HG11 . VAL A 1 40  ? -35.706 -1.165  -52.194 0.02 31.41 ? 33  VAL A HG11 1  
ATOM   508    H HG12 . VAL A 1 40  ? -36.470 0.066   -52.840 0.02 31.85 ? 33  VAL A HG12 1  
ATOM   509    H HG13 . VAL A 1 40  ? -34.923 0.189   -52.487 0.02 31.48 ? 33  VAL A HG13 1  
ATOM   510    H HG21 . VAL A 1 40  ? -34.376 0.363   -49.739 0.02 30.75 ? 33  VAL A HG21 1  
ATOM   511    H HG22 . VAL A 1 40  ? -35.601 -0.218  -48.908 0.02 30.62 ? 33  VAL A HG22 1  
ATOM   512    H HG23 . VAL A 1 40  ? -34.898 -1.108  -50.026 0.02 30.67 ? 33  VAL A HG23 1  
ATOM   513    N N    . VAL A 1 41  ? -38.199 2.064   -49.429 0.02 31.45 ? 34  VAL A N    1  
ATOM   514    C CA   . VAL A 1 41  ? -39.005 2.400   -48.269 0.02 31.35 ? 34  VAL A CA   1  
ATOM   515    C C    . VAL A 1 41  ? -39.700 1.145   -47.781 0.02 31.17 ? 34  VAL A C    1  
ATOM   516    O O    . VAL A 1 41  ? -40.255 0.389   -48.587 0.02 31.37 ? 34  VAL A O    1  
ATOM   517    C CB   . VAL A 1 41  ? -40.026 3.500   -48.600 0.02 31.82 ? 34  VAL A CB   1  
ATOM   518    C CG1  . VAL A 1 41  ? -40.765 3.948   -47.342 0.02 31.75 ? 34  VAL A CG1  1  
ATOM   519    C CG2  . VAL A 1 41  ? -39.318 4.633   -49.217 0.02 32.06 ? 34  VAL A CG2  1  
ATOM   520    H H    . VAL A 1 41  ? -38.653 1.716   -50.067 0.02 31.63 ? 34  VAL A H    1  
ATOM   521    H HA   . VAL A 1 41  ? -38.423 2.720   -47.570 0.02 31.14 ? 34  VAL A HA   1  
ATOM   522    H HB   . VAL A 1 41  ? -40.677 3.166   -49.238 0.02 32.04 ? 34  VAL A HB   1  
ATOM   523    H HG11 . VAL A 1 41  ? -41.459 4.574   -47.597 0.02 32.07 ? 34  VAL A HG11 1  
ATOM   524    H HG12 . VAL A 1 41  ? -41.163 3.178   -46.903 0.02 31.61 ? 34  VAL A HG12 1  
ATOM   525    H HG13 . VAL A 1 41  ? -40.132 4.381   -46.746 0.02 31.55 ? 34  VAL A HG13 1  
ATOM   526    H HG21 . VAL A 1 41  ? -39.942 5.365   -49.341 0.02 32.36 ? 34  VAL A HG21 1  
ATOM   527    H HG22 . VAL A 1 41  ? -38.598 4.905   -48.630 0.02 31.85 ? 34  VAL A HG22 1  
ATOM   528    H HG23 . VAL A 1 41  ? -38.958 4.345   -50.068 0.02 32.15 ? 34  VAL A HG23 1  
ATOM   529    N N    . ALA A 1 42  ? -39.653 0.919   -46.463 0.02 30.82 ? 35  ALA A N    1  
ATOM   530    C CA   . ALA A 1 42  ? -40.381 -0.163  -45.833 0.02 30.68 ? 35  ALA A CA   1  
ATOM   531    C C    . ALA A 1 42  ? -41.382 0.376   -44.812 0.02 30.76 ? 35  ALA A C    1  
ATOM   532    O O    . ALA A 1 42  ? -41.169 1.422   -44.200 0.02 30.75 ? 35  ALA A O    1  
ATOM   533    C CB   . ALA A 1 42  ? -39.416 -1.150  -45.153 0.02 30.23 ? 35  ALA A CB   1  
ATOM   534    H H    . ALA A 1 42  ? -39.192 1.390   -45.914 0.02 30.69 ? 35  ALA A H    1  
ATOM   535    H HA   . ALA A 1 42  ? -40.860 -0.632  -46.521 0.02 30.86 ? 35  ALA A HA   1  
ATOM   536    H HB1  . ALA A 1 42  ? -39.926 -1.912  -44.836 0.02 30.18 ? 35  ALA A HB1  1  
ATOM   537    H HB2  . ALA A 1 42  ? -38.751 -1.435  -45.797 0.02 30.20 ? 35  ALA A HB2  1  
ATOM   538    H HB3  . ALA A 1 42  ? -38.979 -0.712  -44.407 0.02 30.05 ? 35  ALA A HB3  1  
ATOM   539    N N    . GLU A 1 43  ? -42.496 -0.337  -44.668 0.02 30.90 ? 36  GLU A N    1  
ATOM   540    C CA   . GLU A 1 43  ? -43.433 -0.112  -43.573 0.02 30.96 ? 36  GLU A CA   1  
ATOM   541    C C    . GLU A 1 43  ? -42.718 -0.368  -42.251 0.02 30.52 ? 36  GLU A C    1  
ATOM   542    O O    . GLU A 1 43  ? -41.952 -1.327  -42.130 0.02 30.21 ? 36  GLU A O    1  
ATOM   543    C CB   . GLU A 1 43  ? -44.636 -1.070  -43.683 0.02 31.20 ? 36  GLU A CB   1  
ATOM   544    C CG   . GLU A 1 43  ? -46.099 -0.518  -43.849 0.02 31.75 ? 36  GLU A CG   1  
ATOM   545    C CD   . GLU A 1 43  ? -46.263 1.016   -43.761 0.02 31.95 ? 36  GLU A CD   1  
ATOM   546    O OE1  . GLU A 1 43  ? -46.858 1.506   -42.758 0.02 32.01 ? 36  GLU A OE1  1  
ATOM   547    O OE2  . GLU A 1 43  ? -45.828 1.718   -44.704 0.02 32.10 ? 36  GLU A OE2  1  
ATOM   548    H H    . GLU A 1 43  ? -42.734 -0.964  -45.206 0.02 30.98 ? 36  GLU A H    1  
ATOM   549    H HA   . GLU A 1 43  ? -43.739 0.803   -43.588 0.02 31.15 ? 36  GLU A HA   1  
ATOM   550    H HB2  . GLU A 1 43  ? -44.479 -1.656  -44.437 0.02 31.19 ? 36  GLU A HB2  1  
ATOM   551    H HB3  . GLU A 1 43  ? -44.639 -1.608  -42.875 0.02 31.05 ? 36  GLU A HB3  1  
ATOM   552    H HG2  . GLU A 1 43  ? -46.420 -0.791  -44.722 0.02 31.95 ? 36  GLU A HG2  1  
ATOM   553    H HG3  . GLU A 1 43  ? -46.663 -0.913  -43.169 0.02 31.82 ? 36  GLU A HG3  1  
ATOM   554    N N    . THR A 1 44  ? -42.930 0.513   -41.273 0.02 30.53 ? 37  THR A N    1  
ATOM   555    C CA   . THR A 1 44  ? -42.827 0.125   -39.866 0.02 30.26 ? 37  THR A CA   1  
ATOM   556    C C    . THR A 1 44  ? -44.069 0.614   -39.141 0.02 30.56 ? 37  THR A C    1  
ATOM   557    O O    . THR A 1 44  ? -44.780 1.498   -39.618 0.02 30.92 ? 37  THR A O    1  
ATOM   558    C CB   . THR A 1 44  ? -41.603 0.682   -39.109 0.02 29.94 ? 37  THR A CB   1  
ATOM   559    O OG1  . THR A 1 44  ? -41.909 1.978   -38.579 0.02 30.13 ? 37  THR A OG1  1  
ATOM   560    C CG2  . THR A 1 44  ? -40.395 0.754   -39.939 0.02 29.78 ? 37  THR A CG2  1  
ATOM   561    H H    . THR A 1 44  ? -43.124 1.340   -41.401 0.02 30.72 ? 37  THR A H    1  
ATOM   562    H HA   . THR A 1 44  ? -42.805 -0.839  -39.802 0.02 30.14 ? 37  THR A HA   1  
ATOM   563    H HB   . THR A 1 44  ? -41.406 0.088   -38.369 0.02 29.73 ? 37  THR A HB   1  
ATOM   564    H HG1  . THR A 1 44  ? -41.260 2.269   -38.133 0.02 29.97 ? 37  THR A HG1  1  
ATOM   565    H HG21 . THR A 1 44  ? -39.626 0.952   -39.385 0.02 29.57 ? 37  THR A HG21 1  
ATOM   566    H HG22 . THR A 1 44  ? -40.248 -0.096  -40.385 0.02 29.70 ? 37  THR A HG22 1  
ATOM   567    H HG23 . THR A 1 44  ? -40.495 1.452   -40.605 0.02 29.99 ? 37  THR A HG23 1  
ATOM   568    N N    . GLU A 1 45  ? -44.296 0.062   -37.948 0.02 30.42 ? 38  GLU A N    1  
ATOM   569    C CA   . GLU A 1 45  ? -45.480 0.419   -37.181 0.02 30.70 ? 38  GLU A CA   1  
ATOM   570    C C    . GLU A 1 45  ? -45.494 1.900   -36.815 0.02 30.87 ? 38  GLU A C    1  
ATOM   571    O O    . GLU A 1 45  ? -46.577 2.464   -36.625 0.02 31.28 ? 38  GLU A O    1  
ATOM   572    C CB   . GLU A 1 45  ? -45.576 -0.406  -35.898 0.02 30.48 ? 38  GLU A CB   1  
ATOM   573    C CG   . GLU A 1 45  ? -45.303 -1.871  -35.988 0.02 30.31 ? 38  GLU A CG   1  
ATOM   574    C CD   . GLU A 1 45  ? -45.241 -2.484  -34.595 0.02 30.08 ? 38  GLU A CD   1  
ATOM   575    O OE1  . GLU A 1 45  ? -44.408 -2.020  -33.795 0.02 29.86 ? 38  GLU A OE1  1  
ATOM   576    O OE2  . GLU A 1 45  ? -46.063 -3.383  -34.313 0.02 30.15 ? 38  GLU A OE2  1  
ATOM   577    H H    . GLU A 1 45  ? -43.779 -0.505  -37.564 0.02 30.19 ? 38  GLU A H    1  
ATOM   578    H HA   . GLU A 1 45  ? -46.271 0.231   -37.710 0.02 30.97 ? 38  GLU A HA   1  
ATOM   579    H HB2  . GLU A 1 45  ? -44.952 -0.038  -35.253 0.02 30.25 ? 38  GLU A HB2  1  
ATOM   580    H HB3  . GLU A 1 45  ? -46.476 -0.318  -35.550 0.02 30.70 ? 38  GLU A HB3  1  
ATOM   581    H HG2  . GLU A 1 45  ? -46.016 -2.303  -36.486 0.02 30.56 ? 38  GLU A HG2  1  
ATOM   582    H HG3  . GLU A 1 45  ? -44.449 -2.023  -36.423 0.02 30.12 ? 38  GLU A HG3  1  
ATOM   583    N N    . TYR A 1 46  ? -44.322 2.521   -36.687 0.02 30.61 ? 39  TYR A N    1  
ATOM   584    C CA   . TYR A 1 46  ? -44.175 3.935   -36.368 0.02 30.77 ? 39  TYR A CA   1  
ATOM   585    C C    . TYR A 1 46  ? -44.098 4.815   -37.615 0.02 31.01 ? 39  TYR A C    1  
ATOM   586    O O    . TYR A 1 46  ? -43.926 6.030   -37.496 0.02 31.16 ? 39  TYR A O    1  
ATOM   587    C CB   . TYR A 1 46  ? -42.935 4.120   -35.490 0.02 30.41 ? 39  TYR A CB   1  
ATOM   588    C CG   . TYR A 1 46  ? -42.992 3.309   -34.202 0.02 30.20 ? 39  TYR A CG   1  
ATOM   589    C CD1  . TYR A 1 46  ? -42.639 1.958   -34.185 0.02 29.88 ? 39  TYR A CD1  1  
ATOM   590    C CD2  . TYR A 1 46  ? -43.386 3.885   -32.996 0.02 30.36 ? 39  TYR A CD2  1  
ATOM   591    C CE1  . TYR A 1 46  ? -42.694 1.210   -32.997 0.02 29.73 ? 39  TYR A CE1  1  
ATOM   592    C CE2  . TYR A 1 46  ? -43.437 3.149   -31.827 0.02 30.21 ? 39  TYR A CE2  1  
ATOM   593    C CZ   . TYR A 1 46  ? -43.091 1.809   -31.825 0.02 29.90 ? 39  TYR A CZ   1  
ATOM   594    O OH   . TYR A 1 46  ? -43.126 1.071   -30.638 0.02 29.79 ? 39  TYR A OH   1  
ATOM   595    H H    . TYR A 1 46  ? -43.567 2.125   -36.778 0.02 30.35 ? 39  TYR A H    1  
ATOM   596    H HA   . TYR A 1 46  ? -44.949 4.215   -35.860 0.02 31.01 ? 39  TYR A HA   1  
ATOM   597    H HB2  . TYR A 1 46  ? -42.156 3.829   -35.987 0.02 30.20 ? 39  TYR A HB2  1  
ATOM   598    H HB3  . TYR A 1 46  ? -42.843 5.054   -35.252 0.02 30.55 ? 39  TYR A HB3  1  
ATOM   599    H HD1  . TYR A 1 46  ? -42.374 1.547   -34.977 0.02 29.79 ? 39  TYR A HD1  1  
ATOM   600    H HD2  . TYR A 1 46  ? -43.625 4.785   -32.972 0.02 30.60 ? 39  TYR A HD2  1  
ATOM   601    H HE1  . TYR A 1 46  ? -42.455 0.311   -33.002 0.02 29.53 ? 39  TYR A HE1  1  
ATOM   602    H HE2  . TYR A 1 46  ? -43.702 3.562   -31.036 0.02 30.35 ? 39  TYR A HE2  1  
ATOM   603    H HH   . TYR A 1 46  ? -43.479 1.519   -30.025 0.02 29.93 ? 39  TYR A HH   1  
ATOM   604    N N    . GLY A 1 47  ? -44.252 4.238   -38.795 0.02 31.10 ? 40  GLY A N    1  
ATOM   605    C CA   . GLY A 1 47  ? -44.139 4.976   -40.035 0.02 31.36 ? 40  GLY A CA   1  
ATOM   606    C C    . GLY A 1 47  ? -43.095 4.385   -40.972 0.02 31.13 ? 40  GLY A C    1  
ATOM   607    O O    . GLY A 1 47  ? -42.357 3.459   -40.642 0.02 30.74 ? 40  GLY A O    1  
ATOM   608    H H    . GLY A 1 47  ? -44.432 3.407   -38.904 0.02 31.03 ? 40  GLY A H    1  
ATOM   609    H HA2  . GLY A 1 47  ? -44.995 4.972   -40.493 0.02 31.66 ? 40  GLY A HA2  1  
ATOM   610    H HA3  . GLY A 1 47  ? -43.896 5.896   -39.847 0.02 31.44 ? 40  GLY A HA3  1  
ATOM   611    N N    . LYS A 1 48  ? -43.045 4.980   -42.155 0.02 31.41 ? 41  LYS A N    1  
ATOM   612    C CA   . LYS A 1 48  ? -42.203 4.496   -43.240 0.02 31.30 ? 41  LYS A CA   1  
ATOM   613    C C    . LYS A 1 48  ? -40.751 4.897   -43.026 0.02 31.03 ? 41  LYS A C    1  
ATOM   614    O O    . LYS A 1 48  ? -40.462 5.958   -42.488 0.02 31.09 ? 41  LYS A O    1  
ATOM   615    C CB   . LYS A 1 48  ? -42.746 5.027   -44.564 0.02 31.78 ? 41  LYS A CB   1  
ATOM   616    C CG   . LYS A 1 48  ? -44.095 4.408   -44.897 0.02 32.05 ? 41  LYS A CG   1  
ATOM   617    C CD   . LYS A 1 48  ? -44.638 4.839   -46.276 0.02 32.57 ? 41  LYS A CD   1  
ATOM   618    C CE   . LYS A 1 48  ? -45.961 5.565   -46.135 0.02 33.03 ? 41  LYS A CE   1  
ATOM   619    N NZ   . LYS A 1 48  ? -45.868 6.678   -45.148 0.02 33.03 ? 41  LYS A NZ   1  
ATOM   620    H H    . LYS A 1 48  ? -43.501 5.679   -42.351 0.02 31.69 ? 41  LYS A H    1  
ATOM   621    H HA   . LYS A 1 48  ? -42.249 3.530   -43.277 0.02 31.14 ? 41  LYS A HA   1  
ATOM   622    H HB2  . LYS A 1 48  ? -42.865 5.986   -44.495 0.02 32.00 ? 41  LYS A HB2  1  
ATOM   623    H HB3  . LYS A 1 48  ? -42.127 4.822   -45.279 0.02 31.74 ? 41  LYS A HB3  1  
ATOM   624    H HG2  . LYS A 1 48  ? -44.006 3.443   -44.898 0.02 31.85 ? 41  LYS A HG2  1  
ATOM   625    H HG3  . LYS A 1 48  ? -44.734 4.671   -44.219 0.02 32.13 ? 41  LYS A HG3  1  
ATOM   626    H HD2  . LYS A 1 48  ? -44.007 5.436   -46.706 0.02 32.61 ? 41  LYS A HD2  1  
ATOM   627    H HD3  . LYS A 1 48  ? -44.781 4.051   -46.825 0.02 32.60 ? 41  LYS A HD3  1  
ATOM   628    H HE2  . LYS A 1 48  ? -46.211 5.937   -46.997 0.02 33.37 ? 41  LYS A HE2  1  
ATOM   629    H HE3  . LYS A 1 48  ? -46.638 4.939   -45.829 0.02 33.02 ? 41  LYS A HE3  1  
ATOM   630    H HZ1  . LYS A 1 48  ? -46.164 6.400   -44.357 0.02 32.93 ? 41  LYS A HZ1  1  
ATOM   631    H HZ2  . LYS A 1 48  ? -45.020 6.934   -45.067 0.02 32.82 ? 41  LYS A HZ2  1  
ATOM   632    H HZ3  . LYS A 1 48  ? -46.359 7.371   -45.415 0.02 33.38 ? 41  LYS A HZ3  1  
ATOM   633    N N    . VAL A 1 49  ? -39.824 4.023   -43.418 0.02 30.76 ? 42  VAL A N    1  
ATOM   634    C CA   . VAL A 1 49  ? -38.401 4.264   -43.227 0.02 30.51 ? 42  VAL A CA   1  
ATOM   635    C C    . VAL A 1 49  ? -37.682 4.073   -44.548 0.02 30.61 ? 42  VAL A C    1  
ATOM   636    O O    . VAL A 1 49  ? -38.049 3.208   -45.354 0.02 30.68 ? 42  VAL A O    1  
ATOM   637    C CB   . VAL A 1 49  ? -37.783 3.336   -42.158 0.02 30.05 ? 42  VAL A CB   1  
ATOM   638    C CG1  . VAL A 1 49  ? -38.343 3.649   -40.789 0.02 29.98 ? 42  VAL A CG1  1  
ATOM   639    C CG2  . VAL A 1 49  ? -37.997 1.890   -42.549 0.02 29.91 ? 42  VAL A CG2  1  
ATOM   640    H H    . VAL A 1 49  ? -40.000 3.277   -43.809 0.02 30.74 ? 42  VAL A H    1  
ATOM   641    H HA   . VAL A 1 49  ? -38.265 5.182   -42.952 0.02 30.62 ? 42  VAL A HA   1  
ATOM   642    H HB   . VAL A 1 49  ? -36.826 3.493   -42.124 0.02 29.93 ? 42  VAL A HB   1  
ATOM   643    H HG11 . VAL A 1 49  ? -37.711 3.349   -40.120 0.02 29.73 ? 42  VAL A HG11 1  
ATOM   644    H HG12 . VAL A 1 49  ? -38.473 4.607   -40.717 0.02 30.19 ? 42  VAL A HG12 1  
ATOM   645    H HG13 . VAL A 1 49  ? -39.188 3.191   -40.681 0.02 30.00 ? 42  VAL A HG13 1  
ATOM   646    H HG21 . VAL A 1 49  ? -37.535 1.319   -41.920 0.02 29.64 ? 42  VAL A HG21 1  
ATOM   647    H HG22 . VAL A 1 49  ? -38.944 1.687   -42.544 0.02 30.04 ? 42  VAL A HG22 1  
ATOM   648    H HG23 . VAL A 1 49  ? -37.632 1.751   -43.430 0.02 29.99 ? 42  VAL A HG23 1  
ATOM   649    N N    . LYS A 1 50  ? -36.647 4.873   -44.754 0.02 30.66 ? 43  LYS A N    1  
ATOM   650    C CA   . LYS A 1 50  ? -35.874 4.856   -45.991 0.02 30.82 ? 43  LYS A CA   1  
ATOM   651    C C    . LYS A 1 50  ? -34.503 4.268   -45.713 0.02 30.50 ? 43  LYS A C    1  
ATOM   652    O O    . LYS A 1 50  ? -33.754 4.798   -44.885 0.02 30.38 ? 43  LYS A O    1  
ATOM   653    C CB   . LYS A 1 50  ? -35.714 6.254   -46.582 0.02 31.25 ? 43  LYS A CB   1  
ATOM   654    C CG   . LYS A 1 50  ? -34.771 6.308   -47.789 0.02 31.46 ? 43  LYS A CG   1  
ATOM   655    C CD   . LYS A 1 50  ? -34.782 7.668   -48.467 0.02 31.96 ? 43  LYS A CD   1  
ATOM   656    C CE   . LYS A 1 50  ? -33.874 8.741   -47.792 0.02 31.99 ? 43  LYS A CE   1  
ATOM   657    N NZ   . LYS A 1 50  ? -33.707 8.674   -46.317 0.02 31.61 ? 43  LYS A NZ   1  
ATOM   658    H H    . LYS A 1 50  ? -36.364 5.443   -44.178 0.02 30.62 ? 43  LYS A H    1  
ATOM   659    H HA   . LYS A 1 50  ? -36.319 4.295   -46.645 0.02 30.90 ? 43  LYS A HA   1  
ATOM   660    H HB2  . LYS A 1 50  ? -36.583 6.574   -46.865 0.02 31.49 ? 43  LYS A HB2  1  
ATOM   661    H HB3  . LYS A 1 50  ? -35.352 6.837   -45.898 0.02 31.20 ? 43  LYS A HB3  1  
ATOM   662    H HG2  . LYS A 1 50  ? -33.865 6.125   -47.497 0.02 31.26 ? 43  LYS A HG2  1  
ATOM   663    H HG3  . LYS A 1 50  ? -35.052 5.646   -48.441 0.02 31.49 ? 43  LYS A HG3  1  
ATOM   664    H HD2  . LYS A 1 50  ? -34.471 7.561   -49.379 0.02 32.14 ? 43  LYS A HD2  1  
ATOM   665    H HD3  . LYS A 1 50  ? -35.692 8.005   -48.475 0.02 32.13 ? 43  LYS A HD3  1  
ATOM   666    H HE2  . LYS A 1 50  ? -32.990 8.676   -48.177 0.02 32.01 ? 43  LYS A HE2  1  
ATOM   667    H HE3  . LYS A 1 50  ? -34.243 9.616   -47.996 0.02 32.31 ? 43  LYS A HE3  1  
ATOM   668    H HZ1  . LYS A 1 50  ? -33.488 7.848   -46.071 0.02 31.34 ? 43  LYS A HZ1  1  
ATOM   669    H HZ2  . LYS A 1 50  ? -33.065 9.233   -46.058 0.02 31.71 ? 43  LYS A HZ2  1  
ATOM   670    H HZ3  . LYS A 1 50  ? -34.469 8.903   -45.921 0.02 31.58 ? 43  LYS A HZ3  1  
ATOM   671    N N    . GLY A 1 51  ? -34.173 3.188   -46.419 0.02 30.40 ? 44  GLY A N    1  
ATOM   672    C CA   . GLY A 1 51  ? -32.847 2.627   -46.402 0.02 30.19 ? 44  GLY A CA   1  
ATOM   673    C C    . GLY A 1 51  ? -32.162 2.755   -47.750 0.02 30.48 ? 44  GLY A C    1  
ATOM   674    O O    . GLY A 1 51  ? -32.693 3.338   -48.694 0.02 30.86 ? 44  GLY A O    1  
ATOM   675    H H    . GLY A 1 51  ? -34.724 2.753   -46.912 0.02 30.48 ? 44  GLY A H    1  
ATOM   676    H HA2  . GLY A 1 51  ? -32.307 3.090   -45.747 0.02 30.11 ? 44  GLY A HA2  1  
ATOM   677    H HA3  . GLY A 1 51  ? -32.894 1.690   -46.160 0.02 29.97 ? 44  GLY A HA3  1  
ATOM   678    N N    . VAL A 1 52  ? -30.942 2.219   -47.810 0.02 30.34 ? 45  VAL A N    1  
ATOM   679    C CA   . VAL A 1 52  ? -30.131 2.336   -49.015 0.02 30.64 ? 45  VAL A CA   1  
ATOM   680    C C    . VAL A 1 52  ? -29.304 1.073   -49.217 0.02 30.45 ? 45  VAL A C    1  
ATOM   681    O O    . VAL A 1 52  ? -28.705 0.534   -48.291 0.02 30.10 ? 45  VAL A O    1  
ATOM   682    C CB   . VAL A 1 52  ? -29.232 3.594   -48.953 0.02 30.85 ? 45  VAL A CB   1  
ATOM   683    C CG1  . VAL A 1 52  ? -28.239 3.500   -47.844 0.02 30.54 ? 45  VAL A CG1  1  
ATOM   684    C CG2  . VAL A 1 52  ? -28.521 3.832   -50.288 0.02 31.25 ? 45  VAL A CG2  1  
ATOM   685    H H    . VAL A 1 52  ? -30.563 1.795   -47.169 0.02 30.10 ? 45  VAL A H    1  
ATOM   686    H HA   . VAL A 1 52  ? -30.721 2.424   -49.776 0.02 30.88 ? 45  VAL A HA   1  
ATOM   687    H HB   . VAL A 1 52  ? -29.796 4.364   -48.780 0.02 30.98 ? 45  VAL A HB   1  
ATOM   688    H HG11 . VAL A 1 52  ? -27.613 4.235   -47.916 0.02 30.72 ? 45  VAL A HG11 1  
ATOM   689    H HG12 . VAL A 1 52  ? -28.719 3.557   -47.007 0.02 30.36 ? 45  VAL A HG12 1  
ATOM   690    H HG13 . VAL A 1 52  ? -27.755 2.665   -47.896 0.02 30.38 ? 45  VAL A HG13 1  
ATOM   691    H HG21 . VAL A 1 52  ? -28.168 4.733   -50.295 0.02 31.45 ? 45  VAL A HG21 1  
ATOM   692    H HG22 . VAL A 1 52  ? -27.796 3.197   -50.379 0.02 31.15 ? 45  VAL A HG22 1  
ATOM   693    H HG23 . VAL A 1 52  ? -29.160 3.726   -51.007 0.02 31.44 ? 45  VAL A HG23 1  
ATOM   694    N N    . LYS A 1 53  ? -29.252 0.608   -50.454 0.02 30.73 ? 46  LYS A N    1  
ATOM   695    C CA   . LYS A 1 53  ? -28.395 -0.522  -50.754 0.02 30.62 ? 46  LYS A CA   1  
ATOM   696    C C    . LYS A 1 53  ? -26.938 -0.113  -50.632 0.02 30.67 ? 46  LYS A C    1  
ATOM   697    O O    . LYS A 1 53  ? -26.534 0.965   -51.092 0.02 30.99 ? 46  LYS A O    1  
ATOM   698    C CB   . LYS A 1 53  ? -28.661 -1.067  -52.155 0.02 30.95 ? 46  LYS A CB   1  
ATOM   699    C CG   . LYS A 1 53  ? -27.803 -2.306  -52.430 0.02 30.87 ? 46  LYS A CG   1  
ATOM   700    C CD   . LYS A 1 53  ? -28.271 -3.060  -53.651 0.02 31.16 ? 46  LYS A CD   1  
ATOM   701    C CE   . LYS A 1 53  ? -29.526 -3.862  -53.350 0.02 31.00 ? 46  LYS A CE   1  
ATOM   702    N NZ   . LYS A 1 53  ? -30.123 -4.384  -54.620 0.02 31.38 ? 46  LYS A NZ   1  
ATOM   703    H H    . LYS A 1 53  ? -29.691 0.922   -51.119 0.02 30.99 ? 46  LYS A H    1  
ATOM   704    H HA   . LYS A 1 53  ? -28.565 -1.237  -50.128 0.02 30.35 ? 46  LYS A HA   1  
ATOM   705    H HB2  . LYS A 1 53  ? -29.596 -1.309  -52.226 0.02 30.96 ? 46  LYS A HB2  1  
ATOM   706    H HB3  . LYS A 1 53  ? -28.434 -0.390  -52.807 0.02 31.25 ? 46  LYS A HB3  1  
ATOM   707    H HG2  . LYS A 1 53  ? -26.882 -2.038  -52.569 0.02 30.96 ? 46  LYS A HG2  1  
ATOM   708    H HG3  . LYS A 1 53  ? -27.861 -2.904  -51.669 0.02 30.57 ? 46  LYS A HG3  1  
ATOM   709    H HD2  . LYS A 1 53  ? -28.487 -2.420  -54.344 0.02 31.46 ? 46  LYS A HD2  1  
ATOM   710    H HD3  . LYS A 1 53  ? -27.573 -3.663  -53.951 0.02 31.17 ? 46  LYS A HD3  1  
ATOM   711    H HE2  . LYS A 1 53  ? -29.299 -4.612  -52.780 0.02 30.75 ? 46  LYS A HE2  1  
ATOM   712    H HE3  . LYS A 1 53  ? -30.182 -3.296  -52.915 0.02 30.95 ? 46  LYS A HE3  1  
ATOM   713    H HZ1  . LYS A 1 53  ? -29.887 -3.867  -55.306 0.02 31.65 ? 46  LYS A HZ1  1  
ATOM   714    H HZ2  . LYS A 1 53  ? -29.837 -5.215  -54.770 0.02 31.34 ? 46  LYS A HZ2  1  
ATOM   715    H HZ3  . LYS A 1 53  ? -31.011 -4.392  -54.553 0.02 31.41 ? 46  LYS A HZ3  1  
ATOM   716    N N    . ARG A 1 54  ? -26.152 -1.004  -50.027 0.02 30.39 ? 47  ARG A N    1  
ATOM   717    C CA   . ARG A 1 54  ? -24.718 -0.870  -49.860 0.02 30.43 ? 47  ARG A CA   1  
ATOM   718    C C    . ARG A 1 54  ? -24.027 -2.097  -50.438 0.02 30.47 ? 47  ARG A C    1  
ATOM   719    O O    . ARG A 1 54  ? -24.644 -3.136  -50.653 0.02 30.37 ? 47  ARG A O    1  
ATOM   720    C CB   . ARG A 1 54  ? -24.327 -0.714  -48.370 0.02 30.08 ? 47  ARG A CB   1  
ATOM   721    C CG   . ARG A 1 54  ? -25.048 0.436   -47.685 0.02 30.04 ? 47  ARG A CG   1  
ATOM   722    C CD   . ARG A 1 54  ? -24.793 0.468   -46.185 0.02 29.70 ? 47  ARG A CD   1  
ATOM   723    N NE   . ARG A 1 54  ? -25.599 1.524   -45.594 0.02 29.69 ? 47  ARG A NE   1  
ATOM   724    C CZ   . ARG A 1 54  ? -25.263 2.800   -45.648 0.02 29.95 ? 47  ARG A CZ   1  
ATOM   725    N NH1  . ARG A 1 54  ? -24.134 3.155   -46.236 0.02 30.24 ? 47  ARG A NH1  1  
ATOM   726    N NH2  . ARG A 1 54  ? -26.065 3.721   -45.125 0.02 29.97 ? 47  ARG A NH2  1  
ATOM   727    H H    . ARG A 1 54  ? -26.454 -1.728  -49.682 0.02 30.19 ? 47  ARG A H    1  
ATOM   728    H HA   . ARG A 1 54  ? -24.403 -0.094  -50.343 0.02 30.71 ? 47  ARG A HA   1  
ATOM   729    H HB2  . ARG A 1 54  ? -24.548 -1.533  -47.902 0.02 29.83 ? 47  ARG A HB2  1  
ATOM   730    H HB3  . ARG A 1 54  ? -23.374 -0.547  -48.307 0.02 30.17 ? 47  ARG A HB3  1  
ATOM   731    H HG2  . ARG A 1 54  ? -24.735 1.273   -48.063 0.02 30.30 ? 47  ARG A HG2  1  
ATOM   732    H HG3  . ARG A 1 54  ? -26.003 0.350   -47.825 0.02 30.01 ? 47  ARG A HG3  1  
ATOM   733    H HD2  . ARG A 1 54  ? -25.054 -0.383  -45.794 0.02 29.46 ? 47  ARG A HD2  1  
ATOM   734    H HD3  . ARG A 1 54  ? -23.855 0.650   -46.017 0.02 29.76 ? 47  ARG A HD3  1  
ATOM   735    H HE   . ARG A 1 54  ? -26.420 1.359   -45.441 0.02 29.60 ? 47  ARG A HE   1  
ATOM   736    H HH11 . ARG A 1 54  ? -23.619 2.567   -46.588 0.02 30.25 ? 47  ARG A HH11 1  
ATOM   737    H HH12 . ARG A 1 54  ? -23.913 3.983   -46.270 0.02 30.43 ? 47  ARG A HH12 1  
ATOM   738    H HH21 . ARG A 1 54  ? -26.795 3.485   -44.737 0.02 29.81 ? 47  ARG A HH21 1  
ATOM   739    H HH22 . ARG A 1 54  ? -25.839 4.550   -45.147 0.02 30.16 ? 47  ARG A HH22 1  
ATOM   740    N N    . LEU A 1 55  ? -22.728 -1.964  -50.622 0.02 30.65 ? 48  LEU A N    1  
ATOM   741    C CA   . LEU A 1 55  ? -21.872 -2.957  -51.255 0.02 30.79 ? 48  LEU A CA   1  
ATOM   742    C C    . LEU A 1 55  ? -20.856 -3.502  -50.259 0.02 30.54 ? 48  LEU A C    1  
ATOM   743    O O    . LEU A 1 55  ? -20.593 -2.888  -49.234 0.02 30.36 ? 48  LEU A O    1  
ATOM   744    C CB   . LEU A 1 55  ? -21.115 -2.330  -52.426 0.02 31.31 ? 48  LEU A CB   1  
ATOM   745    C CG   . LEU A 1 55  ? -21.992 -1.595  -53.440 0.02 31.65 ? 48  LEU A CG   1  
ATOM   746    C CD1  . LEU A 1 55  ? -21.097 -0.811  -54.371 0.02 32.17 ? 48  LEU A CD1  1  
ATOM   747    C CD2  . LEU A 1 55  ? -22.887 -2.590  -54.174 0.02 31.66 ? 48  LEU A CD2  1  
ATOM   748    H H    . LEU A 1 55  ? -22.296 -1.267  -50.376 0.02 30.72 ? 48  LEU A H    1  
ATOM   749    H HA   . LEU A 1 55  ? -22.417 -3.685  -51.587 0.02 30.75 ? 48  LEU A HA   1  
ATOM   750    H HB2  . LEU A 1 55  ? -20.480 -1.688  -52.073 0.02 31.36 ? 48  LEU A HB2  1  
ATOM   751    H HB3  . LEU A 1 55  ? -20.637 -3.030  -52.895 0.02 31.42 ? 48  LEU A HB3  1  
ATOM   752    H HG   . LEU A 1 55  ? -22.561 -0.964  -52.970 0.02 31.55 ? 48  LEU A HG   1  
ATOM   753    H HD11 . LEU A 1 55  ? -21.626 -0.458  -55.103 0.02 32.43 ? 48  LEU A HD11 1  
ATOM   754    H HD12 . LEU A 1 55  ? -20.687 -0.084  -53.882 0.02 32.22 ? 48  LEU A HD12 1  
ATOM   755    H HD13 . LEU A 1 55  ? -20.411 -1.404  -54.707 0.02 32.21 ? 48  LEU A HD13 1  
ATOM   756    H HD21 . LEU A 1 55  ? -23.303 -2.146  -54.925 0.02 31.94 ? 48  LEU A HD21 1  
ATOM   757    H HD22 . LEU A 1 55  ? -22.346 -3.334  -54.482 0.02 31.72 ? 48  LEU A HD22 1  
ATOM   758    H HD23 . LEU A 1 55  ? -23.568 -2.911  -53.562 0.02 31.37 ? 48  LEU A HD23 1  
ATOM   759    N N    . THR A 1 56  ? -20.267 -4.657  -50.568 0.02 30.58 ? 49  THR A N    1  
ATOM   760    C CA   . THR A 1 56  ? -19.205 -5.226  -49.737 0.02 30.43 ? 49  THR A CA   1  
ATOM   761    C C    . THR A 1 56  ? -17.920 -5.403  -50.533 0.02 30.85 ? 49  THR A C    1  
ATOM   762    O O    . THR A 1 56  ? -17.915 -5.441  -51.777 0.02 31.22 ? 49  THR A O    1  
ATOM   763    C CB   . THR A 1 56  ? -19.594 -6.580  -49.138 0.02 30.10 ? 49  THR A CB   1  
ATOM   764    O OG1  . THR A 1 56  ? -19.390 -7.604  -50.119 0.02 30.33 ? 49  THR A OG1  1  
ATOM   765    C CG2  . THR A 1 56  ? -21.017 -6.585  -48.691 0.02 29.81 ? 49  THR A CG2  1  
ATOM   766    H H    . THR A 1 56  ? -20.475 -5.136  -51.247 0.02 30.71 ? 49  THR A H    1  
ATOM   767    H HA   . THR A 1 56  ? -19.012 -4.632  -48.996 0.02 30.32 ? 49  THR A HA   1  
ATOM   768    H HB   . THR A 1 56  ? -19.034 -6.759  -48.368 0.02 29.96 ? 49  THR A HB   1  
ATOM   769    H HG1  . THR A 1 56  ? -19.936 -8.230  -50.003 0.02 30.18 ? 49  THR A HG1  1  
ATOM   770    H HG21 . THR A 1 56  ? -21.180 -7.362  -48.136 0.02 29.59 ? 49  THR A HG21 1  
ATOM   771    H HG22 . THR A 1 56  ? -21.207 -5.782  -48.184 0.02 29.72 ? 49  THR A HG22 1  
ATOM   772    H HG23 . THR A 1 56  ? -21.606 -6.621  -49.458 0.02 29.95 ? 49  THR A HG23 1  
ATOM   773    N N    . VAL A 1 57  ? -16.816 -5.540  -49.798 0.02 30.82 ? 50  VAL A N    1  
ATOM   774    C CA   . VAL A 1 57  ? -15.535 -5.807  -50.435 0.02 31.24 ? 50  VAL A CA   1  
ATOM   775    C C    . VAL A 1 57  ? -15.524 -7.132  -51.183 0.02 31.34 ? 50  VAL A C    1  
ATOM   776    O O    . VAL A 1 57  ? -14.591 -7.379  -51.956 0.02 31.74 ? 50  VAL A O    1  
ATOM   777    C CB   . VAL A 1 57  ? -14.355 -5.821  -49.441 0.02 31.22 ? 50  VAL A CB   1  
ATOM   778    C CG1  . VAL A 1 57  ? -14.369 -4.574  -48.507 0.02 31.10 ? 50  VAL A CG1  1  
ATOM   779    C CG2  . VAL A 1 57  ? -14.331 -7.128  -48.664 0.02 30.89 ? 50  VAL A CG2  1  
ATOM   780    H H    . VAL A 1 57  ? -16.786 -5.480  -48.945 0.02 30.59 ? 50  VAL A H    1  
ATOM   781    H HA   . VAL A 1 57  ? -15.359 -5.106  -51.081 0.02 31.53 ? 50  VAL A HA   1  
ATOM   782    H HB   . VAL A 1 57  ? -13.534 -5.775  -49.959 0.02 31.57 ? 50  VAL A HB   1  
ATOM   783    H HG11 . VAL A 1 57  ? -13.531 -4.540  -48.022 0.02 31.11 ? 50  VAL A HG11 1  
ATOM   784    H HG12 . VAL A 1 57  ? -14.468 -3.779  -49.053 0.02 31.36 ? 50  VAL A HG12 1  
ATOM   785    H HG13 . VAL A 1 57  ? -15.105 -4.638  -47.883 0.02 30.79 ? 50  VAL A HG13 1  
ATOM   786    H HG21 . VAL A 1 57  ? -13.886 -6.982  -47.814 0.02 30.79 ? 50  VAL A HG21 1  
ATOM   787    H HG22 . VAL A 1 57  ? -15.242 -7.422  -48.512 0.02 30.63 ? 50  VAL A HG22 1  
ATOM   788    H HG23 . VAL A 1 57  ? -13.852 -7.796  -49.175 0.02 31.09 ? 50  VAL A HG23 1  
ATOM   789    N N    . TYR A 1 58  ? -16.526 -7.992  -50.976 0.02 31.02 ? 51  TYR A N    1  
ATOM   790    C CA   . TYR A 1 58  ? -16.601 -9.264  -51.672 0.02 31.15 ? 51  TYR A CA   1  
ATOM   791    C C    . TYR A 1 58  ? -17.498 -9.190  -52.912 0.02 31.38 ? 51  TYR A C    1  
ATOM   792    O O    . TYR A 1 58  ? -17.758 -10.217 -53.542 0.02 31.50 ? 51  TYR A O    1  
ATOM   793    C CB   . TYR A 1 58  ? -17.066 -10.370 -50.704 0.02 30.75 ? 51  TYR A CB   1  
ATOM   794    C CG   . TYR A 1 58  ? -15.970 -10.763 -49.743 0.02 30.66 ? 51  TYR A CG   1  
ATOM   795    C CD1  . TYR A 1 58  ? -14.975 -11.638 -50.120 0.02 30.94 ? 51  TYR A CD1  1  
ATOM   796    C CD2  . TYR A 1 58  ? -15.926 -10.255 -48.455 0.02 30.32 ? 51  TYR A CD2  1  
ATOM   797    C CE1  . TYR A 1 58  ? -13.960 -11.986 -49.268 0.02 30.91 ? 51  TYR A CE1  1  
ATOM   798    C CE2  . TYR A 1 58  ? -14.903 -10.612 -47.581 0.02 30.28 ? 51  TYR A CE2  1  
ATOM   799    C CZ   . TYR A 1 58  ? -13.932 -11.480 -47.991 0.02 30.57 ? 51  TYR A CZ   1  
ATOM   800    O OH   . TYR A 1 58  ? -12.913 -11.834 -47.135 0.02 30.57 ? 51  TYR A OH   1  
ATOM   801    H H    . TYR A 1 58  ? -17.182 -7.856  -50.442 0.02 30.76 ? 51  TYR A H    1  
ATOM   802    H HA   . TYR A 1 58  ? -15.710 -9.495  -51.950 0.02 31.40 ? 51  TYR A HA   1  
ATOM   803    H HB2  . TYR A 1 58  ? -17.819 -10.045 -50.186 0.02 30.48 ? 51  TYR A HB2  1  
ATOM   804    H HB3  . TYR A 1 58  ? -17.326 -11.155 -51.211 0.02 30.84 ? 51  TYR A HB3  1  
ATOM   805    H HD1  . TYR A 1 58  ? -14.982 -11.986 -50.979 0.02 31.19 ? 51  TYR A HD1  1  
ATOM   806    H HD2  . TYR A 1 58  ? -16.584 -9.661  -48.179 0.02 30.15 ? 51  TYR A HD2  1  
ATOM   807    H HE1  . TYR A 1 58  ? -13.303 -12.578 -49.550 0.02 31.13 ? 51  TYR A HE1  1  
ATOM   808    H HE2  . TYR A 1 58  ? -14.879 -10.265 -46.721 0.02 30.08 ? 51  TYR A HE2  1  
ATOM   809    H HH   . TYR A 1 58  ? -12.887 -11.306 -46.488 0.02 30.40 ? 51  TYR A HH   1  
ATOM   810    N N    . ASP A 1 59  ? -17.967 -7.990  -53.270 0.02 31.49 ? 52  ASP A N    1  
ATOM   811    C CA   . ASP A 1 59  ? -18.822 -7.792  -54.431 0.02 31.75 ? 52  ASP A CA   1  
ATOM   812    C C    . ASP A 1 59  ? -20.220 -8.378  -54.212 0.02 31.44 ? 52  ASP A C    1  
ATOM   813    O O    . ASP A 1 59  ? -20.903 -8.776  -55.159 0.02 31.66 ? 52  ASP A O    1  
ATOM   814    C CB   . ASP A 1 59  ? -18.160 -8.361  -55.688 0.02 32.25 ? 52  ASP A CB   1  
ATOM   815    C CG   . ASP A 1 59  ? -16.876 -7.647  -56.025 0.02 32.63 ? 52  ASP A CG   1  
ATOM   816    O OD1  . ASP A 1 59  ? -16.883 -6.402  -55.971 0.02 32.72 ? 52  ASP A OD1  1  
ATOM   817    O OD2  . ASP A 1 59  ? -15.858 -8.311  -56.321 0.02 32.88 ? 52  ASP A OD2  1  
ATOM   818    H H    . ASP A 1 59  ? -17.801 -7.262  -52.850 0.02 31.44 ? 52  ASP A H    1  
ATOM   819    H HA   . ASP A 1 59  ? -18.927 -6.836  -54.560 0.02 31.84 ? 52  ASP A HA   1  
ATOM   820    H HB2  . ASP A 1 59  ? -17.962 -9.301  -55.580 0.02 32.20 ? 52  ASP A HB2  1  
ATOM   821    H HB3  . ASP A 1 59  ? -18.763 -8.245  -56.434 0.02 32.44 ? 52  ASP A HB3  1  
ATOM   822    N N    . ASP A 1 60  ? -20.662 -8.407  -52.954 0.02 30.98 ? 53  ASP A N    1  
ATOM   823    C CA   . ASP A 1 60  ? -22.063 -8.624  -52.633 0.02 30.71 ? 53  ASP A CA   1  
ATOM   824    C C    . ASP A 1 60  ? -22.720 -7.273  -52.352 0.02 30.64 ? 53  ASP A C    1  
ATOM   825    O O    . ASP A 1 60  ? -22.078 -6.225  -52.354 0.02 30.77 ? 53  ASP A O    1  
ATOM   826    C CB   . ASP A 1 60  ? -22.220 -9.563  -51.438 0.02 30.30 ? 53  ASP A CB   1  
ATOM   827    C CG   . ASP A 1 60  ? -21.693 -10.949 -51.716 0.02 30.40 ? 53  ASP A CG   1  
ATOM   828    O OD1  . ASP A 1 60  ? -22.030 -11.504 -52.796 0.02 30.68 ? 53  ASP A OD1  1  
ATOM   829    O OD2  . ASP A 1 60  ? -20.931 -11.455 -50.868 0.02 30.24 ? 53  ASP A OD2  1  
ATOM   830    H H    . ASP A 1 60  ? -20.159 -8.310  -52.269 0.02 30.83 ? 53  ASP A H    1  
ATOM   831    H HA   . ASP A 1 60  ? -22.512 -9.033  -53.387 0.02 30.89 ? 53  ASP A HA   1  
ATOM   832    H HB2  . ASP A 1 60  ? -21.739 -9.196  -50.679 0.02 30.14 ? 53  ASP A HB2  1  
ATOM   833    H HB3  . ASP A 1 60  ? -23.160 -9.649  -51.223 0.02 30.15 ? 53  ASP A HB3  1  
ATOM   834    N N    . SER A 1 61  ? -24.014 -7.305  -52.101 0.02 30.47 ? 54  SER A N    1  
ATOM   835    C CA   . SER A 1 61  ? -24.729 -6.094  -51.744 0.02 30.40 ? 54  SER A CA   1  
ATOM   836    C C    . SER A 1 61  ? -25.873 -6.432  -50.805 0.02 30.06 ? 54  SER A C    1  
ATOM   837    O O    . SER A 1 61  ? -26.324 -7.586  -50.721 0.02 29.96 ? 54  SER A O    1  
ATOM   838    C CB   . SER A 1 61  ? -25.256 -5.371  -52.980 0.02 30.81 ? 54  SER A CB   1  
ATOM   839    O OG   . SER A 1 61  ? -26.073 -6.223  -53.774 0.02 30.96 ? 54  SER A OG   1  
ATOM   840    H H    . SER A 1 61  ? -24.501 -8.010  -52.132 0.02 30.42 ? 54  SER A H    1  
ATOM   841    H HA   . SER A 1 61  ? -24.127 -5.495  -51.278 0.02 30.34 ? 54  SER A HA   1  
ATOM   842    H HB2  . SER A 1 61  ? -25.774 -4.600  -52.703 0.02 30.77 ? 54  SER A HB2  1  
ATOM   843    H HB3  . SER A 1 61  ? -24.494 -5.085  -53.505 0.02 31.04 ? 54  SER A HB3  1  
ATOM   844    H HG   . SER A 1 61  ? -26.783 -6.399  -53.363 0.02 30.80 ? 54  SER A HG   1  
ATOM   845    N N    . TYR A 1 62  ? -26.324 -5.401  -50.083 0.02 29.91 ? 55  TYR A N    1  
ATOM   846    C CA   . TYR A 1 62  ? -27.440 -5.552  -49.171 0.02 29.64 ? 55  TYR A CA   1  
ATOM   847    C C    . TYR A 1 62  ? -28.170 -4.228  -48.965 0.02 29.69 ? 55  TYR A C    1  
ATOM   848    O O    . TYR A 1 62  ? -27.584 -3.153  -49.086 0.02 29.83 ? 55  TYR A O    1  
ATOM   849    C CB   . TYR A 1 62  ? -26.933 -6.091  -47.815 0.02 29.26 ? 55  TYR A CB   1  
ATOM   850    C CG   . TYR A 1 62  ? -25.937 -5.163  -47.150 0.02 29.18 ? 55  TYR A CG   1  
ATOM   851    C CD1  . TYR A 1 62  ? -24.618 -5.116  -47.556 0.02 29.34 ? 55  TYR A CD1  1  
ATOM   852    C CD2  . TYR A 1 62  ? -26.321 -4.333  -46.111 0.02 29.00 ? 55  TYR A CD2  1  
ATOM   853    C CE1  . TYR A 1 62  ? -23.709 -4.266  -46.944 0.02 29.32 ? 55  TYR A CE1  1  
ATOM   854    C CE2  . TYR A 1 62  ? -25.431 -3.499  -45.498 0.02 28.98 ? 55  TYR A CE2  1  
ATOM   855    C CZ   . TYR A 1 62  ? -24.132 -3.457  -45.904 0.02 29.13 ? 55  TYR A CZ   1  
ATOM   856    O OH   . TYR A 1 62  ? -23.221 -2.607  -45.319 0.02 29.16 ? 55  TYR A OH   1  
ATOM   857    H H    . TYR A 1 62  ? -25.985 -4.616  -50.095 0.02 29.99 ? 55  TYR A H    1  
ATOM   858    H HA   . TYR A 1 62  ? -28.073 -6.181  -49.545 0.02 29.70 ? 55  TYR A HA   1  
ATOM   859    H HB2  . TYR A 1 62  ? -27.691 -6.198  -47.224 0.02 29.10 ? 55  TYR A HB2  1  
ATOM   860    H HB3  . TYR A 1 62  ? -26.493 -6.941  -47.956 0.02 29.25 ? 55  TYR A HB3  1  
ATOM   861    H HD1  . TYR A 1 62  ? -24.333 -5.659  -48.247 0.02 29.48 ? 55  TYR A HD1  1  
ATOM   862    H HD2  . TYR A 1 62  ? -27.202 -4.351  -45.819 0.02 28.93 ? 55  TYR A HD2  1  
ATOM   863    H HE1  . TYR A 1 62  ? -22.825 -4.238  -47.224 0.02 29.45 ? 55  TYR A HE1  1  
ATOM   864    H HE2  . TYR A 1 62  ? -25.716 -2.954  -44.807 0.02 28.88 ? 55  TYR A HE2  1  
ATOM   865    H HH   . TYR A 1 62  ? -22.438 -2.863  -45.471 0.02 29.22 ? 55  TYR A HH   1  
ATOM   866    N N    . TYR A 1 63  ? -29.441 -4.340  -48.585 0.02 29.61 ? 56  TYR A N    1  
ATOM   867    C CA   . TYR A 1 63  ? -30.227 -3.210  -48.132 0.02 29.62 ? 56  TYR A CA   1  
ATOM   868    C C    . TYR A 1 63  ? -29.882 -2.921  -46.674 0.02 29.29 ? 56  TYR A C    1  
ATOM   869    O O    . TYR A 1 63  ? -29.747 -3.844  -45.864 0.02 29.01 ? 56  TYR A O    1  
ATOM   870    C CB   . TYR A 1 63  ? -31.718 -3.490  -48.297 0.02 29.71 ? 56  TYR A CB   1  
ATOM   871    C CG   . TYR A 1 63  ? -32.129 -3.674  -49.772 0.02 30.11 ? 56  TYR A CG   1  
ATOM   872    C CD1  . TYR A 1 63  ? -32.672 -2.636  -50.486 0.02 30.43 ? 56  TYR A CD1  1  
ATOM   873    C CD2  . TYR A 1 63  ? -31.927 -4.873  -50.426 0.02 30.18 ? 56  TYR A CD2  1  
ATOM   874    C CE1  . TYR A 1 63  ? -33.029 -2.774  -51.841 0.02 30.84 ? 56  TYR A CE1  1  
ATOM   875    C CE2  . TYR A 1 63  ? -32.280 -5.038  -51.791 0.02 30.59 ? 56  TYR A CE2  1  
ATOM   876    C CZ   . TYR A 1 63  ? -32.829 -3.971  -52.484 0.02 30.91 ? 56  TYR A CZ   1  
ATOM   877    O OH   . TYR A 1 63  ? -33.168 -4.117  -53.830 0.02 31.35 ? 56  TYR A OH   1  
ATOM   878    H H    . TYR A 1 63  ? -29.873 -5.078  -48.578 0.02 29.57 ? 56  TYR A H    1  
ATOM   879    H HA   . TYR A 1 63  ? -30.003 -2.426  -48.655 0.02 29.83 ? 56  TYR A HA   1  
ATOM   880    H HB2  . TYR A 1 63  ? -31.945 -4.301  -47.820 0.02 29.54 ? 56  TYR A HB2  1  
ATOM   881    H HB3  . TYR A 1 63  ? -32.221 -2.745  -47.942 0.02 29.72 ? 56  TYR A HB3  1  
ATOM   882    H HD1  . TYR A 1 63  ? -32.804 -1.825  -50.056 0.02 30.41 ? 56  TYR A HD1  1  
ATOM   883    H HD2  . TYR A 1 63  ? -31.552 -5.584  -49.959 0.02 29.98 ? 56  TYR A HD2  1  
ATOM   884    H HE1  . TYR A 1 63  ? -33.398 -2.059  -52.299 0.02 31.08 ? 56  TYR A HE1  1  
ATOM   885    H HE2  . TYR A 1 63  ? -32.137 -5.849  -52.221 0.02 30.66 ? 56  TYR A HE2  1  
ATOM   886    H HH   . TYR A 1 63  ? -33.340 -3.366  -54.165 0.02 31.53 ? 56  TYR A HH   1  
ATOM   887    N N    . SER A 1 64  ? -29.719 -1.637  -46.367 0.02 29.35 ? 57  SER A N    1  
ATOM   888    C CA   . SER A 1 64  ? -29.288 -1.155  -45.060 0.02 29.12 ? 57  SER A CA   1  
ATOM   889    C C    . SER A 1 64  ? -30.281 -0.116  -44.567 0.02 29.19 ? 57  SER A C    1  
ATOM   890    O O    . SER A 1 64  ? -30.524 0.895   -45.245 0.02 29.49 ? 57  SER A O    1  
ATOM   891    C CB   . SER A 1 64  ? -27.894 -0.535  -45.137 0.02 29.20 ? 57  SER A CB   1  
ATOM   892    O OG   . SER A 1 64  ? -27.357 -0.296  -43.860 0.02 29.02 ? 57  SER A OG   1  
ATOM   893    H H    . SER A 1 64  ? -29.854 -1.006  -46.926 0.02 29.57 ? 57  SER A H    1  
ATOM   894    H HA   . SER A 1 64  ? -29.265 -1.885  -44.423 0.02 28.89 ? 57  SER A HA   1  
ATOM   895    H HB2  . SER A 1 64  ? -27.303 -1.134  -45.616 0.02 29.16 ? 57  SER A HB2  1  
ATOM   896    H HB3  . SER A 1 64  ? -27.970 0.304   -45.610 0.02 29.45 ? 57  SER A HB3  1  
ATOM   897    H HG   . SER A 1 64  ? -26.590 0.036   -43.924 0.02 29.06 ? 57  SER A HG   1  
ATOM   898    N N    . PHE A 1 65  ? -30.841 -0.367  -43.385 0.02 28.95 ? 58  PHE A N    1  
ATOM   899    C CA   . PHE A 1 65  ? -31.657 0.590   -42.661 0.02 29.01 ? 58  PHE A CA   1  
ATOM   900    C C    . PHE A 1 65  ? -30.983 0.782   -41.304 0.02 28.76 ? 58  PHE A C    1  
ATOM   901    O O    . PHE A 1 65  ? -30.906 -0.168  -40.522 0.02 28.49 ? 58  PHE A O    1  
ATOM   902    C CB   . PHE A 1 65  ? -33.082 0.084   -42.463 0.02 29.00 ? 58  PHE A CB   1  
ATOM   903    C CG   . PHE A 1 65  ? -33.824 -0.215  -43.718 0.02 29.26 ? 58  PHE A CG   1  
ATOM   904    C CD1  . PHE A 1 65  ? -33.687 -1.439  -44.340 0.02 29.21 ? 58  PHE A CD1  1  
ATOM   905    C CD2  . PHE A 1 65  ? -34.697 0.719   -44.267 0.02 29.59 ? 58  PHE A CD2  1  
ATOM   906    C CE1  . PHE A 1 65  ? -34.392 -1.732  -45.485 0.02 29.48 ? 58  PHE A CE1  1  
ATOM   907    C CE2  . PHE A 1 65  ? -35.411 0.410   -45.404 0.02 29.86 ? 58  PHE A CE2  1  
ATOM   908    C CZ   . PHE A 1 65  ? -35.249 -0.814  -46.007 0.02 29.80 ? 58  PHE A CZ   1  
ATOM   909    H H    . PHE A 1 65  ? -30.759 -1.114  -42.979 0.02 28.77 ? 58  PHE A H    1  
ATOM   910    H HA   . PHE A 1 65  ? -31.678 1.433   -43.132 0.02 29.23 ? 58  PHE A HA   1  
ATOM   911    H HB2  . PHE A 1 65  ? -33.051 -0.739  -41.953 0.02 28.80 ? 58  PHE A HB2  1  
ATOM   912    H HB3  . PHE A 1 65  ? -33.586 0.752   -41.975 0.02 29.07 ? 58  PHE A HB3  1  
ATOM   913    H HD1  . PHE A 1 65  ? -33.110 -2.072  -43.982 0.02 29.01 ? 58  PHE A HD1  1  
ATOM   914    H HD2  . PHE A 1 65  ? -34.815 1.545   -43.857 0.02 29.65 ? 58  PHE A HD2  1  
ATOM   915    H HE1  . PHE A 1 65  ? -34.290 -2.558  -45.894 0.02 29.46 ? 58  PHE A HE1  1  
ATOM   916    H HE2  . PHE A 1 65  ? -35.990 1.036   -45.771 0.02 30.10 ? 58  PHE A HE2  1  
ATOM   917    H HZ   . PHE A 1 65  ? -35.718 -1.014  -46.783 0.02 30.01 ? 58  PHE A HZ   1  
ATOM   918    N N    . GLU A 1 66  ? -30.473 1.980   -41.044 0.02 28.89 ? 59  GLU A N    1  
ATOM   919    C CA   . GLU A 1 66  ? -29.767 2.292   -39.814 0.02 28.74 ? 59  GLU A CA   1  
ATOM   920    C C    . GLU A 1 66  ? -30.499 3.430   -39.119 0.02 28.88 ? 59  GLU A C    1  
ATOM   921    O O    . GLU A 1 66  ? -31.175 4.240   -39.756 0.02 29.16 ? 59  GLU A O    1  
ATOM   922    C CB   . GLU A 1 66  ? -28.309 2.668   -40.080 0.02 28.82 ? 59  GLU A CB   1  
ATOM   923    C CG   . GLU A 1 66  ? -27.434 1.532   -40.672 0.02 28.71 ? 59  GLU A CG   1  
ATOM   924    C CD   . GLU A 1 66  ? -26.052 2.017   -41.038 0.02 28.89 ? 59  GLU A CD   1  
ATOM   925    O OE1  . GLU A 1 66  ? -25.921 2.794   -42.039 0.02 29.21 ? 59  GLU A OE1  1  
ATOM   926    O OE2  . GLU A 1 66  ? -25.095 1.661   -40.325 0.02 28.75 ? 59  GLU A OE2  1  
ATOM   927    H H    . GLU A 1 66  ? -30.528 2.647   -41.576 0.02 29.10 ? 59  GLU A H    1  
ATOM   928    H HA   . GLU A 1 66  ? -29.777 1.527   -39.220 0.02 28.52 ? 59  GLU A HA   1  
ATOM   929    H HB2  . GLU A 1 66  ? -28.281 3.411   -40.696 0.02 29.06 ? 59  GLU A HB2  1  
ATOM   930    H HB3  . GLU A 1 66  ? -27.911 2.931   -39.239 0.02 28.75 ? 59  GLU A HB3  1  
ATOM   931    H HG2  . GLU A 1 66  ? -27.338 0.820   -40.023 0.02 28.49 ? 59  GLU A HG2  1  
ATOM   932    H HG3  . GLU A 1 66  ? -27.856 1.191   -41.475 0.02 28.78 ? 59  GLU A HG3  1  
ATOM   933    N N    . GLY A 1 67  ? -30.407 3.466   -37.799 0.02 28.70 ? 60  GLY A N    1  
ATOM   934    C CA   . GLY A 1 67  ? -31.068 4.529   -37.090 0.02 28.87 ? 60  GLY A CA   1  
ATOM   935    C C    . GLY A 1 67  ? -32.556 4.374   -36.961 0.02 28.91 ? 60  GLY A C    1  
ATOM   936    O O    . GLY A 1 67  ? -33.276 5.374   -36.853 0.02 29.17 ? 60  GLY A O    1  
ATOM   937    H H    . GLY A 1 67  ? -29.976 2.908   -37.314 0.02 28.52 ? 60  GLY A H    1  
ATOM   938    H HA2  . GLY A 1 67  ? -30.699 4.577   -36.194 0.02 28.77 ? 60  GLY A HA2  1  
ATOM   939    H HA3  . GLY A 1 67  ? -30.887 5.372   -37.532 0.02 29.09 ? 60  GLY A HA3  1  
ATOM   940    N N    . ILE A 1 68  ? -33.057 3.152   -36.919 0.02 28.71 ? 61  ILE A N    1  
ATOM   941    C CA   . ILE A 1 68  ? -34.468 3.011   -36.609 0.02 28.79 ? 61  ILE A CA   1  
ATOM   942    C C    . ILE A 1 68  ? -34.628 3.127   -35.099 0.02 28.69 ? 61  ILE A C    1  
ATOM   943    O O    . ILE A 1 68  ? -34.052 2.312   -34.374 0.02 28.43 ? 61  ILE A O    1  
ATOM   944    C CB   . ILE A 1 68  ? -35.055 1.679   -37.068 0.02 28.68 ? 61  ILE A CB   1  
ATOM   945    C CG1  . ILE A 1 68  ? -34.878 1.474   -38.580 0.02 28.80 ? 61  ILE A CG1  1  
ATOM   946    C CG2  . ILE A 1 68  ? -36.476 1.641   -36.659 0.02 28.82 ? 61  ILE A CG2  1  
ATOM   947    C CD1  . ILE A 1 68  ? -35.577 0.183   -39.113 0.02 28.72 ? 61  ILE A CD1  1  
ATOM   948    H H    . ILE A 1 68  ? -32.623 2.428   -37.053 0.02 28.55 ? 61  ILE A H    1  
ATOM   949    H HA   . ILE A 1 68  ? -34.959 3.722   -37.045 0.02 29.02 ? 61  ILE A HA   1  
ATOM   950    H HB   . ILE A 1 68  ? -34.590 0.967   -36.601 0.02 28.47 ? 61  ILE A HB   1  
ATOM   951    H HG12 . ILE A 1 68  ? -35.240 2.234   -39.060 0.02 29.03 ? 61  ILE A HG12 1  
ATOM   952    H HG13 . ILE A 1 68  ? -33.930 1.391   -38.768 0.02 28.74 ? 61  ILE A HG13 1  
ATOM   953    H HG21 . ILE A 1 68  ? -36.955 0.964   -37.150 0.02 28.86 ? 61  ILE A HG21 1  
ATOM   954    H HG22 . ILE A 1 68  ? -36.530 1.434   -35.713 0.02 28.70 ? 61  ILE A HG22 1  
ATOM   955    H HG23 . ILE A 1 68  ? -36.866 2.509   -36.834 0.02 29.03 ? 61  ILE A HG23 1  
ATOM   956    H HD11 . ILE A 1 68  ? -35.284 0.021   -40.022 0.02 28.79 ? 61  ILE A HD11 1  
ATOM   957    H HD12 . ILE A 1 68  ? -35.322 -0.564  -38.549 0.02 28.51 ? 61  ILE A HD12 1  
ATOM   958    H HD13 . ILE A 1 68  ? -36.537 0.300   -39.094 0.02 28.84 ? 61  ILE A HD13 1  
ATOM   959    N N    . PRO A 1 69  ? -35.405 4.086   -34.592 0.02 28.92 ? 62  PRO A N    1  
ATOM   960    C CA   . PRO A 1 69  ? -35.643 4.162   -33.146 0.02 28.88 ? 62  PRO A CA   1  
ATOM   961    C C    . PRO A 1 69  ? -36.637 3.096   -32.729 0.02 28.79 ? 62  PRO A C    1  
ATOM   962    O O    . PRO A 1 69  ? -37.659 2.894   -33.384 0.02 28.96 ? 62  PRO A O    1  
ATOM   963    C CB   . PRO A 1 69  ? -36.237 5.566   -32.960 0.02 29.23 ? 62  PRO A CB   1  
ATOM   964    C CG   . PRO A 1 69  ? -36.986 5.759   -34.215 0.02 29.45 ? 62  PRO A CG   1  
ATOM   965    C CD   . PRO A 1 69  ? -36.093 5.192   -35.294 0.02 29.29 ? 62  PRO A CD   1  
ATOM   966    H HA   . PRO A 1 69  ? -34.817 4.080   -32.649 0.02 28.73 ? 62  PRO A HA   1  
ATOM   967    H HB2  . PRO A 1 69  ? -36.832 5.577   -32.196 0.02 29.28 ? 62  PRO A HB2  1  
ATOM   968    H HB3  . PRO A 1 69  ? -35.527 6.217   -32.865 0.02 29.28 ? 62  PRO A HB3  1  
ATOM   969    H HG2  . PRO A 1 69  ? -37.817 5.262   -34.173 0.02 29.48 ? 62  PRO A HG2  1  
ATOM   970    H HG3  . PRO A 1 69  ? -37.154 6.703   -34.366 0.02 29.70 ? 62  PRO A HG3  1  
ATOM   971    H HD2  . PRO A 1 69  ? -36.625 4.856   -36.031 0.02 29.35 ? 62  PRO A HD2  1  
ATOM   972    H HD3  . PRO A 1 69  ? -35.454 5.859   -35.590 0.02 29.38 ? 62  PRO A HD3  1  
ATOM   973    N N    . TYR A 1 70  ? -36.321 2.383   -31.651 0.02 28.58 ? 63  TYR A N    1  
ATOM   974    C CA   . TYR A 1 70  ? -37.284 1.497   -31.036 0.02 28.56 ? 63  TYR A CA   1  
ATOM   975    C C    . TYR A 1 70  ? -37.799 2.058   -29.719 0.02 28.71 ? 63  TYR A C    1  
ATOM   976    O O    . TYR A 1 70  ? -38.759 1.524   -29.160 0.02 28.80 ? 63  TYR A O    1  
ATOM   977    C CB   . TYR A 1 70  ? -36.660 0.103   -30.837 0.02 28.26 ? 63  TYR A CB   1  
ATOM   978    C CG   . TYR A 1 70  ? -35.476 0.061   -29.918 0.02 28.06 ? 63  TYR A CG   1  
ATOM   979    C CD1  . TYR A 1 70  ? -35.647 0.067   -28.528 0.02 28.08 ? 63  TYR A CD1  1  
ATOM   980    C CD2  . TYR A 1 70  ? -34.193 0.003   -30.412 0.02 27.90 ? 63  TYR A CD2  1  
ATOM   981    C CE1  . TYR A 1 70  ? -34.590 0.013   -27.697 0.02 27.94 ? 63  TYR A CE1  1  
ATOM   982    C CE2  . TYR A 1 70  ? -33.116 -0.059  -29.575 0.02 27.76 ? 63  TYR A CE2  1  
ATOM   983    C CZ   . TYR A 1 70  ? -33.325 -0.049  -28.197 0.02 27.78 ? 63  TYR A CZ   1  
ATOM   984    O OH   . TYR A 1 70  ? -32.274 -0.106  -27.315 0.02 27.68 ? 63  TYR A OH   1  
ATOM   985    H H    . TYR A 1 70  ? -35.558 2.399   -31.261 0.02 28.46 ? 63  TYR A H    1  
ATOM   986    H HA   . TYR A 1 70  ? -38.048 1.396   -31.622 0.02 28.69 ? 63  TYR A HA   1  
ATOM   987    H HB2  . TYR A 1 70  ? -37.335 -0.493  -30.480 0.02 28.28 ? 63  TYR A HB2  1  
ATOM   988    H HB3  . TYR A 1 70  ? -36.366 -0.223  -31.700 0.02 28.20 ? 63  TYR A HB3  1  
ATOM   989    H HD1  . TYR A 1 70  ? -36.505 0.104   -28.175 0.02 28.21 ? 63  TYR A HD1  1  
ATOM   990    H HD2  . TYR A 1 70  ? -34.058 -0.007  -31.330 0.02 27.90 ? 63  TYR A HD2  1  
ATOM   991    H HE1  . TYR A 1 70  ? -34.721 0.016   -26.779 0.02 27.97 ? 63  TYR A HE1  1  
ATOM   992    H HE2  . TYR A 1 70  ? -32.254 -0.097  -29.919 0.02 27.68 ? 63  TYR A HE2  1  
ATOM   993    H HH   . TYR A 1 70  ? -31.591 0.238   -27.652 0.02 27.67 ? 63  TYR A HH   1  
ATOM   994    N N    . ALA A 1 71  ? -37.220 3.151   -29.243 0.02 28.79 ? 64  ALA A N    1  
ATOM   995    C CA   . ALA A 1 71  ? -37.678 3.742   -27.991 0.02 28.98 ? 64  ALA A CA   1  
ATOM   996    C C    . ALA A 1 71  ? -37.507 5.248   -28.042 0.02 29.25 ? 64  ALA A C    1  
ATOM   997    O O    . ALA A 1 71  ? -36.895 5.803   -28.952 0.02 29.27 ? 64  ALA A O    1  
ATOM   998    C CB   . ALA A 1 71  ? -36.925 3.176   -26.781 0.02 28.78 ? 64  ALA A CB   1  
ATOM   999    H H    . ALA A 1 71  ? -36.567 3.564   -29.620 0.02 28.77 ? 64  ALA A H    1  
ATOM   1000   H HA   . ALA A 1 71  ? -38.624 3.563   -27.873 0.02 29.11 ? 64  ALA A HA   1  
ATOM   1001   H HB1  . ALA A 1 71  ? -37.253 2.283   -26.595 0.02 28.68 ? 64  ALA A HB1  1  
ATOM   1002   H HB2  . ALA A 1 71  ? -35.976 3.149   -26.976 0.02 28.65 ? 64  ALA A HB2  1  
ATOM   1003   H HB3  . ALA A 1 71  ? -37.087 3.746   -26.016 0.02 28.94 ? 64  ALA A HB3  1  
ATOM   1004   N N    . GLN A 1 72  ? -38.050 5.891   -27.021 0.02 29.50 ? 65  GLN A N    1  
ATOM   1005   C CA   . GLN A 1 72  ? -37.944 7.327   -26.938 0.02 29.79 ? 65  GLN A CA   1  
ATOM   1006   C C    . GLN A 1 72  ? -36.501 7.660   -26.591 0.02 29.65 ? 65  GLN A C    1  
ATOM   1007   O O    . GLN A 1 72  ? -35.871 6.934   -25.820 0.02 29.42 ? 65  GLN A O    1  
ATOM   1008   C CB   . GLN A 1 72  ? -38.911 7.850   -25.880 0.02 30.11 ? 65  GLN A CB   1  
ATOM   1009   C CG   . GLN A 1 72  ? -39.204 9.308   -25.967 0.02 30.51 ? 65  GLN A CG   1  
ATOM   1010   C CD   . GLN A 1 72  ? -40.106 9.650   -27.150 0.02 30.78 ? 65  GLN A CD   1  
ATOM   1011   O OE1  . GLN A 1 72  ? -41.102 8.969   -27.428 0.02 30.83 ? 65  GLN A OE1  1  
ATOM   1012   N NE2  . GLN A 1 72  ? -39.757 10.706  -27.843 0.02 30.98 ? 65  GLN A NE2  1  
ATOM   1013   H H    . GLN A 1 72  ? -38.464 5.519   -26.367 0.02 29.51 ? 65  GLN A H    1  
ATOM   1014   H HA   . GLN A 1 72  ? -38.171 7.724   -27.790 0.02 29.92 ? 65  GLN A HA   1  
ATOM   1015   H HB2  . GLN A 1 72  ? -39.756 7.388   -25.981 0.02 30.19 ? 65  GLN A HB2  1  
ATOM   1016   H HB3  . GLN A 1 72  ? -38.537 7.668   -25.005 0.02 30.01 ? 65  GLN A HB3  1  
ATOM   1017   H HG2  . GLN A 1 72  ? -39.649 9.592   -25.155 0.02 30.68 ? 65  GLN A HG2  1  
ATOM   1018   H HG3  . GLN A 1 72  ? -38.370 9.791   -26.071 0.02 30.45 ? 65  GLN A HG3  1  
ATOM   1019   H HE21 . GLN A 1 72  ? -39.075 11.170  -27.604 0.02 30.90 ? 65  GLN A HE21 1  
ATOM   1020   H HE22 . GLN A 1 72  ? -40.208 10.926  -28.539 0.02 31.21 ? 65  GLN A HE22 1  
ATOM   1021   N N    . PRO A 1 73  ? -35.923 8.696   -27.169 0.02 29.80 ? 66  PRO A N    1  
ATOM   1022   C CA   . PRO A 1 73  ? -34.634 9.148   -26.690 0.02 29.78 ? 66  PRO A CA   1  
ATOM   1023   C C    . PRO A 1 73  ? -34.675 9.330   -25.183 0.02 29.88 ? 66  PRO A C    1  
ATOM   1024   O O    . PRO A 1 73  ? -35.536 10.049  -24.670 0.02 30.20 ? 66  PRO A O    1  
ATOM   1025   C CB   . PRO A 1 73  ? -34.448 10.476  -27.433 0.02 30.12 ? 66  PRO A CB   1  
ATOM   1026   C CG   . PRO A 1 73  ? -35.134 10.193  -28.741 0.02 30.09 ? 66  PRO A CG   1  
ATOM   1027   C CD   . PRO A 1 73  ? -36.357 9.465   -28.358 0.02 30.04 ? 66  PRO A CD   1  
ATOM   1028   H HA   . PRO A 1 73  ? -33.938 8.530   -26.947 0.02 29.54 ? 66  PRO A HA   1  
ATOM   1029   H HB2  . PRO A 1 73  ? -34.891 11.196  -26.956 0.02 30.38 ? 66  PRO A HB2  1  
ATOM   1030   H HB3  . PRO A 1 73  ? -33.506 10.665  -27.564 0.02 30.09 ? 66  PRO A HB3  1  
ATOM   1031   H HG2  . PRO A 1 73  ? -35.355 11.024  -29.187 0.02 30.35 ? 66  PRO A HG2  1  
ATOM   1032   H HG3  . PRO A 1 73  ? -34.566 9.646   -29.302 0.02 29.88 ? 66  PRO A HG3  1  
ATOM   1033   H HD2  . PRO A 1 73  ? -37.055 10.096  -28.122 0.02 30.30 ? 66  PRO A HD2  1  
ATOM   1034   H HD3  . PRO A 1 73  ? -36.636 8.872   -29.072 0.02 29.91 ? 66  PRO A HD3  1  
ATOM   1035   N N    . PRO A 1 74  ? -33.787 8.590   -24.392 0.02 29.64 ? 67  PRO A N    1  
ATOM   1036   C CA   . PRO A 1 74  ? -33.948 8.601   -22.932 0.02 29.72 ? 67  PRO A CA   1  
ATOM   1037   C C    . PRO A 1 74  ? -33.118 9.719   -22.328 0.02 29.98 ? 67  PRO A C    1  
ATOM   1038   O O    . PRO A 1 74  ? -32.099 9.506   -21.674 0.02 29.89 ? 67  PRO A O    1  
ATOM   1039   C CB   . PRO A 1 74  ? -33.454 7.204   -22.544 0.02 29.34 ? 67  PRO A CB   1  
ATOM   1040   C CG   . PRO A 1 74  ? -32.405 6.875   -23.653 0.02 29.13 ? 67  PRO A CG   1  
ATOM   1041   C CD   . PRO A 1 74  ? -32.561 7.871   -24.758 0.02 29.33 ? 67  PRO A CD   1  
ATOM   1042   H HA   . PRO A 1 74  ? -34.879 8.706   -22.685 0.02 29.86 ? 67  PRO A HA   1  
ATOM   1043   H HB2  . PRO A 1 74  ? -33.043 7.229   -21.664 0.02 29.37 ? 67  PRO A HB2  1  
ATOM   1044   H HB3  . PRO A 1 74  ? -34.196 6.581   -22.568 0.02 29.26 ? 67  PRO A HB3  1  
ATOM   1045   H HG2  . PRO A 1 74  ? -31.512 6.928   -23.282 0.02 29.14 ? 67  PRO A HG2  1  
ATOM   1046   H HG3  . PRO A 1 74  ? -32.570 5.983   -23.990 0.02 28.91 ? 67  PRO A HG3  1  
ATOM   1047   H HD2  . PRO A 1 74  ? -31.811 8.486   -24.756 0.02 29.44 ? 67  PRO A HD2  1  
ATOM   1048   H HD3  . PRO A 1 74  ? -32.659 7.424   -25.613 0.02 29.19 ? 67  PRO A HD3  1  
ATOM   1049   N N    . VAL A 1 75  ? -33.513 10.940  -22.638 0.02 30.34 ? 68  VAL A N    1  
ATOM   1050   C CA   . VAL A 1 75  ? -32.767 12.110  -22.232 0.02 30.65 ? 68  VAL A CA   1  
ATOM   1051   C C    . VAL A 1 75  ? -33.614 12.878  -21.218 0.02 31.06 ? 68  VAL A C    1  
ATOM   1052   O O    . VAL A 1 75  ? -34.796 12.607  -21.027 0.02 31.11 ? 68  VAL A O    1  
ATOM   1053   C CB   . VAL A 1 75  ? -32.381 12.974  -23.431 0.02 30.80 ? 68  VAL A CB   1  
ATOM   1054   C CG1  . VAL A 1 75  ? -31.409 12.189  -24.330 0.02 30.43 ? 68  VAL A CG1  1  
ATOM   1055   C CG2  . VAL A 1 75  ? -33.639 13.382  -24.170 0.02 31.00 ? 68  VAL A CG2  1  
ATOM   1056   H H    . VAL A 1 75  ? -34.230 11.115  -23.072 0.02 30.44 ? 68  VAL A H    1  
ATOM   1057   H HA   . VAL A 1 75  ? -31.944 11.846  -21.796 0.02 30.54 ? 68  VAL A HA   1  
ATOM   1058   H HB   . VAL A 1 75  ? -31.927 13.772  -23.125 0.02 31.05 ? 68  VAL A HB   1  
ATOM   1059   H HG11 . VAL A 1 75  ? -31.391 11.259  -24.051 0.02 30.17 ? 68  VAL A HG11 1  
ATOM   1060   H HG12 . VAL A 1 75  ? -31.712 12.248  -25.250 0.02 30.51 ? 68  VAL A HG12 1  
ATOM   1061   H HG13 . VAL A 1 75  ? -30.523 12.577  -24.246 0.02 30.42 ? 68  VAL A HG13 1  
ATOM   1062   H HG21 . VAL A 1 75  ? -33.390 13.855  -24.979 0.02 31.09 ? 68  VAL A HG21 1  
ATOM   1063   H HG22 . VAL A 1 75  ? -34.156 12.598  -24.404 0.02 30.78 ? 68  VAL A HG22 1  
ATOM   1064   H HG23 . VAL A 1 75  ? -34.166 13.957  -23.593 0.02 31.27 ? 68  VAL A HG23 1  
ATOM   1065   N N    . GLY A 1 76  ? -32.979 13.808  -20.547 0.02 31.37 ? 69  GLY A N    1  
ATOM   1066   C CA   . GLY A 1 76  ? -33.692 14.654  -19.600 0.02 31.81 ? 69  GLY A CA   1  
ATOM   1067   C C    . GLY A 1 76  ? -34.312 13.810  -18.507 0.02 31.72 ? 69  GLY A C    1  
ATOM   1068   O O    . GLY A 1 76  ? -33.630 13.049  -17.801 0.02 31.49 ? 69  GLY A O    1  
ATOM   1069   H H    . GLY A 1 76  ? -32.138 13.973  -20.618 0.02 31.35 ? 69  GLY A H    1  
ATOM   1070   H HA2  . GLY A 1 76  ? -33.094 15.308  -19.206 0.02 32.03 ? 69  GLY A HA2  1  
ATOM   1071   H HA3  . GLY A 1 76  ? -34.401 15.121  -20.065 0.02 32.00 ? 69  GLY A HA3  1  
ATOM   1072   N N    . GLU A 1 77  ? -35.632 13.912  -18.395 0.02 31.92 ? 70  GLU A N    1  
ATOM   1073   C CA   . GLU A 1 77  ? -36.369 13.188  -17.371 0.02 31.92 ? 70  GLU A CA   1  
ATOM   1074   C C    . GLU A 1 77  ? -36.357 11.685  -17.575 0.02 31.43 ? 70  GLU A C    1  
ATOM   1075   O O    . GLU A 1 77  ? -36.656 10.950  -16.635 0.02 31.40 ? 70  GLU A O    1  
ATOM   1076   C CB   . GLU A 1 77  ? -37.805 13.668  -17.352 0.02 32.32 ? 70  GLU A CB   1  
ATOM   1077   C CG   . GLU A 1 77  ? -37.933 15.063  -16.831 0.02 32.87 ? 70  GLU A CG   1  
ATOM   1078   C CD   . GLU A 1 77  ? -37.548 15.129  -15.385 0.02 33.03 ? 70  GLU A CD   1  
ATOM   1079   O OE1  . GLU A 1 77  ? -36.421 15.570  -15.080 0.02 33.06 ? 70  GLU A OE1  1  
ATOM   1080   O OE2  . GLU A 1 77  ? -38.373 14.698  -14.558 0.02 33.15 ? 70  GLU A OE2  1  
ATOM   1081   H H    . GLU A 1 77  ? -36.126 14.393  -18.903 0.02 32.08 ? 70  GLU A H    1  
ATOM   1082   H HA   . GLU A 1 77  ? -35.969 13.371  -16.508 0.02 32.02 ? 70  GLU A HA   1  
ATOM   1083   H HB2  . GLU A 1 77  ? -38.145 13.645  -18.257 0.02 32.27 ? 70  GLU A HB2  1  
ATOM   1084   H HB3  . GLU A 1 77  ? -38.327 13.081  -16.786 0.02 32.31 ? 70  GLU A HB3  1  
ATOM   1085   H HG2  . GLU A 1 77  ? -37.340 15.645  -17.331 0.02 32.90 ? 70  GLU A HG2  1  
ATOM   1086   H HG3  . GLU A 1 77  ? -38.853 15.353  -16.918 0.02 33.13 ? 70  GLU A HG3  1  
ATOM   1087   N N    . LEU A 1 78  ? -36.072 11.213  -18.785 0.02 31.10 ? 71  LEU A N    1  
ATOM   1088   C CA   . LEU A 1 78  ? -36.043 9.772   -19.026 0.02 30.67 ? 71  LEU A CA   1  
ATOM   1089   C C    . LEU A 1 78  ? -34.706 9.158   -18.670 0.02 30.37 ? 71  LEU A C    1  
ATOM   1090   O O    . LEU A 1 78  ? -34.556 7.940   -18.788 0.02 30.03 ? 71  LEU A O    1  
ATOM   1091   C CB   . LEU A 1 78  ? -36.390 9.486   -20.491 0.02 30.48 ? 71  LEU A CB   1  
ATOM   1092   C CG   . LEU A 1 78  ? -37.863 9.756   -20.789 0.02 30.76 ? 71  LEU A CG   1  
ATOM   1093   C CD1  . LEU A 1 78  ? -38.076 9.786   -22.292 0.02 30.66 ? 71  LEU A CD1  1  
ATOM   1094   C CD2  . LEU A 1 78  ? -38.788 8.752   -20.101 0.02 30.75 ? 71  LEU A CD2  1  
ATOM   1095   H H    . LEU A 1 78  ? -35.887 11.699  -19.467 0.02 31.14 ? 71  LEU A H    1  
ATOM   1096   H HA   . LEU A 1 78  ? -36.713 9.335   -18.480 0.02 30.72 ? 71  LEU A HA   1  
ATOM   1097   H HB2  . LEU A 1 78  ? -35.853 10.068  -21.049 0.02 30.50 ? 71  LEU A HB2  1  
ATOM   1098   H HB3  . LEU A 1 78  ? -36.204 8.561   -20.708 0.02 30.19 ? 71  LEU A HB3  1  
ATOM   1099   H HG   . LEU A 1 78  ? -38.091 10.633  -20.444 0.02 31.07 ? 71  LEU A HG   1  
ATOM   1100   H HD11 . LEU A 1 78  ? -38.678 9.075   -22.557 0.02 30.55 ? 71  LEU A HD11 1  
ATOM   1101   H HD12 . LEU A 1 78  ? -38.464 10.643  -22.526 0.02 30.95 ? 71  LEU A HD12 1  
ATOM   1102   H HD13 . LEU A 1 78  ? -37.219 9.685   -22.730 0.02 30.47 ? 71  LEU A HD13 1  
ATOM   1103   H HD21 . LEU A 1 78  ? -38.293 8.275   -19.416 0.02 30.53 ? 71  LEU A HD21 1  
ATOM   1104   H HD22 . LEU A 1 78  ? -39.526 9.234   -19.697 0.02 31.05 ? 71  LEU A HD22 1  
ATOM   1105   H HD23 . LEU A 1 78  ? -39.130 8.119   -20.752 0.02 30.71 ? 71  LEU A HD23 1  
ATOM   1106   N N    . ARG A 1 79  ? -33.730 9.972   -18.274 0.02 30.52 ? 72  ARG A N    1  
ATOM   1107   C CA   . ARG A 1 79  ? -32.430 9.434   -17.915 0.02 30.30 ? 72  ARG A CA   1  
ATOM   1108   C C    . ARG A 1 79  ? -32.573 8.515   -16.712 0.02 30.24 ? 72  ARG A C    1  
ATOM   1109   O O    . ARG A 1 79  ? -33.240 8.848   -15.729 0.02 30.54 ? 72  ARG A O    1  
ATOM   1110   C CB   . ARG A 1 79  ? -31.436 10.550  -17.601 0.02 30.58 ? 72  ARG A CB   1  
ATOM   1111   C CG   . ARG A 1 79  ? -30.060 10.026  -17.281 0.02 30.40 ? 72  ARG A CG   1  
ATOM   1112   C CD   . ARG A 1 79  ? -29.113 11.083  -16.832 0.02 30.74 ? 72  ARG A CD   1  
ATOM   1113   N NE   . ARG A 1 79  ? -28.808 12.020  -17.889 0.02 30.88 ? 72  ARG A NE   1  
ATOM   1114   C CZ   . ARG A 1 79  ? -28.074 13.109  -17.699 0.02 31.25 ? 72  ARG A CZ   1  
ATOM   1115   N NH1  . ARG A 1 79  ? -27.580 13.380  -16.491 0.02 31.50 ? 72  ARG A NH1  1  
ATOM   1116   N NH2  . ARG A 1 79  ? -27.838 13.940  -18.710 0.02 31.41 ? 72  ARG A NH2  1  
ATOM   1117   H H    . ARG A 1 79  ? -33.793 10.825  -18.209 0.02 30.78 ? 72  ARG A H    1  
ATOM   1118   H HA   . ARG A 1 79  ? -32.083 8.918   -18.660 0.02 30.04 ? 72  ARG A HA   1  
ATOM   1119   H HB2  . ARG A 1 79  ? -31.363 11.137  -18.367 0.02 30.64 ? 72  ARG A HB2  1  
ATOM   1120   H HB3  . ARG A 1 79  ? -31.753 11.051  -16.835 0.02 30.85 ? 72  ARG A HB3  1  
ATOM   1121   H HG2  . ARG A 1 79  ? -30.118 9.379   -16.563 0.02 30.33 ? 72  ARG A HG2  1  
ATOM   1122   H HG3  . ARG A 1 79  ? -29.688 9.612   -18.074 0.02 30.17 ? 72  ARG A HG3  1  
ATOM   1123   H HD2  . ARG A 1 79  ? -29.513 11.577  -16.099 0.02 31.01 ? 72  ARG A HD2  1  
ATOM   1124   H HD3  . ARG A 1 79  ? -28.285 10.674  -16.537 0.02 30.64 ? 72  ARG A HD3  1  
ATOM   1125   H HE   . ARG A 1 79  ? -29.310 12.003  -18.583 0.02 30.80 ? 72  ARG A HE   1  
ATOM   1126   H HH11 . ARG A 1 79  ? -27.730 12.852  -15.834 0.02 31.42 ? 72  ARG A HH11 1  
ATOM   1127   H HH12 . ARG A 1 79  ? -27.103 14.085  -16.373 0.02 31.76 ? 72  ARG A HH12 1  
ATOM   1128   H HH21 . ARG A 1 79  ? -28.161 13.765  -19.487 0.02 31.27 ? 72  ARG A HH21 1  
ATOM   1129   H HH22 . ARG A 1 79  ? -27.362 14.644  -18.590 0.02 31.67 ? 72  ARG A HH22 1  
ATOM   1130   N N    . PHE A 1 80  ? -31.925 7.358   -16.807 0.02 29.88 ? 73  PHE A N    1  
ATOM   1131   C CA   . PHE A 1 80  ? -31.937 6.294   -15.826 0.02 29.79 ? 73  PHE A CA   1  
ATOM   1132   C C    . PHE A 1 80  ? -33.267 5.548   -15.743 0.02 29.76 ? 73  PHE A C    1  
ATOM   1133   O O    . PHE A 1 80  ? -33.401 4.631   -14.898 0.02 29.73 ? 73  PHE A O    1  
ATOM   1134   C CB   . PHE A 1 80  ? -31.594 6.812   -14.422 0.02 30.11 ? 73  PHE A CB   1  
ATOM   1135   C CG   . PHE A 1 80  ? -30.295 7.561   -14.338 0.02 30.22 ? 73  PHE A CG   1  
ATOM   1136   C CD1  . PHE A 1 80  ? -29.108 6.975   -14.743 0.02 29.95 ? 73  PHE A CD1  1  
ATOM   1137   C CD2  . PHE A 1 80  ? -30.257 8.838   -13.799 0.02 30.63 ? 73  PHE A CD2  1  
ATOM   1138   C CE1  . PHE A 1 80  ? -27.915 7.641   -14.644 0.02 30.10 ? 73  PHE A CE1  1  
ATOM   1139   C CE2  . PHE A 1 80  ? -29.068 9.534   -13.717 0.02 30.79 ? 73  PHE A CE2  1  
ATOM   1140   C CZ   . PHE A 1 80  ? -27.888 8.939   -14.122 0.02 30.53 ? 73  PHE A CZ   1  
ATOM   1141   H H    . PHE A 1 80  ? -31.428 7.168   -17.476 0.02 29.71 ? 73  PHE A H    1  
ATOM   1142   H HA   . PHE A 1 80  ? -31.254 5.657   -16.083 0.02 29.55 ? 73  PHE A HA   1  
ATOM   1143   H HB2  . PHE A 1 80  ? -32.302 7.397   -14.119 0.02 30.36 ? 73  PHE A HB2  1  
ATOM   1144   H HB3  . PHE A 1 80  ? -31.523 6.048   -13.829 0.02 30.04 ? 73  PHE A HB3  1  
ATOM   1145   H HD1  . PHE A 1 80  ? -29.118 6.116   -15.089 0.02 29.70 ? 73  PHE A HD1  1  
ATOM   1146   H HD2  . PHE A 1 80  ? -31.047 9.240   -13.525 0.02 30.84 ? 73  PHE A HD2  1  
ATOM   1147   H HE1  . PHE A 1 80  ? -27.131 7.235   -14.931 0.02 29.95 ? 73  PHE A HE1  1  
ATOM   1148   H HE2  . PHE A 1 80  ? -29.056 10.391  -13.362 0.02 31.09 ? 73  PHE A HE2  1  
ATOM   1149   H HZ   . PHE A 1 80  ? -27.085 9.402   -14.058 0.02 30.67 ? 73  PHE A HZ   1  
ATOM   1150   N N    . LYS A 1 81  ? -34.259 5.904   -16.536 0.02 29.83 ? 74  LYS A N    1  
ATOM   1151   C CA   . LYS A 1 81  ? -35.570 5.280   -16.436 0.02 29.89 ? 74  LYS A CA   1  
ATOM   1152   C C    . LYS A 1 81  ? -35.781 4.245   -17.532 0.02 29.56 ? 74  LYS A C    1  
ATOM   1153   O O    . LYS A 1 81  ? -35.099 4.246   -18.545 0.02 29.33 ? 74  LYS A O    1  
ATOM   1154   C CB   . LYS A 1 81  ? -36.686 6.323   -16.545 0.02 30.27 ? 74  LYS A CB   1  
ATOM   1155   C CG   . LYS A 1 81  ? -36.535 7.514   -15.624 0.02 30.66 ? 74  LYS A CG   1  
ATOM   1156   C CD   . LYS A 1 81  ? -36.322 7.131   -14.180 0.02 30.80 ? 74  LYS A CD   1  
ATOM   1157   C CE   . LYS A 1 81  ? -36.269 8.366   -13.278 0.02 31.26 ? 74  LYS A CE   1  
ATOM   1158   N NZ   . LYS A 1 81  ? -35.575 9.591   -13.849 0.02 31.36 ? 74  LYS A NZ   1  
ATOM   1159   H H    . LYS A 1 81  ? -34.200 6.506   -17.141 0.02 29.87 ? 74  LYS A H    1  
ATOM   1160   H HA   . LYS A 1 81  ? -35.652 4.824   -15.584 0.02 29.94 ? 74  LYS A HA   1  
ATOM   1161   H HB2  . LYS A 1 81  ? -36.699 6.651   -17.456 0.02 30.22 ? 74  LYS A HB2  1  
ATOM   1162   H HB3  . LYS A 1 81  ? -37.533 5.900   -16.344 0.02 30.37 ? 74  LYS A HB3  1  
ATOM   1163   H HG2  . LYS A 1 81  ? -35.765 8.026   -15.913 0.02 30.60 ? 74  LYS A HG2  1  
ATOM   1164   H HG3  . LYS A 1 81  ? -37.337 8.057   -15.675 0.02 30.91 ? 74  LYS A HG3  1  
ATOM   1165   H HD2  . LYS A 1 81  ? -37.059 6.572   -13.887 0.02 30.85 ? 74  LYS A HD2  1  
ATOM   1166   H HD3  . LYS A 1 81  ? -35.484 6.649   -14.103 0.02 30.58 ? 74  LYS A HD3  1  
ATOM   1167   H HE2  . LYS A 1 81  ? -37.179 8.625   -13.068 0.02 31.51 ? 74  LYS A HE2  1  
ATOM   1168   H HE3  . LYS A 1 81  ? -35.812 8.140   -12.458 0.02 31.31 ? 74  LYS A HE3  1  
ATOM   1169   H HZ1  . LYS A 1 81  ? -35.769 9.687   -14.711 0.02 31.24 ? 74  LYS A HZ1  1  
ATOM   1170   H HZ2  . LYS A 1 81  ? -35.847 10.318  -13.417 0.02 31.67 ? 74  LYS A HZ2  1  
ATOM   1171   H HZ3  . LYS A 1 81  ? -34.694 9.515   -13.755 0.02 31.26 ? 74  LYS A HZ3  1  
ATOM   1172   N N    . ALA A 1 82  ? -36.785 3.413   -17.316 0.02 29.60 ? 75  ALA A N    1  
ATOM   1173   C CA   . ALA A 1 82  ? -37.239 2.429   -18.284 0.02 29.38 ? 75  ALA A CA   1  
ATOM   1174   C C    . ALA A 1 82  ? -37.572 3.093   -19.623 0.02 29.37 ? 75  ALA A C    1  
ATOM   1175   O O    . ALA A 1 82  ? -37.995 4.258   -19.656 0.02 29.65 ? 75  ALA A O    1  
ATOM   1176   C CB   . ALA A 1 82  ? -38.465 1.707   -17.725 0.02 29.57 ? 75  ALA A CB   1  
ATOM   1177   H H    . ALA A 1 82  ? -37.244 3.409   -16.592 0.02 29.79 ? 75  ALA A H    1  
ATOM   1178   H HA   . ALA A 1 82  ? -36.538 1.776   -18.434 0.02 29.14 ? 75  ALA A HA   1  
ATOM   1179   H HB1  . ALA A 1 82  ? -38.809 1.098   -18.398 0.02 29.46 ? 75  ALA A HB1  1  
ATOM   1180   H HB2  . ALA A 1 82  ? -38.207 1.208   -16.934 0.02 29.57 ? 75  ALA A HB2  1  
ATOM   1181   H HB3  . ALA A 1 82  ? -39.138 2.366   -17.493 0.02 29.84 ? 75  ALA A HB3  1  
ATOM   1182   N N    . PRO A 1 83  ? -37.419 2.385   -20.746 0.02 29.10 ? 76  PRO A N    1  
ATOM   1183   C CA   . PRO A 1 83  ? -37.600 3.044   -22.042 0.02 29.12 ? 76  PRO A CA   1  
ATOM   1184   C C    . PRO A 1 83  ? -39.069 3.282   -22.304 0.02 29.42 ? 76  PRO A C    1  
ATOM   1185   O O    . PRO A 1 83  ? -39.926 2.521   -21.870 0.02 29.50 ? 76  PRO A O    1  
ATOM   1186   C CB   . PRO A 1 83  ? -37.017 2.026   -23.040 0.02 28.78 ? 76  PRO A CB   1  
ATOM   1187   C CG   . PRO A 1 83  ? -37.381 0.722   -22.416 0.02 28.69 ? 76  PRO A CG   1  
ATOM   1188   C CD   . PRO A 1 83  ? -37.331 0.920   -20.909 0.02 28.84 ? 76  PRO A CD   1  
ATOM   1189   H HA   . PRO A 1 83  ? -37.104 3.874   -22.083 0.02 29.18 ? 76  PRO A HA   1  
ATOM   1190   H HB2  . PRO A 1 83  ? -37.444 2.117   -23.904 0.02 28.81 ? 76  PRO A HB2  1  
ATOM   1191   H HB3  . PRO A 1 83  ? -36.055 2.121   -23.113 0.02 28.64 ? 76  PRO A HB3  1  
ATOM   1192   H HG2  . PRO A 1 83  ? -38.280 0.486   -22.691 0.02 28.81 ? 76  PRO A HG2  1  
ATOM   1193   H HG3  . PRO A 1 83  ? -36.750 0.037   -22.693 0.02 28.47 ? 76  PRO A HG3  1  
ATOM   1194   H HD2  . PRO A 1 83  ? -38.091 0.485   -20.495 0.02 28.96 ? 76  PRO A HD2  1  
ATOM   1195   H HD3  . PRO A 1 83  ? -36.492 0.585   -20.560 0.02 28.69 ? 76  PRO A HD3  1  
ATOM   1196   N N    . GLN A 1 84  ? -39.359 4.322   -23.061 0.02 29.61 ? 77  GLN A N    1  
ATOM   1197   C CA   . GLN A 1 84  ? -40.697 4.516   -23.591 0.02 29.89 ? 77  GLN A CA   1  
ATOM   1198   C C    . GLN A 1 84  ? -40.646 4.446   -25.121 0.02 29.77 ? 77  GLN A C    1  
ATOM   1199   O O    . GLN A 1 84  ? -39.755 5.011   -25.765 0.02 29.62 ? 77  GLN A O    1  
ATOM   1200   C CB   . GLN A 1 84  ? -41.283 5.854   -23.076 0.02 30.32 ? 77  GLN A CB   1  
ATOM   1201   C CG   . GLN A 1 84  ? -42.174 5.749   -21.765 0.02 30.64 ? 77  GLN A CG   1  
ATOM   1202   C CD   . GLN A 1 84  ? -43.629 6.168   -22.023 0.02 31.09 ? 77  GLN A CD   1  
ATOM   1203   O OE1  . GLN A 1 84  ? -44.565 5.496   -21.591 0.02 31.26 ? 77  GLN A OE1  1  
ATOM   1204   N NE2  . GLN A 1 84  ? -43.812 7.275   -22.752 0.02 31.31 ? 77  GLN A NE2  1  
ATOM   1205   H H    . GLN A 1 84  ? -38.797 4.931   -23.290 0.02 29.62 ? 77  GLN A H    1  
ATOM   1206   H HA   . GLN A 1 84  ? -41.276 3.802   -23.288 0.02 29.92 ? 77  GLN A HA   1  
ATOM   1207   H HB2  . GLN A 1 84  ? -40.544 6.447   -22.866 0.02 30.30 ? 77  GLN A HB2  1  
ATOM   1208   H HB3  . GLN A 1 84  ? -41.824 6.243   -23.778 0.02 30.47 ? 77  GLN A HB3  1  
ATOM   1209   H HG2  . GLN A 1 84  ? -42.177 4.836   -21.436 0.02 30.52 ? 77  GLN A HG2  1  
ATOM   1210   H HG3  . GLN A 1 84  ? -41.813 6.339   -21.087 0.02 30.73 ? 77  GLN A HG3  1  
ATOM   1211   H HE21 . GLN A 1 84  ? -44.595 7.631   -22.811 0.02 31.61 ? 77  GLN A HE21 1  
ATOM   1212   H HE22 . GLN A 1 84  ? -43.147 7.640   -23.156 0.02 31.17 ? 77  GLN A HE22 1  
ATOM   1213   N N    . ARG A 1 85  ? -41.597 3.699   -25.694 0.02 29.88 ? 78  ARG A N    1  
ATOM   1214   C CA   . ARG A 1 85  ? -41.708 3.574   -27.149 0.02 29.82 ? 78  ARG A CA   1  
ATOM   1215   C C    . ARG A 1 85  ? -41.766 4.956   -27.810 0.02 30.05 ? 78  ARG A C    1  
ATOM   1216   O O    . ARG A 1 85  ? -42.164 5.931   -27.164 0.02 30.36 ? 78  ARG A O    1  
ATOM   1217   C CB   . ARG A 1 85  ? -42.963 2.802   -27.550 0.02 30.00 ? 78  ARG A CB   1  
ATOM   1218   C CG   . ARG A 1 85  ? -43.261 1.506   -26.838 0.02 29.86 ? 78  ARG A CG   1  
ATOM   1219   C CD   . ARG A 1 85  ? -42.067 0.606   -26.780 0.02 29.42 ? 78  ARG A CD   1  
ATOM   1220   N NE   . ARG A 1 85  ? -42.342 -0.623  -26.039 0.02 29.35 ? 78  ARG A NE   1  
ATOM   1221   C CZ   . ARG A 1 85  ? -42.479 -0.671  -24.722 0.02 29.44 ? 78  ARG A CZ   1  
ATOM   1222   N NH1  . ARG A 1 85  ? -42.692 -1.834  -24.142 0.02 29.43 ? 78  ARG A NH1  1  
ATOM   1223   N NH2  . ARG A 1 85  ? -42.398 0.439   -24.001 0.02 29.57 ? 78  ARG A NH2  1  
ATOM   1224   H H    . ARG A 1 85  ? -42.189 3.255   -25.259 0.02 30.02 ? 78  ARG A H    1  
ATOM   1225   H HA   . ARG A 1 85  ? -40.937 3.096   -27.491 0.02 29.54 ? 78  ARG A HA   1  
ATOM   1226   H HB2  . ARG A 1 85  ? -43.728 3.386   -27.437 0.02 30.30 ? 78  ARG A HB2  1  
ATOM   1227   H HB3  . ARG A 1 85  ? -42.868 2.581   -28.490 0.02 29.96 ? 78  ARG A HB3  1  
ATOM   1228   H HG2  . ARG A 1 85  ? -43.580 1.660   -25.932 0.02 29.99 ? 78  ARG A HG2  1  
ATOM   1229   H HG3  . ARG A 1 85  ? -43.936 1.029   -27.348 0.02 29.96 ? 78  ARG A HG3  1  
ATOM   1230   H HD2  . ARG A 1 85  ? -41.802 0.380   -27.680 0.02 29.30 ? 78  ARG A HD2  1  
ATOM   1231   H HD3  . ARG A 1 85  ? -41.318 1.001   -26.290 0.02 29.33 ? 78  ARG A HD3  1  
ATOM   1232   H HE   . ARG A 1 85  ? -42.640 -1.302  -26.479 0.02 29.33 ? 78  ARG A HE   1  
ATOM   1233   H HH11 . ARG A 1 85  ? -42.741 -2.549  -24.614 0.02 29.37 ? 78  ARG A HH11 1  
ATOM   1234   H HH12 . ARG A 1 85  ? -42.788 -1.869  -23.289 0.02 29.50 ? 78  ARG A HH12 1  
ATOM   1235   H HH21 . ARG A 1 85  ? -42.247 1.201   -24.373 0.02 29.60 ? 78  ARG A HH21 1  
ATOM   1236   H HH22 . ARG A 1 85  ? -42.494 0.394   -23.148 0.02 29.64 ? 78  ARG A HH22 1  
ATOM   1237   N N    . PRO A 1 86  ? -41.457 5.054   -29.117 0.02 29.95 ? 79  PRO A N    1  
ATOM   1238   C CA   . PRO A 1 86  ? -41.316 6.371   -29.761 0.02 30.18 ? 79  PRO A CA   1  
ATOM   1239   C C    . PRO A 1 86  ? -42.600 6.914   -30.380 0.02 30.61 ? 79  PRO A C    1  
ATOM   1240   O O    . PRO A 1 86  ? -43.672 6.306   -30.307 0.02 30.74 ? 79  PRO A O    1  
ATOM   1241   C CB   . PRO A 1 86  ? -40.275 6.103   -30.857 0.02 29.92 ? 79  PRO A CB   1  
ATOM   1242   C CG   . PRO A 1 86  ? -40.508 4.731   -31.233 0.02 29.70 ? 79  PRO A CG   1  
ATOM   1243   C CD   . PRO A 1 86  ? -40.851 4.002   -29.948 0.02 29.63 ? 79  PRO A CD   1  
ATOM   1244   H HA   . PRO A 1 86  ? -40.962 7.016   -29.128 0.02 30.24 ? 79  PRO A HA   1  
ATOM   1245   H HB2  . PRO A 1 86  ? -40.415 6.695   -31.611 0.02 30.10 ? 79  PRO A HB2  1  
ATOM   1246   H HB3  . PRO A 1 86  ? -39.381 6.202   -30.498 0.02 29.76 ? 79  PRO A HB3  1  
ATOM   1247   H HG2  . PRO A 1 86  ? -41.241 4.710   -31.859 0.02 29.87 ? 79  PRO A HG2  1  
ATOM   1248   H HG3  . PRO A 1 86  ? -39.704 4.362   -31.631 0.02 29.47 ? 79  PRO A HG3  1  
ATOM   1249   H HD2  . PRO A 1 86  ? -41.477 3.282   -30.111 0.02 29.66 ? 79  PRO A HD2  1  
ATOM   1250   H HD3  . PRO A 1 86  ? -40.043 3.669   -29.532 0.02 29.39 ? 79  PRO A HD3  1  
ATOM   1251   N N    . THR A 1 87  ? -42.447 8.115   -31.023 0.02 30.87 ? 80  THR A N    1  
ATOM   1252   C CA   . THR A 1 87  ? -43.543 8.846   -31.671 0.02 31.33 ? 80  THR A CA   1  
ATOM   1253   C C    . THR A 1 87  ? -43.668 8.471   -33.146 0.02 31.33 ? 80  THR A C    1  
ATOM   1254   O O    . THR A 1 87  ? -42.786 8.815   -33.943 0.02 31.19 ? 80  THR A O    1  
ATOM   1255   C CB   . THR A 1 87  ? -43.337 10.367  -31.594 0.02 31.67 ? 80  THR A CB   1  
ATOM   1256   O OG1  . THR A 1 87  ? -42.357 10.777  -32.571 0.02 31.59 ? 80  THR A OG1  1  
ATOM   1257   C CG2  . THR A 1 87  ? -42.914 10.820  -30.194 0.02 31.66 ? 80  THR A CG2  1  
ATOM   1258   H H    . THR A 1 87  ? -41.694 8.527   -31.084 0.02 30.81 ? 80  THR A H    1  
ATOM   1259   H HA   . THR A 1 87  ? -44.367 8.624   -31.216 0.02 31.47 ? 80  THR A HA   1  
ATOM   1260   H HB   . THR A 1 87  ? -44.181 10.804  -31.800 0.02 32.01 ? 80  THR A HB   1  
ATOM   1261   H HG1  . THR A 1 87  ? -42.737 11.025  -33.278 0.02 31.72 ? 80  THR A HG1  1  
ATOM   1262   H HG21 . THR A 1 87  ? -42.657 11.755  -30.217 0.02 31.89 ? 80  THR A HG21 1  
ATOM   1263   H HG22 . THR A 1 87  ? -43.651 10.712  -29.574 0.02 31.77 ? 80  THR A HG22 1  
ATOM   1264   H HG23 . THR A 1 87  ? -42.160 10.298  -29.879 0.02 31.34 ? 80  THR A HG23 1  
ATOM   1265   N N    . PRO A 1 88  ? -44.789 7.889   -33.565 0.02 31.56 ? 81  PRO A N    1  
ATOM   1266   C CA   . PRO A 1 88  ? -44.895 7.388   -34.933 0.02 31.57 ? 81  PRO A CA   1  
ATOM   1267   C C    . PRO A 1 88  ? -45.070 8.526   -35.915 0.02 31.95 ? 81  PRO A C    1  
ATOM   1268   O O    . PRO A 1 88  ? -45.929 9.395   -35.769 0.02 32.40 ? 81  PRO A O    1  
ATOM   1269   C CB   . PRO A 1 88  ? -46.144 6.520   -34.884 0.02 31.75 ? 81  PRO A CB   1  
ATOM   1270   C CG   . PRO A 1 88  ? -47.011 7.239   -33.877 0.02 32.10 ? 81  PRO A CG   1  
ATOM   1271   C CD   . PRO A 1 88  ? -46.123 8.043   -32.965 0.02 31.92 ? 81  PRO A CD   1  
ATOM   1272   H HA   . PRO A 1 88  ? -44.121 6.860   -35.172 0.02 31.26 ? 81  PRO A HA   1  
ATOM   1273   H HB2  . PRO A 1 88  ? -46.549 6.510   -35.758 0.02 31.95 ? 81  PRO A HB2  1  
ATOM   1274   H HB3  . PRO A 1 88  ? -45.928 5.626   -34.583 0.02 31.49 ? 81  PRO A HB3  1  
ATOM   1275   H HG2  . PRO A 1 88  ? -47.618 7.827   -34.348 0.02 32.45 ? 81  PRO A HG2  1  
ATOM   1276   H HG3  . PRO A 1 88  ? -47.502 6.578   -33.370 0.02 32.11 ? 81  PRO A HG3  1  
ATOM   1277   H HD2  . PRO A 1 88  ? -46.390 8.975   -32.989 0.02 32.21 ? 81  PRO A HD2  1  
ATOM   1278   H HD3  . PRO A 1 88  ? -46.142 7.685   -32.064 0.02 31.77 ? 81  PRO A HD3  1  
ATOM   1279   N N    . TRP A 1 89  ? -44.230 8.520   -36.928 0.02 31.79 ? 82  TRP A N    1  
ATOM   1280   C CA   . TRP A 1 89  ? -43.965 9.747   -37.658 0.02 32.09 ? 82  TRP A CA   1  
ATOM   1281   C C    . TRP A 1 89  ? -44.738 9.790   -38.953 0.02 32.47 ? 82  TRP A C    1  
ATOM   1282   O O    . TRP A 1 89  ? -45.107 8.772   -39.539 0.02 32.41 ? 82  TRP A O    1  
ATOM   1283   C CB   . TRP A 1 89  ? -42.493 9.906   -37.984 0.02 31.81 ? 82  TRP A CB   1  
ATOM   1284   C CG   . TRP A 1 89  ? -42.022 8.690   -38.668 0.02 31.48 ? 82  TRP A CG   1  
ATOM   1285   C CD1  . TRP A 1 89  ? -42.125 8.398   -40.012 0.02 31.60 ? 82  TRP A CD1  1  
ATOM   1286   C CD2  . TRP A 1 89  ? -41.436 7.534   -38.050 0.02 31.01 ? 82  TRP A CD2  1  
ATOM   1287   N NE1  . TRP A 1 89  ? -41.633 7.133   -40.247 0.02 31.23 ? 82  TRP A NE1  1  
ATOM   1288   C CE2  . TRP A 1 89  ? -41.187 6.596   -39.069 0.02 30.86 ? 82  TRP A CE2  1  
ATOM   1289   C CE3  . TRP A 1 89  ? -41.077 7.213   -36.733 0.02 30.72 ? 82  TRP A CE3  1  
ATOM   1290   C CZ2  . TRP A 1 89  ? -40.596 5.345   -38.811 0.02 30.44 ? 82  TRP A CZ2  1  
ATOM   1291   C CZ3  . TRP A 1 89  ? -40.493 5.975   -36.487 0.02 30.31 ? 82  TRP A CZ3  1  
ATOM   1292   C CH2  . TRP A 1 89  ? -40.253 5.063   -37.524 0.02 30.17 ? 82  TRP A CH2  1  
ATOM   1293   H H    . TRP A 1 89  ? -43.816 7.824   -37.210 0.02 31.54 ? 82  TRP A H    1  
ATOM   1294   H HA   . TRP A 1 89  ? -44.232 10.497  -37.117 0.02 32.29 ? 82  TRP A HA   1  
ATOM   1295   H HB2  . TRP A 1 89  ? -42.381 10.669  -38.569 0.02 32.06 ? 82  TRP A HB2  1  
ATOM   1296   H HB3  . TRP A 1 89  ? -41.988 10.023  -37.163 0.02 31.64 ? 82  TRP A HB3  1  
ATOM   1297   H HD1  . TRP A 1 89  ? -42.494 8.960   -40.657 0.02 31.91 ? 82  TRP A HD1  1  
ATOM   1298   H HE1  . TRP A 1 89  ? -41.582 6.756   -41.016 0.02 31.24 ? 82  TRP A HE1  1  
ATOM   1299   H HE3  . TRP A 1 89  ? -41.226 7.812   -36.040 0.02 30.83 ? 82  TRP A HE3  1  
ATOM   1300   H HZ2  . TRP A 1 89  ? -40.437 4.736   -39.498 0.02 30.38 ? 82  TRP A HZ2  1  
ATOM   1301   H HZ3  . TRP A 1 89  ? -40.251 5.753   -35.618 0.02 30.14 ? 82  TRP A HZ3  1  
ATOM   1302   H HH2  . TRP A 1 89  ? -39.863 4.243   -37.332 0.02 29.92 ? 82  TRP A HH2  1  
ATOM   1303   N N    . ALA A 1 90  ? -44.933 11.020  -39.399 0.02 32.89 ? 83  ALA A N    1  
ATOM   1304   C CA   . ALA A 1 90  ? -45.446 11.305  -40.707 0.02 33.30 ? 83  ALA A CA   1  
ATOM   1305   C C    . ALA A 1 90  ? -44.359 11.090  -41.744 0.02 33.14 ? 83  ALA A C    1  
ATOM   1306   O O    . ALA A 1 90  ? -43.160 11.220  -41.476 0.02 32.88 ? 83  ALA A O    1  
ATOM   1307   C CB   . ALA A 1 90  ? -45.943 12.747  -40.778 0.02 33.87 ? 83  ALA A CB   1  
ATOM   1308   H H    . ALA A 1 90  ? -44.767 11.731  -38.941 0.02 32.96 ? 83  ALA A H    1  
ATOM   1309   H HA   . ALA A 1 90  ? -46.184 10.705  -40.903 0.02 33.35 ? 83  ALA A HA   1  
ATOM   1310   H HB1  . ALA A 1 90  ? -46.361 12.897  -41.642 0.02 34.17 ? 83  ALA A HB1  1  
ATOM   1311   H HB2  . ALA A 1 90  ? -46.580 12.893  -40.059 0.02 33.98 ? 83  ALA A HB2  1  
ATOM   1312   H HB3  . ALA A 1 90  ? -45.185 13.342  -40.668 0.02 33.84 ? 83  ALA A HB3  1  
ATOM   1313   N N    . GLY A 1 91  ? -44.802 10.774  -42.952 0.02 33.35 ? 84  GLY A N    1  
ATOM   1314   C CA   . GLY A 1 91  ? -43.866 10.764  -44.031 0.02 33.31 ? 84  GLY A CA   1  
ATOM   1315   C C    . GLY A 1 91  ? -42.908 9.599   -43.895 0.02 32.74 ? 84  GLY A C    1  
ATOM   1316   O O    . GLY A 1 91  ? -43.246 8.532   -43.379 0.02 32.45 ? 84  GLY A O    1  
ATOM   1317   H H    . GLY A 1 91  ? -45.607 10.554  -43.152 0.02 33.53 ? 84  GLY A H    1  
ATOM   1318   H HA2  . GLY A 1 91  ? -44.339 10.680  -44.871 0.02 33.56 ? 84  GLY A HA2  1  
ATOM   1319   H HA3  . GLY A 1 91  ? -43.355 11.587  -44.034 0.02 33.43 ? 84  GLY A HA3  1  
ATOM   1320   N N    . VAL A 1 92  ? -41.688 9.828   -44.366 0.02 32.62 ? 85  VAL A N    1  
ATOM   1321   C CA   . VAL A 1 92  ? -40.678 8.798   -44.490 0.02 32.17 ? 85  VAL A CA   1  
ATOM   1322   C C    . VAL A 1 92  ? -39.443 9.270   -43.743 0.02 31.93 ? 85  VAL A C    1  
ATOM   1323   O O    . VAL A 1 92  ? -38.878 10.321  -44.067 0.02 32.18 ? 85  VAL A O    1  
ATOM   1324   C CB   . VAL A 1 92  ? -40.354 8.497   -45.958 0.02 32.33 ? 85  VAL A CB   1  
ATOM   1325   C CG1  . VAL A 1 92  ? -39.558 7.187   -46.057 0.02 31.89 ? 85  VAL A CG1  1  
ATOM   1326   C CG2  . VAL A 1 92  ? -41.624 8.403   -46.777 0.02 32.75 ? 85  VAL A CG2  1  
ATOM   1327   H H    . VAL A 1 92  ? -41.413 10.597  -44.627 0.02 32.83 ? 85  VAL A H    1  
ATOM   1328   H HA   . VAL A 1 92  ? -40.993 7.981   -44.074 0.02 31.95 ? 85  VAL A HA   1  
ATOM   1329   H HB   . VAL A 1 92  ? -39.813 9.214   -46.323 0.02 32.49 ? 85  VAL A HB   1  
ATOM   1330   H HG11 . VAL A 1 92  ? -39.267 7.060   -46.973 0.02 32.00 ? 85  VAL A HG11 1  
ATOM   1331   H HG12 . VAL A 1 92  ? -38.787 7.244   -45.470 0.02 31.63 ? 85  VAL A HG12 1  
ATOM   1332   H HG13 . VAL A 1 92  ? -40.129 6.449   -45.780 0.02 31.79 ? 85  VAL A HG13 1  
ATOM   1333   H HG21 . VAL A 1 92  ? -41.411 8.048   -47.653 0.02 32.81 ? 85  VAL A HG21 1  
ATOM   1334   H HG22 . VAL A 1 92  ? -42.245 7.815   -46.322 0.02 32.64 ? 85  VAL A HG22 1  
ATOM   1335   H HG23 . VAL A 1 92  ? -42.012 9.287   -46.866 0.02 33.08 ? 85  VAL A HG23 1  
ATOM   1336   N N    . ARG A 1 93  ? -39.017 8.474   -42.774 0.02 31.48 ? 86  ARG A N    1  
ATOM   1337   C CA   . ARG A 1 93  ? -37.851 8.776   -41.955 0.02 31.23 ? 86  ARG A CA   1  
ATOM   1338   C C    . ARG A 1 93  ? -36.570 8.295   -42.617 0.02 31.04 ? 86  ARG A C    1  
ATOM   1339   O O    . ARG A 1 93  ? -36.490 7.153   -43.063 0.02 30.83 ? 86  ARG A O    1  
ATOM   1340   C CB   . ARG A 1 93  ? -38.001 8.109   -40.584 0.02 30.87 ? 86  ARG A CB   1  
ATOM   1341   C CG   . ARG A 1 93  ? -36.730 8.073   -39.730 0.02 30.54 ? 86  ARG A CG   1  
ATOM   1342   C CD   . ARG A 1 93  ? -36.913 7.203   -38.470 0.02 30.19 ? 86  ARG A CD   1  
ATOM   1343   N NE   . ARG A 1 93  ? -37.625 7.869   -37.369 0.02 30.33 ? 86  ARG A NE   1  
ATOM   1344   C CZ   . ARG A 1 93  ? -37.069 8.751   -36.533 0.02 30.38 ? 86  ARG A CZ   1  
ATOM   1345   N NH1  . ARG A 1 93  ? -35.794 9.104   -36.659 0.02 30.32 ? 86  ARG A NH1  1  
ATOM   1346   N NH2  . ARG A 1 93  ? -37.793 9.288   -35.570 0.02 30.54 ? 86  ARG A NH2  1  
ATOM   1347   H H    . ARG A 1 93  ? -39.405 7.741   -42.559 0.02 31.32 ? 86  ARG A H    1  
ATOM   1348   H HA   . ARG A 1 93  ? -37.782 9.736   -41.835 0.02 31.46 ? 86  ARG A HA   1  
ATOM   1349   H HB2  . ARG A 1 93  ? -38.680 8.587   -40.082 0.02 31.03 ? 86  ARG A HB2  1  
ATOM   1350   H HB3  . ARG A 1 93  ? -38.284 7.194   -40.722 0.02 30.72 ? 86  ARG A HB3  1  
ATOM   1351   H HG2  . ARG A 1 93  ? -35.994 7.698   -40.231 0.02 30.43 ? 86  ARG A HG2  1  
ATOM   1352   H HG3  . ARG A 1 93  ? -36.514 8.979   -39.457 0.02 30.71 ? 86  ARG A HG3  1  
ATOM   1353   H HD2  . ARG A 1 93  ? -37.425 6.417   -38.713 0.02 30.10 ? 86  ARG A HD2  1  
ATOM   1354   H HD3  . ARG A 1 93  ? -36.043 6.929   -38.144 0.02 29.97 ? 86  ARG A HD3  1  
ATOM   1355   H HE   . ARG A 1 93  ? -38.414 7.583   -37.178 0.02 30.37 ? 86  ARG A HE   1  
ATOM   1356   H HH11 . ARG A 1 93  ? -35.312 8.758   -37.280 0.02 30.23 ? 86  ARG A HH11 1  
ATOM   1357   H HH12 . ARG A 1 93  ? -35.449 9.674   -36.118 0.02 30.38 ? 86  ARG A HH12 1  
ATOM   1358   H HH21 . ARG A 1 93  ? -38.620 9.069   -35.483 0.02 30.61 ? 86  ARG A HH21 1  
ATOM   1359   H HH22 . ARG A 1 93  ? -37.438 9.859   -35.034 0.02 30.60 ? 86  ARG A HH22 1  
ATOM   1360   N N    . ASP A 1 94  ? -35.566 9.168   -42.657 0.02 31.14 ? 87  ASP A N    1  
ATOM   1361   C CA   . ASP A 1 94  ? -34.241 8.820   -43.167 0.02 31.01 ? 87  ASP A CA   1  
ATOM   1362   C C    . ASP A 1 94  ? -33.553 7.788   -42.257 0.02 30.53 ? 87  ASP A C    1  
ATOM   1363   O O    . ASP A 1 94  ? -33.357 8.028   -41.065 0.02 30.38 ? 87  ASP A O    1  
ATOM   1364   C CB   . ASP A 1 94  ? -33.423 10.112  -43.295 0.02 31.34 ? 87  ASP A CB   1  
ATOM   1365   C CG   . ASP A 1 94  ? -31.944 9.884   -43.607 0.02 31.27 ? 87  ASP A CG   1  
ATOM   1366   O OD1  . ASP A 1 94  ? -31.410 8.747   -43.500 0.02 30.96 ? 87  ASP A OD1  1  
ATOM   1367   O OD2  . ASP A 1 94  ? -31.290 10.889  -43.942 0.02 31.57 ? 87  ASP A OD2  1  
ATOM   1368   H H    . ASP A 1 94  ? -35.632 9.983   -42.405 0.02 31.30 ? 87  ASP A H    1  
ATOM   1369   H HA   . ASP A 1 94  ? -34.334 8.415   -44.036 0.02 31.08 ? 87  ASP A HA   1  
ATOM   1370   H HB2  . ASP A 1 94  ? -33.792 10.634  -44.024 0.02 31.66 ? 87  ASP A HB2  1  
ATOM   1371   H HB3  . ASP A 1 94  ? -33.488 10.618  -42.471 0.02 31.31 ? 87  ASP A HB3  1  
ATOM   1372   N N    . CYS A 1 95  ? -33.178 6.642   -42.834 0.02 30.32 ? 88  CYS A N    1  
ATOM   1373   C CA   . CYS A 1 95  ? -32.371 5.610   -42.185 0.02 29.91 ? 88  CYS A CA   1  
ATOM   1374   C C    . CYS A 1 95  ? -31.182 5.203   -43.057 0.02 29.92 ? 88  CYS A C    1  
ATOM   1375   O O    . CYS A 1 95  ? -30.722 4.058   -43.028 0.02 29.66 ? 88  CYS A O    1  
ATOM   1376   C CB   . CYS A 1 95  ? -33.232 4.399   -41.844 0.02 29.65 ? 88  CYS A CB   1  
ATOM   1377   S SG   . CYS A 1 95  ? -34.606 4.756   -40.752 0.02 29.67 ? 88  CYS A SG   1  
ATOM   1378   H H    . CYS A 1 95  ? -33.387 6.436   -43.644 0.02 30.43 ? 88  CYS A H    1  
ATOM   1379   H HA   . CYS A 1 95  ? -32.015 5.969   -41.357 0.02 29.84 ? 88  CYS A HA   1  
ATOM   1380   H HB2  . CYS A 1 95  ? -33.606 4.051   -42.666 0.02 29.75 ? 88  CYS A HB2  1  
ATOM   1381   H HB3  . CYS A 1 95  ? -32.684 3.716   -41.432 0.02 29.40 ? 88  CYS A HB3  1  
ATOM   1382   H HG   . CYS A 1 95  ? -34.154 5.353   -39.814 0.02 29.60 ? 88  CYS A HG   1  
ATOM   1383   N N    . CYS A 1 96  ? -30.667 6.152   -43.842 0.02 30.26 ? 89  CYS A N    1  
ATOM   1384   C CA   . CYS A 1 96  ? -29.520 5.955   -44.722 0.02 30.36 ? 89  CYS A CA   1  
ATOM   1385   C C    . CYS A 1 96  ? -28.189 6.199   -44.028 0.02 30.28 ? 89  CYS A C    1  
ATOM   1386   O O    . CYS A 1 96  ? -27.143 6.136   -44.685 0.02 30.40 ? 89  CYS A O    1  
ATOM   1387   C CB   . CYS A 1 96  ? -29.627 6.881   -45.942 0.02 30.84 ? 89  CYS A CB   1  
ATOM   1388   S SG   . CYS A 1 96  ? -31.041 6.501   -46.950 0.02 31.02 ? 89  CYS A SG   1  
ATOM   1389   H H    . CYS A 1 96  ? -30.983 6.947   -43.874 0.02 30.46 ? 89  CYS A H    1  
ATOM   1390   H HA   . CYS A 1 96  ? -29.530 5.043   -45.049 0.02 30.21 ? 89  CYS A HA   1  
ATOM   1391   H HB2  . CYS A 1 96  ? -29.720 7.797   -45.637 0.02 31.02 ? 89  CYS A HB2  1  
ATOM   1392   H HB3  . CYS A 1 96  ? -28.831 6.792   -46.487 0.02 30.93 ? 89  CYS A HB3  1  
ATOM   1393   H HG   . CYS A 1 96  ? -31.995 6.359   -46.238 0.02 30.87 ? 89  CYS A HG   1  
ATOM   1394   N N    . ASN A 1 97  ? -28.213 6.502   -42.722 0.02 30.14 ? 90  ASN A N    1  
ATOM   1395   C CA   . ASN A 1 97  ? -27.030 6.797   -41.924 0.02 30.09 ? 90  ASN A CA   1  
ATOM   1396   C C    . ASN A 1 97  ? -27.166 6.142   -40.548 0.02 29.69 ? 90  ASN A C    1  
ATOM   1397   O O    . ASN A 1 97  ? -28.274 5.971   -40.028 0.02 29.56 ? 90  ASN A O    1  
ATOM   1398   C CB   . ASN A 1 97  ? -26.834 8.314   -41.676 0.02 30.45 ? 90  ASN A CB   1  
ATOM   1399   C CG   . ASN A 1 97  ? -25.950 9.018   -42.713 0.02 30.89 ? 90  ASN A CG   1  
ATOM   1400   O OD1  . ASN A 1 97  ? -25.002 9.733   -42.344 0.02 31.10 ? 90  ASN A OD1  1  
ATOM   1401   N ND2  . ASN A 1 97  ? -26.303 8.910   -43.990 0.02 31.09 ? 90  ASN A ND2  1  
ATOM   1402   H H    . ASN A 1 97  ? -28.938 6.536   -42.265 0.02 30.08 ? 90  ASN A H    1  
ATOM   1403   H HA   . ASN A 1 97  ? -26.243 6.434   -42.361 0.02 30.11 ? 90  ASN A HA   1  
ATOM   1404   H HB2  . ASN A 1 97  ? -27.703 8.742   -41.676 0.02 30.53 ? 90  ASN A HB2  1  
ATOM   1405   H HB3  . ASN A 1 97  ? -26.413 8.429   -40.812 0.02 30.35 ? 90  ASN A HB3  1  
ATOM   1406   H HD21 . ASN A 1 97  ? -27.063 8.561   -44.203 0.02 31.13 ? 90  ASN A HD21 1  
ATOM   1407   H HD22 . ASN A 1 97  ? -25.770 9.192   -44.605 0.02 31.20 ? 90  ASN A HD22 1  
ATOM   1408   N N    . HIS A 1 98  ? -26.026 5.814   -39.956 0.02 29.53 ? 91  HIS A N    1  
ATOM   1409   C CA   . HIS A 1 98  ? -25.969 5.428   -38.552 0.02 29.24 ? 91  HIS A CA   1  
ATOM   1410   C C    . HIS A 1 98  ? -26.389 6.596   -37.657 0.02 29.38 ? 91  HIS A C    1  
ATOM   1411   O O    . HIS A 1 98  ? -26.347 7.767   -38.045 0.02 29.73 ? 91  HIS A O    1  
ATOM   1412   C CB   . HIS A 1 98  ? -24.547 5.006   -38.192 0.02 29.16 ? 91  HIS A CB   1  
ATOM   1413   C CG   . HIS A 1 98  ? -23.579 6.150   -38.163 0.02 29.49 ? 91  HIS A CG   1  
ATOM   1414   N ND1  . HIS A 1 98  ? -22.817 6.508   -39.252 0.02 29.82 ? 91  HIS A ND1  1  
ATOM   1415   C CD2  . HIS A 1 98  ? -23.272 7.034   -37.184 0.02 29.59 ? 91  HIS A CD2  1  
ATOM   1416   C CE1  . HIS A 1 98  ? -22.068 7.550   -38.942 0.02 30.12 ? 91  HIS A CE1  1  
ATOM   1417   N NE2  . HIS A 1 98  ? -22.329 7.893   -37.692 0.02 29.99 ? 91  HIS A NE2  1  
ATOM   1418   H H    . HIS A 1 98  ? -25.264 5.809   -40.349 0.02 29.62 ? 91  HIS A H    1  
ATOM   1419   H HA   . HIS A 1 98  ? -26.570 4.685   -38.384 0.02 29.03 ? 91  HIS A HA   1  
ATOM   1420   H HB2  . HIS A 1 98  ? -24.550 4.575   -37.326 0.02 28.95 ? 91  HIS A HB2  1  
ATOM   1421   H HB3  . HIS A 1 98  ? -24.230 4.388   -38.866 0.02 29.13 ? 91  HIS A HB3  1  
ATOM   1422   H HD2  . HIS A 1 98  ? -23.632 7.050   -36.328 0.02 29.45 ? 91  HIS A HD2  1  
ATOM   1423   H HE1  . HIS A 1 98  ? -21.469 7.972   -39.515 0.02 30.40 ? 91  HIS A HE1  1  
ATOM   1424   H HE2  . HIS A 1 98  ? -21.967 8.543   -37.267 0.02 30.15 ? 91  HIS A HE2  1  
ATOM   1425   N N    . LYS A 1 99  ? -26.790 6.267   -36.443 0.02 29.15 ? 92  LYS A N    1  
ATOM   1426   C CA   . LYS A 1 99  ? -26.927 7.241   -35.374 0.02 29.27 ? 92  LYS A CA   1  
ATOM   1427   C C    . LYS A 1 99  ? -25.779 6.952   -34.389 0.02 29.16 ? 92  LYS A C    1  
ATOM   1428   O O    . LYS A 1 99  ? -25.049 5.978   -34.563 0.02 28.99 ? 92  LYS A O    1  
ATOM   1429   C CB   . LYS A 1 99  ? -28.349 7.151   -34.810 0.02 29.16 ? 92  LYS A CB   1  
ATOM   1430   C CG   . LYS A 1 99  ? -28.867 8.488   -34.225 0.02 29.49 ? 92  LYS A CG   1  
ATOM   1431   C CD   . LYS A 1 99  ? -30.216 8.927   -34.822 0.02 29.63 ? 92  LYS A CD   1  
ATOM   1432   C CE   . LYS A 1 99  ? -30.071 9.599   -36.132 0.02 29.98 ? 92  LYS A CE   1  
ATOM   1433   N NZ   . LYS A 1 99  ? -31.100 10.687  -36.148 0.02 30.35 ? 92  LYS A NZ   1  
ATOM   1434   H H    . LYS A 1 99  ? -26.982 5.467   -36.198 0.02 28.93 ? 92  LYS A H    1  
ATOM   1435   H HA   . LYS A 1 99  ? -26.807 8.130   -35.736 0.02 29.54 ? 92  LYS A HA   1  
ATOM   1436   H HB2  . LYS A 1 99  ? -28.949 6.901   -35.528 0.02 29.08 ? 92  LYS A HB2  1  
ATOM   1437   H HB3  . LYS A 1 99  ? -28.383 6.477   -34.116 0.02 28.98 ? 92  LYS A HB3  1  
ATOM   1438   H HG2  . LYS A 1 99  ? -29.012 8.354   -33.275 0.02 29.43 ? 92  LYS A HG2  1  
ATOM   1439   H HG3  . LYS A 1 99  ? -28.223 9.189   -34.388 0.02 29.70 ? 92  LYS A HG3  1  
ATOM   1440   H HD2  . LYS A 1 99  ? -30.768 8.142   -34.964 0.02 29.44 ? 92  LYS A HD2  1  
ATOM   1441   H HD3  . LYS A 1 99  ? -30.657 9.531   -34.205 0.02 29.72 ? 92  LYS A HD3  1  
ATOM   1442   H HE2  . LYS A 1 99  ? -29.182 9.972   -36.222 0.02 30.06 ? 92  LYS A HE2  1  
ATOM   1443   H HE3  . LYS A 1 99  ? -30.264 8.969   -36.845 0.02 29.93 ? 92  LYS A HE3  1  
ATOM   1444   H HZ1  . LYS A 1 99  ? -30.870 11.306  -36.741 0.02 30.58 ? 92  LYS A HZ1  1  
ATOM   1445   H HZ2  . LYS A 1 99  ? -31.893 10.356  -36.370 0.02 30.32 ? 92  LYS A HZ2  1  
ATOM   1446   H HZ3  . LYS A 1 99  ? -31.160 11.071  -35.350 0.02 30.40 ? 92  LYS A HZ3  1  
ATOM   1447   N N    . ASP A 1 100 ? -25.530 7.794   -33.375 0.02 29.29 ? 93  ASP A N    1  
ATOM   1448   C CA   . ASP A 1 100 ? -24.267 7.458   -32.706 0.02 29.23 ? 93  ASP A CA   1  
ATOM   1449   C C    . ASP A 1 100 ? -24.482 6.475   -31.553 0.02 28.91 ? 93  ASP A C    1  
ATOM   1450   O O    . ASP A 1 100 ? -25.593 6.049   -31.253 0.02 28.74 ? 93  ASP A O    1  
ATOM   1451   C CB   . ASP A 1 100 ? -23.501 8.682   -32.230 0.02 29.59 ? 93  ASP A CB   1  
ATOM   1452   C CG   . ASP A 1 100 ? -24.283 9.520   -31.351 0.02 29.72 ? 93  ASP A CG   1  
ATOM   1453   O OD1  . ASP A 1 100 ? -24.281 10.746  -31.612 0.02 30.11 ? 93  ASP A OD1  1  
ATOM   1454   O OD2  . ASP A 1 100 ? -24.899 8.944   -30.427 0.02 29.48 ? 93  ASP A OD2  1  
ATOM   1455   H H    . ASP A 1 100 ? -25.997 8.448   -33.079 0.02 29.42 ? 93  ASP A H    1  
ATOM   1456   H HA   . ASP A 1 100 ? -23.668 7.024   -33.329 0.02 29.20 ? 93  ASP A HA   1  
ATOM   1457   H HB2  . ASP A 1 100 ? -22.703 8.409   -31.746 0.02 29.56 ? 93  ASP A HB2  1  
ATOM   1458   H HB3  . ASP A 1 100 ? -23.253 9.220   -32.998 0.02 29.81 ? 93  ASP A HB3  1  
ATOM   1459   N N    . LYS A 1 101 ? -23.373 6.095   -30.951 0.02 28.87 ? 94  LYS A N    1  
ATOM   1460   C CA   . LYS A 1 101 ? -23.324 5.037   -29.965 0.02 28.58 ? 94  LYS A CA   1  
ATOM   1461   C C    . LYS A 1 101 ? -23.668 5.619   -28.591 0.02 28.66 ? 94  LYS A C    1  
ATOM   1462   O O    . LYS A 1 101 ? -23.613 6.828   -28.370 0.02 28.95 ? 94  LYS A O    1  
ATOM   1463   C CB   . LYS A 1 101 ? -21.937 4.380   -29.979 0.02 28.55 ? 94  LYS A CB   1  
ATOM   1464   C CG   . LYS A 1 101 ? -20.779 5.329   -29.634 0.02 28.87 ? 94  LYS A CG   1  
ATOM   1465   C CD   . LYS A 1 101 ? -19.399 4.675   -29.736 0.02 28.90 ? 94  LYS A CD   1  
ATOM   1466   C CE   . LYS A 1 101 ? -19.123 4.107   -31.130 0.02 28.85 ? 94  LYS A CE   1  
ATOM   1467   N NZ   . LYS A 1 101 ? -17.711 3.664   -31.293 0.02 28.99 ? 94  LYS A NZ   1  
ATOM   1468   H H    . LYS A 1 101 ? -22.606 6.451   -31.097 0.02 29.03 ? 94  LYS A H    1  
ATOM   1469   H HA   . LYS A 1 101 ? -23.984 4.362   -30.176 0.02 28.39 ? 94  LYS A HA   1  
ATOM   1470   H HB2  . LYS A 1 101 ? -21.925 3.653   -29.339 0.02 28.37 ? 94  LYS A HB2  1  
ATOM   1471   H HB3  . LYS A 1 101 ? -21.775 4.030   -30.864 0.02 28.52 ? 94  LYS A HB3  1  
ATOM   1472   H HG2  . LYS A 1 101 ? -20.800 6.087   -30.237 0.02 29.08 ? 94  LYS A HG2  1  
ATOM   1473   H HG3  . LYS A 1 101 ? -20.890 5.633   -28.720 0.02 28.91 ? 94  LYS A HG3  1  
ATOM   1474   H HD2  . LYS A 1 101 ? -18.715 5.336   -29.547 0.02 29.14 ? 94  LYS A HD2  1  
ATOM   1475   H HD3  . LYS A 1 101 ? -19.346 3.949   -29.099 0.02 28.72 ? 94  LYS A HD3  1  
ATOM   1476   H HE2  . LYS A 1 101 ? -19.686 3.332   -31.271 0.02 28.61 ? 94  LYS A HE2  1  
ATOM   1477   H HE3  . LYS A 1 101 ? -19.317 4.785   -31.795 0.02 29.00 ? 94  LYS A HE3  1  
ATOM   1478   H HZ1  . LYS A 1 101 ? -17.689 2.850   -31.650 0.02 28.85 ? 94  LYS A HZ1  1  
ATOM   1479   H HZ2  . LYS A 1 101 ? -17.271 4.224   -31.826 0.02 29.23 ? 94  LYS A HZ2  1  
ATOM   1480   H HZ3  . LYS A 1 101 ? -17.309 3.638   -30.499 0.02 29.01 ? 94  LYS A HZ3  1  
ATOM   1481   N N    . SER A 1 102 ? -24.075 4.739   -27.689 0.02 28.42 ? 95  SER A N    1  
ATOM   1482   C CA   . SER A 1 102 ? -24.323 5.127   -26.301 0.02 28.51 ? 95  SER A CA   1  
ATOM   1483   C C    . SER A 1 102 ? -23.083 5.791   -25.696 0.02 28.75 ? 95  SER A C    1  
ATOM   1484   O O    . SER A 1 102 ? -21.950 5.471   -26.043 0.02 28.76 ? 95  SER A O    1  
ATOM   1485   C CB   . SER A 1 102 ? -24.741 3.876   -25.524 0.02 28.23 ? 95  SER A CB   1  
ATOM   1486   O OG   . SER A 1 102 ? -24.972 4.135   -24.147 0.02 28.33 ? 95  SER A OG   1  
ATOM   1487   H H    . SER A 1 102 ? -24.217 3.914   -27.858 0.02 28.24 ? 95  SER A H    1  
ATOM   1488   H HA   . SER A 1 102 ? -25.055 5.760   -26.257 0.02 28.62 ? 95  SER A HA   1  
ATOM   1489   H HB2  . SER A 1 102 ? -25.554 3.523   -25.918 0.02 28.12 ? 95  SER A HB2  1  
ATOM   1490   H HB3  . SER A 1 102 ? -24.031 3.223   -25.610 0.02 28.13 ? 95  SER A HB3  1  
ATOM   1491   H HG   . SER A 1 102 ? -25.797 4.145   -23.997 0.02 28.30 ? 95  SER A HG   1  
ATOM   1492   N N    . VAL A 1 103 ? -23.294 6.730   -24.757 0.02 28.99 ? 96  VAL A N    1  
ATOM   1493   C CA   . VAL A 1 103 ? -22.152 7.430   -24.181 0.02 29.28 ? 96  VAL A CA   1  
ATOM   1494   C C    . VAL A 1 103 ? -21.225 6.418   -23.518 0.02 29.15 ? 96  VAL A C    1  
ATOM   1495   O O    . VAL A 1 103 ? -21.668 5.576   -22.731 0.02 28.94 ? 96  VAL A O    1  
ATOM   1496   C CB   . VAL A 1 103 ? -22.611 8.506   -23.174 0.02 29.58 ? 96  VAL A CB   1  
ATOM   1497   C CG1  . VAL A 1 103 ? -21.430 9.347   -22.760 0.02 29.95 ? 96  VAL A CG1  1  
ATOM   1498   C CG2  . VAL A 1 103 ? -23.709 9.378   -23.749 0.02 29.71 ? 96  VAL A CG2  1  
ATOM   1499   H H    . VAL A 1 103 ? -24.061 6.963   -24.448 0.02 29.01 ? 96  VAL A H    1  
ATOM   1500   H HA   . VAL A 1 103 ? -21.656 7.868   -24.886 0.02 29.43 ? 96  VAL A HA   1  
ATOM   1501   H HB   . VAL A 1 103 ? -22.962 8.077   -22.380 0.02 29.48 ? 96  VAL A HB   1  
ATOM   1502   H HG11 . VAL A 1 103 ? -21.716 9.982   -22.087 0.02 30.15 ? 96  VAL A HG11 1  
ATOM   1503   H HG12 . VAL A 1 103 ? -20.742 8.772   -22.397 0.02 29.88 ? 96  VAL A HG12 1  
ATOM   1504   H HG13 . VAL A 1 103 ? -21.087 9.816   -23.535 0.02 30.09 ? 96  VAL A HG13 1  
ATOM   1505   H HG21 . VAL A 1 103 ? -23.747 10.202  -23.242 0.02 29.98 ? 96  VAL A HG21 1  
ATOM   1506   H HG22 . VAL A 1 103 ? -23.494 9.572   -24.674 0.02 29.74 ? 96  VAL A HG22 1  
ATOM   1507   H HG23 . VAL A 1 103 ? -24.561 8.920   -23.692 0.02 29.54 ? 96  VAL A HG23 1  
ATOM   1508   N N    . GLN A 1 104 ? -19.929 6.542   -23.784 0.02 29.32 ? 97  GLN A N    1  
ATOM   1509   C CA   . GLN A 1 104 ? -18.960 5.539   -23.393 0.02 29.22 ? 97  GLN A CA   1  
ATOM   1510   C C    . GLN A 1 104 ? -17.564 6.108   -23.539 0.02 29.57 ? 97  GLN A C    1  
ATOM   1511   O O    . GLN A 1 104 ? -17.349 7.134   -24.192 0.02 29.85 ? 97  GLN A O    1  
ATOM   1512   C CB   . GLN A 1 104 ? -19.111 4.256   -24.226 0.02 28.87 ? 97  GLN A CB   1  
ATOM   1513   C CG   . GLN A 1 104 ? -18.964 4.485   -25.727 0.02 28.90 ? 97  GLN A CG   1  
ATOM   1514   C CD   . GLN A 1 104 ? -19.313 3.245   -26.508 0.02 28.57 ? 97  GLN A CD   1  
ATOM   1515   O OE1  . GLN A 1 104 ? -18.455 2.438   -26.795 0.02 28.52 ? 97  GLN A OE1  1  
ATOM   1516   N NE2  . GLN A 1 104 ? -20.573 3.080   -26.804 0.02 28.37 ? 97  GLN A NE2  1  
ATOM   1517   H H    . GLN A 1 104 ? -19.582 7.218   -24.178 0.02 29.52 ? 97  GLN A H    1  
ATOM   1518   H HA   . GLN A 1 104 ? -19.099 5.302   -22.465 0.02 29.20 ? 97  GLN A HA   1  
ATOM   1519   H HB2  . GLN A 1 104 ? -18.429 3.622   -23.959 0.02 28.84 ? 97  GLN A HB2  1  
ATOM   1520   H HB3  . GLN A 1 104 ? -19.992 3.882   -24.068 0.02 28.68 ? 97  GLN A HB3  1  
ATOM   1521   H HG2  . GLN A 1 104 ? -19.559 5.198   -26.003 0.02 28.98 ? 97  GLN A HG2  1  
ATOM   1522   H HG3  . GLN A 1 104 ? -18.043 4.718   -25.923 0.02 29.09 ? 97  GLN A HG3  1  
ATOM   1523   H HE21 . GLN A 1 104 ? -21.102 3.751   -26.810 0.02 28.45 ? 97  GLN A HE21 1  
ATOM   1524   H HE22 . GLN A 1 104 ? -20.873 2.300   -26.979 0.02 28.18 ? 97  GLN A HE22 1  
ATOM   1525   N N    . VAL A 1 105 ? -16.618 5.433   -22.905 0.02 29.60 ? 98  VAL A N    1  
ATOM   1526   C CA   . VAL A 1 105 ? -15.206 5.781   -22.983 0.02 29.96 ? 98  VAL A CA   1  
ATOM   1527   C C    . VAL A 1 105 ? -14.606 5.023   -24.160 0.02 29.84 ? 98  VAL A C    1  
ATOM   1528   O O    . VAL A 1 105 ? -14.500 3.797   -24.129 0.02 29.59 ? 98  VAL A O    1  
ATOM   1529   C CB   . VAL A 1 105 ? -14.475 5.416   -21.678 0.02 30.10 ? 98  VAL A CB   1  
ATOM   1530   C CG1  . VAL A 1 105 ? -12.969 5.532   -21.852 0.02 30.44 ? 98  VAL A CG1  1  
ATOM   1531   C CG2  . VAL A 1 105 ? -14.966 6.254   -20.524 0.02 30.34 ? 98  VAL A CG2  1  
ATOM   1532   H H    . VAL A 1 105 ? -16.772 4.747   -22.416 0.02 29.44 ? 98  VAL A H    1  
ATOM   1533   H HA   . VAL A 1 105 ? -15.113 6.733   -23.139 0.02 30.21 ? 98  VAL A HA   1  
ATOM   1534   H HB   . VAL A 1 105 ? -14.673 4.495   -21.457 0.02 29.85 ? 98  VAL A HB   1  
ATOM   1535   H HG11 . VAL A 1 105 ? -12.547 5.572   -20.978 0.02 30.60 ? 98  VAL A HG11 1  
ATOM   1536   H HG12 . VAL A 1 105 ? -12.646 4.755   -22.332 0.02 30.27 ? 98  VAL A HG12 1  
ATOM   1537   H HG13 . VAL A 1 105 ? -12.773 6.334   -22.361 0.02 30.67 ? 98  VAL A HG13 1  
ATOM   1538   H HG21 . VAL A 1 105 ? -15.412 7.050   -20.856 0.02 30.44 ? 98  VAL A HG21 1  
ATOM   1539   H HG22 . VAL A 1 105 ? -15.586 5.719   -20.005 0.02 30.13 ? 98  VAL A HG22 1  
ATOM   1540   H HG23 . VAL A 1 105 ? -14.207 6.513   -19.980 0.02 30.61 ? 98  VAL A HG23 1  
ATOM   1541   N N    . ASP A 1 106 ? -14.220 5.722   -25.212 0.02 30.04 ? 99  ASP A N    1  
ATOM   1542   C CA   . ASP A 1 106 ? -13.724 4.929   -26.318 0.02 29.94 ? 99  ASP A CA   1  
ATOM   1543   C C    . ASP A 1 106 ? -12.319 4.441   -26.022 0.02 30.17 ? 99  ASP A C    1  
ATOM   1544   O O    . ASP A 1 106 ? -11.514 5.077   -25.330 0.02 30.54 ? 99  ASP A O    1  
ATOM   1545   C CB   . ASP A 1 106 ? -13.777 5.627   -27.663 0.02 30.09 ? 99  ASP A CB   1  
ATOM   1546   C CG   . ASP A 1 106 ? -13.057 4.817   -28.729 0.02 30.08 ? 99  ASP A CG   1  
ATOM   1547   O OD1  . ASP A 1 106 ? -13.654 3.804   -29.179 0.02 29.70 ? 99  ASP A OD1  1  
ATOM   1548   O OD2  . ASP A 1 106 ? -11.888 5.119   -29.035 0.02 30.46 ? 99  ASP A OD2  1  
ATOM   1549   H H    . ASP A 1 106 ? -14.233 6.576   -25.312 0.02 30.24 ? 99  ASP A H    1  
ATOM   1550   H HA   . ASP A 1 106 ? -14.280 4.146   -26.402 0.02 29.63 ? 99  ASP A HA   1  
ATOM   1551   H HB2  . ASP A 1 106 ? -14.705 5.651   -27.936 0.02 29.88 ? 99  ASP A HB2  1  
ATOM   1552   H HB3  . ASP A 1 106 ? -13.443 6.523   -27.601 0.02 30.41 ? 99  ASP A HB3  1  
ATOM   1553   N N    . PHE A 1 107 ? -12.081 3.269   -26.538 0.02 29.98 ? 100 PHE A N    1  
ATOM   1554   C CA   . PHE A 1 107 ? -10.995 2.380   -26.209 0.02 30.11 ? 100 PHE A CA   1  
ATOM   1555   C C    . PHE A 1 107 ? -9.649  2.874   -26.701 0.02 30.60 ? 100 PHE A C    1  
ATOM   1556   O O    . PHE A 1 107 ? -8.620  2.592   -26.069 0.02 30.89 ? 100 PHE A O    1  
ATOM   1557   C CB   . PHE A 1 107 ? -11.346 1.047   -26.847 0.02 29.77 ? 100 PHE A CB   1  
ATOM   1558   C CG   . PHE A 1 107 ? -11.883 1.184   -28.265 0.02 29.64 ? 100 PHE A CG   1  
ATOM   1559   C CD1  . PHE A 1 107 ? -11.034 1.511   -29.318 0.02 29.94 ? 100 PHE A CD1  1  
ATOM   1560   C CD2  . PHE A 1 107 ? -13.229 1.008   -28.544 0.02 29.26 ? 100 PHE A CD2  1  
ATOM   1561   C CE1  . PHE A 1 107 ? -11.507 1.606   -30.623 0.02 29.85 ? 100 PHE A CE1  1  
ATOM   1562   C CE2  . PHE A 1 107 ? -13.708 1.123   -29.855 0.02 29.18 ? 100 PHE A CE2  1  
ATOM   1563   C CZ   . PHE A 1 107 ? -12.849 1.414   -30.887 0.02 29.47 ? 100 PHE A CZ   1  
ATOM   1564   H H    . PHE A 1 107 ? -12.618 2.954   -27.117 0.02 29.78 ? 100 PHE A H    1  
ATOM   1565   H HA   . PHE A 1 107 ? -10.947 2.258   -25.248 0.02 30.11 ? 100 PHE A HA   1  
ATOM   1566   H HB2  . PHE A 1 107 ? -10.556 0.489   -26.873 0.02 29.93 ? 100 PHE A HB2  1  
ATOM   1567   H HB3  . PHE A 1 107 ? -12.030 0.624   -26.305 0.02 29.52 ? 100 PHE A HB3  1  
ATOM   1568   H HD1  . PHE A 1 107 ? -10.130 1.621   -29.146 0.02 30.22 ? 100 PHE A HD1  1  
ATOM   1569   H HD2  . PHE A 1 107 ? -13.817 0.793   -27.856 0.02 29.09 ? 100 PHE A HD2  1  
ATOM   1570   H HE1  . PHE A 1 107 ? -10.921 1.819   -31.316 0.02 30.08 ? 100 PHE A HE1  1  
ATOM   1571   H HE2  . PHE A 1 107 ? -14.612 0.993   -30.035 0.02 28.95 ? 100 PHE A HE2  1  
ATOM   1572   H HZ   . PHE A 1 107 ? -13.175 1.497   -31.751 0.02 29.43 ? 100 PHE A HZ   1  
ATOM   1573   N N    . ILE A 1 108 ? -9.645  3.603   -27.809 0.02 30.74 ? 101 ILE A N    1  
ATOM   1574   C CA   . ILE A 1 108 ? -8.422  4.086   -28.408 0.02 31.24 ? 101 ILE A CA   1  
ATOM   1575   C C    . ILE A 1 108 ? -8.204  5.538   -28.028 0.02 31.67 ? 101 ILE A C    1  
ATOM   1576   O O    . ILE A 1 108 ? -7.242  5.857   -27.328 0.02 32.04 ? 101 ILE A O    1  
ATOM   1577   C CB   . ILE A 1 108 ? -8.459  3.877   -29.953 0.02 31.23 ? 101 ILE A CB   1  
ATOM   1578   C CG1  . ILE A 1 108 ? -7.923  2.494   -30.365 0.02 31.13 ? 101 ILE A CG1  1  
ATOM   1579   C CG2  . ILE A 1 108 ? -7.638  4.881   -30.627 0.02 31.77 ? 101 ILE A CG2  1  
ATOM   1580   C CD1  . ILE A 1 108 ? -6.447  2.304   -30.128 0.02 31.57 ? 101 ILE A CD1  1  
ATOM   1581   H H    . ILE A 1 108 ? -10.355 3.851   -28.223 0.02 30.57 ? 101 ILE A H    1  
ATOM   1582   H HA   . ILE A 1 108 ? -7.680  3.575   -28.055 0.02 31.35 ? 101 ILE A HA   1  
ATOM   1583   H HB   . ILE A 1 108 ? -9.373  3.956   -30.273 0.02 30.97 ? 101 ILE A HB   1  
ATOM   1584   H HG12 . ILE A 1 108 ? -8.375  1.811   -29.851 0.02 30.80 ? 101 ILE A HG12 1  
ATOM   1585   H HG13 . ILE A 1 108 ? -8.092  2.358   -31.309 0.02 31.13 ? 101 ILE A HG13 1  
ATOM   1586   H HG21 . ILE A 1 108 ? -7.432  4.563   -31.520 0.02 31.80 ? 101 ILE A HG21 1  
ATOM   1587   H HG22 . ILE A 1 108 ? -8.135  5.713   -30.678 0.02 31.83 ? 101 ILE A HG22 1  
ATOM   1588   H HG23 . ILE A 1 108 ? -6.812  5.006   -30.133 0.02 32.07 ? 101 ILE A HG23 1  
ATOM   1589   H HD11 . ILE A 1 108 ? -6.262  2.385   -29.179 0.02 31.61 ? 101 ILE A HD11 1  
ATOM   1590   H HD12 . ILE A 1 108 ? -6.197  1.416   -30.429 0.02 31.47 ? 101 ILE A HD12 1  
ATOM   1591   H HD13 . ILE A 1 108 ? -5.945  2.969   -30.624 0.02 31.92 ? 101 ILE A HD13 1  
ATOM   1592   N N    . THR A 1 109 ? -9.133  6.422   -28.436 0.02 31.62 ? 102 THR A N    1  
ATOM   1593   C CA   . THR A 1 109 ? -9.105  7.813   -28.002 0.02 32.01 ? 102 THR A CA   1  
ATOM   1594   C C    . THR A 1 109 ? -8.895  7.906   -26.499 0.02 32.10 ? 102 THR A C    1  
ATOM   1595   O O    . THR A 1 109 ? -8.124  8.752   -26.029 0.02 32.61 ? 102 THR A O    1  
ATOM   1596   C CB   . THR A 1 109 ? -10.407 8.522   -28.413 0.02 31.83 ? 102 THR A CB   1  
ATOM   1597   O OG1  . THR A 1 109 ? -10.337 9.947   -28.190 0.02 32.31 ? 102 THR A OG1  1  
ATOM   1598   C CG2  . THR A 1 109 ? -11.535 8.003   -27.636 0.02 31.36 ? 102 THR A CG2  1  
ATOM   1599   H H    . THR A 1 109 ? -9.790  6.233   -28.957 0.02 31.39 ? 102 THR A H    1  
ATOM   1600   H HA   . THR A 1 109 ? -8.366  8.260   -28.447 0.02 32.39 ? 102 THR A HA   1  
ATOM   1601   H HB   . THR A 1 109 ? -10.578 8.354   -29.354 0.02 31.74 ? 102 THR A HB   1  
ATOM   1602   H HG1  . THR A 1 109 ? -10.504 10.125  -27.385 0.02 32.38 ? 102 THR A HG1  1  
ATOM   1603   H HG21 . THR A 1 109 ? -11.524 8.374   -26.741 0.02 31.48 ? 102 THR A HG21 1  
ATOM   1604   H HG22 . THR A 1 109 ? -12.365 8.252   -28.068 0.02 31.22 ? 102 THR A HG22 1  
ATOM   1605   H HG23 . THR A 1 109 ? -11.468 7.039   -27.581 0.02 31.08 ? 102 THR A HG23 1  
ATOM   1606   N N    . GLY A 1 110 ? -9.556  7.037   -25.730 0.02 31.65 ? 103 GLY A N    1  
ATOM   1607   C CA   . GLY A 1 110 ? -9.478  7.093   -24.285 0.02 31.73 ? 103 GLY A CA   1  
ATOM   1608   C C    . GLY A 1 110 ? -10.505 7.992   -23.635 0.02 31.74 ? 103 GLY A C    1  
ATOM   1609   O O    . GLY A 1 110 ? -10.938 7.690   -22.508 0.02 31.61 ? 103 GLY A O    1  
ATOM   1610   H H    . GLY A 1 110 ? -10.061 6.409   -26.030 0.02 31.31 ? 103 GLY A H    1  
ATOM   1611   H HA2  . GLY A 1 110 ? -9.581  6.202   -23.916 0.02 31.46 ? 103 GLY A HA2  1  
ATOM   1612   H HA3  . GLY A 1 110 ? -8.598  7.418   -24.033 0.02 32.10 ? 103 GLY A HA3  1  
ATOM   1613   N N    . LYS A 1 111 ? -10.912 9.073   -24.304 0.02 31.93 ? 104 LYS A N    1  
ATOM   1614   C CA   . LYS A 1 111 ? -11.888 10.027  -23.794 0.02 31.98 ? 104 LYS A CA   1  
ATOM   1615   C C    . LYS A 1 111 ? -13.282 9.668   -24.303 0.02 31.48 ? 104 LYS A C    1  
ATOM   1616   O O    . LYS A 1 111 ? -13.453 8.755   -25.110 0.02 31.16 ? 104 LYS A O    1  
ATOM   1617   C CB   . LYS A 1 111 ? -11.573 11.465  -24.233 0.02 32.51 ? 104 LYS A CB   1  
ATOM   1618   C CG   . LYS A 1 111 ? -10.082 11.919  -24.289 0.02 33.11 ? 104 LYS A CG   1  
ATOM   1619   C CD   . LYS A 1 111 ? -9.701  12.626  -25.636 0.02 33.40 ? 104 LYS A CD   1  
ATOM   1620   C CE   . LYS A 1 111 ? -9.159  14.073  -25.481 0.02 34.14 ? 104 LYS A CE   1  
ATOM   1621   N NZ   . LYS A 1 111 ? -8.121  14.229  -24.428 0.02 34.53 ? 104 LYS A NZ   1  
ATOM   1622   H H    . LYS A 1 111 ? -10.626 9.279   -25.088 0.02 32.06 ? 104 LYS A H    1  
ATOM   1623   H HA   . LYS A 1 111 ? -11.898 9.987   -22.828 0.02 32.03 ? 104 LYS A HA   1  
ATOM   1624   H HB2  . LYS A 1 111 ? -11.947 11.580  -25.122 0.02 32.40 ? 104 LYS A HB2  1  
ATOM   1625   H HB3  . LYS A 1 111 ? -12.025 12.064  -23.615 0.02 32.61 ? 104 LYS A HB3  1  
ATOM   1626   H HG2  . LYS A 1 111 ? -9.927  12.553  -23.570 0.02 33.41 ? 104 LYS A HG2  1  
ATOM   1627   H HG3  . LYS A 1 111 ? -9.507  11.145  -24.180 0.02 33.04 ? 104 LYS A HG3  1  
ATOM   1628   H HD2  . LYS A 1 111 ? -9.011  12.103  -26.071 0.02 33.35 ? 104 LYS A HD2  1  
ATOM   1629   H HD3  . LYS A 1 111 ? -10.483 12.671  -26.209 0.02 33.20 ? 104 LYS A HD3  1  
ATOM   1630   H HE2  . LYS A 1 111 ? -8.760  14.350  -26.323 0.02 34.35 ? 104 LYS A HE2  1  
ATOM   1631   H HE3  . LYS A 1 111 ? -9.895  14.667  -25.263 0.02 34.21 ? 104 LYS A HE3  1  
ATOM   1632   H HZ1  . LYS A 1 111 ? -7.562  14.890  -24.640 0.02 34.99 ? 104 LYS A HZ1  1  
ATOM   1633   H HZ2  . LYS A 1 111 ? -8.506  14.416  -23.647 0.02 34.43 ? 104 LYS A HZ2  1  
ATOM   1634   H HZ3  . LYS A 1 111 ? -7.657  13.473  -24.348 0.02 34.43 ? 104 LYS A HZ3  1  
ATOM   1635   N N    . VAL A 1 112 ? -14.276 10.425  -23.849 0.02 31.46 ? 105 VAL A N    1  
ATOM   1636   C CA   . VAL A 1 112 ? -15.660 10.008  -23.985 0.02 31.01 ? 105 VAL A CA   1  
ATOM   1637   C C    . VAL A 1 112 ? -16.175 10.346  -25.370 0.02 30.98 ? 105 VAL A C    1  
ATOM   1638   O O    . VAL A 1 112 ? -15.792 11.353  -25.981 0.02 31.38 ? 105 VAL A O    1  
ATOM   1639   C CB   . VAL A 1 112 ? -16.526 10.663  -22.895 0.02 31.07 ? 105 VAL A CB   1  
ATOM   1640   C CG1  . VAL A 1 112 ? -17.958 10.149  -22.960 0.02 30.62 ? 105 VAL A CG1  1  
ATOM   1641   C CG2  . VAL A 1 112 ? -15.919 10.416  -21.521 0.02 31.22 ? 105 VAL A CG2  1  
ATOM   1642   H H    . VAL A 1 112 ? -14.177 11.182  -23.457 0.02 31.73 ? 105 VAL A H    1  
ATOM   1643   H HA   . VAL A 1 112 ? -15.711 9.046   -23.880 0.02 30.71 ? 105 VAL A HA   1  
ATOM   1644   H HB   . VAL A 1 112 ? -16.546 11.620  -23.047 0.02 31.35 ? 105 VAL A HB   1  
ATOM   1645   H HG11 . VAL A 1 112 ? -18.445 10.483  -22.192 0.02 30.70 ? 105 VAL A HG11 1  
ATOM   1646   H HG12 . VAL A 1 112 ? -18.378 10.469  -23.772 0.02 30.55 ? 105 VAL A HG12 1  
ATOM   1647   H HG13 . VAL A 1 112 ? -17.948 9.181   -22.943 0.02 30.36 ? 105 VAL A HG13 1  
ATOM   1648   H HG21 . VAL A 1 112 ? -16.620 10.173  -20.900 0.02 31.06 ? 105 VAL A HG21 1  
ATOM   1649   H HG22 . VAL A 1 112 ? -15.273 9.696   -21.591 0.02 31.15 ? 105 VAL A HG22 1  
ATOM   1650   H HG23 . VAL A 1 112 ? -15.477 11.222  -21.216 0.02 31.60 ? 105 VAL A HG23 1  
ATOM   1651   N N    . CYS A 1 113 ? -17.017 9.466   -25.887 0.02 30.54 ? 106 CYS A N    1  
ATOM   1652   C CA   . CYS A 1 113 ? -17.649 9.606   -27.182 0.02 30.48 ? 106 CYS A CA   1  
ATOM   1653   C C    . CYS A 1 113 ? -19.074 9.134   -26.995 0.02 30.08 ? 106 CYS A C    1  
ATOM   1654   O O    . CYS A 1 113 ? -19.413 8.559   -25.953 0.02 29.85 ? 106 CYS A O    1  
ATOM   1655   C CB   . CYS A 1 113 ? -16.938 8.773   -28.241 0.02 30.45 ? 106 CYS A CB   1  
ATOM   1656   S SG   . CYS A 1 113 ? -16.974 6.999   -27.809 0.02 30.07 ? 106 CYS A SG   1  
ATOM   1657   H H    . CYS A 1 113 ? -17.252 8.746   -25.484 0.02 30.29 ? 106 CYS A H    1  
ATOM   1658   H HA   . CYS A 1 113 ? -17.654 10.536  -27.453 0.02 30.77 ? 106 CYS A HA   1  
ATOM   1659   H HB2  . CYS A 1 113 ? -17.382 8.891   -29.097 0.02 30.36 ? 106 CYS A HB2  1  
ATOM   1660   H HB3  . CYS A 1 113 ? -16.013 9.059   -28.301 0.02 30.77 ? 106 CYS A HB3  1  
ATOM   1661   H HG   . CYS A 1 113 ? -16.283 6.834   -26.841 0.02 30.31 ? 106 CYS A HG   1  
ATOM   1662   N N    . GLY A 1 114 ? -19.912 9.384   -27.997 0.02 30.04 ? 107 GLY A N    1  
ATOM   1663   C CA   . GLY A 1 114 ? -21.280 8.900   -27.998 0.02 29.72 ? 107 GLY A CA   1  
ATOM   1664   C C    . GLY A 1 114 ? -22.255 9.916   -27.429 0.02 29.92 ? 107 GLY A C    1  
ATOM   1665   O O    . GLY A 1 114 ? -21.886 11.000  -26.979 0.02 30.30 ? 107 GLY A O    1  
ATOM   1666   H H    . GLY A 1 114 ? -19.703 9.833   -28.695 0.02 30.22 ? 107 GLY A H    1  
ATOM   1667   H HA2  . GLY A 1 114 ? -21.549 8.696   -28.908 0.02 29.63 ? 107 GLY A HA2  1  
ATOM   1668   H HA3  . GLY A 1 114 ? -21.336 8.084   -27.477 0.02 29.49 ? 107 GLY A HA3  1  
ATOM   1669   N N    . SER A 1 115 ? -23.535 9.538   -27.438 0.02 29.68 ? 108 SER A N    1  
ATOM   1670   C CA   . SER A 1 115 ? -24.618 10.425  -27.042 0.02 29.87 ? 108 SER A CA   1  
ATOM   1671   C C    . SER A 1 115 ? -25.665 9.659   -26.248 0.02 29.61 ? 108 SER A C    1  
ATOM   1672   O O    . SER A 1 115 ? -25.771 8.439   -26.369 0.02 29.26 ? 108 SER A O    1  
ATOM   1673   C CB   . SER A 1 115 ? -25.297 11.069  -28.251 0.02 29.99 ? 108 SER A CB   1  
ATOM   1674   O OG   . SER A 1 115 ? -26.540 11.588  -27.844 0.02 30.09 ? 108 SER A OG   1  
ATOM   1675   H H    . SER A 1 115 ? -23.801 8.758   -27.668 0.02 29.43 ? 108 SER A H    1  
ATOM   1676   H HA   . SER A 1 115 ? -24.262 11.132  -26.480 0.02 30.13 ? 108 SER A HA   1  
ATOM   1677   H HB2  . SER A 1 115 ? -24.736 11.784  -28.590 0.02 30.25 ? 108 SER A HB2  1  
ATOM   1678   H HB3  . SER A 1 115 ? -25.449 10.412  -28.934 0.02 29.77 ? 108 SER A HB3  1  
ATOM   1679   H HG   . SER A 1 115 ? -27.108 11.483  -28.455 0.02 30.07 ? 108 SER A HG   1  
ATOM   1680   N N    . GLU A 1 116 ? -26.454 10.387  -25.444 0.02 29.82 ? 109 GLU A N    1  
ATOM   1681   C CA   . GLU A 1 116 ? -27.575 9.747   -24.757 0.02 29.63 ? 109 GLU A CA   1  
ATOM   1682   C C    . GLU A 1 116 ? -28.667 9.300   -25.712 0.02 29.48 ? 109 GLU A C    1  
ATOM   1683   O O    . GLU A 1 116 ? -29.484 8.449   -25.341 0.02 29.27 ? 109 GLU A O    1  
ATOM   1684   C CB   . GLU A 1 116 ? -28.218 10.670  -23.713 0.02 29.95 ? 109 GLU A CB   1  
ATOM   1685   C CG   . GLU A 1 116 ? -27.360 11.045  -22.528 0.02 30.13 ? 109 GLU A CG   1  
ATOM   1686   C CD   . GLU A 1 116 ? -28.203 11.712  -21.408 0.02 30.41 ? 109 GLU A CD   1  
ATOM   1687   O OE1  . GLU A 1 116 ? -28.424 12.937  -21.492 0.02 30.79 ? 109 GLU A OE1  1  
ATOM   1688   O OE2  . GLU A 1 116 ? -28.674 11.004  -20.493 0.02 30.28 ? 109 GLU A OE2  1  
ATOM   1689   H H    . GLU A 1 116 ? -26.362 11.220  -25.283 0.02 30.08 ? 109 GLU A H    1  
ATOM   1690   H HA   . GLU A 1 116 ? -27.247 8.961   -24.289 0.02 29.44 ? 109 GLU A HA   1  
ATOM   1691   H HB2  . GLU A 1 116 ? -28.481 11.492  -24.155 0.02 30.19 ? 109 GLU A HB2  1  
ATOM   1692   H HB3  . GLU A 1 116 ? -29.006 10.227  -23.361 0.02 29.85 ? 109 GLU A HB3  1  
ATOM   1693   H HG2  . GLU A 1 116 ? -26.944 10.247  -22.169 0.02 29.91 ? 109 GLU A HG2  1  
ATOM   1694   H HG3  . GLU A 1 116 ? -26.678 11.672  -22.811 0.02 30.31 ? 109 GLU A HG3  1  
ATOM   1695   N N    . ASP A 1 117 ? -28.731 9.890   -26.912 0.02 29.62 ? 110 ASP A N    1  
ATOM   1696   C CA   . ASP A 1 117 ? -29.769 9.600   -27.907 0.02 29.55 ? 110 ASP A CA   1  
ATOM   1697   C C    . ASP A 1 117 ? -29.277 8.416   -28.741 0.02 29.22 ? 110 ASP A C    1  
ATOM   1698   O O    . ASP A 1 117 ? -28.740 8.580   -29.833 0.02 29.27 ? 110 ASP A O    1  
ATOM   1699   C CB   . ASP A 1 117 ? -30.027 10.830  -28.775 0.02 29.91 ? 110 ASP A CB   1  
ATOM   1700   C CG   . ASP A 1 117 ? -31.127 10.619  -29.836 0.02 29.91 ? 110 ASP A CG   1  
ATOM   1701   O OD1  . ASP A 1 117 ? -31.701 9.517   -29.941 0.02 29.62 ? 110 ASP A OD1  1  
ATOM   1702   O OD2  . ASP A 1 117 ? -31.441 11.601  -30.555 0.02 30.25 ? 110 ASP A OD2  1  
ATOM   1703   H H    . ASP A 1 117 ? -28.159 10.469  -27.180 0.02 29.79 ? 110 ASP A H    1  
ATOM   1704   H HA   . ASP A 1 117 ? -30.597 9.351   -27.474 0.02 29.50 ? 110 ASP A HA   1  
ATOM   1705   H HB2  . ASP A 1 117 ? -30.305 11.562  -28.205 0.02 30.14 ? 110 ASP A HB2  1  
ATOM   1706   H HB3  . ASP A 1 117 ? -29.205 11.061  -29.237 0.02 29.97 ? 110 ASP A HB3  1  
ATOM   1707   N N    . CYS A 1 118 ? -29.432 7.200   -28.187 0.02 28.91 ? 111 CYS A N    1  
ATOM   1708   C CA   . CYS A 1 118 ? -28.766 6.036   -28.758 0.02 28.62 ? 111 CYS A CA   1  
ATOM   1709   C C    . CYS A 1 118 ? -29.651 4.812   -28.927 0.02 28.37 ? 111 CYS A C    1  
ATOM   1710   O O    . CYS A 1 118 ? -29.123 3.746   -29.252 0.02 28.14 ? 111 CYS A O    1  
ATOM   1711   C CB   . CYS A 1 118 ? -27.566 5.646   -27.912 0.02 28.52 ? 111 CYS A CB   1  
ATOM   1712   S SG   . CYS A 1 118 ? -28.017 5.180   -26.182 0.02 28.43 ? 111 CYS A SG   1  
ATOM   1713   H H    . CYS A 1 118 ? -29.913 7.032   -27.495 0.02 28.88 ? 111 CYS A H    1  
ATOM   1714   H HA   . CYS A 1 118 ? -28.430 6.264   -29.636 0.02 28.68 ? 111 CYS A HA   1  
ATOM   1715   H HB2  . CYS A 1 118 ? -27.119 4.892   -28.325 0.02 28.36 ? 111 CYS A HB2  1  
ATOM   1716   H HB3  . CYS A 1 118 ? -26.960 6.400   -27.876 0.02 28.70 ? 111 CYS A HB3  1  
ATOM   1717   H HG   . CYS A 1 118 ? -29.161 4.829   -26.154 0.02 28.38 ? 111 CYS A HG   1  
ATOM   1718   N N    . LEU A 1 119 ? -30.962 4.924   -28.750 0.02 28.45 ? 112 LEU A N    1  
ATOM   1719   C CA   . LEU A 1 119 ? -31.826 3.754   -28.706 0.02 28.27 ? 112 LEU A CA   1  
ATOM   1720   C C    . LEU A 1 119 ? -32.314 3.439   -30.125 0.02 28.26 ? 112 LEU A C    1  
ATOM   1721   O O    . LEU A 1 119 ? -33.465 3.664   -30.492 0.02 28.42 ? 112 LEU A O    1  
ATOM   1722   C CB   . LEU A 1 119 ? -32.965 3.976   -27.735 0.02 28.40 ? 112 LEU A CB   1  
ATOM   1723   C CG   . LEU A 1 119 ? -32.481 4.053   -26.250 0.02 28.40 ? 112 LEU A CG   1  
ATOM   1724   C CD1  . LEU A 1 119 ? -33.693 3.959   -25.371 0.02 28.54 ? 112 LEU A CD1  1  
ATOM   1725   C CD2  . LEU A 1 119 ? -31.434 2.980   -25.844 0.02 28.13 ? 112 LEU A CD2  1  
ATOM   1726   H H    . LEU A 1 119 ? -31.376 5.663   -28.661 0.02 28.63 ? 112 LEU A H    1  
ATOM   1727   H HA   . LEU A 1 119 ? -31.307 2.996   -28.405 0.02 28.09 ? 112 LEU A HA   1  
ATOM   1728   H HB2  . LEU A 1 119 ? -33.401 4.809   -27.954 0.02 28.61 ? 112 LEU A HB2  1  
ATOM   1729   H HB3  . LEU A 1 119 ? -33.604 3.252   -27.819 0.02 28.33 ? 112 LEU A HB3  1  
ATOM   1730   H HG   . LEU A 1 119 ? -32.074 4.918   -26.098 0.02 28.54 ? 112 LEU A HG   1  
ATOM   1731   H HD11 . LEU A 1 119 ? -33.418 4.026   -24.444 0.02 28.59 ? 112 LEU A HD11 1  
ATOM   1732   H HD12 . LEU A 1 119 ? -34.293 4.689   -25.592 0.02 28.73 ? 112 LEU A HD12 1  
ATOM   1733   H HD13 . LEU A 1 119 ? -34.137 3.110   -25.517 0.02 28.42 ? 112 LEU A HD13 1  
ATOM   1734   H HD21 . LEU A 1 119 ? -31.271 3.037   -24.893 0.02 28.17 ? 112 LEU A HD21 1  
ATOM   1735   H HD22 . LEU A 1 119 ? -31.790 2.102   -26.051 0.02 28.00 ? 112 LEU A HD22 1  
ATOM   1736   H HD23 . LEU A 1 119 ? -30.608 3.129   -26.325 0.02 28.09 ? 112 LEU A HD23 1  
ATOM   1737   N N    . TYR A 1 120 ? -31.394 2.889   -30.910 0.02 28.12 ? 113 TYR A N    1  
ATOM   1738   C CA   . TYR A 1 120 ? -31.633 2.569   -32.313 0.02 28.13 ? 113 TYR A CA   1  
ATOM   1739   C C    . TYR A 1 120 ? -31.238 1.136   -32.629 0.02 27.89 ? 113 TYR A C    1  
ATOM   1740   O O    . TYR A 1 120 ? -30.460 0.504   -31.919 0.02 27.71 ? 113 TYR A O    1  
ATOM   1741   C CB   . TYR A 1 120 ? -30.850 3.509   -33.226 0.02 28.32 ? 113 TYR A CB   1  
ATOM   1742   C CG   . TYR A 1 120 ? -31.259 4.943   -32.998 0.02 28.61 ? 113 TYR A CG   1  
ATOM   1743   C CD1  . TYR A 1 120 ? -32.369 5.471   -33.644 0.02 28.84 ? 113 TYR A CD1  1  
ATOM   1744   C CD2  . TYR A 1 120 ? -30.572 5.750   -32.104 0.02 28.71 ? 113 TYR A CD2  1  
ATOM   1745   C CE1  . TYR A 1 120 ? -32.779 6.767   -33.425 0.02 29.15 ? 113 TYR A CE1  1  
ATOM   1746   C CE2  . TYR A 1 120 ? -30.980 7.078   -31.861 0.02 29.02 ? 113 TYR A CE2  1  
ATOM   1747   C CZ   . TYR A 1 120 ? -32.086 7.578   -32.530 0.02 29.24 ? 113 TYR A CZ   1  
ATOM   1748   O OH   . TYR A 1 120 ? -32.503 8.884   -32.307 0.02 29.59 ? 113 TYR A OH   1  
ATOM   1749   H H    . TYR A 1 120 ? -30.603 2.698   -30.643 0.02 28.03 ? 113 TYR A H    1  
ATOM   1750   H HA   . TYR A 1 120 ? -32.575 2.670   -32.510 0.02 28.23 ? 113 TYR A HA   1  
ATOM   1751   H HB2  . TYR A 1 120 ? -29.905 3.419   -33.038 0.02 28.25 ? 113 TYR A HB2  1  
ATOM   1752   H HB3  . TYR A 1 120 ? -31.031 3.274   -34.150 0.02 28.34 ? 113 TYR A HB3  1  
ATOM   1753   H HD1  . TYR A 1 120 ? -32.846 4.940   -34.242 0.02 28.81 ? 113 TYR A HD1  1  
ATOM   1754   H HD2  . TYR A 1 120 ? -29.834 5.410   -31.654 0.02 28.58 ? 113 TYR A HD2  1  
ATOM   1755   H HE1  . TYR A 1 120 ? -33.523 7.094   -33.876 0.02 29.32 ? 113 TYR A HE1  1  
ATOM   1756   H HE2  . TYR A 1 120 ? -30.507 7.610   -31.264 0.02 29.11 ? 113 TYR A HE2  1  
ATOM   1757   H HH   . TYR A 1 120 ? -31.840 9.362   -32.131 0.02 29.67 ? 113 TYR A HH   1  
ATOM   1758   N N    . LEU A 1 121 ? -31.779 0.647   -33.742 0.02 27.91 ? 114 LEU A N    1  
ATOM   1759   C CA   . LEU A 1 121 ? -31.386 -0.640  -34.276 0.02 27.74 ? 114 LEU A CA   1  
ATOM   1760   C C    . LEU A 1 121 ? -31.228 -0.500  -35.784 0.02 27.88 ? 114 LEU A C    1  
ATOM   1761   O O    . LEU A 1 121 ? -31.790 0.404   -36.386 0.02 28.10 ? 114 LEU A O    1  
ATOM   1762   C CB   . LEU A 1 121 ? -32.409 -1.711  -33.923 0.02 27.67 ? 114 LEU A CB   1  
ATOM   1763   C CG   . LEU A 1 121 ? -33.865 -1.592  -34.320 0.02 27.85 ? 114 LEU A CG   1  
ATOM   1764   C CD1  . LEU A 1 121 ? -34.115 -1.966  -35.785 0.02 27.96 ? 114 LEU A CD1  1  
ATOM   1765   C CD2  . LEU A 1 121 ? -34.687 -2.478  -33.422 0.02 27.80 ? 114 LEU A CD2  1  
ATOM   1766   H H    . LEU A 1 121 ? -32.391 1.041   -34.191 0.02 28.05 ? 114 LEU A H    1  
ATOM   1767   H HA   . LEU A 1 121 ? -30.528 -0.899  -33.910 0.02 27.63 ? 114 LEU A HA   1  
ATOM   1768   H HB2  . LEU A 1 121 ? -32.089 -2.550  -34.283 0.02 27.57 ? 114 LEU A HB2  1  
ATOM   1769   H HB3  . LEU A 1 121 ? -32.417 -1.773  -32.956 0.02 27.60 ? 114 LEU A HB3  1  
ATOM   1770   H HG   . LEU A 1 121 ? -34.152 -0.672  -34.188 0.02 27.98 ? 114 LEU A HG   1  
ATOM   1771   H HD11 . LEU A 1 121 ? -35.071 -2.039  -35.925 0.02 28.08 ? 114 LEU A HD11 1  
ATOM   1772   H HD12 . LEU A 1 121 ? -33.745 -1.284  -36.364 0.02 28.05 ? 114 LEU A HD12 1  
ATOM   1773   H HD13 . LEU A 1 121 ? -33.694 -2.820  -35.970 0.02 27.84 ? 114 LEU A HD13 1  
ATOM   1774   H HD21 . LEU A 1 121 ? -35.592 -2.534  -33.760 0.02 27.93 ? 114 LEU A HD21 1  
ATOM   1775   H HD22 . LEU A 1 121 ? -34.286 -3.358  -33.402 0.02 27.66 ? 114 LEU A HD22 1  
ATOM   1776   H HD23 . LEU A 1 121 ? -34.691 -2.103  -32.530 0.02 27.78 ? 114 LEU A HD23 1  
ATOM   1777   N N    . SER A 1 122 ? -30.468 -1.422  -36.373 0.02 27.77 ? 115 SER A N    1  
ATOM   1778   C CA   . SER A 1 122 ? -30.187 -1.428  -37.809 0.02 27.92 ? 115 SER A CA   1  
ATOM   1779   C C    . SER A 1 122 ? -30.598 -2.757  -38.416 0.02 27.86 ? 115 SER A C    1  
ATOM   1780   O O    . SER A 1 122 ? -30.396 -3.809  -37.809 0.02 27.68 ? 115 SER A O    1  
ATOM   1781   C CB   . SER A 1 122 ? -28.715 -1.197  -38.067 0.02 27.93 ? 115 SER A CB   1  
ATOM   1782   O OG   . SER A 1 122 ? -28.323 0.116   -37.715 0.02 28.07 ? 115 SER A OG   1  
ATOM   1783   H H    . SER A 1 122 ? -30.095 -2.070  -35.953 0.02 27.64 ? 115 SER A H    1  
ATOM   1784   H HA   . SER A 1 122 ? -30.698 -0.734  -38.249 0.02 28.09 ? 115 SER A HA   1  
ATOM   1785   H HB2  . SER A 1 122 ? -28.202 -1.838  -37.552 0.02 27.78 ? 115 SER A HB2  1  
ATOM   1786   H HB3  . SER A 1 122 ? -28.544 -1.338  -39.010 0.02 28.03 ? 115 SER A HB3  1  
ATOM   1787   H HG   . SER A 1 122 ? -27.488 0.180   -37.713 0.02 28.07 ? 115 SER A HG   1  
ATOM   1788   N N    . VAL A 1 123 ? -31.131 -2.716  -39.643 0.02 28.06 ? 116 VAL A N    1  
ATOM   1789   C CA   . VAL A 1 123 ? -31.719 -3.896  -40.278 0.02 28.08 ? 116 VAL A CA   1  
ATOM   1790   C C    . VAL A 1 123 ? -31.051 -4.102  -41.636 0.02 28.23 ? 116 VAL A C    1  
ATOM   1791   O O    . VAL A 1 123 ? -30.960 -3.161  -42.424 0.02 28.45 ? 116 VAL A O    1  
ATOM   1792   C CB   . VAL A 1 123 ? -33.242 -3.750  -40.446 0.02 28.25 ? 116 VAL A CB   1  
ATOM   1793   C CG1  . VAL A 1 123 ? -33.830 -4.976  -41.093 0.02 28.31 ? 116 VAL A CG1  1  
ATOM   1794   C CG2  . VAL A 1 123 ? -33.927 -3.521  -39.085 0.02 28.16 ? 116 VAL A CG2  1  
ATOM   1795   H H    . VAL A 1 123 ? -31.161 -2.010  -40.126 0.02 28.21 ? 116 VAL A H    1  
ATOM   1796   H HA   . VAL A 1 123 ? -31.545 -4.681  -39.738 0.02 27.93 ? 116 VAL A HA   1  
ATOM   1797   H HB   . VAL A 1 123 ? -33.432 -2.992  -41.015 0.02 28.43 ? 116 VAL A HB   1  
ATOM   1798   H HG11 . VAL A 1 123 ? -34.792 -4.883  -41.120 0.02 28.44 ? 116 VAL A HG11 1  
ATOM   1799   H HG12 . VAL A 1 123 ? -33.487 -5.072  -41.994 0.02 28.41 ? 116 VAL A HG12 1  
ATOM   1800   H HG13 . VAL A 1 123 ? -33.587 -5.751  -40.563 0.02 28.16 ? 116 VAL A HG13 1  
ATOM   1801   H HG21 . VAL A 1 123 ? -34.869 -3.733  -39.164 0.02 28.25 ? 116 VAL A HG21 1  
ATOM   1802   H HG22 . VAL A 1 123 ? -33.518 -4.099  -38.425 0.02 27.98 ? 116 VAL A HG22 1  
ATOM   1803   H HG23 . VAL A 1 123 ? -33.812 -2.596  -38.826 0.02 28.21 ? 116 VAL A HG23 1  
ATOM   1804   N N    . TYR A 1 124 ? -30.581 -5.323  -41.897 0.02 28.16 ? 117 TYR A N    1  
ATOM   1805   C CA   . TYR A 1 124 ? -29.869 -5.616  -43.140 0.02 28.32 ? 117 TYR A CA   1  
ATOM   1806   C C    . TYR A 1 124 ? -30.394 -6.895  -43.773 0.02 28.39 ? 117 TYR A C    1  
ATOM   1807   O O    . TYR A 1 124 ? -30.698 -7.865  -43.076 0.02 28.24 ? 117 TYR A O    1  
ATOM   1808   C CB   . TYR A 1 124 ? -28.381 -5.771  -42.912 0.02 28.22 ? 117 TYR A CB   1  
ATOM   1809   C CG   . TYR A 1 124 ? -27.754 -4.758  -41.983 0.02 28.12 ? 117 TYR A CG   1  
ATOM   1810   C CD1  . TYR A 1 124 ? -27.495 -3.467  -42.405 0.02 28.32 ? 117 TYR A CD1  1  
ATOM   1811   C CD2  . TYR A 1 124 ? -27.404 -5.099  -40.683 0.02 27.88 ? 117 TYR A CD2  1  
ATOM   1812   C CE1  . TYR A 1 124 ? -26.916 -2.544  -41.583 0.02 28.28 ? 117 TYR A CE1  1  
ATOM   1813   C CE2  . TYR A 1 124 ? -26.814 -4.165  -39.837 0.02 27.83 ? 117 TYR A CE2  1  
ATOM   1814   C CZ   . TYR A 1 124 ? -26.582 -2.903  -40.280 0.02 28.03 ? 117 TYR A CZ   1  
ATOM   1815   O OH   . TYR A 1 124 ? -25.991 -1.988  -39.472 0.02 28.03 ? 117 TYR A OH   1  
ATOM   1816   H H    . TYR A 1 124 ? -30.676 -5.998  -41.380 0.02 28.03 ? 117 TYR A H    1  
ATOM   1817   H HA   . TYR A 1 124 ? -30.007 -4.896  -43.766 0.02 28.50 ? 117 TYR A HA   1  
ATOM   1818   H HB2  . TYR A 1 124 ? -28.220 -6.651  -42.547 0.02 28.10 ? 117 TYR A HB2  1  
ATOM   1819   H HB3  . TYR A 1 124 ? -27.929 -5.685  -43.762 0.02 28.38 ? 117 TYR A HB3  1  
ATOM   1820   H HD1  . TYR A 1 124 ? -27.719 -3.220  -43.273 0.02 28.50 ? 117 TYR A HD1  1  
ATOM   1821   H HD2  . TYR A 1 124 ? -27.566 -5.959  -40.375 0.02 27.77 ? 117 TYR A HD2  1  
ATOM   1822   H HE1  . TYR A 1 124 ? -26.751 -1.684  -41.884 0.02 28.44 ? 117 TYR A HE1  1  
ATOM   1823   H HE2  . TYR A 1 124 ? -26.582 -4.399  -38.970 0.02 27.69 ? 117 TYR A HE2  1  
ATOM   1824   H HH   . TYR A 1 124 ? -25.179 -1.923  -39.670 0.02 28.09 ? 117 TYR A HH   1  
ATOM   1825   N N    . THR A 1 125 ? -30.422 -6.919  -45.111 0.02 28.66 ? 118 THR A N    1  
ATOM   1826   C CA   . THR A 1 125 ? -30.868 -8.110  -45.827 0.02 28.80 ? 118 THR A CA   1  
ATOM   1827   C C    . THR A 1 125 ? -30.494 -7.965  -47.301 0.02 29.11 ? 118 THR A C    1  
ATOM   1828   O O    . THR A 1 125 ? -30.536 -6.857  -47.837 0.02 29.29 ? 118 THR A O    1  
ATOM   1829   C CB   . THR A 1 125 ? -32.383 -8.310  -45.699 0.02 28.88 ? 118 THR A CB   1  
ATOM   1830   O OG1  . THR A 1 125 ? -32.800 -9.465  -46.442 0.02 29.08 ? 118 THR A OG1  1  
ATOM   1831   C CG2  . THR A 1 125 ? -33.156 -7.110  -46.249 0.02 29.10 ? 118 THR A CG2  1  
ATOM   1832   H H    . THR A 1 125 ? -30.175 -6.268  -45.608 0.02 28.79 ? 118 THR A H    1  
ATOM   1833   H HA   . THR A 1 125 ? -30.416 -8.885  -45.469 0.02 28.67 ? 118 THR A HA   1  
ATOM   1834   H HB   . THR A 1 125 ? -32.612 -8.424  -44.764 0.02 28.71 ? 118 THR A HB   1  
ATOM   1835   H HG1  . THR A 1 125 ? -33.633 -9.555  -46.381 0.02 29.16 ? 118 THR A HG1  1  
ATOM   1836   H HG21 . THR A 1 125 ? -34.094 -7.197  -46.024 0.02 29.15 ? 118 THR A HG21 1  
ATOM   1837   H HG22 . THR A 1 125 ? -32.818 -6.285  -45.874 0.02 29.02 ? 118 THR A HG22 1  
ATOM   1838   H HG23 . THR A 1 125 ? -33.065 -7.072  -47.212 0.02 29.31 ? 118 THR A HG23 1  
ATOM   1839   N N    . ASN A 1 126 ? -30.123 -9.079  -47.945 0.02 29.22 ? 119 ASN A N    1  
ATOM   1840   C CA   . ASN A 1 126 ? -29.698 -8.979  -49.345 0.02 29.56 ? 119 ASN A CA   1  
ATOM   1841   C C    . ASN A 1 126 ? -30.867 -8.901  -50.325 0.02 29.88 ? 119 ASN A C    1  
ATOM   1842   O O    . ASN A 1 126 ? -30.626 -8.791  -51.535 0.02 30.21 ? 119 ASN A O    1  
ATOM   1843   C CB   . ASN A 1 126 ? -28.766 -10.156 -49.720 0.02 29.62 ? 119 ASN A CB   1  
ATOM   1844   C CG   . ASN A 1 126 ? -29.456 -11.491 -49.693 0.02 29.64 ? 119 ASN A CG   1  
ATOM   1845   O OD1  . ASN A 1 126 ? -30.622 -11.595 -50.031 0.02 29.79 ? 119 ASN A OD1  1  
ATOM   1846   N ND2  . ASN A 1 126 ? -28.715 -12.544 -49.322 0.02 29.54 ? 119 ASN A ND2  1  
ATOM   1847   H H    . ASN A 1 126 ? -30.119 -9.870  -47.618 0.02 29.13 ? 119 ASN A H    1  
ATOM   1848   H HA   . ASN A 1 126 ? -29.183 -8.166  -49.454 0.02 29.60 ? 119 ASN A HA   1  
ATOM   1849   H HB2  . ASN A 1 126 ? -28.413 -10.014 -50.610 0.02 29.86 ? 119 ASN A HB2  1  
ATOM   1850   H HB3  . ASN A 1 126 ? -28.034 -10.197 -49.088 0.02 29.44 ? 119 ASN A HB3  1  
ATOM   1851   H HD21 . ASN A 1 126 ? -29.065 -13.330 -49.299 0.02 29.58 ? 119 ASN A HD21 1  
ATOM   1852   H HD22 . ASN A 1 126 ? -27.889 -12.440 -49.116 0.02 29.46 ? 119 ASN A HD22 1  
ATOM   1853   N N    . ASN A 1 127 ? -32.113 -8.932  -49.854 0.02 29.83 ? 120 ASN A N    1  
ATOM   1854   C CA   . ASN A 1 127 ? -33.261 -8.926  -50.761 0.02 30.18 ? 120 ASN A CA   1  
ATOM   1855   C C    . ASN A 1 127 ? -34.519 -8.562  -49.993 0.02 30.11 ? 120 ASN A C    1  
ATOM   1856   O O    . ASN A 1 127 ? -34.858 -9.227  -49.020 0.02 29.89 ? 120 ASN A O    1  
ATOM   1857   C CB   . ASN A 1 127 ? -33.419 -10.307 -51.423 0.02 30.36 ? 120 ASN A CB   1  
ATOM   1858   C CG   . ASN A 1 127 ? -34.645 -10.402 -52.351 0.02 30.76 ? 120 ASN A CG   1  
ATOM   1859   O OD1  . ASN A 1 127 ? -35.578 -9.602  -52.257 0.02 30.87 ? 120 ASN A OD1  1  
ATOM   1860   N ND2  . ASN A 1 127 ? -34.652 -11.409 -53.234 0.02 31.02 ? 120 ASN A ND2  1  
ATOM   1861   H H    . ASN A 1 127 ? -32.324 -8.956  -49.023 0.02 29.63 ? 120 ASN A H    1  
ATOM   1862   H HA   . ASN A 1 127 ? -33.120 -8.260  -51.453 0.02 30.38 ? 120 ASN A HA   1  
ATOM   1863   H HB2  . ASN A 1 127 ? -32.623 -10.496 -51.943 0.02 30.43 ? 120 ASN A HB2  1  
ATOM   1864   H HB3  . ASN A 1 127 ? -33.530 -10.972 -50.729 0.02 30.17 ? 120 ASN A HB3  1  
ATOM   1865   H HD21 . ASN A 1 127 ? -34.154 -12.101 -53.105 0.02 30.93 ? 120 ASN A HD21 1  
ATOM   1866   H HD22 . ASN A 1 127 ? -35.162 -11.372 -53.925 0.02 31.30 ? 120 ASN A HD22 1  
ATOM   1867   N N    . LEU A 1 128 ? -35.279 -7.582  -50.486 0.02 30.37 ? 121 LEU A N    1  
ATOM   1868   C CA   . LEU A 1 128 ? -36.399 -7.094  -49.684 0.02 30.32 ? 121 LEU A CA   1  
ATOM   1869   C C    . LEU A 1 128 ? -37.743 -7.713  -50.026 0.02 30.61 ? 121 LEU A C    1  
ATOM   1870   O O    . LEU A 1 128 ? -38.648 -7.691  -49.181 0.02 30.55 ? 121 LEU A O    1  
ATOM   1871   C CB   . LEU A 1 128 ? -36.537 -5.585  -49.823 0.02 30.45 ? 121 LEU A CB   1  
ATOM   1872   C CG   . LEU A 1 128 ? -36.275 -4.761  -48.580 0.02 30.14 ? 121 LEU A CG   1  
ATOM   1873   C CD1  . LEU A 1 128 ? -37.198 -3.550  -48.571 0.02 30.38 ? 121 LEU A CD1  1  
ATOM   1874   C CD2  . LEU A 1 128 ? -36.380 -5.567  -47.266 0.02 29.80 ? 121 LEU A CD2  1  
ATOM   1875   H H    . LEU A 1 128 ? -35.179 -7.207  -51.252 0.02 30.58 ? 121 LEU A H    1  
ATOM   1876   H HA   . LEU A 1 128 ? -36.221 -7.362  -48.778 0.02 30.05 ? 121 LEU A HA   1  
ATOM   1877   H HB2  . LEU A 1 128 ? -35.909 -5.284  -50.496 0.02 30.56 ? 121 LEU A HB2  1  
ATOM   1878   H HB3  . LEU A 1 128 ? -37.438 -5.392  -50.121 0.02 30.68 ? 121 LEU A HB3  1  
ATOM   1879   H HG   . LEU A 1 128 ? -35.368 -4.425  -48.647 0.02 30.06 ? 121 LEU A HG   1  
ATOM   1880   H HD11 . LEU A 1 128 ? -36.756 -2.820  -49.031 0.02 30.50 ? 121 LEU A HD11 1  
ATOM   1881   H HD12 . LEU A 1 128 ? -38.032 -3.770  -49.015 0.02 30.60 ? 121 LEU A HD12 1  
ATOM   1882   H HD13 . LEU A 1 128 ? -37.378 -3.298  -47.652 0.02 30.21 ? 121 LEU A HD13 1  
ATOM   1883   H HD21 . LEU A 1 128 ? -36.406 -4.945  -46.523 0.02 29.69 ? 121 LEU A HD21 1  
ATOM   1884   H HD22 . LEU A 1 128 ? -37.186 -6.109  -47.275 0.02 29.89 ? 121 LEU A HD22 1  
ATOM   1885   H HD23 . LEU A 1 128 ? -35.602 -6.140  -47.186 0.02 29.62 ? 121 LEU A HD23 1  
ATOM   1886   N N    . ASN A 1 129 ? -37.888 -8.312  -51.199 0.02 30.94 ? 122 ASN A N    1  
ATOM   1887   C CA   . ASN A 1 129 ? -39.163 -8.879  -51.635 0.02 31.28 ? 122 ASN A CA   1  
ATOM   1888   C C    . ASN A 1 129 ? -39.140 -10.393 -51.597 0.02 31.27 ? 122 ASN A C    1  
ATOM   1889   O O    . ASN A 1 129 ? -39.886 -11.027 -52.353 0.02 31.64 ? 122 ASN A O    1  
ATOM   1890   C CB   . ASN A 1 129 ? -39.500 -8.438  -53.051 0.02 31.77 ? 122 ASN A CB   1  
ATOM   1891   C CG   . ASN A 1 129 ? -39.545 -6.976  -53.171 0.02 31.86 ? 122 ASN A CG   1  
ATOM   1892   O OD1  . ASN A 1 129 ? -38.961 -6.260  -52.343 0.02 31.54 ? 122 ASN A OD1  1  
ATOM   1893   N ND2  . ASN A 1 129 ? -40.270 -6.493  -54.174 0.02 32.32 ? 122 ASN A ND2  1  
ATOM   1894   H H    . ASN A 1 129 ? -37.251 -8.406  -51.769 0.02 31.01 ? 122 ASN A H    1  
ATOM   1895   H HA   . ASN A 1 129 ? -39.872 -8.577  -51.046 0.02 31.25 ? 122 ASN A HA   1  
ATOM   1896   H HB2  . ASN A 1 129 ? -38.824 -8.771  -53.660 0.02 31.84 ? 122 ASN A HB2  1  
ATOM   1897   H HB3  . ASN A 1 129 ? -40.372 -8.787  -53.292 0.02 32.01 ? 122 ASN A HB3  1  
ATOM   1898   H HD21 . ASN A 1 129 ? -40.934 -6.948  -54.475 0.02 32.51 ? 122 ASN A HD21 1  
ATOM   1899   H HD22 . ASN A 1 129 ? -40.078 -5.731  -54.524 0.02 32.44 ? 122 ASN A HD22 1  
ATOM   1900   N N    . PRO A 1 130 ? -38.328 -11.006 -50.730 0.02 30.89 ? 123 PRO A N    1  
ATOM   1901   C CA   . PRO A 1 130 ? -37.868 -12.348 -51.057 0.02 30.95 ? 123 PRO A CA   1  
ATOM   1902   C C    . PRO A 1 130 ? -39.052 -13.262 -51.306 0.02 31.31 ? 123 PRO A C    1  
ATOM   1903   O O    . PRO A 1 130 ? -40.190 -12.965 -50.917 0.02 31.44 ? 123 PRO A O    1  
ATOM   1904   C CB   . PRO A 1 130 ? -37.058 -12.771 -49.822 0.02 30.51 ? 123 PRO A CB   1  
ATOM   1905   C CG   . PRO A 1 130 ? -36.909 -11.555 -49.001 0.02 30.22 ? 123 PRO A CG   1  
ATOM   1906   C CD   . PRO A 1 130 ? -38.111 -10.743 -49.292 0.02 30.45 ? 123 PRO A CD   1  
ATOM   1907   H HA   . PRO A 1 130 ? -37.295 -12.335 -51.838 0.02 31.05 ? 123 PRO A HA   1  
ATOM   1908   H HB2  . PRO A 1 130 ? -37.534 -13.462 -49.330 0.02 30.50 ? 123 PRO A HB2  1  
ATOM   1909   H HB3  . PRO A 1 130 ? -36.187 -13.087 -50.106 0.02 30.47 ? 123 PRO A HB3  1  
ATOM   1910   H HG2  . PRO A 1 130 ? -36.881 -11.803 -48.062 0.02 29.97 ? 123 PRO A HG2  1  
ATOM   1911   H HG3  . PRO A 1 130 ? -36.101 -11.090 -49.258 0.02 30.18 ? 123 PRO A HG3  1  
ATOM   1912   H HD2  . PRO A 1 130 ? -38.861 -11.069 -48.769 0.02 30.42 ? 123 PRO A HD2  1  
ATOM   1913   H HD3  . PRO A 1 130 ? -37.917 -9.834  -49.087 0.02 30.35 ? 123 PRO A HD3  1  
ATOM   1914   N N    . GLU A 1 131 ? -38.759 -14.367 -52.004 0.02 31.52 ? 124 GLU A N    1  
ATOM   1915   C CA   . GLU A 1 131 ? -39.754 -15.352 -52.397 0.02 31.92 ? 124 GLU A CA   1  
ATOM   1916   C C    . GLU A 1 131 ? -40.476 -15.955 -51.182 0.02 31.81 ? 124 GLU A C    1  
ATOM   1917   O O    . GLU A 1 131 ? -41.698 -15.794 -51.098 0.02 32.06 ? 124 GLU A O    1  
ATOM   1918   C CB   . GLU A 1 131 ? -39.118 -16.462 -53.291 0.02 32.14 ? 124 GLU A CB   1  
ATOM   1919   C CG   . GLU A 1 131 ? -37.659 -16.223 -53.967 0.02 32.07 ? 124 GLU A CG   1  
ATOM   1920   C CD   . GLU A 1 131 ? -37.595 -15.590 -55.389 0.02 32.44 ? 124 GLU A CD   1  
ATOM   1921   O OE1  . GLU A 1 131 ? -38.339 -15.978 -56.340 0.02 32.93 ? 124 GLU A OE1  1  
ATOM   1922   O OE2  . GLU A 1 131 ? -36.733 -14.690 -55.568 0.02 32.27 ? 124 GLU A OE2  1  
ATOM   1923   H H    . GLU A 1 131 ? -37.962 -14.555 -52.245 0.02 31.46 ? 124 GLU A H    1  
ATOM   1924   H HA   . GLU A 1 131 ? -40.427 -14.907 -52.934 0.02 32.20 ? 124 GLU A HA   1  
ATOM   1925   H HB2  . GLU A 1 131 ? -39.039 -17.263 -52.747 0.02 32.01 ? 124 GLU A HB2  1  
ATOM   1926   H HB3  . GLU A 1 131 ? -39.739 -16.636 -54.014 0.02 32.51 ? 124 GLU A HB3  1  
ATOM   1927   H HG2  . GLU A 1 131 ? -37.108 -15.679 -53.386 0.02 31.73 ? 124 GLU A HG2  1  
ATOM   1928   H HG3  . GLU A 1 131 ? -37.234 -17.092 -54.053 0.02 32.14 ? 124 GLU A HG3  1  
ATOM   1929   N N    . THR A 1 132 ? -39.771 -16.597 -50.223 0.02 31.47 ? 125 THR A N    1  
ATOM   1930   C CA   . THR A 1 132 ? -40.374 -16.966 -48.936 0.02 31.34 ? 125 THR A CA   1  
ATOM   1931   C C    . THR A 1 132 ? -39.547 -16.461 -47.746 0.02 30.81 ? 125 THR A C    1  
ATOM   1932   O O    . THR A 1 132 ? -38.358 -16.143 -47.857 0.02 30.55 ? 125 THR A O    1  
ATOM   1933   C CB   . THR A 1 132 ? -40.594 -18.492 -48.751 0.02 31.55 ? 125 THR A CB   1  
ATOM   1934   O OG1  . THR A 1 132 ? -39.675 -18.981 -47.780 0.02 31.18 ? 125 THR A OG1  1  
ATOM   1935   C CG2  . THR A 1 132 ? -40.402 -19.280 -50.017 0.02 31.93 ? 125 THR A CG2  1  
ATOM   1936   H H    . THR A 1 132 ? -38.944 -16.823 -50.296 0.02 31.34 ? 125 THR A H    1  
ATOM   1937   H HA   . THR A 1 132 ? -41.245 -16.544 -48.875 0.02 31.49 ? 125 THR A HA   1  
ATOM   1938   H HB   . THR A 1 132 ? -41.497 -18.647 -48.431 0.02 31.72 ? 125 THR A HB   1  
ATOM   1939   H HG1  . THR A 1 132 ? -38.889 -18.905 -48.070 0.02 31.06 ? 125 THR A HG1  1  
ATOM   1940   H HG21 . THR A 1 132 ? -40.998 -18.956 -50.710 0.02 32.22 ? 125 THR A HG21 1  
ATOM   1941   H HG22 . THR A 1 132 ? -39.486 -19.203 -50.322 0.02 31.79 ? 125 THR A HG22 1  
ATOM   1942   H HG23 . THR A 1 132 ? -40.597 -20.213 -49.840 0.02 32.06 ? 125 THR A HG23 1  
ATOM   1943   N N    . LYS A 1 133 ? -40.190 -16.455 -46.589 0.02 30.71 ? 126 LYS A N    1  
ATOM   1944   C CA   . LYS A 1 133 ? -39.773 -15.610 -45.473 0.02 30.29 ? 126 LYS A CA   1  
ATOM   1945   C C    . LYS A 1 133 ? -38.491 -16.085 -44.798 0.02 29.92 ? 126 LYS A C    1  
ATOM   1946   O O    . LYS A 1 133 ? -38.335 -17.259 -44.476 0.02 29.98 ? 126 LYS A O    1  
ATOM   1947   C CB   . LYS A 1 133 ? -40.905 -15.550 -44.474 0.02 30.35 ? 126 LYS A CB   1  
ATOM   1948   C CG   . LYS A 1 133 ? -42.017 -14.617 -44.889 0.02 30.60 ? 126 LYS A CG   1  
ATOM   1949   C CD   . LYS A 1 133 ? -43.355 -15.315 -45.205 0.02 31.04 ? 126 LYS A CD   1  
ATOM   1950   C CE   . LYS A 1 133 ? -44.428 -14.227 -45.243 0.02 31.33 ? 126 LYS A CE   1  
ATOM   1951   N NZ   . LYS A 1 133 ? -43.915 -12.974 -45.974 0.02 31.26 ? 126 LYS A NZ   1  
ATOM   1952   H H    . LYS A 1 133 ? -40.884 -16.932 -46.424 0.02 30.89 ? 126 LYS A H    1  
ATOM   1953   H HA   . LYS A 1 133 ? -39.614 -14.710 -45.799 0.02 30.25 ? 126 LYS A HA   1  
ATOM   1954   H HB2  . LYS A 1 133 ? -41.279 -16.441 -44.386 0.02 30.53 ? 126 LYS A HB2  1  
ATOM   1955   H HB3  . LYS A 1 133 ? -40.562 -15.239 -43.620 0.02 30.07 ? 126 LYS A HB3  1  
ATOM   1956   H HG2  . LYS A 1 133 ? -42.175 -13.988 -44.169 0.02 30.41 ? 126 LYS A HG2  1  
ATOM   1957   H HG3  . LYS A 1 133 ? -41.742 -14.137 -45.685 0.02 30.71 ? 126 LYS A HG3  1  
ATOM   1958   H HD2  . LYS A 1 133 ? -43.316 -15.749 -46.072 0.02 31.26 ? 126 LYS A HD2  1  
ATOM   1959   H HD3  . LYS A 1 133 ? -43.576 -15.955 -44.510 0.02 30.97 ? 126 LYS A HD3  1  
ATOM   1960   H HE2  . LYS A 1 133 ? -45.211 -14.566 -45.706 0.02 31.68 ? 126 LYS A HE2  1  
ATOM   1961   H HE3  . LYS A 1 133 ? -44.660 -13.976 -44.333 0.02 31.25 ? 126 LYS A HE3  1  
ATOM   1962   H HZ1  . LYS A 1 133 ? -43.242 -12.604 -45.526 0.02 30.95 ? 126 LYS A HZ1  1  
ATOM   1963   H HZ2  . LYS A 1 133 ? -43.627 -13.203 -46.784 0.02 31.39 ? 126 LYS A HZ2  1  
ATOM   1964   H HZ3  . LYS A 1 133 ? -44.566 -12.373 -46.059 0.02 31.42 ? 126 LYS A HZ3  1  
ATOM   1965   N N    . ARG A 1 134 ? -37.586 -15.130 -44.509 0.02 29.57 ? 127 ARG A N    1  
ATOM   1966   C CA   . ARG A 1 134 ? -36.252 -15.495 -44.064 0.02 29.28 ? 127 ARG A CA   1  
ATOM   1967   C C    . ARG A 1 134 ? -36.118 -15.570 -42.527 0.02 28.99 ? 127 ARG A C    1  
ATOM   1968   O O    . ARG A 1 134 ? -36.820 -14.873 -41.786 0.02 28.92 ? 127 ARG A O    1  
ATOM   1969   C CB   . ARG A 1 134 ? -35.241 -14.481 -44.606 0.02 29.15 ? 127 ARG A CB   1  
ATOM   1970   C CG   . ARG A 1 134 ? -35.277 -14.308 -46.120 0.02 29.44 ? 127 ARG A CG   1  
ATOM   1971   C CD   . ARG A 1 134 ? -34.292 -13.264 -46.544 0.02 29.34 ? 127 ARG A CD   1  
ATOM   1972   N NE   . ARG A 1 134 ? -33.947 -13.374 -47.955 0.02 29.63 ? 127 ARG A NE   1  
ATOM   1973   C CZ   . ARG A 1 134 ? -32.807 -12.952 -48.479 0.02 29.62 ? 127 ARG A CZ   1  
ATOM   1974   N NH1  . ARG A 1 134 ? -31.904 -12.372 -47.702 0.02 29.33 ? 127 ARG A NH1  1  
ATOM   1975   N NH2  . ARG A 1 134 ? -32.568 -13.131 -49.791 0.02 29.94 ? 127 ARG A NH2  1  
ATOM   1976   H H    . ARG A 1 134 ? -37.728 -14.285 -44.560 0.02 29.52 ? 127 ARG A H    1  
ATOM   1977   H HA   . ARG A 1 134 ? -36.041 -16.363 -44.436 0.02 29.40 ? 127 ARG A HA   1  
ATOM   1978   H HB2  . ARG A 1 134 ? -35.437 -13.617 -44.214 0.02 29.08 ? 127 ARG A HB2  1  
ATOM   1979   H HB3  . ARG A 1 134 ? -34.347 -14.761 -44.352 0.02 28.96 ? 127 ARG A HB3  1  
ATOM   1980   H HG2  . ARG A 1 134 ? -35.042 -15.146 -46.545 0.02 29.51 ? 127 ARG A HG2  1  
ATOM   1981   H HG3  . ARG A 1 134 ? -36.160 -14.025 -46.404 0.02 29.65 ? 127 ARG A HG3  1  
ATOM   1982   H HD2  . ARG A 1 134 ? -34.668 -12.393 -46.391 0.02 29.33 ? 127 ARG A HD2  1  
ATOM   1983   H HD3  . ARG A 1 134 ? -33.485 -13.373 -46.018 0.02 29.13 ? 127 ARG A HD3  1  
ATOM   1984   H HE   . ARG A 1 134 ? -34.452 -13.863 -48.449 0.02 29.83 ? 127 ARG A HE   1  
ATOM   1985   H HH11 . ARG A 1 134 ? -32.055 -12.266 -46.866 0.02 29.14 ? 127 ARG A HH11 1  
ATOM   1986   H HH12 . ARG A 1 134 ? -31.166 -12.094 -48.033 0.02 29.35 ? 127 ARG A HH12 1  
ATOM   1987   H HH21 . ARG A 1 134 ? -33.161 -13.505 -50.284 0.02 30.15 ? 127 ARG A HH21 1  
ATOM   1988   H HH22 . ARG A 1 134 ? -31.835 -12.849 -50.137 0.02 29.96 ? 127 ARG A HH22 1  
ATOM   1989   N N    . PRO A 1 135 ? -35.211 -16.408 -42.019 0.02 28.84 ? 128 PRO A N    1  
ATOM   1990   C CA   . PRO A 1 135 ? -34.883 -16.351 -40.584 0.02 28.56 ? 128 PRO A CA   1  
ATOM   1991   C C    . PRO A 1 135 ? -34.293 -15.000 -40.226 0.02 28.31 ? 128 PRO A C    1  
ATOM   1992   O O    . PRO A 1 135 ? -33.559 -14.402 -41.013 0.02 28.28 ? 128 PRO A O    1  
ATOM   1993   C CB   . PRO A 1 135 ? -33.841 -17.456 -40.395 0.02 28.51 ? 128 PRO A CB   1  
ATOM   1994   C CG   . PRO A 1 135 ? -33.967 -18.338 -41.643 0.02 28.82 ? 128 PRO A CG   1  
ATOM   1995   C CD   . PRO A 1 135 ? -34.475 -17.465 -42.733 0.02 28.97 ? 128 PRO A CD   1  
ATOM   1996   H HA   . PRO A 1 135 ? -35.660 -16.543 -40.037 0.02 28.62 ? 128 PRO A HA   1  
ATOM   1997   H HB2  . PRO A 1 135 ? -32.958 -17.067 -40.333 0.02 28.35 ? 128 PRO A HB2  1  
ATOM   1998   H HB3  . PRO A 1 135 ? -34.051 -17.956 -39.594 0.02 28.47 ? 128 PRO A HB3  1  
ATOM   1999   H HG2  . PRO A 1 135 ? -33.095 -18.696 -41.870 0.02 28.80 ? 128 PRO A HG2  1  
ATOM   2000   H HG3  . PRO A 1 135 ? -34.591 -19.059 -41.468 0.02 28.98 ? 128 PRO A HG3  1  
ATOM   2001   H HD2  . PRO A 1 135 ? -33.740 -17.088 -43.239 0.02 28.93 ? 128 PRO A HD2  1  
ATOM   2002   H HD3  . PRO A 1 135 ? -35.077 -17.965 -43.302 0.02 29.22 ? 128 PRO A HD3  1  
ATOM   2003   N N    . VAL A 1 136 ? -34.573 -14.558 -38.999 0.02 28.15 ? 129 VAL A N    1  
ATOM   2004   C CA   . VAL A 1 136 ? -34.119 -13.268 -38.488 0.02 27.94 ? 129 VAL A CA   1  
ATOM   2005   C C    . VAL A 1 136 ? -33.113 -13.520 -37.372 0.02 27.70 ? 129 VAL A C    1  
ATOM   2006   O O    . VAL A 1 136 ? -33.434 -14.198 -36.396 0.02 27.69 ? 129 VAL A O    1  
ATOM   2007   C CB   . VAL A 1 136 ? -35.299 -12.421 -37.979 0.02 28.01 ? 129 VAL A CB   1  
ATOM   2008   C CG1  . VAL A 1 136 ? -34.793 -11.077 -37.399 0.02 27.83 ? 129 VAL A CG1  1  
ATOM   2009   C CG2  . VAL A 1 136 ? -36.329 -12.191 -39.085 0.02 28.30 ? 129 VAL A CG2  1  
ATOM   2010   H H    . VAL A 1 136 ? -35.040 -15.003 -38.433 0.02 28.18 ? 129 VAL A H    1  
ATOM   2011   H HA   . VAL A 1 136 ? -33.670 -12.787 -39.198 0.02 27.95 ? 129 VAL A HA   1  
ATOM   2012   H HB   . VAL A 1 136 ? -35.742 -12.902 -37.263 0.02 28.02 ? 129 VAL A HB   1  
ATOM   2013   H HG11 . VAL A 1 136 ? -35.524 -10.440 -37.381 0.02 27.92 ? 129 VAL A HG11 1  
ATOM   2014   H HG12 . VAL A 1 136 ? -34.466 -11.223 -36.498 0.02 27.69 ? 129 VAL A HG12 1  
ATOM   2015   H HG13 . VAL A 1 136 ? -34.074 -10.748 -37.958 0.02 27.78 ? 129 VAL A HG13 1  
ATOM   2016   H HG21 . VAL A 1 136 ? -37.033 -11.614 -38.756 0.02 28.35 ? 129 VAL A HG21 1  
ATOM   2017   H HG22 . VAL A 1 136 ? -35.891 -11.777 -39.843 0.02 28.31 ? 129 VAL A HG22 1  
ATOM   2018   H HG23 . VAL A 1 136 ? -36.704 -13.044 -39.351 0.02 28.44 ? 129 VAL A HG23 1  
ATOM   2019   N N    . LEU A 1 137 ? -31.897 -13.014 -37.547 0.02 27.57 ? 130 LEU A N    1  
ATOM   2020   C CA   . LEU A 1 137 ? -30.839 -13.046 -36.547 0.02 27.37 ? 130 LEU A CA   1  
ATOM   2021   C C    . LEU A 1 137 ? -30.716 -11.664 -35.906 0.02 27.25 ? 130 LEU A C    1  
ATOM   2022   O O    . LEU A 1 137 ? -30.560 -10.663 -36.608 0.02 27.29 ? 130 LEU A O    1  
ATOM   2023   C CB   . LEU A 1 137 ? -29.501 -13.441 -37.177 0.02 27.37 ? 130 LEU A CB   1  
ATOM   2024   C CG   . LEU A 1 137 ? -29.234 -14.934 -37.384 0.02 27.47 ? 130 LEU A CG   1  
ATOM   2025   C CD1  . LEU A 1 137 ? -30.433 -15.564 -38.013 0.02 27.68 ? 130 LEU A CD1  1  
ATOM   2026   C CD2  . LEU A 1 137 ? -27.990 -15.135 -38.232 0.02 27.52 ? 130 LEU A CD2  1  
ATOM   2027   H H    . LEU A 1 137 ? -31.647 -12.629 -38.268 0.02 27.61 ? 130 LEU A H    1  
ATOM   2028   H HA   . LEU A 1 137 ? -31.057 -13.694 -35.862 0.02 27.36 ? 130 LEU A HA   1  
ATOM   2029   H HB2  . LEU A 1 137 ? -29.455 -13.026 -38.050 0.02 27.44 ? 130 LEU A HB2  1  
ATOM   2030   H HB3  . LEU A 1 137 ? -28.785 -13.093 -36.625 0.02 27.25 ? 130 LEU A HB3  1  
ATOM   2031   H HG   . LEU A 1 137 ? -29.085 -15.358 -36.528 0.02 27.42 ? 130 LEU A HG   1  
ATOM   2032   H HD11 . LEU A 1 137 ? -31.091 -15.742 -37.325 0.02 27.68 ? 130 LEU A HD11 1  
ATOM   2033   H HD12 . LEU A 1 137 ? -30.795 -14.959 -38.677 0.02 27.74 ? 130 LEU A HD12 1  
ATOM   2034   H HD13 . LEU A 1 137 ? -30.167 -16.387 -38.446 0.02 27.78 ? 130 LEU A HD13 1  
ATOM   2035   H HD21 . LEU A 1 137 ? -28.183 -15.763 -38.947 0.02 27.67 ? 130 LEU A HD21 1  
ATOM   2036   H HD22 . LEU A 1 137 ? -27.721 -14.284 -38.614 0.02 27.51 ? 130 LEU A HD22 1  
ATOM   2037   H HD23 . LEU A 1 137 ? -27.283 -15.478 -37.665 0.02 27.45 ? 130 LEU A HD23 1  
ATOM   2038   N N    . VAL A 1 138 ? -30.752 -11.617 -34.575 0.02 27.14 ? 131 VAL A N    1  
ATOM   2039   C CA   . VAL A 1 138 ? -30.658 -10.365 -33.817 0.02 27.06 ? 131 VAL A CA   1  
ATOM   2040   C C    . VAL A 1 138 ? -29.381 -10.419 -33.003 0.02 26.93 ? 131 VAL A C    1  
ATOM   2041   O O    . VAL A 1 138 ? -29.242 -11.291 -32.135 0.02 26.89 ? 131 VAL A O    1  
ATOM   2042   C CB   . VAL A 1 138 ? -31.858 -10.176 -32.878 0.02 27.11 ? 131 VAL A CB   1  
ATOM   2043   C CG1  . VAL A 1 138 ? -31.784 -8.809  -32.219 0.02 27.07 ? 131 VAL A CG1  1  
ATOM   2044   C CG2  . VAL A 1 138 ? -33.169 -10.348 -33.621 0.02 27.29 ? 131 VAL A CG2  1  
ATOM   2045   H H    . VAL A 1 138 ? -30.829 -12.309 -34.084 0.02 27.14 ? 131 VAL A H    1  
ATOM   2046   H HA   . VAL A 1 138 ? -30.611 -9.611  -34.417 0.02 27.10 ? 131 VAL A HA   1  
ATOM   2047   H HB   . VAL A 1 138 ? -31.821 -10.852 -32.189 0.02 27.08 ? 131 VAL A HB   1  
ATOM   2048   H HG11 . VAL A 1 138 ? -32.626 -8.636  -31.778 0.02 27.14 ? 131 VAL A HG11 1  
ATOM   2049   H HG12 . VAL A 1 138 ? -31.062 -8.809  -31.576 0.02 26.98 ? 131 VAL A HG12 1  
ATOM   2050   H HG13 . VAL A 1 138 ? -31.616 -8.133  -32.888 0.02 27.10 ? 131 VAL A HG13 1  
ATOM   2051   H HG21 . VAL A 1 138 ? -33.896 -9.974  -33.103 0.02 27.34 ? 131 VAL A HG21 1  
ATOM   2052   H HG22 . VAL A 1 138 ? -33.098 -9.889  -34.471 0.02 27.33 ? 131 VAL A HG22 1  
ATOM   2053   H HG23 . VAL A 1 138 ? -33.318 -11.291 -33.777 0.02 27.33 ? 131 VAL A HG23 1  
ATOM   2054   N N    . TYR A 1 139 ? -28.458 -9.508  -33.263 0.02 26.90 ? 132 TYR A N    1  
ATOM   2055   C CA   . TYR A 1 139 ? -27.173 -9.524  -32.590 0.02 26.83 ? 132 TYR A CA   1  
ATOM   2056   C C    . TYR A 1 139 ? -27.148 -8.467  -31.503 0.02 26.80 ? 132 TYR A C    1  
ATOM   2057   O O    . TYR A 1 139 ? -27.480 -7.312  -31.760 0.02 26.85 ? 132 TYR A O    1  
ATOM   2058   C CB   . TYR A 1 139 ? -26.008 -9.248  -33.522 0.02 26.89 ? 132 TYR A CB   1  
ATOM   2059   C CG   . TYR A 1 139 ? -24.699 -9.384  -32.805 0.02 26.86 ? 132 TYR A CG   1  
ATOM   2060   C CD1  . TYR A 1 139 ? -24.268 -10.624 -32.391 0.02 26.84 ? 132 TYR A CD1  1  
ATOM   2061   C CD2  . TYR A 1 139 ? -23.905 -8.293  -32.507 0.02 26.90 ? 132 TYR A CD2  1  
ATOM   2062   C CE1  . TYR A 1 139 ? -23.108 -10.787 -31.752 0.02 26.85 ? 132 TYR A CE1  1  
ATOM   2063   C CE2  . TYR A 1 139 ? -22.700 -8.459  -31.836 0.02 26.92 ? 132 TYR A CE2  1  
ATOM   2064   C CZ   . TYR A 1 139 ? -22.319 -9.720  -31.458 0.02 26.89 ? 132 TYR A CZ   1  
ATOM   2065   O OH   . TYR A 1 139 ? -21.155 -9.927  -30.781 0.02 26.95 ? 132 TYR A OH   1  
ATOM   2066   H H    . TYR A 1 139 ? -28.551 -8.870  -33.819 0.02 26.95 ? 132 TYR A H    1  
ATOM   2067   H HA   . TYR A 1 139 ? -27.031 -10.392 -32.196 0.02 26.81 ? 132 TYR A HA   1  
ATOM   2068   H HB2  . TYR A 1 139 ? -26.027 -9.888  -34.248 0.02 26.93 ? 132 TYR A HB2  1  
ATOM   2069   H HB3  . TYR A 1 139 ? -26.081 -8.344  -33.857 0.02 26.93 ? 132 TYR A HB3  1  
ATOM   2070   H HD1  . TYR A 1 139 ? -24.789 -11.365 -32.579 0.02 26.84 ? 132 TYR A HD1  1  
ATOM   2071   H HD2  . TYR A 1 139 ? -24.175 -7.445  -32.772 0.02 26.94 ? 132 TYR A HD2  1  
ATOM   2072   H HE1  . TYR A 1 139 ? -22.846 -11.638 -31.487 0.02 26.86 ? 132 TYR A HE1  1  
ATOM   2073   H HE2  . TYR A 1 139 ? -22.158 -7.732  -31.636 0.02 26.98 ? 132 TYR A HE2  1  
ATOM   2074   H HH   . TYR A 1 139 ? -20.533 -9.486  -31.130 0.02 27.03 ? 132 TYR A HH   1  
ATOM   2075   N N    . ILE A 1 140 ? -26.725 -8.865  -30.311 0.02 26.75 ? 133 ILE A N    1  
ATOM   2076   C CA   . ILE A 1 140 ? -26.562 -7.945  -29.181 0.02 26.75 ? 133 ILE A CA   1  
ATOM   2077   C C    . ILE A 1 140 ? -25.078 -7.882  -28.858 0.02 26.76 ? 133 ILE A C    1  
ATOM   2078   O O    . ILE A 1 140 ? -24.475 -8.883  -28.451 0.02 26.74 ? 133 ILE A O    1  
ATOM   2079   C CB   . ILE A 1 140 ? -27.359 -8.381  -27.945 0.02 26.74 ? 133 ILE A CB   1  
ATOM   2080   C CG1  . ILE A 1 140 ? -28.809 -8.672  -28.287 0.02 26.78 ? 133 ILE A CG1  1  
ATOM   2081   C CG2  . ILE A 1 140 ? -27.241 -7.321  -26.893 0.02 26.79 ? 133 ILE A CG2  1  
ATOM   2082   C CD1  . ILE A 1 140 ? -29.676 -9.091  -27.129 0.02 26.84 ? 133 ILE A CD1  1  
ATOM   2083   H H    . ILE A 1 140 ? -26.527 -9.675  -30.129 0.02 26.73 ? 133 ILE A H    1  
ATOM   2084   H HA   . ILE A 1 140 ? -26.861 -7.063  -29.441 0.02 26.79 ? 133 ILE A HA   1  
ATOM   2085   H HB   . ILE A 1 140 ? -26.965 -9.198  -27.599 0.02 26.72 ? 133 ILE A HB   1  
ATOM   2086   H HG12 . ILE A 1 140 ? -29.202 -7.877  -28.670 0.02 26.82 ? 133 ILE A HG12 1  
ATOM   2087   H HG13 . ILE A 1 140 ? -28.835 -9.387  -28.934 0.02 26.78 ? 133 ILE A HG13 1  
ATOM   2088   H HG21 . ILE A 1 140 ? -27.537 -7.687  -26.045 0.02 26.80 ? 133 ILE A HG21 1  
ATOM   2089   H HG22 . ILE A 1 140 ? -26.320 -7.033  -26.822 0.02 26.79 ? 133 ILE A HG22 1  
ATOM   2090   H HG23 . ILE A 1 140 ? -27.804 -6.575  -27.139 0.02 26.83 ? 133 ILE A HG23 1  
ATOM   2091   H HD11 . ILE A 1 140 ? -30.534 -9.393  -27.466 0.02 26.89 ? 133 ILE A HD11 1  
ATOM   2092   H HD12 . ILE A 1 140 ? -29.243 -9.813  -26.649 0.02 26.82 ? 133 ILE A HD12 1  
ATOM   2093   H HD13 . ILE A 1 140 ? -29.798 -8.332  -26.537 0.02 26.87 ? 133 ILE A HD13 1  
ATOM   2094   N N    . HIS A 1 141 ? -24.488 -6.703  -29.021 0.02 26.83 ? 134 HIS A N    1  
ATOM   2095   C CA   . HIS A 1 141 ? -23.054 -6.570  -28.886 0.02 26.90 ? 134 HIS A CA   1  
ATOM   2096   C C    . HIS A 1 141 ? -22.647 -6.688  -27.413 0.02 26.91 ? 134 HIS A C    1  
ATOM   2097   O O    . HIS A 1 141 ? -23.459 -6.497  -26.520 0.02 26.89 ? 134 HIS A O    1  
ATOM   2098   C CB   . HIS A 1 141 ? -22.580 -5.241  -29.447 0.02 27.03 ? 134 HIS A CB   1  
ATOM   2099   C CG   . HIS A 1 141 ? -23.050 -4.054  -28.673 0.02 27.09 ? 134 HIS A CG   1  
ATOM   2100   N ND1  . HIS A 1 141 ? -22.411 -3.639  -27.530 0.02 27.17 ? 134 HIS A ND1  1  
ATOM   2101   C CD2  . HIS A 1 141 ? -24.055 -3.174  -28.886 0.02 27.13 ? 134 HIS A CD2  1  
ATOM   2102   C CE1  . HIS A 1 141 ? -22.997 -2.541  -27.077 0.02 27.25 ? 134 HIS A CE1  1  
ATOM   2103   N NE2  . HIS A 1 141 ? -24.008 -2.248  -27.870 0.02 27.23 ? 134 HIS A NE2  1  
ATOM   2104   H H    . HIS A 1 141 ? -24.898 -5.973  -29.196 0.02 26.86 ? 134 HIS A H    1  
ATOM   2105   H HA   . HIS A 1 141 ? -22.617 -7.278  -29.377 0.02 26.89 ? 134 HIS A HA   1  
ATOM   2106   H HB2  . HIS A 1 141 ? -21.613 -5.228  -29.436 0.02 27.10 ? 134 HIS A HB2  1  
ATOM   2107   H HB3  . HIS A 1 141 ? -22.905 -5.139  -30.353 0.02 27.04 ? 134 HIS A HB3  1  
ATOM   2108   H HD1  . HIS A 1 141 ? -21.724 -4.020  -27.190 0.02 27.18 ? 134 HIS A HD1  1  
ATOM   2109   H HD2  . HIS A 1 141 ? -24.666 -3.190  -29.582 0.02 27.12 ? 134 HIS A HD2  1  
ATOM   2110   H HE1  . HIS A 1 141 ? -22.757 -2.082  -26.307 0.02 27.33 ? 134 HIS A HE1  1  
ATOM   2111   N N    . GLY A 1 142 ? -21.392 -7.074  -27.205 0.02 26.98 ? 135 GLY A N    1  
ATOM   2112   C CA   . GLY A 1 142 ? -20.762 -7.095  -25.902 0.02 27.05 ? 135 GLY A CA   1  
ATOM   2113   C C    . GLY A 1 142 ? -19.997 -5.817  -25.631 0.02 27.22 ? 135 GLY A C    1  
ATOM   2114   O O    . GLY A 1 142 ? -20.195 -4.794  -26.289 0.02 27.27 ? 135 GLY A O    1  
ATOM   2115   H H    . GLY A 1 142 ? -20.867 -7.343  -27.824 0.02 27.01 ? 135 GLY A H    1  
ATOM   2116   H HA2  . GLY A 1 142 ? -21.435 -7.215  -25.215 0.02 27.01 ? 135 GLY A HA2  1  
ATOM   2117   H HA3  . GLY A 1 142 ? -20.139 -7.832  -25.854 0.02 27.08 ? 135 GLY A HA3  1  
ATOM   2118   N N    . GLY A 1 143 ? -19.092 -5.883  -24.650 0.02 27.34 ? 136 GLY A N    1  
ATOM   2119   C CA   . GLY A 1 143 ? -18.375 -4.709  -24.189 0.02 27.55 ? 136 GLY A CA   1  
ATOM   2120   C C    . GLY A 1 143 ? -18.624 -4.377  -22.718 0.02 27.63 ? 136 GLY A C    1  
ATOM   2121   O O    . GLY A 1 143 ? -18.603 -3.207  -22.320 0.02 27.78 ? 136 GLY A O    1  
ATOM   2122   H H    . GLY A 1 143 ? -18.870 -6.607  -24.246 0.02 27.34 ? 136 GLY A H    1  
ATOM   2123   H HA2  . GLY A 1 143 ? -17.424 -4.853  -24.311 0.02 27.67 ? 136 GLY A HA2  1  
ATOM   2124   H HA3  . GLY A 1 143 ? -18.629 -3.941  -24.720 0.02 27.57 ? 136 GLY A HA3  1  
ATOM   2125   N N    . GLY A 1 144 ? -18.868 -5.407  -21.911 0.02 27.56 ? 137 GLY A N    1  
ATOM   2126   C CA   . GLY A 1 144 ? -18.946 -5.224  -20.468 0.02 27.68 ? 137 GLY A CA   1  
ATOM   2127   C C    . GLY A 1 144 ? -20.143 -4.436  -19.969 0.02 27.66 ? 137 GLY A C    1  
ATOM   2128   O O    . GLY A 1 144 ? -20.181 -4.052  -18.784 0.02 27.82 ? 137 GLY A O    1  
ATOM   2129   H H    . GLY A 1 144 ? -18.996 -6.210  -22.176 0.02 27.46 ? 137 GLY A H    1  
ATOM   2130   H HA2  . GLY A 1 144 ? -18.971 -6.096  -20.046 0.02 27.65 ? 137 GLY A HA2  1  
ATOM   2131   H HA3  . GLY A 1 144 ? -18.144 -4.771  -20.172 0.02 27.85 ? 137 GLY A HA3  1  
ATOM   2132   N N    . PHE A 1 145 ? -21.144 -4.219  -20.820 0.02 27.51 ? 138 PHE A N    1  
ATOM   2133   C CA   . PHE A 1 145 ? -22.248 -3.310  -20.557 0.02 27.54 ? 138 PHE A CA   1  
ATOM   2134   C C    . PHE A 1 145 ? -21.786 -1.854  -20.421 0.02 27.76 ? 138 PHE A C    1  
ATOM   2135   O O    . PHE A 1 145 ? -22.565 -1.008  -19.939 0.02 27.86 ? 138 PHE A O    1  
ATOM   2136   C CB   . PHE A 1 145 ? -23.027 -3.716  -19.299 0.02 27.58 ? 138 PHE A CB   1  
ATOM   2137   C CG   . PHE A 1 145 ? -23.654 -5.088  -19.389 0.02 27.42 ? 138 PHE A CG   1  
ATOM   2138   C CD1  . PHE A 1 145 ? -24.832 -5.291  -20.097 0.02 27.30 ? 138 PHE A CD1  1  
ATOM   2139   C CD2  . PHE A 1 145 ? -23.038 -6.175  -18.793 0.02 27.44 ? 138 PHE A CD2  1  
ATOM   2140   C CE1  . PHE A 1 145 ? -25.393 -6.548  -20.195 0.02 27.21 ? 138 PHE A CE1  1  
ATOM   2141   C CE2  . PHE A 1 145 ? -23.600 -7.414  -18.871 0.02 27.35 ? 138 PHE A CE2  1  
ATOM   2142   C CZ   . PHE A 1 145 ? -24.767 -7.611  -19.586 0.02 27.23 ? 138 PHE A CZ   1  
ATOM   2143   H H    . PHE A 1 145 ? -21.213 -4.618  -21.571 0.02 27.41 ? 138 PHE A H    1  
ATOM   2144   H HA   . PHE A 1 145 ? -22.868 -3.362  -21.297 0.02 27.44 ? 138 PHE A HA   1  
ATOM   2145   H HB2  . PHE A 1 145 ? -22.426 -3.701  -18.542 0.02 27.70 ? 138 PHE A HB2  1  
ATOM   2146   H HB3  . PHE A 1 145 ? -23.743 -3.079  -19.159 0.02 27.63 ? 138 PHE A HB3  1  
ATOM   2147   H HD1  . PHE A 1 145 ? -25.248 -4.574  -20.508 0.02 27.31 ? 138 PHE A HD1  1  
ATOM   2148   H HD2  . PHE A 1 145 ? -22.250 -6.057  -18.319 0.02 27.55 ? 138 PHE A HD2  1  
ATOM   2149   H HE1  . PHE A 1 145 ? -26.185 -6.678  -20.663 0.02 27.15 ? 138 PHE A HE1  1  
ATOM   2150   H HE2  . PHE A 1 145 ? -23.179 -8.135  -18.468 0.02 27.38 ? 138 PHE A HE2  1  
ATOM   2151   H HZ   . PHE A 1 145 ? -25.139 -8.459  -19.636 0.02 27.19 ? 138 PHE A HZ   1  
ATOM   2152   N N    . ILE A 1 146 ? -20.545 -1.554  -20.810 0.02 27.88 ? 139 ILE A N    1  
ATOM   2153   C CA   . ILE A 1 146 ? -19.996 -0.199  -20.729 0.02 28.14 ? 139 ILE A CA   1  
ATOM   2154   C C    . ILE A 1 146 ? -19.477 0.340   -22.067 0.02 28.18 ? 139 ILE A C    1  
ATOM   2155   O O    . ILE A 1 146 ? -19.259 1.555   -22.181 0.02 28.41 ? 139 ILE A O    1  
ATOM   2156   C CB   . ILE A 1 146 ? -18.878 -0.103  -19.666 0.02 28.38 ? 139 ILE A CB   1  
ATOM   2157   C CG1  . ILE A 1 146 ? -17.720 -1.067  -19.963 0.02 28.36 ? 139 ILE A CG1  1  
ATOM   2158   C CG2  . ILE A 1 146 ? -19.445 -0.352  -18.234 0.02 28.43 ? 139 ILE A CG2  1  
ATOM   2159   C CD1  . ILE A 1 146 ? -16.396 -0.585  -19.349 0.02 28.70 ? 139 ILE A CD1  1  
ATOM   2160   H H    . ILE A 1 146 ? -19.990 -2.126  -21.125 0.02 27.83 ? 139 ILE A H    1  
ATOM   2161   H HA   . ILE A 1 146 ? -20.704 0.392   -20.434 0.02 28.18 ? 139 ILE A HA   1  
ATOM   2162   H HB   . ILE A 1 146 ? -18.521 0.798   -19.688 0.02 28.58 ? 139 ILE A HB   1  
ATOM   2163   H HG12 . ILE A 1 146 ? -17.931 -1.937  -19.592 0.02 28.25 ? 139 ILE A HG12 1  
ATOM   2164   H HG13 . ILE A 1 146 ? -17.597 -1.150  -20.918 0.02 28.29 ? 139 ILE A HG13 1  
ATOM   2165   H HG21 . ILE A 1 146 ? -18.727 -0.244  -17.593 0.02 28.62 ? 139 ILE A HG21 1  
ATOM   2166   H HG22 . ILE A 1 146 ? -20.152 0.285   -18.047 0.02 28.47 ? 139 ILE A HG22 1  
ATOM   2167   H HG23 . ILE A 1 146 ? -19.795 -1.255  -18.191 0.02 28.27 ? 139 ILE A HG23 1  
ATOM   2168   H HD11 . ILE A 1 146 ? -15.702 -1.233  -19.533 0.02 28.70 ? 139 ILE A HD11 1  
ATOM   2169   H HD12 . ILE A 1 146 ? -16.156 0.275   -19.725 0.02 28.85 ? 139 ILE A HD12 1  
ATOM   2170   H HD13 . ILE A 1 146 ? -16.513 -0.500  -18.391 0.02 28.80 ? 139 ILE A HD13 1  
ATOM   2171   N N    . ILE A 1 147 ? -19.200 -0.487  -23.081 0.02 28.02 ? 140 ILE A N    1  
ATOM   2172   C CA   . ILE A 1 147 ? -18.844 0.008   -24.411 0.02 28.08 ? 140 ILE A CA   1  
ATOM   2173   C C    . ILE A 1 147 ? -19.604 -0.794  -25.458 0.02 27.82 ? 140 ILE A C    1  
ATOM   2174   O O    . ILE A 1 147 ? -20.218 -1.818  -25.169 0.02 27.62 ? 140 ILE A O    1  
ATOM   2175   C CB   . ILE A 1 147 ? -17.336 -0.061  -24.712 0.02 28.28 ? 140 ILE A CB   1  
ATOM   2176   C CG1  . ILE A 1 147 ? -16.863 -1.523  -24.753 0.02 28.13 ? 140 ILE A CG1  1  
ATOM   2177   C CG2  . ILE A 1 147 ? -16.546 0.780   -23.736 0.02 28.59 ? 140 ILE A CG2  1  
ATOM   2178   C CD1  . ILE A 1 147 ? -15.404 -1.697  -25.091 0.02 28.35 ? 140 ILE A CD1  1  
ATOM   2179   H H    . ILE A 1 147 ? -19.212 -1.341  -23.022 0.02 27.89 ? 140 ILE A H    1  
ATOM   2180   H HA   . ILE A 1 147 ? -19.116 0.934   -24.500 0.02 28.19 ? 140 ILE A HA   1  
ATOM   2181   H HB   . ILE A 1 147 ? -17.205 0.311   -25.596 0.02 28.33 ? 140 ILE A HB   1  
ATOM   2182   H HG12 . ILE A 1 147 ? -17.025 -1.934  -23.893 0.02 28.09 ? 140 ILE A HG12 1  
ATOM   2183   H HG13 . ILE A 1 147 ? -17.362 -1.995  -25.436 0.02 27.96 ? 140 ILE A HG13 1  
ATOM   2184   H HG21 . ILE A 1 147 ? -15.671 0.964   -24.113 0.02 28.77 ? 140 ILE A HG21 1  
ATOM   2185   H HG22 . ILE A 1 147 ? -17.024 1.610   -23.581 0.02 28.66 ? 140 ILE A HG22 1  
ATOM   2186   H HG23 . ILE A 1 147 ? -16.454 0.296   -22.899 0.02 28.57 ? 140 ILE A HG23 1  
ATOM   2187   H HD11 . ILE A 1 147 ? -15.181 -2.640  -25.053 0.02 28.29 ? 140 ILE A HD11 1  
ATOM   2188   H HD12 . ILE A 1 147 ? -15.246 -1.361  -25.983 0.02 28.37 ? 140 ILE A HD12 1  
ATOM   2189   H HD13 . ILE A 1 147 ? -14.871 -1.206  -24.448 0.02 28.56 ? 140 ILE A HD13 1  
ATOM   2190   N N    . GLY A 1 148 ? -19.558 -0.296  -26.684 0.02 27.88 ? 141 GLY A N    1  
ATOM   2191   C CA   . GLY A 1 148 ? -20.112 -1.006  -27.818 0.02 27.71 ? 141 GLY A CA   1  
ATOM   2192   C C    . GLY A 1 148 ? -21.057 -0.155  -28.655 0.02 27.74 ? 141 GLY A C    1  
ATOM   2193   O O    . GLY A 1 148 ? -21.501 0.922   -28.266 0.02 27.87 ? 141 GLY A O    1  
ATOM   2194   H H    . GLY A 1 148 ? -19.192 0.454   -26.877 0.02 28.05 ? 141 GLY A H    1  
ATOM   2195   H HA2  . GLY A 1 148 ? -19.381 -1.305  -28.377 0.02 27.76 ? 141 GLY A HA2  1  
ATOM   2196   H HA3  . GLY A 1 148 ? -20.591 -1.785  -27.520 0.02 27.55 ? 141 GLY A HA3  1  
ATOM   2197   N N    . GLU A 1 149 ? -21.402 -0.709  -29.811 0.02 27.64 ? 142 GLU A N    1  
ATOM   2198   C CA   . GLU A 1 149 ? -22.223 0.007   -30.778 0.02 27.71 ? 142 GLU A CA   1  
ATOM   2199   C C    . GLU A 1 149 ? -22.704 -0.986  -31.831 0.02 27.58 ? 142 GLU A C    1  
ATOM   2200   O O    . GLU A 1 149 ? -22.267 -2.134  -31.858 0.02 27.46 ? 142 GLU A O    1  
ATOM   2201   C CB   . GLU A 1 149 ? -21.419 1.116   -31.448 0.02 28.00 ? 142 GLU A CB   1  
ATOM   2202   C CG   . GLU A 1 149 ? -20.235 0.570   -32.228 0.02 28.08 ? 142 GLU A CG   1  
ATOM   2203   C CD   . GLU A 1 149 ? -19.112 0.108   -31.353 0.02 28.11 ? 142 GLU A CD   1  
ATOM   2204   O OE1  . GLU A 1 149 ? -18.735 0.890   -30.450 0.02 28.26 ? 142 GLU A OE1  1  
ATOM   2205   O OE2  . GLU A 1 149 ? -18.599 -1.031  -31.570 0.02 28.02 ? 142 GLU A OE2  1  
ATOM   2206   H H    . GLU A 1 149 ? -21.162 -1.491  -30.061 0.02 27.56 ? 142 GLU A H    1  
ATOM   2207   H HA   . GLU A 1 149 ? -23.001 0.388   -30.346 0.02 27.69 ? 142 GLU A HA   1  
ATOM   2208   H HB2  . GLU A 1 149 ? -21.991 1.590   -32.069 0.02 28.06 ? 142 GLU A HB2  1  
ATOM   2209   H HB3  . GLU A 1 149 ? -21.084 1.726   -30.780 0.02 28.11 ? 142 GLU A HB3  1  
ATOM   2210   H HG2  . GLU A 1 149 ? -20.507 -0.181  -32.773 0.02 27.96 ? 142 GLU A HG2  1  
ATOM   2211   H HG3  . GLU A 1 149 ? -19.889 1.277   -32.794 0.02 28.29 ? 142 GLU A HG3  1  
ATOM   2212   N N    . ASN A 1 150 ? -23.607 -0.516  -32.691 0.02 27.63 ? 143 ASN A N    1  
ATOM   2213   C CA   . ASN A 1 150 ? -24.014 -1.246  -33.893 0.02 27.59 ? 143 ASN A CA   1  
ATOM   2214   C C    . ASN A 1 150 ? -23.494 -0.593  -35.163 0.02 27.82 ? 143 ASN A C    1  
ATOM   2215   O O    . ASN A 1 150 ? -23.993 -0.907  -36.249 0.02 27.85 ? 143 ASN A O    1  
ATOM   2216   C CB   . ASN A 1 150 ? -25.530 -1.380  -33.959 0.02 27.51 ? 143 ASN A CB   1  
ATOM   2217   C CG   . ASN A 1 150 ? -26.257 -0.048  -34.149 0.02 27.70 ? 143 ASN A CG   1  
ATOM   2218   O OD1  . ASN A 1 150 ? -25.657 1.018   -34.279 0.02 27.89 ? 143 ASN A OD1  1  
ATOM   2219   N ND2  . ASN A 1 150 ? -27.570 -0.130  -34.171 0.02 27.68 ? 143 ASN A ND2  1  
ATOM   2220   H H    . ASN A 1 150 ? -24.011 0.234   -32.598 0.02 27.72 ? 143 ASN A H    1  
ATOM   2221   H HA   . ASN A 1 150 ? -23.637 -2.134  -33.870 0.02 27.49 ? 143 ASN A HA   1  
ATOM   2222   H HB2  . ASN A 1 150 ? -25.771 -1.966  -34.690 0.02 27.49 ? 143 ASN A HB2  1  
ATOM   2223   H HB3  . ASN A 1 150 ? -25.843 -1.755  -33.122 0.02 27.40 ? 143 ASN A HB3  1  
ATOM   2224   H HD21 . ASN A 1 150 ? -28.047 0.569   -34.018 0.02 27.78 ? 143 ASN A HD21 1  
ATOM   2225   H HD22 . ASN A 1 150 ? -27.949 -0.881  -34.331 0.02 27.59 ? 143 ASN A HD22 1  
ATOM   2226   N N    . HIS A 1 151 ? -22.487 0.267   -35.041 0.02 28.02 ? 144 HIS A N    1  
ATOM   2227   C CA   . HIS A 1 151 ? -21.859 0.876   -36.206 0.02 28.30 ? 144 HIS A CA   1  
ATOM   2228   C C    . HIS A 1 151 ? -21.143 -0.189  -37.019 0.02 28.28 ? 144 HIS A C    1  
ATOM   2229   O O    . HIS A 1 151 ? -20.613 -1.166  -36.489 0.02 28.13 ? 144 HIS A O    1  
ATOM   2230   C CB   . HIS A 1 151 ? -20.875 1.970   -35.796 0.02 28.55 ? 144 HIS A CB   1  
ATOM   2231   C CG   . HIS A 1 151 ? -21.492 3.054   -34.982 0.02 28.64 ? 144 HIS A CG   1  
ATOM   2232   N ND1  . HIS A 1 151 ? -20.757 4.076   -34.412 0.02 28.88 ? 144 HIS A ND1  1  
ATOM   2233   C CD2  . HIS A 1 151 ? -22.774 3.256   -34.605 0.02 28.55 ? 144 HIS A CD2  1  
ATOM   2234   C CE1  . HIS A 1 151 ? -21.563 4.855   -33.715 0.02 28.93 ? 144 HIS A CE1  1  
ATOM   2235   N NE2  . HIS A 1 151 ? -22.790 4.384   -33.819 0.02 28.73 ? 144 HIS A NE2  1  
ATOM   2236   H H    . HIS A 1 151 ? -22.142 0.508   -34.292 0.02 28.02 ? 144 HIS A H    1  
ATOM   2237   H HA   . HIS A 1 151 ? -22.538 1.284   -36.768 0.02 28.37 ? 144 HIS A HA   1  
ATOM   2238   H HB2  . HIS A 1 151 ? -20.162 1.578   -35.270 0.02 28.50 ? 144 HIS A HB2  1  
ATOM   2239   H HB3  . HIS A 1 151 ? -20.505 2.378   -36.594 0.02 28.76 ? 144 HIS A HB3  1  
ATOM   2240   H HD2  . HIS A 1 151 ? -23.504 2.729   -34.829 0.02 28.42 ? 144 HIS A HD2  1  
ATOM   2241   H HE1  . HIS A 1 151 ? -21.311 5.615   -33.244 0.02 29.10 ? 144 HIS A HE1  1  
ATOM   2242   H HE2  . HIS A 1 151 ? -23.489 4.732   -33.461 0.02 28.74 ? 144 HIS A HE2  1  
ATOM   2243   N N    . ARG A 1 152 ? -21.115 0.018   -38.328 0.02 28.49 ? 145 ARG A N    1  
ATOM   2244   C CA   . ARG A 1 152 ? -20.559 -0.987  -39.208 0.02 28.51 ? 145 ARG A CA   1  
ATOM   2245   C C    . ARG A 1 152 ? -19.037 -0.940  -39.285 0.02 28.73 ? 145 ARG A C    1  
ATOM   2246   O O    . ARG A 1 152 ? -18.451 -1.859  -39.859 0.02 28.78 ? 145 ARG A O    1  
ATOM   2247   C CB   . ARG A 1 152 ? -21.198 -0.852  -40.604 0.02 28.68 ? 145 ARG A CB   1  
ATOM   2248   C CG   . ARG A 1 152 ? -22.706 -1.143  -40.589 0.02 28.49 ? 145 ARG A CG   1  
ATOM   2249   C CD   . ARG A 1 152 ? -23.392 -1.078  -41.965 0.02 28.68 ? 145 ARG A CD   1  
ATOM   2250   N NE   . ARG A 1 152 ? -23.379 0.306   -42.411 0.02 28.98 ? 145 ARG A NE   1  
ATOM   2251   C CZ   . ARG A 1 152 ? -22.493 0.826   -43.239 0.02 29.30 ? 145 ARG A CZ   1  
ATOM   2252   N NH1  . ARG A 1 152 ? -21.523 0.101   -43.780 0.02 29.38 ? 145 ARG A NH1  1  
ATOM   2253   N NH2  . ARG A 1 152 ? -22.593 2.116   -43.505 0.02 29.58 ? 145 ARG A NH2  1  
ATOM   2254   H H    . ARG A 1 152 ? -21.404 0.723   -38.716 0.02 28.63 ? 145 ARG A H    1  
ATOM   2255   H HA   . ARG A 1 152 ? -20.802 -1.863  -38.867 0.02 28.31 ? 145 ARG A HA   1  
ATOM   2256   H HB2  . ARG A 1 152 ? -21.070 0.054   -40.919 0.02 28.89 ? 145 ARG A HB2  1  
ATOM   2257   H HB3  . ARG A 1 152 ? -20.773 -1.482  -41.201 0.02 28.74 ? 145 ARG A HB3  1  
ATOM   2258   H HG2  . ARG A 1 152 ? -22.854 -2.032  -40.230 0.02 28.30 ? 145 ARG A HG2  1  
ATOM   2259   H HG3  . ARG A 1 152 ? -23.141 -0.486  -40.025 0.02 28.46 ? 145 ARG A HG3  1  
ATOM   2260   H HD2  . ARG A 1 152 ? -22.926 -1.638  -42.606 0.02 28.76 ? 145 ARG A HD2  1  
ATOM   2261   H HD3  . ARG A 1 152 ? -24.318 -1.355  -41.881 0.02 28.57 ? 145 ARG A HD3  1  
ATOM   2262   H HE   . ARG A 1 152 ? -24.089 0.771   -42.272 0.02 28.98 ? 145 ARG A HE   1  
ATOM   2263   H HH11 . ARG A 1 152 ? -21.447 -0.733  -43.597 0.02 29.22 ? 145 ARG A HH11 1  
ATOM   2264   H HH12 . ARG A 1 152 ? -20.963 0.471   -44.314 0.02 29.62 ? 145 ARG A HH12 1  
ATOM   2265   H HH21 . ARG A 1 152 ? -23.231 2.572   -43.153 0.02 29.54 ? 145 ARG A HH21 1  
ATOM   2266   H HH22 . ARG A 1 152 ? -22.046 2.482   -44.053 0.02 29.82 ? 145 ARG A HH22 1  
ATOM   2267   N N    . ASP A 1 153 ? -18.375 0.080   -38.714 0.02 28.91 ? 146 ASP A N    1  
ATOM   2268   C CA   . ASP A 1 153 ? -16.929 -0.007  -38.538 0.02 29.12 ? 146 ASP A CA   1  
ATOM   2269   C C    . ASP A 1 153 ? -16.551 -1.110  -37.565 0.02 28.88 ? 146 ASP A C    1  
ATOM   2270   O O    . ASP A 1 153 ? -15.386 -1.525  -37.522 0.02 29.05 ? 146 ASP A O    1  
ATOM   2271   C CB   . ASP A 1 153 ? -16.329 1.333   -38.044 0.02 29.43 ? 146 ASP A CB   1  
ATOM   2272   C CG   . ASP A 1 153 ? -16.640 1.609   -36.548 0.02 29.28 ? 146 ASP A CG   1  
ATOM   2273   O OD1  . ASP A 1 153 ? -15.819 2.242   -35.812 0.02 29.52 ? 146 ASP A OD1  1  
ATOM   2274   O OD2  . ASP A 1 153 ? -17.725 1.160   -36.128 0.02 28.95 ? 146 ASP A OD2  1  
ATOM   2275   H H    . ASP A 1 153 ? -18.734 0.801   -38.423 0.02 28.94 ? 146 ASP A H    1  
ATOM   2276   H HA   . ASP A 1 153 ? -16.526 -0.224  -39.393 0.02 29.27 ? 146 ASP A HA   1  
ATOM   2277   H HB2  . ASP A 1 153 ? -15.366 1.297   -38.146 0.02 29.62 ? 146 ASP A HB2  1  
ATOM   2278   H HB3  . ASP A 1 153 ? -16.695 2.060   -38.572 0.02 29.59 ? 146 ASP A HB3  1  
ATOM   2279   N N    . MET A 1 154 ? -17.520 -1.626  -36.830 0.02 28.54 ? 147 MET A N    1  
ATOM   2280   C CA   . MET A 1 154 ? -17.283 -2.624  -35.816 0.02 28.33 ? 147 MET A CA   1  
ATOM   2281   C C    . MET A 1 154 ? -18.081 -3.891  -36.041 0.02 28.07 ? 147 MET A C    1  
ATOM   2282   O O    . MET A 1 154 ? -17.561 -4.986  -35.832 0.02 28.02 ? 147 MET A O    1  
ATOM   2283   C CB   . MET A 1 154 ? -17.642 -2.028  -34.449 0.02 28.22 ? 147 MET A CB   1  
ATOM   2284   C CG   . MET A 1 154 ? -16.579 -1.117  -33.917 0.02 28.50 ? 147 MET A CG   1  
ATOM   2285   S SD   . MET A 1 154 ? -15.170 -2.113  -33.390 0.02 28.63 ? 147 MET A SD   1  
ATOM   2286   C CE   . MET A 1 154 ? -15.896 -2.909  -31.936 0.02 28.26 ? 147 MET A CE   1  
ATOM   2287   H H    . MET A 1 154 ? -18.348 -1.410  -36.895 0.02 28.44 ? 147 MET A H    1  
ATOM   2288   H HA   . MET A 1 154 ? -16.341 -2.848  -35.812 0.02 28.47 ? 147 MET A HA   1  
ATOM   2289   H HB2  . MET A 1 154 ? -18.459 -1.514  -34.533 0.02 28.15 ? 147 MET A HB2  1  
ATOM   2290   H HB3  . MET A 1 154 ? -17.776 -2.757  -33.829 0.02 28.06 ? 147 MET A HB3  1  
ATOM   2291   H HG2  . MET A 1 154 ? -16.286 -0.500  -34.608 0.02 28.70 ? 147 MET A HG2  1  
ATOM   2292   H HG3  . MET A 1 154 ? -16.918 -0.626  -33.153 0.02 28.45 ? 147 MET A HG3  1  
ATOM   2293   H HE1  . MET A 1 154 ? -15.788 -3.868  -32.015 0.02 28.15 ? 147 MET A HE1  1  
ATOM   2294   H HE2  . MET A 1 154 ? -15.441 -2.593  -31.142 0.02 28.33 ? 147 MET A HE2  1  
ATOM   2295   H HE3  . MET A 1 154 ? -16.838 -2.687  -31.882 0.02 28.14 ? 147 MET A HE3  1  
ATOM   2296   N N    . TYR A 1 155 ? -19.320 -3.773  -36.456 0.02 27.96 ? 148 TYR A N    1  
ATOM   2297   C CA   . TYR A 1 155 ? -20.187 -4.923  -36.664 0.02 27.76 ? 148 TYR A CA   1  
ATOM   2298   C C    . TYR A 1 155 ? -20.863 -4.819  -38.037 0.02 27.86 ? 148 TYR A C    1  
ATOM   2299   O O    . TYR A 1 155 ? -22.065 -4.637  -38.134 0.02 27.77 ? 148 TYR A O    1  
ATOM   2300   C CB   . TYR A 1 155 ? -21.211 -5.025  -35.564 0.02 27.52 ? 148 TYR A CB   1  
ATOM   2301   C CG   . TYR A 1 155 ? -20.548 -5.290  -34.230 0.02 27.45 ? 148 TYR A CG   1  
ATOM   2302   C CD1  . TYR A 1 155 ? -20.083 -6.553  -33.901 0.02 27.37 ? 148 TYR A CD1  1  
ATOM   2303   C CD2  . TYR A 1 155 ? -20.369 -4.258  -33.314 0.02 27.49 ? 148 TYR A CD2  1  
ATOM   2304   C CE1  . TYR A 1 155 ? -19.461 -6.781  -32.646 0.02 27.34 ? 148 TYR A CE1  1  
ATOM   2305   C CE2  . TYR A 1 155 ? -19.756 -4.459  -32.106 0.02 27.46 ? 148 TYR A CE2  1  
ATOM   2306   C CZ   . TYR A 1 155 ? -19.311 -5.717  -31.763 0.02 27.38 ? 148 TYR A CZ   1  
ATOM   2307   O OH   . TYR A 1 155 ? -18.698 -5.882  -30.548 0.02 27.39 ? 148 TYR A OH   1  
ATOM   2308   H H    . TYR A 1 155 ? -19.696 -3.023  -36.623 0.02 28.02 ? 148 TYR A H    1  
ATOM   2309   H HA   . TYR A 1 155 ? -19.650 -5.729  -36.655 0.02 27.75 ? 148 TYR A HA   1  
ATOM   2310   H HB2  . TYR A 1 155 ? -21.708 -4.195  -35.512 0.02 27.55 ? 148 TYR A HB2  1  
ATOM   2311   H HB3  . TYR A 1 155 ? -21.813 -5.760  -35.762 0.02 27.43 ? 148 TYR A HB3  1  
ATOM   2312   H HD1  . TYR A 1 155 ? -20.197 -7.254  -34.500 0.02 27.36 ? 148 TYR A HD1  1  
ATOM   2313   H HD2  . TYR A 1 155 ? -20.670 -3.407  -33.529 0.02 27.56 ? 148 TYR A HD2  1  
ATOM   2314   H HE1  . TYR A 1 155 ? -19.149 -7.625  -32.421 0.02 27.31 ? 148 TYR A HE1  1  
ATOM   2315   H HE2  . TYR A 1 155 ? -19.655 -3.749  -31.518 0.02 27.52 ? 148 TYR A HE2  1  
ATOM   2316   H HH   . TYR A 1 155 ? -18.239 -6.583  -30.540 0.02 27.42 ? 148 TYR A HH   1  
ATOM   2317   N N    . GLY A 1 156 ? -20.086 -4.963  -39.093 0.02 28.08 ? 149 GLY A N    1  
ATOM   2318   C CA   . GLY A 1 156 ? -20.647 -4.876  -40.417 0.02 28.23 ? 149 GLY A CA   1  
ATOM   2319   C C    . GLY A 1 156 ? -21.284 -6.195  -40.822 0.02 28.12 ? 149 GLY A C    1  
ATOM   2320   O O    . GLY A 1 156 ? -20.737 -7.256  -40.558 0.02 28.06 ? 149 GLY A O    1  
ATOM   2321   H H    . GLY A 1 156 ? -19.240 -5.116  -39.066 0.02 28.17 ? 149 GLY A H    1  
ATOM   2322   H HA2  . GLY A 1 156 ? -21.314 -4.177  -40.415 0.02 28.22 ? 149 GLY A HA2  1  
ATOM   2323   H HA3  . GLY A 1 156 ? -19.959 -4.644  -41.056 0.02 28.43 ? 149 GLY A HA3  1  
ATOM   2324   N N    . PRO A 1 157 ? -22.458 -6.136  -41.455 0.02 28.12 ? 150 PRO A N    1  
ATOM   2325   C CA   . PRO A 1 157 ? -23.200 -7.343  -41.840 0.02 28.06 ? 150 PRO A CA   1  
ATOM   2326   C C    . PRO A 1 157 ? -22.705 -8.032  -43.110 0.02 28.29 ? 150 PRO A C    1  
ATOM   2327   O O    . PRO A 1 157 ? -23.357 -8.974  -43.577 0.02 28.31 ? 150 PRO A O    1  
ATOM   2328   C CB   . PRO A 1 157 ? -24.606 -6.779  -42.054 0.02 28.05 ? 150 PRO A CB   1  
ATOM   2329   C CG   . PRO A 1 157 ? -24.331 -5.461  -42.682 0.02 28.27 ? 150 PRO A CG   1  
ATOM   2330   C CD   . PRO A 1 157 ? -23.133 -4.921  -41.938 0.02 28.26 ? 150 PRO A CD   1  
ATOM   2331   H HA   . PRO A 1 157 ? -23.218 -7.978  -41.111 0.02 27.90 ? 150 PRO A HA   1  
ATOM   2332   H HB2  . PRO A 1 157 ? -25.116 -7.350  -42.648 0.02 28.11 ? 150 PRO A HB2  1  
ATOM   2333   H HB3  . PRO A 1 157 ? -25.058 -6.669  -41.207 0.02 27.90 ? 150 PRO A HB3  1  
ATOM   2334   H HG2  . PRO A 1 157 ? -24.116 -5.580  -43.619 0.02 28.45 ? 150 PRO A HG2  1  
ATOM   2335   H HG3  . PRO A 1 157 ? -25.097 -4.878  -42.585 0.02 28.27 ? 150 PRO A HG3  1  
ATOM   2336   H HD2  . PRO A 1 157 ? -22.550 -4.437  -42.540 0.02 28.46 ? 150 PRO A HD2  1  
ATOM   2337   H HD3  . PRO A 1 157 ? -23.415 -4.364  -41.198 0.02 28.16 ? 150 PRO A HD3  1  
ATOM   2338   N N    . ASP A 1 158 ? -21.542 -7.615  -43.600 0.02 28.51 ? 151 ASP A N    1  
ATOM   2339   C CA   . ASP A 1 158 ? -21.069 -7.962  -44.942 0.02 28.81 ? 151 ASP A CA   1  
ATOM   2340   C C    . ASP A 1 158 ? -20.925 -9.460  -45.169 0.02 28.82 ? 151 ASP A C    1  
ATOM   2341   O O    . ASP A 1 158 ? -20.990 -9.929  -46.315 0.02 29.06 ? 151 ASP A O    1  
ATOM   2342   C CB   . ASP A 1 158 ? -19.728 -7.287  -45.195 0.02 29.06 ? 151 ASP A CB   1  
ATOM   2343   C CG   . ASP A 1 158 ? -19.808 -5.779  -45.060 0.02 29.13 ? 151 ASP A CG   1  
ATOM   2344   O OD1  . ASP A 1 158 ? -19.316 -5.087  -45.979 0.02 29.47 ? 151 ASP A OD1  1  
ATOM   2345   O OD2  . ASP A 1 158 ? -20.354 -5.304  -44.041 0.02 28.89 ? 151 ASP A OD2  1  
ATOM   2346   H H    . ASP A 1 158 ? -20.996 -7.117  -43.168 0.02 28.50 ? 151 ASP A H    1  
ATOM   2347   H HA   . ASP A 1 158 ? -21.702 -7.624  -45.594 0.02 28.91 ? 151 ASP A HA   1  
ATOM   2348   H HB2  . ASP A 1 158 ? -19.070 -7.614  -44.569 0.02 28.99 ? 151 ASP A HB2  1  
ATOM   2349   H HB3  . ASP A 1 158 ? -19.445 -7.488  -46.100 0.02 29.29 ? 151 ASP A HB3  1  
ATOM   2350   N N    . TYR A 1 159 ? -20.627 -10.215 -44.112 0.02 28.61 ? 152 TYR A N    1  
ATOM   2351   C CA   . TYR A 1 159 ? -20.492 -11.656 -44.252 0.02 28.64 ? 152 TYR A CA   1  
ATOM   2352   C C    . TYR A 1 159 ? -21.828 -12.368 -44.123 0.02 28.50 ? 152 TYR A C    1  
ATOM   2353   O O    . TYR A 1 159 ? -22.094 -13.333 -44.849 0.02 28.65 ? 152 TYR A O    1  
ATOM   2354   C CB   . TYR A 1 159 ? -19.521 -12.217 -43.213 0.02 28.55 ? 152 TYR A CB   1  
ATOM   2355   C CG   . TYR A 1 159 ? -18.178 -11.546 -43.146 0.02 28.71 ? 152 TYR A CG   1  
ATOM   2356   C CD1  . TYR A 1 159 ? -17.655 -10.835 -44.222 0.02 29.01 ? 152 TYR A CD1  1  
ATOM   2357   C CD2  . TYR A 1 159 ? -17.422 -11.617 -41.995 0.02 28.61 ? 152 TYR A CD2  1  
ATOM   2358   C CE1  . TYR A 1 159 ? -16.415 -10.215 -44.140 0.02 29.21 ? 152 TYR A CE1  1  
ATOM   2359   C CE2  . TYR A 1 159 ? -16.197 -11.013 -41.894 0.02 28.79 ? 152 TYR A CE2  1  
ATOM   2360   C CZ   . TYR A 1 159 ? -15.676 -10.302 -42.959 0.02 29.10 ? 152 TYR A CZ   1  
ATOM   2361   O OH   . TYR A 1 159 ? -14.437 -9.702  -42.813 0.02 29.34 ? 152 TYR A OH   1  
ATOM   2362   H H    . TYR A 1 159 ? -20.496 -9.916  -43.322 0.02 28.47 ? 152 TYR A H    1  
ATOM   2363   H HA   . TYR A 1 159 ? -20.133 -11.857 -45.128 0.02 28.87 ? 152 TYR A HA   1  
ATOM   2364   H HB2  . TYR A 1 159 ? -19.927 -12.141 -42.336 0.02 28.34 ? 152 TYR A HB2  1  
ATOM   2365   H HB3  . TYR A 1 159 ? -19.370 -13.153 -43.423 0.02 28.62 ? 152 TYR A HB3  1  
ATOM   2366   H HD1  . TYR A 1 159 ? -18.150 -10.770 -45.003 0.02 29.10 ? 152 TYR A HD1  1  
ATOM   2367   H HD2  . TYR A 1 159 ? -17.755 -12.088 -41.267 0.02 28.43 ? 152 TYR A HD2  1  
ATOM   2368   H HE1  . TYR A 1 159 ? -16.081 -9.741  -44.864 0.02 29.44 ? 152 TYR A HE1  1  
ATOM   2369   H HE2  . TYR A 1 159 ? -15.711 -11.077 -41.107 0.02 28.74 ? 152 TYR A HE2  1  
ATOM   2370   H HH   . TYR A 1 159 ? -13.856 -10.273 -42.621 0.02 29.40 ? 152 TYR A HH   1  
ATOM   2371   N N    . PHE A 1 160 ? -22.687 -11.923 -43.210 0.02 28.25 ? 153 PHE A N    1  
ATOM   2372   C CA   . PHE A 1 160 ? -23.947 -12.624 -43.027 0.02 28.16 ? 153 PHE A CA   1  
ATOM   2373   C C    . PHE A 1 160 ? -24.875 -12.430 -44.213 0.02 28.35 ? 153 PHE A C    1  
ATOM   2374   O O    . PHE A 1 160 ? -25.722 -13.284 -44.470 0.02 28.41 ? 153 PHE A O    1  
ATOM   2375   C CB   . PHE A 1 160 ? -24.672 -12.165 -41.765 0.02 27.90 ? 153 PHE A CB   1  
ATOM   2376   C CG   . PHE A 1 160 ? -24.354 -12.981 -40.544 0.02 27.73 ? 153 PHE A CG   1  
ATOM   2377   C CD1  . PHE A 1 160 ? -24.798 -14.276 -40.441 0.02 27.75 ? 153 PHE A CD1  1  
ATOM   2378   C CD2  . PHE A 1 160 ? -23.641 -12.431 -39.498 0.02 27.58 ? 153 PHE A CD2  1  
ATOM   2379   C CE1  . PHE A 1 160 ? -24.524 -15.042 -39.281 0.02 27.64 ? 153 PHE A CE1  1  
ATOM   2380   C CE2  . PHE A 1 160 ? -23.356 -13.183 -38.351 0.02 27.46 ? 153 PHE A CE2  1  
ATOM   2381   C CZ   . PHE A 1 160 ? -23.807 -14.486 -38.254 0.02 27.49 ? 153 PHE A CZ   1  
ATOM   2382   H H    . PHE A 1 160 ? -22.567 -11.244 -42.705 0.02 28.16 ? 153 PHE A H    1  
ATOM   2383   H HA   . PHE A 1 160 ? -23.763 -13.568 -42.939 0.02 28.18 ? 153 PHE A HA   1  
ATOM   2384   H HB2  . PHE A 1 160 ? -24.438 -11.244 -41.586 0.02 27.86 ? 153 PHE A HB2  1  
ATOM   2385   H HB3  . PHE A 1 160 ? -25.626 -12.234 -41.909 0.02 27.90 ? 153 PHE A HB3  1  
ATOM   2386   H HD1  . PHE A 1 160 ? -25.287 -14.650 -41.134 0.02 27.88 ? 153 PHE A HD1  1  
ATOM   2387   H HD2  . PHE A 1 160 ? -23.341 -11.556 -39.561 0.02 27.59 ? 153 PHE A HD2  1  
ATOM   2388   H HE1  . PHE A 1 160 ? -24.824 -15.920 -39.224 0.02 27.68 ? 153 PHE A HE1  1  
ATOM   2389   H HE2  . PHE A 1 160 ? -22.872 -12.804 -37.653 0.02 27.39 ? 153 PHE A HE2  1  
ATOM   2390   H HZ   . PHE A 1 160 ? -23.619 -14.984 -37.494 0.02 27.43 ? 153 PHE A HZ   1  
ATOM   2391   N N    . ILE A 1 161 ? -24.770 -11.301 -44.925 0.02 28.49 ? 154 ILE A N    1  
ATOM   2392   C CA   . ILE A 1 161 ? -25.721 -11.070 -46.010 0.02 28.70 ? 154 ILE A CA   1  
ATOM   2393   C C    . ILE A 1 161 ? -25.365 -11.877 -47.256 0.02 29.00 ? 154 ILE A C    1  
ATOM   2394   O O    . ILE A 1 161 ? -26.112 -11.827 -48.234 0.02 29.23 ? 154 ILE A O    1  
ATOM   2395   C CB   . ILE A 1 161 ? -25.869 -9.564  -46.331 0.02 28.78 ? 154 ILE A CB   1  
ATOM   2396   C CG1  . ILE A 1 161 ? -24.536 -8.922  -46.689 0.02 28.92 ? 154 ILE A CG1  1  
ATOM   2397   C CG2  . ILE A 1 161 ? -26.502 -8.847  -45.151 0.02 28.53 ? 154 ILE A CG2  1  
ATOM   2398   C CD1  . ILE A 1 161 ? -24.042 -9.244  -48.106 0.02 29.28 ? 154 ILE A CD1  1  
ATOM   2399   H H    . ILE A 1 161 ? -24.175 -10.697 -44.815 0.02 28.49 ? 154 ILE A H    1  
ATOM   2400   H HA   . ILE A 1 161 ? -26.591 -11.380 -45.716 0.02 28.62 ? 154 ILE A HA   1  
ATOM   2401   H HB   . ILE A 1 161 ? -26.460 -9.474  -47.091 0.02 28.95 ? 154 ILE A HB   1  
ATOM   2402   H HG12 . ILE A 1 161 ? -24.638 -7.962  -46.623 0.02 28.93 ? 154 ILE A HG12 1  
ATOM   2403   H HG13 . ILE A 1 161 ? -23.854 -9.215  -46.072 0.02 28.80 ? 154 ILE A HG13 1  
ATOM   2404   H HG21 . ILE A 1 161 ? -26.670 -7.923  -45.392 0.02 28.60 ? 154 ILE A HG21 1  
ATOM   2405   H HG22 . ILE A 1 161 ? -27.337 -9.282  -44.925 0.02 28.50 ? 154 ILE A HG22 1  
ATOM   2406   H HG23 . ILE A 1 161 ? -25.891 -8.892  -44.401 0.02 28.37 ? 154 ILE A HG23 1  
ATOM   2407   H HD11 . ILE A 1 161 ? -23.445 -8.537  -48.390 0.02 29.40 ? 154 ILE A HD11 1  
ATOM   2408   H HD12 . ILE A 1 161 ? -23.565 -10.088 -48.096 0.02 29.28 ? 154 ILE A HD12 1  
ATOM   2409   H HD13 . ILE A 1 161 ? -24.805 -9.295  -48.701 0.02 29.40 ? 154 ILE A HD13 1  
ATOM   2410   N N    . LYS A 1 162 ? -24.259 -12.625 -47.237 0.02 29.05 ? 155 LYS A N    1  
ATOM   2411   C CA   . LYS A 1 162 ? -24.059 -13.694 -48.212 0.02 29.33 ? 155 LYS A CA   1  
ATOM   2412   C C    . LYS A 1 162 ? -25.075 -14.813 -48.025 0.02 29.30 ? 155 LYS A C    1  
ATOM   2413   O O    . LYS A 1 162 ? -25.308 -15.588 -48.958 0.02 29.58 ? 155 LYS A O    1  
ATOM   2414   C CB   . LYS A 1 162 ? -22.638 -14.241 -48.108 0.02 29.41 ? 155 LYS A CB   1  
ATOM   2415   C CG   . LYS A 1 162 ? -21.540 -13.255 -48.451 0.02 29.55 ? 155 LYS A CG   1  
ATOM   2416   C CD   . LYS A 1 162 ? -20.134 -13.845 -48.318 0.02 29.65 ? 155 LYS A CD   1  
ATOM   2417   C CE   . LYS A 1 162 ? -19.031 -12.840 -48.751 0.02 29.85 ? 155 LYS A CE   1  
ATOM   2418   N NZ   . LYS A 1 162 ? -17.658 -13.432 -49.001 0.02 30.14 ? 155 LYS A NZ   1  
ATOM   2419   H H    . LYS A 1 162 ? -23.615 -12.532 -46.681 0.02 28.95 ? 155 LYS A H    1  
ATOM   2420   H HA   . LYS A 1 162 ? -24.176 -13.343 -49.103 0.02 29.54 ? 155 LYS A HA   1  
ATOM   2421   H HB2  . LYS A 1 162 ? -22.480 -14.548 -47.205 0.02 29.22 ? 155 LYS A HB2  1  
ATOM   2422   H HB3  . LYS A 1 162 ? -22.559 -14.982 -48.723 0.02 29.62 ? 155 LYS A HB3  1  
ATOM   2423   H HG2  . LYS A 1 162 ? -21.661 -12.974 -49.367 0.02 29.78 ? 155 LYS A HG2  1  
ATOM   2424   H HG3  . LYS A 1 162 ? -21.602 -12.493 -47.857 0.02 29.38 ? 155 LYS A HG3  1  
ATOM   2425   H HD2  . LYS A 1 162 ? -19.978 -14.080 -47.391 0.02 29.43 ? 155 LYS A HD2  1  
ATOM   2426   H HD3  . LYS A 1 162 ? -20.063 -14.636 -48.874 0.02 29.84 ? 155 LYS A HD3  1  
ATOM   2427   H HE2  . LYS A 1 162 ? -19.306 -12.403 -49.569 0.02 30.02 ? 155 LYS A HE2  1  
ATOM   2428   H HE3  . LYS A 1 162 ? -18.927 -12.180 -48.048 0.02 29.66 ? 155 LYS A HE3  1  
ATOM   2429   H HZ1  . LYS A 1 162 ? -17.162 -13.367 -48.265 0.02 30.04 ? 155 LYS A HZ1  1  
ATOM   2430   H HZ2  . LYS A 1 162 ? -17.727 -14.287 -49.235 0.02 30.19 ? 155 LYS A HZ2  1  
ATOM   2431   H HZ3  . LYS A 1 162 ? -17.250 -12.988 -49.655 0.02 30.38 ? 155 LYS A HZ3  1  
ATOM   2432   N N    . LYS A 1 163 ? -25.731 -14.871 -46.870 0.02 29.01 ? 156 LYS A N    1  
ATOM   2433   C CA   . LYS A 1 163 ? -26.753 -15.862 -46.583 0.02 29.01 ? 156 LYS A CA   1  
ATOM   2434   C C    . LYS A 1 163 ? -28.133 -15.226 -46.669 0.02 29.01 ? 156 LYS A C    1  
ATOM   2435   O O    . LYS A 1 163 ? -28.277 -14.007 -46.642 0.02 28.93 ? 156 LYS A O    1  
ATOM   2436   C CB   . LYS A 1 163 ? -26.544 -16.484 -45.194 0.02 28.76 ? 156 LYS A CB   1  
ATOM   2437   C CG   . LYS A 1 163 ? -25.226 -17.270 -44.973 0.02 28.80 ? 156 LYS A CG   1  
ATOM   2438   C CD   . LYS A 1 163 ? -24.722 -18.111 -46.144 0.02 29.15 ? 156 LYS A CD   1  
ATOM   2439   C CE   . LYS A 1 163 ? -25.619 -19.327 -46.548 0.02 29.37 ? 156 LYS A CE   1  
ATOM   2440   N NZ   . LYS A 1 163 ? -25.214 -20.008 -47.878 0.02 29.76 ? 156 LYS A NZ   1  
ATOM   2441   H H    . LYS A 1 163 ? -25.606 -14.321 -46.231 0.02 28.84 ? 156 LYS A H    1  
ATOM   2442   H HA   . LYS A 1 163 ? -26.711 -16.562 -47.254 0.02 29.23 ? 156 LYS A HA   1  
ATOM   2443   H HB2  . LYS A 1 163 ? -26.556 -15.767 -44.544 0.02 28.56 ? 156 LYS A HB2  1  
ATOM   2444   H HB3  . LYS A 1 163 ? -27.278 -17.087 -45.012 0.02 28.79 ? 156 LYS A HB3  1  
ATOM   2445   H HG2  . LYS A 1 163 ? -24.526 -16.635 -44.755 0.02 28.72 ? 156 LYS A HG2  1  
ATOM   2446   H HG3  . LYS A 1 163 ? -25.358 -17.875 -44.230 0.02 28.71 ? 156 LYS A HG3  1  
ATOM   2447   H HD2  . LYS A 1 163 ? -24.624 -17.542 -46.925 0.02 29.27 ? 156 LYS A HD2  1  
ATOM   2448   H HD3  . LYS A 1 163 ? -23.856 -18.469 -45.887 0.02 29.17 ? 156 LYS A HD3  1  
ATOM   2449   H HE2  . LYS A 1 163 ? -25.573 -20.002 -45.854 0.02 29.28 ? 156 LYS A HE2  1  
ATOM   2450   H HE3  . LYS A 1 163 ? -26.530 -19.009 -46.636 0.02 29.37 ? 156 LYS A HE3  1  
ATOM   2451   H HZ1  . LYS A 1 163 ? -24.327 -20.038 -47.955 0.02 29.79 ? 156 LYS A HZ1  1  
ATOM   2452   H HZ2  . LYS A 1 163 ? -25.527 -20.842 -47.896 0.02 29.87 ? 156 LYS A HZ2  1  
ATOM   2453   H HZ3  . LYS A 1 163 ? -25.548 -19.562 -48.574 0.02 29.90 ? 156 LYS A HZ3  1  
ATOM   2454   N N    . ASP A 1 164 ? -29.167 -16.060 -46.736 0.02 29.13 ? 157 ASP A N    1  
ATOM   2455   C CA   . ASP A 1 164 ? -30.497 -15.528 -47.054 0.02 29.24 ? 157 ASP A CA   1  
ATOM   2456   C C    . ASP A 1 164 ? -31.310 -15.266 -45.790 0.02 28.99 ? 157 ASP A C    1  
ATOM   2457   O O    . ASP A 1 164 ? -32.426 -15.757 -45.607 0.02 29.10 ? 157 ASP A O    1  
ATOM   2458   C CB   . ASP A 1 164 ? -31.214 -16.459 -48.002 0.02 29.59 ? 157 ASP A CB   1  
ATOM   2459   C CG   . ASP A 1 164 ? -30.524 -16.497 -49.341 0.02 29.90 ? 157 ASP A CG   1  
ATOM   2460   O OD1  . ASP A 1 164 ? -30.043 -15.420 -49.781 0.02 29.88 ? 157 ASP A OD1  1  
ATOM   2461   O OD2  . ASP A 1 164 ? -30.432 -17.598 -49.917 0.02 30.19 ? 157 ASP A OD2  1  
ATOM   2462   H H    . ASP A 1 164 ? -29.133 -16.902 -46.596 0.02 29.18 ? 157 ASP A H    1  
ATOM   2463   H HA   . ASP A 1 164 ? -30.387 -14.676 -47.497 0.02 29.28 ? 157 ASP A HA   1  
ATOM   2464   H HB2  . ASP A 1 164 ? -31.218 -17.349 -47.623 0.02 29.59 ? 157 ASP A HB2  1  
ATOM   2465   H HB3  . ASP A 1 164 ? -32.125 -16.152 -48.132 0.02 29.67 ? 157 ASP A HB3  1  
ATOM   2466   N N    . VAL A 1 165 ? -30.741 -14.392 -44.965 0.02 28.72 ? 158 VAL A N    1  
ATOM   2467   C CA   . VAL A 1 165 ? -31.230 -14.091 -43.632 0.02 28.47 ? 158 VAL A CA   1  
ATOM   2468   C C    . VAL A 1 165 ? -31.510 -12.593 -43.552 0.02 28.41 ? 158 VAL A C    1  
ATOM   2469   O O    . VAL A 1 165 ? -31.133 -11.822 -44.436 0.02 28.53 ? 158 VAL A O    1  
ATOM   2470   C CB   . VAL A 1 165 ? -30.213 -14.515 -42.546 0.02 28.23 ? 158 VAL A CB   1  
ATOM   2471   C CG1  . VAL A 1 165 ? -29.852 -15.969 -42.710 0.02 28.34 ? 158 VAL A CG1  1  
ATOM   2472   C CG2  . VAL A 1 165 ? -28.955 -13.642 -42.616 0.02 28.12 ? 158 VAL A CG2  1  
ATOM   2473   H H    . VAL A 1 165 ? -30.037 -13.949 -45.169 0.02 28.69 ? 158 VAL A H    1  
ATOM   2474   H HA   . VAL A 1 165 ? -32.060 -14.569 -43.472 0.02 28.55 ? 158 VAL A HA   1  
ATOM   2475   H HB   . VAL A 1 165 ? -30.613 -14.399 -41.673 0.02 28.10 ? 158 VAL A HB   1  
ATOM   2476   H HG11 . VAL A 1 165 ? -29.350 -16.258 -41.931 0.02 28.20 ? 158 VAL A HG11 1  
ATOM   2477   H HG12 . VAL A 1 165 ? -30.667 -16.489 -42.791 0.02 28.45 ? 158 VAL A HG12 1  
ATOM   2478   H HG13 . VAL A 1 165 ? -29.313 -16.067 -43.511 0.02 28.46 ? 158 VAL A HG13 1  
ATOM   2479   H HG21 . VAL A 1 165 ? -28.174 -14.212 -42.592 0.02 28.13 ? 158 VAL A HG21 1  
ATOM   2480   H HG22 . VAL A 1 165 ? -28.959 -13.137 -43.443 0.02 28.25 ? 158 VAL A HG22 1  
ATOM   2481   H HG23 . VAL A 1 165 ? -28.947 -13.031 -41.867 0.02 27.97 ? 158 VAL A HG23 1  
ATOM   2482   N N    . VAL A 1 166 ? -32.213 -12.200 -42.495 0.02 28.27 ? 159 VAL A N    1  
ATOM   2483   C CA   . VAL A 1 166 ? -32.320 -10.803 -42.077 0.02 28.17 ? 159 VAL A CA   1  
ATOM   2484   C C    . VAL A 1 166 ? -31.510 -10.651 -40.796 0.02 27.89 ? 159 VAL A C    1  
ATOM   2485   O O    . VAL A 1 166 ? -31.731 -11.390 -39.828 0.02 27.78 ? 159 VAL A O    1  
ATOM   2486   C CB   . VAL A 1 166 ? -33.779 -10.375 -41.853 0.02 28.29 ? 159 VAL A CB   1  
ATOM   2487   C CG1  . VAL A 1 166 ? -33.830 -8.938  -41.353 0.02 28.21 ? 159 VAL A CG1  1  
ATOM   2488   C CG2  . VAL A 1 166 ? -34.603 -10.513 -43.129 0.02 28.61 ? 159 VAL A CG2  1  
ATOM   2489   H H    . VAL A 1 166 ? -32.661 -12.735 -42.000 0.02 28.24 ? 159 VAL A H    1  
ATOM   2490   H HA   . VAL A 1 166 ? -31.926 -10.227 -42.746 0.02 28.25 ? 159 VAL A HA   1  
ATOM   2491   H HB   . VAL A 1 166 ? -34.178 -10.948 -41.182 0.02 28.24 ? 159 VAL A HB   1  
ATOM   2492   H HG11 . VAL A 1 166 ? -34.743 -8.619  -41.410 0.02 28.33 ? 159 VAL A HG11 1  
ATOM   2493   H HG12 . VAL A 1 166 ? -33.531 -8.911  -40.431 0.02 28.03 ? 159 VAL A HG12 1  
ATOM   2494   H HG13 . VAL A 1 166 ? -33.247 -8.394  -41.903 0.02 28.24 ? 159 VAL A HG13 1  
ATOM   2495   H HG21 . VAL A 1 166 ? -35.480 -10.125 -42.983 0.02 28.70 ? 159 VAL A HG21 1  
ATOM   2496   H HG22 . VAL A 1 166 ? -34.147 -10.048 -43.848 0.02 28.68 ? 159 VAL A HG22 1  
ATOM   2497   H HG23 . VAL A 1 166 ? -34.691 -11.454 -43.349 0.02 28.68 ? 159 VAL A HG23 1  
ATOM   2498   N N    . LEU A 1 167 ? -30.554 -9.738  -40.810 0.02 27.82 ? 160 LEU A N    1  
ATOM   2499   C CA   . LEU A 1 167 ? -29.697 -9.468  -39.665 0.02 27.60 ? 160 LEU A CA   1  
ATOM   2500   C C    . LEU A 1 167 ? -30.034 -8.109  -39.063 0.02 27.56 ? 160 LEU A C    1  
ATOM   2501   O O    . LEU A 1 167 ? -30.086 -7.103  -39.782 0.02 27.70 ? 160 LEU A O    1  
ATOM   2502   C CB   . LEU A 1 167 ? -28.239 -9.511  -40.083 0.02 27.61 ? 160 LEU A CB   1  
ATOM   2503   C CG   . LEU A 1 167 ? -27.187 -9.175  -39.052 0.02 27.45 ? 160 LEU A CG   1  
ATOM   2504   C CD1  . LEU A 1 167 ? -27.365 -10.093 -37.839 0.02 27.29 ? 160 LEU A CD1  1  
ATOM   2505   C CD2  . LEU A 1 167 ? -25.802 -9.250  -39.645 0.02 27.53 ? 160 LEU A CD2  1  
ATOM   2506   H H    . LEU A 1 167 ? -30.369 -9.254  -41.486 0.02 27.92 ? 160 LEU A H    1  
ATOM   2507   H HA   . LEU A 1 167 ? -29.844 -10.140 -38.986 0.02 27.52 ? 160 LEU A HA   1  
ATOM   2508   H HB2  . LEU A 1 167 ? -28.047 -10.407 -40.393 0.02 27.65 ? 160 LEU A HB2  1  
ATOM   2509   H HB3  . LEU A 1 167 ? -28.126 -8.888  -40.816 0.02 27.73 ? 160 LEU A HB3  1  
ATOM   2510   H HG   . LEU A 1 167 ? -27.320 -8.261  -38.756 0.02 27.43 ? 160 LEU A HG   1  
ATOM   2511   H HD11 . LEU A 1 167 ? -26.691 -9.870  -37.181 0.02 27.21 ? 160 LEU A HD11 1  
ATOM   2512   H HD12 . LEU A 1 167 ? -28.248 -9.959  -37.465 0.02 27.26 ? 160 LEU A HD12 1  
ATOM   2513   H HD13 . LEU A 1 167 ? -27.262 -11.011 -38.122 0.02 27.32 ? 160 LEU A HD13 1  
ATOM   2514   H HD21 . LEU A 1 167 ? -25.171 -8.882  -39.010 0.02 27.47 ? 160 LEU A HD21 1  
ATOM   2515   H HD22 . LEU A 1 167 ? -25.582 -10.176 -39.827 0.02 27.55 ? 160 LEU A HD22 1  
ATOM   2516   H HD23 . LEU A 1 167 ? -25.778 -8.741  -40.466 0.02 27.67 ? 160 LEU A HD23 1  
ATOM   2517   N N    . ILE A 1 168 ? -30.206 -8.077  -37.731 0.02 27.41 ? 161 ILE A N    1  
ATOM   2518   C CA   . ILE A 1 168 ? -30.556 -6.849  -37.012 0.02 27.39 ? 161 ILE A CA   1  
ATOM   2519   C C    . ILE A 1 168 ? -29.551 -6.658  -35.881 0.02 27.23 ? 161 ILE A C    1  
ATOM   2520   O O    . ILE A 1 168 ? -29.277 -7.607  -35.134 0.02 27.11 ? 161 ILE A O    1  
ATOM   2521   C CB   . ILE A 1 168 ? -31.988 -6.912  -36.454 0.02 27.44 ? 161 ILE A CB   1  
ATOM   2522   C CG1  . ILE A 1 168 ? -32.997 -7.125  -37.586 0.02 27.65 ? 161 ILE A CG1  1  
ATOM   2523   C CG2  . ILE A 1 168 ? -32.317 -5.671  -35.631 0.02 27.45 ? 161 ILE A CG2  1  
ATOM   2524   C CD1  . ILE A 1 168 ? -34.414 -7.267  -37.127 0.02 27.76 ? 161 ILE A CD1  1  
ATOM   2525   H H    . ILE A 1 168 ? -30.110 -8.758  -37.226 0.02 27.33 ? 161 ILE A H    1  
ATOM   2526   H HA   . ILE A 1 168 ? -30.490 -6.096  -37.612 0.02 27.49 ? 161 ILE A HA   1  
ATOM   2527   H HB   . ILE A 1 168 ? -32.049 -7.680  -35.868 0.02 27.36 ? 161 ILE A HB   1  
ATOM   2528   H HG12 . ILE A 1 168 ? -32.956 -6.366  -38.182 0.02 27.74 ? 161 ILE A HG12 1  
ATOM   2529   H HG13 . ILE A 1 168 ? -32.762 -7.930  -38.062 0.02 27.65 ? 161 ILE A HG13 1  
ATOM   2530   H HG21 . ILE A 1 168 ? -33.272 -5.617  -35.488 0.02 27.54 ? 161 ILE A HG21 1  
ATOM   2531   H HG22 . ILE A 1 168 ? -31.865 -5.733  -34.778 0.02 27.34 ? 161 ILE A HG22 1  
ATOM   2532   H HG23 . ILE A 1 168 ? -32.008 -4.885  -36.104 0.02 27.51 ? 161 ILE A HG23 1  
ATOM   2533   H HD11 . ILE A 1 168 ? -34.755 -6.403  -36.860 0.02 27.80 ? 161 ILE A HD11 1  
ATOM   2534   H HD12 . ILE A 1 168 ? -34.950 -7.622  -37.850 0.02 27.90 ? 161 ILE A HD12 1  
ATOM   2535   H HD13 . ILE A 1 168 ? -34.441 -7.872  -36.372 0.02 27.67 ? 161 ILE A HD13 1  
ATOM   2536   N N    . ASN A 1 169 ? -28.976 -5.456  -35.778 0.02 27.27 ? 162 ASN A N    1  
ATOM   2537   C CA   . ASN A 1 169 ? -27.955 -5.147  -34.780 0.02 27.18 ? 162 ASN A CA   1  
ATOM   2538   C C    . ASN A 1 169 ? -28.494 -4.036  -33.887 0.02 27.21 ? 162 ASN A C    1  
ATOM   2539   O O    . ASN A 1 169 ? -28.855 -2.975  -34.379 0.02 27.36 ? 162 ASN A O    1  
ATOM   2540   C CB   . ASN A 1 169 ? -26.630 -4.709  -35.404 0.02 27.26 ? 162 ASN A CB   1  
ATOM   2541   C CG   . ASN A 1 169 ? -25.881 -5.849  -36.049 0.02 27.24 ? 162 ASN A CG   1  
ATOM   2542   O OD1  . ASN A 1 169 ? -26.312 -6.360  -37.060 0.02 27.31 ? 162 ASN A OD1  1  
ATOM   2543   N ND2  . ASN A 1 169 ? -24.743 -6.226  -35.478 0.02 27.20 ? 162 ASN A ND2  1  
ATOM   2544   H H    . ASN A 1 169 ? -29.177 -4.789  -36.271 0.02 27.37 ? 162 ASN A H    1  
ATOM   2545   H HA   . ASN A 1 169 ? -27.795 -5.928  -34.227 0.02 27.08 ? 162 ASN A HA   1  
ATOM   2546   H HB2  . ASN A 1 169 ? -26.807 -4.037  -36.077 0.02 27.38 ? 162 ASN A HB2  1  
ATOM   2547   H HB3  . ASN A 1 169 ? -26.060 -4.342  -34.717 0.02 27.24 ? 162 ASN A HB3  1  
ATOM   2548   H HD21 . ASN A 1 169 ? -24.162 -5.637  -35.255 0.02 27.23 ? 162 ASN A HD21 1  
ATOM   2549   H HD22 . ASN A 1 169 ? -24.582 -7.058  -35.347 0.02 27.16 ? 162 ASN A HD22 1  
ATOM   2550   N N    . ILE A 1 170 ? -28.552 -4.280  -32.582 0.02 27.11 ? 163 ILE A N    1  
ATOM   2551   C CA   . ILE A 1 170 ? -29.227 -3.340  -31.701 0.02 27.17 ? 163 ILE A CA   1  
ATOM   2552   C C    . ILE A 1 170 ? -28.209 -2.585  -30.858 0.02 27.19 ? 163 ILE A C    1  
ATOM   2553   O O    . ILE A 1 170 ? -27.069 -3.005  -30.655 0.02 27.12 ? 163 ILE A O    1  
ATOM   2554   C CB   . ILE A 1 170 ? -30.287 -4.024  -30.812 0.02 27.13 ? 163 ILE A CB   1  
ATOM   2555   C CG1  . ILE A 1 170 ? -29.648 -4.878  -29.714 0.02 27.01 ? 163 ILE A CG1  1  
ATOM   2556   C CG2  . ILE A 1 170 ? -31.217 -4.873  -31.642 0.02 27.16 ? 163 ILE A CG2  1  
ATOM   2557   C CD1  . ILE A 1 170 ? -30.683 -5.402  -28.775 0.02 27.02 ? 163 ILE A CD1  1  
ATOM   2558   H H    . ILE A 1 170 ? -28.210 -4.963  -32.195 0.02 27.03 ? 163 ILE A H    1  
ATOM   2559   H HA   . ILE A 1 170 ? -29.699 -2.683  -32.230 0.02 27.28 ? 163 ILE A HA   1  
ATOM   2560   H HB   . ILE A 1 170 ? -30.814 -3.331  -30.386 0.02 27.21 ? 163 ILE A HB   1  
ATOM   2561   H HG12 . ILE A 1 170 ? -29.179 -5.632  -30.103 0.02 26.94 ? 163 ILE A HG12 1  
ATOM   2562   H HG13 . ILE A 1 170 ? -29.037 -4.339  -29.194 0.02 27.01 ? 163 ILE A HG13 1  
ATOM   2563   H HG21 . ILE A 1 170 ? -32.114 -4.814  -31.285 0.02 27.22 ? 163 ILE A HG21 1  
ATOM   2564   H HG22 . ILE A 1 170 ? -31.200 -4.550  -32.554 0.02 27.22 ? 163 ILE A HG22 1  
ATOM   2565   H HG23 . ILE A 1 170 ? -30.909 -5.790  -31.619 0.02 27.08 ? 163 ILE A HG23 1  
ATOM   2566   H HD11 . ILE A 1 170 ? -30.266 -6.011  -28.145 0.02 26.96 ? 163 ILE A HD11 1  
ATOM   2567   H HD12 . ILE A 1 170 ? -31.066 -4.648  -28.303 0.02 27.10 ? 163 ILE A HD12 1  
ATOM   2568   H HD13 . ILE A 1 170 ? -31.376 -5.865  -29.269 0.02 27.05 ? 163 ILE A HD13 1  
ATOM   2569   N N    . GLN A 1 171 ? -28.639 -1.412  -30.398 0.02 27.32 ? 164 GLN A N    1  
ATOM   2570   C CA   . GLN A 1 171 ? -27.937 -0.675  -29.360 0.02 27.38 ? 164 GLN A CA   1  
ATOM   2571   C C    . GLN A 1 171 ? -28.795 -0.668  -28.106 0.02 27.39 ? 164 GLN A C    1  
ATOM   2572   O O    . GLN A 1 171 ? -29.975 -1.007  -28.133 0.02 27.39 ? 164 GLN A O    1  
ATOM   2573   C CB   . GLN A 1 171 ? -27.600 0.759   -29.820 0.02 27.59 ? 164 GLN A CB   1  
ATOM   2574   C CG   . GLN A 1 171 ? -26.397 0.752   -30.772 0.02 27.63 ? 164 GLN A CG   1  
ATOM   2575   C CD   . GLN A 1 171 ? -25.871 2.128   -31.189 0.02 27.89 ? 164 GLN A CD   1  
ATOM   2576   O OE1  . GLN A 1 171 ? -24.797 2.229   -31.773 0.02 27.97 ? 164 GLN A OE1  1  
ATOM   2577   N NE2  . GLN A 1 171 ? -26.612 3.180   -30.860 0.02 28.06 ? 164 GLN A NE2  1  
ATOM   2578   H H    . GLN A 1 171 ? -29.357 -1.029  -30.666 0.02 27.40 ? 164 GLN A H    1  
ATOM   2579   H HA   . GLN A 1 171 ? -27.105 -1.120  -29.154 0.02 27.31 ? 164 GLN A HA   1  
ATOM   2580   H HB2  . GLN A 1 171 ? -28.367 1.136   -30.273 0.02 27.67 ? 164 GLN A HB2  1  
ATOM   2581   H HB3  . GLN A 1 171 ? -27.373 1.301   -29.052 0.02 27.67 ? 164 GLN A HB3  1  
ATOM   2582   H HG2  . GLN A 1 171 ? -25.664 0.295   -30.331 0.02 27.56 ? 164 GLN A HG2  1  
ATOM   2583   H HG3  . GLN A 1 171 ? -26.648 0.267   -31.568 0.02 27.57 ? 164 GLN A HG3  1  
ATOM   2584   H HE21 . GLN A 1 171 ? -27.466 3.121   -30.852 0.02 28.04 ? 164 GLN A HE21 1  
ATOM   2585   H HE22 . GLN A 1 171 ? -26.230 3.918   -30.659 0.02 28.20 ? 164 GLN A HE22 1  
ATOM   2586   N N    . TYR A 1 172 ? -28.158 -0.292  -27.002 0.02 27.44 ? 165 TYR A N    1  
ATOM   2587   C CA   . TYR A 1 172 ? -28.821 -0.195  -25.701 0.02 27.50 ? 165 TYR A CA   1  
ATOM   2588   C C    . TYR A 1 172 ? -27.936 0.639   -24.789 0.02 27.63 ? 165 TYR A C    1  
ATOM   2589   O O    . TYR A 1 172 ? -26.735 0.746   -25.010 0.02 27.63 ? 165 TYR A O    1  
ATOM   2590   C CB   . TYR A 1 172 ? -29.085 -1.592  -25.107 0.02 27.35 ? 165 TYR A CB   1  
ATOM   2591   C CG   . TYR A 1 172 ? -27.833 -2.412  -24.979 0.02 27.22 ? 165 TYR A CG   1  
ATOM   2592   C CD1  . TYR A 1 172 ? -27.361 -3.171  -26.034 0.02 27.10 ? 165 TYR A CD1  1  
ATOM   2593   C CD2  . TYR A 1 172 ? -27.120 -2.443  -23.796 0.02 27.26 ? 165 TYR A CD2  1  
ATOM   2594   C CE1  . TYR A 1 172 ? -26.211 -3.904  -25.926 0.02 27.02 ? 165 TYR A CE1  1  
ATOM   2595   C CE2  . TYR A 1 172 ? -25.984 -3.179  -23.669 0.02 27.19 ? 165 TYR A CE2  1  
ATOM   2596   C CZ   . TYR A 1 172 ? -25.519 -3.924  -24.732 0.02 27.07 ? 165 TYR A CZ   1  
ATOM   2597   O OH   . TYR A 1 172 ? -24.359 -4.647  -24.584 0.02 27.04 ? 165 TYR A OH   1  
ATOM   2598   H H    . TYR A 1 172 ? -27.322 -0.090  -26.988 0.02 27.45 ? 165 TYR A H    1  
ATOM   2599   H HA   . TYR A 1 172 ? -29.670 0.258   -25.805 0.02 27.59 ? 165 TYR A HA   1  
ATOM   2600   H HB2  . TYR A 1 172 ? -29.466 -1.490  -24.223 0.02 27.41 ? 165 TYR A HB2  1  
ATOM   2601   H HB3  . TYR A 1 172 ? -29.707 -2.070  -25.672 0.02 27.30 ? 165 TYR A HB3  1  
ATOM   2602   H HD1  . TYR A 1 172 ? -27.823 -3.157  -26.840 0.02 27.09 ? 165 TYR A HD1  1  
ATOM   2603   H HD2  . TYR A 1 172 ? -27.421 -1.943  -23.072 0.02 27.36 ? 165 TYR A HD2  1  
ATOM   2604   H HE1  . TYR A 1 172 ? -25.909 -4.399  -26.649 0.02 26.97 ? 165 TYR A HE1  1  
ATOM   2605   H HE2  . TYR A 1 172 ? -25.520 -3.174  -22.864 0.02 27.24 ? 165 TYR A HE2  1  
ATOM   2606   H HH   . TYR A 1 172 ? -23.713 -4.233  -24.917 0.02 27.09 ? 165 TYR A HH   1  
ATOM   2607   N N    . ARG A 1 173 ? -28.539 1.230   -23.744 0.02 27.79 ? 166 ARG A N    1  
ATOM   2608   C CA   . ARG A 1 173 ? -27.777 2.136   -22.895 0.02 27.97 ? 166 ARG A CA   1  
ATOM   2609   C C    . ARG A 1 173 ? -26.701 1.400   -22.104 0.02 27.90 ? 166 ARG A C    1  
ATOM   2610   O O    . ARG A 1 173 ? -26.953 0.342   -21.529 0.02 27.78 ? 166 ARG A O    1  
ATOM   2611   C CB   . ARG A 1 173 ? -28.709 2.866   -21.918 0.02 28.19 ? 166 ARG A CB   1  
ATOM   2612   C CG   . ARG A 1 173 ? -29.408 4.110   -22.493 0.02 28.41 ? 166 ARG A CG   1  
ATOM   2613   C CD   . ARG A 1 173 ? -30.440 4.629   -21.503 0.02 28.64 ? 166 ARG A CD   1  
ATOM   2614   N NE   . ARG A 1 173 ? -31.650 3.817   -21.526 0.02 28.56 ? 166 ARG A NE   1  
ATOM   2615   C CZ   . ARG A 1 173 ? -32.696 4.018   -20.750 0.02 28.76 ? 166 ARG A CZ   1  
ATOM   2616   N NH1  . ARG A 1 173 ? -32.689 5.012   -19.855 0.02 29.04 ? 166 ARG A NH1  1  
ATOM   2617   N NH2  . ARG A 1 173 ? -33.741 3.224   -20.857 0.02 28.71 ? 166 ARG A NH2  1  
ATOM   2618   H H    . ARG A 1 173 ? -29.361 1.130   -23.519 0.02 27.81 ? 166 ARG A H    1  
ATOM   2619   H HA   . ARG A 1 173 ? -27.338 2.791   -23.456 0.02 28.05 ? 166 ARG A HA   1  
ATOM   2620   H HB2  . ARG A 1 173 ? -29.405 2.260   -21.620 0.02 28.13 ? 166 ARG A HB2  1  
ATOM   2621   H HB3  . ARG A 1 173 ? -28.182 3.144   -21.154 0.02 28.30 ? 166 ARG A HB3  1  
ATOM   2622   H HG2  . ARG A 1 173 ? -28.753 4.803   -22.664 0.02 28.53 ? 166 ARG A HG2  1  
ATOM   2623   H HG3  . ARG A 1 173 ? -29.866 3.864   -23.312 0.02 28.33 ? 166 ARG A HG3  1  
ATOM   2624   H HD2  . ARG A 1 173 ? -30.066 4.600   -20.615 0.02 28.70 ? 166 ARG A HD2  1  
ATOM   2625   H HD3  . ARG A 1 173 ? -30.679 5.538   -21.729 0.02 28.83 ? 166 ARG A HD3  1  
ATOM   2626   H HE   . ARG A 1 173 ? -31.776 3.329   -22.217 0.02 28.42 ? 166 ARG A HE   1  
ATOM   2627   H HH11 . ARG A 1 173 ? -32.003 5.522   -19.789 0.02 29.10 ? 166 ARG A HH11 1  
ATOM   2628   H HH12 . ARG A 1 173 ? -33.367 5.144   -19.344 0.02 29.19 ? 166 ARG A HH12 1  
ATOM   2629   H HH21 . ARG A 1 173 ? -33.740 2.594   -21.433 0.02 28.54 ? 166 ARG A HH21 1  
ATOM   2630   H HH22 . ARG A 1 173 ? -34.427 3.345   -20.357 0.02 28.86 ? 166 ARG A HH22 1  
ATOM   2631   N N    . LEU A 1 174 ? -25.518 2.002   -22.026 0.02 28.02 ? 167 LEU A N    1  
ATOM   2632   C CA   . LEU A 1 174 ? -24.375 1.435   -21.334 0.02 28.02 ? 167 LEU A CA   1  
ATOM   2633   C C    . LEU A 1 174 ? -24.038 2.201   -20.050 0.02 28.28 ? 167 LEU A C    1  
ATOM   2634   O O    . LEU A 1 174 ? -24.486 3.325   -19.810 0.02 28.50 ? 167 LEU A O    1  
ATOM   2635   C CB   . LEU A 1 174 ? -23.156 1.441   -22.241 0.02 28.01 ? 167 LEU A CB   1  
ATOM   2636   C CG   . LEU A 1 174 ? -23.438 0.853   -23.628 0.02 27.81 ? 167 LEU A CG   1  
ATOM   2637   C CD1  . LEU A 1 174 ? -22.227 0.978   -24.517 0.02 27.87 ? 167 LEU A CD1  1  
ATOM   2638   C CD2  . LEU A 1 174 ? -23.848 -0.585  -23.492 0.02 27.58 ? 167 LEU A CD2  1  
ATOM   2639   H H    . LEU A 1 174 ? -25.350 2.764   -22.374 0.02 28.14 ? 167 LEU A H    1  
ATOM   2640   H HA   . LEU A 1 174 ? -24.572 0.520   -21.093 0.02 27.88 ? 167 LEU A HA   1  
ATOM   2641   H HB2  . LEU A 1 174 ? -22.855 2.358   -22.348 0.02 28.19 ? 167 LEU A HB2  1  
ATOM   2642   H HB3  . LEU A 1 174 ? -22.456 0.917   -21.823 0.02 28.00 ? 167 LEU A HB3  1  
ATOM   2643   H HG   . LEU A 1 174 ? -24.169 1.336   -24.040 0.02 27.83 ? 167 LEU A HG   1  
ATOM   2644   H HD11 . LEU A 1 174 ? -22.488 0.802   -25.432 0.02 27.79 ? 167 LEU A HD11 1  
ATOM   2645   H HD12 . LEU A 1 174 ? -21.858 1.872   -24.448 0.02 28.06 ? 167 LEU A HD12 1  
ATOM   2646   H HD13 . LEU A 1 174 ? -21.576 0.329   -24.225 0.02 27.83 ? 167 LEU A HD13 1  
ATOM   2647   H HD21 . LEU A 1 174 ? -23.562 -1.066  -24.281 0.02 27.48 ? 167 LEU A HD21 1  
ATOM   2648   H HD22 . LEU A 1 174 ? -23.429 -0.968  -22.708 0.02 27.59 ? 167 LEU A HD22 1  
ATOM   2649   H HD23 . LEU A 1 174 ? -24.812 -0.628  -23.408 0.02 27.54 ? 167 LEU A HD23 1  
ATOM   2650   N N    . GLY A 1 175 ? -23.192 1.569   -19.244 0.02 28.30 ? 168 GLY A N    1  
ATOM   2651   C CA   . GLY A 1 175 ? -22.642 2.190   -18.063 0.02 28.58 ? 168 GLY A CA   1  
ATOM   2652   C C    . GLY A 1 175 ? -23.730 2.623   -17.102 0.02 28.71 ? 168 GLY A C    1  
ATOM   2653   O O    . GLY A 1 175 ? -24.844 2.123   -17.110 0.02 28.58 ? 168 GLY A O    1  
ATOM   2654   H H    . GLY A 1 175 ? -22.921 0.766   -19.370 0.02 28.16 ? 168 GLY A H    1  
ATOM   2655   H HA2  . GLY A 1 175 ? -22.056 1.563   -17.618 0.02 28.56 ? 168 GLY A HA2  1  
ATOM   2656   H HA3  . GLY A 1 175 ? -22.121 2.965   -18.321 0.02 28.73 ? 168 GLY A HA3  1  
ATOM   2657   N N    . ALA A 1 176 ? -23.408 3.629   -16.284 0.02 29.04 ? 169 ALA A N    1  
ATOM   2658   C CA   . ALA A 1 176 ? -24.384 4.096   -15.294 0.02 29.24 ? 169 ALA A CA   1  
ATOM   2659   C C    . ALA A 1 176 ? -25.671 4.595   -15.949 0.02 29.20 ? 169 ALA A C    1  
ATOM   2660   O O    . ALA A 1 176 ? -26.751 4.514   -15.359 0.02 29.27 ? 169 ALA A O    1  
ATOM   2661   C CB   . ALA A 1 176 ? -23.787 5.209   -14.449 0.02 29.64 ? 169 ALA A CB   1  
ATOM   2662   H H    . ALA A 1 176 ? -22.658 4.046   -16.287 0.02 29.17 ? 169 ALA A H    1  
ATOM   2663   H HA   . ALA A 1 176 ? -24.615 3.359   -14.711 0.02 29.17 ? 169 ALA A HA   1  
ATOM   2664   H HB1  . ALA A 1 176 ? -24.488 5.573   -13.885 0.02 29.79 ? 169 ALA A HB1  1  
ATOM   2665   H HB2  . ALA A 1 176 ? -23.078 4.841   -13.901 0.02 29.69 ? 169 ALA A HB2  1  
ATOM   2666   H HB3  . ALA A 1 176 ? -23.437 5.902   -15.030 0.02 29.72 ? 169 ALA A HB3  1  
ATOM   2667   N N    . LEU A 1 177 ? -25.584 5.137   -17.159 0.02 29.15 ? 170 LEU A N    1  
ATOM   2668   C CA   . LEU A 1 177 ? -26.815 5.580   -17.803 0.02 29.15 ? 170 LEU A CA   1  
ATOM   2669   C C    . LEU A 1 177 ? -27.728 4.407   -18.115 0.02 28.86 ? 170 LEU A C    1  
ATOM   2670   O O    . LEU A 1 177 ? -28.947 4.566   -18.179 0.02 28.91 ? 170 LEU A O    1  
ATOM   2671   C CB   . LEU A 1 177 ? -26.492 6.363   -19.073 0.02 29.17 ? 170 LEU A CB   1  
ATOM   2672   C CG   . LEU A 1 177 ? -25.814 7.708   -18.873 0.02 29.53 ? 170 LEU A CG   1  
ATOM   2673   C CD1  . LEU A 1 177 ? -25.419 8.360   -20.192 0.02 29.58 ? 170 LEU A CD1  1  
ATOM   2674   C CD2  . LEU A 1 177 ? -26.746 8.616   -18.099 0.02 29.85 ? 170 LEU A CD2  1  
ATOM   2675   H H    . LEU A 1 177 ? -24.861 5.248   -17.608 0.02 29.14 ? 170 LEU A H    1  
ATOM   2676   H HA   . LEU A 1 177 ? -27.301 6.152   -17.190 0.02 29.36 ? 170 LEU A HA   1  
ATOM   2677   H HB2  . LEU A 1 177 ? -25.903 5.826   -19.623 0.02 28.99 ? 170 LEU A HB2  1  
ATOM   2678   H HB3  . LEU A 1 177 ? -27.322 6.531   -19.544 0.02 29.17 ? 170 LEU A HB3  1  
ATOM   2679   H HG   . LEU A 1 177 ? -25.007 7.575   -18.357 0.02 29.57 ? 170 LEU A HG   1  
ATOM   2680   H HD11 . LEU A 1 177 ? -24.547 8.034   -20.466 0.02 29.52 ? 170 LEU A HD11 1  
ATOM   2681   H HD12 . LEU A 1 177 ? -26.080 8.132   -20.865 0.02 29.42 ? 170 LEU A HD12 1  
ATOM   2682   H HD13 . LEU A 1 177 ? -25.388 9.322   -20.070 0.02 29.85 ? 170 LEU A HD13 1  
ATOM   2683   H HD21 . LEU A 1 177 ? -26.329 9.486   -17.992 0.02 30.11 ? 170 LEU A HD21 1  
ATOM   2684   H HD22 . LEU A 1 177 ? -27.578 8.707   -18.588 0.02 29.82 ? 170 LEU A HD22 1  
ATOM   2685   H HD23 . LEU A 1 177 ? -26.923 8.227   -17.231 0.02 29.87 ? 170 LEU A HD23 1  
ATOM   2686   N N    . GLY A 1 178 ? -27.164 3.224   -18.281 0.02 28.60 ? 171 GLY A N    1  
ATOM   2687   C CA   . GLY A 1 178 ? -27.991 2.065   -18.493 0.02 28.38 ? 171 GLY A CA   1  
ATOM   2688   C C    . GLY A 1 178 ? -28.329 1.286   -17.238 0.02 28.42 ? 171 GLY A C    1  
ATOM   2689   O O    . GLY A 1 178 ? -29.330 0.572   -17.224 0.02 28.35 ? 171 GLY A O    1  
ATOM   2690   H H    . GLY A 1 178 ? -26.322 3.071   -18.269 0.02 28.57 ? 171 GLY A H    1  
ATOM   2691   H HA2  . GLY A 1 178 ? -28.825 2.329   -18.907 0.02 28.40 ? 171 GLY A HA2  1  
ATOM   2692   H HA3  . GLY A 1 178 ? -27.531 1.463   -19.097 0.02 28.20 ? 171 GLY A HA3  1  
ATOM   2693   N N    . PHE A 1 179 ? -27.521 1.433   -16.173 0.02 28.58 ? 172 PHE A N    1  
ATOM   2694   C CA   . PHE A 1 179 ? -27.584 0.448   -15.099 0.02 28.59 ? 172 PHE A CA   1  
ATOM   2695   C C    . PHE A 1 179 ? -27.551 1.060   -13.694 0.02 28.93 ? 172 PHE A C    1  
ATOM   2696   O O    . PHE A 1 179 ? -27.366 0.323   -12.715 0.02 29.00 ? 172 PHE A O    1  
ATOM   2697   C CB   . PHE A 1 179 ? -26.457 -0.576  -15.346 0.02 28.39 ? 172 PHE A CB   1  
ATOM   2698   C CG   . PHE A 1 179 ? -26.707 -1.412  -16.583 0.02 28.10 ? 172 PHE A CG   1  
ATOM   2699   C CD1  . PHE A 1 179 ? -27.613 -2.437  -16.536 0.02 28.01 ? 172 PHE A CD1  1  
ATOM   2700   C CD2  . PHE A 1 179 ? -26.115 -1.093  -17.815 0.02 27.97 ? 172 PHE A CD2  1  
ATOM   2701   C CE1  . PHE A 1 179 ? -27.897 -3.203  -17.675 0.02 27.78 ? 172 PHE A CE1  1  
ATOM   2702   C CE2  . PHE A 1 179 ? -26.403 -1.853  -18.959 0.02 27.73 ? 172 PHE A CE2  1  
ATOM   2703   C CZ   . PHE A 1 179 ? -27.290 -2.882  -18.888 0.02 27.64 ? 172 PHE A CZ   1  
ATOM   2704   H H    . PHE A 1 179 ? -26.948 2.060   -16.063 0.02 28.69 ? 172 PHE A H    1  
ATOM   2705   H HA   . PHE A 1 179 ? -28.423 -0.035  -15.165 0.02 28.54 ? 172 PHE A HA   1  
ATOM   2706   H HB2  . PHE A 1 179 ? -25.623 -0.102  -15.476 0.02 28.44 ? 172 PHE A HB2  1  
ATOM   2707   H HB3  . PHE A 1 179 ? -26.381 -1.165  -14.582 0.02 28.44 ? 172 PHE A HB3  1  
ATOM   2708   H HD1  . PHE A 1 179 ? -28.022 -2.642  -15.730 0.02 28.12 ? 172 PHE A HD1  1  
ATOM   2709   H HD2  . PHE A 1 179 ? -25.510 -0.389  -17.872 0.02 28.06 ? 172 PHE A HD2  1  
ATOM   2710   H HE1  . PHE A 1 179 ? -28.504 -3.903  -17.622 0.02 27.75 ? 172 PHE A HE1  1  
ATOM   2711   H HE2  . PHE A 1 179 ? -25.993 -1.653  -19.767 0.02 27.67 ? 172 PHE A HE2  1  
ATOM   2712   H HZ   . PHE A 1 179 ? -27.470 -3.388  -19.644 0.02 27.51 ? 172 PHE A HZ   1  
ATOM   2713   N N    . LEU A 1 180 ? -27.782 2.369   -13.568 0.02 29.17 ? 173 LEU A N    1  
ATOM   2714   C CA   . LEU A 1 180 ? -28.021 2.958   -12.250 0.02 29.53 ? 173 LEU A CA   1  
ATOM   2715   C C    . LEU A 1 180 ? -29.195 2.252   -11.587 0.02 29.59 ? 173 LEU A C    1  
ATOM   2716   O O    . LEU A 1 180 ? -30.152 1.861   -12.250 0.02 29.44 ? 173 LEU A O    1  
ATOM   2717   C CB   . LEU A 1 180 ? -28.321 4.457   -12.372 0.02 29.81 ? 173 LEU A CB   1  
ATOM   2718   C CG   . LEU A 1 180 ? -28.042 5.267   -11.107 0.02 30.23 ? 173 LEU A CG   1  
ATOM   2719   C CD1  . LEU A 1 180 ? -26.546 5.446   -10.977 0.02 30.28 ? 173 LEU A CD1  1  
ATOM   2720   C CD2  . LEU A 1 180 ? -28.780 6.627   -11.107 0.02 30.55 ? 173 LEU A CD2  1  
ATOM   2721   H H    . LEU A 1 180 ? -27.802 2.926   -14.215 0.02 29.16 ? 173 LEU A H    1  
ATOM   2722   H HA   . LEU A 1 180 ? -27.238 2.843   -11.692 0.02 29.61 ? 173 LEU A HA   1  
ATOM   2723   H HB2  . LEU A 1 180 ? -27.769 4.836   -13.071 0.02 29.74 ? 173 LEU A HB2  1  
ATOM   2724   H HB3  . LEU A 1 180 ? -29.257 4.568   -12.599 0.02 29.82 ? 173 LEU A HB3  1  
ATOM   2725   H HG   . LEU A 1 180 ? -28.351 4.762   -10.342 0.02 30.29 ? 173 LEU A HG   1  
ATOM   2726   H HD11 . LEU A 1 180 ? -26.253 6.142   -11.582 0.02 30.31 ? 173 LEU A HD11 1  
ATOM   2727   H HD12 . LEU A 1 180 ? -26.342 5.695   -10.064 0.02 30.53 ? 173 LEU A HD12 1  
ATOM   2728   H HD13 . LEU A 1 180 ? -26.096 4.616   -11.192 0.02 30.06 ? 173 LEU A HD13 1  
ATOM   2729   H HD21 . LEU A 1 180 ? -28.533 7.116   -10.310 0.02 30.83 ? 173 LEU A HD21 1  
ATOM   2730   H HD22 . LEU A 1 180 ? -28.517 7.134   -11.890 0.02 30.50 ? 173 LEU A HD22 1  
ATOM   2731   H HD23 . LEU A 1 180 ? -29.737 6.473   -11.121 0.02 30.56 ? 173 LEU A HD23 1  
ATOM   2732   N N    . SER A 1 181 ? -29.121 2.074   -10.263 0.02 29.85 ? 174 SER A N    1  
ATOM   2733   C CA   . SER A 1 181 ? -30.181 1.389   -9.537  0.02 29.97 ? 174 SER A CA   1  
ATOM   2734   C C    . SER A 1 181 ? -30.322 2.004   -8.144  0.02 30.42 ? 174 SER A C    1  
ATOM   2735   O O    . SER A 1 181 ? -29.316 2.190   -7.466  0.02 30.56 ? 174 SER A O    1  
ATOM   2736   C CB   . SER A 1 181 ? -29.867 -0.100  -9.392  0.02 29.76 ? 174 SER A CB   1  
ATOM   2737   O OG   . SER A 1 181 ? -30.830 -0.742  -8.581  0.02 29.95 ? 174 SER A OG   1  
ATOM   2738   H H    . SER A 1 181 ? -28.465 2.333   -9.777  0.02 29.97 ? 174 SER A H    1  
ATOM   2739   H HA   . SER A 1 181 ? -31.020 1.483   -10.014 0.02 29.93 ? 174 SER A HA   1  
ATOM   2740   H HB2  . SER A 1 181 ? -29.868 -0.508  -10.270 0.02 29.51 ? 174 SER A HB2  1  
ATOM   2741   H HB3  . SER A 1 181 ? -28.993 -0.194  -8.988  0.02 29.80 ? 174 SER A HB3  1  
ATOM   2742   H HG   . SER A 1 181 ? -31.569 -0.769  -8.978  0.02 29.92 ? 174 SER A HG   1  
ATOM   2743   N N    . LEU A 1 182 ? -31.552 2.302   -7.732  0.02 30.67 ? 175 LEU A N    1  
ATOM   2744   C CA   . LEU A 1 182 ? -31.819 2.938   -6.436  0.02 31.15 ? 175 LEU A CA   1  
ATOM   2745   C C    . LEU A 1 182 ? -32.908 2.206   -5.670  0.02 31.35 ? 175 LEU A C    1  
ATOM   2746   O O    . LEU A 1 182 ? -33.945 1.863   -6.228  0.02 31.26 ? 175 LEU A O    1  
ATOM   2747   C CB   . LEU A 1 182 ? -32.270 4.372   -6.595  0.02 31.41 ? 175 LEU A CB   1  
ATOM   2748   C CG   . LEU A 1 182 ? -31.368 5.352   -7.319  0.02 31.34 ? 175 LEU A CG   1  
ATOM   2749   C CD1  . LEU A 1 182 ? -32.112 6.674   -7.408  0.02 31.68 ? 175 LEU A CD1  1  
ATOM   2750   C CD2  . LEU A 1 182 ? -30.035 5.540   -6.649  0.02 31.46 ? 175 LEU A CD2  1  
ATOM   2751   H H    . LEU A 1 182 ? -32.262 2.146   -8.190  0.02 30.59 ? 175 LEU A H    1  
ATOM   2752   H HA   . LEU A 1 182 ? -31.014 2.941   -5.898  0.02 31.24 ? 175 LEU A HA   1  
ATOM   2753   H HB2  . LEU A 1 182 ? -33.117 4.361   -7.069  0.02 31.35 ? 175 LEU A HB2  1  
ATOM   2754   H HB3  . LEU A 1 182 ? -32.408 4.733   -5.706  0.02 31.75 ? 175 LEU A HB3  1  
ATOM   2755   H HG   . LEU A 1 182 ? -31.211 5.028   -8.220  0.02 31.03 ? 175 LEU A HG   1  
ATOM   2756   H HD11 . LEU A 1 182 ? -33.022 6.544   -7.102  0.02 31.83 ? 175 LEU A HD11 1  
ATOM   2757   H HD12 . LEU A 1 182 ? -31.666 7.324   -6.847  0.02 31.94 ? 175 LEU A HD12 1  
ATOM   2758   H HD13 . LEU A 1 182 ? -32.110 6.973   -8.330  0.02 31.52 ? 175 LEU A HD13 1  
ATOM   2759   H HD21 . LEU A 1 182 ? -29.639 6.366   -6.966  0.02 31.53 ? 175 LEU A HD21 1  
ATOM   2760   H HD22 . LEU A 1 182 ? -30.164 5.575   -5.689  0.02 31.73 ? 175 LEU A HD22 1  
ATOM   2761   H HD23 . LEU A 1 182 ? -29.463 4.792   -6.878  0.02 31.20 ? 175 LEU A HD23 1  
ATOM   2762   N N    . ASN A 1 183 ? -32.715 2.086   -4.350  0.02 31.70 ? 176 ASN A N    1  
ATOM   2763   C CA   . ASN A 1 183 ? -33.636 1.325   -3.517  0.02 31.94 ? 176 ASN A CA   1  
ATOM   2764   C C    . ASN A 1 183 ? -35.018 1.967   -3.438  0.02 32.26 ? 176 ASN A C    1  
ATOM   2765   O O    . ASN A 1 183 ? -36.032 1.276   -3.564  0.02 32.29 ? 176 ASN A O    1  
ATOM   2766   C CB   . ASN A 1 183 ? -33.000 1.152   -2.132  0.02 32.29 ? 176 ASN A CB   1  
ATOM   2767   C CG   . ASN A 1 183 ? -31.566 0.670   -2.246  0.02 32.05 ? 176 ASN A CG   1  
ATOM   2768   O OD1  . ASN A 1 183 ? -30.939 0.859   -3.285  0.02 31.77 ? 176 ASN A OD1  1  
ATOM   2769   N ND2  . ASN A 1 183 ? -31.073 0.021   -1.254  0.02 32.19 ? 176 ASN A ND2  1  
ATOM   2770   H H    . ASN A 1 183 ? -32.052 2.430   -3.928  0.02 31.82 ? 176 ASN A H    1  
ATOM   2771   H HA   . ASN A 1 183 ? -33.751 0.440   -3.896  0.02 31.71 ? 176 ASN A HA   1  
ATOM   2772   H HB2  . ASN A 1 183 ? -32.996 2.007   -1.677  0.02 32.60 ? 176 ASN A HB2  1  
ATOM   2773   H HB3  . ASN A 1 183 ? -33.502 0.502   -1.616  0.02 32.39 ? 176 ASN A HB3  1  
ATOM   2774   H HD21 . ASN A 1 183 ? -30.228 -0.108  -1.175  0.02 32.38 ? 176 ASN A HD21 1  
ATOM   2775   H HD22 . ASN A 1 183 ? -31.626 -0.342  -0.721  0.02 32.10 ? 176 ASN A HD22 1  
ATOM   2776   N N    . SER A 1 184 ? -35.091 3.277   -3.228  0.02 32.52 ? 177 SER A N    1  
ATOM   2777   C CA   . SER A 1 184 ? -36.383 3.901   -2.936  0.02 32.96 ? 177 SER A CA   1  
ATOM   2778   C C    . SER A 1 184 ? -37.339 3.755   -4.109  0.02 32.77 ? 177 SER A C    1  
ATOM   2779   O O    . SER A 1 184 ? -37.098 4.292   -5.200  0.02 32.47 ? 177 SER A O    1  
ATOM   2780   C CB   . SER A 1 184 ? -36.186 5.363   -2.573  0.02 33.33 ? 177 SER A CB   1  
ATOM   2781   O OG   . SER A 1 184 ? -35.436 5.412   -1.394  0.02 33.64 ? 177 SER A OG   1  
ATOM   2782   H H    . SER A 1 184 ? -34.422 3.819   -3.245  0.02 32.49 ? 177 SER A H    1  
ATOM   2783   H HA   . SER A 1 184 ? -36.786 3.460   -2.174  0.02 33.19 ? 177 SER A HA   1  
ATOM   2784   H HB2  . SER A 1 184 ? -35.696 5.815   -3.272  0.02 33.13 ? 177 SER A HB2  1  
ATOM   2785   H HB3  . SER A 1 184 ? -37.047 5.789   -2.438  0.02 33.60 ? 177 SER A HB3  1  
ATOM   2786   H HG   . SER A 1 184 ? -35.075 4.664   -1.252  0.02 33.42 ? 177 SER A HG   1  
ATOM   2787   N N    . GLU A 1 185 ? -38.425 3.011   -3.881  0.02 32.97 ? 178 GLU A N    1  
ATOM   2788   C CA   . GLU A 1 185 ? -39.389 2.787   -4.944  0.02 32.84 ? 178 GLU A CA   1  
ATOM   2789   C C    . GLU A 1 185 ? -39.846 4.103   -5.537  0.02 32.97 ? 178 GLU A C    1  
ATOM   2790   O O    . GLU A 1 185 ? -39.860 4.270   -6.770  0.02 32.62 ? 178 GLU A O    1  
ATOM   2791   C CB   . GLU A 1 185 ? -40.587 1.999   -4.422  0.02 33.19 ? 178 GLU A CB   1  
ATOM   2792   C CG   . GLU A 1 185 ? -41.480 1.578   -5.546  0.02 32.92 ? 178 GLU A CG   1  
ATOM   2793   C CD   . GLU A 1 185 ? -42.435 0.499   -5.183  0.02 33.22 ? 178 GLU A CD   1  
ATOM   2794   O OE1  . GLU A 1 185 ? -42.599 0.214   -3.976  0.02 33.56 ? 178 GLU A OE1  1  
ATOM   2795   O OE2  . GLU A 1 185 ? -43.027 -0.066  -6.113  0.02 33.13 ? 178 GLU A OE2  1  
ATOM   2796   H H    . GLU A 1 185 ? -38.617 2.630   -3.138  0.02 33.20 ? 178 GLU A H    1  
ATOM   2797   H HA   . GLU A 1 185 ? -38.976 2.276   -5.645  0.02 32.46 ? 178 GLU A HA   1  
ATOM   2798   H HB2  . GLU A 1 185 ? -40.280 1.213   -3.948  0.02 33.25 ? 178 GLU A HB2  1  
ATOM   2799   H HB3  . GLU A 1 185 ? -41.104 2.567   -3.830  0.02 33.56 ? 178 GLU A HB3  1  
ATOM   2800   H HG2  . GLU A 1 185 ? -42.001 2.342   -5.840  0.02 32.92 ? 178 GLU A HG2  1  
ATOM   2801   H HG3  . GLU A 1 185 ? -40.933 1.260   -6.277  0.02 32.55 ? 178 GLU A HG3  1  
ATOM   2802   N N    . ASP A 1 186 ? -40.256 5.013   -4.651  0.02 33.51 ? 179 ASP A N    1  
ATOM   2803   C CA   . ASP A 1 186 ? -40.419 6.434   -4.931  0.02 33.72 ? 179 ASP A CA   1  
ATOM   2804   C C    . ASP A 1 186 ? -39.762 6.872   -6.237  0.02 33.26 ? 179 ASP A C    1  
ATOM   2805   O O    . ASP A 1 186 ? -40.443 7.401   -7.123  0.02 33.28 ? 179 ASP A O    1  
ATOM   2806   C CB   . ASP A 1 186 ? -39.848 7.200   -3.721  0.02 34.11 ? 179 ASP A CB   1  
ATOM   2807   C CG   . ASP A 1 186 ? -39.910 8.673   -3.881  0.02 34.47 ? 179 ASP A CG   1  
ATOM   2808   O OD1  . ASP A 1 186 ? -40.113 9.395   -2.850  0.02 35.06 ? 179 ASP A OD1  1  
ATOM   2809   O OD2  . ASP A 1 186 ? -39.753 9.121   -5.042  0.02 34.21 ? 179 ASP A OD2  1  
ATOM   2810   H H    . ASP A 1 186 ? -40.447 4.813   -3.837  0.02 33.78 ? 179 ASP A H    1  
ATOM   2811   H HA   . ASP A 1 186 ? -41.366 6.638   -4.994  0.02 33.98 ? 179 ASP A HA   1  
ATOM   2812   H HB2  . ASP A 1 186 ? -40.356 6.965   -2.929  0.02 34.40 ? 179 ASP A HB2  1  
ATOM   2813   H HB3  . ASP A 1 186 ? -38.918 6.953   -3.602  0.02 33.87 ? 179 ASP A HB3  1  
ATOM   2814   N N    . LEU A 1 187 ? -38.444 6.728   -6.353  0.02 32.91 ? 180 LEU A N    1  
ATOM   2815   C CA   . LEU A 1 187 ? -37.703 7.323   -7.463  0.02 32.58 ? 180 LEU A CA   1  
ATOM   2816   C C    . LEU A 1 187 ? -37.813 6.542   -8.767  0.02 32.09 ? 180 LEU A C    1  
ATOM   2817   O O    . LEU A 1 187 ? -37.504 7.098   -9.828  0.02 31.90 ? 180 LEU A O    1  
ATOM   2818   C CB   . LEU A 1 187 ? -36.235 7.487   -7.071  0.02 32.48 ? 180 LEU A CB   1  
ATOM   2819   C CG   . LEU A 1 187 ? -35.996 8.213   -5.739  0.02 32.99 ? 180 LEU A CG   1  
ATOM   2820   C CD1  . LEU A 1 187 ? -34.545 8.141   -5.322  0.02 32.87 ? 180 LEU A CD1  1  
ATOM   2821   C CD2  . LEU A 1 187 ? -36.447 9.651   -5.857  0.02 33.36 ? 180 LEU A CD2  1  
ATOM   2822   H H    . LEU A 1 187 ? -37.954 6.294   -5.795  0.02 32.88 ? 180 LEU A H    1  
ATOM   2823   H HA   . LEU A 1 187 ? -38.059 8.207   -7.637  0.02 32.80 ? 180 LEU A HA   1  
ATOM   2824   H HB2  . LEU A 1 187 ? -35.829 6.609   -7.007  0.02 32.25 ? 180 LEU A HB2  1  
ATOM   2825   H HB3  . LEU A 1 187 ? -35.797 8.004   -7.766  0.02 32.32 ? 180 LEU A HB3  1  
ATOM   2826   H HG   . LEU A 1 187 ? -36.527 7.793   -5.046  0.02 33.19 ? 180 LEU A HG   1  
ATOM   2827   H HD11 . LEU A 1 187 ? -34.462 8.477   -4.417  0.02 33.21 ? 180 LEU A HD11 1  
ATOM   2828   H HD12 . LEU A 1 187 ? -34.256 7.217   -5.351  0.02 32.60 ? 180 LEU A HD12 1  
ATOM   2829   H HD13 . LEU A 1 187 ? -34.011 8.676   -5.930  0.02 32.77 ? 180 LEU A HD13 1  
ATOM   2830   H HD21 . LEU A 1 187 ? -35.971 10.069  -6.593  0.02 33.18 ? 180 LEU A HD21 1  
ATOM   2831   H HD22 . LEU A 1 187 ? -37.403 9.669   -6.025  0.02 33.46 ? 180 LEU A HD22 1  
ATOM   2832   H HD23 . LEU A 1 187 ? -36.248 10.118  -5.031  0.02 33.70 ? 180 LEU A HD23 1  
ATOM   2833   N N    . ASN A 1 188 ? -38.262 5.286   -8.731  0.02 31.91 ? 181 ASN A N    1  
ATOM   2834   C CA   . ASN A 1 188 ? -38.728 4.625   -9.941  0.02 31.59 ? 181 ASN A CA   1  
ATOM   2835   C C    . ASN A 1 188 ? -37.551 4.411   -10.912 0.02 31.10 ? 181 ASN A C    1  
ATOM   2836   O O    . ASN A 1 188 ? -37.668 4.473   -12.145 0.02 30.87 ? 181 ASN A O    1  
ATOM   2837   C CB   . ASN A 1 188 ? -39.900 5.433   -10.516 0.02 31.88 ? 181 ASN A CB   1  
ATOM   2838   C CG   . ASN A 1 188 ? -40.000 5.372   -11.994 0.02 31.59 ? 181 ASN A CG   1  
ATOM   2839   O OD1  . ASN A 1 188 ? -39.389 6.184   -12.690 0.02 31.51 ? 181 ASN A OD1  1  
ATOM   2840   N ND2  . ASN A 1 188 ? -40.754 4.394   -12.506 0.02 31.47 ? 181 ASN A ND2  1  
ATOM   2841   H H    . ASN A 1 188 ? -38.300 4.797   -8.026  0.02 31.99 ? 181 ASN A H    1  
ATOM   2842   H HA   . ASN A 1 188 ? -39.070 3.753   -9.700  0.02 31.55 ? 181 ASN A HA   1  
ATOM   2843   H HB2  . ASN A 1 188 ? -40.722 5.068   -10.155 0.02 32.10 ? 181 ASN A HB2  1  
ATOM   2844   H HB3  . ASN A 1 188 ? -39.821 6.364   -10.267 0.02 32.10 ? 181 ASN A HB3  1  
ATOM   2845   H HD21 . ASN A 1 188 ? -40.892 3.674   -12.054 0.02 31.51 ? 181 ASN A HD21 1  
ATOM   2846   H HD22 . ASN A 1 188 ? -41.096 4.480   -13.290 0.02 31.37 ? 181 ASN A HD22 1  
ATOM   2847   N N    . VAL A 1 189 ? -36.402 4.107   -10.318 0.02 30.98 ? 182 VAL A N    1  
ATOM   2848   C CA   . VAL A 1 189 ? -35.128 3.832   -10.972 0.02 30.57 ? 182 VAL A CA   1  
ATOM   2849   C C    . VAL A 1 189 ? -34.693 2.475   -10.431 0.02 30.41 ? 182 VAL A C    1  
ATOM   2850   O O    . VAL A 1 189 ? -33.715 2.381   -9.690  0.02 30.44 ? 182 VAL A O    1  
ATOM   2851   C CB   . VAL A 1 189 ? -34.093 4.933   -10.691 0.02 30.69 ? 182 VAL A CB   1  
ATOM   2852   C CG1  . VAL A 1 189 ? -32.744 4.626   -11.322 0.02 30.32 ? 182 VAL A CG1  1  
ATOM   2853   C CG2  . VAL A 1 189 ? -34.612 6.290   -11.180 0.02 30.93 ? 182 VAL A CG2  1  
ATOM   2854   H H    . VAL A 1 189 ? -36.337 4.030   -9.468  0.02 31.17 ? 182 VAL A H    1  
ATOM   2855   H HA   . VAL A 1 189 ? -35.258 3.755   -11.933 0.02 30.37 ? 182 VAL A HA   1  
ATOM   2856   H HB   . VAL A 1 189 ? -33.960 4.993   -9.734  0.02 30.90 ? 182 VAL A HB   1  
ATOM   2857   H HG11 . VAL A 1 189 ? -32.070 5.195   -10.924 0.02 30.44 ? 182 VAL A HG11 1  
ATOM   2858   H HG12 . VAL A 1 189 ? -32.512 3.698   -11.181 0.02 30.18 ? 182 VAL A HG12 1  
ATOM   2859   H HG13 . VAL A 1 189 ? -32.802 4.799   -12.274 0.02 30.13 ? 182 VAL A HG13 1  
ATOM   2860   H HG21 . VAL A 1 189 ? -34.078 6.993   -10.784 0.02 31.10 ? 182 VAL A HG21 1  
ATOM   2861   H HG22 . VAL A 1 189 ? -34.531 6.328   -12.143 0.02 30.72 ? 182 VAL A HG22 1  
ATOM   2862   H HG23 . VAL A 1 189 ? -35.538 6.388   -10.924 0.02 31.14 ? 182 VAL A HG23 1  
ATOM   2863   N N    . PRO A 1 190 ? -35.396 1.402   -10.765 0.02 30.27 ? 183 PRO A N    1  
ATOM   2864   C CA   . PRO A 1 190 ? -35.072 0.105   -10.146 0.02 30.19 ? 183 PRO A CA   1  
ATOM   2865   C C    . PRO A 1 190 ? -33.776 -0.524  -10.638 0.02 29.81 ? 183 PRO A C    1  
ATOM   2866   O O    . PRO A 1 190 ? -33.247 -1.409  -9.945  0.02 29.80 ? 183 PRO A O    1  
ATOM   2867   C CB   . PRO A 1 190 ? -36.286 -0.745  -10.499 0.02 30.21 ? 183 PRO A CB   1  
ATOM   2868   C CG   . PRO A 1 190 ? -36.763 -0.124  -11.835 0.02 30.07 ? 183 PRO A CG   1  
ATOM   2869   C CD   . PRO A 1 190 ? -36.642 1.339   -11.541 0.02 30.30 ? 183 PRO A CD   1  
ATOM   2870   H HA   . PRO A 1 190 ? -35.025 0.196   -9.183  0.02 30.42 ? 183 PRO A HA   1  
ATOM   2871   H HB2  . PRO A 1 190 ? -36.028 -1.674  -10.597 0.02 30.04 ? 183 PRO A HB2  1  
ATOM   2872   H HB3  . PRO A 1 190 ? -36.964 -0.645  -9.816  0.02 30.50 ? 183 PRO A HB3  1  
ATOM   2873   H HG2  . PRO A 1 190 ? -36.163 -0.383  -12.553 0.02 29.78 ? 183 PRO A HG2  1  
ATOM   2874   H HG3  . PRO A 1 190 ? -37.679 -0.377  -12.027 0.02 30.17 ? 183 PRO A HG3  1  
ATOM   2875   H HD2  . PRO A 1 190 ? -36.562 1.840   -12.366 0.02 30.18 ? 183 PRO A HD2  1  
ATOM   2876   H HD3  . PRO A 1 190 ? -37.390 1.644   -11.008 0.02 30.60 ? 183 PRO A HD3  1  
ATOM   2877   N N    . GLY A 1 191 ? -33.228 -0.075  -11.763 0.02 29.55 ? 184 GLY A N    1  
ATOM   2878   C CA   . GLY A 1 191 ? -32.087 -0.719  -12.388 0.02 29.21 ? 184 GLY A CA   1  
ATOM   2879   C C    . GLY A 1 191 ? -32.436 -1.320  -13.746 0.02 28.91 ? 184 GLY A C    1  
ATOM   2880   O O    . GLY A 1 191 ? -33.584 -1.358  -14.168 0.02 28.97 ? 184 GLY A O    1  
ATOM   2881   H H    . GLY A 1 191 ? -33.497 0.629   -12.175 0.02 29.59 ? 184 GLY A H    1  
ATOM   2882   H HA2  . GLY A 1 191 ? -31.369 -0.079  -12.492 0.02 29.20 ? 184 GLY A HA2  1  
ATOM   2883   H HA3  . GLY A 1 191 ? -31.766 -1.430  -11.818 0.02 29.21 ? 184 GLY A HA3  1  
ATOM   2884   N N    . ASN A 1 192 ? -31.391 -1.790  -14.428 0.02 28.63 ? 185 ASN A N    1  
ATOM   2885   C CA   . ASN A 1 192 ? -31.518 -2.599  -15.649 0.02 28.35 ? 185 ASN A CA   1  
ATOM   2886   C C    . ASN A 1 192 ? -32.164 -1.843  -16.805 0.02 28.31 ? 185 ASN A C    1  
ATOM   2887   O O    . ASN A 1 192 ? -32.807 -2.457  -17.657 0.02 28.20 ? 185 ASN A O    1  
ATOM   2888   C CB   . ASN A 1 192 ? -32.306 -3.877  -15.388 0.02 28.37 ? 185 ASN A CB   1  
ATOM   2889   C CG   . ASN A 1 192 ? -31.623 -4.754  -14.400 0.02 28.41 ? 185 ASN A CG   1  
ATOM   2890   O OD1  . ASN A 1 192 ? -30.405 -4.698  -14.268 0.02 28.33 ? 185 ASN A OD1  1  
ATOM   2891   N ND2  . ASN A 1 192 ? -32.399 -5.544  -13.668 0.02 28.59 ? 185 ASN A ND2  1  
ATOM   2892   H H    . ASN A 1 192 ? -30.575 -1.658  -14.195 0.02 28.62 ? 185 ASN A H    1  
ATOM   2893   H HA   . ASN A 1 192 ? -30.629 -2.856  -15.928 0.02 28.21 ? 185 ASN A HA   1  
ATOM   2894   H HB2  . ASN A 1 192 ? -33.187 -3.656  -15.054 0.02 28.54 ? 185 ASN A HB2  1  
ATOM   2895   H HB3  . ASN A 1 192 ? -32.391 -4.383  -16.209 0.02 28.21 ? 185 ASN A HB3  1  
ATOM   2896   H HD21 . ASN A 1 192 ? -32.055 -6.206  -13.248 0.02 28.65 ? 185 ASN A HD21 1  
ATOM   2897   H HD22 . ASN A 1 192 ? -33.244 -5.396  -13.620 0.02 28.66 ? 185 ASN A HD22 1  
ATOM   2898   N N    . ALA A 1 193 ? -31.973 -0.528  -16.868 0.02 28.44 ? 186 ALA A N    1  
ATOM   2899   C CA   . ALA A 1 193 ? -32.567 0.239   -17.963 0.02 28.44 ? 186 ALA A CA   1  
ATOM   2900   C C    . ALA A 1 193 ? -32.064 -0.282  -19.309 0.02 28.16 ? 186 ALA A C    1  
ATOM   2901   O O    . ALA A 1 193 ? -32.838 -0.414  -20.264 0.02 28.12 ? 186 ALA A O    1  
ATOM   2902   C CB   . ALA A 1 193 ? -32.263 1.736   -17.788 0.02 28.66 ? 186 ALA A CB   1  
ATOM   2903   H H    . ALA A 1 193 ? -31.499 -0.071  -16.324 0.02 28.54 ? 186 ALA A H    1  
ATOM   2904   H HA   . ALA A 1 193 ? -33.530 0.126   -17.942 0.02 28.54 ? 186 ALA A HA   1  
ATOM   2905   H HB1  . ALA A 1 193 ? -32.595 2.222   -18.557 0.02 28.67 ? 186 ALA A HB1  1  
ATOM   2906   H HB2  . ALA A 1 193 ? -32.715 2.049   -16.990 0.02 28.86 ? 186 ALA A HB2  1  
ATOM   2907   H HB3  . ALA A 1 193 ? -31.309 1.877   -17.701 0.02 28.61 ? 186 ALA A HB3  1  
ATOM   2908   N N    . GLY A 1 194 ? -30.776 -0.616  -19.387 0.02 28.00 ? 187 GLY A N    1  
ATOM   2909   C CA   . GLY A 1 194 ? -30.217 -1.089  -20.649 0.02 27.77 ? 187 GLY A CA   1  
ATOM   2910   C C    . GLY A 1 194 ? -30.780 -2.429  -21.086 0.02 27.62 ? 187 GLY A C    1  
ATOM   2911   O O    . GLY A 1 194 ? -30.890 -2.714  -22.295 0.02 27.50 ? 187 GLY A O    1  
ATOM   2912   H H    . GLY A 1 194 ? -30.216 -0.579  -18.739 0.02 28.04 ? 187 GLY A H    1  
ATOM   2913   H HA2  . GLY A 1 194 ? -30.416 -0.440  -21.342 0.02 27.80 ? 187 GLY A HA2  1  
ATOM   2914   H HA3  . GLY A 1 194 ? -29.253 -1.166  -20.574 0.02 27.71 ? 187 GLY A HA3  1  
ATOM   2915   N N    . LEU A 1 195 ? -31.111 -3.303  -20.116 0.02 27.66 ? 188 LEU A N    1  
ATOM   2916   C CA   . LEU A 1 195 ? -31.764 -4.554  -20.490 0.02 27.58 ? 188 LEU A CA   1  
ATOM   2917   C C    . LEU A 1 195 ? -33.192 -4.304  -20.937 0.02 27.70 ? 188 LEU A C    1  
ATOM   2918   O O    . LEU A 1 195 ? -33.687 -4.976  -21.852 0.02 27.64 ? 188 LEU A O    1  
ATOM   2919   C CB   . LEU A 1 195 ? -31.759 -5.564  -19.338 0.02 27.64 ? 188 LEU A CB   1  
ATOM   2920   C CG   . LEU A 1 195 ? -30.402 -6.128  -18.935 0.02 27.54 ? 188 LEU A CG   1  
ATOM   2921   C CD1  . LEU A 1 195 ? -30.591 -7.121  -17.739 0.02 27.67 ? 188 LEU A CD1  1  
ATOM   2922   C CD2  . LEU A 1 195 ? -29.651 -6.803  -20.086 0.02 27.33 ? 188 LEU A CD2  1  
ATOM   2923   H H    . LEU A 1 195 ? -30.964 -3.199  -19.281 0.02 27.74 ? 188 LEU A H    1  
ATOM   2924   H HA   . LEU A 1 195 ? -31.281 -4.944  -21.232 0.02 27.44 ? 188 LEU A HA   1  
ATOM   2925   H HB2  . LEU A 1 195 ? -32.138 -5.139  -18.552 0.02 27.80 ? 188 LEU A HB2  1  
ATOM   2926   H HB3  . LEU A 1 195 ? -32.320 -6.310  -19.589 0.02 27.63 ? 188 LEU A HB3  1  
ATOM   2927   H HG   . LEU A 1 195 ? -29.848 -5.393  -18.635 0.02 27.58 ? 188 LEU A HG   1  
ATOM   2928   H HD11 . LEU A 1 195 ? -29.814 -7.695  -17.668 0.02 27.60 ? 188 LEU A HD11 1  
ATOM   2929   H HD12 . LEU A 1 195 ? -30.694 -6.611  -16.923 0.02 27.81 ? 188 LEU A HD12 1  
ATOM   2930   H HD13 . LEU A 1 195 ? -31.387 -7.651  -17.894 0.02 27.71 ? 188 LEU A HD13 1  
ATOM   2931   H HD21 . LEU A 1 195 ? -29.287 -7.647  -19.781 0.02 27.31 ? 188 LEU A HD21 1  
ATOM   2932   H HD22 . LEU A 1 195 ? -30.263 -6.949  -20.824 0.02 27.29 ? 188 LEU A HD22 1  
ATOM   2933   H HD23 . LEU A 1 195 ? -28.925 -6.228  -20.368 0.02 27.28 ? 188 LEU A HD23 1  
ATOM   2934   N N    . LYS A 1 196 ? -33.874 -3.346  -20.315 0.02 27.93 ? 189 LYS A N    1  
ATOM   2935   C CA   . LYS A 1 196 ? -35.227 -3.049  -20.748 0.02 28.09 ? 189 LYS A CA   1  
ATOM   2936   C C    . LYS A 1 196 ? -35.212 -2.424  -22.135 0.02 28.02 ? 189 LYS A C    1  
ATOM   2937   O O    . LYS A 1 196 ? -36.164 -2.595  -22.893 0.02 28.10 ? 189 LYS A O    1  
ATOM   2938   C CB   . LYS A 1 196 ? -35.929 -2.149  -19.716 0.02 28.40 ? 189 LYS A CB   1  
ATOM   2939   C CG   . LYS A 1 196 ? -36.096 -2.886  -18.381 0.02 28.53 ? 189 LYS A CG   1  
ATOM   2940   C CD   . LYS A 1 196 ? -36.669 -2.053  -17.241 0.02 28.85 ? 189 LYS A CD   1  
ATOM   2941   C CE   . LYS A 1 196 ? -36.647 -2.867  -15.914 0.02 28.98 ? 189 LYS A CE   1  
ATOM   2942   N NZ   . LYS A 1 196 ? -36.342 -2.002  -14.751 0.02 29.23 ? 189 LYS A NZ   1  
ATOM   2943   H H    . LYS A 1 196 ? -33.575 -2.857  -19.682 0.02 28.00 ? 189 LYS A H    1  
ATOM   2944   H HA   . LYS A 1 196 ? -35.727 -3.875  -20.802 0.02 28.10 ? 189 LYS A HA   1  
ATOM   2945   H HB2  . LYS A 1 196 ? -35.396 -1.352  -19.570 0.02 28.41 ? 189 LYS A HB2  1  
ATOM   2946   H HB3  . LYS A 1 196 ? -36.811 -1.910  -20.036 0.02 28.53 ? 189 LYS A HB3  1  
ATOM   2947   H HG2  . LYS A 1 196 ? -36.692 -3.638  -18.519 0.02 28.56 ? 189 LYS A HG2  1  
ATOM   2948   H HG3  . LYS A 1 196 ? -35.228 -3.205  -18.089 0.02 28.40 ? 189 LYS A HG3  1  
ATOM   2949   H HD2  . LYS A 1 196 ? -36.139 -1.250  -17.125 0.02 28.86 ? 189 LYS A HD2  1  
ATOM   2950   H HD3  . LYS A 1 196 ? -37.590 -1.827  -17.441 0.02 29.02 ? 189 LYS A HD3  1  
ATOM   2951   H HE2  . LYS A 1 196 ? -37.519 -3.263  -15.767 0.02 29.12 ? 189 LYS A HE2  1  
ATOM   2952   H HE3  . LYS A 1 196 ? -35.966 -3.555  -15.960 0.02 28.80 ? 189 LYS A HE3  1  
ATOM   2953   H HZ1  . LYS A 1 196 ? -36.708 -2.347  -14.018 0.02 29.37 ? 189 LYS A HZ1  1  
ATOM   2954   H HZ2  . LYS A 1 196 ? -35.462 -1.946  -14.640 0.02 29.12 ? 189 LYS A HZ2  1  
ATOM   2955   H HZ3  . LYS A 1 196 ? -36.673 -1.187  -14.882 0.02 29.37 ? 189 LYS A HZ3  1  
ATOM   2956   N N    . ASP A 1 197 ? -34.147 -1.700  -22.469 0.02 27.92 ? 190 ASP A N    1  
ATOM   2957   C CA   . ASP A 1 197 ? -33.957 -1.261  -23.843 0.02 27.85 ? 190 ASP A CA   1  
ATOM   2958   C C    . ASP A 1 197 ? -33.938 -2.469  -24.780 0.02 27.67 ? 190 ASP A C    1  
ATOM   2959   O O    . ASP A 1 197 ? -34.670 -2.510  -25.769 0.02 27.71 ? 190 ASP A O    1  
ATOM   2960   C CB   . ASP A 1 197 ? -32.669 -0.461  -23.960 0.02 27.79 ? 190 ASP A CB   1  
ATOM   2961   C CG   . ASP A 1 197 ? -32.703 0.873   -23.167 0.02 28.03 ? 190 ASP A CG   1  
ATOM   2962   O OD1  . ASP A 1 197 ? -33.780 1.312   -22.796 0.02 28.24 ? 190 ASP A OD1  1  
ATOM   2963   O OD2  . ASP A 1 197 ? -31.634 1.435   -22.954 0.02 28.04 ? 190 ASP A OD2  1  
ATOM   2964   H H    . ASP A 1 197 ? -33.525 -1.458  -21.934 0.02 27.91 ? 190 ASP A H    1  
ATOM   2965   H HA   . ASP A 1 197 ? -34.693 -0.686  -24.095 0.02 27.99 ? 190 ASP A HA   1  
ATOM   2966   H HB2  . ASP A 1 197 ? -31.945 -0.991  -23.604 0.02 27.68 ? 190 ASP A HB2  1  
ATOM   2967   H HB3  . ASP A 1 197 ? -32.500 -0.261  -24.889 0.02 27.76 ? 190 ASP A HB3  1  
ATOM   2968   N N    . GLN A 1 198 ? -33.165 -3.501  -24.426 0.02 27.50 ? 191 GLN A N    1  
ATOM   2969   C CA   . GLN A 1 198 ? -33.092 -4.694  -25.260 0.02 27.36 ? 191 GLN A CA   1  
ATOM   2970   C C    . GLN A 1 198 ? -34.464 -5.336  -25.418 0.02 27.49 ? 191 GLN A C    1  
ATOM   2971   O O    . GLN A 1 198 ? -34.862 -5.726  -26.524 0.02 27.48 ? 191 GLN A O    1  
ATOM   2972   C CB   . GLN A 1 198 ? -32.095 -5.687  -24.664 0.02 27.22 ? 191 GLN A CB   1  
ATOM   2973   C CG   . GLN A 1 198 ? -30.689 -5.216  -24.702 0.02 27.13 ? 191 GLN A CG   1  
ATOM   2974   C CD   . GLN A 1 198 ? -29.764 -6.091  -23.898 0.02 27.06 ? 191 GLN A CD   1  
ATOM   2975   O OE1  . GLN A 1 198 ? -30.148 -7.185  -23.479 0.02 27.06 ? 191 GLN A OE1  1  
ATOM   2976   N NE2  . GLN A 1 198 ? -28.561 -5.625  -23.675 0.02 27.03 ? 191 GLN A NE2  1  
ATOM   2977   H H    . GLN A 1 198 ? -32.684 -3.534  -23.716 0.02 27.48 ? 191 GLN A H    1  
ATOM   2978   H HA   . GLN A 1 198 ? -32.772 -4.436  -26.138 0.02 27.31 ? 191 GLN A HA   1  
ATOM   2979   H HB2  . GLN A 1 198 ? -32.323 -5.839  -23.737 0.02 27.29 ? 191 GLN A HB2  1  
ATOM   2980   H HB3  . GLN A 1 198 ? -32.147 -6.520  -25.150 0.02 27.17 ? 191 GLN A HB3  1  
ATOM   2981   H HG2  . GLN A 1 198 ? -30.379 -5.220  -25.620 0.02 27.07 ? 191 GLN A HG2  1  
ATOM   2982   H HG3  . GLN A 1 198 ? -30.645 -4.318  -24.345 0.02 27.20 ? 191 GLN A HG3  1  
ATOM   2983   H HE21 . GLN A 1 198 ? -28.367 -4.813  -23.875 0.02 27.07 ? 191 GLN A HE21 1  
ATOM   2984   H HE22 . GLN A 1 198 ? -27.967 -6.128  -23.321 0.02 27.00 ? 191 GLN A HE22 1  
ATOM   2985   N N    . VAL A 1 199 ? -35.210 -5.432  -24.325 0.02 27.64 ? 192 VAL A N    1  
ATOM   2986   C CA   . VAL A 1 199 ? -36.566 -5.957  -24.383 0.02 27.84 ? 192 VAL A CA   1  
ATOM   2987   C C    . VAL A 1 199 ? -37.365 -5.205  -25.435 0.02 27.96 ? 192 VAL A C    1  
ATOM   2988   O O    . VAL A 1 199 ? -38.003 -5.795  -26.310 0.02 28.04 ? 192 VAL A O    1  
ATOM   2989   C CB   . VAL A 1 199 ? -37.236 -5.867  -22.997 0.02 28.05 ? 192 VAL A CB   1  
ATOM   2990   C CG1  . VAL A 1 199 ? -38.633 -6.420  -23.034 0.02 28.31 ? 192 VAL A CG1  1  
ATOM   2991   C CG2  . VAL A 1 199 ? -36.433 -6.625  -21.971 0.02 27.96 ? 192 VAL A CG2  1  
ATOM   2992   H H    . VAL A 1 199 ? -34.954 -5.191  -23.546 0.02 27.67 ? 192 VAL A H    1  
ATOM   2993   H HA   . VAL A 1 199 ? -36.539 -6.893  -24.631 0.02 27.78 ? 192 VAL A HA   1  
ATOM   2994   H HB   . VAL A 1 199 ? -37.276 -4.941  -22.726 0.02 28.12 ? 192 VAL A HB   1  
ATOM   2995   H HG11 . VAL A 1 199 ? -39.039 -6.308  -22.163 0.02 28.49 ? 192 VAL A HG11 1  
ATOM   2996   H HG12 . VAL A 1 199 ? -39.161 -5.968  -23.702 0.02 28.37 ? 192 VAL A HG12 1  
ATOM   2997   H HG13 . VAL A 1 199 ? -38.581 -7.359  -23.253 0.02 28.28 ? 192 VAL A HG13 1  
ATOM   2998   H HG21 . VAL A 1 199 ? -37.010 -6.865  -21.230 0.02 28.13 ? 192 VAL A HG21 1  
ATOM   2999   H HG22 . VAL A 1 199 ? -36.073 -7.427  -22.380 0.02 27.85 ? 192 VAL A HG22 1  
ATOM   3000   H HG23 . VAL A 1 199 ? -35.711 -6.059  -21.660 0.02 27.88 ? 192 VAL A HG23 1  
ATOM   3001   N N    . MET A 1 200 ? -37.325 -3.882  -25.389 0.02 28.03 ? 193 MET A N    1  
ATOM   3002   C CA   . MET A 1 200 ? -38.176 -3.155  -26.335 0.02 28.21 ? 193 MET A CA   1  
ATOM   3003   C C    . MET A 1 200 ? -37.649 -3.264  -27.759 0.02 28.07 ? 193 MET A C    1  
ATOM   3004   O O    . MET A 1 200 ? -38.437 -3.255  -28.713 0.02 28.21 ? 193 MET A O    1  
ATOM   3005   C CB   . MET A 1 200 ? -38.328 -1.708  -25.912 0.02 28.39 ? 193 MET A CB   1  
ATOM   3006   C CG   . MET A 1 200 ? -39.028 -1.665  -24.557 0.02 28.59 ? 193 MET A CG   1  
ATOM   3007   S SD   . MET A 1 200 ? -39.182 -3.348  -23.845 0.02 28.50 ? 193 MET A SD   1  
ATOM   3008   C CE   . MET A 1 200 ? -39.065 -2.988  -22.061 0.02 28.69 ? 193 MET A CE   1  
ATOM   3009   H H    . MET A 1 200 ? -36.828 -3.411  -24.877 0.02 28.00 ? 193 MET A H    1  
ATOM   3010   H HA   . MET A 1 200 ? -39.062 -3.551  -26.345 0.02 28.35 ? 193 MET A HA   1  
ATOM   3011   H HB2  . MET A 1 200 ? -37.459 -1.291  -25.833 0.02 28.27 ? 193 MET A HB2  1  
ATOM   3012   H HB3  . MET A 1 200 ? -38.881 -1.238  -26.556 0.02 28.53 ? 193 MET A HB3  1  
ATOM   3013   H HG2  . MET A 1 200 ? -38.487 -1.135  -23.960 0.02 28.58 ? 193 MET A HG2  1  
ATOM   3014   H HG3  . MET A 1 200 ? -39.913 -1.276  -24.650 0.02 28.81 ? 193 MET A HG3  1  
ATOM   3015   H HE1  . MET A 1 200 ? -39.893 -2.579  -21.787 0.02 28.93 ? 193 MET A HE1  1  
ATOM   3016   H HE2  . MET A 1 200 ? -38.948 -3.819  -21.578 0.02 28.61 ? 193 MET A HE2  1  
ATOM   3017   H HE3  . MET A 1 200 ? -38.317 -2.401  -21.877 0.02 28.67 ? 193 MET A HE3  1  
ATOM   3018   N N    . ALA A 1 201 ? -36.334 -3.414  -27.930 0.02 27.83 ? 194 ALA A N    1  
ATOM   3019   C CA   . ALA A 1 201 ? -35.825 -3.674  -29.279 0.02 27.71 ? 194 ALA A CA   1  
ATOM   3020   C C    . ALA A 1 201 ? -36.345 -5.002  -29.819 0.02 27.71 ? 194 ALA A C    1  
ATOM   3021   O O    . ALA A 1 201 ? -36.714 -5.109  -30.994 0.02 27.78 ? 194 ALA A O    1  
ATOM   3022   C CB   . ALA A 1 201 ? -34.305 -3.650  -29.285 0.02 27.50 ? 194 ALA A CB   1  
ATOM   3023   H H    . ALA A 1 201 ? -35.738 -3.378  -27.315 0.02 27.75 ? 194 ALA A H    1  
ATOM   3024   H HA   . ALA A 1 201 ? -36.136 -2.968  -29.867 0.02 27.82 ? 194 ALA A HA   1  
ATOM   3025   H HB1  . ALA A 1 201 ? -33.988 -4.030  -30.117 0.02 27.45 ? 194 ALA A HB1  1  
ATOM   3026   H HB2  . ALA A 1 201 ? -34.006 -2.732  -29.206 0.02 27.54 ? 194 ALA A HB2  1  
ATOM   3027   H HB3  . ALA A 1 201 ? -33.976 -4.177  -28.542 0.02 27.42 ? 194 ALA A HB3  1  
ATOM   3028   N N    . LEU A 1 202 ? -36.407 -6.026  -28.963 0.02 27.68 ? 195 LEU A N    1  
ATOM   3029   C CA   . LEU A 1 202 ? -36.933 -7.319  -29.387 0.02 27.72 ? 195 LEU A CA   1  
ATOM   3030   C C    . LEU A 1 202 ? -38.421 -7.249  -29.686 0.02 28.01 ? 195 LEU A C    1  
ATOM   3031   O O    . LEU A 1 202 ? -38.921 -7.958  -30.564 0.02 28.11 ? 195 LEU A O    1  
ATOM   3032   C CB   . LEU A 1 202 ? -36.666 -8.358  -28.309 0.02 27.66 ? 195 LEU A CB   1  
ATOM   3033   C CG   . LEU A 1 202 ? -35.201 -8.729  -28.123 0.02 27.42 ? 195 LEU A CG   1  
ATOM   3034   C CD1  . LEU A 1 202 ? -35.076 -9.805  -27.065 0.02 27.41 ? 195 LEU A CD1  1  
ATOM   3035   C CD2  . LEU A 1 202 ? -34.552 -9.219  -29.433 0.02 27.32 ? 195 LEU A CD2  1  
ATOM   3036   H H    . LEU A 1 202 ? -36.151 -5.996  -28.148 0.02 27.65 ? 195 LEU A H    1  
ATOM   3037   H HA   . LEU A 1 202 ? -36.484 -7.594  -30.201 0.02 27.65 ? 195 LEU A HA   1  
ATOM   3038   H HB2  . LEU A 1 202 ? -36.989 -8.004  -27.466 0.02 27.74 ? 195 LEU A HB2  1  
ATOM   3039   H HB3  . LEU A 1 202 ? -37.155 -9.163  -28.524 0.02 27.74 ? 195 LEU A HB3  1  
ATOM   3040   H HG   . LEU A 1 202 ? -34.713 -7.947  -27.830 0.02 27.36 ? 195 LEU A HG   1  
ATOM   3041   H HD11 . LEU A 1 202 ? -35.538 -9.519  -26.262 0.02 27.51 ? 195 LEU A HD11 1  
ATOM   3042   H HD12 . LEU A 1 202 ? -35.469 -10.625 -27.401 0.02 27.47 ? 195 LEU A HD12 1  
ATOM   3043   H HD13 . LEU A 1 202 ? -34.139 -9.945  -26.872 0.02 27.28 ? 195 LEU A HD13 1  
ATOM   3044   H HD21 . LEU A 1 202 ? -33.682 -9.597  -29.231 0.02 27.20 ? 195 LEU A HD21 1  
ATOM   3045   H HD22 . LEU A 1 202 ? -35.122 -9.893  -29.835 0.02 27.41 ? 195 LEU A HD22 1  
ATOM   3046   H HD23 . LEU A 1 202 ? -34.455 -8.466  -30.035 0.02 27.32 ? 195 LEU A HD23 1  
ATOM   3047   N N    . ARG A 1 203 ? -39.154 -6.437  -28.931 0.02 28.18 ? 196 ARG A N    1  
ATOM   3048   C CA   . ARG A 1 203 ? -40.558 -6.234  -29.229 0.02 28.51 ? 196 ARG A CA   1  
ATOM   3049   C C    . ARG A 1 203 ? -40.747 -5.549  -30.581 0.02 28.59 ? 196 ARG A C    1  
ATOM   3050   O O    . ARG A 1 203 ? -41.668 -5.890  -31.323 0.02 28.82 ? 196 ARG A O    1  
ATOM   3051   C CB   . ARG A 1 203 ? -41.207 -5.427  -28.106 0.02 28.70 ? 196 ARG A CB   1  
ATOM   3052   C CG   . ARG A 1 203 ? -41.513 -6.248  -26.879 0.02 28.79 ? 196 ARG A CG   1  
ATOM   3053   C CD   . ARG A 1 203 ? -41.899 -5.370  -25.672 0.02 28.97 ? 196 ARG A CD   1  
ATOM   3054   N NE   . ARG A 1 203 ? -42.114 -6.188  -24.503 0.02 29.05 ? 196 ARG A NE   1  
ATOM   3055   C CZ   . ARG A 1 203 ? -42.104 -5.752  -23.253 0.02 29.14 ? 196 ARG A CZ   1  
ATOM   3056   N NH1  . ARG A 1 203 ? -41.895 -4.466  -22.974 0.02 29.16 ? 196 ARG A NH1  1  
ATOM   3057   N NH2  . ARG A 1 203 ? -42.309 -6.629  -22.283 0.02 29.24 ? 196 ARG A NH2  1  
ATOM   3058   H H    . ARG A 1 203 ? -38.866 -6.006  -28.247 0.02 28.14 ? 196 ARG A H    1  
ATOM   3059   H HA   . ARG A 1 203 ? -40.991 -7.103  -29.271 0.02 28.59 ? 196 ARG A HA   1  
ATOM   3060   H HB2  . ARG A 1 203 ? -40.598 -4.722  -27.839 0.02 28.59 ? 196 ARG A HB2  1  
ATOM   3061   H HB3  . ARG A 1 203 ? -42.035 -5.041  -28.435 0.02 28.92 ? 196 ARG A HB3  1  
ATOM   3062   H HG2  . ARG A 1 203 ? -42.260 -6.833  -27.078 0.02 28.97 ? 196 ARG A HG2  1  
ATOM   3063   H HG3  . ARG A 1 203 ? -40.729 -6.766  -26.638 0.02 28.59 ? 196 ARG A HG3  1  
ATOM   3064   H HD2  . ARG A 1 203 ? -41.181 -4.746  -25.475 0.02 28.82 ? 196 ARG A HD2  1  
ATOM   3065   H HD3  . ARG A 1 203 ? -42.722 -4.895  -25.861 0.02 29.20 ? 196 ARG A HD3  1  
ATOM   3066   H HE   . ARG A 1 203 ? -42.323 -7.013  -24.632 0.02 29.13 ? 196 ARG A HE   1  
ATOM   3067   H HH11 . ARG A 1 203 ? -41.759 -3.906  -23.607 0.02 29.12 ? 196 ARG A HH11 1  
ATOM   3068   H HH12 . ARG A 1 203 ? -41.891 -4.193  -22.162 0.02 29.24 ? 196 ARG A HH12 1  
ATOM   3069   H HH21 . ARG A 1 203 ? -42.446 -7.457  -22.471 0.02 29.25 ? 196 ARG A HH21 1  
ATOM   3070   H HH22 . ARG A 1 203 ? -42.311 -6.366  -21.462 0.02 29.32 ? 196 ARG A HH22 1  
ATOM   3071   N N    . TRP A 1 204 ? -39.906 -4.563  -30.906 0.02 28.45 ? 197 TRP A N    1  
ATOM   3072   C CA   . TRP A 1 204 ? -39.993 -3.938  -32.219 0.02 28.55 ? 197 TRP A CA   1  
ATOM   3073   C C    . TRP A 1 204 ? -39.713 -4.977  -33.299 0.02 28.47 ? 197 TRP A C    1  
ATOM   3074   O O    . TRP A 1 204 ? -40.466 -5.116  -34.264 0.02 28.68 ? 197 TRP A O    1  
ATOM   3075   C CB   . TRP A 1 204 ? -39.016 -2.757  -32.320 0.02 28.43 ? 197 TRP A CB   1  
ATOM   3076   C CG   . TRP A 1 204 ? -39.085 -1.981  -33.593 0.02 28.58 ? 197 TRP A CG   1  
ATOM   3077   C CD1  . TRP A 1 204 ? -39.698 -0.775  -33.796 0.02 28.85 ? 197 TRP A CD1  1  
ATOM   3078   C CD2  . TRP A 1 204 ? -38.503 -2.350  -34.846 0.02 28.51 ? 197 TRP A CD2  1  
ATOM   3079   N NE1  . TRP A 1 204 ? -39.550 -0.381  -35.111 0.02 28.96 ? 197 TRP A NE1  1  
ATOM   3080   C CE2  . TRP A 1 204 ? -38.813 -1.324  -35.771 0.02 28.75 ? 197 TRP A CE2  1  
ATOM   3081   C CE3  . TRP A 1 204 ? -37.750 -3.444  -35.283 0.02 28.31 ? 197 TRP A CE3  1  
ATOM   3082   C CZ2  . TRP A 1 204 ? -38.403 -1.365  -37.097 0.02 28.79 ? 197 TRP A CZ2  1  
ATOM   3083   C CZ3  . TRP A 1 204 ? -37.341 -3.477  -36.624 0.02 28.35 ? 197 TRP A CZ3  1  
ATOM   3084   C CH2  . TRP A 1 204 ? -37.670 -2.442  -37.503 0.02 28.59 ? 197 TRP A CH2  1  
ATOM   3085   H H    . TRP A 1 204 ? -39.284 -4.258  -30.403 0.02 28.32 ? 197 TRP A H    1  
ATOM   3086   H HA   . TRP A 1 204 ? -40.892 -3.599  -32.344 0.02 28.78 ? 197 TRP A HA   1  
ATOM   3087   H HB2  . TRP A 1 204 ? -39.208 -2.136  -31.605 0.02 28.50 ? 197 TRP A HB2  1  
ATOM   3088   H HB3  . TRP A 1 204 ? -38.112 -3.087  -32.232 0.02 28.23 ? 197 TRP A HB3  1  
ATOM   3089   H HD1  . TRP A 1 204 ? -40.165 -0.300  -33.147 0.02 28.97 ? 197 TRP A HD1  1  
ATOM   3090   H HE1  . TRP A 1 204 ? -39.854 0.339   -35.456 0.02 29.14 ? 197 TRP A HE1  1  
ATOM   3091   H HE3  . TRP A 1 204 ? -37.532 -4.132  -34.700 0.02 28.18 ? 197 TRP A HE3  1  
ATOM   3092   H HZ2  . TRP A 1 204 ? -38.619 -0.679  -37.684 0.02 28.97 ? 197 TRP A HZ2  1  
ATOM   3093   H HZ3  . TRP A 1 204 ? -36.840 -4.193  -36.935 0.02 28.24 ? 197 TRP A HZ3  1  
ATOM   3094   H HH2  . TRP A 1 204 ? -37.384 -2.486  -38.387 0.02 28.64 ? 197 TRP A HH2  1  
ATOM   3095   N N    . ILE A 1 205 ? -38.665 -5.771  -33.100 0.02 28.21 ? 198 ILE A N    1  
ATOM   3096   C CA   . ILE A 1 205 ? -38.309 -6.781  -34.091 0.02 28.15 ? 198 ILE A CA   1  
ATOM   3097   C C    . ILE A 1 205 ? -39.469 -7.741  -34.320 0.02 28.38 ? 198 ILE A C    1  
ATOM   3098   O O    . ILE A 1 205 ? -39.872 -7.988  -35.467 0.02 28.55 ? 198 ILE A O    1  
ATOM   3099   C CB   . ILE A 1 205 ? -37.033 -7.512  -33.648 0.02 27.87 ? 198 ILE A CB   1  
ATOM   3100   C CG1  . ILE A 1 205 ? -35.842 -6.570  -33.665 0.02 27.70 ? 198 ILE A CG1  1  
ATOM   3101   C CG2  . ILE A 1 205 ? -36.738 -8.726  -34.564 0.02 27.86 ? 198 ILE A CG2  1  
ATOM   3102   C CD1  . ILE A 1 205 ? -34.686 -7.084  -32.829 0.02 27.47 ? 198 ILE A CD1  1  
ATOM   3103   H H    . ILE A 1 205 ? -38.159 -5.746  -32.408 0.02 28.08 ? 198 ILE A H    1  
ATOM   3104   H HA   . ILE A 1 205 ? -38.123 -6.344  -34.936 0.02 28.19 ? 198 ILE A HA   1  
ATOM   3105   H HB   . ILE A 1 205 ? -37.163 -7.825  -32.740 0.02 27.84 ? 198 ILE A HB   1  
ATOM   3106   H HG12 . ILE A 1 205 ? -35.530 -6.479  -34.574 0.02 27.72 ? 198 ILE A HG12 1  
ATOM   3107   H HG13 . ILE A 1 205 ? -36.107 -5.703  -33.329 0.02 27.76 ? 198 ILE A HG13 1  
ATOM   3108   H HG21 . ILE A 1 205 ? -35.783 -8.765  -34.731 0.02 27.71 ? 198 ILE A HG21 1  
ATOM   3109   H HG22 . ILE A 1 205 ? -37.036 -9.535  -34.124 0.02 27.89 ? 198 ILE A HG22 1  
ATOM   3110   H HG23 . ILE A 1 205 ? -37.209 -8.618  -35.402 0.02 28.00 ? 198 ILE A HG23 1  
ATOM   3111   H HD11 . ILE A 1 205 ? -34.428 -6.402  -32.191 0.02 27.43 ? 198 ILE A HD11 1  
ATOM   3112   H HD12 . ILE A 1 205 ? -34.973 -7.883  -32.361 0.02 27.47 ? 198 ILE A HD12 1  
ATOM   3113   H HD13 . ILE A 1 205 ? -33.940 -7.292  -33.413 0.02 27.40 ? 198 ILE A HD13 1  
ATOM   3114   N N    . LYS A 1 206 ? -40.020 -8.307  -33.237 0.02 28.44 ? 199 LYS A N    1  
ATOM   3115   C CA   . LYS A 1 206 ? -41.149 -9.225  -33.360 0.02 28.72 ? 199 LYS A CA   1  
ATOM   3116   C C    . LYS A 1 206 ? -42.220 -8.672  -34.294 0.02 29.05 ? 199 LYS A C    1  
ATOM   3117   O O    . LYS A 1 206 ? -42.746 -9.401  -35.143 0.02 29.27 ? 199 LYS A O    1  
ATOM   3118   C CB   . LYS A 1 206 ? -41.764 -9.511  -31.987 0.02 28.82 ? 199 LYS A CB   1  
ATOM   3119   C CG   . LYS A 1 206 ? -41.986 -10.983 -31.554 0.02 28.97 ? 199 LYS A CG   1  
ATOM   3120   C CD   . LYS A 1 206 ? -42.912 -11.797 -32.420 0.02 29.25 ? 199 LYS A CD   1  
ATOM   3121   C CE   . LYS A 1 206 ? -43.184 -13.204 -31.909 0.02 29.46 ? 199 LYS A CE   1  
ATOM   3122   N NZ   . LYS A 1 206 ? -43.994 -13.995 -32.893 0.02 29.77 ? 199 LYS A NZ   1  
ATOM   3123   H H    . LYS A 1 206 ? -39.755 -8.176  -32.433 0.02 28.35 ? 199 LYS A H    1  
ATOM   3124   H HA   . LYS A 1 206 ? -40.832 -10.067 -33.726 0.02 28.68 ? 199 LYS A HA   1  
ATOM   3125   H HB2  . LYS A 1 206 ? -41.195 -9.104  -31.316 0.02 28.63 ? 199 LYS A HB2  1  
ATOM   3126   H HB3  . LYS A 1 206 ? -42.634 -9.085  -31.969 0.02 29.02 ? 199 LYS A HB3  1  
ATOM   3127   H HG2  . LYS A 1 206 ? -41.135 -11.440 -31.475 0.02 28.78 ? 199 LYS A HG2  1  
ATOM   3128   H HG3  . LYS A 1 206 ? -42.443 -10.967 -30.714 0.02 29.12 ? 199 LYS A HG3  1  
ATOM   3129   H HD2  . LYS A 1 206 ? -43.766 -11.342 -32.463 0.02 29.45 ? 199 LYS A HD2  1  
ATOM   3130   H HD3  . LYS A 1 206 ? -42.525 -11.869 -33.310 0.02 29.12 ? 199 LYS A HD3  1  
ATOM   3131   H HE2  . LYS A 1 206 ? -42.346 -13.666 -31.769 0.02 29.28 ? 199 LYS A HE2  1  
ATOM   3132   H HE3  . LYS A 1 206 ? -43.686 -13.161 -31.081 0.02 29.63 ? 199 LYS A HE3  1  
ATOM   3133   H HZ1  . LYS A 1 206 ? -44.863 -13.837 -32.775 0.02 30.03 ? 199 LYS A HZ1  1  
ATOM   3134   H HZ2  . LYS A 1 206 ? -43.770 -13.771 -33.725 0.02 29.69 ? 199 LYS A HZ2  1  
ATOM   3135   H HZ3  . LYS A 1 206 ? -43.840 -14.864 -32.778 0.02 29.82 ? 199 LYS A HZ3  1  
ATOM   3136   N N    . ASN A 1 207 ? -42.589 -7.397  -34.136 0.02 29.12 ? 200 ASN A N    1  
ATOM   3137   C CA   . ASN A 1 207 ? -43.698 -6.854  -34.916 0.02 29.48 ? 200 ASN A CA   1  
ATOM   3138   C C    . ASN A 1 207 ? -43.279 -6.054  -36.132 0.02 29.48 ? 200 ASN A C    1  
ATOM   3139   O O    . ASN A 1 207 ? -44.156 -5.460  -36.758 0.02 29.79 ? 200 ASN A O    1  
ATOM   3140   C CB   . ASN A 1 207 ? -44.587 -5.911  -34.103 0.02 29.69 ? 200 ASN A CB   1  
ATOM   3141   C CG   . ASN A 1 207 ? -44.999 -6.477  -32.781 0.02 29.74 ? 200 ASN A CG   1  
ATOM   3142   O OD1  . ASN A 1 207 ? -45.326 -5.723  -31.865 0.02 29.92 ? 200 ASN A OD1  1  
ATOM   3143   N ND2  . ASN A 1 207 ? -45.018 -7.791  -32.671 0.02 29.64 ? 200 ASN A ND2  1  
ATOM   3144   H H    . ASN A 1 207 ? -42.215 -6.839  -33.600 0.02 28.98 ? 200 ASN A H    1  
ATOM   3145   H HA   . ASN A 1 207 ? -44.252 -7.589  -35.219 0.02 29.66 ? 200 ASN A HA   1  
ATOM   3146   H HB2  . ASN A 1 207 ? -44.109 -5.084  -33.946 0.02 29.55 ? 200 ASN A HB2  1  
ATOM   3147   H HB3  . ASN A 1 207 ? -45.394 -5.734  -34.609 0.02 29.97 ? 200 ASN A HB3  1  
ATOM   3148   H HD21 . ASN A 1 207 ? -45.033 -8.286  -33.373 0.02 29.70 ? 200 ASN A HD21 1  
ATOM   3149   H HD22 . ASN A 1 207 ? -45.020 -8.151  -31.891 0.02 29.52 ? 200 ASN A HD22 1  
ATOM   3150   N N    . ASN A 1 208 ? -41.995 -5.957  -36.444 0.02 29.18 ? 201 ASN A N    1  
ATOM   3151   C CA   . ASN A 1 208 ? -41.571 -5.245  -37.625 0.02 29.22 ? 201 ASN A CA   1  
ATOM   3152   C C    . ASN A 1 208 ? -40.780 -6.097  -38.619 0.02 29.11 ? 201 ASN A C    1  
ATOM   3153   O O    . ASN A 1 208 ? -40.691 -5.702  -39.776 0.02 29.25 ? 201 ASN A O    1  
ATOM   3154   C CB   . ASN A 1 208 ? -40.741 -4.009  -37.250 0.02 29.06 ? 201 ASN A CB   1  
ATOM   3155   C CG   . ASN A 1 208 ? -41.614 -2.853  -36.784 0.02 29.29 ? 201 ASN A CG   1  
ATOM   3156   O OD1  . ASN A 1 208 ? -42.106 -2.072  -37.592 0.02 29.57 ? 201 ASN A OD1  1  
ATOM   3157   N ND2  . ASN A 1 208 ? -41.859 -2.788  -35.493 0.02 29.22 ? 201 ASN A ND2  1  
ATOM   3158   H H    . ASN A 1 208 ? -41.354 -6.294  -35.986 0.02 28.97 ? 201 ASN A H    1  
ATOM   3159   H HA   . ASN A 1 208 ? -42.362 -4.922  -38.084 0.02 29.48 ? 201 ASN A HA   1  
ATOM   3160   H HB2  . ASN A 1 208 ? -40.127 -4.243  -36.539 0.02 28.83 ? 201 ASN A HB2  1  
ATOM   3161   H HB3  . ASN A 1 208 ? -40.244 -3.706  -38.024 0.02 29.07 ? 201 ASN A HB3  1  
ATOM   3162   H HD21 . ASN A 1 208 ? -41.467 -2.196  -35.013 0.02 29.10 ? 201 ASN A HD21 1  
ATOM   3163   H HD22 . ASN A 1 208 ? -42.406 -3.343  -35.132 0.02 29.32 ? 201 ASN A HD22 1  
ATOM   3164   N N    . CYS A 1 209 ? -40.241 -7.258  -38.229 0.02 28.90 ? 202 CYS A N    1  
ATOM   3165   C CA   . CYS A 1 209 ? -39.303 -7.931  -39.122 0.02 28.80 ? 202 CYS A CA   1  
ATOM   3166   C C    . CYS A 1 209 ? -39.988 -8.394  -40.410 0.02 29.11 ? 202 CYS A C    1  
ATOM   3167   O O    . CYS A 1 209 ? -39.344 -8.456  -41.460 0.02 29.13 ? 202 CYS A O    1  
ATOM   3168   C CB   . CYS A 1 209 ? -38.624 -9.113  -38.421 0.02 28.57 ? 202 CYS A CB   1  
ATOM   3169   S SG   . CYS A 1 209 ? -39.733 -10.396 -37.869 0.02 28.76 ? 202 CYS A SG   1  
ATOM   3170   H H    . CYS A 1 209 ? -40.409 -7.666  -37.494 0.02 28.85 ? 202 CYS A H    1  
ATOM   3171   H HA   . CYS A 1 209 ? -38.609 -7.298  -39.364 0.02 28.70 ? 202 CYS A HA   1  
ATOM   3172   H HB2  . CYS A 1 209 ? -38.011 -9.516  -39.053 0.02 28.52 ? 202 CYS A HB2  1  
ATOM   3173   H HB3  . CYS A 1 209 ? -38.127 -8.796  -37.654 0.02 28.39 ? 202 CYS A HB3  1  
ATOM   3174   H HG   . CYS A 1 209 ? -40.607 -9.931  -37.195 0.02 28.89 ? 202 CYS A HG   1  
ATOM   3175   N N    . ALA A 1 210 ? -41.281 -8.715  -40.354 0.02 29.40 ? 203 ALA A N    1  
ATOM   3176   C CA   . ALA A 1 210 ? -42.011 -9.116  -41.555 0.02 29.76 ? 203 ALA A CA   1  
ATOM   3177   C C    . ALA A 1 210 ? -41.923 -8.062  -42.655 0.02 29.91 ? 203 ALA A C    1  
ATOM   3178   O O    . ALA A 1 210 ? -41.985 -8.401  -43.846 0.02 30.13 ? 203 ALA A O    1  
ATOM   3179   C CB   . ALA A 1 210 ? -43.477 -9.389  -41.213 0.02 30.10 ? 203 ALA A CB   1  
ATOM   3180   H H    . ALA A 1 210 ? -41.749 -8.729  -39.635 0.02 29.42 ? 203 ALA A H    1  
ATOM   3181   H HA   . ALA A 1 210 ? -41.632 -9.944  -41.890 0.02 29.73 ? 203 ALA A HA   1  
ATOM   3182   H HB1  . ALA A 1 210 ? -43.849 -9.997  -41.867 0.02 30.32 ? 203 ALA A HB1  1  
ATOM   3183   H HB2  . ALA A 1 210 ? -43.522 -9.786  -40.330 0.02 30.00 ? 203 ALA A HB2  1  
ATOM   3184   H HB3  . ALA A 1 210 ? -43.963 -8.550  -41.222 0.02 30.23 ? 203 ALA A HB3  1  
ATOM   3185   N N    . ASN A 1 211 ? -41.808 -6.778  -42.275 0.02 29.84 ? 204 ASN A N    1  
ATOM   3186   C CA   . ASN A 1 211 ? -41.741 -5.673  -43.220 0.02 30.03 ? 204 ASN A CA   1  
ATOM   3187   C C    . ASN A 1 211 ? -40.447 -5.675  -44.013 0.02 29.87 ? 204 ASN A C    1  
ATOM   3188   O O    . ASN A 1 211 ? -40.359 -4.969  -45.025 0.02 30.08 ? 204 ASN A O    1  
ATOM   3189   C CB   . ASN A 1 211 ? -41.874 -4.317  -42.505 0.02 30.02 ? 204 ASN A CB   1  
ATOM   3190   C CG   . ASN A 1 211 ? -43.119 -4.225  -41.623 0.02 30.19 ? 204 ASN A CG   1  
ATOM   3191   O OD1  . ASN A 1 211 ? -44.124 -4.873  -41.879 0.02 30.47 ? 204 ASN A OD1  1  
ATOM   3192   N ND2  . ASN A 1 211 ? -43.054 -3.394  -40.591 0.02 30.06 ? 204 ASN A ND2  1  
ATOM   3193   H H    . ASN A 1 211 ? -41.762 -6.531  -41.455 0.02 29.71 ? 204 ASN A H    1  
ATOM   3194   H HA   . ASN A 1 211 ? -42.474 -5.749  -43.847 0.02 30.32 ? 204 ASN A HA   1  
ATOM   3195   H HB2  . ASN A 1 211 ? -41.095 -4.168  -41.948 0.02 29.76 ? 204 ASN A HB2  1  
ATOM   3196   H HB3  . ASN A 1 211 ? -41.934 -3.622  -43.176 0.02 30.21 ? 204 ASN A HB3  1  
ATOM   3197   H HD21 . ASN A 1 211 ? -43.773 -3.144  -40.191 0.02 30.22 ? 204 ASN A HD21 1  
ATOM   3198   H HD22 . ASN A 1 211 ? -42.292 -3.097  -40.327 0.02 29.83 ? 204 ASN A HD22 1  
ATOM   3199   N N    . PHE A 1 212 ? -39.459 -6.465  -43.594 0.02 29.55 ? 205 PHE A N    1  
ATOM   3200   C CA   . PHE A 1 212 ? -38.162 -6.517  -44.254 0.02 29.42 ? 205 PHE A CA   1  
ATOM   3201   C C    . PHE A 1 212 ? -37.881 -7.897  -44.838 0.02 29.45 ? 205 PHE A C    1  
ATOM   3202   O O    . PHE A 1 212 ? -36.742 -8.178  -45.188 0.02 29.32 ? 205 PHE A O    1  
ATOM   3203   C CB   . PHE A 1 212 ? -37.055 -6.101  -43.278 0.02 29.07 ? 205 PHE A CB   1  
ATOM   3204   C CG   . PHE A 1 212 ? -37.231 -4.695  -42.764 0.02 29.08 ? 205 PHE A CG   1  
ATOM   3205   C CD1  . PHE A 1 212 ? -38.062 -4.438  -41.700 0.02 29.07 ? 205 PHE A CD1  1  
ATOM   3206   C CD2  . PHE A 1 212 ? -36.606 -3.633  -43.396 0.02 29.17 ? 205 PHE A CD2  1  
ATOM   3207   C CE1  . PHE A 1 212 ? -38.262 -3.121  -41.248 0.02 29.13 ? 205 PHE A CE1  1  
ATOM   3208   C CE2  . PHE A 1 212 ? -36.806 -2.324  -42.962 0.02 29.24 ? 205 PHE A CE2  1  
ATOM   3209   C CZ   . PHE A 1 212 ? -37.626 -2.080  -41.866 0.02 29.21 ? 205 PHE A CZ   1  
ATOM   3210   H H    . PHE A 1 212 ? -39.523 -6.991  -42.919 0.02 29.43 ? 205 PHE A H    1  
ATOM   3211   H HA   . PHE A 1 212 ? -38.149 -5.881  -44.982 0.02 29.59 ? 205 PHE A HA   1  
ATOM   3212   H HB2  . PHE A 1 212 ? -37.059 -6.708  -42.521 0.02 28.91 ? 205 PHE A HB2  1  
ATOM   3213   H HB3  . PHE A 1 212 ? -36.199 -6.146  -43.732 0.02 29.01 ? 205 PHE A HB3  1  
ATOM   3214   H HD1  . PHE A 1 212 ? -38.495 -5.144  -41.281 0.02 29.04 ? 205 PHE A HD1  1  
ATOM   3215   H HD2  . PHE A 1 212 ? -36.056 -3.792  -44.126 0.02 29.21 ? 205 PHE A HD2  1  
ATOM   3216   H HE1  . PHE A 1 212 ? -38.815 -2.955  -40.523 0.02 29.14 ? 205 PHE A HE1  1  
ATOM   3217   H HE2  . PHE A 1 212 ? -36.364 -1.624  -43.386 0.02 29.32 ? 205 PHE A HE2  1  
ATOM   3218   H HZ   . PHE A 1 212 ? -37.758 -1.213  -41.562 0.02 29.28 ? 205 PHE A HZ   1  
ATOM   3219   N N    . GLY A 1 213 ? -38.893 -8.753  -44.930 0.02 29.64 ? 206 GLY A N    1  
ATOM   3220   C CA   . GLY A 1 213 ? -38.749 -10.093 -45.452 0.02 29.73 ? 206 GLY A CA   1  
ATOM   3221   C C    . GLY A 1 213 ? -38.537 -11.148 -44.393 0.02 29.50 ? 206 GLY A C    1  
ATOM   3222   O O    . GLY A 1 213 ? -38.304 -12.318 -44.739 0.02 29.57 ? 206 GLY A O    1  
ATOM   3223   H H    . GLY A 1 213 ? -39.696 -8.574  -44.685 0.02 29.76 ? 206 GLY A H    1  
ATOM   3224   H HA2  . GLY A 1 213 ? -39.552 -10.327 -45.942 0.02 30.00 ? 206 GLY A HA2  1  
ATOM   3225   H HA3  . GLY A 1 213 ? -38.004 -10.116 -46.072 0.02 29.71 ? 206 GLY A HA3  1  
ATOM   3226   N N    . GLY A 1 214 ? -38.608 -10.762 -43.111 0.02 29.27 ? 207 GLY A N    1  
ATOM   3227   C CA   . GLY A 1 214 ? -38.390 -11.678 -42.023 0.02 29.07 ? 207 GLY A CA   1  
ATOM   3228   C C    . GLY A 1 214 ? -39.565 -12.602 -41.755 0.02 29.33 ? 207 GLY A C    1  
ATOM   3229   O O    . GLY A 1 214 ? -40.699 -12.327 -42.117 0.02 29.64 ? 207 GLY A O    1  
ATOM   3230   H H    . GLY A 1 214 ? -38.779 -9.959  -42.858 0.02 29.24 ? 207 GLY A H    1  
ATOM   3231   H HA2  . GLY A 1 214 ? -37.607 -12.218 -42.203 0.02 28.97 ? 207 GLY A HA2  1  
ATOM   3232   H HA3  . GLY A 1 214 ? -38.227 -11.172 -41.215 0.02 28.90 ? 207 GLY A HA3  1  
ATOM   3233   N N    . ASN A 1 215 ? -39.254 -13.715 -41.099 0.02 29.22 ? 208 ASN A N    1  
ATOM   3234   C CA   . ASN A 1 215 ? -40.263 -14.620 -40.565 0.02 29.45 ? 208 ASN A CA   1  
ATOM   3235   C C    . ASN A 1 215 ? -40.406 -14.343 -39.072 0.02 29.27 ? 208 ASN A C    1  
ATOM   3236   O O    . ASN A 1 215 ? -39.505 -14.694 -38.311 0.02 29.00 ? 208 ASN A O    1  
ATOM   3237   C CB   . ASN A 1 215 ? -39.827 -16.063 -40.796 0.02 29.53 ? 208 ASN A CB   1  
ATOM   3238   C CG   . ASN A 1 215 ? -40.807 -17.095 -40.262 0.02 29.81 ? 208 ASN A CG   1  
ATOM   3239   O OD1  . ASN A 1 215 ? -41.881 -16.783 -39.760 0.02 29.99 ? 208 ASN A OD1  1  
ATOM   3240   N ND2  . ASN A 1 215 ? -40.423 -18.362 -40.403 0.02 29.90 ? 208 ASN A ND2  1  
ATOM   3241   H H    . ASN A 1 215 ? -38.449 -13.970 -40.959 0.02 29.05 ? 208 ASN A H    1  
ATOM   3242   H HA   . ASN A 1 215 ? -41.110 -14.475 -41.007 0.02 29.71 ? 208 ASN A HA   1  
ATOM   3243   H HB2  . ASN A 1 215 ? -39.736 -16.212 -41.751 0.02 29.67 ? 208 ASN A HB2  1  
ATOM   3244   H HB3  . ASN A 1 215 ? -38.976 -16.212 -40.358 0.02 29.29 ? 208 ASN A HB3  1  
ATOM   3245   H HD21 . ASN A 1 215 ? -39.789 -18.558 -40.949 0.02 29.86 ? 208 ASN A HD21 1  
ATOM   3246   H HD22 . ASN A 1 215 ? -40.808 -18.979 -39.948 0.02 30.02 ? 208 ASN A HD22 1  
ATOM   3247   N N    . PRO A 1 216 ? -41.489 -13.714 -38.606 0.02 29.43 ? 209 PRO A N    1  
ATOM   3248   C CA   . PRO A 1 216 ? -41.607 -13.463 -37.154 0.02 29.29 ? 209 PRO A CA   1  
ATOM   3249   C C    . PRO A 1 216 ? -41.765 -14.726 -36.323 0.02 29.36 ? 209 PRO A C    1  
ATOM   3250   O O    . PRO A 1 216 ? -41.770 -14.619 -35.093 0.02 29.25 ? 209 PRO A O    1  
ATOM   3251   C CB   . PRO A 1 216 ? -42.843 -12.543 -37.034 0.02 29.55 ? 209 PRO A CB   1  
ATOM   3252   C CG   . PRO A 1 216 ? -43.537 -12.630 -38.320 0.02 29.88 ? 209 PRO A CG   1  
ATOM   3253   C CD   . PRO A 1 216 ? -42.596 -13.129 -39.372 0.02 29.77 ? 209 PRO A CD   1  
ATOM   3254   H HA   . PRO A 1 216 ? -40.830 -12.981 -36.835 0.02 29.03 ? 209 PRO A HA   1  
ATOM   3255   H HB2  . PRO A 1 216 ? -43.417 -12.851 -36.317 0.02 29.66 ? 209 PRO A HB2  1  
ATOM   3256   H HB3  . PRO A 1 216 ? -42.554 -11.633 -36.869 0.02 29.40 ? 209 PRO A HB3  1  
ATOM   3257   H HG2  . PRO A 1 216 ? -44.287 -13.239 -38.229 0.02 30.13 ? 209 PRO A HG2  1  
ATOM   3258   H HG3  . PRO A 1 216 ? -43.857 -11.748 -38.561 0.02 29.96 ? 209 PRO A HG3  1  
ATOM   3259   H HD2  . PRO A 1 216 ? -43.029 -13.811 -39.908 0.02 30.01 ? 209 PRO A HD2  1  
ATOM   3260   H HD3  . PRO A 1 216 ? -42.277 -12.397 -39.922 0.02 29.70 ? 209 PRO A HD3  1  
ATOM   3261   N N    . ASP A 1 217 ? -41.871 -15.909 -36.941 0.02 29.56 ? 210 ASP A N    1  
ATOM   3262   C CA   . ASP A 1 217 ? -41.920 -17.172 -36.215 0.02 29.66 ? 210 ASP A CA   1  
ATOM   3263   C C    . ASP A 1 217 ? -40.545 -17.807 -36.061 0.02 29.36 ? 210 ASP A C    1  
ATOM   3264   O O    . ASP A 1 217 ? -40.425 -18.846 -35.421 0.02 29.42 ? 210 ASP A O    1  
ATOM   3265   C CB   . ASP A 1 217 ? -42.870 -18.151 -36.908 0.02 30.12 ? 210 ASP A CB   1  
ATOM   3266   C CG   . ASP A 1 217 ? -44.313 -17.785 -36.701 0.02 30.48 ? 210 ASP A CG   1  
ATOM   3267   O OD1  . ASP A 1 217 ? -45.020 -17.435 -37.678 0.02 30.77 ? 210 ASP A OD1  1  
ATOM   3268   O OD2  . ASP A 1 217 ? -44.741 -17.835 -35.541 0.02 30.50 ? 210 ASP A OD2  1  
ATOM   3269   H H    . ASP A 1 217 ? -41.914 -16.004 -37.793 0.02 29.67 ? 210 ASP A H    1  
ATOM   3270   H HA   . ASP A 1 217 ? -42.277 -17.008 -35.328 0.02 29.66 ? 210 ASP A HA   1  
ATOM   3271   H HB2  . ASP A 1 217 ? -42.690 -18.165 -37.864 0.02 30.16 ? 210 ASP A HB2  1  
ATOM   3272   H HB3  . ASP A 1 217 ? -42.735 -19.035 -36.534 0.02 30.18 ? 210 ASP A HB3  1  
ATOM   3273   N N    . ASN A 1 218 ? -39.494 -17.174 -36.585 0.02 29.08 ? 211 ASN A N    1  
ATOM   3274   C CA   . ASN A 1 218 ? -38.167 -17.790 -36.642 0.02 28.87 ? 211 ASN A CA   1  
ATOM   3275   C C    . ASN A 1 218 ? -37.102 -16.712 -36.384 0.02 28.50 ? 211 ASN A C    1  
ATOM   3276   O O    . ASN A 1 218 ? -36.324 -16.330 -37.260 0.02 28.40 ? 211 ASN A O    1  
ATOM   3277   C CB   . ASN A 1 218 ? -37.970 -18.503 -37.976 0.02 29.05 ? 211 ASN A CB   1  
ATOM   3278   C CG   . ASN A 1 218 ? -36.659 -19.255 -38.048 0.02 28.90 ? 211 ASN A CG   1  
ATOM   3279   O OD1  . ASN A 1 218 ? -36.130 -19.692 -37.029 0.02 28.75 ? 211 ASN A OD1  1  
ATOM   3280   N ND2  . ASN A 1 218 ? -36.115 -19.393 -39.250 0.02 28.96 ? 211 ASN A ND2  1  
ATOM   3281   H H    . ASN A 1 218 ? -39.527 -16.384 -36.921 0.02 29.03 ? 211 ASN A H    1  
ATOM   3282   H HA   . ASN A 1 218 ? -38.099 -18.444 -35.930 0.02 28.88 ? 211 ASN A HA   1  
ATOM   3283   H HB2  . ASN A 1 218 ? -38.693 -19.136 -38.097 0.02 29.31 ? 211 ASN A HB2  1  
ATOM   3284   H HB3  . ASN A 1 218 ? -37.984 -17.847 -38.688 0.02 29.06 ? 211 ASN A HB3  1  
ATOM   3285   H HD21 . ASN A 1 218 ? -35.603 -20.064 -39.414 0.02 29.04 ? 211 ASN A HD21 1  
ATOM   3286   H HD22 . ASN A 1 218 ? -36.273 -18.815 -39.867 0.02 28.95 ? 211 ASN A HD22 1  
ATOM   3287   N N    . ILE A 1 219 ? -37.080 -16.236 -35.141 0.02 28.34 ? 212 ILE A N    1  
ATOM   3288   C CA   . ILE A 1 219 ? -36.128 -15.242 -34.660 0.02 28.04 ? 212 ILE A CA   1  
ATOM   3289   C C    . ILE A 1 219 ? -35.092 -15.929 -33.795 0.02 27.87 ? 212 ILE A C    1  
ATOM   3290   O O    . ILE A 1 219 ? -35.435 -16.744 -32.940 0.02 27.97 ? 212 ILE A O    1  
ATOM   3291   C CB   . ILE A 1 219 ? -36.825 -14.136 -33.845 0.02 28.02 ? 212 ILE A CB   1  
ATOM   3292   C CG1  . ILE A 1 219 ? -37.820 -13.370 -34.719 0.02 28.21 ? 212 ILE A CG1  1  
ATOM   3293   C CG2  . ILE A 1 219 ? -35.782 -13.183 -33.257 0.02 27.74 ? 212 ILE A CG2  1  
ATOM   3294   C CD1  . ILE A 1 219 ? -38.789 -12.531 -33.928 0.02 28.32 ? 212 ILE A CD1  1  
ATOM   3295   H H    . ILE A 1 219 ? -37.630 -16.480 -34.544 0.02 28.43 ? 212 ILE A H    1  
ATOM   3296   H HA   . ILE A 1 219 ? -35.669 -14.839 -35.413 0.02 27.98 ? 212 ILE A HA   1  
ATOM   3297   H HB   . ILE A 1 219 ? -37.316 -14.552 -33.116 0.02 28.12 ? 212 ILE A HB   1  
ATOM   3298   H HG12 . ILE A 1 219 ? -37.323 -12.775 -35.301 0.02 28.11 ? 212 ILE A HG12 1  
ATOM   3299   H HG13 . ILE A 1 219 ? -38.330 -14.000 -35.250 0.02 28.39 ? 212 ILE A HG13 1  
ATOM   3300   H HG21 . ILE A 1 219 ? -36.235 -12.471 -32.783 0.02 27.76 ? 212 ILE A HG21 1  
ATOM   3301   H HG22 . ILE A 1 219 ? -35.206 -13.656 -32.637 0.02 27.65 ? 212 ILE A HG22 1  
ATOM   3302   H HG23 . ILE A 1 219 ? -35.252 -12.812 -33.979 0.02 27.67 ? 212 ILE A HG23 1  
ATOM   3303   H HD11 . ILE A 1 219 ? -38.336 -12.161 -33.158 0.02 28.17 ? 212 ILE A HD11 1  
ATOM   3304   H HD12 . ILE A 1 219 ? -39.119 -11.817 -34.495 0.02 28.38 ? 212 ILE A HD12 1  
ATOM   3305   H HD13 . ILE A 1 219 ? -39.527 -13.087 -33.637 0.02 28.51 ? 212 ILE A HD13 1  
ATOM   3306   N N    . THR A 1 220 ? -33.835 -15.587 -34.021 0.02 27.67 ? 213 THR A N    1  
ATOM   3307   C CA   . THR A 1 220 ? -32.700 -16.038 -33.227 0.02 27.52 ? 213 THR A CA   1  
ATOM   3308   C C    . THR A 1 220 ? -31.994 -14.822 -32.659 0.02 27.30 ? 213 THR A C    1  
ATOM   3309   O O    . THR A 1 220 ? -31.612 -13.918 -33.410 0.02 27.24 ? 213 THR A O    1  
ATOM   3310   C CB   . THR A 1 220 ? -31.718 -16.824 -34.077 0.02 27.53 ? 213 THR A CB   1  
ATOM   3311   O OG1  . THR A 1 220 ? -32.381 -17.969 -34.577 0.02 27.77 ? 213 THR A OG1  1  
ATOM   3312   C CG2  . THR A 1 220 ? -30.481 -17.188 -33.270 0.02 27.41 ? 213 THR A CG2  1  
ATOM   3313   H H    . THR A 1 220 ? -33.603 -15.082 -34.671 0.02 27.63 ? 213 THR A H    1  
ATOM   3314   H HA   . THR A 1 220 ? -32.998 -16.600 -32.498 0.02 27.57 ? 213 THR A HA   1  
ATOM   3315   H HB   . THR A 1 220 ? -31.430 -16.273 -34.821 0.02 27.50 ? 213 THR A HB   1  
ATOM   3316   H HG1  . THR A 1 220 ? -33.169 -17.773 -34.788 0.02 27.86 ? 213 THR A HG1  1  
ATOM   3317   H HG21 . THR A 1 220 ? -30.213 -18.097 -33.461 0.02 27.50 ? 213 THR A HG21 1  
ATOM   3318   H HG22 . THR A 1 220 ? -29.751 -16.592 -33.495 0.02 27.30 ? 213 THR A HG22 1  
ATOM   3319   H HG23 . THR A 1 220 ? -30.665 -17.106 -32.323 0.02 27.36 ? 213 THR A HG23 1  
ATOM   3320   N N    . VAL A 1 221 ? -31.794 -14.820 -31.344 0.02 27.23 ? 214 VAL A N    1  
ATOM   3321   C CA   . VAL A 1 221 ? -30.994 -13.804 -30.679 0.02 27.07 ? 214 VAL A CA   1  
ATOM   3322   C C    . VAL A 1 221 ? -29.635 -14.398 -30.339 0.02 26.99 ? 214 VAL A C    1  
ATOM   3323   O O    . VAL A 1 221 ? -29.543 -15.539 -29.846 0.02 27.06 ? 214 VAL A O    1  
ATOM   3324   C CB   . VAL A 1 221 ? -31.724 -13.279 -29.431 0.02 27.09 ? 214 VAL A CB   1  
ATOM   3325   C CG1  . VAL A 1 221 ? -30.957 -12.117 -28.806 0.02 26.96 ? 214 VAL A CG1  1  
ATOM   3326   C CG2  . VAL A 1 221 ? -33.110 -12.856 -29.807 0.02 27.22 ? 214 VAL A CG2  1  
ATOM   3327   H H    . VAL A 1 221 ? -32.131 -15.399 -30.811 0.02 27.30 ? 214 VAL A H    1  
ATOM   3328   H HA   . VAL A 1 221 ? -30.851 -13.055 -31.274 0.02 27.03 ? 214 VAL A HA   1  
ATOM   3329   H HB   . VAL A 1 221 ? -31.790 -13.990 -28.780 0.02 27.13 ? 214 VAL A HB   1  
ATOM   3330   H HG11 . VAL A 1 221 ? -31.554 -11.630 -28.224 0.02 27.00 ? 214 VAL A HG11 1  
ATOM   3331   H HG12 . VAL A 1 221 ? -30.208 -12.468 -28.305 0.02 26.91 ? 214 VAL A HG12 1  
ATOM   3332   H HG13 . VAL A 1 221 ? -30.635 -11.533 -29.504 0.02 26.91 ? 214 VAL A HG13 1  
ATOM   3333   H HG21 . VAL A 1 221 ? -33.526 -12.421 -29.049 0.02 27.25 ? 214 VAL A HG21 1  
ATOM   3334   H HG22 . VAL A 1 221 ? -33.057 -12.233 -30.547 0.02 27.20 ? 214 VAL A HG22 1  
ATOM   3335   H HG23 . VAL A 1 221 ? -33.630 -13.629 -30.069 0.02 27.34 ? 214 VAL A HG23 1  
ATOM   3336   N N    . PHE A 1 222 ? -28.581 -13.635 -30.605 0.02 26.89 ? 215 PHE A N    1  
ATOM   3337   C CA   . PHE A 1 222 ? -27.224 -14.043 -30.300 0.02 26.85 ? 215 PHE A CA   1  
ATOM   3338   C C    . PHE A 1 222 ? -26.385 -12.838 -29.912 0.02 26.77 ? 215 PHE A C    1  
ATOM   3339   O O    . PHE A 1 222 ? -26.714 -11.702 -30.231 0.02 26.75 ? 215 PHE A O    1  
ATOM   3340   C CB   . PHE A 1 222 ? -26.559 -14.821 -31.458 0.02 26.92 ? 215 PHE A CB   1  
ATOM   3341   C CG   . PHE A 1 222 ? -26.218 -14.021 -32.694 0.02 26.92 ? 215 PHE A CG   1  
ATOM   3342   C CD1  . PHE A 1 222 ? -27.182 -13.375 -33.416 0.02 26.95 ? 215 PHE A CD1  1  
ATOM   3343   C CD2  . PHE A 1 222 ? -24.937 -14.036 -33.172 0.02 26.96 ? 215 PHE A CD2  1  
ATOM   3344   C CE1  . PHE A 1 222 ? -26.853 -12.698 -34.602 0.02 27.00 ? 215 PHE A CE1  1  
ATOM   3345   C CE2  . PHE A 1 222 ? -24.588 -13.377 -34.350 0.02 27.02 ? 215 PHE A CE2  1  
ATOM   3346   C CZ   . PHE A 1 222 ? -25.563 -12.699 -35.060 0.02 27.03 ? 215 PHE A CZ   1  
ATOM   3347   H H    . PHE A 1 222 ? -28.633 -12.859 -30.949 0.02 26.86 ? 215 PHE A H    1  
ATOM   3348   H HA   . PHE A 1 222 ? -27.249 -14.621 -29.525 0.02 26.87 ? 215 PHE A HA   1  
ATOM   3349   H HB2  . PHE A 1 222 ? -25.736 -15.212 -31.126 0.02 26.92 ? 215 PHE A HB2  1  
ATOM   3350   H HB3  . PHE A 1 222 ? -27.167 -15.518 -31.746 0.02 26.99 ? 215 PHE A HB3  1  
ATOM   3351   H HD1  . PHE A 1 222 ? -28.058 -13.376 -33.111 0.02 26.96 ? 215 PHE A HD1  1  
ATOM   3352   H HD2  . PHE A 1 222 ? -24.283 -14.499 -32.701 0.02 26.97 ? 215 PHE A HD2  1  
ATOM   3353   H HE1  . PHE A 1 222 ? -27.511 -12.240 -35.073 0.02 27.03 ? 215 PHE A HE1  1  
ATOM   3354   H HE2  . PHE A 1 222 ? -23.707 -13.384 -34.643 0.02 27.07 ? 215 PHE A HE2  1  
ATOM   3355   H HZ   . PHE A 1 222 ? -25.344 -12.244 -35.837 0.02 27.09 ? 215 PHE A HZ   1  
ATOM   3356   N N    . GLY A 1 223 ? -25.327 -13.118 -29.152 0.02 26.77 ? 216 GLY A N    1  
ATOM   3357   C CA   . GLY A 1 223 ? -24.390 -12.116 -28.672 0.02 26.74 ? 216 GLY A CA   1  
ATOM   3358   C C    . GLY A 1 223 ? -23.134 -12.716 -28.074 0.02 26.80 ? 216 GLY A C    1  
ATOM   3359   O O    . GLY A 1 223 ? -23.120 -13.881 -27.673 0.02 26.84 ? 216 GLY A O    1  
ATOM   3360   H H    . GLY A 1 223 ? -25.135 -13.910 -28.891 0.02 26.80 ? 216 GLY A H    1  
ATOM   3361   H HA2  . GLY A 1 223 ? -24.128 -11.542 -29.403 0.02 26.75 ? 216 GLY A HA2  1  
ATOM   3362   H HA3  . GLY A 1 223 ? -24.821 -11.572 -27.998 0.02 26.72 ? 216 GLY A HA3  1  
ATOM   3363   N N    . GLU A 1 224 ? -22.075 -11.925 -28.023 0.02 26.83 ? 217 GLU A N    1  
ATOM   3364   C CA   . GLU A 1 224 ? -20.793 -12.335 -27.481 0.02 26.93 ? 217 GLU A CA   1  
ATOM   3365   C C    . GLU A 1 224 ? -20.497 -11.526 -26.224 0.02 26.96 ? 217 GLU A C    1  
ATOM   3366   O O    . GLU A 1 224 ? -20.684 -10.312 -26.196 0.02 26.94 ? 217 GLU A O    1  
ATOM   3367   C CB   . GLU A 1 224 ? -19.682 -12.165 -28.529 0.02 27.03 ? 217 GLU A CB   1  
ATOM   3368   C CG   . GLU A 1 224 ? -18.289 -12.645 -28.126 0.02 27.19 ? 217 GLU A CG   1  
ATOM   3369   C CD   . GLU A 1 224 ? -17.432 -11.537 -27.573 0.02 27.29 ? 217 GLU A CD   1  
ATOM   3370   O OE1  . GLU A 1 224 ? -16.263 -11.779 -27.164 0.02 27.46 ? 217 GLU A OE1  1  
ATOM   3371   O OE2  . GLU A 1 224 ? -17.939 -10.411 -27.567 0.02 27.23 ? 217 GLU A OE2  1  
ATOM   3372   H H    . GLU A 1 224 ? -22.076 -11.117 -28.304 0.02 26.82 ? 217 GLU A H    1  
ATOM   3373   H HA   . GLU A 1 224 ? -20.843 -13.266 -27.238 0.02 26.96 ? 217 GLU A HA   1  
ATOM   3374   H HB2  . GLU A 1 224 ? -19.940 -12.669 -29.316 0.02 27.02 ? 217 GLU A HB2  1  
ATOM   3375   H HB3  . GLU A 1 224 ? -19.631 -11.225 -28.760 0.02 27.03 ? 217 GLU A HB3  1  
ATOM   3376   H HG2  . GLU A 1 224 ? -18.376 -13.330 -27.449 0.02 27.20 ? 217 GLU A HG2  1  
ATOM   3377   H HG3  . GLU A 1 224 ? -17.836 -13.002 -28.903 0.02 27.26 ? 217 GLU A HG3  1  
ATOM   3378   N N    . SER A 1 225 ? -20.075 -12.225 -25.170 0.02 27.05 ? 218 SER A N    1  
ATOM   3379   C CA   . SER A 1 225 ? -19.636 -11.624 -23.903 0.02 27.13 ? 218 SER A CA   1  
ATOM   3380   C C    . SER A 1 225 ? -20.816 -10.923 -23.237 0.02 27.06 ? 218 SER A C    1  
ATOM   3381   O O    . SER A 1 225 ? -21.823 -11.585 -22.956 0.02 27.01 ? 218 SER A O    1  
ATOM   3382   C CB   . SER A 1 225 ? -18.407 -10.773 -24.174 0.02 27.25 ? 218 SER A CB   1  
ATOM   3383   O OG   . SER A 1 225 ? -17.534 -10.770 -23.046 0.02 27.43 ? 218 SER A OG   1  
ATOM   3384   H H    . SER A 1 225 ? -20.037 -13.081 -25.168 0.02 27.07 ? 218 SER A H    1  
ATOM   3385   H HA   . SER A 1 225 ? -19.355 -12.332 -23.303 0.02 27.21 ? 218 SER A HA   1  
ATOM   3386   H HB2  . SER A 1 225 ? -17.934 -11.143 -24.935 0.02 27.28 ? 218 SER A HB2  1  
ATOM   3387   H HB3  . SER A 1 225 ? -18.684 -9.866  -24.372 0.02 27.22 ? 218 SER A HB3  1  
ATOM   3388   H HG   . SER A 1 225 ? -17.910 -10.419 -22.379 0.02 27.41 ? 218 SER A HG   1  
ATOM   3389   N N    . ALA A 1 226 ? -20.754 -9.622  -22.932 0.02 27.09 ? 219 ALA A N    1  
ATOM   3390   C CA   . ALA A 1 226 ? -21.936 -9.009  -22.330 0.02 27.06 ? 219 ALA A CA   1  
ATOM   3391   C C    . ALA A 1 226 ? -23.156 -9.156  -23.220 0.02 26.93 ? 219 ALA A C    1  
ATOM   3392   O O    . ALA A 1 226 ? -24.283 -9.161  -22.728 0.02 26.92 ? 219 ALA A O    1  
ATOM   3393   C CB   . ALA A 1 226 ? -21.692 -7.531  -21.997 0.02 27.15 ? 219 ALA A CB   1  
ATOM   3394   H H    . ALA A 1 226 ? -20.077 -9.108  -23.048 0.02 27.16 ? 219 ALA A H    1  
ATOM   3395   H HA   . ALA A 1 226 ? -22.124 -9.468  -21.497 0.02 27.10 ? 219 ALA A HA   1  
ATOM   3396   H HB1  . ALA A 1 226 ? -22.494 -7.178  -21.590 0.02 27.14 ? 219 ALA A HB1  1  
ATOM   3397   H HB2  . ALA A 1 226 ? -20.945 -7.449  -21.387 0.02 27.26 ? 219 ALA A HB2  1  
ATOM   3398   H HB3  . ALA A 1 226 ? -21.498 -7.043  -22.811 0.02 27.13 ? 219 ALA A HB3  1  
ATOM   3399   N N    . GLY A 1 227 ? -22.956 -9.331  -24.525 0.02 26.87 ? 220 GLY A N    1  
ATOM   3400   C CA   . GLY A 1 227 ? -24.079 -9.588  -25.401 0.02 26.78 ? 220 GLY A CA   1  
ATOM   3401   C C    . GLY A 1 227 ? -24.620 -10.990 -25.256 0.02 26.77 ? 220 GLY A C    1  
ATOM   3402   O O    . GLY A 1 227 ? -25.789 -11.235 -25.525 0.02 26.76 ? 220 GLY A O    1  
ATOM   3403   H H    . GLY A 1 227 ? -22.191 -9.312  -24.911 0.02 26.89 ? 220 GLY A H    1  
ATOM   3404   H HA2  . GLY A 1 227 ? -24.794 -8.965  -25.213 0.02 26.78 ? 220 GLY A HA2  1  
ATOM   3405   H HA3  . GLY A 1 227 ? -23.789 -9.466  -26.314 0.02 26.77 ? 220 GLY A HA3  1  
ATOM   3406   N N    . ALA A 1 228 ? -23.758 -11.921 -24.852 0.02 26.82 ? 221 ALA A N    1  
ATOM   3407   C CA   . ALA A 1 228 ? -24.187 -13.269 -24.499 0.02 26.87 ? 221 ALA A CA   1  
ATOM   3408   C C    . ALA A 1 228 ? -24.941 -13.269 -23.166 0.02 26.94 ? 221 ALA A C    1  
ATOM   3409   O O    . ALA A 1 228 ? -26.021 -13.849 -23.037 0.02 26.98 ? 221 ALA A O    1  
ATOM   3410   C CB   . ALA A 1 228 ? -22.960 -14.167 -24.414 0.02 26.95 ? 221 ALA A CB   1  
ATOM   3411   H H    . ALA A 1 228 ? -22.915 -11.797 -24.776 0.02 26.86 ? 221 ALA A H    1  
ATOM   3412   H HA   . ALA A 1 228 ? -24.779 -13.611 -25.183 0.02 26.85 ? 221 ALA A HA   1  
ATOM   3413   H HB1  . ALA A 1 228 ? -23.248 -15.068 -24.200 0.02 27.01 ? 221 ALA A HB1  1  
ATOM   3414   H HB2  . ALA A 1 228 ? -22.510 -14.158 -25.272 0.02 26.94 ? 221 ALA A HB2  1  
ATOM   3415   H HB3  . ALA A 1 228 ? -22.365 -13.839 -23.726 0.02 27.00 ? 221 ALA A HB3  1  
ATOM   3416   N N    . ALA A 1 229 ? -24.394 -12.583 -22.179 0.02 26.98 ? 222 ALA A N    1  
ATOM   3417   C CA   . ALA A 1 229 ? -25.146 -12.408 -20.942 0.02 27.08 ? 222 ALA A CA   1  
ATOM   3418   C C    . ALA A 1 229 ? -26.494 -11.770 -21.233 0.02 27.04 ? 222 ALA A C    1  
ATOM   3419   O O    . ALA A 1 229 ? -27.525 -12.218 -20.730 0.02 27.14 ? 222 ALA A O    1  
ATOM   3420   C CB   . ALA A 1 229 ? -24.342 -11.569 -19.939 0.02 27.16 ? 222 ALA A CB   1  
ATOM   3421   H H    . ALA A 1 229 ? -23.620 -12.210 -22.205 0.02 26.99 ? 222 ALA A H    1  
ATOM   3422   H HA   . ALA A 1 229 ? -25.310 -13.278 -20.544 0.02 27.15 ? 222 ALA A HA   1  
ATOM   3423   H HB1  . ALA A 1 229 ? -24.879 -11.428 -19.147 0.02 27.24 ? 222 ALA A HB1  1  
ATOM   3424   H HB2  . ALA A 1 229 ? -23.527 -12.037 -19.711 0.02 27.21 ? 222 ALA A HB2  1  
ATOM   3425   H HB3  . ALA A 1 229 ? -24.126 -10.717 -20.343 0.02 27.11 ? 222 ALA A HB3  1  
ATOM   3426   N N    . SER A 1 230 ? -26.513 -10.753 -22.105 0.02 26.95 ? 223 SER A N    1  
ATOM   3427   C CA   . SER A 1 230 ? -27.772 -10.121 -22.475 0.02 26.95 ? 223 SER A CA   1  
ATOM   3428   C C    . SER A 1 230 ? -28.726 -11.113 -23.138 0.02 26.96 ? 223 SER A C    1  
ATOM   3429   O O    . SER A 1 230 ? -29.903 -11.192 -22.780 0.02 27.06 ? 223 SER A O    1  
ATOM   3430   C CB   . SER A 1 230 ? -27.504 -8.934  -23.409 0.02 26.89 ? 223 SER A CB   1  
ATOM   3431   O OG   . SER A 1 230 ? -26.720 -7.928  -22.820 0.02 26.93 ? 223 SER A OG   1  
ATOM   3432   H H    . SER A 1 230 ? -25.820 -10.422 -22.482 0.02 26.92 ? 223 SER A H    1  
ATOM   3433   H HA   . SER A 1 230 ? -28.203 -9.795  -21.671 0.02 27.04 ? 223 SER A HA   1  
ATOM   3434   H HB2  . SER A 1 230 ? -27.039 -9.257  -24.198 0.02 26.83 ? 223 SER A HB2  1  
ATOM   3435   H HB3  . SER A 1 230 ? -28.352 -8.549  -23.665 0.02 26.91 ? 223 SER A HB3  1  
ATOM   3436   H HG   . SER A 1 230 ? -25.924 -8.181  -22.766 0.02 26.92 ? 223 SER A HG   1  
ATOM   3437   N N    . THR A 1 231 ? -28.239 -11.870 -24.139 0.02 26.89 ? 224 THR A N    1  
ATOM   3438   C CA   . THR A 1 231 ? -29.105 -12.848 -24.779 0.02 26.94 ? 224 THR A CA   1  
ATOM   3439   C C    . THR A 1 231 ? -29.677 -13.811 -23.749 0.02 27.09 ? 224 THR A C    1  
ATOM   3440   O O    . THR A 1 231 ? -30.861 -14.138 -23.783 0.02 27.21 ? 224 THR A O    1  
ATOM   3441   C CB   . THR A 1 231 ? -28.339 -13.618 -25.863 0.02 26.89 ? 224 THR A CB   1  
ATOM   3442   O OG1  . THR A 1 231 ? -27.926 -12.720 -26.893 0.02 26.81 ? 224 THR A OG1  1  
ATOM   3443   C CG2  . THR A 1 231 ? -29.213 -14.734 -26.436 0.02 27.00 ? 224 THR A CG2  1  
ATOM   3444   H H    . THR A 1 231 ? -27.436 -11.848 -24.434 0.02 26.85 ? 224 THR A H    1  
ATOM   3445   H HA   . THR A 1 231 ? -29.850 -12.389 -25.194 0.02 26.96 ? 224 THR A HA   1  
ATOM   3446   H HB   . THR A 1 231 ? -27.552 -14.025 -25.470 0.02 26.90 ? 224 THR A HB   1  
ATOM   3447   H HG1  . THR A 1 231 ? -27.154 -12.435 -26.743 0.02 26.77 ? 224 THR A HG1  1  
ATOM   3448   H HG21 . THR A 1 231 ? -28.875 -15.010 -27.300 0.02 26.97 ? 224 THR A HG21 1  
ATOM   3449   H HG22 . THR A 1 231 ? -29.205 -15.500 -25.847 0.02 27.07 ? 224 THR A HG22 1  
ATOM   3450   H HG23 . THR A 1 231 ? -30.126 -14.434 -26.540 0.02 27.04 ? 224 THR A HG23 1  
ATOM   3451   N N    . HIS A 1 232 ? -28.856 -14.229 -22.790 0.02 27.12 ? 225 HIS A N    1  
ATOM   3452   C CA   . HIS A 1 232 ? -29.364 -15.114 -21.749 0.02 27.31 ? 225 HIS A CA   1  
ATOM   3453   C C    . HIS A 1 232 ? -30.438 -14.425 -20.899 0.02 27.42 ? 225 HIS A C    1  
ATOM   3454   O O    . HIS A 1 232 ? -31.508 -14.992 -20.674 0.02 27.60 ? 225 HIS A O    1  
ATOM   3455   C CB   . HIS A 1 232 ? -28.208 -15.633 -20.900 0.02 27.35 ? 225 HIS A CB   1  
ATOM   3456   C CG   . HIS A 1 232 ? -28.616 -16.711 -19.945 0.02 27.58 ? 225 HIS A CG   1  
ATOM   3457   N ND1  . HIS A 1 232 ? -27.907 -17.004 -18.803 0.02 27.70 ? 225 HIS A ND1  1  
ATOM   3458   C CD2  . HIS A 1 232 ? -29.656 -17.579 -19.975 0.02 27.75 ? 225 HIS A CD2  1  
ATOM   3459   C CE1  . HIS A 1 232 ? -28.496 -17.997 -18.166 0.02 27.93 ? 225 HIS A CE1  1  
ATOM   3460   N NE2  . HIS A 1 232 ? -29.556 -18.370 -18.855 0.02 27.97 ? 225 HIS A NE2  1  
ATOM   3461   H H    . HIS A 1 232 ? -28.022 -14.029 -22.730 0.02 27.07 ? 225 HIS A H    1  
ATOM   3462   H HA   . HIS A 1 232 ? -29.784 -15.877 -22.171 0.02 27.37 ? 225 HIS A HA   1  
ATOM   3463   H HB2  . HIS A 1 232 ? -27.529 -15.996 -21.488 0.02 27.29 ? 225 HIS A HB2  1  
ATOM   3464   H HB3  . HIS A 1 232 ? -27.832 -14.905 -20.383 0.02 27.33 ? 225 HIS A HB3  1  
ATOM   3465   H HD2  . HIS A 1 232 ? -30.313 -17.631 -20.629 0.02 27.74 ? 225 HIS A HD2  1  
ATOM   3466   H HE1  . HIS A 1 232 ? -28.208 -18.374 -17.366 0.02 28.06 ? 225 HIS A HE1  1  
ATOM   3467   H HE2  . HIS A 1 232 ? -30.098 -18.997 -18.635 0.02 28.13 ? 225 HIS A HE2  1  
ATOM   3468   N N    . TYR A 1 233 ? -30.201 -13.176 -20.479 0.02 27.37 ? 226 TYR A N    1  
ATOM   3469   C CA   . TYR A 1 233 ? -31.241 -12.423 -19.775 0.02 27.50 ? 226 TYR A CA   1  
ATOM   3470   C C    . TYR A 1 233 ? -32.532 -12.340 -20.577 0.02 27.56 ? 226 TYR A C    1  
ATOM   3471   O O    . TYR A 1 233 ? -33.634 -12.469 -20.024 0.02 27.77 ? 226 TYR A O    1  
ATOM   3472   C CB   . TYR A 1 233 ? -30.737 -11.026 -19.453 0.02 27.44 ? 226 TYR A CB   1  
ATOM   3473   C CG   . TYR A 1 233 ? -29.750 -10.928 -18.314 0.02 27.50 ? 226 TYR A CG   1  
ATOM   3474   C CD1  . TYR A 1 233 ? -30.093 -11.342 -17.029 0.02 27.72 ? 226 TYR A CD1  1  
ATOM   3475   C CD2  . TYR A 1 233 ? -28.507 -10.371 -18.506 0.02 27.39 ? 226 TYR A CD2  1  
ATOM   3476   C CE1  . TYR A 1 233 ? -29.208 -11.232 -15.996 0.02 27.81 ? 226 TYR A CE1  1  
ATOM   3477   C CE2  . TYR A 1 233 ? -27.622 -10.248 -17.483 0.02 27.49 ? 226 TYR A CE2  1  
ATOM   3478   C CZ   . TYR A 1 233 ? -27.977 -10.680 -16.220 0.02 27.69 ? 226 TYR A CZ   1  
ATOM   3479   O OH   . TYR A 1 233 ? -27.091 -10.553 -15.192 0.02 27.82 ? 226 TYR A OH   1  
ATOM   3480   H H    . TYR A 1 233 ? -29.457 -12.755 -20.569 0.02 27.28 ? 226 TYR A H    1  
ATOM   3481   H HA   . TYR A 1 233 ? -31.447 -12.875 -18.943 0.02 27.65 ? 226 TYR A HA   1  
ATOM   3482   H HB2  . TYR A 1 233 ? -30.305 -10.667 -20.244 0.02 27.31 ? 226 TYR A HB2  1  
ATOM   3483   H HB3  . TYR A 1 233 ? -31.500 -10.472 -19.226 0.02 27.53 ? 226 TYR A HB3  1  
ATOM   3484   H HD1  . TYR A 1 233 ? -30.930 -11.713 -16.880 0.02 27.82 ? 226 TYR A HD1  1  
ATOM   3485   H HD2  . TYR A 1 233 ? -28.263 -10.076 -19.350 0.02 27.27 ? 226 TYR A HD2  1  
ATOM   3486   H HE1  . TYR A 1 233 ? -29.441 -11.513 -15.142 0.02 27.97 ? 226 TYR A HE1  1  
ATOM   3487   H HE2  . TYR A 1 233 ? -26.783 -9.877  -17.632 0.02 27.44 ? 226 TYR A HE2  1  
ATOM   3488   H HH   . TYR A 1 233 ? -26.489 -10.004 -15.395 0.02 27.77 ? 226 TYR A HH   1  
ATOM   3489   N N    . MET A 1 234 ? -32.433 -12.136 -21.896 0.02 27.41 ? 227 MET A N    1  
ATOM   3490   C CA   . MET A 1 234 ? -33.653 -12.120 -22.687 0.02 27.50 ? 227 MET A CA   1  
ATOM   3491   C C    . MET A 1 234 ? -34.328 -13.489 -22.725 0.02 27.67 ? 227 MET A C    1  
ATOM   3492   O O    . MET A 1 234 ? -35.496 -13.574 -23.090 0.02 27.84 ? 227 MET A O    1  
ATOM   3493   C CB   . MET A 1 234 ? -33.359 -11.638 -24.106 0.02 27.34 ? 227 MET A CB   1  
ATOM   3494   C CG   . MET A 1 234 ? -32.718 -10.269 -24.171 0.02 27.22 ? 227 MET A CG   1  
ATOM   3495   S SD   . MET A 1 234 ? -33.820 -8.950  -23.556 0.02 27.40 ? 227 MET A SD   1  
ATOM   3496   C CE   . MET A 1 234 ? -32.924 -8.478  -22.058 0.02 27.40 ? 227 MET A CE   1  
ATOM   3497   H H    . MET A 1 234 ? -31.705 -12.010 -22.332 0.02 27.29 ? 227 MET A H    1  
ATOM   3498   H HA   . MET A 1 234 ? -34.267 -11.480 -22.301 0.02 27.60 ? 227 MET A HA   1  
ATOM   3499   H HB2  . MET A 1 234 ? -32.760 -12.272 -24.527 0.02 27.27 ? 227 MET A HB2  1  
ATOM   3500   H HB3  . MET A 1 234 ? -34.196 -11.596 -24.592 0.02 27.43 ? 227 MET A HB3  1  
ATOM   3501   H HG2  . MET A 1 234 ? -31.909 -10.264 -23.643 0.02 27.17 ? 227 MET A HG2  1  
ATOM   3502   H HG3  . MET A 1 234 ? -32.508 -10.063 -25.093 0.02 27.15 ? 227 MET A HG3  1  
ATOM   3503   H HE1  . MET A 1 234 ? -33.345 -7.693  -21.674 0.02 27.50 ? 227 MET A HE1  1  
ATOM   3504   H HE2  . MET A 1 234 ? -32.966 -9.216  -21.430 0.02 27.45 ? 227 MET A HE2  1  
ATOM   3505   H HE3  . MET A 1 234 ? -32.000 -8.282  -22.268 0.02 27.28 ? 227 MET A HE3  1  
ATOM   3506   N N    . MET A 1 235 ? -33.608 -14.564 -22.412 0.02 27.66 ? 228 MET A N    1  
ATOM   3507   C CA   . MET A 1 235 ? -34.211 -15.898 -22.364 0.02 27.88 ? 228 MET A CA   1  
ATOM   3508   C C    . MET A 1 235 ? -34.824 -16.191 -21.002 0.02 28.13 ? 228 MET A C    1  
ATOM   3509   O O    . MET A 1 235 ? -35.642 -17.114 -20.868 0.02 28.39 ? 228 MET A O    1  
ATOM   3510   C CB   . MET A 1 235 ? -33.147 -16.950 -22.721 0.02 27.80 ? 228 MET A CB   1  
ATOM   3511   C CG   . MET A 1 235 ? -32.652 -16.831 -24.190 0.02 27.62 ? 228 MET A CG   1  
ATOM   3512   S SD   . MET A 1 235 ? -31.222 -17.886 -24.576 0.02 27.55 ? 228 MET A SD   1  
ATOM   3513   C CE   . MET A 1 235 ? -32.089 -19.470 -24.576 0.02 27.87 ? 228 MET A CE   1  
ATOM   3514   H H    . MET A 1 235 ? -32.775 -14.546 -22.218 0.02 27.57 ? 228 MET A H    1  
ATOM   3515   H HA   . MET A 1 235 ? -34.914 -15.960 -23.026 0.02 27.94 ? 228 MET A HA   1  
ATOM   3516   H HB2  . MET A 1 235 ? -32.380 -16.836 -22.141 0.02 27.73 ? 228 MET A HB2  1  
ATOM   3517   H HB3  . MET A 1 235 ? -33.521 -17.833 -22.603 0.02 27.97 ? 228 MET A HB3  1  
ATOM   3518   H HG2  . MET A 1 235 ? -33.380 -17.081 -24.777 0.02 27.71 ? 228 MET A HG2  1  
ATOM   3519   H HG3  . MET A 1 235 ? -32.398 -15.912 -24.362 0.02 27.48 ? 228 MET A HG3  1  
ATOM   3520   H HE1  . MET A 1 235 ? -31.894 -19.931 -23.745 0.02 27.97 ? 228 MET A HE1  1  
ATOM   3521   H HE2  . MET A 1 235 ? -33.044 -19.319 -24.648 0.02 27.97 ? 228 MET A HE2  1  
ATOM   3522   H HE3  . MET A 1 235 ? -31.783 -19.999 -25.330 0.02 27.88 ? 228 MET A HE3  1  
ATOM   3523   N N    . LEU A 1 236 ? -34.481 -15.387 -20.016 0.02 28.10 ? 229 LEU A N    1  
ATOM   3524   C CA   . LEU A 1 236 ? -34.890 -15.606 -18.636 0.02 28.36 ? 229 LEU A CA   1  
ATOM   3525   C C    . LEU A 1 236 ? -36.171 -14.859 -18.246 0.02 28.57 ? 229 LEU A C    1  
ATOM   3526   O O    . LEU A 1 236 ? -36.976 -15.383 -17.472 0.02 28.89 ? 229 LEU A O    1  
ATOM   3527   C CB   . LEU A 1 236 ? -33.740 -15.205 -17.731 0.02 28.27 ? 229 LEU A CB   1  
ATOM   3528   C CG   . LEU A 1 236 ? -32.492 -16.068 -17.739 0.02 28.19 ? 229 LEU A CG   1  
ATOM   3529   C CD1  . LEU A 1 236 ? -31.461 -15.426 -16.828 0.02 28.13 ? 229 LEU A CD1  1  
ATOM   3530   C CD2  . LEU A 1 236 ? -32.790 -17.555 -17.335 0.02 28.47 ? 229 LEU A CD2  1  
ATOM   3531   H H    . LEU A 1 236 ? -33.983 -14.695 -20.118 0.02 27.95 ? 229 LEU A H    1  
ATOM   3532   H HA   . LEU A 1 236 ? -35.056 -16.548 -18.497 0.02 28.51 ? 229 LEU A HA   1  
ATOM   3533   H HB2  . LEU A 1 236 ? -33.464 -14.315 -17.987 0.02 28.10 ? 229 LEU A HB2  1  
ATOM   3534   H HB3  . LEU A 1 236 ? -34.061 -15.189 -16.816 0.02 28.45 ? 229 LEU A HB3  1  
ATOM   3535   H HG   . LEU A 1 236 ? -32.128 -16.077 -18.639 0.02 28.03 ? 229 LEU A HG   1  
ATOM   3536   H HD11 . LEU A 1 236 ? -30.605 -15.863 -16.952 0.02 28.06 ? 229 LEU A HD11 1  
ATOM   3537   H HD12 . LEU A 1 236 ? -31.384 -14.486 -17.053 0.02 28.00 ? 229 LEU A HD12 1  
ATOM   3538   H HD13 . LEU A 1 236 ? -31.755 -15.518 -15.908 0.02 28.31 ? 229 LEU A HD13 1  
ATOM   3539   H HD21 . LEU A 1 236 ? -31.989 -18.085 -17.465 0.02 28.42 ? 229 LEU A HD21 1  
ATOM   3540   H HD22 . LEU A 1 236 ? -33.058 -17.586 -16.404 0.02 28.65 ? 229 LEU A HD22 1  
ATOM   3541   H HD23 . LEU A 1 236 ? -33.503 -17.901 -17.891 0.02 28.55 ? 229 LEU A HD23 1  
ATOM   3542   N N    . THR A 1 237 ? -36.402 -13.656 -18.758 0.02 28.44 ? 230 THR A N    1  
ATOM   3543   C CA   . THR A 1 237 ? -37.532 -12.859 -18.287 0.02 28.67 ? 230 THR A CA   1  
ATOM   3544   C C    . THR A 1 237 ? -38.844 -13.286 -18.943 0.02 28.91 ? 230 THR A C    1  
ATOM   3545   O O    . THR A 1 237 ? -38.900 -13.525 -20.151 0.02 28.79 ? 230 THR A O    1  
ATOM   3546   C CB   . THR A 1 237 ? -37.302 -11.377 -18.580 0.02 28.50 ? 230 THR A CB   1  
ATOM   3547   O OG1  . THR A 1 237 ? -38.319 -10.612 -17.937 0.02 28.77 ? 230 THR A OG1  1  
ATOM   3548   C CG2  . THR A 1 237 ? -37.345 -11.110 -20.085 0.02 28.30 ? 230 THR A CG2  1  
ATOM   3549   H H    . THR A 1 237 ? -35.927 -13.283 -19.366 0.02 28.25 ? 230 THR A H    1  
ATOM   3550   H HA   . THR A 1 237 ? -37.621 -12.965 -17.329 0.02 28.83 ? 230 THR A HA   1  
ATOM   3551   H HB   . THR A 1 237 ? -36.431 -11.111 -18.245 0.02 28.37 ? 230 THR A HB   1  
ATOM   3552   H HG1  . THR A 1 237 ? -38.347 -10.793 -17.117 0.02 28.95 ? 230 THR A HG1  1  
ATOM   3553   H HG21 . THR A 1 237 ? -36.942 -10.249 -20.280 0.02 28.20 ? 230 THR A HG21 1  
ATOM   3554   H HG22 . THR A 1 237 ? -36.854 -11.799 -20.557 0.02 28.17 ? 230 THR A HG22 1  
ATOM   3555   H HG23 . THR A 1 237 ? -38.259 -11.107 -20.395 0.02 28.45 ? 230 THR A HG23 1  
ATOM   3556   N N    . GLU A 1 238 ? -39.922 -13.315 -18.151 0.02 29.28 ? 231 GLU A N    1  
ATOM   3557   C CA   . GLU A 1 238 ? -41.249 -13.556 -18.698 0.02 29.57 ? 231 GLU A CA   1  
ATOM   3558   C C    . GLU A 1 238 ? -41.737 -12.411 -19.587 0.02 29.48 ? 231 GLU A C    1  
ATOM   3559   O O    . GLU A 1 238 ? -42.711 -12.597 -20.334 0.02 29.65 ? 231 GLU A O    1  
ATOM   3560   C CB   . GLU A 1 238 ? -42.267 -13.793 -17.577 0.02 30.03 ? 231 GLU A CB   1  
ATOM   3561   C CG   . GLU A 1 238 ? -41.849 -14.877 -16.569 0.02 30.19 ? 231 GLU A CG   1  
ATOM   3562   C CD   . GLU A 1 238 ? -42.566 -16.213 -16.754 0.02 30.50 ? 231 GLU A CD   1  
ATOM   3563   O OE1  . GLU A 1 238 ? -43.807 -16.203 -16.915 0.02 30.88 ? 231 GLU A OE1  1  
ATOM   3564   O OE2  . GLU A 1 238 ? -41.886 -17.267 -16.701 0.02 30.41 ? 231 GLU A OE2  1  
ATOM   3565   H H    . GLU A 1 238 ? -39.906 -13.195 -17.302 0.02 29.38 ? 231 GLU A H    1  
ATOM   3566   H HA   . GLU A 1 238 ? -41.215 -14.360 -19.237 0.02 29.59 ? 231 GLU A HA   1  
ATOM   3567   H HB2  . GLU A 1 238 ? -42.391 -12.967 -17.087 0.02 30.04 ? 231 GLU A HB2  1  
ATOM   3568   H HB3  . GLU A 1 238 ? -43.108 -14.064 -17.975 0.02 30.25 ? 231 GLU A HB3  1  
ATOM   3569   H HG2  . GLU A 1 238 ? -40.897 -15.041 -16.647 0.02 29.94 ? 231 GLU A HG2  1  
ATOM   3570   H HG3  . GLU A 1 238 ? -42.055 -14.560 -15.674 0.02 30.39 ? 231 GLU A HG3  1  
ATOM   3571   N N    . GLN A 1 239 ? -41.083 -11.248 -19.524 0.02 29.24 ? 232 GLN A N    1  
ATOM   3572   C CA   . GLN A 1 239 ? -41.446 -10.123 -20.373 0.02 29.19 ? 232 GLN A CA   1  
ATOM   3573   C C    . GLN A 1 239 ? -41.235 -10.449 -21.844 0.02 29.01 ? 232 GLN A C    1  
ATOM   3574   O O    . GLN A 1 239 ? -42.059 -10.074 -22.674 0.02 29.14 ? 232 GLN A O    1  
ATOM   3575   C CB   . GLN A 1 239 ? -40.634 -8.868  -20.011 0.02 28.97 ? 232 GLN A CB   1  
ATOM   3576   C CG   . GLN A 1 239 ? -40.919 -8.283  -18.650 0.02 29.21 ? 232 GLN A CG   1  
ATOM   3577   C CD   . GLN A 1 239 ? -42.219 -7.505  -18.572 0.02 29.58 ? 232 GLN A CD   1  
ATOM   3578   O OE1  . GLN A 1 239 ? -43.277 -7.939  -19.048 0.02 29.77 ? 232 GLN A OE1  1  
ATOM   3579   N NE2  . GLN A 1 239 ? -42.149 -6.358  -17.931 0.02 29.73 ? 232 GLN A NE2  1  
ATOM   3580   H H    . GLN A 1 239 ? -40.420 -11.089 -18.999 0.02 29.14 ? 232 GLN A H    1  
ATOM   3581   H HA   . GLN A 1 239 ? -42.385 -9.920  -20.236 0.02 29.45 ? 232 GLN A HA   1  
ATOM   3582   H HB2  . GLN A 1 239 ? -39.690 -9.093  -20.024 0.02 28.76 ? 232 GLN A HB2  1  
ATOM   3583   H HB3  . GLN A 1 239 ? -40.813 -8.176  -20.664 0.02 28.90 ? 232 GLN A HB3  1  
ATOM   3584   H HG2  . GLN A 1 239 ? -40.964 -8.999  -17.997 0.02 29.31 ? 232 GLN A HG2  1  
ATOM   3585   H HG3  . GLN A 1 239 ? -40.199 -7.674  -18.422 0.02 29.07 ? 232 GLN A HG3  1  
ATOM   3586   H HE21 . GLN A 1 239 ? -41.603 -5.749  -18.200 0.02 29.57 ? 232 GLN A HE21 1  
ATOM   3587   H HE22 . GLN A 1 239 ? -42.646 -6.224  -17.241 0.02 30.00 ? 232 GLN A HE22 1  
ATOM   3588   N N    . THR A 1 240 ? -40.169 -11.171 -22.173 0.02 28.76 ? 233 THR A N    1  
ATOM   3589   C CA   . THR A 1 240 ? -39.856 -11.514 -23.552 0.02 28.59 ? 233 THR A CA   1  
ATOM   3590   C C    . THR A 1 240 ? -40.422 -12.876 -23.961 0.02 28.78 ? 233 THR A C    1  
ATOM   3591   O O    . THR A 1 240 ? -40.136 -13.333 -25.064 0.02 28.65 ? 233 THR A O    1  
ATOM   3592   C CB   . THR A 1 240 ? -38.339 -11.478 -23.788 0.02 28.23 ? 233 THR A CB   1  
ATOM   3593   O OG1  . THR A 1 240 ? -37.673 -12.396 -22.914 0.02 28.19 ? 233 THR A OG1  1  
ATOM   3594   C CG2  . THR A 1 240 ? -37.760 -10.085 -23.560 0.02 28.08 ? 233 THR A CG2  1  
ATOM   3595   H H    . THR A 1 240 ? -39.617 -11.489 -21.600 0.02 28.71 ? 233 THR A H    1  
ATOM   3596   H HA   . THR A 1 240 ? -40.254 -10.847 -24.128 0.02 28.62 ? 233 THR A HA   1  
ATOM   3597   H HB   . THR A 1 240 ? -38.156 -11.726 -24.709 0.02 28.14 ? 233 THR A HB   1  
ATOM   3598   H HG1  . THR A 1 240 ? -38.054 -12.418 -22.171 0.02 28.34 ? 233 THR A HG1  1  
ATOM   3599   H HG21 . THR A 1 240 ? -36.865 -10.028 -23.928 0.02 27.88 ? 233 THR A HG21 1  
ATOM   3600   H HG22 . THR A 1 240 ? -38.320 -9.424  -23.995 0.02 28.15 ? 233 THR A HG22 1  
ATOM   3601   H HG23 . THR A 1 240 ? -37.720 -9.893  -22.613 0.02 28.15 ? 233 THR A HG23 1  
ATOM   3602   N N    . ARG A 1 241 ? -41.231 -13.519 -23.110 0.02 29.12 ? 234 ARG A N    1  
ATOM   3603   C CA   . ARG A 1 241 ? -41.774 -14.850 -23.396 0.02 29.36 ? 234 ARG A CA   1  
ATOM   3604   C C    . ARG A 1 241 ? -42.299 -14.948 -24.823 0.02 29.42 ? 234 ARG A C    1  
ATOM   3605   O O    . ARG A 1 241 ? -43.052 -14.086 -25.282 0.02 29.59 ? 234 ARG A O    1  
ATOM   3606   C CB   . ARG A 1 241 ? -42.908 -15.188 -22.409 0.02 29.80 ? 234 ARG A CB   1  
ATOM   3607   C CG   . ARG A 1 241 ? -43.727 -16.472 -22.747 0.02 30.15 ? 234 ARG A CG   1  
ATOM   3608   C CD   . ARG A 1 241 ? -44.997 -16.549 -21.903 0.02 30.67 ? 234 ARG A CD   1  
ATOM   3609   N NE   . ARG A 1 241 ? -46.285 -16.556 -22.615 0.02 31.03 ? 234 ARG A NE   1  
ATOM   3610   C CZ   . ARG A 1 241 ? -46.840 -15.484 -23.196 0.02 31.11 ? 234 ARG A CZ   1  
ATOM   3611   N NH1  . ARG A 1 241 ? -46.184 -14.331 -23.241 0.02 30.83 ? 234 ARG A NH1  1  
ATOM   3612   N NH2  . ARG A 1 241 ? -48.037 -15.568 -23.768 0.02 31.50 ? 234 ARG A NH2  1  
ATOM   3613   H H    . ARG A 1 241 ? -41.478 -13.200 -22.355 0.02 29.25 ? 234 ARG A H    1  
ATOM   3614   H HA   . ARG A 1 241 ? -41.070 -15.505 -23.286 0.02 29.23 ? 234 ARG A HA   1  
ATOM   3615   H HB2  . ARG A 1 241 ? -42.523 -15.306 -21.528 0.02 29.77 ? 234 ARG A HB2  1  
ATOM   3616   H HB3  . ARG A 1 241 ? -43.529 -14.444 -22.392 0.02 29.94 ? 234 ARG A HB3  1  
ATOM   3617   H HG2  . ARG A 1 241 ? -43.985 -16.486 -23.682 0.02 30.15 ? 234 ARG A HG2  1  
ATOM   3618   H HG3  . ARG A 1 241 ? -43.189 -17.252 -22.535 0.02 30.10 ? 234 ARG A HG3  1  
ATOM   3619   H HD2  . ARG A 1 241 ? -44.958 -17.358 -21.369 0.02 30.82 ? 234 ARG A HD2  1  
ATOM   3620   H HD3  . ARG A 1 241 ? -45.014 -15.776 -21.316 0.02 30.66 ? 234 ARG A HD3  1  
ATOM   3621   H HE   . ARG A 1 241 ? -46.524 -17.318 -22.942 0.02 31.14 ? 234 ARG A HE   1  
ATOM   3622   H HH11 . ARG A 1 241 ? -45.414 -14.254 -22.868 0.02 30.61 ? 234 ARG A HH11 1  
ATOM   3623   H HH12 . ARG A 1 241 ? -46.541 -13.651 -23.629 0.02 30.90 ? 234 ARG A HH12 1  
ATOM   3624   H HH21 . ARG A 1 241 ? -48.467 -16.310 -23.763 0.02 31.70 ? 234 ARG A HH21 1  
ATOM   3625   H HH22 . ARG A 1 241 ? -48.373 -14.885 -24.164 0.02 31.55 ? 234 ARG A HH22 1  
ATOM   3626   N N    . GLY A 1 242 ? -41.921 -16.031 -25.511 0.02 29.35 ? 235 GLY A N    1  
ATOM   3627   C CA   . GLY A 1 242 ? -42.373 -16.302 -26.871 0.02 29.46 ? 235 GLY A CA   1  
ATOM   3628   C C    . GLY A 1 242 ? -41.797 -15.434 -27.971 0.02 29.18 ? 235 GLY A C    1  
ATOM   3629   O O    . GLY A 1 242 ? -41.985 -15.759 -29.146 0.02 29.27 ? 235 GLY A O    1  
ATOM   3630   H H    . GLY A 1 242 ? -41.402 -16.638 -25.192 0.02 29.26 ? 235 GLY A H    1  
ATOM   3631   H HA2  . GLY A 1 242 ? -42.158 -17.221 -27.091 0.02 29.49 ? 235 GLY A HA2  1  
ATOM   3632   H HA3  . GLY A 1 242 ? -43.338 -16.211 -26.903 0.02 29.74 ? 235 GLY A HA3  1  
ATOM   3633   N N    . LEU A 1 243 ? -41.084 -14.353 -27.630 0.02 28.89 ? 236 LEU A N    1  
ATOM   3634   C CA   . LEU A 1 243 ? -40.641 -13.355 -28.603 0.02 28.68 ? 236 LEU A CA   1  
ATOM   3635   C C    . LEU A 1 243 ? -39.519 -13.823 -29.519 0.02 28.44 ? 236 LEU A C    1  
ATOM   3636   O O    . LEU A 1 243 ? -39.102 -13.057 -30.401 0.02 28.32 ? 236 LEU A O    1  
ATOM   3637   C CB   . LEU A 1 243 ? -40.122 -12.089 -27.923 0.02 28.47 ? 236 LEU A CB   1  
ATOM   3638   C CG   . LEU A 1 243 ? -41.044 -11.006 -27.329 0.02 28.65 ? 236 LEU A CG   1  
ATOM   3639   C CD1  . LEU A 1 243 ? -40.212 -9.901  -26.672 0.02 28.42 ? 236 LEU A CD1  1  
ATOM   3640   C CD2  . LEU A 1 243 ? -41.926 -10.430 -28.398 0.02 28.84 ? 236 LEU A CD2  1  
ATOM   3641   H H    . LEU A 1 243 ? -40.839 -14.182 -26.825 0.02 28.83 ? 236 LEU A H    1  
ATOM   3642   H HA   . LEU A 1 243 ? -41.398 -13.115 -29.163 0.02 28.85 ? 236 LEU A HA   1  
ATOM   3643   H HB2  . LEU A 1 243 ? -39.559 -12.382 -27.193 0.02 28.38 ? 236 LEU A HB2  1  
ATOM   3644   H HB3  . LEU A 1 243 ? -39.563 -11.632 -28.569 0.02 28.30 ? 236 LEU A HB3  1  
ATOM   3645   H HG   . LEU A 1 243 ? -41.609 -11.403 -26.647 0.02 28.84 ? 236 LEU A HG   1  
ATOM   3646   H HD11 . LEU A 1 243 ? -39.756 -9.392  -27.363 0.02 28.28 ? 236 LEU A HD11 1  
ATOM   3647   H HD12 . LEU A 1 243 ? -40.798 -9.313  -26.170 0.02 28.57 ? 236 LEU A HD12 1  
ATOM   3648   H HD13 . LEU A 1 243 ? -39.563 -10.310 -26.078 0.02 28.31 ? 236 LEU A HD13 1  
ATOM   3649   H HD21 . LEU A 1 243 ? -42.389 -9.654  -28.048 0.02 28.94 ? 236 LEU A HD21 1  
ATOM   3650   H HD22 . LEU A 1 243 ? -41.366 -10.167 -29.144 0.02 28.68 ? 236 LEU A HD22 1  
ATOM   3651   H HD23 . LEU A 1 243 ? -42.571 -11.104 -28.666 0.02 29.04 ? 236 LEU A HD23 1  
ATOM   3652   N N    . PHE A 1 244 ? -38.953 -14.998 -29.290 0.02 28.39 ? 237 PHE A N    1  
ATOM   3653   C CA   . PHE A 1 244 ? -38.002 -15.527 -30.250 0.02 28.24 ? 237 PHE A CA   1  
ATOM   3654   C C    . PHE A 1 244 ? -37.835 -17.017 -29.996 0.02 28.37 ? 237 PHE A C    1  
ATOM   3655   O O    . PHE A 1 244 ? -38.449 -17.588 -29.101 0.02 28.58 ? 237 PHE A O    1  
ATOM   3656   C CB   . PHE A 1 244 ? -36.680 -14.756 -30.217 0.02 27.90 ? 237 PHE A CB   1  
ATOM   3657   C CG   . PHE A 1 244 ? -35.985 -14.734 -28.885 0.02 27.77 ? 237 PHE A CG   1  
ATOM   3658   C CD1  . PHE A 1 244 ? -36.281 -13.758 -27.937 0.02 27.76 ? 237 PHE A CD1  1  
ATOM   3659   C CD2  . PHE A 1 244 ? -34.972 -15.622 -28.620 0.02 27.68 ? 237 PHE A CD2  1  
ATOM   3660   C CE1  . PHE A 1 244 ? -35.605 -13.718 -26.728 0.02 27.66 ? 237 PHE A CE1  1  
ATOM   3661   C CE2  . PHE A 1 244 ? -34.297 -15.582 -27.429 0.02 27.59 ? 237 PHE A CE2  1  
ATOM   3662   C CZ   . PHE A 1 244 ? -34.619 -14.613 -26.472 0.02 27.58 ? 237 PHE A CZ   1  
ATOM   3663   H H    . PHE A 1 244 ? -39.099 -15.499 -28.608 0.02 28.46 ? 237 PHE A H    1  
ATOM   3664   H HA   . PHE A 1 244 ? -38.379 -15.431 -31.137 0.02 28.32 ? 237 PHE A HA   1  
ATOM   3665   H HB2  . PHE A 1 244 ? -36.073 -15.159 -30.853 0.02 27.84 ? 237 PHE A HB2  1  
ATOM   3666   H HB3  . PHE A 1 244 ? -36.849 -13.837 -30.470 0.02 27.87 ? 237 PHE A HB3  1  
ATOM   3667   H HD1  . PHE A 1 244 ? -36.953 -13.139 -28.106 0.02 27.84 ? 237 PHE A HD1  1  
ATOM   3668   H HD2  . PHE A 1 244 ? -34.753 -16.263 -29.253 0.02 27.71 ? 237 PHE A HD2  1  
ATOM   3669   H HE1  . PHE A 1 244 ? -35.818 -13.074 -26.094 0.02 27.68 ? 237 PHE A HE1  1  
ATOM   3670   H HE2  . PHE A 1 244 ? -33.627 -16.202 -27.255 0.02 27.55 ? 237 PHE A HE2  1  
ATOM   3671   H HZ   . PHE A 1 244 ? -34.170 -14.588 -25.659 0.02 27.54 ? 237 PHE A HZ   1  
ATOM   3672   N N    . HIS A 1 245 ? -37.040 -17.654 -30.833 0.02 28.29 ? 238 HIS A N    1  
ATOM   3673   C CA   . HIS A 1 245 ? -37.168 -19.094 -30.990 0.02 28.52 ? 238 HIS A CA   1  
ATOM   3674   C C    . HIS A 1 245 ? -35.868 -19.860 -30.884 0.02 28.39 ? 238 HIS A C    1  
ATOM   3675   O O    . HIS A 1 245 ? -35.919 -21.092 -30.746 0.02 28.60 ? 238 HIS A O    1  
ATOM   3676   C CB   . HIS A 1 245 ? -37.859 -19.395 -32.325 0.02 28.75 ? 238 HIS A CB   1  
ATOM   3677   C CG   . HIS A 1 245 ? -39.065 -18.536 -32.552 0.02 28.90 ? 238 HIS A CG   1  
ATOM   3678   N ND1  . HIS A 1 245 ? -38.992 -17.283 -33.134 0.02 28.74 ? 238 HIS A ND1  1  
ATOM   3679   C CD2  . HIS A 1 245 ? -40.362 -18.715 -32.212 0.02 29.22 ? 238 HIS A CD2  1  
ATOM   3680   C CE1  . HIS A 1 245 ? -40.198 -16.750 -33.174 0.02 28.96 ? 238 HIS A CE1  1  
ATOM   3681   N NE2  . HIS A 1 245 ? -41.047 -17.601 -32.627 0.02 29.26 ? 238 HIS A NE2  1  
ATOM   3682   H H    . HIS A 1 245 ? -36.432 -17.284 -31.311 0.02 28.14 ? 238 HIS A H    1  
ATOM   3683   H HA   . HIS A 1 245 ? -37.749 -19.435 -30.293 0.02 28.68 ? 238 HIS A HA   1  
ATOM   3684   H HB2  . HIS A 1 245 ? -37.235 -19.238 -33.047 0.02 28.63 ? 238 HIS A HB2  1  
ATOM   3685   H HB3  . HIS A 1 245 ? -38.142 -20.321 -32.334 0.02 28.96 ? 238 HIS A HB3  1  
ATOM   3686   H HD2  . HIS A 1 245 ? -40.725 -19.466 -31.801 0.02 29.42 ? 238 HIS A HD2  1  
ATOM   3687   H HE1  . HIS A 1 245 ? -40.415 -15.921 -33.529 0.02 28.94 ? 238 HIS A HE1  1  
ATOM   3688   H HE2  . HIS A 1 245 ? -41.892 -17.470 -32.538 0.02 29.46 ? 238 HIS A HE2  1  
ATOM   3689   N N    . ARG A 1 246 ? -34.721 -19.189 -30.903 0.02 28.09 ? 239 ARG A N    1  
ATOM   3690   C CA   . ARG A 1 246 ? -33.426 -19.808 -30.693 0.02 27.98 ? 239 ARG A CA   1  
ATOM   3691   C C    . ARG A 1 246 ? -32.530 -18.796 -30.009 0.02 27.71 ? 239 ARG A C    1  
ATOM   3692   O O    . ARG A 1 246 ? -32.665 -17.594 -30.232 0.02 27.57 ? 239 ARG A O    1  
ATOM   3693   C CB   . ARG A 1 246 ? -32.737 -20.248 -31.999 0.02 28.00 ? 239 ARG A CB   1  
ATOM   3694   C CG   . ARG A 1 246 ? -33.442 -21.340 -32.857 0.02 28.31 ? 239 ARG A CG   1  
ATOM   3695   C CD   . ARG A 1 246 ? -34.335 -20.741 -33.912 0.02 28.39 ? 239 ARG A CD   1  
ATOM   3696   N NE   . ARG A 1 246 ? -34.797 -21.723 -34.883 0.02 28.70 ? 239 ARG A NE   1  
ATOM   3697   C CZ   . ARG A 1 246 ? -35.729 -22.630 -34.635 0.02 29.02 ? 239 ARG A CZ   1  
ATOM   3698   N NH1  . ARG A 1 246 ? -36.094 -23.472 -35.597 0.02 29.32 ? 239 ARG A NH1  1  
ATOM   3699   N NH2  . ARG A 1 246 ? -36.273 -22.718 -33.426 0.02 29.07 ? 239 ARG A NH2  1  
ATOM   3700   H H    . ARG A 1 246 ? -34.670 -18.346 -31.038 0.02 27.97 ? 239 ARG A H    1  
ATOM   3701   H HA   . ARG A 1 246 ? -33.515 -20.573 -30.110 0.02 28.11 ? 239 ARG A HA   1  
ATOM   3702   H HB2  . ARG A 1 246 ? -32.640 -19.464 -32.560 0.02 27.89 ? 239 ARG A HB2  1  
ATOM   3703   H HB3  . ARG A 1 246 ? -31.856 -20.583 -31.770 0.02 27.94 ? 239 ARG A HB3  1  
ATOM   3704   H HG2  . ARG A 1 246 ? -32.768 -21.871 -33.310 0.02 28.35 ? 239 ARG A HG2  1  
ATOM   3705   H HG3  . ARG A 1 246 ? -33.984 -21.904 -32.283 0.02 28.47 ? 239 ARG A HG3  1  
ATOM   3706   H HD2  . ARG A 1 246 ? -35.114 -20.348 -33.493 0.02 28.43 ? 239 ARG A HD2  1  
ATOM   3707   H HD3  . ARG A 1 246 ? -33.842 -20.060 -34.392 0.02 28.24 ? 239 ARG A HD3  1  
ATOM   3708   H HE   . ARG A 1 246 ? -34.589 -21.590 -35.707 0.02 28.70 ? 239 ARG A HE   1  
ATOM   3709   H HH11 . ARG A 1 246 ? -35.734 -23.420 -36.374 0.02 29.31 ? 239 ARG A HH11 1  
ATOM   3710   H HH12 . ARG A 1 246 ? -36.687 -24.072 -35.437 0.02 29.55 ? 239 ARG A HH12 1  
ATOM   3711   H HH21 . ARG A 1 246 ? -36.037 -22.176 -32.803 0.02 28.89 ? 239 ARG A HH21 1  
ATOM   3712   H HH22 . ARG A 1 246 ? -36.871 -23.314 -33.267 0.02 29.30 ? 239 ARG A HH22 1  
ATOM   3713   N N    . GLY A 1 247 ? -31.589 -19.285 -29.221 0.02 27.65 ? 240 GLY A N    1  
ATOM   3714   C CA   . GLY A 1 247 ? -30.581 -18.431 -28.629 0.02 27.44 ? 240 GLY A CA   1  
ATOM   3715   C C    . GLY A 1 247 ? -29.185 -18.987 -28.781 0.02 27.39 ? 240 GLY A C    1  
ATOM   3716   O O    . GLY A 1 247 ? -28.970 -20.184 -28.690 0.02 27.55 ? 240 GLY A O    1  
ATOM   3717   H H    . GLY A 1 247 ? -31.507 -20.111 -29.018 0.02 27.77 ? 240 GLY A H    1  
ATOM   3718   H HA2  . GLY A 1 247 ? -30.602 -17.564 -29.052 0.02 27.33 ? 240 GLY A HA2  1  
ATOM   3719   H HA3  . GLY A 1 247 ? -30.777 -18.325 -27.687 0.02 27.45 ? 240 GLY A HA3  1  
ATOM   3720   N N    . ILE A 1 248 ? -28.235 -18.093 -29.012 0.02 27.22 ? 241 ILE A N    1  
ATOM   3721   C CA   . ILE A 1 248 ? -26.832 -18.457 -29.091 0.02 27.21 ? 241 ILE A CA   1  
ATOM   3722   C C    . ILE A 1 248 ? -26.051 -17.599 -28.113 0.02 27.09 ? 241 ILE A C    1  
ATOM   3723   O O    . ILE A 1 248 ? -26.026 -16.374 -28.252 0.02 26.97 ? 241 ILE A O    1  
ATOM   3724   C CB   . ILE A 1 248 ? -26.252 -18.269 -30.499 0.02 27.20 ? 241 ILE A CB   1  
ATOM   3725   C CG1  . ILE A 1 248 ? -27.079 -19.022 -31.546 0.02 27.34 ? 241 ILE A CG1  1  
ATOM   3726   C CG2  . ILE A 1 248 ? -24.805 -18.659 -30.462 0.02 27.23 ? 241 ILE A CG2  1  
ATOM   3727   C CD1  . ILE A 1 248 ? -26.657 -18.687 -32.998 0.02 27.35 ? 241 ILE A CD1  1  
ATOM   3728   H H    . ILE A 1 248 ? -28.382 -17.257 -29.120 0.02 27.14 ? 241 ILE A H    1  
ATOM   3729   H HA   . ILE A 1 248 ? -26.729 -19.384 -28.843 0.02 27.32 ? 241 ILE A HA   1  
ATOM   3730   H HB   . ILE A 1 248 ? -26.295 -17.330 -30.716 0.02 27.10 ? 241 ILE A HB   1  
ATOM   3731   H HG12 . ILE A 1 248 ? -26.962 -19.976 -31.411 0.02 27.46 ? 241 ILE A HG12 1  
ATOM   3732   H HG13 . ILE A 1 248 ? -28.013 -18.786 -31.447 0.02 27.34 ? 241 ILE A HG13 1  
ATOM   3733   H HG21 . ILE A 1 248 ? -24.688 -19.346 -29.792 0.02 27.30 ? 241 ILE A HG21 1  
ATOM   3734   H HG22 . ILE A 1 248 ? -24.531 -18.991 -31.328 0.02 27.31 ? 241 ILE A HG22 1  
ATOM   3735   H HG23 . ILE A 1 248 ? -24.279 -17.882 -30.228 0.02 27.15 ? 241 ILE A HG23 1  
ATOM   3736   H HD11 . ILE A 1 248 ? -27.360 -18.954 -33.612 0.02 27.44 ? 241 ILE A HD11 1  
ATOM   3737   H HD12 . ILE A 1 248 ? -26.504 -17.733 -33.062 0.02 27.25 ? 241 ILE A HD12 1  
ATOM   3738   H HD13 . ILE A 1 248 ? -25.837 -19.158 -33.211 0.02 27.41 ? 241 ILE A HD13 1  
ATOM   3739   N N    . LEU A 1 249 ? -25.381 -18.243 -27.153 0.02 27.17 ? 242 LEU A N    1  
ATOM   3740   C CA   . LEU A 1 249 ? -24.570 -17.572 -26.137 0.02 27.12 ? 242 LEU A CA   1  
ATOM   3741   C C    . LEU A 1 249 ? -23.088 -17.749 -26.455 0.02 27.16 ? 242 LEU A C    1  
ATOM   3742   O O    . LEU A 1 249 ? -22.527 -18.820 -26.223 0.02 27.30 ? 242 LEU A O    1  
ATOM   3743   C CB   . LEU A 1 249 ? -24.871 -18.129 -24.736 0.02 27.23 ? 242 LEU A CB   1  
ATOM   3744   C CG   . LEU A 1 249 ? -26.329 -18.299 -24.357 0.02 27.29 ? 242 LEU A CG   1  
ATOM   3745   C CD1  . LEU A 1 249 ? -26.483 -18.825 -22.898 0.02 27.45 ? 242 LEU A CD1  1  
ATOM   3746   C CD2  . LEU A 1 249 ? -27.098 -17.003 -24.536 0.02 27.16 ? 242 LEU A CD2  1  
ATOM   3747   H H    . LEU A 1 249 ? -25.399 -19.090 -27.058 0.02 27.27 ? 242 LEU A H    1  
ATOM   3748   H HA   . LEU A 1 249 ? -24.774 -16.628 -26.132 0.02 27.02 ? 242 LEU A HA   1  
ATOM   3749   H HB2  . LEU A 1 249 ? -24.459 -18.999 -24.653 0.02 27.34 ? 242 LEU A HB2  1  
ATOM   3750   H HB3  . LEU A 1 249 ? -24.473 -17.543 -24.084 0.02 27.20 ? 242 LEU A HB3  1  
ATOM   3751   H HG   . LEU A 1 249 ? -26.724 -18.959 -24.947 0.02 27.35 ? 242 LEU A HG   1  
ATOM   3752   H HD11 . LEU A 1 249 ? -27.411 -19.062 -22.749 0.02 27.52 ? 242 LEU A HD11 1  
ATOM   3753   H HD12 . LEU A 1 249 ? -25.916 -19.603 -22.774 0.02 27.54 ? 242 LEU A HD12 1  
ATOM   3754   H HD13 . LEU A 1 249 ? -26.216 -18.126 -22.281 0.02 27.40 ? 242 LEU A HD13 1  
ATOM   3755   H HD21 . LEU A 1 249 ? -27.908 -17.031 -24.004 0.02 27.23 ? 242 LEU A HD21 1  
ATOM   3756   H HD22 . LEU A 1 249 ? -26.540 -16.266 -24.246 0.02 27.09 ? 242 LEU A HD22 1  
ATOM   3757   H HD23 . LEU A 1 249 ? -27.319 -16.897 -25.475 0.02 27.12 ? 242 LEU A HD23 1  
ATOM   3758   N N    . MET A 1 250 ? -22.433 -16.683 -26.920 0.02 27.07 ? 243 MET A N    1  
ATOM   3759   C CA   . MET A 1 250 ? -21.024 -16.721 -27.290 0.02 27.15 ? 243 MET A CA   1  
ATOM   3760   C C    . MET A 1 250 ? -20.174 -16.131 -26.160 0.02 27.18 ? 243 MET A C    1  
ATOM   3761   O O    . MET A 1 250 ? -20.170 -14.920 -25.936 0.02 27.11 ? 243 MET A O    1  
ATOM   3762   C CB   . MET A 1 250 ? -20.797 -15.968 -28.599 0.02 27.10 ? 243 MET A CB   1  
ATOM   3763   C CG   . MET A 1 250 ? -21.793 -16.378 -29.654 0.02 27.08 ? 243 MET A CG   1  
ATOM   3764   S SD   . MET A 1 250 ? -21.832 -15.291 -31.125 0.02 27.04 ? 243 MET A SD   1  
ATOM   3765   C CE   . MET A 1 250 ? -20.155 -15.384 -31.670 0.02 27.20 ? 243 MET A CE   1  
ATOM   3766   H H    . MET A 1 250 ? -22.794 -15.918 -27.019 0.02 26.99 ? 243 MET A H    1  
ATOM   3767   H HA   . MET A 1 250 ? -20.759 -17.638 -27.427 0.02 27.25 ? 243 MET A HA   1  
ATOM   3768   H HB2  . MET A 1 250 ? -20.905 -15.019 -28.442 0.02 27.03 ? 243 MET A HB2  1  
ATOM   3769   H HB3  . MET A 1 250 ? -19.903 -16.150 -28.925 0.02 27.19 ? 243 MET A HB3  1  
ATOM   3770   H HG2  . MET A 1 250 ? -21.577 -17.277 -29.941 0.02 27.18 ? 243 MET A HG2  1  
ATOM   3771   H HG3  . MET A 1 250 ? -22.686 -16.367 -29.276 0.02 27.03 ? 243 MET A HG3  1  
ATOM   3772   H HE1  . MET A 1 250 ? -19.833 -16.289 -31.540 0.02 27.28 ? 243 MET A HE1  1  
ATOM   3773   H HE2  . MET A 1 250 ? -20.116 -15.139 -32.606 0.02 27.24 ? 243 MET A HE2  1  
ATOM   3774   H HE3  . MET A 1 250 ? -19.624 -14.762 -31.152 0.02 27.19 ? 243 MET A HE3  1  
ATOM   3775   N N    . SER A 1 251 ? -19.420 -16.988 -25.483 0.02 27.34 ? 244 SER A N    1  
ATOM   3776   C CA   . SER A 1 251 ? -18.521 -16.559 -24.406 0.02 27.43 ? 244 SER A CA   1  
ATOM   3777   C C    . SER A 1 251 ? -19.254 -15.731 -23.347 0.02 27.35 ? 244 SER A C    1  
ATOM   3778   O O    . SER A 1 251 ? -18.799 -14.664 -22.956 0.02 27.36 ? 244 SER A O    1  
ATOM   3779   C CB   . SER A 1 251 ? -17.321 -15.777 -24.945 0.02 27.50 ? 244 SER A CB   1  
ATOM   3780   O OG   . SER A 1 251 ? -16.534 -16.529 -25.852 0.02 27.64 ? 244 SER A OG   1  
ATOM   3781   H H    . SER A 1 251 ? -19.407 -17.826 -25.635 0.02 27.41 ? 244 SER A H    1  
ATOM   3782   H HA   . SER A 1 251 ? -18.173 -17.351 -23.969 0.02 27.56 ? 244 SER A HA   1  
ATOM   3783   H HB2  . SER A 1 251 ? -17.644 -14.983 -25.399 0.02 27.40 ? 244 SER A HB2  1  
ATOM   3784   H HB3  . SER A 1 251 ? -16.763 -15.520 -24.196 0.02 27.59 ? 244 SER A HB3  1  
ATOM   3785   H HG   . SER A 1 251 ? -16.974 -17.185 -26.131 0.02 27.62 ? 244 SER A HG   1  
ATOM   3786   N N    . GLY A 1 252 ? -20.362 -16.248 -22.845 0.02 27.33 ? 245 GLY A N    1  
ATOM   3787   C CA   . GLY A 1 252 ? -21.034 -15.548 -21.762 0.02 27.31 ? 245 GLY A CA   1  
ATOM   3788   C C    . GLY A 1 252 ? -22.397 -16.094 -21.435 0.02 27.30 ? 245 GLY A C    1  
ATOM   3789   O O    . GLY A 1 252 ? -23.112 -16.648 -22.262 0.02 27.26 ? 245 GLY A O    1  
ATOM   3790   H H    . GLY A 1 252 ? -20.737 -16.976 -23.104 0.02 27.34 ? 245 GLY A H    1  
ATOM   3791   H HA2  . GLY A 1 252 ? -20.493 -15.585 -20.959 0.02 27.42 ? 245 GLY A HA2  1  
ATOM   3792   H HA3  . GLY A 1 252 ? -21.142 -14.619 -22.011 0.02 27.23 ? 245 GLY A HA3  1  
ATOM   3793   N N    . ASN A 1 253 ? -22.784 -15.874 -20.190 0.02 27.38 ? 246 ASN A N    1  
ATOM   3794   C CA   . ASN A 1 253 ? -24.124 -16.151 -19.706 0.02 27.42 ? 246 ASN A CA   1  
ATOM   3795   C C    . ASN A 1 253 ? -24.387 -15.214 -18.526 0.02 27.49 ? 246 ASN A C    1  
ATOM   3796   O O    . ASN A 1 253 ? -23.481 -14.558 -18.008 0.02 27.53 ? 246 ASN A O    1  
ATOM   3797   C CB   . ASN A 1 253 ? -24.279 -17.589 -19.248 0.02 27.60 ? 246 ASN A CB   1  
ATOM   3798   C CG   . ASN A 1 253 ? -24.057 -17.701 -17.766 0.02 27.82 ? 246 ASN A CG   1  
ATOM   3799   O OD1  . ASN A 1 253 ? -24.978 -17.929 -17.031 0.02 27.95 ? 246 ASN A OD1  1  
ATOM   3800   N ND2  . ASN A 1 253 ? -22.872 -17.401 -17.331 0.02 27.88 ? 246 ASN A ND2  1  
ATOM   3801   H H    . ASN A 1 253 ? -22.267 -15.555 -19.589 0.02 27.44 ? 246 ASN A H    1  
ATOM   3802   H HA   . ASN A 1 253 ? -24.779 -15.979 -20.394 0.02 27.33 ? 246 ASN A HA   1  
ATOM   3803   H HB2  . ASN A 1 253 ? -25.180 -17.888 -19.450 0.02 27.59 ? 246 ASN A HB2  1  
ATOM   3804   H HB3  . ASN A 1 253 ? -23.631 -18.150 -19.699 0.02 27.63 ? 246 ASN A HB3  1  
ATOM   3805   H HD21 . ASN A 1 253 ? -22.635 -17.638 -16.543 0.02 28.04 ? 246 ASN A HD21 1  
ATOM   3806   H HD22 . ASN A 1 253 ? -22.325 -16.961 -17.825 0.02 27.80 ? 246 ASN A HD22 1  
ATOM   3807   N N    . ALA A 1 254 ? -25.615 -15.230 -18.054 0.02 27.55 ? 247 ALA A N    1  
ATOM   3808   C CA   . ALA A 1 254 ? -26.017 -14.328 -16.979 0.02 27.64 ? 247 ALA A CA   1  
ATOM   3809   C C    . ALA A 1 254 ? -25.508 -14.740 -15.598 0.02 27.87 ? 247 ALA A C    1  
ATOM   3810   O O    . ALA A 1 254 ? -25.565 -13.920 -14.667 0.02 27.97 ? 247 ALA A O    1  
ATOM   3811   C CB   . ALA A 1 254 ? -27.539 -14.220 -16.955 0.02 27.69 ? 247 ALA A CB   1  
ATOM   3812   H H    . ALA A 1 254 ? -26.227 -15.755 -18.324 0.02 27.57 ? 247 ALA A H    1  
ATOM   3813   H HA   . ALA A 1 254 ? -25.662 -13.448 -17.165 0.02 27.55 ? 247 ALA A HA   1  
ATOM   3814   H HB1  . ALA A 1 254 ? -27.801 -13.581 -16.278 0.02 27.76 ? 247 ALA A HB1  1  
ATOM   3815   H HB2  . ALA A 1 254 ? -27.843 -13.929 -17.827 0.02 27.56 ? 247 ALA A HB2  1  
ATOM   3816   H HB3  . ALA A 1 254 ? -27.916 -15.089 -16.754 0.02 27.80 ? 247 ALA A HB3  1  
ATOM   3817   N N    . ILE A 1 255 ? -25.021 -15.965 -15.385 0.02 27.99 ? 248 ILE A N    1  
ATOM   3818   C CA   . ILE A 1 255 ? -24.477 -16.254 -14.057 0.02 28.24 ? 248 ILE A CA   1  
ATOM   3819   C C    . ILE A 1 255 ? -22.965 -16.143 -14.028 0.02 28.26 ? 248 ILE A C    1  
ATOM   3820   O O    . ILE A 1 255 ? -22.348 -16.400 -12.993 0.02 28.49 ? 248 ILE A O    1  
ATOM   3821   C CB   . ILE A 1 255 ? -24.963 -17.600 -13.507 0.02 28.47 ? 248 ILE A CB   1  
ATOM   3822   C CG1  . ILE A 1 255 ? -24.908 -18.720 -14.509 0.02 28.43 ? 248 ILE A CG1  1  
ATOM   3823   C CG2  . ILE A 1 255 ? -26.398 -17.479 -13.143 0.02 28.55 ? 248 ILE A CG2  1  
ATOM   3824   C CD1  . ILE A 1 255 ? -25.326 -20.043 -13.894 0.02 28.72 ? 248 ILE A CD1  1  
ATOM   3825   H H    . ILE A 1 255 ? -25.015 -16.607 -15.941 0.02 27.96 ? 248 ILE A H    1  
ATOM   3826   H HA   . ILE A 1 255 ? -24.797 -15.584 -13.439 0.02 28.30 ? 248 ILE A HA   1  
ATOM   3827   H HB   . ILE A 1 255 ? -24.444 -17.840 -12.721 0.02 28.65 ? 248 ILE A HB   1  
ATOM   3828   H HG12 . ILE A 1 255 ? -25.579 -18.543 -15.169 0.02 28.28 ? 248 ILE A HG12 1  
ATOM   3829   H HG13 . ILE A 1 255 ? -24.025 -18.787 -14.903 0.02 28.40 ? 248 ILE A HG13 1  
ATOM   3830   H HG21 . ILE A 1 255 ? -26.452 -16.689 -12.594 0.02 28.62 ? 248 ILE A HG21 1  
ATOM   3831   H HG22 . ILE A 1 255 ? -26.945 -17.390 -13.939 0.02 28.39 ? 248 ILE A HG22 1  
ATOM   3832   H HG23 . ILE A 1 255 ? -26.678 -18.250 -12.621 0.02 28.73 ? 248 ILE A HG23 1  
ATOM   3833   H HD11 . ILE A 1 255 ? -26.280 -20.154 -14.026 0.02 28.73 ? 248 ILE A HD11 1  
ATOM   3834   H HD12 . ILE A 1 255 ? -24.845 -20.771 -14.321 0.02 28.73 ? 248 ILE A HD12 1  
ATOM   3835   H HD13 . ILE A 1 255 ? -25.120 -20.029 -12.950 0.02 28.90 ? 248 ILE A HD13 1  
ATOM   3836   N N    . CYS A 1 256 ? -22.361 -15.699 -15.119 0.02 28.06 ? 249 CYS A N    1  
ATOM   3837   C CA   . CYS A 1 256 ? -20.990 -15.237 -15.061 0.02 28.10 ? 249 CYS A CA   1  
ATOM   3838   C C    . CYS A 1 256 ? -20.826 -14.227 -13.924 0.02 28.24 ? 249 CYS A C    1  
ATOM   3839   O O    . CYS A 1 256 ? -21.720 -13.404 -13.688 0.02 28.19 ? 249 CYS A O    1  
ATOM   3840   C CB   . CYS A 1 256 ? -20.585 -14.583 -16.371 0.02 27.88 ? 249 CYS A CB   1  
ATOM   3841   S SG   . CYS A 1 256 ? -20.425 -15.783 -17.706 0.02 27.78 ? 249 CYS A SG   1  
ATOM   3842   H H    . CYS A 1 256 ? -22.727 -15.642 -15.888 0.02 27.92 ? 249 CYS A H    1  
ATOM   3843   H HA   . CYS A 1 256 ? -20.420 -16.003 -14.918 0.02 28.22 ? 249 CYS A HA   1  
ATOM   3844   H HB2  . CYS A 1 256 ? -21.267 -13.942 -16.621 0.02 27.77 ? 249 CYS A HB2  1  
ATOM   3845   H HB3  . CYS A 1 256 ? -19.732 -14.136 -16.251 0.02 27.94 ? 249 CYS A HB3  1  
ATOM   3846   H HG   . CYS A 1 256 ? -19.396 -16.368 -17.530 0.02 27.93 ? 249 CYS A HG   1  
ATOM   3847   N N    . PRO A 1 257 ? -19.696 -14.247 -13.225 0.02 28.45 ? 250 PRO A N    1  
ATOM   3848   C CA   . PRO A 1 257 ? -19.519 -13.334 -12.078 0.02 28.64 ? 250 PRO A CA   1  
ATOM   3849   C C    . PRO A 1 257 ? -19.544 -11.857 -12.475 0.02 28.51 ? 250 PRO A C    1  
ATOM   3850   O O    . PRO A 1 257 ? -19.938 -11.006 -11.667 0.02 28.59 ? 250 PRO A O    1  
ATOM   3851   C CB   . PRO A 1 257 ? -18.151 -13.753 -11.520 0.02 28.90 ? 250 PRO A CB   1  
ATOM   3852   C CG   . PRO A 1 257 ? -17.458 -14.456 -12.650 0.02 28.79 ? 250 PRO A CG   1  
ATOM   3853   C CD   . PRO A 1 257 ? -18.564 -15.169 -13.392 0.02 28.58 ? 250 PRO A CD   1  
ATOM   3854   H HA   . PRO A 1 257 ? -20.204 -13.493 -11.410 0.02 28.74 ? 250 PRO A HA   1  
ATOM   3855   H HB2  . PRO A 1 257 ? -17.653 -12.963 -11.257 0.02 28.96 ? 250 PRO A HB2  1  
ATOM   3856   H HB3  . PRO A 1 257 ? -18.277 -14.346 -10.765 0.02 29.08 ? 250 PRO A HB3  1  
ATOM   3857   H HG2  . PRO A 1 257 ? -17.013 -13.816 -13.224 0.02 28.71 ? 250 PRO A HG2  1  
ATOM   3858   H HG3  . PRO A 1 257 ? -16.819 -15.088 -12.284 0.02 28.98 ? 250 PRO A HG3  1  
ATOM   3859   H HD2  . PRO A 1 257 ? -18.335 -15.273 -14.326 0.02 28.45 ? 250 PRO A HD2  1  
ATOM   3860   H HD3  . PRO A 1 257 ? -18.761 -16.025 -12.987 0.02 28.70 ? 250 PRO A HD3  1  
ATOM   3861   N N    . TRP A 1 258 ? -19.134 -11.544 -13.706 0.02 28.34 ? 251 TRP A N    1  
ATOM   3862   C CA   . TRP A 1 258 ? -19.127 -10.170 -14.214 0.02 28.25 ? 251 TRP A CA   1  
ATOM   3863   C C    . TRP A 1 258 ? -20.472 -9.725  -14.764 0.02 28.04 ? 251 TRP A C    1  
ATOM   3864   O O    . TRP A 1 258 ? -20.632 -8.538  -15.073 0.02 28.00 ? 251 TRP A O    1  
ATOM   3865   C CB   . TRP A 1 258 ? -18.061 -10.024 -15.300 0.02 28.19 ? 251 TRP A CB   1  
ATOM   3866   C CG   . TRP A 1 258 ? -18.144 -11.084 -16.351 0.02 28.02 ? 251 TRP A CG   1  
ATOM   3867   C CD1  . TRP A 1 258 ? -17.432 -12.234 -16.409 0.02 28.10 ? 251 TRP A CD1  1  
ATOM   3868   C CD2  . TRP A 1 258 ? -19.005 -11.086 -17.496 0.02 27.77 ? 251 TRP A CD2  1  
ATOM   3869   N NE1  . TRP A 1 258 ? -17.791 -12.962 -17.529 0.02 27.92 ? 251 TRP A NE1  1  
ATOM   3870   C CE2  . TRP A 1 258 ? -18.754 -12.270 -18.210 0.02 27.71 ? 251 TRP A CE2  1  
ATOM   3871   C CE3  . TRP A 1 258 ? -19.962 -10.196 -17.985 0.02 27.62 ? 251 TRP A CE3  1  
ATOM   3872   C CZ2  . TRP A 1 258 ? -19.432 -12.595 -19.368 0.02 27.52 ? 251 TRP A CZ2  1  
ATOM   3873   C CZ3  . TRP A 1 258 ? -20.620 -10.513 -19.128 0.02 27.42 ? 251 TRP A CZ3  1  
ATOM   3874   C CH2  . TRP A 1 258 ? -20.356 -11.703 -19.819 0.02 27.37 ? 251 TRP A CH2  1  
ATOM   3875   H H    . TRP A 1 258 ? -18.845 -12.127 -14.259 0.02 28.30 ? 251 TRP A H    1  
ATOM   3876   H HA   . TRP A 1 258 ? -18.893 -9.564  -13.497 0.02 28.41 ? 251 TRP A HA   1  
ATOM   3877   H HB2  . TRP A 1 258 ? -18.175 -9.168  -15.739 0.02 28.13 ? 251 TRP A HB2  1  
ATOM   3878   H HB3  . TRP A 1 258 ? -17.186 -10.065 -14.886 0.02 28.37 ? 251 TRP A HB3  1  
ATOM   3879   H HD1  . TRP A 1 258 ? -16.792 -12.490 -15.787 0.02 28.28 ? 251 TRP A HD1  1  
ATOM   3880   H HE1  . TRP A 1 258 ? -17.466 -13.721 -17.763 0.02 27.96 ? 251 TRP A HE1  1  
ATOM   3881   H HE3  . TRP A 1 258 ? -20.145 -9.409  -17.530 0.02 27.67 ? 251 TRP A HE3  1  
ATOM   3882   H HZ2  . TRP A 1 258 ? -19.253 -13.378 -19.830 0.02 27.51 ? 251 TRP A HZ2  1  
ATOM   3883   H HZ3  . TRP A 1 258 ? -21.259 -9.928  -19.461 0.02 27.35 ? 251 TRP A HZ3  1  
ATOM   3884   H HH2  . TRP A 1 258 ? -20.820 -11.890 -20.600 0.02 27.26 ? 251 TRP A HH2  1  
ATOM   3885   N N    . ALA A 1 259 ? -21.430 -10.631 -14.922 0.02 27.94 ? 252 ALA A N    1  
ATOM   3886   C CA   . ALA A 1 259 ? -22.701 -10.305 -15.562 0.02 27.77 ? 252 ALA A CA   1  
ATOM   3887   C C    . ALA A 1 259 ? -23.720 -9.738  -14.594 0.02 27.90 ? 252 ALA A C    1  
ATOM   3888   O O    . ALA A 1 259 ? -24.886 -9.566  -14.971 0.02 27.82 ? 252 ALA A O    1  
ATOM   3889   C CB   . ALA A 1 259 ? -23.296 -11.549 -16.236 0.02 27.64 ? 252 ALA A CB   1  
ATOM   3890   H H    . ALA A 1 259 ? -21.364 -11.445 -14.671 0.02 27.99 ? 252 ALA A H    1  
ATOM   3891   H HA   . ALA A 1 259 ? -22.547 -9.637  -16.246 0.02 27.69 ? 252 ALA A HA   1  
ATOM   3892   H HB1  . ALA A 1 259 ? -23.603 -12.158 -15.547 0.02 27.73 ? 252 ALA A HB1  1  
ATOM   3893   H HB2  . ALA A 1 259 ? -24.041 -11.292 -16.801 0.02 27.52 ? 252 ALA A HB2  1  
ATOM   3894   H HB3  . ALA A 1 259 ? -22.607 -11.968 -16.773 0.02 27.61 ? 252 ALA A HB3  1  
ATOM   3895   N N    . ASN A 1 260 ? -23.301 -9.431  -13.374 0.02 28.14 ? 253 ASN A N    1  
ATOM   3896   C CA   . ASN A 1 260 ? -24.249 -9.281  -12.290 0.02 28.33 ? 253 ASN A CA   1  
ATOM   3897   C C    . ASN A 1 260 ? -23.554 -8.653  -11.095 0.02 28.60 ? 253 ASN A C    1  
ATOM   3898   O O    . ASN A 1 260 ? -22.560 -9.188  -10.619 0.02 28.72 ? 253 ASN A O    1  
ATOM   3899   C CB   . ASN A 1 260 ? -24.791 -10.658 -11.926 0.02 28.43 ? 253 ASN A CB   1  
ATOM   3900   C CG   . ASN A 1 260 ? -26.014 -10.576 -11.184 0.02 28.56 ? 253 ASN A CG   1  
ATOM   3901   O OD1  . ASN A 1 260 ? -26.113 -11.108 -10.103 0.02 28.82 ? 253 ASN A OD1  1  
ATOM   3902   N ND2  . ASN A 1 260 ? -26.984 -9.854  -11.744 0.02 28.41 ? 253 ASN A ND2  1  
ATOM   3903   H H    . ASN A 1 260 ? -22.482 -9.311  -13.151 0.02 28.21 ? 253 ASN A H    1  
ATOM   3904   H HA   . ASN A 1 260 ? -24.974 -8.707  -12.570 0.02 28.27 ? 253 ASN A HA   1  
ATOM   3905   H HB2  . ASN A 1 260 ? -24.968 -11.174 -12.727 0.02 28.29 ? 253 ASN A HB2  1  
ATOM   3906   H HB3  . ASN A 1 260 ? -24.146 -11.116 -11.363 0.02 28.58 ? 253 ASN A HB3  1  
ATOM   3907   H HD21 . ASN A 1 260 ? -27.801 -9.962  -11.496 0.02 28.50 ? 253 ASN A HD21 1  
ATOM   3908   H HD22 . ASN A 1 260 ? -26.795 -9.289  -12.360 0.02 28.25 ? 253 ASN A HD22 1  
ATOM   3909   N N    . THR A 1 261 ? -24.071 -7.515  -10.626 0.02 28.71 ? 254 THR A N    1  
ATOM   3910   C CA   . THR A 1 261 ? -23.510 -6.841  -9.450  0.02 29.02 ? 254 THR A CA   1  
ATOM   3911   C C    . THR A 1 261 ? -24.641 -6.147  -8.696  0.02 29.21 ? 254 THR A C    1  
ATOM   3912   O O    . THR A 1 261 ? -25.611 -5.710  -9.304  0.02 29.09 ? 254 THR A O    1  
ATOM   3913   C CB   . THR A 1 261 ? -22.405 -5.841  -9.866  0.02 29.03 ? 254 THR A CB   1  
ATOM   3914   O OG1  . THR A 1 261 ? -21.675 -5.371  -8.719  0.02 29.37 ? 254 THR A OG1  1  
ATOM   3915   C CG2  . THR A 1 261 ? -22.982 -4.644  -10.639 0.02 28.95 ? 254 THR A CG2  1  
ATOM   3916   H H    . THR A 1 261 ? -24.756 -7.124  -10.963 0.02 28.64 ? 254 THR A H    1  
ATOM   3917   H HA   . THR A 1 261 ? -23.115 -7.499  -8.857  0.02 29.15 ? 254 THR A HA   1  
ATOM   3918   H HB   . THR A 1 261 ? -21.785 -6.299  -10.452 0.02 28.90 ? 254 THR A HB   1  
ATOM   3919   H HG1  . THR A 1 261 ? -20.864 -5.586  -8.783  0.02 29.38 ? 254 THR A HG1  1  
ATOM   3920   H HG21 . THR A 1 261 ? -22.258 -4.112  -11.003 0.02 28.96 ? 254 THR A HG21 1  
ATOM   3921   H HG22 . THR A 1 261 ? -23.543 -4.949  -11.368 0.02 28.75 ? 254 THR A HG22 1  
ATOM   3922   H HG23 . THR A 1 261 ? -23.513 -4.088  -10.046 0.02 29.12 ? 254 THR A HG23 1  
ATOM   3923   N N    . GLN A 1 262 ? -24.532 -6.061  -7.368  0.02 29.56 ? 255 GLN A N    1  
ATOM   3924   C CA   . GLN A 1 262 ? -25.492 -5.278  -6.588  0.02 29.81 ? 255 GLN A CA   1  
ATOM   3925   C C    . GLN A 1 262 ? -24.892 -3.897  -6.432  0.02 29.97 ? 255 GLN A C    1  
ATOM   3926   O O    . GLN A 1 262 ? -23.913 -3.720  -5.711  0.02 30.22 ? 255 GLN A O    1  
ATOM   3927   C CB   . GLN A 1 262 ? -25.792 -5.934  -5.235  0.02 30.15 ? 255 GLN A CB   1  
ATOM   3928   C CG   . GLN A 1 262 ? -26.744 -7.130  -5.378  0.02 30.07 ? 255 GLN A CG   1  
ATOM   3929   C CD   . GLN A 1 262 ? -27.856 -6.799  -6.355  0.02 29.81 ? 255 GLN A CD   1  
ATOM   3930   O OE1  . GLN A 1 262 ? -28.567 -5.803  -6.163  0.02 29.94 ? 255 GLN A OE1  1  
ATOM   3931   N NE2  . GLN A 1 262 ? -27.952 -7.561  -7.452  0.02 29.49 ? 255 GLN A NE2  1  
ATOM   3932   H H    . GLN A 1 262 ? -23.919 -6.438  -6.903  0.02 29.67 ? 255 GLN A H    1  
ATOM   3933   H HA   . GLN A 1 262 ? -26.304 -5.163  -7.096  0.02 29.68 ? 255 GLN A HA   1  
ATOM   3934   H HB2  . GLN A 1 262 ? -24.965 -6.240  -4.835  0.02 30.25 ? 255 GLN A HB2  1  
ATOM   3935   H HB3  . GLN A 1 262 ? -26.222 -5.278  -4.667  0.02 30.35 ? 255 GLN A HB3  1  
ATOM   3936   H HG2  . GLN A 1 262 ? -26.257 -7.902  -5.700  0.02 29.96 ? 255 GLN A HG2  1  
ATOM   3937   H HG3  . GLN A 1 262 ? -27.150 -7.320  -4.518  0.02 30.33 ? 255 GLN A HG3  1  
ATOM   3938   H HE21 . GLN A 1 262 ? -27.413 -7.436  -8.112  0.02 29.30 ? 255 GLN A HE21 1  
ATOM   3939   H HE22 . GLN A 1 262 ? -28.555 -8.170  -7.505  0.02 29.48 ? 255 GLN A HE22 1  
ATOM   3940   N N    . CYS A 1 263 ? -25.457 -2.913  -7.142  0.02 29.87 ? 256 CYS A N    1  
ATOM   3941   C CA   . CYS A 1 263 ? -24.798 -1.627  -7.298  0.02 29.98 ? 256 CYS A CA   1  
ATOM   3942   C C    . CYS A 1 263 ? -25.521 -0.464  -6.607  0.02 30.30 ? 256 CYS A C    1  
ATOM   3943   O O    . CYS A 1 263 ? -25.145 0.691   -6.836  0.02 30.40 ? 256 CYS A O    1  
ATOM   3944   C CB   . CYS A 1 263 ? -24.607 -1.332  -8.800  0.02 29.64 ? 256 CYS A CB   1  
ATOM   3945   S SG   . CYS A 1 263 ? -26.088 -1.223  -9.838  0.02 29.37 ? 256 CYS A SG   1  
ATOM   3946   H H    . CYS A 1 263 ? -26.221 -2.970  -7.533  0.02 29.77 ? 256 CYS A H    1  
ATOM   3947   H HA   . CYS A 1 263 ? -23.915 -1.685  -6.905  0.02 30.09 ? 256 CYS A HA   1  
ATOM   3948   H HB2  . CYS A 1 263 ? -24.134 -0.492  -8.894  0.02 29.75 ? 256 CYS A HB2  1  
ATOM   3949   H HB3  . CYS A 1 263 ? -24.060 -2.039  -9.171  0.02 29.49 ? 256 CYS A HB3  1  
ATOM   3950   H HG   . CYS A 1 263 ? -26.972 -1.973  -9.531  0.02 29.25 ? 256 CYS A HG   1  
ATOM   3951   N N    . GLN A 1 264 ? -26.493 -0.741  -5.723  0.02 30.51 ? 257 GLN A N    1  
ATOM   3952   C CA   . GLN A 1 264 ? -27.441 0.280   -5.262  0.02 30.80 ? 257 GLN A CA   1  
ATOM   3953   C C    . GLN A 1 264 ? -26.768 1.391   -4.456  0.02 31.18 ? 257 GLN A C    1  
ATOM   3954   O O    . GLN A 1 264 ? -27.257 2.525   -4.449  0.02 31.37 ? 257 GLN A O    1  
ATOM   3955   C CB   . GLN A 1 264 ? -28.545 -0.350  -4.418  0.02 31.00 ? 257 GLN A CB   1  
ATOM   3956   C CG   . GLN A 1 264 ? -29.554 -1.209  -5.155  0.02 30.73 ? 257 GLN A CG   1  
ATOM   3957   C CD   . GLN A 1 264 ? -28.928 -2.439  -5.770  0.02 30.38 ? 257 GLN A CD   1  
ATOM   3958   O OE1  . GLN A 1 264 ? -28.038 -3.085  -5.181  0.02 30.43 ? 257 GLN A OE1  1  
ATOM   3959   N NE2  . GLN A 1 264 ? -29.384 -2.773  -6.968  0.02 30.05 ? 257 GLN A NE2  1  
ATOM   3960   H H    . GLN A 1 264 ? -26.618 -1.514  -5.371  0.02 30.52 ? 257 GLN A H    1  
ATOM   3961   H HA   . GLN A 1 264 ? -27.867 0.688   -6.028  0.02 30.65 ? 257 GLN A HA   1  
ATOM   3962   H HB2  . GLN A 1 264 ? -28.143 -0.897  -3.724  0.02 31.11 ? 257 GLN A HB2  1  
ATOM   3963   H HB3  . GLN A 1 264 ? -29.018 0.379   -4.007  0.02 31.26 ? 257 GLN A HB3  1  
ATOM   3964   H HG2  . GLN A 1 264 ? -30.235 -1.506  -4.533  0.02 30.93 ? 257 GLN A HG2  1  
ATOM   3965   H HG3  . GLN A 1 264 ? -29.962 -0.690  -5.862  0.02 30.62 ? 257 GLN A HG3  1  
ATOM   3966   H HE21 . GLN A 1 264 ? -30.152 -2.492  -7.228  0.02 30.07 ? 257 GLN A HE21 1  
ATOM   3967   H HE22 . GLN A 1 264 ? -28.915 -3.281  -7.478  0.02 29.84 ? 257 GLN A HE22 1  
ATOM   3968   N N    . HIS A 1 265 ? -25.688 1.074   -3.739  0.02 31.33 ? 258 HIS A N    1  
ATOM   3969   C CA   . HIS A 1 265 ? -24.940 2.052   -2.965  0.02 31.74 ? 258 HIS A CA   1  
ATOM   3970   C C    . HIS A 1 265 ? -23.820 2.686   -3.775  0.02 31.63 ? 258 HIS A C    1  
ATOM   3971   O O    . HIS A 1 265 ? -23.057 3.488   -3.244  0.02 31.98 ? 258 HIS A O    1  
ATOM   3972   C CB   . HIS A 1 265 ? -24.380 1.380   -1.709  0.02 32.06 ? 258 HIS A CB   1  
ATOM   3973   C CG   . HIS A 1 265 ? -23.657 2.313   -0.779  0.02 32.53 ? 258 HIS A CG   1  
ATOM   3974   N ND1  . HIS A 1 265 ? -22.707 1.870   0.112   0.02 32.78 ? 258 HIS A ND1  1  
ATOM   3975   C CD2  . HIS A 1 265 ? -23.720 3.658   -0.618  0.02 32.83 ? 258 HIS A CD2  1  
ATOM   3976   C CE1  . HIS A 1 265 ? -22.222 2.896   0.785   0.02 33.21 ? 258 HIS A CE1  1  
ATOM   3977   N NE2  . HIS A 1 265 ? -22.824 3.991   0.362   0.02 33.26 ? 258 HIS A NE2  1  
ATOM   3978   H H    . HIS A 1 265 ? -25.363 0.282   -3.685  0.02 31.23 ? 258 HIS A H    1  
ATOM   3979   H HA   . HIS A 1 265 ? -25.545 2.753   -2.684  0.02 31.93 ? 258 HIS A HA   1  
ATOM   3980   H HB2  . HIS A 1 265 ? -25.109 0.973   -1.217  0.02 32.18 ? 258 HIS A HB2  1  
ATOM   3981   H HB3  . HIS A 1 265 ? -23.751 0.697   -1.989  0.02 31.88 ? 258 HIS A HB3  1  
ATOM   3982   H HD2  . HIS A 1 265 ? -24.264 4.252   -1.080  0.02 32.79 ? 258 HIS A HD2  1  
ATOM   3983   H HE1  . HIS A 1 265 ? -21.573 2.853   1.450   0.02 33.47 ? 258 HIS A HE1  1  
ATOM   3984   H HE2  . HIS A 1 265 ? -22.673 4.786   0.657   0.02 33.53 ? 258 HIS A HE2  1  
ATOM   3985   N N    . ARG A 1 266 ? -23.691 2.343   -5.059  0.02 31.20 ? 259 ARG A N    1  
ATOM   3986   C CA   . ARG A 1 266 ? -22.639 2.947   -5.869  0.02 31.13 ? 259 ARG A CA   1  
ATOM   3987   C C    . ARG A 1 266 ? -23.054 4.253   -6.539  0.02 31.19 ? 259 ARG A C    1  
ATOM   3988   O O    . ARG A 1 266 ? -22.182 4.991   -6.995  0.02 31.28 ? 259 ARG A O    1  
ATOM   3989   C CB   . ARG A 1 266 ? -22.173 1.953   -6.927  0.02 30.69 ? 259 ARG A CB   1  
ATOM   3990   C CG   . ARG A 1 266 ? -21.459 0.776   -6.280  0.02 30.71 ? 259 ARG A CG   1  
ATOM   3991   C CD   . ARG A 1 266 ? -21.240 -0.382  -7.218  0.02 30.30 ? 259 ARG A CD   1  
ATOM   3992   N NE   . ARG A 1 266 ? -20.890 -1.587  -6.482  0.02 30.36 ? 259 ARG A NE   1  
ATOM   3993   C CZ   . ARG A 1 266 ? -20.851 -2.801  -7.002  0.02 30.09 ? 259 ARG A CZ   1  
ATOM   3994   N NH1  . ARG A 1 266 ? -21.139 -2.976  -8.281  0.02 29.72 ? 259 ARG A NH1  1  
ATOM   3995   N NH2  . ARG A 1 266 ? -20.542 -3.851  -6.239  0.02 30.21 ? 259 ARG A NH2  1  
ATOM   3996   H H    . ARG A 1 266 ? -24.192 1.782   -5.474  0.02 30.96 ? 259 ARG A H    1  
ATOM   3997   H HA   . ARG A 1 266 ? -21.878 3.142   -5.303  0.02 31.37 ? 259 ARG A HA   1  
ATOM   3998   H HB2  . ARG A 1 266 ? -22.946 1.625   -7.408  0.02 30.47 ? 259 ARG A HB2  1  
ATOM   3999   H HB3  . ARG A 1 266 ? -21.556 2.389   -7.532  0.02 30.65 ? 259 ARG A HB3  1  
ATOM   4000   H HG2  . ARG A 1 266 ? -20.594 1.075   -5.959  0.02 30.89 ? 259 ARG A HG2  1  
ATOM   4001   H HG3  . ARG A 1 266 ? -21.990 0.457   -5.532  0.02 30.86 ? 259 ARG A HG3  1  
ATOM   4002   H HD2  . ARG A 1 266 ? -22.056 -0.555  -7.713  0.02 30.11 ? 259 ARG A HD2  1  
ATOM   4003   H HD3  . ARG A 1 266 ? -20.513 -0.170  -7.823  0.02 30.21 ? 259 ARG A HD3  1  
ATOM   4004   H HE   . ARG A 1 266 ? -20.794 -1.519  -5.628  0.02 30.59 ? 259 ARG A HE   1  
ATOM   4005   H HH11 . ARG A 1 266 ? -21.343 -2.309  -8.777  0.02 29.65 ? 259 ARG A HH11 1  
ATOM   4006   H HH12 . ARG A 1 266 ? -21.111 -3.764  -8.613  0.02 29.56 ? 259 ARG A HH12 1  
ATOM   4007   H HH21 . ARG A 1 266 ? -20.356 -3.736  -5.410  0.02 30.47 ? 259 ARG A HH21 1  
ATOM   4008   H HH22 . ARG A 1 266 ? -20.511 -4.638  -6.578  0.02 30.05 ? 259 ARG A HH22 1  
ATOM   4009   N N    . ALA A 1 267 ? -24.344 4.547   -6.628  0.02 31.17 ? 260 ALA A N    1  
ATOM   4010   C CA   . ALA A 1 267 ? -24.749 5.813   -7.225  0.02 31.28 ? 260 ALA A CA   1  
ATOM   4011   C C    . ALA A 1 267 ? -24.211 6.986   -6.400  0.02 31.79 ? 260 ALA A C    1  
ATOM   4012   O O    . ALA A 1 267 ? -23.635 7.946   -6.939  0.02 31.92 ? 260 ALA A O    1  
ATOM   4013   C CB   . ALA A 1 267 ? -26.269 5.862   -7.346  0.02 31.22 ? 260 ALA A CB   1  
ATOM   4014   H H    . ALA A 1 267 ? -24.989 4.050   -6.357  0.02 31.12 ? 260 ALA A H    1  
ATOM   4015   H HA   . ALA A 1 267 ? -24.373 5.874   -8.115  0.02 31.08 ? 260 ALA A HA   1  
ATOM   4016   H HB1  . ALA A 1 267 ? -26.658 5.884   -6.461  0.02 31.45 ? 260 ALA A HB1  1  
ATOM   4017   H HB2  . ALA A 1 267 ? -26.518 6.654   -7.842  0.02 31.29 ? 260 ALA A HB2  1  
ATOM   4018   H HB3  . ALA A 1 267 ? -26.577 5.077   -7.816  0.02 30.92 ? 260 ALA A HB3  1  
ATOM   4019   N N    . PHE A 1 268 ? -24.339 6.895   -5.078  0.02 32.13 ? 261 PHE A N    1  
ATOM   4020   C CA   . PHE A 1 268 ? -23.785 7.932   -4.218  0.02 32.66 ? 261 PHE A CA   1  
ATOM   4021   C C    . PHE A 1 268 ? -22.322 8.157   -4.524  0.02 32.71 ? 261 PHE A C    1  
ATOM   4022   O O    . PHE A 1 268 ? -21.868 9.295   -4.657  0.02 33.02 ? 261 PHE A O    1  
ATOM   4023   C CB   . PHE A 1 268 ? -23.964 7.531   -2.759  0.02 33.00 ? 261 PHE A CB   1  
ATOM   4024   C CG   . PHE A 1 268 ? -23.284 8.467   -1.785  0.02 33.58 ? 261 PHE A CG   1  
ATOM   4025   C CD1  . PHE A 1 268 ? -23.785 9.731   -1.550  0.02 33.98 ? 261 PHE A CD1  1  
ATOM   4026   C CD2  . PHE A 1 268 ? -22.144 8.072   -1.113  0.02 33.77 ? 261 PHE A CD2  1  
ATOM   4027   C CE1  . PHE A 1 268 ? -23.166 10.568  -0.652  0.02 34.55 ? 261 PHE A CE1  1  
ATOM   4028   C CE2  . PHE A 1 268 ? -21.520 8.910   -0.233  0.02 34.34 ? 261 PHE A CE2  1  
ATOM   4029   C CZ   . PHE A 1 268 ? -22.033 10.154  -0.001  0.02 34.73 ? 261 PHE A CZ   1  
ATOM   4030   H H    . PHE A 1 268 ? -24.733 6.254   -4.663  0.02 32.09 ? 261 PHE A H    1  
ATOM   4031   H HA   . PHE A 1 268 ? -24.256 8.764   -4.367  0.02 32.82 ? 261 PHE A HA   1  
ATOM   4032   H HB2  . PHE A 1 268 ? -24.911 7.506   -2.554  0.02 33.03 ? 261 PHE A HB2  1  
ATOM   4033   H HB3  . PHE A 1 268 ? -23.580 6.648   -2.636  0.02 32.83 ? 261 PHE A HB3  1  
ATOM   4034   H HD1  . PHE A 1 268 ? -24.555 10.009  -1.988  0.02 33.89 ? 261 PHE A HD1  1  
ATOM   4035   H HD2  . PHE A 1 268 ? -21.793 7.225   -1.266  0.02 33.53 ? 261 PHE A HD2  1  
ATOM   4036   H HE1  . PHE A 1 268 ? -23.507 11.419  -0.496  0.02 34.84 ? 261 PHE A HE1  1  
ATOM   4037   H HE2  . PHE A 1 268 ? -20.756 8.630   0.211   0.02 34.49 ? 261 PHE A HE2  1  
ATOM   4038   H HZ   . PHE A 1 268 ? -21.608 10.722  0.600   0.02 35.14 ? 261 PHE A HZ   1  
ATOM   4039   N N    . THR A 1 269 ? -21.567 7.076   -4.662  0.02 32.45 ? 262 THR A N    1  
ATOM   4040   C CA   . THR A 1 269 ? -20.147 7.217   -4.922  0.02 32.54 ? 262 THR A CA   1  
ATOM   4041   C C    . THR A 1 269 ? -19.896 7.927   -6.245  0.02 32.40 ? 262 THR A C    1  
ATOM   4042   O O    . THR A 1 269 ? -18.978 8.744   -6.363  0.02 32.70 ? 262 THR A O    1  
ATOM   4043   C CB   . THR A 1 269 ? -19.499 5.840   -4.917  0.02 32.27 ? 262 THR A CB   1  
ATOM   4044   O OG1  . THR A 1 269 ? -19.735 5.236   -3.643  0.02 32.44 ? 262 THR A OG1  1  
ATOM   4045   C CG2  . THR A 1 269 ? -18.034 5.961   -5.159  0.02 32.43 ? 262 THR A CG2  1  
ATOM   4046   H H    . THR A 1 269 ? -21.852 6.271   -4.610  0.02 32.24 ? 262 THR A H    1  
ATOM   4047   H HA   . THR A 1 269 ? -19.743 7.744   -4.215  0.02 32.92 ? 262 THR A HA   1  
ATOM   4048   H HB   . THR A 1 269 ? -19.890 5.292   -5.612  0.02 31.90 ? 262 THR A HB   1  
ATOM   4049   H HG1  . THR A 1 269 ? -19.554 5.783   -3.032  0.02 32.78 ? 262 THR A HG1  1  
ATOM   4050   H HG21 . THR A 1 269 ? -17.650 6.602   -4.540  0.02 32.82 ? 262 THR A HG21 1  
ATOM   4051   H HG22 . THR A 1 269 ? -17.609 5.099   -5.024  0.02 32.28 ? 262 THR A HG22 1  
ATOM   4052   H HG23 . THR A 1 269 ? -17.857 6.260   -6.061  0.02 32.35 ? 262 THR A HG23 1  
ATOM   4053   N N    . LEU A 1 270 ? -20.699 7.617   -7.251  0.02 31.97 ? 263 LEU A N    1  
ATOM   4054   C CA   . LEU A 1 270 ? -20.552 8.275   -8.551  0.02 31.85 ? 263 LEU A CA   1  
ATOM   4055   C C    . LEU A 1 270 ? -20.846 9.768   -8.434  0.02 32.26 ? 263 LEU A C    1  
ATOM   4056   O O    . LEU A 1 270 ? -20.079 10.617  -8.910  0.02 32.49 ? 263 LEU A O    1  
ATOM   4057   C CB   . LEU A 1 270 ? -21.502 7.612   -9.540  0.02 31.35 ? 263 LEU A CB   1  
ATOM   4058   C CG   . LEU A 1 270 ? -21.673 8.317   -10.889 0.02 31.23 ? 263 LEU A CG   1  
ATOM   4059   C CD1  . LEU A 1 270 ? -20.343 8.325   -11.607 0.02 31.24 ? 263 LEU A CD1  1  
ATOM   4060   C CD2  . LEU A 1 270 ? -22.751 7.620   -11.682 0.02 30.79 ? 263 LEU A CD2  1  
ATOM   4061   H H    . LEU A 1 270 ? -21.337 7.045   -7.207  0.02 31.77 ? 263 LEU A H    1  
ATOM   4062   H HA   . LEU A 1 270 ? -19.644 8.166   -8.865  0.02 31.85 ? 263 LEU A HA   1  
ATOM   4063   H HB2  . LEU A 1 270 ? -21.175 6.717   -9.713  0.02 31.11 ? 263 LEU A HB2  1  
ATOM   4064   H HB3  . LEU A 1 270 ? -22.378 7.556   -9.131  0.02 31.35 ? 263 LEU A HB3  1  
ATOM   4065   H HG   . LEU A 1 270 ? -21.953 9.232   -10.754 0.02 31.49 ? 263 LEU A HG   1  
ATOM   4066   H HD11 . LEU A 1 270 ? -20.418 8.880   -12.399 0.02 31.23 ? 263 LEU A HD11 1  
ATOM   4067   H HD12 . LEU A 1 270 ? -19.654 8.679   -11.026 0.02 31.55 ? 263 LEU A HD12 1  
ATOM   4068   H HD13 . LEU A 1 270 ? -20.124 7.415   -11.864 0.02 30.98 ? 263 LEU A HD13 1  
ATOM   4069   H HD21 . LEU A 1 270 ? -22.778 8.000   -12.573 0.02 30.73 ? 263 LEU A HD21 1  
ATOM   4070   H HD22 . LEU A 1 270 ? -22.541 6.676   -11.735 0.02 30.56 ? 263 LEU A HD22 1  
ATOM   4071   H HD23 . LEU A 1 270 ? -23.605 7.741   -11.242 0.02 30.85 ? 263 LEU A HD23 1  
ATOM   4072   N N    . ALA A 1 271 ? -21.967 10.096  -7.799  0.02 32.41 ? 264 ALA A N    1  
ATOM   4073   C CA   . ALA A 1 271 ? -22.310 11.485  -7.523  0.02 32.87 ? 264 ALA A CA   1  
ATOM   4074   C C    . ALA A 1 271 ? -21.160 12.201  -6.826  0.02 33.39 ? 264 ALA A C    1  
ATOM   4075   O O    . ALA A 1 271 ? -20.735 13.283  -7.246  0.02 33.69 ? 264 ALA A O    1  
ATOM   4076   C CB   . ALA A 1 271 ? -23.582 11.528  -6.678  0.02 33.02 ? 264 ALA A CB   1  
ATOM   4077   H H    . ALA A 1 271 ? -22.544 9.527   -7.514  0.02 32.27 ? 264 ALA A H    1  
ATOM   4078   H HA   . ALA A 1 271 ? -22.490 11.943  -8.358  0.02 32.80 ? 264 ALA A HA   1  
ATOM   4079   H HB1  . ALA A 1 271 ? -23.791 12.447  -6.460  0.02 33.36 ? 264 ALA A HB1  1  
ATOM   4080   H HB2  . ALA A 1 271 ? -24.312 11.129  -7.174  0.02 32.73 ? 264 ALA A HB2  1  
ATOM   4081   H HB3  . ALA A 1 271 ? -23.426 11.021  -5.867  0.02 33.09 ? 264 ALA A HB3  1  
ATOM   4082   N N    . LYS A 1 272 ? -20.630 11.591  -5.764  0.02 33.52 ? 265 LYS A N    1  
ATOM   4083   C CA   . LYS A 1 272 ? -19.512 12.171  -5.034  0.02 34.05 ? 265 LYS A CA   1  
ATOM   4084   C C    . LYS A 1 272 ? -18.316 12.438  -5.943  0.02 34.05 ? 265 LYS A C    1  
ATOM   4085   O O    . LYS A 1 272 ? -17.715 13.512  -5.873  0.02 34.53 ? 265 LYS A O    1  
ATOM   4086   C CB   . LYS A 1 272 ? -19.136 11.244  -3.868  0.02 34.14 ? 265 LYS A CB   1  
ATOM   4087   C CG   . LYS A 1 272 ? -20.225 11.128  -2.779  0.02 34.28 ? 265 LYS A CG   1  
ATOM   4088   C CD   . LYS A 1 272 ? -20.411 12.396  -1.970  0.02 34.91 ? 265 LYS A CD   1  
ATOM   4089   C CE   . LYS A 1 272 ? -19.130 13.171  -1.851  0.02 35.38 ? 265 LYS A CE   1  
ATOM   4090   N NZ   . LYS A 1 272 ? -19.184 14.241  -0.825  0.02 36.08 ? 265 LYS A NZ   1  
ATOM   4091   H H    . LYS A 1 272 ? -20.910 10.846  -5.440  0.02 33.35 ? 265 LYS A H    1  
ATOM   4092   H HA   . LYS A 1 272 ? -19.796 13.021  -4.665  0.02 34.40 ? 265 LYS A HA   1  
ATOM   4093   H HB2  . LYS A 1 272 ? -19.024 10.353  -4.232  0.02 33.78 ? 265 LYS A HB2  1  
ATOM   4094   H HB3  . LYS A 1 272 ? -18.296 11.523  -3.482  0.02 34.47 ? 265 LYS A HB3  1  
ATOM   4095   H HG2  . LYS A 1 272 ? -21.080 10.938  -3.190  0.02 34.00 ? 265 LYS A HG2  1  
ATOM   4096   H HG3  . LYS A 1 272 ? -19.987 10.410  -2.175  0.02 34.29 ? 265 LYS A HG3  1  
ATOM   4097   H HD2  . LYS A 1 272 ? -21.075 12.961  -2.391  0.02 34.88 ? 265 LYS A HD2  1  
ATOM   4098   H HD3  . LYS A 1 272 ? -20.694 12.162  -1.076  0.02 35.09 ? 265 LYS A HD3  1  
ATOM   4099   H HE2  . LYS A 1 272 ? -18.416 12.560  -1.610  0.02 35.34 ? 265 LYS A HE2  1  
ATOM   4100   H HE3  . LYS A 1 272 ? -18.937 13.593  -2.702  0.02 35.30 ? 265 LYS A HE3  1  
ATOM   4101   H HZ1  . LYS A 1 272 ? -18.531 14.820  -0.951  0.02 36.35 ? 265 LYS A HZ1  1  
ATOM   4102   H HZ2  . LYS A 1 272 ? -19.959 14.674  -0.875  0.02 36.14 ? 265 LYS A HZ2  1  
ATOM   4103   H HZ3  . LYS A 1 272 ? -19.105 13.881  -0.017  0.02 36.21 ? 265 LYS A HZ3  1  
ATOM   4104   N N    . LEU A 1 273 ? -17.950 11.487  -6.816  0.02 33.57 ? 266 LEU A N    1  
ATOM   4105   C CA   . LEU A 1 273 ? -16.820 11.727  -7.708  0.02 33.61 ? 266 LEU A CA   1  
ATOM   4106   C C    . LEU A 1 273 ? -17.074 12.909  -8.642  0.02 33.73 ? 266 LEU A C    1  
ATOM   4107   O O    . LEU A 1 273 ? -16.124 13.567  -9.079  0.02 34.03 ? 266 LEU A O    1  
ATOM   4108   C CB   . LEU A 1 273 ? -16.519 10.478  -8.537  0.02 33.07 ? 266 LEU A CB   1  
ATOM   4109   C CG   . LEU A 1 273 ? -15.846 9.296   -7.847  0.02 33.01 ? 266 LEU A CG   1  
ATOM   4110   C CD1  . LEU A 1 273 ? -16.436 7.989   -8.387  0.02 32.41 ? 266 LEU A CD1  1  
ATOM   4111   C CD2  . LEU A 1 273 ? -14.346 9.313   -8.003  0.02 33.33 ? 266 LEU A CD2  1  
ATOM   4112   H H    . LEU A 1 273 ? -18.327 10.720  -6.901  0.02 33.25 ? 266 LEU A H    1  
ATOM   4113   H HA   . LEU A 1 273 ? -16.041 11.924  -7.176  0.02 33.95 ? 266 LEU A HA   1  
ATOM   4114   H HB2  . LEU A 1 273 ? -17.362 10.152  -8.887  0.02 32.74 ? 266 LEU A HB2  1  
ATOM   4115   H HB3  . LEU A 1 273 ? -15.951 10.743  -9.277  0.02 33.07 ? 266 LEU A HB3  1  
ATOM   4116   H HG   . LEU A 1 273 ? -16.041 9.344   -6.900  0.02 33.20 ? 266 LEU A HG   1  
ATOM   4117   H HD11 . LEU A 1 273 ? -16.016 7.234   -7.942  0.02 32.39 ? 266 LEU A HD11 1  
ATOM   4118   H HD12 . LEU A 1 273 ? -17.392 7.980   -8.224  0.02 32.25 ? 266 LEU A HD12 1  
ATOM   4119   H HD13 . LEU A 1 273 ? -16.265 7.947   -9.340  0.02 32.23 ? 266 LEU A HD13 1  
ATOM   4120   H HD21 . LEU A 1 273 ? -13.962 8.611   -7.459  0.02 33.35 ? 266 LEU A HD21 1  
ATOM   4121   H HD22 . LEU A 1 273 ? -14.124 9.168   -8.935  0.02 33.14 ? 266 LEU A HD22 1  
ATOM   4122   H HD23 . LEU A 1 273 ? -14.009 10.172  -7.707  0.02 33.73 ? 266 LEU A HD23 1  
ATOM   4123   N N    . ALA A 1 274 ? -18.333 13.186  -8.968  0.02 33.55 ? 267 ALA A N    1  
ATOM   4124   C CA   . ALA A 1 274 ? -18.681 14.187  -9.974  0.02 33.62 ? 267 ALA A CA   1  
ATOM   4125   C C    . ALA A 1 274 ? -18.948 15.579  -9.410  0.02 34.23 ? 267 ALA A C    1  
ATOM   4126   O O    . ALA A 1 274 ? -19.246 16.494  -10.189 0.02 34.40 ? 267 ALA A O    1  
ATOM   4127   C CB   . ALA A 1 274 ? -19.909 13.732  -10.748 0.02 33.14 ? 267 ALA A CB   1  
ATOM   4128   H H    . ALA A 1 274 ? -19.014 12.794  -8.621  0.02 33.40 ? 267 ALA A H    1  
ATOM   4129   H HA   . ALA A 1 274 ? -17.947 14.261  -10.600 0.02 33.60 ? 267 ALA A HA   1  
ATOM   4130   H HB1  . ALA A 1 274 ? -20.068 14.340  -11.485 0.02 33.18 ? 267 ALA A HB1  1  
ATOM   4131   H HB2  . ALA A 1 274 ? -19.752 12.835  -11.080 0.02 32.77 ? 267 ALA A HB2  1  
ATOM   4132   H HB3  . ALA A 1 274 ? -20.668 13.730  -10.145 0.02 33.20 ? 267 ALA A HB3  1  
ATOM   4133   N N    . GLY A 1 275 ? -18.879 15.745  -8.090  0.02 34.59 ? 268 GLY A N    1  
ATOM   4134   C CA   . GLY A 1 275 ? -19.050 17.026  -7.433  0.02 35.23 ? 268 GLY A CA   1  
ATOM   4135   C C    . GLY A 1 275 ? -20.260 17.166  -6.524  0.02 35.36 ? 268 GLY A C    1  
ATOM   4136   O O    . GLY A 1 275 ? -20.554 18.283  -6.085  0.02 35.90 ? 268 GLY A O    1  
ATOM   4137   H H    . GLY A 1 275 ? -18.732 15.101  -7.541  0.02 34.48 ? 268 GLY A H    1  
ATOM   4138   H HA2  . GLY A 1 275 ? -18.268 17.191  -6.883  0.02 35.55 ? 268 GLY A HA2  1  
ATOM   4139   H HA3  . GLY A 1 275 ? -19.101 17.722  -8.105  0.02 35.33 ? 268 GLY A HA3  1  
ATOM   4140   N N    . TYR A 1 276 ? -20.968 16.087  -6.236  0.02 34.94 ? 269 TYR A N    1  
ATOM   4141   C CA   . TYR A 1 276 ? -22.172 16.163  -5.432  0.02 35.06 ? 269 TYR A CA   1  
ATOM   4142   C C    . TYR A 1 276 ? -21.822 16.588  -4.014  0.02 35.67 ? 269 TYR A C    1  
ATOM   4143   O O    . TYR A 1 276 ? -20.847 16.100  -3.446  0.02 35.75 ? 269 TYR A O    1  
ATOM   4144   C CB   . TYR A 1 276 ? -22.861 14.809  -5.400  0.02 34.52 ? 269 TYR A CB   1  
ATOM   4145   C CG   . TYR A 1 276 ? -24.015 14.686  -4.453  0.02 34.66 ? 269 TYR A CG   1  
ATOM   4146   C CD1  . TYR A 1 276 ? -25.197 15.364  -4.666  0.02 34.76 ? 269 TYR A CD1  1  
ATOM   4147   C CD2  . TYR A 1 276 ? -23.933 13.849  -3.348  0.02 34.74 ? 269 TYR A CD2  1  
ATOM   4148   C CE1  . TYR A 1 276 ? -26.262 15.238  -3.800  0.02 34.94 ? 269 TYR A CE1  1  
ATOM   4149   C CE2  . TYR A 1 276 ? -24.979 13.704  -2.484  0.02 34.91 ? 269 TYR A CE2  1  
ATOM   4150   C CZ   . TYR A 1 276 ? -26.144 14.396  -2.693  0.02 35.02 ? 269 TYR A CZ   1  
ATOM   4151   O OH   . TYR A 1 276 ? -27.182 14.225  -1.810  0.02 35.24 ? 269 TYR A OH   1  
ATOM   4152   H H    . TYR A 1 276 ? -20.759 15.292  -6.482  0.02 34.59 ? 269 TYR A H    1  
ATOM   4153   H HA   . TYR A 1 276 ? -22.782 16.811  -5.813  0.02 35.15 ? 269 TYR A HA   1  
ATOM   4154   H HB2  . TYR A 1 276 ? -23.193 14.611  -6.289  0.02 34.17 ? 269 TYR A HB2  1  
ATOM   4155   H HB3  . TYR A 1 276 ? -22.205 14.144  -5.135  0.02 34.41 ? 269 TYR A HB3  1  
ATOM   4156   H HD1  . TYR A 1 276 ? -25.272 15.928  -5.404  0.02 34.73 ? 269 TYR A HD1  1  
ATOM   4157   H HD2  . TYR A 1 276 ? -23.148 13.376  -3.194  0.02 34.70 ? 269 TYR A HD2  1  
ATOM   4158   H HE1  . TYR A 1 276 ? -27.050 15.705  -3.954  0.02 35.03 ? 269 TYR A HE1  1  
ATOM   4159   H HE2  . TYR A 1 276 ? -24.895 13.143  -1.753  0.02 34.99 ? 269 TYR A HE2  1  
ATOM   4160   H HH   . TYR A 1 276 ? -27.905 14.138  -2.227  0.02 35.09 ? 269 TYR A HH   1  
ATOM   4161   N N    . LYS A 1 277 ? -22.618 17.509  -3.469  0.02 36.12 ? 270 LYS A N    1  
ATOM   4162   C CA   . LYS A 1 277 ? -22.524 17.936  -2.080  0.02 36.74 ? 270 LYS A CA   1  
ATOM   4163   C C    . LYS A 1 277 ? -23.891 17.733  -1.437  0.02 36.76 ? 270 LYS A C    1  
ATOM   4164   O O    . LYS A 1 277 ? -24.880 18.359  -1.849  0.02 36.81 ? 270 LYS A O    1  
ATOM   4165   C CB   . LYS A 1 277 ? -22.043 19.380  -1.998  0.02 37.40 ? 270 LYS A CB   1  
ATOM   4166   C CG   . LYS A 1 277 ? -20.679 19.566  -2.665  0.02 37.43 ? 270 LYS A CG   1  
ATOM   4167   C CD   . LYS A 1 277 ? -20.151 20.996  -2.627  0.02 38.15 ? 270 LYS A CD   1  
ATOM   4168   C CE   . LYS A 1 277 ? -18.783 21.089  -3.297  0.02 38.20 ? 270 LYS A CE   1  
ATOM   4169   N NZ   . LYS A 1 277 ? -18.763 20.400  -4.639  0.02 37.53 ? 270 LYS A NZ   1  
ATOM   4170   H H    . LYS A 1 277 ? -23.238 17.915  -3.902  0.02 36.11 ? 270 LYS A H    1  
ATOM   4171   H HA   . LYS A 1 277 ? -21.882 17.379  -1.615  0.02 36.72 ? 270 LYS A HA   1  
ATOM   4172   H HB2  . LYS A 1 277 ? -22.685 19.960  -2.434  0.02 37.45 ? 270 LYS A HB2  1  
ATOM   4173   H HB3  . LYS A 1 277 ? -21.954 19.622  -1.063  0.02 37.82 ? 270 LYS A HB3  1  
ATOM   4174   H HG2  . LYS A 1 277 ? -20.032 19.000  -2.224  0.02 37.39 ? 270 LYS A HG2  1  
ATOM   4175   H HG3  . LYS A 1 277 ? -20.757 19.306  -3.592  0.02 37.03 ? 270 LYS A HG3  1  
ATOM   4176   H HD2  . LYS A 1 277 ? -20.763 21.579  -3.102  0.02 38.21 ? 270 LYS A HD2  1  
ATOM   4177   H HD3  . LYS A 1 277 ? -20.059 21.288  -1.706  0.02 38.58 ? 270 LYS A HD3  1  
ATOM   4178   H HE2  . LYS A 1 277 ? -18.563 22.024  -3.434  0.02 38.65 ? 270 LYS A HE2  1  
ATOM   4179   H HE3  . LYS A 1 277 ? -18.119 20.671  -2.731  0.02 38.26 ? 270 LYS A HE3  1  
ATOM   4180   H HZ1  . LYS A 1 277 ? -19.550 20.493  -5.045  0.02 37.29 ? 270 LYS A HZ1  1  
ATOM   4181   H HZ2  . LYS A 1 277 ? -18.128 20.753  -5.152  0.02 37.69 ? 270 LYS A HZ2  1  
ATOM   4182   H HZ3  . LYS A 1 277 ? -18.599 19.531  -4.530  0.02 37.23 ? 270 LYS A HZ3  1  
ATOM   4183   N N    . GLY A 1 278 ? -23.942 16.823  -0.469  0.02 36.75 ? 271 GLY A N    1  
ATOM   4184   C CA   . GLY A 1 278 ? -25.185 16.402  0.147   0.02 36.73 ? 271 GLY A CA   1  
ATOM   4185   C C    . GLY A 1 278 ? -25.032 15.025  0.780   0.02 36.46 ? 271 GLY A C    1  
ATOM   4186   O O    . GLY A 1 278 ? -23.942 14.450  0.814   0.02 36.34 ? 271 GLY A O    1  
ATOM   4187   H H    . GLY A 1 278 ? -23.248 16.432  -0.147  0.02 36.78 ? 271 GLY A H    1  
ATOM   4188   H HA2  . GLY A 1 278 ? -25.446 17.039  0.830   0.02 37.21 ? 271 GLY A HA2  1  
ATOM   4189   H HA3  . GLY A 1 278 ? -25.884 16.358  -0.524  0.02 36.46 ? 271 GLY A HA3  1  
ATOM   4190   N N    . GLU A 1 279 ? -26.168 14.491  1.235   0.02 36.37 ? 272 GLU A N    1  
ATOM   4191   C CA   . GLU A 1 279 ? -26.224 13.206  1.933   0.02 36.18 ? 272 GLU A CA   1  
ATOM   4192   C C    . GLU A 1 279 ? -26.066 12.016  0.985   0.02 35.44 ? 272 GLU A C    1  
ATOM   4193   O O    . GLU A 1 279 ? -25.922 12.163  -0.228  0.02 35.07 ? 272 GLU A O    1  
ATOM   4194   C CB   . GLU A 1 279 ? -27.553 13.057  2.680   0.02 36.40 ? 272 GLU A CB   1  
ATOM   4195   C CG   . GLU A 1 279 ? -27.792 14.160  3.690   0.02 37.12 ? 272 GLU A CG   1  
ATOM   4196   C CD   . GLU A 1 279 ? -26.492 14.756  4.110   0.02 37.54 ? 272 GLU A CD   1  
ATOM   4197   O OE1  . GLU A 1 279 ? -25.904 14.294  5.121   0.02 37.83 ? 272 GLU A OE1  1  
ATOM   4198   O OE2  . GLU A 1 279 ? -26.015 15.631  3.360   0.02 37.59 ? 272 GLU A OE2  1  
ATOM   4199   H H    . GLU A 1 279 ? -26.937 14.871  1.155   0.02 36.46 ? 272 GLU A H    1  
ATOM   4200   H HA   . GLU A 1 279 ? -25.490 13.148  2.560   0.02 36.40 ? 272 GLU A HA   1  
ATOM   4201   H HB2  . GLU A 1 279 ? -28.278 13.077  2.040   0.02 36.12 ? 272 GLU A HB2  1  
ATOM   4202   H HB3  . GLU A 1 279 ? -27.559 12.209  3.149   0.02 36.39 ? 272 GLU A HB3  1  
ATOM   4203   H HG2  . GLU A 1 279 ? -28.340 14.858  3.298   0.02 37.13 ? 272 GLU A HG2  1  
ATOM   4204   H HG3  . GLU A 1 279 ? -28.220 13.802  4.478   0.02 37.34 ? 272 GLU A HG3  1  
ATOM   4205   N N    . ASP A 1 280 ? -26.041 10.820  1.583   0.02 35.29 ? 273 ASP A N    1  
ATOM   4206   C CA   . ASP A 1 280 ? -26.362 9.573   0.888   0.02 34.68 ? 273 ASP A CA   1  
ATOM   4207   C C    . ASP A 1 280 ? -27.833 9.295   1.173   0.02 34.71 ? 273 ASP A C    1  
ATOM   4208   O O    . ASP A 1 280 ? -28.203 8.479   2.020   0.02 34.77 ? 273 ASP A O    1  
ATOM   4209   C CB   . ASP A 1 280 ? -25.449 8.428   1.341   0.02 34.55 ? 273 ASP A CB   1  
ATOM   4210   C CG   . ASP A 1 280 ? -26.058 7.025   1.109   0.02 34.09 ? 273 ASP A CG   1  
ATOM   4211   O OD1  . ASP A 1 280 ? -26.428 6.710   -0.034  0.02 33.61 ? 273 ASP A OD1  1  
ATOM   4212   O OD2  . ASP A 1 280 ? -26.190 6.250   2.097   0.02 34.26 ? 273 ASP A OD2  1  
ATOM   4213   H H    . ASP A 1 280 ? -25.832 10.706  2.406   0.02 35.57 ? 273 ASP A H    1  
ATOM   4214   H HA   . ASP A 1 280 ? -26.253 9.697   -0.068  0.02 34.37 ? 273 ASP A HA   1  
ATOM   4215   H HB2  . ASP A 1 280 ? -24.626 8.476   0.830   0.02 34.42 ? 273 ASP A HB2  1  
ATOM   4216   H HB3  . ASP A 1 280 ? -25.258 8.521   2.286   0.02 34.93 ? 273 ASP A HB3  1  
ATOM   4217   N N    . ASN A 1 281 ? -28.686 10.044  0.491   0.02 34.74 ? 274 ASN A N    1  
ATOM   4218   C CA   . ASN A 1 281 ? -30.080 9.671   0.328   0.02 34.66 ? 274 ASN A CA   1  
ATOM   4219   C C    . ASN A 1 281 ? -30.389 9.671   -1.162  0.02 34.17 ? 274 ASN A C    1  
ATOM   4220   O O    . ASN A 1 281 ? -29.926 10.543  -1.903  0.02 34.13 ? 274 ASN A O    1  
ATOM   4221   C CB   . ASN A 1 281 ? -31.039 10.592  1.067   0.02 35.26 ? 274 ASN A CB   1  
ATOM   4222   C CG   . ASN A 1 281 ? -31.140 11.969  0.461   0.02 35.46 ? 274 ASN A CG   1  
ATOM   4223   O OD1  . ASN A 1 281 ? -31.622 12.129  -0.650  0.02 35.14 ? 274 ASN A OD1  1  
ATOM   4224   N ND2  . ASN A 1 281 ? -30.745 12.991  1.231   0.02 36.05 ? 274 ASN A ND2  1  
ATOM   4225   H H    . ASN A 1 281 ? -28.477 10.785  0.107   0.02 34.84 ? 274 ASN A H    1  
ATOM   4226   H HA   . ASN A 1 281 ? -30.211 8.775   0.672   0.02 34.54 ? 274 ASN A HA   1  
ATOM   4227   H HB2  . ASN A 1 281 ? -31.923 10.191  1.037   0.02 35.22 ? 274 ASN A HB2  1  
ATOM   4228   H HB3  . ASN A 1 281 ? -30.748 10.692  1.990   0.02 35.60 ? 274 ASN A HB3  1  
ATOM   4229   H HD21 . ASN A 1 281 ? -30.930 12.991  2.071   0.02 36.37 ? 274 ASN A HD21 1  
ATOM   4230   H HD22 . ASN A 1 281 ? -30.314 13.651  0.886   0.02 36.13 ? 274 ASN A HD22 1  
ATOM   4231   N N    . ASP A 1 282 ? -31.186 8.693   -1.586  0.02 33.84 ? 275 ASP A N    1  
ATOM   4232   C CA   . ASP A 1 282 ? -31.284 8.407   -3.011  0.02 33.30 ? 275 ASP A CA   1  
ATOM   4233   C C    . ASP A 1 282 ? -31.978 9.547   -3.745  0.02 33.42 ? 275 ASP A C    1  
ATOM   4234   O O    . ASP A 1 282 ? -31.564 9.936   -4.842  0.02 33.13 ? 275 ASP A O    1  
ATOM   4235   C CB   . ASP A 1 282 ? -32.014 7.082   -3.219  0.02 32.97 ? 275 ASP A CB   1  
ATOM   4236   C CG   . ASP A 1 282 ? -31.166 5.868   -2.817  0.02 32.75 ? 275 ASP A CG   1  
ATOM   4237   O OD1  . ASP A 1 282 ? -29.907 5.951   -2.817  0.02 32.64 ? 275 ASP A OD1  1  
ATOM   4238   O OD2  . ASP A 1 282 ? -31.784 4.840   -2.515  0.02 32.73 ? 275 ASP A OD2  1  
ATOM   4239   H H    . ASP A 1 282 ? -31.678 8.199   -1.088  0.02 33.94 ? 275 ASP A H    1  
ATOM   4240   H HA   . ASP A 1 282 ? -30.390 8.318   -3.368  0.02 33.11 ? 275 ASP A HA   1  
ATOM   4241   H HB2  . ASP A 1 282 ? -32.826 7.082   -2.689  0.02 33.21 ? 275 ASP A HB2  1  
ATOM   4242   H HB3  . ASP A 1 282 ? -32.240 6.987   -4.158  0.02 32.68 ? 275 ASP A HB3  1  
ATOM   4243   N N    . LYS A 1 283 ? -33.034 10.101  -3.147  0.02 33.87 ? 276 LYS A N    1  
ATOM   4244   C CA   . LYS A 1 283 ? -33.755 11.204  -3.784  0.02 34.06 ? 276 LYS A CA   1  
ATOM   4245   C C    . LYS A 1 283 ? -32.810 12.339  -4.143  0.02 34.17 ? 276 LYS A C    1  
ATOM   4246   O O    . LYS A 1 283 ? -32.850 12.869  -5.260  0.02 33.98 ? 276 LYS A O    1  
ATOM   4247   C CB   . LYS A 1 283 ? -34.877 11.711  -2.882  0.02 34.65 ? 276 LYS A CB   1  
ATOM   4248   C CG   . LYS A 1 283 ? -35.609 12.963  -3.429  0.02 34.94 ? 276 LYS A CG   1  
ATOM   4249   C CD   . LYS A 1 283 ? -36.820 13.325  -2.553  0.02 35.53 ? 276 LYS A CD   1  
ATOM   4250   C CE   . LYS A 1 283 ? -37.652 14.524  -3.083  0.02 35.87 ? 276 LYS A CE   1  
ATOM   4251   N NZ   . LYS A 1 283 ? -36.892 15.780  -3.398  0.02 36.00 ? 276 LYS A NZ   1  
ATOM   4252   H H    . LYS A 1 283 ? -33.351 9.851   -2.389  0.02 34.09 ? 276 LYS A H    1  
ATOM   4253   H HA   . LYS A 1 283 ? -34.163 10.878  -4.598  0.02 33.78 ? 276 LYS A HA   1  
ATOM   4254   H HB2  . LYS A 1 283 ? -35.536 11.006  -2.789  0.02 34.59 ? 276 LYS A HB2  1  
ATOM   4255   H HB3  . LYS A 1 283 ? -34.503 11.932  -2.015  0.02 34.95 ? 276 LYS A HB3  1  
ATOM   4256   H HG2  . LYS A 1 283 ? -34.997 13.715  -3.433  0.02 35.08 ? 276 LYS A HG2  1  
ATOM   4257   H HG3  . LYS A 1 283 ? -35.925 12.782  -4.328  0.02 34.64 ? 276 LYS A HG3  1  
ATOM   4258   H HD2  . LYS A 1 283 ? -37.407 12.556  -2.502  0.02 35.41 ? 276 LYS A HD2  1  
ATOM   4259   H HD3  . LYS A 1 283 ? -36.504 13.551  -1.664  0.02 35.84 ? 276 LYS A HD3  1  
ATOM   4260   H HE2  . LYS A 1 283 ? -38.102 14.254  -3.898  0.02 35.62 ? 276 LYS A HE2  1  
ATOM   4261   H HE3  . LYS A 1 283 ? -38.315 14.750  -2.413  0.02 36.30 ? 276 LYS A HE3  1  
ATOM   4262   H HZ1  . LYS A 1 283 ? -37.456 16.459  -3.511  0.02 36.35 ? 276 LYS A HZ1  1  
ATOM   4263   H HZ2  . LYS A 1 283 ? -36.337 15.976  -2.728  0.02 36.10 ? 276 LYS A HZ2  1  
ATOM   4264   H HZ3  . LYS A 1 283 ? -36.418 15.667  -4.144  0.02 35.65 ? 276 LYS A HZ3  1  
ATOM   4265   N N    . ASP A 1 284 ? -31.924 12.711  -3.224  0.02 34.50 ? 277 ASP A N    1  
ATOM   4266   C CA   . ASP A 1 284 ? -31.032 13.821  -3.518  0.02 34.69 ? 277 ASP A CA   1  
ATOM   4267   C C    . ASP A 1 284 ? -29.881 13.393  -4.424  0.02 34.19 ? 277 ASP A C    1  
ATOM   4268   O O    . ASP A 1 284 ? -29.402 14.182  -5.246  0.02 34.18 ? 277 ASP A O    1  
ATOM   4269   C CB   . ASP A 1 284 ? -30.523 14.443  -2.219  0.02 35.26 ? 277 ASP A CB   1  
ATOM   4270   C CG   . ASP A 1 284 ? -31.644 15.118  -1.406  0.02 35.84 ? 277 ASP A CG   1  
ATOM   4271   O OD1  . ASP A 1 284 ? -32.560 15.733  -2.005  0.02 35.94 ? 277 ASP A OD1  1  
ATOM   4272   O OD2  . ASP A 1 284 ? -31.604 15.033  -0.160  0.02 36.24 ? 277 ASP A OD2  1  
ATOM   4273   H H    . ASP A 1 284 ? -31.819 12.349  -2.451  0.02 34.64 ? 277 ASP A H    1  
ATOM   4274   H HA   . ASP A 1 284 ? -31.570 14.445  -3.985  0.02 34.81 ? 277 ASP A HA   1  
ATOM   4275   H HB2  . ASP A 1 284 ? -30.137 13.745  -1.668  0.02 35.17 ? 277 ASP A HB2  1  
ATOM   4276   H HB3  . ASP A 1 284 ? -29.847 15.107  -2.423  0.02 35.39 ? 277 ASP A HB3  1  
ATOM   4277   N N    . VAL A 1 285 ? -29.410 12.154  -4.273  0.02 33.84 ? 278 VAL A N    1  
ATOM   4278   C CA   . VAL A 1 285 ? -28.396 11.619  -5.181  0.02 33.37 ? 278 VAL A CA   1  
ATOM   4279   C C    . VAL A 1 285 ? -28.904 11.665  -6.621  0.02 33.00 ? 278 VAL A C    1  
ATOM   4280   O O    . VAL A 1 285 ? -28.179 12.055  -7.543  0.02 32.85 ? 278 VAL A O    1  
ATOM   4281   C CB   . VAL A 1 285 ? -28.014 10.182  -4.772  0.02 33.06 ? 278 VAL A CB   1  
ATOM   4282   C CG1  . VAL A 1 285 ? -27.394 9.441   -5.938  0.02 32.52 ? 278 VAL A CG1  1  
ATOM   4283   C CG2  . VAL A 1 285 ? -27.053 10.192  -3.561  0.02 33.42 ? 278 VAL A CG2  1  
ATOM   4284   H H    . VAL A 1 285 ? -29.657 11.613  -3.654  0.02 33.89 ? 278 VAL A H    1  
ATOM   4285   H HA   . VAL A 1 285 ? -27.599 12.167  -5.124  0.02 33.54 ? 278 VAL A HA   1  
ATOM   4286   H HB   . VAL A 1 285 ? -28.818 9.706   -4.517  0.02 33.01 ? 278 VAL A HB   1  
ATOM   4287   H HG11 . VAL A 1 285 ? -27.044 8.595   -5.618  0.02 32.37 ? 278 VAL A HG11 1  
ATOM   4288   H HG12 . VAL A 1 285 ? -28.067 9.272   -6.615  0.02 32.29 ? 278 VAL A HG12 1  
ATOM   4289   H HG13 . VAL A 1 285 ? -26.673 9.974   -6.307  0.02 32.58 ? 278 VAL A HG13 1  
ATOM   4290   H HG21 . VAL A 1 285 ? -26.975 9.293   -3.210  0.02 33.29 ? 278 VAL A HG21 1  
ATOM   4291   H HG22 . VAL A 1 285 ? -26.183 10.513  -3.842  0.02 33.41 ? 278 VAL A HG22 1  
ATOM   4292   H HG23 . VAL A 1 285 ? -27.417 10.775  -2.878  0.02 33.81 ? 278 VAL A HG23 1  
ATOM   4293   N N    . LEU A 1 286 ? -30.155 11.259  -6.831  0.02 32.88 ? 279 LEU A N    1  
ATOM   4294   C CA   . LEU A 1 286 ? -30.720 11.252  -8.182  0.02 32.55 ? 279 LEU A CA   1  
ATOM   4295   C C    . LEU A 1 286 ? -30.781 12.664  -8.757  0.02 32.84 ? 279 LEU A C    1  
ATOM   4296   O O    . LEU A 1 286 ? -30.389 12.901  -9.903  0.02 32.62 ? 279 LEU A O    1  
ATOM   4297   C CB   . LEU A 1 286 ? -32.117 10.638  -8.154  0.02 32.49 ? 279 LEU A CB   1  
ATOM   4298   C CG   . LEU A 1 286 ? -32.814 10.375  -9.498  0.02 32.14 ? 279 LEU A CG   1  
ATOM   4299   C CD1  . LEU A 1 286 ? -31.958 9.525   -10.382 0.02 31.63 ? 279 LEU A CD1  1  
ATOM   4300   C CD2  . LEU A 1 286 ? -34.137 9.693   -9.283  0.02 32.15 ? 279 LEU A CD2  1  
ATOM   4301   H H    . LEU A 1 286 ? -30.692 10.987  -6.222  0.02 33.00 ? 279 LEU A H    1  
ATOM   4302   H HA   . LEU A 1 286 ? -30.152 10.719  -8.754  0.02 32.22 ? 279 LEU A HA   1  
ATOM   4303   H HB2  . LEU A 1 286 ? -32.069 9.793   -7.681  0.02 32.37 ? 279 LEU A HB2  1  
ATOM   4304   H HB3  . LEU A 1 286 ? -32.688 11.243  -7.660  0.02 32.84 ? 279 LEU A HB3  1  
ATOM   4305   H HG   . LEU A 1 286 ? -32.979 11.221  -9.944  0.02 32.29 ? 279 LEU A HG   1  
ATOM   4306   H HD11 . LEU A 1 286 ? -32.425 9.373   -11.219 0.02 31.44 ? 279 LEU A HD11 1  
ATOM   4307   H HD12 . LEU A 1 286 ? -31.121 9.984   -10.552 0.02 31.65 ? 279 LEU A HD12 1  
ATOM   4308   H HD13 . LEU A 1 286 ? -31.791 8.680   -9.938  0.02 31.51 ? 279 LEU A HD13 1  
ATOM   4309   H HD21 . LEU A 1 286 ? -34.631 9.700   -10.117 0.02 32.02 ? 279 LEU A HD21 1  
ATOM   4310   H HD22 . LEU A 1 286 ? -33.977 8.779   -9.004  0.02 31.96 ? 279 LEU A HD22 1  
ATOM   4311   H HD23 . LEU A 1 286 ? -34.633 10.168  -8.600  0.02 32.51 ? 279 LEU A HD23 1  
ATOM   4312   N N    . GLU A 1 287 ? -31.260 13.620  -7.947  0.02 33.38 ? 280 GLU A N    1  
ATOM   4313   C CA   . GLU A 1 287 ? -31.454 14.993  -8.418  0.02 33.73 ? 280 GLU A CA   1  
ATOM   4314   C C    . GLU A 1 287 ? -30.145 15.581  -8.924  0.02 33.74 ? 280 GLU A C    1  
ATOM   4315   O O    . GLU A 1 287 ? -30.147 16.422  -9.824  0.02 33.82 ? 280 GLU A O    1  
ATOM   4316   C CB   . GLU A 1 287 ? -32.079 15.863  -7.299  0.02 34.37 ? 280 GLU A CB   1  
ATOM   4317   C CG   . GLU A 1 287 ? -31.083 16.707  -6.367  0.02 34.89 ? 280 GLU A CG   1  
ATOM   4318   C CD   . GLU A 1 287 ? -31.309 16.581  -4.838  0.02 35.29 ? 280 GLU A CD   1  
ATOM   4319   O OE1  . GLU A 1 287 ? -30.299 16.673  -4.067  0.02 35.45 ? 280 GLU A OE1  1  
ATOM   4320   O OE2  . GLU A 1 287 ? -32.470 16.362  -4.396  0.02 35.49 ? 280 GLU A OE2  1  
ATOM   4321   H H    . GLU A 1 287 ? -31.476 13.488  -7.124  0.02 33.56 ? 280 GLU A H    1  
ATOM   4322   H HA   . GLU A 1 287 ? -32.072 14.982  -9.164  0.02 33.59 ? 280 GLU A HA   1  
ATOM   4323   H HB2  . GLU A 1 287 ? -32.676 16.499  -7.720  0.02 34.52 ? 280 GLU A HB2  1  
ATOM   4324   H HB3  . GLU A 1 287 ? -32.601 15.284  -6.724  0.02 34.37 ? 280 GLU A HB3  1  
ATOM   4325   H HG2  . GLU A 1 287 ? -30.181 16.403  -6.523  0.02 34.71 ? 280 GLU A HG2  1  
ATOM   4326   H HG3  . GLU A 1 287 ? -31.162 17.648  -6.597  0.02 35.18 ? 280 GLU A HG3  1  
ATOM   4327   N N    . PHE A 1 288 ? -29.015 15.136  -8.373  0.02 33.70 ? 281 PHE A N    1  
ATOM   4328   C CA   . PHE A 1 288 ? -27.713 15.562  -8.872  0.02 33.71 ? 281 PHE A CA   1  
ATOM   4329   C C    . PHE A 1 288 ? -27.327 14.817  -10.148 0.02 33.15 ? 281 PHE A C    1  
ATOM   4330   O O    . PHE A 1 288 ? -26.824 15.418  -11.106 0.02 33.16 ? 281 PHE A O    1  
ATOM   4331   C CB   . PHE A 1 288 ? -26.650 15.332  -7.809  0.02 33.90 ? 281 PHE A CB   1  
ATOM   4332   C CG   . PHE A 1 288 ? -25.269 15.597  -8.274  0.02 33.93 ? 281 PHE A CG   1  
ATOM   4333   C CD1  . PHE A 1 288 ? -24.742 16.874  -8.201  0.02 34.46 ? 281 PHE A CD1  1  
ATOM   4334   C CD2  . PHE A 1 288 ? -24.489 14.581  -8.791  0.02 33.47 ? 281 PHE A CD2  1  
ATOM   4335   C CE1  . PHE A 1 288 ? -23.475 17.133  -8.628  0.02 34.54 ? 281 PHE A CE1  1  
ATOM   4336   C CE2  . PHE A 1 288 ? -23.220 14.838  -9.230  0.02 33.54 ? 281 PHE A CE2  1  
ATOM   4337   C CZ   . PHE A 1 288 ? -22.705 16.128  -9.138  0.02 34.09 ? 281 PHE A CZ   1  
ATOM   4338   H H    . PHE A 1 288 ? -28.977 14.590  -7.714  0.02 33.68 ? 281 PHE A H    1  
ATOM   4339   H HA   . PHE A 1 288 ? -27.740 16.510  -9.073  0.02 34.01 ? 281 PHE A HA   1  
ATOM   4340   H HB2  . PHE A 1 288 ? -26.825 15.915  -7.061  0.02 34.30 ? 281 PHE A HB2  1  
ATOM   4341   H HB3  . PHE A 1 288 ? -26.689 14.407  -7.526  0.02 33.65 ? 281 PHE A HB3  1  
ATOM   4342   H HD1  . PHE A 1 288 ? -25.255 17.567  -7.854  0.02 34.79 ? 281 PHE A HD1  1  
ATOM   4343   H HD2  . PHE A 1 288 ? -24.832 13.720  -8.852  0.02 33.14 ? 281 PHE A HD2  1  
ATOM   4344   H HE1  . PHE A 1 288 ? -23.134 17.996  -8.570  0.02 34.93 ? 281 PHE A HE1  1  
ATOM   4345   H HE2  . PHE A 1 288 ? -22.698 14.152  -9.575  0.02 33.26 ? 281 PHE A HE2  1  
ATOM   4346   H HZ   . PHE A 1 288 ? -21.840 16.310  -9.432  0.02 34.17 ? 281 PHE A HZ   1  
ATOM   4347   N N    . LEU A 1 289 ? -27.498 13.495  -10.148 0.02 32.69 ? 282 LEU A N    1  
ATOM   4348   C CA   . LEU A 1 289 ? -27.072 12.700  -11.293 0.02 32.19 ? 282 LEU A CA   1  
ATOM   4349   C C    . LEU A 1 289 ? -27.929 12.984  -12.518 0.02 32.04 ? 282 LEU A C    1  
ATOM   4350   O O    . LEU A 1 289 ? -27.480 12.750  -13.644 0.02 31.75 ? 282 LEU A O    1  
ATOM   4351   C CB   . LEU A 1 289 ? -27.119 11.209  -10.958 0.02 31.79 ? 282 LEU A CB   1  
ATOM   4352   C CG   . LEU A 1 289 ? -26.099 10.704  -9.939  0.02 31.87 ? 282 LEU A CG   1  
ATOM   4353   C CD1  . LEU A 1 289 ? -26.411 9.268   -9.600  0.02 31.53 ? 282 LEU A CD1  1  
ATOM   4354   C CD2  . LEU A 1 289 ? -24.676 10.862  -10.440 0.02 31.85 ? 282 LEU A CD2  1  
ATOM   4355   H H    . LEU A 1 289 ? -27.860 13.044  -9.513  0.02 32.69 ? 282 LEU A H    1  
ATOM   4356   H HA   . LEU A 1 289 ? -26.154 12.928  -11.507 0.02 32.23 ? 282 LEU A HA   1  
ATOM   4357   H HB2  . LEU A 1 289 ? -28.000 11.007  -10.609 0.02 31.81 ? 282 LEU A HB2  1  
ATOM   4358   H HB3  . LEU A 1 289 ? -26.973 10.711  -11.776 0.02 31.47 ? 282 LEU A HB3  1  
ATOM   4359   H HG   . LEU A 1 289 ? -26.181 11.225  -9.123  0.02 32.21 ? 282 LEU A HG   1  
ATOM   4360   H HD11 . LEU A 1 289 ? -25.891 9.002   -8.825  0.02 31.65 ? 282 LEU A HD11 1  
ATOM   4361   H HD12 . LEU A 1 289 ? -27.358 9.188   -9.409  0.02 31.56 ? 282 LEU A HD12 1  
ATOM   4362   H HD13 . LEU A 1 289 ? -26.186 8.711   -10.360 0.02 31.21 ? 282 LEU A HD13 1  
ATOM   4363   H HD21 . LEU A 1 289 ? -24.087 10.304  -9.912  0.02 31.84 ? 282 LEU A HD21 1  
ATOM   4364   H HD22 . LEU A 1 289 ? -24.642 10.594  -11.368 0.02 31.58 ? 282 LEU A HD22 1  
ATOM   4365   H HD23 . LEU A 1 289 ? -24.407 11.789  -10.358 0.02 32.17 ? 282 LEU A HD23 1  
ATOM   4366   N N    . MET A 1 290 ? -29.160 13.473  -12.309 0.02 32.27 ? 283 MET A N    1  
ATOM   4367   C CA   . MET A 1 290 ? -30.044 13.880  -13.394 0.02 32.23 ? 283 MET A CA   1  
ATOM   4368   C C    . MET A 1 290 ? -29.623 15.210  -14.008 0.02 32.56 ? 283 MET A C    1  
ATOM   4369   O O    . MET A 1 290 ? -29.986 15.494  -15.152 0.02 32.47 ? 283 MET A O    1  
ATOM   4370   C CB   . MET A 1 290 ? -31.482 13.993  -12.879 0.02 32.45 ? 283 MET A CB   1  
ATOM   4371   C CG   . MET A 1 290 ? -32.123 12.657  -12.512 0.02 32.14 ? 283 MET A CG   1  
ATOM   4372   S SD   . MET A 1 290 ? -32.505 11.706  -13.959 0.02 31.58 ? 283 MET A SD   1  
ATOM   4373   C CE   . MET A 1 290 ? -33.986 12.490  -14.590 0.02 31.82 ? 283 MET A CE   1  
ATOM   4374   H H    . MET A 1 290 ? -29.509 13.579  -11.532 0.02 32.47 ? 283 MET A H    1  
ATOM   4375   H HA   . MET A 1 290 ? -30.034 13.201  -14.086 0.02 31.88 ? 283 MET A HA   1  
ATOM   4376   H HB2  . MET A 1 290 ? -31.485 14.546  -12.084 0.02 32.80 ? 283 MET A HB2  1  
ATOM   4377   H HB3  . MET A 1 290 ? -32.030 14.404  -13.565 0.02 32.49 ? 283 MET A HB3  1  
ATOM   4378   H HG2  . MET A 1 290 ? -31.511 12.135  -11.972 0.02 32.07 ? 283 MET A HG2  1  
ATOM   4379   H HG3  . MET A 1 290 ? -32.952 12.812  -12.036 0.02 32.36 ? 283 MET A HG3  1  
ATOM   4380   H HE1  . MET A 1 290 ? -34.357 13.074  -13.911 0.02 32.14 ? 283 MET A HE1  1  
ATOM   4381   H HE2  . MET A 1 290 ? -33.753 13.006  -15.376 0.02 31.86 ? 283 MET A HE2  1  
ATOM   4382   H HE3  . MET A 1 290 ? -34.629 11.805  -14.819 0.02 31.60 ? 283 MET A HE3  1  
ATOM   4383   N N    . LYS A 1 291 ? -28.874 16.031  -13.272 0.02 32.98 ? 284 LYS A N    1  
ATOM   4384   C CA   . LYS A 1 291 ? -28.447 17.347  -13.745 0.02 33.40 ? 284 LYS A CA   1  
ATOM   4385   C C    . LYS A 1 291 ? -27.059 17.330  -14.349 0.02 33.29 ? 284 LYS A C    1  
ATOM   4386   O O    . LYS A 1 291 ? -26.658 18.312  -14.977 0.02 33.57 ? 284 LYS A O    1  
ATOM   4387   C CB   . LYS A 1 291 ? -28.435 18.369  -12.594 0.02 34.02 ? 284 LYS A CB   1  
ATOM   4388   C CG   . LYS A 1 291 ? -29.553 19.401  -12.616 0.02 34.45 ? 284 LYS A CG   1  
ATOM   4389   C CD   . LYS A 1 291 ? -30.004 19.729  -11.176 0.02 34.87 ? 284 LYS A CD   1  
ATOM   4390   C CE   . LYS A 1 291 ? -31.531 19.850  -11.001 0.02 34.99 ? 284 LYS A CE   1  
ATOM   4391   N NZ   . LYS A 1 291 ? -32.367 20.111  -12.236 0.02 34.63 ? 284 LYS A NZ   1  
ATOM   4392   H H    . LYS A 1 291 ? -28.597 15.846  -12.480 0.02 33.06 ? 284 LYS A H    1  
ATOM   4393   H HA   . LYS A 1 291 ? -29.068 17.662  -14.418 0.02 33.42 ? 284 LYS A HA   1  
ATOM   4394   H HB2  . LYS A 1 291 ? -28.487 17.879  -11.762 0.02 33.98 ? 284 LYS A HB2  1  
ATOM   4395   H HB3  . LYS A 1 291 ? -27.597 18.857  -12.623 0.02 34.22 ? 284 LYS A HB3  1  
ATOM   4396   H HG2  . LYS A 1 291 ? -29.224 20.214  -13.031 0.02 34.73 ? 284 LYS A HG2  1  
ATOM   4397   H HG3  . LYS A 1 291 ? -30.306 19.048  -13.115 0.02 34.21 ? 284 LYS A HG3  1  
ATOM   4398   H HD2  . LYS A 1 291 ? -29.714 19.025  -10.578 0.02 34.70 ? 284 LYS A HD2  1  
ATOM   4399   H HD3  . LYS A 1 291 ? -29.596 20.560  -10.898 0.02 35.29 ? 284 LYS A HD3  1  
ATOM   4400   H HE2  . LYS A 1 291 ? -31.854 19.033  -10.589 0.02 34.90 ? 284 LYS A HE2  1  
ATOM   4401   H HE3  . LYS A 1 291 ? -31.697 20.598  -10.403 0.02 35.44 ? 284 LYS A HE3  1  
ATOM   4402   H HZ1  . LYS A 1 291 ? -33.204 20.300  -12.000 0.02 34.77 ? 284 LYS A HZ1  1  
ATOM   4403   H HZ2  . LYS A 1 291 ? -32.031 20.799  -12.689 0.02 34.70 ? 284 LYS A HZ2  1  
ATOM   4404   H HZ3  . LYS A 1 291 ? -32.370 19.391  -12.762 0.02 34.23 ? 284 LYS A HZ3  1  
ATOM   4405   N N    . ALA A 1 292 ? -26.300 16.260  -14.152 0.02 32.92 ? 285 ALA A N    1  
ATOM   4406   C CA   . ALA A 1 292 ? -24.911 16.286  -14.571 0.02 32.91 ? 285 ALA A CA   1  
ATOM   4407   C C    . ALA A 1 292 ? -24.790 16.033  -16.070 0.02 32.60 ? 285 ALA A C    1  
ATOM   4408   O O    . ALA A 1 292 ? -25.678 15.455  -16.699 0.02 32.25 ? 285 ALA A O    1  
ATOM   4409   C CB   . ALA A 1 292 ? -24.099 15.255  -13.803 0.02 32.68 ? 285 ALA A CB   1  
ATOM   4410   H H    . ALA A 1 292 ? -26.558 15.528  -13.790 0.02 32.71 ? 285 ALA A H    1  
ATOM   4411   H HA   . ALA A 1 292 ? -24.535 17.161  -14.385 0.02 33.30 ? 285 ALA A HA   1  
ATOM   4412   H HB1  . ALA A 1 292 ? -23.168 15.339  -14.058 0.02 32.73 ? 285 ALA A HB1  1  
ATOM   4413   H HB2  . ALA A 1 292 ? -24.197 15.425  -12.855 0.02 32.90 ? 285 ALA A HB2  1  
ATOM   4414   H HB3  . ALA A 1 292 ? -24.428 14.368  -14.011 0.02 32.31 ? 285 ALA A HB3  1  
ATOM   4415   N N    . LYS A 1 293 ? -23.669 16.478  -16.633 0.02 32.77 ? 286 LYS A N    1  
ATOM   4416   C CA   . LYS A 1 293 ? -23.388 16.219  -18.036 0.02 32.50 ? 286 LYS A CA   1  
ATOM   4417   C C    . LYS A 1 293 ? -23.128 14.723  -18.191 0.02 31.95 ? 286 LYS A C    1  
ATOM   4418   O O    . LYS A 1 293 ? -22.417 14.134  -17.363 0.02 31.91 ? 286 LYS A O    1  
ATOM   4419   C CB   . LYS A 1 293 ? -22.178 17.028  -18.542 0.02 32.88 ? 286 LYS A CB   1  
ATOM   4420   C CG   . LYS A 1 293 ? -22.519 18.424  -19.109 0.02 33.32 ? 286 LYS A CG   1  
ATOM   4421   C CD   . LYS A 1 293 ? -21.288 19.240  -19.699 0.02 33.76 ? 286 LYS A CD   1  
ATOM   4422   C CE   . LYS A 1 293 ? -20.522 18.553  -20.861 0.02 33.45 ? 286 LYS A CE   1  
ATOM   4423   N NZ   . LYS A 1 293 ? -19.491 19.464  -21.532 0.02 33.90 ? 286 LYS A NZ   1  
ATOM   4424   H H    . LYS A 1 293 ? -23.054 16.910  -16.223 0.02 33.05 ? 286 LYS A H    1  
ATOM   4425   H HA   . LYS A 1 293 ? -24.166 16.467  -18.557 0.02 32.48 ? 286 LYS A HA   1  
ATOM   4426   H HB2  . LYS A 1 293 ? -21.567 17.159  -17.800 0.02 33.10 ? 286 LYS A HB2  1  
ATOM   4427   H HB3  . LYS A 1 293 ? -21.734 16.526  -19.243 0.02 32.65 ? 286 LYS A HB3  1  
ATOM   4428   H HG2  . LYS A 1 293 ? -23.176 18.318  -19.816 0.02 33.12 ? 286 LYS A HG2  1  
ATOM   4429   H HG3  . LYS A 1 293 ? -22.902 18.949  -18.388 0.02 33.58 ? 286 LYS A HG3  1  
ATOM   4430   H HD2  . LYS A 1 293 ? -21.616 20.089  -20.033 0.02 34.03 ? 286 LYS A HD2  1  
ATOM   4431   H HD3  . LYS A 1 293 ? -20.651 19.400  -18.983 0.02 34.02 ? 286 LYS A HD3  1  
ATOM   4432   H HE2  . LYS A 1 293 ? -20.043 17.791  -20.501 0.02 33.25 ? 286 LYS A HE2  1  
ATOM   4433   H HE3  . LYS A 1 293 ? -21.153 18.259  -21.540 0.02 33.15 ? 286 LYS A HE3  1  
ATOM   4434   H HZ1  . LYS A 1 293 ? -19.070 19.026  -22.184 0.02 33.70 ? 286 LYS A HZ1  1  
ATOM   4435   H HZ2  . LYS A 1 293 ? -19.897 20.177  -21.878 0.02 34.12 ? 286 LYS A HZ2  1  
ATOM   4436   H HZ3  . LYS A 1 293 ? -18.891 19.739  -20.935 0.02 34.17 ? 286 LYS A HZ3  1  
ATOM   4437   N N    . PRO A 1 294 ? -23.682 14.073  -19.211 0.02 31.55 ? 287 PRO A N    1  
ATOM   4438   C CA   . PRO A 1 294 ? -23.502 12.603  -19.300 0.02 31.05 ? 287 PRO A CA   1  
ATOM   4439   C C    . PRO A 1 294 ? -22.051 12.175  -19.365 0.02 31.04 ? 287 PRO A C    1  
ATOM   4440   O O    . PRO A 1 294 ? -21.684 11.139  -18.811 0.02 30.79 ? 287 PRO A O    1  
ATOM   4441   C CB   . PRO A 1 294 ? -24.258 12.215  -20.579 0.02 30.76 ? 287 PRO A CB   1  
ATOM   4442   C CG   . PRO A 1 294 ? -24.661 13.467  -21.254 0.02 31.12 ? 287 PRO A CG   1  
ATOM   4443   C CD   . PRO A 1 294 ? -24.584 14.601  -20.260 0.02 31.59 ? 287 PRO A CD   1  
ATOM   4444   H HA   . PRO A 1 294 ? -23.928 12.168  -18.552 0.02 30.95 ? 287 PRO A HA   1  
ATOM   4445   H HB2  . PRO A 1 294 ? -23.664 11.700  -21.149 0.02 30.59 ? 287 PRO A HB2  1  
ATOM   4446   H HB3  . PRO A 1 294 ? -25.041 11.694  -20.342 0.02 30.57 ? 287 PRO A HB3  1  
ATOM   4447   H HG2  . PRO A 1 294 ? -24.102 13.605  -22.024 0.02 31.17 ? 287 PRO A HG2  1  
ATOM   4448   H HG3  . PRO A 1 294 ? -25.579 13.365  -21.548 0.02 31.01 ? 287 PRO A HG3  1  
ATOM   4449   H HD2  . PRO A 1 294 ? -24.224 15.403  -20.660 0.02 31.88 ? 287 PRO A HD2  1  
ATOM   4450   H HD3  . PRO A 1 294 ? -25.462 14.774  -19.890 0.02 31.62 ? 287 PRO A HD3  1  
ATOM   4451   N N    . GLN A 1 295 ? -21.199 12.949  -20.022 0.02 31.32 ? 288 GLN A N    1  
ATOM   4452   C CA   . GLN A 1 295 ? -19.824 12.512  -20.207 0.02 31.31 ? 288 GLN A CA   1  
ATOM   4453   C C    . GLN A 1 295 ? -19.039 12.555  -18.900 0.02 31.57 ? 288 GLN A C    1  
ATOM   4454   O O    . GLN A 1 295 ? -18.216 11.675  -18.651 0.02 31.42 ? 288 GLN A O    1  
ATOM   4455   C CB   . GLN A 1 295 ? -19.141 13.352  -21.288 0.02 31.59 ? 288 GLN A CB   1  
ATOM   4456   C CG   . GLN A 1 295 ? -20.091 13.693  -22.440 0.02 31.52 ? 288 GLN A CG   1  
ATOM   4457   C CD   . GLN A 1 295 ? -20.890 14.961  -22.130 0.02 31.93 ? 288 GLN A CD   1  
ATOM   4458   O OE1  . GLN A 1 295 ? -20.323 15.969  -21.812 0.02 32.39 ? 288 GLN A OE1  1  
ATOM   4459   N NE2  . GLN A 1 295 ? -22.185 14.874  -22.149 0.02 31.79 ? 288 GLN A NE2  1  
ATOM   4460   H H    . GLN A 1 295 ? -21.390 13.718  -20.322 0.02 31.54 ? 288 GLN A H    1  
ATOM   4461   H HA   . GLN A 1 295 ? -19.830 11.591  -20.511 0.02 30.98 ? 288 GLN A HA   1  
ATOM   4462   H HB2  . GLN A 1 295 ? -18.836 14.187  -20.898 0.02 31.97 ? 288 GLN A HB2  1  
ATOM   4463   H HB3  . GLN A 1 295 ? -18.386 12.861  -21.645 0.02 31.49 ? 288 GLN A HB3  1  
ATOM   4464   H HG2  . GLN A 1 295 ? -19.580 13.843  -23.251 0.02 31.58 ? 288 GLN A HG2  1  
ATOM   4465   H HG3  . GLN A 1 295 ? -20.716 12.962  -22.571 0.02 31.18 ? 288 GLN A HG3  1  
ATOM   4466   H HE21 . GLN A 1 295 ? -22.575 14.461  -22.790 0.02 31.59 ? 288 GLN A HE21 1  
ATOM   4467   H HE22 . GLN A 1 295 ? -22.633 15.236  -21.527 0.02 31.91 ? 288 GLN A HE22 1  
ATOM   4468   N N    . ASP A 1 296 ? -19.295 13.532  -18.035 0.02 31.99 ? 289 ASP A N    1  
ATOM   4469   C CA   . ASP A 1 296 ? -18.576 13.572  -16.757 0.02 32.27 ? 289 ASP A CA   1  
ATOM   4470   C C    . ASP A 1 296 ? -18.840 12.312  -15.934 0.02 31.90 ? 289 ASP A C    1  
ATOM   4471   O O    . ASP A 1 296 ? -17.921 11.744  -15.327 0.02 31.94 ? 289 ASP A O    1  
ATOM   4472   C CB   . ASP A 1 296 ? -18.966 14.821  -15.953 0.02 32.78 ? 289 ASP A CB   1  
ATOM   4473   C CG   . ASP A 1 296 ? -18.589 16.127  -16.651 0.02 33.19 ? 289 ASP A CG   1  
ATOM   4474   O OD1  . ASP A 1 296 ? -17.776 16.110  -17.607 0.02 33.17 ? 289 ASP A OD1  1  
ATOM   4475   O OD2  . ASP A 1 296 ? -19.121 17.184  -16.240 0.02 33.58 ? 289 ASP A OD2  1  
ATOM   4476   H H    . ASP A 1 296 ? -19.867 14.161  -18.157 0.02 32.13 ? 289 ASP A H    1  
ATOM   4477   H HA   . ASP A 1 296 ? -17.624 13.610  -16.942 0.02 32.41 ? 289 ASP A HA   1  
ATOM   4478   H HB2  . ASP A 1 296 ? -19.926 14.815  -15.808 0.02 32.66 ? 289 ASP A HB2  1  
ATOM   4479   H HB3  . ASP A 1 296 ? -18.506 14.795  -15.101 0.02 33.00 ? 289 ASP A HB3  1  
ATOM   4480   N N    . LEU A 1 297 ? -20.093 11.856  -15.901 0.02 31.60 ? 290 LEU A N    1  
ATOM   4481   C CA   . LEU A 1 297 ? -20.405 10.597  -15.237 0.02 31.26 ? 290 LEU A CA   1  
ATOM   4482   C C    . LEU A 1 297 ? -19.646 9.437   -15.875 0.02 30.90 ? 290 LEU A C    1  
ATOM   4483   O O    . LEU A 1 297 ? -19.021 8.625   -15.183 0.02 30.85 ? 290 LEU A O    1  
ATOM   4484   C CB   . LEU A 1 297 ? -21.912 10.345  -15.280 0.02 31.01 ? 290 LEU A CB   1  
ATOM   4485   C CG   . LEU A 1 297 ? -22.793 11.493  -14.773 0.02 31.36 ? 290 LEU A CG   1  
ATOM   4486   C CD1  . LEU A 1 297 ? -24.243 11.081  -14.643 0.02 31.15 ? 290 LEU A CD1  1  
ATOM   4487   C CD2  . LEU A 1 297 ? -22.248 12.034  -13.447 0.02 31.81 ? 290 LEU A CD2  1  
ATOM   4488   H H    . LEU A 1 297 ? -20.772 12.249  -16.249 0.02 31.61 ? 290 LEU A H    1  
ATOM   4489   H HA   . LEU A 1 297 ? -20.131 10.656  -14.308 0.02 31.45 ? 290 LEU A HA   1  
ATOM   4490   H HB2  . LEU A 1 297 ? -22.162 10.189  -16.200 0.02 30.81 ? 290 LEU A HB2  1  
ATOM   4491   H HB3  . LEU A 1 297 ? -22.113 9.558   -14.760 0.02 30.84 ? 290 LEU A HB3  1  
ATOM   4492   H HG   . LEU A 1 297 ? -22.754 12.219  -15.414 0.02 31.50 ? 290 LEU A HG   1  
ATOM   4493   H HD11 . LEU A 1 297 ? -24.806 11.853  -14.796 0.02 31.33 ? 290 LEU A HD11 1  
ATOM   4494   H HD12 . LEU A 1 297 ? -24.432 10.392  -15.299 0.02 30.83 ? 290 LEU A HD12 1  
ATOM   4495   H HD13 . LEU A 1 297 ? -24.394 10.731  -13.753 0.02 31.19 ? 290 LEU A HD13 1  
ATOM   4496   H HD21 . LEU A 1 297 ? -22.916 12.611  -13.049 0.02 32.01 ? 290 LEU A HD21 1  
ATOM   4497   H HD22 . LEU A 1 297 ? -22.057 11.286  -12.857 0.02 31.70 ? 290 LEU A HD22 1  
ATOM   4498   H HD23 . LEU A 1 297 ? -21.437 12.539  -13.618 0.02 32.03 ? 290 LEU A HD23 1  
ATOM   4499   N N    . ILE A 1 298 ? -19.671 9.352   -17.208 0.02 30.70 ? 291 ILE A N    1  
ATOM   4500   C CA   . ILE A 1 298 ? -19.128 8.170   -17.866 0.02 30.35 ? 291 ILE A CA   1  
ATOM   4501   C C    . ILE A 1 298 ? -17.615 8.089   -17.689 0.02 30.58 ? 291 ILE A C    1  
ATOM   4502   O O    . ILE A 1 298 ? -17.070 7.003   -17.446 0.02 30.41 ? 291 ILE A O    1  
ATOM   4503   C CB   . ILE A 1 298 ? -19.574 8.169   -19.340 0.02 30.13 ? 291 ILE A CB   1  
ATOM   4504   C CG1  . ILE A 1 298 ? -21.103 7.939   -19.417 0.02 29.87 ? 291 ILE A CG1  1  
ATOM   4505   C CG2  . ILE A 1 298 ? -18.791 7.175   -20.130 0.02 29.89 ? 291 ILE A CG2  1  
ATOM   4506   C CD1  . ILE A 1 298 ? -21.616 6.647   -18.794 0.02 29.54 ? 291 ILE A CD1  1  
ATOM   4507   H H    . ILE A 1 298 ? -19.991 9.946   -17.738 0.02 30.77 ? 291 ILE A H    1  
ATOM   4508   H HA   . ILE A 1 298 ? -19.491 7.381   -17.439 0.02 30.15 ? 291 ILE A HA   1  
ATOM   4509   H HB   . ILE A 1 298 ? -19.391 9.047   -19.711 0.02 30.36 ? 291 ILE A HB   1  
ATOM   4510   H HG12 . ILE A 1 298 ? -21.557 8.670   -18.976 0.02 30.07 ? 291 ILE A HG12 1  
ATOM   4511   H HG13 . ILE A 1 298 ? -21.357 7.922   -20.351 0.02 29.76 ? 291 ILE A HG13 1  
ATOM   4512   H HG21 . ILE A 1 298 ? -19.220 7.061   -20.993 0.02 29.73 ? 291 ILE A HG21 1  
ATOM   4513   H HG22 . ILE A 1 298 ? -17.888 7.510   -20.250 0.02 30.11 ? 291 ILE A HG22 1  
ATOM   4514   H HG23 . ILE A 1 298 ? -18.779 6.330   -19.655 0.02 29.72 ? 291 ILE A HG23 1  
ATOM   4515   H HD11 . ILE A 1 298 ? -21.456 6.649   -17.836 0.02 29.66 ? 291 ILE A HD11 1  
ATOM   4516   H HD12 . ILE A 1 298 ? -22.570 6.577   -18.958 0.02 29.42 ? 291 ILE A HD12 1  
ATOM   4517   H HD13 . ILE A 1 298 ? -21.155 5.898   -19.201 0.02 29.36 ? 291 ILE A HD13 1  
ATOM   4518   N N    . LYS A 1 299 ? -16.920 9.225   -17.743 0.02 31.02 ? 292 LYS A N    1  
ATOM   4519   C CA   . LYS A 1 299 ? -15.464 9.240   -17.558 0.02 31.33 ? 292 LYS A CA   1  
ATOM   4520   C C    . LYS A 1 299 ? -15.059 8.903   -16.129 0.02 31.48 ? 292 LYS A C    1  
ATOM   4521   O O    . LYS A 1 299 ? -13.965 8.376   -15.914 0.02 31.61 ? 292 LYS A O    1  
ATOM   4522   C CB   . LYS A 1 299 ? -14.873 10.606  -17.921 0.02 31.84 ? 292 LYS A CB   1  
ATOM   4523   C CG   . LYS A 1 299 ? -13.305 10.692  -17.845 0.02 32.24 ? 292 LYS A CG   1  
ATOM   4524   C CD   . LYS A 1 299 ? -12.583 9.984   -19.032 0.02 32.07 ? 292 LYS A CD   1  
ATOM   4525   C CE   . LYS A 1 299 ? -11.785 10.978  -19.952 0.02 32.51 ? 292 LYS A CE   1  
ATOM   4526   N NZ   . LYS A 1 299 ? -12.496 12.261  -20.299 0.02 32.72 ? 292 LYS A NZ   1  
ATOM   4527   H H    . LYS A 1 299 ? -17.266 9.996   -17.889 0.02 31.18 ? 292 LYS A H    1  
ATOM   4528   H HA   . LYS A 1 299 ? -15.071 8.575   -18.144 0.02 31.15 ? 292 LYS A HA   1  
ATOM   4529   H HB2  . LYS A 1 299 ? -15.140 10.835  -18.826 0.02 31.76 ? 292 LYS A HB2  1  
ATOM   4530   H HB3  . LYS A 1 299 ? -15.229 11.268  -17.308 0.02 32.05 ? 292 LYS A HB3  1  
ATOM   4531   H HG2  . LYS A 1 299 ? -13.048 11.628  -17.853 0.02 32.61 ? 292 LYS A HG2  1  
ATOM   4532   H HG3  . LYS A 1 299 ? -12.997 10.282  -17.023 0.02 32.28 ? 292 LYS A HG3  1  
ATOM   4533   H HD2  . LYS A 1 299 ? -11.951 9.341   -18.670 0.02 32.08 ? 292 LYS A HD2  1  
ATOM   4534   H HD3  . LYS A 1 299 ? -13.238 9.527   -19.582 0.02 31.71 ? 292 LYS A HD3  1  
ATOM   4535   H HE2  . LYS A 1 299 ? -10.949 11.212  -19.517 0.02 32.86 ? 292 LYS A HE2  1  
ATOM   4536   H HE3  . LYS A 1 299 ? -11.594 10.525  -20.786 0.02 32.34 ? 292 LYS A HE3  1  
ATOM   4537   H HZ1  . LYS A 1 299 ? -12.702 12.707  -19.558 0.02 32.99 ? 292 LYS A HZ1  1  
ATOM   4538   H HZ2  . LYS A 1 299 ? -11.969 12.770  -20.802 0.02 32.90 ? 292 LYS A HZ2  1  
ATOM   4539   H HZ3  . LYS A 1 299 ? -13.243 12.088  -20.749 0.02 32.43 ? 292 LYS A HZ3  1  
ATOM   4540   N N    . LEU A 1 300 ? -15.905 9.223   -15.148 0.02 31.53 ? 293 LEU A N    1  
ATOM   4541   C CA   . LEU A 1 300 ? -15.635 8.908   -13.744 0.02 31.71 ? 293 LEU A CA   1  
ATOM   4542   C C    . LEU A 1 300 ? -16.085 7.502   -13.339 0.02 31.30 ? 293 LEU A C    1  
ATOM   4543   O O    . LEU A 1 300 ? -15.733 7.039   -12.241 0.02 31.44 ? 293 LEU A O    1  
ATOM   4544   C CB   . LEU A 1 300 ? -16.315 9.959   -12.851 0.02 32.05 ? 293 LEU A CB   1  
ATOM   4545   C CG   . LEU A 1 300 ? -15.806 11.408  -12.990 0.02 32.57 ? 293 LEU A CG   1  
ATOM   4546   C CD1  . LEU A 1 300 ? -16.742 12.389  -12.303 0.02 32.84 ? 293 LEU A CD1  1  
ATOM   4547   C CD2  . LEU A 1 300 ? -14.392 11.613  -12.439 0.02 33.04 ? 293 LEU A CD2  1  
ATOM   4548   H H    . LEU A 1 300 ? -16.654 9.624   -15.274 0.02 31.49 ? 293 LEU A H    1  
ATOM   4549   H HA   . LEU A 1 300 ? -14.678 8.963   -13.587 0.02 31.95 ? 293 LEU A HA   1  
ATOM   4550   H HB2  . LEU A 1 300 ? -17.262 9.966   -13.062 0.02 31.85 ? 293 LEU A HB2  1  
ATOM   4551   H HB3  . LEU A 1 300 ? -16.194 9.693   -11.925 0.02 32.17 ? 293 LEU A HB3  1  
ATOM   4552   H HG   . LEU A 1 300 ? -15.788 11.634  -13.933 0.02 32.49 ? 293 LEU A HG   1  
ATOM   4553   H HD11 . LEU A 1 300 ? -16.428 13.290  -12.474 0.02 33.18 ? 293 LEU A HD11 1  
ATOM   4554   H HD12 . LEU A 1 300 ? -17.638 12.279  -12.659 0.02 32.58 ? 293 LEU A HD12 1  
ATOM   4555   H HD13 . LEU A 1 300 ? -16.743 12.214  -11.351 0.02 32.96 ? 293 LEU A HD13 1  
ATOM   4556   H HD21 . LEU A 1 300 ? -14.004 12.398  -12.855 0.02 33.32 ? 293 LEU A HD21 1  
ATOM   4557   H HD22 . LEU A 1 300 ? -14.440 11.740  -11.480 0.02 33.25 ? 293 LEU A HD22 1  
ATOM   4558   H HD23 . LEU A 1 300 ? -13.852 10.834  -12.643 0.02 32.87 ? 293 LEU A HD23 1  
ATOM   4559   N N    . GLU A 1 301 ? -16.855 6.811   -14.188 0.02 30.84 ? 294 GLU A N    1  
ATOM   4560   C CA   . GLU A 1 301 ? -17.240 5.433   -13.899 0.02 30.48 ? 294 GLU A CA   1  
ATOM   4561   C C    . GLU A 1 301 ? -16.052 4.607   -13.451 0.02 30.57 ? 294 GLU A C    1  
ATOM   4562   O O    . GLU A 1 301 ? -16.138 3.881   -12.457 0.02 30.57 ? 294 GLU A O    1  
ATOM   4563   C CB   . GLU A 1 301 ? -17.876 4.769   -15.114 0.02 30.03 ? 294 GLU A CB   1  
ATOM   4564   C CG   . GLU A 1 301 ? -19.302 4.451   -14.840 0.02 29.82 ? 294 GLU A CG   1  
ATOM   4565   C CD   . GLU A 1 301 ? -19.865 3.324   -15.631 0.02 29.39 ? 294 GLU A CD   1  
ATOM   4566   O OE1  . GLU A 1 301 ? -21.099 3.254   -15.664 0.02 29.26 ? 294 GLU A OE1  1  
ATOM   4567   O OE2  . GLU A 1 301 ? -19.123 2.490   -16.209 0.02 29.23 ? 294 GLU A OE2  1  
ATOM   4568   H H    . GLU A 1 301 ? -17.162 7.120   -14.929 0.02 30.75 ? 294 GLU A H    1  
ATOM   4569   H HA   . GLU A 1 301 ? -17.889 5.443   -13.180 0.02 30.49 ? 294 GLU A HA   1  
ATOM   4570   H HB2  . GLU A 1 301 ? -17.829 5.364   -15.876 0.02 30.06 ? 294 GLU A HB2  1  
ATOM   4571   H HB3  . GLU A 1 301 ? -17.412 3.941   -15.312 0.02 29.88 ? 294 GLU A HB3  1  
ATOM   4572   H HG2  . GLU A 1 301 ? -19.398 4.204   -13.909 0.02 29.91 ? 294 GLU A HG2  1  
ATOM   4573   H HG3  . GLU A 1 301 ? -19.836 5.239   -15.025 0.02 29.92 ? 294 GLU A HG3  1  
ATOM   4574   N N    . GLU A 1 302 ? -15.003 4.592   -14.267 0.02 30.63 ? 295 GLU A N    1  
ATOM   4575   C CA   . GLU A 1 302 ? -13.623 4.367   -13.873 0.02 30.91 ? 295 GLU A CA   1  
ATOM   4576   C C    . GLU A 1 302 ? -13.444 4.108   -12.375 0.02 31.16 ? 295 GLU A C    1  
ATOM   4577   O O    . GLU A 1 302 ? -12.930 3.047   -11.995 0.02 31.09 ? 295 GLU A O    1  
ATOM   4578   C CB   . GLU A 1 302 ? -12.817 5.632   -14.277 0.02 31.32 ? 295 GLU A CB   1  
ATOM   4579   C CG   . GLU A 1 302 ? -11.350 5.442   -14.555 0.02 31.50 ? 295 GLU A CG   1  
ATOM   4580   C CD   . GLU A 1 302 ? -11.124 5.037   -15.993 0.02 31.25 ? 295 GLU A CD   1  
ATOM   4581   O OE1  . GLU A 1 302 ? -10.028 4.562   -16.341 0.02 31.26 ? 295 GLU A OE1  1  
ATOM   4582   O OE2  . GLU A 1 302 ? -12.087 5.174   -16.768 0.02 31.06 ? 295 GLU A OE2  1  
ATOM   4583   H H    . GLU A 1 302 ? -15.081 4.702   -15.113 0.02 30.52 ? 295 GLU A H    1  
ATOM   4584   H HA   . GLU A 1 302 ? -13.265 3.612   -14.366 0.02 30.73 ? 295 GLU A HA   1  
ATOM   4585   H HB2  . GLU A 1 302 ? -13.228 6.035   -15.054 0.02 31.21 ? 295 GLU A HB2  1  
ATOM   4586   H HB3  . GLU A 1 302 ? -12.878 6.258   -13.538 0.02 31.62 ? 295 GLU A HB3  1  
ATOM   4587   H HG2  . GLU A 1 302 ? -10.880 6.273   -14.396 0.02 31.88 ? 295 GLU A HG2  1  
ATOM   4588   H HG3  . GLU A 1 302 ? -11.000 4.745   -13.978 0.02 31.46 ? 295 GLU A HG3  1  
ATOM   4589   N N    . LYS A 1 303 ? -13.860 5.043   -11.526 0.02 31.47 ? 296 LYS A N    1  
ATOM   4590   C CA   . LYS A 1 303 ? -13.407 5.087   -10.141 0.02 31.86 ? 296 LYS A CA   1  
ATOM   4591   C C    . LYS A 1 303 ? -14.439 4.641   -9.115  0.02 31.77 ? 296 LYS A C    1  
ATOM   4592   O O    . LYS A 1 303 ? -14.142 4.690   -7.919  0.02 32.13 ? 296 LYS A O    1  
ATOM   4593   C CB   . LYS A 1 303 ? -12.961 6.498   -9.780  0.02 32.40 ? 296 LYS A CB   1  
ATOM   4594   C CG   . LYS A 1 303 ? -11.512 6.766   -10.050 0.02 32.74 ? 296 LYS A CG   1  
ATOM   4595   C CD   . LYS A 1 303 ? -11.293 7.243   -11.441 0.02 32.67 ? 296 LYS A CD   1  
ATOM   4596   C CE   . LYS A 1 303 ? -10.125 8.230   -11.491 0.02 33.27 ? 296 LYS A CE   1  
ATOM   4597   N NZ   . LYS A 1 303 ? -8.920  7.784   -10.701 0.02 33.65 ? 296 LYS A NZ   1  
ATOM   4598   H H    . LYS A 1 303 ? -14.409 5.671   -11.732 0.02 31.49 ? 296 LYS A H    1  
ATOM   4599   H HA   . LYS A 1 303 ? -12.635 4.508   -10.055 0.02 31.91 ? 296 LYS A HA   1  
ATOM   4600   H HB2  . LYS A 1 303 ? -13.488 7.134   -10.289 0.02 32.35 ? 296 LYS A HB2  1  
ATOM   4601   H HB3  . LYS A 1 303 ? -13.112 6.639   -8.830  0.02 32.62 ? 296 LYS A HB3  1  
ATOM   4602   H HG2  . LYS A 1 303 ? -11.199 7.450   -9.436  0.02 33.14 ? 296 LYS A HG2  1  
ATOM   4603   H HG3  . LYS A 1 303 ? -11.005 5.947   -9.930  0.02 32.65 ? 296 LYS A HG3  1  
ATOM   4604   H HD2  . LYS A 1 303 ? -11.087 6.486   -12.010 0.02 32.45 ? 296 LYS A HD2  1  
ATOM   4605   H HD3  . LYS A 1 303 ? -12.089 7.698   -11.753 0.02 32.49 ? 296 LYS A HD3  1  
ATOM   4606   H HE2  . LYS A 1 303 ? -9.850  8.344   -12.414 0.02 33.24 ? 296 LYS A HE2  1  
ATOM   4607   H HE3  . LYS A 1 303 ? -10.423 9.080   -11.129 0.02 33.49 ? 296 LYS A HE3  1  
ATOM   4608   H HZ1  . LYS A 1 303 ? -8.364  8.471   -10.585 0.02 34.06 ? 296 LYS A HZ1  1  
ATOM   4609   H HZ2  . LYS A 1 303 ? -9.163  7.479   -9.904  0.02 33.62 ? 296 LYS A HZ2  1  
ATOM   4610   H HZ3  . LYS A 1 303 ? -8.491  7.140   -11.139 0.02 33.55 ? 296 LYS A HZ3  1  
ATOM   4611   N N    . VAL A 1 304 ? -15.633 4.231   -9.527  0.02 31.35 ? 297 VAL A N    1  
ATOM   4612   C CA   . VAL A 1 304 ? -16.683 3.944   -8.560  0.02 31.32 ? 297 VAL A CA   1  
ATOM   4613   C C    . VAL A 1 304 ? -16.298 2.756   -7.666  0.02 31.34 ? 297 VAL A C    1  
ATOM   4614   O O    . VAL A 1 304 ? -16.293 2.873   -6.434  0.02 31.67 ? 297 VAL A O    1  
ATOM   4615   C CB   . VAL A 1 304 ? -18.018 3.727   -9.288  0.02 30.90 ? 297 VAL A CB   1  
ATOM   4616   C CG1  . VAL A 1 304 ? -19.105 3.297   -8.348  0.02 30.89 ? 297 VAL A CG1  1  
ATOM   4617   C CG2  . VAL A 1 304 ? -18.430 4.992   -10.046 0.02 30.96 ? 297 VAL A CG2  1  
ATOM   4618   H H    . VAL A 1 304 ? -15.860 4.112   -10.347 0.02 31.10 ? 297 VAL A H    1  
ATOM   4619   H HA   . VAL A 1 304 ? -16.788 4.719   -7.986  0.02 31.61 ? 297 VAL A HA   1  
ATOM   4620   H HB   . VAL A 1 304 ? -17.892 3.026   -9.944  0.02 30.63 ? 297 VAL A HB   1  
ATOM   4621   H HG11 . VAL A 1 304 ? -19.964 3.537   -8.721  0.02 30.74 ? 297 VAL A HG11 1  
ATOM   4622   H HG12 . VAL A 1 304 ? -19.058 2.339   -8.221  0.02 30.74 ? 297 VAL A HG12 1  
ATOM   4623   H HG13 . VAL A 1 304 ? -18.980 3.750   -7.502  0.02 31.20 ? 297 VAL A HG13 1  
ATOM   4624   H HG21 . VAL A 1 304 ? -19.251 4.820   -10.532 0.02 30.71 ? 297 VAL A HG21 1  
ATOM   4625   H HG22 . VAL A 1 304 ? -18.573 5.709   -9.409  0.02 31.25 ? 297 VAL A HG22 1  
ATOM   4626   H HG23 . VAL A 1 304 ? -17.727 5.235   -10.669 0.02 30.99 ? 297 VAL A HG23 1  
ATOM   4627   N N    . LEU A 1 305 ? -15.943 1.613   -8.256  0.02 31.03 ? 298 LEU A N    1  
ATOM   4628   C CA   . LEU A 1 305 ? -15.634 0.428   -7.445  0.02 31.07 ? 298 LEU A CA   1  
ATOM   4629   C C    . LEU A 1 305 ? -14.512 0.713   -6.436  0.02 31.58 ? 298 LEU A C    1  
ATOM   4630   O O    . LEU A 1 305 ? -13.527 1.389   -6.749  0.02 31.81 ? 298 LEU A O    1  
ATOM   4631   C CB   . LEU A 1 305 ? -15.245 -0.748  -8.355  0.02 30.72 ? 298 LEU A CB   1  
ATOM   4632   C CG   . LEU A 1 305 ? -16.325 -1.438  -9.196  0.02 30.25 ? 298 LEU A CG   1  
ATOM   4633   C CD1  . LEU A 1 305 ? -15.706 -2.326  -10.323 0.02 29.98 ? 298 LEU A CD1  1  
ATOM   4634   C CD2  . LEU A 1 305 ? -17.241 -2.272  -8.315  0.02 30.23 ? 298 LEU A CD2  1  
ATOM   4635   H H    . LEU A 1 305 ? -15.879 1.500   -9.104  0.02 30.82 ? 298 LEU A H    1  
ATOM   4636   H HA   . LEU A 1 305 ? -16.426 0.181   -6.945  0.02 31.03 ? 298 LEU A HA   1  
ATOM   4637   H HB2  . LEU A 1 305 ? -14.570 -0.435  -8.977  0.02 30.73 ? 298 LEU A HB2  1  
ATOM   4638   H HB3  . LEU A 1 305 ? -14.856 -1.432  -7.786  0.02 30.84 ? 298 LEU A HB3  1  
ATOM   4639   H HG   . LEU A 1 305 ? -16.869 -0.761  -9.626  0.02 30.16 ? 298 LEU A HG   1  
ATOM   4640   H HD11 . LEU A 1 305 ? -16.382 -2.508  -10.990 0.02 29.71 ? 298 LEU A HD11 1  
ATOM   4641   H HD12 . LEU A 1 305 ? -14.961 -1.855  -10.727 0.02 30.09 ? 298 LEU A HD12 1  
ATOM   4642   H HD13 . LEU A 1 305 ? -15.396 -3.157  -9.935  0.02 30.00 ? 298 LEU A HD13 1  
ATOM   4643   H HD21 . LEU A 1 305 ? -18.080 -2.433  -8.772  0.02 30.00 ? 298 LEU A HD21 1  
ATOM   4644   H HD22 . LEU A 1 305 ? -16.805 -3.113  -8.120  0.02 30.21 ? 298 LEU A HD22 1  
ATOM   4645   H HD23 . LEU A 1 305 ? -17.405 -1.789  -7.492  0.02 30.49 ? 298 LEU A HD23 1  
ATOM   4646   N N    . THR A 1 306 ? -14.666 0.185   -5.214  0.02 31.79 ? 299 THR A N    1  
ATOM   4647   C CA   . THR A 1 306 ? -13.673 0.397   -4.171  0.02 32.32 ? 299 THR A CA   1  
ATOM   4648   C C    . THR A 1 306 ? -12.407 -0.416  -4.447  0.02 32.39 ? 299 THR A C    1  
ATOM   4649   O O    . THR A 1 306 ? -12.400 -1.368  -5.226  0.02 32.03 ? 299 THR A O    1  
ATOM   4650   C CB   . THR A 1 306 ? -14.234 0.010   -2.796  0.02 32.56 ? 299 THR A CB   1  
ATOM   4651   O OG1  . THR A 1 306 ? -14.641 -1.357  -2.802  0.02 32.28 ? 299 THR A OG1  1  
ATOM   4652   C CG2  . THR A 1 306 ? -15.443 0.910   -2.385  0.02 32.62 ? 299 THR A CG2  1  
ATOM   4653   H H    . THR A 1 306 ? -15.342 -0.285  -4.969  0.02 31.66 ? 299 THR A H    1  
ATOM   4654   H HA   . THR A 1 306 ? -13.427 1.334   -4.147  0.02 32.53 ? 299 THR A HA   1  
ATOM   4655   H HB   . THR A 1 306 ? -13.535 0.120   -2.136  0.02 32.92 ? 299 THR A HB   1  
ATOM   4656   H HG1  . THR A 1 306 ? -15.233 -1.486  -2.221  0.02 32.30 ? 299 THR A HG1  1  
ATOM   4657   H HG21 . THR A 1 306 ? -16.072 0.994   -3.116  0.02 32.31 ? 299 THR A HG21 1  
ATOM   4658   H HG22 . THR A 1 306 ? -15.906 0.522   -1.629  0.02 32.71 ? 299 THR A HG22 1  
ATOM   4659   H HG23 . THR A 1 306 ? -15.125 1.793   -2.143  0.02 32.92 ? 299 THR A HG23 1  
ATOM   4660   N N    . LEU A 1 307 ? -11.324 -0.015  -3.777  0.02 32.90 ? 300 LEU A N    1  
ATOM   4661   C CA   . LEU A 1 307 ? -10.058 -0.757  -3.817  0.02 33.08 ? 300 LEU A CA   1  
ATOM   4662   C C    . LEU A 1 307 ? -10.245 -2.237  -3.459  0.02 32.91 ? 300 LEU A C    1  
ATOM   4663   O O    . LEU A 1 307 ? -9.594  -3.107  -4.052  0.02 32.79 ? 300 LEU A O    1  
ATOM   4664   C CB   . LEU A 1 307 ? -9.055  -0.086  -2.864  0.02 33.74 ? 300 LEU A CB   1  
ATOM   4665   C CG   . LEU A 1 307 ? -7.544  -0.255  -3.013  0.02 34.07 ? 300 LEU A CG   1  
ATOM   4666   C CD1  . LEU A 1 307 ? -7.227  -1.703  -2.998  0.02 33.89 ? 300 LEU A CD1  1  
ATOM   4667   C CD2  . LEU A 1 307 ? -6.944  0.415   -4.272  0.02 34.05 ? 300 LEU A CD2  1  
ATOM   4668   H H    . LEU A 1 307 ? -11.295 0.696   -3.295  0.02 33.17 ? 300 LEU A H    1  
ATOM   4669   H HA   . LEU A 1 307 ? -9.690  -0.708  -4.712  0.02 32.92 ? 300 LEU A HA   1  
ATOM   4670   H HB2  . LEU A 1 307 ? -9.200  0.868   -2.920  0.02 33.86 ? 300 LEU A HB2  1  
ATOM   4671   H HB3  . LEU A 1 307 ? -9.271  -0.381  -1.967  0.02 33.90 ? 300 LEU A HB3  1  
ATOM   4672   H HG   . LEU A 1 307 ? -7.118  0.147   -2.237  0.02 34.50 ? 300 LEU A HG   1  
ATOM   4673   H HD11 . LEU A 1 307 ? -6.278  -1.810  -2.828  0.02 34.20 ? 300 LEU A HD11 1  
ATOM   4674   H HD12 . LEU A 1 307 ? -7.741  -2.128  -2.296  0.02 33.88 ? 300 LEU A HD12 1  
ATOM   4675   H HD13 . LEU A 1 307 ? -7.459  -2.078  -3.860  0.02 33.51 ? 300 LEU A HD13 1  
ATOM   4676   H HD21 . LEU A 1 307 ? -6.171  -0.098  -4.558  0.02 34.28 ? 300 LEU A HD21 1  
ATOM   4677   H HD22 . LEU A 1 307 ? -7.609  0.425   -4.979  0.02 33.64 ? 300 LEU A HD22 1  
ATOM   4678   H HD23 . LEU A 1 307 ? -6.676  1.322   -4.055  0.02 34.27 ? 300 LEU A HD23 1  
ATOM   4679   N N    . GLU A 1 308 ? -11.122 -2.544  -2.490  0.02 32.93 ? 301 GLU A N    1  
ATOM   4680   C CA   . GLU A 1 308 ? -11.368 -3.933  -2.106  0.02 32.83 ? 301 GLU A CA   1  
ATOM   4681   C C    . GLU A 1 308 ? -12.320 -4.616  -3.078  0.02 32.24 ? 301 GLU A C    1  
ATOM   4682   O O    . GLU A 1 308 ? -12.184 -5.816  -3.353  0.02 32.08 ? 301 GLU A O    1  
ATOM   4683   C CB   . GLU A 1 308 ? -11.955 -4.022  -0.684  0.02 33.14 ? 301 GLU A CB   1  
ATOM   4684   C CG   . GLU A 1 308 ? -11.074 -3.535  0.474   0.02 33.78 ? 301 GLU A CG   1  
ATOM   4685   C CD   . GLU A 1 308 ? -11.268 -2.047  0.776   0.02 34.04 ? 301 GLU A CD   1  
ATOM   4686   O OE1  . GLU A 1 308 ? -11.674 -1.296  -0.152  0.02 33.74 ? 301 GLU A OE1  1  
ATOM   4687   O OE2  . GLU A 1 308 ? -11.041 -1.644  1.944   0.02 34.57 ? 301 GLU A OE2  1  
ATOM   4688   H H    . GLU A 1 308 ? -11.576 -1.971  -2.040  0.02 33.04 ? 301 GLU A H    1  
ATOM   4689   H HA   . GLU A 1 308 ? -10.530 -4.421  -2.120  0.02 32.97 ? 301 GLU A HA   1  
ATOM   4690   H HB2  . GLU A 1 308 ? -12.773 -3.502  -0.660  0.02 33.04 ? 301 GLU A HB2  1  
ATOM   4691   H HB3  . GLU A 1 308 ? -12.168 -4.950  -0.505  0.02 33.05 ? 301 GLU A HB3  1  
ATOM   4692   H HG2  . GLU A 1 308 ? -11.308 -4.033  1.271   0.02 33.95 ? 301 GLU A HG2  1  
ATOM   4693   H HG3  . GLU A 1 308 ? -10.142 -3.683  0.257   0.02 33.91 ? 301 GLU A HG3  1  
ATOM   4694   N N    . GLU A 1 309 ? -13.327 -3.887  -3.562  0.02 31.97 ? 302 GLU A N    1  
ATOM   4695   C CA   . GLU A 1 309 ? -14.258 -4.479  -4.524  0.02 31.45 ? 302 GLU A CA   1  
ATOM   4696   C C    . GLU A 1 309 ? -13.490 -5.080  -5.697  0.02 31.21 ? 302 GLU A C    1  
ATOM   4697   O O    . GLU A 1 309 ? -13.847 -6.144  -6.215  0.02 30.92 ? 302 GLU A O    1  
ATOM   4698   C CB   . GLU A 1 309 ? -15.274 -3.424  -4.982  0.02 31.26 ? 302 GLU A CB   1  
ATOM   4699   C CG   . GLU A 1 309 ? -16.542 -3.351  -4.121  0.02 31.32 ? 302 GLU A CG   1  
ATOM   4700   C CD   . GLU A 1 309 ? -17.425 -2.160  -4.428  0.02 31.24 ? 302 GLU A CD   1  
ATOM   4701   O OE1  . GLU A 1 309 ? -16.899 -1.183  -4.976  0.02 31.29 ? 302 GLU A OE1  1  
ATOM   4702   O OE2  . GLU A 1 309 ? -18.632 -2.209  -4.130  0.02 31.17 ? 302 GLU A OE2  1  
ATOM   4703   H H    . GLU A 1 309 ? -13.485 -3.069  -3.358  0.02 32.09 ? 302 GLU A H    1  
ATOM   4704   H HA   . GLU A 1 309 ? -14.750 -5.194  -4.093  0.02 31.42 ? 302 GLU A HA   1  
ATOM   4705   H HB2  . GLU A 1 309 ? -14.851 -2.550  -4.951  0.02 31.44 ? 302 GLU A HB2  1  
ATOM   4706   H HB3  . GLU A 1 309 ? -15.545 -3.628  -5.890  0.02 30.94 ? 302 GLU A HB3  1  
ATOM   4707   H HG2  . GLU A 1 309 ? -17.069 -4.148  -4.281  0.02 31.13 ? 302 GLU A HG2  1  
ATOM   4708   H HG3  . GLU A 1 309 ? -16.282 -3.305  -3.187  0.02 31.65 ? 302 GLU A HG3  1  
ATOM   4709   N N    . ARG A 1 310 ? -12.391 -4.449  -6.076  0.02 31.39 ? 303 ARG A N    1  
ATOM   4710   C CA   . ARG A 1 310 ? -11.573 -4.972  -7.156  0.02 31.24 ? 303 ARG A CA   1  
ATOM   4711   C C    . ARG A 1 310 ? -10.896 -6.282  -6.749  0.02 31.40 ? 303 ARG A C    1  
ATOM   4712   O O    . ARG A 1 310 ? -10.864 -7.234  -7.540  0.02 31.15 ? 303 ARG A O    1  
ATOM   4713   C CB   . ARG A 1 310 ? -10.553 -3.917  -7.570  0.02 31.47 ? 303 ARG A CB   1  
ATOM   4714   C CG   . ARG A 1 310 ? -11.025 -2.937  -8.680  0.02 31.21 ? 303 ARG A CG   1  
ATOM   4715   C CD   . ARG A 1 310 ? -10.517 -1.518  -8.414  0.02 31.60 ? 303 ARG A CD   1  
ATOM   4716   N NE   . ARG A 1 310 ? -9.956  -0.823  -9.577  0.02 31.62 ? 303 ARG A NE   1  
ATOM   4717   C CZ   . ARG A 1 310 ? -10.683 -0.251  -10.533 0.02 31.35 ? 303 ARG A CZ   1  
ATOM   4718   N NH1  . ARG A 1 310 ? -12.001 -0.319  -10.485 0.02 31.03 ? 303 ARG A NH1  1  
ATOM   4719   N NH2  . ARG A 1 310 ? -10.096 0.384   -11.548 0.02 31.44 ? 303 ARG A NH2  1  
ATOM   4720   H H    . ARG A 1 310 ? -12.095 -3.724  -5.725  0.02 31.63 ? 303 ARG A H    1  
ATOM   4721   H HA   . ARG A 1 310 ? -12.142 -5.154  -7.921  0.02 30.90 ? 303 ARG A HA   1  
ATOM   4722   H HB2  . ARG A 1 310 ? -10.333 -3.393  -6.789  0.02 31.79 ? 303 ARG A HB2  1  
ATOM   4723   H HB3  . ARG A 1 310 ? -9.758  -4.369  -7.892  0.02 31.52 ? 303 ARG A HB3  1  
ATOM   4724   H HG2  . ARG A 1 310 ? -10.675 -3.234  -9.532  0.02 31.05 ? 303 ARG A HG2  1  
ATOM   4725   H HG3  . ARG A 1 310 ? -11.995 -2.915  -8.704  0.02 31.00 ? 303 ARG A HG3  1  
ATOM   4726   H HD2  . ARG A 1 310 ? -11.257 -0.984  -8.090  0.02 31.57 ? 303 ARG A HD2  1  
ATOM   4727   H HD3  . ARG A 1 310 ? -9.822  -1.548  -7.741  0.02 31.93 ? 303 ARG A HD3  1  
ATOM   4728   H HE   . ARG A 1 310 ? -9.108  -0.675  -9.580  0.02 31.88 ? 303 ARG A HE   1  
ATOM   4729   H HH11 . ARG A 1 310 ? -12.392 -0.718  -9.833  0.02 31.00 ? 303 ARG A HH11 1  
ATOM   4730   H HH12 . ARG A 1 310 ? -12.473 0.044   -11.104 0.02 30.87 ? 303 ARG A HH12 1  
ATOM   4731   H HH21 . ARG A 1 310 ? -9.237  0.428   -11.592 0.02 31.67 ? 303 ARG A HH21 1  
ATOM   4732   H HH22 . ARG A 1 310 ? -10.573 0.740   -12.169 0.02 31.28 ? 303 ARG A HH22 1  
ATOM   4733   N N    . THR A 1 311 ? -10.375 -6.366  -5.509  0.02 31.84 ? 304 THR A N    1  
ATOM   4734   C CA   . THR A 1 311 ? -9.754  -7.617  -5.069  0.02 32.03 ? 304 THR A CA   1  
ATOM   4735   C C    . THR A 1 311 ? -10.730 -8.765  -5.221  0.02 31.69 ? 304 THR A C    1  
ATOM   4736   O O    . THR A 1 311 ? -10.334 -9.886  -5.559  0.02 31.64 ? 304 THR A O    1  
ATOM   4737   C CB   . THR A 1 311 ? -9.289  -7.534  -3.598  0.02 32.58 ? 304 THR A CB   1  
ATOM   4738   O OG1  . THR A 1 311 ? -8.020  -8.189  -3.439  0.02 32.93 ? 304 THR A OG1  1  
ATOM   4739   C CG2  . THR A 1 311 ? -10.262 -8.247  -2.690  0.02 32.57 ? 304 THR A CG2  1  
ATOM   4740   H H    . THR A 1 311 ? -10.374 -5.736  -4.928  0.02 32.04 ? 304 THR A H    1  
ATOM   4741   H HA   . THR A 1 311 ? -8.981  -7.807  -5.620  0.02 32.08 ? 304 THR A HA   1  
ATOM   4742   H HB   . THR A 1 311 ? -9.218  -6.607  -3.314  0.02 32.74 ? 304 THR A HB   1  
ATOM   4743   H HG1  . THR A 1 311 ? -7.822  -8.243  -2.623  0.02 33.24 ? 304 THR A HG1  1  
ATOM   4744   H HG21 . THR A 1 311 ? -11.155 -7.890  -2.795  0.02 32.34 ? 304 THR A HG21 1  
ATOM   4745   H HG22 . THR A 1 311 ? -10.260 -9.202  -2.849  0.02 32.48 ? 304 THR A HG22 1  
ATOM   4746   H HG23 . THR A 1 311 ? -9.992  -8.106  -1.770  0.02 32.93 ? 304 THR A HG23 1  
ATOM   4747   N N    . ASN A 1 312 ? -12.002 -8.506  -4.934  0.02 31.51 ? 305 ASN A N    1  
ATOM   4748   C CA   . ASN A 1 312 ? -13.080 -9.475  -4.942  0.02 31.25 ? 305 ASN A CA   1  
ATOM   4749   C C    . ASN A 1 312 ? -13.590 -9.727  -6.358  0.02 30.76 ? 305 ASN A C    1  
ATOM   4750   O O    . ASN A 1 312 ? -14.589 -10.416 -6.534  0.02 30.52 ? 305 ASN A O    1  
ATOM   4751   C CB   . ASN A 1 312 ? -14.224 -8.999  -4.029  0.02 31.31 ? 305 ASN A CB   1  
ATOM   4752   C CG   . ASN A 1 312 ? -13.842 -9.007  -2.549  0.02 31.81 ? 305 ASN A CG   1  
ATOM   4753   O OD1  . ASN A 1 312 ? -12.805 -9.543  -2.183  0.02 32.12 ? 305 ASN A OD1  1  
ATOM   4754   N ND2  . ASN A 1 312 ? -14.696 -8.428  -1.693  0.02 31.93 ? 305 ASN A ND2  1  
ATOM   4755   H H    . ASN A 1 312 ? -12.275 -7.719  -4.725  0.02 31.55 ? 305 ASN A H    1  
ATOM   4756   H HA   . ASN A 1 312 ? -12.748 -10.313 -4.585  0.02 31.40 ? 305 ASN A HA   1  
ATOM   4757   H HB2  . ASN A 1 312 ? -14.459 -8.090  -4.265  0.02 31.25 ? 305 ASN A HB2  1  
ATOM   4758   H HB3  . ASN A 1 312 ? -14.993 -9.578  -4.141  0.02 31.11 ? 305 ASN A HB3  1  
ATOM   4759   H HD21 . ASN A 1 312 ? -15.350 -7.953  -1.988  0.02 31.72 ? 305 ASN A HD21 1  
ATOM   4760   H HD22 . ASN A 1 312 ? -14.592 -8.536  -0.846  0.02 32.24 ? 305 ASN A HD22 1  
ATOM   4761   N N    . LYS A 1 313 ? -12.925 -9.132  -7.340  0.02 30.65 ? 306 LYS A N    1  
ATOM   4762   C CA   . LYS A 1 313 ? -13.169 -9.393  -8.757  0.02 30.24 ? 306 LYS A CA   1  
ATOM   4763   C C    . LYS A 1 313 ? -14.508 -8.846  -9.253  0.02 29.90 ? 306 LYS A C    1  
ATOM   4764   O O    . LYS A 1 313 ? -14.998 -9.285  -10.299 0.02 29.57 ? 306 LYS A O    1  
ATOM   4765   C CB   . LYS A 1 313 ? -13.060 -10.893 -9.070  0.02 30.16 ? 306 LYS A CB   1  
ATOM   4766   C CG   . LYS A 1 313 ? -11.698 -11.500 -8.743  0.02 30.50 ? 306 LYS A CG   1  
ATOM   4767   C CD   . LYS A 1 313 ? -10.558 -10.722 -9.380  0.02 30.63 ? 306 LYS A CD   1  
ATOM   4768   C CE   . LYS A 1 313 ? -9.167  -11.144 -8.915  0.02 31.04 ? 306 LYS A CE   1  
ATOM   4769   N NZ   . LYS A 1 313 ? -8.563  -10.082 -7.991  0.02 31.48 ? 306 LYS A NZ   1  
ATOM   4770   H H    . LYS A 1 313 ? -12.302 -8.556  -7.215  0.02 30.82 ? 306 LYS A H    1  
ATOM   4771   H HA   . LYS A 1 313 ? -12.491 -8.924  -9.261  0.02 30.27 ? 306 LYS A HA   1  
ATOM   4772   H HB2  . LYS A 1 313 ? -13.732 -11.379 -8.570  0.02 30.16 ? 306 LYS A HB2  1  
ATOM   4773   H HB3  . LYS A 1 313 ? -13.214 -11.017 -10.019 0.02 29.91 ? 306 LYS A HB3  1  
ATOM   4774   H HG2  . LYS A 1 313 ? -11.570 -11.501 -7.782  0.02 30.75 ? 306 LYS A HG2  1  
ATOM   4775   H HG3  . LYS A 1 313 ? -11.664 -12.406 -9.083  0.02 30.42 ? 306 LYS A HG3  1  
ATOM   4776   H HD2  . LYS A 1 313 ? -10.599 -10.830 -10.344 0.02 30.40 ? 306 LYS A HD2  1  
ATOM   4777   H HD3  . LYS A 1 313 ? -10.637 -9.785  -9.151  0.02 30.74 ? 306 LYS A HD3  1  
ATOM   4778   H HE2  . LYS A 1 313 ? -9.226  -11.989 -8.438  0.02 31.10 ? 306 LYS A HE2  1  
ATOM   4779   H HE3  . LYS A 1 313 ? -8.588  -11.239 -9.688  0.02 30.98 ? 306 LYS A HE3  1  
ATOM   4780   H HZ1  . LYS A 1 313 ? -7.870  -10.418 -7.546  0.02 31.75 ? 306 LYS A HZ1  1  
ATOM   4781   H HZ2  . LYS A 1 313 ? -8.284  -9.384  -8.466  0.02 31.50 ? 306 LYS A HZ2  1  
ATOM   4782   H HZ3  . LYS A 1 313 ? -9.174  -9.807  -7.404  0.02 31.49 ? 306 LYS A HZ3  1  
ATOM   4783   N N    . VAL A 1 314 ? -15.100 -7.857  -8.577  0.02 30.01 ? 307 VAL A N    1  
ATOM   4784   C CA   . VAL A 1 314 ? -16.212 -7.132  -9.188  0.02 29.72 ? 307 VAL A CA   1  
ATOM   4785   C C    . VAL A 1 314 ? -15.641 -6.366  -10.371 0.02 29.60 ? 307 VAL A C    1  
ATOM   4786   O O    . VAL A 1 314 ? -14.679 -5.604  -10.225 0.02 29.86 ? 307 VAL A O    1  
ATOM   4787   C CB   . VAL A 1 314 ? -16.899 -6.181  -8.197  0.02 29.92 ? 307 VAL A CB   1  
ATOM   4788   C CG1  . VAL A 1 314 ? -18.063 -5.427  -8.889  0.02 29.66 ? 307 VAL A CG1  1  
ATOM   4789   C CG2  . VAL A 1 314 ? -17.371 -6.927  -6.981  0.02 30.10 ? 307 VAL A CG2  1  
ATOM   4790   H H    . VAL A 1 314 ? -14.883 -7.592  -7.790  0.02 30.25 ? 307 VAL A H    1  
ATOM   4791   H HA   . VAL A 1 314 ? -16.870 -7.763  -9.512  0.02 29.52 ? 307 VAL A HA   1  
ATOM   4792   H HB   . VAL A 1 314 ? -16.254 -5.514  -7.904  0.02 30.14 ? 307 VAL A HB   1  
ATOM   4793   H HG11 . VAL A 1 314 ? -18.516 -4.875  -8.238  0.02 29.80 ? 307 VAL A HG11 1  
ATOM   4794   H HG12 . VAL A 1 314 ? -17.706 -4.870  -9.597  0.02 29.59 ? 307 VAL A HG12 1  
ATOM   4795   H HG13 . VAL A 1 314 ? -18.684 -6.071  -9.254  0.02 29.45 ? 307 VAL A HG13 1  
ATOM   4796   H HG21 . VAL A 1 314 ? -18.146 -6.475  -6.613  0.02 30.11 ? 307 VAL A HG21 1  
ATOM   4797   H HG22 . VAL A 1 314 ? -17.605 -7.832  -7.238  0.02 29.97 ? 307 VAL A HG22 1  
ATOM   4798   H HG23 . VAL A 1 314 ? -16.652 -6.943  -6.330  0.02 30.38 ? 307 VAL A HG23 1  
ATOM   4799   N N    . MET A 1 315 ? -16.184 -6.611  -11.560 0.02 29.26 ? 308 MET A N    1  
ATOM   4800   C CA   . MET A 1 315 ? -15.520 -6.065  -12.734 0.02 29.18 ? 308 MET A CA   1  
ATOM   4801   C C    . MET A 1 315 ? -16.015 -4.674  -13.103 0.02 29.15 ? 308 MET A C    1  
ATOM   4802   O O    . MET A 1 315 ? -15.214 -3.811  -13.462 0.02 29.31 ? 308 MET A O    1  
ATOM   4803   C CB   . MET A 1 315 ? -15.695 -7.023  -13.906 0.02 28.87 ? 308 MET A CB   1  
ATOM   4804   C CG   . MET A 1 315 ? -14.464 -7.878  -14.130 0.02 29.01 ? 308 MET A CG   1  
ATOM   4805   S SD   . MET A 1 315 ? -13.915 -9.225  -13.074 0.02 29.29 ? 308 MET A SD   1  
ATOM   4806   C CE   . MET A 1 315 ? -12.251 -8.573  -12.843 0.02 29.63 ? 308 MET A CE   1  
ATOM   4807   H H    . MET A 1 315 ? -16.902 -7.064  -11.710 0.02 29.09 ? 308 MET A H    1  
ATOM   4808   H HA   . MET A 1 315 ? -14.570 -6.006  -12.555 0.02 29.38 ? 308 MET A HA   1  
ATOM   4809   H HB2  . MET A 1 315 ? -16.463 -7.592  -13.748 0.02 28.74 ? 308 MET A HB2  1  
ATOM   4810   H HB3  . MET A 1 315 ? -15.826 -6.503  -14.715 0.02 28.76 ? 308 MET A HB3  1  
ATOM   4811   H HG2  . MET A 1 315 ? -14.619 -8.362  -14.939 0.02 28.84 ? 308 MET A HG2  1  
ATOM   4812   H HG3  . MET A 1 315 ? -13.720 -7.271  -14.261 0.02 29.15 ? 308 MET A HG3  1  
ATOM   4813   H HE1  . MET A 1 315 ? -11.946 -8.806  -11.953 0.02 29.81 ? 308 MET A HE1  1  
ATOM   4814   H HE2  . MET A 1 315 ? -11.662 -8.955  -13.511 0.02 29.52 ? 308 MET A HE2  1  
ATOM   4815   H HE3  . MET A 1 315 ? -12.254 -7.608  -12.934 0.02 29.79 ? 308 MET A HE3  1  
ATOM   4816   N N    . PHE A 1 316 ? -17.305 -4.427  -12.984 0.02 28.99 ? 309 PHE A N    1  
ATOM   4817   C CA   . PHE A 1 316 ? -17.823 -3.133  -13.387 0.02 28.98 ? 309 PHE A CA   1  
ATOM   4818   C C    . PHE A 1 316 ? -18.709 -2.551  -12.296 0.02 29.13 ? 309 PHE A C    1  
ATOM   4819   O O    . PHE A 1 316 ? -19.539 -3.267  -11.723 0.02 29.07 ? 309 PHE A O    1  
ATOM   4820   C CB   . PHE A 1 316 ? -18.626 -3.238  -14.671 0.02 28.64 ? 309 PHE A CB   1  
ATOM   4821   C CG   . PHE A 1 316 ? -17.922 -3.987  -15.758 0.02 28.49 ? 309 PHE A CG   1  
ATOM   4822   C CD1  . PHE A 1 316 ? -16.977 -3.356  -16.553 0.02 28.56 ? 309 PHE A CD1  1  
ATOM   4823   C CD2  . PHE A 1 316 ? -18.224 -5.316  -15.995 0.02 28.31 ? 309 PHE A CD2  1  
ATOM   4824   C CE1  . PHE A 1 316 ? -16.327 -4.037  -17.559 0.02 28.46 ? 309 PHE A CE1  1  
ATOM   4825   C CE2  . PHE A 1 316 ? -17.579 -6.024  -17.020 0.02 28.20 ? 309 PHE A CE2  1  
ATOM   4826   C CZ   . PHE A 1 316 ? -16.626 -5.375  -17.798 0.02 28.27 ? 309 PHE A CZ   1  
ATOM   4827   H H    . PHE A 1 316 ? -17.889 -4.981  -12.684 0.02 28.91 ? 309 PHE A H    1  
ATOM   4828   H HA   . PHE A 1 316 ? -17.088 -2.524  -13.552 0.02 29.13 ? 309 PHE A HA   1  
ATOM   4829   H HB2  . PHE A 1 316 ? -19.458 -3.695  -14.476 0.02 28.53 ? 309 PHE A HB2  1  
ATOM   4830   H HB3  . PHE A 1 316 ? -18.813 -2.343  -14.992 0.02 28.67 ? 309 PHE A HB3  1  
ATOM   4831   H HD1  . PHE A 1 316 ? -16.768 -2.464  -16.393 0.02 28.71 ? 309 PHE A HD1  1  
ATOM   4832   H HD2  . PHE A 1 316 ? -18.862 -5.739  -15.472 0.02 28.29 ? 309 PHE A HD2  1  
ATOM   4833   H HE1  . PHE A 1 316 ? -15.691 -3.603  -18.073 0.02 28.54 ? 309 PHE A HE1  1  
ATOM   4834   H HE2  . PHE A 1 316 ? -17.782 -6.920  -17.173 0.02 28.10 ? 309 PHE A HE2  1  
ATOM   4835   H HZ   . PHE A 1 316 ? -16.188 -5.834  -18.473 0.02 28.22 ? 309 PHE A HZ   1  
ATOM   4836   N N    . PRO A 1 317 ? -18.602 -1.242  -12.043 0.02 29.36 ? 310 PRO A N    1  
ATOM   4837   C CA   . PRO A 1 317 ? -19.425 -0.645  -10.980 0.02 29.56 ? 310 PRO A CA   1  
ATOM   4838   C C    . PRO A 1 317 ? -20.905 -0.728  -11.255 0.02 29.35 ? 310 PRO A C    1  
ATOM   4839   O O    . PRO A 1 317 ? -21.676 -0.961  -10.329 0.02 29.46 ? 310 PRO A O    1  
ATOM   4840   C CB   . PRO A 1 317 ? -18.932 0.807   -10.945 0.02 29.86 ? 310 PRO A CB   1  
ATOM   4841   C CG   . PRO A 1 317 ? -18.457 1.057   -12.365 0.02 29.68 ? 310 PRO A CG   1  
ATOM   4842   C CD   . PRO A 1 317 ? -17.755 -0.227  -12.694 0.02 29.50 ? 310 PRO A CD   1  
ATOM   4843   H HA   . PRO A 1 317 ? -19.238 -1.073  -10.132 0.02 29.71 ? 310 PRO A HA   1  
ATOM   4844   H HB2  . PRO A 1 317 ? -19.662 1.401   -10.712 0.02 29.92 ? 310 PRO A HB2  1  
ATOM   4845   H HB3  . PRO A 1 317 ? -18.198 0.896   -10.319 0.02 30.10 ? 310 PRO A HB3  1  
ATOM   4846   H HG2  . PRO A 1 317 ? -19.219 1.206   -12.945 0.02 29.50 ? 310 PRO A HG2  1  
ATOM   4847   H HG3  . PRO A 1 317 ? -17.843 1.806   -12.392 0.02 29.89 ? 310 PRO A HG3  1  
ATOM   4848   H HD2  . PRO A 1 317 ? -17.736 -0.361  -13.654 0.02 29.32 ? 310 PRO A HD2  1  
ATOM   4849   H HD3  . PRO A 1 317 ? -16.862 -0.235  -12.317 0.02 29.71 ? 310 PRO A HD3  1  
ATOM   4850   N N    . PHE A 1 318 ? -21.346 -0.524  -12.500 0.02 29.09 ? 311 PHE A N    1  
ATOM   4851   C CA   . PHE A 1 318 ? -22.756 -0.647  -12.828 0.02 28.92 ? 311 PHE A CA   1  
ATOM   4852   C C    . PHE A 1 318 ? -22.951 -1.700  -13.910 0.02 28.57 ? 311 PHE A C    1  
ATOM   4853   O O    . PHE A 1 318 ? -22.122 -1.837  -14.810 0.02 28.45 ? 311 PHE A O    1  
ATOM   4854   C CB   . PHE A 1 318 ? -23.359 0.680   -13.269 0.02 29.00 ? 311 PHE A CB   1  
ATOM   4855   C CG   . PHE A 1 318 ? -23.171 1.773   -12.274 0.02 29.38 ? 311 PHE A CG   1  
ATOM   4856   C CD1  . PHE A 1 318 ? -24.067 1.918   -11.225 0.02 29.58 ? 311 PHE A CD1  1  
ATOM   4857   C CD2  . PHE A 1 318 ? -22.090 2.617   -12.355 0.02 29.59 ? 311 PHE A CD2  1  
ATOM   4858   C CE1  . PHE A 1 318 ? -23.897 2.902   -10.304 0.02 29.96 ? 311 PHE A CE1  1  
ATOM   4859   C CE2  . PHE A 1 318 ? -21.912 3.619   -11.424 0.02 29.98 ? 311 PHE A CE2  1  
ATOM   4860   C CZ   . PHE A 1 318 ? -22.818 3.750   -10.394 0.02 30.16 ? 311 PHE A CZ   1  
ATOM   4861   H H    . PHE A 1 318 ? -20.846 -0.300  -13.155 0.02 29.04 ? 311 PHE A H    1  
ATOM   4862   H HA   . PHE A 1 318 ? -23.239 -0.941  -12.042 0.02 29.01 ? 311 PHE A HA   1  
ATOM   4863   H HB2  . PHE A 1 318 ? -22.956 0.962   -14.105 0.02 28.92 ? 311 PHE A HB2  1  
ATOM   4864   H HB3  . PHE A 1 318 ? -24.313 0.558   -13.386 0.02 28.93 ? 311 PHE A HB3  1  
ATOM   4865   H HD1  . PHE A 1 318 ? -24.798 1.347   -11.158 0.02 29.48 ? 311 PHE A HD1  1  
ATOM   4866   H HD2  . PHE A 1 318 ? -21.482 2.520   -13.049 0.02 29.49 ? 311 PHE A HD2  1  
ATOM   4867   H HE1  . PHE A 1 318 ? -24.507 2.993   -9.610  0.02 30.11 ? 311 PHE A HE1  1  
ATOM   4868   H HE2  . PHE A 1 318 ? -21.182 4.190   -11.486 0.02 30.15 ? 311 PHE A HE2  1  
ATOM   4869   H HZ   . PHE A 1 318 ? -22.706 4.420   -9.762  0.02 30.45 ? 311 PHE A HZ   1  
ATOM   4870   N N    . GLY A 1 319 ? -24.034 -2.453  -13.768 0.02 28.47 ? 312 GLY A N    1  
ATOM   4871   C CA   . GLY A 1 319 ? -24.392 -3.519  -14.664 0.02 28.19 ? 312 GLY A CA   1  
ATOM   4872   C C    . GLY A 1 319 ? -25.717 -4.108  -14.239 0.02 28.19 ? 312 GLY A C    1  
ATOM   4873   O O    . GLY A 1 319 ? -26.404 -3.570  -13.364 0.02 28.40 ? 312 GLY A O    1  
ATOM   4874   H H    . GLY A 1 319 ? -24.598 -2.360  -13.129 0.02 28.58 ? 312 GLY A H    1  
ATOM   4875   H HA2  . GLY A 1 319 ? -24.471 -3.176  -15.566 0.02 28.08 ? 312 GLY A HA2  1  
ATOM   4876   H HA3  . GLY A 1 319 ? -23.718 -4.213  -14.646 0.02 28.15 ? 312 GLY A HA3  1  
ATOM   4877   N N    . PRO A 1 320 ? -26.119 -5.211  -14.870 0.02 28.00 ? 313 PRO A N    1  
ATOM   4878   C CA   . PRO A 1 320 ? -27.380 -5.852  -14.499 0.02 28.05 ? 313 PRO A CA   1  
ATOM   4879   C C    . PRO A 1 320 ? -27.412 -6.167  -13.005 0.02 28.31 ? 313 PRO A C    1  
ATOM   4880   O O    . PRO A 1 320 ? -26.418 -6.594  -12.436 0.02 28.37 ? 313 PRO A O    1  
ATOM   4881   C CB   . PRO A 1 320 ? -27.375 -7.140  -15.320 0.02 27.85 ? 313 PRO A CB   1  
ATOM   4882   C CG   . PRO A 1 320 ? -26.503 -6.805  -16.524 0.02 27.65 ? 313 PRO A CG   1  
ATOM   4883   C CD   . PRO A 1 320 ? -25.460 -5.874  -16.012 0.02 27.78 ? 313 PRO A CD   1  
ATOM   4884   H HA   . PRO A 1 320 ? -28.132 -5.301  -14.755 0.02 28.06 ? 313 PRO A HA   1  
ATOM   4885   H HB2  . PRO A 1 320 ? -26.975 -7.849  -14.795 0.02 27.90 ? 313 PRO A HB2  1  
ATOM   4886   H HB3  . PRO A 1 320 ? -28.281 -7.368  -15.585 0.02 27.83 ? 313 PRO A HB3  1  
ATOM   4887   H HG2  . PRO A 1 320 ? -26.099 -7.614  -16.872 0.02 27.57 ? 313 PRO A HG2  1  
ATOM   4888   H HG3  . PRO A 1 320 ? -27.042 -6.370  -17.200 0.02 27.59 ? 313 PRO A HG3  1  
ATOM   4889   H HD2  . PRO A 1 320 ? -24.680 -6.366  -15.718 0.02 27.80 ? 313 PRO A HD2  1  
ATOM   4890   H HD3  . PRO A 1 320 ? -25.232 -5.220  -16.689 0.02 27.72 ? 313 PRO A HD3  1  
ATOM   4891   N N    . THR A 1 321 ? -28.584 -6.036  -12.409 0.02 28.48 ? 314 THR A N    1  
ATOM   4892   C CA   . THR A 1 321 ? -28.690 -6.115  -10.957 0.02 28.79 ? 314 THR A CA   1  
ATOM   4893   C C    . THR A 1 321 ? -30.029 -6.736  -10.592 0.02 28.94 ? 314 THR A C    1  
ATOM   4894   O O    . THR A 1 321 ? -30.965 -6.778  -11.389 0.02 28.85 ? 314 THR A O    1  
ATOM   4895   C CB   . THR A 1 321 ? -28.539 -4.711  -10.324 0.02 29.00 ? 314 THR A CB   1  
ATOM   4896   O OG1  . THR A 1 321 ? -28.090 -4.811  -8.962  0.02 29.30 ? 314 THR A OG1  1  
ATOM   4897   C CG2  . THR A 1 321 ? -29.846 -3.993  -10.371 0.02 29.12 ? 314 THR A CG2  1  
ATOM   4898   H H    . THR A 1 321 ? -29.331 -5.916  -12.813 0.02 28.45 ? 314 THR A H    1  
ATOM   4899   H HA   . THR A 1 321 ? -27.990 -6.685  -10.603 0.02 28.80 ? 314 THR A HA   1  
ATOM   4900   H HB   . THR A 1 321 ? -27.893 -4.197  -10.832 0.02 28.90 ? 314 THR A HB   1  
ATOM   4901   H HG1  . THR A 1 321 ? -27.477 -4.256  -8.824  0.02 29.39 ? 314 THR A HG1  1  
ATOM   4902   H HG21 . THR A 1 321 ? -29.714 -3.058  -10.152 0.02 29.24 ? 314 THR A HG21 1  
ATOM   4903   H HG22 . THR A 1 321 ? -30.225 -4.057  -11.260 0.02 28.94 ? 314 THR A HG22 1  
ATOM   4904   H HG23 . THR A 1 321 ? -30.473 -4.377  -9.744  0.02 29.29 ? 314 THR A HG23 1  
ATOM   4905   N N    . VAL A 1 322 ? -30.125 -7.216  -9.355  0.02 29.21 ? 315 VAL A N    1  
ATOM   4906   C CA   . VAL A 1 322 ? -31.419 -7.638  -8.844  0.02 29.45 ? 315 VAL A CA   1  
ATOM   4907   C C    . VAL A 1 322 ? -32.151 -6.381  -8.413  0.02 29.68 ? 315 VAL A C    1  
ATOM   4908   O O    . VAL A 1 322 ? -31.632 -5.577  -7.634  0.02 29.86 ? 315 VAL A O    1  
ATOM   4909   C CB   . VAL A 1 322 ? -31.267 -8.654  -7.694  0.02 29.73 ? 315 VAL A CB   1  
ATOM   4910   C CG1  . VAL A 1 322 ? -32.605 -8.852  -6.995  0.02 30.05 ? 315 VAL A CG1  1  
ATOM   4911   C CG2  . VAL A 1 322 ? -30.756 -9.972  -8.237  0.02 29.54 ? 315 VAL A CG2  1  
ATOM   4912   H H    . VAL A 1 322 ? -29.483 -7.284  -8.808  0.02 29.28 ? 315 VAL A H    1  
ATOM   4913   H HA   . VAL A 1 322 ? -31.935 -8.052  -9.549  0.02 29.33 ? 315 VAL A HA   1  
ATOM   4914   H HB   . VAL A 1 322 ? -30.626 -8.330  -7.046  0.02 29.85 ? 315 VAL A HB   1  
ATOM   4915   H HG11 . VAL A 1 322 ? -32.552 -9.611  -6.389  0.02 30.22 ? 315 VAL A HG11 1  
ATOM   4916   H HG12 . VAL A 1 322 ? -32.830 -8.052  -6.493  0.02 30.23 ? 315 VAL A HG12 1  
ATOM   4917   H HG13 . VAL A 1 322 ? -33.278 -9.021  -7.676  0.02 29.94 ? 315 VAL A HG13 1  
ATOM   4918   H HG21 . VAL A 1 322 ? -31.196 -10.696 -7.769  0.02 29.71 ? 315 VAL A HG21 1  
ATOM   4919   H HG22 . VAL A 1 322 ? -30.954 -10.030 -9.184  0.02 29.31 ? 315 VAL A HG22 1  
ATOM   4920   H HG23 . VAL A 1 322 ? -29.797 -10.021 -8.100  0.02 29.50 ? 315 VAL A HG23 1  
ATOM   4921   N N    . GLU A 1 323 ? -33.307 -6.161  -8.975  0.02 29.68 ? 316 GLU A N    1  
ATOM   4922   C CA   . GLU A 1 323 ? -33.970 -4.898  -8.747  0.02 29.90 ? 316 GLU A CA   1  
ATOM   4923   C C    . GLU A 1 323 ? -34.518 -4.886  -7.322  0.02 30.36 ? 316 GLU A C    1  
ATOM   4924   O O    . GLU A 1 323 ? -34.921 -5.933  -6.805  0.02 30.50 ? 316 GLU A O    1  
ATOM   4925   C CB   . GLU A 1 323 ? -35.056 -4.666  -9.800  0.02 29.82 ? 316 GLU A CB   1  
ATOM   4926   C CG   . GLU A 1 323 ? -34.424 -4.080  -11.089 0.02 29.46 ? 316 GLU A CG   1  
ATOM   4927   C CD   . GLU A 1 323 ? -35.254 -4.226  -12.352 0.02 29.30 ? 316 GLU A CD   1  
ATOM   4928   O OE1  . GLU A 1 323 ? -34.720 -4.778  -13.348 0.02 28.98 ? 316 GLU A OE1  1  
ATOM   4929   O OE2  . GLU A 1 323 ? -36.415 -3.758  -12.373 0.02 29.53 ? 316 GLU A OE2  1  
ATOM   4930   H H    . GLU A 1 323 ? -33.732 -6.711  -9.478  0.02 29.59 ? 316 GLU A H    1  
ATOM   4931   H HA   . GLU A 1 323 ? -33.312 -4.194  -8.844  0.02 29.84 ? 316 GLU A HA   1  
ATOM   4932   H HB2  . GLU A 1 323 ? -35.482 -5.509  -10.007 0.02 29.81 ? 316 GLU A HB2  1  
ATOM   4933   H HB3  . GLU A 1 323 ? -35.711 -4.039  -9.468  0.02 30.05 ? 316 GLU A HB3  1  
ATOM   4934   H HG2  . GLU A 1 323 ? -34.279 -3.134  -10.959 0.02 29.53 ? 316 GLU A HG2  1  
ATOM   4935   H HG3  . GLU A 1 323 ? -33.576 -4.523  -11.243 0.02 29.27 ? 316 GLU A HG3  1  
ATOM   4936   N N    . PRO A 1 324 ? -34.502 -3.741  -6.644  0.02 30.63 ? 317 PRO A N    1  
ATOM   4937   C CA   . PRO A 1 324 ? -34.916 -3.718  -5.221  0.02 31.11 ? 317 PRO A CA   1  
ATOM   4938   C C    . PRO A 1 324 ? -36.435 -3.721  -4.996  0.02 31.44 ? 317 PRO A C    1  
ATOM   4939   O O    . PRO A 1 324 ? -36.864 -3.780  -3.830  0.02 31.86 ? 317 PRO A O    1  
ATOM   4940   C CB   . PRO A 1 324 ? -34.257 -2.435  -4.710  0.02 31.28 ? 317 PRO A CB   1  
ATOM   4941   C CG   . PRO A 1 324 ? -34.177 -1.564  -5.946  0.02 30.99 ? 317 PRO A CG   1  
ATOM   4942   C CD   . PRO A 1 324 ? -33.816 -2.500  -7.035  0.02 30.54 ? 317 PRO A CD   1  
ATOM   4943   H HA   . PRO A 1 324 ? -34.528 -4.468  -4.747  0.02 31.14 ? 317 PRO A HA   1  
ATOM   4944   H HB2  . PRO A 1 324 ? -34.796 -2.029  -4.015  0.02 31.62 ? 317 PRO A HB2  1  
ATOM   4945   H HB3  . PRO A 1 324 ? -33.366 -2.642  -4.391  0.02 31.24 ? 317 PRO A HB3  1  
ATOM   4946   H HG2  . PRO A 1 324 ? -35.039 -1.156  -6.118  0.02 31.11 ? 317 PRO A HG2  1  
ATOM   4947   H HG3  . PRO A 1 324 ? -33.489 -0.888  -5.834  0.02 31.01 ? 317 PRO A HG3  1  
ATOM   4948   H HD2  . PRO A 1 324 ? -34.163 -2.179  -7.879  0.02 30.39 ? 317 PRO A HD2  1  
ATOM   4949   H HD3  . PRO A 1 324 ? -32.856 -2.628  -7.062  0.02 30.39 ? 317 PRO A HD3  1  
ATOM   4950   N N    . TYR A 1 325 ? -37.232 -3.688  -6.065  0.02 31.30 ? 318 TYR A N    1  
ATOM   4951   C CA   . TYR A 1 325 ? -38.690 -3.795  -6.083  0.02 31.58 ? 318 TYR A CA   1  
ATOM   4952   C C    . TYR A 1 325 ? -39.089 -3.994  -7.539  0.02 31.23 ? 318 TYR A C    1  
ATOM   4953   O O    . TYR A 1 325 ? -38.317 -3.659  -8.431  0.02 30.84 ? 318 TYR A O    1  
ATOM   4954   C CB   . TYR A 1 325 ? -39.371 -2.534  -5.524  0.02 31.99 ? 318 TYR A CB   1  
ATOM   4955   C CG   . TYR A 1 325 ? -38.895 -1.283  -6.229  0.02 31.78 ? 318 TYR A CG   1  
ATOM   4956   C CD1  . TYR A 1 325 ? -37.735 -0.650  -5.826  0.02 31.72 ? 318 TYR A CD1  1  
ATOM   4957   C CD2  . TYR A 1 325 ? -39.580 -0.763  -7.325  0.02 31.67 ? 318 TYR A CD2  1  
ATOM   4958   C CE1  . TYR A 1 325 ? -37.271 0.484   -6.475  0.02 31.57 ? 318 TYR A CE1  1  
ATOM   4959   C CE2  . TYR A 1 325 ? -39.123 0.379   -7.985  0.02 31.51 ? 318 TYR A CE2  1  
ATOM   4960   C CZ   . TYR A 1 325 ? -37.968 0.991   -7.556  0.02 31.47 ? 318 TYR A CZ   1  
ATOM   4961   O OH   . TYR A 1 325 ? -37.521 2.127   -8.191  0.02 31.37 ? 318 TYR A OH   1  
ATOM   4962   H H    . TYR A 1 325 ? -36.918 -3.592  -6.858  0.02 31.05 ? 318 TYR A H    1  
ATOM   4963   H HA   . TYR A 1 325 ? -38.976 -4.571  -5.582  0.02 31.75 ? 318 TYR A HA   1  
ATOM   4964   H HB2  . TYR A 1 325 ? -40.329 -2.602  -5.651  0.02 32.17 ? 318 TYR A HB2  1  
ATOM   4965   H HB3  . TYR A 1 325 ? -39.167 -2.448  -4.580  0.02 32.25 ? 318 TYR A HB3  1  
ATOM   4966   H HD1  . TYR A 1 325 ? -37.261 -0.988  -5.104  0.02 31.81 ? 318 TYR A HD1  1  
ATOM   4967   H HD2  . TYR A 1 325 ? -40.357 -1.182  -7.619  0.02 31.73 ? 318 TYR A HD2  1  
ATOM   4968   H HE1  . TYR A 1 325 ? -36.495 0.903   -6.183  0.02 31.57 ? 318 TYR A HE1  1  
ATOM   4969   H HE2  . TYR A 1 325 ? -39.592 0.725   -8.711  0.02 31.46 ? 318 TYR A HE2  1  
ATOM   4970   H HH   . TYR A 1 325 ? -36.858 2.444   -7.786  0.02 31.39 ? 318 TYR A HH   1  
ATOM   4971   N N    . GLN A 1 326 ? -40.281 -4.543  -7.797  0.02 31.41 ? 319 GLN A N    1  
ATOM   4972   C CA   . GLN A 1 326 ? -40.685 -4.838  -9.168  0.02 31.15 ? 319 GLN A CA   1  
ATOM   4973   C C    . GLN A 1 326 ? -41.910 -4.007  -9.550  0.02 31.43 ? 319 GLN A C    1  
ATOM   4974   O O    . GLN A 1 326 ? -42.989 -4.180  -8.989  0.02 31.88 ? 319 GLN A O    1  
ATOM   4975   C CB   . GLN A 1 326 ? -40.911 -6.350  -9.373  0.02 31.10 ? 319 GLN A CB   1  
ATOM   4976   C CG   . GLN A 1 326 ? -42.268 -6.965  -9.038  0.02 31.57 ? 319 GLN A CG   1  
ATOM   4977   C CD   . GLN A 1 326 ? -42.740 -7.980  -10.091 0.02 31.47 ? 319 GLN A CD   1  
ATOM   4978   O OE1  . GLN A 1 326 ? -42.100 -8.180  -11.124 0.02 31.04 ? 319 GLN A OE1  1  
ATOM   4979   N NE2  . GLN A 1 326 ? -43.877 -8.624  -9.811  0.02 31.91 ? 319 GLN A NE2  1  
ATOM   4980   H H    . GLN A 1 326 ? -40.866 -4.745  -7.203  0.02 31.71 ? 319 GLN A H    1  
ATOM   4981   H HA   . GLN A 1 326 ? -39.971 -4.577  -9.768  0.02 30.83 ? 319 GLN A HA   1  
ATOM   4982   H HB2  . GLN A 1 326 ? -40.738 -6.545  -10.309 0.02 30.84 ? 319 GLN A HB2  1  
ATOM   4983   H HB3  . GLN A 1 326 ? -40.262 -6.822  -8.829  0.02 31.04 ? 319 GLN A HB3  1  
ATOM   4984   H HG2  . GLN A 1 326 ? -42.185 -7.448  -8.202  0.02 31.80 ? 319 GLN A HG2  1  
ATOM   4985   H HG3  . GLN A 1 326 ? -42.953 -6.295  -8.965  0.02 31.75 ? 319 GLN A HG3  1  
ATOM   4986   H HE21 . GLN A 1 326 ? -44.400 -8.321  -9.204  0.02 32.19 ? 319 GLN A HE21 1  
ATOM   4987   H HE22 . GLN A 1 326 ? -44.088 -9.338  -10.242 0.02 31.93 ? 319 GLN A HE22 1  
ATOM   4988   N N    . THR A 1 327 ? -41.735 -3.119  -10.519 0.02 31.20 ? 320 THR A N    1  
ATOM   4989   C CA   . THR A 1 327 ? -42.798 -2.238  -11.000 0.02 31.45 ? 320 THR A CA   1  
ATOM   4990   C C    . THR A 1 327 ? -43.145 -2.558  -12.456 0.02 31.21 ? 320 THR A C    1  
ATOM   4991   O O    . THR A 1 327 ? -42.838 -3.640  -12.945 0.02 30.98 ? 320 THR A O    1  
ATOM   4992   C CB   . THR A 1 327 ? -42.376 -0.782  -10.848 0.02 31.48 ? 320 THR A CB   1  
ATOM   4993   O OG1  . THR A 1 327 ? -43.537 0.050   -10.949 0.02 31.83 ? 320 THR A OG1  1  
ATOM   4994   C CG2  . THR A 1 327 ? -41.337 -0.423  -11.910 0.02 30.98 ? 320 THR A CG2  1  
ATOM   4995   H H    . THR A 1 327 ? -40.985 -3.004  -10.922 0.02 30.91 ? 320 THR A H    1  
ATOM   4996   H HA   . THR A 1 327 ? -43.595 -2.370  -10.464 0.02 31.80 ? 320 THR A HA   1  
ATOM   4997   H HB   . THR A 1 327 ? -41.969 -0.656  -9.976  0.02 31.62 ? 320 THR A HB   1  
ATOM   4998   H HG1  . THR A 1 327 ? -44.207 -0.349  -10.636 0.02 32.07 ? 320 THR A HG1  1  
ATOM   4999   H HG21 . THR A 1 327 ? -40.711 0.231   -11.558 0.02 30.98 ? 320 THR A HG21 1  
ATOM   5000   H HG22 . THR A 1 327 ? -40.847 -1.221  -12.172 0.02 30.74 ? 320 THR A HG22 1  
ATOM   5001   H HG23 . THR A 1 327 ? -41.771 -0.055  -12.697 0.02 30.94 ? 320 THR A HG23 1  
ATOM   5002   N N    . ALA A 1 328 ? -43.779 -1.577  -13.123 0.02 31.29 ? 321 ALA A N    1  
ATOM   5003   C CA   . ALA A 1 328 ? -44.309 -1.695  -14.488 0.02 31.17 ? 321 ALA A CA   1  
ATOM   5004   C C    . ALA A 1 328 ? -43.595 -2.739  -15.330 0.02 30.71 ? 321 ALA A C    1  
ATOM   5005   O O    . ALA A 1 328 ? -44.202 -3.738  -15.741 0.02 30.74 ? 321 ALA A O    1  
ATOM   5006   C CB   . ALA A 1 328 ? -44.238 -0.338  -15.196 0.02 31.15 ? 321 ALA A CB   1  
ATOM   5007   H H    . ALA A 1 328 ? -43.925 -0.799  -12.789 0.02 31.45 ? 321 ALA A H    1  
ATOM   5008   H HA   . ALA A 1 328 ? -45.245 -1.946  -14.446 0.02 31.44 ? 321 ALA A HA   1  
ATOM   5009   H HB1  . ALA A 1 328 ? -44.430 -0.480  -16.137 0.02 31.05 ? 321 ALA A HB1  1  
ATOM   5010   H HB2  . ALA A 1 328 ? -44.889 0.270   -14.812 0.02 31.48 ? 321 ALA A HB2  1  
ATOM   5011   H HB3  . ALA A 1 328 ? -43.340 0.021   -15.098 0.02 30.93 ? 321 ALA A HB3  1  
ATOM   5012   N N    . ASP A 1 329 ? -42.316 -2.504  -15.639 0.02 30.32 ? 322 ASP A N    1  
ATOM   5013   C CA   . ASP A 1 329 ? -41.621 -3.208  -16.715 0.02 29.91 ? 322 ASP A CA   1  
ATOM   5014   C C    . ASP A 1 329 ? -40.444 -4.073  -16.232 0.02 29.65 ? 322 ASP A C    1  
ATOM   5015   O O    . ASP A 1 329 ? -39.440 -4.171  -16.949 0.02 29.30 ? 322 ASP A O    1  
ATOM   5016   C CB   . ASP A 1 329 ? -41.096 -2.200  -17.740 0.02 29.69 ? 322 ASP A CB   1  
ATOM   5017   C CG   . ASP A 1 329 ? -41.041 -2.772  -19.157 0.02 29.49 ? 322 ASP A CG   1  
ATOM   5018   O OD1  . ASP A 1 329 ? -41.924 -2.386  -19.974 0.02 29.69 ? 322 ASP A OD1  1  
ATOM   5019   O OD2  . ASP A 1 329 ? -40.149 -3.606  -19.477 0.02 29.15 ? 322 ASP A OD2  1  
ATOM   5020   H H    . ASP A 1 329 ? -41.824 -1.928  -15.230 0.02 30.32 ? 322 ASP A H    1  
ATOM   5021   H HA   . ASP A 1 329 ? -42.253 -3.783  -17.176 0.02 29.96 ? 322 ASP A HA   1  
ATOM   5022   H HB2  . ASP A 1 329 ? -41.681 -1.426  -17.757 0.02 29.90 ? 322 ASP A HB2  1  
ATOM   5023   H HB3  . ASP A 1 329 ? -40.201 -1.925  -17.487 0.02 29.51 ? 322 ASP A HB3  1  
ATOM   5024   N N    . CYS A 1 330 ? -40.543 -4.700  -15.057 0.02 29.84 ? 323 CYS A N    1  
ATOM   5025   C CA   . CYS A 1 330 ? -39.390 -5.389  -14.470 0.02 29.65 ? 323 CYS A CA   1  
ATOM   5026   C C    . CYS A 1 330 ? -38.909 -6.554  -15.339 0.02 29.32 ? 323 CYS A C    1  
ATOM   5027   O O    . CYS A 1 330 ? -39.696 -7.158  -16.060 0.02 29.37 ? 323 CYS A O    1  
ATOM   5028   C CB   . CYS A 1 330 ? -39.744 -5.927  -13.079 0.02 29.98 ? 323 CYS A CB   1  
ATOM   5029   S SG   . CYS A 1 330 ? -38.283 -6.188  -12.104 0.02 29.86 ? 323 CYS A SG   1  
ATOM   5030   H H    . CYS A 1 330 ? -41.259 -4.743  -14.585 0.02 30.11 ? 323 CYS A H    1  
ATOM   5031   H HA   . CYS A 1 330 ? -38.658 -4.765  -14.369 0.02 29.55 ? 323 CYS A HA   1  
ATOM   5032   H HB2  . CYS A 1 330 ? -40.312 -5.293  -12.616 0.02 30.24 ? 323 CYS A HB2  1  
ATOM   5033   H HB3  . CYS A 1 330 ? -40.198 -6.777  -13.168 0.02 30.03 ? 323 CYS A HB3  1  
ATOM   5034   H HG   . CYS A 1 330 ? -37.945 -5.243  -11.454 0.02 29.92 ? 323 CYS A HG   1  
ATOM   5035   N N    . VAL A 1 331 ? -37.622 -6.888  -15.206 0.02 29.04 ? 324 VAL A N    1  
ATOM   5036   C CA   . VAL A 1 331 ? -36.965 -7.919  -16.017 0.02 28.76 ? 324 VAL A CA   1  
ATOM   5037   C C    . VAL A 1 331 ? -36.144 -8.881  -15.159 0.02 28.77 ? 324 VAL A C    1  
ATOM   5038   O O    . VAL A 1 331 ? -36.019 -10.054 -15.507 0.02 28.72 ? 324 VAL A O    1  
ATOM   5039   C CB   . VAL A 1 331 ? -36.078 -7.278  -17.115 0.02 28.43 ? 324 VAL A CB   1  
ATOM   5040   C CG1  . VAL A 1 331 ? -34.834 -6.755  -16.513 0.02 28.34 ? 324 VAL A CG1  1  
ATOM   5041   C CG2  . VAL A 1 331 ? -35.718 -8.276  -18.208 0.02 28.20 ? 324 VAL A CG2  1  
ATOM   5042   H H    . VAL A 1 331 ? -37.092 -6.521  -14.638 0.02 29.04 ? 324 VAL A H    1  
ATOM   5043   H HA   . VAL A 1 331 ? -37.642 -8.448  -16.464 0.02 28.80 ? 324 VAL A HA   1  
ATOM   5044   H HB   . VAL A 1 331 ? -36.543 -6.536  -17.535 0.02 28.45 ? 324 VAL A HB   1  
ATOM   5045   H HG11 . VAL A 1 331 ? -35.004 -6.525  -15.587 0.02 28.52 ? 324 VAL A HG11 1  
ATOM   5046   H HG12 . VAL A 1 331 ? -34.145 -7.435  -16.573 0.02 28.19 ? 324 VAL A HG12 1  
ATOM   5047   H HG13 . VAL A 1 331 ? -34.568 -5.962  -17.004 0.02 28.29 ? 324 VAL A HG13 1  
ATOM   5048   H HG21 . VAL A 1 331 ? -36.526 -8.712  -18.518 0.02 28.28 ? 324 VAL A HG21 1  
ATOM   5049   H HG22 . VAL A 1 331 ? -35.298 -7.798  -18.939 0.02 28.02 ? 324 VAL A HG22 1  
ATOM   5050   H HG23 . VAL A 1 331 ? -35.099 -8.930  -17.845 0.02 28.17 ? 324 VAL A HG23 1  
ATOM   5051   N N    . LEU A 1 332 ? -35.561 -8.413  -14.039 0.02 28.87 ? 325 LEU A N    1  
ATOM   5052   C CA   . LEU A 1 332 ? -34.792 -9.269  -13.128 0.02 28.92 ? 325 LEU A CA   1  
ATOM   5053   C C    . LEU A 1 332 ? -35.270 -9.020  -11.699 0.02 29.30 ? 325 LEU A C    1  
ATOM   5054   O O    . LEU A 1 332 ? -34.593 -8.328  -10.922 0.02 29.37 ? 325 LEU A O    1  
ATOM   5055   C CB   . LEU A 1 332 ? -33.278 -9.034  -13.247 0.02 28.67 ? 325 LEU A CB   1  
ATOM   5056   C CG   . LEU A 1 332 ? -32.586 -8.933  -14.627 0.02 28.33 ? 325 LEU A CG   1  
ATOM   5057   C CD1  . LEU A 1 332 ? -31.088 -8.855  -14.460 0.02 28.18 ? 325 LEU A CD1  1  
ATOM   5058   C CD2  . LEU A 1 332 ? -32.909 -10.078 -15.671 0.02 28.19 ? 325 LEU A CD2  1  
ATOM   5059   H H    . LEU A 1 332 ? -35.600 -7.595  -13.786 0.02 28.94 ? 325 LEU A H    1  
ATOM   5060   H HA   . LEU A 1 332 ? -34.964 -10.200 -13.340 0.02 28.92 ? 325 LEU A HA   1  
ATOM   5061   H HB2  . LEU A 1 332 ? -33.076 -8.207  -12.784 0.02 28.74 ? 325 LEU A HB2  1  
ATOM   5062   H HB3  . LEU A 1 332 ? -32.839 -9.757  -12.774 0.02 28.71 ? 325 LEU A HB3  1  
ATOM   5063   H HG   . LEU A 1 332 ? -32.862 -8.093  -15.020 0.02 28.30 ? 325 LEU A HG   1  
ATOM   5064   H HD11 . LEU A 1 332 ? -30.806 -9.518  -13.812 0.02 28.25 ? 325 LEU A HD11 1  
ATOM   5065   H HD12 . LEU A 1 332 ? -30.667 -9.028  -15.316 0.02 27.99 ? 325 LEU A HD12 1  
ATOM   5066   H HD13 . LEU A 1 332 ? -30.851 -7.969  -14.144 0.02 28.25 ? 325 LEU A HD13 1  
ATOM   5067   H HD21 . LEU A 1 332 ? -33.830 -10.355 -15.580 0.02 28.34 ? 325 LEU A HD21 1  
ATOM   5068   H HD22 . LEU A 1 332 ? -32.747 -9.743  -16.569 0.02 28.02 ? 325 LEU A HD22 1  
ATOM   5069   H HD23 . LEU A 1 332 ? -32.328 -10.834 -15.487 0.02 28.16 ? 325 LEU A HD23 1  
ATOM   5070   N N    . PRO A 1 333 ? -36.437 -9.560  -11.317 0.02 29.60 ? 326 PRO A N    1  
ATOM   5071   C CA   . PRO A 1 333 ? -36.864 -9.490  -9.904  0.02 30.01 ? 326 PRO A CA   1  
ATOM   5072   C C    . PRO A 1 333 ? -36.082 -10.398 -8.979  0.02 30.13 ? 326 PRO A C    1  
ATOM   5073   O O    . PRO A 1 333 ? -36.291 -10.343 -7.754  0.02 30.49 ? 326 PRO A O    1  
ATOM   5074   C CB   . PRO A 1 333 ? -38.330 -9.930  -9.961  0.02 30.31 ? 326 PRO A CB   1  
ATOM   5075   C CG   . PRO A 1 333 ? -38.403 -10.806 -11.098 0.02 30.07 ? 326 PRO A CG   1  
ATOM   5076   C CD   . PRO A 1 333 ? -37.507 -10.127 -12.147 0.02 29.62 ? 326 PRO A CD   1  
ATOM   5077   H HA   . PRO A 1 333 ? -36.819 -8.578  -9.580  0.02 30.07 ? 326 PRO A HA   1  
ATOM   5078   H HB2  . PRO A 1 333 ? -38.562 -10.402 -9.150  0.02 30.58 ? 326 PRO A HB2  1  
ATOM   5079   H HB3  . PRO A 1 333 ? -38.897 -9.155  -10.092 0.02 30.40 ? 326 PRO A HB3  1  
ATOM   5080   H HG2  . PRO A 1 333 ? -38.056 -11.681 -10.860 0.02 30.10 ? 326 PRO A HG2  1  
ATOM   5081   H HG3  . PRO A 1 333 ? -39.322 -10.871 -11.403 0.02 30.20 ? 326 PRO A HG3  1  
ATOM   5082   H HD2  . PRO A 1 333 ? -37.148 -10.777 -12.758 0.02 29.44 ? 326 PRO A HD2  1  
ATOM   5083   H HD3  . PRO A 1 333 ? -37.992 -9.428  -12.615 0.02 29.59 ? 326 PRO A HD3  1  
ATOM   5084   N N    . LYS A 1 334 ? -35.174 -11.204 -9.513  0.02 29.88 ? 327 LYS A N    1  
ATOM   5085   C CA   . LYS A 1 334 ? -34.496 -12.222 -8.735  0.02 30.01 ? 327 LYS A CA   1  
ATOM   5086   C C    . LYS A 1 334 ? -33.155 -12.526 -9.359  0.02 29.66 ? 327 LYS A C    1  
ATOM   5087   O O    . LYS A 1 334 ? -32.892 -12.197 -10.527 0.02 29.32 ? 327 LYS A O    1  
ATOM   5088   C CB   . LYS A 1 334 ? -35.343 -13.483 -8.613  0.02 30.31 ? 327 LYS A CB   1  
ATOM   5089   C CG   . LYS A 1 334 ? -36.297 -13.303 -7.475  0.02 30.78 ? 327 LYS A CG   1  
ATOM   5090   C CD   . LYS A 1 334 ? -36.893 -14.604 -7.039  0.02 31.15 ? 327 LYS A CD   1  
ATOM   5091   C CE   . LYS A 1 334 ? -36.706 -14.851 -5.541  0.02 31.49 ? 327 LYS A CE   1  
ATOM   5092   N NZ   . LYS A 1 334 ? -38.020 -15.090 -4.985  0.02 32.01 ? 327 LYS A NZ   1  
ATOM   5093   H H    . LYS A 1 334 ? -34.925 -11.176 -10.334 0.02 29.64 ? 327 LYS A H    1  
ATOM   5094   H HA   . LYS A 1 334 ? -34.328 -11.880 -7.844  0.02 30.18 ? 327 LYS A HA   1  
ATOM   5095   H HB2  . LYS A 1 334 ? -35.858 -13.623 -9.420  0.02 30.21 ? 327 LYS A HB2  1  
ATOM   5096   H HB3  . LYS A 1 334 ? -34.772 -14.247 -8.444  0.02 30.35 ? 327 LYS A HB3  1  
ATOM   5097   H HG2  . LYS A 1 334 ? -35.821 -12.907 -6.729  0.02 30.88 ? 327 LYS A HG2  1  
ATOM   5098   H HG3  . LYS A 1 334 ? -37.016 -12.717 -7.758  0.02 30.78 ? 327 LYS A HG3  1  
ATOM   5099   H HD2  . LYS A 1 334 ? -37.845 -14.585 -7.222  0.02 31.37 ? 327 LYS A HD2  1  
ATOM   5100   H HD3  . LYS A 1 334 ? -36.476 -15.331 -7.525  0.02 31.00 ? 327 LYS A HD3  1  
ATOM   5101   H HE2  . LYS A 1 334 ? -36.159 -15.640 -5.394  0.02 31.43 ? 327 LYS A HE2  1  
ATOM   5102   H HE3  . LYS A 1 334 ? -36.324 -14.078 -5.093  0.02 31.46 ? 327 LYS A HE3  1  
ATOM   5103   H HZ1  . LYS A 1 334 ? -38.404 -14.316 -4.771  0.02 32.16 ? 327 LYS A HZ1  1  
ATOM   5104   H HZ2  . LYS A 1 334 ? -38.531 -15.517 -5.575  0.02 32.03 ? 327 LYS A HZ2  1  
ATOM   5105   H HZ3  . LYS A 1 334 ? -37.946 -15.590 -4.251  0.02 32.21 ? 327 LYS A HZ3  1  
ATOM   5106   N N    . HIS A 1 335 ? -32.316 -13.174 -8.561  0.02 29.77 ? 328 HIS A N    1  
ATOM   5107   C CA   . HIS A 1 335 ? -30.930 -13.392 -8.948  0.02 29.51 ? 328 HIS A CA   1  
ATOM   5108   C C    . HIS A 1 335 ? -30.850 -14.327 -10.153 0.02 29.27 ? 328 HIS A C    1  
ATOM   5109   O O    . HIS A 1 335 ? -31.743 -15.157 -10.358 0.02 29.36 ? 328 HIS A O    1  
ATOM   5110   C CB   . HIS A 1 335 ? -30.143 -13.973 -7.780  0.02 29.75 ? 328 HIS A CB   1  
ATOM   5111   C CG   . HIS A 1 335 ? -30.301 -13.204 -6.495  0.02 30.05 ? 328 HIS A CG   1  
ATOM   5112   N ND1  . HIS A 1 335 ? -29.386 -12.263 -6.073  0.02 30.02 ? 328 HIS A ND1  1  
ATOM   5113   C CD2  . HIS A 1 335 ? -31.270 -13.234 -5.548  0.02 30.44 ? 328 HIS A CD2  1  
ATOM   5114   C CE1  . HIS A 1 335 ? -29.773 -11.759 -4.917  0.02 30.36 ? 328 HIS A CE1  1  
ATOM   5115   N NE2  . HIS A 1 335 ? -30.912 -12.333 -4.574  0.02 30.62 ? 328 HIS A NE2  1  
ATOM   5116   H H    . HIS A 1 335 ? -32.530 -13.504 -7.803  0.02 30.02 ? 328 HIS A H    1  
ATOM   5117   H HA   . HIS A 1 335 ? -30.525 -12.544 -9.189  0.02 29.36 ? 328 HIS A HA   1  
ATOM   5118   H HB2  . HIS A 1 335 ? -30.455 -14.879 -7.631  0.02 29.91 ? 328 HIS A HB2  1  
ATOM   5119   H HB3  . HIS A 1 335 ? -29.201 -13.984 -8.009  0.02 29.60 ? 328 HIS A HB3  1  
ATOM   5120   H HD2  . HIS A 1 335 ? -32.029 -13.773 -5.550  0.02 30.58 ? 328 HIS A HD2  1  
ATOM   5121   H HE1  . HIS A 1 335 ? -29.319 -11.108 -4.433  0.02 30.43 ? 328 HIS A HE1  1  
ATOM   5122   H HE2  . HIS A 1 335 ? -31.364 -12.160 -3.865  0.02 30.88 ? 328 HIS A HE2  1  
ATOM   5123   N N    . PRO A 1 336 ? -29.794 -14.236 -10.971 0.02 29.00 ? 329 PRO A N    1  
ATOM   5124   C CA   . PRO A 1 336 ? -29.746 -15.122 -12.146 0.02 28.81 ? 329 PRO A CA   1  
ATOM   5125   C C    . PRO A 1 336 ? -30.069 -16.588 -11.854 0.02 29.03 ? 329 PRO A C    1  
ATOM   5126   O O    . PRO A 1 336 ? -30.999 -17.081 -12.500 0.02 29.05 ? 329 PRO A O    1  
ATOM   5127   C CB   . PRO A 1 336 ? -28.322 -14.903 -12.669 0.02 28.53 ? 329 PRO A CB   1  
ATOM   5128   C CG   . PRO A 1 336 ? -27.532 -14.462 -11.442 0.02 28.63 ? 329 PRO A CG   1  
ATOM   5129   C CD   . PRO A 1 336 ? -28.540 -13.459 -10.877 0.02 28.85 ? 329 PRO A CD   1  
ATOM   5130   H HA   . PRO A 1 336 ? -30.369 -14.798 -12.814 0.02 28.73 ? 329 PRO A HA   1  
ATOM   5131   H HB2  . PRO A 1 336 ? -28.025 -15.706 -13.083 0.02 28.51 ? 329 PRO A HB2  1  
ATOM   5132   H HB3  . PRO A 1 336 ? -28.336 -14.181 -13.312 0.02 28.35 ? 329 PRO A HB3  1  
ATOM   5133   H HG2  . PRO A 1 336 ? -27.398 -15.209 -10.835 0.02 28.74 ? 329 PRO A HG2  1  
ATOM   5134   H HG3  . PRO A 1 336 ? -26.693 -14.052 -11.710 0.02 28.46 ? 329 PRO A HG3  1  
ATOM   5135   H HD2  . PRO A 1 336 ? -28.331 -13.210 -9.968  0.02 29.03 ? 329 PRO A HD2  1  
ATOM   5136   H HD3  . PRO A 1 336 ? -28.586 -12.683 -11.453 0.02 28.75 ? 329 PRO A HD3  1  
ATOM   5137   N N    . ARG A 1 337 ? -29.425 -17.267 -10.873 0.02 29.24 ? 330 ARG A N    1  
ATOM   5138   C CA   . ARG A 1 337 ? -29.629 -18.711 -10.711 0.02 29.48 ? 330 ARG A CA   1  
ATOM   5139   C C    . ARG A 1 337 ? -31.092 -19.047 -10.472 0.02 29.73 ? 330 ARG A C    1  
ATOM   5140   O O    . ARG A 1 337 ? -31.579 -20.093 -10.928 0.02 29.83 ? 330 ARG A O    1  
ATOM   5141   C CB   . ARG A 1 337 ? -28.789 -19.278 -9.561  0.02 29.76 ? 330 ARG A CB   1  
ATOM   5142   C CG   . ARG A 1 337 ? -27.278 -19.279 -9.704  0.02 29.62 ? 330 ARG A CG   1  
ATOM   5143   C CD   . ARG A 1 337 ? -26.664 -20.122 -8.554  0.02 29.98 ? 330 ARG A CD   1  
ATOM   5144   N NE   . ARG A 1 337 ? -27.672 -20.436 -7.535  0.02 30.35 ? 330 ARG A NE   1  
ATOM   5145   C CZ   . ARG A 1 337 ? -28.061 -21.654 -7.159  0.02 30.70 ? 330 ARG A CZ   1  
ATOM   5146   N NH1  . ARG A 1 337 ? -27.546 -22.756 -7.703  0.02 30.76 ? 330 ARG A NH1  1  
ATOM   5147   N NH2  . ARG A 1 337 ? -29.006 -21.762 -6.234  0.02 31.04 ? 330 ARG A NH2  1  
ATOM   5148   H H    . ARG A 1 337 ? -28.870 -16.924 -10.314 0.02 29.27 ? 330 ARG A H    1  
ATOM   5149   H HA   . ARG A 1 337 ? -29.361 -19.153 -11.531 0.02 29.33 ? 330 ARG A HA   1  
ATOM   5150   H HB2  . ARG A 1 337 ? -29.007 -18.783 -8.758  0.02 29.92 ? 330 ARG A HB2  1  
ATOM   5151   H HB3  . ARG A 1 337 ? -29.061 -20.201 -9.451  0.02 29.93 ? 330 ARG A HB3  1  
ATOM   5152   H HG2  . ARG A 1 337 ? -27.036 -19.685 -10.549 0.02 29.41 ? 330 ARG A HG2  1  
ATOM   5153   H HG3  . ARG A 1 337 ? -26.932 -18.379 -9.646  0.02 29.57 ? 330 ARG A HG3  1  
ATOM   5154   H HD2  . ARG A 1 337 ? -26.296 -20.948 -8.908  0.02 29.98 ? 330 ARG A HD2  1  
ATOM   5155   H HD3  . ARG A 1 337 ? -25.965 -19.605 -8.128  0.02 30.00 ? 330 ARG A HD3  1  
ATOM   5156   H HE   . ARG A 1 337 ? -27.972 -19.779 -7.068  0.02 30.37 ? 330 ARG A HE   1  
ATOM   5157   H HH11 . ARG A 1 337 ? -26.938 -22.698 -8.305  0.02 30.56 ? 330 ARG A HH11 1  
ATOM   5158   H HH12 . ARG A 1 337 ? -27.816 -23.528 -7.442  0.02 31.02 ? 330 ARG A HH12 1  
ATOM   5159   H HH21 . ARG A 1 337 ? -29.343 -21.052 -5.884  0.02 31.02 ? 330 ARG A HH21 1  
ATOM   5160   H HH22 . ARG A 1 337 ? -29.270 -22.538 -5.975  0.02 31.31 ? 330 ARG A HH22 1  
ATOM   5161   N N    . GLU A 1 338 ? -31.809 -18.176 -9.752  0.02 29.86 ? 331 GLU A N    1  
ATOM   5162   C CA   . GLU A 1 338 ? -33.211 -18.427 -9.440  0.02 30.17 ? 331 GLU A CA   1  
ATOM   5163   C C    . GLU A 1 338 ? -34.117 -18.243 -10.658 0.02 30.02 ? 331 GLU A C    1  
ATOM   5164   O O    . GLU A 1 338 ? -35.142 -18.910 -10.779 0.02 30.27 ? 331 GLU A O    1  
ATOM   5165   C CB   . GLU A 1 338 ? -33.655 -17.519 -8.273  0.02 30.40 ? 331 GLU A CB   1  
ATOM   5166   C CG   . GLU A 1 338 ? -33.558 -18.168 -6.915  0.02 30.80 ? 331 GLU A CG   1  
ATOM   5167   C CD   . GLU A 1 338 ? -34.418 -19.427 -6.790  0.02 31.20 ? 331 GLU A CD   1  
ATOM   5168   O OE1  . GLU A 1 338 ? -35.657 -19.314 -6.904  0.02 31.43 ? 331 GLU A OE1  1  
ATOM   5169   O OE2  . GLU A 1 338 ? -33.857 -20.530 -6.586  0.02 31.32 ? 331 GLU A OE2  1  
ATOM   5170   H H    . GLU A 1 338 ? -31.501 -17.443 -9.431  0.02 29.80 ? 331 GLU A H    1  
ATOM   5171   H HA   . GLU A 1 338 ? -33.295 -19.350 -9.157  0.02 30.40 ? 331 GLU A HA   1  
ATOM   5172   H HB2  . GLU A 1 338 ? -33.087 -16.732 -8.250  0.02 30.20 ? 331 GLU A HB2  1  
ATOM   5173   H HB3  . GLU A 1 338 ? -34.578 -17.248 -8.406  0.02 30.52 ? 331 GLU A HB3  1  
ATOM   5174   H HG2  . GLU A 1 338 ? -32.633 -18.411 -6.748  0.02 30.71 ? 331 GLU A HG2  1  
ATOM   5175   H HG3  . GLU A 1 338 ? -33.864 -17.535 -6.247  0.02 30.94 ? 331 GLU A HG3  1  
ATOM   5176   N N    . MET A 1 339 ? -33.770 -17.356 -11.583 0.02 29.65 ? 332 MET A N    1  
ATOM   5177   C CA   . MET A 1 339 ? -34.615 -17.216 -12.773 0.02 29.56 ? 332 MET A CA   1  
ATOM   5178   C C    . MET A 1 339 ? -34.485 -18.389 -13.738 0.02 29.45 ? 332 MET A C    1  
ATOM   5179   O O    . MET A 1 339 ? -35.365 -18.620 -14.569 0.02 29.46 ? 332 MET A O    1  
ATOM   5180   C CB   . MET A 1 339 ? -34.266 -15.928 -13.466 0.02 29.27 ? 332 MET A CB   1  
ATOM   5181   C CG   . MET A 1 339 ? -34.550 -14.788 -12.523 0.02 29.33 ? 332 MET A CG   1  
ATOM   5182   S SD   . MET A 1 339 ? -36.184 -14.108 -12.780 0.02 29.52 ? 332 MET A SD   1  
ATOM   5183   C CE   . MET A 1 339 ? -35.933 -12.913 -14.060 0.02 29.06 ? 332 MET A CE   1  
ATOM   5184   H H    . MET A 1 339 ? -33.088 -16.835 -11.547 0.02 29.47 ? 332 MET A H    1  
ATOM   5185   H HA   . MET A 1 339 ? -35.539 -17.148 -12.484 0.02 29.83 ? 332 MET A HA   1  
ATOM   5186   H HB2  . MET A 1 339 ? -33.322 -15.926 -13.689 0.02 29.02 ? 332 MET A HB2  1  
ATOM   5187   H HB3  . MET A 1 339 ? -34.816 -15.834 -14.259 0.02 29.32 ? 332 MET A HB3  1  
ATOM   5188   H HG2  . MET A 1 339 ? -34.535 -15.120 -11.614 0.02 29.53 ? 332 MET A HG2  1  
ATOM   5189   H HG3  . MET A 1 339 ? -33.884 -14.097 -12.633 0.02 29.11 ? 332 MET A HG3  1  
ATOM   5190   H HE1  . MET A 1 339 ? -35.027 -12.570 -14.024 0.02 28.88 ? 332 MET A HE1  1  
ATOM   5191   H HE2  . MET A 1 339 ? -36.090 -13.344 -14.914 0.02 29.07 ? 332 MET A HE2  1  
ATOM   5192   H HE3  . MET A 1 339 ? -36.578 -12.203 -13.951 0.02 29.03 ? 332 MET A HE3  1  
ATOM   5193   N N    . VAL A 1 340 ? -33.412 -19.158 -13.640 0.02 29.40 ? 333 VAL A N    1  
ATOM   5194   C CA   . VAL A 1 340 ? -33.298 -20.349 -14.480 0.02 29.41 ? 333 VAL A CA   1  
ATOM   5195   C C    . VAL A 1 340 ? -34.426 -21.350 -14.210 0.02 29.83 ? 333 VAL A C    1  
ATOM   5196   O O    . VAL A 1 340 ? -34.543 -22.346 -14.915 0.02 29.92 ? 333 VAL A O    1  
ATOM   5197   C CB   . VAL A 1 340 ? -31.913 -20.992 -14.257 0.02 29.35 ? 333 VAL A CB   1  
ATOM   5198   C CG1  . VAL A 1 340 ? -31.744 -22.254 -15.100 0.02 29.40 ? 333 VAL A CG1  1  
ATOM   5199   C CG2  . VAL A 1 340 ? -30.807 -20.003 -14.567 0.02 29.00 ? 333 VAL A CG2  1  
ATOM   5200   H H    . VAL A 1 340 ? -32.747 -19.008 -13.114 0.02 29.37 ? 333 VAL A H    1  
ATOM   5201   H HA   . VAL A 1 340 ? -33.359 -20.082 -15.410 0.02 29.21 ? 333 VAL A HA   1  
ATOM   5202   H HB   . VAL A 1 340 ? -31.835 -21.236 -13.321 0.02 29.57 ? 333 VAL A HB   1  
ATOM   5203   H HG11 . VAL A 1 340 ? -30.809 -22.508 -15.110 0.02 29.33 ? 333 VAL A HG11 1  
ATOM   5204   H HG12 . VAL A 1 340 ? -32.269 -22.965 -14.706 0.02 29.69 ? 333 VAL A HG12 1  
ATOM   5205   H HG13 . VAL A 1 340 ? -32.047 -22.072 -16.003 0.02 29.26 ? 333 VAL A HG13 1  
ATOM   5206   H HG21 . VAL A 1 340 ? -30.478 -19.637 -13.733 0.02 29.06 ? 333 VAL A HG21 1  
ATOM   5207   H HG22 . VAL A 1 340 ? -30.089 -20.457 -15.033 0.02 28.90 ? 333 VAL A HG22 1  
ATOM   5208   H HG23 . VAL A 1 340 ? -31.167 -19.292 -15.119 0.02 28.84 ? 333 VAL A HG23 1  
ATOM   5209   N N    . LYS A 1 341 ? -35.304 -21.076 -13.222 0.02 30.14 ? 334 LYS A N    1  
ATOM   5210   C CA   . LYS A 1 341 ? -36.190 -22.100 -12.672 0.02 30.62 ? 334 LYS A CA   1  
ATOM   5211   C C    . LYS A 1 341 ? -37.426 -22.361 -13.513 0.02 30.75 ? 334 LYS A C    1  
ATOM   5212   O O    . LYS A 1 341 ? -37.789 -23.521 -13.744 0.02 30.97 ? 334 LYS A O    1  
ATOM   5213   C CB   . LYS A 1 341 ? -36.633 -21.672 -11.294 0.02 30.95 ? 334 LYS A CB   1  
ATOM   5214   C CG   . LYS A 1 341 ? -35.552 -21.800 -10.300 0.02 30.95 ? 334 LYS A CG   1  
ATOM   5215   C CD   . LYS A 1 341 ? -35.829 -22.918 -9.352  0.02 31.44 ? 334 LYS A CD   1  
ATOM   5216   C CE   . LYS A 1 341 ? -35.359 -22.583 -7.994  0.02 31.63 ? 334 LYS A CE   1  
ATOM   5217   N NZ   . LYS A 1 341 ? -33.937 -22.179 -8.039  0.02 31.30 ? 334 LYS A NZ   1  
ATOM   5218   H H    . LYS A 1 341 ? -35.406 -20.313 -12.846 0.02 30.10 ? 334 LYS A H    1  
ATOM   5219   H HA   . LYS A 1 341 ? -35.697 -22.922 -12.596 0.02 30.70 ? 334 LYS A HA   1  
ATOM   5220   H HB2  . LYS A 1 341 ? -36.907 -20.742 -11.326 0.02 30.85 ? 334 LYS A HB2  1  
ATOM   5221   H HB3  . LYS A 1 341 ? -37.380 -22.233 -11.028 0.02 31.29 ? 334 LYS A HB3  1  
ATOM   5222   H HG2  . LYS A 1 341 ? -34.717 -21.984 -10.760 0.02 30.69 ? 334 LYS A HG2  1  
ATOM   5223   H HG3  . LYS A 1 341 ? -35.489 -20.985 -9.778  0.02 30.94 ? 334 LYS A HG3  1  
ATOM   5224   H HD2  . LYS A 1 341 ? -36.773 -23.136 -9.308  0.02 31.72 ? 334 LYS A HD2  1  
ATOM   5225   H HD3  . LYS A 1 341 ? -35.312 -23.673 -9.631  0.02 31.39 ? 334 LYS A HD3  1  
ATOM   5226   H HE2  . LYS A 1 341 ? -35.882 -21.846 -7.641  0.02 31.65 ? 334 LYS A HE2  1  
ATOM   5227   H HE3  . LYS A 1 341 ? -35.437 -23.362 -7.420  0.02 31.98 ? 334 LYS A HE3  1  
ATOM   5228   H HZ1  . LYS A 1 341 ? -33.466 -22.774 -8.501  0.02 31.27 ? 334 LYS A HZ1  1  
ATOM   5229   H HZ2  . LYS A 1 341 ? -33.863 -21.384 -8.435  0.02 31.01 ? 334 LYS A HZ2  1  
ATOM   5230   H HZ3  . LYS A 1 341 ? -33.609 -22.127 -7.211  0.02 31.46 ? 334 LYS A HZ3  1  
ATOM   5231   N N    . THR A 1 342 ? -38.152 -21.307 -13.875 0.02 30.68 ? 335 THR A N    1  
ATOM   5232   C CA   . THR A 1 342 ? -39.326 -21.433 -14.727 0.02 30.82 ? 335 THR A CA   1  
ATOM   5233   C C    . THR A 1 342 ? -39.152 -20.663 -16.035 0.02 30.39 ? 335 THR A C    1  
ATOM   5234   O O    . THR A 1 342 ? -40.125 -20.512 -16.776 0.02 30.50 ? 335 THR A O    1  
ATOM   5235   C CB   . THR A 1 342 ? -40.578 -20.937 -13.994 0.02 31.19 ? 335 THR A CB   1  
ATOM   5236   O OG1  . THR A 1 342 ? -41.743 -21.247 -14.785 0.02 31.37 ? 335 THR A OG1  1  
ATOM   5237   C CG2  . THR A 1 342 ? -40.481 -19.416 -13.757 0.02 30.94 ? 335 THR A CG2  1  
ATOM   5238   H H    . THR A 1 342 ? -37.983 -20.502 -13.628 0.02 30.58 ? 335 THR A H    1  
ATOM   5239   H HA   . THR A 1 342 ? -39.464 -22.368 -14.948 0.02 31.01 ? 335 THR A HA   1  
ATOM   5240   H HB   . THR A 1 342 ? -40.651 -21.372 -13.132 0.02 31.50 ? 335 THR A HB   1  
ATOM   5241   H HG1  . THR A 1 342 ? -42.011 -22.026 -14.618 0.02 31.66 ? 335 THR A HG1  1  
ATOM   5242   H HG21 . THR A 1 342 ? -40.849 -19.196 -12.886 0.02 31.16 ? 335 THR A HG21 1  
ATOM   5243   H HG22 . THR A 1 342 ? -39.555 -19.127 -13.781 0.02 30.61 ? 335 THR A HG22 1  
ATOM   5244   H HG23 . THR A 1 342 ? -40.979 -18.937 -14.436 0.02 30.94 ? 335 THR A HG23 1  
ATOM   5245   N N    . ALA A 1 343 ? -37.926 -20.206 -16.320 0.02 29.96 ? 336 ALA A N    1  
ATOM   5246   C CA   . ALA A 1 343 ? -37.597 -19.323 -17.441 0.02 29.56 ? 336 ALA A CA   1  
ATOM   5247   C C    . ALA A 1 343 ? -38.049 -19.905 -18.765 0.02 29.58 ? 336 ALA A C    1  
ATOM   5248   O O    . ALA A 1 343 ? -37.665 -21.023 -19.132 0.02 29.67 ? 336 ALA A O    1  
ATOM   5249   C CB   . ALA A 1 343 ? -36.093 -19.071 -17.467 0.02 29.20 ? 336 ALA A CB   1  
ATOM   5250   H H    . ALA A 1 343 ? -37.234 -20.404 -15.850 0.02 29.92 ? 336 ALA A H    1  
ATOM   5251   H HA   . ALA A 1 343 ? -38.041 -18.469 -17.322 0.02 29.55 ? 336 ALA A HA   1  
ATOM   5252   H HB1  . ALA A 1 343 ? -35.892 -18.344 -16.860 0.02 29.17 ? 336 ALA A HB1  1  
ATOM   5253   H HB2  . ALA A 1 343 ? -35.626 -19.874 -17.197 0.02 29.26 ? 336 ALA A HB2  1  
ATOM   5254   H HB3  . ALA A 1 343 ? -35.829 -18.816 -18.363 0.02 28.97 ? 336 ALA A HB3  1  
ATOM   5255   N N    . TRP A 1 344 ? -38.871 -19.154 -19.489 0.02 29.53 ? 337 TRP A N    1  
ATOM   5256   C CA   . TRP A 1 344 ? -39.384 -19.668 -20.754 0.02 29.59 ? 337 TRP A CA   1  
ATOM   5257   C C    . TRP A 1 344 ? -38.258 -20.088 -21.702 0.02 29.29 ? 337 TRP A C    1  
ATOM   5258   O O    . TRP A 1 344 ? -38.454 -20.975 -22.522 0.02 29.42 ? 337 TRP A O    1  
ATOM   5259   C CB   . TRP A 1 344 ? -40.276 -18.622 -21.410 0.02 29.58 ? 337 TRP A CB   1  
ATOM   5260   C CG   . TRP A 1 344 ? -39.511 -17.502 -21.960 0.02 29.17 ? 337 TRP A CG   1  
ATOM   5261   C CD1  . TRP A 1 344 ? -39.080 -16.401 -21.303 0.02 29.00 ? 337 TRP A CD1  1  
ATOM   5262   C CD2  . TRP A 1 344 ? -39.067 -17.373 -23.311 0.02 28.92 ? 337 TRP A CD2  1  
ATOM   5263   N NE1  . TRP A 1 344 ? -38.402 -15.559 -22.171 0.02 28.66 ? 337 TRP A NE1  1  
ATOM   5264   C CE2  . TRP A 1 344 ? -38.380 -16.141 -23.409 0.02 28.61 ? 337 TRP A CE2  1  
ATOM   5265   C CE3  . TRP A 1 344 ? -39.195 -18.169 -24.447 0.02 28.97 ? 337 TRP A CE3  1  
ATOM   5266   C CZ2  . TRP A 1 344 ? -37.818 -15.700 -24.582 0.02 28.35 ? 337 TRP A CZ2  1  
ATOM   5267   C CZ3  . TRP A 1 344 ? -38.631 -17.723 -25.629 0.02 28.70 ? 337 TRP A CZ3  1  
ATOM   5268   C CH2  . TRP A 1 344 ? -37.954 -16.495 -25.688 0.02 28.40 ? 337 TRP A CH2  1  
ATOM   5269   H H    . TRP A 1 344 ? -39.154 -18.376 -19.270 0.02 29.49 ? 337 TRP A H    1  
ATOM   5270   H HA   . TRP A 1 344 ? -39.929 -20.450 -20.583 0.02 29.89 ? 337 TRP A HA   1  
ATOM   5271   H HB2  . TRP A 1 344 ? -40.767 -19.032 -22.138 0.02 29.70 ? 337 TRP A HB2  1  
ATOM   5272   H HB3  . TRP A 1 344 ? -40.895 -18.271 -20.753 0.02 29.78 ? 337 TRP A HB3  1  
ATOM   5273   H HD1  . TRP A 1 344 ? -39.235 -16.221 -20.408 0.02 29.12 ? 337 TRP A HD1  1  
ATOM   5274   H HE1  . TRP A 1 344 ? -38.044 -14.804 -21.965 0.02 28.53 ? 337 TRP A HE1  1  
ATOM   5275   H HE3  . TRP A 1 344 ? -39.648 -18.979 -24.406 0.02 29.20 ? 337 TRP A HE3  1  
ATOM   5276   H HZ2  . TRP A 1 344 ? -37.368 -14.886 -24.619 0.02 28.18 ? 337 TRP A HZ2  1  
ATOM   5277   H HZ3  . TRP A 1 344 ? -38.708 -18.243 -26.397 0.02 28.75 ? 337 TRP A HZ3  1  
ATOM   5278   H HH2  . TRP A 1 344 ? -37.581 -16.213 -26.492 0.02 28.25 ? 337 TRP A HH2  1  
ATOM   5279   N N    . GLY A 1 345 ? -37.087 -19.466 -21.603 0.02 28.94 ? 338 GLY A N    1  
ATOM   5280   C CA   . GLY A 1 345 ? -36.020 -19.661 -22.567 0.02 28.67 ? 338 GLY A CA   1  
ATOM   5281   C C    . GLY A 1 345 ? -35.280 -20.971 -22.431 0.02 28.77 ? 338 GLY A C    1  
ATOM   5282   O O    . GLY A 1 345 ? -34.655 -21.410 -23.398 0.02 28.70 ? 338 GLY A O    1  
ATOM   5283   H H    . GLY A 1 345 ? -36.891 -18.912 -20.977 0.02 28.87 ? 338 GLY A H    1  
ATOM   5284   H HA2  . GLY A 1 345 ? -36.398 -19.636 -23.456 0.02 28.66 ? 338 GLY A HA2  1  
ATOM   5285   H HA3  . GLY A 1 345 ? -35.377 -18.942 -22.497 0.02 28.44 ? 338 GLY A HA3  1  
ATOM   5286   N N    . ASN A 1 346 ? -35.357 -21.623 -21.270 0.02 28.98 ? 339 ASN A N    1  
ATOM   5287   C CA   . ASN A 1 346 ? -34.788 -22.955 -21.179 0.02 29.18 ? 339 ASN A CA   1  
ATOM   5288   C C    . ASN A 1 346 ? -35.420 -23.887 -22.195 0.02 29.39 ? 339 ASN A C    1  
ATOM   5289   O O    . ASN A 1 346 ? -34.832 -24.916 -22.520 0.02 29.47 ? 339 ASN A O    1  
ATOM   5290   C CB   . ASN A 1 346 ? -34.974 -23.539 -19.779 0.02 29.51 ? 339 ASN A CB   1  
ATOM   5291   C CG   . ASN A 1 346 ? -34.270 -22.737 -18.707 0.02 29.36 ? 339 ASN A CG   1  
ATOM   5292   O OD1  . ASN A 1 346 ? -33.270 -22.057 -18.956 0.02 29.02 ? 339 ASN A OD1  1  
ATOM   5293   N ND2  . ASN A 1 346 ? -34.781 -22.829 -17.490 0.02 29.66 ? 339 ASN A ND2  1  
ATOM   5294   H H    . ASN A 1 346 ? -35.723 -21.325 -20.552 0.02 29.04 ? 339 ASN A H    1  
ATOM   5295   H HA   . ASN A 1 346 ? -33.836 -22.903 -21.355 0.02 29.00 ? 339 ASN A HA   1  
ATOM   5296   H HB2  . ASN A 1 346 ? -35.920 -23.576 -19.568 0.02 29.71 ? 339 ASN A HB2  1  
ATOM   5297   H HB3  . ASN A 1 346 ? -34.597 -24.433 -19.764 0.02 29.66 ? 339 ASN A HB3  1  
ATOM   5298   H HD21 . ASN A 1 346 ? -34.385 -22.448 -16.830 0.02 29.62 ? 339 ASN A HD21 1  
ATOM   5299   H HD22 . ASN A 1 346 ? -35.504 -23.274 -17.364 0.02 29.90 ? 339 ASN A HD22 1  
ATOM   5300   N N    . SER A 1 347 ? -36.600 -23.547 -22.701 0.02 29.51 ? 340 SER A N    1  
ATOM   5301   C CA   . SER A 1 347 ? -37.338 -24.409 -23.603 0.02 29.78 ? 340 SER A CA   1  
ATOM   5302   C C    . SER A 1 347 ? -37.328 -23.911 -25.051 0.02 29.57 ? 340 SER A C    1  
ATOM   5303   O O    . SER A 1 347 ? -38.311 -24.095 -25.753 0.02 29.80 ? 340 SER A O    1  
ATOM   5304   C CB   . SER A 1 347 ? -38.762 -24.578 -23.080 0.02 30.17 ? 340 SER A CB   1  
ATOM   5305   O OG   . SER A 1 347 ? -38.726 -25.235 -21.812 0.02 30.47 ? 340 SER A OG   1  
ATOM   5306   H H    . SER A 1 347 ? -37.008 -22.815 -22.517 0.02 29.46 ? 340 SER A H    1  
ATOM   5307   H HA   . SER A 1 347 ? -36.930 -25.283 -23.592 0.02 29.92 ? 340 SER A HA   1  
ATOM   5308   H HB2  . SER A 1 347 ? -39.161 -23.700 -22.973 0.02 30.05 ? 340 SER A HB2  1  
ATOM   5309   H HB3  . SER A 1 347 ? -39.278 -25.108 -23.708 0.02 30.37 ? 340 SER A HB3  1  
ATOM   5310   H HG   . SER A 1 347 ? -38.121 -25.817 -21.808 0.02 30.42 ? 340 SER A HG   1  
ATOM   5311   N N    . ILE A 1 348 ? -36.250 -23.258 -25.492 0.02 29.17 ? 341 ILE A N    1  
ATOM   5312   C CA   . ILE A 1 348 ? -35.987 -23.065 -26.920 0.02 29.01 ? 341 ILE A CA   1  
ATOM   5313   C C    . ILE A 1 348 ? -34.613 -23.626 -27.260 0.02 28.87 ? 341 ILE A C    1  
ATOM   5314   O O    . ILE A 1 348 ? -33.719 -23.651 -26.408 0.02 28.75 ? 341 ILE A O    1  
ATOM   5315   C CB   . ILE A 1 348 ? -36.070 -21.585 -27.354 0.02 28.72 ? 341 ILE A CB   1  
ATOM   5316   C CG1  . ILE A 1 348 ? -35.067 -20.717 -26.604 0.02 28.41 ? 341 ILE A CG1  1  
ATOM   5317   C CG2  . ILE A 1 348 ? -37.486 -21.007 -27.147 0.02 28.91 ? 341 ILE A CG2  1  
ATOM   5318   C CD1  . ILE A 1 348 ? -35.056 -19.244 -27.125 0.02 28.16 ? 341 ILE A CD1  1  
ATOM   5319   H H    . ILE A 1 348 ? -35.655 -22.910 -24.979 0.02 29.01 ? 341 ILE A H    1  
ATOM   5320   H HA   . ILE A 1 348 ? -36.649 -23.562 -27.420 0.02 29.23 ? 341 ILE A HA   1  
ATOM   5321   H HB   . ILE A 1 348 ? -35.860 -21.529 -28.298 0.02 28.65 ? 341 ILE A HB   1  
ATOM   5322   H HG12 . ILE A 1 348 ? -35.311 -20.706 -25.668 0.02 28.50 ? 341 ILE A HG12 1  
ATOM   5323   H HG13 . ILE A 1 348 ? -34.176 -21.080 -26.708 0.02 28.32 ? 341 ILE A HG13 1  
ATOM   5324   H HG21 . ILE A 1 348 ? -37.643 -20.319 -27.810 0.02 28.80 ? 341 ILE A HG21 1  
ATOM   5325   H HG22 . ILE A 1 348 ? -38.140 -21.717 -27.242 0.02 29.18 ? 341 ILE A HG22 1  
ATOM   5326   H HG23 . ILE A 1 348 ? -37.542 -20.626 -26.257 0.02 28.90 ? 341 ILE A HG23 1  
ATOM   5327   H HD11 . ILE A 1 348 ? -34.148 -18.909 -27.116 0.02 27.96 ? 341 ILE A HD11 1  
ATOM   5328   H HD12 . ILE A 1 348 ? -35.406 -19.228 -28.027 0.02 28.21 ? 341 ILE A HD12 1  
ATOM   5329   H HD13 . ILE A 1 348 ? -35.617 -18.698 -26.556 0.02 28.18 ? 341 ILE A HD13 1  
ATOM   5330   N N    . PRO A 1 349 ? -34.377 -24.028 -28.498 0.02 28.89 ? 342 PRO A N    1  
ATOM   5331   C CA   . PRO A 1 349 ? -33.049 -24.547 -28.854 0.02 28.79 ? 342 PRO A CA   1  
ATOM   5332   C C    . PRO A 1 349 ? -31.973 -23.511 -28.589 0.02 28.43 ? 342 PRO A C    1  
ATOM   5333   O O    . PRO A 1 349 ? -32.165 -22.326 -28.843 0.02 28.22 ? 342 PRO A O    1  
ATOM   5334   C CB   . PRO A 1 349 ? -33.175 -24.866 -30.346 0.02 28.89 ? 342 PRO A CB   1  
ATOM   5335   C CG   . PRO A 1 349 ? -34.642 -25.042 -30.579 0.02 29.18 ? 342 PRO A CG   1  
ATOM   5336   C CD   . PRO A 1 349 ? -35.333 -24.117 -29.608 0.02 29.07 ? 342 PRO A CD   1  
ATOM   5337   H HA   . PRO A 1 349 ? -32.855 -25.352 -28.350 0.02 28.95 ? 342 PRO A HA   1  
ATOM   5338   H HB2  . PRO A 1 349 ? -32.826 -24.136 -30.877 0.02 28.69 ? 342 PRO A HB2  1  
ATOM   5339   H HB3  . PRO A 1 349 ? -32.695 -25.685 -30.540 0.02 29.01 ? 342 PRO A HB3  1  
ATOM   5340   H HG2  . PRO A 1 349 ? -34.857 -24.799 -31.492 0.02 29.19 ? 342 PRO A HG2  1  
ATOM   5341   H HG3  . PRO A 1 349 ? -34.889 -25.963 -30.407 0.02 29.43 ? 342 PRO A HG3  1  
ATOM   5342   H HD2  . PRO A 1 349 ? -35.468 -23.249 -30.004 0.02 28.91 ? 342 PRO A HD2  1  
ATOM   5343   H HD3  . PRO A 1 349 ? -36.171 -24.507 -29.321 0.02 29.32 ? 342 PRO A HD3  1  
ATOM   5344   N N    . THR A 1 350 ? -30.847 -23.965 -28.059 0.02 28.40 ? 343 THR A N    1  
ATOM   5345   C CA   . THR A 1 350 ? -29.782 -23.081 -27.622 0.02 28.12 ? 343 THR A CA   1  
ATOM   5346   C C    . THR A 1 350 ? -28.430 -23.625 -28.060 0.02 28.11 ? 343 THR A C    1  
ATOM   5347   O O    . THR A 1 350 ? -28.202 -24.834 -28.024 0.02 28.35 ? 343 THR A O    1  
ATOM   5348   C CB   . THR A 1 350 ? -29.824 -22.925 -26.092 0.02 28.14 ? 343 THR A CB   1  
ATOM   5349   O OG1  . THR A 1 350 ? -31.123 -22.478 -25.715 0.02 28.21 ? 343 THR A OG1  1  
ATOM   5350   C CG2  . THR A 1 350 ? -28.804 -21.924 -25.608 0.02 27.88 ? 343 THR A CG2  1  
ATOM   5351   H H    . THR A 1 350 ? -30.676 -24.793 -27.930 0.02 28.56 ? 343 THR A H    1  
ATOM   5352   H HA   . THR A 1 350 ? -29.907 -22.209 -28.024 0.02 27.96 ? 343 THR A HA   1  
ATOM   5353   H HB   . THR A 1 350 ? -29.637 -23.783 -25.680 0.02 28.30 ? 343 THR A HB   1  
ATOM   5354   H HG1  . THR A 1 350 ? -31.708 -23.002 -26.009 0.02 28.37 ? 343 THR A HG1  1  
ATOM   5355   H HG21 . THR A 1 350 ? -28.709 -22.003 -24.648 0.02 27.92 ? 343 THR A HG21 1  
ATOM   5356   H HG22 . THR A 1 350 ? -27.938 -22.077 -26.011 0.02 27.86 ? 343 THR A HG22 1  
ATOM   5357   H HG23 . THR A 1 350 ? -29.095 -21.029 -25.829 0.02 27.74 ? 343 THR A HG23 1  
ATOM   5358   N N    . MET A 1 351 ? -27.539 -22.729 -28.474 0.02 27.89 ? 344 MET A N    1  
ATOM   5359   C CA   . MET A 1 351 ? -26.136 -23.057 -28.666 0.02 27.89 ? 344 MET A CA   1  
ATOM   5360   C C    . MET A 1 351 ? -25.285 -22.172 -27.757 0.02 27.72 ? 344 MET A C    1  
ATOM   5361   O O    . MET A 1 351 ? -25.593 -20.993 -27.563 0.02 27.53 ? 344 MET A O    1  
ATOM   5362   C CB   . MET A 1 351 ? -25.746 -22.895 -30.150 0.02 27.87 ? 344 MET A CB   1  
ATOM   5363   C CG   . MET A 1 351 ? -24.307 -23.192 -30.466 0.02 27.91 ? 344 MET A CG   1  
ATOM   5364   S SD   . MET A 1 351 ? -24.075 -23.553 -32.256 0.02 28.05 ? 344 MET A SD   1  
ATOM   5365   C CE   . MET A 1 351 ? -24.577 -21.998 -33.021 0.02 27.81 ? 344 MET A CE   1  
ATOM   5366   H H    . MET A 1 351 ? -27.730 -21.913 -28.649 0.02 27.75 ? 344 MET A H    1  
ATOM   5367   H HA   . MET A 1 351 ? -25.995 -23.982 -28.423 0.02 28.06 ? 344 MET A HA   1  
ATOM   5368   H HB2  . MET A 1 351 ? -26.292 -23.492 -30.682 0.02 28.01 ? 344 MET A HB2  1  
ATOM   5369   H HB3  . MET A 1 351 ? -25.916 -21.978 -30.414 0.02 27.72 ? 344 MET A HB3  1  
ATOM   5370   H HG2  . MET A 1 351 ? -23.767 -22.422 -30.227 0.02 27.78 ? 344 MET A HG2  1  
ATOM   5371   H HG3  . MET A 1 351 ? -24.023 -23.963 -29.955 0.02 28.05 ? 344 MET A HG3  1  
ATOM   5372   H HE1  . MET A 1 351 ? -24.183 -21.930 -33.902 0.02 27.86 ? 344 MET A HE1  1  
ATOM   5373   H HE2  . MET A 1 351 ? -25.544 -21.983 -33.085 0.02 27.81 ? 344 MET A HE2  1  
ATOM   5374   H HE3  . MET A 1 351 ? -24.261 -21.264 -32.469 0.02 27.67 ? 344 MET A HE3  1  
ATOM   5375   N N    . MET A 1 352 ? -24.223 -22.745 -27.192 0.02 27.82 ? 345 MET A N    1  
ATOM   5376   C CA   . MET A 1 352 ? -23.312 -22.034 -26.308 0.02 27.73 ? 345 MET A CA   1  
ATOM   5377   C C    . MET A 1 352 ? -21.884 -22.412 -26.668 0.02 27.83 ? 345 MET A C    1  
ATOM   5378   O O    . MET A 1 352 ? -21.623 -23.533 -27.120 0.02 28.03 ? 345 MET A O    1  
ATOM   5379   C CB   . MET A 1 352 ? -23.555 -22.372 -24.805 0.02 27.83 ? 345 MET A CB   1  
ATOM   5380   C CG   . MET A 1 352 ? -24.968 -22.270 -24.334 0.02 27.82 ? 345 MET A CG   1  
ATOM   5381   S SD   . MET A 1 352 ? -24.998 -22.691 -22.571 0.02 28.02 ? 345 MET A SD   1  
ATOM   5382   C CE   . MET A 1 352 ? -26.737 -22.506 -22.193 0.02 28.09 ? 345 MET A CE   1  
ATOM   5383   H H    . MET A 1 352 ? -24.001 -23.559 -27.318 0.02 27.97 ? 345 MET A H    1  
ATOM   5384   H HA   . MET A 1 352 ? -23.429 -21.081 -26.429 0.02 27.57 ? 345 MET A HA   1  
ATOM   5385   H HB2  . MET A 1 352 ? -23.271 -23.280 -24.638 0.02 28.01 ? 345 MET A HB2  1  
ATOM   5386   H HB3  . MET A 1 352 ? -23.024 -21.773 -24.260 0.02 27.78 ? 345 MET A HB3  1  
ATOM   5387   H HG2  . MET A 1 352 ? -25.295 -21.368 -24.456 0.02 27.67 ? 345 MET A HG2  1  
ATOM   5388   H HG3  . MET A 1 352 ? -25.525 -22.903 -24.809 0.02 27.91 ? 345 MET A HG3  1  
ATOM   5389   H HE1  . MET A 1 352 ? -27.258 -22.997 -22.847 0.02 28.16 ? 345 MET A HE1  1  
ATOM   5390   H HE2  . MET A 1 352 ? -26.912 -22.850 -21.308 0.02 28.24 ? 345 MET A HE2  1  
ATOM   5391   H HE3  . MET A 1 352 ? -26.962 -21.567 -22.231 0.02 27.94 ? 345 MET A HE3  1  
ATOM   5392   N N    . GLY A 1 353 ? -20.952 -21.491 -26.442 0.02 27.73 ? 346 GLY A N    1  
ATOM   5393   C CA   . GLY A 1 353 ? -19.555 -21.856 -26.607 0.02 27.89 ? 346 GLY A CA   1  
ATOM   5394   C C    . GLY A 1 353 ? -18.594 -20.792 -26.132 0.02 27.83 ? 346 GLY A C    1  
ATOM   5395   O O    . GLY A 1 353 ? -18.983 -19.693 -25.742 0.02 27.66 ? 346 GLY A O    1  
ATOM   5396   H H    . GLY A 1 353 ? -21.095 -20.683 -26.201 0.02 27.61 ? 346 GLY A H    1  
ATOM   5397   H HA2  . GLY A 1 353 ? -19.378 -22.663 -26.102 0.02 28.04 ? 346 GLY A HA2  1  
ATOM   5398   H HA3  . GLY A 1 353 ? -19.369 -22.036 -27.540 0.02 27.92 ? 346 GLY A HA3  1  
ATOM   5399   N N    . ASN A 1 354 ? -17.317 -21.159 -26.174 0.02 28.02 ? 347 ASN A N    1  
ATOM   5400   C CA   . ASN A 1 354 ? -16.213 -20.307 -25.787 0.02 28.06 ? 347 ASN A CA   1  
ATOM   5401   C C    . ASN A 1 354 ? -15.064 -20.566 -26.750 0.02 28.25 ? 347 ASN A C    1  
ATOM   5402   O O    . ASN A 1 354 ? -15.078 -21.531 -27.516 0.02 28.37 ? 347 ASN A O    1  
ATOM   5403   C CB   . ASN A 1 354 ? -15.775 -20.578 -24.336 0.02 28.21 ? 347 ASN A CB   1  
ATOM   5404   C CG   . ASN A 1 354 ? -16.917 -20.442 -23.343 0.02 28.09 ? 347 ASN A CG   1  
ATOM   5405   O OD1  . ASN A 1 354 ? -17.319 -19.341 -23.005 0.02 27.91 ? 347 ASN A OD1  1  
ATOM   5406   N ND2  . ASN A 1 354 ? -17.446 -21.561 -22.886 0.02 28.23 ? 347 ASN A ND2  1  
ATOM   5407   H H    . ASN A 1 354 ? -17.058 -21.927 -26.441 0.02 28.16 ? 347 ASN A H    1  
ATOM   5408   H HA   . ASN A 1 354 ? -16.476 -19.376 -25.867 0.02 27.91 ? 347 ASN A HA   1  
ATOM   5409   H HB2  . ASN A 1 354 ? -15.439 -21.481 -24.277 0.02 28.39 ? 347 ASN A HB2  1  
ATOM   5410   H HB3  . ASN A 1 354 ? -15.080 -19.951 -24.094 0.02 28.24 ? 347 ASN A HB3  1  
ATOM   5411   H HD21 . ASN A 1 354 ? -18.295 -21.620 -22.777 0.02 28.16 ? 347 ASN A HD21 1  
ATOM   5412   H HD22 . ASN A 1 354 ? -16.941 -22.235 -22.712 0.02 28.40 ? 347 ASN A HD22 1  
ATOM   5413   N N    . THR A 1 355 ? -14.081 -19.680 -26.715 0.02 28.31 ? 348 THR A N    1  
ATOM   5414   C CA   . THR A 1 355 ? -12.853 -19.842 -27.466 0.02 28.56 ? 348 THR A CA   1  
ATOM   5415   C C    . THR A 1 355 ? -11.884 -20.713 -26.685 0.02 28.86 ? 348 THR A C    1  
ATOM   5416   O O    . THR A 1 355 ? -12.042 -20.929 -25.490 0.02 28.88 ? 348 THR A O    1  
ATOM   5417   C CB   . THR A 1 355 ? -12.209 -18.493 -27.747 0.02 28.56 ? 348 THR A CB   1  
ATOM   5418   O OG1  . THR A 1 355 ? -11.665 -17.977 -26.533 0.02 28.64 ? 348 THR A OG1  1  
ATOM   5419   C CG2  . THR A 1 355 ? -13.235 -17.534 -28.276 0.02 28.27 ? 348 THR A CG2  1  
ATOM   5420   H H    . THR A 1 355 ? -14.103 -18.965 -26.247 0.02 28.23 ? 348 THR A H    1  
ATOM   5421   H HA   . THR A 1 355 ? -13.051 -20.275 -28.309 0.02 28.57 ? 348 THR A HA   1  
ATOM   5422   H HB   . THR A 1 355 ? -11.501 -18.602 -28.400 0.02 28.73 ? 348 THR A HB   1  
ATOM   5423   H HG1  . THR A 1 355 ? -11.015 -17.472 -26.699 0.02 28.74 ? 348 THR A HG1  1  
ATOM   5424   H HG21 . THR A 1 355 ? -12.801 -16.704 -28.522 0.02 28.29 ? 348 THR A HG21 1  
ATOM   5425   H HG22 . THR A 1 355 ? -13.670 -17.907 -29.056 0.02 28.23 ? 348 THR A HG22 1  
ATOM   5426   H HG23 . THR A 1 355 ? -13.909 -17.353 -27.607 0.02 28.11 ? 348 THR A HG23 1  
ATOM   5427   N N    . SER A 1 356 ? -10.845 -21.188 -27.348 0.02 29.15 ? 349 SER A N    1  
ATOM   5428   C CA   . SER A 1 356 ? -9.977  -22.158 -26.701 0.02 29.49 ? 349 SER A CA   1  
ATOM   5429   C C    . SER A 1 356 ? -8.942  -21.545 -25.742 0.02 29.69 ? 349 SER A C    1  
ATOM   5430   O O    . SER A 1 356 ? -8.220  -22.302 -25.096 0.02 30.00 ? 349 SER A O    1  
ATOM   5431   C CB   . SER A 1 356 ? -9.265  -22.999 -27.766 0.02 29.79 ? 349 SER A CB   1  
ATOM   5432   O OG   . SER A 1 356 ? -8.528  -22.171 -28.629 0.02 29.88 ? 349 SER A OG   1  
ATOM   5433   H H    . SER A 1 356 ? -10.613 -20.963 -28.140 0.02 29.18 ? 349 SER A H    1  
ATOM   5434   H HA   . SER A 1 356 ? -10.533 -22.758 -26.185 0.02 29.46 ? 349 SER A HA   1  
ATOM   5435   H HB2  . SER A 1 356 ? -8.663  -23.618 -27.326 0.02 30.04 ? 349 SER A HB2  1  
ATOM   5436   H HB3  . SER A 1 356 ? -9.927  -23.487 -28.277 0.02 29.70 ? 349 SER A HB3  1  
ATOM   5437   H HG   . SER A 1 356 ? -7.845  -21.883 -28.239 0.02 30.02 ? 349 SER A HG   1  
ATOM   5438   N N    . TYR A 1 357 ? -8.830  -20.220 -25.638 0.02 29.56 ? 350 TYR A N    1  
ATOM   5439   C CA   . TYR A 1 357 ? -7.956  -19.565 -24.656 0.02 29.75 ? 350 TYR A CA   1  
ATOM   5440   C C    . TYR A 1 357 ? -8.521  -18.192 -24.258 0.02 29.48 ? 350 TYR A C    1  
ATOM   5441   O O    . TYR A 1 357 ? -7.885  -17.155 -24.406 0.02 29.57 ? 350 TYR A O    1  
ATOM   5442   C CB   . TYR A 1 357 ? -6.528  -19.443 -25.185 0.02 30.14 ? 350 TYR A CB   1  
ATOM   5443   C CG   . TYR A 1 357 ? -5.478  -19.162 -24.120 0.02 30.48 ? 350 TYR A CG   1  
ATOM   5444   C CD1  . TYR A 1 357 ? -5.824  -19.071 -22.773 0.02 30.42 ? 350 TYR A CD1  1  
ATOM   5445   C CD2  . TYR A 1 357 ? -4.152  -19.030 -24.452 0.02 30.91 ? 350 TYR A CD2  1  
ATOM   5446   C CE1  . TYR A 1 357 ? -4.871  -18.832 -21.805 0.02 30.77 ? 350 TYR A CE1  1  
ATOM   5447   C CE2  . TYR A 1 357 ? -3.193  -18.796 -23.500 0.02 31.27 ? 350 TYR A CE2  1  
ATOM   5448   C CZ   . TYR A 1 357 ? -3.560  -18.692 -22.168 0.02 31.19 ? 350 TYR A CZ   1  
ATOM   5449   O OH   . TYR A 1 357 ? -2.611  -18.453 -21.205 0.02 31.58 ? 350 TYR A OH   1  
ATOM   5450   H H    . TYR A 1 357 ? -9.264  -19.667 -26.127 0.02 29.37 ? 350 TYR A H    1  
ATOM   5451   H HA   . TYR A 1 357 ? -7.944  -20.117 -23.859 0.02 29.84 ? 350 TYR A HA   1  
ATOM   5452   H HB2  . TYR A 1 357 ? -6.288  -20.281 -25.608 0.02 30.29 ? 350 TYR A HB2  1  
ATOM   5453   H HB3  . TYR A 1 357 ? -6.491  -18.725 -25.835 0.02 30.07 ? 350 TYR A HB3  1  
ATOM   5454   H HD1  . TYR A 1 357 ? -6.714  -19.162 -22.522 0.02 30.16 ? 350 TYR A HD1  1  
ATOM   5455   H HD2  . TYR A 1 357 ? -3.900  -19.098 -25.342 0.02 30.99 ? 350 TYR A HD2  1  
ATOM   5456   H HE1  . TYR A 1 357 ? -5.120  -18.762 -20.911 0.02 30.74 ? 350 TYR A HE1  1  
ATOM   5457   H HE2  . TYR A 1 357 ? -2.302  -18.702 -23.749 0.02 31.59 ? 350 TYR A HE2  1  
ATOM   5458   H HH   . TYR A 1 357 ? -1.843  -18.583 -21.518 0.02 31.86 ? 350 TYR A HH   1  
ATOM   5459   N N    . GLU A 1 358 ? -9.739  -18.200 -23.720 0.02 29.18 ? 351 GLU A N    1  
ATOM   5460   C CA   . GLU A 1 358 ? -10.443 -16.966 -23.361 0.02 28.93 ? 351 GLU A CA   1  
ATOM   5461   C C    . GLU A 1 358 ? -9.554  -15.990 -22.600 0.02 29.13 ? 351 GLU A C    1  
ATOM   5462   O O    . GLU A 1 358 ? -9.484  -14.788 -22.920 0.02 29.07 ? 351 GLU A O    1  
ATOM   5463   C CB   . GLU A 1 358 ? -11.666 -17.298 -22.504 0.02 28.72 ? 351 GLU A CB   1  
ATOM   5464   C CG   . GLU A 1 358 ? -12.776 -18.085 -23.172 0.02 28.51 ? 351 GLU A CG   1  
ATOM   5465   C CD   . GLU A 1 358 ? -13.671 -17.187 -24.024 0.02 28.22 ? 351 GLU A CD   1  
ATOM   5466   O OE1  . GLU A 1 358 ? -14.546 -17.702 -24.742 0.02 28.07 ? 351 GLU A OE1  1  
ATOM   5467   O OE2  . GLU A 1 358 ? -13.486 -15.966 -23.940 0.02 28.17 ? 351 GLU A OE2  1  
ATOM   5468   H H    . GLU A 1 358 ? -10.185 -18.913 -23.555 0.02 29.15 ? 351 GLU A H    1  
ATOM   5469   H HA   . GLU A 1 358 ? -10.747 -16.533 -24.174 0.02 28.79 ? 351 GLU A HA   1  
ATOM   5470   H HB2  . GLU A 1 358 ? -11.365 -17.817 -21.746 0.02 28.88 ? 351 GLU A HB2  1  
ATOM   5471   H HB3  . GLU A 1 358 ? -12.050 -16.469 -22.188 0.02 28.59 ? 351 GLU A HB3  1  
ATOM   5472   H HG2  . GLU A 1 358 ? -12.387 -18.758 -23.752 0.02 28.62 ? 351 GLU A HG2  1  
ATOM   5473   H HG3  . GLU A 1 358 ? -13.328 -18.507 -22.499 0.02 28.48 ? 351 GLU A HG3  1  
ATOM   5474   N N    . GLY A 1 359 ? -8.922  -16.484 -21.529 0.02 29.40 ? 352 GLY A N    1  
ATOM   5475   C CA   . GLY A 1 359 ? -8.180  -15.665 -20.601 0.02 29.63 ? 352 GLY A CA   1  
ATOM   5476   C C    . GLY A 1 359 ? -6.985  -14.954 -21.178 0.02 29.90 ? 352 GLY A C    1  
ATOM   5477   O O    . GLY A 1 359 ? -6.526  -13.978 -20.576 0.02 30.06 ? 352 GLY A O    1  
ATOM   5478   H H    . GLY A 1 359 ? -8.920  -17.313 -21.322 0.02 29.47 ? 352 GLY A H    1  
ATOM   5479   H HA2  . GLY A 1 359 ? -8.773  -14.992 -20.238 0.02 29.46 ? 352 GLY A HA2  1  
ATOM   5480   H HA3  . GLY A 1 359 ? -7.872  -16.229 -19.882 0.02 29.80 ? 352 GLY A HA3  1  
ATOM   5481   N N    . LEU A 1 360 ? -6.481  -15.383 -22.349 0.02 29.99 ? 353 LEU A N    1  
ATOM   5482   C CA   . LEU A 1 360 ? -5.490  -14.567 -23.045 0.02 30.25 ? 353 LEU A CA   1  
ATOM   5483   C C    . LEU A 1 360 ? -5.974  -13.134 -23.151 0.02 30.07 ? 353 LEU A C    1  
ATOM   5484   O O    . LEU A 1 360 ? -5.166  -12.208 -23.283 0.02 30.35 ? 353 LEU A O    1  
ATOM   5485   C CB   . LEU A 1 360 ? -5.218  -15.163 -24.439 0.02 30.30 ? 353 LEU A CB   1  
ATOM   5486   C CG   . LEU A 1 360 ? -3.878  -14.928 -25.117 0.02 30.74 ? 353 LEU A CG   1  
ATOM   5487   C CD1  . LEU A 1 360 ? -2.676  -15.499 -24.346 0.02 31.21 ? 353 LEU A CD1  1  
ATOM   5488   C CD2  . LEU A 1 360 ? -3.972  -15.549 -26.534 0.02 30.70 ? 353 LEU A CD2  1  
ATOM   5489   H H    . LEU A 1 360 ? -6.696  -16.112 -22.744 0.02 29.92 ? 353 LEU A H    1  
ATOM   5490   H HA   . LEU A 1 360 ? -4.663  -14.567 -22.544 0.02 30.55 ? 353 LEU A HA   1  
ATOM   5491   H HB2  . LEU A 1 360 ? -5.326  -16.126 -24.382 0.02 30.31 ? 353 LEU A HB2  1  
ATOM   5492   H HB3  . LEU A 1 360 ? -5.890  -14.805 -25.040 0.02 30.05 ? 353 LEU A HB3  1  
ATOM   5493   H HG   . LEU A 1 360 ? -3.742  -13.973 -25.217 0.02 30.77 ? 353 LEU A HG   1  
ATOM   5494   H HD11 . LEU A 1 360 ? -1.885  -14.982 -24.560 0.02 31.50 ? 353 LEU A HD11 1  
ATOM   5495   H HD12 . LEU A 1 360 ? -2.849  -15.450 -23.394 0.02 31.18 ? 353 LEU A HD12 1  
ATOM   5496   H HD13 . LEU A 1 360 ? -2.541  -16.422 -24.601 0.02 31.30 ? 353 LEU A HD13 1  
ATOM   5497   H HD21 . LEU A 1 360 ? -3.692  -14.884 -27.182 0.02 30.79 ? 353 LEU A HD21 1  
ATOM   5498   H HD22 . LEU A 1 360 ? -3.395  -16.326 -26.588 0.02 30.94 ? 353 LEU A HD22 1  
ATOM   5499   H HD23 . LEU A 1 360 ? -4.888  -15.813 -26.708 0.02 30.39 ? 353 LEU A HD23 1  
ATOM   5500   N N    . PHE A 1 361 ? -7.281  -12.950 -23.061 0.02 29.67 ? 354 PHE A N    1  
ATOM   5501   C CA   . PHE A 1 361 ? -7.904  -11.640 -22.931 0.02 29.49 ? 354 PHE A CA   1  
ATOM   5502   C C    . PHE A 1 361 ? -7.705  -11.041 -21.539 0.02 29.65 ? 354 PHE A C    1  
ATOM   5503   O O    . PHE A 1 361 ? -8.637  -10.428 -20.991 0.02 29.43 ? 354 PHE A O    1  
ATOM   5504   C CB   . PHE A 1 361 ? -9.390  -11.785 -23.214 0.02 29.06 ? 354 PHE A CB   1  
ATOM   5505   C CG   . PHE A 1 361 ? -10.045 -10.523 -23.609 0.02 28.87 ? 354 PHE A CG   1  
ATOM   5506   C CD1  . PHE A 1 361 ? -9.729  -9.938  -24.824 0.02 28.92 ? 354 PHE A CD1  1  
ATOM   5507   C CD2  . PHE A 1 361 ? -10.999 -9.950  -22.817 0.02 28.67 ? 354 PHE A CD2  1  
ATOM   5508   C CE1  . PHE A 1 361 ? -10.319 -8.804  -25.205 0.02 28.79 ? 354 PHE A CE1  1  
ATOM   5509   C CE2  . PHE A 1 361 ? -11.607 -8.787  -23.207 0.02 28.53 ? 354 PHE A CE2  1  
ATOM   5510   C CZ   . PHE A 1 361 ? -11.245 -8.217  -24.389 0.02 28.59 ? 354 PHE A CZ   1  
ATOM   5511   H H    . PHE A 1 361 ? -7.850  -13.593 -23.088 0.02 29.50 ? 354 PHE A H    1  
ATOM   5512   H HA   . PHE A 1 361 ? -7.522  -11.030 -23.580 0.02 29.59 ? 354 PHE A HA   1  
ATOM   5513   H HB2  . PHE A 1 361 ? -9.511  -12.420 -23.934 0.02 28.99 ? 354 PHE A HB2  1  
ATOM   5514   H HB3  . PHE A 1 361 ? -9.829  -12.103 -22.414 0.02 28.99 ? 354 PHE A HB3  1  
ATOM   5515   H HD1  . PHE A 1 361 ? -9.086  -10.326 -25.370 0.02 29.09 ? 354 PHE A HD1  1  
ATOM   5516   H HD2  . PHE A 1 361 ? -11.223 -10.343 -22.008 0.02 28.66 ? 354 PHE A HD2  1  
ATOM   5517   H HE1  . PHE A 1 361 ? -10.086 -8.404  -26.014 0.02 28.85 ? 354 PHE A HE1  1  
ATOM   5518   H HE2  . PHE A 1 361 ? -12.243 -8.379  -22.664 0.02 28.42 ? 354 PHE A HE2  1  
ATOM   5519   H HZ   . PHE A 1 361 ? -11.644 -7.434  -24.654 0.02 28.52 ? 354 PHE A HZ   1  
ATOM   5520   N N    . PHE A 1 362 ? -6.539  -11.260 -20.932 0.02 30.03 ? 355 PHE A N    1  
ATOM   5521   C CA   . PHE A 1 362 ? -6.114  -10.498 -19.774 0.02 30.29 ? 355 PHE A CA   1  
ATOM   5522   C C    . PHE A 1 362 ? -4.681  -10.016 -19.882 0.02 30.79 ? 355 PHE A C    1  
ATOM   5523   O O    . PHE A 1 362 ? -4.147  -9.474  -18.905 0.02 31.09 ? 355 PHE A O    1  
ATOM   5524   C CB   . PHE A 1 362 ? -6.328  -11.328 -18.514 0.02 30.32 ? 355 PHE A CB   1  
ATOM   5525   C CG   . PHE A 1 362 ? -7.732  -11.334 -18.089 0.02 29.94 ? 355 PHE A CG   1  
ATOM   5526   C CD1  . PHE A 1 362 ? -8.641  -12.165 -18.696 0.02 29.58 ? 355 PHE A CD1  1  
ATOM   5527   C CD2  . PHE A 1 362 ? -8.176  -10.426 -17.165 0.02 29.97 ? 355 PHE A CD2  1  
ATOM   5528   C CE1  . PHE A 1 362 ? -9.937  -12.129 -18.362 0.02 29.28 ? 355 PHE A CE1  1  
ATOM   5529   C CE2  . PHE A 1 362 ? -9.486  -10.399 -16.811 0.02 29.67 ? 355 PHE A CE2  1  
ATOM   5530   C CZ   . PHE A 1 362 ? -10.372 -11.252 -17.416 0.02 29.32 ? 355 PHE A CZ   1  
ATOM   5531   H H    . PHE A 1 362 ? -5.969  -11.851 -21.164 0.02 30.18 ? 355 PHE A H    1  
ATOM   5532   H HA   . PHE A 1 362 ? -6.676  -9.712  -19.697 0.02 30.16 ? 355 PHE A HA   1  
ATOM   5533   H HB2  . PHE A 1 362 ? -6.056  -12.245 -18.673 0.02 30.37 ? 355 PHE A HB2  1  
ATOM   5534   H HB3  . PHE A 1 362 ? -5.803  -10.942 -17.800 0.02 30.58 ? 355 PHE A HB3  1  
ATOM   5535   H HD1  . PHE A 1 362 ? -8.352  -12.763 -19.345 0.02 29.58 ? 355 PHE A HD1  1  
ATOM   5536   H HD2  . PHE A 1 362 ? -7.573  -9.847  -16.756 0.02 30.24 ? 355 PHE A HD2  1  
ATOM   5537   H HE1  . PHE A 1 362 ? -10.536 -12.712 -18.766 0.02 29.08 ? 355 PHE A HE1  1  
ATOM   5538   H HE2  . PHE A 1 362 ? -9.784  -9.797  -16.168 0.02 29.72 ? 355 PHE A HE2  1  
ATOM   5539   H HZ   . PHE A 1 362 ? -11.271 -11.240 -17.174 0.02 29.14 ? 355 PHE A HZ   1  
ATOM   5540   N N    . THR A 1 363 ? -4.052  -10.166 -21.051 0.02 30.94 ? 356 THR A N    1  
ATOM   5541   C CA   . THR A 1 363 ? -2.665  -9.739  -21.187 0.02 31.47 ? 356 THR A CA   1  
ATOM   5542   C C    . THR A 1 363 ? -2.514  -8.253  -20.850 0.02 31.64 ? 356 THR A C    1  
ATOM   5543   O O    . THR A 1 363 ? -1.611  -7.868  -20.105 0.02 32.03 ? 356 THR A O    1  
ATOM   5544   C CB   . THR A 1 363 ? -2.139  -10.041 -22.602 0.02 31.59 ? 356 THR A CB   1  
ATOM   5545   O OG1  . THR A 1 363 ? -2.107  -11.464 -22.831 0.02 31.54 ? 356 THR A OG1  1  
ATOM   5546   C CG2  . THR A 1 363 ? -0.723  -9.491  -22.755 0.02 32.21 ? 356 THR A CG2  1  
ATOM   5547   H H    . THR A 1 363 ? -4.400  -10.501 -21.759 0.02 30.77 ? 356 THR A H    1  
ATOM   5548   H HA   . THR A 1 363 ? -2.122  -10.239 -20.562 0.02 31.70 ? 356 THR A HA   1  
ATOM   5549   H HB   . THR A 1 363 ? -2.711  -9.617  -23.259 0.02 31.37 ? 356 THR A HB   1  
ATOM   5550   H HG1  . THR A 1 363 ? -1.453  -11.668 -23.317 0.02 31.69 ? 356 THR A HG1  1  
ATOM   5551   H HG21 . THR A 1 363 ? -0.313  -9.858  -23.552 0.02 32.36 ? 356 THR A HG21 1  
ATOM   5552   H HG22 . THR A 1 363 ? -0.743  -8.525  -22.821 0.02 32.25 ? 356 THR A HG22 1  
ATOM   5553   H HG23 . THR A 1 363 ? -0.182  -9.740  -21.991 0.02 32.45 ? 356 THR A HG23 1  
ATOM   5554   N N    . SER A 1 364 ? -3.410  -7.407  -21.363 0.02 31.37 ? 357 SER A N    1  
ATOM   5555   C CA   . SER A 1 364 ? -3.224  -5.957  -21.205 0.02 31.59 ? 357 SER A CA   1  
ATOM   5556   C C    . SER A 1 364 ? -3.248  -5.570  -19.740 0.02 31.77 ? 357 SER A C    1  
ATOM   5557   O O    . SER A 1 364 ? -2.346  -4.893  -19.243 0.02 32.27 ? 357 SER A O    1  
ATOM   5558   C CB   . SER A 1 364 ? -4.317  -5.162  -21.918 0.02 31.22 ? 357 SER A CB   1  
ATOM   5559   O OG   . SER A 1 364 ? -4.264  -5.273  -23.331 0.02 31.13 ? 357 SER A OG   1  
ATOM   5560   H H    . SER A 1 364 ? -4.121  -7.641  -21.784 0.02 31.08 ? 357 SER A H    1  
ATOM   5561   H HA   . SER A 1 364 ? -2.370  -5.697  -21.582 0.02 31.93 ? 357 SER A HA   1  
ATOM   5562   H HB2  . SER A 1 364 ? -5.184  -5.466  -21.607 0.02 30.90 ? 357 SER A HB2  1  
ATOM   5563   H HB3  . SER A 1 364 ? -4.200  -4.230  -21.681 0.02 31.41 ? 357 SER A HB3  1  
ATOM   5564   H HG   . SER A 1 364 ? -3.549  -4.947  -23.626 0.02 31.43 ? 357 SER A HG   1  
ATOM   5565   N N    . ILE A 1 365 ? -4.334  -5.931  -19.075 0.02 31.39 ? 358 ILE A N    1  
ATOM   5566   C CA   . ILE A 1 365 ? -4.441  -5.810  -17.639 0.02 31.51 ? 358 ILE A CA   1  
ATOM   5567   C C    . ILE A 1 365 ? -3.175  -6.334  -16.975 0.02 31.98 ? 358 ILE A C    1  
ATOM   5568   O O    . ILE A 1 365 ? -2.514  -5.600  -16.211 0.02 32.38 ? 358 ILE A O    1  
ATOM   5569   C CB   . ILE A 1 365 ? -5.696  -6.551  -17.132 0.02 31.04 ? 358 ILE A CB   1  
ATOM   5570   C CG1  . ILE A 1 365 ? -6.943  -6.202  -17.967 0.02 30.58 ? 358 ILE A CG1  1  
ATOM   5571   C CG2  . ILE A 1 365 ? -5.932  -6.200  -15.671 0.02 31.17 ? 358 ILE A CG2  1  
ATOM   5572   C CD1  . ILE A 1 365 ? -7.121  -7.011  -19.269 0.02 30.34 ? 358 ILE A CD1  1  
ATOM   5573   H H    . ILE A 1 365 ? -5.018  -6.239  -19.458 0.02 31.09 ? 358 ILE A H    1  
ATOM   5574   H HA   . ILE A 1 365 ? -4.534  -4.873  -17.406 0.02 31.63 ? 358 ILE A HA   1  
ATOM   5575   H HB   . ILE A 1 365 ? -5.540  -7.505  -17.190 0.02 31.01 ? 358 ILE A HB   1  
ATOM   5576   H HG12 . ILE A 1 365 ? -7.734  -6.341  -17.424 0.02 30.36 ? 358 ILE A HG12 1  
ATOM   5577   H HG13 . ILE A 1 365 ? -6.887  -5.267  -18.217 0.02 30.66 ? 358 ILE A HG13 1  
ATOM   5578   H HG21 . ILE A 1 365 ? -6.280  -6.981  -15.214 0.02 31.05 ? 358 ILE A HG21 1  
ATOM   5579   H HG22 . ILE A 1 365 ? -5.093  -5.931  -15.270 0.02 31.54 ? 358 ILE A HG22 1  
ATOM   5580   H HG23 . ILE A 1 365 ? -6.566  -5.468  -15.612 0.02 31.04 ? 358 ILE A HG23 1  
ATOM   5581   H HD11 . ILE A 1 365 ? -7.265  -6.405  -20.012 0.02 30.27 ? 358 ILE A HD11 1  
ATOM   5582   H HD12 . ILE A 1 365 ? -6.335  -7.552  -19.431 0.02 30.56 ? 358 ILE A HD12 1  
ATOM   5583   H HD13 . ILE A 1 365 ? -7.890  -7.595  -19.161 0.02 30.07 ? 358 ILE A HD13 1  
ATOM   5584   N N    . LEU A 1 366 ? -2.803  -7.585  -17.269 0.02 31.97 ? 359 LEU A N    1  
ATOM   5585   C CA   . LEU A 1 366 ? -1.719  -8.226  -16.540 0.02 32.43 ? 359 LEU A CA   1  
ATOM   5586   C C    . LEU A 1 366 ? -0.410  -7.491  -16.742 0.02 33.00 ? 359 LEU A C    1  
ATOM   5587   O O    . LEU A 1 366 ? 0.369   -7.350  -15.779 0.02 33.47 ? 359 LEU A O    1  
ATOM   5588   C CB   . LEU A 1 366 ? -1.558  -9.688  -16.953 0.02 32.33 ? 359 LEU A CB   1  
ATOM   5589   C CG   . LEU A 1 366 ? -2.467  -10.746 -16.315 0.02 32.00 ? 359 LEU A CG   1  
ATOM   5590   C CD1  . LEU A 1 366 ? -2.115  -12.110 -16.853 0.02 32.02 ? 359 LEU A CD1  1  
ATOM   5591   C CD2  . LEU A 1 366 ? -2.343  -10.772 -14.808 0.02 32.24 ? 359 LEU A CD2  1  
ATOM   5592   H H    . LEU A 1 366 ? -3.163  -8.071  -17.875 0.02 31.72 ? 359 LEU A H    1  
ATOM   5593   H HA   . LEU A 1 366 ? -1.930  -8.210  -15.595 0.02 32.49 ? 359 LEU A HA   1  
ATOM   5594   H HB2  . LEU A 1 366 ? -1.690  -9.744  -17.912 0.02 32.14 ? 359 LEU A HB2  1  
ATOM   5595   H HB3  . LEU A 1 366 ? -0.647  -9.952  -16.748 0.02 32.70 ? 359 LEU A HB3  1  
ATOM   5596   H HG   . LEU A 1 366 ? -3.392  -10.553 -16.538 0.02 31.63 ? 359 LEU A HG   1  
ATOM   5597   H HD11 . LEU A 1 366 ? -2.677  -12.771 -16.424 0.02 31.86 ? 359 LEU A HD11 1  
ATOM   5598   H HD12 . LEU A 1 366 ? -2.261  -12.123 -17.812 0.02 31.83 ? 359 LEU A HD12 1  
ATOM   5599   H HD13 . LEU A 1 366 ? -1.183  -12.286 -16.654 0.02 32.41 ? 359 LEU A HD13 1  
ATOM   5600   H HD21 . LEU A 1 366 ? -2.768  -11.572 -14.468 0.02 32.12 ? 359 LEU A HD21 1  
ATOM   5601   H HD22 . LEU A 1 366 ? -1.403  -10.772 -14.571 0.02 32.65 ? 359 LEU A HD22 1  
ATOM   5602   H HD23 . LEU A 1 366 ? -2.781  -9.986  -14.444 0.02 32.14 ? 359 LEU A HD23 1  
ATOM   5603   N N    . LYS A 1 367 ? -0.158  -7.021  -17.978 0.02 32.99 ? 360 LYS A N    1  
ATOM   5604   C CA   . LYS A 1 367 ? 1.043   -6.245  -18.280 0.02 33.55 ? 360 LYS A CA   1  
ATOM   5605   C C    . LYS A 1 367 ? 1.286   -5.189  -17.212 0.02 33.89 ? 360 LYS A C    1  
ATOM   5606   O O    . LYS A 1 367 ? 2.430   -4.936  -16.820 0.02 34.50 ? 360 LYS A O    1  
ATOM   5607   C CB   . LYS A 1 367 ? 0.914   -5.585  -19.666 0.02 33.40 ? 360 LYS A CB   1  
ATOM   5608   C CG   . LYS A 1 367 ? 2.200   -5.536  -20.555 0.02 33.92 ? 360 LYS A CG   1  
ATOM   5609   C CD   . LYS A 1 367 ? 3.244   -4.502  -20.071 0.02 34.59 ? 360 LYS A CD   1  
ATOM   5610   C CE   . LYS A 1 367 ? 3.638   -3.487  -21.175 0.02 34.87 ? 360 LYS A CE   1  
ATOM   5611   N NZ   . LYS A 1 367 ? 4.336   -2.290  -20.566 0.02 35.49 ? 360 LYS A NZ   1  
ATOM   5612   H H    . LYS A 1 367 ? -0.670  -7.143  -18.656 0.02 32.69 ? 360 LYS A H    1  
ATOM   5613   H HA   . LYS A 1 367 ? 1.811   -6.837  -18.304 0.02 33.84 ? 360 LYS A HA   1  
ATOM   5614   H HB2  . LYS A 1 367 ? 0.244   -6.072  -20.171 0.02 33.01 ? 360 LYS A HB2  1  
ATOM   5615   H HB3  . LYS A 1 367 ? 0.609   -4.676  -19.544 0.02 33.35 ? 360 LYS A HB3  1  
ATOM   5616   H HG2  . LYS A 1 367 ? 2.617   -6.410  -20.551 0.02 34.00 ? 360 LYS A HG2  1  
ATOM   5617   H HG3  . LYS A 1 367 ? 1.943   -5.298  -21.458 0.02 33.77 ? 360 LYS A HG3  1  
ATOM   5618   H HD2  . LYS A 1 367 ? 2.877   -4.009  -19.323 0.02 34.55 ? 360 LYS A HD2  1  
ATOM   5619   H HD3  . LYS A 1 367 ? 4.049   -4.965  -19.793 0.02 34.94 ? 360 LYS A HD3  1  
ATOM   5620   H HE2  . LYS A 1 367 ? 4.244   -3.913  -21.801 0.02 35.04 ? 360 LYS A HE2  1  
ATOM   5621   H HE3  . LYS A 1 367 ? 2.841   -3.179  -21.633 0.02 34.50 ? 360 LYS A HE3  1  
ATOM   5622   H HZ1  . LYS A 1 367 ? 5.069   -2.557  -20.140 0.02 35.70 ? 360 LYS A HZ1  1  
ATOM   5623   H HZ2  . LYS A 1 367 ? 4.562   -1.702  -21.196 0.02 35.83 ? 360 LYS A HZ2  1  
ATOM   5624   H HZ3  . LYS A 1 367 ? 3.796   -1.892  -19.981 0.02 35.35 ? 360 LYS A HZ3  1  
ATOM   5625   N N    . GLN A 1 368 ? 0.225   -4.580  -16.717 0.02 33.56 ? 361 GLN A N    1  
ATOM   5626   C CA   . GLN A 1 368 ? 0.419   -3.470  -15.806 0.02 33.90 ? 361 GLN A CA   1  
ATOM   5627   C C    . GLN A 1 368 ? 0.338   -3.932  -14.344 0.02 33.98 ? 361 GLN A C    1  
ATOM   5628   O O    . GLN A 1 368 ? -0.721  -4.378  -13.910 0.02 33.51 ? 361 GLN A O    1  
ATOM   5629   C CB   . GLN A 1 368 ? -0.590  -2.382  -16.192 0.02 33.59 ? 361 GLN A CB   1  
ATOM   5630   C CG   . GLN A 1 368 ? 0.014   -1.165  -16.987 0.02 33.91 ? 361 GLN A CG   1  
ATOM   5631   C CD   . GLN A 1 368 ? 0.925   -1.519  -18.169 0.02 34.08 ? 361 GLN A CD   1  
ATOM   5632   O OE1  . GLN A 1 368 ? 1.017   -2.672  -18.580 0.02 33.92 ? 361 GLN A OE1  1  
ATOM   5633   N NE2  . GLN A 1 368 ? 1.604   -0.507  -18.719 0.02 34.45 ? 361 GLN A NE2  1  
ATOM   5634   H H    . GLN A 1 368 ? -0.594  -4.787  -16.878 0.02 33.16 ? 361 GLN A H    1  
ATOM   5635   H HA   . GLN A 1 368 ? 1.303   -3.096  -15.945 0.02 34.35 ? 361 GLN A HA   1  
ATOM   5636   H HB2  . GLN A 1 368 ? -1.267  -2.782  -16.759 0.02 33.15 ? 361 GLN A HB2  1  
ATOM   5637   H HB3  . GLN A 1 368 ? -1.005  -2.036  -15.386 0.02 33.63 ? 361 GLN A HB3  1  
ATOM   5638   H HG2  . GLN A 1 368 ? -0.722  -0.643  -17.347 0.02 33.62 ? 361 GLN A HG2  1  
ATOM   5639   H HG3  . GLN A 1 368 ? 0.532   -0.623  -16.371 0.02 34.32 ? 361 GLN A HG3  1  
ATOM   5640   H HE21 . GLN A 1 368 ? 1.596   0.268   -18.350 0.02 34.65 ? 361 GLN A HE21 1  
ATOM   5641   H HE22 . GLN A 1 368 ? 2.051   -0.633  -19.442 0.02 34.51 ? 361 GLN A HE22 1  
ATOM   5642   N N    . MET A 1 369 ? 1.477   -3.897  -13.622 0.02 34.60 ? 362 MET A N    1  
ATOM   5643   C CA   . MET A 1 369 ? 1.670   -4.359  -12.221 0.02 34.89 ? 362 MET A CA   1  
ATOM   5644   C C    . MET A 1 369 ? 1.548   -5.886  -12.089 0.02 34.63 ? 362 MET A C    1  
ATOM   5645   O O    . MET A 1 369 ? 1.026   -6.386  -11.082 0.02 34.51 ? 362 MET A O    1  
ATOM   5646   C CB   . MET A 1 369 ? 0.792   -3.567  -11.210 0.02 34.87 ? 362 MET A CB   1  
ATOM   5647   C CG   . MET A 1 369 ? -0.417  -4.239  -10.370 0.02 34.29 ? 362 MET A CG   1  
ATOM   5648   S SD   . MET A 1 369 ? -0.903  -3.449  -8.774  0.02 34.44 ? 362 MET A SD   1  
ATOM   5649   C CE   . MET A 1 369 ? -2.487  -2.735  -9.243  0.02 33.74 ? 362 MET A CE   1  
ATOM   5650   H H    . MET A 1 369 ? 2.208   -3.587  -13.954 0.02 34.92 ? 362 MET A H    1  
ATOM   5651   H HA   . MET A 1 369 ? 2.585   -4.141  -11.979 0.02 35.38 ? 362 MET A HA   1  
ATOM   5652   H HB2  . MET A 1 369 ? 1.408   -3.237  -10.532 0.02 35.29 ? 362 MET A HB2  1  
ATOM   5653   H HB3  . MET A 1 369 ? 0.421   -2.801  -11.679 0.02 34.92 ? 362 MET A HB3  1  
ATOM   5654   H HG2  . MET A 1 369 ? -1.208  -4.244  -10.931 0.02 33.91 ? 362 MET A HG2  1  
ATOM   5655   H HG3  . MET A 1 369 ? -0.206  -5.138  -10.110 0.02 34.20 ? 362 MET A HG3  1  
ATOM   5656   H HE1  . MET A 1 369 ? -2.833  -2.218  -8.496  0.02 33.68 ? 362 MET A HE1  1  
ATOM   5657   H HE2  . MET A 1 369 ? -2.357  -2.160  -10.015 0.02 33.83 ? 362 MET A HE2  1  
ATOM   5658   H HE3  . MET A 1 369 ? -3.105  -3.448  -9.468  0.02 33.39 ? 362 MET A HE3  1  
ATOM   5659   N N    . PRO A 1 370 ? 2.232   -6.644  -12.964 0.02 34.71 ? 363 PRO A N    1  
ATOM   5660   C CA   . PRO A 1 370 ? 2.276   -8.125  -12.844 0.02 34.57 ? 363 PRO A CA   1  
ATOM   5661   C C    . PRO A 1 370 ? 2.075   -8.727  -11.459 0.02 34.63 ? 363 PRO A C    1  
ATOM   5662   O O    . PRO A 1 370 ? 1.985   -9.961  -11.361 0.02 34.49 ? 363 PRO A O    1  
ATOM   5663   C CB   . PRO A 1 370 ? 3.687   -8.469  -13.353 0.02 35.12 ? 363 PRO A CB   1  
ATOM   5664   C CG   . PRO A 1 370 ? 4.446   -7.145  -13.378 0.02 35.67 ? 363 PRO A CG   1  
ATOM   5665   C CD   . PRO A 1 370 ? 3.387   -6.157  -13.733 0.02 35.21 ? 363 PRO A CD   1  
ATOM   5666   H HA   . PRO A 1 370 ? 1.623   -8.514  -13.445 0.02 34.14 ? 363 PRO A HA   1  
ATOM   5667   H HB2  . PRO A 1 370 ? 4.109   -9.087  -12.739 0.02 35.34 ? 363 PRO A HB2  1  
ATOM   5668   H HB3  . PRO A 1 370 ? 3.635   -8.851  -14.242 0.02 34.93 ? 363 PRO A HB3  1  
ATOM   5669   H HG2  . PRO A 1 370 ? 4.820   -6.958  -12.502 0.02 35.99 ? 363 PRO A HG2  1  
ATOM   5670   H HG3  . PRO A 1 370 ? 5.140   -7.169  -14.057 0.02 35.94 ? 363 PRO A HG3  1  
ATOM   5671   H HD2  . PRO A 1 370 ? 3.671   -5.273  -13.459 0.02 35.51 ? 363 PRO A HD2  1  
ATOM   5672   H HD3  . PRO A 1 370 ? 3.200   -6.197  -14.684 0.02 34.99 ? 363 PRO A HD3  1  
ATOM   5673   N N    . LEU A 1 371 ? 2.078   -7.932  -10.384 0.02 34.90 ? 364 LEU A N    1  
ATOM   5674   C CA   . LEU A 1 371 ? 1.654   -8.419  -9.079  0.02 34.97 ? 364 LEU A CA   1  
ATOM   5675   C C    . LEU A 1 371 ? 0.344   -9.174  -9.137  0.02 34.36 ? 364 LEU A C    1  
ATOM   5676   O O    . LEU A 1 371 ? 0.091   -10.007 -8.263  0.02 34.42 ? 364 LEU A O    1  
ATOM   5677   C CB   . LEU A 1 371 ? 1.483   -7.264  -8.100  0.02 35.22 ? 364 LEU A CB   1  
ATOM   5678   C CG   . LEU A 1 371 ? 2.575   -6.219  -8.055  0.02 35.77 ? 364 LEU A CG   1  
ATOM   5679   C CD1  . LEU A 1 371 ? 1.991   -4.911  -7.566  0.02 35.67 ? 364 LEU A CD1  1  
ATOM   5680   C CD2  . LEU A 1 371 ? 3.650   -6.673  -7.150  0.02 36.48 ? 364 LEU A CD2  1  
ATOM   5681   H H    . LEU A 1 371 ? 2.354   -7.125  -10.377 0.02 35.10 ? 364 LEU A H    1  
ATOM   5682   H HA   . LEU A 1 371 ? 2.329   -9.020  -8.736  0.02 35.31 ? 364 LEU A HA   1  
ATOM   5683   H HB2  . LEU A 1 371 ? 0.655   -6.808  -8.312  0.02 34.84 ? 364 LEU A HB2  1  
ATOM   5684   H HB3  . LEU A 1 371 ? 1.423   -7.636  -7.204  0.02 35.42 ? 364 LEU A HB3  1  
ATOM   5685   H HG   . LEU A 1 371 ? 2.955   -6.077  -8.932  0.02 35.75 ? 364 LEU A HG   1  
ATOM   5686   H HD11 . LEU A 1 371 ? 1.392   -4.573  -8.243  0.02 35.24 ? 364 LEU A HD11 1  
ATOM   5687   H HD12 . LEU A 1 371 ? 1.508   -5.068  -6.740  0.02 35.65 ? 364 LEU A HD12 1  
ATOM   5688   H HD13 . LEU A 1 371 ? 2.713   -4.279  -7.419  0.02 36.07 ? 364 LEU A HD13 1  
ATOM   5689   H HD21 . LEU A 1 371 ? 3.321   -6.628  -6.239  0.02 36.61 ? 364 LEU A HD21 1  
ATOM   5690   H HD22 . LEU A 1 371 ? 3.899   -7.583  -7.371  0.02 36.47 ? 364 LEU A HD22 1  
ATOM   5691   H HD23 . LEU A 1 371 ? 4.407   -6.079  -7.251  0.02 36.84 ? 364 LEU A HD23 1  
ATOM   5692   N N    . LEU A 1 372 ? -0.509  -8.855  -10.108 0.02 33.81 ? 365 LEU A N    1  
ATOM   5693   C CA   . LEU A 1 372 ? -1.704  -9.643  -10.363 0.02 33.25 ? 365 LEU A CA   1  
ATOM   5694   C C    . LEU A 1 372 ? -1.422  -11.138 -10.217 0.02 33.35 ? 365 LEU A C    1  
ATOM   5695   O O    . LEU A 1 372 ? -2.262  -11.884 -9.696  0.02 33.13 ? 365 LEU A O    1  
ATOM   5696   C CB   . LEU A 1 372 ? -2.230  -9.310  -11.761 0.02 32.76 ? 365 LEU A CB   1  
ATOM   5697   C CG   . LEU A 1 372 ? -2.675  -7.865  -12.058 0.02 32.61 ? 365 LEU A CG   1  
ATOM   5698   C CD1  . LEU A 1 372 ? -3.686  -7.430  -10.982 0.02 32.58 ? 365 LEU A CD1  1  
ATOM   5699   C CD2  . LEU A 1 372 ? -1.502  -6.844  -12.210 0.02 33.07 ? 365 LEU A CD2  1  
ATOM   5700   H H    . LEU A 1 372 ? -0.403  -8.193  -10.633 0.02 33.77 ? 365 LEU A H    1  
ATOM   5701   H HA   . LEU A 1 372 ? -2.386  -9.398  -9.718  0.02 33.15 ? 365 LEU A HA   1  
ATOM   5702   H HB2  . LEU A 1 372 ? -1.531  -9.519  -12.403 0.02 32.88 ? 365 LEU A HB2  1  
ATOM   5703   H HB3  . LEU A 1 372 ? -2.996  -9.883  -11.931 0.02 32.43 ? 365 LEU A HB3  1  
ATOM   5704   H HG   . LEU A 1 372 ? -3.151  -7.867  -12.902 0.02 32.25 ? 365 LEU A HG   1  
ATOM   5705   H HD11 . LEU A 1 372 ? -4.395  -8.089  -10.927 0.02 32.35 ? 365 LEU A HD11 1  
ATOM   5706   H HD12 . LEU A 1 372 ? -3.230  -7.365  -10.130 0.02 32.96 ? 365 LEU A HD12 1  
ATOM   5707   H HD13 . LEU A 1 372 ? -4.055  -6.568  -11.228 0.02 32.44 ? 365 LEU A HD13 1  
ATOM   5708   H HD21 . LEU A 1 372 ? -1.231  -6.578  -11.326 0.02 33.39 ? 365 LEU A HD21 1  
ATOM   5709   H HD22 . LEU A 1 372 ? -0.755  -7.253  -12.676 0.02 33.23 ? 365 LEU A HD22 1  
ATOM   5710   H HD23 . LEU A 1 372 ? -1.820  -6.063  -12.686 0.02 32.90 ? 365 LEU A HD23 1  
ATOM   5711   N N    . VAL A 1 373 ? -0.221  -11.576 -10.595 0.02 33.72 ? 366 VAL A N    1  
ATOM   5712   C CA   . VAL A 1 373 ? 0.052   -13.005 -10.742 0.02 33.77 ? 366 VAL A CA   1  
ATOM   5713   C C    . VAL A 1 373 ? 0.143   -13.689 -9.386  0.02 34.10 ? 366 VAL A C    1  
ATOM   5714   O O    . VAL A 1 373 ? -0.220  -14.857 -9.250  0.02 34.01 ? 366 VAL A O    1  
ATOM   5715   C CB   . VAL A 1 373 ? 1.346   -13.206 -11.556 0.02 34.14 ? 366 VAL A CB   1  
ATOM   5716   C CG1  . VAL A 1 373 ? 1.702   -14.678 -11.652 0.02 34.33 ? 366 VAL A CG1  1  
ATOM   5717   C CG2  . VAL A 1 373 ? 1.200   -12.596 -12.957 0.02 33.78 ? 366 VAL A CG2  1  
ATOM   5718   H H    . VAL A 1 373 ? 0.453   -11.073 -10.767 0.02 33.97 ? 366 VAL A H    1  
ATOM   5719   H HA   . VAL A 1 373 ? -0.679  -13.414 -11.230 0.02 33.38 ? 366 VAL A HA   1  
ATOM   5720   H HB   . VAL A 1 373 ? 2.075   -12.751 -11.109 0.02 34.53 ? 366 VAL A HB   1  
ATOM   5721   H HG11 . VAL A 1 373 ? 0.890   -15.207 -11.634 0.02 34.01 ? 366 VAL A HG11 1  
ATOM   5722   H HG12 . VAL A 1 373 ? 2.181   -14.834 -12.480 0.02 34.41 ? 366 VAL A HG12 1  
ATOM   5723   H HG13 . VAL A 1 373 ? 2.269   -14.910 -10.901 0.02 34.73 ? 366 VAL A HG13 1  
ATOM   5724   H HG21 . VAL A 1 373 ? 2.074   -12.554 -13.377 0.02 34.05 ? 366 VAL A HG21 1  
ATOM   5725   H HG22 . VAL A 1 373 ? 0.609   -13.160 -13.482 0.02 33.42 ? 366 VAL A HG22 1  
ATOM   5726   H HG23 . VAL A 1 373 ? 0.826   -11.706 -12.881 0.02 33.68 ? 366 VAL A HG23 1  
ATOM   5727   N N    . LYS A 1 374 ? 0.614   -12.977 -8.370  0.02 34.52 ? 367 LYS A N    1  
ATOM   5728   C CA   . LYS A 1 374 ? 0.912   -13.610 -7.091  0.02 34.94 ? 367 LYS A CA   1  
ATOM   5729   C C    . LYS A 1 374 ? -0.351  -14.023 -6.342  0.02 34.60 ? 367 LYS A C    1  
ATOM   5730   O O    . LYS A 1 374 ? -0.318  -15.030 -5.617  0.02 34.82 ? 367 LYS A O    1  
ATOM   5731   C CB   . LYS A 1 374 ? 1.786   -12.668 -6.262  0.02 35.50 ? 367 LYS A CB   1  
ATOM   5732   C CG   . LYS A 1 374 ? 2.828   -13.388 -5.440  0.02 36.18 ? 367 LYS A CG   1  
ATOM   5733   C CD   . LYS A 1 374 ? 4.125   -12.568 -5.268  0.02 36.81 ? 367 LYS A CD   1  
ATOM   5734   C CE   . LYS A 1 374 ? 4.765   -12.770 -3.896  0.02 37.50 ? 367 LYS A CE   1  
ATOM   5735   N NZ   . LYS A 1 374 ? 6.081   -13.496 -3.916  0.02 38.10 ? 367 LYS A NZ   1  
ATOM   5736   H H    . LYS A 1 374 ? 0.765   -12.132 -8.391  0.02 34.60 ? 367 LYS A H    1  
ATOM   5737   H HA   . LYS A 1 374 ? 1.419   -14.419 -7.267  0.02 35.15 ? 367 LYS A HA   1  
ATOM   5738   H HB2  . LYS A 1 374 ? 2.254   -12.066 -6.862  0.02 35.57 ? 367 LYS A HB2  1  
ATOM   5739   H HB3  . LYS A 1 374 ? 1.220   -12.159 -5.663  0.02 35.38 ? 367 LYS A HB3  1  
ATOM   5740   H HG2  . LYS A 1 374 ? 2.459   -13.572 -4.562  0.02 36.23 ? 367 LYS A HG2  1  
ATOM   5741   H HG3  . LYS A 1 374 ? 3.060   -14.218 -5.887  0.02 36.21 ? 367 LYS A HG3  1  
ATOM   5742   H HD2  . LYS A 1 374 ? 4.766   -12.845 -5.941  0.02 36.94 ? 367 LYS A HD2  1  
ATOM   5743   H HD3  . LYS A 1 374 ? 3.926   -11.623 -5.370  0.02 36.68 ? 367 LYS A HD3  1  
ATOM   5744   H HE2  . LYS A 1 374 ? 4.926   -11.896 -3.507  0.02 37.73 ? 367 LYS A HE2  1  
ATOM   5745   H HE3  . LYS A 1 374 ? 4.157   -13.272 -3.331  0.02 37.37 ? 367 LYS A HE3  1  
ATOM   5746   H HZ1  . LYS A 1 374 ? 5.954   -14.345 -4.150  0.02 37.91 ? 367 LYS A HZ1  1  
ATOM   5747   H HZ2  . LYS A 1 374 ? 6.632   -13.113 -4.499  0.02 38.29 ? 367 LYS A HZ2  1  
ATOM   5748   H HZ3  . LYS A 1 374 ? 6.455   -13.476 -3.110  0.02 38.49 ? 367 LYS A HZ3  1  
ATOM   5749   N N    . GLU A 1 375 ? -1.461  -13.293 -6.538  0.02 34.10 ? 368 GLU A N    1  
ATOM   5750   C CA   . GLU A 1 375 ? -2.793  -13.851 -6.310  0.02 33.71 ? 368 GLU A CA   1  
ATOM   5751   C C    . GLU A 1 375 ? -2.808  -15.365 -6.367  0.02 33.70 ? 368 GLU A C    1  
ATOM   5752   O O    . GLU A 1 375 ? -3.373  -16.002 -5.476  0.02 33.73 ? 368 GLU A O    1  
ATOM   5753   C CB   . GLU A 1 375 ? -3.793  -13.420 -7.378  0.02 33.09 ? 368 GLU A CB   1  
ATOM   5754   C CG   . GLU A 1 375 ? -4.382  -12.070 -7.324  0.02 33.02 ? 368 GLU A CG   1  
ATOM   5755   C CD   . GLU A 1 375 ? -5.223  -11.829 -8.557  0.02 32.45 ? 368 GLU A CD   1  
ATOM   5756   O OE1  . GLU A 1 375 ? -4.738  -11.099 -9.449  0.02 32.39 ? 368 GLU A OE1  1  
ATOM   5757   O OE2  . GLU A 1 375 ? -6.338  -12.389 -8.646  0.02 32.10 ? 368 GLU A OE2  1  
ATOM   5758   H H    . GLU A 1 375 ? -1.465  -12.478 -6.804  0.02 34.00 ? 368 GLU A H    1  
ATOM   5759   H HA   . GLU A 1 375 ? -3.124  -13.563 -5.444  0.02 33.87 ? 368 GLU A HA   1  
ATOM   5760   H HB2  . GLU A 1 375 ? -3.353  -13.503 -8.238  0.02 32.94 ? 368 GLU A HB2  1  
ATOM   5761   H HB3  . GLU A 1 375 ? -4.539  -14.039 -7.348  0.02 32.88 ? 368 GLU A HB3  1  
ATOM   5762   H HG2  . GLU A 1 375 ? -4.953  -11.989 -6.545  0.02 33.11 ? 368 GLU A HG2  1  
ATOM   5763   H HG3  . GLU A 1 375 ? -3.677  -11.405 -7.305  0.02 33.28 ? 368 GLU A HG3  1  
ATOM   5764   N N    . LEU A 1 376 ? -2.255  -15.956 -7.430  0.02 33.67 ? 369 LEU A N    1  
ATOM   5765   C CA   . LEU A 1 376 ? -2.351  -17.400 -7.619  0.02 33.67 ? 369 LEU A CA   1  
ATOM   5766   C C    . LEU A 1 376 ? -1.570  -18.183 -6.564  0.02 34.28 ? 369 LEU A C    1  
ATOM   5767   O O    . LEU A 1 376 ? -1.653  -19.413 -6.510  0.02 34.38 ? 369 LEU A O    1  
ATOM   5768   C CB   . LEU A 1 376 ? -1.872  -17.774 -9.022  0.02 33.53 ? 369 LEU A CB   1  
ATOM   5769   C CG   . LEU A 1 376 ? -3.002  -17.837 -10.055 0.02 32.90 ? 369 LEU A CG   1  
ATOM   5770   C CD1  . LEU A 1 376 ? -3.645  -16.456 -10.227 0.02 32.59 ? 369 LEU A CD1  1  
ATOM   5771   C CD2  . LEU A 1 376 ? -2.449  -18.388 -11.354 0.02 32.84 ? 369 LEU A CD2  1  
ATOM   5772   H H    . LEU A 1 376 ? -1.816  -15.544 -8.043  0.02 33.67 ? 369 LEU A H    1  
ATOM   5773   H HA   . LEU A 1 376 ? -3.282  -17.632 -7.554  0.02 33.38 ? 369 LEU A HA   1  
ATOM   5774   H HB2  . LEU A 1 376 ? -1.232  -17.107 -9.320  0.02 33.68 ? 369 LEU A HB2  1  
ATOM   5775   H HB3  . LEU A 1 376 ? -1.449  -18.648 -8.996  0.02 33.73 ? 369 LEU A HB3  1  
ATOM   5776   H HG   . LEU A 1 376 ? -3.688  -18.447 -9.748  0.02 32.76 ? 369 LEU A HG   1  
ATOM   5777   H HD11 . LEU A 1 376 ? -4.286  -16.489 -10.952 0.02 32.22 ? 369 LEU A HD11 1  
ATOM   5778   H HD12 . LEU A 1 376 ? -4.100  -16.215 -9.407  0.02 32.60 ? 369 LEU A HD12 1  
ATOM   5779   H HD13 . LEU A 1 376 ? -2.952  -15.808 -10.418 0.02 32.78 ? 369 LEU A HD13 1  
ATOM   5780   H HD21 . LEU A 1 376 ? -3.150  -18.371 -12.025 0.02 32.46 ? 369 LEU A HD21 1  
ATOM   5781   H HD22 . LEU A 1 376 ? -1.702  -17.841 -11.639 0.02 33.00 ? 369 LEU A HD22 1  
ATOM   5782   H HD23 . LEU A 1 376 ? -2.152  -19.298 -11.204 0.02 33.06 ? 369 LEU A HD23 1  
ATOM   5783   N N    . GLU A 1 377 ? -0.823  -17.498 -5.713  0.02 34.73 ? 370 GLU A N    1  
ATOM   5784   C CA   . GLU A 1 377 ? -0.076  -18.209 -4.683  0.02 35.34 ? 370 GLU A CA   1  
ATOM   5785   C C    . GLU A 1 377 ? -1.007  -18.898 -3.678  0.02 35.33 ? 370 GLU A C    1  
ATOM   5786   O O    . GLU A 1 377 ? -0.650  -19.947 -3.137  0.02 35.72 ? 370 GLU A O    1  
ATOM   5787   C CB   . GLU A 1 377 ? 0.877   -17.241 -4.007  0.02 35.87 ? 370 GLU A CB   1  
ATOM   5788   C CG   . GLU A 1 377 ? 2.003   -17.915 -3.294  0.02 36.57 ? 370 GLU A CG   1  
ATOM   5789   C CD   . GLU A 1 377 ? 2.509   -17.100 -2.139  0.02 37.11 ? 370 GLU A CD   1  
ATOM   5790   O OE1  . GLU A 1 377 ? 2.450   -17.596 -0.985  0.02 37.44 ? 370 GLU A OE1  1  
ATOM   5791   O OE2  . GLU A 1 377 ? 2.964   -15.966 -2.385  0.02 37.23 ? 370 GLU A OE2  1  
ATOM   5792   H H    . GLU A 1 377 ? -0.730  -16.644 -5.708  0.02 34.71 ? 370 GLU A H    1  
ATOM   5793   H HA   . GLU A 1 377 ? 0.460   -18.896 -5.107  0.02 35.48 ? 370 GLU A HA   1  
ATOM   5794   H HB2  . GLU A 1 377 ? 1.278   -16.676 -4.686  0.02 35.82 ? 370 GLU A HB2  1  
ATOM   5795   H HB3  . GLU A 1 377 ? 0.385   -16.696 -3.375  0.02 35.83 ? 370 GLU A HB3  1  
ATOM   5796   H HG2  . GLU A 1 377 ? 1.696   -18.772 -2.959  0.02 36.58 ? 370 GLU A HG2  1  
ATOM   5797   H HG3  . GLU A 1 377 ? 2.740   -18.041 -3.913  0.02 36.73 ? 370 GLU A HG3  1  
ATOM   5798   N N    . THR A 1 378 ? -2.196  -18.338 -3.417  0.02 34.93 ? 371 THR A N    1  
ATOM   5799   C CA   . THR A 1 378 ? -3.273  -19.084 -2.775  0.02 34.80 ? 371 THR A CA   1  
ATOM   5800   C C    . THR A 1 378 ? -4.574  -19.101 -3.568  0.02 34.14 ? 371 THR A C    1  
ATOM   5801   O O    . THR A 1 378 ? -5.434  -19.941 -3.281  0.02 34.05 ? 371 THR A O    1  
ATOM   5802   C CB   . THR A 1 378 ? -3.561  -18.529 -1.357  0.02 35.09 ? 371 THR A CB   1  
ATOM   5803   O OG1  . THR A 1 378 ? -4.091  -17.199 -1.430  0.02 34.81 ? 371 THR A OG1  1  
ATOM   5804   C CG2  . THR A 1 378 ? -2.295  -18.486 -0.532  0.02 35.80 ? 371 THR A CG2  1  
ATOM   5805   H H    . THR A 1 378 ? -2.397  -17.523 -3.590  0.02 34.75 ? 371 THR A H    1  
ATOM   5806   H HA   . THR A 1 378 ? -2.990  -20.003 -2.684  0.02 35.03 ? 371 THR A HA   1  
ATOM   5807   H HB   . THR A 1 378 ? -4.197  -19.104 -0.905  0.02 35.05 ? 371 THR A HB   1  
ATOM   5808   H HG1  . THR A 1 378 ? -4.925  -17.219 -1.486  0.02 34.47 ? 371 THR A HG1  1  
ATOM   5809   H HG21 . THR A 1 378 ? -1.667  -17.853 -0.911  0.02 35.88 ? 371 THR A HG21 1  
ATOM   5810   H HG22 . THR A 1 378 ? -2.504  -18.214 0.375   0.02 36.00 ? 371 THR A HG22 1  
ATOM   5811   H HG23 . THR A 1 378 ? -1.888  -19.366 -0.516  0.02 36.01 ? 371 THR A HG23 1  
ATOM   5812   N N    . CYS A 1 379 ? -4.738  -18.210 -4.553  0.02 33.73 ? 372 CYS A N    1  
ATOM   5813   C CA   . CYS A 1 379 ? -5.929  -18.105 -5.402  0.02 33.12 ? 372 CYS A CA   1  
ATOM   5814   C C    . CYS A 1 379 ? -7.195  -17.783 -4.623  0.02 32.94 ? 372 CYS A C    1  
ATOM   5815   O O    . CYS A 1 379 ? -8.305  -17.984 -5.112  0.02 32.52 ? 372 CYS A O    1  
ATOM   5816   C CB   . CYS A 1 379 ? -6.141  -19.368 -6.223  0.02 32.96 ? 372 CYS A CB   1  
ATOM   5817   S SG   . CYS A 1 379 ? -4.807  -19.636 -7.414  0.02 33.08 ? 372 CYS A SG   1  
ATOM   5818   H H    . CYS A 1 379 ? -4.137  -17.634 -4.763  0.02 33.82 ? 372 CYS A H    1  
ATOM   5819   H HA   . CYS A 1 379 ? -5.780  -17.377 -6.026  0.02 32.94 ? 372 CYS A HA   1  
ATOM   5820   H HB2  . CYS A 1 379 ? -6.194  -20.137 -5.636  0.02 33.19 ? 372 CYS A HB2  1  
ATOM   5821   H HB3  . CYS A 1 379 ? -6.964  -19.278 -6.729  0.02 32.58 ? 372 CYS A HB3  1  
ATOM   5822   H HG   . CYS A 1 379 ? -3.796  -19.809 -6.805  0.02 33.57 ? 372 CYS A HG   1  
ATOM   5823   N N    . VAL A 1 380 ? -7.045  -17.257 -3.416  0.02 33.29 ? 373 VAL A N    1  
ATOM   5824   C CA   . VAL A 1 380 ? -8.201  -16.908 -2.607  0.02 33.20 ? 373 VAL A CA   1  
ATOM   5825   C C    . VAL A 1 380 ? -9.117  -15.899 -3.299  0.02 32.69 ? 373 VAL A C    1  
ATOM   5826   O O    . VAL A 1 380 ? -10.342 -15.944 -3.135  0.02 32.46 ? 373 VAL A O    1  
ATOM   5827   C CB   . VAL A 1 380 ? -7.648  -16.404 -1.271  0.02 33.74 ? 373 VAL A CB   1  
ATOM   5828   C CG1  . VAL A 1 380 ? -7.741  -14.938 -0.983  0.02 33.75 ? 373 VAL A CG1  1  
ATOM   5829   C CG2  . VAL A 1 380 ? -7.259  -17.491 -0.279  0.02 34.25 ? 373 VAL A CG2  1  
ATOM   5830   H H    . VAL A 1 380 ? -6.287  -17.093 -3.044  0.02 33.61 ? 373 VAL A H    1  
ATOM   5831   H HA   . VAL A 1 380 ? -8.722  -17.708 -2.441  0.02 33.19 ? 373 VAL A HA   1  
ATOM   5832   H HB   . VAL A 1 380 ? -8.541  -16.461 -0.898  0.02 33.63 ? 373 VAL A HB   1  
ATOM   5833   H HG11 . VAL A 1 380 ? -7.442  -14.769 -0.077  0.02 34.14 ? 373 VAL A HG11 1  
ATOM   5834   H HG12 . VAL A 1 380 ? -7.167  -14.470 -1.608  0.02 33.64 ? 373 VAL A HG12 1  
ATOM   5835   H HG13 . VAL A 1 380 ? -8.658  -14.644 -1.091  0.02 33.49 ? 373 VAL A HG13 1  
ATOM   5836   H HG21 . VAL A 1 380 ? -7.264  -17.123 0.618   0.02 34.52 ? 373 VAL A HG21 1  
ATOM   5837   H HG22 . VAL A 1 380 ? -7.900  -18.215 -0.350  0.02 34.11 ? 373 VAL A HG22 1  
ATOM   5838   H HG23 . VAL A 1 380 ? -6.381  -17.823 -0.501  0.02 34.45 ? 373 VAL A HG23 1  
ATOM   5839   N N    . ASN A 1 381 ? -8.552  -15.003 -4.101  0.02 32.55 ? 374 ASN A N    1  
ATOM   5840   C CA   . ASN A 1 381 ? -9.369  -13.957 -4.703  0.02 32.13 ? 374 ASN A CA   1  
ATOM   5841   C C    . ASN A 1 381 ? -10.281 -14.485 -5.801  0.02 31.63 ? 374 ASN A C    1  
ATOM   5842   O O    . ASN A 1 381 ? -11.290 -13.845 -6.115  0.02 31.30 ? 374 ASN A O    1  
ATOM   5843   C CB   . ASN A 1 381 ? -8.457  -12.840 -5.201  0.02 32.20 ? 374 ASN A CB   1  
ATOM   5844   C CG   . ASN A 1 381 ? -8.026  -11.930 -4.070  0.02 32.63 ? 374 ASN A CG   1  
ATOM   5845   O OD1  . ASN A 1 381 ? -8.640  -11.959 -3.007  0.02 32.77 ? 374 ASN A OD1  1  
ATOM   5846   N ND2  . ASN A 1 381 ? -6.954  -11.167 -4.265  0.02 32.88 ? 374 ASN A ND2  1  
ATOM   5847   H H    . ASN A 1 381 ? -7.719  -14.976 -4.309  0.02 32.72 ? 374 ASN A H    1  
ATOM   5848   H HA   . ASN A 1 381 ? -9.945  -13.588 -4.015  0.02 32.18 ? 374 ASN A HA   1  
ATOM   5849   H HB2  . ASN A 1 381 ? -7.659  -13.229 -5.590  0.02 32.31 ? 374 ASN A HB2  1  
ATOM   5850   H HB3  . ASN A 1 381 ? -8.929  -12.304 -5.856  0.02 31.89 ? 374 ASN A HB3  1  
ATOM   5851   H HD21 . ASN A 1 381 ? -6.923  -10.380 -3.925  0.02 33.07 ? 374 ASN A HD21 1  
ATOM   5852   H HD22 . ASN A 1 381 ? -6.295  -11.460 -4.731  0.02 32.89 ? 374 ASN A HD22 1  
ATOM   5853   N N    . PHE A 1 382 ? -9.984  -15.655 -6.345  0.02 31.61 ? 375 PHE A N    1  
ATOM   5854   C CA   . PHE A 1 382 ? -10.797 -16.246 -7.404  0.02 31.19 ? 375 PHE A CA   1  
ATOM   5855   C C    . PHE A 1 382 ? -11.824 -17.239 -6.883  0.02 31.18 ? 375 PHE A C    1  
ATOM   5856   O O    . PHE A 1 382 ? -12.662 -17.720 -7.646  0.02 30.87 ? 375 PHE A O    1  
ATOM   5857   C CB   . PHE A 1 382 ? -9.890  -16.910 -8.430  0.02 31.20 ? 375 PHE A CB   1  
ATOM   5858   C CG   . PHE A 1 382 ? -9.179  -15.934 -9.287  0.02 31.11 ? 375 PHE A CG   1  
ATOM   5859   C CD1  . PHE A 1 382 ? -9.865  -15.268 -10.284 0.02 30.69 ? 375 PHE A CD1  1  
ATOM   5860   C CD2  . PHE A 1 382 ? -7.846  -15.659 -9.091  0.02 31.50 ? 375 PHE A CD2  1  
ATOM   5861   C CE1  . PHE A 1 382 ? -9.226  -14.372 -11.085 0.02 30.65 ? 375 PHE A CE1  1  
ATOM   5862   C CE2  . PHE A 1 382 ? -7.199  -14.760 -9.878  0.02 31.47 ? 375 PHE A CE2  1  
ATOM   5863   C CZ   . PHE A 1 382 ? -7.902  -14.097 -10.882 0.02 31.04 ? 375 PHE A CZ   1  
ATOM   5864   H H    . PHE A 1 382 ? -9.306  -16.128 -6.119  0.02 31.86 ? 375 PHE A H    1  
ATOM   5865   H HA   . PHE A 1 382 ? -11.282 -15.538 -7.859  0.02 30.93 ? 375 PHE A HA   1  
ATOM   5866   H HB2  . PHE A 1 382 ? -9.222  -17.438 -7.966  0.02 31.51 ? 375 PHE A HB2  1  
ATOM   5867   H HB3  . PHE A 1 382 ? -10.424 -17.481 -9.003  0.02 30.99 ? 375 PHE A HB3  1  
ATOM   5868   H HD1  . PHE A 1 382 ? -10.765 -15.451 -10.420 0.02 30.46 ? 375 PHE A HD1  1  
ATOM   5869   H HD2  . PHE A 1 382 ? -7.380  -16.097 -8.418  0.02 31.80 ? 375 PHE A HD2  1  
ATOM   5870   H HE1  . PHE A 1 382 ? -9.696  -13.932 -11.755 0.02 30.39 ? 375 PHE A HE1  1  
ATOM   5871   H HE2  . PHE A 1 382 ? -6.297  -14.581 -9.739  0.02 31.76 ? 375 PHE A HE2  1  
ATOM   5872   H HZ   . PHE A 1 382 ? -7.465  -13.484 -11.427 0.02 31.05 ? 375 PHE A HZ   1  
ATOM   5873   N N    . VAL A 1 383 ? -11.811 -17.529 -5.590  0.02 31.55 ? 376 VAL A N    1  
ATOM   5874   C CA   . VAL A 1 383 ? -12.924 -18.307 -5.057  0.02 31.56 ? 376 VAL A CA   1  
ATOM   5875   C C    . VAL A 1 383 ? -14.225 -17.586 -5.349  0.02 31.19 ? 376 VAL A C    1  
ATOM   5876   O O    . VAL A 1 383 ? -14.320 -16.372 -5.103  0.02 31.15 ? 376 VAL A O    1  
ATOM   5877   C CB   . VAL A 1 383 ? -12.763 -18.498 -3.542  0.02 32.06 ? 376 VAL A CB   1  
ATOM   5878   C CG1  . VAL A 1 383 ? -13.952 -19.286 -3.014  0.02 32.11 ? 376 VAL A CG1  1  
ATOM   5879   C CG2  . VAL A 1 383 ? -11.448 -19.176 -3.284  0.02 32.46 ? 376 VAL A CG2  1  
ATOM   5880   H H    . VAL A 1 383 ? -11.201 -17.304 -5.033  0.02 31.81 ? 376 VAL A H    1  
ATOM   5881   H HA   . VAL A 1 383 ? -12.935 -19.177 -5.476  0.02 31.54 ? 376 VAL A HA   1  
ATOM   5882   H HB   . VAL A 1 383 ? -12.750 -17.628 -3.115  0.02 32.10 ? 376 VAL A HB   1  
ATOM   5883   H HG11 . VAL A 1 383 ? -14.158 -20.000 -3.635  0.02 31.98 ? 376 VAL A HG11 1  
ATOM   5884   H HG12 . VAL A 1 383 ? -13.724 -19.656 -2.148  0.02 32.46 ? 376 VAL A HG12 1  
ATOM   5885   H HG13 . VAL A 1 383 ? -14.715 -18.694 -2.929  0.02 31.95 ? 376 VAL A HG13 1  
ATOM   5886   H HG21 . VAL A 1 383 ? -11.479 -19.625 -2.424  0.02 32.78 ? 376 VAL A HG21 1  
ATOM   5887   H HG22 . VAL A 1 383 ? -11.287 -19.815 -3.994  0.02 32.36 ? 376 VAL A HG22 1  
ATOM   5888   H HG23 . VAL A 1 383 ? -10.747 -18.507 -3.281  0.02 32.52 ? 376 VAL A HG23 1  
ATOM   5889   N N    . PRO A 1 384 ? -15.257 -18.271 -5.814  0.02 30.98 ? 377 PRO A N    1  
ATOM   5890   C CA   . PRO A 1 384 ? -16.546 -17.610 -6.018  0.02 30.68 ? 377 PRO A CA   1  
ATOM   5891   C C    . PRO A 1 384 ? -16.946 -16.790 -4.803  0.02 30.90 ? 377 PRO A C    1  
ATOM   5892   O O    . PRO A 1 384 ? -16.938 -17.287 -3.660  0.02 31.29 ? 377 PRO A O    1  
ATOM   5893   C CB   . PRO A 1 384 ? -17.500 -18.776 -6.252  0.02 30.64 ? 377 PRO A CB   1  
ATOM   5894   C CG   . PRO A 1 384 ? -16.649 -19.775 -6.947  0.02 30.67 ? 377 PRO A CG   1  
ATOM   5895   C CD   . PRO A 1 384 ? -15.259 -19.634 -6.375  0.02 30.98 ? 377 PRO A CD   1  
ATOM   5896   H HA   . PRO A 1 384 ? -16.525 -17.042 -6.802  0.02 30.42 ? 377 PRO A HA   1  
ATOM   5897   H HB2  . PRO A 1 384 ? -17.817 -19.128 -5.410  0.02 30.88 ? 377 PRO A HB2  1  
ATOM   5898   H HB3  . PRO A 1 384 ? -18.243 -18.489 -6.801  0.02 30.38 ? 377 PRO A HB3  1  
ATOM   5899   H HG2  . PRO A 1 384 ? -16.997 -20.665 -6.790  0.02 30.79 ? 377 PRO A HG2  1  
ATOM   5900   H HG3  . PRO A 1 384 ? -16.640 -19.580 -7.896  0.02 30.40 ? 377 PRO A HG3  1  
ATOM   5901   H HD2  . PRO A 1 384 ? -15.110 -20.295 -5.684  0.02 31.28 ? 377 PRO A HD2  1  
ATOM   5902   H HD3  . PRO A 1 384 ? -14.596 -19.703 -7.076  0.02 30.90 ? 377 PRO A HD3  1  
ATOM   5903   N N    . SER A 1 385 ? -17.348 -15.545 -5.070  0.02 30.67 ? 378 SER A N    1  
ATOM   5904   C CA   . SER A 1 385 ? -17.614 -14.594 -3.989  0.02 30.90 ? 378 SER A CA   1  
ATOM   5905   C C    . SER A 1 385 ? -18.651 -15.129 -3.007  0.02 31.14 ? 378 SER A C    1  
ATOM   5906   O O    . SER A 1 385 ? -18.548 -14.883 -1.794  0.02 31.52 ? 378 SER A O    1  
ATOM   5907   C CB   . SER A 1 385 ? -18.090 -13.258 -4.573  0.02 30.61 ? 378 SER A CB   1  
ATOM   5908   O OG   . SER A 1 385 ? -19.309 -13.406 -5.276  0.02 30.31 ? 378 SER A OG   1  
ATOM   5909   H H    . SER A 1 385 ? -17.485 -15.238 -5.855  0.02 30.42 ? 378 SER A H    1  
ATOM   5910   H HA   . SER A 1 385 ? -16.791 -14.426 -3.503  0.02 31.13 ? 378 SER A HA   1  
ATOM   5911   H HB2  . SER A 1 385 ? -18.223 -12.627 -3.851  0.02 30.79 ? 378 SER A HB2  1  
ATOM   5912   H HB3  . SER A 1 385 ? -17.417 -12.925 -5.187  0.02 30.49 ? 378 SER A HB3  1  
ATOM   5913   H HG   . SER A 1 385 ? -19.908 -13.690 -4.761  0.02 30.43 ? 378 SER A HG   1  
ATOM   5914   N N    . GLU A 1 386 ? -19.660 -15.850 -3.501  0.02 30.96 ? 379 GLU A N    1  
ATOM   5915   C CA   . GLU A 1 386 ? -20.733 -16.282 -2.614  0.02 31.22 ? 379 GLU A CA   1  
ATOM   5916   C C    . GLU A 1 386 ? -20.254 -17.322 -1.604  0.02 31.67 ? 379 GLU A C    1  
ATOM   5917   O O    . GLU A 1 386 ? -20.801 -17.399 -0.491  0.02 32.03 ? 379 GLU A O    1  
ATOM   5918   C CB   . GLU A 1 386 ? -21.906 -16.815 -3.417  0.02 30.97 ? 379 GLU A CB   1  
ATOM   5919   C CG   . GLU A 1 386 ? -21.588 -18.045 -4.250  0.02 30.86 ? 379 GLU A CG   1  
ATOM   5920   C CD   . GLU A 1 386 ? -21.290 -17.741 -5.700  0.02 30.41 ? 379 GLU A CD   1  
ATOM   5921   O OE1  . GLU A 1 386 ? -20.714 -16.668 -6.019  0.02 30.24 ? 379 GLU A OE1  1  
ATOM   5922   O OE2  . GLU A 1 386 ? -21.638 -18.617 -6.524  0.02 30.27 ? 379 GLU A OE2  1  
ATOM   5923   H H    . GLU A 1 386 ? -19.745 -16.088 -4.318  0.02 30.72 ? 379 GLU A H    1  
ATOM   5924   H HA   . GLU A 1 386 ? -21.044 -15.516 -2.110  0.02 31.30 ? 379 GLU A HA   1  
ATOM   5925   H HB2  . GLU A 1 386 ? -22.620 -17.053 -2.806  0.02 31.18 ? 379 GLU A HB2  1  
ATOM   5926   H HB3  . GLU A 1 386 ? -22.206 -16.118 -4.021  0.02 30.71 ? 379 GLU A HB3  1  
ATOM   5927   H HG2  . GLU A 1 386 ? -20.813 -18.498 -3.882  0.02 31.06 ? 379 GLU A HG2  1  
ATOM   5928   H HG3  . GLU A 1 386 ? -22.355 -18.639 -4.224  0.02 30.92 ? 379 GLU A HG3  1  
ATOM   5929   N N    . LEU A 1 387 ? -19.230 -18.104 -1.950  0.02 31.70 ? 380 LEU A N    1  
ATOM   5930   C CA   . LEU A 1 387 ? -18.666 -19.080 -1.018  0.02 32.17 ? 380 LEU A CA   1  
ATOM   5931   C C    . LEU A 1 387 ? -17.600 -18.500 -0.113  0.02 32.50 ? 380 LEU A C    1  
ATOM   5932   O O    . LEU A 1 387 ? -17.299 -19.094 0.931   0.02 32.97 ? 380 LEU A O    1  
ATOM   5933   C CB   . LEU A 1 387 ? -18.000 -20.262 -1.740  0.02 32.13 ? 380 LEU A CB   1  
ATOM   5934   C CG   . LEU A 1 387 ? -18.681 -21.101 -2.816  0.02 31.87 ? 380 LEU A CG   1  
ATOM   5935   C CD1  . LEU A 1 387 ? -17.680 -22.122 -3.312  0.02 31.97 ? 380 LEU A CD1  1  
ATOM   5936   C CD2  . LEU A 1 387 ? -19.904 -21.813 -2.312  0.02 32.08 ? 380 LEU A CD2  1  
ATOM   5937   H H    . LEU A 1 387 ? -18.845 -18.084 -2.718  0.02 31.48 ? 380 LEU A H    1  
ATOM   5938   H HA   . LEU A 1 387 ? -19.377 -19.428 -0.459  0.02 32.36 ? 380 LEU A HA   1  
ATOM   5939   H HB2  . LEU A 1 387 ? -17.184 -19.926 -2.138  0.02 32.01 ? 380 LEU A HB2  1  
ATOM   5940   H HB3  . LEU A 1 387 ? -17.749 -20.891 -1.048  0.02 32.48 ? 380 LEU A HB3  1  
ATOM   5941   H HG   . LEU A 1 387 ? -18.938 -20.525 -3.553  0.02 31.53 ? 380 LEU A HG   1  
ATOM   5942   H HD11 . LEU A 1 387 ? -17.387 -22.664 -2.562  0.02 32.32 ? 380 LEU A HD11 1  
ATOM   5943   H HD12 . LEU A 1 387 ? -18.106 -22.684 -3.980  0.02 31.82 ? 380 LEU A HD12 1  
ATOM   5944   H HD13 . LEU A 1 387 ? -16.921 -21.659 -3.699  0.02 31.85 ? 380 LEU A HD13 1  
ATOM   5945   H HD21 . LEU A 1 387 ? -20.255 -22.377 -3.005  0.02 31.91 ? 380 LEU A HD21 1  
ATOM   5946   H HD22 . LEU A 1 387 ? -19.651 -22.356 -1.549  0.02 32.43 ? 380 LEU A HD22 1  
ATOM   5947   H HD23 . LEU A 1 387 ? -20.567 -21.159 -2.043  0.02 32.09 ? 380 LEU A HD23 1  
ATOM   5948   N N    . ALA A 1 388 ? -16.988 -17.395 -0.502  0.02 32.32 ? 381 ALA A N    1  
ATOM   5949   C CA   . ALA A 1 388 ? -15.818 -16.870 0.187   0.02 32.65 ? 381 ALA A CA   1  
ATOM   5950   C C    . ALA A 1 388 ? -16.195 -15.850 1.255   0.02 32.90 ? 381 ALA A C    1  
ATOM   5951   O O    . ALA A 1 388 ? -17.243 -15.205 1.187   0.02 32.71 ? 381 ALA A O    1  
ATOM   5952   C CB   . ALA A 1 388 ? -14.868 -16.200 -0.792  0.02 32.38 ? 381 ALA A CB   1  
ATOM   5953   H H    . ALA A 1 388 ? -17.239 -16.917 -1.171  0.02 32.02 ? 381 ALA A H    1  
ATOM   5954   H HA   . ALA A 1 388 ? -15.345 -17.605 0.606   0.02 32.92 ? 381 ALA A HA   1  
ATOM   5955   H HB1  . ALA A 1 388 ? -14.102 -15.859 -0.309  0.02 32.64 ? 381 ALA A HB1  1  
ATOM   5956   H HB2  . ALA A 1 388 ? -14.583 -16.855 -1.446  0.02 32.26 ? 381 ALA A HB2  1  
ATOM   5957   H HB3  . ALA A 1 388 ? -15.340 -15.470 -1.222  0.02 32.12 ? 381 ALA A HB3  1  
ATOM   5958   N N    . ASP A 1 389 ? -15.304 -15.685 2.225   0.02 33.38 ? 382 ASP A N    1  
ATOM   5959   C CA   . ASP A 1 389 ? -15.522 -14.692 3.276   0.02 33.70 ? 382 ASP A CA   1  
ATOM   5960   C C    . ASP A 1 389 ? -14.966 -13.328 2.857   0.02 33.54 ? 382 ASP A C    1  
ATOM   5961   O O    . ASP A 1 389 ? -14.154 -13.205 1.949   0.02 33.30 ? 382 ASP A O    1  
ATOM   5962   C CB   . ASP A 1 389 ? -14.898 -15.144 4.602   0.02 34.34 ? 382 ASP A CB   1  
ATOM   5963   C CG   . ASP A 1 389 ? -13.430 -15.430 4.498   0.02 34.53 ? 382 ASP A CG   1  
ATOM   5964   O OD1  . ASP A 1 389 ? -12.675 -15.059 5.421   0.02 34.99 ? 382 ASP A OD1  1  
ATOM   5965   O OD2  . ASP A 1 389 ? -13.020 -16.042 3.499   0.02 34.25 ? 382 ASP A OD2  1  
ATOM   5966   H H    . ASP A 1 389 ? -14.571 -16.128 2.295   0.02 33.55 ? 382 ASP A H    1  
ATOM   5967   H HA   . ASP A 1 389 ? -16.477 -14.592 3.421   0.02 33.64 ? 382 ASP A HA   1  
ATOM   5968   H HB2  . ASP A 1 389 ? -15.014 -14.436 5.251   0.02 34.55 ? 382 ASP A HB2  1  
ATOM   5969   H HB3  . ASP A 1 389 ? -15.336 -15.953 4.907   0.02 34.46 ? 382 ASP A HB3  1  
ATOM   5970   N N    . ALA A 1 390 ? -15.405 -12.280 3.554   0.02 33.74 ? 383 ALA A N    1  
ATOM   5971   C CA   . ALA A 1 390 ? -15.067 -10.923 3.127   0.02 33.61 ? 383 ALA A CA   1  
ATOM   5972   C C    . ALA A 1 390 ? -13.559 -10.721 3.040   0.02 33.83 ? 383 ALA A C    1  
ATOM   5973   O O    . ALA A 1 390 ? -13.056 -10.170 2.058   0.02 33.55 ? 383 ALA A O    1  
ATOM   5974   C CB   . ALA A 1 390 ? -15.676 -9.908  4.093   0.02 33.90 ? 383 ALA A CB   1  
ATOM   5975   H H    . ALA A 1 390 ? -15.890 -12.326 4.260   0.02 33.97 ? 383 ALA A H    1  
ATOM   5976   H HA   . ALA A 1 390 ? -15.440 -10.766 2.247   0.02 33.22 ? 383 ALA A HA   1  
ATOM   5977   H HB1  . ALA A 1 390 ? -16.587 -10.168 4.297   0.02 33.86 ? 383 ALA A HB1  1  
ATOM   5978   H HB2  . ALA A 1 390 ? -15.142 -9.901  4.901   0.02 34.31 ? 383 ALA A HB2  1  
ATOM   5979   H HB3  . ALA A 1 390 ? -15.658 -9.031  3.679   0.02 33.76 ? 383 ALA A HB3  1  
ATOM   5980   N N    . GLU A 1 391 ? -12.826 -11.123 4.078   0.02 34.37 ? 384 GLU A N    1  
ATOM   5981   C CA   . GLU A 1 391 ? -11.371 -11.049 4.085   0.02 34.65 ? 384 GLU A CA   1  
ATOM   5982   C C    . GLU A 1 391 ? -10.757 -12.080 3.153   0.02 34.43 ? 384 GLU A C    1  
ATOM   5983   O O    . GLU A 1 391 ? -9.695  -11.830 2.585   0.02 34.48 ? 384 GLU A O    1  
ATOM   5984   C CB   . GLU A 1 391 ? -10.809 -11.255 5.532   0.02 35.36 ? 384 GLU A CB   1  
ATOM   5985   C CG   . GLU A 1 391 ? -10.734 -10.008 6.415   0.02 35.76 ? 384 GLU A CG   1  
ATOM   5986   C CD   . GLU A 1 391 ? -9.867  -10.178 7.684   0.02 36.50 ? 384 GLU A CD   1  
ATOM   5987   O OE1  . GLU A 1 391 ? -9.763  -11.280 8.293   0.02 36.73 ? 384 GLU A OE1  1  
ATOM   5988   O OE2  . GLU A 1 391 ? -9.279  -9.166  8.079   0.02 36.89 ? 384 GLU A OE2  1  
ATOM   5989   H H    . GLU A 1 391 ? -13.158 -11.456 4.795   0.02 34.60 ? 384 GLU A H    1  
ATOM   5990   H HA   . GLU A 1 391 ? -11.101 -10.173 3.773   0.02 34.59 ? 384 GLU A HA   1  
ATOM   5991   H HB2  . GLU A 1 391 ? -11.367 -11.899 5.996   0.02 35.46 ? 384 GLU A HB2  1  
ATOM   5992   H HB3  . GLU A 1 391 ? -9.906  -11.600 5.463   0.02 35.52 ? 384 GLU A HB3  1  
ATOM   5993   H HG2  . GLU A 1 391 ? -10.338 -9.290  5.898   0.02 35.68 ? 384 GLU A HG2  1  
ATOM   5994   H HG3  . GLU A 1 391 ? -11.630 -9.754  6.684   0.02 35.66 ? 384 GLU A HG3  1  
ATOM   5995   N N    . ARG A 1 392 ? -11.437 -13.206 2.956   0.02 34.22 ? 385 ARG A N    1  
ATOM   5996   C CA   . ARG A 1 392 ? -10.891 -14.361 2.261   0.02 34.11 ? 385 ARG A CA   1  
ATOM   5997   C C    . ARG A 1 392 ? -9.652  -14.900 2.961   0.02 34.67 ? 385 ARG A C    1  
ATOM   5998   O O    . ARG A 1 392 ? -8.580  -15.021 2.367   0.02 34.71 ? 385 ARG A O    1  
ATOM   5999   C CB   . ARG A 1 392 ? -10.607 -14.028 0.800   0.02 33.62 ? 385 ARG A CB   1  
ATOM   6000   C CG   . ARG A 1 392 ? -11.866 -13.656 0.065   0.02 33.08 ? 385 ARG A CG   1  
ATOM   6001   C CD   . ARG A 1 392 ? -11.587 -13.329 -1.369  0.02 32.65 ? 385 ARG A CD   1  
ATOM   6002   N NE   . ARG A 1 392 ? -12.787 -12.839 -2.042  0.02 32.17 ? 385 ARG A NE   1  
ATOM   6003   C CZ   . ARG A 1 392 ? -13.488 -13.527 -2.936  0.02 31.78 ? 385 ARG A CZ   1  
ATOM   6004   N NH1  . ARG A 1 392 ? -13.122 -14.760 -3.302  0.02 31.80 ? 385 ARG A NH1  1  
ATOM   6005   N NH2  . ARG A 1 392 ? -14.568 -12.983 -3.462  0.02 31.41 ? 385 ARG A NH2  1  
ATOM   6006   H H    . ARG A 1 392 ? -12.247 -13.323 3.218   0.02 34.15 ? 385 ARG A H    1  
ATOM   6007   H HA   . ARG A 1 392 ? -11.550 -15.062 2.263   0.02 34.01 ? 385 ARG A HA   1  
ATOM   6008   H HB2  . ARG A 1 392 ? -9.978  -13.293 0.735   0.02 33.69 ? 385 ARG A HB2  1  
ATOM   6009   H HB3  . ARG A 1 392 ? -10.238 -14.818 0.381   0.02 33.61 ? 385 ARG A HB3  1  
ATOM   6010   H HG2  . ARG A 1 392 ? -12.487 -14.397 0.096   0.02 33.00 ? 385 ARG A HG2  1  
ATOM   6011   H HG3  . ARG A 1 392 ? -12.260 -12.875 0.482   0.02 33.11 ? 385 ARG A HG3  1  
ATOM   6012   H HD2  . ARG A 1 392 ? -10.917 -12.630 -1.410  0.02 32.79 ? 385 ARG A HD2  1  
ATOM   6013   H HD3  . ARG A 1 392 ? -11.256 -14.124 -1.808  0.02 32.60 ? 385 ARG A HD3  1  
ATOM   6014   H HE   . ARG A 1 392 ? -13.172 -12.156 -1.692  0.02 32.20 ? 385 ARG A HE   1  
ATOM   6015   H HH11 . ARG A 1 392 ? -12.425 -15.132 -2.970  0.02 32.06 ? 385 ARG A HH11 1  
ATOM   6016   H HH12 . ARG A 1 392 ? -13.590 -15.189 -3.878  0.02 31.56 ? 385 ARG A HH12 1  
ATOM   6017   H HH21 . ARG A 1 392 ? -14.807 -12.193 -3.230  0.02 31.42 ? 385 ARG A HH21 1  
ATOM   6018   H HH22 . ARG A 1 392 ? -15.027 -13.419 -4.040  0.02 31.18 ? 385 ARG A HH22 1  
ATOM   6019   N N    . THR A 1 393 ? -9.800  -15.212 4.267   0.02 35.16 ? 386 THR A N    1  
ATOM   6020   C CA   . THR A 1 393 ? -8.834  -16.046 4.972   0.02 35.72 ? 386 THR A CA   1  
ATOM   6021   C C    . THR A 1 393 ? -9.459  -17.087 5.885   0.02 36.03 ? 386 THR A C    1  
ATOM   6022   O O    . THR A 1 393 ? -8.719  -17.838 6.534   0.02 36.53 ? 386 THR A O    1  
ATOM   6023   C CB   . THR A 1 393 ? -7.874  -15.209 5.810   0.02 36.25 ? 386 THR A CB   1  
ATOM   6024   O OG1  . THR A 1 393 ? -7.235  -16.081 6.758   0.02 36.89 ? 386 THR A OG1  1  
ATOM   6025   C CG2  . THR A 1 393 ? -8.621  -14.053 6.523   0.02 36.29 ? 386 THR A CG2  1  
ATOM   6026   H H    . THR A 1 393 ? -10.457 -14.946 4.754   0.02 35.20 ? 386 THR A H    1  
ATOM   6027   H HA   . THR A 1 393 ? -8.301  -16.521 4.316   0.02 35.62 ? 386 THR A HA   1  
ATOM   6028   H HB   . THR A 1 393 ? -7.201  -14.822 5.229   0.02 36.17 ? 386 THR A HB   1  
ATOM   6029   H HG1  . THR A 1 393 ? -6.409  -15.918 6.798   0.02 37.04 ? 386 THR A HG1  1  
ATOM   6030   H HG21 . THR A 1 393 ? -9.568  -14.249 6.598   0.02 36.06 ? 386 THR A HG21 1  
ATOM   6031   H HG22 . THR A 1 393 ? -8.258  -13.931 7.415   0.02 36.75 ? 386 THR A HG22 1  
ATOM   6032   H HG23 . THR A 1 393 ? -8.507  -13.229 6.025   0.02 36.11 ? 386 THR A HG23 1  
ATOM   6033   N N    . ALA A 1 394 ? -10.782 -17.158 5.962   0.02 35.79 ? 387 ALA A N    1  
ATOM   6034   C CA   . ALA A 1 394 ? -11.388 -18.279 6.653   0.02 36.06 ? 387 ALA A CA   1  
ATOM   6035   C C    . ALA A 1 394 ? -10.798 -19.569 6.098   0.02 36.06 ? 387 ALA A C    1  
ATOM   6036   O O    . ALA A 1 394 ? -10.702 -19.725 4.865   0.02 35.57 ? 387 ALA A O    1  
ATOM   6037   C CB   . ALA A 1 394 ? -12.899 -18.265 6.471   0.02 35.71 ? 387 ALA A CB   1  
ATOM   6038   H H    . ALA A 1 394 ? -11.335 -16.586 5.638   0.02 35.49 ? 387 ALA A H    1  
ATOM   6039   H HA   . ALA A 1 394 ? -11.191 -18.211 7.597   0.02 36.51 ? 387 ALA A HA   1  
ATOM   6040   H HB1  . ALA A 1 394 ? -13.286 -19.031 6.921   0.02 35.96 ? 387 ALA A HB1  1  
ATOM   6041   H HB2  . ALA A 1 394 ? -13.253 -17.442 6.838   0.02 35.70 ? 387 ALA A HB2  1  
ATOM   6042   H HB3  . ALA A 1 394 ? -13.093 -18.299 5.524   0.02 35.30 ? 387 ALA A HB3  1  
ATOM   6043   N N    . PRO A 1 395 ? -10.346 -20.497 6.953   0.02 36.64 ? 388 PRO A N    1  
ATOM   6044   C CA   . PRO A 1 395 ? -9.864  -21.780 6.406   0.02 36.68 ? 388 PRO A CA   1  
ATOM   6045   C C    . PRO A 1 395 ? -10.789 -22.372 5.351   0.02 36.11 ? 388 PRO A C    1  
ATOM   6046   O O    . PRO A 1 395 ? -10.323 -23.109 4.478   0.02 35.96 ? 388 PRO A O    1  
ATOM   6047   C CB   . PRO A 1 395 ? -9.755  -22.691 7.641   0.02 37.36 ? 388 PRO A CB   1  
ATOM   6048   C CG   . PRO A 1 395 ? -10.071 -21.838 8.833   0.02 37.70 ? 388 PRO A CG   1  
ATOM   6049   C CD   . PRO A 1 395 ? -10.162 -20.417 8.425   0.02 37.32 ? 388 PRO A CD   1  
ATOM   6050   H HA   . PRO A 1 395 ? -8.982  -21.658 6.025   0.02 36.72 ? 388 PRO A HA   1  
ATOM   6051   H HB2  . PRO A 1 395 ? -10.389 -23.424 7.569   0.02 37.30 ? 388 PRO A HB2  1  
ATOM   6052   H HB3  . PRO A 1 395 ? -8.852  -23.038 7.700   0.02 37.65 ? 388 PRO A HB3  1  
ATOM   6053   H HG2  . PRO A 1 395 ? -10.914 -22.127 9.212   0.02 37.72 ? 388 PRO A HG2  1  
ATOM   6054   H HG3  . PRO A 1 395 ? -9.361  -21.948 9.483   0.02 38.18 ? 388 PRO A HG3  1  
ATOM   6055   H HD2  . PRO A 1 395 ? -10.927 -20.000 8.849   0.02 37.30 ? 388 PRO A HD2  1  
ATOM   6056   H HD3  . PRO A 1 395 ? -9.339  -19.953 8.647   0.02 37.55 ? 388 PRO A HD3  1  
ATOM   6057   N N    . GLU A 1 396 ? -12.086 -22.063 5.399   0.02 35.84 ? 389 GLU A N    1  
ATOM   6058   C CA   . GLU A 1 396 ? -12.989 -22.465 4.328   0.02 35.31 ? 389 GLU A CA   1  
ATOM   6059   C C    . GLU A 1 396 ? -12.490 -21.924 2.982   0.02 34.78 ? 389 GLU A C    1  
ATOM   6060   O O    . GLU A 1 396 ? -12.514 -22.639 1.968   0.02 34.49 ? 389 GLU A O    1  
ATOM   6061   C CB   . GLU A 1 396 ? -14.429 -22.001 4.669   0.02 35.15 ? 389 GLU A CB   1  
ATOM   6062   C CG   . GLU A 1 396 ? -14.750 -20.455 4.494   0.02 34.79 ? 389 GLU A CG   1  
ATOM   6063   C CD   . GLU A 1 396 ? -15.782 -19.824 5.526   0.02 35.01 ? 389 GLU A CD   1  
ATOM   6064   O OE1  . GLU A 1 396 ? -15.902 -20.307 6.671   0.02 35.57 ? 389 GLU A OE1  1  
ATOM   6065   O OE2  . GLU A 1 396 ? -16.463 -18.805 5.193   0.02 34.67 ? 389 GLU A OE2  1  
ATOM   6066   H H    . GLU A 1 396 ? -12.461 -21.616 6.027   0.02 35.98 ? 389 GLU A H    1  
ATOM   6067   H HA   . GLU A 1 396 ? -12.994 -23.434 4.274   0.02 35.45 ? 389 GLU A HA   1  
ATOM   6068   H HB2  . GLU A 1 396 ? -15.039 -22.494 4.099   0.02 34.91 ? 389 GLU A HB2  1  
ATOM   6069   H HB3  . GLU A 1 396 ? -14.612 -22.230 5.592   0.02 35.53 ? 389 GLU A HB3  1  
ATOM   6070   H HG2  . GLU A 1 396 ? -13.916 -19.971 4.577   0.02 34.87 ? 389 GLU A HG2  1  
ATOM   6071   H HG3  . GLU A 1 396 ? -15.108 -20.317 3.599   0.02 34.37 ? 389 GLU A HG3  1  
ATOM   6072   N N    . THR A 1 397 ? -11.930 -20.710 2.984   0.02 34.71 ? 390 THR A N    1  
ATOM   6073   C CA   . THR A 1 397 ? -11.590 -20.022 1.737   0.02 34.21 ? 390 THR A CA   1  
ATOM   6074   C C    . THR A 1 397 ? -10.200 -20.405 1.235   0.02 34.36 ? 390 THR A C    1  
ATOM   6075   O O    . THR A 1 397 ? -9.984  -20.554 0.020   0.02 34.00 ? 390 THR A O    1  
ATOM   6076   C CB   . THR A 1 397 ? -11.669 -18.513 1.929   0.02 34.10 ? 390 THR A CB   1  
ATOM   6077   O OG1  . THR A 1 397 ? -12.959 -18.160 2.432   0.02 34.01 ? 390 THR A OG1  1  
ATOM   6078   C CG2  . THR A 1 397 ? -11.415 -17.802 0.595   0.02 33.61 ? 390 THR A CG2  1  
ATOM   6079   H H    . THR A 1 397 ? -11.730 -20.266 3.691   0.02 34.96 ? 390 THR A H    1  
ATOM   6080   H HA   . THR A 1 397 ? -12.237 -20.264 1.058   0.02 33.87 ? 390 THR A HA   1  
ATOM   6081   H HB   . THR A 1 397 ? -10.987 -18.228 2.556   0.02 34.45 ? 390 THR A HB   1  
ATOM   6082   H HG1  . THR A 1 397 ? -13.472 -18.825 2.395   0.02 33.98 ? 390 THR A HG1  1  
ATOM   6083   H HG21 . THR A 1 397 ? -10.465 -17.778 0.410   0.02 33.75 ? 390 THR A HG21 1  
ATOM   6084   H HG22 . THR A 1 397 ? -11.861 -18.282 -0.115  0.02 33.31 ? 390 THR A HG22 1  
ATOM   6085   H HG23 . THR A 1 397 ? -11.755 -16.894 0.626   0.02 33.48 ? 390 THR A HG23 1  
ATOM   6086   N N    . LEU A 1 398 ? -9.233  -20.519 2.147   0.02 34.92 ? 391 LEU A N    1  
ATOM   6087   C CA   . LEU A 1 398 ? -7.892  -20.915 1.743   0.02 35.16 ? 391 LEU A CA   1  
ATOM   6088   C C    . LEU A 1 398 ? -7.898  -22.332 1.177   0.02 35.14 ? 391 LEU A C    1  
ATOM   6089   O O    . LEU A 1 398 ? -7.168  -22.635 0.220   0.02 35.02 ? 391 LEU A O    1  
ATOM   6090   C CB   . LEU A 1 398 ? -6.941  -20.767 2.934   0.02 35.83 ? 391 LEU A CB   1  
ATOM   6091   C CG   . LEU A 1 398 ? -5.439  -20.985 2.729   0.02 36.20 ? 391 LEU A CG   1  
ATOM   6092   C CD1  . LEU A 1 398 ? -4.853  -19.952 1.784   0.02 35.88 ? 391 LEU A CD1  1  
ATOM   6093   C CD2  . LEU A 1 398 ? -4.719  -20.974 4.074   0.02 36.92 ? 391 LEU A CD2  1  
ATOM   6094   H H    . LEU A 1 398 ? -9.330  -20.367 2.983   0.02 35.19 ? 391 LEU A H    1  
ATOM   6095   H HA   . LEU A 1 398 ? -7.585  -20.313 1.050   0.02 34.92 ? 391 LEU A HA   1  
ATOM   6096   H HB2  . LEU A 1 398 ? -7.035  -19.858 3.263   0.02 35.84 ? 391 LEU A HB2  1  
ATOM   6097   H HB3  . LEU A 1 398 ? -7.231  -21.382 3.627   0.02 36.10 ? 391 LEU A HB3  1  
ATOM   6098   H HG   . LEU A 1 398 ? -5.301  -21.859 2.333   0.02 36.23 ? 391 LEU A HG   1  
ATOM   6099   H HD11 . LEU A 1 398 ? -5.101  -19.066 2.091   0.02 35.78 ? 391 LEU A HD11 1  
ATOM   6100   H HD12 . LEU A 1 398 ? -3.888  -20.045 1.773   0.02 36.19 ? 391 LEU A HD12 1  
ATOM   6101   H HD13 . LEU A 1 398 ? -5.212  -20.103 0.897   0.02 35.49 ? 391 LEU A HD13 1  
ATOM   6102   H HD21 . LEU A 1 398 ? -5.367  -21.149 4.773   0.02 37.02 ? 391 LEU A HD21 1  
ATOM   6103   H HD22 . LEU A 1 398 ? -4.032  -21.660 4.079   0.02 37.23 ? 391 LEU A HD22 1  
ATOM   6104   H HD23 . LEU A 1 398 ? -4.319  -20.100 4.210   0.02 36.97 ? 391 LEU A HD23 1  
ATOM   6105   N N    . GLU A 1 399 ? -8.774  -23.200 1.693   0.02 35.26 ? 392 GLU A N    1  
ATOM   6106   C CA   . GLU A 1 399 ? -8.826  -24.559 1.166   0.02 35.29 ? 392 GLU A CA   1  
ATOM   6107   C C    . GLU A 1 399 ? -9.599  -24.614 -0.157  0.02 34.66 ? 392 GLU A C    1  
ATOM   6108   O O    . GLU A 1 399 ? -9.231  -25.368 -1.052  0.02 34.59 ? 392 GLU A O    1  
ATOM   6109   C CB   . GLU A 1 399 ? -9.438  -25.510 2.190   0.02 35.70 ? 392 GLU A CB   1  
ATOM   6110   C CG   . GLU A 1 399 ? -8.959  -26.966 2.069   0.02 36.04 ? 392 GLU A CG   1  
ATOM   6111   C CD   . GLU A 1 399 ? -9.442  -27.831 3.200   0.02 36.54 ? 392 GLU A CD   1  
ATOM   6112   O OE1  . GLU A 1 399 ? -8.596  -28.247 4.018   0.02 37.15 ? 392 GLU A OE1  1  
ATOM   6113   O OE2  . GLU A 1 399 ? -10.665 -28.104 3.287   0.02 36.37 ? 392 GLU A OE2  1  
ATOM   6114   H H    . GLU A 1 399 ? -9.339  -23.030 2.315   0.02 35.34 ? 392 GLU A H    1  
ATOM   6115   H HA   . GLU A 1 399 ? -7.920  -24.855 0.992   0.02 35.51 ? 392 GLU A HA   1  
ATOM   6116   H HB2  . GLU A 1 399 ? -9.210  -25.207 3.085   0.02 36.04 ? 392 GLU A HB2  1  
ATOM   6117   H HB3  . GLU A 1 399 ? -10.401 -25.502 2.072   0.02 35.44 ? 392 GLU A HB3  1  
ATOM   6118   H HG2  . GLU A 1 399 ? -9.299  -27.346 1.242   0.02 35.73 ? 392 GLU A HG2  1  
ATOM   6119   H HG3  . GLU A 1 399 ? -7.987  -26.986 2.074   0.02 36.29 ? 392 GLU A HG3  1  
ATOM   6120   N N    . MET A 1 400 ? -10.682 -23.852 -0.288  0.02 34.25 ? 393 MET A N    1  
ATOM   6121   C CA   . MET A 1 400 ? -11.342 -23.747 -1.591  0.02 33.66 ? 393 MET A CA   1  
ATOM   6122   C C    . MET A 1 400 ? -10.384 -23.194 -2.640  0.02 33.43 ? 393 MET A C    1  
ATOM   6123   O O    . MET A 1 400 ? -10.365 -23.659 -3.781  0.02 33.17 ? 393 MET A O    1  
ATOM   6124   C CB   . MET A 1 400 ? -12.578 -22.856 -1.497  0.02 33.32 ? 393 MET A CB   1  
ATOM   6125   C CG   . MET A 1 400 ? -13.757 -23.457 -0.761  0.02 33.47 ? 393 MET A CG   1  
ATOM   6126   S SD   . MET A 1 400 ? -14.932 -22.140 -0.480  0.02 33.19 ? 393 MET A SD   1  
ATOM   6127   C CE   . MET A 1 400 ? -16.103 -22.860 0.676   0.02 33.55 ? 393 MET A CE   1  
ATOM   6128   H H    . MET A 1 400 ? -11.046 -23.396 0.339   0.02 34.31 ? 393 MET A H    1  
ATOM   6129   H HA   . MET A 1 400 ? -11.637 -24.629 -1.862  0.02 33.68 ? 393 MET A HA   1  
ATOM   6130   H HB2  . MET A 1 400 ? -12.335 -22.038 -1.036  0.02 33.39 ? 393 MET A HB2  1  
ATOM   6131   H HB3  . MET A 1 400 ? -12.872 -22.642 -2.394  0.02 32.94 ? 393 MET A HB3  1  
ATOM   6132   H HG2  . MET A 1 400 ? -14.180 -24.149 -1.289  0.02 33.34 ? 393 MET A HG2  1  
ATOM   6133   H HG3  . MET A 1 400 ? -13.466 -23.807 0.092   0.02 33.87 ? 393 MET A HG3  1  
ATOM   6134   H HE1  . MET A 1 400 ? -15.715 -22.852 1.567   0.02 33.94 ? 393 MET A HE1  1  
ATOM   6135   H HE2  . MET A 1 400 ? -16.922 -22.341 0.665   0.02 33.39 ? 393 MET A HE2  1  
ATOM   6136   H HE3  . MET A 1 400 ? -16.291 -23.774 0.406   0.02 33.56 ? 393 MET A HE3  1  
ATOM   6137   N N    . GLY A 1 401 ? -9.584  -22.198 -2.267  0.02 33.55 ? 394 GLY A N    1  
ATOM   6138   C CA   . GLY A 1 401 ? -8.625  -21.640 -3.201  0.02 33.42 ? 394 GLY A CA   1  
ATOM   6139   C C    . GLY A 1 401 ? -7.561  -22.640 -3.602  0.02 33.71 ? 394 GLY A C    1  
ATOM   6140   O O    . GLY A 1 401 ? -7.032  -22.591 -4.713  0.02 33.53 ? 394 GLY A O    1  
ATOM   6141   H H    . GLY A 1 401 ? -9.576  -21.839 -1.488  0.02 33.74 ? 394 GLY A H    1  
ATOM   6142   H HA2  . GLY A 1 401 ? -9.089  -21.337 -3.996  0.02 33.03 ? 394 GLY A HA2  1  
ATOM   6143   H HA3  . GLY A 1 401 ? -8.181  -20.879 -2.794  0.02 33.56 ? 394 GLY A HA3  1  
ATOM   6144   N N    . ALA A 1 402 ? -7.206  -23.544 -2.687  0.02 34.23 ? 395 ALA A N    1  
ATOM   6145   C CA   . ALA A 1 402 ? -6.217  -24.560 -3.019  0.02 34.57 ? 395 ALA A CA   1  
ATOM   6146   C C    . ALA A 1 402 ? -6.736  -25.479 -4.121  0.02 34.27 ? 395 ALA A C    1  
ATOM   6147   O O    . ALA A 1 402 ? -5.965  -25.997 -4.935  0.02 34.35 ? 395 ALA A O    1  
ATOM   6148   C CB   . ALA A 1 402 ? -5.851  -25.363 -1.770  0.02 35.21 ? 395 ALA A CB   1  
ATOM   6149   H H    . ALA A 1 402 ? -7.526  -23.596 -1.894  0.02 34.40 ? 395 ALA A H    1  
ATOM   6150   H HA   . ALA A 1 402 ? -5.415  -24.121 -3.340  0.02 34.63 ? 395 ALA A HA   1  
ATOM   6151   H HB1  . ALA A 1 402 ? -5.253  -26.082 -2.019  0.02 35.45 ? 395 ALA A HB1  1  
ATOM   6152   H HB2  . ALA A 1 402 ? -5.412  -24.773 -1.141  0.02 35.43 ? 395 ALA A HB2  1  
ATOM   6153   H HB3  . ALA A 1 402 ? -6.662  -25.725 -1.386  0.02 35.18 ? 395 ALA A HB3  1  
ATOM   6154   N N    . LYS A 1 403 ? -8.043  -25.683 -4.163  0.02 33.98 ? 396 LYS A N    1  
ATOM   6155   C CA   . LYS A 1 403 ? -8.620  -26.495 -5.220  0.02 33.69 ? 396 LYS A CA   1  
ATOM   6156   C C    . LYS A 1 403 ? -8.460  -25.812 -6.585  0.02 33.23 ? 396 LYS A C    1  
ATOM   6157   O O    . LYS A 1 403 ? -7.840  -26.369 -7.502  0.02 33.29 ? 396 LYS A O    1  
ATOM   6158   C CB   . LYS A 1 403 ? -10.079 -26.771 -4.878  0.02 33.50 ? 396 LYS A CB   1  
ATOM   6159   C CG   . LYS A 1 403 ? -10.212 -27.520 -3.594  0.02 34.01 ? 396 LYS A CG   1  
ATOM   6160   C CD   . LYS A 1 403 ? -11.573 -28.114 -3.426  0.02 33.90 ? 396 LYS A CD   1  
ATOM   6161   C CE   . LYS A 1 403 ? -11.690 -28.878 -2.106  0.02 34.51 ? 396 LYS A CE   1  
ATOM   6162   N NZ   . LYS A 1 403 ? -13.090 -28.873 -1.638  0.02 34.53 ? 396 LYS A NZ   1  
ATOM   6163   H H    . LYS A 1 403 ? -8.612  -25.362 -3.605  0.02 33.95 ? 396 LYS A H    1  
ATOM   6164   H HA   . LYS A 1 403 ? -8.154  -27.345 -5.242  0.02 33.98 ? 396 LYS A HA   1  
ATOM   6165   H HB2  . LYS A 1 403 ? -10.548 -25.930 -4.777  0.02 33.29 ? 396 LYS A HB2  1  
ATOM   6166   H HB3  . LYS A 1 403 ? -10.484 -27.301 -5.580  0.02 33.29 ? 396 LYS A HB3  1  
ATOM   6167   H HG2  . LYS A 1 403 ? -9.564  -28.240 -3.579  0.02 34.27 ? 396 LYS A HG2  1  
ATOM   6168   H HG3  . LYS A 1 403 ? -10.052 -26.916 -2.853  0.02 34.22 ? 396 LYS A HG3  1  
ATOM   6169   H HD2  . LYS A 1 403 ? -12.235 -27.406 -3.443  0.02 33.65 ? 396 LYS A HD2  1  
ATOM   6170   H HD3  . LYS A 1 403 ? -11.735 -28.739 -4.151  0.02 33.75 ? 396 LYS A HD3  1  
ATOM   6171   H HE2  . LYS A 1 403 ? -11.418 -29.801 -2.243  0.02 34.75 ? 396 LYS A HE2  1  
ATOM   6172   H HE3  . LYS A 1 403 ? -11.140 -28.455 -1.428  0.02 34.71 ? 396 LYS A HE3  1  
ATOM   6173   H HZ1  . LYS A 1 403 ? -13.208 -28.232 -1.034  0.02 34.67 ? 396 LYS A HZ1  1  
ATOM   6174   H HZ2  . LYS A 1 403 ? -13.642 -28.734 -2.320  0.02 34.18 ? 396 LYS A HZ2  1  
ATOM   6175   H HZ3  . LYS A 1 403 ? -13.281 -29.659 -1.268  0.02 34.79 ? 396 LYS A HZ3  1  
ATOM   6176   N N    . ILE A 1 404 ? -8.999  -24.603 -6.725  0.02 32.80 ? 397 ILE A N    1  
ATOM   6177   C CA   . ILE A 1 404 ? -8.665  -23.732 -7.858  0.02 32.44 ? 397 ILE A CA   1  
ATOM   6178   C C    . ILE A 1 404 ? -7.183  -23.825 -8.178  0.02 32.76 ? 397 ILE A C    1  
ATOM   6179   O O    . ILE A 1 404 ? -6.783  -24.209 -9.286  0.02 32.67 ? 397 ILE A O    1  
ATOM   6180   C CB   . ILE A 1 404 ? -9.055  -22.280 -7.522  0.02 32.20 ? 397 ILE A CB   1  
ATOM   6181   C CG1  . ILE A 1 404 ? -10.537 -22.058 -7.739  0.02 31.78 ? 397 ILE A CG1  1  
ATOM   6182   C CG2  . ILE A 1 404 ? -8.195  -21.293 -8.285  0.02 32.09 ? 397 ILE A CG2  1  
ATOM   6183   C CD1  . ILE A 1 404 ? -11.055 -20.792 -7.080  0.02 31.64 ? 397 ILE A CD1  1  
ATOM   6184   H H    . ILE A 1 404 ? -9.569  -24.263 -6.176  0.02 32.74 ? 397 ILE A H    1  
ATOM   6185   H HA   . ILE A 1 404 ? -9.167  -24.009 -8.640  0.02 32.18 ? 397 ILE A HA   1  
ATOM   6186   H HB   . ILE A 1 404 ? -8.882  -22.144 -6.578  0.02 32.47 ? 397 ILE A HB   1  
ATOM   6187   H HG12 . ILE A 1 404 ? -10.711 -21.991 -8.693  0.02 31.51 ? 397 ILE A HG12 1  
ATOM   6188   H HG13 . ILE A 1 404 ? -11.017 -22.811 -7.364  0.02 31.90 ? 397 ILE A HG13 1  
ATOM   6189   H HG21 . ILE A 1 404 ? -8.161  -21.543 -9.221  0.02 31.93 ? 397 ILE A HG21 1  
ATOM   6190   H HG22 . ILE A 1 404 ? -8.589  -20.411 -8.202  0.02 31.89 ? 397 ILE A HG22 1  
ATOM   6191   H HG23 . ILE A 1 404 ? -7.302  -21.276 -7.909  0.02 32.42 ? 397 ILE A HG23 1  
ATOM   6192   H HD11 . ILE A 1 404 ? -10.867 -20.834 -6.131  0.02 31.94 ? 397 ILE A HD11 1  
ATOM   6193   H HD12 . ILE A 1 404 ? -10.608 -20.025 -7.469  0.02 31.48 ? 397 ILE A HD12 1  
ATOM   6194   H HD13 . ILE A 1 404 ? -12.011 -20.727 -7.224  0.02 31.45 ? 397 ILE A HD13 1  
ATOM   6195   N N    . LYS A 1 405 ? -6.349  -23.458 -7.202  0.02 33.17 ? 398 LYS A N    1  
ATOM   6196   C CA   . LYS A 1 405 ? -4.911  -23.323 -7.416  0.02 33.52 ? 398 LYS A CA   1  
ATOM   6197   C C    . LYS A 1 405 ? -4.303  -24.586 -8.020  0.02 33.78 ? 398 LYS A C    1  
ATOM   6198   O O    . LYS A 1 405 ? -3.325  -24.518 -8.779  0.02 33.92 ? 398 LYS A O    1  
ATOM   6199   C CB   . LYS A 1 405 ? -4.220  -23.003 -6.092  0.02 34.02 ? 398 LYS A CB   1  
ATOM   6200   C CG   . LYS A 1 405 ? -2.746  -22.678 -6.207  0.02 34.43 ? 398 LYS A CG   1  
ATOM   6201   C CD   . LYS A 1 405 ? -2.072  -22.711 -4.827  0.02 35.04 ? 398 LYS A CD   1  
ATOM   6202   C CE   . LYS A 1 405 ? -0.555  -22.781 -4.949  0.02 35.56 ? 398 LYS A CE   1  
ATOM   6203   N NZ   . LYS A 1 405 ? 0.076   -22.795 -3.601  0.02 36.19 ? 398 LYS A NZ   1  
ATOM   6204   H H    . LYS A 1 405 ? -6.603  -23.281 -6.403  0.02 33.28 ? 398 LYS A H    1  
ATOM   6205   H HA   . LYS A 1 405 ? -4.746  -22.584 -8.022  0.02 33.31 ? 398 LYS A HA   1  
ATOM   6206   H HB2  . LYS A 1 405 ? -4.663  -22.245 -5.679  0.02 33.87 ? 398 LYS A HB2  1  
ATOM   6207   H HB3  . LYS A 1 405 ? -4.304  -23.778 -5.517  0.02 34.26 ? 398 LYS A HB3  1  
ATOM   6208   H HG2  . LYS A 1 405 ? -2.308  -23.323 -6.781  0.02 34.53 ? 398 LYS A HG2  1  
ATOM   6209   H HG3  . LYS A 1 405 ? -2.642  -21.781 -6.560  0.02 34.26 ? 398 LYS A HG3  1  
ATOM   6210   H HD2  . LYS A 1 405 ? -2.301  -21.906 -4.335  0.02 34.99 ? 398 LYS A HD2  1  
ATOM   6211   H HD3  . LYS A 1 405 ? -2.373  -23.494 -4.341  0.02 35.21 ? 398 LYS A HD3  1  
ATOM   6212   H HE2  . LYS A 1 405 ? -0.307  -23.598 -5.408  0.02 35.65 ? 398 LYS A HE2  1  
ATOM   6213   H HE3  . LYS A 1 405 ? -0.230  -22.007 -5.434  0.02 35.44 ? 398 LYS A HE3  1  
ATOM   6214   H HZ1  . LYS A 1 405 ? -0.418  -22.317 -3.035  0.02 36.12 ? 398 LYS A HZ1  1  
ATOM   6215   H HZ2  . LYS A 1 405 ? 0.141   -23.631 -3.300  0.02 36.43 ? 398 LYS A HZ2  1  
ATOM   6216   H HZ3  . LYS A 1 405 ? 0.891   -22.440 -3.645  0.02 36.45 ? 398 LYS A HZ3  1  
ATOM   6217   N N    . LYS A 1 406 ? -4.848  -25.749 -7.680  0.02 33.90 ? 399 LYS A N    1  
ATOM   6218   C CA   . LYS A 1 406 ? -4.271  -26.980 -8.192  0.02 34.21 ? 399 LYS A CA   1  
ATOM   6219   C C    . LYS A 1 406 ? -4.703  -27.215 -9.636  0.02 33.81 ? 399 LYS A C    1  
ATOM   6220   O O    . LYS A 1 406 ? -3.954  -27.814 -10.413 0.02 34.01 ? 399 LYS A O    1  
ATOM   6221   C CB   . LYS A 1 406 ? -4.688  -28.169 -7.329  0.02 34.58 ? 399 LYS A CB   1  
ATOM   6222   C CG   . LYS A 1 406 ? -3.564  -28.922 -6.537  0.02 35.28 ? 399 LYS A CG   1  
ATOM   6223   C CD   . LYS A 1 406 ? -4.039  -30.398 -6.355  0.02 35.53 ? 399 LYS A CD   1  
ATOM   6224   C CE   . LYS A 1 406 ? -3.060  -31.382 -5.702  0.02 36.28 ? 399 LYS A CE   1  
ATOM   6225   N NZ   . LYS A 1 406 ? -3.768  -32.691 -5.492  0.02 36.51 ? 399 LYS A NZ   1  
ATOM   6226   H H    . LYS A 1 406 ? -5.545  -25.846 -7.189  0.02 33.82 ? 399 LYS A H    1  
ATOM   6227   H HA   . LYS A 1 406 ? -3.304  -26.910 -8.168  0.02 34.50 ? 399 LYS A HA   1  
ATOM   6228   H HB2  . LYS A 1 406 ? -5.329  -27.853 -6.673  0.02 34.57 ? 399 LYS A HB2  1  
ATOM   6229   H HB3  . LYS A 1 406 ? -5.120  -28.818 -7.904  0.02 34.41 ? 399 LYS A HB3  1  
ATOM   6230   H HG2  . LYS A 1 406 ? -2.732  -28.919 -7.037  0.02 35.35 ? 399 LYS A HG2  1  
ATOM   6231   H HG3  . LYS A 1 406 ? -3.451  -28.507 -5.668  0.02 35.51 ? 399 LYS A HG3  1  
ATOM   6232   H HD2  . LYS A 1 406 ? -4.845  -30.390 -5.814  0.02 35.39 ? 399 LYS A HD2  1  
ATOM   6233   H HD3  . LYS A 1 406 ? -4.248  -30.759 -7.231  0.02 35.39 ? 399 LYS A HD3  1  
ATOM   6234   H HE2  . LYS A 1 406 ? -2.299  -31.528 -6.285  0.02 36.46 ? 399 LYS A HE2  1  
ATOM   6235   H HE3  . LYS A 1 406 ? -2.772  -31.037 -4.841  0.02 36.45 ? 399 LYS A HE3  1  
ATOM   6236   H HZ1  . LYS A 1 406 ? -4.209  -32.692 -4.720  0.02 36.66 ? 399 LYS A HZ1  1  
ATOM   6237   H HZ2  . LYS A 1 406 ? -4.344  -32.820 -6.153  0.02 36.19 ? 399 LYS A HZ2  1  
ATOM   6238   H HZ3  . LYS A 1 406 ? -3.182  -33.358 -5.479  0.02 36.86 ? 399 LYS A HZ3  1  
ATOM   6239   N N    . ALA A 1 407 ? -5.909  -26.769 -9.996  0.02 33.27 ? 400 ALA A N    1  
ATOM   6240   C CA   . ALA A 1 407 ? -6.444  -27.013 -11.336 0.02 32.89 ? 400 ALA A CA   1  
ATOM   6241   C C    . ALA A 1 407 ? -5.723  -26.211 -12.404 0.02 32.73 ? 400 ALA A C    1  
ATOM   6242   O O    . ALA A 1 407 ? -5.822  -26.553 -13.589 0.02 32.58 ? 400 ALA A O    1  
ATOM   6243   C CB   . ALA A 1 407 ? -7.935  -26.697 -11.373 0.02 32.42 ? 400 ALA A CB   1  
ATOM   6244   H H    . ALA A 1 407 ? -6.433  -26.324 -9.483  0.02 33.14 ? 400 ALA A H    1  
ATOM   6245   H HA   . ALA A 1 407 ? -6.338  -27.946 -11.561 0.02 33.07 ? 400 ALA A HA   1  
ATOM   6246   H HB1  . ALA A 1 407 ? -8.317  -27.056 -12.188 0.02 32.21 ? 400 ALA A HB1  1  
ATOM   6247   H HB2  . ALA A 1 407 ? -8.361  -27.105 -10.603 0.02 32.56 ? 400 ALA A HB2  1  
ATOM   6248   H HB3  . ALA A 1 407 ? -8.050  -25.735 -11.344 0.02 32.23 ? 400 ALA A HB3  1  
ATOM   6249   N N    . HIS A 1 408 ? -4.963  -25.199 -12.007 0.02 32.85 ? 401 HIS A N    1  
ATOM   6250   C CA   . HIS A 1 408 ? -4.414  -24.210 -12.924 0.02 32.69 ? 401 HIS A CA   1  
ATOM   6251   C C    . HIS A 1 408 ? -2.942  -23.921 -12.754 0.02 33.16 ? 401 HIS A C    1  
ATOM   6252   O O    . HIS A 1 408 ? -2.308  -23.524 -13.736 0.02 33.17 ? 401 HIS A O    1  
ATOM   6253   C CB   . HIS A 1 408 ? -5.161  -22.885 -12.786 0.02 32.28 ? 401 HIS A CB   1  
ATOM   6254   C CG   . HIS A 1 408 ? -6.595  -22.976 -13.173 0.02 31.80 ? 401 HIS A CG   1  
ATOM   6255   N ND1  . HIS A 1 408 ? -7.001  -23.347 -14.437 0.02 31.51 ? 401 HIS A ND1  1  
ATOM   6256   C CD2  . HIS A 1 408 ? -7.721  -22.731 -12.469 0.02 31.58 ? 401 HIS A CD2  1  
ATOM   6257   C CE1  . HIS A 1 408 ? -8.318  -23.345 -14.484 0.02 31.15 ? 401 HIS A CE1  1  
ATOM   6258   N NE2  . HIS A 1 408 ? -8.779  -22.977 -13.302 0.02 31.19 ? 401 HIS A NE2  1  
ATOM   6259   H H    . HIS A 1 408 ? -4.742  -25.061 -11.190 0.02 33.06 ? 401 HIS A H    1  
ATOM   6260   H HA   . HIS A 1 408 ? -4.538  -24.533 -13.829 0.02 32.55 ? 401 HIS A HA   1  
ATOM   6261   H HB2  . HIS A 1 408 ? -5.128  -22.603 -11.863 0.02 32.43 ? 401 HIS A HB2  1  
ATOM   6262   H HB3  . HIS A 1 408 ? -4.733  -22.220 -13.343 0.02 32.22 ? 401 HIS A HB3  1  
ATOM   6263   H HD1  . HIS A 1 408 ? -6.476  -23.561 -15.081 0.02 31.58 ? 401 HIS A HD1  1  
ATOM   6264   H HD2  . HIS A 1 408 ? -7.769  -22.460 -11.581 0.02 31.71 ? 401 HIS A HD2  1  
ATOM   6265   H HE1  . HIS A 1 408 ? -8.833  -23.565 -15.223 0.02 30.93 ? 401 HIS A HE1  1  
ATOM   6266   N N    . VAL A 1 409 ? -2.367  -24.072 -11.560 0.02 33.57 ? 402 VAL A N    1  
ATOM   6267   C CA   . VAL A 1 409 ? -0.921  -23.990 -11.428 0.02 34.11 ? 402 VAL A CA   1  
ATOM   6268   C C    . VAL A 1 409 ? -0.383  -25.366 -11.801 0.02 34.45 ? 402 VAL A C    1  
ATOM   6269   O O    . VAL A 1 409 ? -0.829  -26.380 -11.259 0.02 34.49 ? 402 VAL A O    1  
ATOM   6270   C CB   . VAL A 1 409 ? -0.496  -23.543 -10.023 0.02 34.50 ? 402 VAL A CB   1  
ATOM   6271   C CG1  . VAL A 1 409 ? 1.021   -23.542 -9.894  0.02 35.09 ? 402 VAL A CG1  1  
ATOM   6272   C CG2  . VAL A 1 409 ? -1.026  -22.146 -9.758  0.02 34.15 ? 402 VAL A CG2  1  
ATOM   6273   H H    . VAL A 1 409 ? -2.786  -24.222 -10.827 0.02 33.57 ? 402 VAL A H    1  
ATOM   6274   H HA   . VAL A 1 409 ? -0.572  -23.345 -12.061 0.02 34.04 ? 402 VAL A HA   1  
ATOM   6275   H HB   . VAL A 1 409 ? -0.865  -24.144 -9.357  0.02 34.64 ? 402 VAL A HB   1  
ATOM   6276   H HG11 . VAL A 1 409 ? 1.270   -22.995 -9.136  0.02 35.26 ? 402 VAL A HG11 1  
ATOM   6277   H HG12 . VAL A 1 409 ? 1.336   -24.451 -9.769  0.02 35.42 ? 402 VAL A HG12 1  
ATOM   6278   H HG13 . VAL A 1 409 ? 1.401   -23.163 -10.703 0.02 35.00 ? 402 VAL A HG13 1  
ATOM   6279   H HG21 . VAL A 1 409 ? -0.731  -21.862 -8.879  0.02 34.44 ? 402 VAL A HG21 1  
ATOM   6280   H HG22 . VAL A 1 409 ? -0.677  -21.540 -10.429 0.02 33.99 ? 402 VAL A HG22 1  
ATOM   6281   H HG23 . VAL A 1 409 ? -1.994  -22.160 -9.799  0.02 33.84 ? 402 VAL A HG23 1  
ATOM   6282   N N    . THR A 1 410 ? 0.517   -25.399 -12.791 0.02 34.68 ? 403 THR A N    1  
ATOM   6283   C CA   . THR A 1 410 ? 0.908   -26.629 -13.468 0.02 34.92 ? 403 THR A CA   1  
ATOM   6284   C C    . THR A 1 410 ? 2.183   -27.234 -12.893 0.02 35.66 ? 403 THR A C    1  
ATOM   6285   O O    . THR A 1 410 ? 2.365   -28.463 -12.932 0.02 35.97 ? 403 THR A O    1  
ATOM   6286   C CB   . THR A 1 410 ? 1.070   -26.352 -14.975 0.02 34.69 ? 403 THR A CB   1  
ATOM   6287   O OG1  . THR A 1 410 ? 2.050   -25.330 -15.192 0.02 34.91 ? 403 THR A OG1  1  
ATOM   6288   C CG2  . THR A 1 410 ? -0.237  -25.889 -15.557 0.02 34.00 ? 403 THR A CG2  1  
ATOM   6289   H H    . THR A 1 410 ? 0.934   -24.705 -13.081 0.02 34.74 ? 403 THR A H    1  
ATOM   6290   H HA   . THR A 1 410 ? 0.201   -27.283 -13.363 0.02 34.78 ? 403 THR A HA   1  
ATOM   6291   H HB   . THR A 1 410 ? 1.342   -27.164 -15.428 0.02 34.88 ? 403 THR A HB   1  
ATOM   6292   H HG1  . THR A 1 410 ? 1.728   -24.578 -15.002 0.02 34.68 ? 403 THR A HG1  1  
ATOM   6293   H HG21 . THR A 1 410 ? -0.684  -25.290 -14.942 0.02 33.81 ? 403 THR A HG21 1  
ATOM   6294   H HG22 . THR A 1 410 ? -0.081  -25.415 -16.387 0.02 33.86 ? 403 THR A HG22 1  
ATOM   6295   H HG23 . THR A 1 410 ? -0.809  -26.653 -15.726 0.02 33.89 ? 403 THR A HG23 1  
ATOM   6296   N N    . GLY A 1 411 ? 3.051   -26.401 -12.336 0.02 36.00 ? 404 GLY A N    1  
ATOM   6297   C CA   . GLY A 1 411 ? 4.295   -26.823 -11.735 0.02 36.75 ? 404 GLY A CA   1  
ATOM   6298   C C    . GLY A 1 411 ? 4.550   -26.199 -10.375 0.02 37.03 ? 404 GLY A C    1  
ATOM   6299   O O    . GLY A 1 411 ? 3.733   -26.311 -9.453  0.02 36.91 ? 404 GLY A O    1  
ATOM   6300   H H    . GLY A 1 411 ? 2.934   -25.550 -12.303 0.02 35.82 ? 404 GLY A H    1  
ATOM   6301   H HA2  . GLY A 1 411 ? 4.290   -27.785 -11.626 0.02 36.94 ? 404 GLY A HA2  1  
ATOM   6302   H HA3  . GLY A 1 411 ? 5.026   -26.584 -12.326 0.02 36.93 ? 404 GLY A HA3  1  
ATOM   6303   N N    . GLU A 1 412 ? 5.686   -25.501 -10.265 0.02 37.43 ? 405 GLU A N    1  
ATOM   6304   C CA   . GLU A 1 412 ? 6.276   -25.097 -8.985  0.02 37.90 ? 405 GLU A CA   1  
ATOM   6305   C C    . GLU A 1 412 ? 5.919   -23.680 -8.551  0.02 37.59 ? 405 GLU A C    1  
ATOM   6306   O O    . GLU A 1 412 ? 5.990   -23.376 -7.353  0.02 37.83 ? 405 GLU A O    1  
ATOM   6307   C CB   . GLU A 1 412 ? 7.813   -25.221 -9.056  0.02 38.69 ? 405 GLU A CB   1  
ATOM   6308   C CG   . GLU A 1 412 ? 8.583   -24.783 -7.797  0.02 39.23 ? 405 GLU A CG   1  
ATOM   6309   C CD   . GLU A 1 412 ? 10.092  -25.121 -7.849  0.02 40.13 ? 405 GLU A CD   1  
ATOM   6310   O OE1  . GLU A 1 412 ? 10.492  -25.965 -8.670  0.02 40.37 ? 405 GLU A OE1  1  
ATOM   6311   O OE2  . GLU A 1 412 ? 10.883  -24.538 -7.070  0.02 40.65 ? 405 GLU A OE2  1  
ATOM   6312   H H    . GLU A 1 412 ? 6.146   -25.242 -10.944 0.02 37.46 ? 405 GLU A H    1  
ATOM   6313   H HA   . GLU A 1 412 ? 5.962   -25.703 -8.293  0.02 38.00 ? 405 GLU A HA   1  
ATOM   6314   H HB2  . GLU A 1 412 ? 8.040   -26.149 -9.225  0.02 38.97 ? 405 GLU A HB2  1  
ATOM   6315   H HB3  . GLU A 1 412 ? 8.127   -24.669 -9.790  0.02 38.62 ? 405 GLU A HB3  1  
ATOM   6316   H HG2  . GLU A 1 412 ? 8.495   -23.822 -7.691  0.02 39.07 ? 405 GLU A HG2  1  
ATOM   6317   H HG3  . GLU A 1 412 ? 8.203   -25.236 -7.028  0.02 39.21 ? 405 GLU A HG3  1  
ATOM   6318   N N    . THR A 1 413 ? 5.540   -22.813 -9.472  0.02 37.09 ? 406 THR A N    1  
ATOM   6319   C CA   . THR A 1 413 ? 5.363   -21.394 -9.208  0.02 36.90 ? 406 THR A CA   1  
ATOM   6320   C C    . THR A 1 413 ? 4.436   -20.797 -10.265 0.02 36.18 ? 406 THR A C    1  
ATOM   6321   O O    . THR A 1 413 ? 4.436   -21.276 -11.408 0.02 35.99 ? 406 THR A O    1  
ATOM   6322   C CB   . THR A 1 413 ? 6.740   -20.699 -9.221  0.02 37.52 ? 406 THR A CB   1  
ATOM   6323   O OG1  . THR A 1 413 ? 7.534   -21.231 -8.156  0.02 38.20 ? 406 THR A OG1  1  
ATOM   6324   C CG2  . THR A 1 413 ? 6.650   -19.174 -9.063  0.02 37.38 ? 406 THR A CG2  1  
ATOM   6325   H H    . THR A 1 413 ? 5.376   -23.029 -10.288 0.02 36.87 ? 406 THR A H    1  
ATOM   6326   H HA   . THR A 1 413 ? 4.962   -21.280 -8.333  0.02 36.90 ? 406 THR A HA   1  
ATOM   6327   H HB   . THR A 1 413 ? 7.179   -20.892 -10.062 0.02 37.59 ? 406 THR A HB   1  
ATOM   6328   H HG1  . THR A 1 413 ? 7.177   -21.052 -7.416  0.02 38.15 ? 406 THR A HG1  1  
ATOM   6329   H HG21 . THR A 1 413 ? 7.506   -18.777 -9.286  0.02 37.77 ? 406 THR A HG21 1  
ATOM   6330   H HG22 . THR A 1 413 ? 5.976   -18.802 -9.650  0.02 36.90 ? 406 THR A HG22 1  
ATOM   6331   H HG23 . THR A 1 413 ? 6.426   -18.946 -8.148  0.02 37.42 ? 406 THR A HG23 1  
ATOM   6332   N N    . PRO A 1 414 ? 3.606   -19.807 -9.916  0.02 35.78 ? 407 PRO A N    1  
ATOM   6333   C CA   . PRO A 1 414 ? 2.590   -19.323 -10.866 0.02 35.09 ? 407 PRO A CA   1  
ATOM   6334   C C    . PRO A 1 414 ? 3.141   -18.353 -11.892 0.02 35.06 ? 407 PRO A C    1  
ATOM   6335   O O    . PRO A 1 414 ? 4.057   -17.574 -11.613 0.02 35.49 ? 407 PRO A O    1  
ATOM   6336   C CB   . PRO A 1 414 ? 1.575   -18.607 -9.973  0.02 34.77 ? 407 PRO A CB   1  
ATOM   6337   C CG   . PRO A 1 414 ? 2.425   -18.108 -8.831  0.02 35.32 ? 407 PRO A CG   1  
ATOM   6338   C CD   . PRO A 1 414 ? 3.397   -19.231 -8.578  0.02 35.95 ? 407 PRO A CD   1  
ATOM   6339   H HA   . PRO A 1 414 ? 2.165   -20.071 -11.312 0.02 34.89 ? 407 PRO A HA   1  
ATOM   6340   H HB2  . PRO A 1 414 ? 1.177   -17.871 -10.458 0.02 34.42 ? 407 PRO A HB2  1  
ATOM   6341   H HB3  . PRO A 1 414 ? 0.896   -19.229 -9.670  0.02 34.63 ? 407 PRO A HB3  1  
ATOM   6342   H HG2  . PRO A 1 414 ? 2.891   -17.298 -9.092  0.02 35.37 ? 407 PRO A HG2  1  
ATOM   6343   H HG3  . PRO A 1 414 ? 1.869   -17.951 -8.052  0.02 35.26 ? 407 PRO A HG3  1  
ATOM   6344   H HD2  . PRO A 1 414 ? 4.222   -18.881 -8.217  0.02 36.34 ? 407 PRO A HD2  1  
ATOM   6345   H HD3  . PRO A 1 414 ? 3.005   -19.892 -7.987  0.02 36.04 ? 407 PRO A HD3  1  
ATOM   6346   N N    . THR A 1 415 ? 2.501   -18.366 -13.066 0.02 34.57 ? 408 THR A N    1  
ATOM   6347   C CA   . THR A 1 415 ? 2.886   -17.584 -14.237 0.02 34.53 ? 408 THR A CA   1  
ATOM   6348   C C    . THR A 1 415 ? 1.696   -16.825 -14.826 0.02 33.87 ? 408 THR A C    1  
ATOM   6349   O O    . THR A 1 415 ? 0.640   -16.675 -14.211 0.02 33.51 ? 408 THR A O    1  
ATOM   6350   C CB   . THR A 1 415 ? 3.463   -18.493 -15.331 0.02 34.68 ? 408 THR A CB   1  
ATOM   6351   O OG1  . THR A 1 415 ? 2.447   -19.392 -15.771 0.02 34.20 ? 408 THR A OG1  1  
ATOM   6352   C CG2  . THR A 1 415 ? 4.656   -19.266 -14.820 0.02 35.34 ? 408 THR A CG2  1  
ATOM   6353   H H    . THR A 1 415 ? 1.805   -18.849 -13.207 0.02 34.28 ? 408 THR A H    1  
ATOM   6354   H HA   . THR A 1 415 ? 3.564   -16.940 -13.980 0.02 34.85 ? 408 THR A HA   1  
ATOM   6355   H HB   . THR A 1 415 ? 3.757   -17.971 -16.083 0.02 34.73 ? 408 THR A HB   1  
ATOM   6356   H HG1  . THR A 1 415 ? 2.791   -20.037 -16.182 0.02 34.33 ? 408 THR A HG1  1  
ATOM   6357   H HG21 . THR A 1 415 ? 4.746   -20.093 -15.320 0.02 35.35 ? 408 THR A HG21 1  
ATOM   6358   H HG22 . THR A 1 415 ? 5.463   -18.740 -14.929 0.02 35.71 ? 408 THR A HG22 1  
ATOM   6359   H HG23 . THR A 1 415 ? 4.545   -19.486 -13.883 0.02 35.43 ? 408 THR A HG23 1  
ATOM   6360   N N    . ALA A 1 416 ? 1.883   -16.354 -16.063 0.02 33.77 ? 409 ALA A N    1  
ATOM   6361   C CA   . ALA A 1 416 ? 0.804   -15.711 -16.812 0.02 33.18 ? 409 ALA A CA   1  
ATOM   6362   C C    . ALA A 1 416 ? -0.165  -16.733 -17.384 0.02 32.75 ? 409 ALA A C    1  
ATOM   6363   O O    . ALA A 1 416 ? -1.389  -16.593 -17.229 0.02 32.28 ? 409 ALA A O    1  
ATOM   6364   C CB   . ALA A 1 416 ? 1.407   -14.869 -17.942 0.02 33.30 ? 409 ALA A CB   1  
ATOM   6365   H H    . ALA A 1 416 ? 2.626   -16.392 -16.493 0.02 34.04 ? 409 ALA A H    1  
ATOM   6366   H HA   . ALA A 1 416 ? 0.307   -15.123 -16.228 0.02 33.02 ? 409 ALA A HA   1  
ATOM   6367   H HB1  . ALA A 1 416 ? 2.002   -14.209 -17.552 0.02 33.56 ? 409 ALA A HB1  1  
ATOM   6368   H HB2  . ALA A 1 416 ? 1.906   -15.447 -18.538 0.02 33.51 ? 409 ALA A HB2  1  
ATOM   6369   H HB3  . ALA A 1 416 ? 0.697   -14.424 -18.430 0.02 32.93 ? 409 ALA A HB3  1  
ATOM   6370   N N    . ASP A 1 417 ? 0.367   -17.759 -18.057 0.02 32.95 ? 410 ASP A N    1  
ATOM   6371   C CA   . ASP A 1 417 ? -0.475  -18.796 -18.642 0.02 32.62 ? 410 ASP A CA   1  
ATOM   6372   C C    . ASP A 1 417 ? -1.395  -19.400 -17.595 0.02 32.43 ? 410 ASP A C    1  
ATOM   6373   O O    . ASP A 1 417 ? -2.585  -19.585 -17.847 0.02 31.98 ? 410 ASP A O    1  
ATOM   6374   C CB   . ASP A 1 417 ? 0.384   -19.892 -19.294 0.02 33.00 ? 410 ASP A CB   1  
ATOM   6375   C CG   . ASP A 1 417 ? 1.050   -19.442 -20.588 0.02 33.09 ? 410 ASP A CG   1  
ATOM   6376   O OD1  . ASP A 1 417 ? 0.353   -19.053 -21.577 0.02 32.68 ? 410 ASP A OD1  1  
ATOM   6377   O OD2  . ASP A 1 417 ? 2.295   -19.495 -20.612 0.02 33.62 ? 410 ASP A OD2  1  
ATOM   6378   H H    . ASP A 1 417 ? 1.210   -17.873 -18.185 0.02 33.30 ? 410 ASP A H    1  
ATOM   6379   H HA   . ASP A 1 417 ? -1.025  -18.397 -19.334 0.02 32.30 ? 410 ASP A HA   1  
ATOM   6380   H HB2  . ASP A 1 417 ? 1.087   -20.148 -18.676 0.02 33.39 ? 410 ASP A HB2  1  
ATOM   6381   H HB3  . ASP A 1 417 ? -0.165  -20.662 -19.498 0.02 32.85 ? 410 ASP A HB3  1  
ATOM   6382   N N    . ASN A 1 418 ? -0.865  -19.734 -16.409 0.02 32.81 ? 411 ASN A N    1  
ATOM   6383   C CA   . ASN A 1 418 ? -1.746  -20.227 -15.356 0.02 32.68 ? 411 ASN A CA   1  
ATOM   6384   C C    . ASN A 1 418 ? -2.782  -19.167 -15.007 0.02 32.23 ? 411 ASN A C    1  
ATOM   6385   O O    . ASN A 1 418 ? -3.972  -19.456 -14.907 0.02 31.87 ? 411 ASN A O    1  
ATOM   6386   C CB   . ASN A 1 418 ? -0.957  -20.612 -14.097 0.02 33.21 ? 411 ASN A CB   1  
ATOM   6387   C CG   . ASN A 1 418 ? 0.121   -21.628 -14.353 0.02 33.69 ? 411 ASN A CG   1  
ATOM   6388   O OD1  . ASN A 1 418 ? 0.033   -22.461 -15.266 0.02 33.61 ? 411 ASN A OD1  1  
ATOM   6389   N ND2  . ASN A 1 418 ? 1.156   -21.584 -13.518 0.02 34.25 ? 411 ASN A ND2  1  
ATOM   6390   H H    . ASN A 1 418 ? -0.034  -19.671 -16.198 0.02 33.16 ? 411 ASN A H    1  
ATOM   6391   H HA   . ASN A 1 418 ? -2.211  -21.015 -15.672 0.02 32.56 ? 411 ASN A HA   1  
ATOM   6392   H HB2  . ASN A 1 418 ? -0.536  -19.819 -13.729 0.02 33.37 ? 411 ASN A HB2  1  
ATOM   6393   H HB3  . ASN A 1 418 ? -1.570  -20.989 -13.449 0.02 33.12 ? 411 ASN A HB3  1  
ATOM   6394   H HD21 . ASN A 1 418 ? 1.802   -22.144 -13.609 0.02 34.57 ? 411 ASN A HD21 1  
ATOM   6395   H HD22 . ASN A 1 418 ? 1.182   -20.993 -12.894 0.02 34.32 ? 411 ASN A HD22 1  
ATOM   6396   N N    . PHE A 1 419 ? -2.345  -17.922 -14.826 0.02 32.31 ? 412 PHE A N    1  
ATOM   6397   C CA   . PHE A 1 419 ? -3.299  -16.862 -14.511 0.02 31.94 ? 412 PHE A CA   1  
ATOM   6398   C C    . PHE A 1 419 ? -4.326  -16.721 -15.630 0.02 31.41 ? 412 PHE A C    1  
ATOM   6399   O O    . PHE A 1 419 ? -5.538  -16.633 -15.390 0.02 31.04 ? 412 PHE A O    1  
ATOM   6400   C CB   . PHE A 1 419 ? -2.576  -15.539 -14.276 0.02 32.17 ? 412 PHE A CB   1  
ATOM   6401   C CG   . PHE A 1 419 ? -3.490  -14.435 -13.805 0.02 31.88 ? 412 PHE A CG   1  
ATOM   6402   C CD1  . PHE A 1 419 ? -4.355  -13.812 -14.683 0.02 31.44 ? 412 PHE A CD1  1  
ATOM   6403   C CD2  . PHE A 1 419 ? -3.500  -14.030 -12.479 0.02 32.08 ? 412 PHE A CD2  1  
ATOM   6404   C CE1  . PHE A 1 419 ? -5.206  -12.821 -14.258 0.02 31.20 ? 412 PHE A CE1  1  
ATOM   6405   C CE2  . PHE A 1 419 ? -4.356  -13.008 -12.050 0.02 31.85 ? 412 PHE A CE2  1  
ATOM   6406   C CZ   . PHE A 1 419 ? -5.205  -12.421 -12.929 0.02 31.41 ? 412 PHE A CZ   1  
ATOM   6407   H H    . PHE A 1 419 ? -1.526  -17.674 -14.881 0.02 32.58 ? 412 PHE A H    1  
ATOM   6408   H HA   . PHE A 1 419 ? -3.770  -17.090 -13.698 0.02 31.92 ? 412 PHE A HA   1  
ATOM   6409   H HB2  . PHE A 1 419 ? -1.890  -15.673 -13.608 0.02 32.54 ? 412 PHE A HB2  1  
ATOM   6410   H HB3  . PHE A 1 419 ? -2.164  -15.247 -15.102 0.02 32.19 ? 412 PHE A HB3  1  
ATOM   6411   H HD1  . PHE A 1 419 ? -4.368  -14.076 -15.575 0.02 31.31 ? 412 PHE A HD1  1  
ATOM   6412   H HD2  . PHE A 1 419 ? -2.924  -14.437 -11.875 0.02 32.40 ? 412 PHE A HD2  1  
ATOM   6413   H HE1  . PHE A 1 419 ? -5.779  -12.414 -14.867 0.02 30.93 ? 412 PHE A HE1  1  
ATOM   6414   H HE2  . PHE A 1 419 ? -4.360  -12.742 -11.159 0.02 32.01 ? 412 PHE A HE2  1  
ATOM   6415   H HZ   . PHE A 1 419 ? -5.775  -11.743 -12.643 0.02 31.28 ? 412 PHE A HZ   1  
ATOM   6416   N N    . MET A 1 420 ? -3.857  -16.703 -16.873 0.02 31.41 ? 413 MET A N    1  
ATOM   6417   C CA   . MET A 1 420 ? -4.801  -16.501 -17.967 0.02 30.95 ? 413 MET A CA   1  
ATOM   6418   C C    . MET A 1 420 ? -5.694  -17.718 -18.129 0.02 30.72 ? 413 MET A C    1  
ATOM   6419   O O    . MET A 1 420 ? -6.909  -17.584 -18.291 0.02 30.32 ? 413 MET A O    1  
ATOM   6420   C CB   . MET A 1 420 ? -4.041  -16.169 -19.245 0.02 31.05 ? 413 MET A CB   1  
ATOM   6421   C CG   . MET A 1 420 ? -3.272  -14.912 -19.065 0.02 31.27 ? 413 MET A CG   1  
ATOM   6422   S SD   . MET A 1 420 ? -2.642  -14.209 -20.602 0.02 31.35 ? 413 MET A SD   1  
ATOM   6423   C CE   . MET A 1 420 ? -1.187  -15.200 -20.841 0.02 31.91 ? 413 MET A CE   1  
ATOM   6424   H H    . MET A 1 420 ? -3.033  -16.803 -17.096 0.02 31.68 ? 413 MET A H    1  
ATOM   6425   H HA   . MET A 1 420 ? -5.366  -15.742 -17.762 0.02 30.75 ? 413 MET A HA   1  
ATOM   6426   H HB2  . MET A 1 420 ? -3.417  -16.882 -19.451 0.02 31.30 ? 413 MET A HB2  1  
ATOM   6427   H HB3  . MET A 1 420 ? -4.666  -16.046 -19.975 0.02 30.77 ? 413 MET A HB3  1  
ATOM   6428   H HG2  . MET A 1 420 ? -3.856  -14.257 -18.654 0.02 31.08 ? 413 MET A HG2  1  
ATOM   6429   H HG3  . MET A 1 420 ? -2.514  -15.078 -18.488 0.02 31.61 ? 413 MET A HG3  1  
ATOM   6430   H HE1  . MET A 1 420 ? -0.797  -14.985 -21.700 0.02 32.02 ? 413 MET A HE1  1  
ATOM   6431   H HE2  . MET A 1 420 ? -0.554  -15.011 -20.133 0.02 32.21 ? 413 MET A HE2  1  
ATOM   6432   H HE3  . MET A 1 420 ? -1.441  -16.136 -20.824 0.02 31.84 ? 413 MET A HE3  1  
ATOM   6433   N N    . ASP A 1 421 ? -5.111  -18.919 -18.024 0.02 31.02 ? 414 ASP A N    1  
ATOM   6434   C CA   . ASP A 1 421 ? -5.916  -20.130 -18.005 0.02 30.89 ? 414 ASP A CA   1  
ATOM   6435   C C    . ASP A 1 421 ? -6.920  -20.102 -16.865 0.02 30.73 ? 414 ASP A C    1  
ATOM   6436   O O    . ASP A 1 421 ? -8.082  -20.474 -17.046 0.02 30.43 ? 414 ASP A O    1  
ATOM   6437   C CB   . ASP A 1 421 ? -5.012  -21.369 -17.895 0.02 31.34 ? 414 ASP A CB   1  
ATOM   6438   C CG   . ASP A 1 421 ? -5.792  -22.664 -17.979 0.02 31.27 ? 414 ASP A CG   1  
ATOM   6439   O OD1  . ASP A 1 421 ? -6.668  -22.790 -18.860 0.02 30.93 ? 414 ASP A OD1  1  
ATOM   6440   O OD2  . ASP A 1 421 ? -5.536  -23.601 -17.176 0.02 31.59 ? 414 ASP A OD2  1  
ATOM   6441   H H    . ASP A 1 421 ? -4.265  -19.052 -17.964 0.02 31.32 ? 414 ASP A H    1  
ATOM   6442   H HA   . ASP A 1 421 ? -6.418  -20.187 -18.829 0.02 30.66 ? 414 ASP A HA   1  
ATOM   6443   H HB2  . ASP A 1 421 ? -4.372  -21.356 -18.621 0.02 31.46 ? 414 ASP A HB2  1  
ATOM   6444   H HB3  . ASP A 1 421 ? -4.542  -21.351 -17.051 0.02 31.59 ? 414 ASP A HB3  1  
ATOM   6445   N N    . LEU A 1 422 ? -6.484  -19.694 -15.663 0.02 30.97 ? 415 LEU A N    1  
ATOM   6446   C CA   . LEU A 1 422 ? -7.443  -19.557 -14.574 0.02 30.84 ? 415 LEU A CA   1  
ATOM   6447   C C    . LEU A 1 422 ? -8.580  -18.628 -14.976 0.02 30.38 ? 415 LEU A C    1  
ATOM   6448   O O    . LEU A 1 422 ? -9.752  -18.946 -14.778 0.02 30.15 ? 415 LEU A O    1  
ATOM   6449   C CB   . LEU A 1 422 ? -6.739  -19.050 -13.309 0.02 31.20 ? 415 LEU A CB   1  
ATOM   6450   C CG   . LEU A 1 422 ? -7.553  -19.148 -12.014 0.02 31.21 ? 415 LEU A CG   1  
ATOM   6451   C CD1  . LEU A 1 422 ? -6.605  -19.101 -10.816 0.02 31.71 ? 415 LEU A CD1  1  
ATOM   6452   C CD2  . LEU A 1 422 ? -8.587  -18.071 -11.873 0.02 30.86 ? 415 LEU A CD2  1  
ATOM   6453   H H    . LEU A 1 422 ? -5.672  -19.496 -15.463 0.02 31.22 ? 415 LEU A H    1  
ATOM   6454   H HA   . LEU A 1 422 ? -7.828  -20.425 -14.380 0.02 30.86 ? 415 LEU A HA   1  
ATOM   6455   H HB2  . LEU A 1 422 ? -5.936  -19.579 -13.181 0.02 31.51 ? 415 LEU A HB2  1  
ATOM   6456   H HB3  . LEU A 1 422 ? -6.495  -18.120 -13.436 0.02 31.18 ? 415 LEU A HB3  1  
ATOM   6457   H HG   . LEU A 1 422 ? -8.020  -19.998 -12.008 0.02 31.16 ? 415 LEU A HG   1  
ATOM   6458   H HD11 . LEU A 1 422 ? -7.122  -19.122 -9.997  0.02 31.73 ? 415 LEU A HD11 1  
ATOM   6459   H HD12 . LEU A 1 422 ? -6.018  -19.871 -10.855 0.02 31.95 ? 415 LEU A HD12 1  
ATOM   6460   H HD13 . LEU A 1 422 ? -6.082  -18.286 -10.858 0.02 31.79 ? 415 LEU A HD13 1  
ATOM   6461   H HD21 . LEU A 1 422 ? -8.937  -18.099 -10.971 0.02 30.96 ? 415 LEU A HD21 1  
ATOM   6462   H HD22 . LEU A 1 422 ? -8.173  -17.210 -12.045 0.02 30.87 ? 415 LEU A HD22 1  
ATOM   6463   H HD23 . LEU A 1 422 ? -9.304  -18.229 -12.503 0.02 30.57 ? 415 LEU A HD23 1  
ATOM   6464   N N    . CYS A 1 423 ? -8.248  -17.481 -15.567 0.02 30.28 ? 416 CYS A N    1  
ATOM   6465   C CA   . CYS A 1 423 ? -9.285  -16.532 -15.961 0.02 29.89 ? 416 CYS A CA   1  
ATOM   6466   C C    . CYS A 1 423 ? -10.277 -17.147 -16.946 0.02 29.55 ? 416 CYS A C    1  
ATOM   6467   O O    . CYS A 1 423 ? -11.473 -16.831 -16.909 0.02 29.26 ? 416 CYS A O    1  
ATOM   6468   C CB   . CYS A 1 423 ? -8.648  -15.275 -16.557 0.02 29.90 ? 416 CYS A CB   1  
ATOM   6469   S SG   . CYS A 1 423 ? -7.791  -14.261 -15.350 0.02 30.26 ? 416 CYS A SG   1  
ATOM   6470   H H    . CYS A 1 423 ? -7.442  -17.229 -15.732 0.02 30.46 ? 416 CYS A H    1  
ATOM   6471   H HA   . CYS A 1 423 ? -9.782  -16.268 -15.171 0.02 29.86 ? 416 CYS A HA   1  
ATOM   6472   H HB2  . CYS A 1 423 ? -8.009  -15.526 -17.238 0.02 30.01 ? 416 CYS A HB2  1  
ATOM   6473   H HB3  . CYS A 1 423 ? -9.348  -14.732 -16.947 0.02 29.64 ? 416 CYS A HB3  1  
ATOM   6474   H HG   . CYS A 1 423 ? -8.602  -13.943 -14.526 0.02 30.16 ? 416 CYS A HG   1  
ATOM   6475   N N    . SER A 1 424 ? -9.811  -18.016 -17.855 0.02 29.62 ? 417 SER A N    1  
ATOM   6476   C CA   . SER A 1 424 ? -10.768 -18.619 -18.781 0.02 29.35 ? 417 SER A CA   1  
ATOM   6477   C C    . SER A 1 424 ? -11.879 -19.307 -18.009 0.02 29.26 ? 417 SER A C    1  
ATOM   6478   O O    . SER A 1 424 ? -13.049 -19.258 -18.389 0.02 28.98 ? 417 SER A O    1  
ATOM   6479   C CB   . SER A 1 424 ? -10.078 -19.625 -19.721 0.02 29.52 ? 417 SER A CB   1  
ATOM   6480   O OG   . SER A 1 424 ? -9.003  -19.016 -20.402 0.02 29.66 ? 417 SER A OG   1  
ATOM   6481   H H    . SER A 1 424 ? -8.993  -18.257 -17.948 0.02 29.84 ? 417 SER A H    1  
ATOM   6482   H HA   . SER A 1 424 ? -11.167 -17.921 -19.321 0.02 29.14 ? 417 SER A HA   1  
ATOM   6483   H HB2  . SER A 1 424 ? -9.738  -20.365 -19.196 0.02 29.74 ? 417 SER A HB2  1  
ATOM   6484   H HB3  . SER A 1 424 ? -10.722 -19.955 -20.365 0.02 29.34 ? 417 SER A HB3  1  
ATOM   6485   H HG   . SER A 1 424 ? -9.078  -19.155 -21.226 0.02 29.58 ? 417 SER A HG   1  
ATOM   6486   N N    . HIS A 1 425 ? -11.522 -19.942 -16.895 0.02 29.55 ? 418 HIS A N    1  
ATOM   6487   C CA   . HIS A 1 425 ? -12.507 -20.715 -16.151 0.02 29.54 ? 418 HIS A CA   1  
ATOM   6488   C C    . HIS A 1 425 ? -13.358 -19.848 -15.233 0.02 29.41 ? 418 HIS A C    1  
ATOM   6489   O O    . HIS A 1 425 ? -14.574 -20.032 -15.175 0.02 29.24 ? 418 HIS A O    1  
ATOM   6490   C CB   . HIS A 1 425 ? -11.786 -21.810 -15.388 0.02 29.95 ? 418 HIS A CB   1  
ATOM   6491   C CG   . HIS A 1 425 ? -11.310 -22.898 -16.288 0.02 30.08 ? 418 HIS A CG   1  
ATOM   6492   N ND1  . HIS A 1 425 ? -12.023 -24.056 -16.487 0.02 30.10 ? 418 HIS A ND1  1  
ATOM   6493   C CD2  . HIS A 1 425 ? -10.256 -22.947 -17.135 0.02 30.21 ? 418 HIS A CD2  1  
ATOM   6494   C CE1  . HIS A 1 425 ? -11.379 -24.812 -17.359 0.02 30.26 ? 418 HIS A CE1  1  
ATOM   6495   N NE2  . HIS A 1 425 ? -10.304 -24.162 -17.764 0.02 30.32 ? 418 HIS A NE2  1  
ATOM   6496   H H    . HIS A 1 425 ? -10.731 -19.947 -16.571 0.02 29.76 ? 418 HIS A H    1  
ATOM   6497   H HA   . HIS A 1 425 ? -13.102 -21.153 -16.776 0.02 29.40 ? 418 HIS A HA   1  
ATOM   6498   H HB2  . HIS A 1 425 ? -11.012 -21.430 -14.943 0.02 30.13 ? 418 HIS A HB2  1  
ATOM   6499   H HB3  . HIS A 1 425 ? -12.388 -22.195 -14.732 0.02 29.99 ? 418 HIS A HB3  1  
ATOM   6500   H HD2  . HIS A 1 425 ? -9.593  -22.304 -17.229 0.02 30.25 ? 418 HIS A HD2  1  
ATOM   6501   H HE1  . HIS A 1 425 ? -11.647 -25.656 -17.649 0.02 30.33 ? 418 HIS A HE1  1  
ATOM   6502   H HE2  . HIS A 1 425 ? -9.736  -24.446 -18.338 0.02 30.43 ? 418 HIS A HE2  1  
ATOM   6503   N N    . PHE A 1 426 ? -12.740 -18.878 -14.560 0.02 29.52 ? 419 PHE A N    1  
ATOM   6504   C CA   . PHE A 1 426 ? -13.462 -18.044 -13.591 0.02 29.47 ? 419 PHE A CA   1  
ATOM   6505   C C    . PHE A 1 426 ? -14.537 -17.238 -14.290 0.02 29.10 ? 419 PHE A C    1  
ATOM   6506   O O    . PHE A 1 426 ? -15.666 -17.130 -13.809 0.02 29.00 ? 419 PHE A O    1  
ATOM   6507   C CB   . PHE A 1 426 ? -12.485 -17.105 -12.876 0.02 29.70 ? 419 PHE A CB   1  
ATOM   6508   C CG   . PHE A 1 426 ? -13.145 -16.137 -11.898 0.02 29.69 ? 419 PHE A CG   1  
ATOM   6509   C CD1  . PHE A 1 426 ? -13.401 -16.512 -10.590 0.02 29.95 ? 419 PHE A CD1  1  
ATOM   6510   C CD2  . PHE A 1 426 ? -13.481 -14.847 -12.295 0.02 29.47 ? 419 PHE A CD2  1  
ATOM   6511   C CE1  . PHE A 1 426 ? -13.994 -15.625 -9.704  0.02 29.98 ? 419 PHE A CE1  1  
ATOM   6512   C CE2  . PHE A 1 426 ? -14.073 -13.961 -11.418 0.02 29.49 ? 419 PHE A CE2  1  
ATOM   6513   C CZ   . PHE A 1 426 ? -14.322 -14.358 -10.103 0.02 29.75 ? 419 PHE A CZ   1  
ATOM   6514   H H    . PHE A 1 426 ? -11.912 -18.669 -14.663 0.02 29.65 ? 419 PHE A H    1  
ATOM   6515   H HA   . PHE A 1 426 ? -13.888 -18.605 -12.928 0.02 29.57 ? 419 PHE A HA   1  
ATOM   6516   H HB2  . PHE A 1 426 ? -11.837 -17.637 -12.391 0.02 29.97 ? 419 PHE A HB2  1  
ATOM   6517   H HB3  . PHE A 1 426 ? -12.025 -16.575 -13.544 0.02 29.64 ? 419 PHE A HB3  1  
ATOM   6518   H HD1  . PHE A 1 426 ? -13.178 -17.367 -10.304 0.02 30.13 ? 419 PHE A HD1  1  
ATOM   6519   H HD2  . PHE A 1 426 ? -13.314 -14.579 -13.170 0.02 29.31 ? 419 PHE A HD2  1  
ATOM   6520   H HE1  . PHE A 1 426 ? -14.162 -15.887 -8.830  0.02 30.18 ? 419 PHE A HE1  1  
ATOM   6521   H HE2  . PHE A 1 426 ? -14.295 -13.103 -11.697 0.02 29.36 ? 419 PHE A HE2  1  
ATOM   6522   H HZ   . PHE A 1 426 ? -14.720 -13.767 -9.507  0.02 29.80 ? 419 PHE A HZ   1  
ATOM   6523   N N    . TYR A 1 427 ? -14.201 -16.693 -15.454 0.02 28.92 ? 420 TYR A N    1  
ATOM   6524   C CA   . TYR A 1 427 ? -15.091 -15.793 -16.160 0.02 28.61 ? 420 TYR A CA   1  
ATOM   6525   C C    . TYR A 1 427 ? -15.976 -16.477 -17.199 0.02 28.38 ? 420 TYR A C    1  
ATOM   6526   O O    . TYR A 1 427 ? -17.027 -15.922 -17.532 0.02 28.15 ? 420 TYR A O    1  
ATOM   6527   C CB   . TYR A 1 427 ? -14.263 -14.686 -16.840 0.02 28.58 ? 420 TYR A CB   1  
ATOM   6528   C CG   . TYR A 1 427 ? -13.461 -13.771 -15.896 0.02 28.83 ? 420 TYR A CG   1  
ATOM   6529   C CD1  . TYR A 1 427 ? -14.079 -12.797 -15.137 0.02 28.83 ? 420 TYR A CD1  1  
ATOM   6530   C CD2  . TYR A 1 427 ? -12.093 -13.833 -15.841 0.02 29.11 ? 420 TYR A CD2  1  
ATOM   6531   C CE1  . TYR A 1 427 ? -13.337 -11.960 -14.302 0.02 29.11 ? 420 TYR A CE1  1  
ATOM   6532   C CE2  . TYR A 1 427 ? -11.350 -12.999 -15.009 0.02 29.38 ? 420 TYR A CE2  1  
ATOM   6533   C CZ   . TYR A 1 427 ? -11.975 -12.051 -14.247 0.02 29.38 ? 420 TYR A CZ   1  
ATOM   6534   O OH   . TYR A 1 427 ? -11.230 -11.213 -13.414 0.02 29.70 ? 420 TYR A OH   1  
ATOM   6535   H H    . TYR A 1 427 ? -13.448 -16.820 -15.843 0.02 29.01 ? 420 TYR A H    1  
ATOM   6536   H HA   . TYR A 1 427 ? -15.679 -15.369 -15.519 0.02 28.59 ? 420 TYR A HA   1  
ATOM   6537   H HB2  . TYR A 1 427 ? -13.634 -15.103 -17.449 0.02 28.62 ? 420 TYR A HB2  1  
ATOM   6538   H HB3  . TYR A 1 427 ? -14.869 -14.120 -17.347 0.02 28.39 ? 420 TYR A HB3  1  
ATOM   6539   H HD1  . TYR A 1 427 ? -15.005 -12.720 -15.155 0.02 28.68 ? 420 TYR A HD1  1  
ATOM   6540   H HD2  . TYR A 1 427 ? -11.648 -14.465 -16.354 0.02 29.13 ? 420 TYR A HD2  1  
ATOM   6541   H HE1  . TYR A 1 427 ? -13.782 -11.344 -13.793 0.02 29.13 ? 420 TYR A HE1  1  
ATOM   6542   H HE2  . TYR A 1 427 ? -10.423 -13.071 -14.983 0.02 29.59 ? 420 TYR A HE2  1  
ATOM   6543   H HH   . TYR A 1 427 ? -10.410 -11.358 -13.521 0.02 29.86 ? 420 TYR A HH   1  
ATOM   6544   N N    . PHE A 1 428 ? -15.610 -17.672 -17.695 0.02 28.47 ? 421 PHE A N    1  
ATOM   6545   C CA   . PHE A 1 428 ? -16.386 -18.277 -18.777 0.02 28.29 ? 421 PHE A CA   1  
ATOM   6546   C C    . PHE A 1 428 ? -16.774 -19.747 -18.607 0.02 28.42 ? 421 PHE A C    1  
ATOM   6547   O O    . PHE A 1 428 ? -17.961 -20.053 -18.637 0.02 28.32 ? 421 PHE A O    1  
ATOM   6548   C CB   . PHE A 1 428 ? -15.633 -18.059 -20.092 0.02 28.24 ? 421 PHE A CB   1  
ATOM   6549   C CG   . PHE A 1 428 ? -15.394 -16.607 -20.364 0.02 28.13 ? 421 PHE A CG   1  
ATOM   6550   C CD1  . PHE A 1 428 ? -16.438 -15.787 -20.697 0.02 27.89 ? 421 PHE A CD1  1  
ATOM   6551   C CD2  . PHE A 1 428 ? -14.151 -16.069 -20.225 0.02 28.31 ? 421 PHE A CD2  1  
ATOM   6552   C CE1  . PHE A 1 428 ? -16.229 -14.439 -20.907 0.02 27.82 ? 421 PHE A CE1  1  
ATOM   6553   C CE2  . PHE A 1 428 ? -13.935 -14.744 -20.434 0.02 28.26 ? 421 PHE A CE2  1  
ATOM   6554   C CZ   . PHE A 1 428 ? -14.974 -13.927 -20.778 0.02 28.02 ? 421 PHE A CZ   1  
ATOM   6555   H H    . PHE A 1 428 ? -14.934 -18.129 -17.433 0.02 28.65 ? 421 PHE A H    1  
ATOM   6556   H HA   . PHE A 1 428 ? -17.219 -17.790 -18.853 0.02 28.12 ? 421 PHE A HA   1  
ATOM   6557   H HB2  . PHE A 1 428 ? -14.770 -18.498 -20.056 0.02 28.42 ? 421 PHE A HB2  1  
ATOM   6558   H HB3  . PHE A 1 428 ? -16.157 -18.429 -20.819 0.02 28.13 ? 421 PHE A HB3  1  
ATOM   6559   H HD1  . PHE A 1 428 ? -17.293 -16.139 -20.781 0.02 27.79 ? 421 PHE A HD1  1  
ATOM   6560   H HD2  . PHE A 1 428 ? -13.441 -16.621 -19.992 0.02 28.50 ? 421 PHE A HD2  1  
ATOM   6561   H HE1  . PHE A 1 428 ? -16.938 -13.890 -21.142 0.02 27.68 ? 421 PHE A HE1  1  
ATOM   6562   H HE2  . PHE A 1 428 ? -13.078 -14.394 -20.346 0.02 28.42 ? 421 PHE A HE2  1  
ATOM   6563   H HZ   . PHE A 1 428 ? -14.820 -13.023 -20.926 0.02 28.00 ? 421 PHE A HZ   1  
ATOM   6564   N N    . TRP A 1 429 ? -15.817 -20.675 -18.471 0.02 28.69 ? 422 TRP A N    1  
ATOM   6565   C CA   . TRP A 1 429 ? -16.196 -22.086 -18.508 0.02 28.84 ? 422 TRP A CA   1  
ATOM   6566   C C    . TRP A 1 429 ? -16.967 -22.503 -17.261 0.02 28.97 ? 422 TRP A C    1  
ATOM   6567   O O    . TRP A 1 429 ? -17.982 -23.194 -17.356 0.02 28.96 ? 422 TRP A O    1  
ATOM   6568   C CB   . TRP A 1 429 ? -14.964 -22.963 -18.680 0.02 29.13 ? 422 TRP A CB   1  
ATOM   6569   C CG   . TRP A 1 429 ? -14.353 -22.844 -20.030 0.02 29.06 ? 422 TRP A CG   1  
ATOM   6570   C CD1  . TRP A 1 429 ? -13.269 -22.112 -20.357 0.02 29.11 ? 422 TRP A CD1  1  
ATOM   6571   C CD2  . TRP A 1 429 ? -14.776 -23.512 -21.230 0.02 29.00 ? 422 TRP A CD2  1  
ATOM   6572   N NE1  . TRP A 1 429 ? -12.975 -22.266 -21.711 0.02 29.07 ? 422 TRP A NE1  1  
ATOM   6573   C CE2  . TRP A 1 429 ? -13.895 -23.107 -22.266 0.02 29.00 ? 422 TRP A CE2  1  
ATOM   6574   C CE3  . TRP A 1 429 ? -15.822 -24.383 -21.536 0.02 28.98 ? 422 TRP A CE3  1  
ATOM   6575   C CZ2  . TRP A 1 429 ? -14.013 -23.575 -23.579 0.02 28.98 ? 422 TRP A CZ2  1  
ATOM   6576   C CZ3  . TRP A 1 429 ? -15.943 -24.849 -22.842 0.02 28.96 ? 422 TRP A CZ3  1  
ATOM   6577   C CH2  . TRP A 1 429 ? -15.040 -24.435 -23.847 0.02 28.95 ? 422 TRP A CH2  1  
ATOM   6578   H H    . TRP A 1 429 ? -14.978 -20.523 -18.365 0.02 28.80 ? 422 TRP A H    1  
ATOM   6579   H HA   . TRP A 1 429 ? -16.774 -22.237 -19.271 0.02 28.70 ? 422 TRP A HA   1  
ATOM   6580   H HB2  . TRP A 1 429 ? -14.295 -22.714 -18.025 0.02 29.27 ? 422 TRP A HB2  1  
ATOM   6581   H HB3  . TRP A 1 429 ? -15.224 -23.888 -18.556 0.02 29.27 ? 422 TRP A HB3  1  
ATOM   6582   H HD1  . TRP A 1 429 ? -12.785 -21.587 -19.764 0.02 29.18 ? 422 TRP A HD1  1  
ATOM   6583   H HE1  . TRP A 1 429 ? -12.329 -21.889 -22.127 0.02 29.11 ? 422 TRP A HE1  1  
ATOM   6584   H HE3  . TRP A 1 429 ? -16.417 -24.663 -20.883 0.02 29.01 ? 422 TRP A HE3  1  
ATOM   6585   H HZ2  . TRP A 1 429 ? -13.422 -23.304 -24.240 0.02 29.00 ? 422 TRP A HZ2  1  
ATOM   6586   H HZ3  . TRP A 1 429 ? -16.636 -25.429 -23.058 0.02 28.97 ? 422 TRP A HZ3  1  
ATOM   6587   H HH2  . TRP A 1 429 ? -15.151 -24.754 -24.712 0.02 28.96 ? 422 TRP A HH2  1  
ATOM   6588   N N    . PHE A 1 430 ? -16.515 -22.090 -16.080 0.02 29.12 ? 423 PHE A N    1  
ATOM   6589   C CA   . PHE A 1 430 ? -17.231 -22.538 -14.887 0.02 29.30 ? 423 PHE A CA   1  
ATOM   6590   C C    . PHE A 1 430 ? -18.670 -22.042 -14.880 0.02 29.08 ? 423 PHE A C    1  
ATOM   6591   O O    . PHE A 1 430 ? -19.586 -22.861 -14.723 0.02 29.17 ? 423 PHE A O    1  
ATOM   6592   C CB   . PHE A 1 430 ? -16.457 -22.131 -13.634 0.02 29.54 ? 423 PHE A CB   1  
ATOM   6593   C CG   . PHE A 1 430 ? -17.017 -22.740 -12.382 0.02 29.81 ? 423 PHE A CG   1  
ATOM   6594   C CD1  . PHE A 1 430 ? -17.247 -24.107 -12.321 0.02 30.04 ? 423 PHE A CD1  1  
ATOM   6595   C CD2  . PHE A 1 430 ? -17.361 -21.958 -11.311 0.02 29.85 ? 423 PHE A CD2  1  
ATOM   6596   C CE1  . PHE A 1 430 ? -17.773 -24.702 -11.181 0.02 30.33 ? 423 PHE A CE1  1  
ATOM   6597   C CE2  . PHE A 1 430 ? -17.882 -22.553 -10.144 0.02 30.15 ? 423 PHE A CE2  1  
ATOM   6598   C CZ   . PHE A 1 430 ? -18.103 -23.930 -10.102 0.02 30.39 ? 423 PHE A CZ   1  
ATOM   6599   H H    . PHE A 1 430 ? -15.833 -21.583 -15.944 0.02 29.15 ? 423 PHE A H    1  
ATOM   6600   H HA   . PHE A 1 430 ? -17.269 -23.505 -14.907 0.02 29.46 ? 423 PHE A HA   1  
ATOM   6601   H HB2  . PHE A 1 430 ? -15.537 -22.416 -13.732 0.02 29.69 ? 423 PHE A HB2  1  
ATOM   6602   H HB3  . PHE A 1 430 ? -16.483 -21.173 -13.530 0.02 29.41 ? 423 PHE A HB3  1  
ATOM   6603   H HD1  . PHE A 1 430 ? -17.026 -24.638 -13.048 0.02 30.03 ? 423 PHE A HD1  1  
ATOM   6604   H HD2  . PHE A 1 430 ? -17.211 -21.045 -11.345 0.02 29.72 ? 423 PHE A HD2  1  
ATOM   6605   H HE1  . PHE A 1 430 ? -17.914 -25.621 -11.159 0.02 30.52 ? 423 PHE A HE1  1  
ATOM   6606   H HE2  . PHE A 1 430 ? -18.111 -22.029 -9.412  0.02 30.21 ? 423 PHE A HE2  1  
ATOM   6607   H HZ   . PHE A 1 430 ? -18.456 -24.324 -9.341  0.02 30.61 ? 423 PHE A HZ   1  
ATOM   6608   N N    . PRO A 1 431 ? -18.954 -20.757 -15.102 0.02 28.82 ? 424 PRO A N    1  
ATOM   6609   C CA   . PRO A 1 431 ? -20.356 -20.340 -15.210 0.02 28.64 ? 424 PRO A CA   1  
ATOM   6610   C C    . PRO A 1 431 ? -21.132 -21.116 -16.255 0.02 28.55 ? 424 PRO A C    1  
ATOM   6611   O O    . PRO A 1 431 ? -22.304 -21.435 -16.036 0.02 28.59 ? 424 PRO A O    1  
ATOM   6612   C CB   . PRO A 1 431 ? -20.259 -18.841 -15.574 0.02 28.40 ? 424 PRO A CB   1  
ATOM   6613   C CG   . PRO A 1 431 ? -18.960 -18.428 -15.168 0.02 28.52 ? 424 PRO A CG   1  
ATOM   6614   C CD   . PRO A 1 431 ? -18.034 -19.615 -15.140 0.02 28.75 ? 424 PRO A CD   1  
ATOM   6615   H HA   . PRO A 1 431 ? -20.797 -20.436 -14.353 0.02 28.78 ? 424 PRO A HA   1  
ATOM   6616   H HB2  . PRO A 1 431 ? -20.355 -18.724 -16.531 0.02 28.23 ? 424 PRO A HB2  1  
ATOM   6617   H HB3  . PRO A 1 431 ? -20.943 -18.344 -15.106 0.02 28.37 ? 424 PRO A HB3  1  
ATOM   6618   H HG2  . PRO A 1 431 ? -18.631 -17.771 -15.798 0.02 28.38 ? 424 PRO A HG2  1  
ATOM   6619   H HG3  . PRO A 1 431 ? -19.022 -18.041 -14.281 0.02 28.62 ? 424 PRO A HG3  1  
ATOM   6620   H HD2  . PRO A 1 431 ? -17.480 -19.642 -15.933 0.02 28.69 ? 424 PRO A HD2  1  
ATOM   6621   H HD3  . PRO A 1 431 ? -17.495 -19.579 -14.339 0.02 28.94 ? 424 PRO A HD3  1  
ATOM   6622   N N    . MET A 1 432 ? -20.507 -21.450 -17.388 0.02 28.47 ? 425 MET A N    1  
ATOM   6623   C CA   . MET A 1 432 ? -21.228 -22.213 -18.394 0.02 28.42 ? 425 MET A CA   1  
ATOM   6624   C C    . MET A 1 432 ? -21.682 -23.546 -17.822 0.02 28.72 ? 425 MET A C    1  
ATOM   6625   O O    . MET A 1 432 ? -22.833 -23.947 -17.986 0.02 28.74 ? 425 MET A O    1  
ATOM   6626   C CB   . MET A 1 432 ? -20.354 -22.462 -19.635 0.02 28.37 ? 425 MET A CB   1  
ATOM   6627   C CG   . MET A 1 432 ? -21.093 -23.222 -20.673 0.02 28.36 ? 425 MET A CG   1  
ATOM   6628   S SD   . MET A 1 432 ? -20.013 -23.728 -22.043 0.02 28.43 ? 425 MET A SD   1  
ATOM   6629   C CE   . MET A 1 432 ? -19.016 -24.891 -21.122 0.02 28.82 ? 425 MET A CE   1  
ATOM   6630   H H    . MET A 1 432 ? -19.694 -21.258 -17.578 0.02 28.46 ? 425 MET A H    1  
ATOM   6631   H HA   . MET A 1 432 ? -22.008 -21.709 -18.667 0.02 28.28 ? 425 MET A HA   1  
ATOM   6632   H HB2  . MET A 1 432 ? -20.094 -21.615 -20.024 0.02 28.21 ? 425 MET A HB2  1  
ATOM   6633   H HB3  . MET A 1 432 ? -19.564 -22.958 -19.391 0.02 28.53 ? 425 MET A HB3  1  
ATOM   6634   H HG2  . MET A 1 432 ? -21.468 -24.027 -20.290 0.02 28.53 ? 425 MET A HG2  1  
ATOM   6635   H HG3  . MET A 1 432 ? -21.803 -22.668 -21.027 0.02 28.20 ? 425 MET A HG3  1  
ATOM   6636   H HE1  . MET A 1 432 ? -18.472 -24.414 -20.477 0.02 28.83 ? 425 MET A HE1  1  
ATOM   6637   H HE2  . MET A 1 432 ? -19.601 -25.510 -20.652 0.02 28.91 ? 425 MET A HE2  1  
ATOM   6638   H HE3  . MET A 1 432 ? -18.446 -25.378 -21.737 0.02 28.94 ? 425 MET A HE3  1  
ATOM   6639   N N    . HIS A 1 433 ? -20.747 -24.259 -17.204 0.02 28.98 ? 426 HIS A N    1  
ATOM   6640   C CA   . HIS A 1 433 ? -21.046 -25.494 -16.478 0.02 29.32 ? 426 HIS A CA   1  
ATOM   6641   C C    . HIS A 1 433 ? -22.188 -25.300 -15.489 0.02 29.40 ? 426 HIS A C    1  
ATOM   6642   O O    . HIS A 1 433 ? -23.159 -26.065 -15.478 0.02 29.56 ? 426 HIS A O    1  
ATOM   6643   C CB   . HIS A 1 433 ? -19.773 -25.946 -15.769 0.02 29.60 ? 426 HIS A CB   1  
ATOM   6644   C CG   . HIS A 1 433 ? -19.914 -27.218 -14.995 0.02 30.01 ? 426 HIS A CG   1  
ATOM   6645   N ND1  . HIS A 1 433 ? -20.569 -28.326 -15.484 0.02 30.17 ? 426 HIS A ND1  1  
ATOM   6646   C CD2  . HIS A 1 433 ? -19.456 -27.564 -13.766 0.02 30.33 ? 426 HIS A CD2  1  
ATOM   6647   C CE1  . HIS A 1 433 ? -20.508 -29.303 -14.593 0.02 30.58 ? 426 HIS A CE1  1  
ATOM   6648   N NE2  . HIS A 1 433 ? -19.843 -28.866 -13.540 0.02 30.68 ? 426 HIS A NE2  1  
ATOM   6649   H H    . HIS A 1 433 ? -19.917 -24.042 -17.192 0.02 28.98 ? 426 HIS A H    1  
ATOM   6650   H HA   . HIS A 1 433 ? -21.307 -26.189 -17.101 0.02 29.37 ? 426 HIS A HA   1  
ATOM   6651   H HB2  . HIS A 1 433 ? -19.086 -26.090 -16.435 0.02 29.57 ? 426 HIS A HB2  1  
ATOM   6652   H HB3  . HIS A 1 433 ? -19.484 -25.247 -15.164 0.02 29.56 ? 426 HIS A HB3  1  
ATOM   6653   H HD2  . HIS A 1 433 ? -18.967 -27.024 -13.190 0.02 30.34 ? 426 HIS A HD2  1  
ATOM   6654   H HE1  . HIS A 1 433 ? -20.883 -30.149 -14.685 0.02 30.78 ? 426 HIS A HE1  1  
ATOM   6655   H HE2  . HIS A 1 433 ? -19.678 -29.317 -12.828 0.02 30.94 ? 426 HIS A HE2  1  
ATOM   6656   N N    . ARG A 1 434 ? -22.103 -24.256 -14.655 0.02 29.33 ? 427 ARG A N    1  
ATOM   6657   C CA   . ARG A 1 434 ? -23.147 -24.079 -13.655 0.02 29.46 ? 427 ARG A CA   1  
ATOM   6658   C C    . ARG A 1 434 ? -24.496 -23.868 -14.311 0.02 29.30 ? 427 ARG A C    1  
ATOM   6659   O O    . ARG A 1 434 ? -25.510 -24.385 -13.842 0.02 29.51 ? 427 ARG A O    1  
ATOM   6660   C CB   . ARG A 1 434 ? -22.820 -22.921 -12.715 0.02 29.42 ? 427 ARG A CB   1  
ATOM   6661   C CG   . ARG A 1 434 ? -21.576 -23.127 -11.937 0.02 29.63 ? 427 ARG A CG   1  
ATOM   6662   C CD   . ARG A 1 434 ? -21.210 -21.918 -11.126 0.02 29.60 ? 427 ARG A CD   1  
ATOM   6663   N NE   . ARG A 1 434 ? -22.082 -21.735 -9.948  0.02 29.81 ? 427 ARG A NE   1  
ATOM   6664   C CZ   . ARG A 1 434 ? -21.941 -20.743 -9.079  0.02 29.88 ? 427 ARG A CZ   1  
ATOM   6665   N NH1  . ARG A 1 434 ? -20.976 -19.851 -9.248  0.02 29.76 ? 427 ARG A NH1  1  
ATOM   6666   N NH2  . ARG A 1 434 ? -22.757 -20.661 -8.009  0.02 30.12 ? 427 ARG A NH2  1  
ATOM   6667   H H    . ARG A 1 434 ? -21.475 -23.669 -14.642 0.02 29.24 ? 427 ARG A H    1  
ATOM   6668   H HA   . ARG A 1 434 ? -23.205 -24.896 -13.132 0.02 29.72 ? 427 ARG A HA   1  
ATOM   6669   H HB2  . ARG A 1 434 ? -22.714 -22.110 -13.231 0.02 29.18 ? 427 ARG A HB2  1  
ATOM   6670   H HB3  . ARG A 1 434 ? -23.550 -22.820 -12.091 0.02 29.53 ? 427 ARG A HB3  1  
ATOM   6671   H HG2  . ARG A 1 434 ? -21.706 -23.863 -11.319 0.02 29.90 ? 427 ARG A HG2  1  
ATOM   6672   H HG3  . ARG A 1 434 ? -20.846 -23.322 -12.541 0.02 29.57 ? 427 ARG A HG3  1  
ATOM   6673   H HD2  . ARG A 1 434 ? -20.301 -22.027 -10.816 0.02 29.72 ? 427 ARG A HD2  1  
ATOM   6674   H HD3  . ARG A 1 434 ? -21.277 -21.128 -11.686 0.02 29.35 ? 427 ARG A HD3  1  
ATOM   6675   H HE   . ARG A 1 434 ? -22.864 -22.086 -9.994  0.02 29.84 ? 427 ARG A HE   1  
ATOM   6676   H HH11 . ARG A 1 434 ? -20.448 -19.904 -9.918  0.02 29.63 ? 427 ARG A HH11 1  
ATOM   6677   H HH12 . ARG A 1 434 ? -20.880 -19.210 -8.687  0.02 29.82 ? 427 ARG A HH12 1  
ATOM   6678   H HH21 . ARG A 1 434 ? -23.384 -21.237 -7.902  0.02 30.23 ? 427 ARG A HH21 1  
ATOM   6679   H HH22 . ARG A 1 434 ? -22.669 -20.015 -7.451  0.02 30.18 ? 427 ARG A HH22 1  
ATOM   6680   N N    . LEU A 1 435 ? -24.531 -23.103 -15.401 0.02 28.96 ? 428 LEU A N    1  
ATOM   6681   C CA   . LEU A 1 435 ? -25.796 -22.852 -16.066 0.02 28.84 ? 428 LEU A CA   1  
ATOM   6682   C C    . LEU A 1 435 ? -26.376 -24.127 -16.643 0.02 29.03 ? 428 LEU A C    1  
ATOM   6683   O O    . LEU A 1 435 ? -27.570 -24.400 -16.519 0.02 29.17 ? 428 LEU A O    1  
ATOM   6684   C CB   . LEU A 1 435 ? -25.597 -21.812 -17.175 0.02 28.48 ? 428 LEU A CB   1  
ATOM   6685   C CG   . LEU A 1 435 ? -26.755 -21.659 -18.151 0.02 28.36 ? 428 LEU A CG   1  
ATOM   6686   C CD1  . LEU A 1 435 ? -28.024 -21.245 -17.405 0.02 28.47 ? 428 LEU A CD1  1  
ATOM   6687   C CD2  . LEU A 1 435 ? -26.381 -20.633 -19.221 0.02 28.05 ? 428 LEU A CD2  1  
ATOM   6688   H H    . LEU A 1 435 ? -23.851 -22.726 -15.763 0.02 28.83 ? 428 LEU A H    1  
ATOM   6689   H HA   . LEU A 1 435 ? -26.426 -22.500 -15.421 0.02 28.90 ? 428 LEU A HA   1  
ATOM   6690   H HB2  . LEU A 1 435 ? -25.447 -20.946 -16.763 0.02 28.39 ? 428 LEU A HB2  1  
ATOM   6691   H HB3  . LEU A 1 435 ? -24.816 -22.062 -17.688 0.02 28.44 ? 428 LEU A HB3  1  
ATOM   6692   H HG   . LEU A 1 435 ? -26.928 -22.502 -18.598 0.02 28.47 ? 428 LEU A HG   1  
ATOM   6693   H HD11 . LEU A 1 435 ? -28.766 -21.204 -18.025 0.02 28.42 ? 428 LEU A HD11 1  
ATOM   6694   H HD12 . LEU A 1 435 ? -28.213 -21.898 -16.718 0.02 28.69 ? 428 LEU A HD12 1  
ATOM   6695   H HD13 . LEU A 1 435 ? -27.878 -20.377 -17.004 0.02 28.37 ? 428 LEU A HD13 1  
ATOM   6696   H HD21 . LEU A 1 435 ? -26.513 -21.022 -20.092 0.02 28.03 ? 428 LEU A HD21 1  
ATOM   6697   H HD22 . LEU A 1 435 ? -26.946 -19.856 -19.123 0.02 27.96 ? 428 LEU A HD22 1  
ATOM   6698   H HD23 . LEU A 1 435 ? -25.452 -20.381 -19.113 0.02 27.99 ? 428 LEU A HD23 1  
ATOM   6699   N N    . LEU A 1 436 ? -25.551 -24.902 -17.328 0.02 29.06 ? 429 LEU A N    1  
ATOM   6700   C CA   . LEU A 1 436 ? -26.083 -26.095 -17.976 0.02 29.25 ? 429 LEU A CA   1  
ATOM   6701   C C    . LEU A 1 436 ? -26.698 -27.030 -16.944 0.02 29.66 ? 429 LEU A C    1  
ATOM   6702   O O    . LEU A 1 436 ? -27.779 -27.588 -17.154 0.02 29.84 ? 429 LEU A O    1  
ATOM   6703   C CB   . LEU A 1 436 ? -24.981 -26.804 -18.760 0.02 29.28 ? 429 LEU A CB   1  
ATOM   6704   C CG   . LEU A 1 436 ? -24.480 -26.076 -20.008 0.02 28.97 ? 429 LEU A CG   1  
ATOM   6705   C CD1  . LEU A 1 436 ? -23.129 -26.654 -20.499 0.02 29.00 ? 429 LEU A CD1  1  
ATOM   6706   C CD2  . LEU A 1 436 ? -25.555 -26.133 -21.067 0.02 28.99 ? 429 LEU A CD2  1  
ATOM   6707   H H    . LEU A 1 436 ? -24.709 -24.768 -17.417 0.02 29.00 ? 429 LEU A H    1  
ATOM   6708   H HA   . LEU A 1 436 ? -26.785 -25.837 -18.592 0.02 29.14 ? 429 LEU A HA   1  
ATOM   6709   H HB2  . LEU A 1 436 ? -24.220 -26.934 -18.176 0.02 29.34 ? 429 LEU A HB2  1  
ATOM   6710   H HB3  . LEU A 1 436 ? -25.323 -27.662 -19.046 0.02 29.49 ? 429 LEU A HB3  1  
ATOM   6711   H HG   . LEU A 1 436 ? -24.339 -25.143 -19.786 0.02 28.76 ? 429 LEU A HG   1  
ATOM   6712   H HD11 . LEU A 1 436 ? -22.428 -26.402 -19.880 0.02 28.99 ? 429 LEU A HD11 1  
ATOM   6713   H HD12 . LEU A 1 436 ? -23.192 -27.620 -20.549 0.02 29.23 ? 429 LEU A HD12 1  
ATOM   6714   H HD13 . LEU A 1 436 ? -22.928 -26.289 -21.373 0.02 28.84 ? 429 LEU A HD13 1  
ATOM   6715   H HD21 . LEU A 1 436 ? -25.295 -25.555 -21.800 0.02 28.87 ? 429 LEU A HD21 1  
ATOM   6716   H HD22 . LEU A 1 436 ? -25.653 -27.043 -21.385 0.02 29.24 ? 429 LEU A HD22 1  
ATOM   6717   H HD23 . LEU A 1 436 ? -26.390 -25.824 -20.689 0.02 28.90 ? 429 LEU A HD23 1  
ATOM   6718   N N    . GLN A 1 437 ? -26.016 -27.209 -15.823 0.02 29.84 ? 430 GLN A N    1  
ATOM   6719   C CA   . GLN A 1 437 ? -26.537 -28.120 -14.801 0.02 30.28 ? 430 GLN A CA   1  
ATOM   6720   C C    . GLN A 1 437 ? -27.810 -27.573 -14.160 0.02 30.34 ? 430 GLN A C    1  
ATOM   6721   O O    . GLN A 1 437 ? -28.782 -28.313 -13.980 0.02 30.66 ? 430 GLN A O    1  
ATOM   6722   C CB   . GLN A 1 437 ? -25.464 -28.403 -13.766 0.02 30.49 ? 430 GLN A CB   1  
ATOM   6723   C CG   . GLN A 1 437 ? -24.297 -29.218 -14.287 0.02 30.57 ? 430 GLN A CG   1  
ATOM   6724   C CD   . GLN A 1 437 ? -24.750 -30.480 -15.044 0.02 30.81 ? 430 GLN A CD   1  
ATOM   6725   O OE1  . GLN A 1 437 ? -25.764 -31.087 -14.706 0.02 31.13 ? 430 GLN A OE1  1  
ATOM   6726   N NE2  . GLN A 1 437 ? -24.027 -30.828 -16.107 0.02 30.69 ? 430 GLN A NE2  1  
ATOM   6727   H H    . GLN A 1 437 ? -25.268 -26.828 -15.634 0.02 29.75 ? 430 GLN A H    1  
ATOM   6728   H HA   . GLN A 1 437 ? -26.776 -28.951 -15.232 0.02 30.44 ? 430 GLN A HA   1  
ATOM   6729   H HB2  . GLN A 1 437 ? -25.113 -27.558 -13.449 0.02 30.33 ? 430 GLN A HB2  1  
ATOM   6730   H HB3  . GLN A 1 437 ? -25.863 -28.889 -13.028 0.02 30.79 ? 430 GLN A HB3  1  
ATOM   6731   H HG2  . GLN A 1 437 ? -23.768 -28.675 -14.887 0.02 30.31 ? 430 GLN A HG2  1  
ATOM   6732   H HG3  . GLN A 1 437 ? -23.749 -29.494 -13.538 0.02 30.78 ? 430 GLN A HG3  1  
ATOM   6733   H HE21 . GLN A 1 437 ? -24.419 -31.166 -16.791 0.02 30.66 ? 430 GLN A HE21 1  
ATOM   6734   H HE22 . GLN A 1 437 ? -23.177 -30.705 -16.113 0.02 30.64 ? 430 GLN A HE22 1  
ATOM   6735   N N    . LEU A 1 438 ? -27.860 -26.274 -13.846 0.02 30.09 ? 431 LEU A N    1  
ATOM   6736   C CA   . LEU A 1 438 ? -29.131 -25.719 -13.389 0.02 30.16 ? 431 LEU A CA   1  
ATOM   6737   C C    . LEU A 1 438 ? -30.200 -25.922 -14.434 0.02 30.12 ? 431 LEU A C    1  
ATOM   6738   O O    . LEU A 1 438 ? -31.333 -26.310 -14.128 0.02 30.41 ? 431 LEU A O    1  
ATOM   6739   C CB   . LEU A 1 438 ? -29.018 -24.235 -13.093 0.02 29.88 ? 431 LEU A CB   1  
ATOM   6740   C CG   . LEU A 1 438 ? -28.725 -23.684 -11.726 0.02 30.03 ? 431 LEU A CG   1  
ATOM   6741   C CD1  . LEU A 1 438 ? -28.859 -22.161 -11.884 0.02 29.70 ? 431 LEU A CD1  1  
ATOM   6742   C CD2  . LEU A 1 438 ? -29.663 -24.217 -10.621 0.02 30.49 ? 431 LEU A CD2  1  
ATOM   6743   H H    . LEU A 1 438 ? -27.206 -25.718 -13.889 0.02 29.90 ? 431 LEU A H    1  
ATOM   6744   H HA   . LEU A 1 438 ? -29.412 -26.185 -12.588 0.02 30.46 ? 431 LEU A HA   1  
ATOM   6745   H HB2  . LEU A 1 438 ? -28.334 -23.875 -13.681 0.02 29.64 ? 431 LEU A HB2  1  
ATOM   6746   H HB3  . LEU A 1 438 ? -29.874 -23.851 -13.338 0.02 29.81 ? 431 LEU A HB3  1  
ATOM   6747   H HG   . LEU A 1 438 ? -27.807 -23.898 -11.494 0.02 30.06 ? 431 LEU A HG   1  
ATOM   6748   H HD11 . LEU A 1 438 ? -28.302 -21.872 -12.621 0.02 29.45 ? 431 LEU A HD11 1  
ATOM   6749   H HD12 . LEU A 1 438 ? -29.785 -21.943 -12.068 0.02 29.76 ? 431 LEU A HD12 1  
ATOM   6750   H HD13 . LEU A 1 438 ? -28.569 -21.737 -11.062 0.02 29.74 ? 431 LEU A HD13 1  
ATOM   6751   H HD21 . LEU A 1 438 ? -29.974 -25.102 -10.857 0.02 30.66 ? 431 LEU A HD21 1  
ATOM   6752   H HD22 . LEU A 1 438 ? -29.175 -24.252 -9.785  0.02 30.65 ? 431 LEU A HD22 1  
ATOM   6753   H HD23 . LEU A 1 438 ? -30.422 -23.622 -10.536 0.02 30.46 ? 431 LEU A HD23 1  
ATOM   6754   N N    . ARG A 1 439 ? -29.853 -25.637 -15.685 0.02 29.79 ? 432 ARG A N    1  
ATOM   6755   C CA   . ARG A 1 439 ? -30.819 -25.703 -16.760 0.02 29.73 ? 432 ARG A CA   1  
ATOM   6756   C C    . ARG A 1 439 ? -31.398 -27.106 -16.873 0.02 30.14 ? 432 ARG A C    1  
ATOM   6757   O O    . ARG A 1 439 ? -32.608 -27.277 -17.024 0.02 30.33 ? 432 ARG A O    1  
ATOM   6758   C CB   . ARG A 1 439 ? -30.125 -25.261 -18.052 0.02 29.37 ? 432 ARG A CB   1  
ATOM   6759   C CG   . ARG A 1 439 ? -31.039 -24.837 -19.142 0.02 29.20 ? 432 ARG A CG   1  
ATOM   6760   C CD   . ARG A 1 439 ? -30.359 -24.894 -20.545 0.02 28.95 ? 432 ARG A CD   1  
ATOM   6761   N NE   . ARG A 1 439 ? -31.369 -25.044 -21.578 0.02 28.98 ? 432 ARG A NE   1  
ATOM   6762   C CZ   . ARG A 1 439 ? -31.780 -26.214 -22.048 0.02 29.28 ? 432 ARG A CZ   1  
ATOM   6763   N NH1  . ARG A 1 439 ? -31.236 -27.354 -21.626 0.02 29.56 ? 432 ARG A NH1  1  
ATOM   6764   N NH2  . ARG A 1 439 ? -32.732 -26.252 -22.947 0.02 29.33 ? 432 ARG A NH2  1  
ATOM   6765   H H    . ARG A 1 439 ? -29.064 -25.403 -15.932 0.02 29.61 ? 432 ARG A H    1  
ATOM   6766   H HA   . ARG A 1 439 ? -31.545 -25.088 -16.575 0.02 29.70 ? 432 ARG A HA   1  
ATOM   6767   H HB2  . ARG A 1 439 ? -29.551 -24.509 -17.845 0.02 29.18 ? 432 ARG A HB2  1  
ATOM   6768   H HB3  . ARG A 1 439 ? -29.590 -26.000 -18.380 0.02 29.46 ? 432 ARG A HB3  1  
ATOM   6769   H HG2  . ARG A 1 439 ? -31.815 -25.420 -19.152 0.02 29.42 ? 432 ARG A HG2  1  
ATOM   6770   H HG3  . ARG A 1 439 ? -31.314 -23.924 -18.973 0.02 29.07 ? 432 ARG A HG3  1  
ATOM   6771   H HD2  . ARG A 1 439 ? -29.879 -24.069 -20.706 0.02 28.71 ? 432 ARG A HD2  1  
ATOM   6772   H HD3  . ARG A 1 439 ? -29.748 -25.643 -20.595 0.02 29.04 ? 432 ARG A HD3  1  
ATOM   6773   H HE   . ARG A 1 439 ? -31.492 -24.365 -22.086 0.02 28.80 ? 432 ARG A HE   1  
ATOM   6774   H HH11 . ARG A 1 439 ? -30.621 -27.349 -21.030 0.02 29.56 ? 432 ARG A HH11 1  
ATOM   6775   H HH12 . ARG A 1 439 ? -31.508 -28.101 -21.947 0.02 29.77 ? 432 ARG A HH12 1  
ATOM   6776   H HH21 . ARG A 1 439 ? -33.087 -25.529 -23.242 0.02 29.16 ? 432 ARG A HH21 1  
ATOM   6777   H HH22 . ARG A 1 439 ? -32.966 -27.011 -23.259 0.02 29.54 ? 432 ARG A HH22 1  
ATOM   6778   N N    . PHE A 1 440 ? -30.548 -28.121 -16.750 0.02 30.32 ? 433 PHE A N    1  
ATOM   6779   C CA   . PHE A 1 440 ? -30.987 -29.505 -16.882 0.02 30.74 ? 433 PHE A CA   1  
ATOM   6780   C C    . PHE A 1 440 ? -32.082 -29.880 -15.893 0.02 31.16 ? 433 PHE A C    1  
ATOM   6781   O O    . PHE A 1 440 ? -32.795 -30.860 -16.104 0.02 31.52 ? 433 PHE A O    1  
ATOM   6782   C CB   . PHE A 1 440 ? -29.779 -30.413 -16.692 0.02 30.91 ? 433 PHE A CB   1  
ATOM   6783   C CG   . PHE A 1 440 ? -28.917 -30.551 -17.943 0.02 30.65 ? 433 PHE A CG   1  
ATOM   6784   C CD1  . PHE A 1 440 ? -29.481 -30.563 -19.216 0.02 30.54 ? 433 PHE A CD1  1  
ATOM   6785   C CD2  . PHE A 1 440 ? -27.542 -30.639 -17.823 0.02 30.56 ? 433 PHE A CD2  1  
ATOM   6786   C CE1  . PHE A 1 440 ? -28.676 -30.674 -20.355 0.02 30.35 ? 433 PHE A CE1  1  
ATOM   6787   C CE2  . PHE A 1 440 ? -26.736 -30.733 -18.940 0.02 30.37 ? 433 PHE A CE2  1  
ATOM   6788   C CZ   . PHE A 1 440 ? -27.312 -30.758 -20.217 0.02 30.26 ? 433 PHE A CZ   1  
ATOM   6789   H H    . PHE A 1 440 ? -29.709 -28.034 -16.592 0.02 30.23 ? 433 PHE A H    1  
ATOM   6790   H HA   . PHE A 1 440 ? -31.358 -29.630 -17.769 0.02 30.68 ? 433 PHE A HA   1  
ATOM   6791   H HB2  . PHE A 1 440 ? -29.211 -30.002 -16.025 0.02 30.88 ? 433 PHE A HB2  1  
ATOM   6792   H HB3  . PHE A 1 440 ? -30.077 -31.265 -16.361 0.02 31.26 ? 433 PHE A HB3  1  
ATOM   6793   H HD1  . PHE A 1 440 ? -30.402 -30.504 -19.315 0.02 30.63 ? 433 PHE A HD1  1  
ATOM   6794   H HD2  . PHE A 1 440 ? -27.154 -30.619 -16.982 0.02 30.65 ? 433 PHE A HD2  1  
ATOM   6795   H HE1  . PHE A 1 440 ? -29.061 -30.685 -21.200 0.02 30.30 ? 433 PHE A HE1  1  
ATOM   6796   H HE2  . PHE A 1 440 ? -25.812 -30.797 -18.841 0.02 30.34 ? 433 PHE A HE2  1  
ATOM   6797   H HZ   . PHE A 1 440 ? -26.772 -30.831 -20.968 0.02 30.16 ? 433 PHE A HZ   1  
ATOM   6798   N N    . ASN A 1 441 ? -32.222 -29.157 -14.796 0.02 31.19 ? 434 ASN A N    1  
ATOM   6799   C CA   . ASN A 1 441 ? -33.325 -29.449 -13.889 0.02 31.62 ? 434 ASN A CA   1  
ATOM   6800   C C    . ASN A 1 441 ? -34.238 -28.265 -13.692 0.02 31.49 ? 434 ASN A C    1  
ATOM   6801   O O    . ASN A 1 441 ? -34.726 -28.053 -12.575 0.02 31.76 ? 434 ASN A O    1  
ATOM   6802   C CB   . ASN A 1 441 ? -32.820 -29.945 -12.543 0.02 31.95 ? 434 ASN A CB   1  
ATOM   6803   C CG   . ASN A 1 441 ? -31.663 -29.150 -12.023 0.02 31.63 ? 434 ASN A CG   1  
ATOM   6804   O OD1  . ASN A 1 441 ? -30.643 -29.720 -11.630 0.02 31.68 ? 434 ASN A OD1  1  
ATOM   6805   N ND2  . ASN A 1 441 ? -31.806 -27.826 -12.002 0.02 31.34 ? 434 ASN A ND2  1  
ATOM   6806   H H    . ASN A 1 441 ? -31.707 -28.513 -14.560 0.02 30.99 ? 434 ASN A H    1  
ATOM   6807   H HA   . ASN A 1 441 ? -33.868 -30.154 -14.268 0.02 31.87 ? 434 ASN A HA   1  
ATOM   6808   H HB2  . ASN A 1 441 ? -33.538 -29.891 -11.896 0.02 32.21 ? 434 ASN A HB2  1  
ATOM   6809   H HB3  . ASN A 1 441 ? -32.529 -30.867 -12.634 0.02 32.16 ? 434 ASN A HB3  1  
ATOM   6810   H HD21 . ASN A 1 441 ? -31.122 -27.315 -11.890 0.02 31.13 ? 434 ASN A HD21 1  
ATOM   6811   H HD22 . ASN A 1 441 ? -32.583 -27.480 -12.102 0.02 31.40 ? 434 ASN A HD22 1  
ATOM   6812   N N    . HIS A 1 442 ? -34.434 -27.477 -14.736 0.02 31.10 ? 435 HIS A N    1  
ATOM   6813   C CA   . HIS A 1 442 ? -35.517 -26.515 -14.819 0.02 31.05 ? 435 HIS A CA   1  
ATOM   6814   C C    . HIS A 1 442 ? -35.892 -26.375 -16.267 0.02 30.85 ? 435 HIS A C    1  
ATOM   6815   O O    . HIS A 1 442 ? -35.608 -25.364 -16.929 0.02 30.45 ? 435 HIS A O    1  
ATOM   6816   C CB   . HIS A 1 442 ? -35.140 -25.201 -14.152 0.02 30.76 ? 435 HIS A CB   1  
ATOM   6817   C CG   . HIS A 1 442 ? -35.006 -25.359 -12.679 0.02 31.06 ? 435 HIS A CG   1  
ATOM   6818   N ND1  . HIS A 1 442 ? -33.803 -25.607 -12.054 0.02 31.02 ? 435 HIS A ND1  1  
ATOM   6819   C CD2  . HIS A 1 442 ? -35.951 -25.451 -11.720 0.02 31.48 ? 435 HIS A CD2  1  
ATOM   6820   C CE1  . HIS A 1 442 ? -34.005 -25.754 -10.760 0.02 31.38 ? 435 HIS A CE1  1  
ATOM   6821   N NE2  . HIS A 1 442 ? -35.302 -25.683 -10.538 0.02 31.66 ? 435 HIS A NE2  1  
ATOM   6822   H H    . HIS A 1 442 ? -33.937 -27.484 -15.437 0.02 30.89 ? 435 HIS A H    1  
ATOM   6823   H HA   . HIS A 1 442 ? -36.282 -26.877 -14.347 0.02 31.40 ? 435 HIS A HA   1  
ATOM   6824   H HB2  . HIS A 1 442 ? -34.289 -24.891 -14.497 0.02 30.46 ? 435 HIS A HB2  1  
ATOM   6825   H HB3  . HIS A 1 442 ? -35.830 -24.550 -14.333 0.02 30.70 ? 435 HIS A HB3  1  
ATOM   6826   H HD2  . HIS A 1 442 ? -36.866 -25.348 -11.838 0.02 31.64 ? 435 HIS A HD2  1  
ATOM   6827   H HE1  . HIS A 1 442 ? -33.351 -25.908 -10.118 0.02 31.44 ? 435 HIS A HE1  1  
ATOM   6828   H HE2  . HIS A 1 442 ? -35.680 -25.752 -9.769  0.02 31.95 ? 435 HIS A HE2  1  
ATOM   6829   N N    . THR A 1 443 ? -36.531 -27.413 -16.768 0.02 31.17 ? 436 THR A N    1  
ATOM   6830   C CA   . THR A 1 443 ? -36.328 -27.893 -18.117 0.02 31.03 ? 436 THR A CA   1  
ATOM   6831   C C    . THR A 1 443 ? -37.548 -28.700 -18.529 0.02 31.44 ? 436 THR A C    1  
ATOM   6832   O O    . THR A 1 443 ? -38.671 -28.437 -18.061 0.02 31.67 ? 436 THR A O    1  
ATOM   6833   C CB   . THR A 1 443 ? -34.989 -28.698 -18.212 0.02 31.06 ? 436 THR A CB   1  
ATOM   6834   O OG1  . THR A 1 443 ? -34.535 -28.741 -19.583 0.02 30.86 ? 436 THR A OG1  1  
ATOM   6835   C CG2  . THR A 1 443 ? -35.024 -30.151 -17.498 0.02 31.65 ? 436 THR A CG2  1  
ATOM   6836   H H    . THR A 1 443 ? -37.116 -27.860 -16.324 0.02 31.51 ? 436 THR A H    1  
ATOM   6837   H HA   . THR A 1 443 ? -36.255 -27.141 -18.725 0.02 30.70 ? 436 THR A HA   1  
ATOM   6838   H HB   . THR A 1 443 ? -34.345 -28.192 -17.713 0.02 30.88 ? 436 THR A HB   1  
ATOM   6839   H HG1  . THR A 1 443 ? -34.414 -27.959 -19.867 0.02 30.55 ? 436 THR A HG1  1  
ATOM   6840   H HG21 . THR A 1 443 ? -35.785 -30.677 -17.775 0.02 31.88 ? 436 THR A HG21 1  
ATOM   6841   H HG22 . THR A 1 443 ? -34.222 -30.638 -17.732 0.02 31.79 ? 436 THR A HG22 1  
ATOM   6842   H HG23 . THR A 1 443 ? -35.062 -30.055 -16.532 0.02 31.70 ? 436 THR A HG23 1  
ATOM   6843   N N    . SER A 1 444 ? -37.279 -29.710 -19.381 0.02 31.60 ? 437 SER A N    1  
ATOM   6844   C CA   . SER A 1 444 ? -38.149 -30.300 -20.386 0.02 31.83 ? 437 SER A CA   1  
ATOM   6845   C C    . SER A 1 444 ? -37.399 -30.453 -21.716 0.02 31.58 ? 437 SER A C    1  
ATOM   6846   O O    . SER A 1 444 ? -36.382 -29.786 -21.900 0.02 31.12 ? 437 SER A O    1  
ATOM   6847   C CB   . SER A 1 444 ? -39.363 -29.421 -20.581 0.02 31.76 ? 437 SER A CB   1  
ATOM   6848   O OG   . SER A 1 444 ? -38.872 -28.164 -21.000 0.02 31.26 ? 437 SER A OG   1  
ATOM   6849   H H    . SER A 1 444 ? -36.518 -30.098 -19.408 0.02 31.60 ? 437 SER A H    1  
ATOM   6850   H HA   . SER A 1 444 ? -38.439 -31.178 -20.089 0.02 32.23 ? 437 SER A HA   1  
ATOM   6851   H HB2  . SER A 1 444 ? -39.922 -29.801 -21.278 0.02 31.78 ? 437 SER A HB2  1  
ATOM   6852   H HB3  . SER A 1 444 ? -39.864 -29.335 -19.756 0.02 32.07 ? 437 SER A HB3  1  
ATOM   6853   H HG   . SER A 1 444 ? -39.282 -27.555 -20.593 0.02 31.25 ? 437 SER A HG   1  
ATOM   6854   N N    . GLY A 1 445 ? -37.805 -31.301 -22.648 0.02 31.90 ? 438 GLY A N    1  
ATOM   6855   C CA   . GLY A 1 445 ? -36.951 -31.534 -23.797 0.02 31.71 ? 438 GLY A CA   1  
ATOM   6856   C C    . GLY A 1 445 ? -36.499 -30.295 -24.585 0.02 31.16 ? 438 GLY A C    1  
ATOM   6857   O O    . GLY A 1 445 ? -37.317 -29.716 -25.308 0.02 31.14 ? 438 GLY A O    1  
ATOM   6858   H H    . GLY A 1 445 ? -38.547 -31.735 -22.644 0.02 32.24 ? 438 GLY A H    1  
ATOM   6859   H HA2  . GLY A 1 445 ? -36.146 -31.972 -23.483 0.02 31.70 ? 438 GLY A HA2  1  
ATOM   6860   H HA3  . GLY A 1 445 ? -37.406 -32.139 -24.402 0.02 31.99 ? 438 GLY A HA3  1  
ATOM   6861   N N    . THR A 1 446 ? -35.235 -29.881 -24.484 0.02 30.77 ? 439 THR A N    1  
ATOM   6862   C CA   . THR A 1 446 ? -34.755 -28.786 -25.299 0.02 30.30 ? 439 THR A CA   1  
ATOM   6863   C C    . THR A 1 446 ? -33.254 -28.932 -25.562 0.02 30.03 ? 439 THR A C    1  
ATOM   6864   O O    . THR A 1 446 ? -32.452 -28.815 -24.632 0.02 29.93 ? 439 THR A O    1  
ATOM   6865   C CB   . THR A 1 446 ? -35.071 -27.458 -24.603 0.02 30.06 ? 439 THR A CB   1  
ATOM   6866   O OG1  . THR A 1 446 ? -36.490 -27.354 -24.388 0.02 30.32 ? 439 THR A OG1  1  
ATOM   6867   C CG2  . THR A 1 446 ? -34.565 -26.270 -25.417 0.02 29.59 ? 439 THR A CG2  1  
ATOM   6868   H H    . THR A 1 446 ? -34.649 -30.211 -23.952 0.02 30.78 ? 439 THR A H    1  
ATOM   6869   H HA   . THR A 1 446 ? -35.234 -28.794 -26.138 0.02 30.35 ? 439 THR A HA   1  
ATOM   6870   H HB   . THR A 1 446 ? -34.653 -27.454 -23.738 0.02 30.08 ? 439 THR A HB   1  
ATOM   6871   H HG1  . THR A 1 446 ? -36.686 -27.658 -23.627 0.02 30.34 ? 439 THR A HG1  1  
ATOM   6872   H HG21 . THR A 1 446 ? -33.598 -26.195 -25.355 0.02 29.42 ? 439 THR A HG21 1  
ATOM   6873   H HG22 . THR A 1 446 ? -34.811 -26.382 -26.350 0.02 29.57 ? 439 THR A HG22 1  
ATOM   6874   H HG23 . THR A 1 446 ? -34.962 -25.451 -25.081 0.02 29.50 ? 439 THR A HG23 1  
ATOM   6875   N N    . PRO A 1 447 ? -32.839 -29.174 -26.816 0.02 29.96 ? 440 PRO A N    1  
ATOM   6876   C CA   . PRO A 1 447 ? -31.405 -29.325 -27.120 0.02 29.81 ? 440 PRO A CA   1  
ATOM   6877   C C    . PRO A 1 447 ? -30.571 -28.082 -26.821 0.02 29.37 ? 440 PRO A C    1  
ATOM   6878   O O    . PRO A 1 447 ? -30.896 -26.968 -27.238 0.02 29.11 ? 440 PRO A O    1  
ATOM   6879   C CB   . PRO A 1 447 ? -31.386 -29.637 -28.637 0.02 29.89 ? 440 PRO A CB   1  
ATOM   6880   C CG   . PRO A 1 447 ? -32.667 -29.153 -29.172 0.02 29.88 ? 440 PRO A CG   1  
ATOM   6881   C CD   . PRO A 1 447 ? -33.671 -29.323 -28.024 0.02 30.01 ? 440 PRO A CD   1  
ATOM   6882   H HA   . PRO A 1 447 ? -31.045 -30.084 -26.641 0.02 30.00 ? 440 PRO A HA   1  
ATOM   6883   H HB2  . PRO A 1 447 ? -30.645 -29.180 -29.063 0.02 29.68 ? 440 PRO A HB2  1  
ATOM   6884   H HB3  . PRO A 1 447 ? -31.312 -30.593 -28.779 0.02 30.17 ? 440 PRO A HB3  1  
ATOM   6885   H HG2  . PRO A 1 447 ? -32.585 -28.220 -29.421 0.02 29.62 ? 440 PRO A HG2  1  
ATOM   6886   H HG3  . PRO A 1 447 ? -32.928 -29.688 -29.937 0.02 30.11 ? 440 PRO A HG3  1  
ATOM   6887   H HD2  . PRO A 1 447 ? -34.340 -28.620 -28.067 0.02 29.83 ? 440 PRO A HD2  1  
ATOM   6888   H HD3  . PRO A 1 447 ? -34.077 -30.204 -28.052 0.02 30.32 ? 440 PRO A HD3  1  
ATOM   6889   N N    . VAL A 1 448 ? -29.451 -28.299 -26.134 0.02 29.33 ? 441 VAL A N    1  
ATOM   6890   C CA   . VAL A 1 448 ? -28.327 -27.364 -26.104 0.02 28.99 ? 441 VAL A CA   1  
ATOM   6891   C C    . VAL A 1 448 ? -27.110 -27.994 -26.786 0.02 29.05 ? 441 VAL A C    1  
ATOM   6892   O O    . VAL A 1 448 ? -26.703 -29.114 -26.437 0.02 29.34 ? 441 VAL A O    1  
ATOM   6893   C CB   . VAL A 1 448 ? -27.961 -26.952 -24.667 0.02 28.93 ? 441 VAL A CB   1  
ATOM   6894   C CG1  . VAL A 1 448 ? -27.023 -25.768 -24.702 0.02 28.58 ? 441 VAL A CG1  1  
ATOM   6895   C CG2  . VAL A 1 448 ? -29.196 -26.609 -23.885 0.02 29.01 ? 441 VAL A CG2  1  
ATOM   6896   H H    . VAL A 1 448 ? -29.316 -28.995 -25.651 0.02 29.53 ? 441 VAL A H    1  
ATOM   6897   H HA   . VAL A 1 448 ? -28.574 -26.570 -26.597 0.02 28.80 ? 441 VAL A HA   1  
ATOM   6898   H HB   . VAL A 1 448 ? -27.515 -27.690 -24.216 0.02 29.10 ? 441 VAL A HB   1  
ATOM   6899   H HG11 . VAL A 1 448 ? -26.276 -25.962 -25.288 0.02 28.59 ? 441 VAL A HG11 1  
ATOM   6900   H HG12 . VAL A 1 448 ? -27.514 -25.000 -25.029 0.02 28.43 ? 441 VAL A HG12 1  
ATOM   6901   H HG13 . VAL A 1 448 ? -26.701 -25.597 -23.803 0.02 28.53 ? 441 VAL A HG13 1  
ATOM   6902   H HG21 . VAL A 1 448 ? -28.934 -26.116 -23.094 0.02 28.96 ? 441 VAL A HG21 1  
ATOM   6903   H HG22 . VAL A 1 448 ? -29.784 -26.069 -24.436 0.02 28.87 ? 441 VAL A HG22 1  
ATOM   6904   H HG23 . VAL A 1 448 ? -29.639 -27.435 -23.633 0.02 29.27 ? 441 VAL A HG23 1  
ATOM   6905   N N    . TYR A 1 449 ? -26.530 -27.261 -27.743 0.02 28.82 ? 442 TYR A N    1  
ATOM   6906   C CA   . TYR A 1 449 ? -25.329 -27.641 -28.476 0.02 28.87 ? 442 TYR A CA   1  
ATOM   6907   C C    . TYR A 1 449 ? -24.138 -26.799 -28.036 0.02 28.65 ? 442 TYR A C    1  
ATOM   6908   O O    . TYR A 1 449 ? -24.278 -25.595 -27.819 0.02 28.38 ? 442 TYR A O    1  
ATOM   6909   C CB   . TYR A 1 449 ? -25.554 -27.445 -29.983 0.02 28.84 ? 442 TYR A CB   1  
ATOM   6910   C CG   . TYR A 1 449 ? -26.646 -28.313 -30.537 0.02 29.10 ? 442 TYR A CG   1  
ATOM   6911   C CD1  . TYR A 1 449 ? -27.952 -27.873 -30.600 0.02 29.06 ? 442 TYR A CD1  1  
ATOM   6912   C CD2  . TYR A 1 449 ? -26.361 -29.593 -31.014 0.02 29.44 ? 442 TYR A CD2  1  
ATOM   6913   C CE1  . TYR A 1 449 ? -28.953 -28.666 -31.111 0.02 29.35 ? 442 TYR A CE1  1  
ATOM   6914   C CE2  . TYR A 1 449 ? -27.355 -30.393 -31.521 0.02 29.73 ? 442 TYR A CE2  1  
ATOM   6915   C CZ   . TYR A 1 449 ? -28.648 -29.934 -31.561 0.02 29.69 ? 442 TYR A CZ   1  
ATOM   6916   O OH   . TYR A 1 449 ? -29.622 -30.765 -32.074 0.02 30.02 ? 442 TYR A OH   1  
ATOM   6917   H H    . TYR A 1 449 ? -26.847 -26.511 -28.007 0.02 28.65 ? 442 TYR A H    1  
ATOM   6918   H HA   . TYR A 1 449 ? -25.122 -28.571 -28.309 0.02 29.10 ? 442 TYR A HA   1  
ATOM   6919   H HB2  . TYR A 1 449 ? -25.809 -26.525 -30.144 0.02 28.62 ? 442 TYR A HB2  1  
ATOM   6920   H HB3  . TYR A 1 449 ? -24.732 -27.645 -30.454 0.02 28.88 ? 442 TYR A HB3  1  
ATOM   6921   H HD1  . TYR A 1 449 ? -28.160 -27.021 -30.291 0.02 28.86 ? 442 TYR A HD1  1  
ATOM   6922   H HD2  . TYR A 1 449 ? -25.489 -29.911 -30.981 0.02 29.50 ? 442 TYR A HD2  1  
ATOM   6923   H HE1  . TYR A 1 449 ? -29.829 -28.358 -31.139 0.02 29.34 ? 442 TYR A HE1  1  
ATOM   6924   H HE2  . TYR A 1 449 ? -27.155 -31.246 -31.830 0.02 29.98 ? 442 TYR A HE2  1  
ATOM   6925   H HH   . TYR A 1 449 ? -29.330 -31.165 -32.754 0.02 30.14 ? 442 TYR A HH   1  
ATOM   6926   N N    . LEU A 1 450 ? -22.964 -27.425 -27.925 0.02 28.81 ? 443 LEU A N    1  
ATOM   6927   C CA   . LEU A 1 450 ? -21.746 -26.725 -27.539 0.02 28.68 ? 443 LEU A CA   1  
ATOM   6928   C C    . LEU A 1 450 ? -20.735 -26.672 -28.675 0.02 28.71 ? 443 LEU A C    1  
ATOM   6929   O O    . LEU A 1 450 ? -20.476 -27.685 -29.337 0.02 28.97 ? 443 LEU A O    1  
ATOM   6930   C CB   . LEU A 1 450 ? -21.058 -27.383 -26.321 0.02 28.89 ? 443 LEU A CB   1  
ATOM   6931   C CG   . LEU A 1 450 ? -21.857 -27.430 -25.022 0.02 28.92 ? 443 LEU A CG   1  
ATOM   6932   C CD1  . LEU A 1 450 ? -21.009 -27.997 -23.898 0.02 29.15 ? 443 LEU A CD1  1  
ATOM   6933   C CD2  . LEU A 1 450 ? -22.341 -26.036 -24.602 0.02 28.60 ? 443 LEU A CD2  1  
ATOM   6934   H H    . LEU A 1 450 ? -22.854 -28.260 -28.064 0.02 29.02 ? 443 LEU A H    1  
ATOM   6935   H HA   . LEU A 1 450 ? -21.971 -25.820 -27.299 0.02 28.47 ? 443 LEU A HA   1  
ATOM   6936   H HB2  . LEU A 1 450 ? -20.829 -28.291 -26.558 0.02 29.12 ? 443 LEU A HB2  1  
ATOM   6937   H HB3  . LEU A 1 450 ? -20.243 -26.894 -26.129 0.02 28.83 ? 443 LEU A HB3  1  
ATOM   6938   H HG   . LEU A 1 450 ? -22.631 -28.000 -25.153 0.02 29.03 ? 443 LEU A HG   1  
ATOM   6939   H HD11 . LEU A 1 450 ? -20.291 -28.524 -24.281 0.02 29.31 ? 443 LEU A HD11 1  
ATOM   6940   H HD12 . LEU A 1 450 ? -20.639 -27.265 -23.383 0.02 29.03 ? 443 LEU A HD12 1  
ATOM   6941   H HD13 . LEU A 1 450 ? -21.567 -28.557 -23.335 0.02 29.30 ? 443 LEU A HD13 1  
ATOM   6942   H HD21 . LEU A 1 450 ? -22.790 -26.103 -23.746 0.02 28.65 ? 443 LEU A HD21 1  
ATOM   6943   H HD22 . LEU A 1 450 ? -21.577 -25.443 -24.524 0.02 28.51 ? 443 LEU A HD22 1  
ATOM   6944   H HD23 . LEU A 1 450 ? -22.956 -25.699 -25.272 0.02 28.47 ? 443 LEU A HD23 1  
ATOM   6945   N N    . TYR A 1 451 ? -20.120 -25.500 -28.848 0.02 28.50 ? 444 TYR A N    1  
ATOM   6946   C CA   . TYR A 1 451 ? -18.975 -25.322 -29.722 0.02 28.56 ? 444 TYR A CA   1  
ATOM   6947   C C    . TYR A 1 451 ? -17.786 -24.783 -28.938 0.02 28.56 ? 444 TYR A C    1  
ATOM   6948   O O    . TYR A 1 451 ? -17.919 -24.197 -27.850 0.02 28.43 ? 444 TYR A O    1  
ATOM   6949   C CB   . TYR A 1 451 ? -19.289 -24.358 -30.902 0.02 28.38 ? 444 TYR A CB   1  
ATOM   6950   C CG   . TYR A 1 451 ? -19.415 -22.900 -30.469 0.02 28.09 ? 444 TYR A CG   1  
ATOM   6951   C CD1  . TYR A 1 451 ? -18.306 -22.095 -30.331 0.02 28.06 ? 444 TYR A CD1  1  
ATOM   6952   C CD2  . TYR A 1 451 ? -20.641 -22.367 -30.174 0.02 27.90 ? 444 TYR A CD2  1  
ATOM   6953   C CE1  . TYR A 1 451 ? -18.417 -20.778 -29.912 0.02 27.85 ? 444 TYR A CE1  1  
ATOM   6954   C CE2  . TYR A 1 451 ? -20.771 -21.057 -29.740 0.02 27.68 ? 444 TYR A CE2  1  
ATOM   6955   C CZ   . TYR A 1 451 ? -19.664 -20.270 -29.610 0.02 27.65 ? 444 TYR A CZ   1  
ATOM   6956   O OH   . TYR A 1 451 ? -19.833 -18.958 -29.193 0.02 27.47 ? 444 TYR A OH   1  
ATOM   6957   H H    . TYR A 1 451 ? -20.360 -24.777 -28.462 0.02 28.33 ? 444 TYR A H    1  
ATOM   6958   H HA   . TYR A 1 451 ? -18.725 -26.182 -30.087 0.02 28.77 ? 444 TYR A HA   1  
ATOM   6959   H HB2  . TYR A 1 451 ? -18.574 -24.420 -31.551 0.02 28.48 ? 444 TYR A HB2  1  
ATOM   6960   H HB3  . TYR A 1 451 ? -20.133 -24.616 -31.305 0.02 28.37 ? 444 TYR A HB3  1  
ATOM   6961   H HD1  . TYR A 1 451 ? -17.467 -22.443 -30.518 0.02 28.22 ? 444 TYR A HD1  1  
ATOM   6962   H HD2  . TYR A 1 451 ? -21.398 -22.898 -30.249 0.02 27.94 ? 444 TYR A HD2  1  
ATOM   6963   H HE1  . TYR A 1 451 ? -17.659 -20.250 -29.825 0.02 27.86 ? 444 TYR A HE1  1  
ATOM   6964   H HE2  . TYR A 1 451 ? -21.611 -20.712 -29.551 0.02 27.57 ? 444 TYR A HE2  1  
ATOM   6965   H HH   . TYR A 1 451 ? -19.100 -18.641 -28.936 0.02 27.50 ? 444 TYR A HH   1  
ATOM   6966   N N    . ARG A 1 452 ? -16.612 -24.962 -29.522 0.02 28.75 ? 445 ARG A N    1  
ATOM   6967   C CA   . ARG A 1 452 ? -15.356 -24.457 -28.983 0.02 28.82 ? 445 ARG A CA   1  
ATOM   6968   C C    . ARG A 1 452 ? -14.585 -23.823 -30.132 0.02 28.85 ? 445 ARG A C    1  
ATOM   6969   O O    . ARG A 1 452 ? -14.150 -24.528 -31.059 0.02 29.09 ? 445 ARG A O    1  
ATOM   6970   C CB   . ARG A 1 452 ? -14.570 -25.593 -28.316 0.02 29.15 ? 445 ARG A CB   1  
ATOM   6971   C CG   . ARG A 1 452 ? -13.319 -25.199 -27.597 0.02 29.29 ? 445 ARG A CG   1  
ATOM   6972   C CD   . ARG A 1 452 ? -12.733 -26.415 -26.833 0.02 29.65 ? 445 ARG A CD   1  
ATOM   6973   N NE   . ARG A 1 452 ? -11.555 -26.092 -26.053 0.02 29.83 ? 445 ARG A NE   1  
ATOM   6974   C CZ   . ARG A 1 452 ? -10.300 -26.128 -26.486 0.02 30.10 ? 445 ARG A CZ   1  
ATOM   6975   N NH1  . ARG A 1 452 ? -10.006 -26.494 -27.737 0.02 30.24 ? 445 ARG A NH1  1  
ATOM   6976   N NH2  . ARG A 1 452 ? -9.324  -25.802 -25.658 0.02 30.29 ? 445 ARG A NH2  1  
ATOM   6977   H H    . ARG A 1 452 ? -16.511 -25.386 -30.255 0.02 28.86 ? 445 ARG A H    1  
ATOM   6978   H HA   . ARG A 1 452 ? -15.535 -23.776 -28.319 0.02 28.66 ? 445 ARG A HA   1  
ATOM   6979   H HB2  . ARG A 1 452 ? -15.152 -26.007 -27.664 0.02 29.14 ? 445 ARG A HB2  1  
ATOM   6980   H HB3  . ARG A 1 452 ? -14.330 -26.246 -28.987 0.02 29.33 ? 445 ARG A HB3  1  
ATOM   6981   H HG2  . ARG A 1 452 ? -12.661 -24.900 -28.242 0.02 29.36 ? 445 ARG A HG2  1  
ATOM   6982   H HG3  . ARG A 1 452 ? -13.513 -24.491 -26.967 0.02 29.13 ? 445 ARG A HG3  1  
ATOM   6983   H HD2  . ARG A 1 452 ? -13.406 -26.738 -26.219 0.02 29.60 ? 445 ARG A HD2  1  
ATOM   6984   H HD3  . ARG A 1 452 ? -12.499 -27.113 -27.461 0.02 29.84 ? 445 ARG A HD3  1  
ATOM   6985   H HE   . ARG A 1 452 ? -11.685 -25.827 -25.250 0.02 29.76 ? 445 ARG A HE   1  
ATOM   6986   H HH11 . ARG A 1 452 ? -10.634 -26.708 -28.279 0.02 30.14 ? 445 ARG A HH11 1  
ATOM   6987   H HH12 . ARG A 1 452 ? -9.188  -26.514 -27.998 0.02 30.44 ? 445 ARG A HH12 1  
ATOM   6988   H HH21 . ARG A 1 452 ? -9.505  -25.567 -24.857 0.02 30.22 ? 445 ARG A HH21 1  
ATOM   6989   H HH22 . ARG A 1 452 ? -8.508  -25.821 -25.920 0.02 30.49 ? 445 ARG A HH22 1  
ATOM   6990   N N    . PHE A 1 453 ? -14.462 -22.492 -30.103 0.02 28.65 ? 446 PHE A N    1  
ATOM   6991   C CA   . PHE A 1 453 ? -13.839 -21.758 -31.203 0.02 28.70 ? 446 PHE A CA   1  
ATOM   6992   C C    . PHE A 1 453 ? -12.332 -21.760 -31.009 0.02 28.98 ? 446 PHE A C    1  
ATOM   6993   O O    . PHE A 1 453 ? -11.811 -21.180 -30.054 0.02 28.98 ? 446 PHE A O    1  
ATOM   6994   C CB   . PHE A 1 453 ? -14.357 -20.332 -31.340 0.02 28.42 ? 446 PHE A CB   1  
ATOM   6995   C CG   . PHE A 1 453 ? -13.847 -19.657 -32.570 0.02 28.50 ? 446 PHE A CG   1  
ATOM   6996   C CD1  . PHE A 1 453 ? -14.443 -19.900 -33.787 0.02 28.50 ? 446 PHE A CD1  1  
ATOM   6997   C CD2  . PHE A 1 453 ? -12.740 -18.851 -32.518 0.02 28.63 ? 446 PHE A CD2  1  
ATOM   6998   C CE1  . PHE A 1 453 ? -13.946 -19.312 -34.935 0.02 28.63 ? 446 PHE A CE1  1  
ATOM   6999   C CE2  . PHE A 1 453 ? -12.239 -18.264 -33.659 0.02 28.77 ? 446 PHE A CE2  1  
ATOM   7000   C CZ   . PHE A 1 453 ? -12.853 -18.501 -34.868 0.02 28.76 ? 446 PHE A CZ   1  
ATOM   7001   H H    . PHE A 1 453 ? -14.737 -21.994 -29.465 0.02 28.51 ? 446 PHE A H    1  
ATOM   7002   H HA   . PHE A 1 453 ? -14.028 -22.211 -32.036 0.02 28.77 ? 446 PHE A HA   1  
ATOM   7003   H HB2  . PHE A 1 453 ? -15.323 -20.349 -31.387 0.02 28.26 ? 446 PHE A HB2  1  
ATOM   7004   H HB3  . PHE A 1 453 ? -14.069 -19.812 -30.576 0.02 28.38 ? 446 PHE A HB3  1  
ATOM   7005   H HD1  . PHE A 1 453 ? -15.186 -20.455 -33.839 0.02 28.45 ? 446 PHE A HD1  1  
ATOM   7006   H HD2  . PHE A 1 453 ? -12.325 -18.699 -31.705 0.02 28.66 ? 446 PHE A HD2  1  
ATOM   7007   H HE1  . PHE A 1 453 ? -14.362 -19.470 -35.751 0.02 28.65 ? 446 PHE A HE1  1  
ATOM   7008   H HE2  . PHE A 1 453 ? -11.496 -17.707 -33.611 0.02 28.89 ? 446 PHE A HE2  1  
ATOM   7009   H HZ   . PHE A 1 453 ? -12.525 -18.103 -35.637 0.02 28.87 ? 446 PHE A HZ   1  
ATOM   7010   N N    . ASP A 1 454 ? -11.642 -22.420 -31.940 0.02 29.28 ? 447 ASP A N    1  
ATOM   7011   C CA   . ASP A 1 454 ? -10.243 -22.788 -31.817 0.02 29.65 ? 447 ASP A CA   1  
ATOM   7012   C C    . ASP A 1 454 ? -9.479  -22.474 -33.113 0.02 29.88 ? 447 ASP A C    1  
ATOM   7013   O O    . ASP A 1 454 ? -8.527  -23.172 -33.464 0.02 30.26 ? 447 ASP A O    1  
ATOM   7014   C CB   . ASP A 1 454 ? -10.169 -24.275 -31.450 0.02 29.89 ? 447 ASP A CB   1  
ATOM   7015   C CG   . ASP A 1 454 ? -8.780  -24.746 -31.105 0.02 30.30 ? 447 ASP A CG   1  
ATOM   7016   O OD1  . ASP A 1 454 ? -7.979  -23.963 -30.542 0.02 30.35 ? 447 ASP A OD1  1  
ATOM   7017   O OD2  . ASP A 1 454 ? -8.518  -25.951 -31.381 0.02 30.61 ? 447 ASP A OD2  1  
ATOM   7018   H H    . ASP A 1 454 ? -11.993 -22.681 -32.675 0.02 29.28 ? 447 ASP A H    1  
ATOM   7019   H HA   . ASP A 1 454 ? -9.838  -22.274 -31.102 0.02 29.63 ? 447 ASP A HA   1  
ATOM   7020   H HB2  . ASP A 1 454 ? -10.731 -24.431 -30.678 0.02 29.75 ? 447 ASP A HB2  1  
ATOM   7021   H HB3  . ASP A 1 454 ? -10.496 -24.808 -32.190 0.02 29.95 ? 447 ASP A HB3  1  
ATOM   7022   N N    . PHE A 1 455 ? -9.883  -21.425 -33.825 0.02 29.69 ? 448 PHE A N    1  
ATOM   7023   C CA   . PHE A 1 455 ? -9.253  -21.037 -35.081 0.02 29.92 ? 448 PHE A CA   1  
ATOM   7024   C C    . PHE A 1 455 ? -8.389  -19.806 -34.875 0.02 30.00 ? 448 PHE A C    1  
ATOM   7025   O O    . PHE A 1 455 ? -8.898  -18.739 -34.522 0.02 29.73 ? 448 PHE A O    1  
ATOM   7026   C CB   . PHE A 1 455 ? -10.291 -20.754 -36.157 0.02 29.72 ? 448 PHE A CB   1  
ATOM   7027   C CG   . PHE A 1 455 ? -9.675  -20.343 -37.444 0.02 29.98 ? 448 PHE A CG   1  
ATOM   7028   C CD1  . PHE A 1 455 ? -9.233  -21.292 -38.315 0.02 30.33 ? 448 PHE A CD1  1  
ATOM   7029   C CD2  . PHE A 1 455 ? -9.480  -19.007 -37.747 0.02 29.94 ? 448 PHE A CD2  1  
ATOM   7030   C CE1  . PHE A 1 455 ? -8.642  -20.923 -39.519 0.02 30.62 ? 448 PHE A CE1  1  
ATOM   7031   C CE2  . PHE A 1 455 ? -8.881  -18.642 -38.933 0.02 30.24 ? 448 PHE A CE2  1  
ATOM   7032   C CZ   . PHE A 1 455 ? -8.458  -19.608 -39.807 0.02 30.58 ? 448 PHE A CZ   1  
ATOM   7033   H H    . PHE A 1 455 ? -10.543 -20.923 -33.607 0.02 29.44 ? 448 PHE A H    1  
ATOM   7034   H HA   . PHE A 1 455 ? -8.683  -21.753 -35.397 0.02 30.19 ? 448 PHE A HA   1  
ATOM   7035   H HB2  . PHE A 1 455 ? -10.815 -21.556 -36.309 0.02 29.70 ? 448 PHE A HB2  1  
ATOM   7036   H HB3  . PHE A 1 455 ? -10.867 -20.034 -35.861 0.02 29.47 ? 448 PHE A HB3  1  
ATOM   7037   H HD1  . PHE A 1 455 ? -9.359  -22.190 -38.110 0.02 30.38 ? 448 PHE A HD1  1  
ATOM   7038   H HD2  . PHE A 1 455 ? -9.763  -18.352 -37.153 0.02 29.74 ? 448 PHE A HD2  1  
ATOM   7039   H HE1  . PHE A 1 455 ? -8.352  -21.575 -40.113 0.02 30.88 ? 448 PHE A HE1  1  
ATOM   7040   H HE2  . PHE A 1 455 ? -8.761  -17.744 -39.140 0.02 30.24 ? 448 PHE A HE2  1  
ATOM   7041   H HZ   . PHE A 1 455 ? -8.061  -19.361 -40.611 0.02 30.81 ? 448 PHE A HZ   1  
ATOM   7042   N N    . ASP A 1 456 ? -7.102  -19.949 -35.128 0.02 30.43 ? 449 ASP A N    1  
ATOM   7043   C CA   . ASP A 1 456 ? -6.118  -18.920 -34.823 0.02 30.62 ? 449 ASP A CA   1  
ATOM   7044   C C    . ASP A 1 456 ? -5.537  -18.289 -36.088 0.02 30.89 ? 449 ASP A C    1  
ATOM   7045   O O    . ASP A 1 456 ? -4.934  -18.985 -36.908 0.02 31.26 ? 449 ASP A O    1  
ATOM   7046   C CB   . ASP A 1 456 ? -5.002  -19.520 -33.973 0.02 30.96 ? 449 ASP A CB   1  
ATOM   7047   C CG   . ASP A 1 456 ? -4.468  -18.549 -32.984 0.02 30.92 ? 449 ASP A CG   1  
ATOM   7048   O OD1  . ASP A 1 456 ? -3.362  -18.042 -33.202 0.02 31.30 ? 449 ASP A OD1  1  
ATOM   7049   O OD2  . ASP A 1 456 ? -5.173  -18.292 -31.978 0.02 30.54 ? 449 ASP A OD2  1  
ATOM   7050   H H    . ASP A 1 456 ? -6.763  -20.661 -35.467 0.02 30.64 ? 449 ASP A H    1  
ATOM   7051   H HA   . ASP A 1 456 ? -6.547  -18.213 -34.317 0.02 30.38 ? 449 ASP A HA   1  
ATOM   7052   H HB2  . ASP A 1 456 ? -5.346  -20.288 -33.492 0.02 30.91 ? 449 ASP A HB2  1  
ATOM   7053   H HB3  . ASP A 1 456 ? -4.270  -19.791 -34.545 0.02 31.30 ? 449 ASP A HB3  1  
ATOM   7054   N N    . SER A 1 457 ? -5.663  -16.960 -36.208 0.02 30.77 ? 450 SER A N    1  
ATOM   7055   C CA   . SER A 1 457 ? -5.060  -16.214 -37.313 0.02 31.08 ? 450 SER A CA   1  
ATOM   7056   C C    . SER A 1 457 ? -4.723  -14.782 -36.924 0.02 31.08 ? 450 SER A C    1  
ATOM   7057   O O    . SER A 1 457 ? -5.377  -14.155 -36.086 0.02 30.73 ? 450 SER A O    1  
ATOM   7058   C CB   . SER A 1 457 ? -5.959  -16.155 -38.560 0.02 30.96 ? 450 SER A CB   1  
ATOM   7059   O OG   . SER A 1 457 ? -5.461  -15.201 -39.504 0.02 31.21 ? 450 SER A OG   1  
ATOM   7060   H H    . SER A 1 457 ? -6.096  -16.470 -35.651 0.02 30.53 ? 450 SER A H    1  
ATOM   7061   H HA   . SER A 1 457 ? -4.231  -16.645 -37.568 0.02 31.43 ? 450 SER A HA   1  
ATOM   7062   H HB2  . SER A 1 457 ? -5.981  -17.031 -38.977 0.02 31.08 ? 450 SER A HB2  1  
ATOM   7063   H HB3  . SER A 1 457 ? -6.852  -15.890 -38.291 0.02 30.61 ? 450 SER A HB3  1  
ATOM   7064   H HG   . SER A 1 457 ? -4.659  -15.366 -39.693 0.02 31.53 ? 450 SER A HG   1  
ATOM   7065   N N    . GLU A 1 458 ? -3.708  -14.257 -37.596 0.02 31.53 ? 451 GLU A N    1  
ATOM   7066   C CA   . GLU A 1 458 ? -3.309  -12.869 -37.446 0.02 31.64 ? 451 GLU A CA   1  
ATOM   7067   C C    . GLU A 1 458 ? -3.451  -12.082 -38.755 0.02 31.80 ? 451 GLU A C    1  
ATOM   7068   O O    . GLU A 1 458 ? -3.270  -10.864 -38.754 0.02 31.91 ? 451 GLU A O    1  
ATOM   7069   C CB   . GLU A 1 458 ? -1.880  -12.804 -36.884 0.02 32.11 ? 451 GLU A CB   1  
ATOM   7070   C CG   . GLU A 1 458 ? -0.903  -13.936 -37.347 0.02 32.60 ? 451 GLU A CG   1  
ATOM   7071   C CD   . GLU A 1 458 ? -1.280  -15.361 -36.889 0.02 32.43 ? 451 GLU A CD   1  
ATOM   7072   O OE1  . GLU A 1 458 ? -1.527  -15.595 -35.685 0.02 32.17 ? 451 GLU A OE1  1  
ATOM   7073   O OE2  . GLU A 1 458 ? -1.318  -16.253 -37.767 0.02 32.61 ? 451 GLU A OE2  1  
ATOM   7074   H H    . GLU A 1 458 ? -3.233  -14.692 -38.161 0.02 31.81 ? 451 GLU A H    1  
ATOM   7075   H HA   . GLU A 1 458 ? -3.892  -12.449 -36.796 0.02 31.33 ? 451 GLU A HA   1  
ATOM   7076   H HB2  . GLU A 1 458 ? -1.489  -11.952 -37.134 0.02 32.31 ? 451 GLU A HB2  1  
ATOM   7077   H HB3  . GLU A 1 458 ? -1.937  -12.862 -35.916 0.02 31.95 ? 451 GLU A HB3  1  
ATOM   7078   H HG2  . GLU A 1 458 ? -0.882  -13.942 -38.317 0.02 32.77 ? 451 GLU A HG2  1  
ATOM   7079   H HG3  . GLU A 1 458 ? -0.014  -13.744 -37.006 0.02 32.92 ? 451 GLU A HG3  1  
ATOM   7080   N N    . ASP A 1 459 ? -3.830  -12.730 -39.862 0.02 31.84 ? 452 ASP A N    1  
ATOM   7081   C CA   . ASP A 1 459 ? -3.970  -12.003 -41.129 0.02 32.02 ? 452 ASP A CA   1  
ATOM   7082   C C    . ASP A 1 459 ? -5.289  -11.234 -41.191 0.02 31.57 ? 452 ASP A C    1  
ATOM   7083   O O    . ASP A 1 459 ? -5.458  -10.347 -42.044 0.02 31.71 ? 452 ASP A O    1  
ATOM   7084   C CB   . ASP A 1 459 ? -3.855  -12.972 -42.314 0.02 32.29 ? 452 ASP A CB   1  
ATOM   7085   C CG   . ASP A 1 459 ? -2.411  -13.439 -42.561 0.02 32.85 ? 452 ASP A CG   1  
ATOM   7086   O OD1  . ASP A 1 459 ? -2.204  -14.557 -43.126 0.02 32.97 ? 452 ASP A OD1  1  
ATOM   7087   O OD2  . ASP A 1 459 ? -1.478  -12.679 -42.216 0.02 33.23 ? 452 ASP A OD2  1  
ATOM   7088   H H    . ASP A 1 459 ? -4.014  -13.569 -39.906 0.02 31.78 ? 452 ASP A H    1  
ATOM   7089   H HA   . ASP A 1 459 ? -3.251  -11.354 -41.202 0.02 32.33 ? 452 ASP A HA   1  
ATOM   7090   H HB2  . ASP A 1 459 ? -4.401  -13.754 -42.143 0.02 32.03 ? 452 ASP A HB2  1  
ATOM   7091   H HB3  . ASP A 1 459 ? -4.167  -12.524 -43.114 0.02 32.40 ? 452 ASP A HB3  1  
ATOM   7092   N N    . LEU A 1 460 ? -6.237  -11.579 -40.318 0.02 31.07 ? 453 LEU A N    1  
ATOM   7093   C CA   . LEU A 1 460 ? -7.527  -10.916 -40.226 0.02 30.65 ? 453 LEU A CA   1  
ATOM   7094   C C    . LEU A 1 460 ? -7.818  -10.721 -38.745 0.02 30.32 ? 453 LEU A C    1  
ATOM   7095   O O    . LEU A 1 460 ? -7.745  -11.686 -37.980 0.02 30.21 ? 453 LEU A O    1  
ATOM   7096   C CB   . LEU A 1 460 ? -8.617  -11.765 -40.887 0.02 30.41 ? 453 LEU A CB   1  
ATOM   7097   C CG   . LEU A 1 460 ? -9.906  -11.060 -41.314 0.02 30.12 ? 453 LEU A CG   1  
ATOM   7098   C CD1  . LEU A 1 460 ? -9.606  -10.015 -42.417 0.02 30.45 ? 453 LEU A CD1  1  
ATOM   7099   C CD2  . LEU A 1 460 ? -10.973 -12.068 -41.787 0.02 29.91 ? 453 LEU A CD2  1  
ATOM   7100   H H    . LEU A 1 460 ? -6.151  -12.227 -39.761 0.02 30.99 ? 453 LEU A H    1  
ATOM   7101   H HA   . LEU A 1 460 ? -7.491  -10.052 -40.657 0.02 30.77 ? 453 LEU A HA   1  
ATOM   7102   H HB2  . LEU A 1 460 ? -8.239  -12.175 -41.678 0.02 30.66 ? 453 LEU A HB2  1  
ATOM   7103   H HB3  . LEU A 1 460 ? -8.874  -12.462 -40.264 0.02 30.22 ? 453 LEU A HB3  1  
ATOM   7104   H HG   . LEU A 1 460 ? -10.266 -10.592 -40.544 0.02 29.90 ? 453 LEU A HG   1  
ATOM   7105   H HD11 . LEU A 1 460 ? -10.444 -9.681  -42.772 0.02 30.29 ? 453 LEU A HD11 1  
ATOM   7106   H HD12 . LEU A 1 460 ? -9.092  -9.284  -42.045 0.02 30.56 ? 453 LEU A HD12 1  
ATOM   7107   H HD13 . LEU A 1 460 ? -9.097  -10.448 -43.117 0.02 30.72 ? 453 LEU A HD13 1  
ATOM   7108   H HD21 . LEU A 1 460 ? -11.429 -12.436 -41.016 0.02 29.65 ? 453 LEU A HD21 1  
ATOM   7109   H HD22 . LEU A 1 460 ? -11.609 -11.615 -42.361 0.02 29.88 ? 453 LEU A HD22 1  
ATOM   7110   H HD23 . LEU A 1 460 ? -10.533 -12.779 -42.278 0.02 30.12 ? 453 LEU A HD23 1  
ATOM   7111   N N    . ILE A 1 461 ? -8.127  -9.488  -38.330 0.02 30.21 ? 454 ILE A N    1  
ATOM   7112   C CA   . ILE A 1 461 ? -8.314  -9.195  -36.916 0.02 29.97 ? 454 ILE A CA   1  
ATOM   7113   C C    . ILE A 1 461 ? -9.515  -8.270  -36.729 0.02 29.66 ? 454 ILE A C    1  
ATOM   7114   O O    . ILE A 1 461 ? -10.186 -7.876  -37.683 0.02 29.62 ? 454 ILE A O    1  
ATOM   7115   C CB   . ILE A 1 461 ? -7.055  -8.583  -36.286 0.02 30.33 ? 454 ILE A CB   1  
ATOM   7116   C CG1  . ILE A 1 461 ? -6.780  -7.194  -36.881 0.02 30.61 ? 454 ILE A CG1  1  
ATOM   7117   C CG2  . ILE A 1 461 ? -5.880  -9.496  -36.525 0.02 30.69 ? 454 ILE A CG2  1  
ATOM   7118   C CD1  . ILE A 1 461 ? -5.718  -6.401  -36.128 0.02 31.02 ? 454 ILE A CD1  1  
ATOM   7119   H H    . ILE A 1 461 ? -8.224  -8.809  -38.844 0.02 30.29 ? 454 ILE A H    1  
ATOM   7120   H HA   . ILE A 1 461 ? -8.504  -10.024 -36.446 0.02 29.81 ? 454 ILE A HA   1  
ATOM   7121   H HB   . ILE A 1 461 ? -7.196  -8.495  -35.331 0.02 30.18 ? 454 ILE A HB   1  
ATOM   7122   H HG12 . ILE A 1 461 ? -6.472  -7.303  -37.792 0.02 30.80 ? 454 ILE A HG12 1  
ATOM   7123   H HG13 . ILE A 1 461 ? -7.589  -6.664  -36.872 0.02 30.40 ? 454 ILE A HG13 1  
ATOM   7124   H HG21 . ILE A 1 461 ? -5.358  -9.151  -37.267 0.02 30.97 ? 454 ILE A HG21 1  
ATOM   7125   H HG22 . ILE A 1 461 ? -5.337  -9.522  -35.723 0.02 30.81 ? 454 ILE A HG22 1  
ATOM   7126   H HG23 . ILE A 1 461 ? -6.202  -10.387 -36.724 0.02 30.54 ? 454 ILE A HG23 1  
ATOM   7127   H HD11 . ILE A 1 461 ? -5.761  -5.474  -36.402 0.02 31.15 ? 454 ILE A HD11 1  
ATOM   7128   H HD12 . ILE A 1 461 ? -5.896  -6.477  -35.177 0.02 30.87 ? 454 ILE A HD12 1  
ATOM   7129   H HD13 . ILE A 1 461 ? -4.845  -6.768  -36.327 0.02 31.31 ? 454 ILE A HD13 1  
ATOM   7130   N N    . ASN A 1 462 ? -9.804  -7.955  -35.475 0.02 29.45 ? 455 ASN A N    1  
ATOM   7131   C CA   . ASN A 1 462 ? -10.816 -6.965  -35.146 0.02 29.21 ? 455 ASN A CA   1  
ATOM   7132   C C    . ASN A 1 462 ? -10.289 -6.021  -34.073 0.02 29.33 ? 455 ASN A C    1  
ATOM   7133   O O    . ASN A 1 462 ? -9.227  -6.249  -33.486 0.02 29.56 ? 455 ASN A O    1  
ATOM   7134   C CB   . ASN A 1 462 ? -12.134 -7.625  -34.707 0.02 28.78 ? 455 ASN A CB   1  
ATOM   7135   C CG   . ASN A 1 462 ? -12.048 -8.276  -33.313 0.02 28.64 ? 455 ASN A CG   1  
ATOM   7136   O OD1  . ASN A 1 462 ? -11.810 -7.605  -32.323 0.02 28.67 ? 455 ASN A OD1  1  
ATOM   7137   N ND2  . ASN A 1 462 ? -12.286 -9.578  -33.247 0.02 28.51 ? 455 ASN A ND2  1  
ATOM   7138   H H    . ASN A 1 462 ? -9.421  -8.303  -34.794 0.02 29.46 ? 455 ASN A H    1  
ATOM   7139   H HA   . ASN A 1 462 ? -11.003 -6.446  -35.941 0.02 29.29 ? 455 ASN A HA   1  
ATOM   7140   H HB2  . ASN A 1 462 ? -12.838 -6.963  -34.695 0.02 28.66 ? 455 ASN A HB2  1  
ATOM   7141   H HB3  . ASN A 1 462 ? -12.357 -8.321  -35.343 0.02 28.75 ? 455 ASN A HB3  1  
ATOM   7142   H HD21 . ASN A 1 462 ? -11.641 -10.136 -33.340 0.02 28.66 ? 455 ASN A HD21 1  
ATOM   7143   H HD22 . ASN A 1 462 ? -13.082 -9.860  -33.103 0.02 28.31 ? 455 ASN A HD22 1  
ATOM   7144   N N    . PRO A 1 463 ? -10.991 -4.917  -33.827 0.02 29.24 ? 456 PRO A N    1  
ATOM   7145   C CA   . PRO A 1 463 ? -10.431 -3.864  -32.962 0.02 29.46 ? 456 PRO A CA   1  
ATOM   7146   C C    . PRO A 1 463 ? -10.158 -4.308  -31.549 0.02 29.38 ? 456 PRO A C    1  
ATOM   7147   O O    . PRO A 1 463 ? -9.255  -3.760  -30.900 0.02 29.68 ? 456 PRO A O    1  
ATOM   7148   C CB   . PRO A 1 463 ? -11.519 -2.781  -32.993 0.02 29.32 ? 456 PRO A CB   1  
ATOM   7149   C CG   . PRO A 1 463 ? -12.053 -2.907  -34.368 0.02 29.25 ? 456 PRO A CG   1  
ATOM   7150   C CD   . PRO A 1 463 ? -12.177 -4.428  -34.546 0.02 29.04 ? 456 PRO A CD   1  
ATOM   7151   H HA   . PRO A 1 463 ? -9.618  -3.511  -33.354 0.02 29.77 ? 456 PRO A HA   1  
ATOM   7152   H HB2  . PRO A 1 463 ? -12.206 -2.984  -32.340 0.02 29.08 ? 456 PRO A HB2  1  
ATOM   7153   H HB3  . PRO A 1 463 ? -11.128 -1.907  -32.834 0.02 29.55 ? 456 PRO A HB3  1  
ATOM   7154   H HG2  . PRO A 1 463 ? -12.901 -2.467  -34.453 0.02 29.09 ? 456 PRO A HG2  1  
ATOM   7155   H HG3  . PRO A 1 463 ? -11.411 -2.546  -34.995 0.02 29.51 ? 456 PRO A HG3  1  
ATOM   7156   H HD2  . PRO A 1 463 ? -12.986 -4.759  -34.123 0.02 28.77 ? 456 PRO A HD2  1  
ATOM   7157   H HD3  . PRO A 1 463 ? -12.139 -4.666  -35.487 0.02 29.10 ? 456 PRO A HD3  1  
ATOM   7158   N N    . TYR A 1 464 ? -10.947 -5.244  -31.038 0.02 29.03 ? 457 TYR A N    1  
ATOM   7159   C CA   . TYR A 1 464 ? -10.737 -5.781  -29.702 0.02 28.98 ? 457 TYR A CA   1  
ATOM   7160   C C    . TYR A 1 464 ? -9.316  -6.294  -29.507 0.02 29.31 ? 457 TYR A C    1  
ATOM   7161   O O    . TYR A 1 464 ? -8.855  -6.400  -28.371 0.02 29.39 ? 457 TYR A O    1  
ATOM   7162   C CB   . TYR A 1 464 ? -11.728 -6.909  -29.491 0.02 28.62 ? 457 TYR A CB   1  
ATOM   7163   C CG   . TYR A 1 464 ? -12.755 -6.793  -28.420 0.02 28.33 ? 457 TYR A CG   1  
ATOM   7164   C CD1  . TYR A 1 464 ? -12.425 -7.053  -27.097 0.02 28.35 ? 457 TYR A CD1  1  
ATOM   7165   C CD2  . TYR A 1 464 ? -14.108 -6.589  -28.729 0.02 28.06 ? 457 TYR A CD2  1  
ATOM   7166   C CE1  . TYR A 1 464 ? -13.396 -7.007  -26.087 0.02 28.13 ? 457 TYR A CE1  1  
ATOM   7167   C CE2  . TYR A 1 464 ? -15.088 -6.584  -27.700 0.02 27.83 ? 457 TYR A CE2  1  
ATOM   7168   C CZ   . TYR A 1 464 ? -14.693 -6.808  -26.377 0.02 27.87 ? 457 TYR A CZ   1  
ATOM   7169   O OH   . TYR A 1 464 ? -15.529 -6.815  -25.285 0.02 27.72 ? 457 TYR A OH   1  
ATOM   7170   H H    . TYR A 1 464 ? -11.617 -5.587  -31.455 0.02 28.85 ? 457 TYR A H    1  
ATOM   7171   H HA   . TYR A 1 464 ? -10.913 -5.096  -29.042 0.02 28.98 ? 457 TYR A HA   1  
ATOM   7172   H HB2  . TYR A 1 464 ? -12.251 -7.020  -30.290 0.02 28.53 ? 457 TYR A HB2  1  
ATOM   7173   H HB3  . TYR A 1 464 ? -11.218 -7.715  -29.331 0.02 28.69 ? 457 TYR A HB3  1  
ATOM   7174   H HD1  . TYR A 1 464 ? -11.535 -7.209  -26.873 0.02 28.55 ? 457 TYR A HD1  1  
ATOM   7175   H HD2  . TYR A 1 464 ? -14.362 -6.451  -29.617 0.02 28.05 ? 457 TYR A HD2  1  
ATOM   7176   H HE1  . TYR A 1 464 ? -13.181 -7.163  -25.204 0.02 28.17 ? 457 TYR A HE1  1  
ATOM   7177   H HE2  . TYR A 1 464 ? -15.983 -6.425  -27.900 0.02 27.68 ? 457 TYR A HE2  1  
ATOM   7178   H HH   . TYR A 1 464 ? -15.113 -7.085  -24.612 0.02 27.81 ? 457 TYR A HH   1  
ATOM   7179   N N    . ARG A 1 465 ? -8.617  -6.663  -30.584 0.02 29.54 ? 458 ARG A N    1  
ATOM   7180   C CA   . ARG A 1 465 ? -7.255  -7.141  -30.411 0.02 29.91 ? 458 ARG A CA   1  
ATOM   7181   C C    . ARG A 1 465 ? -6.321  -6.036  -29.950 0.02 30.31 ? 458 ARG A C    1  
ATOM   7182   O O    . ARG A 1 465 ? -5.303  -6.313  -29.310 0.02 30.60 ? 458 ARG A O    1  
ATOM   7183   C CB   . ARG A 1 465 ? -6.719  -7.735  -31.702 0.02 30.10 ? 458 ARG A CB   1  
ATOM   7184   C CG   . ARG A 1 465 ? -5.273  -8.164  -31.525 0.02 30.55 ? 458 ARG A CG   1  
ATOM   7185   C CD   . ARG A 1 465 ? -4.823  -9.205  -32.518 0.02 30.71 ? 458 ARG A CD   1  
ATOM   7186   N NE   . ARG A 1 465 ? -5.739  -10.332 -32.645 0.02 30.36 ? 458 ARG A NE   1  
ATOM   7187   C CZ   . ARG A 1 465 ? -5.355  -11.571 -32.936 0.02 30.50 ? 458 ARG A CZ   1  
ATOM   7188   N NH1  . ARG A 1 465 ? -4.074  -11.851 -33.111 0.02 30.98 ? 458 ARG A NH1  1  
ATOM   7189   N NH2  . ARG A 1 465 ? -6.248  -12.529 -33.044 0.02 30.20 ? 458 ARG A NH2  1  
ATOM   7190   H H    . ARG A 1 465 ? -8.905  -6.659  -31.391 0.02 29.51 ? 458 ARG A H    1  
ATOM   7191   H HA   . ARG A 1 465 ? -7.246  -7.831  -29.730 0.02 29.83 ? 458 ARG A HA   1  
ATOM   7192   H HB2  . ARG A 1 465 ? -7.258  -8.500  -31.945 0.02 29.88 ? 458 ARG A HB2  1  
ATOM   7193   H HB3  . ARG A 1 465 ? -6.753  -7.058  -32.397 0.02 30.19 ? 458 ARG A HB3  1  
ATOM   7194   H HG2  . ARG A 1 465 ? -4.704  -7.384  -31.634 0.02 30.82 ? 458 ARG A HG2  1  
ATOM   7195   H HG3  . ARG A 1 465 ? -5.158  -8.534  -30.635 0.02 30.50 ? 458 ARG A HG3  1  
ATOM   7196   H HD2  . ARG A 1 465 ? -4.742  -8.795  -33.393 0.02 30.80 ? 458 ARG A HD2  1  
ATOM   7197   H HD3  . ARG A 1 465 ? -3.959  -9.528  -32.227 0.02 31.02 ? 458 ARG A HD3  1  
ATOM   7198   H HE   . ARG A 1 465 ? -6.576  -10.157 -32.720 0.02 30.07 ? 458 ARG A HE   1  
ATOM   7199   H HH11 . ARG A 1 465 ? -3.479  -11.236 -33.048 0.02 31.21 ? 458 ARG A HH11 1  
ATOM   7200   H HH12 . ARG A 1 465 ? -3.836  -12.657 -33.297 0.02 31.08 ? 458 ARG A HH12 1  
ATOM   7201   H HH21 . ARG A 1 465 ? -7.083  -12.359 -32.928 0.02 29.92 ? 458 ARG A HH21 1  
ATOM   7202   H HH22 . ARG A 1 465 ? -5.995  -13.330 -33.227 0.02 30.31 ? 458 ARG A HH22 1  
ATOM   7203   N N    . ILE A 1 466 ? -6.605  -4.789  -30.305 0.02 30.38 ? 459 ILE A N    1  
ATOM   7204   C CA   . ILE A 1 466 ? -5.681  -3.740  -29.913 0.02 30.82 ? 459 ILE A CA   1  
ATOM   7205   C C    . ILE A 1 466 ? -6.131  -3.142  -28.589 0.02 30.70 ? 459 ILE A C    1  
ATOM   7206   O O    . ILE A 1 466 ? -5.446  -2.307  -28.002 0.02 31.06 ? 459 ILE A O    1  
ATOM   7207   C CB   . ILE A 1 466 ? -5.521  -2.715  -31.056 0.02 31.09 ? 459 ILE A CB   1  
ATOM   7208   C CG1  . ILE A 1 466 ? -4.494  -3.259  -32.077 0.02 31.43 ? 459 ILE A CG1  1  
ATOM   7209   C CG2  . ILE A 1 466 ? -5.082  -1.346  -30.541 0.02 31.50 ? 459 ILE A CG2  1  
ATOM   7210   C CD1  . ILE A 1 466 ? -5.046  -3.586  -33.446 0.02 31.25 ? 459 ILE A CD1  1  
ATOM   7211   H H    . ILE A 1 466 ? -7.299  -4.529  -30.740 0.02 30.22 ? 459 ILE A H    1  
ATOM   7212   H HA   . ILE A 1 466 ? -4.812  -4.137  -29.762 0.02 31.08 ? 459 ILE A HA   1  
ATOM   7213   H HB   . ILE A 1 466 ? -6.372  -2.614  -31.507 0.02 30.85 ? 459 ILE A HB   1  
ATOM   7214   H HG12 . ILE A 1 466 ? -3.782  -2.608  -32.201 0.02 31.82 ? 459 ILE A HG12 1  
ATOM   7215   H HG13 . ILE A 1 466 ? -4.114  -4.085  -31.730 0.02 31.45 ? 459 ILE A HG13 1  
ATOM   7216   H HG21 . ILE A 1 466 ? -4.418  -1.475  -29.852 0.02 31.68 ? 459 ILE A HG21 1  
ATOM   7217   H HG22 . ILE A 1 466 ? -4.710  -0.845  -31.280 0.02 31.76 ? 459 ILE A HG22 1  
ATOM   7218   H HG23 . ILE A 1 466 ? -5.848  -0.877  -30.174 0.02 31.34 ? 459 ILE A HG23 1  
ATOM   7219   H HD11 . ILE A 1 466 ? -5.592  -2.843  -33.744 0.02 31.22 ? 459 ILE A HD11 1  
ATOM   7220   H HD12 . ILE A 1 466 ? -4.304  -3.721  -34.056 0.02 31.53 ? 459 ILE A HD12 1  
ATOM   7221   H HD13 . ILE A 1 466 ? -5.582  -4.392  -33.395 0.02 30.91 ? 459 ILE A HD13 1  
ATOM   7222   N N    . MET A 1 467 ? -7.247  -3.637  -28.061 0.02 30.24 ? 460 MET A N    1  
ATOM   7223   C CA   . MET A 1 467 ? -7.741  -3.179  -26.771 0.02 30.13 ? 460 MET A CA   1  
ATOM   7224   C C    . MET A 1 467 ? -7.490  -4.265  -25.719 0.02 30.08 ? 460 MET A C    1  
ATOM   7225   O O    . MET A 1 467 ? -7.720  -4.071  -24.514 0.02 30.12 ? 460 MET A O    1  
ATOM   7226   C CB   . MET A 1 467 ? -9.201  -2.737  -26.974 0.02 29.72 ? 460 MET A CB   1  
ATOM   7227   C CG   . MET A 1 467 ? -9.292  -1.653  -28.154 0.02 29.80 ? 460 MET A CG   1  
ATOM   7228   S SD   . MET A 1 467 ? -10.765 -1.338  -29.230 0.02 29.39 ? 460 MET A SD   1  
ATOM   7229   C CE   . MET A 1 467 ? -12.161 -2.005  -28.329 0.02 28.99 ? 460 MET A CE   1  
ATOM   7230   H H    . MET A 1 467 ? -7.741  -4.237  -28.424 0.02 30.02 ? 460 MET A H    1  
ATOM   7231   H HA   . MET A 1 467 ? -7.243  -2.392  -26.502 0.02 30.39 ? 460 MET A HA   1  
ATOM   7232   H HB2  . MET A 1 467 ? -9.741  -3.508  -27.208 0.02 29.46 ? 460 MET A HB2  1  
ATOM   7233   H HB3  . MET A 1 467 ? -9.529  -2.326  -26.160 0.02 29.69 ? 460 MET A HB3  1  
ATOM   7234   H HG2  . MET A 1 467 ? -9.068  -0.794  -27.765 0.02 30.02 ? 460 MET A HG2  1  
ATOM   7235   H HG3  . MET A 1 467 ? -8.590  -1.867  -28.783 0.02 29.96 ? 460 MET A HG3  1  
ATOM   7236   H HE1  . MET A 1 467 ? -12.018 -2.954  -28.187 0.02 28.90 ? 460 MET A HE1  1  
ATOM   7237   H HE2  . MET A 1 467 ? -12.240 -1.544  -27.479 0.02 29.10 ? 460 MET A HE2  1  
ATOM   7238   H HE3  . MET A 1 467 ? -12.966 -1.873  -28.856 0.02 28.79 ? 460 MET A HE3  1  
ATOM   7239   N N    . ARG A 1 468 ? -6.967  -5.408  -26.171 0.02 30.06 ? 461 ARG A N    1  
ATOM   7240   C CA   . ARG A 1 468 ? -5.911  -6.146  -25.499 0.02 30.34 ? 461 ARG A CA   1  
ATOM   7241   C C    . ARG A 1 468 ? -4.580  -5.913  -26.211 0.02 30.84 ? 461 ARG A C    1  
ATOM   7242   O O    . ARG A 1 468 ? -4.152  -6.765  -26.989 0.02 30.95 ? 461 ARG A O    1  
ATOM   7243   C CB   . ARG A 1 468 ? -6.256  -7.651  -25.433 0.02 30.10 ? 461 ARG A CB   1  
ATOM   7244   C CG   . ARG A 1 468 ? -6.220  -8.452  -26.795 0.02 30.04 ? 461 ARG A CG   1  
ATOM   7245   C CD   . ARG A 1 468 ? -7.403  -9.403  -27.076 0.02 29.68 ? 461 ARG A CD   1  
ATOM   7246   N NE   . ARG A 1 468 ? -7.304  -10.129 -28.359 0.02 29.65 ? 461 ARG A NE   1  
ATOM   7247   C CZ   . ARG A 1 468 ? -6.387  -11.069 -28.635 0.02 29.90 ? 461 ARG A CZ   1  
ATOM   7248   N NH1  . ARG A 1 468 ? -5.415  -11.421 -27.771 0.02 30.20 ? 461 ARG A NH1  1  
ATOM   7249   N NH2  . ARG A 1 468 ? -6.389  -11.671 -29.812 0.02 29.88 ? 461 ARG A NH2  1  
ATOM   7250   H H    . ARG A 1 468 ? -7.218  -5.786  -26.901 0.02 29.90 ? 461 ARG A H    1  
ATOM   7251   H HA   . ARG A 1 468 ? -5.861  -5.824  -24.593 0.02 30.41 ? 461 ARG A HA   1  
ATOM   7252   H HB2  . ARG A 1 468 ? -5.603  -8.071  -24.853 0.02 30.31 ? 461 ARG A HB2  1  
ATOM   7253   H HB3  . ARG A 1 468 ? -7.144  -7.748  -25.051 0.02 29.82 ? 461 ARG A HB3  1  
ATOM   7254   H HG2  . ARG A 1 468 ? -6.171  -7.824  -27.533 0.02 30.00 ? 461 ARG A HG2  1  
ATOM   7255   H HG3  . ARG A 1 468 ? -5.421  -8.989  -26.802 0.02 30.33 ? 461 ARG A HG3  1  
ATOM   7256   H HD2  . ARG A 1 468 ? -7.446  -10.063 -26.350 0.02 29.74 ? 461 ARG A HD2  1  
ATOM   7257   H HD3  . ARG A 1 468 ? -8.222  -8.915  -27.068 0.02 29.42 ? 461 ARG A HD3  1  
ATOM   7258   H HE   . ARG A 1 468 ? -7.970  -10.054 -28.895 0.02 29.44 ? 461 ARG A HE   1  
ATOM   7259   H HH11 . ARG A 1 468 ? -5.377  -11.062 -26.992 0.02 30.23 ? 461 ARG A HH11 1  
ATOM   7260   H HH12 . ARG A 1 468 ? -4.838  -12.020 -27.992 0.02 30.38 ? 461 ARG A HH12 1  
ATOM   7261   H HH21 . ARG A 1 468 ? -6.982  -11.470 -30.405 0.02 29.72 ? 461 ARG A HH21 1  
ATOM   7262   H HH22 . ARG A 1 468 ? -5.785  -12.258 -29.992 0.02 30.07 ? 461 ARG A HH22 1  
ATOM   7263   N N    . SER A 1 469 ? -3.958  -4.744  -26.056 0.02 31.17 ? 462 SER A N    1  
ATOM   7264   C CA   . SER A 1 469 ? -3.132  -4.230  -27.154 0.02 31.59 ? 462 SER A CA   1  
ATOM   7265   C C    . SER A 1 469 ? -1.981  -5.200  -27.427 0.02 31.88 ? 462 SER A C    1  
ATOM   7266   O O    . SER A 1 469 ? -0.805  -4.893  -27.254 0.02 32.42 ? 462 SER A O    1  
ATOM   7267   C CB   . SER A 1 469 ? -2.652  -2.796  -26.893 0.02 32.04 ? 462 SER A CB   1  
ATOM   7268   O OG   . SER A 1 469 ? -3.103  -1.930  -27.930 0.02 32.01 ? 462 SER A OG   1  
ATOM   7269   H H    . SER A 1 469 ? -3.980  -4.256  -25.348 0.02 31.19 ? 462 SER A H    1  
ATOM   7270   H HA   . SER A 1 469 ? -3.679  -4.201  -27.952 0.02 31.42 ? 462 SER A HA   1  
ATOM   7271   H HB2  . SER A 1 469 ? -3.007  -2.482  -26.046 0.02 32.00 ? 462 SER A HB2  1  
ATOM   7272   H HB3  . SER A 1 469 ? -1.682  -2.770  -26.871 0.02 32.43 ? 462 SER A HB3  1  
ATOM   7273   H HG   . SER A 1 469 ? -2.651  -2.058  -28.625 0.02 32.14 ? 462 SER A HG   1  
ATOM   7274   N N    . GLY A 1 470 ? -2.353  -6.403  -27.879 0.02 31.56 ? 463 GLY A N    1  
ATOM   7275   C CA   . GLY A 1 470 ? -1.461  -7.543  -27.929 0.02 31.78 ? 463 GLY A CA   1  
ATOM   7276   C C    . GLY A 1 470 ? -0.665  -7.666  -29.212 0.02 32.18 ? 463 GLY A C    1  
ATOM   7277   O O    . GLY A 1 470 ? 0.569   -7.671  -29.144 0.02 32.70 ? 463 GLY A O    1  
ATOM   7278   H H    . GLY A 1 470 ? -3.135  -6.578  -28.191 0.02 31.23 ? 463 GLY A H    1  
ATOM   7279   H HA2  . GLY A 1 470 ? -0.838  -7.484  -27.189 0.02 31.99 ? 463 GLY A HA2  1  
ATOM   7280   H HA3  . GLY A 1 470 ? -1.982  -8.355  -27.811 0.02 31.48 ? 463 GLY A HA3  1  
ATOM   7281   N N    . ARG A 1 471 ? -1.325  -7.728  -30.372 0.02 32.00 ? 464 ARG A N    1  
ATOM   7282   C CA   . ARG A 1 471 ? -0.635  -7.822  -31.659 0.02 32.43 ? 464 ARG A CA   1  
ATOM   7283   C C    . ARG A 1 471 ? 0.416   -8.930  -31.616 0.02 32.80 ? 464 ARG A C    1  
ATOM   7284   O O    . ARG A 1 471 ? 1.282   -8.938  -30.743 0.02 33.13 ? 464 ARG A O    1  
ATOM   7285   C CB   . ARG A 1 471 ? 0.052   -6.492  -32.040 0.02 32.90 ? 464 ARG A CB   1  
ATOM   7286   C CG   . ARG A 1 471 ? -0.327  -5.185  -31.246 0.02 32.71 ? 464 ARG A CG   1  
ATOM   7287   C CD   . ARG A 1 471 ? -0.925  -4.041  -32.073 0.02 32.68 ? 464 ARG A CD   1  
ATOM   7288   N NE   . ARG A 1 471 ? -1.029  -4.400  -33.476 0.02 32.70 ? 464 ARG A NE   1  
ATOM   7289   C CZ   . ARG A 1 471 ? -0.271  -3.922  -34.460 0.02 33.17 ? 464 ARG A CZ   1  
ATOM   7290   N NH1  . ARG A 1 471 ? 0.642   -2.977  -34.257 0.02 33.68 ? 464 ARG A NH1  1  
ATOM   7291   N NH2  . ARG A 1 471 ? -0.449  -4.379  -35.679 0.02 33.17 ? 464 ARG A NH2  1  
ATOM   7292   H H    . ARG A 1 471 ? -2.180  -7.711  -30.438 0.02 31.66 ? 464 ARG A H    1  
ATOM   7293   H HA   . ARG A 1 471 ? -1.284  -8.038  -32.343 0.02 32.23 ? 464 ARG A HA   1  
ATOM   7294   H HB2  . ARG A 1 471 ? 1.002   -6.610  -31.896 0.02 33.24 ? 464 ARG A HB2  1  
ATOM   7295   H HB3  . ARG A 1 471 ? -0.091  -6.366  -32.983 0.02 33.08 ? 464 ARG A HB3  1  
ATOM   7296   H HG2  . ARG A 1 471 ? -0.971  -5.390  -30.549 0.02 32.32 ? 464 ARG A HG2  1  
ATOM   7297   H HG3  . ARG A 1 471 ? 0.485   -4.834  -30.846 0.02 33.03 ? 464 ARG A HG3  1  
ATOM   7298   H HD2  . ARG A 1 471 ? -1.818  -3.853  -31.739 0.02 32.31 ? 464 ARG A HD2  1  
ATOM   7299   H HD3  . ARG A 1 471 ? -0.366  -3.253  -31.986 0.02 33.05 ? 464 ARG A HD3  1  
ATOM   7300   H HE   . ARG A 1 471 ? -1.536  -5.070  -33.666 0.02 32.43 ? 464 ARG A HE   1  
ATOM   7301   H HH11 . ARG A 1 471 ? 0.789   -2.661  -33.471 0.02 33.71 ? 464 ARG A HH11 1  
ATOM   7302   H HH12 . ARG A 1 471 ? 1.087   -2.689  -34.927 0.02 34.00 ? 464 ARG A HH12 1  
ATOM   7303   H HH21 . ARG A 1 471 ? -1.046  -4.981  -35.826 0.02 32.86 ? 464 ARG A HH21 1  
ATOM   7304   H HH22 . ARG A 1 471 ? 0.014   -4.061  -36.329 0.02 33.48 ? 464 ARG A HH22 1  
ATOM   7305   N N    . GLY A 1 472 ? 0.354   -9.857  -32.573 0.02 32.79 ? 465 GLY A N    1  
ATOM   7306   C CA   . GLY A 1 472 ? 1.423   -10.822 -32.713 0.02 33.23 ? 465 GLY A CA   1  
ATOM   7307   C C    . GLY A 1 472 ? 1.208   -12.131 -31.985 0.02 33.00 ? 465 GLY A C    1  
ATOM   7308   O O    . GLY A 1 472 ? 1.765   -13.160 -32.389 0.02 33.24 ? 465 GLY A O    1  
ATOM   7309   H H    . GLY A 1 472 ? -0.287  -9.948  -33.137 0.02 32.56 ? 465 GLY A H    1  
ATOM   7310   H HA2  . GLY A 1 472 ? 1.565   -11.012 -33.656 0.02 33.40 ? 465 GLY A HA2  1  
ATOM   7311   H HA3  . GLY A 1 472 ? 2.236   -10.427 -32.360 0.02 33.59 ? 465 GLY A HA3  1  
ATOM   7312   N N    . VAL A 1 473 ? 0.362   -12.136 -30.966 0.02 32.55 ? 466 VAL A N    1  
ATOM   7313   C CA   . VAL A 1 473 ? 0.382   -13.165 -29.929 0.02 32.49 ? 466 VAL A CA   1  
ATOM   7314   C C    . VAL A 1 473 ? -0.630  -14.251 -30.282 0.02 32.08 ? 466 VAL A C    1  
ATOM   7315   O O    . VAL A 1 473 ? -1.758  -13.962 -30.702 0.02 31.65 ? 466 VAL A O    1  
ATOM   7316   C CB   . VAL A 1 473 ? 0.135   -12.566 -28.536 0.02 32.32 ? 466 VAL A CB   1  
ATOM   7317   C CG1  . VAL A 1 473 ? 0.144   -11.039 -28.564 0.02 32.38 ? 466 VAL A CG1  1  
ATOM   7318   C CG2  . VAL A 1 473 ? -1.147  -13.071 -27.900 0.02 31.75 ? 466 VAL A CG2  1  
ATOM   7319   H H    . VAL A 1 473 ? -0.258  -11.550 -30.867 0.02 32.28 ? 466 VAL A H    1  
ATOM   7320   H HA   . VAL A 1 473 ? 1.260   -13.575 -29.914 0.02 32.88 ? 466 VAL A HA   1  
ATOM   7321   H HB   . VAL A 1 473 ? 0.870   -12.843 -27.968 0.02 32.62 ? 466 VAL A HB   1  
ATOM   7322   H HG11 . VAL A 1 473 ? 0.146   -10.714 -27.649 0.02 32.39 ? 466 VAL A HG11 1  
ATOM   7323   H HG12 . VAL A 1 473 ? 0.937   -10.729 -29.027 0.02 32.75 ? 466 VAL A HG12 1  
ATOM   7324   H HG13 . VAL A 1 473 ? -0.651  -10.731 -29.021 0.02 32.05 ? 466 VAL A HG13 1  
ATOM   7325   H HG21 . VAL A 1 473 ? -1.260  -12.636 -27.042 0.02 31.68 ? 466 VAL A HG21 1  
ATOM   7326   H HG22 . VAL A 1 473 ? -1.892  -12.854 -28.480 0.02 31.48 ? 466 VAL A HG22 1  
ATOM   7327   H HG23 . VAL A 1 473 ? -1.088  -14.028 -27.757 0.02 31.77 ? 466 VAL A HG23 1  
ATOM   7328   N N    . LYS A 1 474 ? -0.221  -15.504 -30.088 0.02 32.27 ? 467 LYS A N    1  
ATOM   7329   C CA   . LYS A 1 474 ? -0.972  -16.649 -30.582 0.02 32.02 ? 467 LYS A CA   1  
ATOM   7330   C C    . LYS A 1 474 ? -2.216  -16.894 -29.728 0.02 31.52 ? 467 LYS A C    1  
ATOM   7331   O O    . LYS A 1 474 ? -2.728  -15.982 -29.077 0.02 31.33 ? 467 LYS A O    1  
ATOM   7332   C CB   . LYS A 1 474 ? -0.055  -17.881 -30.616 0.02 32.48 ? 467 LYS A CB   1  
ATOM   7333   C CG   . LYS A 1 474 ? 0.993   -17.818 -31.726 0.02 32.97 ? 467 LYS A CG   1  
ATOM   7334   C CD   . LYS A 1 474 ? 0.507   -18.507 -33.011 0.02 32.97 ? 467 LYS A CD   1  
ATOM   7335   C CE   . LYS A 1 474 ? 1.508   -18.418 -34.174 0.02 33.50 ? 467 LYS A CE   1  
ATOM   7336   N NZ   . LYS A 1 474 ? 2.898   -18.894 -33.822 0.02 34.13 ? 467 LYS A NZ   1  
ATOM   7337   H H    . LYS A 1 474 ? 0.499   -15.716 -29.670 0.02 32.55 ? 467 LYS A H    1  
ATOM   7338   H HA   . LYS A 1 474 ? -1.265  -16.472 -31.492 0.02 31.92 ? 467 LYS A HA   1  
ATOM   7339   H HB2  . LYS A 1 474 ? 0.412   -17.954 -29.768 0.02 32.66 ? 467 LYS A HB2  1  
ATOM   7340   H HB3  . LYS A 1 474 ? -0.572  -18.684 -30.776 0.02 32.32 ? 467 LYS A HB3  1  
ATOM   7341   H HG2  . LYS A 1 474 ? 1.177   -16.886 -31.932 0.02 32.94 ? 467 LYS A HG2  1  
ATOM   7342   H HG3  . LYS A 1 474 ? 1.801   -18.262 -31.424 0.02 33.36 ? 467 LYS A HG3  1  
ATOM   7343   H HD2  . LYS A 1 474 ? 0.354   -19.447 -32.826 0.02 33.04 ? 467 LYS A HD2  1  
ATOM   7344   H HD3  . LYS A 1 474 ? -0.319  -18.089 -33.299 0.02 32.60 ? 467 LYS A HD3  1  
ATOM   7345   H HE2  . LYS A 1 474 ? 1.184   -18.965 -34.905 0.02 33.52 ? 467 LYS A HE2  1  
ATOM   7346   H HE3  . LYS A 1 474 ? 1.573   -17.494 -34.462 0.02 33.44 ? 467 LYS A HE3  1  
ATOM   7347   H HZ1  . LYS A 1 474 ? 3.374   -19.023 -34.564 0.02 34.46 ? 467 LYS A HZ1  1  
ATOM   7348   H HZ2  . LYS A 1 474 ? 3.312   -18.286 -33.318 0.02 34.19 ? 467 LYS A HZ2  1  
ATOM   7349   H HZ3  . LYS A 1 474 ? 2.852   -19.662 -33.374 0.02 34.14 ? 467 LYS A HZ3  1  
ATOM   7350   N N    . GLY A 1 475 ? -2.721  -18.121 -29.761 0.02 31.34 ? 468 GLY A N    1  
ATOM   7351   C CA   . GLY A 1 475 ? -3.899  -18.490 -28.998 0.02 30.93 ? 468 GLY A CA   1  
ATOM   7352   C C    . GLY A 1 475 ? -5.175  -17.756 -29.374 0.02 30.44 ? 468 GLY A C    1  
ATOM   7353   O O    . GLY A 1 475 ? -5.114  -16.668 -29.959 0.02 30.41 ? 468 GLY A O    1  
ATOM   7354   H H    . GLY A 1 475 ? -2.399  -18.769 -30.220 0.02 31.49 ? 468 GLY A H    1  
ATOM   7355   H HA2  . GLY A 1 475 ? -4.061  -19.440 -29.111 0.02 30.96 ? 468 GLY A HA2  1  
ATOM   7356   H HA3  . GLY A 1 475 ? -3.718  -18.327 -28.060 0.02 30.96 ? 468 GLY A HA3  1  
ATOM   7357   N N    . VAL A 1 476 ? -6.329  -18.335 -29.045 0.02 30.10 ? 469 VAL A N    1  
ATOM   7358   C CA   . VAL A 1 476 ? -7.629  -17.807 -29.473 0.02 29.67 ? 469 VAL A CA   1  
ATOM   7359   C C    . VAL A 1 476 ? -8.300  -17.171 -28.256 0.02 29.42 ? 469 VAL A C    1  
ATOM   7360   O O    . VAL A 1 476 ? -9.028  -17.807 -27.501 0.02 29.26 ? 469 VAL A O    1  
ATOM   7361   C CB   . VAL A 1 476 ? -8.492  -18.887 -30.122 0.02 29.53 ? 469 VAL A CB   1  
ATOM   7362   C CG1  . VAL A 1 476 ? -9.742  -18.313 -30.710 0.02 29.17 ? 469 VAL A CG1  1  
ATOM   7363   C CG2  . VAL A 1 476 ? -7.699  -19.580 -31.205 0.02 29.87 ? 469 VAL A CG2  1  
ATOM   7364   H H    . VAL A 1 476 ? -6.386  -19.051 -28.581 0.02 30.14 ? 469 VAL A H    1  
ATOM   7365   H HA   . VAL A 1 476 ? -7.482  -17.115 -30.133 0.02 29.69 ? 469 VAL A HA   1  
ATOM   7366   H HB   . VAL A 1 476 ? -8.740  -19.548 -29.458 0.02 29.49 ? 469 VAL A HB   1  
ATOM   7367   H HG11 . VAL A 1 476 ? -10.349 -19.035 -30.931 0.02 29.09 ? 469 VAL A HG11 1  
ATOM   7368   H HG12 . VAL A 1 476 ? -10.158 -17.702 -30.084 0.02 28.99 ? 469 VAL A HG12 1  
ATOM   7369   H HG13 . VAL A 1 476 ? -9.502  -17.836 -31.519 0.02 29.24 ? 469 VAL A HG13 1  
ATOM   7370   H HG21 . VAL A 1 476 ? -8.253  -20.269 -31.605 0.02 29.82 ? 469 VAL A HG21 1  
ATOM   7371   H HG22 . VAL A 1 476 ? -7.452  -18.927 -31.877 0.02 29.89 ? 469 VAL A HG22 1  
ATOM   7372   H HG23 . VAL A 1 476 ? -6.904  -19.975 -30.822 0.02 30.14 ? 469 VAL A HG23 1  
ATOM   7373   N N    . SER A 1 477 ? -8.083  -15.869 -28.123 0.02 29.41 ? 470 SER A N    1  
ATOM   7374   C CA   . SER A 1 477 ? -8.596  -15.040 -27.039 0.02 29.22 ? 470 SER A CA   1  
ATOM   7375   C C    . SER A 1 477 ? -10.102 -14.793 -27.155 0.02 28.81 ? 470 SER A C    1  
ATOM   7376   O O    . SER A 1 477 ? -10.712 -14.889 -28.224 0.02 28.67 ? 470 SER A O    1  
ATOM   7377   C CB   . SER A 1 477 ? -7.856  -13.707 -27.041 0.02 29.40 ? 470 SER A CB   1  
ATOM   7378   O OG   . SER A 1 477 ? -8.344  -12.843 -26.041 0.02 29.25 ? 470 SER A OG   1  
ATOM   7379   H H    . SER A 1 477 ? -7.592  -15.426 -28.670 0.02 29.55 ? 470 SER A H    1  
ATOM   7380   H HA   . SER A 1 477 ? -8.426  -15.469 -26.188 0.02 29.29 ? 470 SER A HA   1  
ATOM   7381   H HB2  . SER A 1 477 ? -6.915  -13.872 -26.881 0.02 29.69 ? 470 SER A HB2  1  
ATOM   7382   H HB3  . SER A 1 477 ? -7.971  -13.287 -27.906 0.02 29.37 ? 470 SER A HB3  1  
ATOM   7383   H HG   . SER A 1 477 ? -9.140  -12.639 -26.207 0.02 29.03 ? 470 SER A HG   1  
ATOM   7384   N N    . HIS A 1 478 ? -10.709 -14.499 -26.003 0.02 28.66 ? 471 HIS A N    1  
ATOM   7385   C CA   . HIS A 1 478 ? -12.013 -13.861 -25.954 0.02 28.33 ? 471 HIS A CA   1  
ATOM   7386   C C    . HIS A 1 478 ? -12.080 -12.800 -27.050 0.02 28.29 ? 471 HIS A C    1  
ATOM   7387   O O    . HIS A 1 478 ? -11.149 -12.018 -27.204 0.02 28.50 ? 471 HIS A O    1  
ATOM   7388   C CB   . HIS A 1 478 ? -12.196 -13.206 -24.570 0.02 28.31 ? 471 HIS A CB   1  
ATOM   7389   C CG   . HIS A 1 478 ? -13.592 -12.770 -24.263 0.02 28.02 ? 471 HIS A CG   1  
ATOM   7390   N ND1  . HIS A 1 478 ? -14.650 -13.648 -24.226 0.02 27.84 ? 471 HIS A ND1  1  
ATOM   7391   C CD2  . HIS A 1 478 ? -14.093 -11.560 -23.922 0.02 27.94 ? 471 HIS A CD2  1  
ATOM   7392   C CE1  . HIS A 1 478 ? -15.754 -12.989 -23.925 0.02 27.65 ? 471 HIS A CE1  1  
ATOM   7393   N NE2  . HIS A 1 478 ? -15.440 -11.722 -23.713 0.02 27.70 ? 471 HIS A NE2  1  
ATOM   7394   H H    . HIS A 1 478 ? -10.370 -14.658 -25.231 0.02 28.76 ? 471 HIS A H    1  
ATOM   7395   H HA   . HIS A 1 478 ? -12.708 -14.520 -26.090 0.02 28.20 ? 471 HIS A HA   1  
ATOM   7396   H HB2  . HIS A 1 478 ? -11.921 -13.834 -23.886 0.02 28.41 ? 471 HIS A HB2  1  
ATOM   7397   H HB3  . HIS A 1 478 ? -11.643 -12.418 -24.537 0.02 28.43 ? 471 HIS A HB3  1  
ATOM   7398   H HD1  . HIS A 1 478 ? -14.606 -14.486 -24.404 0.02 27.87 ? 471 HIS A HD1  1  
ATOM   7399   H HD2  . HIS A 1 478 ? -13.617 -10.764 -23.851 0.02 28.04 ? 471 HIS A HD2  1  
ATOM   7400   H HE1  . HIS A 1 478 ? -16.602 -13.361 -23.842 0.02 27.53 ? 471 HIS A HE1  1  
ATOM   7401   N N    . THR A 1 479 ? -13.160 -12.818 -27.824 0.02 28.05 ? 472 THR A N    1  
ATOM   7402   C CA   . THR A 1 479 ? -13.503 -11.881 -28.896 0.02 27.99 ? 472 THR A CA   1  
ATOM   7403   C C    . THR A 1 479 ? -12.833 -12.224 -30.223 0.02 28.17 ? 472 THR A C    1  
ATOM   7404   O O    . THR A 1 479 ? -13.134 -11.571 -31.223 0.02 28.14 ? 472 THR A O    1  
ATOM   7405   C CB   . THR A 1 479 ? -13.166 -10.410 -28.573 0.02 28.08 ? 472 THR A CB   1  
ATOM   7406   O OG1  . THR A 1 479 ? -11.766 -10.171 -28.743 0.02 28.40 ? 472 THR A OG1  1  
ATOM   7407   C CG2  . THR A 1 479 ? -13.612 -10.016 -27.153 0.02 27.98 ? 472 THR A CG2  1  
ATOM   7408   H H    . THR A 1 479 ? -13.764 -13.422 -27.739 0.02 27.94 ? 472 THR A H    1  
ATOM   7409   H HA   . THR A 1 479 ? -14.459 -11.928 -29.049 0.02 27.80 ? 472 THR A HA   1  
ATOM   7410   H HB   . THR A 1 479 ? -13.650 -9.848  -29.191 0.02 28.00 ? 472 THR A HB   1  
ATOM   7411   H HG1  . THR A 1 479 ? -11.546 -9.453  -28.382 0.02 28.47 ? 472 THR A HG1  1  
ATOM   7412   H HG21 . THR A 1 479 ? -12.860 -9.660  -26.653 0.02 28.15 ? 472 THR A HG21 1  
ATOM   7413   H HG22 . THR A 1 479 ? -14.308 -9.344  -27.206 0.02 27.85 ? 472 THR A HG22 1  
ATOM   7414   H HG23 . THR A 1 479 ? -13.959 -10.786 -26.675 0.02 27.91 ? 472 THR A HG23 1  
ATOM   7415   N N    . ASP A 1 480 ? -11.932 -13.205 -30.269 0.02 28.38 ? 473 ASP A N    1  
ATOM   7416   C CA   . ASP A 1 480 ? -11.255 -13.547 -31.524 0.02 28.60 ? 473 ASP A CA   1  
ATOM   7417   C C    . ASP A 1 480 ? -12.216 -14.073 -32.579 0.02 28.46 ? 473 ASP A C    1  
ATOM   7418   O O    . ASP A 1 480 ? -11.905 -14.016 -33.776 0.02 28.61 ? 473 ASP A O    1  
ATOM   7419   C CB   . ASP A 1 480 ? -10.179 -14.606 -31.296 0.02 28.90 ? 473 ASP A CB   1  
ATOM   7420   C CG   . ASP A 1 480 ? -8.837  -14.016 -31.001 0.02 29.22 ? 473 ASP A CG   1  
ATOM   7421   O OD1  . ASP A 1 480 ? -8.662  -12.796 -31.187 0.02 29.26 ? 473 ASP A OD1  1  
ATOM   7422   O OD2  . ASP A 1 480 ? -7.937  -14.761 -30.593 0.02 29.48 ? 473 ASP A OD2  1  
ATOM   7423   H H    . ASP A 1 480 ? -11.701 -13.688 -29.600 0.02 28.42 ? 473 ASP A H    1  
ATOM   7424   H HA   . ASP A 1 480 ? -10.831 -12.750 -31.875 0.02 28.71 ? 473 ASP A HA   1  
ATOM   7425   H HB2  . ASP A 1 480 ? -10.439 -15.173 -30.558 0.02 28.82 ? 473 ASP A HB2  1  
ATOM   7426   H HB3  . ASP A 1 480 ? -10.096 -15.136 -32.101 0.02 28.99 ? 473 ASP A HB3  1  
ATOM   7427   N N    . GLU A 1 481 ? -13.366 -14.602 -32.178 0.02 28.20 ? 474 GLU A N    1  
ATOM   7428   C CA   . GLU A 1 481 ? -14.276 -15.161 -33.172 0.02 28.10 ? 474 GLU A CA   1  
ATOM   7429   C C    . GLU A 1 481 ? -15.014 -14.078 -33.953 0.02 27.98 ? 474 GLU A C    1  
ATOM   7430   O O    . GLU A 1 481 ? -15.489 -14.336 -35.063 0.02 28.01 ? 474 GLU A O    1  
ATOM   7431   C CB   . GLU A 1 481 ? -15.289 -16.099 -32.520 0.02 27.93 ? 474 GLU A CB   1  
ATOM   7432   C CG   . GLU A 1 481 ? -16.461 -15.462 -31.762 0.02 27.66 ? 474 GLU A CG   1  
ATOM   7433   C CD   . GLU A 1 481 ? -16.161 -15.170 -30.297 0.02 27.62 ? 474 GLU A CD   1  
ATOM   7434   O OE1  . GLU A 1 481 ? -15.005 -14.837 -29.969 0.02 27.78 ? 474 GLU A OE1  1  
ATOM   7435   O OE2  . GLU A 1 481 ? -17.112 -15.264 -29.505 0.02 27.46 ? 474 GLU A OE2  1  
ATOM   7436   H H    . GLU A 1 481 ? -13.647 -14.629 -31.370 0.02 28.10 ? 474 GLU A H    1  
ATOM   7437   H HA   . GLU A 1 481 ? -13.762 -15.682 -33.805 0.02 28.28 ? 474 GLU A HA   1  
ATOM   7438   H HB2  . GLU A 1 481 ? -15.672 -16.651 -33.218 0.02 27.95 ? 474 GLU A HB2  1  
ATOM   7439   H HB3  . GLU A 1 481 ? -14.812 -16.661 -31.893 0.02 28.01 ? 474 GLU A HB3  1  
ATOM   7440   H HG2  . GLU A 1 481 ? -16.713 -14.628 -32.180 0.02 27.60 ? 474 GLU A HG2  1  
ATOM   7441   H HG3  . GLU A 1 481 ? -17.217 -16.065 -31.786 0.02 27.59 ? 474 GLU A HG3  1  
ATOM   7442   N N    . LEU A 1 482 ? -15.134 -12.875 -33.395 0.02 27.89 ? 475 LEU A N    1  
ATOM   7443   C CA   . LEU A 1 482 ? -16.033 -11.909 -34.002 0.02 27.77 ? 475 LEU A CA   1  
ATOM   7444   C C    . LEU A 1 482 ? -15.564 -11.555 -35.406 0.02 27.98 ? 475 LEU A C    1  
ATOM   7445   O O    . LEU A 1 482 ? -16.364 -11.130 -36.241 0.02 27.94 ? 475 LEU A O    1  
ATOM   7446   C CB   . LEU A 1 482 ? -16.126 -10.661 -33.133 0.02 27.70 ? 475 LEU A CB   1  
ATOM   7447   C CG   . LEU A 1 482 ? -16.809 -10.877 -31.765 0.02 27.50 ? 475 LEU A CG   1  
ATOM   7448   C CD1  . LEU A 1 482 ? -16.664 -9.639  -30.898 0.02 27.50 ? 475 LEU A CD1  1  
ATOM   7449   C CD2  . LEU A 1 482 ? -18.267 -11.209 -31.936 0.02 27.30 ? 475 LEU A CD2  1  
ATOM   7450   H H    . LEU A 1 482 ? -14.703 -12.600 -32.709 0.02 27.92 ? 475 LEU A H    1  
ATOM   7451   H HA   . LEU A 1 482 ? -16.914 -12.301 -34.066 0.02 27.64 ? 475 LEU A HA   1  
ATOM   7452   H HB2  . LEU A 1 482 ? -15.227 -10.335 -32.974 0.02 27.85 ? 475 LEU A HB2  1  
ATOM   7453   H HB3  . LEU A 1 482 ? -16.637 -9.988  -33.606 0.02 27.66 ? 475 LEU A HB3  1  
ATOM   7454   H HG   . LEU A 1 482 ? -16.383 -11.621 -31.312 0.02 27.54 ? 475 LEU A HG   1  
ATOM   7455   H HD11 . LEU A 1 482 ? -17.433 -9.064  -31.035 0.02 27.40 ? 475 LEU A HD11 1  
ATOM   7456   H HD12 . LEU A 1 482 ? -16.622 -9.904  -29.963 0.02 27.48 ? 475 LEU A HD12 1  
ATOM   7457   H HD13 . LEU A 1 482 ? -15.848 -9.175  -31.145 0.02 27.66 ? 475 LEU A HD13 1  
ATOM   7458   H HD21 . LEU A 1 482 ? -18.690 -11.222 -31.065 0.02 27.20 ? 475 LEU A HD21 1  
ATOM   7459   H HD22 . LEU A 1 482 ? -18.679 -10.527 -32.483 0.02 27.28 ? 475 LEU A HD22 1  
ATOM   7460   H HD23 . LEU A 1 482 ? -18.359 -12.074 -32.356 0.02 27.32 ? 475 LEU A HD23 1  
ATOM   7461   N N    . THR A 1 483 ? -14.272 -11.742 -35.651 0.02 28.25 ? 476 THR A N    1  
ATOM   7462   C CA   . THR A 1 483 ? -13.629 -11.429 -36.919 0.02 28.53 ? 476 THR A CA   1  
ATOM   7463   C C    . THR A 1 483 ? -14.210 -12.252 -38.052 0.02 28.55 ? 476 THR A C    1  
ATOM   7464   O O    . THR A 1 483 ? -14.115 -11.863 -39.219 0.02 28.74 ? 476 THR A O    1  
ATOM   7465   C CB   . THR A 1 483 ? -12.150 -11.735 -36.769 0.02 28.84 ? 476 THR A CB   1  
ATOM   7466   O OG1  . THR A 1 483 ? -11.607 -10.969 -35.682 0.02 28.86 ? 476 THR A OG1  1  
ATOM   7467   C CG2  . THR A 1 483 ? -11.390 -11.525 -38.044 0.02 29.20 ? 476 THR A CG2  1  
ATOM   7468   H H    . THR A 1 483 ? -13.726 -12.075 -35.083 0.02 28.31 ? 476 THR A H    1  
ATOM   7469   H HA   . THR A 1 483 ? -13.735 -10.488 -37.128 0.02 28.55 ? 476 THR A HA   1  
ATOM   7470   H HB   . THR A 1 483 ? -12.070 -12.677 -36.543 0.02 28.83 ? 476 THR A HB   1  
ATOM   7471   H HG1  . THR A 1 483 ? -12.042 -11.123 -34.987 0.02 28.68 ? 476 THR A HG1  1  
ATOM   7472   H HG21 . THR A 1 483 ? -10.441 -11.622 -37.875 0.02 29.42 ? 476 THR A HG21 1  
ATOM   7473   H HG22 . THR A 1 483 ? -11.660 -12.186 -38.694 0.02 29.21 ? 476 THR A HG22 1  
ATOM   7474   H HG23 . THR A 1 483 ? -11.563 -10.643 -38.402 0.02 29.22 ? 476 THR A HG23 1  
ATOM   7475   N N    . TYR A 1 484 ? -14.749 -13.421 -37.743 0.02 28.42 ? 477 TYR A N    1  
ATOM   7476   C CA   . TYR A 1 484 ? -15.276 -14.304 -38.779 0.02 28.48 ? 477 TYR A CA   1  
ATOM   7477   C C    . TYR A 1 484 ? -16.788 -14.222 -38.875 0.02 28.24 ? 477 TYR A C    1  
ATOM   7478   O O    . TYR A 1 484 ? -17.389 -14.925 -39.675 0.02 28.29 ? 477 TYR A O    1  
ATOM   7479   C CB   . TYR A 1 484 ? -14.774 -15.736 -38.531 0.02 28.61 ? 477 TYR A CB   1  
ATOM   7480   C CG   . TYR A 1 484 ? -13.289 -15.720 -38.287 0.02 28.87 ? 477 TYR A CG   1  
ATOM   7481   C CD1  . TYR A 1 484 ? -12.360 -15.672 -39.346 0.02 29.23 ? 477 TYR A CD1  1  
ATOM   7482   C CD2  . TYR A 1 484 ? -12.797 -15.670 -36.988 0.02 28.80 ? 477 TYR A CD2  1  
ATOM   7483   C CE1  . TYR A 1 484 ? -11.006 -15.596 -39.087 0.02 29.51 ? 477 TYR A CE1  1  
ATOM   7484   C CE2  . TYR A 1 484 ? -11.472 -15.606 -36.734 0.02 29.08 ? 477 TYR A CE2  1  
ATOM   7485   C CZ   . TYR A 1 484 ? -10.575 -15.570 -37.758 0.02 29.43 ? 477 TYR A CZ   1  
ATOM   7486   O OH   . TYR A 1 484 ? -9.238  -15.505 -37.439 0.02 29.74 ? 477 TYR A OH   1  
ATOM   7487   H H    . TYR A 1 484 ? -14.823 -13.725 -36.948 0.02 28.31 ? 477 TYR A H    1  
ATOM   7488   H HA   . TYR A 1 484 ? -14.925 -14.024 -39.637 0.02 28.67 ? 477 TYR A HA   1  
ATOM   7489   H HB2  . TYR A 1 484 ? -15.209 -16.084 -37.739 0.02 28.44 ? 477 TYR A HB2  1  
ATOM   7490   H HB3  . TYR A 1 484 ? -14.958 -16.298 -39.298 0.02 28.71 ? 477 TYR A HB3  1  
ATOM   7491   H HD1  . TYR A 1 484 ? -12.659 -15.684 -40.223 0.02 29.30 ? 477 TYR A HD1  1  
ATOM   7492   H HD2  . TYR A 1 484 ? -13.395 -15.689 -36.277 0.02 28.59 ? 477 TYR A HD2  1  
ATOM   7493   H HE1  . TYR A 1 484 ? -10.393 -15.579 -39.782 0.02 29.77 ? 477 TYR A HE1  1  
ATOM   7494   H HE2  . TYR A 1 484 ? -11.172 -15.584 -35.857 0.02 29.05 ? 477 TYR A HE2  1  
ATOM   7495   H HH   . TYR A 1 484 ? -8.999  -16.212 -37.052 0.02 29.79 ? 477 TYR A HH   1  
ATOM   7496   N N    . PHE A 1 485 ? -17.412 -13.325 -38.114 0.02 28.01 ? 478 PHE A N    1  
ATOM   7497   C CA   . PHE A 1 485 ? -18.838 -13.073 -38.184 0.02 27.82 ? 478 PHE A CA   1  
ATOM   7498   C C    . PHE A 1 485 ? -19.182 -11.726 -38.792 0.02 27.85 ? 478 PHE A C    1  
ATOM   7499   O O    . PHE A 1 485 ? -20.203 -11.616 -39.460 0.02 27.83 ? 478 PHE A O    1  
ATOM   7500   C CB   . PHE A 1 485 ? -19.471 -13.134 -36.783 0.02 27.58 ? 478 PHE A CB   1  
ATOM   7501   C CG   . PHE A 1 485 ? -19.637 -14.493 -36.282 0.02 27.56 ? 478 PHE A CG   1  
ATOM   7502   C CD1  . PHE A 1 485 ? -20.703 -15.275 -36.696 0.02 27.54 ? 478 PHE A CD1  1  
ATOM   7503   C CD2  . PHE A 1 485 ? -18.710 -15.031 -35.429 0.02 27.61 ? 478 PHE A CD2  1  
ATOM   7504   C CE1  . PHE A 1 485 ? -20.855 -16.570 -36.219 0.02 27.56 ? 478 PHE A CE1  1  
ATOM   7505   C CE2  . PHE A 1 485 ? -18.872 -16.312 -34.941 0.02 27.62 ? 478 PHE A CE2  1  
ATOM   7506   C CZ   . PHE A 1 485 ? -19.940 -17.077 -35.356 0.02 27.61 ? 478 PHE A CZ   1  
ATOM   7507   H H    . PHE A 1 485 ? -17.009 -12.834 -37.542 0.02 27.99 ? 478 PHE A H    1  
ATOM   7508   H HA   . PHE A 1 485 ? -19.258 -13.762 -38.718 0.02 27.87 ? 478 PHE A HA   1  
ATOM   7509   H HB2  . PHE A 1 485 ? -18.904 -12.661 -36.155 0.02 27.57 ? 478 PHE A HB2  1  
ATOM   7510   H HB3  . PHE A 1 485 ? -20.346 -12.721 -36.817 0.02 27.48 ? 478 PHE A HB3  1  
ATOM   7511   H HD1  . PHE A 1 485 ? -21.334 -14.922 -37.280 0.02 27.53 ? 478 PHE A HD1  1  
ATOM   7512   H HD2  . PHE A 1 485 ? -17.990 -14.516 -35.146 0.02 27.65 ? 478 PHE A HD2  1  
ATOM   7513   H HE1  . PHE A 1 485 ? -21.576 -17.090 -36.485 0.02 27.58 ? 478 PHE A HE1  1  
ATOM   7514   H HE2  . PHE A 1 485 ? -18.243 -16.671 -34.357 0.02 27.67 ? 478 PHE A HE2  1  
ATOM   7515   H HZ   . PHE A 1 485 ? -20.037 -17.945 -35.040 0.02 27.65 ? 478 PHE A HZ   1  
ATOM   7516   N N    . PHE A 1 486 ? -18.358 -10.708 -38.534 0.02 27.92 ? 479 PHE A N    1  
ATOM   7517   C CA   . PHE A 1 486 ? -18.700 -9.323  -38.815 0.02 27.94 ? 479 PHE A CA   1  
ATOM   7518   C C    . PHE A 1 486 ? -17.550 -8.621  -39.516 0.02 28.24 ? 479 PHE A C    1  
ATOM   7519   O O    . PHE A 1 486 ? -16.383 -8.831  -39.202 0.02 28.37 ? 479 PHE A O    1  
ATOM   7520   C CB   . PHE A 1 486 ? -19.017 -8.507  -37.554 0.02 27.76 ? 479 PHE A CB   1  
ATOM   7521   C CG   . PHE A 1 486 ? -20.180 -9.021  -36.798 0.02 27.52 ? 479 PHE A CG   1  
ATOM   7522   C CD1  . PHE A 1 486 ? -21.463 -8.821  -37.237 0.02 27.45 ? 479 PHE A CD1  1  
ATOM   7523   C CD2  . PHE A 1 486 ? -19.975 -9.774  -35.650 0.02 27.40 ? 479 PHE A CD2  1  
ATOM   7524   C CE1  . PHE A 1 486 ? -22.532 -9.354  -36.543 0.02 27.27 ? 479 PHE A CE1  1  
ATOM   7525   C CE2  . PHE A 1 486 ? -21.023 -10.281 -34.964 0.02 27.22 ? 479 PHE A CE2  1  
ATOM   7526   C CZ   . PHE A 1 486 ? -22.298 -10.084 -35.403 0.02 27.16 ? 479 PHE A CZ   1  
ATOM   7527   H H    . PHE A 1 486 ? -17.576 -10.805 -38.199 0.02 27.98 ? 479 PHE A H    1  
ATOM   7528   H HA   . PHE A 1 486 ? -19.482 -9.300  -39.384 0.02 27.93 ? 479 PHE A HA   1  
ATOM   7529   H HB2  . PHE A 1 486 ? -18.236 -8.529  -36.984 0.02 27.80 ? 479 PHE A HB2  1  
ATOM   7530   H HB3  . PHE A 1 486 ? -19.210 -7.594  -37.812 0.02 27.82 ? 479 PHE A HB3  1  
ATOM   7531   H HD1  . PHE A 1 486 ? -21.619 -8.335  -38.009 0.02 27.55 ? 479 PHE A HD1  1  
ATOM   7532   H HD2  . PHE A 1 486 ? -19.109 -9.923  -35.351 0.02 27.46 ? 479 PHE A HD2  1  
ATOM   7533   H HE1  . PHE A 1 486 ? -23.402 -9.210  -36.835 0.02 27.26 ? 479 PHE A HE1  1  
ATOM   7534   H HE2  . PHE A 1 486 ? -20.874 -10.776 -34.197 0.02 27.16 ? 479 PHE A HE2  1  
ATOM   7535   H HZ   . PHE A 1 486 ? -23.010 -10.434 -34.918 0.02 27.07 ? 479 PHE A HZ   1  
ATOM   7536   N N    . TRP A 1 487 ? -17.908 -7.762  -40.461 0.02 28.38 ? 480 TRP A N    1  
ATOM   7537   C CA   . TRP A 1 487 ? -16.928 -6.845  -41.020 0.02 28.69 ? 480 TRP A CA   1  
ATOM   7538   C C    . TRP A 1 487 ? -16.554 -5.778  -39.988 0.02 28.67 ? 480 TRP A C    1  
ATOM   7539   O O    . TRP A 1 487 ? -17.394 -5.298  -39.227 0.02 28.45 ? 480 TRP A O    1  
ATOM   7540   C CB   . TRP A 1 487 ? -17.481 -6.188  -42.301 0.02 28.87 ? 480 TRP A CB   1  
ATOM   7541   C CG   . TRP A 1 487 ? -16.596 -5.102  -42.860 0.02 29.23 ? 480 TRP A CG   1  
ATOM   7542   C CD1  . TRP A 1 487 ? -16.668 -3.744  -42.612 0.02 29.31 ? 480 TRP A CD1  1  
ATOM   7543   C CD2  . TRP A 1 487 ? -15.477 -5.286  -43.715 0.02 29.60 ? 480 TRP A CD2  1  
ATOM   7544   N NE1  . TRP A 1 487 ? -15.670 -3.089  -43.293 0.02 29.72 ? 480 TRP A NE1  1  
ATOM   7545   C CE2  . TRP A 1 487 ? -14.919 -4.019  -43.964 0.02 29.90 ? 480 TRP A CE2  1  
ATOM   7546   C CE3  . TRP A 1 487 ? -14.888 -6.407  -44.299 0.02 29.74 ? 480 TRP A CE3  1  
ATOM   7547   C CZ2  . TRP A 1 487 ? -13.810 -3.848  -44.780 0.02 30.35 ? 480 TRP A CZ2  1  
ATOM   7548   C CZ3  . TRP A 1 487 ? -13.796 -6.234  -45.096 0.02 30.17 ? 480 TRP A CZ3  1  
ATOM   7549   C CH2  . TRP A 1 487 ? -13.263 -4.971  -45.332 0.02 30.47 ? 480 TRP A CH2  1  
ATOM   7550   H H    . TRP A 1 487 ? -18.699 -7.697  -40.787 0.02 28.32 ? 480 TRP A H    1  
ATOM   7551   H HA   . TRP A 1 487 ? -16.127 -7.340  -41.254 0.02 28.83 ? 480 TRP A HA   1  
ATOM   7552   H HB2  . TRP A 1 487 ? -17.553 -6.872  -42.981 0.02 28.94 ? 480 TRP A HB2  1  
ATOM   7553   H HB3  . TRP A 1 487 ? -18.354 -5.812  -42.114 0.02 28.73 ? 480 TRP A HB3  1  
ATOM   7554   H HD1  . TRP A 1 487 ? -17.306 -3.329  -42.077 0.02 29.15 ? 480 TRP A HD1  1  
ATOM   7555   H HE1  . TRP A 1 487 ? -15.524 -2.244  -43.285 0.02 29.86 ? 480 TRP A HE1  1  
ATOM   7556   H HE3  . TRP A 1 487 ? -15.233 -7.254  -44.145 0.02 29.57 ? 480 TRP A HE3  1  
ATOM   7557   H HZ2  . TRP A 1 487 ? -13.455 -3.004  -44.941 0.02 30.57 ? 480 TRP A HZ2  1  
ATOM   7558   H HZ3  . TRP A 1 487 ? -13.399 -6.977  -45.489 0.02 30.29 ? 480 TRP A HZ3  1  
ATOM   7559   H HH2  . TRP A 1 487 ? -12.521 -4.891  -45.886 0.02 30.79 ? 480 TRP A HH2  1  
ATOM   7560   N N    . ASN A 1 488 ? -15.290 -5.391  -39.989 0.02 28.94 ? 481 ASN A N    1  
ATOM   7561   C CA   . ASN A 1 488 ? -14.853 -4.227  -39.242 0.02 29.03 ? 481 ASN A CA   1  
ATOM   7562   C C    . ASN A 1 488 ? -13.830 -3.442  -40.058 0.02 29.48 ? 481 ASN A C    1  
ATOM   7563   O O    . ASN A 1 488 ? -13.224 -3.954  -40.999 0.02 29.72 ? 481 ASN A O    1  
ATOM   7564   C CB   . ASN A 1 488 ? -14.260 -4.635  -37.888 0.02 28.92 ? 481 ASN A CB   1  
ATOM   7565   C CG   . ASN A 1 488 ? -12.916 -5.328  -38.029 0.02 29.17 ? 481 ASN A CG   1  
ATOM   7566   O OD1  . ASN A 1 488 ? -11.886 -4.670  -38.148 0.02 29.52 ? 481 ASN A OD1  1  
ATOM   7567   N ND2  . ASN A 1 488 ? -12.917 -6.653  -37.963 0.02 29.04 ? 481 ASN A ND2  1  
ATOM   7568   H H    . ASN A 1 488 ? -14.663 -5.790  -40.418 0.02 29.10 ? 481 ASN A H    1  
ATOM   7569   H HA   . ASN A 1 488 ? -15.614 -3.648  -39.085 0.02 28.92 ? 481 ASN A HA   1  
ATOM   7570   H HB2  . ASN A 1 488 ? -14.145 -3.844  -37.340 0.02 28.97 ? 481 ASN A HB2  1  
ATOM   7571   H HB3  . ASN A 1 488 ? -14.865 -5.258  -37.457 0.02 28.67 ? 481 ASN A HB3  1  
ATOM   7572   H HD21 . ASN A 1 488 ? -12.194 -7.093  -38.108 0.02 29.20 ? 481 ASN A HD21 1  
ATOM   7573   H HD22 . ASN A 1 488 ? -13.640 -7.072  -37.773 0.02 28.82 ? 481 ASN A HD22 1  
ATOM   7574   N N    . GLN A 1 489 ? -13.626 -2.191  -39.666 0.02 29.63 ? 482 GLN A N    1  
ATOM   7575   C CA   . GLN A 1 489 ? -12.793 -1.293  -40.468 0.02 30.10 ? 482 GLN A CA   1  
ATOM   7576   C C    . GLN A 1 489 ? -11.319 -1.689  -40.496 0.02 30.43 ? 482 GLN A C    1  
ATOM   7577   O O    . GLN A 1 489 ? -10.562 -1.113  -41.287 0.02 30.87 ? 482 GLN A O    1  
ATOM   7578   C CB   . GLN A 1 489 ? -12.955 0.157   -39.977 0.02 30.22 ? 482 GLN A CB   1  
ATOM   7579   C CG   . GLN A 1 489 ? -12.257 0.490   -38.657 0.02 30.24 ? 482 GLN A CG   1  
ATOM   7580   C CD   . GLN A 1 489 ? -12.289 1.997   -38.321 0.02 30.47 ? 482 GLN A CD   1  
ATOM   7581   O OE1  . GLN A 1 489 ? -11.375 2.519   -37.678 0.02 30.73 ? 482 GLN A OE1  1  
ATOM   7582   N NE2  . GLN A 1 489 ? -13.347 2.681   -38.736 0.02 30.41 ? 482 GLN A NE2  1  
ATOM   7583   H H    . GLN A 1 489 ? -13.958 -1.842  -38.959 0.02 29.49 ? 482 GLN A H    1  
ATOM   7584   H HA   . GLN A 1 489 ? -13.110 -1.325  -41.383 0.02 30.18 ? 482 GLN A HA   1  
ATOM   7585   H HB2  . GLN A 1 489 ? -12.593 0.749   -40.654 0.02 30.54 ? 482 GLN A HB2  1  
ATOM   7586   H HB3  . GLN A 1 489 ? -13.900 0.336   -39.864 0.02 30.01 ? 482 GLN A HB3  1  
ATOM   7587   H HG2  . GLN A 1 489 ? -12.701 0.012   -37.940 0.02 29.94 ? 482 GLN A HG2  1  
ATOM   7588   H HG3  . GLN A 1 489 ? -11.327 0.219   -38.705 0.02 30.45 ? 482 GLN A HG3  1  
ATOM   7589   H HE21 . GLN A 1 489 ? -13.513 3.457   -38.408 0.02 30.47 ? 482 GLN A HE21 1  
ATOM   7590   H HE22 . GLN A 1 489 ? -13.875 2.347   -39.323 0.02 30.31 ? 482 GLN A HE22 1  
ATOM   7591   N N    . LEU A 1 490 ? -10.885 -2.663  -39.701 0.02 30.27 ? 483 LEU A N    1  
ATOM   7592   C CA   . LEU A 1 490 ? -9.562  -3.244  -39.841 0.02 30.59 ? 483 LEU A CA   1  
ATOM   7593   C C    . LEU A 1 490 ? -9.538  -4.442  -40.789 0.02 30.61 ? 483 LEU A C    1  
ATOM   7594   O O    . LEU A 1 490 ? -8.475  -5.015  -41.019 0.02 30.91 ? 483 LEU A O    1  
ATOM   7595   C CB   . LEU A 1 490 ? -9.021  -3.677  -38.476 0.02 30.49 ? 483 LEU A CB   1  
ATOM   7596   C CG   . LEU A 1 490 ? -9.004  -2.595  -37.395 0.02 30.49 ? 483 LEU A CG   1  
ATOM   7597   C CD1  . LEU A 1 490 ? -8.331  -3.098  -36.086 0.02 30.47 ? 483 LEU A CD1  1  
ATOM   7598   C CD2  . LEU A 1 490 ? -8.337  -1.329  -37.915 0.02 30.96 ? 483 LEU A CD2  1  
ATOM   7599   H H    . LEU A 1 490 ? -11.347 -3.007  -39.065 0.02 29.99 ? 483 LEU A H    1  
ATOM   7600   H HA   . LEU A 1 490 ? -8.965  -2.569  -40.200 0.02 30.93 ? 483 LEU A HA   1  
ATOM   7601   H HB2  . LEU A 1 490 ? -9.557  -4.414  -38.149 0.02 30.19 ? 483 LEU A HB2  1  
ATOM   7602   H HB3  . LEU A 1 490 ? -8.108  -3.976  -38.604 0.02 30.76 ? 483 LEU A HB3  1  
ATOM   7603   H HG   . LEU A 1 490 ? -9.921  -2.368  -37.180 0.02 30.21 ? 483 LEU A HG   1  
ATOM   7604   H HD11 . LEU A 1 490 ? -7.539  -3.610  -36.310 0.02 30.68 ? 483 LEU A HD11 1  
ATOM   7605   H HD12 . LEU A 1 490 ? -8.084  -2.331  -35.548 0.02 30.60 ? 483 LEU A HD12 1  
ATOM   7606   H HD13 . LEU A 1 490 ? -8.959  -3.655  -35.604 0.02 30.14 ? 483 LEU A HD13 1  
ATOM   7607   H HD21 . LEU A 1 490 ? -7.997  -0.814  -37.170 0.02 31.07 ? 483 LEU A HD21 1  
ATOM   7608   H HD22 . LEU A 1 490 ? -7.608  -1.579  -38.503 0.02 31.24 ? 483 LEU A HD22 1  
ATOM   7609   H HD23 . LEU A 1 490 ? -8.995  -0.809  -38.401 0.02 30.90 ? 483 LEU A HD23 1  
ATOM   7610   N N    . ALA A 1 491 ? -10.678 -4.851  -41.312 0.02 30.33 ? 484 ALA A N    1  
ATOM   7611   C CA   . ALA A 1 491 ? -10.712 -6.048  -42.133 0.02 30.35 ? 484 ALA A CA   1  
ATOM   7612   C C    . ALA A 1 491 ? -10.262 -5.749  -43.570 0.02 30.79 ? 484 ALA A C    1  
ATOM   7613   O O    . ALA A 1 491 ? -9.908  -4.625  -43.927 0.02 31.07 ? 484 ALA A O    1  
ATOM   7614   C CB   . ALA A 1 491 ? -12.111 -6.644  -42.143 0.02 29.92 ? 484 ALA A CB   1  
ATOM   7615   H H    . ALA A 1 491 ? -11.436 -4.461  -41.206 0.02 30.14 ? 484 ALA A H    1  
ATOM   7616   H HA   . ALA A 1 491 ? -10.106 -6.704  -41.759 0.02 30.40 ? 484 ALA A HA   1  
ATOM   7617   H HB1  . ALA A 1 491 ? -12.084 -7.512  -42.573 0.02 29.95 ? 484 ALA A HB1  1  
ATOM   7618   H HB2  . ALA A 1 491 ? -12.413 -6.738  -41.228 0.02 29.67 ? 484 ALA A HB2  1  
ATOM   7619   H HB3  . ALA A 1 491 ? -12.705 -6.047  -42.617 0.02 29.91 ? 484 ALA A HB3  1  
ATOM   7620   N N    . LYS A 1 492 ? -10.284 -6.787  -44.392 0.02 30.88 ? 485 LYS A N    1  
ATOM   7621   C CA   . LYS A 1 492 ? -9.974  -6.663  -45.811 0.02 31.30 ? 485 LYS A CA   1  
ATOM   7622   C C    . LYS A 1 492 ? -10.459 -7.911  -46.521 0.02 31.24 ? 485 LYS A C    1  
ATOM   7623   O O    . LYS A 1 492 ? -10.887 -8.881  -45.893 0.02 30.93 ? 485 LYS A O    1  
ATOM   7624   C CB   . LYS A 1 492 ? -8.476  -6.453  -46.072 0.02 31.84 ? 485 LYS A CB   1  
ATOM   7625   C CG   . LYS A 1 492 ? -7.509  -7.593  -45.659 0.02 31.97 ? 485 LYS A CG   1  
ATOM   7626   C CD   . LYS A 1 492 ? -6.147  -6.970  -45.171 0.02 32.09 ? 485 LYS A CD   1  
ATOM   7627   C CE   . LYS A 1 492 ? -5.168  -7.942  -44.469 0.02 32.21 ? 485 LYS A CE   1  
ATOM   7628   N NZ   . LYS A 1 492 ? -4.504  -7.352  -43.204 0.02 32.42 ? 485 LYS A NZ   1  
ATOM   7629   H H    . LYS A 1 492 ? -10.479 -7.584  -44.148 0.02 30.72 ? 485 LYS A H    1  
ATOM   7630   H HA   . LYS A 1 492 ? -10.460 -5.908  -46.178 0.02 31.30 ? 485 LYS A HA   1  
ATOM   7631   H HB2  . LYS A 1 492 ? -8.357  -6.306  -47.024 0.02 32.13 ? 485 LYS A HB2  1  
ATOM   7632   H HB3  . LYS A 1 492 ? -8.202  -5.657  -45.591 0.02 31.89 ? 485 LYS A HB3  1  
ATOM   7633   H HG2  . LYS A 1 492 ? -7.902  -8.099  -44.933 0.02 31.67 ? 485 LYS A HG2  1  
ATOM   7634   H HG3  . LYS A 1 492 ? -7.343  -8.172  -46.418 0.02 32.31 ? 485 LYS A HG3  1  
ATOM   7635   H HD2  . LYS A 1 492 ? -5.685  -6.587  -45.931 0.02 32.44 ? 485 LYS A HD2  1  
ATOM   7636   H HD3  . LYS A 1 492 ? -6.346  -6.270  -44.532 0.02 31.78 ? 485 LYS A HD3  1  
ATOM   7637   H HE2  . LYS A 1 492 ? -5.647  -8.743  -44.206 0.02 31.87 ? 485 LYS A HE2  1  
ATOM   7638   H HE3  . LYS A 1 492 ? -4.461  -8.173  -45.091 0.02 32.52 ? 485 LYS A HE3  1  
ATOM   7639   H HZ1  . LYS A 1 492 ? -3.633  -7.534  -43.200 0.02 32.69 ? 485 LYS A HZ1  1  
ATOM   7640   H HZ2  . LYS A 1 492 ? -4.611  -6.468  -43.182 0.02 32.59 ? 485 LYS A HZ2  1  
ATOM   7641   H HZ3  . LYS A 1 492 ? -4.871  -7.702  -42.474 0.02 32.13 ? 485 LYS A HZ3  1  
ATOM   7642   N N    . ARG A 1 493 ? -10.414 -7.852  -47.850 0.02 31.60 ? 486 ARG A N    1  
ATOM   7643   C CA   . ARG A 1 493 ? -10.890 -8.946  -48.673 0.02 31.61 ? 486 ARG A CA   1  
ATOM   7644   C C    . ARG A 1 493 ? -9.866  -10.074 -48.695 0.02 31.84 ? 486 ARG A C    1  
ATOM   7645   O O    . ARG A 1 493 ? -8.770  -9.920  -49.241 0.02 32.34 ? 486 ARG A O    1  
ATOM   7646   C CB   . ARG A 1 493 ? -11.156 -8.447  -50.104 0.02 31.97 ? 486 ARG A CB   1  
ATOM   7647   C CG   . ARG A 1 493 ? -11.507 -9.561  -51.051 0.02 32.06 ? 486 ARG A CG   1  
ATOM   7648   C CD   . ARG A 1 493 ? -12.146 -9.024  -52.331 0.02 32.35 ? 486 ARG A CD   1  
ATOM   7649   N NE   . ARG A 1 493 ? -13.372 -9.748  -52.668 0.02 32.10 ? 486 ARG A NE   1  
ATOM   7650   C CZ   . ARG A 1 493 ? -13.977 -9.674  -53.854 0.02 32.38 ? 486 ARG A CZ   1  
ATOM   7651   N NH1  . ARG A 1 493 ? -13.484 -8.905  -54.803 0.02 32.90 ? 486 ARG A NH1  1  
ATOM   7652   N NH2  . ARG A 1 493 ? -15.082 -10.362 -54.093 0.02 32.19 ? 486 ARG A NH2  1  
ATOM   7653   H H    . ARG A 1 493 ? -10.108 -7.184  -48.294 0.02 31.86 ? 486 ARG A H    1  
ATOM   7654   H HA   . ARG A 1 493 ? -11.720 -9.288  -48.313 0.02 31.27 ? 486 ARG A HA   1  
ATOM   7655   H HB2  . ARG A 1 493 ? -11.888 -7.816  -50.095 0.02 31.83 ? 486 ARG A HB2  1  
ATOM   7656   H HB3  . ARG A 1 493 ? -10.358 -8.014  -50.438 0.02 32.33 ? 486 ARG A HB3  1  
ATOM   7657   H HG2  . ARG A 1 493 ? -10.697 -10.040 -51.286 0.02 32.29 ? 486 ARG A HG2  1  
ATOM   7658   H HG3  . ARG A 1 493 ? -12.135 -10.162 -50.626 0.02 31.72 ? 486 ARG A HG3  1  
ATOM   7659   H HD2  . ARG A 1 493 ? -12.361 -8.087  -52.223 0.02 32.37 ? 486 ARG A HD2  1  
ATOM   7660   H HD3  . ARG A 1 493 ? -11.519 -9.137  -53.064 0.02 32.73 ? 486 ARG A HD3  1  
ATOM   7661   H HE   . ARG A 1 493 ? -13.755 -10.201 -52.045 0.02 31.77 ? 486 ARG A HE   1  
ATOM   7662   H HH11 . ARG A 1 493 ? -12.766 -8.455  -54.665 0.02 33.06 ? 486 ARG A HH11 1  
ATOM   7663   H HH12 . ARG A 1 493 ? -13.879 -8.861  -55.565 0.02 33.10 ? 486 ARG A HH12 1  
ATOM   7664   H HH21 . ARG A 1 493 ? -15.419 -10.864 -53.483 0.02 31.88 ? 486 ARG A HH21 1  
ATOM   7665   H HH22 . ARG A 1 493 ? -15.466 -10.303 -54.859 0.02 32.40 ? 486 ARG A HH22 1  
ATOM   7666   N N    . MET A 1 494 ? -10.215 -11.161 -48.161 0.02 31.56 ? 487 MET A N    1  
ATOM   7667   C CA   . MET A 1 494 ? -9.353  -12.322 -48.233 0.02 31.81 ? 487 MET A CA   1  
ATOM   7668   C C    . MET A 1 494 ? -9.695  -13.173 -49.452 0.02 32.05 ? 487 MET A C    1  
ATOM   7669   O O    . MET A 1 494 ? -10.830 -13.137 -49.943 0.02 31.88 ? 487 MET A O    1  
ATOM   7670   C CB   . MET A 1 494 ? -9.493  -13.205 -46.991 0.02 31.44 ? 487 MET A CB   1  
ATOM   7671   C CG   . MET A 1 494 ? -9.338  -12.449 -45.694 0.02 31.17 ? 487 MET A CG   1  
ATOM   7672   S SD   . MET A 1 494 ? -7.756  -11.612 -45.450 0.02 31.62 ? 487 MET A SD   1  
ATOM   7673   C CE   . MET A 1 494 ? -6.665  -13.024 -45.391 0.02 31.93 ? 487 MET A CE   1  
ATOM   7674   H H    . MET A 1 494 ? -10.950 -11.282 -47.733 0.02 31.24 ? 487 MET A H    1  
ATOM   7675   H HA   . MET A 1 494 ? -8.439  -12.010 -48.275 0.02 32.10 ? 487 MET A HA   1  
ATOM   7676   H HB2  . MET A 1 494 ? -10.375 -13.609 -46.999 0.02 31.20 ? 487 MET A HB2  1  
ATOM   7677   H HB3  . MET A 1 494 ? -8.819  -13.903 -47.023 0.02 31.65 ? 487 MET A HB3  1  
ATOM   7678   H HG2  . MET A 1 494 ? -10.031 -11.774 -45.655 0.02 30.98 ? 487 MET A HG2  1  
ATOM   7679   H HG3  . MET A 1 494 ? -9.450  -13.075 -44.965 0.02 30.97 ? 487 MET A HG3  1  
ATOM   7680   H HE1  . MET A 1 494 ? -5.766  -12.725 -45.184 0.02 32.20 ? 487 MET A HE1  1  
ATOM   7681   H HE2  . MET A 1 494 ? -6.981  -13.636 -44.710 0.02 31.67 ? 487 MET A HE2  1  
ATOM   7682   H HE3  . MET A 1 494 ? -6.680  -13.465 -46.253 0.02 32.13 ? 487 MET A HE3  1  
ATOM   7683   N N    . PRO A 1 495 ? -8.741  -13.984 -49.904 0.02 32.47 ? 488 PRO A N    1  
ATOM   7684   C CA   . PRO A 1 495 ? -9.015  -14.902 -51.011 0.02 32.71 ? 488 PRO A CA   1  
ATOM   7685   C C    . PRO A 1 495 ? -9.852  -16.065 -50.516 0.02 32.34 ? 488 PRO A C    1  
ATOM   7686   O O    . PRO A 1 495 ? -9.733  -16.493 -49.361 0.02 32.04 ? 488 PRO A O    1  
ATOM   7687   C CB   . PRO A 1 495 ? -7.617  -15.361 -51.445 0.02 33.28 ? 488 PRO A CB   1  
ATOM   7688   C CG   . PRO A 1 495 ? -6.649  -14.491 -50.739 0.02 33.39 ? 488 PRO A CG   1  
ATOM   7689   C CD   . PRO A 1 495 ? -7.347  -14.106 -49.460 0.02 32.79 ? 488 PRO A CD   1  
ATOM   7690   H HA   . PRO A 1 495 ? -9.462  -14.446 -51.742 0.02 32.81 ? 488 PRO A HA   1  
ATOM   7691   H HB2  . PRO A 1 495 ? -7.488  -16.274 -51.153 0.02 33.24 ? 488 PRO A HB2  1  
ATOM   7692   H HB3  . PRO A 1 495 ? -7.519  -15.279 -52.405 0.02 33.61 ? 488 PRO A HB3  1  
ATOM   7693   H HG2  . PRO A 1 495 ? -5.837  -14.989 -50.557 0.02 33.62 ? 488 PRO A HG2  1  
ATOM   7694   H HG3  . PRO A 1 495 ? -6.463  -13.710 -51.279 0.02 33.63 ? 488 PRO A HG3  1  
ATOM   7695   H HD2  . PRO A 1 495 ? -7.253  -14.814 -48.804 0.02 32.63 ? 488 PRO A HD2  1  
ATOM   7696   H HD3  . PRO A 1 495 ? -7.002  -13.263 -49.135 0.02 32.83 ? 488 PRO A HD3  1  
ATOM   7697   N N    . LYS A 1 496 ? -10.718 -16.588 -51.380 0.02 32.39 ? 489 LYS A N    1  
ATOM   7698   C CA   . LYS A 1 496 ? -11.712 -17.477 -50.798 0.02 32.02 ? 489 LYS A CA   1  
ATOM   7699   C C    . LYS A 1 496 ? -11.173 -18.897 -50.625 0.02 32.22 ? 489 LYS A C    1  
ATOM   7700   O O    . LYS A 1 496 ? -11.831 -19.738 -49.996 0.02 31.96 ? 489 LYS A O    1  
ATOM   7701   C CB   . LYS A 1 496 ? -13.004 -17.364 -51.598 0.02 31.94 ? 489 LYS A CB   1  
ATOM   7702   C CG   . LYS A 1 496 ? -13.785 -16.069 -51.175 0.02 31.55 ? 489 LYS A CG   1  
ATOM   7703   C CD   . LYS A 1 496 ? -13.406 -14.771 -51.977 0.02 31.81 ? 489 LYS A CD   1  
ATOM   7704   C CE   . LYS A 1 496 ? -14.331 -14.526 -53.191 0.02 32.04 ? 489 LYS A CE   1  
ATOM   7705   N NZ   . LYS A 1 496 ? -14.635 -13.105 -53.524 0.02 32.07 ? 489 LYS A NZ   1  
ATOM   7706   H H    . LYS A 1 496 ? -10.751 -16.461 -52.226 0.02 32.65 ? 489 LYS A H    1  
ATOM   7707   H HA   . LYS A 1 496 ? -11.901 -17.150 -49.909 0.02 31.69 ? 489 LYS A HA   1  
ATOM   7708   H HB2  . LYS A 1 496 ? -12.798 -17.301 -52.544 0.02 32.28 ? 489 LYS A HB2  1  
ATOM   7709   H HB3  . LYS A 1 496 ? -13.565 -18.135 -51.428 0.02 31.83 ? 489 LYS A HB3  1  
ATOM   7710   H HG2  . LYS A 1 496 ? -14.738 -16.225 -51.259 0.02 31.39 ? 489 LYS A HG2  1  
ATOM   7711   H HG3  . LYS A 1 496 ? -13.576 -15.871 -50.256 0.02 31.32 ? 489 LYS A HG3  1  
ATOM   7712   H HD2  . LYS A 1 496 ? -13.479 -14.000 -51.394 0.02 31.57 ? 489 LYS A HD2  1  
ATOM   7713   H HD3  . LYS A 1 496 ? -12.494 -14.853 -52.301 0.02 32.10 ? 489 LYS A HD3  1  
ATOM   7714   H HE2  . LYS A 1 496 ? -13.897 -14.909 -53.970 0.02 32.41 ? 489 LYS A HE2  1  
ATOM   7715   H HE3  . LYS A 1 496 ? -15.170 -14.984 -53.046 0.02 31.86 ? 489 LYS A HE3  1  
ATOM   7716   H HZ1  . LYS A 1 496 ? -14.742 -12.633 -52.776 0.02 31.78 ? 489 LYS A HZ1  1  
ATOM   7717   H HZ2  . LYS A 1 496 ? -13.968 -12.750 -53.995 0.02 32.34 ? 489 LYS A HZ2  1  
ATOM   7718   H HZ3  . LYS A 1 496 ? -15.382 -13.053 -54.007 0.02 32.14 ? 489 LYS A HZ3  1  
ATOM   7719   N N    . GLU A 1 497 ? -9.946  -19.144 -51.063 0.02 32.69 ? 490 GLU A N    1  
ATOM   7720   C CA   . GLU A 1 497 ? -9.192  -20.335 -50.688 0.02 32.91 ? 490 GLU A CA   1  
ATOM   7721   C C    . GLU A 1 497 ? -8.632  -20.275 -49.270 0.02 32.69 ? 490 GLU A C    1  
ATOM   7722   O O    . GLU A 1 497 ? -8.216  -21.307 -48.737 0.02 32.79 ? 490 GLU A O    1  
ATOM   7723   C CB   . GLU A 1 497 ? -8.010  -20.501 -51.628 0.02 33.57 ? 490 GLU A CB   1  
ATOM   7724   C CG   . GLU A 1 497 ? -7.095  -19.293 -51.542 0.02 33.76 ? 490 GLU A CG   1  
ATOM   7725   C CD   . GLU A 1 497 ? -7.300  -18.336 -52.708 0.02 33.90 ? 490 GLU A CD   1  
ATOM   7726   O OE1  . GLU A 1 497 ? -6.404  -18.318 -53.565 0.02 34.46 ? 490 GLU A OE1  1  
ATOM   7727   O OE2  . GLU A 1 497 ? -8.334  -17.615 -52.754 0.02 33.50 ? 490 GLU A OE2  1  
ATOM   7728   H H    . GLU A 1 497 ? -9.517  -18.621 -51.588 0.02 32.92 ? 490 GLU A H    1  
ATOM   7729   H HA   . GLU A 1 497 ? -9.766  -21.112 -50.761 0.02 32.84 ? 490 GLU A HA   1  
ATOM   7730   H HB2  . GLU A 1 497 ? -7.499  -21.284 -51.373 0.02 33.74 ? 490 GLU A HB2  1  
ATOM   7731   H HB3  . GLU A 1 497 ? -8.329  -20.593 -52.540 0.02 33.75 ? 490 GLU A HB3  1  
ATOM   7732   H HG2  . GLU A 1 497 ? -7.252  -18.789 -50.735 0.02 33.47 ? 490 GLU A HG2  1  
ATOM   7733   H HG3  . GLU A 1 497 ? -6.175  -19.599 -51.560 0.02 34.15 ? 490 GLU A HG3  1  
ATOM   7734   N N    . SER A 1 498 ? -8.509  -19.082 -48.704 0.02 32.46 ? 491 SER A N    1  
ATOM   7735   C CA   . SER A 1 498 ? -7.732  -18.906 -47.484 0.02 32.36 ? 491 SER A CA   1  
ATOM   7736   C C    . SER A 1 498 ? -8.444  -19.529 -46.291 0.02 31.90 ? 491 SER A C    1  
ATOM   7737   O O    . SER A 1 498 ? -9.669  -19.638 -46.249 0.02 31.55 ? 491 SER A O    1  
ATOM   7738   C CB   . SER A 1 498 ? -7.489  -17.431 -47.213 0.02 32.28 ? 491 SER A CB   1  
ATOM   7739   O OG   . SER A 1 498 ? -8.696  -16.764 -46.953 0.02 31.80 ? 491 SER A OG   1  
ATOM   7740   H H    . SER A 1 498 ? -8.866  -18.361 -49.005 0.02 32.38 ? 491 SER A H    1  
ATOM   7741   H HA   . SER A 1 498 ? -6.870  -19.335 -47.596 0.02 32.70 ? 491 SER A HA   1  
ATOM   7742   H HB2  . SER A 1 498 ? -6.905  -17.340 -46.445 0.02 32.27 ? 491 SER A HB2  1  
ATOM   7743   H HB3  . SER A 1 498 ? -7.071  -17.036 -47.992 0.02 32.59 ? 491 SER A HB3  1  
ATOM   7744   H HG   . SER A 1 498 ? -9.346  -17.266 -47.120 0.02 31.68 ? 491 SER A HG   1  
ATOM   7745   N N    . ARG A 1 499 ? -7.648  -19.957 -45.313 0.02 31.94 ? 492 ARG A N    1  
ATOM   7746   C CA   . ARG A 1 499 ? -8.246  -20.510 -44.098 0.02 31.55 ? 492 ARG A CA   1  
ATOM   7747   C C    . ARG A 1 499 ? -9.205  -19.516 -43.451 0.02 31.04 ? 492 ARG A C    1  
ATOM   7748   O O    . ARG A 1 499 ? -10.241 -19.923 -42.927 0.02 30.69 ? 492 ARG A O    1  
ATOM   7749   C CB   . ARG A 1 499 ? -7.157  -20.959 -43.124 0.02 31.72 ? 492 ARG A CB   1  
ATOM   7750   C CG   . ARG A 1 499 ? -6.108  -19.934 -42.787 0.02 31.88 ? 492 ARG A CG   1  
ATOM   7751   C CD   . ARG A 1 499 ? -4.850  -20.597 -42.228 0.02 32.26 ? 492 ARG A CD   1  
ATOM   7752   N NE   . ARG A 1 499 ? -5.084  -21.340 -40.988 0.02 32.03 ? 492 ARG A NE   1  
ATOM   7753   C CZ   . ARG A 1 499 ? -4.962  -20.818 -39.768 0.02 31.80 ? 492 ARG A CZ   1  
ATOM   7754   N NH1  . ARG A 1 499 ? -4.626  -19.547 -39.607 0.02 31.77 ? 492 ARG A NH1  1  
ATOM   7755   N NH2  . ARG A 1 499 ? -5.190  -21.577 -38.696 0.02 31.64 ? 492 ARG A NH2  1  
ATOM   7756   H H    . ARG A 1 499 ? -6.790  -19.943 -45.333 0.02 32.21 ? 492 ARG A H    1  
ATOM   7757   H HA   . ARG A 1 499 ? -8.758  -21.301 -44.329 0.02 31.54 ? 492 ARG A HA   1  
ATOM   7758   H HB2  . ARG A 1 499 ? -7.573  -21.238 -42.294 0.02 31.47 ? 492 ARG A HB2  1  
ATOM   7759   H HB3  . ARG A 1 499 ? -6.700  -21.717 -43.521 0.02 32.04 ? 492 ARG A HB3  1  
ATOM   7760   H HG2  . ARG A 1 499 ? -5.863  -19.442 -43.582 0.02 32.08 ? 492 ARG A HG2  1  
ATOM   7761   H HG3  . ARG A 1 499 ? -6.455  -19.331 -42.115 0.02 31.58 ? 492 ARG A HG3  1  
ATOM   7762   H HD2  . ARG A 1 499 ? -4.508  -21.230 -42.878 0.02 32.58 ? 492 ARG A HD2  1  
ATOM   7763   H HD3  . ARG A 1 499 ? -4.181  -19.920 -42.059 0.02 32.39 ? 492 ARG A HD3  1  
ATOM   7764   H HE   . ARG A 1 499 ? -5.456  -22.112 -41.052 0.02 31.99 ? 492 ARG A HE   1  
ATOM   7765   H HH11 . ARG A 1 499 ? -4.478  -19.042 -40.281 0.02 31.90 ? 492 ARG A HH11 1  
ATOM   7766   H HH12 . ARG A 1 499 ? -4.557  -19.224 -38.817 0.02 31.65 ? 492 ARG A HH12 1  
ATOM   7767   H HH21 . ARG A 1 499 ? -5.409  -22.403 -38.787 0.02 31.69 ? 492 ARG A HH21 1  
ATOM   7768   H HH22 . ARG A 1 499 ? -5.116  -21.237 -37.911 0.02 31.52 ? 492 ARG A HH22 1  
ATOM   7769   N N    . GLU A 1 500 ? -8.907  -18.217 -43.522 0.02 31.03 ? 493 GLU A N    1  
ATOM   7770   C CA   . GLU A 1 500 ? -9.789  -17.209 -42.939 0.02 30.59 ? 493 GLU A CA   1  
ATOM   7771   C C    . GLU A 1 500 ? -11.132 -17.139 -43.663 0.02 30.38 ? 493 GLU A C    1  
ATOM   7772   O O    . GLU A 1 500 ? -12.190 -17.084 -43.028 0.02 29.99 ? 493 GLU A O    1  
ATOM   7773   C CB   . GLU A 1 500 ? -9.116  -15.837 -42.951 0.02 30.71 ? 493 GLU A CB   1  
ATOM   7774   C CG   . GLU A 1 500 ? -7.849  -15.692 -42.118 0.02 30.92 ? 493 GLU A CG   1  
ATOM   7775   C CD   . GLU A 1 500 ? -6.616  -16.332 -42.716 0.02 31.45 ? 493 GLU A CD   1  
ATOM   7776   O OE1  . GLU A 1 500 ? -6.663  -16.709 -43.909 0.02 31.71 ? 493 GLU A OE1  1  
ATOM   7777   O OE2  . GLU A 1 500 ? -5.590  -16.441 -42.001 0.02 31.66 ? 493 GLU A OE2  1  
ATOM   7778   H H    . GLU A 1 500 ? -8.201  -17.899 -43.894 0.02 31.29 ? 493 GLU A H    1  
ATOM   7779   H HA   . GLU A 1 500 ? -9.964  -17.438 -42.014 0.02 30.38 ? 493 GLU A HA   1  
ATOM   7780   H HB2  . GLU A 1 500 ? -8.887  -15.614 -43.867 0.02 30.96 ? 493 GLU A HB2  1  
ATOM   7781   H HB3  . GLU A 1 500 ? -9.756  -15.192 -42.620 0.02 30.44 ? 493 GLU A HB3  1  
ATOM   7782   H HG2  . GLU A 1 500 ? -7.657  -14.748 -42.021 0.02 30.92 ? 493 GLU A HG2  1  
ATOM   7783   H HG3  . GLU A 1 500 ? -7.999  -16.090 -41.248 0.02 30.73 ? 493 GLU A HG3  1  
ATOM   7784   N N    . TYR A 1 501 ? -11.118 -17.057 -45.002 0.02 30.66 ? 494 TYR A N    1  
ATOM   7785   C CA   . TYR A 1 501 ? -12.393 -17.025 -45.717 0.02 30.51 ? 494 TYR A CA   1  
ATOM   7786   C C    . TYR A 1 501 ? -13.199 -18.282 -45.437 0.02 30.36 ? 494 TYR A C    1  
ATOM   7787   O O    . TYR A 1 501 ? -14.416 -18.224 -45.268 0.02 30.06 ? 494 TYR A O    1  
ATOM   7788   C CB   . TYR A 1 501 ? -12.212 -16.876 -47.239 0.02 30.90 ? 494 TYR A CB   1  
ATOM   7789   C CG   . TYR A 1 501 ? -13.584 -16.825 -47.873 0.02 30.75 ? 494 TYR A CG   1  
ATOM   7790   C CD1  . TYR A 1 501 ? -14.366 -15.703 -47.715 0.02 30.47 ? 494 TYR A CD1  1  
ATOM   7791   C CD2  . TYR A 1 501 ? -14.142 -17.918 -48.533 0.02 30.92 ? 494 TYR A CD2  1  
ATOM   7792   C CE1  . TYR A 1 501 ? -15.625 -15.644 -48.211 0.02 30.36 ? 494 TYR A CE1  1  
ATOM   7793   C CE2  . TYR A 1 501 ? -15.428 -17.859 -49.060 0.02 30.81 ? 494 TYR A CE2  1  
ATOM   7794   C CZ   . TYR A 1 501 ? -16.165 -16.697 -48.889 0.02 30.53 ? 494 TYR A CZ   1  
ATOM   7795   O OH   . TYR A 1 501 ? -17.455 -16.518 -49.348 0.02 30.45 ? 494 TYR A OH   1  
ATOM   7796   H H    . TYR A 1 501 ? -10.414 -17.015 -45.490 0.02 30.95 ? 494 TYR A H    1  
ATOM   7797   H HA   . TYR A 1 501 ? -12.912 -16.266 -45.416 0.02 30.27 ? 494 TYR A HA   1  
ATOM   7798   H HB2  . TYR A 1 501 ? -11.741 -16.052 -47.436 0.02 31.02 ? 494 TYR A HB2  1  
ATOM   7799   H HB3  . TYR A 1 501 ? -11.733 -17.645 -47.584 0.02 31.16 ? 494 TYR A HB3  1  
ATOM   7800   H HD1  . TYR A 1 501 ? -14.026 -14.969 -47.256 0.02 30.37 ? 494 TYR A HD1  1  
ATOM   7801   H HD2  . TYR A 1 501 ? -13.641 -18.693 -48.644 0.02 31.13 ? 494 TYR A HD2  1  
ATOM   7802   H HE1  . TYR A 1 501 ? -16.119 -14.867 -48.099 0.02 30.19 ? 494 TYR A HE1  1  
ATOM   7803   H HE2  . TYR A 1 501 ? -15.790 -18.584 -49.512 0.02 30.95 ? 494 TYR A HE2  1  
ATOM   7804   H HH   . TYR A 1 501 ? -17.912 -16.095 -48.783 0.02 30.21 ? 494 TYR A HH   1  
ATOM   7805   N N    . LYS A 1 502 ? -12.542 -19.435 -45.408 0.02 30.61 ? 495 LYS A N    1  
ATOM   7806   C CA   . LYS A 1 502 ? -13.274 -20.662 -45.128 0.02 30.52 ? 495 LYS A CA   1  
ATOM   7807   C C    . LYS A 1 502 ? -13.922 -20.581 -43.745 0.02 30.09 ? 495 LYS A C    1  
ATOM   7808   O O    . LYS A 1 502 ? -15.054 -21.019 -43.550 0.02 29.90 ? 495 LYS A O    1  
ATOM   7809   C CB   . LYS A 1 502 ? -12.347 -21.866 -45.233 0.02 30.90 ? 495 LYS A CB   1  
ATOM   7810   C CG   . LYS A 1 502 ? -11.849 -22.131 -46.657 0.02 31.38 ? 495 LYS A CG   1  
ATOM   7811   C CD   . LYS A 1 502 ? -12.611 -23.249 -47.350 0.02 31.54 ? 495 LYS A CD   1  
ATOM   7812   C CE   . LYS A 1 502 ? -11.954 -23.615 -48.708 0.02 32.09 ? 495 LYS A CE   1  
ATOM   7813   N NZ   . LYS A 1 502 ? -12.338 -24.991 -49.129 0.02 32.35 ? 495 LYS A NZ   1  
ATOM   7814   H H    . LYS A 1 502 ? -11.697 -19.529 -45.523 0.02 30.84 ? 495 LYS A H    1  
ATOM   7815   H HA   . LYS A 1 502 ? -13.973 -20.770 -45.790 0.02 30.54 ? 495 LYS A HA   1  
ATOM   7816   H HB2  . LYS A 1 502 ? -11.573 -21.715 -44.673 0.02 30.94 ? 495 LYS A HB2  1  
ATOM   7817   H HB3  . LYS A 1 502 ? -12.823 -22.655 -44.934 0.02 30.84 ? 495 LYS A HB3  1  
ATOM   7818   H HG2  . LYS A 1 502 ? -11.949 -21.323 -47.181 0.02 31.38 ? 495 LYS A HG2  1  
ATOM   7819   H HG3  . LYS A 1 502 ? -10.915 -22.393 -46.625 0.02 31.64 ? 495 LYS A HG3  1  
ATOM   7820   H HD2  . LYS A 1 502 ? -12.598 -24.040 -46.791 0.02 31.53 ? 495 LYS A HD2  1  
ATOM   7821   H HD3  . LYS A 1 502 ? -13.525 -22.968 -47.514 0.02 31.34 ? 495 LYS A HD3  1  
ATOM   7822   H HE2  . LYS A 1 502 ? -12.259 -22.993 -49.387 0.02 32.10 ? 495 LYS A HE2  1  
ATOM   7823   H HE3  . LYS A 1 502 ? -10.988 -23.577 -48.629 0.02 32.30 ? 495 LYS A HE3  1  
ATOM   7824   H HZ1  . LYS A 1 502 ? -13.131 -24.971 -49.533 0.02 32.20 ? 495 LYS A HZ1  1  
ATOM   7825   H HZ2  . LYS A 1 502 ? -11.736 -25.319 -49.696 0.02 32.69 ? 495 LYS A HZ2  1  
ATOM   7826   H HZ3  . LYS A 1 502 ? -12.389 -25.523 -48.415 0.02 32.34 ? 495 LYS A HZ3  1  
ATOM   7827   N N    . THR A 1 503 ? -13.244 -19.948 -42.796 0.02 29.96 ? 496 THR A N    1  
ATOM   7828   C CA   . THR A 1 503 ? -13.807 -19.886 -41.446 0.02 29.59 ? 496 THR A CA   1  
ATOM   7829   C C    . THR A 1 503 ? -14.997 -18.931 -41.404 0.02 29.26 ? 496 THR A C    1  
ATOM   7830   O O    . THR A 1 503 ? -16.024 -19.237 -40.785 0.02 29.01 ? 496 THR A O    1  
ATOM   7831   C CB   . THR A 1 503 ? -12.721 -19.491 -40.444 0.02 29.61 ? 496 THR A CB   1  
ATOM   7832   O OG1  . THR A 1 503 ? -11.682 -20.477 -40.442 0.02 29.94 ? 496 THR A OG1  1  
ATOM   7833   C CG2  . THR A 1 503 ? -13.319 -19.394 -39.021 0.02 29.25 ? 496 THR A CG2  1  
ATOM   7834   H H    . THR A 1 503 ? -12.491 -19.547 -42.901 0.02 30.10 ? 496 THR A H    1  
ATOM   7835   H HA   . THR A 1 503 ? -14.130 -20.763 -41.198 0.02 29.59 ? 496 THR A HA   1  
ATOM   7836   H HB   . THR A 1 503 ? -12.348 -18.631 -40.687 0.02 29.65 ? 496 THR A HB   1  
ATOM   7837   H HG1  . THR A 1 503 ? -12.018 -21.242 -40.416 0.02 29.96 ? 496 THR A HG1  1  
ATOM   7838   H HG21 . THR A 1 503 ? -12.647 -19.630 -38.364 0.02 29.32 ? 496 THR A HG21 1  
ATOM   7839   H HG22 . THR A 1 503 ? -13.620 -18.488 -38.851 0.02 29.07 ? 496 THR A HG22 1  
ATOM   7840   H HG23 . THR A 1 503 ? -14.070 -20.001 -38.931 0.02 29.16 ? 496 THR A HG23 1  
ATOM   7841   N N    . ILE A 1 504 ? -14.898 -17.786 -42.086 0.02 29.29 ? 497 ILE A N    1  
ATOM   7842   C CA   . ILE A 1 504 ? -16.078 -16.936 -42.261 0.02 29.05 ? 497 ILE A CA   1  
ATOM   7843   C C    . ILE A 1 504 ? -17.235 -17.771 -42.776 0.02 29.04 ? 497 ILE A C    1  
ATOM   7844   O O    . ILE A 1 504 ? -18.363 -17.687 -42.292 0.02 28.79 ? 497 ILE A O    1  
ATOM   7845   C CB   . ILE A 1 504 ? -15.800 -15.766 -43.226 0.02 29.21 ? 497 ILE A CB   1  
ATOM   7846   C CG1  . ILE A 1 504 ? -14.769 -14.787 -42.671 0.02 29.25 ? 497 ILE A CG1  1  
ATOM   7847   C CG2  . ILE A 1 504 ? -17.120 -15.075 -43.527 0.02 29.02 ? 497 ILE A CG2  1  
ATOM   7848   C CD1  . ILE A 1 504 ? -14.324 -13.719 -43.668 0.02 29.50 ? 497 ILE A CD1  1  
ATOM   7849   H H    . ILE A 1 504 ? -14.178 -17.491 -42.443 0.02 29.47 ? 497 ILE A H    1  
ATOM   7850   H HA   . ILE A 1 504 ? -16.340 -16.557 -41.410 0.02 28.83 ? 497 ILE A HA   1  
ATOM   7851   H HB   . ILE A 1 504 ? -15.451 -16.127 -44.053 0.02 29.46 ? 497 ILE A HB   1  
ATOM   7852   H HG12 . ILE A 1 504 ? -15.146 -14.337 -41.901 0.02 29.02 ? 497 ILE A HG12 1  
ATOM   7853   H HG13 . ILE A 1 504 ? -13.982 -15.283 -42.404 0.02 29.38 ? 497 ILE A HG13 1  
ATOM   7854   H HG21 . ILE A 1 504 ? -16.940 -14.219 -43.936 0.02 29.09 ? 497 ILE A HG21 1  
ATOM   7855   H HG22 . ILE A 1 504 ? -17.645 -15.621 -44.127 0.02 29.09 ? 497 ILE A HG22 1  
ATOM   7856   H HG23 . ILE A 1 504 ? -17.604 -14.937 -42.702 0.02 28.78 ? 497 ILE A HG23 1  
ATOM   7857   H HD11 . ILE A 1 504 ? -13.411 -13.456 -43.476 0.02 29.64 ? 497 ILE A HD11 1  
ATOM   7858   H HD12 . ILE A 1 504 ? -14.375 -14.077 -44.566 0.02 29.70 ? 497 ILE A HD12 1  
ATOM   7859   H HD13 . ILE A 1 504 ? -14.918 -12.957 -43.590 0.02 29.36 ? 497 ILE A HD13 1  
ATOM   7860   N N    . GLU A 1 505 ? -16.965 -18.574 -43.802 0.02 29.35 ? 498 GLU A N    1  
ATOM   7861   C CA   . GLU A 1 505 ? -17.998 -19.395 -44.415 0.02 29.42 ? 498 GLU A CA   1  
ATOM   7862   C C    . GLU A 1 505 ? -18.628 -20.334 -43.412 0.02 29.25 ? 498 GLU A C    1  
ATOM   7863   O O    . GLU A 1 505 ? -19.845 -20.497 -43.370 0.02 29.13 ? 498 GLU A O    1  
ATOM   7864   C CB   . GLU A 1 505 ? -17.390 -20.234 -45.537 0.02 29.85 ? 498 GLU A CB   1  
ATOM   7865   C CG   . GLU A 1 505 ? -17.552 -19.665 -46.887 0.02 30.10 ? 498 GLU A CG   1  
ATOM   7866   C CD   . GLU A 1 505 ? -17.329 -20.680 -48.037 0.02 30.50 ? 498 GLU A CD   1  
ATOM   7867   O OE1  . GLU A 1 505 ? -16.712 -21.775 -47.864 0.02 30.71 ? 498 GLU A OE1  1  
ATOM   7868   O OE2  . GLU A 1 505 ? -17.790 -20.339 -49.140 0.02 30.64 ? 498 GLU A OE2  1  
ATOM   7869   H H    . GLU A 1 505 ? -16.188 -18.656 -44.152 0.02 29.56 ? 498 GLU A H    1  
ATOM   7870   H HA   . GLU A 1 505 ? -18.691 -18.818 -44.771 0.02 29.36 ? 498 GLU A HA   1  
ATOM   7871   H HB2  . GLU A 1 505 ? -16.441 -20.325 -45.371 0.02 29.95 ? 498 GLU A HB2  1  
ATOM   7872   H HB3  . GLU A 1 505 ? -17.810 -21.109 -45.536 0.02 29.90 ? 498 GLU A HB3  1  
ATOM   7873   H HG2  . GLU A 1 505 ? -18.457 -19.321 -46.960 0.02 29.95 ? 498 GLU A HG2  1  
ATOM   7874   H HG3  . GLU A 1 505 ? -16.920 -18.937 -46.995 0.02 30.19 ? 498 GLU A HG3  1  
ATOM   7875   N N    . ARG A 1 506 ? -17.789 -21.033 -42.665 0.02 29.30 ? 499 ARG A N    1  
ATOM   7876   C CA   . ARG A 1 506 ? -18.270 -22.011 -41.701 0.02 29.20 ? 499 ARG A CA   1  
ATOM   7877   C C    . ARG A 1 506 ? -19.054 -21.344 -40.583 0.02 28.83 ? 499 ARG A C    1  
ATOM   7878   O O    . ARG A 1 506 ? -20.126 -21.822 -40.195 0.02 28.74 ? 499 ARG A O    1  
ATOM   7879   C CB   . ARG A 1 506 ? -17.080 -22.779 -41.147 0.02 29.38 ? 499 ARG A CB   1  
ATOM   7880   C CG   . ARG A 1 506 ? -16.497 -23.761 -42.154 0.02 29.80 ? 499 ARG A CG   1  
ATOM   7881   C CD   . ARG A 1 506 ? -15.075 -24.143 -41.801 0.02 30.03 ? 499 ARG A CD   1  
ATOM   7882   N NE   . ARG A 1 506 ? -14.634 -25.328 -42.538 0.02 30.45 ? 499 ARG A NE   1  
ATOM   7883   C CZ   . ARG A 1 506 ? -13.412 -25.836 -42.427 0.02 30.75 ? 499 ARG A CZ   1  
ATOM   7884   N NH1  . ARG A 1 506 ? -12.536 -25.267 -41.614 0.02 30.67 ? 499 ARG A NH1  1  
ATOM   7885   N NH2  . ARG A 1 506 ? -13.071 -26.917 -43.101 0.02 31.16 ? 499 ARG A NH2  1  
ATOM   7886   H H    . ARG A 1 506 ? -16.934 -20.963 -42.705 0.02 29.42 ? 499 ARG A H    1  
ATOM   7887   H HA   . ARG A 1 506 ? -18.861 -22.635 -42.148 0.02 29.31 ? 499 ARG A HA   1  
ATOM   7888   H HB2  . ARG A 1 506 ? -16.383 -22.144 -40.924 0.02 29.34 ? 499 ARG A HB2  1  
ATOM   7889   H HB3  . ARG A 1 506 ? -17.354 -23.273 -40.360 0.02 29.30 ? 499 ARG A HB3  1  
ATOM   7890   H HG2  . ARG A 1 506 ? -17.043 -24.557 -42.170 0.02 29.88 ? 499 ARG A HG2  1  
ATOM   7891   H HG3  . ARG A 1 506 ? -16.484 -23.353 -43.032 0.02 29.90 ? 499 ARG A HG3  1  
ATOM   7892   H HD2  . ARG A 1 506 ? -14.478 -23.408 -42.005 0.02 30.04 ? 499 ARG A HD2  1  
ATOM   7893   H HD3  . ARG A 1 506 ? -15.026 -24.355 -40.856 0.02 29.91 ? 499 ARG A HD3  1  
ATOM   7894   H HE   . ARG A 1 506 ? -15.250 -25.858 -42.819 0.02 30.52 ? 499 ARG A HE   1  
ATOM   7895   H HH11 . ARG A 1 506 ? -12.755 -24.566 -41.166 0.02 30.42 ? 499 ARG A HH11 1  
ATOM   7896   H HH12 . ARG A 1 506 ? -11.746 -25.595 -41.536 0.02 30.88 ? 499 ARG A HH12 1  
ATOM   7897   H HH21 . ARG A 1 506 ? -13.636 -27.290 -43.630 0.02 31.24 ? 499 ARG A HH21 1  
ATOM   7898   H HH22 . ARG A 1 506 ? -12.277 -27.239 -43.024 0.02 31.37 ? 499 ARG A HH22 1  
ATOM   7899   N N    . MET A 1 507 ? -18.529 -20.236 -40.054 0.02 28.66 ? 500 MET A N    1  
ATOM   7900   C CA   . MET A 1 507 ? -19.165 -19.642 -38.881 0.02 28.35 ? 500 MET A CA   1  
ATOM   7901   C C    . MET A 1 507 ? -20.516 -19.045 -39.247 0.02 28.20 ? 500 MET A C    1  
ATOM   7902   O O    . MET A 1 507 ? -21.524 -19.354 -38.610 0.02 28.07 ? 500 MET A O    1  
ATOM   7903   C CB   . MET A 1 507 ? -18.257 -18.598 -38.230 0.02 28.25 ? 500 MET A CB   1  
ATOM   7904   C CG   . MET A 1 507 ? -16.959 -19.148 -37.708 0.02 28.42 ? 500 MET A CG   1  
ATOM   7905   S SD   . MET A 1 507 ? -17.116 -20.575 -36.592 0.02 28.43 ? 500 MET A SD   1  
ATOM   7906   C CE   . MET A 1 507 ? -18.131 -19.902 -35.277 0.02 28.08 ? 500 MET A CE   1  
ATOM   7907   H H    . MET A 1 507 ? -17.830 -19.830 -40.344 0.02 28.74 ? 500 MET A H    1  
ATOM   7908   H HA   . MET A 1 507 ? -19.315 -20.341 -38.226 0.02 28.33 ? 500 MET A HA   1  
ATOM   7909   H HB2  . MET A 1 507 ? -18.043 -17.917 -38.883 0.02 28.30 ? 500 MET A HB2  1  
ATOM   7910   H HB3  . MET A 1 507 ? -18.730 -18.195 -37.491 0.02 28.06 ? 500 MET A HB3  1  
ATOM   7911   H HG2  . MET A 1 507 ? -16.416 -19.434 -38.455 0.02 28.62 ? 500 MET A HG2  1  
ATOM   7912   H HG3  . MET A 1 507 ? -16.502 -18.439 -37.231 0.02 28.35 ? 500 MET A HG3  1  
ATOM   7913   H HE1  . MET A 1 507 ? -18.170 -20.544 -34.552 0.02 28.09 ? 500 MET A HE1  1  
ATOM   7914   H HE2  . MET A 1 507 ? -17.734 -19.074 -34.964 0.02 28.01 ? 500 MET A HE2  1  
ATOM   7915   H HE3  . MET A 1 507 ? -19.023 -19.737 -35.615 0.02 27.99 ? 500 MET A HE3  1  
ATOM   7916   N N    . THR A 1 508 ? -20.576 -18.212 -40.312 0.02 28.26 ? 501 THR A N    1  
ATOM   7917   C CA   . THR A 1 508 ? -21.888 -17.723 -40.715 0.02 28.18 ? 501 THR A CA   1  
ATOM   7918   C C    . THR A 1 508 ? -22.787 -18.865 -41.190 0.02 28.32 ? 501 THR A C    1  
ATOM   7919   O O    . THR A 1 508 ? -24.000 -18.823 -40.985 0.02 28.24 ? 501 THR A O    1  
ATOM   7920   C CB   . THR A 1 508 ? -21.770 -16.634 -41.805 0.02 28.27 ? 501 THR A CB   1  
ATOM   7921   O OG1  . THR A 1 508 ? -20.949 -17.112 -42.873 0.02 28.57 ? 501 THR A OG1  1  
ATOM   7922   C CG2  . THR A 1 508 ? -21.186 -15.352 -41.230 0.02 28.13 ? 501 THR A CG2  1  
ATOM   7923   H H    . THR A 1 508 ? -19.910 -17.927 -40.762 0.02 28.37 ? 501 THR A H    1  
ATOM   7924   H HA   . THR A 1 508 ? -22.310 -17.318 -39.946 0.02 28.00 ? 501 THR A HA   1  
ATOM   7925   H HB   . THR A 1 508 ? -22.653 -16.429 -42.147 0.02 28.26 ? 501 THR A HB   1  
ATOM   7926   H HG1  . THR A 1 508 ? -20.144 -16.957 -42.700 0.02 28.59 ? 501 THR A HG1  1  
ATOM   7927   H HG21 . THR A 1 508 ? -21.518 -14.588 -41.729 0.02 28.14 ? 501 THR A HG21 1  
ATOM   7928   H HG22 . THR A 1 508 ? -21.449 -15.259 -40.307 0.02 27.95 ? 501 THR A HG22 1  
ATOM   7929   H HG23 . THR A 1 508 ? -20.220 -15.361 -41.284 0.02 28.23 ? 501 THR A HG23 1  
ATOM   7930   N N    . GLY A 1 509 ? -22.213 -19.905 -41.798 0.02 28.58 ? 502 GLY A N    1  
ATOM   7931   C CA   . GLY A 1 509 ? -23.019 -21.049 -42.207 0.02 28.77 ? 502 GLY A CA   1  
ATOM   7932   C C    . GLY A 1 509 ? -23.652 -21.785 -41.035 0.02 28.66 ? 502 GLY A C    1  
ATOM   7933   O O    . GLY A 1 509 ? -24.849 -22.045 -41.026 0.02 28.68 ? 502 GLY A O    1  
ATOM   7934   H H    . GLY A 1 509 ? -21.378 -19.968 -41.980 0.02 28.68 ? 502 GLY A H    1  
ATOM   7935   H HA2  . GLY A 1 509 ? -23.733 -20.745 -42.787 0.02 28.80 ? 502 GLY A HA2  1  
ATOM   7936   H HA3  . GLY A 1 509 ? -22.466 -21.678 -42.697 0.02 28.97 ? 502 GLY A HA3  1  
ATOM   7937   N N    . ILE A 1 510 ? -22.847 -22.142 -40.040 0.02 28.59 ? 503 ILE A N    1  
ATOM   7938   C CA   . ILE A 1 510 ? -23.393 -22.819 -38.866 0.02 28.52 ? 503 ILE A CA   1  
ATOM   7939   C C    . ILE A 1 510 ? -24.423 -21.934 -38.158 0.02 28.26 ? 503 ILE A C    1  
ATOM   7940   O O    . ILE A 1 510 ? -25.509 -22.385 -37.804 0.02 28.29 ? 503 ILE A O    1  
ATOM   7941   C CB   . ILE A 1 510 ? -22.244 -23.242 -37.931 0.02 28.52 ? 503 ILE A CB   1  
ATOM   7942   C CG1  . ILE A 1 510 ? -21.402 -24.321 -38.604 0.02 28.85 ? 503 ILE A CG1  1  
ATOM   7943   C CG2  . ILE A 1 510 ? -22.792 -23.725 -36.587 0.02 28.43 ? 503 ILE A CG2  1  
ATOM   7944   C CD1  . ILE A 1 510 ? -20.138 -24.677 -37.857 0.02 28.92 ? 503 ILE A CD1  1  
ATOM   7945   H H    . ILE A 1 510 ? -21.998 -22.011 -40.024 0.02 28.61 ? 503 ILE A H    1  
ATOM   7946   H HA   . ILE A 1 510 ? -23.853 -23.619 -39.154 0.02 28.69 ? 503 ILE A HA   1  
ATOM   7947   H HB   . ILE A 1 510 ? -21.673 -22.477 -37.774 0.02 28.40 ? 503 ILE A HB   1  
ATOM   7948   H HG12 . ILE A 1 510 ? -21.940 -25.124 -38.672 0.02 28.99 ? 503 ILE A HG12 1  
ATOM   7949   H HG13 . ILE A 1 510 ? -21.150 -24.025 -39.491 0.02 28.93 ? 503 ILE A HG13 1  
ATOM   7950   H HG21 . ILE A 1 510 ? -22.086 -24.159 -36.090 0.02 28.49 ? 503 ILE A HG21 1  
ATOM   7951   H HG22 . ILE A 1 510 ? -23.118 -22.962 -36.088 0.02 28.24 ? 503 ILE A HG22 1  
ATOM   7952   H HG23 . ILE A 1 510 ? -23.514 -24.349 -36.750 0.02 28.55 ? 503 ILE A HG23 1  
ATOM   7953   H HD11 . ILE A 1 510 ? -19.588 -25.245 -38.418 0.02 29.15 ? 503 ILE A HD11 1  
ATOM   7954   H HD12 . ILE A 1 510 ? -19.660 -23.862 -37.640 0.02 28.79 ? 503 ILE A HD12 1  
ATOM   7955   H HD13 . ILE A 1 510 ? -20.372 -25.149 -37.042 0.02 28.89 ? 503 ILE A HD13 1  
ATOM   7956   N N    . TRP A 1 511 ? -24.113 -20.651 -37.967 0.02 28.05 ? 504 TRP A N    1  
ATOM   7957   C CA   . TRP A 1 511 ? -25.053 -19.795 -37.237 0.02 27.83 ? 504 TRP A CA   1  
ATOM   7958   C C    . TRP A 1 511 ? -26.379 -19.679 -37.972 0.02 27.91 ? 504 TRP A C    1  
ATOM   7959   O O    . TRP A 1 511 ? -27.445 -19.775 -37.359 0.02 27.88 ? 504 TRP A O    1  
ATOM   7960   C CB   . TRP A 1 511 ? -24.456 -18.404 -36.990 0.02 27.64 ? 504 TRP A CB   1  
ATOM   7961   C CG   . TRP A 1 511 ? -23.823 -18.235 -35.597 0.02 27.50 ? 504 TRP A CG   1  
ATOM   7962   C CD1  . TRP A 1 511 ? -24.025 -17.207 -34.709 0.02 27.31 ? 504 TRP A CD1  1  
ATOM   7963   C CD2  . TRP A 1 511 ? -22.886 -19.114 -34.977 0.02 27.58 ? 504 TRP A CD2  1  
ATOM   7964   N NE1  . TRP A 1 511 ? -23.271 -17.395 -33.586 0.02 27.27 ? 504 TRP A NE1  1  
ATOM   7965   C CE2  . TRP A 1 511 ? -22.564 -18.561 -33.714 0.02 27.43 ? 504 TRP A CE2  1  
ATOM   7966   C CE3  . TRP A 1 511 ? -22.303 -20.319 -35.346 0.02 27.79 ? 504 TRP A CE3  1  
ATOM   7967   C CZ2  . TRP A 1 511 ? -21.680 -19.174 -32.840 0.02 27.49 ? 504 TRP A CZ2  1  
ATOM   7968   C CZ3  . TRP A 1 511 ? -21.417 -20.921 -34.481 0.02 27.85 ? 504 TRP A CZ3  1  
ATOM   7969   C CH2  . TRP A 1 511 ? -21.122 -20.354 -33.233 0.02 27.70 ? 504 TRP A CH2  1  
ATOM   7970   H H    . TRP A 1 511 ? -23.388 -20.273 -38.224 0.02 28.05 ? 504 TRP A H    1  
ATOM   7971   H HA   . TRP A 1 511 ? -25.234 -20.199 -36.376 0.02 27.80 ? 504 TRP A HA   1  
ATOM   7972   H HB2  . TRP A 1 511 ? -23.765 -18.242 -37.648 0.02 27.72 ? 504 TRP A HB2  1  
ATOM   7973   H HB3  . TRP A 1 511 ? -25.153 -17.738 -37.083 0.02 27.57 ? 504 TRP A HB3  1  
ATOM   7974   H HD1  . TRP A 1 511 ? -24.580 -16.475 -34.854 0.02 27.25 ? 504 TRP A HD1  1  
ATOM   7975   H HE1  . TRP A 1 511 ? -23.245 -16.878 -32.905 0.02 27.18 ? 504 TRP A HE1  1  
ATOM   7976   H HE3  . TRP A 1 511 ? -22.492 -20.704 -36.170 0.02 27.91 ? 504 TRP A HE3  1  
ATOM   7977   H HZ2  . TRP A 1 511 ? -21.482 -18.797 -32.014 0.02 27.42 ? 504 TRP A HZ2  1  
ATOM   7978   H HZ3  . TRP A 1 511 ? -21.017 -21.722 -34.724 0.02 28.01 ? 504 TRP A HZ3  1  
ATOM   7979   H HH2  . TRP A 1 511 ? -20.519 -20.782 -32.669 0.02 27.77 ? 504 TRP A HH2  1  
ATOM   7980   N N    . THR A 1 512 ? -26.341 -19.517 -39.305 0.02 28.06 ? 505 THR A N    1  
ATOM   7981   C CA   . THR A 1 512 ? -27.593 -19.441 -40.039 0.02 28.18 ? 505 THR A CA   1  
ATOM   7982   C C    . THR A 1 512 ? -28.297 -20.789 -40.068 0.02 28.41 ? 505 THR A C    1  
ATOM   7983   O O    . THR A 1 512 ? -29.526 -20.849 -40.055 0.02 28.48 ? 505 THR A O    1  
ATOM   7984   C CB   . THR A 1 512 ? -27.358 -18.929 -41.462 0.02 28.33 ? 505 THR A CB   1  
ATOM   7985   O OG1  . THR A 1 512 ? -26.986 -17.551 -41.395 0.02 28.16 ? 505 THR A OG1  1  
ATOM   7986   C CG2  . THR A 1 512 ? -28.629 -19.058 -42.237 0.02 28.56 ? 505 THR A CG2  1  
ATOM   7987   H H    . THR A 1 512 ? -25.633 -19.455 -39.782 0.02 28.11 ? 505 THR A H    1  
ATOM   7988   H HA   . THR A 1 512 ? -28.178 -18.814 -39.591 0.02 28.06 ? 505 THR A HA   1  
ATOM   7989   H HB   . THR A 1 512 ? -26.660 -19.439 -41.905 0.02 28.43 ? 505 THR A HB   1  
ATOM   7990   H HG1  . THR A 1 512 ? -26.212 -17.480 -41.080 0.02 28.08 ? 505 THR A HG1  1  
ATOM   7991   H HG21 . THR A 1 512 ? -28.589 -18.499 -43.030 0.02 28.64 ? 505 THR A HG21 1  
ATOM   7992   H HG22 . THR A 1 512 ? -28.761 -19.979 -42.516 0.02 28.73 ? 505 THR A HG22 1  
ATOM   7993   H HG23 . THR A 1 512 ? -29.379 -18.775 -41.691 0.02 28.49 ? 505 THR A HG23 1  
ATOM   7994   N N    . GLN A 1 513 ? -27.536 -21.878 -40.106 0.02 28.55 ? 506 GLN A N    1  
ATOM   7995   C CA   . GLN A 1 513 ? -28.151 -23.197 -40.061 0.02 28.81 ? 506 GLN A CA   1  
ATOM   7996   C C    . GLN A 1 513 ? -28.906 -23.385 -38.746 0.02 28.71 ? 506 GLN A C    1  
ATOM   7997   O O    . GLN A 1 513 ? -30.068 -23.811 -38.728 0.02 28.88 ? 506 GLN A O    1  
ATOM   7998   C CB   . GLN A 1 513 ? -27.063 -24.260 -40.265 0.02 28.99 ? 506 GLN A CB   1  
ATOM   7999   C CG   . GLN A 1 513 ? -27.590 -25.686 -40.247 0.02 29.32 ? 506 GLN A CG   1  
ATOM   8000   C CD   . GLN A 1 513 ? -28.927 -25.756 -40.879 0.02 29.50 ? 506 GLN A CD   1  
ATOM   8001   O OE1  . GLN A 1 513 ? -29.120 -25.271 -41.998 0.02 29.60 ? 506 GLN A OE1  1  
ATOM   8002   N NE2  . GLN A 1 513 ? -29.886 -26.294 -40.161 0.02 29.57 ? 506 GLN A NE2  1  
ATOM   8003   H H    . GLN A 1 513 ? -26.681 -21.882 -40.152 0.02 28.53 ? 506 GLN A H    1  
ATOM   8004   H HA   . GLN A 1 513 ? -28.795 -23.260 -40.781 0.02 28.96 ? 506 GLN A HA   1  
ATOM   8005   H HB2  . GLN A 1 513 ? -26.642 -24.122 -41.122 0.02 29.07 ? 506 GLN A HB2  1  
ATOM   8006   H HB3  . GLN A 1 513 ? -26.401 -24.166 -39.567 0.02 28.86 ? 506 GLN A HB3  1  
ATOM   8007   H HG2  . GLN A 1 513 ? -26.991 -26.254 -40.752 0.02 29.50 ? 506 GLN A HG2  1  
ATOM   8008   H HG3  . GLN A 1 513 ? -27.662 -26.004 -39.336 0.02 29.28 ? 506 GLN A HG3  1  
ATOM   8009   H HE21 . GLN A 1 513 ? -29.699 -26.677 -39.414 0.02 29.53 ? 506 GLN A HE21 1  
ATOM   8010   H HE22 . GLN A 1 513 ? -30.699 -26.261 -40.436 0.02 29.67 ? 506 GLN A HE22 1  
ATOM   8011   N N    . PHE A 1 514 ? -28.266 -23.021 -37.640 0.02 28.47 ? 507 PHE A N    1  
ATOM   8012   C CA   . PHE A 1 514 ? -28.929 -23.073 -36.344 0.02 28.39 ? 507 PHE A CA   1  
ATOM   8013   C C    . PHE A 1 514 ? -30.157 -22.171 -36.315 0.02 28.31 ? 507 PHE A C    1  
ATOM   8014   O O    . PHE A 1 514 ? -31.254 -22.599 -35.953 0.02 28.46 ? 507 PHE A O    1  
ATOM   8015   C CB   . PHE A 1 514 ? -27.951 -22.669 -35.250 0.02 28.16 ? 507 PHE A CB   1  
ATOM   8016   C CG   . PHE A 1 514 ? -28.510 -22.833 -33.886 0.02 28.12 ? 507 PHE A CG   1  
ATOM   8017   C CD1  . PHE A 1 514 ? -28.897 -24.074 -33.434 0.02 28.36 ? 507 PHE A CD1  1  
ATOM   8018   C CD2  . PHE A 1 514 ? -28.692 -21.745 -33.079 0.02 27.89 ? 507 PHE A CD2  1  
ATOM   8019   C CE1  . PHE A 1 514 ? -29.447 -24.218 -32.166 0.02 28.36 ? 507 PHE A CE1  1  
ATOM   8020   C CE2  . PHE A 1 514 ? -29.231 -21.890 -31.814 0.02 27.89 ? 507 PHE A CE2  1  
ATOM   8021   C CZ   . PHE A 1 514 ? -29.611 -23.114 -31.370 0.02 28.13 ? 507 PHE A CZ   1  
ATOM   8022   H H    . PHE A 1 514 ? -27.451 -22.753 -37.613 0.02 28.38 ? 507 PHE A H    1  
ATOM   8023   H HA   . PHE A 1 514 ? -29.220 -23.982 -36.179 0.02 28.57 ? 507 PHE A HA   1  
ATOM   8024   H HB2  . PHE A 1 514 ? -27.156 -23.219 -35.320 0.02 28.23 ? 507 PHE A HB2  1  
ATOM   8025   H HB3  . PHE A 1 514 ? -27.712 -21.737 -35.369 0.02 28.00 ? 507 PHE A HB3  1  
ATOM   8026   H HD1  . PHE A 1 514 ? -28.784 -24.817 -33.979 0.02 28.54 ? 507 PHE A HD1  1  
ATOM   8027   H HD2  . PHE A 1 514 ? -28.437 -20.908 -33.382 0.02 27.76 ? 507 PHE A HD2  1  
ATOM   8028   H HE1  . PHE A 1 514 ? -29.698 -25.057 -31.860 0.02 28.55 ? 507 PHE A HE1  1  
ATOM   8029   H HE2  . PHE A 1 514 ? -29.343 -21.140 -31.275 0.02 27.76 ? 507 PHE A HE2  1  
ATOM   8030   H HZ   . PHE A 1 514 ? -29.973 -23.207 -30.519 0.02 28.16 ? 507 PHE A HZ   1  
ATOM   8031   N N    . ALA A 1 515 ? -29.979 -20.899 -36.657 0.02 28.11 ? 508 ALA A N    1  
ATOM   8032   C CA   . ALA A 1 515 ? -31.108 -19.979 -36.685 0.02 28.08 ? 508 ALA A CA   1  
ATOM   8033   C C    . ALA A 1 515 ? -32.290 -20.569 -37.453 0.02 28.37 ? 508 ALA A C    1  
ATOM   8034   O O    . ALA A 1 515 ? -33.448 -20.430 -37.043 0.02 28.46 ? 508 ALA A O    1  
ATOM   8035   C CB   . ALA A 1 515 ? -30.667 -18.649 -37.315 0.02 27.92 ? 508 ALA A CB   1  
ATOM   8036   H H    . ALA A 1 515 ? -29.223 -20.547 -36.866 0.02 28.02 ? 508 ALA A H    1  
ATOM   8037   H HA   . ALA A 1 515 ? -31.394 -19.803 -35.777 0.02 28.00 ? 508 ALA A HA   1  
ATOM   8038   H HB1  . ALA A 1 515 ? -31.333 -17.975 -37.125 0.02 27.88 ? 508 ALA A HB1  1  
ATOM   8039   H HB2  . ALA A 1 515 ? -29.814 -18.393 -36.941 0.02 27.78 ? 508 ALA A HB2  1  
ATOM   8040   H HB3  . ALA A 1 515 ? -30.575 -18.768 -38.270 0.02 28.03 ? 508 ALA A HB3  1  
ATOM   8041   N N    . THR A 1 516 ? -32.022 -21.242 -38.568 0.02 28.57 ? 509 THR A N    1  
ATOM   8042   C CA   . THR A 1 516 ? -33.117 -21.809 -39.345 0.02 28.90 ? 509 THR A CA   1  
ATOM   8043   C C    . THR A 1 516 ? -33.797 -22.960 -38.606 0.02 29.11 ? 509 THR A C    1  
ATOM   8044   O O    . THR A 1 516 ? -34.933 -22.824 -38.154 0.02 29.19 ? 509 THR A O    1  
ATOM   8045   C CB   . THR A 1 516 ? -32.608 -22.250 -40.707 0.02 29.11 ? 509 THR A CB   1  
ATOM   8046   O OG1  . THR A 1 516 ? -32.072 -21.114 -41.390 0.02 28.97 ? 509 THR A OG1  1  
ATOM   8047   C CG2  . THR A 1 516 ? -33.731 -22.847 -41.531 0.02 29.50 ? 509 THR A CG2  1  
ATOM   8048   H H    . THR A 1 516 ? -31.237 -21.380 -38.886 0.02 28.55 ? 509 THR A H    1  
ATOM   8049   H HA   . THR A 1 516 ? -33.785 -21.124 -39.487 0.02 28.91 ? 509 THR A HA   1  
ATOM   8050   H HB   . THR A 1 516 ? -31.917 -22.921 -40.596 0.02 29.12 ? 509 THR A HB   1  
ATOM   8051   H HG1  . THR A 1 516 ? -31.416 -20.807 -40.966 0.02 28.78 ? 509 THR A HG1  1  
ATOM   8052   H HG21 . THR A 1 516 ? -33.441 -22.975 -42.447 0.02 29.65 ? 509 THR A HG21 1  
ATOM   8053   H HG22 . THR A 1 516 ? -33.993 -23.706 -41.163 0.02 29.63 ? 509 THR A HG22 1  
ATOM   8054   H HG23 . THR A 1 516 ? -34.496 -22.251 -41.522 0.02 29.51 ? 509 THR A HG23 1  
ATOM   8055   N N    . THR A 1 517 ? -33.113 -24.085 -38.433 0.02 29.23 ? 510 THR A N    1  
ATOM   8056   C CA   . THR A 1 517 ? -33.788 -25.293 -37.967 0.02 29.54 ? 510 THR A CA   1  
ATOM   8057   C C    . THR A 1 517 ? -33.583 -25.615 -36.488 0.02 29.43 ? 510 THR A C    1  
ATOM   8058   O O    . THR A 1 517 ? -34.156 -26.595 -36.011 0.02 29.71 ? 510 THR A O    1  
ATOM   8059   C CB   . THR A 1 517 ? -33.324 -26.505 -38.784 0.02 29.84 ? 510 THR A CB   1  
ATOM   8060   O OG1  . THR A 1 517 ? -31.910 -26.585 -38.661 0.02 29.64 ? 510 THR A OG1  1  
ATOM   8061   C CG2  . THR A 1 517 ? -33.718 -26.367 -40.278 0.02 30.06 ? 510 THR A CG2  1  
ATOM   8062   H H    . THR A 1 517 ? -32.269 -24.171 -38.573 0.02 29.16 ? 510 THR A H    1  
ATOM   8063   H HA   . THR A 1 517 ? -34.740 -25.190 -38.120 0.02 29.69 ? 510 THR A HA   1  
ATOM   8064   H HB   . THR A 1 517 ? -33.730 -27.312 -38.440 0.02 30.05 ? 510 THR A HB   1  
ATOM   8065   H HG1  . THR A 1 517 ? -31.670 -26.322 -37.901 0.02 29.44 ? 510 THR A HG1  1  
ATOM   8066   H HG21 . THR A 1 517 ? -33.802 -27.246 -40.681 0.02 30.31 ? 510 THR A HG21 1  
ATOM   8067   H HG22 . THR A 1 517 ? -34.564 -25.898 -40.361 0.02 30.17 ? 510 THR A HG22 1  
ATOM   8068   H HG23 . THR A 1 517 ? -33.040 -25.869 -40.758 0.02 29.88 ? 510 THR A HG23 1  
ATOM   8069   N N    . GLY A 1 518 ? -32.761 -24.867 -35.761 0.02 29.08 ? 511 GLY A N    1  
ATOM   8070   C CA   . GLY A 1 518 ? -32.507 -25.193 -34.368 0.02 29.02 ? 511 GLY A CA   1  
ATOM   8071   C C    . GLY A 1 518 ? -31.512 -26.310 -34.161 0.02 29.14 ? 511 GLY A C    1  
ATOM   8072   O O    . GLY A 1 518 ? -31.423 -26.847 -33.049 0.02 29.19 ? 511 GLY A O    1  
ATOM   8073   H H    . GLY A 1 518 ? -32.328 -24.186 -36.053 0.02 28.90 ? 511 GLY A H    1  
ATOM   8074   H HA2  . GLY A 1 518 ? -32.167 -24.409 -33.914 0.02 28.77 ? 511 GLY A HA2  1  
ATOM   8075   H HA3  . GLY A 1 518 ? -33.338 -25.447 -33.938 0.02 29.17 ? 511 GLY A HA3  1  
ATOM   8076   N N    . ASN A 1 519 ? -30.756 -26.645 -35.191 0.02 29.22 ? 512 ASN A N    1  
ATOM   8077   C CA   . ASN A 1 519 ? -29.822 -27.750 -35.299 0.02 29.41 ? 512 ASN A CA   1  
ATOM   8078   C C    . ASN A 1 519 ? -28.642 -27.193 -36.093 0.02 29.24 ? 512 ASN A C    1  
ATOM   8079   O O    . ASN A 1 519 ? -28.826 -26.747 -37.236 0.02 29.26 ? 512 ASN A O    1  
ATOM   8080   C CB   . ASN A 1 519 ? -30.535 -28.921 -35.986 0.02 29.85 ? 512 ASN A CB   1  
ATOM   8081   C CG   . ASN A 1 519 ? -29.614 -30.076 -36.339 0.02 30.10 ? 512 ASN A CG   1  
ATOM   8082   O OD1  . ASN A 1 519 ? -28.420 -29.911 -36.515 0.02 29.98 ? 512 ASN A OD1  1  
ATOM   8083   N ND2  . ASN A 1 519 ? -30.194 -31.265 -36.443 0.02 30.51 ? 512 ASN A ND2  1  
ATOM   8084   H H    . ASN A 1 519 ? -30.777 -26.206 -35.925 0.02 29.19 ? 512 ASN A H    1  
ATOM   8085   H HA   . ASN A 1 519 ? -29.536 -28.036 -34.420 0.02 29.39 ? 512 ASN A HA   1  
ATOM   8086   H HB2  . ASN A 1 519 ? -31.214 -29.255 -35.381 0.02 29.97 ? 512 ASN A HB2  1  
ATOM   8087   H HB3  . ASN A 1 519 ? -30.952 -28.608 -36.801 0.02 29.88 ? 512 ASN A HB3  1  
ATOM   8088   H HD21 . ASN A 1 519 ? -31.002 -31.377 -36.168 0.02 30.62 ? 512 ASN A HD21 1  
ATOM   8089   H HD22 . ASN A 1 519 ? -29.762 -31.926 -36.783 0.02 30.69 ? 512 ASN A HD22 1  
ATOM   8090   N N    . PRO A 1 520 ? -27.440 -27.133 -35.510 0.02 29.10 ? 513 PRO A N    1  
ATOM   8091   C CA   . PRO A 1 520 ? -26.339 -26.428 -36.178 0.02 28.94 ? 513 PRO A CA   1  
ATOM   8092   C C    . PRO A 1 520 ? -25.603 -27.248 -37.236 0.02 29.22 ? 513 PRO A C    1  
ATOM   8093   O O    . PRO A 1 520 ? -24.610 -26.760 -37.789 0.02 29.16 ? 513 PRO A O    1  
ATOM   8094   C CB   . PRO A 1 520 ? -25.419 -26.060 -35.011 0.02 28.73 ? 513 PRO A CB   1  
ATOM   8095   C CG   . PRO A 1 520 ? -25.610 -27.263 -34.049 0.02 28.94 ? 513 PRO A CG   1  
ATOM   8096   C CD   . PRO A 1 520 ? -27.056 -27.636 -34.181 0.02 29.10 ? 513 PRO A CD   1  
ATOM   8097   H HA   . PRO A 1 520 ? -26.677 -25.618 -36.587 0.02 28.81 ? 513 PRO A HA   1  
ATOM   8098   H HB2  . PRO A 1 520 ? -24.502 -25.979 -35.314 0.02 28.73 ? 513 PRO A HB2  1  
ATOM   8099   H HB3  . PRO A 1 520 ? -25.715 -25.234 -34.600 0.02 28.52 ? 513 PRO A HB3  1  
ATOM   8100   H HG2  . PRO A 1 520 ? -25.039 -27.998 -34.320 0.02 29.13 ? 513 PRO A HG2  1  
ATOM   8101   H HG3  . PRO A 1 520 ? -25.412 -26.995 -33.137 0.02 28.82 ? 513 PRO A HG3  1  
ATOM   8102   H HD2  . PRO A 1 520 ? -27.155 -28.599 -34.148 0.02 29.35 ? 513 PRO A HD2  1  
ATOM   8103   H HD3  . PRO A 1 520 ? -27.582 -27.207 -33.489 0.02 28.98 ? 513 PRO A HD3  1  
ATOM   8104   N N    . TYR A 1 521 ? -26.054 -28.454 -37.553 0.02 29.57 ? 514 TYR A N    1  
ATOM   8105   C CA   . TYR A 1 521 ? -25.351 -29.294 -38.530 0.02 29.89 ? 514 TYR A CA   1  
ATOM   8106   C C    . TYR A 1 521 ? -25.884 -29.138 -39.961 0.02 30.05 ? 514 TYR A C    1  
ATOM   8107   O O    . TYR A 1 521 ? -27.093 -29.054 -40.169 0.02 30.10 ? 514 TYR A O    1  
ATOM   8108   C CB   . TYR A 1 521 ? -25.470 -30.775 -38.139 0.02 30.26 ? 514 TYR A CB   1  
ATOM   8109   C CG   . TYR A 1 521 ? -24.798 -31.612 -39.185 0.02 30.62 ? 514 TYR A CG   1  
ATOM   8110   C CD1  . TYR A 1 521 ? -23.433 -31.798 -39.155 0.02 30.67 ? 514 TYR A CD1  1  
ATOM   8111   C CD2  . TYR A 1 521 ? -25.512 -32.133 -40.255 0.02 30.95 ? 514 TYR A CD2  1  
ATOM   8112   C CE1  . TYR A 1 521 ? -22.800 -32.519 -40.138 0.02 31.04 ? 514 TYR A CE1  1  
ATOM   8113   C CE2  . TYR A 1 521 ? -24.890 -32.855 -41.222 0.02 31.31 ? 514 TYR A CE2  1  
ATOM   8114   C CZ   . TYR A 1 521 ? -23.529 -33.041 -41.161 0.02 31.35 ? 514 TYR A CZ   1  
ATOM   8115   O OH   . TYR A 1 521 ? -22.881 -33.756 -42.137 0.02 31.75 ? 514 TYR A OH   1  
ATOM   8116   H H    . TYR A 1 521 ? -26.760 -28.808 -37.218 0.02 29.65 ? 514 TYR A H    1  
ATOM   8117   H HA   . TYR A 1 521 ? -24.410 -29.063 -38.537 0.02 29.82 ? 514 TYR A HA   1  
ATOM   8118   H HB2  . TYR A 1 521 ? -25.031 -30.933 -37.288 0.02 30.20 ? 514 TYR A HB2  1  
ATOM   8119   H HB3  . TYR A 1 521 ? -26.405 -31.025 -38.096 0.02 30.35 ? 514 TYR A HB3  1  
ATOM   8120   H HD1  . TYR A 1 521 ? -22.937 -31.440 -38.457 0.02 30.48 ? 514 TYR A HD1  1  
ATOM   8121   H HD2  . TYR A 1 521 ? -26.432 -32.009 -40.303 0.02 30.95 ? 514 TYR A HD2  1  
ATOM   8122   H HE1  . TYR A 1 521 ? -21.882 -32.653 -40.104 0.02 31.10 ? 514 TYR A HE1  1  
ATOM   8123   H HE2  . TYR A 1 521 ? -25.381 -33.211 -41.927 0.02 31.55 ? 514 TYR A HE2  1  
ATOM   8124   H HH   . TYR A 1 521 ? -23.349 -33.783 -42.836 0.02 31.87 ? 514 TYR A HH   1  
ATOM   8125   N N    . SER A 1 522 ? -24.973 -29.149 -40.957 0.02 30.17 ? 515 SER A N    1  
ATOM   8126   C CA   . SER A 1 522 ? -25.330 -29.473 -42.345 0.02 30.49 ? 515 SER A CA   1  
ATOM   8127   C C    . SER A 1 522 ? -24.128 -29.820 -43.226 0.02 30.75 ? 515 SER A C    1  
ATOM   8128   O O    . SER A 1 522 ? -23.045 -29.254 -43.072 0.02 30.59 ? 515 SER A O    1  
ATOM   8129   C CB   . SER A 1 522 ? -26.082 -28.337 -43.049 0.02 30.35 ? 515 SER A CB   1  
ATOM   8130   O OG   . SER A 1 522 ? -26.300 -28.648 -44.430 0.02 30.71 ? 515 SER A OG   1  
ATOM   8131   H H    . SER A 1 522 ? -24.141 -28.962 -40.854 0.02 30.09 ? 515 SER A H    1  
ATOM   8132   H HA   . SER A 1 522 ? -25.910 -30.251 -42.335 0.02 30.71 ? 515 SER A HA   1  
ATOM   8133   H HB2  . SER A 1 522 ? -26.942 -28.220 -42.618 0.02 30.25 ? 515 SER A HB2  1  
ATOM   8134   H HB3  . SER A 1 522 ? -25.560 -27.521 -42.989 0.02 30.14 ? 515 SER A HB3  1  
ATOM   8135   H HG   . SER A 1 522 ? -26.848 -29.280 -44.504 0.02 30.89 ? 515 SER A HG   1  
ATOM   8136   N N    . ASN A 1 523 ? -24.367 -30.742 -44.183 0.02 31.17 ? 516 ASN A N    1  
ATOM   8137   C CA   . ASN A 1 523 ? -23.516 -30.998 -45.359 0.02 31.50 ? 516 ASN A CA   1  
ATOM   8138   C C    . ASN A 1 523 ? -23.423 -29.814 -46.331 0.02 31.36 ? 516 ASN A C    1  
ATOM   8139   O O    . ASN A 1 523 ? -22.875 -29.979 -47.426 0.02 31.61 ? 516 ASN A O    1  
ATOM   8140   C CB   . ASN A 1 523 ? -24.015 -32.191 -46.205 0.02 32.00 ? 516 ASN A CB   1  
ATOM   8141   C CG   . ASN A 1 523 ? -24.752 -33.243 -45.408 0.02 32.21 ? 516 ASN A CG   1  
ATOM   8142   O OD1  . ASN A 1 523 ? -24.990 -33.087 -44.220 0.02 31.98 ? 516 ASN A OD1  1  
ATOM   8143   N ND2  . ASN A 1 523 ? -25.149 -34.332 -46.089 0.02 32.72 ? 516 ASN A ND2  1  
ATOM   8144   H H    . ASN A 1 523 ? -25.060 -31.246 -44.158 0.02 31.30 ? 516 ASN A H    1  
ATOM   8145   H HA   . ASN A 1 523 ? -22.620 -31.202 -45.051 0.02 31.55 ? 516 ASN A HA   1  
ATOM   8146   H HB2  . ASN A 1 523 ? -24.623 -31.859 -46.886 0.02 31.98 ? 516 ASN A HB2  1  
ATOM   8147   H HB3  . ASN A 1 523 ? -23.255 -32.618 -46.627 0.02 32.25 ? 516 ASN A HB3  1  
ATOM   8148   H HD21 . ASN A 1 523 ? -25.357 -35.051 -45.663 0.02 32.93 ? 516 ASN A HD21 1  
ATOM   8149   H HD22 . ASN A 1 523 ? -25.193 -34.314 -46.949 0.02 32.85 ? 516 ASN A HD22 1  
ATOM   8150   N N    . GLU A 1 524 ? -23.960 -28.648 -45.991 0.02 31.03 ? 517 GLU A N    1  
ATOM   8151   C CA   . GLU A 1 524 ? -23.698 -27.412 -46.736 0.02 30.91 ? 517 GLU A CA   1  
ATOM   8152   C C    . GLU A 1 524 ? -22.307 -26.882 -46.468 0.02 30.76 ? 517 GLU A C    1  
ATOM   8153   O O    . GLU A 1 524 ? -21.796 -26.055 -47.236 0.02 30.77 ? 517 GLU A O    1  
ATOM   8154   C CB   . GLU A 1 524 ? -24.735 -26.315 -46.349 0.02 30.58 ? 517 GLU A CB   1  
ATOM   8155   C CG   . GLU A 1 524 ? -24.211 -25.105 -45.399 0.02 30.10 ? 517 GLU A CG   1  
ATOM   8156   C CD   . GLU A 1 524 ? -24.241 -23.725 -46.083 0.02 29.92 ? 517 GLU A CD   1  
ATOM   8157   O OE1  . GLU A 1 524 ? -25.130 -22.900 -45.747 0.02 29.69 ? 517 GLU A OE1  1  
ATOM   8158   O OE2  . GLU A 1 524 ? -23.349 -23.467 -46.930 0.02 30.05 ? 517 GLU A OE2  1  
ATOM   8159   H H    . GLU A 1 524 ? -24.482 -28.539 -45.319 0.02 30.89 ? 517 GLU A H    1  
ATOM   8160   H HA   . GLU A 1 524 ? -23.765 -27.609 -47.683 0.02 31.18 ? 517 GLU A HA   1  
ATOM   8161   H HB2  . GLU A 1 524 ? -25.061 -25.901 -47.166 0.02 30.67 ? 517 GLU A HB2  1  
ATOM   8162   H HB3  . GLU A 1 524 ? -25.479 -26.755 -45.902 0.02 30.61 ? 517 GLU A HB3  1  
ATOM   8163   H HG2  . GLU A 1 524 ? -24.764 -25.055 -44.600 0.02 29.95 ? 517 GLU A HG2  1  
ATOM   8164   H HG3  . GLU A 1 524 ? -23.296 -25.234 -45.139 0.02 30.07 ? 517 GLU A HG3  1  
ATOM   8165   N N    . ILE A 1 525 ? -21.726 -27.319 -45.364 0.02 30.65 ? 518 ILE A N    1  
ATOM   8166   C CA   . ILE A 1 525 ? -20.583 -26.659 -44.769 0.02 30.44 ? 518 ILE A CA   1  
ATOM   8167   C C    . ILE A 1 525 ? -19.380 -27.498 -45.153 0.02 30.79 ? 518 ILE A C    1  
ATOM   8168   O O    . ILE A 1 525 ? -19.225 -28.619 -44.659 0.02 30.94 ? 518 ILE A O    1  
ATOM   8169   C CB   . ILE A 1 525 ? -20.753 -26.533 -43.240 0.02 30.08 ? 518 ILE A CB   1  
ATOM   8170   C CG1  . ILE A 1 525 ? -22.020 -25.723 -42.899 0.02 29.79 ? 518 ILE A CG1  1  
ATOM   8171   C CG2  . ILE A 1 525 ? -19.564 -25.877 -42.619 0.02 29.90 ? 518 ILE A CG2  1  
ATOM   8172   C CD1  . ILE A 1 525 ? -22.527 -25.830 -41.426 0.02 29.53 ? 518 ILE A CD1  1  
ATOM   8173   H H    . ILE A 1 525 ? -21.977 -28.015 -44.936 0.02 30.73 ? 518 ILE A H    1  
ATOM   8174   H HA   . ILE A 1 525 ? -20.484 -25.769 -45.147 0.02 30.34 ? 518 ILE A HA   1  
ATOM   8175   H HB   . ILE A 1 525 ? -20.845 -27.421 -42.856 0.02 30.20 ? 518 ILE A HB   1  
ATOM   8176   H HG12 . ILE A 1 525 ? -21.869 -24.788 -43.107 0.02 29.65 ? 518 ILE A HG12 1  
ATOM   8177   H HG13 . ILE A 1 525 ? -22.741 -26.076 -43.431 0.02 29.95 ? 518 ILE A HG13 1  
ATOM   8178   H HG21 . ILE A 1 525 ? -18.841 -26.521 -42.565 0.02 30.07 ? 518 ILE A HG21 1  
ATOM   8179   H HG22 . ILE A 1 525 ? -19.301 -25.126 -43.176 0.02 29.89 ? 518 ILE A HG22 1  
ATOM   8180   H HG23 . ILE A 1 525 ? -19.799 -25.567 -41.733 0.02 29.65 ? 518 ILE A HG23 1  
ATOM   8181   H HD11 . ILE A 1 525 ? -23.195 -25.143 -41.279 0.02 29.30 ? 518 ILE A HD11 1  
ATOM   8182   H HD12 . ILE A 1 525 ? -22.930 -26.699 -41.290 0.02 29.65 ? 518 ILE A HD12 1  
ATOM   8183   H HD13 . ILE A 1 525 ? -21.785 -25.715 -40.815 0.02 29.49 ? 518 ILE A HD13 1  
ATOM   8184   N N    . GLU A 1 526 ? -18.579 -27.008 -46.098 0.02 30.97 ? 519 GLU A N    1  
ATOM   8185   C CA   . GLU A 1 526 ? -17.339 -27.712 -46.402 0.02 31.33 ? 519 GLU A CA   1  
ATOM   8186   C C    . GLU A 1 526 ? -16.645 -27.906 -45.071 0.02 31.18 ? 519 GLU A C    1  
ATOM   8187   O O    . GLU A 1 526 ? -16.586 -26.974 -44.272 0.02 30.79 ? 519 GLU A O    1  
ATOM   8188   C CB   . GLU A 1 526 ? -16.401 -26.932 -47.339 0.02 31.50 ? 519 GLU A CB   1  
ATOM   8189   C CG   . GLU A 1 526 ? -16.946 -26.402 -48.693 0.02 31.68 ? 519 GLU A CG   1  
ATOM   8190   C CD   . GLU A 1 526 ? -17.400 -24.944 -48.641 0.02 31.31 ? 519 GLU A CD   1  
ATOM   8191   O OE1  . GLU A 1 526 ? -17.954 -24.514 -47.606 0.02 30.91 ? 519 GLU A OE1  1  
ATOM   8192   O OE2  . GLU A 1 526 ? -17.231 -24.209 -49.648 0.02 31.45 ? 519 GLU A OE2  1  
ATOM   8193   H H    . GLU A 1 526 ? -18.719 -26.294 -46.552 0.02 30.91 ? 519 GLU A H    1  
ATOM   8194   H HA   . GLU A 1 526 ? -17.533 -28.577 -46.795 0.02 31.61 ? 519 GLU A HA   1  
ATOM   8195   H HB2  . GLU A 1 526 ? -16.066 -26.169 -46.845 0.02 31.25 ? 519 GLU A HB2  1  
ATOM   8196   H HB3  . GLU A 1 526 ? -15.654 -27.513 -47.547 0.02 31.77 ? 519 GLU A HB3  1  
ATOM   8197   H HG2  . GLU A 1 526 ? -16.239 -26.459 -49.356 0.02 31.95 ? 519 GLU A HG2  1  
ATOM   8198   H HG3  . GLU A 1 526 ? -17.702 -26.943 -48.968 0.02 31.81 ? 519 GLU A HG3  1  
ATOM   8199   N N    . GLY A 1 527 ? -16.164 -29.111 -44.805 0.02 31.51 ? 520 GLY A N    1  
ATOM   8200   C CA   . GLY A 1 527 ? -15.503 -29.389 -43.554 0.02 31.43 ? 520 GLY A CA   1  
ATOM   8201   C C    . GLY A 1 527 ? -16.366 -30.051 -42.501 0.02 31.27 ? 520 GLY A C    1  
ATOM   8202   O O    . GLY A 1 527 ? -15.808 -30.646 -41.570 0.02 31.32 ? 520 GLY A O    1  
ATOM   8203   H H    . GLY A 1 527 ? -16.201 -29.783 -45.338 0.02 31.80 ? 520 GLY A H    1  
ATOM   8204   H HA2  . GLY A 1 527 ? -14.742 -29.969 -43.718 0.02 31.74 ? 520 GLY A HA2  1  
ATOM   8205   H HA3  . GLY A 1 527 ? -15.175 -28.557 -43.178 0.02 31.21 ? 520 GLY A HA3  1  
ATOM   8206   N N    . MET A 1 528 ? -17.693 -29.970 -42.611 0.02 31.12 ? 521 MET A N    1  
ATOM   8207   C CA   . MET A 1 528 ? -18.586 -30.617 -41.657 0.02 31.02 ? 521 MET A CA   1  
ATOM   8208   C C    . MET A 1 528 ? -18.963 -32.025 -42.118 0.02 31.46 ? 521 MET A C    1  
ATOM   8209   O O    . MET A 1 528 ? -19.853 -32.659 -41.539 0.02 31.48 ? 521 MET A O    1  
ATOM   8210   C CB   . MET A 1 528 ? -19.837 -29.752 -41.428 0.02 30.66 ? 521 MET A CB   1  
ATOM   8211   C CG   . MET A 1 528 ? -20.509 -29.841 -40.061 0.02 30.41 ? 521 MET A CG   1  
ATOM   8212   S SD   . MET A 1 528 ? -21.525 -28.346 -39.727 0.02 29.92 ? 521 MET A SD   1  
ATOM   8213   C CE   . MET A 1 528 ? -21.663 -28.311 -37.952 0.02 29.68 ? 521 MET A CE   1  
ATOM   8214   H H    . MET A 1 528 ? -18.101 -29.537 -43.228 0.02 31.09 ? 521 MET A H    1  
ATOM   8215   H HA   . MET A 1 528 ? -18.127 -30.686 -40.805 0.02 30.91 ? 521 MET A HA   1  
ATOM   8216   H HB2  . MET A 1 528 ? -19.585 -28.822 -41.546 0.02 30.47 ? 521 MET A HB2  1  
ATOM   8217   H HB3  . MET A 1 528 ? -20.502 -29.995 -42.090 0.02 30.82 ? 521 MET A HB3  1  
ATOM   8218   H HG2  . MET A 1 528 ? -21.081 -30.617 -40.040 0.02 30.59 ? 521 MET A HG2  1  
ATOM   8219   H HG3  . MET A 1 528 ? -19.833 -29.902 -39.369 0.02 30.37 ? 521 MET A HG3  1  
ATOM   8220   H HE1  . MET A 1 528 ? -22.471 -27.833 -37.711 0.02 29.48 ? 521 MET A HE1  1  
ATOM   8221   H HE2  . MET A 1 528 ? -21.706 -29.221 -37.621 0.02 29.88 ? 521 MET A HE2  1  
ATOM   8222   H HE3  . MET A 1 528 ? -20.889 -27.857 -37.583 0.02 29.60 ? 521 MET A HE3  1  
ATOM   8223   N N    . GLU A 1 529 ? -18.256 -32.556 -43.103 0.02 31.87 ? 522 GLU A N    1  
ATOM   8224   C CA   . GLU A 1 529 ? -18.731 -33.768 -43.756 0.02 32.32 ? 522 GLU A CA   1  
ATOM   8225   C C    . GLU A 1 529 ? -18.654 -34.980 -42.822 0.02 32.54 ? 522 GLU A C    1  
ATOM   8226   O O    . GLU A 1 529 ? -19.433 -35.923 -42.964 0.02 32.81 ? 522 GLU A O    1  
ATOM   8227   C CB   . GLU A 1 529 ? -17.935 -33.985 -45.053 0.02 32.73 ? 522 GLU A CB   1  
ATOM   8228   C CG   . GLU A 1 529 ? -17.592 -32.671 -45.832 0.02 32.54 ? 522 GLU A CG   1  
ATOM   8229   C CD   . GLU A 1 529 ? -18.809 -31.965 -46.456 0.02 32.37 ? 522 GLU A CD   1  
ATOM   8230   O OE1  . GLU A 1 529 ? -18.965 -32.047 -47.697 0.02 32.71 ? 522 GLU A OE1  1  
ATOM   8231   O OE2  . GLU A 1 529 ? -19.602 -31.334 -45.693 0.02 31.93 ? 522 GLU A OE2  1  
ATOM   8232   H H    . GLU A 1 529 ? -17.504 -32.256 -43.382 0.02 31.92 ? 522 GLU A H    1  
ATOM   8233   H HA   . GLU A 1 529 ? -19.664 -33.643 -43.994 0.02 32.23 ? 522 GLU A HA   1  
ATOM   8234   H HB2  . GLU A 1 529 ? -17.098 -34.421 -44.834 0.02 32.89 ? 522 GLU A HB2  1  
ATOM   8235   H HB3  . GLU A 1 529 ? -18.458 -34.549 -45.643 0.02 33.01 ? 522 GLU A HB3  1  
ATOM   8236   H HG2  . GLU A 1 529 ? -17.139 -32.042 -45.248 0.02 32.26 ? 522 GLU A HG2  1  
ATOM   8237   H HG3  . GLU A 1 529 ? -16.999 -32.909 -46.565 0.02 32.84 ? 522 GLU A HG3  1  
ATOM   8238   N N    . ASN A 1 530 ? -17.766 -34.954 -41.826 0.02 32.46 ? 523 ASN A N    1  
ATOM   8239   C CA   . ASN A 1 530 ? -17.661 -36.062 -40.873 0.02 32.68 ? 523 ASN A CA   1  
ATOM   8240   C C    . ASN A 1 530 ? -18.144 -35.710 -39.478 0.02 32.29 ? 523 ASN A C    1  
ATOM   8241   O O    . ASN A 1 530 ? -17.936 -36.484 -38.538 0.02 32.44 ? 523 ASN A O    1  
ATOM   8242   C CB   . ASN A 1 530 ? -16.231 -36.558 -40.794 0.02 33.03 ? 523 ASN A CB   1  
ATOM   8243   C CG   . ASN A 1 530 ? -16.086 -37.917 -41.402 0.02 33.65 ? 523 ASN A CG   1  
ATOM   8244   O OD1  . ASN A 1 530 ? -15.509 -38.074 -42.473 0.02 33.93 ? 523 ASN A OD1  1  
ATOM   8245   N ND2  . ASN A 1 530 ? -16.638 -38.931 -40.715 0.02 33.90 ? 523 ASN A ND2  1  
ATOM   8246   H H    . ASN A 1 530 ? -17.215 -34.309 -41.682 0.02 32.30 ? 523 ASN A H    1  
ATOM   8247   H HA   . ASN A 1 530 ? -18.207 -36.796 -41.187 0.02 32.93 ? 523 ASN A HA   1  
ATOM   8248   H HB2  . ASN A 1 530 ? -15.647 -35.942 -41.263 0.02 32.97 ? 523 ASN A HB2  1  
ATOM   8249   H HB3  . ASN A 1 530 ? -15.971 -36.619 -39.862 0.02 32.94 ? 523 ASN A HB3  1  
ATOM   8250   H HD21 . ASN A 1 530 ? -16.628 -39.731 -41.040 0.02 34.28 ? 523 ASN A HD21 1  
ATOM   8251   H HD22 . ASN A 1 530 ? -16.997 -38.781 -39.949 0.02 33.69 ? 523 ASN A HD22 1  
ATOM   8252   N N    . VAL A 1 531 ? -18.795 -34.574 -39.326 0.02 31.83 ? 524 VAL A N    1  
ATOM   8253   C CA   . VAL A 1 531 ? -19.297 -34.138 -38.036 0.02 31.46 ? 524 VAL A CA   1  
ATOM   8254   C C    . VAL A 1 531 ? -20.684 -34.736 -37.857 0.02 31.55 ? 524 VAL A C    1  
ATOM   8255   O O    . VAL A 1 531 ? -21.539 -34.635 -38.748 0.02 31.57 ? 524 VAL A O    1  
ATOM   8256   C CB   . VAL A 1 531 ? -19.313 -32.604 -37.951 0.02 30.97 ? 524 VAL A CB   1  
ATOM   8257   C CG1  . VAL A 1 531 ? -20.252 -32.095 -36.854 0.02 30.61 ? 524 VAL A CG1  1  
ATOM   8258   C CG2  . VAL A 1 531 ? -17.900 -32.120 -37.764 0.02 30.91 ? 524 VAL A CG2  1  
ATOM   8259   H H    . VAL A 1 531 ? -18.964 -34.028 -39.968 0.02 31.74 ? 524 VAL A H    1  
ATOM   8260   H HA   . VAL A 1 531 ? -18.721 -34.472 -37.333 0.02 31.52 ? 524 VAL A HA   1  
ATOM   8261   H HB   . VAL A 1 531 ? -19.633 -32.248 -38.795 0.02 30.96 ? 524 VAL A HB   1  
ATOM   8262   H HG11 . VAL A 1 531 ? -20.349 -31.136 -36.971 0.02 30.34 ? 524 VAL A HG11 1  
ATOM   8263   H HG12 . VAL A 1 531 ? -21.127 -32.506 -36.917 0.02 30.69 ? 524 VAL A HG12 1  
ATOM   8264   H HG13 . VAL A 1 531 ? -19.856 -32.280 -35.988 0.02 30.62 ? 524 VAL A HG13 1  
ATOM   8265   H HG21 . VAL A 1 531 ? -17.867 -31.168 -37.956 0.02 30.66 ? 524 VAL A HG21 1  
ATOM   8266   H HG22 . VAL A 1 531 ? -17.629 -32.292 -36.850 0.02 30.89 ? 524 VAL A HG22 1  
ATOM   8267   H HG23 . VAL A 1 531 ? -17.316 -32.598 -38.371 0.02 31.19 ? 524 VAL A HG23 1  
ATOM   8268   N N    . SER A 1 532 ? -20.864 -35.434 -36.744 0.02 31.68 ? 525 SER A N    1  
ATOM   8269   C CA   . SER A 1 532 ? -22.160 -35.789 -36.169 0.02 31.75 ? 525 SER A CA   1  
ATOM   8270   C C    . SER A 1 532 ? -22.165 -35.068 -34.819 0.02 31.38 ? 525 SER A C    1  
ATOM   8271   O O    . SER A 1 532 ? -21.370 -35.385 -33.930 0.02 31.46 ? 525 SER A O    1  
ATOM   8272   C CB   . SER A 1 532 ? -22.340 -37.301 -36.003 0.02 32.31 ? 525 SER A CB   1  
ATOM   8273   O OG   . SER A 1 532 ? -21.323 -38.008 -36.676 0.02 32.59 ? 525 SER A OG   1  
ATOM   8274   H H    . SER A 1 532 ? -20.207 -35.731 -36.278 0.02 31.77 ? 525 SER A H    1  
ATOM   8275   H HA   . SER A 1 532 ? -22.878 -35.452 -36.726 0.02 31.70 ? 525 SER A HA   1  
ATOM   8276   H HB2  . SER A 1 532 ? -22.310 -37.521 -35.060 0.02 32.33 ? 525 SER A HB2  1  
ATOM   8277   H HB3  . SER A 1 532 ? -23.199 -37.562 -36.369 0.02 32.49 ? 525 SER A HB3  1  
ATOM   8278   H HG   . SER A 1 532 ? -20.578 -37.633 -36.595 0.02 32.60 ? 525 SER A HG   1  
ATOM   8279   N N    . TRP A 1 533 ? -23.043 -34.084 -34.679 0.02 30.98 ? 526 TRP A N    1  
ATOM   8280   C CA   . TRP A 1 533 ? -22.985 -33.130 -33.573 0.02 30.59 ? 526 TRP A CA   1  
ATOM   8281   C C    . TRP A 1 533 ? -24.340 -33.143 -32.862 0.02 30.55 ? 526 TRP A C    1  
ATOM   8282   O O    . TRP A 1 533 ? -25.313 -32.569 -33.352 0.02 30.41 ? 526 TRP A O    1  
ATOM   8283   C CB   . TRP A 1 533 ? -22.607 -31.762 -34.130 0.02 30.20 ? 526 TRP A CB   1  
ATOM   8284   C CG   . TRP A 1 533 ? -22.478 -30.636 -33.131 0.02 29.80 ? 526 TRP A CG   1  
ATOM   8285   C CD1  . TRP A 1 533 ? -22.452 -30.722 -31.762 0.02 29.76 ? 526 TRP A CD1  1  
ATOM   8286   C CD2  . TRP A 1 533 ? -22.325 -29.252 -33.454 0.02 29.43 ? 526 TRP A CD2  1  
ATOM   8287   N NE1  . TRP A 1 533 ? -22.300 -29.459 -31.221 0.02 29.39 ? 526 TRP A NE1  1  
ATOM   8288   C CE2  . TRP A 1 533 ? -22.238 -28.543 -32.240 0.02 29.19 ? 526 TRP A CE2  1  
ATOM   8289   C CE3  . TRP A 1 533 ? -22.284 -28.539 -34.656 0.02 29.33 ? 526 TRP A CE3  1  
ATOM   8290   C CZ2  . TRP A 1 533 ? -22.095 -27.167 -32.198 0.02 28.85 ? 526 TRP A CZ2  1  
ATOM   8291   C CZ3  . TRP A 1 533 ? -22.159 -27.166 -34.613 0.02 28.99 ? 526 TRP A CZ3  1  
ATOM   8292   C CH2  . TRP A 1 533 ? -22.042 -26.495 -33.397 0.02 28.76 ? 526 TRP A CH2  1  
ATOM   8293   H H    . TRP A 1 533 ? -23.694 -33.940 -35.222 0.02 30.96 ? 526 TRP A H    1  
ATOM   8294   H HA   . TRP A 1 533 ? -22.306 -33.399 -32.937 0.02 30.64 ? 526 TRP A HA   1  
ATOM   8295   H HB2  . TRP A 1 533 ? -21.746 -31.843 -34.565 0.02 30.27 ? 526 TRP A HB2  1  
ATOM   8296   H HB3  . TRP A 1 533 ? -23.274 -31.501 -34.782 0.02 30.16 ? 526 TRP A HB3  1  
ATOM   8297   H HD1  . TRP A 1 533 ? -22.515 -31.507 -31.270 0.02 29.97 ? 526 TRP A HD1  1  
ATOM   8298   H HE1  . TRP A 1 533 ? -22.266 -29.273 -30.385 0.02 29.32 ? 526 TRP A HE1  1  
ATOM   8299   H HE3  . TRP A 1 533 ? -22.355 -28.981 -35.467 0.02 29.50 ? 526 TRP A HE3  1  
ATOM   8300   H HZ2  . TRP A 1 533 ? -22.027 -26.720 -31.387 0.02 28.72 ? 526 TRP A HZ2  1  
ATOM   8301   H HZ3  . TRP A 1 533 ? -22.117 -26.688 -35.406 0.02 28.94 ? 526 TRP A HZ3  1  
ATOM   8302   H HH2  . TRP A 1 533 ? -21.956 -25.574 -33.398 0.02 28.56 ? 526 TRP A HH2  1  
ATOM   8303   N N    . ASP A 1 534 ? -24.416 -33.882 -31.706 0.02 30.74 ? 527 ASP A N    1  
ATOM   8304   C CA   . ASP A 1 534 ? -25.627 -33.957 -30.909 0.02 30.77 ? 527 ASP A CA   1  
ATOM   8305   C C    . ASP A 1 534 ? -25.499 -33.083 -29.665 0.02 30.47 ? 527 ASP A C    1  
ATOM   8306   O O    . ASP A 1 534 ? -24.395 -32.781 -29.217 0.02 30.37 ? 527 ASP A O    1  
ATOM   8307   C CB   . ASP A 1 534 ? -25.908 -35.384 -30.473 0.02 31.28 ? 527 ASP A CB   1  
ATOM   8308   C CG   . ASP A 1 534 ? -25.695 -36.369 -31.577 0.02 31.65 ? 527 ASP A CG   1  
ATOM   8309   O OD1  . ASP A 1 534 ? -26.401 -36.278 -32.601 0.02 31.71 ? 527 ASP A OD1  1  
ATOM   8310   O OD2  . ASP A 1 534 ? -24.824 -37.222 -31.391 0.02 31.91 ? 527 ASP A OD2  1  
ATOM   8311   H H    . ASP A 1 534 ? -23.761 -34.328 -31.373 0.02 30.86 ? 527 ASP A H    1  
ATOM   8312   H HA   . ASP A 1 534 ? -26.376 -33.651 -31.442 0.02 30.70 ? 527 ASP A HA   1  
ATOM   8313   H HB2  . ASP A 1 534 ? -25.312 -35.617 -29.744 0.02 31.35 ? 527 ASP A HB2  1  
ATOM   8314   H HB3  . ASP A 1 534 ? -26.826 -35.463 -30.185 0.02 31.35 ? 527 ASP A HB3  1  
ATOM   8315   N N    . PRO A 1 535 ? -26.609 -32.717 -29.051 0.02 30.40 ? 528 PRO A N    1  
ATOM   8316   C CA   . PRO A 1 535 ? -26.544 -31.816 -27.900 0.02 30.12 ? 528 PRO A CA   1  
ATOM   8317   C C    . PRO A 1 535 ? -25.995 -32.492 -26.637 0.02 30.35 ? 528 PRO A C    1  
ATOM   8318   O O    . PRO A 1 535 ? -25.642 -33.666 -26.633 0.02 30.73 ? 528 PRO A O    1  
ATOM   8319   C CB   . PRO A 1 535 ? -28.006 -31.411 -27.719 0.02 30.07 ? 528 PRO A CB   1  
ATOM   8320   C CG   . PRO A 1 535 ? -28.747 -32.587 -28.095 0.02 30.49 ? 528 PRO A CG   1  
ATOM   8321   C CD   . PRO A 1 535 ? -27.995 -33.161 -29.297 0.02 30.61 ? 528 PRO A CD   1  
ATOM   8322   H HA   . PRO A 1 535 ? -26.010 -31.035 -28.118 0.02 29.86 ? 528 PRO A HA   1  
ATOM   8323   H HB2  . PRO A 1 535 ? -28.175 -31.174 -26.793 0.02 30.02 ? 528 PRO A HB2  1  
ATOM   8324   H HB3  . PRO A 1 535 ? -28.214 -30.676 -28.318 0.02 29.84 ? 528 PRO A HB3  1  
ATOM   8325   H HG2  . PRO A 1 535 ? -28.740 -33.219 -27.362 0.02 30.72 ? 528 PRO A HG2  1  
ATOM   8326   H HG3  . PRO A 1 535 ? -29.655 -32.348 -28.334 0.02 30.48 ? 528 PRO A HG3  1  
ATOM   8327   H HD2  . PRO A 1 535 ? -28.060 -34.123 -29.277 0.02 30.95 ? 528 PRO A HD2  1  
ATOM   8328   H HD3  . PRO A 1 535 ? -28.337 -32.795 -30.126 0.02 30.51 ? 528 PRO A HD3  1  
ATOM   8329   N N    . ILE A 1 536 ? -25.877 -31.704 -25.565 0.02 30.12 ? 529 ILE A N    1  
ATOM   8330   C CA   . ILE A 1 536 ? -25.619 -32.256 -24.223 0.02 30.35 ? 529 ILE A CA   1  
ATOM   8331   C C    . ILE A 1 536 ? -26.947 -32.663 -23.587 0.02 30.60 ? 529 ILE A C    1  
ATOM   8332   O O    . ILE A 1 536 ? -27.966 -31.997 -23.794 0.02 30.45 ? 529 ILE A O    1  
ATOM   8333   C CB   . ILE A 1 536 ? -24.923 -31.222 -23.312 0.02 30.05 ? 529 ILE A CB   1  
ATOM   8334   C CG1  . ILE A 1 536 ? -23.820 -30.435 -24.016 0.02 29.74 ? 529 ILE A CG1  1  
ATOM   8335   C CG2  . ILE A 1 536 ? -24.348 -31.898 -22.024 0.02 30.34 ? 529 ILE A CG2  1  
ATOM   8336   C CD1  . ILE A 1 536 ? -22.563 -31.205 -24.222 0.02 29.94 ? 529 ILE A CD1  1  
ATOM   8337   H H    . ILE A 1 536 ? -25.947 -30.850 -25.586 0.02 29.86 ? 529 ILE A H    1  
ATOM   8338   H HA   . ILE A 1 536 ? -25.050 -33.036 -24.292 0.02 30.57 ? 529 ILE A HA   1  
ATOM   8339   H HB   . ILE A 1 536 ? -25.599 -30.583 -23.039 0.02 29.90 ? 529 ILE A HB   1  
ATOM   8340   H HG12 . ILE A 1 536 ? -24.134 -30.151 -24.885 0.02 29.61 ? 529 ILE A HG12 1  
ATOM   8341   H HG13 . ILE A 1 536 ? -23.606 -29.652 -23.485 0.02 29.56 ? 529 ILE A HG13 1  
ATOM   8342   H HG21 . ILE A 1 536 ? -24.030 -31.204 -21.426 0.02 30.18 ? 529 ILE A HG21 1  
ATOM   8343   H HG22 . ILE A 1 536 ? -25.051 -32.408 -21.590 0.02 30.59 ? 529 ILE A HG22 1  
ATOM   8344   H HG23 . ILE A 1 536 ? -23.616 -32.489 -22.249 0.02 30.45 ? 529 ILE A HG23 1  
ATOM   8345   H HD11 . ILE A 1 536 ? -22.132 -31.369 -23.370 0.02 30.12 ? 529 ILE A HD11 1  
ATOM   8346   H HD12 . ILE A 1 536 ? -22.789 -32.041 -24.652 0.02 30.10 ? 529 ILE A HD12 1  
ATOM   8347   H HD13 . ILE A 1 536 ? -21.973 -30.687 -24.788 0.02 29.75 ? 529 ILE A HD13 1  
ATOM   8348   N N    . GLU A 1 537 ? -26.952 -33.709 -22.760 0.02 31.01 ? 530 GLU A N    1  
ATOM   8349   C CA   . GLU A 1 537 ? -28.116 -33.932 -21.892 0.02 31.26 ? 530 GLU A CA   1  
ATOM   8350   C C    . GLU A 1 537 ? -27.753 -34.090 -20.413 0.02 31.43 ? 530 GLU A C    1  
ATOM   8351   O O    . GLU A 1 537 ? -26.600 -34.343 -20.048 0.02 31.48 ? 530 GLU A O    1  
ATOM   8352   C CB   . GLU A 1 537 ? -28.966 -35.142 -22.338 0.02 31.74 ? 530 GLU A CB   1  
ATOM   8353   C CG   . GLU A 1 537 ? -28.353 -36.512 -22.194 0.02 32.20 ? 530 GLU A CG   1  
ATOM   8354   C CD   . GLU A 1 537 ? -27.381 -36.833 -23.315 0.02 32.14 ? 530 GLU A CD   1  
ATOM   8355   O OE1  . GLU A 1 537 ? -27.344 -38.026 -23.711 0.02 32.58 ? 530 GLU A OE1  1  
ATOM   8356   O OE2  . GLU A 1 537 ? -26.662 -35.908 -23.787 0.02 31.69 ? 530 GLU A OE2  1  
ATOM   8357   H H    . GLU A 1 537 ? -26.318 -34.287 -22.686 0.02 31.17 ? 530 GLU A H    1  
ATOM   8358   H HA   . GLU A 1 537 ? -28.693 -33.155 -21.955 0.02 31.05 ? 530 GLU A HA   1  
ATOM   8359   H HB2  . GLU A 1 537 ? -29.778 -35.149 -21.808 0.02 31.88 ? 530 GLU A HB2  1  
ATOM   8360   H HB3  . GLU A 1 537 ? -29.197 -35.024 -23.275 0.02 31.65 ? 530 GLU A HB3  1  
ATOM   8361   H HG2  . GLU A 1 537 ? -27.879 -36.569 -21.350 0.02 32.25 ? 530 GLU A HG2  1  
ATOM   8362   H HG3  . GLU A 1 537 ? -29.062 -37.174 -22.219 0.02 32.53 ? 530 GLU A HG3  1  
ATOM   8363   N N    . LYS A 1 538 ? -28.782 -33.868 -19.576 0.02 31.52 ? 531 LYS A N    1  
ATOM   8364   C CA   . LYS A 1 538 ? -28.724 -34.090 -18.136 0.02 31.88 ? 531 LYS A CA   1  
ATOM   8365   C C    . LYS A 1 538 ? -28.365 -35.516 -17.828 0.02 32.37 ? 531 LYS A C    1  
ATOM   8366   O O    . LYS A 1 538 ? -29.265 -36.366 -17.770 0.02 32.74 ? 531 LYS A O    1  
ATOM   8367   C CB   . LYS A 1 538 ? -30.091 -33.774 -17.507 0.02 32.05 ? 531 LYS A CB   1  
ATOM   8368   C CG   . LYS A 1 538 ? -30.476 -34.463 -16.203 0.02 32.55 ? 531 LYS A CG   1  
ATOM   8369   C CD   . LYS A 1 538 ? -30.505 -33.590 -14.949 0.02 32.41 ? 531 LYS A CD   1  
ATOM   8370   C CE   . LYS A 1 538 ? -30.788 -34.459 -13.731 0.02 32.94 ? 531 LYS A CE   1  
ATOM   8371   N NZ   . LYS A 1 538 ? -30.191 -33.832 -12.512 0.02 32.76 ? 531 LYS A NZ   1  
ATOM   8372   H H    . LYS A 1 538 ? -29.548 -33.576 -19.836 0.02 31.39 ? 531 LYS A H    1  
ATOM   8373   H HA   . LYS A 1 538 ? -28.056 -33.507 -17.749 0.02 31.71 ? 531 LYS A HA   1  
ATOM   8374   H HB2  . LYS A 1 538 ? -30.166 -32.832 -17.392 0.02 31.76 ? 531 LYS A HB2  1  
ATOM   8375   H HB3  . LYS A 1 538 ? -30.769 -34.047 -18.140 0.02 32.16 ? 531 LYS A HB3  1  
ATOM   8376   H HG2  . LYS A 1 538 ? -31.374 -34.808 -16.323 0.02 32.78 ? 531 LYS A HG2  1  
ATOM   8377   H HG3  . LYS A 1 538 ? -29.881 -35.191 -15.993 0.02 32.80 ? 531 LYS A HG3  1  
ATOM   8378   H HD2  . LYS A 1 538 ? -29.649 -33.151 -14.824 0.02 32.14 ? 531 LYS A HD2  1  
ATOM   8379   H HD3  . LYS A 1 538 ? -31.223 -32.941 -15.015 0.02 32.27 ? 531 LYS A HD3  1  
ATOM   8380   H HE2  . LYS A 1 538 ? -31.747 -34.539 -13.599 0.02 33.16 ? 531 LYS A HE2  1  
ATOM   8381   H HE3  . LYS A 1 538 ? -30.394 -35.338 -13.851 0.02 33.19 ? 531 LYS A HE3  1  
ATOM   8382   H HZ1  . LYS A 1 538 ? -29.338 -33.630 -12.662 0.02 32.51 ? 531 LYS A HZ1  1  
ATOM   8383   H HZ2  . LYS A 1 538 ? -30.633 -33.087 -12.308 0.02 32.61 ? 531 LYS A HZ2  1  
ATOM   8384   H HZ3  . LYS A 1 538 ? -30.239 -34.395 -11.826 0.02 33.07 ? 531 LYS A HZ3  1  
ATOM   8385   N N    . SER A 1 539 ? -27.085 -35.805 -17.672 0.02 32.40 ? 532 SER A N    1  
ATOM   8386   C CA   . SER A 1 539 ? -26.563 -37.182 -17.562 0.02 32.89 ? 532 SER A CA   1  
ATOM   8387   C C    . SER A 1 539 ? -25.208 -37.368 -18.208 0.02 32.76 ? 532 SER A C    1  
ATOM   8388   O O    . SER A 1 539 ? -24.408 -38.130 -17.659 0.02 33.02 ? 532 SER A O    1  
ATOM   8389   C CB   . SER A 1 539 ? -27.453 -38.270 -18.181 0.02 33.38 ? 532 SER A CB   1  
ATOM   8390   O OG   . SER A 1 539 ? -26.972 -38.652 -19.457 0.02 33.35 ? 532 SER A OG   1  
ATOM   8391   H H    . SER A 1 539 ? -26.478 -35.205 -17.589 0.02 32.14 ? 532 SER A H    1  
ATOM   8392   H HA   . SER A 1 539 ? -26.466 -37.404 -16.623 0.02 33.08 ? 532 SER A HA   1  
ATOM   8393   H HB2  . SER A 1 539 ? -27.374 -39.053 -17.611 0.02 33.76 ? 532 SER A HB2  1  
ATOM   8394   H HB3  . SER A 1 539 ? -28.377 -38.049 -18.261 0.02 33.44 ? 532 SER A HB3  1  
ATOM   8395   H HG   . SER A 1 539 ? -27.221 -39.435 -19.633 0.02 33.68 ? 532 SER A HG   1  
ATOM   8396   N N    . ASP A 1 540 ? -24.930 -36.790 -19.387 0.02 32.41 ? 533 ASP A N    1  
ATOM   8397   C CA   . ASP A 1 540 ? -23.565 -36.941 -19.861 0.02 32.35 ? 533 ASP A CA   1  
ATOM   8398   C C    . ASP A 1 540 ? -22.699 -36.440 -18.739 0.02 32.22 ? 533 ASP A C    1  
ATOM   8399   O O    . ASP A 1 540 ? -22.970 -35.383 -18.156 0.02 31.89 ? 533 ASP A O    1  
ATOM   8400   C CB   . ASP A 1 540 ? -23.207 -36.177 -21.156 0.02 31.96 ? 533 ASP A CB   1  
ATOM   8401   C CG   . ASP A 1 540 ? -24.388 -35.783 -21.963 0.02 31.68 ? 533 ASP A CG   1  
ATOM   8402   O OD1  . ASP A 1 540 ? -25.466 -36.247 -21.593 0.02 31.85 ? 533 ASP A OD1  1  
ATOM   8403   O OD2  . ASP A 1 540 ? -24.249 -35.034 -22.962 0.02 31.33 ? 533 ASP A OD2  1  
ATOM   8404   H H    . ASP A 1 540 ? -25.475 -36.353 -19.882 0.02 32.24 ? 533 ASP A H    1  
ATOM   8405   H HA   . ASP A 1 540 ? -23.378 -37.882 -19.998 0.02 32.71 ? 533 ASP A HA   1  
ATOM   8406   H HB2  . ASP A 1 540 ? -22.684 -35.389 -20.942 0.02 31.72 ? 533 ASP A HB2  1  
ATOM   8407   H HB3  . ASP A 1 540 ? -22.689 -36.782 -21.714 0.02 32.18 ? 533 ASP A HB3  1  
ATOM   8408   N N    . GLU A 1 541 ? -21.685 -37.205 -18.425 0.02 32.54 ? 534 GLU A N    1  
ATOM   8409   C CA   . GLU A 1 541 ? -20.706 -36.830 -17.431 0.02 32.52 ? 534 GLU A CA   1  
ATOM   8410   C C    . GLU A 1 541 ? -19.746 -35.801 -17.972 0.02 32.10 ? 534 GLU A C    1  
ATOM   8411   O O    . GLU A 1 541 ? -19.341 -34.895 -17.241 0.02 31.88 ? 534 GLU A O    1  
ATOM   8412   C CB   . GLU A 1 541 ? -19.920 -38.079 -16.975 0.02 33.08 ? 534 GLU A CB   1  
ATOM   8413   C CG   . GLU A 1 541 ? -19.222 -38.834 -18.147 0.02 33.26 ? 534 GLU A CG   1  
ATOM   8414   C CD   . GLU A 1 541 ? -18.125 -39.831 -17.701 0.02 33.73 ? 534 GLU A CD   1  
ATOM   8415   O OE1  . GLU A 1 541 ? -17.941 -40.018 -16.471 0.02 34.06 ? 534 GLU A OE1  1  
ATOM   8416   O OE2  . GLU A 1 541 ? -17.451 -40.438 -18.565 0.02 33.82 ? 534 GLU A OE2  1  
ATOM   8417   H H    . GLU A 1 541 ? -21.528 -37.964 -18.794 0.02 32.81 ? 534 GLU A H    1  
ATOM   8418   H HA   . GLU A 1 541 ? -21.163 -36.442 -16.669 0.02 32.47 ? 534 GLU A HA   1  
ATOM   8419   H HB2  . GLU A 1 541 ? -19.236 -37.812 -16.343 0.02 33.07 ? 534 GLU A HB2  1  
ATOM   8420   H HB3  . GLU A 1 541 ? -20.537 -38.694 -16.546 0.02 33.38 ? 534 GLU A HB3  1  
ATOM   8421   H HG2  . GLU A 1 541 ? -19.896 -39.337 -18.634 0.02 33.43 ? 534 GLU A HG2  1  
ATOM   8422   H HG3  . GLU A 1 541 ? -18.805 -38.192 -18.738 0.02 32.95 ? 534 GLU A HG3  1  
ATOM   8423   N N    . VAL A 1 542 ? -19.442 -35.904 -19.265 0.02 32.02 ? 535 VAL A N    1  
ATOM   8424   C CA   . VAL A 1 542 ? -18.448 -35.097 -19.940 0.02 31.72 ? 535 VAL A CA   1  
ATOM   8425   C C    . VAL A 1 542 ? -19.153 -34.456 -21.125 0.02 31.34 ? 535 VAL A C    1  
ATOM   8426   O O    . VAL A 1 542 ? -19.952 -35.107 -21.805 0.02 31.47 ? 535 VAL A O    1  
ATOM   8427   C CB   . VAL A 1 542 ? -17.249 -35.946 -20.400 0.02 32.07 ? 535 VAL A CB   1  
ATOM   8428   C CG1  . VAL A 1 542 ? -16.243 -35.129 -21.166 0.02 31.82 ? 535 VAL A CG1  1  
ATOM   8429   C CG2  . VAL A 1 542 ? -16.563 -36.604 -19.217 0.02 32.48 ? 535 VAL A CG2  1  
ATOM   8430   H H    . VAL A 1 542 ? -19.830 -36.457 -19.792 0.02 32.16 ? 535 VAL A H    1  
ATOM   8431   H HA   . VAL A 1 542 ? -18.127 -34.401 -19.349 0.02 31.57 ? 535 VAL A HA   1  
ATOM   8432   H HB   . VAL A 1 542 ? -17.575 -36.644 -20.988 0.02 32.26 ? 535 VAL A HB   1  
ATOM   8433   H HG11 . VAL A 1 542 ? -15.433 -35.649 -21.272 0.02 32.08 ? 535 VAL A HG11 1  
ATOM   8434   H HG12 . VAL A 1 542 ? -16.610 -34.912 -22.038 0.02 31.66 ? 535 VAL A HG12 1  
ATOM   8435   H HG13 . VAL A 1 542 ? -16.048 -34.323 -20.668 0.02 31.58 ? 535 VAL A HG13 1  
ATOM   8436   H HG21 . VAL A 1 542 ? -17.158 -36.604 -18.453 0.02 32.52 ? 535 VAL A HG21 1  
ATOM   8437   H HG22 . VAL A 1 542 ? -16.333 -37.513 -19.461 0.02 32.82 ? 535 VAL A HG22 1  
ATOM   8438   H HG23 . VAL A 1 542 ? -15.761 -36.104 -19.010 0.02 32.39 ? 535 VAL A HG23 1  
ATOM   8439   N N    . TYR A 1 543 ? -18.880 -33.192 -21.348 0.02 30.92 ? 536 TYR A N    1  
ATOM   8440   C CA   . TYR A 1 543 ? -19.528 -32.455 -22.414 0.02 30.56 ? 536 TYR A CA   1  
ATOM   8441   C C    . TYR A 1 543 ? -18.838 -32.736 -23.744 0.02 30.61 ? 536 TYR A C    1  
ATOM   8442   O O    . TYR A 1 543 ? -17.612 -32.707 -23.807 0.02 30.71 ? 536 TYR A O    1  
ATOM   8443   C CB   . TYR A 1 543 ? -19.431 -30.965 -22.116 0.02 30.14 ? 536 TYR A CB   1  
ATOM   8444   C CG   . TYR A 1 543 ? -20.158 -30.471 -20.872 0.02 30.07 ? 536 TYR A CG   1  
ATOM   8445   C CD1  . TYR A 1 543 ? -21.363 -31.024 -20.470 0.02 30.22 ? 536 TYR A CD1  1  
ATOM   8446   C CD2  . TYR A 1 543 ? -19.631 -29.422 -20.124 0.02 29.88 ? 536 TYR A CD2  1  
ATOM   8447   C CE1  . TYR A 1 543 ? -22.036 -30.536 -19.347 0.02 30.19 ? 536 TYR A CE1  1  
ATOM   8448   C CE2  . TYR A 1 543 ? -20.279 -28.941 -19.007 0.02 29.84 ? 536 TYR A CE2  1  
ATOM   8449   C CZ   . TYR A 1 543 ? -21.477 -29.498 -18.622 0.02 30.00 ? 536 TYR A CZ   1  
ATOM   8450   O OH   . TYR A 1 543 ? -22.119 -29.003 -17.514 0.02 29.99 ? 536 TYR A OH   1  
ATOM   8451   H H    . TYR A 1 543 ? -18.305 -32.735 -20.906 0.02 30.86 ? 536 TYR A H    1  
ATOM   8452   H HA   . TYR A 1 543 ? -20.461 -32.716 -22.482 0.02 30.60 ? 536 TYR A HA   1  
ATOM   8453   H HB2  . TYR A 1 543 ? -18.494 -30.747 -22.002 0.02 30.15 ? 536 TYR A HB2  1  
ATOM   8454   H HB3  . TYR A 1 543 ? -19.788 -30.482 -22.875 0.02 29.93 ? 536 TYR A HB3  1  
ATOM   8455   H HD1  . TYR A 1 543 ? -21.744 -31.713 -20.960 0.02 30.37 ? 536 TYR A HD1  1  
ATOM   8456   H HD2  . TYR A 1 543 ? -18.824 -29.041 -20.375 0.02 29.81 ? 536 TYR A HD2  1  
ATOM   8457   H HE1  . TYR A 1 543 ? -22.845 -30.910 -19.087 0.02 30.32 ? 536 TYR A HE1  1  
ATOM   8458   H HE2  . TYR A 1 543 ? -19.910 -28.243 -18.517 0.02 29.74 ? 536 TYR A HE2  1  
ATOM   8459   H HH   . TYR A 1 543 ? -22.937 -29.190 -17.548 0.02 30.01 ? 536 TYR A HH   1  
ATOM   8460   N N    . LYS A 1 544 ? -19.622 -32.967 -24.806 0.02 30.56 ? 537 LYS A N    1  
ATOM   8461   C CA   . LYS A 1 544 ? -19.089 -32.989 -26.172 0.02 30.56 ? 537 LYS A CA   1  
ATOM   8462   C C    . LYS A 1 544 ? -19.271 -31.619 -26.811 0.02 30.12 ? 537 LYS A C    1  
ATOM   8463   O O    . LYS A 1 544 ? -20.311 -30.987 -26.629 0.02 29.87 ? 537 LYS A O    1  
ATOM   8464   C CB   . LYS A 1 544 ? -19.766 -34.005 -27.126 0.02 30.85 ? 537 LYS A CB   1  
ATOM   8465   C CG   . LYS A 1 544 ? -20.459 -35.260 -26.621 0.02 31.28 ? 537 LYS A CG   1  
ATOM   8466   C CD   . LYS A 1 544 ? -19.709 -36.546 -26.967 0.02 31.76 ? 537 LYS A CD   1  
ATOM   8467   C CE   . LYS A 1 544 ? -19.288 -37.336 -25.725 0.02 32.16 ? 537 LYS A CE   1  
ATOM   8468   N NZ   . LYS A 1 544 ? -18.437 -36.567 -24.755 0.02 31.97 ? 537 LYS A NZ   1  
ATOM   8469   H H    . LYS A 1 544 ? -20.466 -33.117 -24.760 0.02 30.56 ? 537 LYS A H    1  
ATOM   8470   H HA   . LYS A 1 544 ? -18.137 -33.174 -26.142 0.02 30.69 ? 537 LYS A HA   1  
ATOM   8471   H HB2  . LYS A 1 544 ? -20.445 -33.515 -27.618 0.02 30.66 ? 537 LYS A HB2  1  
ATOM   8472   H HB3  . LYS A 1 544 ? -19.082 -34.287 -27.751 0.02 30.96 ? 537 LYS A HB3  1  
ATOM   8473   H HG2  . LYS A 1 544 ? -20.548 -35.225 -25.656 0.02 31.31 ? 537 LYS A HG2  1  
ATOM   8474   H HG3  . LYS A 1 544 ? -21.333 -35.312 -27.036 0.02 31.26 ? 537 LYS A HG3  1  
ATOM   8475   H HD2  . LYS A 1 544 ? -20.296 -37.120 -27.485 0.02 31.92 ? 537 LYS A HD2  1  
ATOM   8476   H HD3  . LYS A 1 544 ? -18.909 -36.341 -27.475 0.02 31.72 ? 537 LYS A HD3  1  
ATOM   8477   H HE2  . LYS A 1 544 ? -20.086 -37.629 -25.260 0.02 32.30 ? 537 LYS A HE2  1  
ATOM   8478   H HE3  . LYS A 1 544 ? -18.778 -38.111 -26.015 0.02 32.45 ? 537 LYS A HE3  1  
ATOM   8479   H HZ1  . LYS A 1 544 ? -18.651 -36.784 -23.916 0.02 32.03 ? 537 LYS A HZ1  1  
ATOM   8480   H HZ2  . LYS A 1 544 ? -17.577 -36.750 -24.892 0.02 32.14 ? 537 LYS A HZ2  1  
ATOM   8481   H HZ3  . LYS A 1 544 ? -18.571 -35.694 -24.871 0.02 31.64 ? 537 LYS A HZ3  1  
ATOM   8482   N N    . CYS A 1 545 ? -18.295 -31.208 -27.631 0.02 30.06 ? 538 CYS A N    1  
ATOM   8483   C CA   . CYS A 1 545 ? -18.381 -29.941 -28.353 0.02 29.69 ? 538 CYS A CA   1  
ATOM   8484   C C    . CYS A 1 545 ? -17.811 -30.068 -29.762 0.02 29.80 ? 538 CYS A C    1  
ATOM   8485   O O    . CYS A 1 545 ? -16.908 -30.863 -30.018 0.02 30.12 ? 538 CYS A O    1  
ATOM   8486   C CB   . CYS A 1 545 ? -17.619 -28.816 -27.654 0.02 29.47 ? 538 CYS A CB   1  
ATOM   8487   S SG   . CYS A 1 545 ? -15.836 -28.976 -27.630 0.02 29.72 ? 538 CYS A SG   1  
ATOM   8488   H H    . CYS A 1 545 ? -17.572 -31.645 -27.777 0.02 30.25 ? 538 CYS A H    1  
ATOM   8489   H HA   . CYS A 1 545 ? -19.309 -29.679 -28.429 0.02 29.55 ? 538 CYS A HA   1  
ATOM   8490   H HB2  . CYS A 1 545 ? -17.821 -27.986 -28.109 0.02 29.25 ? 538 CYS A HB2  1  
ATOM   8491   H HB3  . CYS A 1 545 ? -17.926 -28.756 -26.737 0.02 29.44 ? 538 CYS A HB3  1  
ATOM   8492   H HG   . CYS A 1 545 ? -15.389 -29.027 -28.741 0.02 29.80 ? 538 CYS A HG   1  
ATOM   8493   N N    . LEU A 1 546 ? -18.315 -29.223 -30.662 0.02 29.55 ? 539 LEU A N    1  
ATOM   8494   C CA   . LEU A 1 546 ? -17.678 -29.064 -31.965 0.02 29.63 ? 539 LEU A CA   1  
ATOM   8495   C C    . LEU A 1 546 ? -16.499 -28.120 -31.817 0.02 29.52 ? 539 LEU A C    1  
ATOM   8496   O O    . LEU A 1 546 ? -16.686 -26.927 -31.567 0.02 29.21 ? 539 LEU A O    1  
ATOM   8497   C CB   . LEU A 1 546 ? -18.669 -28.546 -33.004 0.02 29.45 ? 539 LEU A CB   1  
ATOM   8498   C CG   . LEU A 1 546 ? -18.069 -28.427 -34.412 0.02 29.58 ? 539 LEU A CG   1  
ATOM   8499   C CD1  . LEU A 1 546 ? -17.357 -29.707 -34.786 0.02 30.01 ? 539 LEU A CD1  1  
ATOM   8500   C CD2  . LEU A 1 546 ? -19.140 -28.146 -35.450 0.02 29.50 ? 539 LEU A CD2  1  
ATOM   8501   H H    . LEU A 1 546 ? -19.020 -28.749 -30.549 0.02 29.36 ? 539 LEU A H    1  
ATOM   8502   H HA   . LEU A 1 546 ? -17.340 -29.923 -32.254 0.02 29.90 ? 539 LEU A HA   1  
ATOM   8503   H HB2  . LEU A 1 546 ? -19.414 -29.167 -33.058 0.02 29.56 ? 539 LEU A HB2  1  
ATOM   8504   H HB3  . LEU A 1 546 ? -18.987 -27.674 -32.729 0.02 29.20 ? 539 LEU A HB3  1  
ATOM   8505   H HG   . LEU A 1 546 ? -17.423 -27.704 -34.423 0.02 29.47 ? 539 LEU A HG   1  
ATOM   8506   H HD11 . LEU A 1 546 ? -17.168 -29.698 -35.738 0.02 30.11 ? 539 LEU A HD11 1  
ATOM   8507   H HD12 . LEU A 1 546 ? -16.527 -29.762 -34.285 0.02 30.08 ? 539 LEU A HD12 1  
ATOM   8508   H HD13 . LEU A 1 546 ? -17.929 -30.459 -34.573 0.02 30.14 ? 539 LEU A HD13 1  
ATOM   8509   H HD21 . LEU A 1 546 ? -18.727 -28.087 -36.327 0.02 29.61 ? 539 LEU A HD21 1  
ATOM   8510   H HD22 . LEU A 1 546 ? -19.781 -28.872 -35.439 0.02 29.62 ? 539 LEU A HD22 1  
ATOM   8511   H HD23 . LEU A 1 546 ? -19.571 -27.306 -35.232 0.02 29.24 ? 539 LEU A HD23 1  
ATOM   8512   N N    . ASN A 1 547 ? -15.293 -28.660 -31.942 0.02 29.83 ? 540 ASN A N    1  
ATOM   8513   C CA   . ASN A 1 547 ? -14.076 -27.873 -31.931 0.02 29.83 ? 540 ASN A CA   1  
ATOM   8514   C C    . ASN A 1 547 ? -13.837 -27.311 -33.324 0.02 29.83 ? 540 ASN A C    1  
ATOM   8515   O O    . ASN A 1 547 ? -13.641 -28.066 -34.286 0.02 30.11 ? 540 ASN A O    1  
ATOM   8516   C CB   . ASN A 1 547 ? -12.866 -28.689 -31.486 0.02 30.21 ? 540 ASN A CB   1  
ATOM   8517   C CG   . ASN A 1 547 ? -11.691 -27.804 -31.113 0.02 30.22 ? 540 ASN A CG   1  
ATOM   8518   O OD1  . ASN A 1 547 ? -11.692 -27.180 -30.061 0.02 30.05 ? 540 ASN A OD1  1  
ATOM   8519   N ND2  . ASN A 1 547 ? -10.713 -27.702 -32.004 0.02 30.46 ? 540 ASN A ND2  1  
ATOM   8520   H H    . ASN A 1 547 ? -15.157 -29.498 -32.030 0.02 30.06 ? 540 ASN A H    1  
ATOM   8521   H HA   . ASN A 1 547 ? -14.176 -27.133 -31.313 0.02 29.62 ? 540 ASN A HA   1  
ATOM   8522   H HB2  . ASN A 1 547 ? -13.103 -29.230 -30.720 0.02 30.27 ? 540 ASN A HB2  1  
ATOM   8523   H HB3  . ASN A 1 547 ? -12.584 -29.256 -32.218 0.02 30.44 ? 540 ASN A HB3  1  
ATOM   8524   H HD21 . ASN A 1 547 ? -10.054 -27.168 -31.863 0.02 30.49 ? 540 ASN A HD21 1  
ATOM   8525   H HD22 . ASN A 1 547 ? -10.744 -28.167 -32.723 0.02 30.60 ? 540 ASN A HD22 1  
ATOM   8526   N N    . ILE A 1 548 ? -13.858 -25.988 -33.425 0.02 29.55 ? 541 ILE A N    1  
ATOM   8527   C CA   . ILE A 1 548 ? -13.753 -25.304 -34.709 0.02 29.54 ? 541 ILE A CA   1  
ATOM   8528   C C    . ILE A 1 548 ? -12.330 -24.795 -34.857 0.02 29.74 ? 541 ILE A C    1  
ATOM   8529   O O    . ILE A 1 548 ? -11.924 -23.839 -34.197 0.02 29.60 ? 541 ILE A O    1  
ATOM   8530   C CB   . ILE A 1 548 ? -14.761 -24.158 -34.834 0.02 29.16 ? 541 ILE A CB   1  
ATOM   8531   C CG1  . ILE A 1 548 ? -16.191 -24.664 -34.652 0.02 29.02 ? 541 ILE A CG1  1  
ATOM   8532   C CG2  . ILE A 1 548 ? -14.611 -23.501 -36.218 0.02 29.21 ? 541 ILE A CG2  1  
ATOM   8533   C CD1  . ILE A 1 548 ? -17.244 -23.515 -34.476 0.02 28.65 ? 541 ILE A CD1  1  
ATOM   8534   H H    . ILE A 1 548 ? -13.926 -25.462 -32.755 0.02 29.39 ? 541 ILE A H    1  
ATOM   8535   H HA   . ILE A 1 548 ? -13.927 -25.929 -35.424 0.02 29.70 ? 541 ILE A HA   1  
ATOM   8536   H HB   . ILE A 1 548 ? -14.568 -23.504 -34.145 0.02 29.02 ? 541 ILE A HB   1  
ATOM   8537   H HG12 . ILE A 1 548 ? -16.443 -25.183 -35.429 0.02 29.15 ? 541 ILE A HG12 1  
ATOM   8538   H HG13 . ILE A 1 548 ? -16.231 -25.219 -33.859 0.02 29.05 ? 541 ILE A HG13 1  
ATOM   8539   H HG21 . ILE A 1 548 ? -15.234 -22.763 -36.280 0.02 28.99 ? 541 ILE A HG21 1  
ATOM   8540   H HG22 . ILE A 1 548 ? -13.706 -23.176 -36.336 0.02 29.34 ? 541 ILE A HG22 1  
ATOM   8541   H HG23 . ILE A 1 548 ? -14.815 -24.164 -36.891 0.02 29.36 ? 541 ILE A HG23 1  
ATOM   8542   H HD11 . ILE A 1 548 ? -18.117 -23.901 -34.306 0.02 28.60 ? 541 ILE A HD11 1  
ATOM   8543   H HD12 . ILE A 1 548 ? -16.975 -22.956 -33.731 0.02 28.54 ? 541 ILE A HD12 1  
ATOM   8544   H HD13 . ILE A 1 548 ? -17.270 -22.987 -35.287 0.02 28.64 ? 541 ILE A HD13 1  
ATOM   8545   N N    . SER A 1 549 ? -11.573 -25.426 -35.739 0.02 30.10 ? 542 SER A N    1  
ATOM   8546   C CA   . SER A 1 549 ? -10.225 -25.005 -36.059 0.02 30.38 ? 542 SER A CA   1  
ATOM   8547   C C    . SER A 1 549 ? -10.060 -25.039 -37.586 0.02 30.61 ? 542 SER A C    1  
ATOM   8548   O O    . SER A 1 549 ? -11.045 -24.871 -38.300 0.02 30.44 ? 542 SER A O    1  
ATOM   8549   C CB   . SER A 1 549 ? -9.223  -25.915 -35.365 0.02 30.72 ? 542 SER A CB   1  
ATOM   8550   O OG   . SER A 1 549 ? -7.945  -25.385 -35.503 0.02 30.99 ? 542 SER A OG   1  
ATOM   8551   H H    . SER A 1 549 ? -11.827 -26.121 -36.170 0.02 30.23 ? 542 SER A H    1  
ATOM   8552   H HA   . SER A 1 549 ? -10.079 -24.097 -35.758 0.02 30.22 ? 542 SER A HA   1  
ATOM   8553   H HB2  . SER A 1 549 ? -9.439  -25.971 -34.423 0.02 30.58 ? 542 SER A HB2  1  
ATOM   8554   H HB3  . SER A 1 549 ? -9.250  -26.799 -35.760 0.02 30.92 ? 542 SER A HB3  1  
ATOM   8555   H HG   . SER A 1 549 ? -7.989  -24.548 -35.561 0.02 30.84 ? 542 SER A HG   1  
ATOM   8556   N N    . ASP A 1 550 ? -8.850  -25.268 -38.098 0.02 31.04 ? 543 ASP A N    1  
ATOM   8557   C CA   . ASP A 1 550 ? -8.718  -25.462 -39.545 0.02 31.32 ? 543 ASP A CA   1  
ATOM   8558   C C    . ASP A 1 550 ? -9.567  -26.640 -40.002 0.02 31.39 ? 543 ASP A C    1  
ATOM   8559   O O    . ASP A 1 550 ? -10.116 -26.630 -41.102 0.02 31.41 ? 543 ASP A O    1  
ATOM   8560   C CB   . ASP A 1 550 ? -7.251  -25.649 -39.931 0.02 31.83 ? 543 ASP A CB   1  
ATOM   8561   C CG   . ASP A 1 550 ? -6.513  -24.333 -39.979 0.02 31.84 ? 543 ASP A CG   1  
ATOM   8562   O OD1  . ASP A 1 550 ? -5.686  -24.035 -39.084 0.02 31.84 ? 543 ASP A OD1  1  
ATOM   8563   O OD2  . ASP A 1 550 ? -6.824  -23.552 -40.890 0.02 31.83 ? 543 ASP A OD2  1  
ATOM   8564   H H    . ASP A 1 550 ? -8.115  -25.313 -37.656 0.02 31.20 ? 543 ASP A H    1  
ATOM   8565   H HA   . ASP A 1 550 ? -9.041  -24.667 -39.997 0.02 31.17 ? 543 ASP A HA   1  
ATOM   8566   H HB2  . ASP A 1 550 ? -6.814  -26.226 -39.286 0.02 31.96 ? 543 ASP A HB2  1  
ATOM   8567   H HB3  . ASP A 1 550 ? -7.206  -26.045 -40.813 0.02 32.07 ? 543 ASP A HB3  1  
ATOM   8568   N N    . GLU A 1 551 ? -9.699  -27.654 -39.151 0.02 31.46 ? 544 GLU A N    1  
ATOM   8569   C CA   . GLU A 1 551 ? -10.691 -28.710 -39.270 0.02 31.48 ? 544 GLU A CA   1  
ATOM   8570   C C    . GLU A 1 551 ? -11.789 -28.572 -38.226 0.02 31.06 ? 544 GLU A C    1  
ATOM   8571   O O    . GLU A 1 551 ? -11.547 -28.087 -37.120 0.02 30.86 ? 544 GLU A O    1  
ATOM   8572   C CB   . GLU A 1 551 ? -10.052 -30.082 -39.061 0.02 31.96 ? 544 GLU A CB   1  
ATOM   8573   C CG   . GLU A 1 551 ? -9.816  -30.395 -37.556 0.02 31.94 ? 544 GLU A CG   1  
ATOM   8574   C CD   . GLU A 1 551 ? -8.861  -29.397 -36.907 0.02 31.75 ? 544 GLU A CD   1  
ATOM   8575   O OE1  . GLU A 1 551 ? -8.087  -28.768 -37.669 0.02 31.83 ? 544 GLU A OE1  1  
ATOM   8576   O OE2  . GLU A 1 551 ? -8.861  -29.231 -35.660 0.02 31.54 ? 544 GLU A OE2  1  
ATOM   8577   H H    . GLU A 1 551 ? -9.191  -27.742 -38.472 0.02 31.53 ? 544 GLU A H    1  
ATOM   8578   H HA   . GLU A 1 551 ? -11.099 -28.678 -40.147 0.02 31.51 ? 544 GLU A HA   1  
ATOM   8579   H HB2  . GLU A 1 551 ? -10.639 -30.761 -39.426 0.02 32.05 ? 544 GLU A HB2  1  
ATOM   8580   H HB3  . GLU A 1 551 ? -9.194  -30.105 -39.513 0.02 32.24 ? 544 GLU A HB3  1  
ATOM   8581   H HG2  . GLU A 1 551 ? -10.651 -30.393 -37.063 0.02 31.73 ? 544 GLU A HG2  1  
ATOM   8582   H HG3  . GLU A 1 551 ? -9.412  -31.275 -37.484 0.02 32.29 ? 544 GLU A HG3  1  
ATOM   8583   N N    . LEU A 1 552 ? -12.952 -29.133 -38.531 0.02 30.96 ? 545 LEU A N    1  
ATOM   8584   C CA   . LEU A 1 552 ? -14.041 -29.262 -37.574 0.02 30.66 ? 545 LEU A CA   1  
ATOM   8585   C C    . LEU A 1 552 ? -14.073 -30.678 -37.014 0.02 30.95 ? 545 LEU A C    1  
ATOM   8586   O O    . LEU A 1 552 ? -14.232 -31.639 -37.772 0.02 31.28 ? 545 LEU A O    1  
ATOM   8587   C CB   . LEU A 1 552 ? -15.391 -28.958 -38.211 0.02 30.45 ? 545 LEU A CB   1  
ATOM   8588   C CG   . LEU A 1 552 ? -15.509 -27.725 -39.116 0.02 30.26 ? 545 LEU A CG   1  
ATOM   8589   C CD1  . LEU A 1 552 ? -15.038 -26.493 -38.355 0.02 29.97 ? 545 LEU A CD1  1  
ATOM   8590   C CD2  . LEU A 1 552 ? -14.737 -27.928 -40.378 0.02 30.62 ? 545 LEU A CD2  1  
ATOM   8591   H H    . LEU A 1 552 ? -13.130 -29.468 -39.297 0.02 31.09 ? 545 LEU A H    1  
ATOM   8592   H HA   . LEU A 1 552 ? -13.899 -28.647 -36.841 0.02 30.45 ? 545 LEU A HA   1  
ATOM   8593   H HB2  . LEU A 1 552 ? -15.655 -29.730 -38.734 0.02 30.67 ? 545 LEU A HB2  1  
ATOM   8594   H HB3  . LEU A 1 552 ? -16.028 -28.836 -37.494 0.02 30.23 ? 545 LEU A HB3  1  
ATOM   8595   H HG   . LEU A 1 552 ? -16.438 -27.593 -39.365 0.02 30.14 ? 545 LEU A HG   1  
ATOM   8596   H HD11 . LEU A 1 552 ? -14.084 -26.558 -38.196 0.02 30.12 ? 545 LEU A HD11 1  
ATOM   8597   H HD12 . LEU A 1 552 ? -15.237 -25.702 -38.877 0.02 29.84 ? 545 LEU A HD12 1  
ATOM   8598   H HD13 . LEU A 1 552 ? -15.511 -26.457 -37.514 0.02 29.78 ? 545 LEU A HD13 1  
ATOM   8599   H HD21 . LEU A 1 552 ? -15.216 -27.507 -41.109 0.02 30.56 ? 545 LEU A HD21 1  
ATOM   8600   H HD22 . LEU A 1 552 ? -13.858 -27.530 -40.280 0.02 30.68 ? 545 LEU A HD22 1  
ATOM   8601   H HD23 . LEU A 1 552 ? -14.648 -28.876 -40.551 0.02 30.89 ? 545 LEU A HD23 1  
ATOM   8602   N N    . LYS A 1 553 ? -13.961 -30.797 -35.685 0.02 30.85 ? 546 LYS A N    1  
ATOM   8603   C CA   . LYS A 1 553 ? -13.915 -32.105 -35.036 0.02 31.17 ? 546 LYS A CA   1  
ATOM   8604   C C    . LYS A 1 553 ? -14.733 -32.097 -33.752 0.02 30.94 ? 546 LYS A C    1  
ATOM   8605   O O    . LYS A 1 553 ? -14.634 -31.151 -32.962 0.02 30.63 ? 546 LYS A O    1  
ATOM   8606   C CB   . LYS A 1 553 ? -12.470 -32.501 -34.733 0.02 31.51 ? 546 LYS A CB   1  
ATOM   8607   C CG   . LYS A 1 553 ? -12.282 -33.960 -34.420 0.02 31.94 ? 546 LYS A CG   1  
ATOM   8608   C CD   . LYS A 1 553 ? -10.841 -34.243 -34.061 0.02 32.32 ? 546 LYS A CD   1  
ATOM   8609   C CE   . LYS A 1 553 ? -10.677 -35.015 -32.757 0.02 32.56 ? 546 LYS A CE   1  
ATOM   8610   N NZ   . LYS A 1 553 ? -11.644 -36.163 -32.617 0.02 32.73 ? 546 LYS A NZ   1  
ATOM   8611   H H    . LYS A 1 553 ? -13.896 -30.137 -35.145 0.02 30.63 ? 546 LYS A H    1  
ATOM   8612   H HA   . LYS A 1 553 ? -14.294 -32.776 -35.625 0.02 31.37 ? 546 LYS A HA   1  
ATOM   8613   H HB2  . LYS A 1 553 ? -11.924 -32.306 -35.512 0.02 31.65 ? 546 LYS A HB2  1  
ATOM   8614   H HB3  . LYS A 1 553 ? -12.155 -31.986 -33.977 0.02 31.35 ? 546 LYS A HB3  1  
ATOM   8615   H HG2  . LYS A 1 553 ? -12.849 -34.207 -33.673 0.02 31.83 ? 546 LYS A HG2  1  
ATOM   8616   H HG3  . LYS A 1 553 ? -12.508 -34.485 -35.204 0.02 32.12 ? 546 LYS A HG3  1  
ATOM   8617   H HD2  . LYS A 1 553 ? -10.438 -34.755 -34.779 0.02 32.60 ? 546 LYS A HD2  1  
ATOM   8618   H HD3  . LYS A 1 553 ? -10.377 -33.396 -33.960 0.02 32.16 ? 546 LYS A HD3  1  
ATOM   8619   H HE2  . LYS A 1 553 ? -9.782  -35.390 -32.729 0.02 32.89 ? 546 LYS A HE2  1  
ATOM   8620   H HE3  . LYS A 1 553 ? -10.789 -34.411 -32.016 0.02 32.32 ? 546 LYS A HE3  1  
ATOM   8621   H HZ1  . LYS A 1 553 ? -11.455 -36.638 -31.886 0.02 32.92 ? 546 LYS A HZ1  1  
ATOM   8622   H HZ2  . LYS A 1 553 ? -12.478 -35.855 -32.558 0.02 32.45 ? 546 LYS A HZ2  1  
ATOM   8623   H HZ3  . LYS A 1 553 ? -11.583 -36.696 -33.329 0.02 32.94 ? 546 LYS A HZ3  1  
ATOM   8624   N N    . MET A 1 554 ? -15.528 -33.159 -33.557 0.02 31.14 ? 547 MET A N    1  
ATOM   8625   C CA   . MET A 1 554 ? -16.238 -33.362 -32.306 0.02 31.03 ? 547 MET A CA   1  
ATOM   8626   C C    . MET A 1 554 ? -15.280 -33.973 -31.293 0.02 31.30 ? 547 MET A C    1  
ATOM   8627   O O    . MET A 1 554 ? -14.600 -34.969 -31.577 0.02 31.74 ? 547 MET A O    1  
ATOM   8628   C CB   . MET A 1 554 ? -17.448 -34.270 -32.490 0.02 31.20 ? 547 MET A CB   1  
ATOM   8629   C CG   . MET A 1 554 ? -18.582 -33.727 -33.278 0.02 30.96 ? 547 MET A CG   1  
ATOM   8630   S SD   . MET A 1 554 ? -19.250 -32.170 -32.600 0.02 30.38 ? 547 MET A SD   1  
ATOM   8631   C CE   . MET A 1 554 ? -19.689 -32.695 -30.938 0.02 30.45 ? 547 MET A CE   1  
ATOM   8632   H H    . MET A 1 554 ? -15.666 -33.776 -34.133 0.02 31.35 ? 547 MET A H    1  
ATOM   8633   H HA   . MET A 1 554 ? -16.551 -32.509 -31.972 0.02 30.71 ? 547 MET A HA   1  
ATOM   8634   H HB2  . MET A 1 554 ? -17.153 -35.082 -32.929 0.02 31.52 ? 547 MET A HB2  1  
ATOM   8635   H HB3  . MET A 1 554 ? -17.797 -34.486 -31.615 0.02 31.20 ? 547 MET A HB3  1  
ATOM   8636   H HG2  . MET A 1 554 ? -18.301 -33.581 -34.195 0.02 30.99 ? 547 MET A HG2  1  
ATOM   8637   H HG3  . MET A 1 554 ? -19.298 -34.379 -33.252 0.02 31.11 ? 547 MET A HG3  1  
ATOM   8638   H HE1  . MET A 1 554 ? -20.265 -32.028 -30.533 0.02 30.20 ? 547 MET A HE1  1  
ATOM   8639   H HE2  . MET A 1 554 ? -20.158 -33.540 -30.992 0.02 30.70 ? 547 MET A HE2  1  
ATOM   8640   H HE3  . MET A 1 554 ? -18.878 -32.800 -30.418 0.02 30.53 ? 547 MET A HE3  1  
ATOM   8641   N N    . ILE A 1 555 ? -15.249 -33.380 -30.101 0.02 31.08 ? 548 ILE A N    1  
ATOM   8642   C CA   . ILE A 1 555 ? -14.335 -33.776 -29.043 0.02 31.32 ? 548 ILE A CA   1  
ATOM   8643   C C    . ILE A 1 555 ? -15.011 -33.530 -27.706 0.02 31.13 ? 548 ILE A C    1  
ATOM   8644   O O    . ILE A 1 555 ? -15.976 -32.774 -27.595 0.02 30.78 ? 548 ILE A O    1  
ATOM   8645   C CB   . ILE A 1 555 ? -12.992 -33.014 -29.062 0.02 31.30 ? 548 ILE A CB   1  
ATOM   8646   C CG1  . ILE A 1 555 ? -13.198 -31.494 -28.868 0.02 30.81 ? 548 ILE A CG1  1  
ATOM   8647   C CG2  . ILE A 1 555 ? -12.257 -33.303 -30.348 0.02 31.55 ? 548 ILE A CG2  1  
ATOM   8648   C CD1  . ILE A 1 555 ? -11.949 -30.763 -28.408 0.02 30.84 ? 548 ILE A CD1  1  
ATOM   8649   H H    . ILE A 1 555 ? -15.769 -32.735 -29.882 0.02 30.81 ? 548 ILE A H    1  
ATOM   8650   H HA   . ILE A 1 555 ? -14.148 -34.723 -29.125 0.02 31.65 ? 548 ILE A HA   1  
ATOM   8651   H HB   . ILE A 1 555 ? -12.449 -33.334 -28.328 0.02 31.49 ? 548 ILE A HB   1  
ATOM   8652   H HG12 . ILE A 1 555 ? -13.472 -31.114 -29.717 0.02 30.68 ? 548 ILE A HG12 1  
ATOM   8653   H HG13 . ILE A 1 555 ? -13.881 -31.325 -28.202 0.02 30.65 ? 548 ILE A HG13 1  
ATOM   8654   H HG21 . ILE A 1 555 ? -11.311 -33.138 -30.215 0.02 31.67 ? 548 ILE A HG21 1  
ATOM   8655   H HG22 . ILE A 1 555 ? -12.401 -34.233 -30.585 0.02 31.83 ? 548 ILE A HG22 1  
ATOM   8656   H HG23 . ILE A 1 555 ? -12.603 -32.731 -31.052 0.02 31.34 ? 548 ILE A HG23 1  
ATOM   8657   H HD11 . ILE A 1 555 ? -12.207 -29.953 -27.943 0.02 30.58 ? 548 ILE A HD11 1  
ATOM   8658   H HD12 . ILE A 1 555 ? -11.456 -31.342 -27.808 0.02 31.10 ? 548 ILE A HD12 1  
ATOM   8659   H HD13 . ILE A 1 555 ? -11.402 -30.549 -29.180 0.02 30.90 ? 548 ILE A HD13 1  
ATOM   8660   N N    . ASP A 1 556 ? -14.488 -34.210 -26.696 0.02 31.43 ? 549 ASP A N    1  
ATOM   8661   C CA   . ASP A 1 556 ? -14.766 -33.839 -25.319 0.02 31.31 ? 549 ASP A CA   1  
ATOM   8662   C C    . ASP A 1 556 ? -14.120 -32.501 -25.024 0.02 31.00 ? 549 ASP A C    1  
ATOM   8663   O O    . ASP A 1 556 ? -12.985 -32.245 -25.421 0.02 31.10 ? 549 ASP A O    1  
ATOM   8664   C CB   . ASP A 1 556 ? -14.217 -34.892 -24.362 0.02 31.76 ? 549 ASP A CB   1  
ATOM   8665   C CG   . ASP A 1 556 ? -15.125 -36.067 -24.236 0.02 32.05 ? 549 ASP A CG   1  
ATOM   8666   O OD1  . ASP A 1 556 ? -14.648 -37.201 -24.043 0.02 32.53 ? 549 ASP A OD1  1  
ATOM   8667   O OD2  . ASP A 1 556 ? -16.337 -35.856 -24.330 0.02 31.85 ? 549 ASP A OD2  1  
ATOM   8668   H H    . ASP A 1 556 ? -13.962 -34.884 -26.781 0.02 31.73 ? 549 ASP A H    1  
ATOM   8669   H HA   . ASP A 1 556 ? -15.721 -33.756 -25.191 0.02 31.15 ? 549 ASP A HA   1  
ATOM   8670   H HB2  . ASP A 1 556 ? -13.354 -35.198 -24.675 0.02 31.99 ? 549 ASP A HB2  1  
ATOM   8671   H HB3  . ASP A 1 556 ? -14.123 -34.501 -23.482 0.02 31.69 ? 549 ASP A HB3  1  
ATOM   8672   N N    . VAL A 1 557 ? -14.856 -31.639 -24.335 0.02 30.67 ? 550 VAL A N    1  
ATOM   8673   C CA   . VAL A 1 557 ? -14.324 -30.353 -23.912 0.02 30.41 ? 550 VAL A CA   1  
ATOM   8674   C C    . VAL A 1 557 ? -13.012 -30.542 -23.165 0.02 30.71 ? 550 VAL A C    1  
ATOM   8675   O O    . VAL A 1 557 ? -13.019 -31.132 -22.083 0.02 30.94 ? 550 VAL A O    1  
ATOM   8676   C CB   . VAL A 1 557 ? -15.343 -29.613 -23.032 0.02 30.11 ? 550 VAL A CB   1  
ATOM   8677   C CG1  . VAL A 1 557 ? -14.735 -28.341 -22.501 0.02 29.91 ? 550 VAL A CG1  1  
ATOM   8678   C CG2  . VAL A 1 557 ? -16.621 -29.363 -23.835 0.02 29.84 ? 550 VAL A CG2  1  
ATOM   8679   H H    . VAL A 1 557 ? -15.672 -31.775 -24.109 0.02 30.60 ? 550 VAL A H    1  
ATOM   8680   H HA   . VAL A 1 557 ? -14.160 -29.819 -24.697 0.02 30.25 ? 550 VAL A HA   1  
ATOM   8681   H HB   . VAL A 1 557 ? -15.568 -30.169 -22.268 0.02 30.28 ? 550 VAL A HB   1  
ATOM   8682   H HG11 . VAL A 1 557 ? -15.444 -27.700 -22.343 0.02 29.67 ? 550 VAL A HG11 1  
ATOM   8683   H HG12 . VAL A 1 557 ? -14.270 -28.532 -21.673 0.02 30.09 ? 550 VAL A HG12 1  
ATOM   8684   H HG13 . VAL A 1 557 ? -14.111 -27.993 -23.155 0.02 29.89 ? 550 VAL A HG13 1  
ATOM   8685   H HG21 . VAL A 1 557 ? -17.183 -28.740 -23.353 0.02 29.64 ? 550 VAL A HG21 1  
ATOM   8686   H HG22 . VAL A 1 557 ? -16.376 -28.988 -24.693 0.02 29.73 ? 550 VAL A HG22 1  
ATOM   8687   H HG23 . VAL A 1 557 ? -17.095 -30.196 -23.965 0.02 30.00 ? 550 VAL A HG23 1  
ATOM   8688   N N    . PRO A 1 558 ? -11.880 -30.046 -23.674 0.02 30.77 ? 551 PRO A N    1  
ATOM   8689   C CA   . PRO A 1 558 ? -10.618 -30.194 -22.939 0.02 31.10 ? 551 PRO A CA   1  
ATOM   8690   C C    . PRO A 1 558 ? -10.664 -29.571 -21.568 0.02 31.03 ? 551 PRO A C    1  
ATOM   8691   O O    . PRO A 1 558 ? -9.845  -29.922 -20.705 0.02 31.37 ? 551 PRO A O    1  
ATOM   8692   C CB   . PRO A 1 558 ? -9.596  -29.473 -23.828 0.02 31.11 ? 551 PRO A CB   1  
ATOM   8693   C CG   . PRO A 1 558 ? -10.197 -29.499 -25.193 0.02 30.92 ? 551 PRO A CG   1  
ATOM   8694   C CD   . PRO A 1 558 ? -11.677 -29.421 -24.991 0.02 30.59 ? 551 PRO A CD   1  
ATOM   8695   H HA   . PRO A 1 558 ? -10.381 -31.128 -22.870 0.02 31.41 ? 551 PRO A HA   1  
ATOM   8696   H HB2  . PRO A 1 558 ? -9.482  -28.561 -23.523 0.02 30.93 ? 551 PRO A HB2  1  
ATOM   8697   H HB3  . PRO A 1 558 ? -8.750  -29.944 -23.808 0.02 31.43 ? 551 PRO A HB3  1  
ATOM   8698   H HG2  . PRO A 1 558 ? -9.878  -28.742 -25.703 0.02 30.79 ? 551 PRO A HG2  1  
ATOM   8699   H HG3  . PRO A 1 558 ? -9.961  -30.328 -25.632 0.02 31.17 ? 551 PRO A HG3  1  
ATOM   8700   H HD2  . PRO A 1 558 ? -11.974 -28.499 -24.975 0.02 30.30 ? 551 PRO A HD2  1  
ATOM   8701   H HD3  . PRO A 1 558 ? -12.138 -29.930 -25.672 0.02 30.60 ? 551 PRO A HD3  1  
ATOM   8702   N N    . GLU A 1 559 ? -11.586 -28.643 -21.352 0.02 30.62 ? 552 GLU A N    1  
ATOM   8703   C CA   . GLU A 1 559 ? -11.653 -27.901 -20.107 0.02 30.54 ? 552 GLU A CA   1  
ATOM   8704   C C    . GLU A 1 559 ? -12.422 -28.651 -19.024 0.02 30.69 ? 552 GLU A C    1  
ATOM   8705   O O    . GLU A 1 559 ? -12.533 -28.153 -17.900 0.02 30.68 ? 552 GLU A O    1  
ATOM   8706   C CB   . GLU A 1 559 ? -12.294 -26.543 -20.374 0.02 30.09 ? 552 GLU A CB   1  
ATOM   8707   C CG   . GLU A 1 559 ? -11.350 -25.595 -21.078 0.02 30.02 ? 552 GLU A CG   1  
ATOM   8708   C CD   . GLU A 1 559 ? -11.190 -25.840 -22.591 0.02 30.00 ? 552 GLU A CD   1  
ATOM   8709   O OE1  . GLU A 1 559 ? -12.011 -26.554 -23.209 0.02 29.94 ? 552 GLU A OE1  1  
ATOM   8710   O OE2  . GLU A 1 559 ? -10.223 -25.261 -23.136 0.02 30.07 ? 552 GLU A OE2  1  
ATOM   8711   H H    . GLU A 1 559 ? -12.200 -28.431 -21.912 0.02 30.41 ? 552 GLU A H    1  
ATOM   8712   H HA   . GLU A 1 559 ? -10.749 -27.744 -19.796 0.02 30.72 ? 552 GLU A HA   1  
ATOM   8713   H HB2  . GLU A 1 559 ? -13.090 -26.664 -20.909 0.02 29.92 ? 552 GLU A HB2  1  
ATOM   8714   H HB3  . GLU A 1 559 ? -12.534 -26.137 -19.530 0.02 30.04 ? 552 GLU A HB3  1  
ATOM   8715   H HG2  . GLU A 1 559 ? -11.676 -24.688 -20.963 0.02 29.78 ? 552 GLU A HG2  1  
ATOM   8716   H HG3  . GLU A 1 559 ? -10.474 -25.677 -20.672 0.02 30.25 ? 552 GLU A HG3  1  
ATOM   8717   N N    . MET A 1 560 ? -12.915 -29.851 -19.316 0.02 30.87 ? 553 MET A N    1  
ATOM   8718   C CA   . MET A 1 560 ? -13.867 -30.488 -18.414 0.02 30.99 ? 553 MET A CA   1  
ATOM   8719   C C    . MET A 1 560 ? -13.210 -30.808 -17.072 0.02 31.35 ? 553 MET A C    1  
ATOM   8720   O O    . MET A 1 560 ? -13.813 -30.598 -16.009 0.02 31.35 ? 553 MET A O    1  
ATOM   8721   C CB   . MET A 1 560 ? -14.444 -31.742 -19.078 0.02 31.20 ? 553 MET A CB   1  
ATOM   8722   C CG   . MET A 1 560 ? -15.696 -32.286 -18.399 0.02 31.27 ? 553 MET A CG   1  
ATOM   8723   S SD   . MET A 1 560 ? -17.210 -31.402 -18.881 0.02 30.77 ? 553 MET A SD   1  
ATOM   8724   C CE   . MET A 1 560 ? -18.213 -31.630 -17.386 0.02 30.96 ? 553 MET A CE   1  
ATOM   8725   H H    . MET A 1 560 ? -12.707 -30.318 -20.001 0.02 30.97 ? 553 MET A H    1  
ATOM   8726   H HA   . MET A 1 560 ? -14.604 -29.876 -18.257 0.02 30.74 ? 553 MET A HA   1  
ATOM   8727   H HB2  . MET A 1 560 ? -14.680 -31.530 -19.993 0.02 31.01 ? 553 MET A HB2  1  
ATOM   8728   H HB3  . MET A 1 560 ? -13.770 -32.440 -19.066 0.02 31.51 ? 553 MET A HB3  1  
ATOM   8729   H HG2  . MET A 1 560 ? -15.805 -33.220 -18.633 0.02 31.51 ? 553 MET A HG2  1  
ATOM   8730   H HG3  . MET A 1 560 ? -15.590 -32.203 -17.440 0.02 31.39 ? 553 MET A HG3  1  
ATOM   8731   H HE1  . MET A 1 560 ? -19.121 -31.325 -17.548 0.02 30.82 ? 553 MET A HE1  1  
ATOM   8732   H HE2  . MET A 1 560 ? -18.217 -32.571 -17.155 0.02 31.29 ? 553 MET A HE2  1  
ATOM   8733   H HE3  . MET A 1 560 ? -17.819 -31.113 -16.667 0.02 30.90 ? 553 MET A HE3  1  
ATOM   8734   N N    . GLY A 1 561 ? -11.937 -31.206 -17.107 0.02 31.68 ? 554 GLY A N    1  
ATOM   8735   C CA   . GLY A 1 561 ? -11.248 -31.592 -15.886 0.02 32.10 ? 554 GLY A CA   1  
ATOM   8736   C C    . GLY A 1 561 ? -11.118 -30.438 -14.909 0.02 31.95 ? 554 GLY A C    1  
ATOM   8737   O O    . GLY A 1 561 ? -11.374 -30.589 -13.712 0.02 32.14 ? 554 GLY A O    1  
ATOM   8738   H H    . GLY A 1 561 ? -11.456 -31.249 -17.816 0.02 31.70 ? 554 GLY A H    1  
ATOM   8739   H HA2  . GLY A 1 561 ? -11.737 -32.309 -15.455 0.02 32.28 ? 554 GLY A HA2  1  
ATOM   8740   H HA3  . GLY A 1 561 ? -10.358 -31.909 -16.105 0.02 32.33 ? 554 GLY A HA3  1  
ATOM   8741   N N    . LYS A 1 562 ? -10.732 -29.260 -15.418 0.02 31.64 ? 555 LYS A N    1  
ATOM   8742   C CA   . LYS A 1 562 ? -10.618 -28.090 -14.562 0.02 31.52 ? 555 LYS A CA   1  
ATOM   8743   C C    . LYS A 1 562 ? -11.990 -27.641 -14.093 0.02 31.21 ? 555 LYS A C    1  
ATOM   8744   O O    . LYS A 1 562 ? -12.159 -27.250 -12.932 0.02 31.30 ? 555 LYS A O    1  
ATOM   8745   C CB   . LYS A 1 562 ? -9.889  -26.984 -15.311 0.02 31.32 ? 555 LYS A CB   1  
ATOM   8746   C CG   . LYS A 1 562 ? -8.436  -27.267 -15.545 0.02 31.69 ? 555 LYS A CG   1  
ATOM   8747   C CD   . LYS A 1 562 ? -7.794  -26.273 -16.484 0.02 31.50 ? 555 LYS A CD   1  
ATOM   8748   C CE   . LYS A 1 562 ? -6.308  -26.584 -16.603 0.02 31.95 ? 555 LYS A CE   1  
ATOM   8749   N NZ   . LYS A 1 562 ? -5.841  -26.489 -18.019 0.02 31.89 ? 555 LYS A NZ   1  
ATOM   8750   H H    . LYS A 1 562 ? -10.537 -29.115 -16.239 0.02 31.51 ? 555 LYS A H    1  
ATOM   8751   H HA   . LYS A 1 562 ? -10.089 -28.313 -13.784 0.02 31.81 ? 555 LYS A HA   1  
ATOM   8752   H HB2  . LYS A 1 562 ? -10.302 -26.893 -16.181 0.02 31.07 ? 555 LYS A HB2  1  
ATOM   8753   H HB3  . LYS A 1 562 ? -9.962  -26.157 -14.811 0.02 31.22 ? 555 LYS A HB3  1  
ATOM   8754   H HG2  . LYS A 1 562 ? -7.965  -27.225 -14.698 0.02 31.93 ? 555 LYS A HG2  1  
ATOM   8755   H HG3  . LYS A 1 562 ? -8.342  -28.150 -15.934 0.02 31.86 ? 555 LYS A HG3  1  
ATOM   8756   H HD2  . LYS A 1 562 ? -8.202  -26.340 -17.360 0.02 31.31 ? 555 LYS A HD2  1  
ATOM   8757   H HD3  . LYS A 1 562 ? -7.896  -25.377 -16.137 0.02 31.33 ? 555 LYS A HD3  1  
ATOM   8758   H HE2  . LYS A 1 562 ? -5.802  -25.953 -16.070 0.02 32.03 ? 555 LYS A HE2  1  
ATOM   8759   H HE3  . LYS A 1 562 ? -6.146  -27.486 -16.287 0.02 32.24 ? 555 LYS A HE3  1  
ATOM   8760   H HZ1  . LYS A 1 562 ? -5.592  -27.295 -18.303 0.02 32.17 ? 555 LYS A HZ1  1  
ATOM   8761   H HZ2  . LYS A 1 562 ? -6.498  -26.191 -18.537 0.02 31.63 ? 555 LYS A HZ2  1  
ATOM   8762   H HZ3  . LYS A 1 562 ? -5.147  -25.938 -18.074 0.02 31.84 ? 555 LYS A HZ3  1  
ATOM   8763   N N    . ILE A 1 563 ? -12.988 -27.728 -14.974 0.02 30.91 ? 556 ILE A N    1  
ATOM   8764   C CA   . ILE A 1 563 ? -14.363 -27.418 -14.602 0.02 30.67 ? 556 ILE A CA   1  
ATOM   8765   C C    . ILE A 1 563 ? -14.786 -28.230 -13.381 0.02 31.02 ? 556 ILE A C    1  
ATOM   8766   O O    . ILE A 1 563 ? -15.334 -27.699 -12.407 0.02 30.98 ? 556 ILE A O    1  
ATOM   8767   C CB   . ILE A 1 563 ? -15.291 -27.679 -15.796 0.02 30.40 ? 556 ILE A CB   1  
ATOM   8768   C CG1  . ILE A 1 563 ? -15.151 -26.552 -16.825 0.02 30.03 ? 556 ILE A CG1  1  
ATOM   8769   C CG2  . ILE A 1 563 ? -16.709 -27.772 -15.361 0.02 30.29 ? 556 ILE A CG2  1  
ATOM   8770   C CD1  . ILE A 1 563 ? -15.766 -26.871 -18.211 0.02 29.84 ? 556 ILE A CD1  1  
ATOM   8771   H H    . ILE A 1 563 ? -12.894 -27.964 -15.792 0.02 30.85 ? 556 ILE A H    1  
ATOM   8772   H HA   . ILE A 1 563 ? -14.423 -26.481 -14.367 0.02 30.50 ? 556 ILE A HA   1  
ATOM   8773   H HB   . ILE A 1 563 ? -15.036 -28.518 -16.203 0.02 30.58 ? 556 ILE A HB   1  
ATOM   8774   H HG12 . ILE A 1 563 ? -15.605 -25.764 -16.484 0.02 29.84 ? 556 ILE A HG12 1  
ATOM   8775   H HG13 . ILE A 1 563 ? -14.209 -26.353 -16.952 0.02 30.13 ? 556 ILE A HG13 1  
ATOM   8776   H HG21 . ILE A 1 563 ? -17.286 -27.554 -16.106 0.02 30.06 ? 556 ILE A HG21 1  
ATOM   8777   H HG22 . ILE A 1 563 ? -16.894 -28.672 -15.055 0.02 30.53 ? 556 ILE A HG22 1  
ATOM   8778   H HG23 . ILE A 1 563 ? -16.858 -27.130 -14.651 0.02 30.24 ? 556 ILE A HG23 1  
ATOM   8779   H HD11 . ILE A 1 563 ? -15.509 -26.169 -18.824 0.02 29.66 ? 556 ILE A HD11 1  
ATOM   8780   H HD12 . ILE A 1 563 ? -15.415 -27.721 -18.516 0.02 30.05 ? 556 ILE A HD12 1  
ATOM   8781   H HD13 . ILE A 1 563 ? -16.732 -26.920 -18.148 0.02 29.73 ? 556 ILE A HD13 1  
ATOM   8782   N N    . LYS A 1 564 ? -14.546 -29.536 -13.428 0.02 31.40 ? 557 LYS A N    1  
ATOM   8783   C CA   . LYS A 1 564 ? -15.047 -30.412 -12.381 0.02 31.77 ? 557 LYS A CA   1  
ATOM   8784   C C    . LYS A 1 564 ? -14.427 -30.099 -11.031 0.02 32.04 ? 557 LYS A C    1  
ATOM   8785   O O    . LYS A 1 564 ? -15.102 -30.244 -9.997  0.02 32.22 ? 557 LYS A O    1  
ATOM   8786   C CB   . LYS A 1 564 ? -14.785 -31.867 -12.761 0.02 32.14 ? 557 LYS A CB   1  
ATOM   8787   C CG   . LYS A 1 564 ? -15.602 -32.290 -13.901 0.02 31.95 ? 557 LYS A CG   1  
ATOM   8788   C CD   . LYS A 1 564 ? -16.927 -32.748 -13.457 0.02 32.03 ? 557 LYS A CD   1  
ATOM   8789   C CE   . LYS A 1 564 ? -16.941 -34.306 -13.417 0.02 32.55 ? 557 LYS A CE   1  
ATOM   8790   N NZ   . LYS A 1 564 ? -17.440 -34.925 -14.705 0.02 32.51 ? 557 LYS A NZ   1  
ATOM   8791   H H    . LYS A 1 564 ? -14.101 -29.931 -14.044 0.02 31.47 ? 557 LYS A H    1  
ATOM   8792   H HA   . LYS A 1 564 ? -16.005 -30.294 -12.306 0.02 31.64 ? 557 LYS A HA   1  
ATOM   8793   H HB2  . LYS A 1 564 ? -13.853 -31.962 -13.011 0.02 32.25 ? 557 LYS A HB2  1  
ATOM   8794   H HB3  . LYS A 1 564 ? -14.988 -32.445 -12.011 0.02 32.44 ? 557 LYS A HB3  1  
ATOM   8795   H HG2  . LYS A 1 564 ? -15.726 -31.542 -14.507 0.02 31.61 ? 557 LYS A HG2  1  
ATOM   8796   H HG3  . LYS A 1 564 ? -15.156 -33.018 -14.364 0.02 32.15 ? 557 LYS A HG3  1  
ATOM   8797   H HD2  . LYS A 1 564 ? -17.109 -32.408 -12.566 0.02 32.07 ? 557 LYS A HD2  1  
ATOM   8798   H HD3  . LYS A 1 564 ? -17.603 -32.444 -14.080 0.02 31.76 ? 557 LYS A HD3  1  
ATOM   8799   H HE2  . LYS A 1 564 ? -16.038 -34.625 -13.256 0.02 32.80 ? 557 LYS A HE2  1  
ATOM   8800   H HE3  . LYS A 1 564 ? -17.512 -34.609 -12.693 0.02 32.71 ? 557 LYS A HE3  1  
ATOM   8801   H HZ1  . LYS A 1 564 ? -17.645 -35.784 -14.580 0.02 32.82 ? 557 LYS A HZ1  1  
ATOM   8802   H HZ2  . LYS A 1 564 ? -18.165 -34.494 -14.987 0.02 32.26 ? 557 LYS A HZ2  1  
ATOM   8803   H HZ3  . LYS A 1 564 ? -16.810 -34.869 -15.334 0.02 32.45 ? 557 LYS A HZ3  1  
ATOM   8804   N N    . GLN A 1 565 ? -13.152 -29.712 -10.992 0.02 32.15 ? 558 GLN A N    1  
ATOM   8805   C CA   . GLN A 1 565 ? -12.578 -29.347 -9.703  0.02 32.43 ? 558 GLN A CA   1  
ATOM   8806   C C    . GLN A 1 565 ? -13.157 -28.034 -9.207  0.02 32.12 ? 558 GLN A C    1  
ATOM   8807   O O    . GLN A 1 565 ? -13.283 -27.823 -7.996  0.02 32.34 ? 558 GLN A O    1  
ATOM   8808   C CB   . GLN A 1 565 ? -11.061 -29.239 -9.785  0.02 32.67 ? 558 GLN A CB   1  
ATOM   8809   C CG   . GLN A 1 565 ? -10.437 -28.876 -8.421  0.02 33.04 ? 558 GLN A CG   1  
ATOM   8810   C CD   . GLN A 1 565 ? -10.140 -30.048 -7.465  0.02 33.64 ? 558 GLN A CD   1  
ATOM   8811   O OE1  . GLN A 1 565 ? -11.017 -30.822 -7.079  0.02 33.77 ? 558 GLN A OE1  1  
ATOM   8812   N NE2  . GLN A 1 565 ? -8.894  -30.117 -7.024  0.02 34.05 ? 558 GLN A NE2  1  
ATOM   8813   H H    . GLN A 1 565 ? -12.619 -29.655 -11.659 0.02 32.08 ? 558 GLN A H    1  
ATOM   8814   H HA   . GLN A 1 565 ? -12.804 -30.023 -9.045  0.02 32.72 ? 558 GLN A HA   1  
ATOM   8815   H HB2  . GLN A 1 565 ? -10.687 -30.080 -10.093 0.02 32.89 ? 558 GLN A HB2  1  
ATOM   8816   H HB3  . GLN A 1 565 ? -10.834 -28.538 -10.411 0.02 32.41 ? 558 GLN A HB3  1  
ATOM   8817   H HG2  . GLN A 1 565 ? -9.590  -28.438 -8.593  0.02 33.08 ? 558 GLN A HG2  1  
ATOM   8818   H HG3  . GLN A 1 565 ? -11.014 -28.264 -7.943  0.02 32.90 ? 558 GLN A HG3  1  
ATOM   8819   H HE21 . GLN A 1 565 ? -8.284  -29.630 -7.386  0.02 33.98 ? 558 GLN A HE21 1  
ATOM   8820   H HE22 . GLN A 1 565 ? -8.693  -30.652 -6.382  0.02 34.41 ? 558 GLN A HE22 1  
ATOM   8821   N N    . TRP A 1 566 ? -13.470 -27.111 -10.122 0.02 31.64 ? 559 TRP A N    1  
ATOM   8822   C CA   . TRP A 1 566 ? -14.170 -25.913 -9.679  0.02 31.37 ? 559 TRP A CA   1  
ATOM   8823   C C    . TRP A 1 566 ? -15.474 -26.307 -9.013  0.02 31.42 ? 559 TRP A C    1  
ATOM   8824   O O    . TRP A 1 566 ? -15.836 -25.767 -7.957  0.02 31.52 ? 559 TRP A O    1  
ATOM   8825   C CB   . TRP A 1 566 ? -14.420 -24.956 -10.844 0.02 30.88 ? 559 TRP A CB   1  
ATOM   8826   C CG   . TRP A 1 566 ? -13.250 -24.098 -11.176 0.02 30.82 ? 559 TRP A CG   1  
ATOM   8827   C CD1  . TRP A 1 566 ? -12.123 -24.491 -11.808 0.02 30.96 ? 559 TRP A CD1  1  
ATOM   8828   C CD2  . TRP A 1 566 ? -13.090 -22.698 -10.912 0.02 30.66 ? 559 TRP A CD2  1  
ATOM   8829   N NE1  . TRP A 1 566 ? -11.264 -23.454 -11.946 0.02 30.92 ? 559 TRP A NE1  1  
ATOM   8830   C CE2  . TRP A 1 566 ? -11.829 -22.330 -11.409 0.02 30.73 ? 559 TRP A CE2  1  
ATOM   8831   C CE3  . TRP A 1 566 ? -13.883 -21.726 -10.291 0.02 30.51 ? 559 TRP A CE3  1  
ATOM   8832   C CZ2  . TRP A 1 566 ? -11.340 -21.037 -11.324 0.02 30.65 ? 559 TRP A CZ2  1  
ATOM   8833   C CZ3  . TRP A 1 566 ? -13.397 -20.447 -10.196 0.02 30.43 ? 559 TRP A CZ3  1  
ATOM   8834   C CH2  . TRP A 1 566 ? -12.134 -20.108 -10.691 0.02 30.51 ? 559 TRP A CH2  1  
ATOM   8835   H H    . TRP A 1 566 ? -13.290 -27.147 -10.958 0.02 31.50 ? 559 TRP A H    1  
ATOM   8836   H HA   . TRP A 1 566 ? -13.623 -25.448 -9.029  0.02 31.50 ? 559 TRP A HA   1  
ATOM   8837   H HB2  . TRP A 1 566 ? -14.639 -25.479 -11.627 0.02 30.79 ? 559 TRP A HB2  1  
ATOM   8838   H HB3  . TRP A 1 566 ? -15.158 -24.374 -10.616 0.02 30.70 ? 559 TRP A HB3  1  
ATOM   8839   H HD1  . TRP A 1 566 ? -11.955 -25.350 -12.104 0.02 31.10 ? 559 TRP A HD1  1  
ATOM   8840   H HE1  . TRP A 1 566 ? -10.505 -23.504 -12.319 0.02 31.01 ? 559 TRP A HE1  1  
ATOM   8841   H HE3  . TRP A 1 566 ? -14.720 -21.941 -9.949  0.02 30.50 ? 559 TRP A HE3  1  
ATOM   8842   H HZ2  . TRP A 1 566 ? -10.500 -20.816 -11.652 0.02 30.73 ? 559 TRP A HZ2  1  
ATOM   8843   H HZ3  . TRP A 1 566 ? -13.916 -19.794 -9.789  0.02 30.35 ? 559 TRP A HZ3  1  
ATOM   8844   H HH2  . TRP A 1 566 ? -11.839 -19.231 -10.621 0.02 30.48 ? 559 TRP A HH2  1  
ATOM   8845   N N    . GLU A 1 567 ? -16.173 -27.276 -9.589  0.02 31.42 ? 560 GLU A N    1  
ATOM   8846   C CA   . GLU A 1 567 ? -17.405 -27.732 -8.975  0.02 31.55 ? 560 GLU A CA   1  
ATOM   8847   C C    . GLU A 1 567 ? -17.140 -28.266 -7.565  0.02 32.06 ? 560 GLU A C    1  
ATOM   8848   O O    . GLU A 1 567 ? -18.026 -28.206 -6.710  0.02 32.20 ? 560 GLU A O    1  
ATOM   8849   C CB   . GLU A 1 567 ? -18.075 -28.790 -9.845  0.02 31.56 ? 560 GLU A CB   1  
ATOM   8850   C CG   . GLU A 1 567 ? -19.392 -29.283 -9.304  0.02 31.70 ? 560 GLU A CG   1  
ATOM   8851   C CD   . GLU A 1 567 ? -20.047 -30.350 -10.153 0.02 31.78 ? 560 GLU A CD   1  
ATOM   8852   O OE1  . GLU A 1 567 ? -19.814 -30.404 -11.389 0.02 31.54 ? 560 GLU A OE1  1  
ATOM   8853   O OE2  . GLU A 1 567 ? -20.810 -31.157 -9.580  0.02 32.12 ? 560 GLU A OE2  1  
ATOM   8854   H H    . GLU A 1 567 ? -15.952 -27.688 -10.304 0.02 31.37 ? 560 GLU A H    1  
ATOM   8855   H HA   . GLU A 1 567 ? -18.009 -26.977 -8.906  0.02 31.33 ? 560 GLU A HA   1  
ATOM   8856   H HB2  . GLU A 1 567 ? -18.253 -28.399 -10.713 0.02 31.25 ? 560 GLU A HB2  1  
ATOM   8857   H HB3  . GLU A 1 567 ? -17.483 -29.550 -9.945  0.02 31.80 ? 560 GLU A HB3  1  
ATOM   8858   H HG2  . GLU A 1 567 ? -19.247 -29.663 -8.424  0.02 32.01 ? 560 GLU A HG2  1  
ATOM   8859   H HG3  . GLU A 1 567 ? -20.005 -28.536 -9.235  0.02 31.46 ? 560 GLU A HG3  1  
ATOM   8860   N N    . SER A 1 568 ? -15.920 -28.735 -7.297  0.02 32.37 ? 561 SER A N    1  
ATOM   8861   C CA   . SER A 1 568 ? -15.654 -29.385 -6.008  0.02 32.92 ? 561 SER A CA   1  
ATOM   8862   C C    . SER A 1 568 ? -15.423 -28.384 -4.883  0.02 33.01 ? 561 SER A C    1  
ATOM   8863   O O    . SER A 1 568 ? -15.300 -28.795 -3.727  0.02 33.46 ? 561 SER A O    1  
ATOM   8864   C CB   . SER A 1 568 ? -14.451 -30.313 -6.101  0.02 33.29 ? 561 SER A CB   1  
ATOM   8865   O OG   . SER A 1 568 ? -13.252 -29.588 -6.179  0.02 33.25 ? 561 SER A OG   1  
ATOM   8866   H H    . SER A 1 568 ? -15.242 -28.685 -7.818  0.02 32.31 ? 561 SER A H    1  
ATOM   8867   H HA   . SER A 1 568 ? -16.424 -29.922 -5.772  0.02 33.06 ? 561 SER A HA   1  
ATOM   8868   H HB2  . SER A 1 568 ? -14.426 -30.871 -5.311  0.02 33.68 ? 561 SER A HB2  1  
ATOM   8869   H HB3  . SER A 1 568 ? -14.539 -30.870 -6.889  0.02 33.23 ? 561 SER A HB3  1  
ATOM   8870   H HG   . SER A 1 568 ? -12.609 -30.113 -6.300  0.02 33.45 ? 561 SER A HG   1  
ATOM   8871   N N    . MET A 1 569 ? -15.348 -27.084 -5.183  0.02 32.62 ? 562 MET A N    1  
ATOM   8872   C CA   . MET A 1 569 ? -15.382 -26.110 -4.099  0.02 32.71 ? 562 MET A CA   1  
ATOM   8873   C C    . MET A 1 569 ? -16.737 -26.102 -3.406  0.02 32.76 ? 562 MET A C    1  
ATOM   8874   O O    . MET A 1 569 ? -16.840 -25.596 -2.276  0.02 33.00 ? 562 MET A O    1  
ATOM   8875   C CB   . MET A 1 569 ? -15.052 -24.706 -4.630  0.02 32.30 ? 562 MET A CB   1  
ATOM   8876   C CG   . MET A 1 569 ? -13.588 -24.481 -4.957  0.02 32.37 ? 562 MET A CG   1  
ATOM   8877   S SD   . MET A 1 569 ? -13.281 -22.790 -5.501  0.02 31.96 ? 562 MET A SD   1  
ATOM   8878   C CE   . MET A 1 569 ? -14.204 -22.790 -7.051  0.02 31.40 ? 562 MET A CE   1  
ATOM   8879   H H    . MET A 1 569 ? -15.278 -26.753 -5.970  0.02 32.34 ? 562 MET A H    1  
ATOM   8880   H HA   . MET A 1 569 ? -14.701 -26.339 -3.448  0.02 33.04 ? 562 MET A HA   1  
ATOM   8881   H HB2  . MET A 1 569 ? -15.558 -24.566 -5.441  0.02 31.97 ? 562 MET A HB2  1  
ATOM   8882   H HB3  . MET A 1 569 ? -15.311 -24.046 -3.971  0.02 32.32 ? 562 MET A HB3  1  
ATOM   8883   H HG2  . MET A 1 569 ? -13.055 -24.643 -4.163  0.02 32.72 ? 562 MET A HG2  1  
ATOM   8884   H HG3  . MET A 1 569 ? -13.319 -25.083 -5.664  0.02 32.33 ? 562 MET A HG3  1  
ATOM   8885   H HE1  . MET A 1 569 ? -14.062 -21.943 -7.507  0.02 31.17 ? 562 MET A HE1  1  
ATOM   8886   H HE2  . MET A 1 569 ? -13.885 -23.521 -7.604  0.02 31.43 ? 562 MET A HE2  1  
ATOM   8887   H HE3  . MET A 1 569 ? -15.148 -22.910 -6.862  0.02 31.33 ? 562 MET A HE3  1  
ATOM   8888   N N    . PHE A 1 570 ? -17.764 -26.664 -4.046  0.02 32.60 ? 563 PHE A N    1  
ATOM   8889   C CA   . PHE A 1 570 ? -19.140 -26.648 -3.571  0.02 32.66 ? 563 PHE A CA   1  
ATOM   8890   C C    . PHE A 1 570 ? -19.543 -27.963 -2.903  0.02 33.17 ? 563 PHE A C    1  
ATOM   8891   O O    . PHE A 1 570 ? -20.735 -28.218 -2.737  0.02 33.24 ? 563 PHE A O    1  
ATOM   8892   C CB   . PHE A 1 570 ? -20.103 -26.358 -4.724  0.02 32.19 ? 563 PHE A CB   1  
ATOM   8893   C CG   . PHE A 1 570 ? -20.014 -24.959 -5.279  0.02 31.73 ? 563 PHE A CG   1  
ATOM   8894   C CD1  . PHE A 1 570 ? -19.032 -24.625 -6.197  0.02 31.45 ? 563 PHE A CD1  1  
ATOM   8895   C CD2  . PHE A 1 570 ? -20.935 -23.989 -4.915  0.02 31.60 ? 563 PHE A CD2  1  
ATOM   8896   C CE1  . PHE A 1 570 ? -18.955 -23.350 -6.708  0.02 31.07 ? 563 PHE A CE1  1  
ATOM   8897   C CE2  . PHE A 1 570 ? -20.861 -22.703 -5.462  0.02 31.20 ? 563 PHE A CE2  1  
ATOM   8898   C CZ   . PHE A 1 570 ? -19.872 -22.400 -6.358  0.02 30.94 ? 563 PHE A CZ   1  
ATOM   8899   H H    . PHE A 1 570 ? -17.680 -27.083 -4.789  0.02 32.48 ? 563 PHE A H    1  
ATOM   8900   H HA   . PHE A 1 570 ? -19.235 -25.935 -2.921  0.02 32.70 ? 563 PHE A HA   1  
ATOM   8901   H HB2  . PHE A 1 570 ? -19.909 -26.973 -5.444  0.02 32.13 ? 563 PHE A HB2  1  
ATOM   8902   H HB3  . PHE A 1 570 ? -21.014 -26.485 -4.419  0.02 32.29 ? 563 PHE A HB3  1  
ATOM   8903   H HD1  . PHE A 1 570 ? -18.402 -25.259 -6.451  0.02 31.55 ? 563 PHE A HD1  1  
ATOM   8904   H HD2  . PHE A 1 570 ? -21.614 -24.191 -4.318  0.02 31.80 ? 563 PHE A HD2  1  
ATOM   8905   H HE1  . PHE A 1 570 ? -18.287 -23.141 -7.316  0.02 30.92 ? 563 PHE A HE1  1  
ATOM   8906   H HE2  . PHE A 1 570 ? -21.477 -22.052 -5.214  0.02 31.14 ? 563 PHE A HE2  1  
ATOM   8907   H HZ   . PHE A 1 570 ? -19.810 -21.544 -6.708  0.02 30.70 ? 563 PHE A HZ   1  
ATOM   8908   N N    . GLU A 1 571 ? -18.565 -28.804 -2.551  0.02 33.55 ? 564 GLU A N    1  
ATOM   8909   C CA   . GLU A 1 571 ? -18.837 -30.166 -2.104  0.02 34.07 ? 564 GLU A CA   1  
ATOM   8910   C C    . GLU A 1 571 ? -19.729 -30.217 -0.867  0.02 34.44 ? 564 GLU A C    1  
ATOM   8911   O O    . GLU A 1 571 ? -20.497 -31.165 -0.700  0.02 34.75 ? 564 GLU A O    1  
ATOM   8912   C CB   . GLU A 1 571 ? -17.520 -30.867 -1.814  0.02 34.46 ? 564 GLU A CB   1  
ATOM   8913   C CG   . GLU A 1 571 ? -17.340 -32.156 -2.522  0.02 34.71 ? 564 GLU A CG   1  
ATOM   8914   C CD   . GLU A 1 571 ? -15.946 -32.657 -2.286  0.02 34.99 ? 564 GLU A CD   1  
ATOM   8915   O OE1  . GLU A 1 571 ? -15.239 -32.903 -3.282  0.02 34.78 ? 564 GLU A OE1  1  
ATOM   8916   O OE2  . GLU A 1 571 ? -15.559 -32.721 -1.090  0.02 35.44 ? 564 GLU A OE2  1  
ATOM   8917   H H    . GLU A 1 571 ? -17.729 -28.606 -2.560  0.02 33.55 ? 564 GLU A H    1  
ATOM   8918   H HA   . GLU A 1 571 ? -19.291 -30.647 -2.812  0.02 33.96 ? 564 GLU A HA   1  
ATOM   8919   H HB2  . GLU A 1 571 ? -16.786 -30.293 -2.073  0.02 34.25 ? 564 GLU A HB2  1  
ATOM   8920   H HB3  . GLU A 1 571 ? -17.463 -31.047 -0.863  0.02 34.81 ? 564 GLU A HB3  1  
ATOM   8921   H HG2  . GLU A 1 571 ? -17.969 -32.812 -2.179  0.02 35.05 ? 564 GLU A HG2  1  
ATOM   8922   H HG3  . GLU A 1 571 ? -17.468 -32.031 -3.476  0.02 34.40 ? 564 GLU A HG3  1  
ATOM   8923   N N    . LYS A 1 572 ? -19.631 -29.227 0.015   0.02 34.46 ? 565 LYS A N    1  
ATOM   8924   C CA   . LYS A 1 572 ? -20.512 -29.143 1.182   0.02 34.83 ? 565 LYS A CA   1  
ATOM   8925   C C    . LYS A 1 572 ? -21.329 -27.855 1.173   0.02 34.46 ? 565 LYS A C    1  
ATOM   8926   O O    . LYS A 1 572 ? -21.823 -27.417 2.221   0.02 34.74 ? 565 LYS A O    1  
ATOM   8927   C CB   . LYS A 1 572 ? -19.721 -29.269 2.492   0.02 35.31 ? 565 LYS A CB   1  
ATOM   8928   C CG   . LYS A 1 572 ? -18.217 -29.589 2.412   0.02 35.53 ? 565 LYS A CG   1  
ATOM   8929   C CD   . LYS A 1 572 ? -17.435 -28.514 3.190   0.02 35.55 ? 565 LYS A CD   1  
ATOM   8930   C CE   . LYS A 1 572 ? -15.983 -28.889 3.485   0.02 35.83 ? 565 LYS A CE   1  
ATOM   8931   N NZ   . LYS A 1 572 ? -15.705 -29.066 4.941   0.02 36.53 ? 565 LYS A NZ   1  
ATOM   8932   H H    . LYS A 1 572 ? -19.059 -28.587 -0.038  0.02 34.28 ? 565 LYS A H    1  
ATOM   8933   H HA   . LYS A 1 572 ? -21.140 -29.881 1.156   0.02 35.07 ? 565 LYS A HA   1  
ATOM   8934   H HB2  . LYS A 1 572 ? -19.804 -28.431 2.973   0.02 35.14 ? 565 LYS A HB2  1  
ATOM   8935   H HB3  . LYS A 1 572 ? -20.134 -29.973 3.013   0.02 35.69 ? 565 LYS A HB3  1  
ATOM   8936   H HG2  . LYS A 1 572 ? -18.052 -30.448 2.829   0.02 35.97 ? 565 LYS A HG2  1  
ATOM   8937   H HG3  . LYS A 1 572 ? -17.896 -29.603 1.502   0.02 35.26 ? 565 LYS A HG3  1  
ATOM   8938   H HD2  . LYS A 1 572 ? -17.437 -27.691 2.675   0.02 35.13 ? 565 LYS A HD2  1  
ATOM   8939   H HD3  . LYS A 1 572 ? -17.869 -28.367 4.045   0.02 35.83 ? 565 LYS A HD3  1  
ATOM   8940   H HE2  . LYS A 1 572 ? -15.767 -29.720 3.033   0.02 35.80 ? 565 LYS A HE2  1  
ATOM   8941   H HE3  . LYS A 1 572 ? -15.407 -28.177 3.164   0.02 35.61 ? 565 LYS A HE3  1  
ATOM   8942   H HZ1  . LYS A 1 572 ? -14.846 -29.260 5.066   0.02 36.69 ? 565 LYS A HZ1  1  
ATOM   8943   H HZ2  . LYS A 1 572 ? -15.898 -28.320 5.386   0.02 36.59 ? 565 LYS A HZ2  1  
ATOM   8944   H HZ3  . LYS A 1 572 ? -16.200 -29.729 5.267   0.02 36.77 ? 565 LYS A HZ3  1  
ATOM   8945   N N    . HIS A 1 573 ? -21.477 -27.253 -0.002  0.02 33.88 ? 566 HIS A N    1  
ATOM   8946   C CA   . HIS A 1 573 ? -22.346 -26.110 -0.238  0.02 33.52 ? 566 HIS A CA   1  
ATOM   8947   C C    . HIS A 1 573 ? -23.071 -26.365 -1.548  0.02 33.13 ? 566 HIS A C    1  
ATOM   8948   O O    . HIS A 1 573 ? -23.098 -25.547 -2.471  0.02 32.64 ? 566 HIS A O    1  
ATOM   8949   C CB   . HIS A 1 573 ? -21.529 -24.820 -0.225  0.02 33.25 ? 566 HIS A CB   1  
ATOM   8950   C CG   . HIS A 1 573 ? -20.611 -24.721 0.949   0.02 33.68 ? 566 HIS A CG   1  
ATOM   8951   N ND1  . HIS A 1 573 ? -21.071 -24.760 2.246   0.02 34.17 ? 566 HIS A ND1  1  
ATOM   8952   C CD2  . HIS A 1 573 ? -19.265 -24.618 1.030   0.02 33.74 ? 566 HIS A CD2  1  
ATOM   8953   C CE1  . HIS A 1 573 ? -20.048 -24.671 3.077   0.02 34.51 ? 566 HIS A CE1  1  
ATOM   8954   N NE2  . HIS A 1 573 ? -18.942 -24.571 2.363   0.02 34.26 ? 566 HIS A NE2  1  
ATOM   8955   H H    . HIS A 1 573 ? -21.068 -27.503 -0.710  0.02 33.70 ? 566 HIS A H    1  
ATOM   8956   H HA   . HIS A 1 573 ? -23.011 -26.054 0.463   0.02 33.77 ? 566 HIS A HA   1  
ATOM   8957   H HB2  . HIS A 1 573 ? -20.986 -24.783 -1.027  0.02 32.97 ? 566 HIS A HB2  1  
ATOM   8958   H HB3  . HIS A 1 573 ? -22.134 -24.063 -0.196  0.02 33.11 ? 566 HIS A HB3  1  
ATOM   8959   H HD2  . HIS A 1 573 ? -18.669 -24.567 0.319   0.02 33.50 ? 566 HIS A HD2  1  
ATOM   8960   H HE1  . HIS A 1 573 ? -20.101 -24.664 4.001   0.02 34.88 ? 566 HIS A HE1  1  
ATOM   8961   H HE2  . HIS A 1 573 ? -18.147 -24.504 2.683   0.02 34.41 ? 566 HIS A HE2  1  
ATOM   8962   N N    . ARG A 1 574 ? -23.642 -27.560 -1.636  0.02 33.41 ? 567 ARG A N    1  
ATOM   8963   C CA   . ARG A 1 574 ? -24.158 -28.041 -2.906  0.02 33.14 ? 567 ARG A CA   1  
ATOM   8964   C C    . ARG A 1 574 ? -25.358 -27.224 -3.366  0.02 32.83 ? 567 ARG A C    1  
ATOM   8965   O O    . ARG A 1 574 ? -25.527 -26.989 -4.566  0.02 32.42 ? 567 ARG A O    1  
ATOM   8966   C CB   . ARG A 1 574 ? -24.498 -29.523 -2.771  0.02 33.60 ? 567 ARG A CB   1  
ATOM   8967   C CG   . ARG A 1 574 ? -23.271 -30.457 -2.773  0.02 33.83 ? 567 ARG A CG   1  
ATOM   8968   C CD   . ARG A 1 574 ? -22.635 -30.668 -4.181  0.02 33.42 ? 567 ARG A CD   1  
ATOM   8969   N NE   . ARG A 1 574 ? -23.653 -30.685 -5.238  0.02 33.13 ? 567 ARG A NE   1  
ATOM   8970   C CZ   . ARG A 1 574 ? -23.405 -30.717 -6.539  0.02 32.76 ? 567 ARG A CZ   1  
ATOM   8971   N NH1  . ARG A 1 574 ? -22.167 -30.791 -7.005  0.02 32.65 ? 567 ARG A NH1  1  
ATOM   8972   N NH2  . ARG A 1 574 ? -24.420 -30.699 -7.373  0.02 32.56 ? 567 ARG A NH2  1  
ATOM   8973   H H    . ARG A 1 574 ? -23.735 -28.105 -0.981  0.02 33.78 ? 567 ARG A H    1  
ATOM   8974   H HA   . ARG A 1 574 ? -23.461 -27.948 -3.574  0.02 32.87 ? 567 ARG A HA   1  
ATOM   8975   H HB2  . ARG A 1 574 ? -24.951 -29.651 -1.927  0.02 33.94 ? 567 ARG A HB2  1  
ATOM   8976   H HB3  . ARG A 1 574 ? -25.094 -29.774 -3.490  0.02 33.47 ? 567 ARG A HB3  1  
ATOM   8977   H HG2  . ARG A 1 574 ? -22.592 -30.074 -2.197  0.02 33.92 ? 567 ARG A HG2  1  
ATOM   8978   H HG3  . ARG A 1 574 ? -23.538 -31.327 -2.437  0.02 34.20 ? 567 ARG A HG3  1  
ATOM   8979   H HD2  . ARG A 1 574 ? -22.026 -29.937 -4.372  0.02 33.14 ? 567 ARG A HD2  1  
ATOM   8980   H HD3  . ARG A 1 574 ? -22.155 -31.511 -4.198  0.02 33.65 ? 567 ARG A HD3  1  
ATOM   8981   H HE   . ARG A 1 574 ? -24.447 -30.920 -5.003  0.02 33.31 ? 567 ARG A HE   1  
ATOM   8982   H HH11 . ARG A 1 574 ? -21.499 -30.798 -6.464  0.02 32.80 ? 567 ARG A HH11 1  
ATOM   8983   H HH12 . ARG A 1 574 ? -22.031 -30.817 -7.852  0.02 32.43 ? 567 ARG A HH12 1  
ATOM   8984   H HH21 . ARG A 1 574 ? -25.222 -30.659 -7.067  0.02 32.67 ? 567 ARG A HH21 1  
ATOM   8985   H HH22 . ARG A 1 574 ? -24.283 -30.736 -8.221  0.02 32.35 ? 567 ARG A HH22 1  
ATOM   8986   N N    . ASP A 1 575 ? -26.183 -26.789 -2.419  0.02 33.08 ? 568 ASP A N    1  
ATOM   8987   C CA   . ASP A 1 575 ? -27.265 -25.842 -2.641  0.02 32.85 ? 568 ASP A CA   1  
ATOM   8988   C C    . ASP A 1 575 ? -26.813 -24.577 -3.361  0.02 32.31 ? 568 ASP A C    1  
ATOM   8989   O O    . ASP A 1 575 ? -27.646 -23.893 -3.963  0.02 32.04 ? 568 ASP A O    1  
ATOM   8990   C CB   . ASP A 1 575 ? -27.842 -25.464 -1.285  0.02 33.28 ? 568 ASP A CB   1  
ATOM   8991   C CG   . ASP A 1 575 ? -26.817 -24.750 -0.414  0.02 33.36 ? 568 ASP A CG   1  
ATOM   8992   O OD1  . ASP A 1 575 ? -26.640 -23.550 -0.643  0.02 33.04 ? 568 ASP A OD1  1  
ATOM   8993   O OD2  . ASP A 1 575 ? -26.170 -25.371 0.460   0.02 33.76 ? 568 ASP A OD2  1  
ATOM   8994   H H    . ASP A 1 575 ? -26.126 -27.039 -1.599  0.02 33.41 ? 568 ASP A H    1  
ATOM   8995   H HA   . ASP A 1 575 ? -27.968 -26.259 -3.160  0.02 32.83 ? 568 ASP A HA   1  
ATOM   8996   H HB2  . ASP A 1 575 ? -28.597 -24.869 -1.417  0.02 33.17 ? 568 ASP A HB2  1  
ATOM   8997   H HB3  . ASP A 1 575 ? -28.129 -26.266 -0.822  0.02 33.66 ? 568 ASP A HB3  1  
ATOM   8998   N N    . LEU A 1 576 ? -25.533 -24.226 -3.273  0.02 32.18 ? 569 LEU A N    1  
ATOM   8999   C CA   . LEU A 1 576 ? -25.040 -22.965 -3.824  0.02 31.73 ? 569 LEU A CA   1  
ATOM   9000   C C    . LEU A 1 576 ? -24.458 -23.129 -5.225  0.02 31.32 ? 569 LEU A C    1  
ATOM   9001   O O    . LEU A 1 576 ? -24.336 -22.134 -5.962  0.02 30.92 ? 569 LEU A O    1  
ATOM   9002   C CB   . LEU A 1 576 ? -23.976 -22.359 -2.907  0.02 31.87 ? 569 LEU A CB   1  
ATOM   9003   C CG   . LEU A 1 576 ? -24.437 -21.886 -1.507  0.02 32.28 ? 569 LEU A CG   1  
ATOM   9004   C CD1  . LEU A 1 576 ? -23.315 -21.196 -0.781  0.02 32.37 ? 569 LEU A CD1  1  
ATOM   9005   C CD2  . LEU A 1 576 ? -25.655 -20.974 -1.640  0.02 32.15 ? 569 LEU A CD2  1  
ATOM   9006   H H    . LEU A 1 576 ? -24.922 -24.707 -2.911  0.02 32.37 ? 569 LEU A H    1  
ATOM   9007   H HA   . LEU A 1 576 ? -25.779 -22.341 -3.878  0.02 31.62 ? 569 LEU A HA   1  
ATOM   9008   H HB2  . LEU A 1 576 ? -23.282 -23.023 -2.778  0.02 32.01 ? 569 LEU A HB2  1  
ATOM   9009   H HB3  . LEU A 1 576 ? -23.599 -21.587 -3.357  0.02 31.58 ? 569 LEU A HB3  1  
ATOM   9010   H HG   . LEU A 1 576 ? -24.680 -22.657 -0.983  0.02 32.60 ? 569 LEU A HG   1  
ATOM   9011   H HD11 . LEU A 1 576 ? -23.631 -20.917 0.092   0.02 32.64 ? 569 LEU A HD11 1  
ATOM   9012   H HD12 . LEU A 1 576 ? -22.571 -21.809 -0.680  0.02 32.51 ? 569 LEU A HD12 1  
ATOM   9013   H HD13 . LEU A 1 576 ? -23.044 -20.418 -1.290  0.02 32.07 ? 569 LEU A HD13 1  
ATOM   9014   H HD21 . LEU A 1 576 ? -25.730 -20.426 -0.844  0.02 32.29 ? 569 LEU A HD21 1  
ATOM   9015   H HD22 . LEU A 1 576 ? -25.540 -20.408 -2.419  0.02 31.79 ? 569 LEU A HD22 1  
ATOM   9016   H HD23 . LEU A 1 576 ? -26.451 -21.515 -1.750  0.02 32.32 ? 569 LEU A HD23 1  
ATOM   9017   N N    . PHE A 1 577 ? -24.104 -24.352 -5.599  0.02 31.45 ? 570 PHE A N    1  
ATOM   9018   C CA   . PHE A 1 577 ? -23.654 -24.661 -6.947  0.02 31.13 ? 570 PHE A CA   1  
ATOM   9019   C C    . PHE A 1 577 ? -24.790 -24.459 -7.939  0.02 30.86 ? 570 PHE A C    1  
ATOM   9020   O O    . PHE A 1 577 ? -25.759 -25.211 -7.916  0.02 31.10 ? 570 PHE A O    1  
ATOM   9021   C CB   . PHE A 1 577 ? -23.138 -26.100 -7.024  0.02 31.43 ? 570 PHE A CB   1  
ATOM   9022   C CG   . PHE A 1 577 ? -22.905 -26.576 -8.438  0.02 31.16 ? 570 PHE A CG   1  
ATOM   9023   C CD1  . PHE A 1 577 ? -21.737 -26.252 -9.104  0.02 30.93 ? 570 PHE A CD1  1  
ATOM   9024   C CD2  . PHE A 1 577 ? -23.861 -27.325 -9.098  0.02 31.19 ? 570 PHE A CD2  1  
ATOM   9025   C CE1  . PHE A 1 577 ? -21.533 -26.670 -10.419 0.02 30.72 ? 570 PHE A CE1  1  
ATOM   9026   C CE2  . PHE A 1 577 ? -23.638 -27.748 -10.405 0.02 30.98 ? 570 PHE A CE2  1  
ATOM   9027   C CZ   . PHE A 1 577 ? -22.474 -27.412 -11.047 0.02 30.74 ? 570 PHE A CZ   1  
ATOM   9028   O OXT  . PHE A 1 577 ? -24.757 -23.557 -8.793  0.02 30.45 ? 570 PHE A OXT  1  
ATOM   9029   H H    . PHE A 1 577 ? -24.115 -25.033 -5.082  0.02 31.75 ? 570 PHE A H    1  
ATOM   9030   H HA   . PHE A 1 577 ? -22.928 -24.066 -7.186  0.02 30.94 ? 570 PHE A HA   1  
ATOM   9031   H HB2  . PHE A 1 577 ? -22.296 -26.155 -6.547  0.02 31.60 ? 570 PHE A HB2  1  
ATOM   9032   H HB3  . PHE A 1 577 ? -23.791 -26.690 -6.615  0.02 31.67 ? 570 PHE A HB3  1  
ATOM   9033   H HD1  . PHE A 1 577 ? -21.087 -25.741 -8.679  0.02 30.94 ? 570 PHE A HD1  1  
ATOM   9034   H HD2  . PHE A 1 577 ? -24.652 -27.551 -8.669  0.02 31.38 ? 570 PHE A HD2  1  
ATOM   9035   H HE1  . PHE A 1 577 ? -20.744 -26.454 -10.860 0.02 30.60 ? 570 PHE A HE1  1  
ATOM   9036   H HE2  . PHE A 1 577 ? -24.281 -28.252 -10.846 0.02 31.02 ? 570 PHE A HE2  1  
ATOM   9037   H HZ   . PHE A 1 577 ? -22.329 -27.695 -11.920 0.02 30.62 ? 570 PHE A HZ   1  
HETATM 9038   O O    . HOH B 2 .   ? -2.030  -15.785 -39.455 0.02 32.49 ? 601 HOH A O    1  
HETATM 9039   O O    . HOH B 2 .   ? -19.070 -23.748 -46.282 0.02 30.32 ? 602 HOH A O    1  
HETATM 9040   O O    . HOH B 2 .   ? -6.841  2.216   -48.093 0.02 34.30 ? 603 HOH A O    1  
HETATM 9041   O O    . HOH B 2 .   ? -26.205 -32.141 -35.075 0.02 30.41 ? 604 HOH A O    1  
HETATM 9042   O O    . HOH B 2 .   ? -38.607 10.476  -2.023  0.02 35.07 ? 605 HOH A O    1  
HETATM 9043   O O    . HOH B 2 .   ? -16.412 -11.572 -55.210 0.02 32.32 ? 606 HOH A O    1  
HETATM 9044   O O    . HOH B 2 .   ? -42.022 -11.519 -43.647 0.02 30.16 ? 607 HOH A O    1  
HETATM 9045   O O    . HOH B 2 .   ? -24.794 -25.446 2.179   0.02 34.18 ? 608 HOH A O    1  
HETATM 9046   O O    . HOH B 2 .   ? -11.511 -26.537 4.635   0.02 36.52 ? 609 HOH A O    1  
HETATM 9047   O O    . HOH B 2 .   ? -9.098  -11.076 -12.712 0.02 30.34 ? 610 HOH A O    1  
HETATM 9048   O O    . HOH B 2 .   ? -8.346  -13.818 -36.246 0.02 29.78 ? 611 HOH A O    1  
HETATM 9049   O O    . HOH B 2 .   ? -31.703 14.237  -17.628 0.02 31.74 ? 612 HOH A O    1  
HETATM 9050   O O    . HOH B 2 .   ? -31.353 17.278  -15.555 0.02 33.26 ? 613 HOH A O    1  
HETATM 9051   O O    . HOH B 2 .   ? -10.845 -28.991 -34.511 0.02 30.90 ? 614 HOH A O    1  
HETATM 9052   O O    . HOH B 2 .   ? -31.480 -29.866 -22.787 0.02 30.18 ? 615 HOH A O    1  
HETATM 9053   O O    . HOH B 2 .   ? -27.261 -26.855 -7.184  0.02 31.64 ? 616 HOH A O    1  
HETATM 9054   O O    . HOH B 2 .   ? -12.573 -4.947  -11.037 0.02 30.14 ? 617 HOH A O    1  
HETATM 9055   O O    . HOH B 2 .   ? -44.922 2.699   -42.143 0.02 31.50 ? 618 HOH A O    1  
HETATM 9056   O O    . HOH B 2 .   ? -2.803  -14.803 -32.648 0.02 31.37 ? 619 HOH A O    1  
HETATM 9057   O O    . HOH B 2 .   ? -14.872 1.837   -11.370 0.02 30.58 ? 620 HOH A O    1  
HETATM 9058   O O    . HOH B 2 .   ? 3.201   -9.160  -29.363 0.02 33.88 ? 621 HOH A O    1  
HETATM 9059   O O    . HOH B 2 .   ? -43.346 -8.236  -24.706 0.02 29.33 ? 622 HOH A O    1  
HETATM 9060   O O    . HOH B 2 .   ? -21.258 -1.746  -47.213 0.02 29.89 ? 623 HOH A O    1  
HETATM 9061   O O    . HOH B 2 .   ? -45.075 -3.440  -39.248 0.02 30.45 ? 624 HOH A O    1  
HETATM 9062   O O    . HOH B 2 .   ? -27.839 9.638   -38.534 0.02 30.28 ? 625 HOH A O    1  
HETATM 9063   O O    . HOH B 2 .   ? -4.956  -10.636 -25.504 0.02 30.23 ? 626 HOH A O    1  
HETATM 9064   O O    . HOH B 2 .   ? -27.679 6.997   -2.805  0.02 32.82 ? 627 HOH A O    1  
HETATM 9065   O O    . HOH B 2 .   ? -27.821 2.587   -43.790 0.02 29.47 ? 628 HOH A O    1  
HETATM 9066   O O    . HOH B 2 .   ? -25.142 -35.958 -25.819 0.02 31.46 ? 629 HOH A O    1  
HETATM 9067   O O    . HOH B 2 .   ? -3.463  -17.714 -41.734 0.02 32.44 ? 630 HOH A O    1  
HETATM 9068   O O    . HOH B 2 .   ? -24.666 -33.874 -36.576 0.02 31.06 ? 631 HOH A O    1  
HETATM 9069   O O    . HOH B 2 .   ? -19.510 -11.982 -53.900 0.02 31.35 ? 632 HOH A O    1  
HETATM 9070   O O    . HOH B 2 .   ? -4.781  -13.558 -29.400 0.02 30.51 ? 633 HOH A O    1  
HETATM 9071   O O    . HOH B 2 .   ? -6.694  -15.479 -32.656 0.02 30.02 ? 634 HOH A O    1  
HETATM 9072   O O    . HOH B 2 .   ? -18.629 -4.285  -28.603 0.02 27.50 ? 635 HOH A O    1  
HETATM 9073   O O    . HOH B 2 .   ? -28.629 -3.400  -2.752  0.02 31.18 ? 636 HOH A O    1  
HETATM 9074   O O    . HOH B 2 .   ? -31.192 -33.922 -20.347 0.02 31.78 ? 637 HOH A O    1  
HETATM 9075   O O    . HOH B 2 .   ? -16.389 -32.091 -8.831  0.02 32.86 ? 638 HOH A O    1  
HETATM 9076   O O    . HOH B 2 .   ? -29.734 3.090   -3.436  0.02 31.94 ? 639 HOH A O    1  
HETATM 9077   O O    . HOH B 2 .   ? -42.348 -2.170  -46.423 0.02 30.93 ? 640 HOH A O    1  
HETATM 9078   O O    . HOH B 2 .   ? -36.863 12.106  -25.373 0.02 30.92 ? 641 HOH A O    1  
HETATM 9079   O O    . HOH B 2 .   ? -17.523 -8.075  -26.633 0.02 27.43 ? 642 HOH A O    1  
HETATM 9080   O O    . HOH B 2 .   ? -35.414 3.530   -7.481  0.02 31.42 ? 643 HOH A O    1  
HETATM 9081   O O    . HOH B 2 .   ? -15.479 -14.472 -27.486 0.02 27.66 ? 644 HOH A O    1  
HETATM 9082   O O    . HOH B 2 .   ? -16.996 -5.500  -47.003 0.02 30.06 ? 645 HOH A O    1  
HETATM 9083   O O    . HOH B 2 .   ? -38.978 -20.967 -35.559 0.02 29.47 ? 646 HOH A O    1  
HETATM 9084   O O    . HOH B 2 .   ? -21.597 13.406  0.993   0.02 36.15 ? 647 HOH A O    1  
HETATM 9085   O O    . HOH B 2 .   ? -2.996  -4.627  -35.971 0.02 32.19 ? 648 HOH A O    1  
HETATM 9086   O O    . HOH B 2 .   ? -21.250 -6.121  -14.427 0.02 28.17 ? 649 HOH A O    1  
HETATM 9087   O O    . HOH B 2 .   ? -36.400 5.965   -20.746 0.02 29.61 ? 650 HOH A O    1  
HETATM 9088   O O    . HOH B 2 .   ? -30.030 -30.727 -24.691 0.02 30.16 ? 651 HOH A O    1  
HETATM 9089   O O    . HOH B 2 .   ? -30.085 7.706   -39.382 0.02 29.87 ? 652 HOH A O    1  
HETATM 9090   O O    . HOH B 2 .   ? 3.230   -21.368 -17.255 0.02 34.63 ? 653 HOH A O    1  
HETATM 9091   O O    . HOH B 2 .   ? -10.872 -20.919 -23.176 0.02 29.28 ? 654 HOH A O    1  
HETATM 9092   O O    . HOH B 2 .   ? -25.425 -9.402  -52.726 0.02 30.50 ? 655 HOH A O    1  
HETATM 9093   O O    . HOH B 2 .   ? -8.452  -16.163 -34.657 0.02 29.68 ? 656 HOH A O    1  
HETATM 9094   O O    . HOH B 2 .   ? -9.250  -22.897 -22.556 0.02 29.94 ? 657 HOH A O    1  
HETATM 9095   O O    . HOH B 2 .   ? -28.823 1.861   -35.823 0.02 28.15 ? 658 HOH A O    1  
HETATM 9096   O O    . HOH B 2 .   ? -12.357 -23.174 -40.043 0.02 30.10 ? 659 HOH A O    1  
HETATM 9097   O O    . HOH B 2 .   ? -39.151 -23.418 -19.963 0.02 30.33 ? 660 HOH A O    1  
HETATM 9098   O O    . HOH B 2 .   ? -19.331 -30.269 -5.738  0.02 32.94 ? 661 HOH A O    1  
HETATM 9099   O O    . HOH B 2 .   ? 2.191   5.660   -26.560 0.02 36.00 ? 662 HOH A O    1  
HETATM 9100   O O    . HOH B 2 .   ? -9.721  -12.409 -34.547 0.02 29.22 ? 663 HOH A O    1  
HETATM 9101   O O    . HOH B 2 .   ? -20.286 -2.716  -43.572 0.02 29.07 ? 664 HOH A O    1  
HETATM 9102   O O    . HOH B 2 .   ? -40.721 -18.845 -28.668 0.02 29.31 ? 665 HOH A O    1  
HETATM 9103   O O    . HOH B 2 .   ? -17.605 -17.791 -28.414 0.02 27.57 ? 666 HOH A O    1  
HETATM 9104   O O    . HOH B 2 .   ? -18.880 4.426   -40.363 0.02 29.86 ? 667 HOH A O    1  
HETATM 9105   O O    . HOH B 2 .   ? -10.029 -5.687  -49.319 0.02 32.30 ? 668 HOH A O    1  
HETATM 9106   O O    . HOH B 2 .   ? -25.766 0.803   -37.735 0.02 28.21 ? 669 HOH A O    1  
HETATM 9107   O O    . HOH B 2 .   ? -45.766 4.953   -29.415 0.02 31.11 ? 670 HOH A O    1  
HETATM 9108   O O    . HOH B 2 .   ? -29.459 -11.344 -46.436 0.02 28.84 ? 671 HOH A O    1  
HETATM 9109   O O    . HOH B 2 .   ? -13.230 -30.724 -40.950 0.02 31.68 ? 672 HOH A O    1  
HETATM 9110   O O    . HOH B 2 .   ? -25.741 -5.224  -31.247 0.02 26.95 ? 673 HOH A O    1  
HETATM 9111   O O    . HOH B 2 .   ? -24.048 5.560   -21.559 0.02 28.85 ? 674 HOH A O    1  
HETATM 9112   O O    . HOH B 2 .   ? -19.793 -16.510 -8.503  0.02 29.62 ? 675 HOH A O    1  
HETATM 9113   O O    . HOH B 2 .   ? -33.938 7.898   -38.136 0.02 29.97 ? 676 HOH A O    1  
HETATM 9114   O O    . HOH B 2 .   ? -13.813 -9.293  -40.258 0.02 29.03 ? 677 HOH A O    1  
HETATM 9115   O O    . HOH B 2 .   ? -19.786 -37.788 -21.115 0.02 32.47 ? 678 HOH A O    1  
HETATM 9116   O O    . HOH B 2 .   ? -10.716 -33.638 -25.523 0.02 31.95 ? 679 HOH A O    1  
HETATM 9117   O O    . HOH B 2 .   ? -22.650 2.288   -39.470 0.02 28.91 ? 680 HOH A O    1  
HETATM 9118   O O    . HOH B 2 .   ? -25.369 -0.002  -27.175 0.02 27.49 ? 681 HOH A O    1  
HETATM 9119   O O    . HOH B 2 .   ? -28.676 -18.642 -47.190 0.02 29.52 ? 682 HOH A O    1  
HETATM 9120   O O    . HOH B 2 .   ? -34.529 6.363   -30.056 0.02 29.08 ? 683 HOH A O    1  
HETATM 9121   O O    . HOH B 2 .   ? -1.860  -0.203  -26.316 0.02 32.83 ? 684 HOH A O    1  
HETATM 9122   O O    . HOH B 2 .   ? -29.604 8.541   -20.960 0.02 29.57 ? 685 HOH A O    1  
HETATM 9123   O O    . HOH B 2 .   ? -39.910 3.146   -34.805 0.02 29.51 ? 686 HOH A O    1  
HETATM 9124   O O    . HOH B 2 .   ? -5.957  -14.452 -4.449  0.02 33.12 ? 687 HOH A O    1  
HETATM 9125   O O    . HOH B 2 .   ? -6.141  -21.061 -28.146 0.02 30.39 ? 688 HOH A O    1  
HETATM 9126   O O    . HOH B 2 .   ? -7.590  -21.234 -20.901 0.02 30.24 ? 689 HOH A O    1  
HETATM 9127   O O    . HOH B 2 .   ? -21.947 -34.118 -24.144 0.02 30.90 ? 690 HOH A O    1  
HETATM 9128   O O    . HOH B 2 .   ? -2.728  -23.910 -16.352 0.02 32.64 ? 691 HOH A O    1  
HETATM 9129   O O    . HOH B 2 .   ? -25.903 6.511   -23.303 0.02 28.87 ? 692 HOH A O    1  
HETATM 9130   O O    . HOH B 2 .   ? -19.603 3.896   -18.449 0.02 29.14 ? 693 HOH A O    1  
HETATM 9131   O O    . HOH B 2 .   ? -12.716 -10.509 -44.784 0.02 30.11 ? 694 HOH A O    1  
HETATM 9132   O O    . HOH B 2 .   ? -26.015 -28.422 -47.710 0.02 31.30 ? 695 HOH A O    1  
HETATM 9133   O O    . HOH B 2 .   ? -38.890 -3.211  -11.472 0.02 30.28 ? 696 HOH A O    1  
HETATM 9134   O O    . HOH B 2 .   ? -13.637 -37.281 -21.551 0.02 32.89 ? 697 HOH A O    1  
HETATM 9135   O O    . HOH B 2 .   ? -15.523 -33.178 -40.705 0.02 32.07 ? 698 HOH A O    1  
HETATM 9136   O O    . HOH B 2 .   ? -43.555 -16.654 -32.884 0.02 29.87 ? 699 HOH A O    1  
HETATM 9137   O O    . HOH B 2 .   ? -33.472 2.100   -13.974 0.02 29.46 ? 700 HOH A O    1  
HETATM 9138   O O    . HOH B 2 .   ? -28.340 10.056  -32.053 0.02 29.76 ? 701 HOH A O    1  
HETATM 9139   O O    . HOH B 2 .   ? -24.372 -3.243  -37.540 0.02 27.69 ? 702 HOH A O    1  
HETATM 9140   O O    . HOH B 2 .   ? -33.794 -17.511 -36.838 0.02 28.09 ? 703 HOH A O    1  
HETATM 9141   O O    . HOH B 2 .   ? 0.525   5.031   -36.392 0.02 35.71 ? 704 HOH A O    1  
HETATM 9142   O O    . HOH B 2 .   ? -19.587 -8.100  -29.274 0.02 27.12 ? 705 HOH A O    1  
HETATM 9143   O O    . HOH B 2 .   ? -16.766 -18.233 -11.591 0.02 29.36 ? 706 HOH A O    1  
HETATM 9144   O O    . HOH B 2 .   ? -30.345 6.730   -19.024 0.02 29.35 ? 707 HOH A O    1  
HETATM 9145   O O    . HOH B 2 .   ? -23.986 2.002   -28.371 0.02 27.88 ? 708 HOH A O    1  
HETATM 9146   O O    . HOH B 2 .   ? -37.951 -16.553 -15.225 0.02 29.59 ? 709 HOH A O    1  
HETATM 9147   O O    . HOH B 2 .   ? -1.966  -15.330 -3.252  0.02 34.85 ? 710 HOH A O    1  
HETATM 9148   O O    . HOH B 2 .   ? -18.886 2.176   -42.137 0.02 29.76 ? 711 HOH A O    1  
HETATM 9149   O O    . HOH B 2 .   ? -25.731 4.940   -3.804  0.02 32.02 ? 712 HOH A O    1  
HETATM 9150   O O    . HOH B 2 .   ? -28.760 -1.993  -13.020 0.02 28.69 ? 713 HOH A O    1  
HETATM 9151   O O    . HOH B 2 .   ? -19.777 -9.986  -48.754 0.02 29.80 ? 714 HOH A O    1  
HETATM 9152   O O    . HOH B 2 .   ? -33.285 10.967  -37.754 0.02 30.74 ? 715 HOH A O    1  
HETATM 9153   O O    . HOH B 2 .   ? -26.725 -31.340 -6.065  0.02 33.26 ? 716 HOH A O    1  
HETATM 9154   O O    . HOH B 2 .   ? -2.292  -21.144 -20.069 0.02 32.03 ? 717 HOH A O    1  
HETATM 9155   O O    . HOH B 2 .   ? -8.068  -25.031 -19.559 0.02 30.79 ? 718 HOH A O    1  
HETATM 9156   O O    . HOH B 2 .   ? -19.792 -5.910  -12.386 0.02 28.68 ? 719 HOH A O    1  
HETATM 9157   O O    . HOH B 2 .   ? -35.388 -10.348 -46.266 0.02 29.32 ? 720 HOH A O    1  
HETATM 9158   O O    . HOH B 2 .   ? -27.946 14.564  -23.645 0.02 31.26 ? 721 HOH A O    1  
HETATM 9159   O O    . HOH B 2 .   ? -21.080 -5.480  -54.797 0.02 31.72 ? 722 HOH A O    1  
HETATM 9160   O O    . HOH B 2 .   ? -7.435  -7.477  -40.401 0.02 30.92 ? 723 HOH A O    1  
HETATM 9161   O O    . HOH B 2 .   ? -37.147 6.048   -23.556 0.02 29.50 ? 724 HOH A O    1  
HETATM 9162   O O    . HOH B 2 .   ? -17.975 -8.053  -23.020 0.02 27.40 ? 725 HOH A O    1  
HETATM 9163   O O    . HOH B 2 .   ? -35.974 11.615  -41.461 0.02 31.84 ? 726 HOH A O    1  
HETATM 9164   O O    . HOH B 2 .   ? -31.078 1.391   -14.801 0.02 28.96 ? 727 HOH A O    1  
HETATM 9165   O O    . HOH B 2 .   ? -32.554 7.152   -28.449 0.02 29.06 ? 728 HOH A O    1  
HETATM 9166   O O    . HOH B 2 .   ? -21.484 -9.996  -41.285 0.02 28.00 ? 729 HOH A O    1  
HETATM 9167   O O    . HOH B 2 .   ? -21.041 -15.828 -45.364 0.02 28.97 ? 730 HOH A O    1  
HETATM 9168   O O    . HOH B 2 .   ? -31.800 -22.325 -23.043 0.02 28.44 ? 731 HOH A O    1  
HETATM 9169   O O    . HOH B 2 .   ? -26.422 3.143   -35.872 0.02 28.42 ? 732 HOH A O    1  
HETATM 9170   O O    . HOH B 2 .   ? -25.728 -9.100  -8.027  0.02 29.25 ? 733 HOH A O    1  
HETATM 9171   O O    . HOH B 2 .   ? -40.074 -0.569  -20.936 0.02 29.26 ? 734 HOH A O    1  
HETATM 9172   O O    . HOH B 2 .   ? -45.221 6.783   -42.449 0.02 32.36 ? 735 HOH A O    1  
HETATM 9173   O O    . HOH B 2 .   ? -26.287 4.063   -0.891  0.02 32.83 ? 736 HOH A O    1  
HETATM 9174   O O    . HOH B 2 .   ? -14.292 -21.046 -50.018 0.02 31.62 ? 737 HOH A O    1  
HETATM 9175   O O    . HOH B 2 .   ? -7.225  -11.156 -0.743  0.02 33.86 ? 738 HOH A O    1  
HETATM 9176   O O    . HOH B 2 .   ? -24.734 -33.235 -17.933 0.02 31.20 ? 739 HOH A O    1  
HETATM 9177   O O    . HOH B 2 .   ? -21.548 -4.175  -16.220 0.02 28.02 ? 740 HOH A O    1  
HETATM 9178   O O    . HOH B 2 .   ? -4.739  -21.554 -1.112  0.02 35.14 ? 741 HOH A O    1  
HETATM 9179   O O    . HOH B 2 .   ? -20.176 0.154   -15.094 0.02 28.84 ? 742 HOH A O    1  
HETATM 9180   O O    . HOH B 2 .   ? -16.983 3.346   -21.081 0.02 29.18 ? 743 HOH A O    1  
HETATM 9181   O O    . HOH B 2 .   ? -24.083 -6.708  -38.712 0.02 27.56 ? 744 HOH A O    1  
HETATM 9182   O O    . HOH B 2 .   ? -21.904 1.723   -47.132 0.02 30.37 ? 745 HOH A O    1  
HETATM 9183   O O    . HOH B 2 .   ? -15.166 -34.259 -38.072 0.02 31.97 ? 746 HOH A O    1  
HETATM 9184   O O    . HOH B 2 .   ? -24.809 8.990   -58.740 0.02 35.60 ? 747 HOH A O    1  
HETATM 9185   O O    . HOH B 2 .   ? -27.453 7.307   -51.703 0.02 32.49 ? 748 HOH A O    1  
HETATM 9186   O O    . HOH B 2 .   ? -9.515  -10.156 -30.722 0.02 29.08 ? 749 HOH A O    1  
HETATM 9187   O O    . HOH B 2 .   ? -21.430 -3.834  -23.602 0.02 27.34 ? 750 HOH A O    1  
HETATM 9188   O O    . HOH B 2 .   ? -14.082 -13.493 -6.391  0.02 30.67 ? 751 HOH A O    1  
HETATM 9189   O O    . HOH B 2 .   ? -24.152 -35.666 -39.088 0.02 31.93 ? 752 HOH A O    1  
HETATM 9190   O O    . HOH B 2 .   ? -28.483 -7.364  -52.813 0.02 30.50 ? 753 HOH A O    1  
HETATM 9191   O O    . HOH B 2 .   ? -42.956 -8.822  -38.069 0.02 29.61 ? 754 HOH A O    1  
HETATM 9192   O O    . HOH B 2 .   ? -15.067 -8.265  -36.732 0.02 28.32 ? 755 HOH A O    1  
HETATM 9193   O O    . HOH B 2 .   ? -25.517 -25.105 -11.073 0.02 30.26 ? 756 HOH A O    1  
HETATM 9194   O O    . HOH B 2 .   ? -26.401 2.676   -8.472  0.02 30.30 ? 757 HOH A O    1  
HETATM 9195   O O    . HOH B 2 .   ? -28.904 7.183   -22.839 0.02 29.06 ? 758 HOH A O    1  
HETATM 9196   O O    . HOH B 2 .   ? -27.422 -35.763 -27.464 0.02 31.53 ? 759 HOH A O    1  
HETATM 9197   O O    . HOH B 2 .   ? -39.505 -16.601 -18.174 0.02 29.50 ? 760 HOH A O    1  
HETATM 9198   O O    . HOH B 2 .   ? -13.312 -36.980 -29.962 0.02 32.53 ? 761 HOH A O    1  
HETATM 9199   O O    . HOH B 2 .   ? -1.406  9.264   -31.861 0.02 35.61 ? 762 HOH A O    1  
HETATM 9200   O O    . HOH B 2 .   ? -2.962  12.874  -37.169 0.02 36.51 ? 763 HOH A O    1  
HETATM 9201   O O    . HOH B 2 .   ? -26.042 13.242  -25.276 0.02 30.73 ? 764 HOH A O    1  
HETATM 9202   O O    . HOH B 2 .   ? -26.089 -28.258 0.687   0.02 34.56 ? 765 HOH A O    1  
HETATM 9203   O O    . HOH B 2 .   ? -38.179 3.119   -14.664 0.02 30.21 ? 766 HOH A O    1  
HETATM 9204   O O    . HOH B 2 .   ? -13.996 -24.143 -14.338 0.02 30.10 ? 767 HOH A O    1  
HETATM 9205   O O    . HOH B 2 .   ? -20.934 3.504   -20.796 0.02 28.69 ? 768 HOH A O    1  
HETATM 9206   O O    . HOH B 2 .   ? -22.626 -30.309 -28.323 0.02 29.56 ? 769 HOH A O    1  
HETATM 9207   O O    . HOH B 2 .   ? -16.763 -14.447 -7.725  0.02 29.97 ? 770 HOH A O    1  
HETATM 9208   O O    . HOH B 2 .   ? -15.316 -34.995 -35.836 0.02 31.96 ? 771 HOH A O    1  
HETATM 9209   O O    . HOH B 2 .   ? -13.729 -5.397  -53.947 0.02 32.77 ? 772 HOH A O    1  
HETATM 9210   O O    . HOH B 2 .   ? -9.142  -29.343 -17.911 0.02 31.67 ? 773 HOH A O    1  
HETATM 9211   O O    . HOH B 2 .   ? -11.302 -33.237 -20.919 0.02 31.93 ? 774 HOH A O    1  
HETATM 9212   O O    . HOH B 2 .   ? -14.003 -12.612 6.434   0.02 35.18 ? 775 HOH A O    1  
HETATM 9213   O O    . HOH B 2 .   ? -26.866 -10.697 -5.910  0.02 29.86 ? 776 HOH A O    1  
HETATM 9214   O O    . HOH B 2 .   ? -29.441 -22.615 -1.006  0.02 32.89 ? 777 HOH A O    1  
HETATM 9215   O O    . HOH B 2 .   ? -37.095 10.003  -10.342 0.02 32.48 ? 778 HOH A O    1  
HETATM 9216   O O    . HOH B 2 .   ? -15.479 2.360   -26.888 0.02 29.01 ? 779 HOH A O    1  
HETATM 9217   O O    . HOH B 2 .   ? -9.882  -32.373 -18.994 0.02 32.19 ? 780 HOH A O    1  
HETATM 9218   O O    . HOH B 2 .   ? -19.443 -18.790 -20.906 0.02 27.79 ? 781 HOH A O    1  
HETATM 9219   O O    . HOH B 2 .   ? -23.759 -4.584  -33.176 0.02 27.17 ? 782 HOH A O    1  
HETATM 9220   O O    . HOH B 2 .   ? -12.305 -36.199 -27.219 0.02 32.46 ? 783 HOH A O    1  
HETATM 9221   O O    . HOH B 2 .   ? -8.338  -1.492  -43.273 0.02 31.82 ? 784 HOH A O    1  
HETATM 9222   O O    . HOH B 2 .   ? -17.071 -14.251 -52.183 0.02 31.22 ? 785 HOH A O    1  
HETATM 9223   O O    . HOH B 2 .   ? -21.000 -19.158 -23.576 0.02 27.52 ? 786 HOH A O    1  
HETATM 9224   O O    . HOH B 2 .   ? -8.646  -10.155 -33.421 0.02 29.47 ? 787 HOH A O    1  
HETATM 9225   O O    . HOH B 2 .   ? -16.081 -2.481  -0.392  0.02 32.61 ? 788 HOH A O    1  
HETATM 9226   O O    . HOH B 2 .   ? -6.005  -22.707 -35.711 0.02 31.16 ? 789 HOH A O    1  
HETATM 9227   O O    . HOH B 2 .   ? -15.923 15.562  -15.260 0.02 33.68 ? 790 HOH A O    1  
HETATM 9228   O O    . HOH B 2 .   ? -24.432 19.337  -5.089  0.02 36.29 ? 791 HOH A O    1  
HETATM 9229   O O    . HOH B 2 .   ? -38.026 -25.157 -32.940 0.02 29.95 ? 792 HOH A O    1  
HETATM 9230   O O    . HOH B 2 .   ? -4.689  -19.775 -46.037 0.02 33.08 ? 793 HOH A O    1  
HETATM 9231   O O    . HOH B 2 .   ? -42.544 -13.733 -48.602 0.02 31.42 ? 794 HOH A O    1  
HETATM 9232   O O    . HOH B 2 .   ? -35.889 1.023   -15.096 0.02 29.40 ? 795 HOH A O    1  
HETATM 9233   O O    . HOH B 2 .   ? -39.124 -0.862  -15.413 0.02 29.72 ? 796 HOH A O    1  
HETATM 9234   O O    . HOH B 2 .   ? -16.817 -27.931 0.124   0.02 34.32 ? 797 HOH A O    1  
HETATM 9235   O O    . HOH B 2 .   ? -25.038 -19.263 -5.017  0.02 30.80 ? 798 HOH A O    1  
HETATM 9236   O O    . HOH B 2 .   ? -19.344 -33.319 -12.379 0.02 32.22 ? 799 HOH A O    1  
HETATM 9237   O O    . HOH B 2 .   ? -43.787 -3.089  -30.931 0.02 29.51 ? 800 HOH A O    1  
HETATM 9238   O O    . HOH B 2 .   ? -33.700 16.060  -16.903 0.02 32.68 ? 801 HOH A O    1  
HETATM 9239   O O    . HOH B 2 .   ? -7.908  8.358   -32.523 0.02 32.88 ? 802 HOH A O    1  
HETATM 9240   O O    . HOH B 2 .   ? -44.253 3.062   -23.751 0.02 30.55 ? 803 HOH A O    1  
HETATM 9241   O O    . HOH B 2 .   ? -35.204 8.814   -1.103  0.02 34.47 ? 804 HOH A O    1  
HETATM 9242   O O    . HOH B 2 .   ? -39.655 1.740   -14.043 0.02 30.43 ? 805 HOH A O    1  
HETATM 9243   O O    . HOH B 2 .   ? -1.425  -23.072 -18.164 0.02 32.85 ? 806 HOH A O    1  
HETATM 9244   O O    . HOH B 2 .   ? 2.603   -15.441 -28.243 0.02 33.43 ? 807 HOH A O    1  
HETATM 9245   O O    . HOH B 2 .   ? -38.921 -22.475 -29.994 0.02 29.42 ? 808 HOH A O    1  
HETATM 9246   O O    . HOH B 2 .   ? -6.915  5.033   -44.900 0.02 33.66 ? 809 HOH A O    1  
HETATM 9247   O O    . HOH B 2 .   ? -39.291 0.940   -25.844 0.02 28.93 ? 810 HOH A O    1  
HETATM 9248   O O    . HOH B 2 .   ? -26.414 10.472  -47.031 0.02 32.14 ? 811 HOH A O    1  
HETATM 9249   O O    . HOH B 2 .   ? -21.598 -0.837  -3.065  0.02 31.39 ? 812 HOH A O    1  
HETATM 9250   O O    . HOH B 2 .   ? -44.501 -4.151  -45.237 0.02 31.21 ? 813 HOH A O    1  
HETATM 9251   O O    . HOH B 2 .   ? -17.886 0.459   -44.491 0.02 29.94 ? 814 HOH A O    1  
HETATM 9252   O O    . HOH B 2 .   ? -36.803 8.596   -2.026  0.02 34.35 ? 815 HOH A O    1  
HETATM 9253   O O    . HOH B 2 .   ? -13.148 -38.341 -39.816 0.02 34.00 ? 816 HOH A O    1  
HETATM 9254   O O    . HOH B 2 .   ? -29.639 -35.337 -25.740 0.02 31.69 ? 817 HOH A O    1  
HETATM 9255   O O    . HOH B 2 .   ? -20.295 -15.729 -51.429 0.02 30.59 ? 818 HOH A O    1  
HETATM 9256   O O    . HOH B 2 .   ? -6.355  -26.996 -23.766 0.02 31.36 ? 819 HOH A O    1  
HETATM 9257   O O    . HOH B 2 .   ? 1.068   -8.646  -25.580 0.02 32.92 ? 820 HOH A O    1  
HETATM 9258   O O    . HOH B 2 .   ? -30.846 8.453   -48.888 0.02 31.89 ? 821 HOH A O    1  
HETATM 9259   O O    . HOH B 2 .   ? -34.117 16.477  -23.219 0.02 32.20 ? 822 HOH A O    1  
HETATM 9260   O O    . HOH B 2 .   ? -13.006 -33.439 -41.551 0.02 32.59 ? 823 HOH A O    1  
HETATM 9261   O O    . HOH B 2 .   ? -3.097  -12.405 -3.012  0.02 34.48 ? 824 HOH A O    1  
HETATM 9262   O O    . HOH B 2 .   ? 1.794   -11.902 -36.205 0.02 33.68 ? 825 HOH A O    1  
HETATM 9263   O O    . HOH B 2 .   ? -4.274  -22.194 -45.345 0.02 33.33 ? 826 HOH A O    1  
HETATM 9264   O O    . HOH B 2 .   ? -4.101  -0.023  -39.570 0.02 32.96 ? 827 HOH A O    1  
HETATM 9265   O O    . HOH B 2 .   ? -20.662 -17.946 -46.943 0.02 29.53 ? 828 HOH A O    1  
HETATM 9266   O O    . HOH B 2 .   ? -38.995 -14.230 -13.589 0.02 29.91 ? 829 HOH A O    1  
HETATM 9267   O O    . HOH B 2 .   ? -15.460 16.284  -13.274 0.02 34.41 ? 830 HOH A O    1  
HETATM 9268   O O    . HOH B 2 .   ? -38.405 -26.032 -30.262 0.02 30.14 ? 831 HOH A O    1  
HETATM 9269   O O    . HOH B 2 .   ? -26.554 -26.175 -49.612 0.02 31.19 ? 832 HOH A O    1  
HETATM 9270   O O    . HOH B 2 .   ? -14.793 -7.651  -16.736 0.02 28.56 ? 833 HOH A O    1  
HETATM 9271   O O    . HOH B 2 .   ? 0.057   8.848   -41.730 0.02 37.60 ? 834 HOH A O    1  
ATOM   9272   N N    . VAL A 1 12  ? 0.967   0.459   -28.434 0.02 34.76 ? 5   VAL A N    2  
ATOM   9273   C CA   . VAL A 1 12  ? 0.017   0.786   -27.398 0.02 34.15 ? 5   VAL A CA   2  
ATOM   9274   C C    . VAL A 1 12  ? -0.683  2.039   -27.935 0.02 33.89 ? 5   VAL A C    2  
ATOM   9275   O O    . VAL A 1 12  ? -0.443  2.424   -29.079 0.02 34.02 ? 5   VAL A O    2  
ATOM   9276   C CB   . VAL A 1 12  ? 0.731   0.959   -26.026 0.02 34.39 ? 5   VAL A CB   2  
ATOM   9277   C CG1  . VAL A 1 12  ? -0.206  1.376   -24.903 0.02 33.86 ? 5   VAL A CG1  2  
ATOM   9278   C CG2  . VAL A 1 12  ? 1.394   -0.336  -25.659 0.02 34.61 ? 5   VAL A CG2  2  
ATOM   9279   H HA   . VAL A 1 12  ? -0.648  0.081   -27.328 0.02 33.80 ? 5   VAL A HA   2  
ATOM   9280   H HB   . VAL A 1 12  ? 1.426   1.629   -26.107 0.02 34.80 ? 5   VAL A HB   2  
ATOM   9281   H HG11 . VAL A 1 12  ? -0.240  2.343   -24.862 0.02 33.88 ? 5   VAL A HG11 2  
ATOM   9282   H HG12 . VAL A 1 12  ? -1.088  1.013   -25.078 0.02 33.43 ? 5   VAL A HG12 2  
ATOM   9283   H HG13 . VAL A 1 12  ? 0.131   1.035   -24.060 0.02 34.00 ? 5   VAL A HG13 2  
ATOM   9284   H HG21 . VAL A 1 12  ? 0.753   -1.053  -25.769 0.02 34.23 ? 5   VAL A HG21 2  
ATOM   9285   H HG22 . VAL A 1 12  ? 2.151   -0.480  -26.249 0.02 34.75 ? 5   VAL A HG22 2  
ATOM   9286   H HG23 . VAL A 1 12  ? 1.678   -0.298  -24.735 0.02 35.02 ? 5   VAL A HG23 2  
ATOM   9287   N N    . SER A 1 13  ? -1.525  2.659   -27.101 0.02 33.49 ? 6   SER A N    2  
ATOM   9288   C CA   . SER A 1 13  ? -2.550  3.581   -27.557 0.02 33.23 ? 6   SER A CA   2  
ATOM   9289   C C    . SER A 1 13  ? -2.012  4.674   -28.487 0.02 33.74 ? 6   SER A C    2  
ATOM   9290   O O    . SER A 1 13  ? -2.768  5.325   -29.202 0.02 33.57 ? 6   SER A O    2  
ATOM   9291   C CB   . SER A 1 13  ? -3.217  4.204   -26.330 0.02 33.02 ? 6   SER A CB   2  
ATOM   9292   O OG   . SER A 1 13  ? -3.962  3.210   -25.601 0.02 32.37 ? 6   SER A OG   2  
ATOM   9293   H H    . SER A 1 13  ? -1.544  2.570   -26.255 0.02 33.33 ? 6   SER A H    2  
ATOM   9294   H HA   . SER A 1 13  ? -3.237  3.096   -28.048 0.02 32.87 ? 6   SER A HA   2  
ATOM   9295   H HB2  . SER A 1 13  ? -2.538  4.591   -25.767 0.02 33.14 ? 6   SER A HB2  2  
ATOM   9296   H HB3  . SER A 1 13  ? -3.820  4.884   -26.616 0.02 33.26 ? 6   SER A HB3  2  
ATOM   9297   H HG   . SER A 1 13  ? -4.053  3.443   -24.797 0.02 32.28 ? 6   SER A HG   2  
ATOM   9298   N N    . LEU A 1 14  ? -0.702  4.908   -28.465 0.02 34.40 ? 7   LEU A N    2  
ATOM   9299   C CA   . LEU A 1 14  ? -0.197  6.132   -29.094 0.02 34.94 ? 7   LEU A CA   2  
ATOM   9300   C C    . LEU A 1 14  ? 0.025   5.954   -30.600 0.02 35.15 ? 7   LEU A C    2  
ATOM   9301   O O    . LEU A 1 14  ? -0.578  6.668   -31.416 0.02 35.20 ? 7   LEU A O    2  
ATOM   9302   C CB   . LEU A 1 14  ? 1.078   6.580   -28.401 0.02 35.63 ? 7   LEU A CB   2  
ATOM   9303   C CG   . LEU A 1 14  ? 0.947   7.932   -27.682 0.02 35.94 ? 7   LEU A CG   2  
ATOM   9304   C CD1  . LEU A 1 14  ? 1.840   7.985   -26.475 0.02 36.24 ? 7   LEU A CD1  2  
ATOM   9305   C CD2  . LEU A 1 14  ? 1.256   9.053   -28.685 0.02 36.59 ? 7   LEU A CD2  2  
ATOM   9306   H H    . LEU A 1 14  ? -0.108  4.399   -28.110 0.02 34.58 ? 7   LEU A H    2  
ATOM   9307   H HA   . LEU A 1 14  ? -0.853  6.835   -28.979 0.02 34.74 ? 7   LEU A HA   2  
ATOM   9308   H HB2  . LEU A 1 14  ? 1.336   5.906   -27.753 0.02 35.53 ? 7   LEU A HB2  2  
ATOM   9309   H HB3  . LEU A 1 14  ? 1.767   6.691   -29.069 0.02 36.05 ? 7   LEU A HB3  2  
ATOM   9310   H HG   . LEU A 1 14  ? 0.036   8.051   -27.365 0.02 35.53 ? 7   LEU A HG   2  
ATOM   9311   H HD11 . LEU A 1 14  ? 2.759   7.950   -26.767 0.02 36.63 ? 7   LEU A HD11 2  
ATOM   9312   H HD12 . LEU A 1 14  ? 1.687   8.823   -26.009 0.02 36.48 ? 7   LEU A HD12 2  
ATOM   9313   H HD13 . LEU A 1 14  ? 1.638   7.233   -25.894 0.02 35.82 ? 7   LEU A HD13 2  
ATOM   9314   H HD21 . LEU A 1 14  ? 2.179   9.336   -28.585 0.02 37.11 ? 7   LEU A HD21 2  
ATOM   9315   H HD22 . LEU A 1 14  ? 1.108   8.713   -29.583 0.02 36.57 ? 7   LEU A HD22 2  
ATOM   9316   H HD23 . LEU A 1 14  ? 0.665   9.805   -28.516 0.02 36.52 ? 7   LEU A HD23 2  
ATOM   9317   N N    . MET A 1 15  ? 0.875   5.007   -30.995 0.02 35.31 ? 8   MET A N    2  
ATOM   9318   C CA   . MET A 1 15  ? 0.888   4.631   -32.401 0.02 35.42 ? 8   MET A CA   2  
ATOM   9319   C C    . MET A 1 15  ? -0.500  4.181   -32.825 0.02 34.80 ? 8   MET A C    2  
ATOM   9320   O O    . MET A 1 15  ? -0.967  4.502   -33.926 0.02 34.92 ? 8   MET A O    2  
ATOM   9321   C CB   . MET A 1 15  ? 1.910   3.523   -32.680 0.02 35.54 ? 8   MET A CB   2  
ATOM   9322   C CG   . MET A 1 15  ? 1.338   2.091   -32.732 0.02 35.14 ? 8   MET A CG   2  
ATOM   9323   S SD   . MET A 1 15  ? 0.981   1.617   -31.033 0.02 34.55 ? 8   MET A SD   2  
ATOM   9324   C CE   . MET A 1 15  ? 2.324   0.429   -30.744 0.02 35.16 ? 8   MET A CE   2  
ATOM   9325   H H    . MET A 1 15  ? 1.422   4.581   -30.485 0.02 35.37 ? 8   MET A H    2  
ATOM   9326   H HA   . MET A 1 15  ? 1.145   5.399   -32.927 0.02 35.89 ? 8   MET A HA   2  
ATOM   9327   H HB2  . MET A 1 15  ? 2.348   3.696   -33.528 0.02 36.07 ? 8   MET A HB2  2  
ATOM   9328   H HB3  . MET A 1 15  ? 2.557   3.548   -31.965 0.02 35.42 ? 8   MET A HB3  2  
ATOM   9329   H HG2  . MET A 1 15  ? 0.535   2.023   -33.270 0.02 34.87 ? 8   MET A HG2  2  
ATOM   9330   H HG3  . MET A 1 15  ? 2.007   1.492   -33.094 0.02 35.54 ? 8   MET A HG3  2  
ATOM   9331   H HE1  . MET A 1 15  ? 2.902   0.769   -30.040 0.02 35.46 ? 8   MET A HE1  2  
ATOM   9332   H HE2  . MET A 1 15  ? 1.947   -0.427  -30.479 0.02 34.88 ? 8   MET A HE2  2  
ATOM   9333   H HE3  . MET A 1 15  ? 2.835   0.316   -31.561 0.02 35.48 ? 8   MET A HE3  2  
ATOM   9334   N N    . GLU A 1 16  ? -1.184  3.427   -31.962 0.02 34.16 ? 9   GLU A N    2  
ATOM   9335   C CA   . GLU A 1 16  ? -2.362  2.737   -32.461 0.02 33.58 ? 9   GLU A CA   2  
ATOM   9336   C C    . GLU A 1 16  ? -3.590  3.627   -32.409 0.02 33.21 ? 9   GLU A C    2  
ATOM   9337   O O    . GLU A 1 16  ? -4.552  3.377   -33.139 0.02 32.76 ? 9   GLU A O    2  
ATOM   9338   C CB   . GLU A 1 16  ? -2.578  1.435   -31.723 0.02 33.14 ? 9   GLU A CB   2  
ATOM   9339   C CG   . GLU A 1 16  ? -2.905  1.507   -30.274 0.02 32.86 ? 9   GLU A CG   2  
ATOM   9340   C CD   . GLU A 1 16  ? -2.723  0.137   -29.638 0.02 32.80 ? 9   GLU A CD   2  
ATOM   9341   O OE1  . GLU A 1 16  ? -3.218  -0.139  -28.512 0.02 32.32 ? 9   GLU A OE1  2  
ATOM   9342   O OE2  . GLU A 1 16  ? -2.133  -0.718  -30.332 0.02 33.26 ? 9   GLU A OE2  2  
ATOM   9343   H H    . GLU A 1 16  ? -1.000  3.307   -31.131 0.02 34.08 ? 9   GLU A H    2  
ATOM   9344   H HA   . GLU A 1 16  ? -2.212  2.507   -33.392 0.02 33.74 ? 9   GLU A HA   2  
ATOM   9345   H HB2  . GLU A 1 16  ? -3.306  0.965   -32.157 0.02 32.80 ? 9   GLU A HB2  2  
ATOM   9346   H HB3  . GLU A 1 16  ? -1.763  0.919   -31.818 0.02 33.41 ? 9   GLU A HB3  2  
ATOM   9347   H HG2  . GLU A 1 16  ? -2.358  2.164   -29.844 0.02 33.15 ? 9   GLU A HG2  2  
ATOM   9348   H HG3  . GLU A 1 16  ? -3.836  1.758   -30.186 0.02 32.46 ? 9   GLU A HG3  2  
ATOM   9349   N N    . LYS A 1 17  ? -3.572  4.681   -31.591 0.02 33.43 ? 10  LYS A N    2  
ATOM   9350   C CA   . LYS A 1 17  ? -4.511  5.779   -31.813 0.02 33.40 ? 10  LYS A CA   2  
ATOM   9351   C C    . LYS A 1 17  ? -4.473  6.212   -33.267 0.02 33.68 ? 10  LYS A C    2  
ATOM   9352   O O    . LYS A 1 17  ? -5.506  6.534   -33.872 0.02 33.41 ? 10  LYS A O    2  
ATOM   9353   C CB   . LYS A 1 17  ? -4.165  6.975   -30.922 0.02 33.81 ? 10  LYS A CB   2  
ATOM   9354   C CG   . LYS A 1 17  ? -5.038  7.100   -29.693 0.02 33.44 ? 10  LYS A CG   2  
ATOM   9355   C CD   . LYS A 1 17  ? -4.453  8.064   -28.638 0.02 33.95 ? 10  LYS A CD   2  
ATOM   9356   C CE   . LYS A 1 17  ? -4.060  7.267   -27.407 0.02 33.88 ? 10  LYS A CE   2  
ATOM   9357   N NZ   . LYS A 1 17  ? -4.027  7.988   -26.105 0.02 33.84 ? 10  LYS A NZ   2  
ATOM   9358   H H    . LYS A 1 17  ? -3.039  4.784   -30.927 0.02 33.62 ? 10  LYS A H    2  
ATOM   9359   H HA   . LYS A 1 17  ? -5.413  5.490   -31.608 0.02 32.95 ? 10  LYS A HA   2  
ATOM   9360   H HB2  . LYS A 1 17  ? -3.239  6.918   -30.651 0.02 34.17 ? 10  LYS A HB2  2  
ATOM   9361   H HB3  . LYS A 1 17  ? -4.288  7.784   -31.441 0.02 34.02 ? 10  LYS A HB3  2  
ATOM   9362   H HG2  . LYS A 1 17  ? -5.907  7.441   -29.958 0.02 33.17 ? 10  LYS A HG2  2  
ATOM   9363   H HG3  . LYS A 1 17  ? -5.136  6.218   -29.305 0.02 33.18 ? 10  LYS A HG3  2  
ATOM   9364   H HD2  . LYS A 1 17  ? -3.662  8.499   -28.990 0.02 34.41 ? 10  LYS A HD2  2  
ATOM   9365   H HD3  . LYS A 1 17  ? -5.118  8.722   -28.386 0.02 33.92 ? 10  LYS A HD3  2  
ATOM   9366   H HE2  . LYS A 1 17  ? -4.715  6.567   -27.299 0.02 33.49 ? 10  LYS A HE2  2  
ATOM   9367   H HE3  . LYS A 1 17  ? -3.179  6.893   -27.552 0.02 34.29 ? 10  LYS A HE3  2  
ATOM   9368   H HZ1  . LYS A 1 17  ? -3.676  7.458   -25.482 0.02 33.86 ? 10  LYS A HZ1  2  
ATOM   9369   H HZ2  . LYS A 1 17  ? -3.528  8.722   -26.177 0.02 34.18 ? 10  LYS A HZ2  2  
ATOM   9370   H HZ3  . LYS A 1 17  ? -4.851  8.216   -25.860 0.02 33.46 ? 10  LYS A HZ3  2  
ATOM   9371   N N    . LEU A 1 18  ? -3.275  6.211   -33.848 0.02 34.28 ? 11  LEU A N    2  
ATOM   9372   C CA   . LEU A 1 18  ? -3.051  6.961   -35.076 0.02 34.67 ? 11  LEU A CA   2  
ATOM   9373   C C    . LEU A 1 18  ? -3.477  6.149   -36.282 0.02 34.34 ? 11  LEU A C    2  
ATOM   9374   O O    . LEU A 1 18  ? -4.308  6.601   -37.084 0.02 34.25 ? 11  LEU A O    2  
ATOM   9375   C CB   . LEU A 1 18  ? -1.588  7.353   -35.185 0.02 35.46 ? 11  LEU A CB   2  
ATOM   9376   C CG   . LEU A 1 18  ? -1.275  8.029   -36.519 0.02 35.94 ? 11  LEU A CG   2  
ATOM   9377   C CD1  . LEU A 1 18  ? -2.161  9.251   -36.722 0.02 36.04 ? 11  LEU A CD1  2  
ATOM   9378   C CD2  . LEU A 1 18  ? 0.188   8.363   -36.634 0.02 36.74 ? 11  LEU A CD2  2  
ATOM   9379   H H    . LEU A 1 18  ? -2.587  5.782   -33.562 0.02 34.49 ? 11  LEU A H    2  
ATOM   9380   H HA   . LEU A 1 18  ? -3.587  7.770   -35.052 0.02 34.67 ? 11  LEU A HA   2  
ATOM   9381   H HB2  . LEU A 1 18  ? -1.375  7.972   -34.469 0.02 35.70 ? 11  LEU A HB2  2  
ATOM   9382   H HB3  . LEU A 1 18  ? -1.036  6.561   -35.113 0.02 35.47 ? 11  LEU A HB3  2  
ATOM   9383   H HG   . LEU A 1 18  ? -1.471  7.400   -37.231 0.02 35.68 ? 11  LEU A HG   2  
ATOM   9384   H HD11 . LEU A 1 18  ? -1.815  9.768   -37.465 0.02 36.37 ? 11  LEU A HD11 2  
ATOM   9385   H HD12 . LEU A 1 18  ? -3.068  8.968   -36.915 0.02 35.55 ? 11  LEU A HD12 2  
ATOM   9386   H HD13 . LEU A 1 18  ? -2.147  9.787   -35.914 0.02 36.31 ? 11  LEU A HD13 2  
ATOM   9387   H HD21 . LEU A 1 18  ? 0.697   7.539   -36.667 0.02 36.67 ? 11  LEU A HD21 2  
ATOM   9388   H HD22 . LEU A 1 18  ? 0.334   8.871   -37.447 0.02 36.98 ? 11  LEU A HD22 2  
ATOM   9389   H HD23 . LEU A 1 18  ? 0.451   8.883   -35.859 0.02 37.08 ? 11  LEU A HD23 2  
ATOM   9390   N N    . LYS A 1 19  ? -2.911  4.944   -36.432 0.02 34.21 ? 12  LYS A N    2  
ATOM   9391   C CA   . LYS A 1 19  ? -3.462  4.018   -37.407 0.02 33.93 ? 12  LYS A CA   2  
ATOM   9392   C C    . LYS A 1 19  ? -4.971  3.981   -37.262 0.02 33.26 ? 12  LYS A C    2  
ATOM   9393   O O    . LYS A 1 19  ? -5.699  3.996   -38.257 0.02 33.07 ? 12  LYS A O    2  
ATOM   9394   C CB   . LYS A 1 19  ? -2.871  2.626   -37.204 0.02 33.90 ? 12  LYS A CB   2  
ATOM   9395   C CG   . LYS A 1 19  ? -1.632  2.334   -38.016 0.02 34.21 ? 12  LYS A CG   2  
ATOM   9396   C CD   . LYS A 1 19  ? -1.016  1.022   -37.516 0.02 34.26 ? 12  LYS A CD   2  
ATOM   9397   C CE   . LYS A 1 19  ? -0.125  0.386   -38.546 0.02 34.66 ? 12  LYS A CE   2  
ATOM   9398   N NZ   . LYS A 1 19  ? 0.289   -0.989  -38.097 0.02 34.53 ? 12  LYS A NZ   2  
ATOM   9399   H H    . LYS A 1 19  ? -2.232  4.652   -35.990 0.02 34.31 ? 12  LYS A H    2  
ATOM   9400   H HA   . LYS A 1 19  ? -3.245  4.324   -38.301 0.02 34.24 ? 12  LYS A HA   2  
ATOM   9401   H HB2  . LYS A 1 19  ? -2.629  2.530   -36.269 0.02 34.17 ? 12  LYS A HB2  2  
ATOM   9402   H HB3  . LYS A 1 19  ? -3.543  1.962   -37.433 0.02 33.44 ? 12  LYS A HB3  2  
ATOM   9403   H HG2  . LYS A 1 19  ? -1.869  2.236   -38.952 0.02 33.94 ? 12  LYS A HG2  2  
ATOM   9404   H HG3  . LYS A 1 19  ? -0.989  3.051   -37.895 0.02 34.69 ? 12  LYS A HG3  2  
ATOM   9405   H HD2  . LYS A 1 19  ? -0.484  1.195   -36.722 0.02 34.52 ? 12  LYS A HD2  2  
ATOM   9406   H HD3  . LYS A 1 19  ? -1.726  0.395   -37.308 0.02 33.80 ? 12  LYS A HD3  2  
ATOM   9407   H HE2  . LYS A 1 19  ? -0.603  0.312   -39.387 0.02 34.54 ? 12  LYS A HE2  2  
ATOM   9408   H HE3  . LYS A 1 19  ? 0.671   0.927   -38.653 0.02 35.17 ? 12  LYS A HE3  2  
ATOM   9409   H HZ1  . LYS A 1 19  ? 1.013   -1.253  -38.545 0.02 34.85 ? 12  LYS A HZ1  2  
ATOM   9410   H HZ2  . LYS A 1 19  ? 0.475   -0.978  -37.227 0.02 34.59 ? 12  LYS A HZ2  2  
ATOM   9411   H HZ3  . LYS A 1 19  ? -0.370  -1.569  -38.243 0.02 34.10 ? 12  LYS A HZ3  2  
ATOM   9412   N N    . TRP A 1 20  ? -5.456  4.027   -36.017 0.02 32.94 ? 13  TRP A N    2  
ATOM   9413   C CA   . TRP A 1 20  ? -6.893  4.076   -35.790 0.02 32.38 ? 13  TRP A CA   2  
ATOM   9414   C C    . TRP A 1 20  ? -7.499  5.337   -36.420 0.02 32.54 ? 13  TRP A C    2  
ATOM   9415   O O    . TRP A 1 20  ? -8.429  5.234   -37.229 0.02 32.28 ? 13  TRP A O    2  
ATOM   9416   C CB   . TRP A 1 20  ? -7.181  3.959   -34.285 0.02 32.03 ? 13  TRP A CB   2  
ATOM   9417   C CG   . TRP A 1 20  ? -8.614  3.895   -33.970 0.02 31.48 ? 13  TRP A CG   2  
ATOM   9418   C CD1  . TRP A 1 20  ? -9.372  4.888   -33.442 0.02 31.40 ? 13  TRP A CD1  2  
ATOM   9419   C CD2  . TRP A 1 20  ? -9.494  2.782   -34.181 0.02 30.99 ? 13  TRP A CD2  2  
ATOM   9420   N NE1  . TRP A 1 20  ? -10.664 4.468   -33.299 0.02 30.89 ? 13  TRP A NE1  2  
ATOM   9421   C CE2  . TRP A 1 20  ? -10.767 3.175   -33.751 0.02 30.64 ? 13  TRP A CE2  2  
ATOM   9422   C CE3  . TRP A 1 20  ? -9.321  1.487   -34.675 0.02 30.86 ? 13  TRP A CE3  2  
ATOM   9423   C CZ2  . TRP A 1 20  ? -11.862 2.325   -33.811 0.02 30.17 ? 13  TRP A CZ2  2  
ATOM   9424   C CZ3  . TRP A 1 20  ? -10.420 0.648   -34.741 0.02 30.39 ? 13  TRP A CZ3  2  
ATOM   9425   C CH2  . TRP A 1 20  ? -11.666 1.063   -34.302 0.02 30.05 ? 13  TRP A CH2  2  
ATOM   9426   H H    . TRP A 1 20  ? -4.981  4.038   -35.302 0.02 33.07 ? 13  TRP A H    2  
ATOM   9427   H HA   . TRP A 1 20  ? -7.305  3.311   -36.222 0.02 32.13 ? 13  TRP A HA   2  
ATOM   9428   H HB2  . TRP A 1 20  ? -6.774  3.149   -33.942 0.02 31.96 ? 13  TRP A HB2  2  
ATOM   9429   H HB3  . TRP A 1 20  ? -6.818  4.730   -33.829 0.02 32.28 ? 13  TRP A HB3  2  
ATOM   9430   H HD1  . TRP A 1 20  ? -9.057  5.732   -33.211 0.02 31.67 ? 13  TRP A HD1  2  
ATOM   9431   H HE1  . TRP A 1 20  ? -11.308 4.944   -32.987 0.02 30.78 ? 13  TRP A HE1  2  
ATOM   9432   H HE3  . TRP A 1 20  ? -8.488  1.199   -34.972 0.02 31.12 ? 13  TRP A HE3  2  
ATOM   9433   H HZ2  . TRP A 1 20  ? -12.698 2.597   -33.527 0.02 29.96 ? 13  TRP A HZ2  2  
ATOM   9434   H HZ3  . TRP A 1 20  ? -10.317 -0.214  -35.071 0.02 30.32 ? 13  TRP A HZ3  2  
ATOM   9435   H HH2  . TRP A 1 20  ? -12.386 0.477   -34.354 0.02 29.77 ? 13  TRP A HH2  2  
ATOM   9436   N N    . LYS A 1 21  ? -6.953  6.534   -36.132 0.02 33.01 ? 14  LYS A N    2  
ATOM   9437   C CA   . LYS A 1 21  ? -7.390  7.718   -36.885 0.02 33.22 ? 14  LYS A CA   2  
ATOM   9438   C C    . LYS A 1 21  ? -7.165  7.527   -38.384 0.02 33.46 ? 14  LYS A C    2  
ATOM   9439   O O    . LYS A 1 21  ? -8.105  7.651   -39.181 0.02 33.39 ? 14  LYS A O    2  
ATOM   9440   C CB   . LYS A 1 21  ? -6.681  8.984   -36.384 0.02 33.79 ? 14  LYS A CB   2  
ATOM   9441   C CG   . LYS A 1 21  ? -6.507  10.133  -37.423 0.02 34.13 ? 14  LYS A CG   2  
ATOM   9442   C CD   . LYS A 1 21  ? -7.365  11.365  -37.181 0.02 34.39 ? 14  LYS A CD   2  
ATOM   9443   C CE   . LYS A 1 21  ? -6.504  12.530  -36.748 0.02 35.11 ? 14  LYS A CE   2  
ATOM   9444   N NZ   . LYS A 1 21  ? -5.580  12.965  -37.878 0.02 35.71 ? 14  LYS A NZ   2  
ATOM   9445   H H    . LYS A 1 21  ? -6.357  6.681   -35.530 0.02 33.23 ? 14  LYS A H    2  
ATOM   9446   H HA   . LYS A 1 21  ? -8.342  7.840   -36.747 0.02 32.88 ? 14  LYS A HA   2  
ATOM   9447   H HB2  . LYS A 1 21  ? -7.184  9.336   -35.634 0.02 33.63 ? 14  LYS A HB2  2  
ATOM   9448   H HB3  . LYS A 1 21  ? -5.795  8.735   -36.080 0.02 34.13 ? 14  LYS A HB3  2  
ATOM   9449   H HG2  . LYS A 1 21  ? -5.585  10.424  -37.376 0.02 34.53 ? 14  LYS A HG2  2  
ATOM   9450   H HG3  . LYS A 1 21  ? -6.698  9.846   -38.327 0.02 33.81 ? 14  LYS A HG3  2  
ATOM   9451   H HD2  . LYS A 1 21  ? -7.809  11.615  -38.007 0.02 34.44 ? 14  LYS A HD2  2  
ATOM   9452   H HD3  . LYS A 1 21  ? -8.016  11.178  -36.486 0.02 34.07 ? 14  LYS A HD3  2  
ATOM   9453   H HE2  . LYS A 1 21  ? -7.074  13.279  -36.511 0.02 35.21 ? 14  LYS A HE2  2  
ATOM   9454   H HE3  . LYS A 1 21  ? -5.966  12.267  -35.988 0.02 35.12 ? 14  LYS A HE3  2  
ATOM   9455   H HZ1  . LYS A 1 21  ? -4.993  13.567  -37.581 0.02 36.15 ? 14  LYS A HZ1  2  
ATOM   9456   H HZ2  . LYS A 1 21  ? -5.134  12.263  -38.200 0.02 35.59 ? 14  LYS A HZ2  2  
ATOM   9457   H HZ3  . LYS A 1 21  ? -6.057  13.328  -38.536 0.02 35.77 ? 14  LYS A HZ3  2  
ATOM   9458   N N    . ILE A 1 22  ? -5.924  7.250   -38.792 0.02 33.78 ? 15  ILE A N    2  
ATOM   9459   C CA   . ILE A 1 22  ? -5.649  7.020   -40.209 0.02 34.10 ? 15  ILE A CA   2  
ATOM   9460   C C    . ILE A 1 22  ? -6.599  5.960   -40.749 0.02 33.62 ? 15  ILE A C    2  
ATOM   9461   O O    . ILE A 1 22  ? -6.967  5.971   -41.932 0.02 33.82 ? 15  ILE A O    2  
ATOM   9462   C CB   . ILE A 1 22  ? -4.168  6.627   -40.414 0.02 34.77 ? 15  ILE A CB   2  
ATOM   9463   C CG1  . ILE A 1 22  ? -3.316  7.801   -40.926 0.02 35.39 ? 15  ILE A CG1  2  
ATOM   9464   C CG2  . ILE A 1 22  ? -4.044  5.460   -41.402 0.02 35.01 ? 15  ILE A CG2  2  
ATOM   9465   C CD1  . ILE A 1 22  ? -2.156  8.193   -39.984 0.02 36.00 ? 15  ILE A CD1  2  
ATOM   9466   H H    . ILE A 1 22  ? -5.239  7.187   -38.278 0.02 33.85 ? 15  ILE A H    2  
ATOM   9467   H HA   . ILE A 1 22  ? -5.823  7.836   -40.701 0.02 34.25 ? 15  ILE A HA   2  
ATOM   9468   H HB   . ILE A 1 22  ? -3.810  6.341   -39.562 0.02 34.69 ? 15  ILE A HB   2  
ATOM   9469   H HG12 . ILE A 1 22  ? -2.923  7.546   -41.774 0.02 35.63 ? 15  ILE A HG12 2  
ATOM   9470   H HG13 . ILE A 1 22  ? -3.874  8.584   -41.054 0.02 35.20 ? 15  ILE A HG13 2  
ATOM   9471   H HG21 . ILE A 1 22  ? -3.103  5.310   -41.587 0.02 35.52 ? 15  ILE A HG21 2  
ATOM   9472   H HG22 . ILE A 1 22  ? -4.421  4.663   -41.000 0.02 34.72 ? 15  ILE A HG22 2  
ATOM   9473   H HG23 . ILE A 1 22  ? -4.505  5.678   -42.229 0.02 34.99 ? 15  ILE A HG23 2  
ATOM   9474   H HD11 . ILE A 1 22  ? -1.936  9.128   -40.121 0.02 36.39 ? 15  ILE A HD11 2  
ATOM   9475   H HD12 . ILE A 1 22  ? -2.432  8.052   -39.066 0.02 35.78 ? 15  ILE A HD12 2  
ATOM   9476   H HD13 . ILE A 1 22  ? -1.387  7.637   -40.184 0.02 36.23 ? 15  ILE A HD13 2  
ATOM   9477   N N    . LYS A 1 23  ? -7.023  5.025   -39.895 0.02 33.01 ? 16  LYS A N    2  
ATOM   9478   C CA   . LYS A 1 23  ? -7.967  4.003   -40.339 0.02 32.53 ? 16  LYS A CA   2  
ATOM   9479   C C    . LYS A 1 23  ? -9.417  4.460   -40.154 0.02 32.15 ? 16  LYS A C    2  
ATOM   9480   O O    . LYS A 1 23  ? -10.284 4.100   -40.961 0.02 31.96 ? 16  LYS A O    2  
ATOM   9481   C CB   . LYS A 1 23  ? -7.669  2.684   -39.629 0.02 32.21 ? 16  LYS A CB   2  
ATOM   9482   C CG   . LYS A 1 23  ? -6.305  2.087   -40.056 0.02 32.69 ? 16  LYS A CG   2  
ATOM   9483   C CD   . LYS A 1 23  ? -6.395  1.178   -41.286 0.02 32.75 ? 16  LYS A CD   2  
ATOM   9484   C CE   . LYS A 1 23  ? -5.058  1.206   -42.084 0.02 33.45 ? 16  LYS A CE   2  
ATOM   9485   N NZ   . LYS A 1 23  ? -5.052  0.281   -43.223 0.02 33.58 ? 16  LYS A NZ   2  
ATOM   9486   H H    . LYS A 1 23  ? -6.776  4.953   -39.075 0.02 32.89 ? 16  LYS A H    2  
ATOM   9487   H HA   . LYS A 1 23  ? -7.828  3.843   -41.287 0.02 32.74 ? 16  LYS A HA   2  
ATOM   9488   H HB2  . LYS A 1 23  ? -7.644  2.842   -38.673 0.02 32.00 ? 16  LYS A HB2  2  
ATOM   9489   H HB3  . LYS A 1 23  ? -8.364  2.039   -39.836 0.02 31.95 ? 16  LYS A HB3  2  
ATOM   9490   H HG2  . LYS A 1 23  ? -5.698  2.812   -40.281 0.02 33.11 ? 16  LYS A HG2  2  
ATOM   9491   H HG3  . LYS A 1 23  ? -5.939  1.569   -39.320 0.02 32.60 ? 16  LYS A HG3  2  
ATOM   9492   H HD2  . LYS A 1 23  ? -6.562  0.266   -41.002 0.02 32.66 ? 16  LYS A HD2  2  
ATOM   9493   H HD3  . LYS A 1 23  ? -7.113  1.485   -41.862 0.02 32.48 ? 16  LYS A HD3  2  
ATOM   9494   H HE2  . LYS A 1 23  ? -4.912  2.100   -42.432 0.02 33.60 ? 16  LYS A HE2  2  
ATOM   9495   H HE3  . LYS A 1 23  ? -4.330  0.952   -41.496 0.02 33.74 ? 16  LYS A HE3  2  
ATOM   9496   H HZ1  . LYS A 1 23  ? -5.579  0.592   -43.869 0.02 33.75 ? 16  LYS A HZ1  2  
ATOM   9497   H HZ2  . LYS A 1 23  ? -4.224  0.193   -43.544 0.02 33.89 ? 16  LYS A HZ2  2  
ATOM   9498   H HZ3  . LYS A 1 23  ? -5.351  -0.516  -42.964 0.02 33.22 ? 16  LYS A HZ3  2  
ATOM   9499   N N    . CYS A 1 24  ? -9.684  5.341   -39.184 0.02 32.12 ? 17  CYS A N    2  
ATOM   9500   C CA   . CYS A 1 24  ? -11.017 5.928   -39.086 0.02 31.84 ? 17  CYS A CA   2  
ATOM   9501   C C    . CYS A 1 24  ? -11.341 6.745   -40.329 0.02 32.16 ? 17  CYS A C    2  
ATOM   9502   O O    . CYS A 1 24  ? -12.509 6.893   -40.704 0.02 31.91 ? 17  CYS A O    2  
ATOM   9503   C CB   . CYS A 1 24  ? -11.128 6.795   -37.835 0.02 31.82 ? 17  CYS A CB   2  
ATOM   9504   S SG   . CYS A 1 24  ? -11.950 5.994   -36.467 0.02 31.19 ? 17  CYS A SG   2  
ATOM   9505   H H    . CYS A 1 24  ? -9.121  5.615   -38.597 0.02 32.29 ? 17  CYS A H    2  
ATOM   9506   H HA   . CYS A 1 24  ? -11.673 5.217   -39.013 0.02 31.46 ? 17  CYS A HA   2  
ATOM   9507   H HB2  . CYS A 1 24  ? -10.237 7.033   -37.532 0.02 32.12 ? 17  CYS A HB2  2  
ATOM   9508   H HB3  . CYS A 1 24  ? -11.628 7.599   -38.056 0.02 31.91 ? 17  CYS A HB3  2  
ATOM   9509   H HG   . CYS A 1 24  ? -11.272 5.096   -36.048 0.02 31.06 ? 17  CYS A HG   2  
ATOM   9510   N N    . ILE A 1 25  ? -10.310 7.270   -40.993 0.02 32.76 ? 18  ILE A N    2  
ATOM   9511   C CA   . ILE A 1 25  ? -10.514 8.175   -42.116 0.02 33.11 ? 18  ILE A CA   2  
ATOM   9512   C C    . ILE A 1 25  ? -10.772 7.390   -43.396 0.02 32.99 ? 18  ILE A C    2  
ATOM   9513   O O    . ILE A 1 25  ? -11.712 7.681   -44.150 0.02 32.82 ? 18  ILE A O    2  
ATOM   9514   C CB   . ILE A 1 25  ? -9.300  9.118   -42.230 0.02 33.84 ? 18  ILE A CB   2  
ATOM   9515   C CG1  . ILE A 1 25  ? -9.714  10.535  -41.850 0.02 34.07 ? 18  ILE A CG1  2  
ATOM   9516   C CG2  . ILE A 1 25  ? -8.654  9.088   -43.592 0.02 34.24 ? 18  ILE A CG2  2  
ATOM   9517   C CD1  . ILE A 1 25  ? -8.564  11.357  -41.361 0.02 34.78 ? 18  ILE A CD1  2  
ATOM   9518   H H    . ILE A 1 25  ? -9.484  7.116   -40.815 0.02 32.98 ? 18  ILE A H    2  
ATOM   9519   H HA   . ILE A 1 25  ? -11.299 8.717   -41.937 0.02 33.00 ? 18  ILE A HA   2  
ATOM   9520   H HB   . ILE A 1 25  ? -8.635  8.824   -41.588 0.02 33.96 ? 18  ILE A HB   2  
ATOM   9521   H HG12 . ILE A 1 25  ? -10.095 10.976  -42.626 0.02 34.07 ? 18  ILE A HG12 2  
ATOM   9522   H HG13 . ILE A 1 25  ? -10.367 10.496  -41.133 0.02 33.77 ? 18  ILE A HG13 2  
ATOM   9523   H HG21 . ILE A 1 25  ? -7.923  9.726   -43.603 0.02 34.71 ? 18  ILE A HG21 2  
ATOM   9524   H HG22 . ILE A 1 25  ? -8.304  8.199   -43.755 0.02 34.23 ? 18  ILE A HG22 2  
ATOM   9525   H HG23 . ILE A 1 25  ? -9.301  9.337   -44.270 0.02 34.04 ? 18  ILE A HG23 2  
ATOM   9526   H HD11 . ILE A 1 25  ? -8.647  11.468  -40.400 0.02 34.77 ? 18  ILE A HD11 2  
ATOM   9527   H HD12 . ILE A 1 25  ? -7.736  10.900  -41.572 0.02 35.03 ? 18  ILE A HD12 2  
ATOM   9528   H HD13 . ILE A 1 25  ? -8.590  12.223  -41.802 0.02 35.04 ? 18  ILE A HD13 2  
ATOM   9529   N N    . GLU A 1 26  ? -9.957  6.368   -43.654 0.02 33.16 ? 19  GLU A N    2  
ATOM   9530   C CA   . GLU A 1 26  ? -10.184 5.526   -44.820 0.02 33.04 ? 19  GLU A CA   2  
ATOM   9531   C C    . GLU A 1 26  ? -11.487 4.730   -44.703 0.02 32.46 ? 19  GLU A C    2  
ATOM   9532   O O    . GLU A 1 26  ? -11.883 4.052   -45.655 0.02 32.45 ? 19  GLU A O    2  
ATOM   9533   C CB   . GLU A 1 26  ? -8.976  4.600   -45.036 0.02 33.04 ? 19  GLU A CB   2  
ATOM   9534   C CG   . GLU A 1 26  ? -9.168  3.119   -44.643 0.02 32.61 ? 19  GLU A CG   2  
ATOM   9535   C CD   . GLU A 1 26  ? -8.485  2.138   -45.579 0.02 32.92 ? 19  GLU A CD   2  
ATOM   9536   O OE1  . GLU A 1 26  ? -8.622  2.285   -46.823 0.02 32.85 ? 19  GLU A OE1  2  
ATOM   9537   O OE2  . GLU A 1 26  ? -7.844  1.202   -45.056 0.02 33.26 ? 19  GLU A OE2  2  
ATOM   9538   H H    . GLU A 1 26  ? -9.260  6.170   -43.212 0.02 33.38 ? 19  GLU A H    2  
ATOM   9539   H HA   . GLU A 1 26  ? -10.259 6.095   -45.597 0.02 33.38 ? 19  GLU A HA   2  
ATOM   9540   H HB2  . GLU A 1 26  ? -8.738  4.634   -45.967 0.02 33.47 ? 19  GLU A HB2  2  
ATOM   9541   H HB3  . GLU A 1 26  ? -8.230  4.934   -44.517 0.02 32.94 ? 19  GLU A HB3  2  
ATOM   9542   H HG2  . GLU A 1 26  ? -8.776  2.985   -43.767 0.02 32.55 ? 19  GLU A HG2  2  
ATOM   9543   H HG3  . GLU A 1 26  ? -10.094 2.853   -44.619 0.02 32.24 ? 19  GLU A HG3  2  
ATOM   9544   N N    . ASN A 1 27  ? -12.169 4.783   -43.553 0.02 32.00 ? 20  ASN A N    2  
ATOM   9545   C CA   . ASN A 1 27  ? -13.412 4.020   -43.417 0.02 31.49 ? 20  ASN A CA   2  
ATOM   9546   C C    . ASN A 1 27  ? -14.620 4.879   -43.756 0.02 31.57 ? 20  ASN A C    2  
ATOM   9547   O O    . ASN A 1 27  ? -15.627 4.376   -44.262 0.02 31.49 ? 20  ASN A O    2  
ATOM   9548   C CB   . ASN A 1 27  ? -13.545 3.443   -41.996 0.02 31.03 ? 20  ASN A CB   2  
ATOM   9549   C CG   . ASN A 1 27  ? -14.922 2.847   -41.731 0.02 30.54 ? 20  ASN A CG   2  
ATOM   9550   O OD1  . ASN A 1 27  ? -15.850 3.544   -41.317 0.02 30.43 ? 20  ASN A OD1  2  
ATOM   9551   N ND2  . ASN A 1 27  ? -15.054 1.550   -41.963 0.02 30.29 ? 20  ASN A ND2  2  
ATOM   9552   H H    . ASN A 1 27  ? -11.943 5.232   -42.857 0.02 32.01 ? 20  ASN A H    2  
ATOM   9553   H HA   . ASN A 1 27  ? -13.398 3.274   -44.033 0.02 31.41 ? 20  ASN A HA   2  
ATOM   9554   H HB2  . ASN A 1 27  ? -12.890 2.734   -41.889 0.02 30.99 ? 20  ASN A HB2  2  
ATOM   9555   H HB3  . ASN A 1 27  ? -13.390 4.145   -41.344 0.02 31.12 ? 20  ASN A HB3  2  
ATOM   9556   H HD21 . ASN A 1 27  ? -14.372 1.087   -42.211 0.02 30.40 ? 20  ASN A HD21 2  
ATOM   9557   H HD22 . ASN A 1 27  ? -15.817 1.168   -41.856 0.02 30.04 ? 20  ASN A HD22 2  
ATOM   9558   N N    . LYS A 1 28  ? -14.551 6.175   -43.473 0.02 31.75 ? 21  LYS A N    2  
ATOM   9559   C CA   . LYS A 1 28  ? -15.636 7.061   -43.878 0.02 31.90 ? 21  LYS A CA   2  
ATOM   9560   C C    . LYS A 1 28  ? -15.763 7.096   -45.402 0.02 32.18 ? 21  LYS A C    2  
ATOM   9561   O O    . LYS A 1 28  ? -16.823 6.775   -45.947 0.02 31.95 ? 21  LYS A O    2  
ATOM   9562   C CB   . LYS A 1 28  ? -15.397 8.464   -43.303 0.02 32.31 ? 21  LYS A CB   2  
ATOM   9563   C CG   . LYS A 1 28  ? -16.274 9.564   -43.903 0.02 32.59 ? 21  LYS A CG   2  
ATOM   9564   C CD   . LYS A 1 28  ? -17.702 9.447   -43.386 0.02 32.16 ? 21  LYS A CD   2  
ATOM   9565   C CE   . LYS A 1 28  ? -18.621 10.458  -44.059 0.02 32.47 ? 21  LYS A CE   2  
ATOM   9566   N NZ   . LYS A 1 28  ? -18.171 11.861  -43.830 0.02 33.09 ? 21  LYS A NZ   2  
ATOM   9567   H H    . LYS A 1 28  ? -13.899 6.558   -43.066 0.02 31.82 ? 21  LYS A H    2  
ATOM   9568   H HA   . LYS A 1 28  ? -16.472 6.733   -43.514 0.02 31.58 ? 21  LYS A HA   2  
ATOM   9569   H HB2  . LYS A 1 28  ? -15.573 8.440   -42.347 0.02 32.12 ? 21  LYS A HB2  2  
ATOM   9570   H HB3  . LYS A 1 28  ? -14.470 8.702   -43.457 0.02 32.63 ? 21  LYS A HB3  2  
ATOM   9571   H HG2  . LYS A 1 28  ? -15.925 10.424  -43.621 0.02 32.88 ? 21  LYS A HG2  2  
ATOM   9572   H HG3  . LYS A 1 28  ? -16.284 9.516   -44.871 0.02 32.79 ? 21  LYS A HG3  2  
ATOM   9573   H HD2  . LYS A 1 28  ? -18.033 8.555   -43.571 0.02 31.88 ? 21  LYS A HD2  2  
ATOM   9574   H HD3  . LYS A 1 28  ? -17.716 9.607   -42.429 0.02 32.00 ? 21  LYS A HD3  2  
ATOM   9575   H HE2  . LYS A 1 28  ? -18.625 10.297  -45.014 0.02 32.50 ? 21  LYS A HE2  2  
ATOM   9576   H HE3  . LYS A 1 28  ? -19.518 10.366  -43.702 0.02 32.27 ? 21  LYS A HE3  2  
ATOM   9577   H HZ1  . LYS A 1 28  ? -18.055 12.005  -42.959 0.02 33.12 ? 21  LYS A HZ1  2  
ATOM   9578   H HZ2  . LYS A 1 28  ? -17.401 12.006  -44.252 0.02 33.33 ? 21  LYS A HZ2  2  
ATOM   9579   H HZ3  . LYS A 1 28  ? -18.780 12.432  -44.140 0.02 33.25 ? 21  LYS A HZ3  2  
ATOM   9580   N N    . PHE A 1 29  ? -14.695 7.465   -46.106 0.02 32.70 ? 22  PHE A N    2  
ATOM   9581   C CA   . PHE A 1 29  ? -14.736 7.465   -47.572 0.02 33.05 ? 22  PHE A CA   2  
ATOM   9582   C C    . PHE A 1 29  ? -15.191 6.118   -48.128 0.02 32.70 ? 22  PHE A C    2  
ATOM   9583   O O    . PHE A 1 29  ? -15.964 6.079   -49.092 0.02 32.71 ? 22  PHE A O    2  
ATOM   9584   C CB   . PHE A 1 29  ? -13.371 7.848   -48.135 0.02 33.63 ? 22  PHE A CB   2  
ATOM   9585   C CG   . PHE A 1 29  ? -13.041 9.300   -47.944 0.02 34.15 ? 22  PHE A CG   2  
ATOM   9586   C CD1  . PHE A 1 29  ? -12.197 9.709   -46.911 0.02 34.28 ? 22  PHE A CD1  2  
ATOM   9587   C CD2  . PHE A 1 29  ? -13.590 10.263  -48.786 0.02 34.56 ? 22  PHE A CD2  2  
ATOM   9588   C CE1  . PHE A 1 29  ? -11.888 11.066  -46.739 0.02 34.81 ? 22  PHE A CE1  2  
ATOM   9589   C CE2  . PHE A 1 29  ? -13.296 11.604  -48.606 0.02 35.08 ? 22  PHE A CE2  2  
ATOM   9590   C CZ   . PHE A 1 29  ? -12.444 12.005  -47.580 0.02 35.20 ? 22  PHE A CZ   2  
ATOM   9591   H H    . PHE A 1 29  ? -13.949 7.721   -45.768 0.02 32.90 ? 22  PHE A H    2  
ATOM   9592   H HA   . PHE A 1 29  ? -15.368 8.139   -47.874 0.02 33.20 ? 22  PHE A HA   2  
ATOM   9593   H HB2  . PHE A 1 29  ? -12.690 7.324   -47.685 0.02 33.52 ? 22  PHE A HB2  2  
ATOM   9594   H HB3  . PHE A 1 29  ? -13.353 7.657   -49.086 0.02 33.82 ? 22  PHE A HB3  2  
ATOM   9595   H HD1  . PHE A 1 29  ? -11.823 9.074   -46.344 0.02 34.03 ? 22  PHE A HD1  2  
ATOM   9596   H HD2  . PHE A 1 29  ? -14.161 10.005  -49.474 0.02 34.50 ? 22  PHE A HD2  2  
ATOM   9597   H HE1  . PHE A 1 29  ? -11.324 11.335  -46.051 0.02 34.91 ? 22  PHE A HE1  2  
ATOM   9598   H HE2  . PHE A 1 29  ? -13.665 12.237  -49.176 0.02 35.37 ? 22  PHE A HE2  2  
ATOM   9599   H HZ   . PHE A 1 29  ? -12.244 12.906  -47.466 0.02 35.58 ? 22  PHE A HZ   2  
ATOM   9600   N N    . LEU A 1 30  ? -14.754 5.002   -47.520 0.02 32.45 ? 23  LEU A N    2  
ATOM   9601   C CA   . LEU A 1 30  ? -15.139 3.684   -48.029 0.02 32.16 ? 23  LEU A CA   2  
ATOM   9602   C C    . LEU A 1 30  ? -16.629 3.431   -47.840 0.02 31.74 ? 23  LEU A C    2  
ATOM   9603   O O    . LEU A 1 30  ? -17.289 2.904   -48.747 0.02 31.72 ? 23  LEU A O    2  
ATOM   9604   C CB   . LEU A 1 30  ? -14.315 2.593   -47.352 0.02 31.93 ? 23  LEU A CB   2  
ATOM   9605   C CG   . LEU A 1 30  ? -14.575 1.132   -47.737 0.02 31.62 ? 23  LEU A CG   2  
ATOM   9606   C CD1  . LEU A 1 30  ? -14.375 0.863   -49.251 0.02 32.00 ? 23  LEU A CD1  2  
ATOM   9607   C CD2  . LEU A 1 30  ? -13.677 0.233   -46.873 0.02 31.40 ? 23  LEU A CD2  2  
ATOM   9608   H H    . LEU A 1 30  ? -14.247 4.983   -46.827 0.02 32.47 ? 23  LEU A H    2  
ATOM   9609   H HA   . LEU A 1 30  ? -14.951 3.654   -48.979 0.02 32.45 ? 23  LEU A HA   2  
ATOM   9610   H HB2  . LEU A 1 30  ? -13.378 2.768   -47.529 0.02 32.24 ? 23  LEU A HB2  2  
ATOM   9611   H HB3  . LEU A 1 30  ? -14.474 2.657   -46.397 0.02 31.69 ? 23  LEU A HB3  2  
ATOM   9612   H HG   . LEU A 1 30  ? -15.495 0.913   -47.520 0.02 31.33 ? 23  LEU A HG   2  
ATOM   9613   H HD11 . LEU A 1 30  ? -15.105 0.311   -49.574 0.02 31.89 ? 23  LEU A HD11 2  
ATOM   9614   H HD12 . LEU A 1 30  ? -14.372 1.708   -49.724 0.02 32.37 ? 23  LEU A HD12 2  
ATOM   9615   H HD13 . LEU A 1 30  ? -13.529 0.411   -49.390 0.02 32.00 ? 23  LEU A HD13 2  
ATOM   9616   H HD21 . LEU A 1 30  ? -13.963 0.296   -45.949 0.02 31.22 ? 23  LEU A HD21 2  
ATOM   9617   H HD22 . LEU A 1 30  ? -13.756 -0.684  -47.178 0.02 31.18 ? 23  LEU A HD22 2  
ATOM   9618   H HD23 . LEU A 1 30  ? -12.758 0.532   -46.953 0.02 31.71 ? 23  LEU A HD23 2  
ATOM   9619   N N    . ASN A 1 31  ? -17.171 3.810   -46.673 0.02 31.44 ? 24  ASN A N    2  
ATOM   9620   C CA   . ASN A 1 31  ? -18.617 3.841   -46.465 0.02 31.12 ? 24  ASN A CA   2  
ATOM   9621   C C    . ASN A 1 31  ? -19.298 4.585   -47.600 0.02 31.47 ? 24  ASN A C    2  
ATOM   9622   O O    . ASN A 1 31  ? -20.282 4.106   -48.163 0.02 31.36 ? 24  ASN A O    2  
ATOM   9623   C CB   . ASN A 1 31  ? -18.936 4.447   -45.063 0.02 30.84 ? 24  ASN A CB   2  
ATOM   9624   C CG   . ASN A 1 31  ? -19.818 5.785   -45.071 0.02 30.82 ? 24  ASN A CG   2  
ATOM   9625   O OD1  . ASN A 1 31  ? -21.039 5.702   -44.861 0.02 30.55 ? 24  ASN A OD1  2  
ATOM   9626   N ND2  . ASN A 1 31  ? -19.170 7.004   -45.167 0.02 31.14 ? 24  ASN A ND2  2  
ATOM   9627   H H    . ASN A 1 31  ? -16.715 4.069   -45.997 0.02 31.44 ? 24  ASN A H    2  
ATOM   9628   H HA   . ASN A 1 31  ? -18.946 2.928   -46.475 0.02 30.89 ? 24  ASN A HA   2  
ATOM   9629   H HB2  . ASN A 1 31  ? -19.443 3.784   -44.570 0.02 30.52 ? 24  ASN A HB2  2  
ATOM   9630   H HB3  . ASN A 1 31  ? -18.108 4.628   -44.591 0.02 31.01 ? 24  ASN A HB3  2  
ATOM   9631   H HD21 . ASN A 1 31  ? -19.610 7.738   -45.091 0.02 31.11 ? 24  ASN A HD21 2  
ATOM   9632   H HD22 . ASN A 1 31  ? -18.322 7.041   -45.294 0.02 31.38 ? 24  ASN A HD22 2  
ATOM   9633   N N    . TYR A 1 32  ? -18.759 5.742   -47.973 0.02 31.92 ? 25  TYR A N    2  
ATOM   9634   C CA   . TYR A 1 32  ? -19.326 6.505   -49.081 0.02 32.33 ? 25  TYR A CA   2  
ATOM   9635   C C    . TYR A 1 32  ? -19.251 5.726   -50.394 0.02 32.52 ? 25  TYR A C    2  
ATOM   9636   O O    . TYR A 1 32  ? -20.241 5.627   -51.128 0.02 32.58 ? 25  TYR A O    2  
ATOM   9637   C CB   . TYR A 1 32  ? -18.586 7.836   -49.210 0.02 32.86 ? 25  TYR A CB   2  
ATOM   9638   C CG   . TYR A 1 32  ? -18.883 8.566   -50.482 0.02 33.38 ? 25  TYR A CG   2  
ATOM   9639   C CD1  . TYR A 1 32  ? -19.974 9.420   -50.576 0.02 33.45 ? 25  TYR A CD1  2  
ATOM   9640   C CD2  . TYR A 1 32  ? -18.061 8.412   -51.598 0.02 33.84 ? 25  TYR A CD2  2  
ATOM   9641   C CE1  . TYR A 1 32  ? -20.240 10.093  -51.749 0.02 33.97 ? 25  TYR A CE1  2  
ATOM   9642   C CE2  . TYR A 1 32  ? -18.319 9.066   -52.764 0.02 34.36 ? 25  TYR A CE2  2  
ATOM   9643   C CZ   . TYR A 1 32  ? -19.398 9.914   -52.844 0.02 34.42 ? 25  TYR A CZ   2  
ATOM   9644   O OH   . TYR A 1 32  ? -19.624 10.564  -54.030 0.02 34.99 ? 25  TYR A OH   2  
ATOM   9645   H H    . TYR A 1 32  ? -18.071 6.100   -47.608 0.02 32.03 ? 25  TYR A H    2  
ATOM   9646   H HA   . TYR A 1 32  ? -20.258 6.696   -48.894 0.02 32.19 ? 25  TYR A HA   2  
ATOM   9647   H HB2  . TYR A 1 32  ? -18.842 8.407   -48.470 0.02 32.78 ? 25  TYR A HB2  2  
ATOM   9648   H HB3  . TYR A 1 32  ? -17.632 7.676   -49.181 0.02 32.97 ? 25  TYR A HB3  2  
ATOM   9649   H HD1  . TYR A 1 32  ? -20.531 9.535   -49.840 0.02 33.17 ? 25  TYR A HD1  2  
ATOM   9650   H HD2  . TYR A 1 32  ? -17.327 7.843   -51.550 0.02 33.82 ? 25  TYR A HD2  2  
ATOM   9651   H HE1  . TYR A 1 32  ? -20.972 10.663  -51.807 0.02 34.04 ? 25  TYR A HE1  2  
ATOM   9652   H HE2  . TYR A 1 32  ? -17.759 8.954   -53.498 0.02 34.69 ? 25  TYR A HE2  2  
ATOM   9653   H HH   . TYR A 1 32  ? -19.039 10.342  -54.593 0.02 35.22 ? 25  TYR A HH   2  
ATOM   9654   N N    . ARG A 1 33  ? -18.076 5.173   -50.698 0.02 32.66 ? 26  ARG A N    2  
ATOM   9655   C CA   . ARG A 1 33  ? -17.843 4.548   -51.994 0.02 32.93 ? 26  ARG A CA   2  
ATOM   9656   C C    . ARG A 1 33  ? -18.739 3.327   -52.197 0.02 32.56 ? 26  ARG A C    2  
ATOM   9657   O O    . ARG A 1 33  ? -19.147 3.029   -53.332 0.02 32.79 ? 26  ARG A O    2  
ATOM   9658   C CB   . ARG A 1 33  ? -16.366 4.171   -52.119 0.02 33.14 ? 26  ARG A CB   2  
ATOM   9659   C CG   . ARG A 1 33  ? -15.391 5.282   -51.767 0.02 33.51 ? 26  ARG A CG   2  
ATOM   9660   C CD   . ARG A 1 33  ? -14.208 5.317   -52.711 0.02 34.09 ? 26  ARG A CD   2  
ATOM   9661   N NE   . ARG A 1 33  ? -13.471 4.059   -52.697 0.02 33.96 ? 26  ARG A NE   2  
ATOM   9662   C CZ   . ARG A 1 33  ? -12.701 3.612   -53.685 0.02 34.34 ? 26  ARG A CZ   2  
ATOM   9663   N NH1  . ARG A 1 33  ? -12.547 4.314   -54.812 0.02 34.90 ? 26  ARG A NH1  2  
ATOM   9664   N NH2  . ARG A 1 33  ? -12.089 2.436   -53.541 0.02 34.20 ? 26  ARG A NH2  2  
ATOM   9665   H H    . ARG A 1 33  ? -17.399 5.143   -50.175 0.02 32.62 ? 26  ARG A H    2  
ATOM   9666   H HA   . ARG A 1 33  ? -18.048 5.186   -52.695 0.02 33.29 ? 26  ARG A HA   2  
ATOM   9667   H HB2  . ARG A 1 33  ? -16.186 3.432   -51.517 0.02 32.80 ? 26  ARG A HB2  2  
ATOM   9668   H HB3  . ARG A 1 33  ? -16.191 3.903   -53.035 0.02 33.40 ? 26  ARG A HB3  2  
ATOM   9669   H HG2  . ARG A 1 33  ? -15.841 6.141   -51.792 0.02 33.68 ? 26  ARG A HG2  2  
ATOM   9670   H HG3  . ARG A 1 33  ? -15.035 5.107   -50.884 0.02 33.26 ? 26  ARG A HG3  2  
ATOM   9671   H HD2  . ARG A 1 33  ? -14.528 5.486   -53.608 0.02 34.41 ? 26  ARG A HD2  2  
ATOM   9672   H HD3  . ARG A 1 33  ? -13.601 6.018   -52.426 0.02 34.28 ? 26  ARG A HD3  2  
ATOM   9673   H HE   . ARG A 1 33  ? -13.683 3.492   -52.083 0.02 33.58 ? 26  ARG A HE   2  
ATOM   9674   H HH11 . ARG A 1 33  ? -12.942 5.070   -54.913 0.02 35.01 ? 26  ARG A HH11 2  
ATOM   9675   H HH12 . ARG A 1 33  ? -12.047 4.007   -55.438 0.02 35.15 ? 26  ARG A HH12 2  
ATOM   9676   H HH21 . ARG A 1 33  ? -12.189 1.984   -52.816 0.02 33.87 ? 26  ARG A HH21 2  
ATOM   9677   H HH22 . ARG A 1 33  ? -11.587 2.132   -54.170 0.02 34.47 ? 26  ARG A HH22 2  
ATOM   9678   N N    . LEU A 1 34  ? -19.057 2.597   -51.129 0.02 32.02 ? 27  LEU A N    2  
ATOM   9679   C CA   . LEU A 1 34  ? -19.937 1.446   -51.315 0.02 31.72 ? 27  LEU A CA   2  
ATOM   9680   C C    . LEU A 1 34  ? -21.373 1.788   -51.001 0.02 31.50 ? 27  LEU A C    2  
ATOM   9681   O O    . LEU A 1 34  ? -22.218 0.892   -50.896 0.02 31.22 ? 27  LEU A O    2  
ATOM   9682   C CB   . LEU A 1 34  ? -19.490 0.230   -50.506 0.02 31.32 ? 27  LEU A CB   2  
ATOM   9683   C CG   . LEU A 1 34  ? -18.256 0.279   -49.663 0.02 31.22 ? 27  LEU A CG   2  
ATOM   9684   C CD1  . LEU A 1 34  ? -18.759 0.806   -48.301 0.02 30.87 ? 27  LEU A CD1  2  
ATOM   9685   C CD2  . LEU A 1 34  ? -17.551 -1.078  -49.499 0.02 31.03 ? 27  LEU A CD2  2  
ATOM   9686   H H    . LEU A 1 34  ? -18.791 2.742   -50.326 0.02 31.86 ? 27  LEU A H    2  
ATOM   9687   H HA   . LEU A 1 34  ? -19.907 1.172   -52.247 0.02 31.96 ? 27  LEU A HA   2  
ATOM   9688   H HB2  . LEU A 1 34  ? -20.229 -0.012  -49.926 0.02 31.02 ? 27  LEU A HB2  2  
ATOM   9689   H HB3  . LEU A 1 34  ? -19.337 -0.491  -51.128 0.02 31.44 ? 27  LEU A HB3  2  
ATOM   9690   H HG   . LEU A 1 34  ? -17.628 0.909   -50.051 0.02 31.54 ? 27  LEU A HG   2  
ATOM   9691   H HD11 . LEU A 1 34  ? -18.045 0.804   -47.644 0.02 30.83 ? 27  LEU A HD11 2  
ATOM   9692   H HD12 . LEU A 1 34  ? -19.122 1.703   -48.431 0.02 31.03 ? 27  LEU A HD12 2  
ATOM   9693   H HD13 . LEU A 1 34  ? -19.464 0.221   -48.003 0.02 30.58 ? 27  LEU A HD13 2  
ATOM   9694   H HD21 . LEU A 1 34  ? -16.869 -1.015  -48.812 0.02 30.99 ? 27  LEU A HD21 2  
ATOM   9695   H HD22 . LEU A 1 34  ? -18.210 -1.743  -49.244 0.02 30.73 ? 27  LEU A HD22 2  
ATOM   9696   H HD23 . LEU A 1 34  ? -17.147 -1.321  -50.346 0.02 31.27 ? 27  LEU A HD23 2  
ATOM   9697   N N    . THR A 1 35  ? -21.673 3.061   -50.871 0.02 31.68 ? 28  THR A N    2  
ATOM   9698   C CA   . THR A 1 35  ? -23.049 3.475   -50.869 0.02 31.61 ? 28  THR A CA   2  
ATOM   9699   C C    . THR A 1 35  ? -23.519 3.481   -52.314 0.02 32.01 ? 28  THR A C    2  
ATOM   9700   O O    . THR A 1 35  ? -22.743 3.758   -53.226 0.02 32.44 ? 28  THR A O    2  
ATOM   9701   C CB   . THR A 1 35  ? -23.191 4.854   -50.230 0.02 31.70 ? 28  THR A CB   2  
ATOM   9702   O OG1  . THR A 1 35  ? -22.533 4.844   -48.950 0.02 31.44 ? 28  THR A OG1  2  
ATOM   9703   C CG2  . THR A 1 35  ? -24.648 5.213   -50.055 0.02 31.55 ? 28  THR A CG2  2  
ATOM   9704   H H    . THR A 1 35  ? -21.102 3.697   -50.797 0.02 31.87 ? 28  THR A H    2  
ATOM   9705   H HA   . THR A 1 35  ? -23.585 2.848   -50.364 0.02 31.29 ? 28  THR A HA   2  
ATOM   9706   H HB   . THR A 1 35  ? -22.774 5.518   -50.801 0.02 32.07 ? 28  THR A HB   2  
ATOM   9707   H HG1  . THR A 1 35  ? -21.700 4.787   -49.051 0.02 31.58 ? 28  THR A HG1  2  
ATOM   9708   H HG21 . THR A 1 35  ? -24.846 5.324   -49.112 0.02 31.40 ? 28  THR A HG21 2  
ATOM   9709   H HG22 . THR A 1 35  ? -24.849 6.041   -50.518 0.02 31.86 ? 28  THR A HG22 2  
ATOM   9710   H HG23 . THR A 1 35  ? -25.208 4.508   -50.413 0.02 31.33 ? 28  THR A HG23 2  
ATOM   9711   N N    . THR A 1 36  ? -24.768 3.095   -52.512 0.02 31.90 ? 29  THR A N    2  
ATOM   9712   C CA   . THR A 1 36  ? -25.402 3.120   -53.815 0.02 32.28 ? 29  THR A CA   2  
ATOM   9713   C C    . THR A 1 36  ? -26.475 4.202   -53.806 0.02 32.46 ? 29  THR A C    2  
ATOM   9714   O O    . THR A 1 36  ? -26.666 4.911   -52.814 0.02 32.27 ? 29  THR A O    2  
ATOM   9715   C CB   . THR A 1 36  ? -26.010 1.751   -54.170 0.02 32.10 ? 29  THR A CB   2  
ATOM   9716   O OG1  . THR A 1 36  ? -27.245 1.544   -53.482 0.02 31.79 ? 29  THR A OG1  2  
ATOM   9717   C CG2  . THR A 1 36  ? -25.056 0.626   -53.843 0.02 31.85 ? 29  THR A CG2  2  
ATOM   9718   H H    . THR A 1 36  ? -25.283 2.809   -51.886 0.02 31.62 ? 29  THR A H    2  
ATOM   9719   H HA   . THR A 1 36  ? -24.747 3.342   -54.487 0.02 32.59 ? 29  THR A HA   2  
ATOM   9720   H HB   . THR A 1 36  ? -26.176 1.731   -55.126 0.02 32.41 ? 29  THR A HB   2  
ATOM   9721   H HG1  . THR A 1 36  ? -27.280 2.024   -52.798 0.02 31.67 ? 29  THR A HG1  2  
ATOM   9722   H HG21 . THR A 1 36  ? -25.320 -0.182  -54.311 0.02 31.85 ? 29  THR A HG21 2  
ATOM   9723   H HG22 . THR A 1 36  ? -24.159 0.872   -54.120 0.02 32.05 ? 29  THR A HG22 2  
ATOM   9724   H HG23 . THR A 1 36  ? -25.053 0.457   -52.887 0.02 31.51 ? 29  THR A HG23 2  
ATOM   9725   N N    . ASN A 1 37  ? -27.188 4.310   -54.921 0.02 32.86 ? 30  ASN A N    2  
ATOM   9726   C CA   . ASN A 1 37  ? -28.296 5.244   -55.064 0.02 33.09 ? 30  ASN A CA   2  
ATOM   9727   C C    . ASN A 1 37  ? -29.651 4.564   -54.932 0.02 32.86 ? 30  ASN A C    2  
ATOM   9728   O O    . ASN A 1 37  ? -30.685 5.219   -55.107 0.02 33.07 ? 30  ASN A O    2  
ATOM   9729   C CB   . ASN A 1 37  ? -28.194 5.963   -56.423 0.02 33.73 ? 30  ASN A CB   2  
ATOM   9730   C CG   . ASN A 1 37  ? -26.928 6.811   -56.537 0.02 34.08 ? 30  ASN A CG   2  
ATOM   9731   O OD1  . ASN A 1 37  ? -26.661 7.665   -55.684 0.02 33.96 ? 30  ASN A OD1  2  
ATOM   9732   N ND2  . ASN A 1 37  ? -26.136 6.568   -57.574 0.02 34.58 ? 30  ASN A ND2  2  
ATOM   9733   H H    . ASN A 1 37  ? -27.043 3.843   -55.621 0.02 33.04 ? 30  ASN A H    2  
ATOM   9734   H HA   . ASN A 1 37  ? -28.237 5.919   -54.370 0.02 33.03 ? 30  ASN A HA   2  
ATOM   9735   H HB2  . ASN A 1 37  ? -28.167 5.300   -57.131 0.02 33.82 ? 30  ASN A HB2  2  
ATOM   9736   H HB3  . ASN A 1 37  ? -28.966 6.536   -56.547 0.02 33.88 ? 30  ASN A HB3  2  
ATOM   9737   H HD21 . ASN A 1 37  ? -25.565 5.926   -57.541 0.02 34.68 ? 30  ASN A HD21 2  
ATOM   9738   H HD22 . ASN A 1 37  ? -26.192 7.058   -58.278 0.02 34.82 ? 30  ASN A HD22 2  
ATOM   9739   N N    . GLU A 1 38  ? -29.673 3.269   -54.626 0.02 32.49 ? 31  GLU A N    2  
ATOM   9740   C CA   . GLU A 1 38  ? -30.930 2.524   -54.598 0.02 32.36 ? 31  GLU A CA   2  
ATOM   9741   C C    . GLU A 1 38  ? -31.519 2.658   -53.196 0.02 31.96 ? 31  GLU A C    2  
ATOM   9742   O O    . GLU A 1 38  ? -31.514 1.731   -52.387 0.02 31.53 ? 31  GLU A O    2  
ATOM   9743   C CB   . GLU A 1 38  ? -30.724 1.067   -54.996 0.02 32.23 ? 31  GLU A CB   2  
ATOM   9744   C CG   . GLU A 1 38  ? -32.034 0.354   -55.314 0.02 32.31 ? 31  GLU A CG   2  
ATOM   9745   C CD   . GLU A 1 38  ? -31.858 -1.097  -55.778 0.02 32.15 ? 31  GLU A CD   2  
ATOM   9746   O OE1  . GLU A 1 38  ? -32.749 -1.568  -56.525 0.02 31.91 ? 31  GLU A OE1  2  
ATOM   9747   O OE2  . GLU A 1 38  ? -30.850 -1.739  -55.395 0.02 32.30 ? 31  GLU A OE2  2  
ATOM   9748   H H    . GLU A 1 38  ? -28.978 2.803   -54.436 0.02 32.33 ? 31  GLU A H    2  
ATOM   9749   H HA   . GLU A 1 38  ? -31.552 2.919   -55.227 0.02 32.67 ? 31  GLU A HA   2  
ATOM   9750   H HB2  . GLU A 1 38  ? -30.154 1.029   -55.779 0.02 32.47 ? 31  GLU A HB2  2  
ATOM   9751   H HB3  . GLU A 1 38  ? -30.306 0.594   -54.260 0.02 31.89 ? 31  GLU A HB3  2  
ATOM   9752   H HG2  . GLU A 1 38  ? -32.586 0.352   -54.517 0.02 32.13 ? 31  GLU A HG2  2  
ATOM   9753   H HG3  . GLU A 1 38  ? -32.489 0.835   -56.025 0.02 32.67 ? 31  GLU A HG3  2  
ATOM   9754   N N    . THR A 1 39  ? -32.029 3.839   -52.907 0.02 32.13 ? 32  THR A N    2  
ATOM   9755   C CA   . THR A 1 39  ? -32.842 4.016   -51.723 0.02 31.85 ? 32  THR A CA   2  
ATOM   9756   C C    . THR A 1 39  ? -34.142 3.247   -51.907 0.02 31.81 ? 32  THR A C    2  
ATOM   9757   O O    . THR A 1 39  ? -34.578 2.970   -53.033 0.02 32.12 ? 32  THR A O    2  
ATOM   9758   C CB   . THR A 1 39  ? -33.113 5.502   -51.484 0.02 32.12 ? 32  THR A CB   2  
ATOM   9759   O OG1  . THR A 1 39  ? -33.803 6.043   -52.618 0.02 32.63 ? 32  THR A OG1  2  
ATOM   9760   C CG2  . THR A 1 39  ? -31.805 6.261   -51.260 0.02 32.17 ? 32  THR A CG2  2  
ATOM   9761   H H    . THR A 1 39  ? -31.915 4.552   -53.372 0.02 32.44 ? 32  THR A H    2  
ATOM   9762   H HA   . THR A 1 39  ? -32.376 3.651   -50.959 0.02 31.53 ? 32  THR A HA   2  
ATOM   9763   H HB   . THR A 1 39  ? -33.666 5.609   -50.695 0.02 31.96 ? 32  THR A HB   2  
ATOM   9764   H HG1  . THR A 1 39  ? -34.502 5.602   -52.770 0.02 32.63 ? 32  THR A HG1  2  
ATOM   9765   H HG21 . THR A 1 39  ? -31.183 5.701   -50.771 0.02 31.86 ? 32  THR A HG21 2  
ATOM   9766   H HG22 . THR A 1 39  ? -31.406 6.502   -52.110 0.02 32.44 ? 32  THR A HG22 2  
ATOM   9767   H HG23 . THR A 1 39  ? -31.967 7.067   -50.748 0.02 32.26 ? 32  THR A HG23 2  
ATOM   9768   N N    . VAL A 1 40  ? -34.756 2.885   -50.786 0.02 31.47 ? 33  VAL A N    2  
ATOM   9769   C CA   . VAL A 1 40  ? -35.904 1.995   -50.775 0.02 31.42 ? 33  VAL A CA   2  
ATOM   9770   C C    . VAL A 1 40  ? -36.689 2.282   -49.503 0.02 31.30 ? 33  VAL A C    2  
ATOM   9771   O O    . VAL A 1 40  ? -36.121 2.659   -48.483 0.02 31.10 ? 33  VAL A O    2  
ATOM   9772   C CB   . VAL A 1 40  ? -35.437 0.524   -50.831 0.02 31.07 ? 33  VAL A CB   2  
ATOM   9773   C CG1  . VAL A 1 40  ? -34.520 0.279   -52.026 0.02 31.25 ? 33  VAL A CG1  2  
ATOM   9774   C CG2  . VAL A 1 40  ? -34.683 0.189   -49.560 0.02 30.64 ? 33  VAL A CG2  2  
ATOM   9775   H H    . VAL A 1 40  ? -34.520 3.149   -50.006 0.02 31.29 ? 33  VAL A H    2  
ATOM   9776   H HA   . VAL A 1 40  ? -36.473 2.166   -51.539 0.02 31.72 ? 33  VAL A HA   2  
ATOM   9777   H HB   . VAL A 1 40  ? -36.209 -0.060  -50.905 0.02 31.04 ? 33  VAL A HB   2  
ATOM   9778   H HG11 . VAL A 1 40  ? -34.418 -0.676  -52.143 0.02 31.03 ? 33  VAL A HG11 2  
ATOM   9779   H HG12 . VAL A 1 40  ? -34.916 0.666   -52.820 0.02 31.52 ? 33  VAL A HG12 2  
ATOM   9780   H HG13 . VAL A 1 40  ? -33.653 0.679   -51.858 0.02 31.34 ? 33  VAL A HG13 2  
ATOM   9781   H HG21 . VAL A 1 40  ? -34.010 -0.477  -49.758 0.02 30.64 ? 33  VAL A HG21 2  
ATOM   9782   H HG22 . VAL A 1 40  ? -34.257 0.993   -49.223 0.02 30.62 ? 33  VAL A HG22 2  
ATOM   9783   H HG23 . VAL A 1 40  ? -35.310 -0.151  -48.901 0.02 30.42 ? 33  VAL A HG23 2  
ATOM   9784   N N    . VAL A 1 41  ? -38.004 2.101   -49.557 0.02 31.46 ? 34  VAL A N    2  
ATOM   9785   C CA   . VAL A 1 41  ? -38.866 2.419   -48.428 0.02 31.39 ? 34  VAL A CA   2  
ATOM   9786   C C    . VAL A 1 41  ? -39.531 1.152   -47.932 0.02 31.19 ? 34  VAL A C    2  
ATOM   9787   O O    . VAL A 1 41  ? -40.139 0.412   -48.716 0.02 31.38 ? 34  VAL A O    2  
ATOM   9788   C CB   . VAL A 1 41  ? -39.913 3.489   -48.793 0.02 31.87 ? 34  VAL A CB   2  
ATOM   9789   C CG1  . VAL A 1 41  ? -40.841 3.781   -47.589 0.02 31.82 ? 34  VAL A CG1  2  
ATOM   9790   C CG2  . VAL A 1 41  ? -39.213 4.715   -49.185 0.02 32.07 ? 34  VAL A CG2  2  
ATOM   9791   H H    . VAL A 1 41  ? -38.424 1.795   -50.238 0.02 31.64 ? 34  VAL A H    2  
ATOM   9792   H HA   . VAL A 1 41  ? -38.323 2.768   -47.708 0.02 31.19 ? 34  VAL A HA   2  
ATOM   9793   H HB   . VAL A 1 41  ? -40.453 3.190   -49.542 0.02 32.10 ? 34  VAL A HB   2  
ATOM   9794   H HG11 . VAL A 1 41  ? -41.450 4.494   -47.833 0.02 32.15 ? 34  VAL A HG11 2  
ATOM   9795   H HG12 . VAL A 1 41  ? -41.345 2.987   -47.354 0.02 31.73 ? 34  VAL A HG12 2  
ATOM   9796   H HG13 . VAL A 1 41  ? -40.297 4.062   -46.837 0.02 31.60 ? 34  VAL A HG13 2  
ATOM   9797   H HG21 . VAL A 1 41  ? -39.868 5.386   -49.433 0.02 32.41 ? 34  VAL A HG21 2  
ATOM   9798   H HG22 . VAL A 1 41  ? -38.694 5.024   -48.428 0.02 31.87 ? 34  VAL A HG22 2  
ATOM   9799   H HG23 . VAL A 1 41  ? -38.627 4.515   -49.930 0.02 32.09 ? 34  VAL A HG23 2  
ATOM   9800   N N    . ALA A 1 42  ? -39.394 0.903   -46.625 0.02 30.82 ? 35  ALA A N    2  
ATOM   9801   C CA   . ALA A 1 42  ? -40.083 -0.166  -45.938 0.02 30.65 ? 35  ALA A CA   2  
ATOM   9802   C C    . ALA A 1 42  ? -41.048 0.427   -44.921 0.02 30.72 ? 35  ALA A C    2  
ATOM   9803   O O    . ALA A 1 42  ? -40.842 1.526   -44.399 0.02 30.72 ? 35  ALA A O    2  
ATOM   9804   C CB   . ALA A 1 42  ? -39.088 -1.099  -45.225 0.02 30.20 ? 35  ALA A CB   2  
ATOM   9805   H H    . ALA A 1 42  ? -38.886 1.360   -46.107 0.02 30.68 ? 35  ALA A H    2  
ATOM   9806   H HA   . ALA A 1 42  ? -40.593 -0.689  -46.571 0.02 30.83 ? 35  ALA A HA   2  
ATOM   9807   H HB1  . ALA A 1 42  ? -39.566 -1.882  -44.915 0.02 30.13 ? 35  ALA A HB1  2  
ATOM   9808   H HB2  . ALA A 1 42  ? -38.391 -1.356  -45.848 0.02 30.19 ? 35  ALA A HB2  2  
ATOM   9809   H HB3  . ALA A 1 42  ? -38.692 -0.630  -44.474 0.02 30.04 ? 35  ALA A HB3  2  
ATOM   9810   N N    . GLU A 1 43  ? -42.098 -0.315  -44.627 0.02 30.81 ? 36  GLU A N    2  
ATOM   9811   C CA   . GLU A 1 43  ? -43.033 0.149   -43.629 0.02 30.91 ? 36  GLU A CA   2  
ATOM   9812   C C    . GLU A 1 43  ? -42.611 -0.322  -42.239 0.02 30.51 ? 36  GLU A C    2  
ATOM   9813   O O    . GLU A 1 43  ? -41.946 -1.346  -42.087 0.02 30.23 ? 36  GLU A O    2  
ATOM   9814   C CB   . GLU A 1 43  ? -44.451 -0.312  -43.952 0.02 31.30 ? 36  GLU A CB   2  
ATOM   9815   C CG   . GLU A 1 43  ? -45.421 0.249   -42.965 0.02 31.54 ? 36  GLU A CG   2  
ATOM   9816   C CD   . GLU A 1 43  ? -45.385 1.765   -43.024 0.02 31.96 ? 36  GLU A CD   2  
ATOM   9817   O OE1  . GLU A 1 43  ? -45.287 2.416   -41.973 0.02 32.03 ? 36  GLU A OE1  2  
ATOM   9818   O OE2  . GLU A 1 43  ? -45.408 2.289   -44.165 0.02 32.25 ? 36  GLU A OE2  2  
ATOM   9819   H H    . GLU A 1 43  ? -42.290 -1.072  -44.984 0.02 30.85 ? 36  GLU A H    2  
ATOM   9820   H HA   . GLU A 1 43  ? -43.011 1.118   -43.635 0.02 31.03 ? 36  GLU A HA   2  
ATOM   9821   H HB2  . GLU A 1 43  ? -44.690 0.052   -44.821 0.02 31.54 ? 36  GLU A HB2  2  
ATOM   9822   H HB3  . GLU A 1 43  ? -44.545 -1.267  -43.981 0.02 31.19 ? 36  GLU A HB3  2  
ATOM   9823   H HG2  . GLU A 1 43  ? -46.316 -0.049  -43.196 0.02 31.69 ? 36  GLU A HG2  2  
ATOM   9824   H HG3  . GLU A 1 43  ? -45.197 -0.036  -42.068 0.02 31.31 ? 36  GLU A HG3  2  
ATOM   9825   N N    . THR A 1 44  ? -42.940 0.476   -41.229 0.02 30.52 ? 37  THR A N    2  
ATOM   9826   C CA   . THR A 1 44  ? -42.815 0.061   -39.838 0.02 30.26 ? 37  THR A CA   2  
ATOM   9827   C C    . THR A 1 44  ? -43.978 0.628   -39.041 0.02 30.57 ? 37  THR A C    2  
ATOM   9828   O O    . THR A 1 44  ? -44.528 1.680   -39.371 0.02 30.95 ? 37  THR A O    2  
ATOM   9829   C CB   . THR A 1 44  ? -41.537 0.556   -39.155 0.02 29.94 ? 37  THR A CB   2  
ATOM   9830   O OG1  . THR A 1 44  ? -41.775 1.887   -38.684 0.02 30.15 ? 37  THR A OG1  2  
ATOM   9831   C CG2  . THR A 1 44  ? -40.365 0.549   -40.056 0.02 29.76 ? 37  THR A CG2  2  
ATOM   9832   H H    . THR A 1 44  ? -43.236 1.276   -41.328 0.02 30.71 ? 37  THR A H    2  
ATOM   9833   H HA   . THR A 1 44  ? -42.843 -0.904  -39.779 0.02 30.14 ? 37  THR A HA   2  
ATOM   9834   H HB   . THR A 1 44  ? -41.338 -0.018  -38.399 0.02 29.75 ? 37  THR A HB   2  
ATOM   9835   H HG1  . THR A 1 44  ? -41.162 2.128   -38.165 0.02 30.00 ? 37  THR A HG1  2  
ATOM   9836   H HG21 . THR A 1 44  ? -39.562 0.730   -39.543 0.02 29.53 ? 37  THR A HG21 2  
ATOM   9837   H HG22 . THR A 1 44  ? -40.275 -0.318  -40.485 0.02 29.72 ? 37  THR A HG22 2  
ATOM   9838   H HG23 . THR A 1 44  ? -40.465 1.233   -40.736 0.02 29.94 ? 37  THR A HG23 2  
ATOM   9839   N N    . GLU A 1 45  ? -44.301 -0.072  -37.956 0.02 30.43 ? 38  GLU A N    2  
ATOM   9840   C CA   . GLU A 1 45  ? -45.253 0.346   -36.936 0.02 30.72 ? 38  GLU A CA   2  
ATOM   9841   C C    . GLU A 1 45  ? -45.307 1.847   -36.713 0.02 30.90 ? 38  GLU A C    2  
ATOM   9842   O O    . GLU A 1 45  ? -46.404 2.384   -36.534 0.02 31.32 ? 38  GLU A O    2  
ATOM   9843   C CB   . GLU A 1 45  ? -44.889 -0.257  -35.593 0.02 30.49 ? 38  GLU A CB   2  
ATOM   9844   C CG   . GLU A 1 45  ? -45.260 -1.659  -35.400 0.02 30.39 ? 38  GLU A CG   2  
ATOM   9845   C CD   . GLU A 1 45  ? -45.171 -2.038  -33.938 0.02 30.16 ? 38  GLU A CD   2  
ATOM   9846   O OE1  . GLU A 1 45  ? -44.070 -1.929  -33.357 0.02 29.88 ? 38  GLU A OE1  2  
ATOM   9847   O OE2  . GLU A 1 45  ? -46.222 -2.380  -33.361 0.02 30.29 ? 38  GLU A OE2  2  
ATOM   9848   H H    . GLU A 1 45  ? -43.961 -0.844  -37.785 0.02 30.20 ? 38  GLU A H    2  
ATOM   9849   H HA   . GLU A 1 45  ? -46.139 0.037   -37.182 0.02 30.99 ? 38  GLU A HA   2  
ATOM   9850   H HB2  . GLU A 1 45  ? -43.928 -0.190  -35.487 0.02 30.24 ? 38  GLU A HB2  2  
ATOM   9851   H HB3  . GLU A 1 45  ? -45.327 0.251   -34.893 0.02 30.71 ? 38  GLU A HB3  2  
ATOM   9852   H HG2  . GLU A 1 45  ? -46.169 -1.786  -35.707 0.02 30.67 ? 38  GLU A HG2  2  
ATOM   9853   H HG3  . GLU A 1 45  ? -44.654 -2.224  -35.907 0.02 30.22 ? 38  GLU A HG3  2  
ATOM   9854   N N    . TYR A 1 46  ? -44.155 2.501   -36.611 0.02 30.62 ? 39  TYR A N    2  
ATOM   9855   C CA   . TYR A 1 46  ? -44.063 3.911   -36.264 0.02 30.77 ? 39  TYR A CA   2  
ATOM   9856   C C    . TYR A 1 46  ? -43.947 4.808   -37.488 0.02 31.02 ? 39  TYR A C    2  
ATOM   9857   O O    . TYR A 1 46  ? -43.763 6.020   -37.341 0.02 31.16 ? 39  TYR A O    2  
ATOM   9858   C CB   . TYR A 1 46  ? -42.876 4.123   -35.312 0.02 30.41 ? 39  TYR A CB   2  
ATOM   9859   C CG   . TYR A 1 46  ? -42.975 3.302   -34.027 0.02 30.18 ? 39  TYR A CG   2  
ATOM   9860   C CD1  . TYR A 1 46  ? -42.595 1.963   -33.996 0.02 29.91 ? 39  TYR A CD1  2  
ATOM   9861   C CD2  . TYR A 1 46  ? -43.430 3.866   -32.838 0.02 30.28 ? 39  TYR A CD2  2  
ATOM   9862   C CE1  . TYR A 1 46  ? -42.690 1.211   -32.839 0.02 29.75 ? 39  TYR A CE1  2  
ATOM   9863   C CE2  . TYR A 1 46  ? -43.519 3.122   -31.684 0.02 30.12 ? 39  TYR A CE2  2  
ATOM   9864   C CZ   . TYR A 1 46  ? -43.155 1.786   -31.684 0.02 29.85 ? 39  TYR A CZ   2  
ATOM   9865   O OH   . TYR A 1 46  ? -43.236 1.044   -30.508 0.02 29.73 ? 39  TYR A OH   2  
ATOM   9866   H H    . TYR A 1 46  ? -43.388 2.135   -36.734 0.02 30.35 ? 39  TYR A H    2  
ATOM   9867   H HA   . TYR A 1 46  ? -44.871 4.165   -35.795 0.02 31.00 ? 39  TYR A HA   2  
ATOM   9868   H HB2  . TYR A 1 46  ? -42.059 3.871   -35.770 0.02 30.21 ? 39  TYR A HB2  2  
ATOM   9869   H HB3  . TYR A 1 46  ? -42.835 5.058   -35.060 0.02 30.54 ? 39  TYR A HB3  2  
ATOM   9870   H HD1  . TYR A 1 46  ? -42.291 1.563   -34.780 0.02 29.86 ? 39  TYR A HD1  2  
ATOM   9871   H HD2  . TYR A 1 46  ? -43.689 4.760   -32.820 0.02 30.48 ? 39  TYR A HD2  2  
ATOM   9872   H HE1  . TYR A 1 46  ? -42.435 0.317   -32.844 0.02 29.60 ? 39  TYR A HE1  2  
ATOM   9873   H HE2  . TYR A 1 46  ? -43.830 3.522   -30.903 0.02 30.21 ? 39  TYR A HE2  2  
ATOM   9874   H HH   . TYR A 1 46  ? -43.551 1.510   -29.885 0.02 29.88 ? 39  TYR A HH   2  
ATOM   9875   N N    . GLY A 1 47  ? -44.088 4.254   -38.682 0.02 31.14 ? 40  GLY A N    2  
ATOM   9876   C CA   . GLY A 1 47  ? -43.972 5.020   -39.902 0.02 31.40 ? 40  GLY A CA   2  
ATOM   9877   C C    . GLY A 1 47  ? -42.978 4.412   -40.880 0.02 31.13 ? 40  GLY A C    2  
ATOM   9878   O O    . GLY A 1 47  ? -42.248 3.467   -40.582 0.02 30.74 ? 40  GLY A O    2  
ATOM   9879   H H    . GLY A 1 47  ? -44.258 3.423   -38.811 0.02 31.09 ? 40  GLY A H    2  
ATOM   9880   H HA2  . GLY A 1 47  ? -44.837 5.064   -40.338 0.02 31.68 ? 40  GLY A HA2  2  
ATOM   9881   H HA3  . GLY A 1 47  ? -43.685 5.924   -39.699 0.02 31.51 ? 40  GLY A HA3  2  
ATOM   9882   N N    . LYS A 1 48  ? -42.956 5.025   -42.057 0.02 31.39 ? 41  LYS A N    2  
ATOM   9883   C CA   . LYS A 1 48  ? -42.141 4.580   -43.177 0.02 31.30 ? 41  LYS A CA   2  
ATOM   9884   C C    . LYS A 1 48  ? -40.689 4.941   -42.960 0.02 31.00 ? 41  LYS A C    2  
ATOM   9885   O O    . LYS A 1 48  ? -40.378 6.008   -42.454 0.02 31.06 ? 41  LYS A O    2  
ATOM   9886   C CB   . LYS A 1 48  ? -42.644 5.225   -44.457 0.02 31.77 ? 41  LYS A CB   2  
ATOM   9887   C CG   . LYS A 1 48  ? -44.052 4.868   -44.740 0.02 32.13 ? 41  LYS A CG   2  
ATOM   9888   C CD   . LYS A 1 48  ? -44.662 5.845   -45.700 0.02 32.63 ? 41  LYS A CD   2  
ATOM   9889   C CE   . LYS A 1 48  ? -46.159 5.671   -45.744 0.02 33.10 ? 41  LYS A CE   2  
ATOM   9890   N NZ   . LYS A 1 48  ? -46.807 6.107   -44.487 0.02 33.19 ? 41  LYS A NZ   2  
ATOM   9891   H H    . LYS A 1 48  ? -43.423 5.723   -42.229 0.02 31.66 ? 41  LYS A H    2  
ATOM   9892   H HA   . LYS A 1 48  ? -42.214 3.621   -43.280 0.02 31.16 ? 41  LYS A HA   2  
ATOM   9893   H HB2  . LYS A 1 48  ? -42.591 6.189   -44.365 0.02 31.94 ? 41  LYS A HB2  2  
ATOM   9894   H HB3  . LYS A 1 48  ? -42.099 4.936   -45.204 0.02 31.72 ? 41  LYS A HB3  2  
ATOM   9895   H HG2  . LYS A 1 48  ? -44.078 3.986   -45.140 0.02 32.00 ? 41  LYS A HG2  2  
ATOM   9896   H HG3  . LYS A 1 48  ? -44.563 4.875   -43.920 0.02 32.21 ? 41  LYS A HG3  2  
ATOM   9897   H HD2  . LYS A 1 48  ? -44.470 6.751   -45.413 0.02 32.72 ? 41  LYS A HD2  2  
ATOM   9898   H HD3  . LYS A 1 48  ? -44.305 5.686   -46.590 0.02 32.59 ? 41  LYS A HD3  2  
ATOM   9899   H HE2  . LYS A 1 48  ? -46.519 6.208   -46.471 0.02 33.43 ? 41  LYS A HE2  2  
ATOM   9900   H HE3  . LYS A 1 48  ? -46.368 4.732   -45.882 0.02 33.04 ? 41  LYS A HE3  2  
ATOM   9901   H HZ1  . LYS A 1 48  ? -46.428 5.714   -43.788 0.02 33.00 ? 41  LYS A HZ1  2  
ATOM   9902   H HZ2  . LYS A 1 48  ? -46.726 6.990   -44.402 0.02 33.10 ? 41  LYS A HZ2  2  
ATOM   9903   H HZ3  . LYS A 1 48  ? -47.670 5.895   -44.505 0.02 33.55 ? 41  LYS A HZ3  2  
ATOM   9904   N N    . VAL A 1 49  ? -39.790 4.055   -43.360 0.02 30.73 ? 42  VAL A N    2  
ATOM   9905   C CA   . VAL A 1 49  ? -38.369 4.287   -43.183 0.02 30.49 ? 42  VAL A CA   2  
ATOM   9906   C C    . VAL A 1 49  ? -37.677 4.058   -44.507 0.02 30.60 ? 42  VAL A C    2  
ATOM   9907   O O    . VAL A 1 49  ? -38.070 3.183   -45.292 0.02 30.65 ? 42  VAL A O    2  
ATOM   9908   C CB   . VAL A 1 49  ? -37.752 3.381   -42.098 0.02 30.03 ? 42  VAL A CB   2  
ATOM   9909   C CG1  . VAL A 1 49  ? -38.340 3.711   -40.749 0.02 29.96 ? 42  VAL A CG1  2  
ATOM   9910   C CG2  . VAL A 1 49  ? -37.945 1.920   -42.476 0.02 29.89 ? 42  VAL A CG2  2  
ATOM   9911   H H    . VAL A 1 49  ? -39.979 3.314   -43.752 0.02 30.71 ? 42  VAL A H    2  
ATOM   9912   H HA   . VAL A 1 49  ? -38.221 5.210   -42.931 0.02 30.60 ? 42  VAL A HA   2  
ATOM   9913   H HB   . VAL A 1 49  ? -36.799 3.554   -42.055 0.02 29.91 ? 42  VAL A HB   2  
ATOM   9914   H HG11 . VAL A 1 49  ? -37.665 3.554   -40.072 0.02 29.76 ? 42  VAL A HG11 2  
ATOM   9915   H HG12 . VAL A 1 49  ? -38.605 4.643   -40.742 0.02 30.20 ? 42  VAL A HG12 2  
ATOM   9916   H HG13 . VAL A 1 49  ? -39.111 3.145   -40.593 0.02 29.90 ? 42  VAL A HG13 2  
ATOM   9917   H HG21 . VAL A 1 49  ? -37.531 1.360   -41.804 0.02 29.62 ? 42  VAL A HG21 2  
ATOM   9918   H HG22 . VAL A 1 49  ? -38.891 1.720   -42.530 0.02 30.03 ? 42  VAL A HG22 2  
ATOM   9919   H HG23 . VAL A 1 49  ? -37.521 1.759   -43.326 0.02 29.96 ? 42  VAL A HG23 2  
ATOM   9920   N N    . LYS A 1 50  ? -36.641 4.839   -44.740 0.02 30.67 ? 43  LYS A N    2  
ATOM   9921   C CA   . LYS A 1 50  ? -35.937 4.836   -46.015 0.02 30.84 ? 43  LYS A CA   2  
ATOM   9922   C C    . LYS A 1 50  ? -34.523 4.341   -45.779 0.02 30.53 ? 43  LYS A C    2  
ATOM   9923   O O    . LYS A 1 50  ? -33.775 4.934   -44.989 0.02 30.44 ? 43  LYS A O    2  
ATOM   9924   C CB   . LYS A 1 50  ? -35.913 6.223   -46.647 0.02 31.28 ? 43  LYS A CB   2  
ATOM   9925   C CG   . LYS A 1 50  ? -35.642 6.202   -48.154 0.02 31.53 ? 43  LYS A CG   2  
ATOM   9926   C CD   . LYS A 1 50  ? -35.328 7.594   -48.654 0.02 32.01 ? 43  LYS A CD   2  
ATOM   9927   C CE   . LYS A 1 50  ? -33.874 7.940   -48.357 0.02 31.98 ? 43  LYS A CE   2  
ATOM   9928   N NZ   . LYS A 1 50  ? -33.647 9.431   -48.216 0.02 31.87 ? 43  LYS A NZ   2  
ATOM   9929   H H    . LYS A 1 50  ? -36.314 5.384   -44.163 0.02 30.65 ? 43  LYS A H    2  
ATOM   9930   H HA   . LYS A 1 50  ? -36.376 4.227   -46.629 0.02 30.91 ? 43  LYS A HA   2  
ATOM   9931   H HB2  . LYS A 1 50  ? -36.771 6.649   -46.510 0.02 31.49 ? 43  LYS A HB2  2  
ATOM   9932   H HB3  . LYS A 1 50  ? -35.214 6.743   -46.225 0.02 31.23 ? 43  LYS A HB3  2  
ATOM   9933   H HG2  . LYS A 1 50  ? -34.879 5.634   -48.339 0.02 31.34 ? 43  LYS A HG2  2  
ATOM   9934   H HG3  . LYS A 1 50  ? -36.426 5.875   -48.621 0.02 31.61 ? 43  LYS A HG3  2  
ATOM   9935   H HD2  . LYS A 1 50  ? -35.475 7.647   -49.611 0.02 32.25 ? 43  LYS A HD2  2  
ATOM   9936   H HD3  . LYS A 1 50  ? -35.896 8.233   -48.195 0.02 32.14 ? 43  LYS A HD3  2  
ATOM   9937   H HE2  . LYS A 1 50  ? -33.598 7.506   -47.536 0.02 31.74 ? 43  LYS A HE2  2  
ATOM   9938   H HE3  . LYS A 1 50  ? -33.326 7.627   -49.093 0.02 32.31 ? 43  LYS A HE3  2  
ATOM   9939   H HZ1  . LYS A 1 50  ? -34.136 9.754   -47.545 0.02 31.56 ? 43  LYS A HZ1  2  
ATOM   9940   H HZ2  . LYS A 1 50  ? -32.786 9.593   -48.054 0.02 32.01 ? 43  LYS A HZ2  2  
ATOM   9941   H HZ3  . LYS A 1 50  ? -33.885 9.843   -48.970 0.02 32.02 ? 43  LYS A HZ3  2  
ATOM   9942   N N    . GLY A 1 51  ? -34.175 3.239   -46.442 0.02 30.41 ? 44  GLY A N    2  
ATOM   9943   C CA   . GLY A 1 51  ? -32.841 2.699   -46.400 0.02 30.20 ? 44  GLY A CA   2  
ATOM   9944   C C    . GLY A 1 51  ? -32.163 2.787   -47.753 0.02 30.49 ? 44  GLY A C    2  
ATOM   9945   O O    . GLY A 1 51  ? -32.679 3.383   -48.695 0.02 30.88 ? 44  GLY A O    2  
ATOM   9946   H H    . GLY A 1 51  ? -34.718 2.777   -46.917 0.02 30.48 ? 44  GLY A H    2  
ATOM   9947   H HA2  . GLY A 1 51  ? -32.307 3.199   -45.767 0.02 30.09 ? 44  GLY A HA2  2  
ATOM   9948   H HA3  . GLY A 1 51  ? -32.871 1.772   -46.122 0.02 29.99 ? 44  GLY A HA3  2  
ATOM   9949   N N    . VAL A 1 52  ? -30.962 2.207   -47.814 0.02 30.35 ? 45  VAL A N    2  
ATOM   9950   C CA   . VAL A 1 52  ? -30.144 2.296   -49.018 0.02 30.64 ? 45  VAL A CA   2  
ATOM   9951   C C    . VAL A 1 52  ? -29.376 0.996   -49.211 0.02 30.45 ? 45  VAL A C    2  
ATOM   9952   O O    . VAL A 1 52  ? -28.902 0.377   -48.264 0.02 30.08 ? 45  VAL A O    2  
ATOM   9953   C CB   . VAL A 1 52  ? -29.197 3.523   -48.946 0.02 30.84 ? 45  VAL A CB   2  
ATOM   9954   C CG1  . VAL A 1 52  ? -28.194 3.365   -47.857 0.02 30.52 ? 45  VAL A CG1  2  
ATOM   9955   C CG2  . VAL A 1 52  ? -28.485 3.767   -50.289 0.02 31.25 ? 45  VAL A CG2  2  
ATOM   9956   H H    . VAL A 1 52  ? -30.598 1.771   -47.173 0.02 30.10 ? 45  VAL A H    2  
ATOM   9957   H HA   . VAL A 1 52  ? -30.726 2.410   -49.783 0.02 30.89 ? 45  VAL A HA   2  
ATOM   9958   H HB   . VAL A 1 52  ? -29.728 4.311   -48.749 0.02 30.96 ? 45  VAL A HB   2  
ATOM   9959   H HG11 . VAL A 1 52  ? -27.622 4.146   -47.843 0.02 30.69 ? 45  VAL A HG11 2  
ATOM   9960   H HG12 . VAL A 1 52  ? -28.665 3.283   -47.015 0.02 30.32 ? 45  VAL A HG12 2  
ATOM   9961   H HG13 . VAL A 1 52  ? -27.658 2.575   -48.016 0.02 30.39 ? 45  VAL A HG13 2  
ATOM   9962   H HG21 . VAL A 1 52  ? -28.162 4.679   -50.304 0.02 31.45 ? 45  VAL A HG21 2  
ATOM   9963   H HG22 . VAL A 1 52  ? -27.739 3.155   -50.370 0.02 31.15 ? 45  VAL A HG22 2  
ATOM   9964   H HG23 . VAL A 1 52  ? -29.116 3.631   -51.011 0.02 31.43 ? 45  VAL A HG23 2  
ATOM   9965   N N    . LYS A 1 53  ? -29.254 0.569   -50.455 0.02 30.73 ? 46  LYS A N    2  
ATOM   9966   C CA   . LYS A 1 53  ? -28.414 -0.581  -50.719 0.02 30.62 ? 46  LYS A CA   2  
ATOM   9967   C C    . LYS A 1 53  ? -26.958 -0.166  -50.609 0.02 30.67 ? 46  LYS A C    2  
ATOM   9968   O O    . LYS A 1 53  ? -26.564 0.912   -51.073 0.02 30.99 ? 46  LYS A O    2  
ATOM   9969   C CB   . LYS A 1 53  ? -28.710 -1.175  -52.096 0.02 30.93 ? 46  LYS A CB   2  
ATOM   9970   C CG   . LYS A 1 53  ? -27.844 -2.410  -52.400 0.02 30.85 ? 46  LYS A CG   2  
ATOM   9971   C CD   . LYS A 1 53  ? -28.294 -3.129  -53.665 0.02 31.16 ? 46  LYS A CD   2  
ATOM   9972   C CE   . LYS A 1 53  ? -29.528 -3.955  -53.379 0.02 31.01 ? 46  LYS A CE   2  
ATOM   9973   N NZ   . LYS A 1 53  ? -30.086 -4.572  -54.619 0.02 31.34 ? 46  LYS A NZ   2  
ATOM   9974   H H    . LYS A 1 53  ? -29.632 0.918   -51.140 0.02 31.01 ? 46  LYS A H    2  
ATOM   9975   H HA   . LYS A 1 53  ? -28.584 -1.269  -50.063 0.02 30.33 ? 46  LYS A HA   2  
ATOM   9976   H HB2  . LYS A 1 53  ? -29.642 -1.440  -52.121 0.02 30.91 ? 46  LYS A HB2  2  
ATOM   9977   H HB3  . LYS A 1 53  ? -28.530 -0.507  -52.773 0.02 31.23 ? 46  LYS A HB3  2  
ATOM   9978   H HG2  . LYS A 1 53  ? -26.921 -2.137  -52.512 0.02 30.92 ? 46  LYS A HG2  2  
ATOM   9979   H HG3  . LYS A 1 53  ? -27.918 -3.037  -51.665 0.02 30.55 ? 46  LYS A HG3  2  
ATOM   9980   H HD2  . LYS A 1 53  ? -28.522 -2.472  -54.338 0.02 31.46 ? 46  LYS A HD2  2  
ATOM   9981   H HD3  . LYS A 1 53  ? -27.587 -3.711  -53.983 0.02 31.20 ? 46  LYS A HD3  2  
ATOM   9982   H HE2  . LYS A 1 53  ? -29.300 -4.665  -52.759 0.02 30.72 ? 46  LYS A HE2  2  
ATOM   9983   H HE3  . LYS A 1 53  ? -30.213 -3.386  -52.994 0.02 31.02 ? 46  LYS A HE3  2  
ATOM   9984   H HZ1  . LYS A 1 53  ? -29.865 -4.082  -55.330 0.02 31.62 ? 46  LYS A HZ1  2  
ATOM   9985   H HZ2  . LYS A 1 53  ? -29.761 -5.397  -54.719 0.02 31.35 ? 46  LYS A HZ2  2  
ATOM   9986   H HZ3  . LYS A 1 53  ? -30.973 -4.618  -54.562 0.02 31.28 ? 46  LYS A HZ3  2  
ATOM   9987   N N    . ARG A 1 54  ? -26.169 -1.027  -49.970 0.02 30.38 ? 47  ARG A N    2  
ATOM   9988   C CA   . ARG A 1 54  ? -24.730 -0.890  -49.841 0.02 30.43 ? 47  ARG A CA   2  
ATOM   9989   C C    . ARG A 1 54  ? -24.055 -2.115  -50.445 0.02 30.47 ? 47  ARG A C    2  
ATOM   9990   O O    . ARG A 1 54  ? -24.678 -3.152  -50.655 0.02 30.36 ? 47  ARG A O    2  
ATOM   9991   C CB   . ARG A 1 54  ? -24.298 -0.739  -48.364 0.02 30.09 ? 47  ARG A CB   2  
ATOM   9992   C CG   . ARG A 1 54  ? -24.980 0.418   -47.660 0.02 30.04 ? 47  ARG A CG   2  
ATOM   9993   C CD   . ARG A 1 54  ? -24.536 0.570   -46.203 0.02 29.75 ? 47  ARG A CD   2  
ATOM   9994   N NE   . ARG A 1 54  ? -25.309 1.645   -45.594 0.02 29.79 ? 47  ARG A NE   2  
ATOM   9995   C CZ   . ARG A 1 54  ? -25.060 2.929   -45.822 0.02 30.09 ? 47  ARG A CZ   2  
ATOM   9996   N NH1  . ARG A 1 54  ? -24.064 3.275   -46.625 0.02 30.36 ? 47  ARG A NH1  2  
ATOM   9997   N NH2  . ARG A 1 54  ? -25.816 3.873   -45.258 0.02 30.15 ? 47  ARG A NH2  2  
ATOM   9998   H H    . ARG A 1 54  ? -26.468 -1.729  -49.580 0.02 30.17 ? 47  ARG A H    2  
ATOM   9999   H HA   . ARG A 1 54  ? -24.432 -0.109  -50.327 0.02 30.71 ? 47  ARG A HA   2  
ATOM   10000  H HB2  . ARG A 1 54  ? -24.526 -1.553  -47.891 0.02 29.84 ? 47  ARG A HB2  2  
ATOM   10001  H HB3  . ARG A 1 54  ? -23.342 -0.592  -48.324 0.02 30.18 ? 47  ARG A HB3  2  
ATOM   10002  H HG2  . ARG A 1 54  ? -24.768 1.242   -48.127 0.02 30.31 ? 47  ARG A HG2  2  
ATOM   10003  H HG3  . ARG A 1 54  ? -25.939 0.274   -47.669 0.02 29.96 ? 47  ARG A HG3  2  
ATOM   10004  H HD2  . ARG A 1 54  ? -24.711 -0.254  -45.722 0.02 29.49 ? 47  ARG A HD2  2  
ATOM   10005  H HD3  . ARG A 1 54  ? -23.593 0.793   -46.165 0.02 29.83 ? 47  ARG A HD3  2  
ATOM   10006  H HE   . ARG A 1 54  ? -26.101 1.449   -45.329 0.02 29.70 ? 47  ARG A HE   2  
ATOM   10007  H HH11 . ARG A 1 54  ? -23.576 2.677   -46.998 0.02 30.35 ? 47  ARG A HH11 2  
ATOM   10008  H HH12 . ARG A 1 54  ? -23.904 4.106   -46.769 0.02 30.58 ? 47  ARG A HH12 2  
ATOM   10009  H HH21 . ARG A 1 54  ? -26.461 3.653   -44.735 0.02 30.00 ? 47  ARG A HH21 2  
ATOM   10010  H HH22 . ARG A 1 54  ? -25.645 4.702   -45.403 0.02 30.36 ? 47  ARG A HH22 2  
ATOM   10011  N N    . LEU A 1 55  ? -22.762 -1.978  -50.669 0.02 30.67 ? 48  LEU A N    2  
ATOM   10012  C CA   . LEU A 1 55  ? -21.913 -2.987  -51.281 0.02 30.79 ? 48  LEU A CA   2  
ATOM   10013  C C    . LEU A 1 55  ? -20.918 -3.527  -50.264 0.02 30.54 ? 48  LEU A C    2  
ATOM   10014  O O    . LEU A 1 55  ? -20.691 -2.916  -49.226 0.02 30.35 ? 48  LEU A O    2  
ATOM   10015  C CB   . LEU A 1 55  ? -21.128 -2.392  -52.447 0.02 31.31 ? 48  LEU A CB   2  
ATOM   10016  C CG   . LEU A 1 55  ? -21.928 -1.664  -53.520 0.02 31.66 ? 48  LEU A CG   2  
ATOM   10017  C CD1  . LEU A 1 55  ? -20.952 -0.965  -54.447 0.02 32.19 ? 48  LEU A CD1  2  
ATOM   10018  C CD2  . LEU A 1 55  ? -22.827 -2.658  -54.256 0.02 31.68 ? 48  LEU A CD2  2  
ATOM   10019  H H    . LEU A 1 55  ? -22.330 -1.268  -50.464 0.02 30.76 ? 48  LEU A H    2  
ATOM   10020  H HA   . LEU A 1 55  ? -22.461 -3.715  -51.611 0.02 30.75 ? 48  LEU A HA   2  
ATOM   10021  H HB2  . LEU A 1 55  ? -20.500 -1.759  -52.089 0.02 31.37 ? 48  LEU A HB2  2  
ATOM   10022  H HB3  . LEU A 1 55  ? -20.641 -3.108  -52.882 0.02 31.42 ? 48  LEU A HB3  2  
ATOM   10023  H HG   . LEU A 1 55  ? -22.488 -0.990  -53.100 0.02 31.56 ? 48  LEU A HG   2  
ATOM   10024  H HD11 . LEU A 1 55  ? -21.350 -0.897  -55.329 0.02 32.45 ? 48  LEU A HD11 2  
ATOM   10025  H HD12 . LEU A 1 55  ? -20.762 -0.081  -54.100 0.02 32.22 ? 48  LEU A HD12 2  
ATOM   10026  H HD13 . LEU A 1 55  ? -20.133 -1.484  -54.494 0.02 32.25 ? 48  LEU A HD13 2  
ATOM   10027  H HD21 . LEU A 1 55  ? -23.201 -2.231  -55.039 0.02 31.94 ? 48  LEU A HD21 2  
ATOM   10028  H HD22 . LEU A 1 55  ? -22.296 -3.426  -54.514 0.02 31.76 ? 48  LEU A HD22 2  
ATOM   10029  H HD23 . LEU A 1 55  ? -23.539 -2.937  -53.661 0.02 31.37 ? 48  LEU A HD23 2  
ATOM   10030  N N    . THR A 1 56  ? -20.315 -4.677  -50.571 0.02 30.56 ? 49  THR A N    2  
ATOM   10031  C CA   . THR A 1 56  ? -19.247 -5.247  -49.751 0.02 30.43 ? 49  THR A CA   2  
ATOM   10032  C C    . THR A 1 56  ? -17.979 -5.431  -50.574 0.02 30.85 ? 49  THR A C    2  
ATOM   10033  O O    . THR A 1 56  ? -18.004 -5.446  -51.813 0.02 31.21 ? 49  THR A O    2  
ATOM   10034  C CB   . THR A 1 56  ? -19.651 -6.595  -49.144 0.02 30.10 ? 49  THR A CB   2  
ATOM   10035  O OG1  . THR A 1 56  ? -19.509 -7.627  -50.129 0.02 30.33 ? 49  THR A OG1  2  
ATOM   10036  C CG2  . THR A 1 56  ? -21.069 -6.562  -48.649 0.02 29.79 ? 49  THR A CG2  2  
ATOM   10037  H H    . THR A 1 56  ? -20.518 -5.155  -51.253 0.02 30.68 ? 49  THR A H    2  
ATOM   10038  H HA   . THR A 1 56  ? -19.040 -4.646  -49.020 0.02 30.32 ? 49  THR A HA   2  
ATOM   10039  H HB   . THR A 1 56  ? -19.073 -6.792  -48.391 0.02 29.97 ? 49  THR A HB   2  
ATOM   10040  H HG1  . THR A 1 56  ? -19.938 -8.310  -49.903 0.02 30.19 ? 49  THR A HG1  2  
ATOM   10041  H HG21 . THR A 1 56  ? -21.227 -7.322  -48.071 0.02 29.57 ? 49  THR A HG21 2  
ATOM   10042  H HG22 . THR A 1 56  ? -21.231 -5.744  -48.156 0.02 29.71 ? 49  THR A HG22 2  
ATOM   10043  H HG23 . THR A 1 56  ? -21.682 -6.607  -49.396 0.02 29.91 ? 49  THR A HG23 2  
ATOM   10044  N N    . VAL A 1 57  ? -16.853 -5.598  -49.877 0.02 30.85 ? 50  VAL A N    2  
ATOM   10045  C CA   . VAL A 1 57  ? -15.592 -5.809  -50.579 0.02 31.29 ? 50  VAL A CA   2  
ATOM   10046  C C    . VAL A 1 57  ? -15.534 -7.150  -51.293 0.02 31.39 ? 50  VAL A C    2  
ATOM   10047  O O    . VAL A 1 57  ? -14.617 -7.359  -52.100 0.02 31.81 ? 50  VAL A O    2  
ATOM   10048  C CB   . VAL A 1 57  ? -14.369 -5.711  -49.646 0.02 31.34 ? 50  VAL A CB   2  
ATOM   10049  C CG1  . VAL A 1 57  ? -14.362 -4.377  -48.897 0.02 31.29 ? 50  VAL A CG1  2  
ATOM   10050  C CG2  . VAL A 1 57  ? -14.342 -6.901  -48.686 0.02 30.97 ? 50  VAL A CG2  2  
ATOM   10051  H H    . VAL A 1 57  ? -16.795 -5.597  -49.024 0.02 30.63 ? 50  VAL A H    2  
ATOM   10052  H HA   . VAL A 1 57  ? -15.498 -5.119  -51.254 0.02 31.58 ? 50  VAL A HA   2  
ATOM   10053  H HB   . VAL A 1 57  ? -13.564 -5.742  -50.187 0.02 31.68 ? 50  VAL A HB   2  
ATOM   10054  H HG11 . VAL A 1 57  ? -13.662 -4.398  -48.228 0.02 31.30 ? 50  VAL A HG11 2  
ATOM   10055  H HG12 . VAL A 1 57  ? -14.194 -3.664  -49.533 0.02 31.59 ? 50  VAL A HG12 2  
ATOM   10056  H HG13 . VAL A 1 57  ? -15.220 -4.240  -48.468 0.02 30.99 ? 50  VAL A HG13 2  
ATOM   10057  H HG21 . VAL A 1 57  ? -13.759 -6.694  -47.938 0.02 30.96 ? 50  VAL A HG21 2  
ATOM   10058  H HG22 . VAL A 1 57  ? -15.241 -7.064  -48.363 0.02 30.66 ? 50  VAL A HG22 2  
ATOM   10059  H HG23 . VAL A 1 57  ? -14.010 -7.682  -49.154 0.02 31.08 ? 50  VAL A HG23 2  
ATOM   10060  N N    . TYR A 1 58  ? -16.476 -8.061  -51.020 0.02 31.06 ? 51  TYR A N    2  
ATOM   10061  C CA   . TYR A 1 58  ? -16.578 -9.321  -51.740 0.02 31.18 ? 51  TYR A CA   2  
ATOM   10062  C C    . TYR A 1 58  ? -17.529 -9.219  -52.940 0.02 31.39 ? 51  TYR A C    2  
ATOM   10063  O O    . TYR A 1 58  ? -17.907 -10.244 -53.512 0.02 31.49 ? 51  TYR A O    2  
ATOM   10064  C CB   . TYR A 1 58  ? -17.013 -10.447 -50.777 0.02 30.77 ? 51  TYR A CB   2  
ATOM   10065  C CG   . TYR A 1 58  ? -15.920 -10.816 -49.795 0.02 30.68 ? 51  TYR A CG   2  
ATOM   10066  C CD1  . TYR A 1 58  ? -14.902 -11.672 -50.161 0.02 31.00 ? 51  TYR A CD1  2  
ATOM   10067  C CD2  . TYR A 1 58  ? -15.911 -10.322 -48.499 0.02 30.31 ? 51  TYR A CD2  2  
ATOM   10068  C CE1  . TYR A 1 58  ? -13.893 -12.008 -49.298 0.02 30.97 ? 51  TYR A CE1  2  
ATOM   10069  C CE2  . TYR A 1 58  ? -14.890 -10.671 -47.606 0.02 30.27 ? 51  TYR A CE2  2  
ATOM   10070  C CZ   . TYR A 1 58  ? -13.892 -11.524 -48.014 0.02 30.60 ? 51  TYR A CZ   2  
ATOM   10071  O OH   . TYR A 1 58  ? -12.871 -11.873 -47.160 0.02 30.61 ? 51  TYR A OH   2  
ATOM   10072  H H    . TYR A 1 58  ? -17.082 -7.964  -50.422 0.02 30.78 ? 51  TYR A H    2  
ATOM   10073  H HA   . TYR A 1 58  ? -15.698 -9.550  -52.078 0.02 31.45 ? 51  TYR A HA   2  
ATOM   10074  H HB2  . TYR A 1 58  ? -17.786 -10.155 -50.271 0.02 30.51 ? 51  TYR A HB2  2  
ATOM   10075  H HB3  . TYR A 1 58  ? -17.238 -11.239 -51.290 0.02 30.87 ? 51  TYR A HB3  2  
ATOM   10076  H HD1  . TYR A 1 58  ? -14.887 -12.011 -51.025 0.02 31.27 ? 51  TYR A HD1  2  
ATOM   10077  H HD2  . TYR A 1 58  ? -16.586 -9.746  -48.228 0.02 30.12 ? 51  TYR A HD2  2  
ATOM   10078  H HE1  . TYR A 1 58  ? -13.222 -12.585 -49.579 0.02 31.22 ? 51  TYR A HE1  2  
ATOM   10079  H HE2  . TYR A 1 58  ? -14.886 -10.333 -46.742 0.02 30.05 ? 51  TYR A HE2  2  
ATOM   10080  H HH   . TYR A 1 58  ? -12.723 -11.250 -46.620 0.02 30.47 ? 51  TYR A HH   2  
ATOM   10081  N N    . ASP A 1 59  ? -17.927 -7.996  -53.313 0.02 31.50 ? 52  ASP A N    2  
ATOM   10082  C CA   . ASP A 1 59  ? -18.790 -7.748  -54.462 0.02 31.75 ? 52  ASP A CA   2  
ATOM   10083  C C    . ASP A 1 59  ? -20.202 -8.301  -54.256 0.02 31.45 ? 52  ASP A C    2  
ATOM   10084  O O    . ASP A 1 59  ? -20.906 -8.638  -55.213 0.02 31.66 ? 52  ASP A O    2  
ATOM   10085  C CB   . ASP A 1 59  ? -18.147 -8.298  -55.734 0.02 32.27 ? 52  ASP A CB   2  
ATOM   10086  C CG   . ASP A 1 59  ? -16.814 -7.649  -56.021 0.02 32.65 ? 52  ASP A CG   2  
ATOM   10087  O OD1  . ASP A 1 59  ? -16.745 -6.404  -55.996 0.02 32.71 ? 52  ASP A OD1  2  
ATOM   10088  O OD2  . ASP A 1 59  ? -15.827 -8.377  -56.242 0.02 32.90 ? 52  ASP A OD2  2  
ATOM   10089  H H    . ASP A 1 59  ? -17.697 -7.273  -52.913 0.02 31.46 ? 52  ASP A H    2  
ATOM   10090  H HA   . ASP A 1 59  ? -18.870 -6.786  -54.565 0.02 31.82 ? 52  ASP A HA   2  
ATOM   10091  H HB2  . ASP A 1 59  ? -18.002 -9.251  -55.644 0.02 32.23 ? 52  ASP A HB2  2  
ATOM   10092  H HB3  . ASP A 1 59  ? -18.734 -8.126  -56.486 0.02 32.45 ? 52  ASP A HB3  2  
ATOM   10093  N N    . ASP A 1 60  ? -20.637 -8.356  -52.995 0.02 30.99 ? 53  ASP A N    2  
ATOM   10094  C CA   . ASP A 1 60  ? -22.027 -8.603  -52.645 0.02 30.73 ? 53  ASP A CA   2  
ATOM   10095  C C    . ASP A 1 60  ? -22.710 -7.263  -52.366 0.02 30.64 ? 53  ASP A C    2  
ATOM   10096  O O    . ASP A 1 60  ? -22.081 -6.208  -52.341 0.02 30.77 ? 53  ASP A O    2  
ATOM   10097  C CB   . ASP A 1 60  ? -22.127 -9.533  -51.434 0.02 30.32 ? 53  ASP A CB   2  
ATOM   10098  C CG   . ASP A 1 60  ? -21.539 -10.903 -51.703 0.02 30.45 ? 53  ASP A CG   2  
ATOM   10099  O OD1  . ASP A 1 60  ? -21.803 -11.446 -52.811 0.02 30.78 ? 53  ASP A OD1  2  
ATOM   10100  O OD2  . ASP A 1 60  ? -20.798 -11.395 -50.829 0.02 30.27 ? 53  ASP A OD2  2  
ATOM   10101  H H    . ASP A 1 60  ? -20.127 -8.250  -52.317 0.02 30.84 ? 53  ASP A H    2  
ATOM   10102  H HA   . ASP A 1 60  ? -22.481 -9.032  -53.384 0.02 30.91 ? 53  ASP A HA   2  
ATOM   10103  H HB2  . ASP A 1 60  ? -21.643 -9.135  -50.693 0.02 30.15 ? 53  ASP A HB2  2  
ATOM   10104  H HB3  . ASP A 1 60  ? -23.054 -9.655  -51.189 0.02 30.19 ? 53  ASP A HB3  2  
ATOM   10105  N N    . SER A 1 61  ? -24.010 -7.309  -52.141 0.02 30.47 ? 54  SER A N    2  
ATOM   10106  C CA   . SER A 1 61  ? -24.735 -6.104  -51.780 0.02 30.40 ? 54  SER A CA   2  
ATOM   10107  C C    . SER A 1 61  ? -25.864 -6.437  -50.820 0.02 30.06 ? 54  SER A C    2  
ATOM   10108  O O    . SER A 1 61  ? -26.350 -7.575  -50.762 0.02 29.96 ? 54  SER A O    2  
ATOM   10109  C CB   . SER A 1 61  ? -25.292 -5.394  -53.010 0.02 30.82 ? 54  SER A CB   2  
ATOM   10110  O OG   . SER A 1 61  ? -25.981 -6.298  -53.877 0.02 31.00 ? 54  SER A OG   2  
ATOM   10111  H H    . SER A 1 61  ? -24.494 -8.014  -52.196 0.02 30.42 ? 54  SER A H    2  
ATOM   10112  H HA   . SER A 1 61  ? -24.130 -5.494  -51.332 0.02 30.35 ? 54  SER A HA   2  
ATOM   10113  H HB2  . SER A 1 61  ? -25.903 -4.698  -52.723 0.02 30.77 ? 54  SER A HB2  2  
ATOM   10114  H HB3  . SER A 1 61  ? -24.549 -5.000  -53.488 0.02 31.04 ? 54  SER A HB3  2  
ATOM   10115  H HG   . SER A 1 61  ? -26.599 -6.681  -53.458 0.02 30.85 ? 54  SER A HG   2  
ATOM   10116  N N    . TYR A 1 62  ? -26.283 -5.414  -50.067 0.02 29.91 ? 55  TYR A N    2  
ATOM   10117  C CA   . TYR A 1 62  ? -27.408 -5.568  -49.169 0.02 29.64 ? 55  TYR A CA   2  
ATOM   10118  C C    . TYR A 1 62  ? -28.147 -4.251  -48.955 0.02 29.69 ? 55  TYR A C    2  
ATOM   10119  O O    . TYR A 1 62  ? -27.568 -3.173  -49.070 0.02 29.83 ? 55  TYR A O    2  
ATOM   10120  C CB   . TYR A 1 62  ? -26.908 -6.105  -47.818 0.02 29.26 ? 55  TYR A CB   2  
ATOM   10121  C CG   . TYR A 1 62  ? -25.919 -5.165  -47.146 0.02 29.18 ? 55  TYR A CG   2  
ATOM   10122  C CD1  . TYR A 1 62  ? -24.598 -5.100  -47.547 0.02 29.34 ? 55  TYR A CD1  2  
ATOM   10123  C CD2  . TYR A 1 62  ? -26.319 -4.345  -46.105 0.02 29.00 ? 55  TYR A CD2  2  
ATOM   10124  C CE1  . TYR A 1 62  ? -23.704 -4.242  -46.928 0.02 29.32 ? 55  TYR A CE1  2  
ATOM   10125  C CE2  . TYR A 1 62  ? -25.447 -3.503  -45.491 0.02 28.97 ? 55  TYR A CE2  2  
ATOM   10126  C CZ   . TYR A 1 62  ? -24.148 -3.443  -45.888 0.02 29.13 ? 55  TYR A CZ   2  
ATOM   10127  O OH   . TYR A 1 62  ? -23.258 -2.595  -45.278 0.02 29.16 ? 55  TYR A OH   2  
ATOM   10128  H H    . TYR A 1 62  ? -25.921 -4.640  -50.053 0.02 29.98 ? 55  TYR A H    2  
ATOM   10129  H HA   . TYR A 1 62  ? -28.036 -6.197  -49.551 0.02 29.70 ? 55  TYR A HA   2  
ATOM   10130  H HB2  . TYR A 1 62  ? -27.668 -6.218  -47.231 0.02 29.10 ? 55  TYR A HB2  2  
ATOM   10131  H HB3  . TYR A 1 62  ? -26.463 -6.953  -47.959 0.02 29.25 ? 55  TYR A HB3  2  
ATOM   10132  H HD1  . TYR A 1 62  ? -24.301 -5.637  -48.238 0.02 29.48 ? 55  TYR A HD1  2  
ATOM   10133  H HD2  . TYR A 1 62  ? -27.201 -4.374  -45.819 0.02 28.92 ? 55  TYR A HD2  2  
ATOM   10134  H HE1  . TYR A 1 62  ? -22.817 -4.202  -47.199 0.02 29.45 ? 55  TYR A HE1  2  
ATOM   10135  H HE2  . TYR A 1 62  ? -25.740 -2.967  -44.797 0.02 28.87 ? 55  TYR A HE2  2  
ATOM   10136  H HH   . TYR A 1 62  ? -22.493 -2.935  -45.259 0.02 29.21 ? 55  TYR A HH   2  
ATOM   10137  N N    . TYR A 1 63  ? -29.416 -4.372  -48.566 0.02 29.60 ? 56  TYR A N    2  
ATOM   10138  C CA   . TYR A 1 63  ? -30.208 -3.244  -48.108 0.02 29.63 ? 56  TYR A CA   2  
ATOM   10139  C C    . TYR A 1 63  ? -29.890 -2.956  -46.648 0.02 29.29 ? 56  TYR A C    2  
ATOM   10140  O O    . TYR A 1 63  ? -29.801 -3.874  -45.831 0.02 29.02 ? 56  TYR A O    2  
ATOM   10141  C CB   . TYR A 1 63  ? -31.693 -3.522  -48.263 0.02 29.73 ? 56  TYR A CB   2  
ATOM   10142  C CG   . TYR A 1 63  ? -32.101 -3.747  -49.708 0.02 30.12 ? 56  TYR A CG   2  
ATOM   10143  C CD1  . TYR A 1 63  ? -32.463 -2.695  -50.508 0.02 30.47 ? 56  TYR A CD1  2  
ATOM   10144  C CD2  . TYR A 1 63  ? -32.103 -5.018  -50.253 0.02 30.16 ? 56  TYR A CD2  2  
ATOM   10145  C CE1  . TYR A 1 63  ? -32.820 -2.897  -51.844 0.02 30.86 ? 56  TYR A CE1  2  
ATOM   10146  C CE2  . TYR A 1 63  ? -32.464 -5.235  -51.577 0.02 30.56 ? 56  TYR A CE2  2  
ATOM   10147  C CZ   . TYR A 1 63  ? -32.817 -4.169  -52.364 0.02 30.90 ? 56  TYR A CZ   2  
ATOM   10148  O OH   . TYR A 1 63  ? -33.171 -4.375  -53.690 0.02 31.33 ? 56  TYR A OH   2  
ATOM   10149  H H    . TYR A 1 63  ? -29.843 -5.114  -48.554 0.02 29.55 ? 56  TYR A H    2  
ATOM   10150  H HA   . TYR A 1 63  ? -29.984 -2.458  -48.628 0.02 29.83 ? 56  TYR A HA   2  
ATOM   10151  H HB2  . TYR A 1 63  ? -31.920 -4.320  -47.767 0.02 29.56 ? 56  TYR A HB2  2  
ATOM   10152  H HB3  . TYR A 1 63  ? -32.195 -2.768  -47.923 0.02 29.76 ? 56  TYR A HB3  2  
ATOM   10153  H HD1  . TYR A 1 63  ? -32.456 -1.837  -50.153 0.02 30.47 ? 56  TYR A HD1  2  
ATOM   10154  H HD2  . TYR A 1 63  ? -31.859 -5.740  -49.722 0.02 29.95 ? 56  TYR A HD2  2  
ATOM   10155  H HE1  . TYR A 1 63  ? -33.063 -2.181  -52.377 0.02 31.12 ? 56  TYR A HE1  2  
ATOM   10156  H HE2  . TYR A 1 63  ? -32.457 -6.094  -51.931 0.02 30.61 ? 56  TYR A HE2  2  
ATOM   10157  H HH   . TYR A 1 63  ? -33.265 -3.638  -54.081 0.02 31.52 ? 56  TYR A HH   2  
ATOM   10158  N N    . SER A 1 64  ? -29.752 -1.670  -46.336 0.02 29.36 ? 57  SER A N    2  
ATOM   10159  C CA   . SER A 1 64  ? -29.279 -1.190  -45.045 0.02 29.12 ? 57  SER A CA   2  
ATOM   10160  C C    . SER A 1 64  ? -30.244 -0.131  -44.543 0.02 29.19 ? 57  SER A C    2  
ATOM   10161  O O    . SER A 1 64  ? -30.461 0.889   -45.216 0.02 29.50 ? 57  SER A O    2  
ATOM   10162  C CB   . SER A 1 64  ? -27.872 -0.609  -45.177 0.02 29.20 ? 57  SER A CB   2  
ATOM   10163  O OG   . SER A 1 64  ? -27.391 -0.106  -43.971 0.02 29.04 ? 57  SER A OG   2  
ATOM   10164  H H    . SER A 1 64  ? -29.937 -1.038  -46.880 0.02 29.57 ? 57  SER A H    2  
ATOM   10165  H HA   . SER A 1 64  ? -29.256 -1.917  -44.406 0.02 28.90 ? 57  SER A HA   2  
ATOM   10166  H HB2  . SER A 1 64  ? -27.273 -1.310  -45.476 0.02 29.16 ? 57  SER A HB2  2  
ATOM   10167  H HB3  . SER A 1 64  ? -27.887 0.113   -45.823 0.02 29.46 ? 57  SER A HB3  2  
ATOM   10168  H HG   . SER A 1 64  ? -26.551 -0.102  -43.978 0.02 29.07 ? 57  SER A HG   2  
ATOM   10169  N N    . PHE A 1 65  ? -30.830 -0.380  -43.371 0.02 28.95 ? 58  PHE A N    2  
ATOM   10170  C CA   . PHE A 1 65  ? -31.656 0.586   -42.665 0.02 29.01 ? 58  PHE A CA   2  
ATOM   10171  C C    . PHE A 1 65  ? -31.000 0.776   -41.299 0.02 28.76 ? 58  PHE A C    2  
ATOM   10172  O O    . PHE A 1 65  ? -30.906 -0.182  -40.534 0.02 28.50 ? 58  PHE A O    2  
ATOM   10173  C CB   . PHE A 1 65  ? -33.089 0.095   -42.474 0.02 29.01 ? 58  PHE A CB   2  
ATOM   10174  C CG   . PHE A 1 65  ? -33.818 -0.218  -43.733 0.02 29.26 ? 58  PHE A CG   2  
ATOM   10175  C CD1  . PHE A 1 65  ? -33.619 -1.420  -44.374 0.02 29.22 ? 58  PHE A CD1  2  
ATOM   10176  C CD2  . PHE A 1 65  ? -34.733 0.681   -44.265 0.02 29.58 ? 58  PHE A CD2  2  
ATOM   10177  C CE1  . PHE A 1 65  ? -34.309 -1.724  -45.531 0.02 29.49 ? 58  PHE A CE1  2  
ATOM   10178  C CE2  . PHE A 1 65  ? -35.431 0.363   -45.407 0.02 29.85 ? 58  PHE A CE2  2  
ATOM   10179  C CZ   . PHE A 1 65  ? -35.208 -0.839  -46.037 0.02 29.80 ? 58  PHE A CZ   2  
ATOM   10180  H H    . PHE A 1 65  ? -30.758 -1.125  -42.961 0.02 28.77 ? 58  PHE A H    2  
ATOM   10181  H HA   . PHE A 1 65  ? -31.664 1.427   -43.138 0.02 29.23 ? 58  PHE A HA   2  
ATOM   10182  H HB2  . PHE A 1 65  ? -33.068 -0.721  -41.952 0.02 28.81 ? 58  PHE A HB2  2  
ATOM   10183  H HB3  . PHE A 1 65  ? -33.593 0.774   -41.999 0.02 29.08 ? 58  PHE A HB3  2  
ATOM   10184  H HD1  . PHE A 1 65  ? -33.010 -2.029  -44.025 0.02 29.03 ? 58  PHE A HD1  2  
ATOM   10185  H HD2  . PHE A 1 65  ? -34.890 1.491   -43.839 0.02 29.64 ? 58  PHE A HD2  2  
ATOM   10186  H HE1  . PHE A 1 65  ? -34.167 -2.537  -45.956 0.02 29.48 ? 58  PHE A HE1  2  
ATOM   10187  H HE2  . PHE A 1 65  ? -36.039 0.968   -45.761 0.02 30.08 ? 58  PHE A HE2  2  
ATOM   10188  H HZ   . PHE A 1 65  ? -35.668 -1.048  -46.816 0.02 30.00 ? 58  PHE A HZ   2  
ATOM   10189  N N    . GLU A 1 66  ? -30.525 1.981   -41.024 0.02 28.89 ? 59  GLU A N    2  
ATOM   10190  C CA   . GLU A 1 66  ? -29.830 2.305   -39.792 0.02 28.74 ? 59  GLU A CA   2  
ATOM   10191  C C    . GLU A 1 66  ? -30.569 3.443   -39.111 0.02 28.87 ? 59  GLU A C    2  
ATOM   10192  O O    . GLU A 1 66  ? -31.265 4.224   -39.755 0.02 29.15 ? 59  GLU A O    2  
ATOM   10193  C CB   . GLU A 1 66  ? -28.384 2.685   -40.060 0.02 28.82 ? 59  GLU A CB   2  
ATOM   10194  C CG   . GLU A 1 66  ? -27.538 1.562   -40.697 0.02 28.72 ? 59  GLU A CG   2  
ATOM   10195  C CD   . GLU A 1 66  ? -26.157 2.036   -41.035 0.02 28.90 ? 59  GLU A CD   2  
ATOM   10196  O OE1  . GLU A 1 66  ? -26.007 2.850   -42.005 0.02 29.22 ? 59  GLU A OE1  2  
ATOM   10197  O OE2  . GLU A 1 66  ? -25.223 1.636   -40.322 0.02 28.75 ? 59  GLU A OE2  2  
ATOM   10198  H H    . GLU A 1 66  ? -30.598 2.652   -41.551 0.02 29.10 ? 59  GLU A H    2  
ATOM   10199  H HA   . GLU A 1 66  ? -29.838 1.546   -39.190 0.02 28.52 ? 59  GLU A HA   2  
ATOM   10200  H HB2  . GLU A 1 66  ? -28.363 3.442   -40.660 0.02 29.06 ? 59  GLU A HB2  2  
ATOM   10201  H HB3  . GLU A 1 66  ? -27.972 2.924   -39.219 0.02 28.74 ? 59  GLU A HB3  2  
ATOM   10202  H HG2  . GLU A 1 66  ? -27.457 0.823   -40.076 0.02 28.50 ? 59  GLU A HG2  2  
ATOM   10203  H HG3  . GLU A 1 66  ? -27.965 1.264   -41.514 0.02 28.79 ? 59  GLU A HG3  2  
ATOM   10204  N N    . GLY A 1 67  ? -30.465 3.502   -37.795 0.02 28.71 ? 60  GLY A N    2  
ATOM   10205  C CA   . GLY A 1 67  ? -31.106 4.583   -37.094 0.02 28.87 ? 60  GLY A CA   2  
ATOM   10206  C C    . GLY A 1 67  ? -32.593 4.435   -36.945 0.02 28.92 ? 60  GLY A C    2  
ATOM   10207  O O    . GLY A 1 67  ? -33.307 5.442   -36.835 0.02 29.18 ? 60  GLY A O    2  
ATOM   10208  H H    . GLY A 1 67  ? -30.041 2.942   -37.304 0.02 28.53 ? 60  GLY A H    2  
ATOM   10209  H HA2  . GLY A 1 67  ? -30.723 4.645   -36.205 0.02 28.76 ? 60  GLY A HA2  2  
ATOM   10210  H HA3  . GLY A 1 67  ? -30.924 5.417   -37.555 0.02 29.09 ? 60  GLY A HA3  2  
ATOM   10211  N N    . ILE A 1 68  ? -33.092 3.210   -36.894 0.02 28.72 ? 61  ILE A N    2  
ATOM   10212  C CA   . ILE A 1 68  ? -34.509 3.032   -36.631 0.02 28.80 ? 61  ILE A CA   2  
ATOM   10213  C C    . ILE A 1 68  ? -34.699 3.116   -35.124 0.02 28.70 ? 61  ILE A C    2  
ATOM   10214  O O    . ILE A 1 68  ? -34.108 2.311   -34.399 0.02 28.43 ? 61  ILE A O    2  
ATOM   10215  C CB   . ILE A 1 68  ? -35.041 1.693   -37.140 0.02 28.69 ? 61  ILE A CB   2  
ATOM   10216  C CG1  . ILE A 1 68  ? -34.810 1.552   -38.649 0.02 28.82 ? 61  ILE A CG1  2  
ATOM   10217  C CG2  . ILE A 1 68  ? -36.489 1.586   -36.821 0.02 28.83 ? 61  ILE A CG2  2  
ATOM   10218  C CD1  . ILE A 1 68  ? -35.304 0.215   -39.185 0.02 28.73 ? 61  ILE A CD1  2  
ATOM   10219  H H    . ILE A 1 68  ? -32.642 2.490   -36.994 0.02 28.56 ? 61  ILE A H    2  
ATOM   10220  H HA   . ILE A 1 68  ? -35.004 3.742   -37.064 0.02 29.03 ? 61  ILE A HA   2  
ATOM   10221  H HB   . ILE A 1 68  ? -34.572 0.981   -36.678 0.02 28.48 ? 61  ILE A HB   2  
ATOM   10222  H HG12 . ILE A 1 68  ? -35.279 2.256   -39.121 0.02 29.05 ? 61  ILE A HG12 2  
ATOM   10223  H HG13 . ILE A 1 68  ? -33.859 1.613   -38.830 0.02 28.76 ? 61  ILE A HG13 2  
ATOM   10224  H HG21 . ILE A 1 68  ? -36.869 0.808   -37.251 0.02 28.87 ? 61  ILE A HG21 2  
ATOM   10225  H HG22 . ILE A 1 68  ? -36.601 1.496   -35.865 0.02 28.71 ? 61  ILE A HG22 2  
ATOM   10226  H HG23 . ILE A 1 68  ? -36.934 2.386   -37.135 0.02 29.04 ? 61  ILE A HG23 2  
ATOM   10227  H HD11 . ILE A 1 68  ? -34.907 0.056   -40.054 0.02 28.78 ? 61  ILE A HD11 2  
ATOM   10228  H HD12 . ILE A 1 68  ? -35.036 -0.487  -38.570 0.02 28.52 ? 61  ILE A HD12 2  
ATOM   10229  H HD13 . ILE A 1 68  ? -36.270 0.237   -39.255 0.02 28.86 ? 61  ILE A HD13 2  
ATOM   10230  N N    . PRO A 1 69  ? -35.505 4.046   -34.617 0.02 28.93 ? 62  PRO A N    2  
ATOM   10231  C CA   . PRO A 1 69  ? -35.696 4.137   -33.167 0.02 28.87 ? 62  PRO A CA   2  
ATOM   10232  C C    . PRO A 1 69  ? -36.649 3.049   -32.719 0.02 28.79 ? 62  PRO A C    2  
ATOM   10233  O O    . PRO A 1 69  ? -37.648 2.775   -33.387 0.02 28.96 ? 62  PRO A O    2  
ATOM   10234  C CB   . PRO A 1 69  ? -36.316 5.525   -32.977 0.02 29.22 ? 62  PRO A CB   2  
ATOM   10235  C CG   . PRO A 1 69  ? -37.116 5.680   -34.185 0.02 29.46 ? 62  PRO A CG   2  
ATOM   10236  C CD   . PRO A 1 69  ? -36.277 5.098   -35.310 0.02 29.29 ? 62  PRO A CD   2  
ATOM   10237  H HA   . PRO A 1 69  ? -34.853 4.076   -32.693 0.02 28.73 ? 62  PRO A HA   2  
ATOM   10238  H HB2  . PRO A 1 69  ? -36.879 5.528   -32.190 0.02 29.27 ? 62  PRO A HB2  2  
ATOM   10239  H HB3  . PRO A 1 69  ? -35.620 6.196   -32.921 0.02 29.26 ? 62  PRO A HB3  2  
ATOM   10240  H HG2  . PRO A 1 69  ? -37.942 5.182   -34.090 0.02 29.50 ? 62  PRO A HG2  2  
ATOM   10241  H HG3  . PRO A 1 69  ? -37.296 6.622   -34.343 0.02 29.69 ? 62  PRO A HG3  2  
ATOM   10242  H HD2  . PRO A 1 69  ? -36.845 4.714   -35.994 0.02 29.36 ? 62  PRO A HD2  2  
ATOM   10243  H HD3  . PRO A 1 69  ? -35.681 5.769   -35.674 0.02 29.38 ? 62  PRO A HD3  2  
ATOM   10244  N N    . TYR A 1 70  ? -36.316 2.402   -31.604 0.02 28.57 ? 63  TYR A N    2  
ATOM   10245  C CA   . TYR A 1 70  ? -37.229 1.489   -30.955 0.02 28.56 ? 63  TYR A CA   2  
ATOM   10246  C C    . TYR A 1 70  ? -37.684 2.003   -29.594 0.02 28.71 ? 63  TYR A C    2  
ATOM   10247  O O    . TYR A 1 70  ? -38.454 1.325   -28.920 0.02 28.81 ? 63  TYR A O    2  
ATOM   10248  C CB   . TYR A 1 70  ? -36.568 0.108   -30.819 0.02 28.25 ? 63  TYR A CB   2  
ATOM   10249  C CG   . TYR A 1 70  ? -35.384 0.059   -29.900 0.02 28.05 ? 63  TYR A CG   2  
ATOM   10250  C CD1  . TYR A 1 70  ? -35.561 0.033   -28.504 0.02 28.07 ? 63  TYR A CD1  2  
ATOM   10251  C CD2  . TYR A 1 70  ? -34.098 0.023   -30.391 0.02 27.90 ? 63  TYR A CD2  2  
ATOM   10252  C CE1  . TYR A 1 70  ? -34.519 -0.029  -27.676 0.02 27.92 ? 63  TYR A CE1  2  
ATOM   10253  C CE2  . TYR A 1 70  ? -33.027 -0.049  -29.546 0.02 27.76 ? 63  TYR A CE2  2  
ATOM   10254  C CZ   . TYR A 1 70  ? -33.255 -0.073  -28.164 0.02 27.77 ? 63  TYR A CZ   2  
ATOM   10255  O OH   . TYR A 1 70  ? -32.222 -0.143  -27.274 0.02 27.67 ? 63  TYR A OH   2  
ATOM   10256  H H    . TYR A 1 70  ? -35.558 2.476   -31.208 0.02 28.46 ? 63  TYR A H    2  
ATOM   10257  H HA   . TYR A 1 70  ? -38.019 1.384   -31.505 0.02 28.68 ? 63  TYR A HA   2  
ATOM   10258  H HB2  . TYR A 1 70  ? -37.224 -0.523  -30.488 0.02 28.27 ? 63  TYR A HB2  2  
ATOM   10259  H HB3  . TYR A 1 70  ? -36.263 -0.169  -31.696 0.02 28.19 ? 63  TYR A HB3  2  
ATOM   10260  H HD1  . TYR A 1 70  ? -36.420 0.053   -28.150 0.02 28.20 ? 63  TYR A HD1  2  
ATOM   10261  H HD2  . TYR A 1 70  ? -33.957 0.033   -31.308 0.02 27.91 ? 63  TYR A HD2  2  
ATOM   10262  H HE1  . TYR A 1 70  ? -34.658 -0.049  -26.760 0.02 27.95 ? 63  TYR A HE1  2  
ATOM   10263  H HE2  . TYR A 1 70  ? -32.161 -0.073  -29.882 0.02 27.68 ? 63  TYR A HE2  2  
ATOM   10264  H HH   . TYR A 1 70  ? -31.510 0.108   -27.630 0.02 27.65 ? 63  TYR A HH   2  
ATOM   10265  N N    . ALA A 1 71  ? -37.233 3.185   -29.184 0.02 28.79 ? 64  ALA A N    2  
ATOM   10266  C CA   . ALA A 1 71  ? -37.706 3.808   -27.948 0.02 29.00 ? 64  ALA A CA   2  
ATOM   10267  C C    . ALA A 1 71  ? -37.529 5.314   -28.057 0.02 29.24 ? 64  ALA A C    2  
ATOM   10268  O O    . ALA A 1 71  ? -36.741 5.804   -28.864 0.02 29.21 ? 64  ALA A O    2  
ATOM   10269  C CB   . ALA A 1 71  ? -36.959 3.278   -26.725 0.02 28.81 ? 64  ALA A CB   2  
ATOM   10270  H H    . ALA A 1 71  ? -36.644 3.647   -29.606 0.02 28.75 ? 64  ALA A H    2  
ATOM   10271  H HA   . ALA A 1 71  ? -38.650 3.630   -27.829 0.02 29.15 ? 64  ALA A HA   2  
ATOM   10272  H HB1  . ALA A 1 71  ? -37.242 2.366   -26.557 0.02 28.71 ? 64  ALA A HB1  2  
ATOM   10273  H HB2  . ALA A 1 71  ? -36.005 3.306   -26.893 0.02 28.67 ? 64  ALA A HB2  2  
ATOM   10274  H HB3  . ALA A 1 71  ? -37.174 3.835   -25.963 0.02 28.97 ? 64  ALA A HB3  2  
ATOM   10275  N N    . GLN A 1 72  ? -38.276 6.041   -27.227 0.02 29.51 ? 65  GLN A N    2  
ATOM   10276  C CA   . GLN A 1 72  ? -38.107 7.487   -27.178 0.02 29.80 ? 65  GLN A CA   2  
ATOM   10277  C C    . GLN A 1 72  ? -36.690 7.758   -26.691 0.02 29.65 ? 65  GLN A C    2  
ATOM   10278  O O    . GLN A 1 72  ? -36.163 6.989   -25.884 0.02 29.39 ? 65  GLN A O    2  
ATOM   10279  C CB   . GLN A 1 72  ? -39.178 8.127   -26.269 0.02 30.14 ? 65  GLN A CB   2  
ATOM   10280  C CG   . GLN A 1 72  ? -38.808 9.436   -25.493 0.02 30.49 ? 65  GLN A CG   2  
ATOM   10281  C CD   . GLN A 1 72  ? -39.028 10.738  -26.272 0.02 30.79 ? 65  GLN A CD   2  
ATOM   10282  O OE1  . GLN A 1 72  ? -39.739 10.782  -27.278 0.02 30.86 ? 65  GLN A OE1  2  
ATOM   10283  N NE2  . GLN A 1 72  ? -38.414 11.810  -25.784 0.02 31.01 ? 65  GLN A NE2  2  
ATOM   10284  H H    . GLN A 1 72  ? -38.868 5.722   -26.691 0.02 29.55 ? 65  GLN A H    2  
ATOM   10285  H HA   . GLN A 1 72  ? -38.211 7.847   -28.070 0.02 29.92 ? 65  GLN A HA   2  
ATOM   10286  H HB2  . GLN A 1 72  ? -39.951 8.338   -26.811 0.02 30.27 ? 65  GLN A HB2  2  
ATOM   10287  H HB3  . GLN A 1 72  ? -39.435 7.470   -25.607 0.02 30.03 ? 65  GLN A HB3  2  
ATOM   10288  H HG2  . GLN A 1 72  ? -39.382 9.487   -24.715 0.02 30.68 ? 65  GLN A HG2  2  
ATOM   10289  H HG3  . GLN A 1 72  ? -37.886 9.414   -25.199 0.02 30.39 ? 65  GLN A HG3  2  
ATOM   10290  H HE21 . GLN A 1 72  ? -37.961 11.747  -25.057 0.02 31.08 ? 65  GLN A HE21 2  
ATOM   10291  H HE22 . GLN A 1 72  ? -38.475 12.565  -26.185 0.02 31.10 ? 65  GLN A HE22 2  
ATOM   10292  N N    . PRO A 1 73  ? -36.009 8.764   -27.211 0.02 29.83 ? 66  PRO A N    2  
ATOM   10293  C CA   . PRO A 1 73  ? -34.694 9.074   -26.700 0.02 29.77 ? 66  PRO A CA   2  
ATOM   10294  C C    . PRO A 1 73  ? -34.745 9.211   -25.189 0.02 29.85 ? 66  PRO A C    2  
ATOM   10295  O O    . PRO A 1 73  ? -35.589 9.942   -24.667 0.02 30.18 ? 66  PRO A O    2  
ATOM   10296  C CB   . PRO A 1 73  ? -34.368 10.401  -27.389 0.02 30.10 ? 66  PRO A CB   2  
ATOM   10297  C CG   . PRO A 1 73  ? -35.033 10.240  -28.685 0.02 30.12 ? 66  PRO A CG   2  
ATOM   10298  C CD   . PRO A 1 73  ? -36.331 9.623   -28.371 0.02 30.09 ? 66  PRO A CD   2  
ATOM   10299  H HA   . PRO A 1 73  ? -34.058 8.403   -26.979 0.02 29.53 ? 66  PRO A HA   2  
ATOM   10300  H HB2  . PRO A 1 73  ? -34.748 11.144  -26.893 0.02 30.36 ? 66  PRO A HB2  2  
ATOM   10301  H HB3  . PRO A 1 73  ? -33.409 10.500  -27.494 0.02 30.05 ? 66  PRO A HB3  2  
ATOM   10302  H HG2  . PRO A 1 73  ? -35.152 11.106  -29.101 0.02 30.38 ? 66  PRO A HG2  2  
ATOM   10303  H HG3  . PRO A 1 73  ? -34.507 9.657   -29.250 0.02 29.90 ? 66  PRO A HG3  2  
ATOM   10304  H HD2  . PRO A 1 73  ? -36.972 10.307  -28.122 0.02 30.37 ? 66  PRO A HD2  2  
ATOM   10305  H HD3  . PRO A 1 73  ? -36.643 9.092   -29.121 0.02 29.99 ? 66  PRO A HD3  2  
ATOM   10306  N N    . PRO A 1 74  ? -33.930 8.465   -24.463 0.02 29.60 ? 67  PRO A N    2  
ATOM   10307  C CA   . PRO A 1 74  ? -34.063 8.423   -22.996 0.02 29.68 ? 67  PRO A CA   2  
ATOM   10308  C C    . PRO A 1 74  ? -33.298 9.565   -22.350 0.02 29.96 ? 67  PRO A C    2  
ATOM   10309  O O    . PRO A 1 74  ? -32.300 9.382   -21.661 0.02 29.89 ? 67  PRO A O    2  
ATOM   10310  C CB   . PRO A 1 74  ? -33.477 7.047   -22.666 0.02 29.31 ? 67  PRO A CB   2  
ATOM   10311  C CG   . PRO A 1 74  ? -32.374 6.931   -23.689 0.02 29.12 ? 67  PRO A CG   2  
ATOM   10312  C CD   . PRO A 1 74  ? -32.957 7.471   -24.941 0.02 29.24 ? 67  PRO A CD   2  
ATOM   10313  H HA   . PRO A 1 74  ? -34.994 8.466   -22.731 0.02 29.80 ? 67  PRO A HA   2  
ATOM   10314  H HB2  . PRO A 1 74  ? -33.127 7.033   -21.762 0.02 29.34 ? 67  PRO A HB2  2  
ATOM   10315  H HB3  . PRO A 1 74  ? -34.153 6.366   -22.801 0.02 29.20 ? 67  PRO A HB3  2  
ATOM   10316  H HG2  . PRO A 1 74  ? -31.612 7.466   -23.417 0.02 29.22 ? 67  PRO A HG2  2  
ATOM   10317  H HG3  . PRO A 1 74  ? -32.120 6.002   -23.801 0.02 28.88 ? 67  PRO A HG3  2  
ATOM   10318  H HD2  . PRO A 1 74  ? -32.268 7.887   -25.482 0.02 29.27 ? 67  PRO A HD2  2  
ATOM   10319  H HD3  . PRO A 1 74  ? -33.414 6.771   -25.430 0.02 29.10 ? 67  PRO A HD3  2  
ATOM   10320  N N    . VAL A 1 75  ? -33.761 10.772  -22.622 0.02 30.33 ? 68  VAL A N    2  
ATOM   10321  C CA   . VAL A 1 75  ? -33.031 11.976  -22.294 0.02 30.67 ? 68  VAL A CA   2  
ATOM   10322  C C    . VAL A 1 75  ? -33.856 12.772  -21.284 0.02 31.05 ? 68  VAL A C    2  
ATOM   10323  O O    . VAL A 1 75  ? -35.034 12.505  -21.059 0.02 31.10 ? 68  VAL A O    2  
ATOM   10324  C CB   . VAL A 1 75  ? -32.738 12.806  -23.539 0.02 30.85 ? 68  VAL A CB   2  
ATOM   10325  C CG1  . VAL A 1 75  ? -32.067 11.915  -24.613 0.02 30.57 ? 68  VAL A CG1  2  
ATOM   10326  C CG2  . VAL A 1 75  ? -34.033 13.380  -24.029 0.02 30.93 ? 68  VAL A CG2  2  
ATOM   10327  H H    . VAL A 1 75  ? -34.520 10.918  -22.992 0.02 30.41 ? 68  VAL A H    2  
ATOM   10328  H HA   . VAL A 1 75  ? -32.181 11.755  -21.881 0.02 30.57 ? 68  VAL A HA   2  
ATOM   10329  H HB   . VAL A 1 75  ? -32.133 13.529  -23.314 0.02 31.15 ? 68  VAL A HB   2  
ATOM   10330  H HG11 . VAL A 1 75  ? -31.821 11.066  -24.212 0.02 30.28 ? 68  VAL A HG11 2  
ATOM   10331  H HG12 . VAL A 1 75  ? -32.691 11.770  -25.340 0.02 30.57 ? 68  VAL A HG12 2  
ATOM   10332  H HG13 . VAL A 1 75  ? -31.271 12.364  -24.939 0.02 30.71 ? 68  VAL A HG13 2  
ATOM   10333  H HG21 . VAL A 1 75  ? -33.907 13.711  -24.932 0.02 31.08 ? 68  VAL A HG21 2  
ATOM   10334  H HG22 . VAL A 1 75  ? -34.705 12.685  -24.029 0.02 30.66 ? 68  VAL A HG22 2  
ATOM   10335  H HG23 . VAL A 1 75  ? -34.312 14.095  -23.444 0.02 31.14 ? 68  VAL A HG23 2  
ATOM   10336  N N    . GLY A 1 76  ? -33.223 13.753  -20.692 0.02 31.37 ? 69  GLY A N    2  
ATOM   10337  C CA   . GLY A 1 76  ? -33.937 14.640  -19.793 0.02 31.82 ? 69  GLY A CA   2  
ATOM   10338  C C    . GLY A 1 76  ? -34.402 13.853  -18.590 0.02 31.75 ? 69  GLY A C    2  
ATOM   10339  O O    . GLY A 1 76  ? -33.611 13.167  -17.918 0.02 31.52 ? 69  GLY A O    2  
ATOM   10340  H H    . GLY A 1 76  ? -32.387 13.927  -20.786 0.02 31.37 ? 69  GLY A H    2  
ATOM   10341  H HA2  . GLY A 1 76  ? -33.361 15.364  -19.502 0.02 32.06 ? 69  GLY A HA2  2  
ATOM   10342  H HA3  . GLY A 1 76  ? -34.710 15.008  -20.249 0.02 31.98 ? 69  GLY A HA3  2  
ATOM   10343  N N    . GLU A 1 77  ? -35.711 13.889  -18.358 0.02 31.96 ? 70  GLU A N    2  
ATOM   10344  C CA   . GLU A 1 77  ? -36.295 13.162  -17.245 0.02 31.94 ? 70  GLU A CA   2  
ATOM   10345  C C    . GLU A 1 77  ? -36.420 11.669  -17.514 0.02 31.43 ? 70  GLU A C    2  
ATOM   10346  O O    . GLU A 1 77  ? -36.780 10.927  -16.606 0.02 31.38 ? 70  GLU A O    2  
ATOM   10347  C CB   . GLU A 1 77  ? -37.665 13.738  -16.921 0.02 32.27 ? 70  GLU A CB   2  
ATOM   10348  C CG   . GLU A 1 77  ? -37.605 15.083  -16.257 0.02 32.86 ? 70  GLU A CG   2  
ATOM   10349  C CD   . GLU A 1 77  ? -37.290 14.955  -14.775 0.02 32.99 ? 70  GLU A CD   2  
ATOM   10350  O OE1  . GLU A 1 77  ? -36.191 15.388  -14.372 0.02 33.01 ? 70  GLU A OE1  2  
ATOM   10351  O OE2  . GLU A 1 77  ? -38.135 14.386  -14.050 0.02 33.09 ? 70  GLU A OE2  2  
ATOM   10352  H H    . GLU A 1 77  ? -36.280 14.321  -18.832 0.02 32.15 ? 70  GLU A H    2  
ATOM   10353  H HA   . GLU A 1 77  ? -35.731 13.280  -16.465 0.02 32.08 ? 70  GLU A HA   2  
ATOM   10354  H HB2  . GLU A 1 77  ? -38.167 13.832  -17.742 0.02 32.26 ? 70  GLU A HB2  2  
ATOM   10355  H HB3  . GLU A 1 77  ? -38.125 13.131  -16.321 0.02 32.16 ? 70  GLU A HB3  2  
ATOM   10356  H HG2  . GLU A 1 77  ? -36.904 15.611  -16.668 0.02 33.06 ? 70  GLU A HG2  2  
ATOM   10357  H HG3  . GLU A 1 77  ? -38.462 15.525  -16.358 0.02 33.02 ? 70  GLU A HG3  2  
ATOM   10358  N N    . LEU A 1 78  ? -36.176 11.217  -18.750 0.02 31.10 ? 71  LEU A N    2  
ATOM   10359  C CA   . LEU A 1 78  ? -36.159 9.780   -19.019 0.02 30.66 ? 71  LEU A CA   2  
ATOM   10360  C C    . LEU A 1 78  ? -34.823 9.151   -18.670 0.02 30.37 ? 71  LEU A C    2  
ATOM   10361  O O    . LEU A 1 78  ? -34.686 7.927   -18.796 0.02 30.03 ? 71  LEU A O    2  
ATOM   10362  C CB   . LEU A 1 78  ? -36.499 9.511   -20.489 0.02 30.47 ? 71  LEU A CB   2  
ATOM   10363  C CG   . LEU A 1 78  ? -37.885 10.001  -20.906 0.02 30.79 ? 71  LEU A CG   2  
ATOM   10364  C CD1  . LEU A 1 78  ? -38.065 9.753   -22.379 0.02 30.62 ? 71  LEU A CD1  2  
ATOM   10365  C CD2  . LEU A 1 78  ? -39.018 9.379   -20.136 0.02 30.90 ? 71  LEU A CD2  2  
ATOM   10366  H H    . LEU A 1 78  ? -36.017 11.713  -19.432 0.02 31.15 ? 71  LEU A H    2  
ATOM   10367  H HA   . LEU A 1 78  ? -36.839 9.337   -18.489 0.02 30.71 ? 71  LEU A HA   2  
ATOM   10368  H HB2  . LEU A 1 78  ? -35.844 9.964   -21.041 0.02 30.43 ? 71  LEU A HB2  2  
ATOM   10369  H HB3  . LEU A 1 78  ? -36.465 8.558   -20.664 0.02 30.22 ? 71  LEU A HB3  2  
ATOM   10370  H HG   . LEU A 1 78  ? -37.929 10.956  -20.756 0.02 31.07 ? 71  LEU A HG   2  
ATOM   10371  H HD11 . LEU A 1 78  ? -38.908 10.141  -22.656 0.02 30.76 ? 71  LEU A HD11 2  
ATOM   10372  H HD12 . LEU A 1 78  ? -37.330 10.170  -22.853 0.02 30.71 ? 71  LEU A HD12 2  
ATOM   10373  H HD13 . LEU A 1 78  ? -38.073 8.799   -22.543 0.02 30.32 ? 71  LEU A HD13 2  
ATOM   10374  H HD21 . LEU A 1 78  ? -38.731 8.530   -19.767 0.02 30.82 ? 71  LEU A HD21 2  
ATOM   10375  H HD22 . LEU A 1 78  ? -39.272 9.984   -19.422 0.02 31.23 ? 71  LEU A HD22 2  
ATOM   10376  H HD23 . LEU A 1 78  ? -39.773 9.247   -20.729 0.02 30.76 ? 71  LEU A HD23 2  
ATOM   10377  N N    . ARG A 1 79  ? -33.842 9.957   -18.255 0.02 30.54 ? 72  ARG A N    2  
ATOM   10378  C CA   . ARG A 1 79  ? -32.534 9.427   -17.905 0.02 30.32 ? 72  ARG A CA   2  
ATOM   10379  C C    . ARG A 1 79  ? -32.649 8.518   -16.689 0.02 30.25 ? 72  ARG A C    2  
ATOM   10380  O O    . ARG A 1 79  ? -33.283 8.866   -15.690 0.02 30.55 ? 72  ARG A O    2  
ATOM   10381  C CB   . ARG A 1 79  ? -31.537 10.554  -17.615 0.02 30.60 ? 72  ARG A CB   2  
ATOM   10382  C CG   . ARG A 1 79  ? -30.158 10.047  -17.221 0.02 30.42 ? 72  ARG A CG   2  
ATOM   10383  C CD   . ARG A 1 79  ? -29.185 11.106  -16.804 0.02 30.76 ? 72  ARG A CD   2  
ATOM   10384  N NE   . ARG A 1 79  ? -28.748 11.957  -17.891 0.02 30.86 ? 72  ARG A NE   2  
ATOM   10385  C CZ   . ARG A 1 79  ? -27.987 13.031  -17.699 0.02 31.22 ? 72  ARG A CZ   2  
ATOM   10386  N NH1  . ARG A 1 79  ? -27.595 13.368  -16.469 0.02 31.50 ? 72  ARG A NH1  2  
ATOM   10387  N NH2  . ARG A 1 79  ? -27.622 13.789  -18.725 0.02 31.35 ? 72  ARG A NH2  2  
ATOM   10388  H H    . ARG A 1 79  ? -33.909 10.808  -18.171 0.02 30.80 ? 72  ARG A H    2  
ATOM   10389  H HA   . ARG A 1 79  ? -32.194 8.907   -18.649 0.02 30.06 ? 72  ARG A HA   2  
ATOM   10390  H HB2  . ARG A 1 79  ? -31.438 11.100  -18.409 0.02 30.66 ? 72  ARG A HB2  2  
ATOM   10391  H HB3  . ARG A 1 79  ? -31.878 11.095  -16.888 0.02 30.88 ? 72  ARG A HB3  2  
ATOM   10392  H HG2  . ARG A 1 79  ? -30.244 9.452   -16.462 0.02 30.35 ? 72  ARG A HG2  2  
ATOM   10393  H HG3  . ARG A 1 79  ? -29.770 9.573   -17.970 0.02 30.18 ? 72  ARG A HG3  2  
ATOM   10394  H HD2  . ARG A 1 79  ? -29.604 11.673  -16.136 0.02 31.04 ? 72  ARG A HD2  2  
ATOM   10395  H HD3  . ARG A 1 79  ? -28.400 10.685  -16.421 0.02 30.67 ? 72  ARG A HD3  2  
ATOM   10396  H HE   . ARG A 1 79  ? -29.176 11.904  -18.630 0.02 30.77 ? 72  ARG A HE   2  
ATOM   10397  H HH11 . ARG A 1 79  ? -27.826 12.892  -15.797 0.02 31.44 ? 72  ARG A HH11 2  
ATOM   10398  H HH12 . ARG A 1 79  ? -27.102 14.062  -16.354 0.02 31.75 ? 72  ARG A HH12 2  
ATOM   10399  H HH21 . ARG A 1 79  ? -27.875 13.579  -19.517 0.02 31.19 ? 72  ARG A HH21 2  
ATOM   10400  H HH22 . ARG A 1 79  ? -27.129 14.479  -18.598 0.02 31.61 ? 72  ARG A HH22 2  
ATOM   10401  N N    . PHE A 1 80  ? -32.004 7.361   -16.785 0.02 29.90 ? 73  PHE A N    2  
ATOM   10402  C CA   . PHE A 1 80  ? -32.014 6.299   -15.801 0.02 29.79 ? 73  PHE A CA   2  
ATOM   10403  C C    . PHE A 1 80  ? -33.352 5.564   -15.724 0.02 29.76 ? 73  PHE A C    2  
ATOM   10404  O O    . PHE A 1 80  ? -33.512 4.663   -14.862 0.02 29.71 ? 73  PHE A O    2  
ATOM   10405  C CB   . PHE A 1 80  ? -31.662 6.814   -14.394 0.02 30.11 ? 73  PHE A CB   2  
ATOM   10406  C CG   . PHE A 1 80  ? -30.354 7.549   -14.312 0.02 30.22 ? 73  PHE A CG   2  
ATOM   10407  C CD1  . PHE A 1 80  ? -29.177 6.952   -14.726 0.02 29.95 ? 73  PHE A CD1  2  
ATOM   10408  C CD2  . PHE A 1 80  ? -30.298 8.828   -13.772 0.02 30.64 ? 73  PHE A CD2  2  
ATOM   10409  C CE1  . PHE A 1 80  ? -27.977 7.606   -14.639 0.02 30.10 ? 73  PHE A CE1  2  
ATOM   10410  C CE2  . PHE A 1 80  ? -29.105 9.510   -13.702 0.02 30.79 ? 73  PHE A CE2  2  
ATOM   10411  C CZ   . PHE A 1 80  ? -27.934 8.904   -14.117 0.02 30.53 ? 73  PHE A CZ   2  
ATOM   10412  H H    . PHE A 1 80  ? -31.513 7.166   -17.459 0.02 29.73 ? 73  PHE A H    2  
ATOM   10413  H HA   . PHE A 1 80  ? -31.335 5.660   -16.063 0.02 29.56 ? 73  PHE A HA   2  
ATOM   10414  H HB2  . PHE A 1 80  ? -32.364 7.405   -14.087 0.02 30.36 ? 73  PHE A HB2  2  
ATOM   10415  H HB3  . PHE A 1 80  ? -31.597 6.047   -13.805 0.02 30.03 ? 73  PHE A HB3  2  
ATOM   10416  H HD1  . PHE A 1 80  ? -29.200 6.095   -15.074 0.02 29.70 ? 73  PHE A HD1  2  
ATOM   10417  H HD2  . PHE A 1 80  ? -31.081 9.241   -13.493 0.02 30.84 ? 73  PHE A HD2  2  
ATOM   10418  H HE1  . PHE A 1 80  ? -27.199 7.193   -14.931 0.02 29.95 ? 73  PHE A HE1  2  
ATOM   10419  H HE2  . PHE A 1 80  ? -29.081 10.366  -13.346 0.02 31.10 ? 73  PHE A HE2  2  
ATOM   10420  H HZ   . PHE A 1 80  ? -27.125 9.359   -14.059 0.02 30.66 ? 73  PHE A HZ   2  
ATOM   10421  N N    . LYS A 1 81  ? -34.328 5.924   -16.536 0.02 29.84 ? 74  LYS A N    2  
ATOM   10422  C CA   . LYS A 1 81  ? -35.647 5.317   -16.477 0.02 29.90 ? 74  LYS A CA   2  
ATOM   10423  C C    . LYS A 1 81  ? -35.814 4.261   -17.554 0.02 29.56 ? 74  LYS A C    2  
ATOM   10424  O O    . LYS A 1 81  ? -35.121 4.263   -18.561 0.02 29.32 ? 74  LYS A O    2  
ATOM   10425  C CB   . LYS A 1 81  ? -36.759 6.351   -16.672 0.02 30.25 ? 74  LYS A CB   2  
ATOM   10426  C CG   . LYS A 1 81  ? -36.638 7.589   -15.818 0.02 30.63 ? 74  LYS A CG   2  
ATOM   10427  C CD   . LYS A 1 81  ? -36.160 7.266   -14.443 0.02 30.74 ? 74  LYS A CD   2  
ATOM   10428  C CE   . LYS A 1 81  ? -36.255 8.467   -13.528 0.02 31.23 ? 74  LYS A CE   2  
ATOM   10429  N NZ   . LYS A 1 81  ? -35.769 9.756   -14.174 0.02 31.38 ? 74  LYS A NZ   2  
ATOM   10430  H H    . LYS A 1 81  ? -34.251 6.531   -17.136 0.02 29.89 ? 74  LYS A H    2  
ATOM   10431  H HA   . LYS A 1 81  ? -35.768 4.882   -15.619 0.02 29.98 ? 74  LYS A HA   2  
ATOM   10432  H HB2  . LYS A 1 81  ? -36.749 6.631   -17.599 0.02 30.16 ? 74  LYS A HB2  2  
ATOM   10433  H HB3  . LYS A 1 81  ? -37.612 5.937   -16.475 0.02 30.36 ? 74  LYS A HB3  2  
ATOM   10434  H HG2  . LYS A 1 81  ? -35.999 8.185   -16.238 0.02 30.58 ? 74  LYS A HG2  2  
ATOM   10435  H HG3  . LYS A 1 81  ? -37.503 8.019   -15.742 0.02 30.88 ? 74  LYS A HG3  2  
ATOM   10436  H HD2  . LYS A 1 81  ? -36.709 6.554   -14.076 0.02 30.68 ? 74  LYS A HD2  2  
ATOM   10437  H HD3  . LYS A 1 81  ? -35.231 6.995   -14.480 0.02 30.58 ? 74  LYS A HD3  2  
ATOM   10438  H HE2  . LYS A 1 81  ? -37.182 8.593   -13.269 0.02 31.42 ? 74  LYS A HE2  2  
ATOM   10439  H HE3  . LYS A 1 81  ? -35.715 8.302   -12.741 0.02 31.33 ? 74  LYS A HE3  2  
ATOM   10440  H HZ1  . LYS A 1 81  ? -35.561 9.630   -15.027 0.02 31.19 ? 74  LYS A HZ1  2  
ATOM   10441  H HZ2  . LYS A 1 81  ? -36.408 10.372  -14.125 0.02 31.68 ? 74  LYS A HZ2  2  
ATOM   10442  H HZ3  . LYS A 1 81  ? -35.048 10.055  -13.746 0.02 31.38 ? 74  LYS A HZ3  2  
ATOM   10443  N N    . ALA A 1 82  ? -36.807 3.422   -17.341 0.02 29.60 ? 75  ALA A N    2  
ATOM   10444  C CA   . ALA A 1 82  ? -37.189 2.406   -18.300 0.02 29.38 ? 75  ALA A CA   2  
ATOM   10445  C C    . ALA A 1 82  ? -37.528 3.051   -19.646 0.02 29.36 ? 75  ALA A C    2  
ATOM   10446  O O    . ALA A 1 82  ? -38.096 4.154   -19.687 0.02 29.66 ? 75  ALA A O    2  
ATOM   10447  C CB   . ALA A 1 82  ? -38.385 1.621   -17.767 0.02 29.58 ? 75  ALA A CB   2  
ATOM   10448  H H    . ALA A 1 82  ? -37.295 3.433   -16.635 0.02 29.79 ? 75  ALA A H    2  
ATOM   10449  H HA   . ALA A 1 82  ? -36.450 1.793   -18.425 0.02 29.14 ? 75  ALA A HA   2  
ATOM   10450  H HB1  . ALA A 1 82  ? -38.676 0.986   -18.439 0.02 29.48 ? 75  ALA A HB1  2  
ATOM   10451  H HB2  . ALA A 1 82  ? -38.120 1.145   -16.963 0.02 29.57 ? 75  ALA A HB2  2  
ATOM   10452  H HB3  . ALA A 1 82  ? -39.100 2.244   -17.564 0.02 29.85 ? 75  ALA A HB3  2  
ATOM   10453  N N    . PRO A 1 83  ? -37.204 2.402   -20.760 0.02 29.06 ? 76  PRO A N    2  
ATOM   10454  C CA   . PRO A 1 83  ? -37.428 3.036   -22.063 0.02 29.08 ? 76  PRO A CA   2  
ATOM   10455  C C    . PRO A 1 83  ? -38.904 3.251   -22.323 0.02 29.36 ? 76  PRO A C    2  
ATOM   10456  O O    . PRO A 1 83  ? -39.758 2.493   -21.869 0.02 29.42 ? 76  PRO A O    2  
ATOM   10457  C CB   . PRO A 1 83  ? -36.833 2.022   -23.063 0.02 28.74 ? 76  PRO A CB   2  
ATOM   10458  C CG   . PRO A 1 83  ? -36.910 0.740   -22.371 0.02 28.61 ? 76  PRO A CG   2  
ATOM   10459  C CD   . PRO A 1 83  ? -36.734 1.010   -20.903 0.02 28.75 ? 76  PRO A CD   2  
ATOM   10460  H HA   . PRO A 1 83  ? -36.950 3.877   -22.122 0.02 29.16 ? 76  PRO A HA   2  
ATOM   10461  H HB2  . PRO A 1 83  ? -37.372 2.003   -23.867 0.02 28.76 ? 76  PRO A HB2  2  
ATOM   10462  H HB3  . PRO A 1 83  ? -35.913 2.242   -23.271 0.02 28.62 ? 76  PRO A HB3  2  
ATOM   10463  H HG2  . PRO A 1 83  ? -37.779 0.344   -22.537 0.02 28.69 ? 76  PRO A HG2  2  
ATOM   10464  H HG3  . PRO A 1 83  ? -36.209 0.155   -22.702 0.02 28.39 ? 76  PRO A HG3  2  
ATOM   10465  H HD2  . PRO A 1 83  ? -37.292 0.409   -20.389 0.02 28.79 ? 76  PRO A HD2  2  
ATOM   10466  H HD3  . PRO A 1 83  ? -35.801 0.938   -20.653 0.02 28.62 ? 76  PRO A HD3  2  
ATOM   10467  N N    . GLN A 1 84  ? -39.196 4.267   -23.112 0.02 29.57 ? 77  GLN A N    2  
ATOM   10468  C CA   . GLN A 1 84  ? -40.542 4.535   -23.577 0.02 29.86 ? 77  GLN A CA   2  
ATOM   10469  C C    . GLN A 1 84  ? -40.671 4.212   -25.060 0.02 29.75 ? 77  GLN A C    2  
ATOM   10470  O O    . GLN A 1 84  ? -39.750 4.432   -25.842 0.02 29.54 ? 77  GLN A O    2  
ATOM   10471  C CB   . GLN A 1 84  ? -40.894 6.010   -23.351 0.02 30.26 ? 77  GLN A CB   2  
ATOM   10472  C CG   . GLN A 1 84  ? -40.996 6.447   -21.928 0.02 30.45 ? 77  GLN A CG   2  
ATOM   10473  C CD   . GLN A 1 84  ? -42.423 6.405   -21.448 0.02 30.70 ? 77  GLN A CD   2  
ATOM   10474  O OE1  . GLN A 1 84  ? -43.033 5.332   -21.397 0.02 30.54 ? 77  GLN A OE1  2  
ATOM   10475  N NE2  . GLN A 1 84  ? -42.992 7.575   -21.183 0.02 31.16 ? 77  GLN A NE2  2  
ATOM   10476  H H    . GLN A 1 84  ? -38.614 4.827   -23.410 0.02 29.57 ? 77  GLN A H    2  
ATOM   10477  H HA   . GLN A 1 84  ? -41.172 3.981   -23.092 0.02 29.90 ? 77  GLN A HA   2  
ATOM   10478  H HB2  . GLN A 1 84  ? -40.202 6.550   -23.765 0.02 30.23 ? 77  GLN A HB2  2  
ATOM   10479  H HB3  . GLN A 1 84  ? -41.747 6.192   -23.772 0.02 30.47 ? 77  GLN A HB3  2  
ATOM   10480  H HG2  . GLN A 1 84  ? -40.467 5.857   -21.367 0.02 30.23 ? 77  GLN A HG2  2  
ATOM   10481  H HG3  . GLN A 1 84  ? -40.679 7.362   -21.859 0.02 30.67 ? 77  GLN A HG3  2  
ATOM   10482  H HE21 . GLN A 1 84  ? -43.849 7.638   -21.118 0.02 31.34 ? 77  GLN A HE21 2  
ATOM   10483  H HE22 . GLN A 1 84  ? -42.502 8.274   -21.091 0.02 31.28 ? 77  GLN A HE22 2  
ATOM   10484  N N    . ARG A 1 85  ? -41.862 3.760   -25.444 0.02 29.94 ? 78  ARG A N    2  
ATOM   10485  C CA   . ARG A 1 85  ? -42.136 3.480   -26.847 0.02 29.87 ? 78  ARG A CA   2  
ATOM   10486  C C    . ARG A 1 85  ? -41.797 4.731   -27.652 0.02 30.04 ? 78  ARG A C    2  
ATOM   10487  O O    . ARG A 1 85  ? -42.063 5.852   -27.200 0.02 30.38 ? 78  ARG A O    2  
ATOM   10488  C CB   . ARG A 1 85  ? -43.602 3.096   -27.091 0.02 30.12 ? 78  ARG A CB   2  
ATOM   10489  C CG   . ARG A 1 85  ? -44.514 3.091   -25.844 0.02 30.23 ? 78  ARG A CG   2  
ATOM   10490  C CD   . ARG A 1 85  ? -44.172 1.964   -24.850 0.02 29.88 ? 78  ARG A CD   2  
ATOM   10491  N NE   . ARG A 1 85  ? -44.199 0.623   -25.433 0.02 29.72 ? 78  ARG A NE   2  
ATOM   10492  C CZ   . ARG A 1 85  ? -44.319 -0.501  -24.728 0.02 29.86 ? 78  ARG A CZ   2  
ATOM   10493  N NH1  . ARG A 1 85  ? -44.333 -1.674  -25.362 0.02 29.72 ? 78  ARG A NH1  2  
ATOM   10494  N NH2  . ARG A 1 85  ? -44.465 -0.461  -23.403 0.02 30.15 ? 78  ARG A NH2  2  
ATOM   10495  H H    . ARG A 1 85  ? -42.507 3.663   -24.904 0.02 30.14 ? 78  ARG A H    2  
ATOM   10496  H HA   . ARG A 1 85  ? -41.580 2.741   -27.136 0.02 29.60 ? 78  ARG A HA   2  
ATOM   10497  H HB2  . ARG A 1 85  ? -43.983 3.718   -27.727 0.02 30.39 ? 78  ARG A HB2  2  
ATOM   10498  H HB3  . ARG A 1 85  ? -43.624 2.201   -27.468 0.02 29.97 ? 78  ARG A HB3  2  
ATOM   10499  H HG2  . ARG A 1 85  ? -44.418 3.941   -25.389 0.02 30.48 ? 78  ARG A HG2  2  
ATOM   10500  H HG3  . ARG A 1 85  ? -45.436 2.982   -26.122 0.02 30.30 ? 78  ARG A HG3  2  
ATOM   10501  H HD2  . ARG A 1 85  ? -43.290 2.088   -24.478 0.02 29.66 ? 78  ARG A HD2  2  
ATOM   10502  H HD3  . ARG A 1 85  ? -44.824 1.988   -24.132 0.02 30.00 ? 78  ARG A HD3  2  
ATOM   10503  H HE   . ARG A 1 85  ? -44.130 0.556   -26.290 0.02 29.50 ? 78  ARG A HE   2  
ATOM   10504  H HH11 . ARG A 1 85  ? -44.245 -1.701  -26.217 0.02 29.54 ? 78  ARG A HH11 2  
ATOM   10505  H HH12 . ARG A 1 85  ? -44.419 -2.406  -24.917 0.02 29.82 ? 78  ARG A HH12 2  
ATOM   10506  H HH21 . ARG A 1 85  ? -44.460 0.291   -22.989 0.02 30.26 ? 78  ARG A HH21 2  
ATOM   10507  H HH22 . ARG A 1 85  ? -44.550 -1.194  -22.960 0.02 30.26 ? 78  ARG A HH22 2  
ATOM   10508  N N    . PRO A 1 86  ? -41.233 4.578   -28.850 0.02 29.87 ? 79  PRO A N    2  
ATOM   10509  C CA   . PRO A 1 86  ? -40.866 5.756   -29.630 0.02 30.05 ? 79  PRO A CA   2  
ATOM   10510  C C    . PRO A 1 86  ? -42.107 6.489   -30.122 0.02 30.47 ? 79  PRO A C    2  
ATOM   10511  O O    . PRO A 1 86  ? -43.227 5.971   -30.112 0.02 30.57 ? 79  PRO A O    2  
ATOM   10512  C CB   . PRO A 1 86  ? -40.046 5.197   -30.798 0.02 29.76 ? 79  PRO A CB   2  
ATOM   10513  C CG   . PRO A 1 86  ? -40.348 3.743   -30.853 0.02 29.58 ? 79  PRO A CG   2  
ATOM   10514  C CD   . PRO A 1 86  ? -40.880 3.313   -29.522 0.02 29.60 ? 79  PRO A CD   2  
ATOM   10515  H HA   . PRO A 1 86  ? -40.319 6.356   -29.097 0.02 30.10 ? 79  PRO A HA   2  
ATOM   10516  H HB2  . PRO A 1 86  ? -40.321 5.634   -31.619 0.02 29.92 ? 79  PRO A HB2  2  
ATOM   10517  H HB3  . PRO A 1 86  ? -39.102 5.345   -30.634 0.02 29.59 ? 79  PRO A HB3  2  
ATOM   10518  H HG2  . PRO A 1 86  ? -40.993 3.578   -31.550 0.02 29.72 ? 79  PRO A HG2  2  
ATOM   10519  H HG3  . PRO A 1 86  ? -39.528 3.265   -31.048 0.02 29.33 ? 79  PRO A HG3  2  
ATOM   10520  H HD2  . PRO A 1 86  ? -41.672 2.765   -29.630 0.02 29.73 ? 79  PRO A HD2  2  
ATOM   10521  H HD3  . PRO A 1 86  ? -40.202 2.842   -29.024 0.02 29.37 ? 79  PRO A HD3  2  
ATOM   10522  N N    . THR A 1 87  ? -41.890 7.705   -30.524 0.02 30.76 ? 80  THR A N    2  
ATOM   10523  C CA   . THR A 1 87  ? -43.024 8.511   -30.955 0.02 31.21 ? 80  THR A CA   2  
ATOM   10524  C C    . THR A 1 87  ? -43.042 8.578   -32.485 0.02 31.25 ? 80  THR A C    2  
ATOM   10525  O O    . THR A 1 87  ? -42.003 8.829   -33.116 0.02 31.02 ? 80  THR A O    2  
ATOM   10526  C CB   . THR A 1 87  ? -43.020 9.898   -30.273 0.02 31.64 ? 80  THR A CB   2  
ATOM   10527  O OG1  . THR A 1 87  ? -43.312 10.960  -31.195 0.02 32.09 ? 80  THR A OG1  2  
ATOM   10528  C CG2  . THR A 1 87  ? -41.715 10.161  -29.506 0.02 31.55 ? 80  THR A CG2  2  
ATOM   10529  H H    . THR A 1 87  ? -41.119 8.082   -30.570 0.02 30.74 ? 80  THR A H    2  
ATOM   10530  H HA   . THR A 1 87  ? -43.832 8.071   -30.658 0.02 31.26 ? 80  THR A HA   2  
ATOM   10531  H HB   . THR A 1 87  ? -43.726 9.896   -29.607 0.02 31.71 ? 80  THR A HB   2  
ATOM   10532  H HG1  . THR A 1 87  ? -43.375 11.691  -30.786 0.02 32.33 ? 80  THR A HG1  2  
ATOM   10533  H HG21 . THR A 1 87  ? -41.802 10.976  -28.988 0.02 31.86 ? 80  THR A HG21 2  
ATOM   10534  H HG22 . THR A 1 87  ? -41.525 9.432   -28.894 0.02 31.32 ? 80  THR A HG22 2  
ATOM   10535  H HG23 . THR A 1 87  ? -40.975 10.255  -30.127 0.02 31.46 ? 80  THR A HG23 2  
ATOM   10536  N N    . PRO A 1 88  ? -44.184 8.308   -33.099 0.02 31.55 ? 81  PRO A N    2  
ATOM   10537  C CA   . PRO A 1 88  ? -44.224 8.031   -34.539 0.02 31.50 ? 81  PRO A CA   2  
ATOM   10538  C C    . PRO A 1 88  ? -44.110 9.296   -35.370 0.02 31.80 ? 81  PRO A C    2  
ATOM   10539  O O    . PRO A 1 88  ? -44.153 10.418  -34.868 0.02 31.95 ? 81  PRO A O    2  
ATOM   10540  C CB   . PRO A 1 88  ? -45.593 7.381   -34.726 0.02 31.74 ? 81  PRO A CB   2  
ATOM   10541  C CG   . PRO A 1 88  ? -46.439 8.055   -33.640 0.02 32.13 ? 81  PRO A CG   2  
ATOM   10542  C CD   . PRO A 1 88  ? -45.522 8.343   -32.493 0.02 31.88 ? 81  PRO A CD   2  
ATOM   10543  H HA   . PRO A 1 88  ? -43.529 7.407   -34.792 0.02 31.18 ? 81  PRO A HA   2  
ATOM   10544  H HB2  . PRO A 1 88  ? -45.935 7.592   -35.608 0.02 31.91 ? 81  PRO A HB2  2  
ATOM   10545  H HB3  . PRO A 1 88  ? -45.540 6.424   -34.593 0.02 31.50 ? 81  PRO A HB3  2  
ATOM   10546  H HG2  . PRO A 1 88  ? -46.807 8.883   -33.983 0.02 32.43 ? 81  PRO A HG2  2  
ATOM   10547  H HG3  . PRO A 1 88  ? -47.150 7.463   -33.354 0.02 32.24 ? 81  PRO A HG3  2  
ATOM   10548  H HD2  . PRO A 1 88  ? -45.700 9.226   -32.131 0.02 32.14 ? 81  PRO A HD2  2  
ATOM   10549  H HD3  . PRO A 1 88  ? -45.612 7.658   -31.814 0.02 31.70 ? 81  PRO A HD3  2  
ATOM   10550  N N    . TRP A 1 89  ? -43.991 9.083   -36.679 0.02 31.92 ? 82  TRP A N    2  
ATOM   10551  C CA   . TRP A 1 89  ? -43.830 10.155  -37.643 0.02 32.25 ? 82  TRP A CA   2  
ATOM   10552  C C    . TRP A 1 89  ? -44.755 9.895   -38.819 0.02 32.47 ? 82  TRP A C    2  
ATOM   10553  O O    . TRP A 1 89  ? -45.013 8.755   -39.168 0.02 32.20 ? 82  TRP A O    2  
ATOM   10554  C CB   . TRP A 1 89  ? -42.376 10.245  -38.136 0.02 32.01 ? 82  TRP A CB   2  
ATOM   10555  C CG   . TRP A 1 89  ? -41.870 8.907   -38.686 0.02 31.56 ? 82  TRP A CG   2  
ATOM   10556  C CD1  . TRP A 1 89  ? -41.935 8.463   -39.986 0.02 31.56 ? 82  TRP A CD1  2  
ATOM   10557  C CD2  . TRP A 1 89  ? -41.262 7.840   -37.928 0.02 31.08 ? 82  TRP A CD2  2  
ATOM   10558  N NE1  . TRP A 1 89  ? -41.411 7.175   -40.070 0.02 31.12 ? 82  TRP A NE1  2  
ATOM   10559  C CE2  . TRP A 1 89  ? -40.980 6.788   -38.824 0.02 30.82 ? 82  TRP A CE2  2  
ATOM   10560  C CE3  . TRP A 1 89  ? -40.918 7.686   -36.574 0.02 30.88 ? 82  TRP A CE3  2  
ATOM   10561  C CZ2  . TRP A 1 89  ? -40.365 5.592   -38.410 0.02 30.37 ? 82  TRP A CZ2  2  
ATOM   10562  C CZ3  . TRP A 1 89  ? -40.321 6.501   -36.167 0.02 30.44 ? 82  TRP A CZ3  2  
ATOM   10563  C CH2  . TRP A 1 89  ? -40.048 5.468   -37.093 0.02 30.19 ? 82  TRP A CH2  2  
ATOM   10564  H H    . TRP A 1 89  ? -44.000 8.299   -37.030 0.02 31.82 ? 82  TRP A H    2  
ATOM   10565  H HA   . TRP A 1 89  ? -44.077 11.000  -37.241 0.02 32.55 ? 82  TRP A HA   2  
ATOM   10566  H HB2  . TRP A 1 89  ? -42.323 10.905  -38.846 0.02 32.26 ? 82  TRP A HB2  2  
ATOM   10567  H HB3  . TRP A 1 89  ? -41.801 10.498  -37.400 0.02 31.92 ? 82  TRP A HB3  2  
ATOM   10568  H HD1  . TRP A 1 89  ? -42.302 8.942   -40.695 0.02 31.85 ? 82  TRP A HD1  2  
ATOM   10569  H HE1  . TRP A 1 89  ? -41.341 6.710   -40.786 0.02 31.06 ? 82  TRP A HE1  2  
ATOM   10570  H HE3  . TRP A 1 89  ? -41.093 8.364   -35.963 0.02 31.07 ? 82  TRP A HE3  2  
ATOM   10571  H HZ2  . TRP A 1 89  ? -40.187 4.906   -39.012 0.02 30.22 ? 82  TRP A HZ2  2  
ATOM   10572  H HZ3  . TRP A 1 89  ? -40.088 6.391   -35.275 0.02 30.33 ? 82  TRP A HZ3  2  
ATOM   10573  H HH2  . TRP A 1 89  ? -39.645 4.683   -36.801 0.02 29.91 ? 82  TRP A HH2  2  
ATOM   10574  N N    . ALA A 1 90  ? -45.280 10.966  -39.426 0.02 33.00 ? 83  ALA A N    2  
ATOM   10575  C CA   . ALA A 1 90  ? -45.829 10.812  -40.762 0.02 33.23 ? 83  ALA A CA   2  
ATOM   10576  C C    . ALA A 1 90  ? -44.698 10.956  -41.765 0.02 33.13 ? 83  ALA A C    2  
ATOM   10577  O O    . ALA A 1 90  ? -43.557 11.295  -41.423 0.02 32.89 ? 83  ALA A O    2  
ATOM   10578  C CB   . ALA A 1 90  ? -46.944 11.830  -41.052 0.02 33.88 ? 83  ALA A CB   2  
ATOM   10579  H H    . ALA A 1 90  ? -45.306 11.760  -39.092 0.02 33.24 ? 83  ALA A H    2  
ATOM   10580  H HA   . ALA A 1 90  ? -46.190 9.931   -40.899 0.02 33.08 ? 83  ALA A HA   2  
ATOM   10581  H HB1  . ALA A 1 90  ? -47.157 11.795  -41.995 0.02 34.03 ? 83  ALA A HB1  2  
ATOM   10582  H HB2  . ALA A 1 90  ? -47.727 11.595  -40.527 0.02 33.96 ? 83  ALA A HB2  2  
ATOM   10583  H HB3  . ALA A 1 90  ? -46.630 12.724  -40.823 0.02 34.07 ? 83  ALA A HB3  2  
ATOM   10584  N N    . GLY A 1 91  ? -45.006 10.652  -43.010 0.02 33.36 ? 84  GLY A N    2  
ATOM   10585  C CA   . GLY A 1 91  ? -43.939 10.777  -43.965 0.02 33.29 ? 84  GLY A CA   2  
ATOM   10586  C C    . GLY A 1 91  ? -42.971 9.617   -43.828 0.02 32.75 ? 84  GLY A C    2  
ATOM   10587  O O    . GLY A 1 91  ? -43.332 8.506   -43.446 0.02 32.48 ? 84  GLY A O    2  
ATOM   10588  H H    . GLY A 1 91  ? -45.768 10.383  -43.302 0.02 33.58 ? 84  GLY A H    2  
ATOM   10589  H HA2  . GLY A 1 91  ? -44.301 10.762  -44.862 0.02 33.58 ? 84  GLY A HA2  2  
ATOM   10590  H HA3  . GLY A 1 91  ? -43.454 11.606  -43.835 0.02 33.32 ? 84  GLY A HA3  2  
ATOM   10591  N N    . VAL A 1 92  ? -41.718 9.897   -44.152 0.02 32.64 ? 85  VAL A N    2  
ATOM   10592  C CA   . VAL A 1 92  ? -40.690 8.883   -44.304 0.02 32.20 ? 85  VAL A CA   2  
ATOM   10593  C C    . VAL A 1 92  ? -39.445 9.368   -43.597 0.02 31.95 ? 85  VAL A C    2  
ATOM   10594  O O    . VAL A 1 92  ? -38.943 10.461  -43.883 0.02 32.20 ? 85  VAL A O    2  
ATOM   10595  C CB   . VAL A 1 92  ? -40.378 8.584   -45.777 0.02 32.39 ? 85  VAL A CB   2  
ATOM   10596  C CG1  . VAL A 1 92  ? -39.259 7.522   -45.868 0.02 31.96 ? 85  VAL A CG1  2  
ATOM   10597  C CG2  . VAL A 1 92  ? -41.619 8.120   -46.499 0.02 32.74 ? 85  VAL A CG2  2  
ATOM   10598  H H    . VAL A 1 92  ? -41.432 10.694  -44.287 0.02 32.84 ? 85  VAL A H    2  
ATOM   10599  H HA   . VAL A 1 92  ? -40.979 8.060   -43.883 0.02 31.98 ? 85  VAL A HA   2  
ATOM   10600  H HB   . VAL A 1 92  ? -40.057 9.389   -46.212 0.02 32.61 ? 85  VAL A HB   2  
ATOM   10601  H HG11 . VAL A 1 92  ? -39.242 7.151   -46.765 0.02 32.01 ? 85  VAL A HG11 2  
ATOM   10602  H HG12 . VAL A 1 92  ? -38.406 7.937   -45.668 0.02 31.98 ? 85  VAL A HG12 2  
ATOM   10603  H HG13 . VAL A 1 92  ? -39.443 6.819   -45.223 0.02 31.65 ? 85  VAL A HG13 2  
ATOM   10604  H HG21 . VAL A 1 92  ? -41.450 8.129   -47.454 0.02 32.80 ? 85  VAL A HG21 2  
ATOM   10605  H HG22 . VAL A 1 92  ? -41.827 7.219   -46.209 0.02 32.58 ? 85  VAL A HG22 2  
ATOM   10606  H HG23 . VAL A 1 92  ? -42.354 8.713   -46.292 0.02 33.07 ? 85  VAL A HG23 2  
ATOM   10607  N N    . ARG A 1 93  ? -38.918 8.528   -42.727 0.02 31.50 ? 86  ARG A N    2  
ATOM   10608  C CA   . ARG A 1 93  ? -37.746 8.869   -41.947 0.02 31.24 ? 86  ARG A CA   2  
ATOM   10609  C C    . ARG A 1 93  ? -36.496 8.321   -42.600 0.02 31.04 ? 86  ARG A C    2  
ATOM   10610  O O    . ARG A 1 93  ? -36.469 7.163   -43.007 0.02 30.82 ? 86  ARG A O    2  
ATOM   10611  C CB   . ARG A 1 93  ? -37.872 8.292   -40.547 0.02 30.88 ? 86  ARG A CB   2  
ATOM   10612  C CG   . ARG A 1 93  ? -36.530 8.066   -39.884 0.02 30.50 ? 86  ARG A CG   2  
ATOM   10613  C CD   . ARG A 1 93  ? -36.722 7.803   -38.448 0.02 30.18 ? 86  ARG A CD   2  
ATOM   10614  N NE   . ARG A 1 93  ? -36.810 9.052   -37.675 0.02 30.36 ? 86  ARG A NE   2  
ATOM   10615  C CZ   . ARG A 1 93  ? -36.091 9.293   -36.583 0.02 30.26 ? 86  ARG A CZ   2  
ATOM   10616  N NH1  . ARG A 1 93  ? -35.235 8.383   -36.122 0.02 29.99 ? 86  ARG A NH1  2  
ATOM   10617  N NH2  . ARG A 1 93  ? -36.240 10.432  -35.940 0.02 30.48 ? 86  ARG A NH2  2  
ATOM   10618  H H    . ARG A 1 93  ? -39.230 7.746   -42.566 0.02 31.35 ? 86  ARG A H    2  
ATOM   10619  H HA   . ARG A 1 93  ? -37.662 9.833   -41.889 0.02 31.47 ? 86  ARG A HA   2  
ATOM   10620  H HB2  . ARG A 1 93  ? -38.383 8.907   -40.000 0.02 31.02 ? 86  ARG A HB2  2  
ATOM   10621  H HB3  . ARG A 1 93  ? -38.329 7.443   -40.603 0.02 30.78 ? 86  ARG A HB3  2  
ATOM   10622  H HG2  . ARG A 1 93  ? -36.086 7.298   -40.272 0.02 30.36 ? 86  ARG A HG2  2  
ATOM   10623  H HG3  . ARG A 1 93  ? -35.981 8.862   -39.971 0.02 30.61 ? 86  ARG A HG3  2  
ATOM   10624  H HD2  . ARG A 1 93  ? -37.551 7.313   -38.330 0.02 30.15 ? 86  ARG A HD2  2  
ATOM   10625  H HD3  . ARG A 1 93  ? -35.983 7.265   -38.138 0.02 29.94 ? 86  ARG A HD3  2  
ATOM   10626  H HE   . ARG A 1 93  ? -37.407 9.628   -37.905 0.02 30.54 ? 86  ARG A HE   2  
ATOM   10627  H HH11 . ARG A 1 93  ? -35.126 7.635   -36.522 0.02 29.87 ? 86  ARG A HH11 2  
ATOM   10628  H HH12 . ARG A 1 93  ? -34.777 8.552   -35.418 0.02 29.96 ? 86  ARG A HH12 2  
ATOM   10629  H HH21 . ARG A 1 93  ? -36.795 11.020  -36.235 0.02 30.68 ? 86  ARG A HH21 2  
ATOM   10630  H HH22 . ARG A 1 93  ? -35.779 10.593  -35.231 0.02 30.44 ? 86  ARG A HH22 2  
ATOM   10631  N N    . ASP A 1 94  ? -35.459 9.149   -42.687 0.02 31.15 ? 87  ASP A N    2  
ATOM   10632  C CA   . ASP A 1 94  ? -34.203 8.684   -43.262 0.02 31.02 ? 87  ASP A CA   2  
ATOM   10633  C C    . ASP A 1 94  ? -33.507 7.721   -42.303 0.02 30.54 ? 87  ASP A C    2  
ATOM   10634  O O    . ASP A 1 94  ? -33.210 8.068   -41.155 0.02 30.43 ? 87  ASP A O    2  
ATOM   10635  C CB   . ASP A 1 94  ? -33.287 9.855   -43.594 0.02 31.36 ? 87  ASP A CB   2  
ATOM   10636  C CG   . ASP A 1 94  ? -32.288 9.510   -44.682 0.02 31.40 ? 87  ASP A CG   2  
ATOM   10637  O OD1  . ASP A 1 94  ? -31.903 8.318   -44.844 0.02 31.05 ? 87  ASP A OD1  2  
ATOM   10638  O OD2  . ASP A 1 94  ? -31.898 10.435  -45.406 0.02 31.82 ? 87  ASP A OD2  2  
ATOM   10639  H H    . ASP A 1 94  ? -35.457 9.966   -42.432 0.02 31.32 ? 87  ASP A H    2  
ATOM   10640  H HA   . ASP A 1 94  ? -34.388 8.206   -44.085 0.02 31.06 ? 87  ASP A HA   2  
ATOM   10641  H HB2  . ASP A 1 94  ? -33.823 10.601  -43.899 0.02 31.67 ? 87  ASP A HB2  2  
ATOM   10642  H HB3  . ASP A 1 94  ? -32.791 10.112  -42.802 0.02 31.28 ? 87  ASP A HB3  2  
ATOM   10643  N N    . CYS A 1 95  ? -33.220 6.531   -42.803 0.02 30.31 ? 88  CYS A N    2  
ATOM   10644  C CA   . CYS A 1 95  ? -32.406 5.530   -42.139 0.02 29.91 ? 88  CYS A CA   2  
ATOM   10645  C C    . CYS A 1 95  ? -31.244 5.119   -43.040 0.02 29.92 ? 88  CYS A C    2  
ATOM   10646  O O    . CYS A 1 95  ? -30.818 3.962   -43.068 0.02 29.65 ? 88  CYS A O    2  
ATOM   10647  C CB   . CYS A 1 95  ? -33.292 4.359   -41.735 0.02 29.64 ? 88  CYS A CB   2  
ATOM   10648  S SG   . CYS A 1 95  ? -34.557 4.901   -40.573 0.02 29.67 ? 88  CYS A SG   2  
ATOM   10649  H H    . CYS A 1 95  ? -33.499 6.271   -43.573 0.02 30.40 ? 88  CYS A H    2  
ATOM   10650  H HA   . CYS A 1 95  ? -32.029 5.914   -41.333 0.02 29.83 ? 88  CYS A HA   2  
ATOM   10651  H HB2  . CYS A 1 95  ? -33.744 4.023   -42.522 0.02 29.75 ? 88  CYS A HB2  2  
ATOM   10652  H HB3  . CYS A 1 95  ? -32.765 3.654   -41.335 0.02 29.40 ? 88  CYS A HB3  2  
ATOM   10653  H HG   . CYS A 1 95  ? -33.953 5.500   -39.735 0.02 29.63 ? 88  CYS A HG   2  
ATOM   10654  N N    . CYS A 1 96  ? -30.709 6.088   -43.788 0.02 30.27 ? 89  CYS A N    2  
ATOM   10655  C CA   . CYS A 1 96  ? -29.559 5.868   -44.651 0.02 30.38 ? 89  CYS A CA   2  
ATOM   10656  C C    . CYS A 1 96  ? -28.252 6.165   -43.960 0.02 30.30 ? 89  CYS A C    2  
ATOM   10657  O O    . CYS A 1 96  ? -27.193 6.056   -44.584 0.02 30.40 ? 89  CYS A O    2  
ATOM   10658  C CB   . CYS A 1 96  ? -29.685 6.703   -45.923 0.02 30.86 ? 89  CYS A CB   2  
ATOM   10659  S SG   . CYS A 1 96  ? -31.105 6.132   -46.791 0.02 31.01 ? 89  CYS A SG   2  
ATOM   10660  H H    . CYS A 1 96  ? -31.005 6.890   -43.801 0.02 30.48 ? 89  CYS A H    2  
ATOM   10661  H HA   . CYS A 1 96  ? -29.545 4.938   -44.919 0.02 30.22 ? 89  CYS A HA   2  
ATOM   10662  H HB2  . CYS A 1 96  ? -29.810 7.640   -45.704 0.02 31.04 ? 89  CYS A HB2  2  
ATOM   10663  H HB3  . CYS A 1 96  ? -28.900 6.585   -46.480 0.02 30.95 ? 89  CYS A HB3  2  
ATOM   10664  H HG   . CYS A 1 96  ? -32.083 6.142   -46.101 0.02 30.98 ? 89  CYS A HG   2  
ATOM   10665  N N    . ASN A 1 97  ? -28.306 6.523   -42.678 0.02 30.19 ? 90  ASN A N    2  
ATOM   10666  C CA   . ASN A 1 97  ? -27.117 6.744   -41.882 0.02 30.08 ? 90  ASN A CA   2  
ATOM   10667  C C    . ASN A 1 97  ? -27.320 6.183   -40.486 0.02 29.70 ? 90  ASN A C    2  
ATOM   10668  O O    . ASN A 1 97  ? -28.446 6.093   -39.988 0.02 29.58 ? 90  ASN A O    2  
ATOM   10669  C CB   . ASN A 1 97  ? -26.772 8.224   -41.745 0.02 30.45 ? 90  ASN A CB   2  
ATOM   10670  C CG   . ASN A 1 97  ? -25.773 8.655   -42.748 0.02 30.69 ? 90  ASN A CG   2  
ATOM   10671  O OD1  . ASN A 1 97  ? -24.734 8.011   -42.921 0.02 30.54 ? 90  ASN A OD1  2  
ATOM   10672  N ND2  . ASN A 1 97  ? -26.084 9.728   -43.459 0.02 31.12 ? 90  ASN A ND2  2  
ATOM   10673  H H    . ASN A 1 97  ? -29.036 6.638   -42.243 0.02 30.19 ? 90  ASN A H    2  
ATOM   10674  H HA   . ASN A 1 97  ? -26.368 6.282   -42.292 0.02 30.04 ? 90  ASN A HA   2  
ATOM   10675  H HB2  . ASN A 1 97  ? -27.578 8.750   -41.863 0.02 30.67 ? 90  ASN A HB2  2  
ATOM   10676  H HB3  . ASN A 1 97  ? -26.397 8.384   -40.867 0.02 30.34 ? 90  ASN A HB3  2  
ATOM   10677  H HD21 . ASN A 1 97  ? -25.515 10.059  -44.013 0.02 31.32 ? 90  ASN A HD21 2  
ATOM   10678  H HD22 . ASN A 1 97  ? -26.858 10.087  -43.366 0.02 31.21 ? 90  ASN A HD22 2  
ATOM   10679  N N    . HIS A 1 98  ? -26.212 5.823   -39.869 0.02 29.54 ? 91  HIS A N    2  
ATOM   10680  C CA   . HIS A 1 98  ? -26.233 5.384   -38.485 0.02 29.24 ? 91  HIS A CA   2  
ATOM   10681  C C    . HIS A 1 98  ? -26.524 6.580   -37.573 0.02 29.38 ? 91  HIS A C    2  
ATOM   10682  O O    . HIS A 1 98  ? -26.496 7.748   -37.994 0.02 29.73 ? 91  HIS A O    2  
ATOM   10683  C CB   . HIS A 1 98  ? -24.892 4.745   -38.146 0.02 29.11 ? 91  HIS A CB   2  
ATOM   10684  C CG   . HIS A 1 98  ? -23.752 5.708   -38.227 0.02 29.40 ? 91  HIS A CG   2  
ATOM   10685  N ND1  . HIS A 1 98  ? -22.647 5.510   -39.031 0.02 29.54 ? 91  HIS A ND1  2  
ATOM   10686  C CD2  . HIS A 1 98  ? -23.577 6.910   -37.632 0.02 29.62 ? 91  HIS A CD2  2  
ATOM   10687  C CE1  . HIS A 1 98  ? -21.830 6.546   -38.901 0.02 29.84 ? 91  HIS A CE1  2  
ATOM   10688  N NE2  . HIS A 1 98  ? -22.373 7.408   -38.062 0.02 29.90 ? 91  HIS A NE2  2  
ATOM   10689  H H    . HIS A 1 98  ? -25.433 5.831   -40.226 0.02 29.64 ? 91  HIS A H    2  
ATOM   10690  H HA   . HIS A 1 98  ? -26.936 4.728   -38.355 0.02 29.05 ? 91  HIS A HA   2  
ATOM   10691  H HB2  . HIS A 1 98  ? -24.925 4.374   -37.254 0.02 28.89 ? 91  HIS A HB2  2  
ATOM   10692  H HB3  . HIS A 1 98  ? -24.721 4.041   -38.786 0.02 29.09 ? 91  HIS A HB3  2  
ATOM   10693  H HD2  . HIS A 1 98  ? -24.164 7.316   -37.037 0.02 29.62 ? 91  HIS A HD2  2  
ATOM   10694  H HE1  . HIS A 1 98  ? -21.012 6.655   -39.331 0.02 30.01 ? 91  HIS A HE1  2  
ATOM   10695  H HE2  . HIS A 1 98  ? -22.030 8.161   -37.821 0.02 30.10 ? 91  HIS A HE2  2  
ATOM   10696  N N    . LYS A 1 99  ? -26.794 6.280   -36.313 0.02 29.14 ? 92  LYS A N    2  
ATOM   10697  C CA   . LYS A 1 99  ? -27.059 7.279   -35.290 0.02 29.25 ? 92  LYS A CA   2  
ATOM   10698  C C    . LYS A 1 99  ? -26.289 6.858   -34.031 0.02 29.05 ? 92  LYS A C    2  
ATOM   10699  O O    . LYS A 1 99  ? -26.165 5.667   -33.733 0.02 28.74 ? 92  LYS A O    2  
ATOM   10700  C CB   . LYS A 1 99  ? -28.583 7.423   -35.118 0.02 29.21 ? 92  LYS A CB   2  
ATOM   10701  C CG   . LYS A 1 99  ? -29.105 8.843   -35.550 0.02 29.52 ? 92  LYS A CG   2  
ATOM   10702  C CD   . LYS A 1 99  ? -30.561 8.911   -36.108 0.02 29.76 ? 92  LYS A CD   2  
ATOM   10703  C CE   . LYS A 1 99  ? -31.235 10.212  -35.626 0.02 30.19 ? 92  LYS A CE   2  
ATOM   10704  N NZ   . LYS A 1 99  ? -32.410 10.760  -36.403 0.02 30.42 ? 92  LYS A NZ   2  
ATOM   10705  H H    . LYS A 1 99  ? -26.818 5.476   -36.009 0.02 28.93 ? 92  LYS A H    2  
ATOM   10706  H HA   . LYS A 1 99  ? -26.702 8.129   -35.584 0.02 29.51 ? 92  LYS A HA   2  
ATOM   10707  H HB2  . LYS A 1 99  ? -29.025 6.763   -35.674 0.02 29.24 ? 92  LYS A HB2  2  
ATOM   10708  H HB3  . LYS A 1 99  ? -28.820 7.271   -34.193 0.02 28.99 ? 92  LYS A HB3  2  
ATOM   10709  H HG2  . LYS A 1 99  ? -29.066 9.429   -34.781 0.02 29.43 ? 92  LYS A HG2  2  
ATOM   10710  H HG3  . LYS A 1 99  ? -28.512 9.187   -36.215 0.02 29.71 ? 92  LYS A HG3  2  
ATOM   10711  H HD2  . LYS A 1 99  ? -30.540 8.921   -37.077 0.02 29.70 ? 92  LYS A HD2  2  
ATOM   10712  H HD3  . LYS A 1 99  ? -31.075 8.159   -35.786 0.02 29.72 ? 92  LYS A HD3  2  
ATOM   10713  H HE2  . LYS A 1 99  ? -31.551 10.056  -34.721 0.02 30.29 ? 92  LYS A HE2  2  
ATOM   10714  H HE3  . LYS A 1 99  ? -30.562 10.910  -35.610 0.02 30.26 ? 92  LYS A HE3  2  
ATOM   10715  H HZ1  . LYS A 1 99  ? -32.400 10.455  -37.240 0.02 30.40 ? 92  LYS A HZ1  2  
ATOM   10716  H HZ2  . LYS A 1 99  ? -33.171 10.513  -36.014 0.02 30.32 ? 92  LYS A HZ2  2  
ATOM   10717  H HZ3  . LYS A 1 99  ? -32.379 11.649  -36.421 0.02 30.70 ? 92  LYS A HZ3  2  
ATOM   10718  N N    . ASP A 1 100 ? -25.710 7.818   -33.289 0.02 29.26 ? 93  ASP A N    2  
ATOM   10719  C CA   . ASP A 1 100 ? -24.439 7.401   -32.699 0.02 29.15 ? 93  ASP A CA   2  
ATOM   10720  C C    . ASP A 1 100 ? -24.622 6.456   -31.520 0.02 28.87 ? 93  ASP A C    2  
ATOM   10721  O O    . ASP A 1 100 ? -25.719 6.024   -31.188 0.02 28.71 ? 93  ASP A O    2  
ATOM   10722  C CB   . ASP A 1 100 ? -23.548 8.552   -32.278 0.02 29.51 ? 93  ASP A CB   2  
ATOM   10723  C CG   . ASP A 1 100 ? -24.280 9.787   -32.085 0.02 29.76 ? 93  ASP A CG   2  
ATOM   10724  O OD1  . ASP A 1 100 ? -23.720 10.813  -32.471 0.02 30.09 ? 93  ASP A OD1  2  
ATOM   10725  O OD2  . ASP A 1 100 ? -25.408 9.701   -31.550 0.02 29.66 ? 93  ASP A OD2  2  
ATOM   10726  H H    . ASP A 1 100 ? -26.008 8.601   -33.116 0.02 29.45 ? 93  ASP A H    2  
ATOM   10727  H HA   . ASP A 1 100 ? -23.952 6.906   -33.380 0.02 29.06 ? 93  ASP A HA   2  
ATOM   10728  H HB2  . ASP A 1 100 ? -23.073 8.369   -31.454 0.02 29.47 ? 93  ASP A HB2  2  
ATOM   10729  H HB3  . ASP A 1 100 ? -22.909 8.702   -32.995 0.02 29.67 ? 93  ASP A HB3  2  
ATOM   10730  N N    . LYS A 1 101 ? -23.493 6.104   -30.944 0.02 28.85 ? 94  LYS A N    2  
ATOM   10731  C CA   . LYS A 1 101 ? -23.395 5.031   -29.978 0.02 28.57 ? 94  LYS A CA   2  
ATOM   10732  C C    . LYS A 1 101 ? -23.690 5.581   -28.585 0.02 28.65 ? 94  LYS A C    2  
ATOM   10733  O O    . LYS A 1 101 ? -23.723 6.789   -28.355 0.02 28.95 ? 94  LYS A O    2  
ATOM   10734  C CB   . LYS A 1 101 ? -22.007 4.386   -30.044 0.02 28.55 ? 94  LYS A CB   2  
ATOM   10735  C CG   . LYS A 1 101 ? -20.833 5.293   -29.645 0.02 28.88 ? 94  LYS A CG   2  
ATOM   10736  C CD   . LYS A 1 101 ? -19.488 4.564   -29.730 0.02 28.91 ? 94  LYS A CD   2  
ATOM   10737  C CE   . LYS A 1 101 ? -19.093 4.247   -31.170 0.02 28.95 ? 94  LYS A CE   2  
ATOM   10738  N NZ   . LYS A 1 101 ? -17.807 3.511   -31.269 0.02 28.99 ? 94  LYS A NZ   2  
ATOM   10739  H H    . LYS A 1 101 ? -22.736 6.475   -31.102 0.02 29.02 ? 94  LYS A H    2  
ATOM   10740  H HA   . LYS A 1 101 ? -24.057 4.352   -30.174 0.02 28.38 ? 94  LYS A HA   2  
ATOM   10741  H HB2  . LYS A 1 101 ? -21.993 3.614   -29.460 0.02 28.38 ? 94  LYS A HB2  2  
ATOM   10742  H HB3  . LYS A 1 101 ? -21.851 4.096   -30.952 0.02 28.53 ? 94  LYS A HB3  2  
ATOM   10743  H HG2  . LYS A 1 101 ? -20.808 6.061   -30.234 0.02 29.08 ? 94  LYS A HG2  2  
ATOM   10744  H HG3  . LYS A 1 101 ? -20.955 5.583   -28.726 0.02 28.91 ? 94  LYS A HG3  2  
ATOM   10745  H HD2  . LYS A 1 101 ? -18.791 5.112   -29.342 0.02 29.13 ? 94  LYS A HD2  2  
ATOM   10746  H HD3  . LYS A 1 101 ? -19.557 3.725   -29.253 0.02 28.70 ? 94  LYS A HD3  2  
ATOM   10747  H HE2  . LYS A 1 101 ? -19.777 3.691   -31.573 0.02 28.76 ? 94  LYS A HE2  2  
ATOM   10748  H HE3  . LYS A 1 101 ? -19.008 5.078   -31.666 0.02 29.19 ? 94  LYS A HE3  2  
ATOM   10749  H HZ1  . LYS A 1 101 ? -17.538 3.281   -30.454 0.02 28.81 ? 94  LYS A HZ1  2  
ATOM   10750  H HZ2  . LYS A 1 101 ? -17.920 2.774   -31.753 0.02 28.99 ? 94  LYS A HZ2  2  
ATOM   10751  H HZ3  . LYS A 1 101 ? -17.187 4.019   -31.655 0.02 29.21 ? 94  LYS A HZ3  2  
ATOM   10752  N N    . SER A 1 102 ? -23.905 4.667   -27.661 0.02 28.42 ? 95  SER A N    2  
ATOM   10753  C CA   . SER A 1 102 ? -24.193 5.058   -26.287 0.02 28.49 ? 95  SER A CA   2  
ATOM   10754  C C    . SER A 1 102 ? -22.987 5.762   -25.670 0.02 28.74 ? 95  SER A C    2  
ATOM   10755  O O    . SER A 1 102 ? -21.838 5.494   -26.014 0.02 28.77 ? 95  SER A O    2  
ATOM   10756  C CB   . SER A 1 102 ? -24.588 3.811   -25.497 0.02 28.22 ? 95  SER A CB   2  
ATOM   10757  O OG   . SER A 1 102 ? -24.999 4.132   -24.177 0.02 28.32 ? 95  SER A OG   2  
ATOM   10758  H H    . SER A 1 102 ? -23.883 3.824   -27.801 0.02 28.23 ? 95  SER A H    2  
ATOM   10759  H HA   . SER A 1 102 ? -24.940 5.674   -26.267 0.02 28.60 ? 95  SER A HA   2  
ATOM   10760  H HB2  . SER A 1 102 ? -25.318 3.367   -25.958 0.02 28.10 ? 95  SER A HB2  2  
ATOM   10761  H HB3  . SER A 1 102 ? -23.820 3.222   -25.459 0.02 28.13 ? 95  SER A HB3  2  
ATOM   10762  H HG   . SER A 1 102 ? -25.835 4.189   -24.144 0.02 28.32 ? 95  SER A HG   2  
ATOM   10763  N N    . VAL A 1 103 ? -23.252 6.695   -24.744 0.02 28.97 ? 96  VAL A N    2  
ATOM   10764  C CA   . VAL A 1 103 ? -22.157 7.412   -24.111 0.02 29.27 ? 96  VAL A CA   2  
ATOM   10765  C C    . VAL A 1 103 ? -21.218 6.401   -23.468 0.02 29.14 ? 96  VAL A C    2  
ATOM   10766  O O    . VAL A 1 103 ? -21.647 5.543   -22.690 0.02 28.93 ? 96  VAL A O    2  
ATOM   10767  C CB   . VAL A 1 103 ? -22.694 8.418   -23.074 0.02 29.54 ? 96  VAL A CB   2  
ATOM   10768  C CG1  . VAL A 1 103 ? -21.564 9.273   -22.522 0.02 29.91 ? 96  VAL A CG1  2  
ATOM   10769  C CG2  . VAL A 1 103 ? -23.785 9.279   -23.657 0.02 29.68 ? 96  VAL A CG2  2  
ATOM   10770  H H    . VAL A 1 103 ? -24.037 6.915   -24.472 0.02 28.98 ? 96  VAL A H    2  
ATOM   10771  H HA   . VAL A 1 103 ? -21.657 7.901   -24.779 0.02 29.42 ? 96  VAL A HA   2  
ATOM   10772  H HB   . VAL A 1 103 ? -23.077 7.926   -22.333 0.02 29.42 ? 96  VAL A HB   2  
ATOM   10773  H HG11 . VAL A 1 103 ? -21.924 9.875   -21.853 0.02 30.09 ? 96  VAL A HG11 2  
ATOM   10774  H HG12 . VAL A 1 103 ? -20.902 8.694   -22.115 0.02 29.84 ? 96  VAL A HG12 2  
ATOM   10775  H HG13 . VAL A 1 103 ? -21.159 9.776   -23.244 0.02 30.07 ? 96  VAL A HG13 2  
ATOM   10776  H HG21 . VAL A 1 103 ? -23.894 10.063  -23.098 0.02 29.93 ? 96  VAL A HG21 2  
ATOM   10777  H HG22 . VAL A 1 103 ? -23.526 9.545   -24.553 0.02 29.73 ? 96  VAL A HG22 2  
ATOM   10778  H HG23 . VAL A 1 103 ? -24.616 8.782   -23.683 0.02 29.49 ? 96  VAL A HG23 2  
ATOM   10779  N N    . GLN A 1 104 ? -19.933 6.518   -23.772 0.02 29.30 ? 97  GLN A N    2  
ATOM   10780  C CA   . GLN A 1 104 ? -18.954 5.528   -23.377 0.02 29.22 ? 97  GLN A CA   2  
ATOM   10781  C C    . GLN A 1 104 ? -17.572 6.131   -23.518 0.02 29.57 ? 97  GLN A C    2  
ATOM   10782  O O    . GLN A 1 104 ? -17.367 7.133   -24.214 0.02 29.85 ? 97  GLN A O    2  
ATOM   10783  C CB   . GLN A 1 104 ? -19.075 4.235   -24.210 0.02 28.87 ? 97  GLN A CB   2  
ATOM   10784  C CG   . GLN A 1 104 ? -18.854 4.439   -25.714 0.02 28.91 ? 97  GLN A CG   2  
ATOM   10785  C CD   . GLN A 1 104 ? -19.245 3.220   -26.517 0.02 28.58 ? 97  GLN A CD   2  
ATOM   10786  O OE1  . GLN A 1 104 ? -18.412 2.401   -26.819 0.02 28.53 ? 97  GLN A OE1  2  
ATOM   10787  N NE2  . GLN A 1 104 ? -20.504 3.100   -26.840 0.02 28.39 ? 97  GLN A NE2  2  
ATOM   10788  H H    . GLN A 1 104 ? -19.599 7.181   -24.198 0.02 29.49 ? 97  GLN A H    2  
ATOM   10789  H HA   . GLN A 1 104 ? -19.093 5.291   -22.450 0.02 29.19 ? 97  GLN A HA   2  
ATOM   10790  H HB2  . GLN A 1 104 ? -18.411 3.601   -23.902 0.02 28.83 ? 97  GLN A HB2  2  
ATOM   10791  H HB3  . GLN A 1 104 ? -19.966 3.868   -24.091 0.02 28.67 ? 97  GLN A HB3  2  
ATOM   10792  H HG2  . GLN A 1 104 ? -19.392 5.185   -26.017 0.02 29.01 ? 97  GLN A HG2  2  
ATOM   10793  H HG3  . GLN A 1 104 ? -17.914 4.616   -25.873 0.02 29.09 ? 97  GLN A HG3  2  
ATOM   10794  H HE21 . GLN A 1 104 ? -21.014 3.785   -26.849 0.02