data_5IVI
# 
_entry.id   5IVI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5IVI         
WWPDB D_1000219497 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5IVD PDB . 
unspecified 5IVH PDB . 
unspecified 5IVK PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5IVI 
_pdbx_database_status.recvd_initial_deposition_date   2016-03-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Correy, G.J.'  1 
'Jackson, C.J.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            24 
_citation.language                  ? 
_citation.page_first                977 
_citation.page_last                 987 
_citation.title                     
;Mapping the Accessible Conformational Landscape of an Insect Carboxylesterase Using Conformational Ensemble Analysis and Kinetic Crystallography.
;
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2016.04.009 
_citation.pdbx_database_id_PubMed   27210287 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Correy, G.J.'  1 
primary 'Carr, P.D.'    2 
primary 'Meirelles, T.' 3 
primary 'Mabbitt, P.D.' 4 
primary 'Fraser, N.J.'  5 
primary 'Weik, M.'      6 
primary 'Jackson, C.J.' 7 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5IVI 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     51.816 
_cell.length_a_esd                 ? 
_cell.length_b                     101.254 
_cell.length_b_esd                 ? 
_cell.length_c                     225.818 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5IVI 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Carboxylic ester hydrolase' 66388.836 1   3.1.1.- ? ? ? 
2 non-polymer man 'DIETHYL HYDROGEN PHOSPHATE' 154.102   1   ?       ? ? ? 
3 water       nat water                        18.015    390 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHMNFNVSLMEKLKWKIKCIENKFLNYRLTTNETVVAETEYGKVKGVKRLTVYDDSYYSFEGIPYAQPPVGELRF
KAPQRPTPWAGVRDCCNHKDKSVQVDFITGKVCGSEDCLYLSVYTNNLNPETKRPVLVYIHGGGFIIGENHRDMYGPDYF
IKKDVVLINIQYRLGALGFLSLNSEDLNVPGNAGLKDQVMALRWIKNNCANFGGNPDNITVFGESAGAASTHYMMLTEQT
RGLFHRGILMSGNAICPWANTQCQHRAFTLAKLAGYKGEDNDKDVLEFLMKAKPQDLIKLEEKVLTLEERTNKVMFPFGP
TVEPYQTADCVLPKHPREMVKTAWGNSIPTMMGNTSYEGLFFTSILKQMPLLVKELETCVNFVPSELADAERTAPETLEM
GAKIKKAHVTGETPTADNFMDLCSHFYFWFPMHRLLQLRFNHTSGTPVYLYRFDFDSEDLINPYRIMRSGRGVKGVSHTD
ELTYFFWNQLAKRMPKESREYKTIERMTGIWTQFATTGNPYSNEIEGMENVSWDPIEKSDEVYKCLNISDELKMIDVPEM
GKIKQWESMFEKHRDLF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHMNFNVSLMEKLKWKIKCIENKFLNYRLTTNETVVAETEYGKVKGVKRLTVYDDSYYSFEGIPYAQPPVGELRF
KAPQRPTPWAGVRDCCNHKDKSVQVDFITGKVCGSEDCLYLSVYTNNLNPETKRPVLVYIHGGGFIIGENHRDMYGPDYF
IKKDVVLINIQYRLGALGFLSLNSEDLNVPGNAGLKDQVMALRWIKNNCANFGGNPDNITVFGESAGAASTHYMMLTEQT
RGLFHRGILMSGNAICPWANTQCQHRAFTLAKLAGYKGEDNDKDVLEFLMKAKPQDLIKLEEKVLTLEERTNKVMFPFGP
TVEPYQTADCVLPKHPREMVKTAWGNSIPTMMGNTSYEGLFFTSILKQMPLLVKELETCVNFVPSELADAERTAPETLEM
GAKIKKAHVTGETPTADNFMDLCSHFYFWFPMHRLLQLRFNHTSGTPVYLYRFDFDSEDLINPYRIMRSGRGVKGVSHTD
ELTYFFWNQLAKRMPKESREYKTIERMTGIWTQFATTGNPYSNEIEGMENVSWDPIEKSDEVYKCLNISDELKMIDVPEM
GKIKQWESMFEKHRDLF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   MET n 
1 9   ASN n 
1 10  PHE n 
1 11  ASN n 
1 12  VAL n 
1 13  SER n 
1 14  LEU n 
1 15  MET n 
1 16  GLU n 
1 17  LYS n 
1 18  LEU n 
1 19  LYS n 
1 20  TRP n 
1 21  LYS n 
1 22  ILE n 
1 23  LYS n 
1 24  CYS n 
1 25  ILE n 
1 26  GLU n 
1 27  ASN n 
1 28  LYS n 
1 29  PHE n 
1 30  LEU n 
1 31  ASN n 
1 32  TYR n 
1 33  ARG n 
1 34  LEU n 
1 35  THR n 
1 36  THR n 
1 37  ASN n 
1 38  GLU n 
1 39  THR n 
1 40  VAL n 
1 41  VAL n 
1 42  ALA n 
1 43  GLU n 
1 44  THR n 
1 45  GLU n 
1 46  TYR n 
1 47  GLY n 
1 48  LYS n 
1 49  VAL n 
1 50  LYS n 
1 51  GLY n 
1 52  VAL n 
1 53  LYS n 
1 54  ARG n 
1 55  LEU n 
1 56  THR n 
1 57  VAL n 
1 58  TYR n 
1 59  ASP n 
1 60  ASP n 
1 61  SER n 
1 62  TYR n 
1 63  TYR n 
1 64  SER n 
1 65  PHE n 
1 66  GLU n 
1 67  GLY n 
1 68  ILE n 
1 69  PRO n 
1 70  TYR n 
1 71  ALA n 
1 72  GLN n 
1 73  PRO n 
1 74  PRO n 
1 75  VAL n 
1 76  GLY n 
1 77  GLU n 
1 78  LEU n 
1 79  ARG n 
1 80  PHE n 
1 81  LYS n 
1 82  ALA n 
1 83  PRO n 
1 84  GLN n 
1 85  ARG n 
1 86  PRO n 
1 87  THR n 
1 88  PRO n 
1 89  TRP n 
1 90  ALA n 
1 91  GLY n 
1 92  VAL n 
1 93  ARG n 
1 94  ASP n 
1 95  CYS n 
1 96  CYS n 
1 97  ASN n 
1 98  HIS n 
1 99  LYS n 
1 100 ASP n 
1 101 LYS n 
1 102 SER n 
1 103 VAL n 
1 104 GLN n 
1 105 VAL n 
1 106 ASP n 
1 107 PHE n 
1 108 ILE n 
1 109 THR n 
1 110 GLY n 
1 111 LYS n 
1 112 VAL n 
1 113 CYS n 
1 114 GLY n 
1 115 SER n 
1 116 GLU n 
1 117 ASP n 
1 118 CYS n 
1 119 LEU n 
1 120 TYR n 
1 121 LEU n 
1 122 SER n 
1 123 VAL n 
1 124 TYR n 
1 125 THR n 
1 126 ASN n 
1 127 ASN n 
1 128 LEU n 
1 129 ASN n 
1 130 PRO n 
1 131 GLU n 
1 132 THR n 
1 133 LYS n 
1 134 ARG n 
1 135 PRO n 
1 136 VAL n 
1 137 LEU n 
1 138 VAL n 
1 139 TYR n 
1 140 ILE n 
1 141 HIS n 
1 142 GLY n 
1 143 GLY n 
1 144 GLY n 
1 145 PHE n 
1 146 ILE n 
1 147 ILE n 
1 148 GLY n 
1 149 GLU n 
1 150 ASN n 
1 151 HIS n 
1 152 ARG n 
1 153 ASP n 
1 154 MET n 
1 155 TYR n 
1 156 GLY n 
1 157 PRO n 
1 158 ASP n 
1 159 TYR n 
1 160 PHE n 
1 161 ILE n 
1 162 LYS n 
1 163 LYS n 
1 164 ASP n 
1 165 VAL n 
1 166 VAL n 
1 167 LEU n 
1 168 ILE n 
1 169 ASN n 
1 170 ILE n 
1 171 GLN n 
1 172 TYR n 
1 173 ARG n 
1 174 LEU n 
1 175 GLY n 
1 176 ALA n 
1 177 LEU n 
1 178 GLY n 
1 179 PHE n 
1 180 LEU n 
1 181 SER n 
1 182 LEU n 
1 183 ASN n 
1 184 SER n 
1 185 GLU n 
1 186 ASP n 
1 187 LEU n 
1 188 ASN n 
1 189 VAL n 
1 190 PRO n 
1 191 GLY n 
1 192 ASN n 
1 193 ALA n 
1 194 GLY n 
1 195 LEU n 
1 196 LYS n 
1 197 ASP n 
1 198 GLN n 
1 199 VAL n 
1 200 MET n 
1 201 ALA n 
1 202 LEU n 
1 203 ARG n 
1 204 TRP n 
1 205 ILE n 
1 206 LYS n 
1 207 ASN n 
1 208 ASN n 
1 209 CYS n 
1 210 ALA n 
1 211 ASN n 
1 212 PHE n 
1 213 GLY n 
1 214 GLY n 
1 215 ASN n 
1 216 PRO n 
1 217 ASP n 
1 218 ASN n 
1 219 ILE n 
1 220 THR n 
1 221 VAL n 
1 222 PHE n 
1 223 GLY n 
1 224 GLU n 
1 225 SER n 
1 226 ALA n 
1 227 GLY n 
1 228 ALA n 
1 229 ALA n 
1 230 SER n 
1 231 THR n 
1 232 HIS n 
1 233 TYR n 
1 234 MET n 
1 235 MET n 
1 236 LEU n 
1 237 THR n 
1 238 GLU n 
1 239 GLN n 
1 240 THR n 
1 241 ARG n 
1 242 GLY n 
1 243 LEU n 
1 244 PHE n 
1 245 HIS n 
1 246 ARG n 
1 247 GLY n 
1 248 ILE n 
1 249 LEU n 
1 250 MET n 
1 251 SER n 
1 252 GLY n 
1 253 ASN n 
1 254 ALA n 
1 255 ILE n 
1 256 CYS n 
1 257 PRO n 
1 258 TRP n 
1 259 ALA n 
1 260 ASN n 
1 261 THR n 
1 262 GLN n 
1 263 CYS n 
1 264 GLN n 
1 265 HIS n 
1 266 ARG n 
1 267 ALA n 
1 268 PHE n 
1 269 THR n 
1 270 LEU n 
1 271 ALA n 
1 272 LYS n 
1 273 LEU n 
1 274 ALA n 
1 275 GLY n 
1 276 TYR n 
1 277 LYS n 
1 278 GLY n 
1 279 GLU n 
1 280 ASP n 
1 281 ASN n 
1 282 ASP n 
1 283 LYS n 
1 284 ASP n 
1 285 VAL n 
1 286 LEU n 
1 287 GLU n 
1 288 PHE n 
1 289 LEU n 
1 290 MET n 
1 291 LYS n 
1 292 ALA n 
1 293 LYS n 
1 294 PRO n 
1 295 GLN n 
1 296 ASP n 
1 297 LEU n 
1 298 ILE n 
1 299 LYS n 
1 300 LEU n 
1 301 GLU n 
1 302 GLU n 
1 303 LYS n 
1 304 VAL n 
1 305 LEU n 
1 306 THR n 
1 307 LEU n 
1 308 GLU n 
1 309 GLU n 
1 310 ARG n 
1 311 THR n 
1 312 ASN n 
1 313 LYS n 
1 314 VAL n 
1 315 MET n 
1 316 PHE n 
1 317 PRO n 
1 318 PHE n 
1 319 GLY n 
1 320 PRO n 
1 321 THR n 
1 322 VAL n 
1 323 GLU n 
1 324 PRO n 
1 325 TYR n 
1 326 GLN n 
1 327 THR n 
1 328 ALA n 
1 329 ASP n 
1 330 CYS n 
1 331 VAL n 
1 332 LEU n 
1 333 PRO n 
1 334 LYS n 
1 335 HIS n 
1 336 PRO n 
1 337 ARG n 
1 338 GLU n 
1 339 MET n 
1 340 VAL n 
1 341 LYS n 
1 342 THR n 
1 343 ALA n 
1 344 TRP n 
1 345 GLY n 
1 346 ASN n 
1 347 SER n 
1 348 ILE n 
1 349 PRO n 
1 350 THR n 
1 351 MET n 
1 352 MET n 
1 353 GLY n 
1 354 ASN n 
1 355 THR n 
1 356 SER n 
1 357 TYR n 
1 358 GLU n 
1 359 GLY n 
1 360 LEU n 
1 361 PHE n 
1 362 PHE n 
1 363 THR n 
1 364 SER n 
1 365 ILE n 
1 366 LEU n 
1 367 LYS n 
1 368 GLN n 
1 369 MET n 
1 370 PRO n 
1 371 LEU n 
1 372 LEU n 
1 373 VAL n 
1 374 LYS n 
1 375 GLU n 
1 376 LEU n 
1 377 GLU n 
1 378 THR n 
1 379 CYS n 
1 380 VAL n 
1 381 ASN n 
1 382 PHE n 
1 383 VAL n 
1 384 PRO n 
1 385 SER n 
1 386 GLU n 
1 387 LEU n 
1 388 ALA n 
1 389 ASP n 
1 390 ALA n 
1 391 GLU n 
1 392 ARG n 
1 393 THR n 
1 394 ALA n 
1 395 PRO n 
1 396 GLU n 
1 397 THR n 
1 398 LEU n 
1 399 GLU n 
1 400 MET n 
1 401 GLY n 
1 402 ALA n 
1 403 LYS n 
1 404 ILE n 
1 405 LYS n 
1 406 LYS n 
1 407 ALA n 
1 408 HIS n 
1 409 VAL n 
1 410 THR n 
1 411 GLY n 
1 412 GLU n 
1 413 THR n 
1 414 PRO n 
1 415 THR n 
1 416 ALA n 
1 417 ASP n 
1 418 ASN n 
1 419 PHE n 
1 420 MET n 
1 421 ASP n 
1 422 LEU n 
1 423 CYS n 
1 424 SER n 
1 425 HIS n 
1 426 PHE n 
1 427 TYR n 
1 428 PHE n 
1 429 TRP n 
1 430 PHE n 
1 431 PRO n 
1 432 MET n 
1 433 HIS n 
1 434 ARG n 
1 435 LEU n 
1 436 LEU n 
1 437 GLN n 
1 438 LEU n 
1 439 ARG n 
1 440 PHE n 
1 441 ASN n 
1 442 HIS n 
1 443 THR n 
1 444 SER n 
1 445 GLY n 
1 446 THR n 
1 447 PRO n 
1 448 VAL n 
1 449 TYR n 
1 450 LEU n 
1 451 TYR n 
1 452 ARG n 
1 453 PHE n 
1 454 ASP n 
1 455 PHE n 
1 456 ASP n 
1 457 SER n 
1 458 GLU n 
1 459 ASP n 
1 460 LEU n 
1 461 ILE n 
1 462 ASN n 
1 463 PRO n 
1 464 TYR n 
1 465 ARG n 
1 466 ILE n 
1 467 MET n 
1 468 ARG n 
1 469 SER n 
1 470 GLY n 
1 471 ARG n 
1 472 GLY n 
1 473 VAL n 
1 474 LYS n 
1 475 GLY n 
1 476 VAL n 
1 477 SER n 
1 478 HIS n 
1 479 THR n 
1 480 ASP n 
1 481 GLU n 
1 482 LEU n 
1 483 THR n 
1 484 TYR n 
1 485 PHE n 
1 486 PHE n 
1 487 TRP n 
1 488 ASN n 
1 489 GLN n 
1 490 LEU n 
1 491 ALA n 
1 492 LYS n 
1 493 ARG n 
1 494 MET n 
1 495 PRO n 
1 496 LYS n 
1 497 GLU n 
1 498 SER n 
1 499 ARG n 
1 500 GLU n 
1 501 TYR n 
1 502 LYS n 
1 503 THR n 
1 504 ILE n 
1 505 GLU n 
1 506 ARG n 
1 507 MET n 
1 508 THR n 
1 509 GLY n 
1 510 ILE n 
1 511 TRP n 
1 512 THR n 
1 513 GLN n 
1 514 PHE n 
1 515 ALA n 
1 516 THR n 
1 517 THR n 
1 518 GLY n 
1 519 ASN n 
1 520 PRO n 
1 521 TYR n 
1 522 SER n 
1 523 ASN n 
1 524 GLU n 
1 525 ILE n 
1 526 GLU n 
1 527 GLY n 
1 528 MET n 
1 529 GLU n 
1 530 ASN n 
1 531 VAL n 
1 532 SER n 
1 533 TRP n 
1 534 ASP n 
1 535 PRO n 
1 536 ILE n 
1 537 GLU n 
1 538 LYS n 
1 539 SER n 
1 540 ASP n 
1 541 GLU n 
1 542 VAL n 
1 543 TYR n 
1 544 LYS n 
1 545 CYS n 
1 546 LEU n 
1 547 ASN n 
1 548 ILE n 
1 549 SER n 
1 550 ASP n 
1 551 GLU n 
1 552 LEU n 
1 553 LYS n 
1 554 MET n 
1 555 ILE n 
1 556 ASP n 
1 557 VAL n 
1 558 PRO n 
1 559 GLU n 
1 560 MET n 
1 561 GLY n 
1 562 LYS n 
1 563 ILE n 
1 564 LYS n 
1 565 GLN n 
1 566 TRP n 
1 567 GLU n 
1 568 SER n 
1 569 MET n 
1 570 PHE n 
1 571 GLU n 
1 572 LYS n 
1 573 HIS n 
1 574 ARG n 
1 575 ASP n 
1 576 LEU n 
1 577 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   577 
_entity_src_gen.gene_src_common_name               'Green bottle fly' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 LcaE7 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Lucilia cuprina' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7375 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q25252_LUCCU 
_struct_ref.pdbx_db_accession          Q25252 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNFNVSLMEKLKWKIKCIENKFLNYRLTTNETVVAETEYGKVKGVKRLTVYDDSYYSFEGIPYAQPPVGELRFKAPQRPT
PWDGVRDCCNHKDKSVQVDFITGKVCGSEDCLYLSVYTNNLNPETKRPVLVYIHGGGFIIGENHRDMYGPDYFIKKDVVL
INIQYRLGALGFLSLNSEDLNVPGNAGLKDQVMALRWIKNNCANFGGNPDNITVFGESAGAASTHYMMLTEQTRGLFHRG
ILMSGNAICPWANTQCQHRAFTLAKLAGYKGEDNDKDVLEFLMKAKPQDLIKLEEKVLTLEERTNKVMFPFGPTVEPYQT
ADCVLPKHPREMVKTAWGNSIPTMMGNTSYEGLFFTSILKQMPMLVKELETCVNFVPSELADAERTAPETLEMGAKIKKA
HVTGETPTADNFMDLCSHIYFWFPMHRLLQLRFNHTSGTPVYLYRFDFDSEDLINPYRIMRSGRGVKGVSHADELTYFFW
NQLAKRMPKESREYKTIERMTGIWIQFATTGNPYSNEIEGMENVSWDPIKKSDEVYKCLNISDELKMIDVPEMDKIKQWE
SMFEKHRDLF
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5IVI 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 577 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q25252 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  570 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       570 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5IVI MET A 1   ? UNP Q25252 ?   ?   'initiating methionine' -6  1  
1 5IVI HIS A 2   ? UNP Q25252 ?   ?   'expression tag'        -5  2  
1 5IVI HIS A 3   ? UNP Q25252 ?   ?   'expression tag'        -4  3  
1 5IVI HIS A 4   ? UNP Q25252 ?   ?   'expression tag'        -3  4  
1 5IVI HIS A 5   ? UNP Q25252 ?   ?   'expression tag'        -2  5  
1 5IVI HIS A 6   ? UNP Q25252 ?   ?   'expression tag'        -1  6  
1 5IVI HIS A 7   ? UNP Q25252 ?   ?   'expression tag'        0   7  
1 5IVI ALA A 90  ? UNP Q25252 ASP 83  conflict                83  8  
1 5IVI LEU A 371 ? UNP Q25252 MET 364 conflict                364 9  
1 5IVI PHE A 426 ? UNP Q25252 ILE 419 conflict                419 10 
1 5IVI THR A 479 ? UNP Q25252 ALA 472 conflict                472 11 
1 5IVI THR A 512 ? UNP Q25252 ILE 505 conflict                505 12 
1 5IVI GLU A 537 ? UNP Q25252 LYS 530 conflict                530 13 
1 5IVI GLY A 561 ? UNP Q25252 ASP 554 conflict                554 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'   121.158 
DPF non-polymer         . 'DIETHYL HYDROGEN PHOSPHATE' ? 'C4 H11 O4 P'    154.102 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                        ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5IVI 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.26 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.67 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100mM sodium acetate pH 4.5, PEG 2K MME' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2010-05-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8266 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.8266 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5IVI 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.53 
_reflns.d_resolution_low                 42.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       89882 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.98 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.7 
_reflns.pdbx_Rmerge_I_obs                0.146 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.53 
_reflns_shell.d_res_low                   1.56 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.79 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5IVI 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.530 
_refine.ls_d_res_low                             42.0 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     89882 
_refine.ls_number_reflns_R_free                  4499 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.98 
_refine.ls_percent_reflns_R_free                 5.01 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1995 
_refine.ls_R_factor_R_free                       0.2359 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1976 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4FNG 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.32 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.20 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5IVI 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4564 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             390 
_refine_hist.number_atoms_total               4954 
_refine_hist.d_res_high                       1.530 
_refine_hist.d_res_low                        42.0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 7074 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.038  ? 9793 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 14.158 ? 2757 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 1036 ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 1325 ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.5300 1.5474  . . 137 2821 100.00 . . . 0.3344 . 0.2960 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5474 1.5656  . . 139 2819 100.00 . . . 0.3372 . 0.2915 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5656 1.5847  . . 137 2823 100.00 . . . 0.3212 . 0.2813 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5847 1.6048  . . 154 2798 100.00 . . . 0.3037 . 0.2663 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6048 1.6259  . . 152 2864 100.00 . . . 0.3402 . 0.2563 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6259 1.6481  . . 150 2763 100.00 . . . 0.2799 . 0.2444 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6481 1.6717  . . 156 2852 100.00 . . . 0.2875 . 0.2404 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6717 1.6966  . . 162 2749 100.00 . . . 0.2887 . 0.2298 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6966 1.7232  . . 159 2887 100.00 . . . 0.2453 . 0.2304 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7232 1.7514  . . 154 2759 100.00 . . . 0.2731 . 0.2168 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7514 1.7816  . . 160 2855 100.00 . . . 0.2733 . 0.2118 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7816 1.8140  . . 167 2764 100.00 . . . 0.2339 . 0.2036 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8140 1.8489  . . 156 2847 100.00 . . . 0.2583 . 0.1981 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8489 1.8866  . . 149 2800 100.00 . . . 0.2556 . 0.2075 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8866 1.9277  . . 134 2825 100.00 . . . 0.2734 . 0.2154 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9277 1.9725  . . 144 2875 100.00 . . . 0.2338 . 0.2095 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9725 2.0218  . . 178 2801 100.00 . . . 0.2504 . 0.2081 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0218 2.0765  . . 146 2818 100.00 . . . 0.2704 . 0.2030 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0765 2.1376  . . 138 2854 100.00 . . . 0.2389 . 0.2056 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1376 2.2066  . . 130 2866 100.00 . . . 0.2482 . 0.1996 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2066 2.2854  . . 146 2845 100.00 . . . 0.2573 . 0.2039 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2854 2.3769  . . 143 2884 100.00 . . . 0.2232 . 0.2051 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3769 2.4851  . . 148 2846 100.00 . . . 0.2733 . 0.2008 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4851 2.6161  . . 159 2841 100.00 . . . 0.2281 . 0.2024 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6161 2.7800  . . 144 2856 100.00 . . . 0.2417 . 0.1960 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7800 2.9946  . . 144 2908 100.00 . . . 0.2540 . 0.2008 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9946 3.2958  . . 148 2876 100.00 . . . 0.2404 . 0.1977 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2958 3.7725  . . 137 2921 100.00 . . . 0.1924 . 0.1782 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7725 4.7519  . . 154 2938 100.00 . . . 0.1728 . 0.1556 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7519 42.0250 . . 174 3028 100.00 . . . 0.1966 . 0.1625 . . . . . . . . . . 
# 
_struct.entry_id                     5IVI 
_struct.title                        
'The alpha-esterase-7 carboxylesterase, E3, from the blowfly Lucilia cuprina: phosphorylated enzyme qFit multi-conformer model' 
_struct.pdbx_descriptor              'Carboxylic ester hydrolase (E.C.3.1.1.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5IVI 
_struct_keywords.text            'carboxylesterase, organophosphate, protein dynamics, acetylcholinesterase, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 13  ? LEU A 34  ? SER A 6   LEU A 27  1 ? 22 
HELX_P HELX_P2  AA2 VAL A 75  ? ARG A 79  ? VAL A 68  ARG A 72  5 ? 5  
HELX_P HELX_P3  AA3 TYR A 159 ? LYS A 163 ? TYR A 152 LYS A 156 5 ? 5  
HELX_P HELX_P4  AA4 LEU A 174 ? LEU A 180 ? LEU A 167 LEU A 173 1 ? 7  
HELX_P HELX_P5  AA5 SER A 184 ? ASN A 188 ? SER A 177 ASN A 181 5 ? 5  
HELX_P HELX_P6  AA6 ASN A 192 ? CYS A 209 ? ASN A 185 CYS A 202 1 ? 18 
HELX_P HELX_P7  AA7 ALA A 210 ? PHE A 212 ? ALA A 203 PHE A 205 5 ? 3  
HELX_P HELX_P8  AA8 SER A 225 ? THR A 237 ? SER A 218 THR A 230 1 ? 13 
HELX_P HELX_P9  AA9 GLU A 238 ? ARG A 241 ? GLU A 231 ARG A 234 5 ? 4  
HELX_P HELX_P10 AB1 HIS A 265 ? ALA A 274 ? HIS A 258 ALA A 267 1 ? 10 
HELX_P HELX_P11 AB2 ASN A 281 ? LYS A 291 ? ASN A 274 LYS A 284 1 ? 11 
HELX_P HELX_P12 AB3 LYS A 293 ? GLU A 301 ? LYS A 286 GLU A 294 1 ? 9  
HELX_P HELX_P13 AB4 GLU A 302 ? VAL A 304 ? GLU A 295 VAL A 297 5 ? 3  
HELX_P HELX_P14 AB5 THR A 306 ? ASN A 312 ? THR A 299 ASN A 305 1 ? 7  
HELX_P HELX_P15 AB6 HIS A 335 ? LYS A 341 ? HIS A 328 LYS A 334 1 ? 7  
HELX_P HELX_P16 AB7 THR A 342 ? ILE A 348 ? THR A 335 ILE A 341 5 ? 7  
HELX_P HELX_P17 AB8 GLU A 358 ? PHE A 361 ? GLU A 351 PHE A 354 5 ? 4  
HELX_P HELX_P18 AB9 PHE A 362 ? MET A 369 ? PHE A 355 MET A 362 1 ? 8  
HELX_P HELX_P19 AC1 PRO A 370 ? THR A 378 ? PRO A 363 THR A 371 5 ? 9  
HELX_P HELX_P20 AC2 CYS A 379 ? VAL A 383 ? CYS A 372 VAL A 376 5 ? 5  
HELX_P HELX_P21 AC3 ALA A 394 ? VAL A 409 ? ALA A 387 VAL A 402 1 ? 16 
HELX_P HELX_P22 AC4 THR A 415 ? PHE A 428 ? THR A 408 PHE A 421 1 ? 14 
HELX_P HELX_P23 AC5 PHE A 428 ? ASN A 441 ? PHE A 421 ASN A 434 1 ? 14 
HELX_P HELX_P24 AC6 ASN A 462 ? ARG A 468 ? ASN A 455 ARG A 461 1 ? 7  
HELX_P HELX_P25 AC7 THR A 479 ? PHE A 485 ? THR A 472 PHE A 478 5 ? 7  
HELX_P HELX_P26 AC8 SER A 498 ? GLY A 518 ? SER A 491 GLY A 511 1 ? 21 
HELX_P HELX_P27 AC9 GLU A 559 ? SER A 568 ? GLU A 552 SER A 561 1 ? 10 
HELX_P HELX_P28 AD1 MET A 569 ? GLU A 571 ? MET A 562 GLU A 564 5 ? 3  
HELX_P HELX_P29 AD2 HIS A 573 ? PHE A 577 ? HIS A 566 PHE A 570 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        none 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           SER 
_struct_conn.ptnr1_label_seq_id            225 
_struct_conn.ptnr1_label_atom_id           OG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           DPF 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           P1 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            SER 
_struct_conn.ptnr1_auth_seq_id             218 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            DPF 
_struct_conn.ptnr2_auth_seq_id             601 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.545 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 12 ? 
AA3 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? anti-parallel 
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? parallel      
AA2 11 12 ? anti-parallel 
AA3 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  THR A 35  ? THR A 44  ? THR A 28  THR A 37  
AA1 2  GLY A 47  ? LEU A 55  ? GLY A 40  LEU A 48  
AA1 3  VAL A 92  ? ASP A 94  ? VAL A 85  ASP A 87  
AA2 1  THR A 35  ? THR A 44  ? THR A 28  THR A 37  
AA2 2  GLY A 47  ? LEU A 55  ? GLY A 40  LEU A 48  
AA2 3  SER A 61  ? PRO A 69  ? SER A 54  PRO A 62  
AA2 4  TYR A 120 ? THR A 125 ? TYR A 113 THR A 118 
AA2 5  VAL A 166 ? ILE A 170 ? VAL A 159 ILE A 163 
AA2 6  ARG A 134 ? ILE A 140 ? ARG A 127 ILE A 133 
AA2 7  GLY A 214 ? GLU A 224 ? GLY A 207 GLU A 217 
AA2 8  ARG A 246 ? MET A 250 ? ARG A 239 MET A 243 
AA2 9  THR A 350 ? THR A 355 ? THR A 343 THR A 348 
AA2 10 VAL A 448 ? PHE A 453 ? VAL A 441 PHE A 446 
AA2 11 LYS A 544 ? ILE A 548 ? LYS A 537 ILE A 541 
AA2 12 LEU A 552 ? ASP A 556 ? LEU A 545 ASP A 549 
AA3 1  GLN A 104 ? VAL A 105 ? GLN A 97  VAL A 98  
AA3 2  VAL A 112 ? CYS A 113 ? VAL A 105 CYS A 106 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 40  ? N VAL A 33  O GLY A 51  ? O GLY A 44  
AA1 2  3  N LYS A 50  ? N LYS A 43  O ARG A 93  ? O ARG A 86  
AA2 1  2  N VAL A 40  ? N VAL A 33  O GLY A 51  ? O GLY A 44  
AA2 2  3  N ARG A 54  ? N ARG A 47  O TYR A 62  ? O TYR A 55  
AA2 3  4  N TYR A 63  ? N TYR A 56  O THR A 125 ? O THR A 118 
AA2 4  5  N TYR A 124 ? N TYR A 117 O LEU A 167 ? O LEU A 160 
AA2 5  6  O VAL A 166 ? O VAL A 159 N LEU A 137 ? N LEU A 130 
AA2 6  7  N ARG A 134 ? N ARG A 127 O ASN A 215 ? O ASN A 208 
AA2 7  8  N GLY A 223 ? N GLY A 216 O MET A 250 ? O MET A 243 
AA2 8  9  N LEU A 249 ? N LEU A 242 O MET A 351 ? O MET A 344 
AA2 9  10 N ASN A 354 ? N ASN A 347 O PHE A 453 ? O PHE A 446 
AA2 10 11 N ARG A 452 ? N ARG A 445 O ILE A 548 ? O ILE A 541 
AA2 11 12 N ASN A 547 ? N ASN A 540 O LYS A 553 ? O LYS A 546 
AA3 1  2  N GLN A 104 ? N GLN A 97  O CYS A 113 ? O CYS A 106 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    DPF 
_struct_site.pdbx_auth_seq_id     601 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    9 
_struct_site.details              'binding site for residue DPF A 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 9 GLY A 143 ? GLY A 136 . ? 1_555 ? 
2 AC1 9 GLY A 144 ? GLY A 137 . ? 1_555 ? 
3 AC1 9 SER A 225 ? SER A 218 . ? 1_555 ? 
4 AC1 9 ALA A 226 ? ALA A 219 . ? 1_555 ? 
5 AC1 9 TRP A 258 ? TRP A 251 . ? 1_555 ? 
6 AC1 9 MET A 315 ? MET A 308 . ? 1_555 ? 
7 AC1 9 TYR A 464 ? TYR A 457 . ? 1_555 ? 
8 AC1 9 HIS A 478 ? HIS A 471 . ? 1_555 ? 
9 AC1 9 THR A 479 ? THR A 472 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5IVI 
_atom_sites.fract_transf_matrix[1][1]   0.019299 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009876 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004428 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 12  ? 2.649   -1.560  -27.810 1.00 30.12 ? 5    VAL A N   1 
ATOM   2    C CA  . VAL A 1 12  ? 2.319   -1.257  -29.198 1.00 18.52 ? 5    VAL A CA  1 
ATOM   3    C C   . VAL A 1 12  ? 1.252   -2.210  -29.746 1.00 22.66 ? 5    VAL A C   1 
ATOM   4    O O   . VAL A 1 12  ? 1.317   -3.419  -29.539 1.00 25.28 ? 5    VAL A O   1 
ATOM   5    C CB  . VAL A 1 12  ? 3.579   -1.326  -30.098 1.00 22.14 ? 5    VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 12  ? 3.239   -1.030  -31.537 1.00 23.08 ? 5    VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 12  ? 4.625   -0.343  -29.602 1.00 21.73 ? 5    VAL A CG2 1 
ATOM   8    N N   . SER A 1 13  ? 0.273   -1.656  -30.453 1.00 17.76 ? 6    SER A N   1 
ATOM   9    C CA  . SER A 1 13  ? -0.869  -2.425  -30.942 1.00 19.23 ? 6    SER A CA  1 
ATOM   10   C C   . SER A 1 13  ? -0.503  -3.434  -32.032 1.00 25.71 ? 6    SER A C   1 
ATOM   11   O O   . SER A 1 13  ? 0.535   -3.308  -32.694 1.00 18.40 ? 6    SER A O   1 
ATOM   12   C CB  . SER A 1 13  ? -1.932  -1.477  -31.480 1.00 15.90 ? 6    SER A CB  1 
ATOM   13   O OG  . SER A 1 13  ? -1.462  -0.845  -32.664 1.00 16.53 ? 6    SER A OG  1 
ATOM   14   N N   . LEU A 1 14  ? -1.368  -4.424  -32.230 1.00 19.57 ? 7    LEU A N   1 
ATOM   15   C CA  . LEU A 1 14  ? -1.147  -5.410  -33.289 1.00 16.35 ? 7    LEU A CA  1 
ATOM   16   C C   . LEU A 1 14  ? -1.020  -4.738  -34.653 1.00 25.10 ? 7    LEU A C   1 
ATOM   17   O O   . LEU A 1 14  ? -0.131  -5.088  -35.436 1.00 21.54 ? 7    LEU A O   1 
ATOM   18   C CB  . LEU A 1 14  ? -2.276  -6.445  -33.310 1.00 28.01 ? 7    LEU A CB  1 
ATOM   19   C CG  . LEU A 1 14  ? -2.159  -7.546  -34.369 1.00 40.69 ? 7    LEU A CG  1 
ATOM   20   C CD1 . LEU A 1 14  ? -0.832  -8.271  -34.236 1.00 25.92 ? 7    LEU A CD1 1 
ATOM   21   C CD2 . LEU A 1 14  ? -3.309  -8.525  -34.236 1.00 33.05 ? 7    LEU A CD2 1 
ATOM   22   N N   . MET A 1 15  ? -1.884  -3.764  -34.932 1.00 19.24 ? 8    MET A N   1 
ATOM   23   C CA  . MET A 1 15  ? -1.833  -3.067  -36.222 1.00 17.83 ? 8    MET A CA  1 
ATOM   24   C C   . MET A 1 15  ? -0.476  -2.391  -36.416 1.00 19.90 ? 8    MET A C   1 
ATOM   25   O O   . MET A 1 15  ? 0.104   -2.469  -37.500 1.00 19.57 ? 8    MET A O   1 
ATOM   26   C CB  A MET A 1 15  ? -2.960  -2.036  -36.340 0.29 21.51 ? 8    MET A CB  1 
ATOM   27   C CB  B MET A 1 15  ? -2.958  -2.040  -36.340 0.71 21.60 ? 8    MET A CB  1 
ATOM   28   C CG  A MET A 1 15  ? -3.748  -2.133  -37.645 0.29 29.74 ? 8    MET A CG  1 
ATOM   29   C CG  B MET A 1 15  ? -4.328  -2.646  -36.583 0.71 24.73 ? 8    MET A CG  1 
ATOM   30   S SD  A MET A 1 15  ? -4.185  -0.541  -38.380 0.29 31.02 ? 8    MET A SD  1 
ATOM   31   S SD  B MET A 1 15  ? -4.333  -3.833  -37.946 0.71 22.91 ? 8    MET A SD  1 
ATOM   32   C CE  A MET A 1 15  ? -3.165  -0.578  -39.854 0.29 24.78 ? 8    MET A CE  1 
ATOM   33   C CE  B MET A 1 15  ? -4.351  -5.357  -37.005 0.71 16.83 ? 8    MET A CE  1 
ATOM   34   N N   . GLU A 1 16  ? 0.058   -1.752  -35.381 1.00 15.64 ? 9    GLU A N   1 
ATOM   35   C CA  . GLU A 1 16  ? 1.344   -1.084  -35.587 1.00 22.30 ? 9    GLU A CA  1 
ATOM   36   C C   . GLU A 1 16  ? 2.476   -2.108  -35.613 1.00 19.61 ? 9    GLU A C   1 
ATOM   37   O O   . GLU A 1 16  ? 3.502   -1.891  -36.264 1.00 19.04 ? 9    GLU A O   1 
ATOM   38   C CB  A GLU A 1 16  ? 1.599   -0.023  -34.510 0.45 18.20 ? 9    GLU A CB  1 
ATOM   39   C CB  B GLU A 1 16  ? 1.601   -0.022  -34.510 0.55 18.19 ? 9    GLU A CB  1 
ATOM   40   C CG  A GLU A 1 16  ? 0.588   1.121   -34.495 0.45 20.56 ? 9    GLU A CG  1 
ATOM   41   C CG  B GLU A 1 16  ? 0.614   1.147   -34.517 0.55 20.49 ? 9    GLU A CG  1 
ATOM   42   C CD  A GLU A 1 16  ? 0.751   2.084   -35.656 0.45 30.98 ? 9    GLU A CD  1 
ATOM   43   C CD  B GLU A 1 16  ? 0.753   2.036   -35.734 0.55 31.02 ? 9    GLU A CD  1 
ATOM   44   O OE1 A GLU A 1 16  ? 1.729   1.954   -36.426 0.45 25.90 ? 9    GLU A OE1 1 
ATOM   45   O OE1 B GLU A 1 16  ? 1.638   2.917   -35.730 0.55 36.97 ? 9    GLU A OE1 1 
ATOM   46   O OE2 A GLU A 1 16  ? -0.101  2.985   -35.796 0.45 33.65 ? 9    GLU A OE2 1 
ATOM   47   O OE2 B GLU A 1 16  ? -0.029  1.861   -36.690 0.55 29.86 ? 9    GLU A OE2 1 
ATOM   48   N N   . LYS A 1 17  ? 2.299   -3.225  -34.922 1.00 17.11 ? 10   LYS A N   1 
ATOM   49   C CA  . LYS A 1 17  ? 3.284   -4.301  -34.982 1.00 17.07 ? 10   LYS A CA  1 
ATOM   50   C C   . LYS A 1 17  ? 3.385   -4.891  -36.387 1.00 19.02 ? 10   LYS A C   1 
ATOM   51   O O   . LYS A 1 17  ? 4.482   -5.190  -36.870 1.00 21.33 ? 10   LYS A O   1 
ATOM   52   C CB  . LYS A 1 17  ? 2.947   -5.405  -33.986 1.00 23.94 ? 10   LYS A CB  1 
ATOM   53   C CG  . LYS A 1 17  ? 3.336   -5.099  -32.549 1.00 25.57 ? 10   LYS A CG  1 
ATOM   54   C CD  . LYS A 1 17  ? 2.839   -6.193  -31.625 1.00 18.72 ? 10   LYS A CD  1 
ATOM   55   C CE  . LYS A 1 17  ? 3.333   -5.989  -30.212 1.00 32.42 ? 10   LYS A CE  1 
ATOM   56   N NZ  . LYS A 1 17  ? 3.076   -7.195  -29.376 1.00 54.04 ? 10   LYS A NZ  1 
ATOM   57   N N   A LEU A 1 18  ? 2.246   -5.134  -37.022 0.53 17.74 ? 11   LEU A N   1 
ATOM   58   N N   B LEU A 1 18  ? 2.243   -5.006  -37.059 0.47 18.01 ? 11   LEU A N   1 
ATOM   59   C CA  A LEU A 1 18  ? 2.270   -5.754  -38.341 0.53 19.81 ? 11   LEU A CA  1 
ATOM   60   C CA  B LEU A 1 18  ? 2.216   -5.414  -38.463 0.47 20.18 ? 11   LEU A CA  1 
ATOM   61   C C   A LEU A 1 18  ? 2.824   -4.787  -39.380 0.53 25.42 ? 11   LEU A C   1 
ATOM   62   C C   B LEU A 1 18  ? 2.873   -4.387  -39.382 0.47 23.48 ? 11   LEU A C   1 
ATOM   63   O O   A LEU A 1 18  ? 3.516   -5.193  -40.320 0.53 16.18 ? 11   LEU A O   1 
ATOM   64   O O   B LEU A 1 18  ? 3.701   -4.740  -40.230 0.47 17.99 ? 11   LEU A O   1 
ATOM   65   C CB  A LEU A 1 18  ? 0.874   -6.236  -38.733 0.53 22.95 ? 11   LEU A CB  1 
ATOM   66   C CB  B LEU A 1 18  ? 0.782   -5.651  -38.927 0.47 19.08 ? 11   LEU A CB  1 
ATOM   67   C CG  A LEU A 1 18  ? 0.335   -7.309  -37.787 0.53 24.25 ? 11   LEU A CG  1 
ATOM   68   C CG  B LEU A 1 18  ? 0.018   -6.799  -38.278 0.47 23.44 ? 11   LEU A CG  1 
ATOM   69   C CD1 A LEU A 1 18  ? -1.108  -7.668  -38.116 0.53 20.51 ? 11   LEU A CD1 1 
ATOM   70   C CD1 B LEU A 1 18  ? -1.374  -6.862  -38.867 0.47 17.39 ? 11   LEU A CD1 1 
ATOM   71   C CD2 A LEU A 1 18  ? 1.228   -8.541  -37.825 0.53 31.26 ? 11   LEU A CD2 1 
ATOM   72   C CD2 B LEU A 1 18  ? 0.755   -8.112  -38.479 0.47 21.68 ? 11   LEU A CD2 1 
ATOM   73   N N   A LYS A 1 19  ? 2.529   -3.504  -39.206 0.53 16.25 ? 12   LYS A N   1 
ATOM   74   N N   B LYS A 1 19  ? 2.474   -3.125  -39.232 0.47 15.70 ? 12   LYS A N   1 
ATOM   75   C CA  A LYS A 1 19  ? 3.059   -2.493  -40.105 0.53 17.20 ? 12   LYS A CA  1 
ATOM   76   C CA  B LYS A 1 19  ? 3.042   -2.035  -40.017 0.47 19.81 ? 12   LYS A CA  1 
ATOM   77   C C   A LYS A 1 19  ? 4.578   -2.386  -39.940 0.53 16.74 ? 12   LYS A C   1 
ATOM   78   C C   B LYS A 1 19  ? 4.562   -2.005  -39.886 0.47 18.26 ? 12   LYS A C   1 
ATOM   79   O O   A LYS A 1 19  ? 5.309   -2.348  -40.924 0.53 15.32 ? 12   LYS A O   1 
ATOM   80   O O   B LYS A 1 19  ? 5.271   -1.675  -40.838 0.47 17.69 ? 12   LYS A O   1 
ATOM   81   C CB  A LYS A 1 19  ? 2.382   -1.147  -39.856 0.53 19.50 ? 12   LYS A CB  1 
ATOM   82   C CB  B LYS A 1 19  ? 2.468   -0.686  -39.579 0.47 17.48 ? 12   LYS A CB  1 
ATOM   83   C CG  A LYS A 1 19  ? 0.923   -1.118  -40.310 0.53 19.22 ? 12   LYS A CG  1 
ATOM   84   C CG  B LYS A 1 19  ? 1.148   -0.287  -40.229 0.47 29.90 ? 12   LYS A CG  1 
ATOM   85   C CD  A LYS A 1 19  ? 0.353   0.291   -40.276 0.53 27.95 ? 12   LYS A CD  1 
ATOM   86   C CD  B LYS A 1 19  ? 0.885   1.205   -40.013 0.47 26.38 ? 12   LYS A CD  1 
ATOM   87   C CE  A LYS A 1 19  ? 0.172   0.783   -38.852 0.53 32.62 ? 12   LYS A CE  1 
ATOM   88   C CE  B LYS A 1 19  ? -0.471  1.643   -40.555 0.47 36.56 ? 12   LYS A CE  1 
ATOM   89   N NZ  A LYS A 1 19  ? -0.109  2.244   -38.785 0.53 30.94 ? 12   LYS A NZ  1 
ATOM   90   N NZ  B LYS A 1 19  ? -0.590  3.134   -40.607 0.47 31.03 ? 12   LYS A NZ  1 
ATOM   91   N N   . TRP A 1 20  ? 5.047   -2.347  -38.695 1.00 16.99 ? 13   TRP A N   1 
ATOM   92   C CA  . TRP A 1 20  ? 6.481   -2.366  -38.416 1.00 15.35 ? 13   TRP A CA  1 
ATOM   93   C C   . TRP A 1 20  ? 7.192   -3.500  -39.136 1.00 17.65 ? 13   TRP A C   1 
ATOM   94   O O   . TRP A 1 20  ? 8.257   -3.297  -39.725 1.00 17.48 ? 13   TRP A O   1 
ATOM   95   C CB  . TRP A 1 20  ? 6.718   -2.483  -36.911 1.00 14.96 ? 13   TRP A CB  1 
ATOM   96   C CG  . TRP A 1 20  ? 8.167   -2.436  -36.504 1.00 19.48 ? 13   TRP A CG  1 
ATOM   97   C CD1 . TRP A 1 20  ? 8.928   -3.467  -36.043 1.00 25.44 ? 13   TRP A CD1 1 
ATOM   98   C CD2 . TRP A 1 20  ? 9.010   -1.288  -36.519 1.00 15.22 ? 13   TRP A CD2 1 
ATOM   99   N NE1 . TRP A 1 20  ? 10.202  -3.026  -35.758 1.00 18.81 ? 13   TRP A NE1 1 
ATOM   100  C CE2 . TRP A 1 20  ? 10.276  -1.690  -36.052 1.00 19.98 ? 13   TRP A CE2 1 
ATOM   101  C CE3 . TRP A 1 20  ? 8.822   0.044   -36.885 1.00 16.64 ? 13   TRP A CE3 1 
ATOM   102  C CZ2 . TRP A 1 20  ? 11.341  -0.803  -35.935 1.00 16.02 ? 13   TRP A CZ2 1 
ATOM   103  C CZ3 . TRP A 1 20  ? 9.881   0.921   -36.773 1.00 21.14 ? 13   TRP A CZ3 1 
ATOM   104  C CH2 . TRP A 1 20  ? 11.125  0.495   -36.298 1.00 17.60 ? 13   TRP A CH2 1 
ATOM   105  N N   . LYS A 1 21  ? 6.590   -4.686  -39.107 1.00 19.53 ? 14   LYS A N   1 
ATOM   106  C CA  . LYS A 1 21  ? 7.205   -5.861  -39.711 1.00 20.51 ? 14   LYS A CA  1 
ATOM   107  C C   . LYS A 1 21  ? 7.313   -5.679  -41.223 1.00 19.82 ? 14   LYS A C   1 
ATOM   108  O O   . LYS A 1 21  ? 8.321   -6.047  -41.829 1.00 20.48 ? 14   LYS A O   1 
ATOM   109  C CB  . LYS A 1 21  ? 6.410   -7.123  -39.367 1.00 27.09 ? 14   LYS A CB  1 
ATOM   110  C CG  . LYS A 1 21  ? 6.574   -8.256  -40.354 1.00 39.31 ? 14   LYS A CG  1 
ATOM   111  C CD  . LYS A 1 21  ? 6.018   -9.560  -39.802 1.00 49.18 ? 14   LYS A CD  1 
ATOM   112  C CE  . LYS A 1 21  ? 5.693   -10.529 -40.935 1.00 53.63 ? 14   LYS A CE  1 
ATOM   113  N NZ  . LYS A 1 21  ? 5.469   -9.812  -42.232 1.00 47.96 ? 14   LYS A NZ  1 
ATOM   114  N N   A ILE A 1 22  ? 6.267   -5.121  -41.827 0.46 17.62 ? 15   ILE A N   1 
ATOM   115  N N   B ILE A 1 22  ? 6.277   -5.100  -41.823 0.54 17.63 ? 15   ILE A N   1 
ATOM   116  C CA  A ILE A 1 22  ? 6.297   -4.780  -43.242 0.46 17.36 ? 15   ILE A CA  1 
ATOM   117  C CA  B ILE A 1 22  ? 6.294   -4.791  -43.246 0.54 17.41 ? 15   ILE A CA  1 
ATOM   118  C C   A ILE A 1 22  ? 7.435   -3.806  -43.534 0.46 18.45 ? 15   ILE A C   1 
ATOM   119  C C   B ILE A 1 22  ? 7.382   -3.762  -43.574 0.54 18.53 ? 15   ILE A C   1 
ATOM   120  O O   A ILE A 1 22  ? 8.183   -3.975  -44.503 0.46 18.05 ? 15   ILE A O   1 
ATOM   121  O O   B ILE A 1 22  ? 8.046   -3.852  -44.612 0.54 18.38 ? 15   ILE A O   1 
ATOM   122  C CB  A ILE A 1 22  ? 4.963   -4.170  -43.701 0.46 17.57 ? 15   ILE A CB  1 
ATOM   123  C CB  B ILE A 1 22  ? 4.920   -4.279  -43.713 0.54 17.59 ? 15   ILE A CB  1 
ATOM   124  C CG1 A ILE A 1 22  ? 3.901   -5.262  -43.808 0.46 18.24 ? 15   ILE A CG1 1 
ATOM   125  C CG1 B ILE A 1 22  ? 3.860   -5.350  -43.456 0.54 21.03 ? 15   ILE A CG1 1 
ATOM   126  C CG2 A ILE A 1 22  ? 5.120   -3.482  -45.049 0.46 17.37 ? 15   ILE A CG2 1 
ATOM   127  C CG2 B ILE A 1 22  ? 4.948   -3.919  -45.188 0.54 17.43 ? 15   ILE A CG2 1 
ATOM   128  C CD1 A ILE A 1 22  ? 4.236   -6.324  -44.832 0.46 23.09 ? 15   ILE A CD1 1 
ATOM   129  C CD1 B ILE A 1 22  ? 2.498   -5.016  -44.007 0.54 19.28 ? 15   ILE A CD1 1 
ATOM   130  N N   . LYS A 1 23  ? 7.572   -2.793  -42.685 1.00 13.78 ? 16   LYS A N   1 
ATOM   131  C CA  . LYS A 1 23  ? 8.623   -1.796  -42.859 1.00 20.69 ? 16   LYS A CA  1 
ATOM   132  C C   . LYS A 1 23  ? 10.025  -2.386  -42.687 1.00 19.13 ? 16   LYS A C   1 
ATOM   133  O O   . LYS A 1 23  ? 10.967  -1.973  -43.371 1.00 24.59 ? 16   LYS A O   1 
ATOM   134  C CB  A LYS A 1 23  ? 8.419   -0.638  -41.884 0.39 20.29 ? 16   LYS A CB  1 
ATOM   135  C CB  B LYS A 1 23  ? 8.425   -0.643  -41.880 0.61 20.26 ? 16   LYS A CB  1 
ATOM   136  C CG  A LYS A 1 23  ? 7.323   0.331   -42.295 0.39 22.99 ? 16   LYS A CG  1 
ATOM   137  C CG  B LYS A 1 23  ? 7.325   0.319   -42.275 0.61 23.06 ? 16   LYS A CG  1 
ATOM   138  C CD  A LYS A 1 23  ? 7.783   1.219   -43.448 0.39 25.71 ? 16   LYS A CD  1 
ATOM   139  C CD  B LYS A 1 23  ? 7.723   1.090   -43.524 0.61 26.05 ? 16   LYS A CD  1 
ATOM   140  C CE  A LYS A 1 23  ? 6.643   2.066   -43.997 0.39 19.20 ? 16   LYS A CE  1 
ATOM   141  C CE  B LYS A 1 23  ? 6.656   2.092   -43.925 0.61 19.12 ? 16   LYS A CE  1 
ATOM   142  N NZ  A LYS A 1 23  ? 5.665   1.258   -44.779 0.39 25.26 ? 16   LYS A NZ  1 
ATOM   143  N NZ  B LYS A 1 23  ? 6.955   2.665   -45.265 0.61 18.49 ? 16   LYS A NZ  1 
ATOM   144  N N   . CYS A 1 24  ? 10.172  -3.346  -41.784 1.00 16.88 ? 17   CYS A N   1 
ATOM   145  C CA  . CYS A 1 24  ? 11.450  -4.036  -41.652 1.00 14.93 ? 17   CYS A CA  1 
ATOM   146  C C   . CYS A 1 24  ? 11.798  -4.803  -42.938 1.00 19.47 ? 17   CYS A C   1 
ATOM   147  O O   . CYS A 1 24  ? 12.961  -4.832  -43.347 1.00 21.46 ? 17   CYS A O   1 
ATOM   148  C CB  . CYS A 1 24  ? 11.431  -4.987  -40.447 1.00 20.38 ? 17   CYS A CB  1 
ATOM   149  S SG  . CYS A 1 24  ? 11.288  -4.157  -38.822 1.00 21.58 ? 17   CYS A SG  1 
ATOM   150  N N   A ILE A 1 25  ? 10.794  -5.418  -43.563 0.41 20.54 ? 18   ILE A N   1 
ATOM   151  N N   B ILE A 1 25  ? 10.802  -5.420  -43.572 0.59 20.47 ? 18   ILE A N   1 
ATOM   152  C CA  A ILE A 1 25  ? 11.000  -6.141  -44.817 0.41 22.62 ? 18   ILE A CA  1 
ATOM   153  C CA  B ILE A 1 25  ? 11.055  -6.146  -44.814 0.59 22.57 ? 18   ILE A CA  1 
ATOM   154  C C   A ILE A 1 25  ? 11.361  -5.174  -45.930 0.41 24.23 ? 18   ILE A C   1 
ATOM   155  C C   B ILE A 1 25  ? 11.383  -5.164  -45.929 0.59 24.33 ? 18   ILE A C   1 
ATOM   156  O O   A ILE A 1 25  ? 12.269  -5.430  -46.719 0.41 20.72 ? 18   ILE A O   1 
ATOM   157  O O   B ILE A 1 25  ? 12.304  -5.397  -46.716 0.59 20.72 ? 18   ILE A O   1 
ATOM   158  C CB  A ILE A 1 25  ? 9.748   -6.934  -45.250 0.41 24.02 ? 18   ILE A CB  1 
ATOM   159  C CB  B ILE A 1 25  ? 9.855   -7.018  -45.249 0.59 24.02 ? 18   ILE A CB  1 
ATOM   160  C CG1 A ILE A 1 25  ? 9.359   -7.965  -44.196 0.41 21.44 ? 18   ILE A CG1 1 
ATOM   161  C CG1 B ILE A 1 25  ? 9.532   -8.072  -44.195 0.59 21.28 ? 18   ILE A CG1 1 
ATOM   162  C CG2 A ILE A 1 25  ? 9.987   -7.633  -46.586 0.41 19.36 ? 18   ILE A CG2 1 
ATOM   163  C CG2 B ILE A 1 25  ? 10.149  -7.711  -46.578 0.59 18.96 ? 18   ILE A CG2 1 
ATOM   164  C CD1 A ILE A 1 25  ? 8.007   -8.585  -44.445 0.41 22.36 ? 18   ILE A CD1 1 
ATOM   165  C CD1 B ILE A 1 25  ? 10.598  -9.130  -44.039 0.59 29.18 ? 18   ILE A CD1 1 
ATOM   166  N N   . GLU A 1 26  ? 10.638  -4.061  -45.993 1.00 18.47 ? 19   GLU A N   1 
ATOM   167  C CA  . GLU A 1 26  ? 10.886  -3.049  -47.023 1.00 19.24 ? 19   GLU A CA  1 
ATOM   168  C C   . GLU A 1 26  ? 12.274  -2.433  -46.876 1.00 24.72 ? 19   GLU A C   1 
ATOM   169  O O   . GLU A 1 26  ? 12.955  -2.182  -47.872 1.00 23.82 ? 19   GLU A O   1 
ATOM   170  C CB  . GLU A 1 26  ? 9.817   -1.958  -46.980 1.00 25.46 ? 19   GLU A CB  1 
ATOM   171  C CG  . GLU A 1 26  ? 8.474   -2.422  -47.489 1.00 30.37 ? 19   GLU A CG  1 
ATOM   172  C CD  . GLU A 1 26  ? 7.370   -1.395  -47.290 1.00 41.84 ? 19   GLU A CD  1 
ATOM   173  O OE1 . GLU A 1 26  ? 7.640   -0.329  -46.700 1.00 33.17 ? 19   GLU A OE1 1 
ATOM   174  O OE2 . GLU A 1 26  ? 6.230   -1.655  -47.735 1.00 36.47 ? 19   GLU A OE2 1 
ATOM   175  N N   A ASN A 1 27  ? 12.698  -2.199  -45.641 0.60 19.56 ? 20   ASN A N   1 
ATOM   176  N N   B ASN A 1 27  ? 12.678  -2.181  -45.633 0.40 19.53 ? 20   ASN A N   1 
ATOM   177  C CA  A ASN A 1 27  ? 14.018  -1.642  -45.404 0.60 17.39 ? 20   ASN A CA  1 
ATOM   178  C CA  B ASN A 1 27  ? 14.007  -1.657  -45.341 0.40 17.32 ? 20   ASN A CA  1 
ATOM   179  C C   A ASN A 1 27  ? 15.129  -2.608  -45.833 0.60 19.51 ? 20   ASN A C   1 
ATOM   180  C C   B ASN A 1 27  ? 15.100  -2.553  -45.915 0.40 19.48 ? 20   ASN A C   1 
ATOM   181  O O   A ASN A 1 27  ? 16.215  -2.170  -46.221 0.60 20.01 ? 20   ASN A O   1 
ATOM   182  O O   B ASN A 1 27  ? 16.089  -2.061  -46.462 0.40 17.87 ? 20   ASN A O   1 
ATOM   183  C CB  A ASN A 1 27  ? 14.179  -1.262  -43.937 0.60 19.42 ? 20   ASN A CB  1 
ATOM   184  C CB  B ASN A 1 27  ? 14.206  -1.498  -43.831 0.40 19.48 ? 20   ASN A CB  1 
ATOM   185  C CG  A ASN A 1 27  ? 15.185  -0.150  -43.740 0.60 26.91 ? 20   ASN A CG  1 
ATOM   186  C CG  B ASN A 1 27  ? 15.616  -1.050  -43.470 0.40 20.72 ? 20   ASN A CG  1 
ATOM   187  O OD1 A ASN A 1 27  ? 16.164  -0.297  -43.005 0.60 17.46 ? 20   ASN A OD1 1 
ATOM   188  O OD1 B ASN A 1 27  ? 16.043  0.044   -43.838 0.40 19.39 ? 20   ASN A OD1 1 
ATOM   189  N ND2 A ASN A 1 27  ? 14.959  0.968   -44.417 0.60 14.72 ? 20   ASN A ND2 1 
ATOM   190  N ND2 B ASN A 1 27  ? 16.339  -1.892  -42.743 0.40 15.06 ? 20   ASN A ND2 1 
ATOM   191  N N   A LYS A 1 28  ? 14.855  -3.911  -45.752 0.60 19.17 ? 21   LYS A N   1 
ATOM   192  N N   B LYS A 1 28  ? 14.910  -3.865  -45.788 0.40 19.21 ? 21   LYS A N   1 
ATOM   193  C CA  A LYS A 1 28  ? 15.760  -4.939  -46.273 0.60 20.48 ? 21   LYS A CA  1 
ATOM   194  C CA  B LYS A 1 28  ? 15.874  -4.845  -46.278 0.40 20.72 ? 21   LYS A CA  1 
ATOM   195  C C   A LYS A 1 28  ? 16.056  -4.671  -47.739 0.60 21.33 ? 21   LYS A C   1 
ATOM   196  C C   B LYS A 1 28  ? 16.077  -4.723  -47.779 0.40 21.43 ? 21   LYS A C   1 
ATOM   197  O O   A LYS A 1 28  ? 17.219  -4.606  -48.164 0.60 19.70 ? 21   LYS A O   1 
ATOM   198  O O   B LYS A 1 28  ? 17.207  -4.811  -48.272 0.40 19.81 ? 21   LYS A O   1 
ATOM   199  C CB  A LYS A 1 28  ? 15.153  -6.342  -46.134 0.60 31.44 ? 21   LYS A CB  1 
ATOM   200  C CB  B LYS A 1 28  ? 15.429  -6.267  -45.925 0.40 30.01 ? 21   LYS A CB  1 
ATOM   201  C CG  A LYS A 1 28  ? 15.762  -7.252  -45.069 0.60 35.01 ? 21   LYS A CG  1 
ATOM   202  C CG  B LYS A 1 28  ? 16.332  -6.960  -44.915 0.40 39.07 ? 21   LYS A CG  1 
ATOM   203  C CD  A LYS A 1 28  ? 15.319  -6.850  -43.681 0.60 39.53 ? 21   LYS A CD  1 
ATOM   204  C CD  B LYS A 1 28  ? 16.724  -5.982  -43.824 0.40 37.61 ? 21   LYS A CD  1 
ATOM   205  C CE  A LYS A 1 28  ? 15.060  -8.063  -42.801 0.60 40.32 ? 21   LYS A CE  1 
ATOM   206  C CE  B LYS A 1 28  ? 17.766  -6.538  -42.876 0.40 25.58 ? 21   LYS A CE  1 
ATOM   207  N NZ  A LYS A 1 28  ? 13.766  -7.924  -42.068 0.60 27.26 ? 21   LYS A NZ  1 
ATOM   208  N NZ  B LYS A 1 28  ? 18.243  -5.466  -41.955 0.40 28.64 ? 21   LYS A NZ  1 
ATOM   209  N N   . PHE A 1 29  ? 14.985  -4.517  -48.508 1.00 18.59 ? 22   PHE A N   1 
ATOM   210  C CA  . PHE A 1 29  ? 15.088  -4.373  -49.953 1.00 20.10 ? 22   PHE A CA  1 
ATOM   211  C C   . PHE A 1 29  ? 15.699  -3.048  -50.352 1.00 18.60 ? 22   PHE A C   1 
ATOM   212  O O   . PHE A 1 29  ? 16.524  -2.993  -51.264 1.00 19.38 ? 22   PHE A O   1 
ATOM   213  C CB  A PHE A 1 29  ? 13.708  -4.469  -50.605 0.54 18.20 ? 22   PHE A CB  1 
ATOM   214  C CB  B PHE A 1 29  ? 13.725  -4.588  -50.600 0.46 18.13 ? 22   PHE A CB  1 
ATOM   215  C CG  A PHE A 1 29  ? 13.172  -5.861  -50.722 0.54 23.58 ? 22   PHE A CG  1 
ATOM   216  C CG  B PHE A 1 29  ? 13.322  -6.034  -50.648 0.46 23.05 ? 22   PHE A CG  1 
ATOM   217  C CD1 A PHE A 1 29  ? 13.180  -6.516  -51.946 0.54 21.37 ? 22   PHE A CD1 1 
ATOM   218  C CD1 B PHE A 1 29  ? 14.033  -6.932  -51.432 0.46 29.89 ? 22   PHE A CD1 1 
ATOM   219  C CD2 A PHE A 1 29  ? 12.624  -6.505  -49.626 0.54 26.00 ? 22   PHE A CD2 1 
ATOM   220  C CD2 B PHE A 1 29  ? 12.252  -6.502  -49.904 0.46 27.60 ? 22   PHE A CD2 1 
ATOM   221  C CE1 A PHE A 1 29  ? 12.675  -7.788  -52.067 0.54 25.19 ? 22   PHE A CE1 1 
ATOM   222  C CE1 B PHE A 1 29  ? 13.684  -8.265  -51.480 0.46 23.35 ? 22   PHE A CE1 1 
ATOM   223  C CE2 A PHE A 1 29  ? 12.115  -7.780  -49.740 0.54 23.97 ? 22   PHE A CE2 1 
ATOM   224  C CE2 B PHE A 1 29  ? 11.892  -7.837  -49.948 0.46 24.38 ? 22   PHE A CE2 1 
ATOM   225  C CZ  A PHE A 1 29  ? 12.142  -8.425  -50.963 0.54 32.93 ? 22   PHE A CZ  1 
ATOM   226  C CZ  B PHE A 1 29  ? 12.611  -8.722  -50.737 0.46 31.03 ? 22   PHE A CZ  1 
ATOM   227  N N   . LEU A 1 30  ? 15.288  -1.980  -49.681 1.00 19.25 ? 23   LEU A N   1 
ATOM   228  C CA  . LEU A 1 30  ? 15.833  -0.659  -49.948 1.00 16.76 ? 23   LEU A CA  1 
ATOM   229  C C   . LEU A 1 30  ? 17.333  -0.645  -49.705 1.00 15.12 ? 23   LEU A C   1 
ATOM   230  O O   . LEU A 1 30  ? 18.100  -0.139  -50.521 1.00 16.58 ? 23   LEU A O   1 
ATOM   231  C CB  . LEU A 1 30  ? 15.155  0.400   -49.073 1.00 18.14 ? 23   LEU A CB  1 
ATOM   232  C CG  . LEU A 1 30  ? 15.654  1.832   -49.300 1.00 18.18 ? 23   LEU A CG  1 
ATOM   233  C CD1 . LEU A 1 30  ? 15.534  2.199   -50.764 1.00 18.99 ? 23   LEU A CD1 1 
ATOM   234  C CD2 . LEU A 1 30  ? 14.925  2.857   -48.423 1.00 20.07 ? 23   LEU A CD2 1 
ATOM   235  N N   A ASN A 1 31  ? 17.746  -1.206  -48.577 0.39 16.47 ? 24   ASN A N   1 
ATOM   236  N N   B ASN A 1 31  ? 17.751  -1.206  -48.581 0.61 16.45 ? 24   ASN A N   1 
ATOM   237  C CA  A ASN A 1 31  ? 19.151  -1.207  -48.195 0.39 14.05 ? 24   ASN A CA  1 
ATOM   238  C CA  B ASN A 1 31  ? 19.156  -1.182  -48.209 0.61 13.89 ? 24   ASN A CA  1 
ATOM   239  C C   A ASN A 1 31  ? 20.023  -1.886  -49.247 0.39 18.59 ? 24   ASN A C   1 
ATOM   240  C C   B ASN A 1 31  ? 20.028  -1.885  -49.251 0.61 18.50 ? 24   ASN A C   1 
ATOM   241  O O   A ASN A 1 31  ? 21.126  -1.421  -49.546 0.39 16.91 ? 24   ASN A O   1 
ATOM   242  O O   B ASN A 1 31  ? 21.135  -1.430  -49.552 0.61 16.91 ? 24   ASN A O   1 
ATOM   243  C CB  A ASN A 1 31  ? 19.323  -1.884  -46.834 0.39 21.06 ? 24   ASN A CB  1 
ATOM   244  C CB  B ASN A 1 31  ? 19.338  -1.811  -46.823 0.61 21.16 ? 24   ASN A CB  1 
ATOM   245  C CG  A ASN A 1 31  ? 20.744  -1.810  -46.322 0.39 22.81 ? 24   ASN A CG  1 
ATOM   246  C CG  B ASN A 1 31  ? 20.774  -1.769  -46.350 0.61 22.87 ? 24   ASN A CG  1 
ATOM   247  O OD1 A ASN A 1 31  ? 21.144  -0.814  -45.720 0.39 24.87 ? 24   ASN A OD1 1 
ATOM   248  O OD1 B ASN A 1 31  ? 21.285  -0.715  -45.969 0.61 24.52 ? 24   ASN A OD1 1 
ATOM   249  N ND2 A ASN A 1 31  ? 21.515  -2.869  -46.554 0.39 24.03 ? 24   ASN A ND2 1 
ATOM   250  N ND2 B ASN A 1 31  ? 21.437  -2.923  -46.367 0.61 24.22 ? 24   ASN A ND2 1 
ATOM   251  N N   . TYR A 1 32  ? 19.516  -2.974  -49.820 1.00 20.99 ? 25   TYR A N   1 
ATOM   252  C CA  . TYR A 1 32  ? 20.236  -3.675  -50.880 1.00 14.13 ? 25   TYR A CA  1 
ATOM   253  C C   . TYR A 1 32  ? 20.346  -2.781  -52.109 1.00 18.97 ? 25   TYR A C   1 
ATOM   254  O O   . TYR A 1 32  ? 21.430  -2.655  -52.706 1.00 15.29 ? 25   TYR A O   1 
ATOM   255  C CB  . TYR A 1 32  ? 19.554  -5.000  -51.247 1.00 15.46 ? 25   TYR A CB  1 
ATOM   256  C CG  . TYR A 1 32  ? 20.282  -5.720  -52.364 1.00 17.04 ? 25   TYR A CG  1 
ATOM   257  C CD1 . TYR A 1 32  ? 21.470  -6.395  -52.123 1.00 23.41 ? 25   TYR A CD1 1 
ATOM   258  C CD2 . TYR A 1 32  ? 19.796  -5.693  -53.665 1.00 32.23 ? 25   TYR A CD2 1 
ATOM   259  C CE1 . TYR A 1 32  ? 22.148  -7.036  -53.148 1.00 35.85 ? 25   TYR A CE1 1 
ATOM   260  C CE2 . TYR A 1 32  ? 20.471  -6.336  -54.698 1.00 22.63 ? 25   TYR A CE2 1 
ATOM   261  C CZ  . TYR A 1 32  ? 21.641  -7.005  -54.430 1.00 37.31 ? 25   TYR A CZ  1 
ATOM   262  O OH  . TYR A 1 32  ? 22.315  -7.644  -55.451 1.00 36.23 ? 25   TYR A OH  1 
ATOM   263  N N   A ARG A 1 33  ? 19.239  -2.144  -52.486 0.80 13.27 ? 26   ARG A N   1 
ATOM   264  N N   B ARG A 1 33  ? 19.238  -2.143  -52.472 0.20 13.64 ? 26   ARG A N   1 
ATOM   265  C CA  A ARG A 1 33  ? 19.242  -1.301  -53.676 0.80 16.05 ? 26   ARG A CA  1 
ATOM   266  C CA  B ARG A 1 33  ? 19.204  -1.286  -53.647 0.20 16.06 ? 26   ARG A CA  1 
ATOM   267  C C   A ARG A 1 33  ? 20.204  -0.124  -53.513 0.80 21.62 ? 26   ARG A C   1 
ATOM   268  C C   B ARG A 1 33  ? 20.160  -0.101  -53.512 0.20 21.26 ? 26   ARG A C   1 
ATOM   269  O O   A ARG A 1 33  ? 20.782  0.349   -54.488 0.80 17.22 ? 26   ARG A O   1 
ATOM   270  O O   B ARG A 1 33  ? 20.673  0.403   -54.508 0.20 17.48 ? 26   ARG A O   1 
ATOM   271  C CB  A ARG A 1 33  ? 17.830  -0.807  -54.001 0.80 18.02 ? 26   ARG A CB  1 
ATOM   272  C CB  B ARG A 1 33  ? 17.779  -0.792  -53.904 0.20 17.91 ? 26   ARG A CB  1 
ATOM   273  C CG  A ARG A 1 33  ? 16.955  -1.858  -54.655 0.80 16.68 ? 26   ARG A CG  1 
ATOM   274  C CG  B ARG A 1 33  ? 17.140  -1.382  -55.147 0.20 19.28 ? 26   ARG A CG  1 
ATOM   275  C CD  A ARG A 1 33  ? 15.582  -1.302  -55.013 0.80 22.95 ? 26   ARG A CD  1 
ATOM   276  C CD  B ARG A 1 33  ? 15.759  -0.799  -55.393 0.20 17.47 ? 26   ARG A CD  1 
ATOM   277  N NE  A ARG A 1 33  ? 15.668  -0.133  -55.876 0.80 20.20 ? 26   ARG A NE  1 
ATOM   278  N NE  B ARG A 1 33  ? 15.614  -0.325  -56.767 0.20 23.92 ? 26   ARG A NE  1 
ATOM   279  C CZ  A ARG A 1 33  ? 15.701  -0.188  -57.207 0.80 19.06 ? 26   ARG A CZ  1 
ATOM   280  C CZ  B ARG A 1 33  ? 15.932  0.903   -57.166 0.20 21.64 ? 26   ARG A CZ  1 
ATOM   281  N NH1 A ARG A 1 33  ? 15.659  -1.362  -57.831 0.80 13.85 ? 26   ARG A NH1 1 
ATOM   282  N NH1 B ARG A 1 33  ? 16.412  1.781   -56.294 0.20 16.45 ? 26   ARG A NH1 1 
ATOM   283  N NH2 A ARG A 1 33  ? 15.779  0.933   -57.907 0.80 16.29 ? 26   ARG A NH2 1 
ATOM   284  N NH2 B ARG A 1 33  ? 15.771  1.256   -58.432 0.20 23.33 ? 26   ARG A NH2 1 
ATOM   285  N N   . LEU A 1 34  ? 20.418  0.331   -52.281 1.00 15.71 ? 27   LEU A N   1 
ATOM   286  C CA  . LEU A 1 34  ? 21.278  1.496   -52.057 1.00 11.86 ? 27   LEU A CA  1 
ATOM   287  C C   . LEU A 1 34  ? 22.739  1.109   -51.793 1.00 15.28 ? 27   LEU A C   1 
ATOM   288  O O   . LEU A 1 34  ? 23.598  1.974   -51.642 1.00 19.27 ? 27   LEU A O   1 
ATOM   289  C CB  . LEU A 1 34  ? 20.742  2.337   -50.885 1.00 14.37 ? 27   LEU A CB  1 
ATOM   290  C CG  . LEU A 1 34  ? 19.318  2.880   -51.024 1.00 13.80 ? 27   LEU A CG  1 
ATOM   291  C CD1 . LEU A 1 34  ? 18.830  3.418   -49.683 1.00 19.14 ? 27   LEU A CD1 1 
ATOM   292  C CD2 . LEU A 1 34  ? 19.185  3.973   -52.074 1.00 18.49 ? 27   LEU A CD2 1 
ATOM   293  N N   A THR A 1 35  ? 23.020  -0.189  -51.726 0.72 12.93 ? 28   THR A N   1 
ATOM   294  N N   B THR A 1 35  ? 23.003  -0.190  -51.726 0.28 13.29 ? 28   THR A N   1 
ATOM   295  C CA  A THR A 1 35  ? 24.395  -0.665  -51.543 0.72 13.07 ? 28   THR A CA  1 
ATOM   296  C CA  B THR A 1 35  ? 24.369  -0.677  -51.597 0.28 13.23 ? 28   THR A CA  1 
ATOM   297  C C   A THR A 1 35  ? 25.127  -0.715  -52.879 0.72 18.65 ? 28   THR A C   1 
ATOM   298  C C   B THR A 1 35  ? 25.047  -0.623  -52.961 0.28 18.21 ? 28   THR A C   1 
ATOM   299  O O   A THR A 1 35  ? 24.667  -1.376  -53.805 0.72 19.95 ? 28   THR A O   1 
ATOM   300  O O   B THR A 1 35  ? 24.503  -1.120  -53.945 0.28 19.16 ? 28   THR A O   1 
ATOM   301  C CB  A THR A 1 35  ? 24.433  -2.073  -50.904 0.72 16.23 ? 28   THR A CB  1 
ATOM   302  C CB  B THR A 1 35  ? 24.416  -2.120  -51.049 0.28 15.89 ? 28   THR A CB  1 
ATOM   303  O OG1 A THR A 1 35  ? 23.745  -2.053  -49.648 0.72 18.62 ? 28   THR A OG1 1 
ATOM   304  O OG1 B THR A 1 35  ? 23.710  -2.189  -49.804 0.28 17.59 ? 28   THR A OG1 1 
ATOM   305  C CG2 A THR A 1 35  ? 25.875  -2.560  -50.693 0.72 16.04 ? 28   THR A CG2 1 
ATOM   306  C CG2 B THR A 1 35  ? 25.857  -2.577  -50.839 0.28 15.48 ? 28   THR A CG2 1 
ATOM   307  N N   A THR A 1 36  ? 26.261  -0.024  -52.987 0.72 14.27 ? 29   THR A N   1 
ATOM   308  N N   B THR A 1 36  ? 26.219  0.000   -53.027 0.28 14.56 ? 29   THR A N   1 
ATOM   309  C CA  A THR A 1 36  ? 27.023  -0.052  -54.241 0.72 12.88 ? 29   THR A CA  1 
ATOM   310  C CA  B THR A 1 36  ? 26.983  0.013   -54.272 0.28 13.02 ? 29   THR A CA  1 
ATOM   311  C C   A THR A 1 36  ? 28.134  -1.093  -54.187 0.72 16.17 ? 29   THR A C   1 
ATOM   312  C C   B THR A 1 36  ? 28.072  -1.049  -54.206 0.28 16.06 ? 29   THR A C   1 
ATOM   313  O O   A THR A 1 36  ? 28.308  -1.794  -53.188 0.72 16.08 ? 29   THR A O   1 
ATOM   314  O O   B THR A 1 36  ? 28.184  -1.776  -53.218 0.28 16.08 ? 29   THR A O   1 
ATOM   315  C CB  A THR A 1 36  ? 27.640  1.331   -54.580 0.72 10.10 ? 29   THR A CB  1 
ATOM   316  C CB  B THR A 1 36  ? 27.622  1.392   -54.555 0.28 10.50 ? 29   THR A CB  1 
ATOM   317  O OG1 A THR A 1 36  ? 28.818  1.581   -53.795 0.72 13.82 ? 29   THR A OG1 1 
ATOM   318  O OG1 B THR A 1 36  ? 28.765  1.594   -53.712 0.28 14.25 ? 29   THR A OG1 1 
ATOM   319  C CG2 A THR A 1 36  ? 26.636  2.463   -54.392 0.72 15.84 ? 29   THR A CG2 1 
ATOM   320  C CG2 B THR A 1 36  ? 26.615  2.520   -54.343 0.28 15.77 ? 29   THR A CG2 1 
ATOM   321  N N   A ASN A 1 37  ? 28.881  -1.197  -55.289 0.72 11.02 ? 30   ASN A N   1 
ATOM   322  N N   B ASN A 1 37  ? 28.869  -1.144  -55.266 0.28 11.67 ? 30   ASN A N   1 
ATOM   323  C CA  A ASN A 1 37  ? 30.005  -2.107  -55.372 0.72 17.53 ? 30   ASN A CA  1 
ATOM   324  C CA  B ASN A 1 37  ? 29.966  -2.096  -55.302 0.28 17.57 ? 30   ASN A CA  1 
ATOM   325  C C   A ASN A 1 37  ? 31.336  -1.422  -55.107 0.72 16.25 ? 30   ASN A C   1 
ATOM   326  C C   B ASN A 1 37  ? 31.319  -1.413  -55.135 0.28 16.04 ? 30   ASN A C   1 
ATOM   327  O O   A ASN A 1 37  ? 32.394  -2.045  -55.228 0.72 18.09 ? 30   ASN A O   1 
ATOM   328  O O   B ASN A 1 37  ? 32.365  -2.023  -55.358 0.28 17.98 ? 30   ASN A O   1 
ATOM   329  C CB  A ASN A 1 37  ? 30.013  -2.779  -56.747 0.72 15.26 ? 30   ASN A CB  1 
ATOM   330  C CB  B ASN A 1 37  ? 29.916  -2.896  -56.605 0.28 16.96 ? 30   ASN A CB  1 
ATOM   331  C CG  A ASN A 1 37  ? 28.871  -3.761  -56.909 0.72 21.97 ? 30   ASN A CG  1 
ATOM   332  C CG  B ASN A 1 37  ? 28.809  -3.935  -56.602 0.28 20.47 ? 30   ASN A CG  1 
ATOM   333  O OD1 A ASN A 1 37  ? 28.547  -4.512  -55.986 0.72 21.44 ? 30   ASN A OD1 1 
ATOM   334  O OD1 B ASN A 1 37  ? 28.733  -4.777  -55.706 0.28 21.43 ? 30   ASN A OD1 1 
ATOM   335  N ND2 A ASN A 1 37  ? 28.247  -3.755  -58.079 0.72 23.43 ? 30   ASN A ND2 1 
ATOM   336  N ND2 B ASN A 1 37  ? 27.931  -3.869  -57.598 0.28 19.59 ? 30   ASN A ND2 1 
ATOM   337  N N   . GLU A 1 38  ? 31.287  -0.146  -54.730 1.00 12.28 ? 31   GLU A N   1 
ATOM   338  C CA  . GLU A 1 38  ? 32.500  0.612   -54.433 1.00 12.81 ? 31   GLU A CA  1 
ATOM   339  C C   . GLU A 1 38  ? 32.966  0.350   -53.007 1.00 19.12 ? 31   GLU A C   1 
ATOM   340  O O   . GLU A 1 38  ? 32.718  1.183   -52.130 1.00 18.60 ? 31   GLU A O   1 
ATOM   341  C CB  A GLU A 1 38  ? 32.252  2.111   -54.587 0.34 15.47 ? 31   GLU A CB  1 
ATOM   342  C CB  B GLU A 1 38  ? 32.273  2.114   -54.656 0.66 15.32 ? 31   GLU A CB  1 
ATOM   343  C CG  A GLU A 1 38  ? 32.525  2.709   -55.944 0.34 19.06 ? 31   GLU A CG  1 
ATOM   344  C CG  B GLU A 1 38  ? 32.055  2.500   -56.123 0.66 15.14 ? 31   GLU A CG  1 
ATOM   345  C CD  A GLU A 1 38  ? 32.621  4.219   -55.862 0.34 26.03 ? 31   GLU A CD  1 
ATOM   346  C CD  B GLU A 1 38  ? 32.323  3.975   -56.425 0.66 29.96 ? 31   GLU A CD  1 
ATOM   347  O OE1 A GLU A 1 38  ? 33.636  4.722   -55.336 0.34 26.52 ? 31   GLU A OE1 1 
ATOM   348  O OE1 B GLU A 1 38  ? 32.306  4.817   -55.499 0.66 17.68 ? 31   GLU A OE1 1 
ATOM   349  O OE2 A GLU A 1 38  ? 31.668  4.902   -56.288 0.34 23.63 ? 31   GLU A OE2 1 
ATOM   350  O OE2 B GLU A 1 38  ? 32.554  4.295   -57.611 0.66 22.82 ? 31   GLU A OE2 1 
ATOM   351  N N   . THR A 1 39  ? 33.620  -0.788  -52.771 1.00 14.17 ? 32   THR A N   1 
ATOM   352  C CA  . THR A 1 39  ? 34.222  -1.056  -51.467 1.00 15.72 ? 32   THR A CA  1 
ATOM   353  C C   . THR A 1 39  ? 35.509  -0.240  -51.314 1.00 23.98 ? 32   THR A C   1 
ATOM   354  O O   . THR A 1 39  ? 36.216  0.041   -52.297 1.00 19.70 ? 32   THR A O   1 
ATOM   355  C CB  . THR A 1 39  ? 34.516  -2.554  -51.272 1.00 16.99 ? 32   THR A CB  1 
ATOM   356  O OG1 . THR A 1 39  ? 35.387  -3.019  -52.320 1.00 19.30 ? 32   THR A OG1 1 
ATOM   357  C CG2 . THR A 1 39  ? 33.206  -3.354  -51.308 1.00 17.95 ? 32   THR A CG2 1 
ATOM   358  N N   A VAL A 1 40  ? 35.808  0.149   -50.078 0.57 18.26 ? 33   VAL A N   1 
ATOM   359  N N   B VAL A 1 40  ? 35.797  0.163   -50.079 0.43 18.29 ? 33   VAL A N   1 
ATOM   360  C CA  A VAL A 1 40  ? 37.036  0.872   -49.762 0.57 15.93 ? 33   VAL A CA  1 
ATOM   361  C CA  B VAL A 1 40  ? 36.978  0.963   -49.771 0.43 16.02 ? 33   VAL A CA  1 
ATOM   362  C C   A VAL A 1 40  ? 37.639  0.290   -48.490 0.57 16.21 ? 33   VAL A C   1 
ATOM   363  C C   B VAL A 1 40  ? 37.617  0.469   -48.481 0.43 16.19 ? 33   VAL A C   1 
ATOM   364  O O   A VAL A 1 40  ? 36.925  -0.312  -47.688 0.57 16.24 ? 33   VAL A O   1 
ATOM   365  O O   B VAL A 1 40  ? 36.945  -0.143  -47.653 0.43 16.57 ? 33   VAL A O   1 
ATOM   366  C CB  A VAL A 1 40  ? 36.789  2.382   -49.567 0.57 15.52 ? 33   VAL A CB  1 
ATOM   367  C CB  B VAL A 1 40  ? 36.638  2.458   -49.623 0.43 15.93 ? 33   VAL A CB  1 
ATOM   368  C CG1 A VAL A 1 40  ? 36.340  3.026   -50.873 0.57 16.10 ? 33   VAL A CG1 1 
ATOM   369  C CG1 B VAL A 1 40  ? 36.275  3.061   -50.970 0.43 16.08 ? 33   VAL A CG1 1 
ATOM   370  C CG2 A VAL A 1 40  ? 35.752  2.609   -48.487 0.57 19.42 ? 33   VAL A CG2 1 
ATOM   371  C CG2 B VAL A 1 40  ? 35.501  2.645   -48.634 0.43 19.04 ? 33   VAL A CG2 1 
ATOM   372  N N   A VAL A 1 41  ? 38.946  0.467   -48.320 0.57 12.04 ? 34   VAL A N   1 
ATOM   373  N N   B VAL A 1 41  ? 38.909  0.741   -48.321 0.43 12.55 ? 34   VAL A N   1 
ATOM   374  C CA  A VAL A 1 41  ? 39.656  -0.035  -47.149 0.57 15.52 ? 34   VAL A CA  1 
ATOM   375  C CA  B VAL A 1 41  ? 39.652  0.318   -47.141 0.43 14.36 ? 34   VAL A CA  1 
ATOM   376  C C   A VAL A 1 41  ? 40.360  1.104   -46.421 0.57 17.61 ? 34   VAL A C   1 
ATOM   377  C C   B VAL A 1 41  ? 40.227  1.525   -46.408 0.43 17.84 ? 34   VAL A C   1 
ATOM   378  O O   A VAL A 1 41  ? 41.103  1.873   -47.035 0.57 16.17 ? 34   VAL A O   1 
ATOM   379  O O   B VAL A 1 41  ? 40.763  2.448   -47.026 0.43 13.65 ? 34   VAL A O   1 
ATOM   380  C CB  A VAL A 1 41  ? 40.694  -1.120  -47.533 0.57 15.37 ? 34   VAL A CB  1 
ATOM   381  C CB  B VAL A 1 41  ? 40.797  -0.661  -47.511 0.43 17.50 ? 34   VAL A CB  1 
ATOM   382  C CG1 A VAL A 1 41  ? 41.515  -1.536  -46.312 0.57 15.23 ? 34   VAL A CG1 1 
ATOM   383  C CG1 B VAL A 1 41  ? 41.672  -0.966  -46.295 0.43 16.01 ? 34   VAL A CG1 1 
ATOM   384  C CG2 A VAL A 1 41  ? 40.002  -2.326  -48.172 0.57 13.45 ? 34   VAL A CG2 1 
ATOM   385  C CG2 B VAL A 1 41  ? 40.230  -1.946  -48.113 0.43 17.18 ? 34   VAL A CG2 1 
ATOM   386  N N   A ALA A 1 42  ? 40.116  1.202   -45.112 0.57 14.24 ? 35   ALA A N   1 
ATOM   387  N N   B ALA A 1 42  ? 40.098  1.514   -45.085 0.43 13.62 ? 35   ALA A N   1 
ATOM   388  C CA  A ALA A 1 42  ? 40.696  2.236   -44.263 0.57 12.78 ? 35   ALA A CA  1 
ATOM   389  C CA  B ALA A 1 42  ? 40.687  2.536   -44.240 0.43 14.68 ? 35   ALA A CA  1 
ATOM   390  C C   A ALA A 1 42  ? 41.574  1.621   -43.174 0.57 15.42 ? 35   ALA A C   1 
ATOM   391  C C   B ALA A 1 42  ? 41.539  1.894   -43.154 0.43 14.49 ? 35   ALA A C   1 
ATOM   392  O O   A ALA A 1 42  ? 41.402  0.464   -42.798 0.57 17.57 ? 35   ALA A O   1 
ATOM   393  O O   B ALA A 1 42  ? 41.318  0.750   -42.765 0.43 17.17 ? 35   ALA A O   1 
ATOM   394  C CB  A ALA A 1 42  ? 39.585  3.100   -43.625 0.57 11.56 ? 35   ALA A CB  1 
ATOM   395  C CB  B ALA A 1 42  ? 39.596  3.416   -43.617 0.43 10.24 ? 35   ALA A CB  1 
ATOM   396  N N   A GLU A 1 43  ? 42.529  2.396   -42.677 0.57 16.90 ? 36   GLU A N   1 
ATOM   397  N N   B GLU A 1 43  ? 42.528  2.634   -42.674 0.43 17.41 ? 36   GLU A N   1 
ATOM   398  C CA  A GLU A 1 43  ? 43.393  1.939   -41.596 0.57 15.82 ? 36   GLU A CA  1 
ATOM   399  C CA  B GLU A 1 43  ? 43.381  2.162   -41.593 0.43 17.01 ? 36   GLU A CA  1 
ATOM   400  C C   A GLU A 1 43  ? 42.842  2.358   -40.236 0.57 18.19 ? 36   GLU A C   1 
ATOM   401  C C   B GLU A 1 43  ? 42.715  2.379   -40.238 0.43 18.08 ? 36   GLU A C   1 
ATOM   402  O O   A GLU A 1 43  ? 42.350  3.475   -40.089 0.57 21.40 ? 36   GLU A O   1 
ATOM   403  O O   B GLU A 1 43  ? 41.931  3.307   -40.076 0.43 18.96 ? 36   GLU A O   1 
ATOM   404  C CB  A GLU A 1 43  ? 44.804  2.504   -41.769 0.57 20.00 ? 36   GLU A CB  1 
ATOM   405  C CB  B GLU A 1 43  ? 44.724  2.892   -41.625 0.43 15.06 ? 36   GLU A CB  1 
ATOM   406  C CG  A GLU A 1 43  ? 45.503  2.103   -43.056 0.57 22.52 ? 36   GLU A CG  1 
ATOM   407  C CG  B GLU A 1 43  ? 45.269  3.138   -43.023 0.43 28.43 ? 36   GLU A CG  1 
ATOM   408  C CD  A GLU A 1 43  ? 46.041  0.682   -43.027 0.57 31.90 ? 36   GLU A CD  1 
ATOM   409  C CD  B GLU A 1 43  ? 45.905  1.909   -43.633 0.43 31.75 ? 36   GLU A CD  1 
ATOM   410  O OE1 A GLU A 1 43  ? 46.308  0.168   -41.924 0.57 32.83 ? 36   GLU A OE1 1 
ATOM   411  O OE1 B GLU A 1 43  ? 46.693  1.238   -42.931 0.43 39.39 ? 36   GLU A OE1 1 
ATOM   412  O OE2 A GLU A 1 43  ? 46.212  0.085   -44.113 0.57 44.47 ? 36   GLU A OE2 1 
ATOM   413  O OE2 B GLU A 1 43  ? 45.615  1.612   -44.814 0.43 36.09 ? 36   GLU A OE2 1 
ATOM   414  N N   A THR A 1 44  ? 42.910  1.463   -39.253 0.57 18.58 ? 37   THR A N   1 
ATOM   415  N N   B THR A 1 44  ? 43.006  1.513   -39.274 0.43 18.56 ? 37   THR A N   1 
ATOM   416  C CA  A THR A 1 44  ? 42.686  1.836   -37.853 0.57 16.65 ? 37   THR A CA  1 
ATOM   417  C CA  B THR A 1 44  ? 42.709  1.805   -37.870 0.43 16.64 ? 37   THR A CA  1 
ATOM   418  C C   A THR A 1 44  ? 43.841  1.304   -37.026 0.57 13.12 ? 37   THR A C   1 
ATOM   419  C C   B THR A 1 44  ? 43.916  1.386   -37.057 0.43 12.88 ? 37   THR A C   1 
ATOM   420  O O   A THR A 1 44  ? 44.585  0.441   -37.486 0.57 13.22 ? 37   THR A O   1 
ATOM   421  O O   B THR A 1 44  ? 44.791  0.695   -37.567 0.43 17.13 ? 37   THR A O   1 
ATOM   422  C CB  A THR A 1 44  ? 41.366  1.281   -37.267 0.57 19.95 ? 37   THR A CB  1 
ATOM   423  C CB  B THR A 1 44  ? 41.458  1.070   -37.326 0.43 20.12 ? 37   THR A CB  1 
ATOM   424  O OG1 A THR A 1 44  ? 41.571  -0.050  -36.770 0.57 15.48 ? 37   THR A OG1 1 
ATOM   425  O OG1 B THR A 1 44  ? 41.800  -0.272  -36.957 0.43 19.10 ? 37   THR A OG1 1 
ATOM   426  C CG2 A THR A 1 44  ? 40.251  1.287   -38.306 0.57 15.89 ? 37   THR A CG2 1 
ATOM   427  C CG2 B THR A 1 44  ? 40.321  1.057   -38.341 0.43 16.19 ? 37   THR A CG2 1 
ATOM   428  N N   . GLU A 1 45  ? 43.955  1.768   -35.786 1.00 12.85 ? 38   GLU A N   1 
ATOM   429  C CA  . GLU A 1 45  ? 45.074  1.378   -34.944 1.00 12.85 ? 38   GLU A CA  1 
ATOM   430  C C   . GLU A 1 45  ? 45.119  -0.117  -34.649 1.00 16.90 ? 38   GLU A C   1 
ATOM   431  O O   . GLU A 1 45  ? 46.147  -0.627  -34.208 1.00 15.68 ? 38   GLU A O   1 
ATOM   432  C CB  . GLU A 1 45  ? 45.060  2.169   -33.634 1.00 12.05 ? 38   GLU A CB  1 
ATOM   433  C CG  . GLU A 1 45  ? 43.968  1.813   -32.660 1.00 16.27 ? 38   GLU A CG  1 
ATOM   434  C CD  . GLU A 1 45  ? 44.025  2.697   -31.426 1.00 17.08 ? 38   GLU A CD  1 
ATOM   435  O OE1 . GLU A 1 45  ? 44.985  2.564   -30.637 1.00 15.84 ? 38   GLU A OE1 1 
ATOM   436  O OE2 . GLU A 1 45  ? 43.117  3.543   -31.264 1.00 19.16 ? 38   GLU A OE2 1 
ATOM   437  N N   A TYR A 1 46  ? 44.009  -0.810  -34.888 0.34 13.40 ? 39   TYR A N   1 
ATOM   438  N N   B TYR A 1 46  ? 44.007  -0.807  -34.887 0.66 13.36 ? 39   TYR A N   1 
ATOM   439  C CA  A TYR A 1 46  ? 43.917  -2.238  -34.613 0.34 14.36 ? 39   TYR A CA  1 
ATOM   440  C CA  B TYR A 1 46  ? 43.910  -2.237  -34.620 0.66 14.23 ? 39   TYR A CA  1 
ATOM   441  C C   A TYR A 1 46  ? 43.887  -3.085  -35.883 0.34 15.12 ? 39   TYR A C   1 
ATOM   442  C C   B TYR A 1 46  ? 43.911  -3.085  -35.881 0.66 15.08 ? 39   TYR A C   1 
ATOM   443  O O   A TYR A 1 46  ? 43.804  -4.309  -35.807 0.34 18.40 ? 39   TYR A O   1 
ATOM   444  O O   B TYR A 1 46  ? 43.854  -4.310  -35.796 0.66 18.39 ? 39   TYR A O   1 
ATOM   445  C CB  A TYR A 1 46  ? 42.669  -2.538  -33.778 0.34 16.34 ? 39   TYR A CB  1 
ATOM   446  C CB  B TYR A 1 46  ? 42.636  -2.545  -33.831 0.66 16.21 ? 39   TYR A CB  1 
ATOM   447  C CG  A TYR A 1 46  ? 42.579  -1.748  -32.494 0.34 19.12 ? 39   TYR A CG  1 
ATOM   448  C CG  B TYR A 1 46  ? 42.547  -1.848  -32.500 0.66 19.18 ? 39   TYR A CG  1 
ATOM   449  C CD1 A TYR A 1 46  ? 43.485  -1.954  -31.462 0.34 19.32 ? 39   TYR A CD1 1 
ATOM   450  C CD1 B TYR A 1 46  ? 43.404  -2.181  -31.459 0.66 18.53 ? 39   TYR A CD1 1 
ATOM   451  C CD2 A TYR A 1 46  ? 41.575  -0.807  -32.305 0.34 17.89 ? 39   TYR A CD2 1 
ATOM   452  C CD2 B TYR A 1 46  ? 41.582  -0.879  -32.270 0.66 17.95 ? 39   TYR A CD2 1 
ATOM   453  C CE1 A TYR A 1 46  ? 43.401  -1.234  -30.278 0.34 17.24 ? 39   TYR A CE1 1 
ATOM   454  C CE1 B TYR A 1 46  ? 43.316  -1.549  -30.230 0.66 16.80 ? 39   TYR A CE1 1 
ATOM   455  C CE2 A TYR A 1 46  ? 41.482  -0.084  -31.126 0.34 16.45 ? 39   TYR A CE2 1 
ATOM   456  C CE2 B TYR A 1 46  ? 41.484  -0.242  -31.045 0.66 16.21 ? 39   TYR A CE2 1 
ATOM   457  C CZ  A TYR A 1 46  ? 42.401  -0.301  -30.117 0.34 18.56 ? 39   TYR A CZ  1 
ATOM   458  C CZ  B TYR A 1 46  ? 42.357  -0.582  -30.027 0.66 17.30 ? 39   TYR A CZ  1 
ATOM   459  O OH  A TYR A 1 46  ? 42.312  0.415   -28.941 0.34 20.08 ? 39   TYR A OH  1 
ATOM   460  O OH  B TYR A 1 46  ? 42.256  0.048   -28.802 0.66 15.81 ? 39   TYR A OH  1 
ATOM   461  N N   . GLY A 1 47  ? 43.940  -2.433  -37.043 1.00 14.48 ? 40   GLY A N   1 
ATOM   462  C CA  . GLY A 1 47  ? 43.900  -3.145  -38.311 1.00 14.59 ? 40   GLY A CA  1 
ATOM   463  C C   . GLY A 1 47  ? 42.995  -2.503  -39.345 1.00 17.94 ? 40   GLY A C   1 
ATOM   464  O O   . GLY A 1 47  ? 42.263  -1.551  -39.057 1.00 17.42 ? 40   GLY A O   1 
ATOM   465  N N   . LYS A 1 48  ? 43.051  -3.033  -40.565 1.00 15.76 ? 41   LYS A N   1 
ATOM   466  C CA  . LYS A 1 48  ? 42.297  -2.494  -41.683 1.00 12.86 ? 41   LYS A CA  1 
ATOM   467  C C   . LYS A 1 48  ? 40.825  -2.850  -41.660 1.00 17.19 ? 41   LYS A C   1 
ATOM   468  O O   . LYS A 1 48  ? 40.435  -3.951  -41.300 1.00 14.86 ? 41   LYS A O   1 
ATOM   469  C CB  A LYS A 1 48  ? 42.916  -2.957  -42.996 0.50 17.59 ? 41   LYS A CB  1 
ATOM   470  C CB  B LYS A 1 48  ? 42.884  -2.988  -43.007 0.50 17.59 ? 41   LYS A CB  1 
ATOM   471  C CG  A LYS A 1 48  ? 44.249  -2.304  -43.270 0.50 15.66 ? 41   LYS A CG  1 
ATOM   472  C CG  B LYS A 1 48  ? 44.338  -2.642  -43.235 0.50 16.76 ? 41   LYS A CG  1 
ATOM   473  C CD  A LYS A 1 48  ? 44.917  -2.934  -44.470 0.50 23.64 ? 41   LYS A CD  1 
ATOM   474  C CD  B LYS A 1 48  ? 44.781  -3.162  -44.602 0.50 20.79 ? 41   LYS A CD  1 
ATOM   475  C CE  A LYS A 1 48  ? 45.329  -4.353  -44.158 0.50 15.95 ? 41   LYS A CE  1 
ATOM   476  C CE  B LYS A 1 48  ? 46.141  -2.614  -45.007 0.50 21.65 ? 41   LYS A CE  1 
ATOM   477  N NZ  A LYS A 1 48  ? 46.154  -4.914  -45.266 0.50 28.05 ? 41   LYS A NZ  1 
ATOM   478  N NZ  B LYS A 1 48  ? 47.216  -3.090  -44.105 0.50 15.23 ? 41   LYS A NZ  1 
ATOM   479  N N   . VAL A 1 49  ? 40.010  -1.915  -42.112 1.00 15.13 ? 42   VAL A N   1 
ATOM   480  C CA  . VAL A 1 49  ? 38.579  -2.156  -42.179 1.00 16.78 ? 42   VAL A CA  1 
ATOM   481  C C   . VAL A 1 49  ? 38.047  -1.875  -43.588 1.00 15.93 ? 42   VAL A C   1 
ATOM   482  O O   . VAL A 1 49  ? 38.428  -0.891  -44.223 1.00 14.10 ? 42   VAL A O   1 
ATOM   483  C CB  . VAL A 1 49  ? 37.821  -1.307  -41.130 1.00 15.70 ? 42   VAL A CB  1 
ATOM   484  C CG1 . VAL A 1 49  ? 38.226  -1.737  -39.711 1.00 13.29 ? 42   VAL A CG1 1 
ATOM   485  C CG2 . VAL A 1 49  ? 38.055  0.180   -41.337 1.00 12.46 ? 42   VAL A CG2 1 
ATOM   486  N N   A LYS A 1 50  ? 37.175  -2.757  -44.068 0.73 13.26 ? 43   LYS A N   1 
ATOM   487  N N   B LYS A 1 50  ? 37.149  -2.730  -44.068 0.27 13.32 ? 43   LYS A N   1 
ATOM   488  C CA  A LYS A 1 50  ? 36.569  -2.586  -45.380 0.73 11.05 ? 43   LYS A CA  1 
ATOM   489  C CA  B LYS A 1 50  ? 36.610  -2.583  -45.417 0.27 11.23 ? 43   LYS A CA  1 
ATOM   490  C C   A LYS A 1 50  ? 35.177  -2.023  -45.210 0.73 14.44 ? 43   LYS A C   1 
ATOM   491  C C   B LYS A 1 50  ? 35.156  -2.128  -45.378 0.27 14.25 ? 43   LYS A C   1 
ATOM   492  O O   A LYS A 1 50  ? 34.369  -2.549  -44.442 0.73 16.07 ? 43   LYS A O   1 
ATOM   493  O O   B LYS A 1 50  ? 34.286  -2.840  -44.870 0.27 16.53 ? 43   LYS A O   1 
ATOM   494  C CB  A LYS A 1 50  ? 36.523  -3.915  -46.141 0.73 18.10 ? 43   LYS A CB  1 
ATOM   495  C CB  B LYS A 1 50  ? 36.738  -3.901  -46.185 0.27 17.49 ? 43   LYS A CB  1 
ATOM   496  C CG  A LYS A 1 50  ? 35.792  -3.830  -47.470 0.73 13.99 ? 43   LYS A CG  1 
ATOM   497  C CG  B LYS A 1 50  ? 36.570  -3.781  -47.689 0.27 16.27 ? 43   LYS A CG  1 
ATOM   498  C CD  A LYS A 1 50  ? 35.729  -5.167  -48.190 0.73 28.19 ? 43   LYS A CD  1 
ATOM   499  C CD  B LYS A 1 50  ? 36.914  -5.093  -48.376 0.27 18.02 ? 43   LYS A CD  1 
ATOM   500  C CE  A LYS A 1 50  ? 34.763  -6.118  -47.527 0.73 24.11 ? 43   LYS A CE  1 
ATOM   501  C CE  B LYS A 1 50  ? 36.907  -4.962  -49.893 0.27 18.23 ? 43   LYS A CE  1 
ATOM   502  N NZ  A LYS A 1 50  ? 33.921  -6.809  -48.541 0.73 34.29 ? 43   LYS A NZ  1 
ATOM   503  N NZ  B LYS A 1 50  ? 38.039  -4.131  -50.405 0.27 17.65 ? 43   LYS A NZ  1 
ATOM   504  N N   . GLY A 1 51  ? 34.897  -0.939  -45.914 1.00 12.91 ? 44   GLY A N   1 
ATOM   505  C CA  . GLY A 1 51  ? 33.568  -0.368  -45.905 1.00 13.95 ? 44   GLY A CA  1 
ATOM   506  C C   . GLY A 1 51  ? 33.056  -0.279  -47.322 1.00 18.45 ? 44   GLY A C   1 
ATOM   507  O O   . GLY A 1 51  ? 33.621  -0.875  -48.230 1.00 15.84 ? 44   GLY A O   1 
ATOM   508  N N   . VAL A 1 52  ? 31.994  0.480   -47.513 1.00 13.06 ? 45   VAL A N   1 
ATOM   509  C CA  . VAL A 1 52  ? 31.344  0.509   -48.823 1.00 14.34 ? 45   VAL A CA  1 
ATOM   510  C C   . VAL A 1 52  ? 30.548  1.799   -49.042 1.00 13.91 ? 45   VAL A C   1 
ATOM   511  O O   . VAL A 1 52  ? 29.977  2.383   -48.108 1.00 13.44 ? 45   VAL A O   1 
ATOM   512  C CB  . VAL A 1 52  ? 30.446  -0.738  -48.998 1.00 12.80 ? 45   VAL A CB  1 
ATOM   513  C CG1 . VAL A 1 52  ? 29.309  -0.750  -47.965 1.00 16.47 ? 45   VAL A CG1 1 
ATOM   514  C CG2 . VAL A 1 52  ? 29.885  -0.846  -50.432 1.00 12.59 ? 45   VAL A CG2 1 
ATOM   515  N N   . LYS A 1 53  ? 30.543  2.279   -50.279 1.00 11.93 ? 46   LYS A N   1 
ATOM   516  C CA  . LYS A 1 53  ? 29.699  3.409   -50.635 1.00 11.75 ? 46   LYS A CA  1 
ATOM   517  C C   . LYS A 1 53  ? 28.244  2.997   -50.683 1.00 10.78 ? 46   LYS A C   1 
ATOM   518  O O   . LYS A 1 53  ? 27.901  1.984   -51.275 1.00 13.89 ? 46   LYS A O   1 
ATOM   519  C CB  A LYS A 1 53  ? 30.090  4.014   -51.997 0.78 13.17 ? 46   LYS A CB  1 
ATOM   520  C CB  B LYS A 1 53  ? 30.138  3.988   -51.982 0.22 13.20 ? 46   LYS A CB  1 
ATOM   521  C CG  A LYS A 1 53  ? 29.205  5.212   -52.375 0.78 13.48 ? 46   LYS A CG  1 
ATOM   522  C CG  B LYS A 1 53  ? 29.306  5.153   -52.475 0.22 14.03 ? 46   LYS A CG  1 
ATOM   523  C CD  A LYS A 1 53  ? 29.608  5.885   -53.703 0.78 13.00 ? 46   LYS A CD  1 
ATOM   524  C CD  B LYS A 1 53  ? 30.044  5.874   -53.596 0.22 17.86 ? 46   LYS A CD  1 
ATOM   525  C CE  A LYS A 1 53  ? 30.847  6.755   -53.535 0.78 23.61 ? 46   LYS A CE  1 
ATOM   526  C CE  B LYS A 1 53  ? 29.094  6.453   -54.621 0.22 18.57 ? 46   LYS A CE  1 
ATOM   527  N NZ  A LYS A 1 53  ? 31.172  7.493   -54.803 0.78 16.30 ? 46   LYS A NZ  1 
ATOM   528  N NZ  B LYS A 1 53  ? 29.809  7.169   -55.717 0.22 17.77 ? 46   LYS A NZ  1 
ATOM   529  N N   . ARG A 1 54  ? 27.387  3.812   -50.065 1.00 12.60 ? 47   ARG A N   1 
ATOM   530  C CA  . ARG A 1 54  ? 25.942  3.618   -50.107 1.00 10.47 ? 47   ARG A CA  1 
ATOM   531  C C   . ARG A 1 54  ? 25.276  4.863   -50.681 1.00 14.76 ? 47   ARG A C   1 
ATOM   532  O O   . ARG A 1 54  ? 25.800  5.971   -50.558 1.00 13.41 ? 47   ARG A O   1 
ATOM   533  C CB  . ARG A 1 54  ? 25.391  3.330   -48.690 1.00 11.59 ? 47   ARG A CB  1 
ATOM   534  C CG  . ARG A 1 54  ? 26.010  2.128   -48.003 1.00 12.50 ? 47   ARG A CG  1 
ATOM   535  C CD  . ARG A 1 54  ? 25.381  1.834   -46.615 1.00 13.46 ? 47   ARG A CD  1 
ATOM   536  N NE  . ARG A 1 54  ? 26.017  0.655   -46.024 1.00 9.99  ? 47   ARG A NE  1 
ATOM   537  C CZ  . ARG A 1 54  ? 25.771  -0.605  -46.356 1.00 19.00 ? 47   ARG A CZ  1 
ATOM   538  N NH1 . ARG A 1 54  ? 24.853  -0.893  -47.265 1.00 15.79 ? 47   ARG A NH1 1 
ATOM   539  N NH2 . ARG A 1 54  ? 26.442  -1.585  -45.756 1.00 16.86 ? 47   ARG A NH2 1 
ATOM   540  N N   A LEU A 1 55  ? 24.114  4.685   -51.300 0.63 13.76 ? 48   LEU A N   1 
ATOM   541  N N   B LEU A 1 55  ? 24.119  4.688   -51.309 0.37 13.81 ? 48   LEU A N   1 
ATOM   542  C CA  A LEU A 1 55  ? 23.346  5.816   -51.794 0.63 11.42 ? 48   LEU A CA  1 
ATOM   543  C CA  B LEU A 1 55  ? 23.349  5.826   -51.795 0.37 11.65 ? 48   LEU A CA  1 
ATOM   544  C C   A LEU A 1 55  ? 22.231  6.191   -50.824 0.63 14.17 ? 48   LEU A C   1 
ATOM   545  C C   B LEU A 1 55  ? 22.252  6.205   -50.809 0.37 14.23 ? 48   LEU A C   1 
ATOM   546  O O   A LEU A 1 55  ? 21.960  5.460   -49.877 0.63 16.36 ? 48   LEU A O   1 
ATOM   547  O O   B LEU A 1 55  ? 22.009  5.488   -49.841 0.37 16.21 ? 48   LEU A O   1 
ATOM   548  C CB  A LEU A 1 55  ? 22.767  5.477   -53.171 0.63 17.70 ? 48   LEU A CB  1 
ATOM   549  C CB  B LEU A 1 55  ? 22.742  5.504   -53.163 0.37 17.65 ? 48   LEU A CB  1 
ATOM   550  C CG  A LEU A 1 55  ? 23.760  4.751   -54.083 0.63 14.90 ? 48   LEU A CG  1 
ATOM   551  C CG  B LEU A 1 55  ? 23.752  5.217   -54.273 0.37 21.53 ? 48   LEU A CG  1 
ATOM   552  C CD1 A LEU A 1 55  ? 23.080  4.373   -55.390 0.63 20.02 ? 48   LEU A CD1 1 
ATOM   553  C CD1 B LEU A 1 55  ? 23.090  4.426   -55.387 0.37 19.89 ? 48   LEU A CD1 1 
ATOM   554  C CD2 A LEU A 1 55  ? 24.966  5.631   -54.342 0.63 24.16 ? 48   LEU A CD2 1 
ATOM   555  C CD2 B LEU A 1 55  ? 24.316  6.525   -54.802 0.37 23.28 ? 48   LEU A CD2 1 
ATOM   556  N N   . THR A 1 56  ? 21.599  7.337   -51.047 1.00 13.43 ? 49   THR A N   1 
ATOM   557  C CA  . THR A 1 56  ? 20.433  7.708   -50.235 1.00 13.42 ? 49   THR A CA  1 
ATOM   558  C C   . THR A 1 56  ? 19.224  7.844   -51.153 1.00 22.79 ? 49   THR A C   1 
ATOM   559  O O   . THR A 1 56  ? 19.356  7.733   -52.383 1.00 18.88 ? 49   THR A O   1 
ATOM   560  C CB  . THR A 1 56  ? 20.651  9.016   -49.448 1.00 13.79 ? 49   THR A CB  1 
ATOM   561  O OG1 . THR A 1 56  ? 20.633  10.139  -50.334 1.00 13.61 ? 49   THR A OG1 1 
ATOM   562  C CG2 . THR A 1 56  ? 21.981  8.984   -48.748 1.00 15.39 ? 49   THR A CG2 1 
ATOM   563  N N   . VAL A 1 57  ? 18.047  8.097   -50.575 1.00 17.92 ? 50   VAL A N   1 
ATOM   564  C CA  . VAL A 1 57  ? 16.850  8.243   -51.405 1.00 13.18 ? 50   VAL A CA  1 
ATOM   565  C C   . VAL A 1 57  ? 16.876  9.606   -52.084 1.00 17.96 ? 50   VAL A C   1 
ATOM   566  O O   . VAL A 1 57  ? 16.148  9.835   -53.046 1.00 17.88 ? 50   VAL A O   1 
ATOM   567  C CB  . VAL A 1 57  ? 15.540  8.065   -50.609 1.00 18.14 ? 50   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 57  ? 15.431  6.633   -50.066 1.00 21.08 ? 50   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 57  ? 15.407  9.109   -49.504 1.00 20.96 ? 50   VAL A CG2 1 
ATOM   570  N N   A TYR A 1 58  ? 17.732  10.501  -51.595 0.79 14.58 ? 51   TYR A N   1 
ATOM   571  N N   B TYR A 1 58  ? 17.728  10.500  -51.592 0.21 14.93 ? 51   TYR A N   1 
ATOM   572  C CA  A TYR A 1 58  ? 17.919  11.808  -52.218 0.79 17.21 ? 51   TYR A CA  1 
ATOM   573  C CA  B TYR A 1 58  ? 17.915  11.806  -52.214 0.21 16.89 ? 51   TYR A CA  1 
ATOM   574  C C   A TYR A 1 58  ? 19.017  11.752  -53.267 0.79 18.10 ? 51   TYR A C   1 
ATOM   575  C C   B TYR A 1 58  ? 19.056  11.756  -53.222 0.21 18.17 ? 51   TYR A C   1 
ATOM   576  O O   A TYR A 1 58  ? 19.419  12.784  -53.805 0.79 16.01 ? 51   TYR A O   1 
ATOM   577  O O   B TYR A 1 58  ? 19.528  12.792  -53.694 0.21 16.59 ? 51   TYR A O   1 
ATOM   578  C CB  A TYR A 1 58  ? 18.246  12.871  -51.169 0.79 12.84 ? 51   TYR A CB  1 
ATOM   579  C CB  B TYR A 1 58  ? 18.177  12.873  -51.152 0.21 13.08 ? 51   TYR A CB  1 
ATOM   580  C CG  A TYR A 1 58  ? 17.064  13.156  -50.279 0.79 16.96 ? 51   TYR A CG  1 
ATOM   581  C CG  B TYR A 1 58  ? 16.997  13.085  -50.233 0.21 16.85 ? 51   TYR A CG  1 
ATOM   582  C CD1 A TYR A 1 58  ? 15.987  13.910  -50.749 0.79 15.10 ? 51   TYR A CD1 1 
ATOM   583  C CD1 B TYR A 1 58  ? 15.934  13.895  -50.616 0.21 15.33 ? 51   TYR A CD1 1 
ATOM   584  C CD2 A TYR A 1 58  ? 17.004  12.660  -48.988 0.79 17.49 ? 51   TYR A CD2 1 
ATOM   585  C CD2 B TYR A 1 58  ? 16.936  12.465  -48.994 0.21 16.69 ? 51   TYR A CD2 1 
ATOM   586  C CE1 A TYR A 1 58  ? 14.888  14.176  -49.944 0.79 14.03 ? 51   TYR A CE1 1 
ATOM   587  C CE1 B TYR A 1 58  ? 14.847  14.089  -49.786 0.21 14.48 ? 51   TYR A CE1 1 
ATOM   588  C CE2 A TYR A 1 58  ? 15.905  12.917  -48.180 0.79 13.34 ? 51   TYR A CE2 1 
ATOM   589  C CE2 B TYR A 1 58  ? 15.850  12.651  -48.156 0.21 14.05 ? 51   TYR A CE2 1 
ATOM   590  C CZ  A TYR A 1 58  ? 14.857  13.673  -48.653 0.79 14.96 ? 51   TYR A CZ  1 
ATOM   591  C CZ  B TYR A 1 58  ? 14.811  13.466  -48.555 0.21 15.11 ? 51   TYR A CZ  1 
ATOM   592  O OH  A TYR A 1 58  ? 13.768  13.904  -47.832 0.79 15.21 ? 51   TYR A OH  1 
ATOM   593  O OH  B TYR A 1 58  ? 13.730  13.650  -47.722 0.21 13.21 ? 51   TYR A OH  1 
ATOM   594  N N   . ASP A 1 59  ? 19.488  10.537  -53.534 1.00 17.04 ? 52   ASP A N   1 
ATOM   595  C CA  . ASP A 1 59  ? 20.527  10.280  -54.543 1.00 15.58 ? 52   ASP A CA  1 
ATOM   596  C C   . ASP A 1 59  ? 21.884  10.887  -54.204 1.00 15.68 ? 52   ASP A C   1 
ATOM   597  O O   . ASP A 1 59  ? 22.712  11.115  -55.080 1.00 22.64 ? 52   ASP A O   1 
ATOM   598  C CB  . ASP A 1 59  ? 20.059  10.768  -55.926 1.00 18.84 ? 52   ASP A CB  1 
ATOM   599  C CG  . ASP A 1 59  ? 18.733  10.162  -56.334 1.00 27.51 ? 52   ASP A CG  1 
ATOM   600  O OD1 . ASP A 1 59  ? 18.575  8.927   -56.215 1.00 21.53 ? 52   ASP A OD1 1 
ATOM   601  O OD2 . ASP A 1 59  ? 17.836  10.925  -56.761 1.00 26.58 ? 52   ASP A OD2 1 
ATOM   602  N N   . ASP A 1 60  ? 22.130  11.120  -52.919 1.00 13.23 ? 53   ASP A N   1 
ATOM   603  C CA  . ASP A 1 60  ? 23.486  11.401  -52.438 1.00 12.79 ? 53   ASP A CA  1 
ATOM   604  C C   . ASP A 1 60  ? 24.220  10.096  -52.164 1.00 16.12 ? 53   ASP A C   1 
ATOM   605  O O   . ASP A 1 60  ? 23.617  9.033   -52.240 1.00 16.61 ? 53   ASP A O   1 
ATOM   606  C CB  . ASP A 1 60  ? 23.444  12.252  -51.185 1.00 15.63 ? 53   ASP A CB  1 
ATOM   607  C CG  . ASP A 1 60  ? 22.727  13.560  -51.406 1.00 21.96 ? 53   ASP A CG  1 
ATOM   608  O OD1 . ASP A 1 60  ? 23.090  14.292  -52.352 1.00 24.30 ? 53   ASP A OD1 1 
ATOM   609  O OD2 . ASP A 1 60  ? 21.783  13.843  -50.650 1.00 22.05 ? 53   ASP A OD2 1 
ATOM   610  N N   . SER A 1 61  ? 25.514  10.171  -51.870 1.00 15.16 ? 54   SER A N   1 
ATOM   611  C CA  . SER A 1 61  ? 26.268  8.966   -51.539 1.00 14.49 ? 54   SER A CA  1 
ATOM   612  C C   . SER A 1 61  ? 27.213  9.204   -50.389 1.00 14.74 ? 54   SER A C   1 
ATOM   613  O O   . SER A 1 61  ? 27.609  10.325  -50.127 1.00 16.05 ? 54   SER A O   1 
ATOM   614  C CB  . SER A 1 61  ? 27.045  8.470   -52.748 1.00 17.78 ? 54   SER A CB  1 
ATOM   615  O OG  . SER A 1 61  ? 28.093  9.361   -53.074 1.00 22.84 ? 54   SER A OG  1 
ATOM   616  N N   . TYR A 1 62  ? 27.577  8.129   -49.701 1.00 14.49 ? 55   TYR A N   1 
ATOM   617  C CA  . TYR A 1 62  ? 28.510  8.230   -48.586 1.00 14.55 ? 55   TYR A CA  1 
ATOM   618  C C   . TYR A 1 62  ? 29.244  6.926   -48.382 1.00 12.00 ? 55   TYR A C   1 
ATOM   619  O O   . TYR A 1 62  ? 28.735  5.861   -48.724 1.00 14.09 ? 55   TYR A O   1 
ATOM   620  C CB  . TYR A 1 62  ? 27.775  8.623   -47.300 1.00 14.72 ? 55   TYR A CB  1 
ATOM   621  C CG  . TYR A 1 62  ? 26.742  7.623   -46.843 1.00 14.30 ? 55   TYR A CG  1 
ATOM   622  C CD1 . TYR A 1 62  ? 27.020  6.748   -45.794 1.00 13.47 ? 55   TYR A CD1 1 
ATOM   623  C CD2 . TYR A 1 62  ? 25.480  7.578   -47.421 1.00 16.85 ? 55   TYR A CD2 1 
ATOM   624  C CE1 . TYR A 1 62  ? 26.090  5.829   -45.360 1.00 12.98 ? 55   TYR A CE1 1 
ATOM   625  C CE2 . TYR A 1 62  ? 24.522  6.632   -47.004 1.00 12.64 ? 55   TYR A CE2 1 
ATOM   626  C CZ  . TYR A 1 62  ? 24.841  5.779   -45.957 1.00 13.16 ? 55   TYR A CZ  1 
ATOM   627  O OH  . TYR A 1 62  ? 23.921  4.867   -45.525 1.00 15.47 ? 55   TYR A OH  1 
ATOM   628  N N   . TYR A 1 63  ? 30.448  7.006   -47.829 1.00 14.40 ? 56   TYR A N   1 
ATOM   629  C CA  . TYR A 1 63  ? 31.166  5.810   -47.428 1.00 11.70 ? 56   TYR A CA  1 
ATOM   630  C C   . TYR A 1 63  ? 30.725  5.393   -46.030 1.00 12.97 ? 56   TYR A C   1 
ATOM   631  O O   . TYR A 1 63  ? 30.502  6.255   -45.163 1.00 14.47 ? 56   TYR A O   1 
ATOM   632  C CB  . TYR A 1 63  ? 32.675  6.043   -47.513 1.00 11.65 ? 56   TYR A CB  1 
ATOM   633  C CG  . TYR A 1 63  ? 33.074  6.313   -48.941 1.00 15.56 ? 56   TYR A CG  1 
ATOM   634  C CD1 . TYR A 1 63  ? 33.336  5.257   -49.795 1.00 16.00 ? 56   TYR A CD1 1 
ATOM   635  C CD2 . TYR A 1 63  ? 33.149  7.610   -49.432 1.00 17.70 ? 56   TYR A CD2 1 
ATOM   636  C CE1 . TYR A 1 63  ? 33.685  5.484   -51.117 1.00 20.07 ? 56   TYR A CE1 1 
ATOM   637  C CE2 . TYR A 1 63  ? 33.491  7.851   -50.767 1.00 16.04 ? 56   TYR A CE2 1 
ATOM   638  C CZ  . TYR A 1 63  ? 33.750  6.781   -51.583 1.00 16.86 ? 56   TYR A CZ  1 
ATOM   639  O OH  . TYR A 1 63  ? 34.093  7.034   -52.900 1.00 18.15 ? 56   TYR A OH  1 
ATOM   640  N N   . SER A 1 64  ? 30.580  4.081   -45.851 1.00 10.93 ? 57   SER A N   1 
ATOM   641  C CA  . SER A 1 64  ? 29.980  3.484   -44.646 1.00 15.25 ? 57   SER A CA  1 
ATOM   642  C C   . SER A 1 64  ? 30.840  2.378   -44.060 1.00 15.28 ? 57   SER A C   1 
ATOM   643  O O   . SER A 1 64  ? 31.160  1.407   -44.742 1.00 12.46 ? 57   SER A O   1 
ATOM   644  C CB  . SER A 1 64  ? 28.597  2.926   -44.990 1.00 16.96 ? 57   SER A CB  1 
ATOM   645  O OG  . SER A 1 64  ? 28.061  2.135   -43.928 1.00 14.72 ? 57   SER A OG  1 
ATOM   646  N N   . PHE A 1 65  ? 31.212  2.512   -42.788 1.00 12.83 ? 58   PHE A N   1 
ATOM   647  C CA  . PHE A 1 65  ? 31.935  1.450   -42.085 1.00 12.88 ? 58   PHE A CA  1 
ATOM   648  C C   . PHE A 1 65  ? 31.142  1.145   -40.834 1.00 12.71 ? 58   PHE A C   1 
ATOM   649  O O   . PHE A 1 65  ? 30.999  2.023   -39.990 1.00 14.99 ? 58   PHE A O   1 
ATOM   650  C CB  . PHE A 1 65  ? 33.363  1.872   -41.683 1.00 13.04 ? 58   PHE A CB  1 
ATOM   651  C CG  . PHE A 1 65  ? 34.233  2.309   -42.829 1.00 15.69 ? 58   PHE A CG  1 
ATOM   652  C CD1 . PHE A 1 65  ? 35.181  1.448   -43.345 1.00 12.63 ? 58   PHE A CD1 1 
ATOM   653  C CD2 . PHE A 1 65  ? 34.140  3.596   -43.349 1.00 13.82 ? 58   PHE A CD2 1 
ATOM   654  C CE1 . PHE A 1 65  ? 36.011  1.847   -44.410 1.00 15.99 ? 58   PHE A CE1 1 
ATOM   655  C CE2 . PHE A 1 65  ? 34.956  4.007   -44.411 1.00 13.12 ? 58   PHE A CE2 1 
ATOM   656  C CZ  . PHE A 1 65  ? 35.886  3.124   -44.928 1.00 14.81 ? 58   PHE A CZ  1 
ATOM   657  N N   . GLU A 1 66  ? 30.644  -0.078  -40.704 1.00 12.94 ? 59   GLU A N   1 
ATOM   658  C CA  . GLU A 1 66  ? 29.887  -0.459  -39.506 1.00 10.21 ? 59   GLU A CA  1 
ATOM   659  C C   . GLU A 1 66  ? 30.561  -1.615  -38.793 1.00 16.46 ? 59   GLU A C   1 
ATOM   660  O O   . GLU A 1 66  ? 31.256  -2.406  -39.396 1.00 13.25 ? 59   GLU A O   1 
ATOM   661  C CB  . GLU A 1 66  ? 28.451  -0.828  -39.897 1.00 14.51 ? 59   GLU A CB  1 
ATOM   662  C CG  . GLU A 1 66  ? 27.686  0.310   -40.542 1.00 11.92 ? 59   GLU A CG  1 
ATOM   663  C CD  . GLU A 1 66  ? 26.337  -0.125  -41.069 1.00 19.19 ? 59   GLU A CD  1 
ATOM   664  O OE1 . GLU A 1 66  ? 26.281  -0.766  -42.148 1.00 21.56 ? 59   GLU A OE1 1 
ATOM   665  O OE2 . GLU A 1 66  ? 25.329  0.163   -40.390 1.00 18.65 ? 59   GLU A OE2 1 
ATOM   666  N N   . GLY A 1 67  ? 30.379  -1.726  -37.484 1.00 13.16 ? 60   GLY A N   1 
ATOM   667  C CA  . GLY A 1 67  ? 30.939  -2.869  -36.816 1.00 18.05 ? 60   GLY A CA  1 
ATOM   668  C C   . GLY A 1 67  ? 32.426  -2.775  -36.561 1.00 16.50 ? 60   GLY A C   1 
ATOM   669  O O   . GLY A 1 67  ? 33.119  -3.783  -36.555 1.00 13.75 ? 60   GLY A O   1 
ATOM   670  N N   A ILE A 1 68  ? 32.919  -1.562  -36.344 0.32 12.90 ? 61   ILE A N   1 
ATOM   671  N N   B ILE A 1 68  ? 32.919  -1.557  -36.370 0.68 12.77 ? 61   ILE A N   1 
ATOM   672  C CA  A ILE A 1 68  ? 34.312  -1.378  -35.962 0.32 11.09 ? 61   ILE A CA  1 
ATOM   673  C CA  B ILE A 1 68  ? 34.300  -1.359  -35.959 0.68 10.68 ? 61   ILE A CA  1 
ATOM   674  C C   A ILE A 1 68  ? 34.445  -1.535  -34.456 0.32 12.32 ? 61   ILE A C   1 
ATOM   675  C C   B ILE A 1 68  ? 34.374  -1.587  -34.457 0.68 12.30 ? 61   ILE A C   1 
ATOM   676  O O   A ILE A 1 68  ? 33.922  -0.718  -33.701 0.32 12.94 ? 61   ILE A O   1 
ATOM   677  O O   B ILE A 1 68  ? 33.724  -0.873  -33.707 0.68 13.92 ? 61   ILE A O   1 
ATOM   678  C CB  A ILE A 1 68  ? 34.849  -0.005  -36.373 0.32 12.39 ? 61   ILE A CB  1 
ATOM   679  C CB  B ILE A 1 68  ? 34.811  0.046   -36.284 0.68 12.39 ? 61   ILE A CB  1 
ATOM   680  C CG1 A ILE A 1 68  ? 34.623  0.234   -37.869 0.32 12.03 ? 61   ILE A CG1 1 
ATOM   681  C CG1 B ILE A 1 68  ? 34.583  0.392   -37.765 0.68 12.71 ? 61   ILE A CG1 1 
ATOM   682  C CG2 A ILE A 1 68  ? 36.336  0.109   -36.034 0.32 14.63 ? 61   ILE A CG2 1 
ATOM   683  C CG2 B ILE A 1 68  ? 36.307  0.170   -35.944 0.68 14.69 ? 61   ILE A CG2 1 
ATOM   684  C CD1 A ILE A 1 68  ? 35.186  1.549   -38.353 0.32 16.11 ? 61   ILE A CD1 1 
ATOM   685  C CD1 B ILE A 1 68  ? 35.197  1.722   -38.157 0.68 15.78 ? 61   ILE A CD1 1 
ATOM   686  N N   . PRO A 1 69  ? 35.146  -2.583  -34.008 1.00 13.82 ? 62   PRO A N   1 
ATOM   687  C CA  . PRO A 1 69  ? 35.242  -2.796  -32.557 1.00 14.21 ? 62   PRO A CA  1 
ATOM   688  C C   . PRO A 1 69  ? 36.137  -1.767  -31.888 1.00 14.22 ? 62   PRO A C   1 
ATOM   689  O O   . PRO A 1 69  ? 37.191  -1.438  -32.427 1.00 13.87 ? 62   PRO A O   1 
ATOM   690  C CB  . PRO A 1 69  ? 35.851  -4.192  -32.445 1.00 12.98 ? 62   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 69  ? 36.648  -4.347  -33.687 1.00 18.67 ? 62   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 69  ? 35.976  -3.536  -34.764 1.00 17.24 ? 62   PRO A CD  1 
ATOM   693  N N   . TYR A 1 70  ? 35.721  -1.242  -30.732 1.00 13.79 ? 63   TYR A N   1 
ATOM   694  C CA  . TYR A 1 70  ? 36.586  -0.335  -29.985 1.00 12.85 ? 63   TYR A CA  1 
ATOM   695  C C   . TYR A 1 70  ? 36.936  -0.914  -28.617 1.00 10.35 ? 63   TYR A C   1 
ATOM   696  O O   . TYR A 1 70  ? 37.664  -0.295  -27.856 1.00 16.38 ? 63   TYR A O   1 
ATOM   697  C CB  . TYR A 1 70  ? 35.939  1.043   -29.817 1.00 15.78 ? 63   TYR A CB  1 
ATOM   698  C CG  . TYR A 1 70  ? 34.666  1.079   -28.970 1.00 14.07 ? 63   TYR A CG  1 
ATOM   699  C CD1 . TYR A 1 70  ? 34.736  1.129   -27.586 1.00 12.80 ? 63   TYR A CD1 1 
ATOM   700  C CD2 . TYR A 1 70  ? 33.404  1.086   -29.566 1.00 12.22 ? 63   TYR A CD2 1 
ATOM   701  C CE1 . TYR A 1 70  ? 33.596  1.165   -26.821 1.00 12.51 ? 63   TYR A CE1 1 
ATOM   702  C CE2 . TYR A 1 70  ? 32.247  1.114   -28.798 1.00 12.04 ? 63   TYR A CE2 1 
ATOM   703  C CZ  . TYR A 1 70  ? 32.358  1.160   -27.425 1.00 10.43 ? 63   TYR A CZ  1 
ATOM   704  O OH  . TYR A 1 70  ? 31.220  1.205   -26.643 1.00 13.18 ? 63   TYR A OH  1 
ATOM   705  N N   A ALA A 1 71  ? 36.416  -2.096  -28.317 0.73 14.89 ? 64   ALA A N   1 
ATOM   706  N N   B ALA A 1 71  ? 36.419  -2.102  -28.326 0.27 14.88 ? 64   ALA A N   1 
ATOM   707  C CA  A ALA A 1 71  ? 36.712  -2.784  -27.058 0.73 13.43 ? 64   ALA A CA  1 
ATOM   708  C CA  B ALA A 1 71  ? 36.704  -2.790  -27.071 0.27 13.66 ? 64   ALA A CA  1 
ATOM   709  C C   A ALA A 1 71  ? 36.546  -4.293  -27.240 0.73 11.44 ? 64   ALA A C   1 
ATOM   710  C C   B ALA A 1 71  ? 36.541  -4.298  -27.246 0.27 11.52 ? 64   ALA A C   1 
ATOM   711  O O   A ALA A 1 71  ? 35.943  -4.744  -28.214 0.73 14.17 ? 64   ALA A O   1 
ATOM   712  O O   B ALA A 1 71  ? 35.913  -4.752  -28.204 0.27 14.32 ? 64   ALA A O   1 
ATOM   713  C CB  A ALA A 1 71  ? 35.812  -2.266  -25.942 0.73 14.94 ? 64   ALA A CB  1 
ATOM   714  C CB  B ALA A 1 71  ? 35.795  -2.275  -25.963 0.27 14.77 ? 64   ALA A CB  1 
ATOM   715  N N   . GLN A 1 72  ? 37.127  -5.076  -26.342 1.00 14.17 ? 65   GLN A N   1 
ATOM   716  C CA  . GLN A 1 72  ? 36.952  -6.529  -26.359 1.00 12.12 ? 65   GLN A CA  1 
ATOM   717  C C   . GLN A 1 72  ? 35.498  -6.847  -26.041 1.00 14.65 ? 65   GLN A C   1 
ATOM   718  O O   . GLN A 1 72  ? 34.906  -6.172  -25.193 1.00 12.99 ? 65   GLN A O   1 
ATOM   719  C CB  A GLN A 1 72  ? 37.873  -7.213  -25.349 0.31 18.53 ? 65   GLN A CB  1 
ATOM   720  C CB  B GLN A 1 72  ? 37.883  -7.196  -25.336 0.69 18.66 ? 65   GLN A CB  1 
ATOM   721  C CG  A GLN A 1 72  ? 39.180  -7.707  -25.929 0.31 22.57 ? 65   GLN A CG  1 
ATOM   722  C CG  B GLN A 1 72  ? 37.790  -8.716  -25.261 0.69 23.09 ? 65   GLN A CG  1 
ATOM   723  C CD  A GLN A 1 72  ? 39.866  -8.706  -25.027 0.31 21.98 ? 65   GLN A CD  1 
ATOM   724  C CD  B GLN A 1 72  ? 38.501  -9.409  -26.419 0.69 18.28 ? 65   GLN A CD  1 
ATOM   725  O OE1 A GLN A 1 72  ? 39.336  -9.080  -23.981 0.31 26.22 ? 65   GLN A OE1 1 
ATOM   726  O OE1 B GLN A 1 72  ? 39.155  -8.760  -27.240 0.69 32.77 ? 65   GLN A OE1 1 
ATOM   727  N NE2 A GLN A 1 72  ? 41.055  -9.145  -25.424 0.31 32.21 ? 65   GLN A NE2 1 
ATOM   728  N NE2 B GLN A 1 72  ? 38.379  -10.731 -26.482 0.69 28.64 ? 65   GLN A NE2 1 
ATOM   729  N N   A PRO A 1 73  ? 34.920  -7.866  -26.696 0.43 15.10 ? 66   PRO A N   1 
ATOM   730  N N   B PRO A 1 73  ? 34.908  -7.840  -26.725 0.57 15.06 ? 66   PRO A N   1 
ATOM   731  C CA  A PRO A 1 73  ? 33.545  -8.267  -26.371 0.43 16.01 ? 66   PRO A CA  1 
ATOM   732  C CA  B PRO A 1 73  ? 33.543  -8.233  -26.365 0.57 16.02 ? 66   PRO A CA  1 
ATOM   733  C C   A PRO A 1 73  ? 33.402  -8.568  -24.882 0.43 15.96 ? 66   PRO A C   1 
ATOM   734  C C   B PRO A 1 73  ? 33.447  -8.514  -24.870 0.57 16.07 ? 66   PRO A C   1 
ATOM   735  O O   A PRO A 1 73  ? 34.107  -9.434  -24.368 0.43 16.17 ? 66   PRO A O   1 
ATOM   736  O O   B PRO A 1 73  ? 34.242  -9.284  -24.332 0.57 14.92 ? 66   PRO A O   1 
ATOM   737  C CB  A PRO A 1 73  ? 33.335  -9.523  -27.216 0.43 17.78 ? 66   PRO A CB  1 
ATOM   738  C CB  B PRO A 1 73  ? 33.310  -9.491  -27.196 0.57 17.80 ? 66   PRO A CB  1 
ATOM   739  C CG  A PRO A 1 73  ? 34.284  -9.350  -28.378 0.43 14.18 ? 66   PRO A CG  1 
ATOM   740  C CG  B PRO A 1 73  ? 34.181  -9.279  -28.419 0.57 14.31 ? 66   PRO A CG  1 
ATOM   741  C CD  A PRO A 1 73  ? 35.484  -8.657  -27.808 0.43 14.37 ? 66   PRO A CD  1 
ATOM   742  C CD  B PRO A 1 73  ? 35.396  -8.547  -27.927 0.57 13.83 ? 66   PRO A CD  1 
ATOM   743  N N   . PRO A 1 74  ? 32.516  -7.839  -24.192 1.00 15.95 ? 67   PRO A N   1 
ATOM   744  C CA  . PRO A 1 74  ? 32.456  -7.930  -22.723 1.00 16.17 ? 67   PRO A CA  1 
ATOM   745  C C   . PRO A 1 74  ? 31.717  -9.171  -22.234 1.00 17.07 ? 67   PRO A C   1 
ATOM   746  O O   . PRO A 1 74  ? 30.726  -9.065  -21.508 1.00 17.73 ? 67   PRO A O   1 
ATOM   747  C CB  . PRO A 1 74  ? 31.708  -6.649  -22.336 1.00 16.92 ? 67   PRO A CB  1 
ATOM   748  C CG  . PRO A 1 74  ? 30.820  -6.356  -23.506 1.00 11.10 ? 67   PRO A CG  1 
ATOM   749  C CD  . PRO A 1 74  ? 31.587  -6.829  -24.735 1.00 12.85 ? 67   PRO A CD  1 
ATOM   750  N N   A VAL A 1 75  ? 32.198  -10.341 -22.622 0.56 17.48 ? 68   VAL A N   1 
ATOM   751  N N   B VAL A 1 75  ? 32.206  -10.342 -22.625 0.44 17.41 ? 68   VAL A N   1 
ATOM   752  C CA  A VAL A 1 75  ? 31.548  -11.582 -22.233 0.56 11.22 ? 68   VAL A CA  1 
ATOM   753  C CA  B VAL A 1 75  ? 31.565  -11.596 -22.252 0.44 11.31 ? 68   VAL A CA  1 
ATOM   754  C C   A VAL A 1 75  ? 32.342  -12.323 -21.168 0.56 14.37 ? 68   VAL A C   1 
ATOM   755  C C   B VAL A 1 75  ? 32.347  -12.326 -21.170 0.44 14.36 ? 68   VAL A C   1 
ATOM   756  O O   A VAL A 1 75  ? 33.495  -11.963 -20.871 0.56 15.06 ? 68   VAL A O   1 
ATOM   757  O O   B VAL A 1 75  ? 33.493  -11.963 -20.862 0.44 15.12 ? 68   VAL A O   1 
ATOM   758  C CB  A VAL A 1 75  ? 31.340  -12.498 -23.450 0.56 14.58 ? 68   VAL A CB  1 
ATOM   759  C CB  B VAL A 1 75  ? 31.398  -12.525 -23.474 0.44 14.49 ? 68   VAL A CB  1 
ATOM   760  C CG1 A VAL A 1 75  ? 30.125  -12.040 -24.244 0.56 17.04 ? 68   VAL A CG1 1 
ATOM   761  C CG1 B VAL A 1 75  ? 30.653  -11.798 -24.578 0.44 12.71 ? 68   VAL A CG1 1 
ATOM   762  C CG2 A VAL A 1 75  ? 32.583  -12.491 -24.315 0.56 14.61 ? 68   VAL A CG2 1 
ATOM   763  C CG2 B VAL A 1 75  ? 32.756  -13.018 -23.968 0.44 14.98 ? 68   VAL A CG2 1 
ATOM   764  N N   . GLY A 1 76  ? 31.725  -13.363 -20.611 1.00 14.84 ? 69   GLY A N   1 
ATOM   765  C CA  . GLY A 1 76  ? 32.351  -14.188 -19.585 1.00 12.40 ? 69   GLY A CA  1 
ATOM   766  C C   . GLY A 1 76  ? 32.781  -13.382 -18.388 1.00 13.81 ? 69   GLY A C   1 
ATOM   767  O O   . GLY A 1 76  ? 31.978  -12.666 -17.785 1.00 15.96 ? 69   GLY A O   1 
ATOM   768  N N   . GLU A 1 77  ? 34.071  -13.449 -18.068 1.00 16.44 ? 70   GLU A N   1 
ATOM   769  C CA  . GLU A 1 77  ? 34.608  -12.751 -16.903 1.00 17.10 ? 70   GLU A CA  1 
ATOM   770  C C   . GLU A 1 77  ? 34.615  -11.232 -17.059 1.00 16.32 ? 70   GLU A C   1 
ATOM   771  O O   . GLU A 1 77  ? 34.800  -10.507 -16.083 1.00 19.02 ? 70   GLU A O   1 
ATOM   772  C CB  A GLU A 1 77  ? 36.014  -13.266 -16.585 0.36 17.08 ? 70   GLU A CB  1 
ATOM   773  C CB  B GLU A 1 77  ? 36.036  -13.226 -16.634 0.64 17.16 ? 70   GLU A CB  1 
ATOM   774  C CG  A GLU A 1 77  ? 36.085  -14.780 -16.312 0.36 17.84 ? 70   GLU A CG  1 
ATOM   775  C CG  B GLU A 1 77  ? 36.125  -14.664 -16.179 0.64 18.21 ? 70   GLU A CG  1 
ATOM   776  C CD  A GLU A 1 77  ? 35.421  -15.217 -15.001 0.36 21.75 ? 70   GLU A CD  1 
ATOM   777  C CD  B GLU A 1 77  ? 35.484  -14.861 -14.820 0.64 23.00 ? 70   GLU A CD  1 
ATOM   778  O OE1 A GLU A 1 77  ? 34.299  -14.765 -14.687 0.36 20.22 ? 70   GLU A OE1 1 
ATOM   779  O OE1 B GLU A 1 77  ? 36.033  -14.343 -13.820 0.64 25.33 ? 70   GLU A OE1 1 
ATOM   780  O OE2 A GLU A 1 77  ? 36.029  -16.034 -14.275 0.36 31.83 ? 70   GLU A OE2 1 
ATOM   781  O OE2 B GLU A 1 77  ? 34.428  -15.522 -14.751 0.64 19.99 ? 70   GLU A OE2 1 
ATOM   782  N N   A LEU A 1 78  ? 34.416  -10.763 -18.287 0.46 12.91 ? 71   LEU A N   1 
ATOM   783  N N   B LEU A 1 78  ? 34.429  -10.749 -18.283 0.54 12.84 ? 71   LEU A N   1 
ATOM   784  C CA  A LEU A 1 78  ? 34.392  -9.340  -18.583 0.46 15.29 ? 71   LEU A CA  1 
ATOM   785  C CA  B LEU A 1 78  ? 34.407  -9.317  -18.534 0.54 15.27 ? 71   LEU A CA  1 
ATOM   786  C C   A LEU A 1 78  ? 33.020  -8.737  -18.319 0.46 14.89 ? 71   LEU A C   1 
ATOM   787  C C   B LEU A 1 78  ? 33.012  -8.732  -18.336 0.54 14.91 ? 71   LEU A C   1 
ATOM   788  O O   A LEU A 1 78  ? 32.864  -7.510  -18.336 0.46 13.81 ? 71   LEU A O   1 
ATOM   789  O O   B LEU A 1 78  ? 32.835  -7.508  -18.403 0.54 13.78 ? 71   LEU A O   1 
ATOM   790  C CB  A LEU A 1 78  ? 34.791  -9.091  -20.039 0.46 14.62 ? 71   LEU A CB  1 
ATOM   791  C CB  B LEU A 1 78  ? 34.915  -9.008  -19.946 0.54 14.21 ? 71   LEU A CB  1 
ATOM   792  C CG  A LEU A 1 78  ? 36.187  -9.555  -20.446 0.46 14.75 ? 71   LEU A CG  1 
ATOM   793  C CG  B LEU A 1 78  ? 36.433  -9.063  -20.107 0.54 14.42 ? 71   LEU A CG  1 
ATOM   794  C CD1 A LEU A 1 78  ? 36.343  -9.428  -21.952 0.46 8.97  ? 71   LEU A CD1 1 
ATOM   795  C CD1 B LEU A 1 78  ? 36.822  -8.760  -21.538 0.54 12.55 ? 71   LEU A CD1 1 
ATOM   796  C CD2 A LEU A 1 78  ? 37.259  -8.757  -19.731 0.46 13.46 ? 71   LEU A CD2 1 
ATOM   797  C CD2 B LEU A 1 78  ? 37.096  -8.081  -19.159 0.54 15.77 ? 71   LEU A CD2 1 
ATOM   798  N N   . ARG A 1 79  ? 32.021  -9.595  -18.097 1.00 12.17 ? 72   ARG A N   1 
ATOM   799  C CA  . ARG A 1 79  ? 30.668  -9.115  -17.821 1.00 14.14 ? 72   ARG A CA  1 
ATOM   800  C C   . ARG A 1 79  ? 30.648  -8.225  -16.569 1.00 12.36 ? 72   ARG A C   1 
ATOM   801  O O   . ARG A 1 79  ? 31.236  -8.585  -15.527 1.00 14.04 ? 72   ARG A O   1 
ATOM   802  C CB  . ARG A 1 79  ? 29.675  -10.274 -17.665 1.00 10.06 ? 72   ARG A CB  1 
ATOM   803  C CG  . ARG A 1 79  ? 28.214  -9.793  -17.433 1.00 13.03 ? 72   ARG A CG  1 
ATOM   804  C CD  . ARG A 1 79  ? 27.248  -10.938 -17.094 1.00 11.42 ? 72   ARG A CD  1 
ATOM   805  N NE  . ARG A 1 79  ? 26.886  -11.736 -18.266 1.00 14.42 ? 72   ARG A NE  1 
ATOM   806  C CZ  . ARG A 1 79  ? 26.199  -12.876 -18.207 1.00 29.67 ? 72   ARG A CZ  1 
ATOM   807  N NH1 . ARG A 1 79  ? 25.792  -13.355 -17.033 1.00 15.10 ? 72   ARG A NH1 1 
ATOM   808  N NH2 . ARG A 1 79  ? 25.910  -13.543 -19.318 1.00 17.29 ? 72   ARG A NH2 1 
ATOM   809  N N   A PHE A 1 80  ? 30.004  -7.065  -16.721 0.24 11.72 ? 73   PHE A N   1 
ATOM   810  N N   B PHE A 1 80  ? 29.965  -7.089  -16.694 0.76 11.68 ? 73   PHE A N   1 
ATOM   811  C CA  A PHE A 1 80  ? 29.873  -5.999  -15.714 0.24 10.44 ? 73   PHE A CA  1 
ATOM   812  C CA  B PHE A 1 80  ? 29.850  -6.044  -15.658 0.76 10.55 ? 73   PHE A CA  1 
ATOM   813  C C   A PHE A 1 80  ? 31.122  -5.122  -15.571 0.24 11.68 ? 73   PHE A C   1 
ATOM   814  C C   B PHE A 1 80  ? 31.158  -5.302  -15.371 0.76 11.68 ? 73   PHE A C   1 
ATOM   815  O O   A PHE A 1 80  ? 31.033  -3.999  -15.068 0.24 12.54 ? 73   PHE A O   1 
ATOM   816  O O   B PHE A 1 80  ? 31.230  -4.522  -14.408 0.76 14.82 ? 73   PHE A O   1 
ATOM   817  C CB  A PHE A 1 80  ? 29.501  -6.569  -14.337 0.24 11.67 ? 73   PHE A CB  1 
ATOM   818  C CB  B PHE A 1 80  ? 29.347  -6.618  -14.316 0.76 11.52 ? 73   PHE A CB  1 
ATOM   819  C CG  A PHE A 1 80  ? 28.247  -7.392  -14.338 0.24 10.61 ? 73   PHE A CG  1 
ATOM   820  C CG  B PHE A 1 80  ? 28.073  -7.408  -14.405 0.76 10.57 ? 73   PHE A CG  1 
ATOM   821  C CD1 A PHE A 1 80  ? 27.043  -6.847  -14.753 0.24 9.44  ? 73   PHE A CD1 1 
ATOM   822  C CD1 B PHE A 1 80  ? 26.908  -6.851  -14.906 0.76 9.19  ? 73   PHE A CD1 1 
ATOM   823  C CD2 A PHE A 1 80  ? 28.267  -8.708  -13.903 0.24 11.45 ? 73   PHE A CD2 1 
ATOM   824  C CD2 B PHE A 1 80  ? 28.034  -8.723  -13.937 0.76 11.89 ? 73   PHE A CD2 1 
ATOM   825  C CE1 A PHE A 1 80  ? 25.882  -7.606  -14.747 0.24 11.72 ? 73   PHE A CE1 1 
ATOM   826  C CE1 B PHE A 1 80  ? 25.721  -7.610  -14.953 0.76 11.21 ? 73   PHE A CE1 1 
ATOM   827  C CE2 A PHE A 1 80  ? 27.114  -9.469  -13.892 0.24 11.50 ? 73   PHE A CE2 1 
ATOM   828  C CE2 B PHE A 1 80  ? 26.873  -9.466  -13.984 0.76 12.34 ? 73   PHE A CE2 1 
ATOM   829  C CZ  A PHE A 1 80  ? 25.919  -8.917  -14.313 0.24 9.34  ? 73   PHE A CZ  1 
ATOM   830  C CZ  B PHE A 1 80  ? 25.718  -8.906  -14.488 0.76 9.22  ? 73   PHE A CZ  1 
ATOM   831  N N   A LYS A 1 81  ? 32.273  -5.622  -16.017 0.24 9.89  ? 74   LYS A N   1 
ATOM   832  N N   B LYS A 1 81  ? 32.209  -5.553  -16.149 0.76 9.37  ? 74   LYS A N   1 
ATOM   833  C CA  A LYS A 1 81  ? 33.549  -4.923  -15.833 0.24 14.90 ? 74   LYS A CA  1 
ATOM   834  C CA  B LYS A 1 81  ? 33.502  -4.907  -15.889 0.76 15.21 ? 74   LYS A CA  1 
ATOM   835  C C   A LYS A 1 81  ? 33.785  -3.806  -16.852 0.24 12.49 ? 74   LYS A C   1 
ATOM   836  C C   B LYS A 1 81  ? 33.792  -3.796  -16.889 0.76 12.62 ? 74   LYS A C   1 
ATOM   837  O O   A LYS A 1 81  ? 33.143  -3.762  -17.902 0.24 12.05 ? 74   LYS A O   1 
ATOM   838  O O   B LYS A 1 81  ? 33.200  -3.748  -17.969 0.76 11.88 ? 74   LYS A O   1 
ATOM   839  C CB  A LYS A 1 81  ? 34.717  -5.918  -15.906 0.24 14.83 ? 74   LYS A CB  1 
ATOM   840  C CB  B LYS A 1 81  ? 34.659  -5.925  -15.925 0.76 15.01 ? 74   LYS A CB  1 
ATOM   841  C CG  A LYS A 1 81  ? 34.609  -7.108  -14.964 0.24 13.64 ? 74   LYS A CG  1 
ATOM   842  C CG  B LYS A 1 81  ? 34.377  -7.251  -15.233 0.76 12.79 ? 74   LYS A CG  1 
ATOM   843  C CD  A LYS A 1 81  ? 34.557  -6.661  -13.513 0.24 15.71 ? 74   LYS A CD  1 
ATOM   844  C CD  B LYS A 1 81  ? 34.057  -7.015  -13.759 0.76 16.64 ? 74   LYS A CD  1 
ATOM   845  C CE  A LYS A 1 81  ? 34.357  -7.839  -12.563 0.24 11.54 ? 74   LYS A CE  1 
ATOM   846  C CE  B LYS A 1 81  ? 34.050  -8.324  -12.956 0.76 14.80 ? 74   LYS A CE  1 
ATOM   847  N NZ  A LYS A 1 81  ? 35.550  -8.717  -12.469 0.24 17.32 ? 74   LYS A NZ  1 
ATOM   848  N NZ  B LYS A 1 81  ? 33.211  -9.390  -13.611 0.76 17.42 ? 74   LYS A NZ  1 
ATOM   849  N N   . ALA A 1 82  ? 34.717  -2.911  -16.528 1.00 10.89 ? 75   ALA A N   1 
ATOM   850  C CA  . ALA A 1 82  ? 35.167  -1.867  -17.438 1.00 8.83  ? 75   ALA A CA  1 
ATOM   851  C C   . ALA A 1 82  ? 35.649  -2.490  -18.738 1.00 12.98 ? 75   ALA A C   1 
ATOM   852  O O   . ALA A 1 82  ? 36.166  -3.596  -18.749 1.00 13.80 ? 75   ALA A O   1 
ATOM   853  C CB  . ALA A 1 82  ? 36.295  -1.055  -16.793 1.00 15.23 ? 75   ALA A CB  1 
ATOM   854  N N   A PRO A 1 83  ? 35.475  -1.772  -19.850 0.32 11.82 ? 76   PRO A N   1 
ATOM   855  N N   B PRO A 1 83  ? 35.478  -1.775  -19.845 0.68 11.76 ? 76   PRO A N   1 
ATOM   856  C CA  A PRO A 1 83  ? 35.906  -2.308  -21.141 0.32 11.85 ? 76   PRO A CA  1 
ATOM   857  C CA  B PRO A 1 83  ? 35.920  -2.343  -21.118 0.68 11.75 ? 76   PRO A CA  1 
ATOM   858  C C   A PRO A 1 83  ? 37.421  -2.446  -21.242 0.32 12.46 ? 76   PRO A C   1 
ATOM   859  C C   B PRO A 1 83  ? 37.439  -2.467  -21.205 0.68 12.44 ? 76   PRO A C   1 
ATOM   860  O O   A PRO A 1 83  ? 38.174  -1.678  -20.635 0.32 15.90 ? 76   PRO A O   1 
ATOM   861  O O   B PRO A 1 83  ? 38.186  -1.709  -20.568 0.68 15.77 ? 76   PRO A O   1 
ATOM   862  C CB  A PRO A 1 83  ? 35.382  -1.272  -22.141 0.32 11.61 ? 76   PRO A CB  1 
ATOM   863  C CB  B PRO A 1 83  ? 35.386  -1.344  -22.150 0.68 11.39 ? 76   PRO A CB  1 
ATOM   864  C CG  A PRO A 1 83  ? 35.293  -0.011  -21.357 0.32 12.04 ? 76   PRO A CG  1 
ATOM   865  C CG  B PRO A 1 83  ? 35.307  -0.054  -21.403 0.68 11.99 ? 76   PRO A CG  1 
ATOM   866  C CD  A PRO A 1 83  ? 34.857  -0.445  -19.980 0.32 10.44 ? 76   PRO A CD  1 
ATOM   867  C CD  B PRO A 1 83  ? 34.888  -0.440  -19.997 0.68 10.35 ? 76   PRO A CD  1 
ATOM   868  N N   A GLN A 1 84  ? 37.849  -3.446  -22.004 0.32 11.31 ? 77   GLN A N   1 
ATOM   869  N N   B GLN A 1 84  ? 37.879  -3.451  -21.980 0.68 11.14 ? 77   GLN A N   1 
ATOM   870  C CA  A GLN A 1 84  ? 39.255  -3.666  -22.302 0.32 13.08 ? 77   GLN A CA  1 
ATOM   871  C CA  B GLN A 1 84  ? 39.284  -3.636  -22.317 0.68 12.88 ? 77   GLN A CA  1 
ATOM   872  C C   A GLN A 1 84  ? 39.484  -3.457  -23.794 0.32 14.11 ? 77   GLN A C   1 
ATOM   873  C C   B GLN A 1 84  ? 39.485  -3.357  -23.805 0.68 14.03 ? 77   GLN A C   1 
ATOM   874  O O   A GLN A 1 84  ? 38.569  -3.654  -24.598 0.32 13.83 ? 77   GLN A O   1 
ATOM   875  O O   B GLN A 1 84  ? 38.555  -3.521  -24.602 0.68 13.85 ? 77   GLN A O   1 
ATOM   876  C CB  A GLN A 1 84  ? 39.678  -5.074  -21.884 0.32 15.10 ? 77   GLN A CB  1 
ATOM   877  C CB  B GLN A 1 84  ? 39.735  -5.062  -21.992 0.68 14.90 ? 77   GLN A CB  1 
ATOM   878  C CG  A GLN A 1 84  ? 39.558  -5.333  -20.389 0.32 12.82 ? 77   GLN A CG  1 
ATOM   879  C CG  B GLN A 1 84  ? 39.926  -5.361  -20.508 0.68 15.07 ? 77   GLN A CG  1 
ATOM   880  C CD  A GLN A 1 84  ? 40.607  -4.590  -19.589 0.32 12.05 ? 77   GLN A CD  1 
ATOM   881  C CD  B GLN A 1 84  ? 40.514  -6.741  -20.291 0.68 18.12 ? 77   GLN A CD  1 
ATOM   882  O OE1 A GLN A 1 84  ? 41.687  -4.285  -20.094 0.32 15.73 ? 77   GLN A OE1 1 
ATOM   883  O OE1 B GLN A 1 84  ? 40.470  -7.589  -21.181 0.68 39.03 ? 77   GLN A OE1 1 
ATOM   884  N NE2 A GLN A 1 84  ? 40.297  -4.301  -18.327 0.32 17.79 ? 77   GLN A NE2 1 
ATOM   885  N NE2 B GLN A 1 84  ? 41.075  -6.971  -19.111 0.68 38.93 ? 77   GLN A NE2 1 
ATOM   886  N N   A ARG A 1 85  ? 40.695  -3.054  -24.168 0.32 15.30 ? 78   ARG A N   1 
ATOM   887  N N   B ARG A 1 85  ? 40.691  -2.945  -24.190 0.68 15.48 ? 78   ARG A N   1 
ATOM   888  C CA  A ARG A 1 85  ? 40.994  -2.791  -25.573 0.32 12.78 ? 78   ARG A CA  1 
ATOM   889  C CA  B ARG A 1 85  ? 40.959  -2.704  -25.610 0.68 12.85 ? 78   ARG A CA  1 
ATOM   890  C C   A ARG A 1 85  ? 40.809  -4.059  -26.405 0.32 16.82 ? 78   ARG A C   1 
ATOM   891  C C   B ARG A 1 85  ? 40.822  -4.006  -26.402 0.68 16.75 ? 78   ARG A C   1 
ATOM   892  O O   A ARG A 1 85  ? 41.033  -5.166  -25.913 0.32 17.20 ? 78   ARG A O   1 
ATOM   893  O O   B ARG A 1 85  ? 41.097  -5.090  -25.878 0.68 17.27 ? 78   ARG A O   1 
ATOM   894  C CB  A ARG A 1 85  ? 42.417  -2.244  -25.728 0.32 13.39 ? 78   ARG A CB  1 
ATOM   895  C CB  B ARG A 1 85  ? 42.352  -2.084  -25.801 0.68 12.89 ? 78   ARG A CB  1 
ATOM   896  C CG  A ARG A 1 85  ? 43.518  -3.283  -25.578 0.32 21.43 ? 78   ARG A CG  1 
ATOM   897  C CG  B ARG A 1 85  ? 42.513  -0.750  -25.089 0.68 14.55 ? 78   ARG A CG  1 
ATOM   898  C CD  A ARG A 1 85  ? 44.894  -2.632  -25.612 0.32 28.97 ? 78   ARG A CD  1 
ATOM   899  C CD  B ARG A 1 85  ? 43.923  -0.154  -25.194 0.68 17.94 ? 78   ARG A CD  1 
ATOM   900  N NE  A ARG A 1 85  ? 45.922  -3.541  -26.112 0.32 26.49 ? 78   ARG A NE  1 
ATOM   901  N NE  B ARG A 1 85  ? 44.165  0.590   -26.435 0.68 18.26 ? 78   ARG A NE  1 
ATOM   902  C CZ  A ARG A 1 85  ? 47.203  -3.214  -26.252 0.32 24.75 ? 78   ARG A CZ  1 
ATOM   903  C CZ  B ARG A 1 85  ? 45.071  0.270   -27.348 0.68 32.49 ? 78   ARG A CZ  1 
ATOM   904  N NH1 A ARG A 1 85  ? 47.622  -1.998  -25.926 0.32 31.14 ? 78   ARG A NH1 1 
ATOM   905  N NH1 B ARG A 1 85  ? 45.849  -0.794  -27.182 0.68 34.15 ? 78   ARG A NH1 1 
ATOM   906  N NH2 A ARG A 1 85  ? 48.068  -4.104  -26.718 0.32 35.61 ? 78   ARG A NH2 1 
ATOM   907  N NH2 B ARG A 1 85  ? 45.202  1.027   -28.426 0.68 17.18 ? 78   ARG A NH2 1 
ATOM   908  N N   . PRO A 1 86  ? 40.380  -3.905  -27.669 1.00 16.34 ? 79   PRO A N   1 
ATOM   909  C CA  . PRO A 1 86  ? 40.140  -5.068  -28.527 1.00 17.05 ? 79   PRO A CA  1 
ATOM   910  C C   . PRO A 1 86  ? 41.400  -5.737  -29.066 1.00 15.74 ? 79   PRO A C   1 
ATOM   911  O O   . PRO A 1 86  ? 42.488  -5.150  -29.071 1.00 17.31 ? 79   PRO A O   1 
ATOM   912  C CB  . PRO A 1 86  ? 39.340  -4.473  -29.689 1.00 16.74 ? 79   PRO A CB  1 
ATOM   913  C CG  . PRO A 1 86  ? 39.848  -3.081  -29.798 1.00 14.69 ? 79   PRO A CG  1 
ATOM   914  C CD  . PRO A 1 86  ? 40.074  -2.642  -28.364 1.00 11.58 ? 79   PRO A CD  1 
ATOM   915  N N   A THR A 1 87  ? 41.235  -6.979  -29.503 0.48 20.12 ? 80   THR A N   1 
ATOM   916  N N   B THR A 1 87  ? 41.239  -6.977  -29.510 0.52 20.14 ? 80   THR A N   1 
ATOM   917  C CA  A THR A 1 87  ? 42.293  -7.730  -30.158 0.48 20.83 ? 80   THR A CA  1 
ATOM   918  C CA  B THR A 1 87  ? 42.315  -7.724  -30.140 0.52 20.84 ? 80   THR A CA  1 
ATOM   919  C C   A THR A 1 87  ? 42.473  -7.198  -31.576 0.48 19.66 ? 80   THR A C   1 
ATOM   920  C C   B THR A 1 87  ? 42.486  -7.252  -31.580 0.52 19.72 ? 80   THR A C   1 
ATOM   921  O O   A THR A 1 87  ? 41.497  -7.063  -32.310 0.48 22.72 ? 80   THR A O   1 
ATOM   922  O O   B THR A 1 87  ? 41.517  -7.219  -32.334 0.52 22.83 ? 80   THR A O   1 
ATOM   923  C CB  A THR A 1 87  ? 41.959  -9.240  -30.186 0.48 22.21 ? 80   THR A CB  1 
ATOM   924  C CB  B THR A 1 87  ? 42.026  -9.241  -30.099 0.52 22.31 ? 80   THR A CB  1 
ATOM   925  O OG1 A THR A 1 87  ? 41.565  -9.666  -28.874 0.48 24.27 ? 80   THR A OG1 1 
ATOM   926  O OG1 B THR A 1 87  ? 42.201  -9.721  -28.760 0.52 23.91 ? 80   THR A OG1 1 
ATOM   927  C CG2 A THR A 1 87  ? 43.147  -10.068 -30.650 0.48 15.36 ? 80   THR A CG2 1 
ATOM   928  C CG2 B THR A 1 87  ? 42.950  -10.007 -31.023 0.52 17.80 ? 80   THR A CG2 1 
ATOM   929  N N   . PRO A 1 88  ? 43.721  -6.880  -31.962 1.00 17.78 ? 81   PRO A N   1 
ATOM   930  C CA  . PRO A 1 88  ? 43.980  -6.382  -33.320 1.00 24.85 ? 81   PRO A CA  1 
ATOM   931  C C   . PRO A 1 88  ? 43.998  -7.519  -34.343 1.00 22.97 ? 81   PRO A C   1 
ATOM   932  O O   . PRO A 1 88  ? 43.993  -8.695  -33.957 1.00 23.06 ? 81   PRO A O   1 
ATOM   933  C CB  . PRO A 1 88  ? 45.355  -5.726  -33.194 1.00 21.57 ? 81   PRO A CB  1 
ATOM   934  C CG  . PRO A 1 88  ? 46.040  -6.551  -32.145 1.00 22.57 ? 81   PRO A CG  1 
ATOM   935  C CD  . PRO A 1 88  ? 44.957  -6.968  -31.163 1.00 21.81 ? 81   PRO A CD  1 
ATOM   936  N N   . TRP A 1 89  ? 44.012  -7.177  -35.632 1.00 17.30 ? 82   TRP A N   1 
ATOM   937  C CA  . TRP A 1 89  ? 43.957  -8.189  -36.696 1.00 19.67 ? 82   TRP A CA  1 
ATOM   938  C C   . TRP A 1 89  ? 44.876  -7.795  -37.841 1.00 16.92 ? 82   TRP A C   1 
ATOM   939  O O   . TRP A 1 89  ? 45.013  -6.615  -38.143 1.00 19.27 ? 82   TRP A O   1 
ATOM   940  C CB  . TRP A 1 89  ? 42.525  -8.367  -37.207 1.00 17.04 ? 82   TRP A CB  1 
ATOM   941  C CG  . TRP A 1 89  ? 41.908  -7.084  -37.653 1.00 21.40 ? 82   TRP A CG  1 
ATOM   942  C CD1 . TRP A 1 89  ? 41.895  -6.574  -38.920 1.00 18.31 ? 82   TRP A CD1 1 
ATOM   943  C CD2 . TRP A 1 89  ? 41.203  -6.142  -36.834 1.00 16.59 ? 82   TRP A CD2 1 
ATOM   944  N NE1 . TRP A 1 89  ? 41.254  -5.361  -38.935 1.00 16.83 ? 82   TRP A NE1 1 
ATOM   945  C CE2 . TRP A 1 89  ? 40.804  -5.078  -37.671 1.00 15.55 ? 82   TRP A CE2 1 
ATOM   946  C CE3 . TRP A 1 89  ? 40.872  -6.093  -35.472 1.00 14.11 ? 82   TRP A CE3 1 
ATOM   947  C CZ2 . TRP A 1 89  ? 40.094  -3.969  -37.183 1.00 15.95 ? 82   TRP A CZ2 1 
ATOM   948  C CZ3 . TRP A 1 89  ? 40.162  -4.991  -34.994 1.00 17.98 ? 82   TRP A CZ3 1 
ATOM   949  C CH2 . TRP A 1 89  ? 39.782  -3.951  -35.843 1.00 13.64 ? 82   TRP A CH2 1 
ATOM   950  N N   A ALA A 1 90  ? 45.507  -8.782  -38.477 0.54 19.53 ? 83   ALA A N   1 
ATOM   951  N N   B ALA A 1 90  ? 45.493  -8.776  -38.493 0.46 19.61 ? 83   ALA A N   1 
ATOM   952  C CA  A ALA A 1 90  ? 46.532  -8.515  -39.495 0.54 19.92 ? 83   ALA A CA  1 
ATOM   953  C CA  B ALA A 1 90  ? 46.523  -8.471  -39.486 0.46 19.92 ? 83   ALA A CA  1 
ATOM   954  C C   A ALA A 1 90  ? 45.945  -8.271  -40.887 0.54 24.98 ? 83   ALA A C   1 
ATOM   955  C C   B ALA A 1 90  ? 46.016  -8.452  -40.929 0.46 25.11 ? 83   ALA A C   1 
ATOM   956  O O   A ALA A 1 90  ? 46.569  -7.621  -41.732 0.54 21.63 ? 83   ALA A O   1 
ATOM   957  O O   B ALA A 1 90  ? 46.767  -8.126  -41.852 0.46 23.45 ? 83   ALA A O   1 
ATOM   958  N N   . GLY A 1 91  ? 44.746  -8.789  -41.124 1.00 18.84 ? 84   GLY A N   1 
ATOM   959  C CA  . GLY A 1 91  ? 44.154  -8.725  -42.452 1.00 15.45 ? 84   GLY A CA  1 
ATOM   960  C C   . GLY A 1 91  ? 43.210  -7.547  -42.556 1.00 14.00 ? 84   GLY A C   1 
ATOM   961  O O   . GLY A 1 91  ? 43.462  -6.488  -41.991 1.00 22.66 ? 84   GLY A O   1 
ATOM   962  N N   A VAL A 1 92  ? 42.130  -7.740  -43.307 0.52 15.97 ? 85   VAL A N   1 
ATOM   963  N N   B VAL A 1 92  ? 42.122  -7.723  -43.298 0.48 15.98 ? 85   VAL A N   1 
ATOM   964  C CA  A VAL A 1 92  ? 41.075  -6.739  -43.429 0.52 19.61 ? 85   VAL A CA  1 
ATOM   965  C CA  B VAL A 1 92  ? 41.138  -6.658  -43.453 0.48 19.71 ? 85   VAL A CA  1 
ATOM   966  C C   A VAL A 1 92  ? 39.804  -7.256  -42.772 0.52 22.29 ? 85   VAL A C   1 
ATOM   967  C C   B VAL A 1 92  ? 39.790  -7.069  -42.874 0.48 22.76 ? 85   VAL A C   1 
ATOM   968  O O   A VAL A 1 92  ? 39.418  -8.401  -42.988 0.52 14.98 ? 85   VAL A O   1 
ATOM   969  O O   B VAL A 1 92  ? 39.142  -7.984  -43.381 0.48 19.74 ? 85   VAL A O   1 
ATOM   970  C CB  A VAL A 1 92  ? 40.774  -6.388  -44.905 0.52 20.98 ? 85   VAL A CB  1 
ATOM   971  C CB  B VAL A 1 92  ? 40.952  -6.260  -44.932 0.48 21.19 ? 85   VAL A CB  1 
ATOM   972  C CG1 A VAL A 1 92  ? 39.711  -5.303  -44.986 0.52 20.00 ? 85   VAL A CG1 1 
ATOM   973  C CG1 B VAL A 1 92  ? 39.867  -5.208  -45.062 0.48 20.00 ? 85   VAL A CG1 1 
ATOM   974  C CG2 A VAL A 1 92  ? 42.044  -5.955  -45.630 0.52 15.04 ? 85   VAL A CG2 1 
ATOM   975  C CG2 B VAL A 1 92  ? 42.265  -5.755  -45.520 0.48 15.97 ? 85   VAL A CG2 1 
ATOM   976  N N   A ARG A 1 93  ? 39.162  -6.412  -41.968 0.52 14.86 ? 86   ARG A N   1 
ATOM   977  N N   B ARG A 1 93  ? 39.382  -6.385  -41.808 0.48 15.72 ? 86   ARG A N   1 
ATOM   978  C CA  A ARG A 1 93  ? 37.905  -6.762  -41.320 0.52 14.64 ? 86   ARG A CA  1 
ATOM   979  C CA  B ARG A 1 93  ? 38.112  -6.645  -41.143 0.48 15.35 ? 86   ARG A CA  1 
ATOM   980  C C   A ARG A 1 93  ? 36.726  -6.239  -42.130 0.52 15.27 ? 86   ARG A C   1 
ATOM   981  C C   B ARG A 1 93  ? 36.942  -6.140  -41.967 0.48 15.70 ? 86   ARG A C   1 
ATOM   982  O O   A ARG A 1 93  ? 36.705  -5.066  -42.507 0.52 15.58 ? 86   ARG A O   1 
ATOM   983  O O   B ARG A 1 93  ? 36.902  -4.968  -42.347 0.48 13.61 ? 86   ARG A O   1 
ATOM   984  C CB  A ARG A 1 93  ? 37.856  -6.196  -39.895 0.52 16.60 ? 86   ARG A CB  1 
ATOM   985  C CB  B ARG A 1 93  ? 38.085  -5.987  -39.757 0.48 14.53 ? 86   ARG A CB  1 
ATOM   986  C CG  A ARG A 1 93  ? 36.672  -6.700  -39.067 0.52 15.67 ? 86   ARG A CG  1 
ATOM   987  C CG  B ARG A 1 93  ? 36.695  -5.935  -39.123 0.48 14.64 ? 86   ARG A CG  1 
ATOM   988  C CD  A ARG A 1 93  ? 36.704  -6.132  -37.647 0.52 21.05 ? 86   ARG A CD  1 
ATOM   989  C CD  B ARG A 1 93  ? 36.716  -5.296  -37.730 0.48 13.23 ? 86   ARG A CD  1 
ATOM   990  N NE  A ARG A 1 93  ? 35.789  -6.830  -36.747 0.52 23.27 ? 86   ARG A NE  1 
ATOM   991  N NE  B ARG A 1 93  ? 37.293  -6.160  -36.701 0.48 16.05 ? 86   ARG A NE  1 
ATOM   992  C CZ  A ARG A 1 93  ? 36.112  -7.910  -36.041 0.52 16.03 ? 86   ARG A CZ  1 
ATOM   993  C CZ  B ARG A 1 93  ? 36.588  -7.009  -35.958 0.48 11.80 ? 86   ARG A CZ  1 
ATOM   994  N NH1 A ARG A 1 93  ? 37.329  -8.430  -36.128 0.52 30.16 ? 86   ARG A NH1 1 
ATOM   995  N NH1 B ARG A 1 93  ? 35.278  -7.119  -36.145 0.48 18.55 ? 86   ARG A NH1 1 
ATOM   996  N NH2 A ARG A 1 93  ? 35.216  -8.475  -35.248 0.52 32.47 ? 86   ARG A NH2 1 
ATOM   997  N NH2 B ARG A 1 93  ? 37.192  -7.757  -35.038 0.48 16.54 ? 86   ARG A NH2 1 
ATOM   998  N N   A ASP A 1 94  ? 35.746  -7.102  -42.387 0.52 17.31 ? 87   ASP A N   1 
ATOM   999  N N   B ASP A 1 94  ? 35.982  -7.020  -42.228 0.48 15.66 ? 87   ASP A N   1 
ATOM   1000 C CA  A ASP A 1 94  ? 34.554  -6.703  -43.142 0.52 15.71 ? 87   ASP A CA  1 
ATOM   1001 C CA  B ASP A 1 94  ? 34.774  -6.624  -42.941 0.48 16.65 ? 87   ASP A CA  1 
ATOM   1002 C C   A ASP A 1 94  ? 33.614  -5.846  -42.296 0.52 18.60 ? 87   ASP A C   1 
ATOM   1003 C C   B ASP A 1 94  ? 33.902  -5.700  -42.094 0.48 17.39 ? 87   ASP A C   1 
ATOM   1004 O O   A ASP A 1 94  ? 32.988  -6.337  -41.350 0.52 17.46 ? 87   ASP A O   1 
ATOM   1005 O O   B ASP A 1 94  ? 33.593  -6.012  -40.940 0.48 17.60 ? 87   ASP A O   1 
ATOM   1006 C CB  A ASP A 1 94  ? 33.808  -7.934  -43.677 0.52 25.06 ? 87   ASP A CB  1 
ATOM   1007 C CB  B ASP A 1 94  ? 33.972  -7.853  -43.371 0.48 21.65 ? 87   ASP A CB  1 
ATOM   1008 C CG  A ASP A 1 94  ? 32.634  -7.567  -44.601 0.52 25.93 ? 87   ASP A CG  1 
ATOM   1009 C CG  B ASP A 1 94  ? 32.748  -7.484  -44.190 0.48 26.02 ? 87   ASP A CG  1 
ATOM   1010 O OD1 A ASP A 1 94  ? 31.736  -6.808  -44.179 0.52 16.86 ? 87   ASP A OD1 1 
ATOM   1011 O OD1 B ASP A 1 94  ? 32.725  -6.360  -44.730 0.48 18.39 ? 87   ASP A OD1 1 
ATOM   1012 O OD2 A ASP A 1 94  ? 32.596  -8.044  -45.756 0.52 19.59 ? 87   ASP A OD2 1 
ATOM   1013 O OD2 B ASP A 1 94  ? 31.817  -8.310  -44.300 0.48 27.77 ? 87   ASP A OD2 1 
ATOM   1014 N N   A CYS A 1 95  ? 33.505  -4.572  -42.669 0.52 15.54 ? 88   CYS A N   1 
ATOM   1015 N N   B CYS A 1 95  ? 33.502  -4.573  -42.680 0.48 15.54 ? 88   CYS A N   1 
ATOM   1016 C CA  A CYS A 1 95  ? 32.661  -3.605  -41.961 0.52 17.67 ? 88   CYS A CA  1 
ATOM   1017 C CA  B CYS A 1 95  ? 32.682  -3.574  -41.989 0.48 17.70 ? 88   CYS A CA  1 
ATOM   1018 C C   A CYS A 1 95  ? 31.547  -3.061  -42.883 0.52 15.32 ? 88   CYS A C   1 
ATOM   1019 C C   B CYS A 1 95  ? 31.553  -3.051  -42.898 0.48 15.27 ? 88   CYS A C   1 
ATOM   1020 O O   A CYS A 1 95  ? 31.152  -1.887  -42.801 0.52 15.16 ? 88   CYS A O   1 
ATOM   1021 O O   B CYS A 1 95  ? 31.153  -1.878  -42.821 0.48 15.13 ? 88   CYS A O   1 
ATOM   1022 C CB  A CYS A 1 95  ? 33.517  -2.456  -41.424 0.52 17.09 ? 88   CYS A CB  1 
ATOM   1023 C CB  B CYS A 1 95  ? 33.549  -2.408  -41.511 0.48 16.98 ? 88   CYS A CB  1 
ATOM   1024 S SG  A CYS A 1 95  ? 34.685  -2.923  -40.091 0.52 17.87 ? 88   CYS A SG  1 
ATOM   1025 S SG  B CYS A 1 95  ? 34.683  -2.796  -40.130 0.48 18.04 ? 88   CYS A SG  1 
ATOM   1026 N N   . CYS A 1 96  ? 31.024  -3.923  -43.750 1.00 16.82 ? 89   CYS A N   1 
ATOM   1027 C CA  . CYS A 1 96  ? 29.955  -3.533  -44.689 1.00 12.60 ? 89   CYS A CA  1 
ATOM   1028 C C   . CYS A 1 96  ? 28.599  -3.880  -44.158 1.00 19.67 ? 89   CYS A C   1 
ATOM   1029 O O   . CYS A 1 96  ? 27.626  -3.907  -44.893 1.00 23.42 ? 89   CYS A O   1 
ATOM   1030 C CB  . CYS A 1 96  ? 30.171  -4.234  -46.031 1.00 17.28 ? 89   CYS A CB  1 
ATOM   1031 S SG  . CYS A 1 96  ? 31.665  -3.742  -46.882 1.00 23.64 ? 89   CYS A SG  1 
ATOM   1032 N N   . ASN A 1 97  ? 28.567  -4.146  -42.867 1.00 19.29 ? 90   ASN A N   1 
ATOM   1033 C CA  . ASN A 1 97  ? 27.398  -4.716  -42.207 1.00 24.77 ? 90   ASN A CA  1 
ATOM   1034 C C   . ASN A 1 97  ? 27.413  -4.499  -40.762 1.00 16.00 ? 90   ASN A C   1 
ATOM   1035 O O   . ASN A 1 97  ? 28.460  -4.662  -40.148 1.00 22.71 ? 90   ASN A O   1 
ATOM   1036 C CB  . ASN A 1 97  ? 27.212  -6.226  -42.509 1.00 32.72 ? 90   ASN A CB  1 
ATOM   1037 C CG  . ASN A 1 97  ? 26.432  -6.480  -43.819 1.00 67.79 ? 90   ASN A CG  1 
ATOM   1038 O OD1 . ASN A 1 97  ? 26.908  -7.202  -44.674 1.00 70.27 ? 90   ASN A OD1 1 
ATOM   1039 N ND2 . ASN A 1 97  ? 25.161  -5.915  -43.899 1.00 53.79 ? 90   ASN A ND2 1 
ATOM   1040 N N   . HIS A 1 98  ? 26.231  -4.202  -40.232 1.00 21.89 ? 91   HIS A N   1 
ATOM   1041 C CA  . HIS A 1 98  ? 26.103  -3.881  -38.850 1.00 19.48 ? 91   HIS A CA  1 
ATOM   1042 C C   . HIS A 1 98  ? 26.255  -5.098  -37.951 1.00 15.51 ? 91   HIS A C   1 
ATOM   1043 O O   . HIS A 1 98  ? 26.084  -6.226  -38.381 1.00 20.40 ? 91   HIS A O   1 
ATOM   1044 C CB  . HIS A 1 98  ? 24.750  -3.199  -38.604 1.00 20.77 ? 91   HIS A CB  1 
ATOM   1045 C CG  . HIS A 1 98  ? 23.544  -4.064  -38.856 1.00 24.23 ? 91   HIS A CG  1 
ATOM   1046 N ND1 . HIS A 1 98  ? 23.067  -4.973  -37.931 1.00 25.21 ? 91   HIS A ND1 1 
ATOM   1047 C CD2 . HIS A 1 98  ? 22.684  -4.115  -39.904 1.00 42.72 ? 91   HIS A CD2 1 
ATOM   1048 C CE1 . HIS A 1 98  ? 21.983  -5.560  -38.408 1.00 31.60 ? 91   HIS A CE1 1 
ATOM   1049 N NE2 . HIS A 1 98  ? 21.727  -5.055  -39.601 1.00 36.55 ? 91   HIS A NE2 1 
ATOM   1050 N N   A LYS A 1 99  ? 26.595  -4.831  -36.694 0.56 16.24 ? 92   LYS A N   1 
ATOM   1051 N N   B LYS A 1 99  ? 26.565  -4.863  -36.680 0.44 15.92 ? 92   LYS A N   1 
ATOM   1052 C CA  A LYS A 1 99  ? 26.691  -5.851  -35.669 0.56 15.80 ? 92   LYS A CA  1 
ATOM   1053 C CA  B LYS A 1 99  ? 26.651  -5.953  -35.721 0.44 15.92 ? 92   LYS A CA  1 
ATOM   1054 C C   A LYS A 1 99  ? 25.453  -5.797  -34.787 0.56 16.02 ? 92   LYS A C   1 
ATOM   1055 C C   B LYS A 1 99  ? 25.352  -6.072  -34.947 0.44 14.88 ? 92   LYS A C   1 
ATOM   1056 O O   A LYS A 1 99  ? 24.548  -4.981  -35.000 0.56 16.19 ? 92   LYS A O   1 
ATOM   1057 O O   B LYS A 1 99  ? 24.280  -5.695  -35.427 0.44 24.96 ? 92   LYS A O   1 
ATOM   1058 C CB  A LYS A 1 99  ? 27.960  -5.655  -34.840 0.56 20.61 ? 92   LYS A CB  1 
ATOM   1059 C CB  B LYS A 1 99  ? 27.818  -5.739  -34.756 0.44 20.36 ? 92   LYS A CB  1 
ATOM   1060 C CG  A LYS A 1 99  ? 29.226  -6.158  -35.524 0.56 17.79 ? 92   LYS A CG  1 
ATOM   1061 C CG  B LYS A 1 99  ? 29.108  -5.353  -35.441 0.44 18.14 ? 92   LYS A CG  1 
ATOM   1062 C CD  A LYS A 1 99  ? 29.182  -7.662  -35.700 0.56 22.32 ? 92   LYS A CD  1 
ATOM   1063 C CD  B LYS A 1 99  ? 29.654  -6.466  -36.316 0.44 19.48 ? 92   LYS A CD  1 
ATOM   1064 C CE  A LYS A 1 99  ? 30.554  -8.228  -36.039 0.56 28.02 ? 92   LYS A CE  1 
ATOM   1065 C CE  B LYS A 1 99  ? 30.438  -7.473  -35.504 0.44 24.55 ? 92   LYS A CE  1 
ATOM   1066 N NZ  A LYS A 1 99  ? 30.607  -9.697  -35.772 0.56 25.07 ? 92   LYS A NZ  1 
ATOM   1067 N NZ  B LYS A 1 99  ? 31.329  -8.292  -36.367 0.44 23.35 ? 92   LYS A NZ  1 
ATOM   1068 N N   A ASP A 1 100 ? 25.426  -6.656  -33.782 0.56 15.52 ? 93   ASP A N   1 
ATOM   1069 N N   B ASP A 1 100 ? 25.469  -6.597  -33.738 0.44 15.54 ? 93   ASP A N   1 
ATOM   1070 C CA  A ASP A 1 100 ? 24.270  -6.729  -32.906 0.56 17.73 ? 93   ASP A CA  1 
ATOM   1071 C CA  B ASP A 1 100 ? 24.332  -6.739  -32.846 0.44 17.80 ? 93   ASP A CA  1 
ATOM   1072 C C   A ASP A 1 100 ? 24.157  -5.488  -32.030 0.56 17.83 ? 93   ASP A C   1 
ATOM   1073 C C   B ASP A 1 100 ? 24.174  -5.499  -31.982 0.44 17.88 ? 93   ASP A C   1 
ATOM   1074 O O   A ASP A 1 100 ? 25.136  -4.783  -31.792 0.56 16.66 ? 93   ASP A O   1 
ATOM   1075 O O   B ASP A 1 100 ? 25.146  -4.797  -31.705 0.44 16.70 ? 93   ASP A O   1 
ATOM   1076 C CB  A ASP A 1 100 ? 24.337  -7.973  -32.017 0.56 22.06 ? 93   ASP A CB  1 
ATOM   1077 C CB  B ASP A 1 100 ? 24.505  -7.972  -31.957 0.44 21.95 ? 93   ASP A CB  1 
ATOM   1078 C CG  A ASP A 1 100 ? 24.893  -9.189  -32.737 0.56 23.29 ? 93   ASP A CG  1 
ATOM   1079 C CG  B ASP A 1 100 ? 23.592  -9.116  -32.350 0.44 24.76 ? 93   ASP A CG  1 
ATOM   1080 O OD1 A ASP A 1 100 ? 24.862  -9.225  -33.981 0.56 38.69 ? 93   ASP A OD1 1 
ATOM   1081 O OD1 B ASP A 1 100 ? 22.458  -9.177  -31.832 0.44 23.88 ? 93   ASP A OD1 1 
ATOM   1082 O OD2 A ASP A 1 100 ? 25.367  -10.118 -32.054 0.56 31.41 ? 93   ASP A OD2 1 
ATOM   1083 O OD2 B ASP A 1 100 ? 24.010  -9.953  -33.176 0.44 27.00 ? 93   ASP A OD2 1 
ATOM   1084 N N   . LYS A 1 101 ? 22.949  -5.234  -31.546 1.00 12.46 ? 94   LYS A N   1 
ATOM   1085 C CA  . LYS A 1 101 ? 22.740  -4.201  -30.547 1.00 12.40 ? 94   LYS A CA  1 
ATOM   1086 C C   . LYS A 1 101 ? 22.949  -4.805  -29.164 1.00 12.00 ? 94   LYS A C   1 
ATOM   1087 O O   . LYS A 1 101 ? 22.968  -6.027  -29.006 1.00 13.75 ? 94   LYS A O   1 
ATOM   1088 C CB  A LYS A 1 101 ? 21.344  -3.575  -30.661 0.59 15.57 ? 94   LYS A CB  1 
ATOM   1089 C CB  B LYS A 1 101 ? 21.331  -3.606  -30.666 0.41 15.66 ? 94   LYS A CB  1 
ATOM   1090 C CG  A LYS A 1 101 ? 20.192  -4.562  -30.639 0.59 15.38 ? 94   LYS A CG  1 
ATOM   1091 C CG  B LYS A 1 101 ? 20.216  -4.594  -30.341 0.41 14.53 ? 94   LYS A CG  1 
ATOM   1092 C CD  A LYS A 1 101 ? 18.869  -3.836  -30.847 0.59 19.96 ? 94   LYS A CD  1 
ATOM   1093 C CD  B LYS A 1 101 ? 18.839  -4.055  -30.722 0.41 20.61 ? 94   LYS A CD  1 
ATOM   1094 C CE  A LYS A 1 101 ? 18.786  -3.218  -32.239 0.59 12.69 ? 94   LYS A CE  1 
ATOM   1095 C CE  B LYS A 1 101 ? 18.451  -4.427  -32.153 0.41 21.63 ? 94   LYS A CE  1 
ATOM   1096 N NZ  A LYS A 1 101 ? 17.486  -2.534  -32.462 0.59 21.54 ? 94   LYS A NZ  1 
ATOM   1097 N NZ  B LYS A 1 101 ? 16.983  -4.274  -32.370 0.41 26.83 ? 94   LYS A NZ  1 
ATOM   1098 N N   A SER A 1 102 ? 23.126  -3.942  -28.170 0.52 12.33 ? 95   SER A N   1 
ATOM   1099 N N   B SER A 1 102 ? 23.125  -3.942  -28.170 0.48 12.35 ? 95   SER A N   1 
ATOM   1100 C CA  A SER A 1 102 ? 23.225  -4.371  -26.782 0.52 12.06 ? 95   SER A CA  1 
ATOM   1101 C CA  B SER A 1 102 ? 23.221  -4.371  -26.783 0.48 12.09 ? 95   SER A CA  1 
ATOM   1102 C C   A SER A 1 102 ? 21.930  -5.071  -26.352 0.52 10.79 ? 95   SER A C   1 
ATOM   1103 C C   B SER A 1 102 ? 21.928  -5.078  -26.359 0.48 10.71 ? 95   SER A C   1 
ATOM   1104 O O   A SER A 1 102 ? 20.843  -4.719  -26.823 0.52 11.82 ? 95   SER A O   1 
ATOM   1105 O O   B SER A 1 102 ? 20.842  -4.738  -26.840 0.48 11.78 ? 95   SER A O   1 
ATOM   1106 C CB  A SER A 1 102 ? 23.502  -3.171  -25.885 0.52 12.43 ? 95   SER A CB  1 
ATOM   1107 C CB  B SER A 1 102 ? 23.489  -3.172  -25.882 0.48 12.42 ? 95   SER A CB  1 
ATOM   1108 O OG  A SER A 1 102 ? 23.664  -3.563  -24.526 0.52 12.63 ? 95   SER A OG  1 
ATOM   1109 O OG  B SER A 1 102 ? 23.616  -3.565  -24.522 0.48 12.69 ? 95   SER A OG  1 
ATOM   1110 N N   . VAL A 1 103 ? 22.050  -6.049  -25.457 1.00 9.84  ? 96   VAL A N   1 
ATOM   1111 C CA  . VAL A 1 103 ? 20.882  -6.793  -24.977 1.00 11.50 ? 96   VAL A CA  1 
ATOM   1112 C C   . VAL A 1 103 ? 19.835  -5.855  -24.384 1.00 12.18 ? 96   VAL A C   1 
ATOM   1113 O O   . VAL A 1 103 ? 20.119  -5.048  -23.488 1.00 13.66 ? 96   VAL A O   1 
ATOM   1114 C CB  . VAL A 1 103 ? 21.241  -7.847  -23.922 1.00 12.34 ? 96   VAL A CB  1 
ATOM   1115 C CG1 . VAL A 1 103 ? 20.054  -8.758  -23.692 1.00 12.02 ? 96   VAL A CG1 1 
ATOM   1116 C CG2 . VAL A 1 103 ? 22.449  -8.670  -24.378 1.00 14.98 ? 96   VAL A CG2 1 
ATOM   1117 N N   . GLN A 1 104 ? 18.618  -5.982  -24.892 1.00 11.22 ? 97   GLN A N   1 
ATOM   1118 C CA  . GLN A 1 104 ? 17.535  -5.082  -24.519 1.00 10.88 ? 97   GLN A CA  1 
ATOM   1119 C C   . GLN A 1 104 ? 16.205  -5.682  -24.853 1.00 10.99 ? 97   GLN A C   1 
ATOM   1120 O O   . GLN A 1 104 ? 16.135  -6.644  -25.600 1.00 13.31 ? 97   GLN A O   1 
ATOM   1121 C CB  A GLN A 1 104 ? 17.681  -3.764  -25.252 0.73 9.22  ? 97   GLN A CB  1 
ATOM   1122 C CB  B GLN A 1 104 ? 17.690  -3.743  -25.234 0.27 9.40  ? 97   GLN A CB  1 
ATOM   1123 C CG  A GLN A 1 104 ? 17.679  -3.933  -26.743 0.73 12.03 ? 97   GLN A CG  1 
ATOM   1124 C CG  B GLN A 1 104 ? 17.591  -3.850  -26.738 0.27 12.12 ? 97   GLN A CG  1 
ATOM   1125 C CD  A GLN A 1 104 ? 18.150  -2.691  -27.417 0.73 12.24 ? 97   GLN A CD  1 
ATOM   1126 C CD  B GLN A 1 104 ? 18.008  -2.576  -27.426 0.27 11.52 ? 97   GLN A CD  1 
ATOM   1127 O OE1 A GLN A 1 104 ? 17.373  -1.765  -27.656 0.73 12.29 ? 97   GLN A OE1 1 
ATOM   1128 O OE1 B GLN A 1 104 ? 17.168  -1.773  -27.836 0.27 12.21 ? 97   GLN A OE1 1 
ATOM   1129 N NE2 A GLN A 1 104 ? 19.440  -2.647  -27.710 0.73 11.28 ? 97   GLN A NE2 1 
ATOM   1130 N NE2 B GLN A 1 104 ? 19.314  -2.380  -27.556 0.27 12.09 ? 97   GLN A NE2 1 
ATOM   1131 N N   . VAL A 1 105 ? 15.146  -5.097  -24.305 1.00 12.11 ? 98   VAL A N   1 
ATOM   1132 C CA  . VAL A 1 105 ? 13.806  -5.439  -24.759 1.00 15.84 ? 98   VAL A CA  1 
ATOM   1133 C C   . VAL A 1 105 ? 13.450  -4.618  -25.994 1.00 15.66 ? 98   VAL A C   1 
ATOM   1134 O O   . VAL A 1 105 ? 13.510  -3.388  -25.975 1.00 17.99 ? 98   VAL A O   1 
ATOM   1135 C CB  . VAL A 1 105 ? 12.762  -5.194  -23.669 1.00 14.85 ? 98   VAL A CB  1 
ATOM   1136 C CG1 . VAL A 1 105 ? 11.403  -5.695  -24.134 1.00 23.34 ? 98   VAL A CG1 1 
ATOM   1137 C CG2 . VAL A 1 105 ? 13.159  -5.906  -22.406 1.00 18.54 ? 98   VAL A CG2 1 
ATOM   1138 N N   A ASP A 1 106 ? 13.086  -5.307  -27.069 0.60 19.70 ? 99   ASP A N   1 
ATOM   1139 N N   B ASP A 1 106 ? 13.082  -5.306  -27.069 0.40 19.76 ? 99   ASP A N   1 
ATOM   1140 C CA  A ASP A 1 106 ? 12.659  -4.635  -28.289 0.60 21.20 ? 99   ASP A CA  1 
ATOM   1141 C CA  B ASP A 1 106 ? 12.678  -4.646  -28.306 0.40 21.32 ? 99   ASP A CA  1 
ATOM   1142 C C   A ASP A 1 106 ? 11.368  -3.892  -27.999 0.60 25.00 ? 99   ASP A C   1 
ATOM   1143 C C   B ASP A 1 106 ? 11.379  -3.881  -28.080 0.40 24.95 ? 99   ASP A C   1 
ATOM   1144 O O   A ASP A 1 106 ? 10.385  -4.486  -27.564 0.60 26.72 ? 99   ASP A O   1 
ATOM   1145 O O   B ASP A 1 106 ? 10.362  -4.470  -27.724 0.40 26.88 ? 99   ASP A O   1 
ATOM   1146 C CB  A ASP A 1 106 ? 12.474  -5.642  -29.430 0.60 21.42 ? 99   ASP A CB  1 
ATOM   1147 C CB  B ASP A 1 106 ? 12.517  -5.676  -29.429 0.40 21.44 ? 99   ASP A CB  1 
ATOM   1148 C CG  A ASP A 1 106 ? 12.215  -4.971  -30.777 0.60 31.60 ? 99   ASP A CG  1 
ATOM   1149 C CG  B ASP A 1 106 ? 12.189  -5.041  -30.769 0.40 31.36 ? 99   ASP A CG  1 
ATOM   1150 O OD1 A ASP A 1 106 ? 11.404  -4.020  -30.838 0.60 19.78 ? 99   ASP A OD1 1 
ATOM   1151 O OD1 B ASP A 1 106 ? 13.118  -4.843  -31.583 0.40 25.49 ? 99   ASP A OD1 1 
ATOM   1152 O OD2 A ASP A 1 106 ? 12.834  -5.395  -31.780 0.60 25.48 ? 99   ASP A OD2 1 
ATOM   1153 O OD2 B ASP A 1 106 ? 11.001  -4.745  -31.011 0.40 23.42 ? 99   ASP A OD2 1 
ATOM   1154 N N   A PHE A 1 107 ? 11.385  -2.588  -28.230 0.60 29.49 ? 100  PHE A N   1 
ATOM   1155 N N   B PHE A 1 107 ? 11.420  -2.568  -28.280 0.40 29.50 ? 100  PHE A N   1 
ATOM   1156 C CA  A PHE A 1 107 ? 10.255  -1.733  -27.891 0.60 37.28 ? 100  PHE A CA  1 
ATOM   1157 C CA  B PHE A 1 107 ? 10.295  -1.702  -27.925 0.40 37.11 ? 100  PHE A CA  1 
ATOM   1158 C C   A PHE A 1 107 ? 8.983   -2.063  -28.675 0.60 33.50 ? 100  PHE A C   1 
ATOM   1159 C C   B PHE A 1 107 ? 9.026   -1.901  -28.764 0.40 33.44 ? 100  PHE A C   1 
ATOM   1160 O O   A PHE A 1 107 ? 7.880   -1.811  -28.193 0.60 37.67 ? 100  PHE A O   1 
ATOM   1161 O O   B PHE A 1 107 ? 7.967   -1.386  -28.411 0.40 39.70 ? 100  PHE A O   1 
ATOM   1162 C CB  A PHE A 1 107 ? 10.625  -0.244  -28.069 0.60 38.31 ? 100  PHE A CB  1 
ATOM   1163 C CB  B PHE A 1 107 ? 10.719  -0.217  -27.967 0.40 37.82 ? 100  PHE A CB  1 
ATOM   1164 C CG  A PHE A 1 107 ? 11.043  0.155   -29.473 0.60 42.87 ? 100  PHE A CG  1 
ATOM   1165 C CG  B PHE A 1 107 ? 11.414  0.227   -29.244 0.40 43.06 ? 100  PHE A CG  1 
ATOM   1166 C CD1 A PHE A 1 107 ? 10.648  1.380   -29.985 0.60 47.62 ? 100  PHE A CD1 1 
ATOM   1167 C CD1 B PHE A 1 107 ? 11.476  -0.577  -30.375 0.40 39.94 ? 100  PHE A CD1 1 
ATOM   1168 C CD2 A PHE A 1 107 ? 11.866  -0.646  -30.254 0.60 39.19 ? 100  PHE A CD2 1 
ATOM   1169 C CD2 B PHE A 1 107 ? 12.008  1.479   -29.297 0.40 41.28 ? 100  PHE A CD2 1 
ATOM   1170 C CE1 A PHE A 1 107 ? 11.030  1.783   -31.252 0.60 48.12 ? 100  PHE A CE1 1 
ATOM   1171 C CE1 B PHE A 1 107 ? 12.118  -0.143  -31.523 0.40 48.50 ? 100  PHE A CE1 1 
ATOM   1172 C CE2 A PHE A 1 107 ? 12.251  -0.252  -31.524 0.60 49.05 ? 100  PHE A CE2 1 
ATOM   1173 C CE2 B PHE A 1 107 ? 12.651  1.919   -30.440 0.40 37.93 ? 100  PHE A CE2 1 
ATOM   1174 C CZ  A PHE A 1 107 ? 11.833  0.966   -32.023 0.60 46.46 ? 100  PHE A CZ  1 
ATOM   1175 C CZ  B PHE A 1 107 ? 12.706  1.107   -31.556 0.40 38.11 ? 100  PHE A CZ  1 
ATOM   1176 N N   . ILE A 1 108 ? 9.122   -2.651  -29.858 1.00 27.44 ? 101  ILE A N   1 
ATOM   1177 C CA  . ILE A 1 108 ? 7.938   -2.980  -30.655 1.00 25.43 ? 101  ILE A CA  1 
ATOM   1178 C C   . ILE A 1 108 ? 7.414   -4.396  -30.371 1.00 33.43 ? 101  ILE A C   1 
ATOM   1179 O O   . ILE A 1 108 ? 6.214   -4.592  -30.154 1.00 29.47 ? 101  ILE A O   1 
ATOM   1180 C CB  A ILE A 1 108 ? 8.231   -2.848  -32.165 0.56 32.69 ? 101  ILE A CB  1 
ATOM   1181 C CB  B ILE A 1 108 ? 8.205   -2.840  -32.176 0.44 32.60 ? 101  ILE A CB  1 
ATOM   1182 C CG1 A ILE A 1 108 ? 9.065   -1.597  -32.438 0.56 20.76 ? 101  ILE A CG1 1 
ATOM   1183 C CG1 B ILE A 1 108 ? 7.763   -1.464  -32.677 0.44 29.75 ? 101  ILE A CG1 1 
ATOM   1184 C CG2 A ILE A 1 108 ? 6.935   -2.825  -32.962 0.56 21.42 ? 101  ILE A CG2 1 
ATOM   1185 C CG2 B ILE A 1 108 ? 7.420   -3.887  -32.959 0.44 18.95 ? 101  ILE A CG2 1 
ATOM   1186 C CD1 A ILE A 1 108 ? 8.338   -0.298  -32.147 0.56 30.15 ? 101  ILE A CD1 1 
ATOM   1187 C CD1 B ILE A 1 108 ? 8.449   -0.292  -32.012 0.44 30.17 ? 101  ILE A CD1 1 
ATOM   1188 N N   . THR A 1 109 ? 8.302   -5.384  -30.365 1.00 25.14 ? 102  THR A N   1 
ATOM   1189 C CA  . THR A 1 109 ? 7.875   -6.768  -30.198 1.00 27.64 ? 102  THR A CA  1 
ATOM   1190 C C   . THR A 1 109 ? 7.705   -7.156  -28.733 1.00 31.19 ? 102  THR A C   1 
ATOM   1191 O O   . THR A 1 109 ? 6.920   -8.047  -28.410 1.00 40.73 ? 102  THR A O   1 
ATOM   1192 C CB  . THR A 1 109 ? 8.870   -7.732  -30.863 1.00 38.31 ? 102  THR A CB  1 
ATOM   1193 O OG1 . THR A 1 109 ? 10.118  -7.677  -30.168 1.00 30.12 ? 102  THR A OG1 1 
ATOM   1194 C CG2 . THR A 1 109 ? 9.097   -7.349  -32.316 1.00 43.16 ? 102  THR A CG2 1 
ATOM   1195 N N   . GLY A 1 110 ? 8.447   -6.492  -27.849 1.00 24.14 ? 103  GLY A N   1 
ATOM   1196 C CA  . GLY A 1 110 ? 8.406   -6.809  -26.430 1.00 33.98 ? 103  GLY A CA  1 
ATOM   1197 C C   . GLY A 1 110 ? 9.259   -8.011  -26.064 1.00 28.95 ? 103  GLY A C   1 
ATOM   1198 O O   . GLY A 1 110 ? 9.254   -8.469  -24.916 1.00 31.95 ? 103  GLY A O   1 
ATOM   1199 N N   . LYS A 1 111 ? 9.996   -8.520  -27.045 1.00 28.67 ? 104  LYS A N   1 
ATOM   1200 C CA  . LYS A 1 111 ? 10.876  -9.662  -26.830 1.00 17.42 ? 104  LYS A CA  1 
ATOM   1201 C C   . LYS A 1 111 ? 12.308  -9.178  -26.615 1.00 17.10 ? 104  LYS A C   1 
ATOM   1202 O O   . LYS A 1 111 ? 12.701  -8.160  -27.185 1.00 22.69 ? 104  LYS A O   1 
ATOM   1203 C CB  . LYS A 1 111 ? 10.822  -10.617 -28.025 1.00 30.06 ? 104  LYS A CB  1 
ATOM   1204 C CG  . LYS A 1 111 ? 9.425   -10.873 -28.570 1.00 39.55 ? 104  LYS A CG  1 
ATOM   1205 C CD  . LYS A 1 111 ? 8.491   -11.408 -27.488 1.00 54.46 ? 104  LYS A CD  1 
ATOM   1206 C CE  . LYS A 1 111 ? 7.239   -12.031 -28.085 1.00 40.54 ? 104  LYS A CE  1 
ATOM   1207 N NZ  . LYS A 1 111 ? 6.029   -11.462 -27.431 1.00 49.11 ? 104  LYS A NZ  1 
ATOM   1208 N N   . VAL A 1 112 ? 13.077  -9.909  -25.816 1.00 21.78 ? 105  VAL A N   1 
ATOM   1209 C CA  . VAL A 1 112 ? 14.491  -9.596  -25.641 1.00 18.89 ? 105  VAL A CA  1 
ATOM   1210 C C   . VAL A 1 112 ? 15.220  -9.836  -26.960 1.00 21.27 ? 105  VAL A C   1 
ATOM   1211 O O   . VAL A 1 112 ? 14.973  -10.827 -27.641 1.00 31.28 ? 105  VAL A O   1 
ATOM   1212 C CB  . VAL A 1 112 ? 15.122  -10.440 -24.521 1.00 22.64 ? 105  VAL A CB  1 
ATOM   1213 C CG1 . VAL A 1 112 ? 16.592  -10.094 -24.357 1.00 19.96 ? 105  VAL A CG1 1 
ATOM   1214 C CG2 . VAL A 1 112 ? 14.373  -10.227 -23.212 1.00 26.90 ? 105  VAL A CG2 1 
ATOM   1215 N N   . CYS A 1 113 ? 16.095  -8.910  -27.327 1.00 14.13 ? 106  CYS A N   1 
ATOM   1216 C CA  . CYS A 1 113 ? 16.901  -9.019  -28.530 1.00 15.85 ? 106  CYS A CA  1 
ATOM   1217 C C   . CYS A 1 113 ? 18.310  -8.528  -28.214 1.00 25.32 ? 106  CYS A C   1 
ATOM   1218 O O   . CYS A 1 113 ? 18.570  -8.036  -27.108 1.00 18.74 ? 106  CYS A O   1 
ATOM   1219 C CB  . CYS A 1 113 ? 16.295  -8.208  -29.675 1.00 24.00 ? 106  CYS A CB  1 
ATOM   1220 S SG  . CYS A 1 113 ? 16.319  -6.426  -29.383 1.00 25.00 ? 106  CYS A SG  1 
ATOM   1221 N N   . GLY A 1 114 ? 19.221  -8.663  -29.174 1.00 17.19 ? 107  GLY A N   1 
ATOM   1222 C CA  . GLY A 1 114 ? 20.571  -8.182  -28.985 1.00 16.54 ? 107  GLY A CA  1 
ATOM   1223 C C   . GLY A 1 114 ? 21.547  -9.209  -28.441 1.00 14.66 ? 107  GLY A C   1 
ATOM   1224 O O   . GLY A 1 114 ? 21.227  -10.393 -28.250 1.00 19.54 ? 107  GLY A O   1 
ATOM   1225 N N   . SER A 1 115 ? 22.759  -8.737  -28.175 1.00 11.57 ? 108  SER A N   1 
ATOM   1226 C CA  . SER A 1 115 ? 23.875  -9.594  -27.815 1.00 10.27 ? 108  SER A CA  1 
ATOM   1227 C C   . SER A 1 115 ? 24.789  -8.882  -26.830 1.00 11.47 ? 108  SER A C   1 
ATOM   1228 O O   . SER A 1 115 ? 24.848  -7.667  -26.833 1.00 14.15 ? 108  SER A O   1 
ATOM   1229 C CB  A SER A 1 115 ? 24.662  -9.977  -29.078 0.84 16.54 ? 108  SER A CB  1 
ATOM   1230 C CB  B SER A 1 115 ? 24.666  -10.018 -29.056 0.16 16.61 ? 108  SER A CB  1 
ATOM   1231 O OG  A SER A 1 115 ? 25.932  -10.496 -28.759 0.84 16.99 ? 108  SER A OG  1 
ATOM   1232 O OG  B SER A 1 115 ? 23.908  -10.902 -29.863 0.16 22.42 ? 108  SER A OG  1 
ATOM   1233 N N   . GLU A 1 116 ? 25.503  -9.638  -26.003 1.00 14.51 ? 109  GLU A N   1 
ATOM   1234 C CA  . GLU A 1 116 ? 26.519  -9.045  -25.133 1.00 11.28 ? 109  GLU A CA  1 
ATOM   1235 C C   . GLU A 1 116 ? 27.680  -8.488  -25.959 1.00 12.47 ? 109  GLU A C   1 
ATOM   1236 O O   . GLU A 1 116 ? 28.388  -7.569  -25.530 1.00 15.42 ? 109  GLU A O   1 
ATOM   1237 C CB  . GLU A 1 116 ? 27.045  -10.064 -24.126 1.00 9.99  ? 109  GLU A CB  1 
ATOM   1238 C CG  . GLU A 1 116 ? 26.079  -10.324 -22.984 1.00 12.16 ? 109  GLU A CG  1 
ATOM   1239 C CD  . GLU A 1 116 ? 26.693  -11.185 -21.899 1.00 25.60 ? 109  GLU A CD  1 
ATOM   1240 O OE1 . GLU A 1 116 ? 26.720  -12.429 -22.061 1.00 16.41 ? 109  GLU A OE1 1 
ATOM   1241 O OE2 . GLU A 1 116 ? 27.188  -10.605 -20.908 1.00 18.56 ? 109  GLU A OE2 1 
ATOM   1242 N N   . ASP A 1 117 ? 27.854  -9.061  -27.140 1.00 12.83 ? 110  ASP A N   1 
ATOM   1243 C CA  . ASP A 1 117 ? 28.880  -8.674  -28.083 1.00 11.07 ? 110  ASP A CA  1 
ATOM   1244 C C   . ASP A 1 117 ? 28.365  -7.490  -28.888 1.00 15.00 ? 110  ASP A C   1 
ATOM   1245 O O   . ASP A 1 117 ? 27.816  -7.661  -29.979 1.00 15.94 ? 110  ASP A O   1 
ATOM   1246 C CB  A ASP A 1 117 ? 29.222  -9.862  -28.981 0.49 15.26 ? 110  ASP A CB  1 
ATOM   1247 C CB  B ASP A 1 117 ? 29.242  -9.842  -29.006 0.51 15.28 ? 110  ASP A CB  1 
ATOM   1248 C CG  A ASP A 1 117 ? 30.263  -9.537  -30.027 0.49 15.74 ? 110  ASP A CG  1 
ATOM   1249 C CG  B ASP A 1 117 ? 30.495  -9.578  -29.835 0.51 16.67 ? 110  ASP A CG  1 
ATOM   1250 O OD1 A ASP A 1 117 ? 31.000  -8.541  -29.868 0.49 14.11 ? 110  ASP A OD1 1 
ATOM   1251 O OD1 B ASP A 1 117 ? 30.863  -8.398  -30.023 0.51 13.08 ? 110  ASP A OD1 1 
ATOM   1252 O OD2 A ASP A 1 117 ? 30.346  -10.296 -31.015 0.49 16.67 ? 110  ASP A OD2 1 
ATOM   1253 O OD2 B ASP A 1 117 ? 31.104  -10.556 -30.325 0.51 16.85 ? 110  ASP A OD2 1 
ATOM   1254 N N   . CYS A 1 118 ? 28.535  -6.290  -28.329 1.00 12.43 ? 111  CYS A N   1 
ATOM   1255 C CA  . CYS A 1 118 ? 27.883  -5.084  -28.842 1.00 12.27 ? 111  CYS A CA  1 
ATOM   1256 C C   . CYS A 1 118 ? 28.748  -3.808  -28.878 1.00 11.29 ? 111  CYS A C   1 
ATOM   1257 O O   . CYS A 1 118 ? 28.248  -2.729  -29.224 1.00 10.87 ? 111  CYS A O   1 
ATOM   1258 C CB  . CYS A 1 118 ? 26.613  -4.801  -28.020 1.00 12.43 ? 111  CYS A CB  1 
ATOM   1259 S SG  . CYS A 1 118 ? 26.937  -4.305  -26.294 1.00 13.37 ? 111  CYS A SG  1 
ATOM   1260 N N   . LEU A 1 119 ? 30.024  -3.910  -28.505 1.00 9.65  ? 112  LEU A N   1 
ATOM   1261 C CA  . LEU A 1 119 ? 30.858  -2.718  -28.385 1.00 9.37  ? 112  LEU A CA  1 
ATOM   1262 C C   . LEU A 1 119 ? 31.481  -2.322  -29.724 1.00 13.72 ? 112  LEU A C   1 
ATOM   1263 O O   . LEU A 1 119 ? 32.644  -2.619  -29.998 1.00 11.39 ? 112  LEU A O   1 
ATOM   1264 C CB  . LEU A 1 119 ? 31.918  -2.932  -27.321 1.00 9.45  ? 112  LEU A CB  1 
ATOM   1265 C CG  . LEU A 1 119 ? 31.272  -3.208  -25.962 1.00 7.55  ? 112  LEU A CG  1 
ATOM   1266 C CD1 . LEU A 1 119 ? 32.295  -3.279  -24.828 1.00 8.46  ? 112  LEU A CD1 1 
ATOM   1267 C CD2 . LEU A 1 119 ? 30.232  -2.132  -25.630 1.00 13.22 ? 112  LEU A CD2 1 
ATOM   1268 N N   . TYR A 1 120 ? 30.674  -1.638  -30.532 1.00 11.84 ? 113  TYR A N   1 
ATOM   1269 C CA  . TYR A 1 120 ? 31.047  -1.221  -31.893 1.00 11.55 ? 113  TYR A CA  1 
ATOM   1270 C C   . TYR A 1 120 ? 30.698  0.237   -32.178 1.00 14.95 ? 113  TYR A C   1 
ATOM   1271 O O   . TYR A 1 120 ? 29.842  0.834   -31.516 1.00 12.90 ? 113  TYR A O   1 
ATOM   1272 C CB  . TYR A 1 120 ? 30.361  -2.128  -32.930 1.00 16.83 ? 113  TYR A CB  1 
ATOM   1273 C CG  . TYR A 1 120 ? 30.773  -3.564  -32.790 1.00 12.36 ? 113  TYR A CG  1 
ATOM   1274 C CD1 . TYR A 1 120 ? 31.971  -4.022  -33.333 1.00 13.14 ? 113  TYR A CD1 1 
ATOM   1275 C CD2 . TYR A 1 120 ? 29.989  -4.463  -32.071 1.00 12.39 ? 113  TYR A CD2 1 
ATOM   1276 C CE1 . TYR A 1 120 ? 32.374  -5.368  -33.176 1.00 14.57 ? 113  TYR A CE1 1 
ATOM   1277 C CE2 . TYR A 1 120 ? 30.383  -5.796  -31.900 1.00 10.14 ? 113  TYR A CE2 1 
ATOM   1278 C CZ  . TYR A 1 120 ? 31.579  -6.240  -32.451 1.00 13.14 ? 113  TYR A CZ  1 
ATOM   1279 O OH  . TYR A 1 120 ? 31.953  -7.562  -32.277 1.00 14.98 ? 113  TYR A OH  1 
ATOM   1280 N N   . LEU A 1 121 ? 31.337  0.813   -33.196 1.00 9.11  ? 114  LEU A N   1 
ATOM   1281 C CA  . LEU A 1 121 ? 30.917  2.111   -33.679 1.00 10.49 ? 114  LEU A CA  1 
ATOM   1282 C C   . LEU A 1 121 ? 30.884  2.068   -35.205 1.00 13.55 ? 114  LEU A C   1 
ATOM   1283 O O   . LEU A 1 121 ? 31.429  1.153   -35.833 1.00 11.50 ? 114  LEU A O   1 
ATOM   1284 C CB  . LEU A 1 121 ? 31.843  3.216   -33.166 1.00 12.45 ? 114  LEU A CB  1 
ATOM   1285 C CG  . LEU A 1 121 ? 33.361  3.030   -33.322 1.00 10.33 ? 114  LEU A CG  1 
ATOM   1286 C CD1 . LEU A 1 121 ? 33.784  3.444   -34.743 1.00 11.39 ? 114  LEU A CD1 1 
ATOM   1287 C CD2 . LEU A 1 121 ? 34.146  3.824   -32.280 1.00 12.98 ? 114  LEU A CD2 1 
ATOM   1288 N N   A SER A 1 122 ? 30.235  3.067   -35.791 0.02 8.76  ? 115  SER A N   1 
ATOM   1289 N N   B SER A 1 122 ? 30.251  3.068   -35.792 0.98 8.61  ? 115  SER A N   1 
ATOM   1290 C CA  A SER A 1 122 ? 30.124  3.174   -37.239 0.02 8.73  ? 115  SER A CA  1 
ATOM   1291 C CA  B SER A 1 122 ? 30.085  3.157   -37.246 0.98 8.45  ? 115  SER A CA  1 
ATOM   1292 C C   A SER A 1 122 ? 30.594  4.545   -37.710 0.02 11.17 ? 115  SER A C   1 
ATOM   1293 C C   B SER A 1 122 ? 30.544  4.522   -37.677 0.98 11.18 ? 115  SER A C   1 
ATOM   1294 O O   A SER A 1 122 ? 30.319  5.554   -37.065 0.02 10.34 ? 115  SER A O   1 
ATOM   1295 O O   B SER A 1 122 ? 30.265  5.501   -36.987 0.98 10.21 ? 115  SER A O   1 
ATOM   1296 C CB  A SER A 1 122 ? 28.683  2.926   -37.688 0.02 11.30 ? 115  SER A CB  1 
ATOM   1297 C CB  B SER A 1 122 ? 28.616  2.945   -37.652 0.98 11.39 ? 115  SER A CB  1 
ATOM   1298 O OG  A SER A 1 122 ? 28.245  1.633   -37.309 0.02 12.60 ? 115  SER A OG  1 
ATOM   1299 O OG  B SER A 1 122 ? 28.168  1.637   -37.340 0.98 12.72 ? 115  SER A OG  1 
ATOM   1300 N N   A VAL A 1 123 ? 31.302  4.577   -38.835 0.02 11.69 ? 116  VAL A N   1 
ATOM   1301 N N   B VAL A 1 123 ? 31.233  4.596   -38.820 0.98 11.76 ? 116  VAL A N   1 
ATOM   1302 C CA  A VAL A 1 123 ? 31.838  5.826   -39.366 0.02 11.69 ? 116  VAL A CA  1 
ATOM   1303 C CA  B VAL A 1 123 ? 31.786  5.838   -39.325 0.98 11.73 ? 116  VAL A CA  1 
ATOM   1304 C C   A VAL A 1 123 ? 31.292  6.117   -40.762 0.02 10.21 ? 116  VAL A C   1 
ATOM   1305 C C   B VAL A 1 123 ? 31.243  6.111   -40.724 0.98 9.99  ? 116  VAL A C   1 
ATOM   1306 O O   A VAL A 1 123 ? 31.309  5.254   -41.639 0.02 11.72 ? 116  VAL A O   1 
ATOM   1307 O O   B VAL A 1 123 ? 31.254  5.213   -41.569 0.98 11.76 ? 116  VAL A O   1 
ATOM   1308 C CB  A VAL A 1 123 ? 33.380  5.799   -39.419 0.02 11.53 ? 116  VAL A CB  1 
ATOM   1309 C CB  B VAL A 1 123 ? 33.336  5.810   -39.421 0.98 11.38 ? 116  VAL A CB  1 
ATOM   1310 C CG1 A VAL A 1 123 ? 33.921  7.124   -39.940 0.02 12.82 ? 116  VAL A CG1 1 
ATOM   1311 C CG1 B VAL A 1 123 ? 33.863  7.171   -39.912 0.98 12.73 ? 116  VAL A CG1 1 
ATOM   1312 C CG2 A VAL A 1 123 ? 33.953  5.492   -38.043 0.02 12.12 ? 116  VAL A CG2 1 
ATOM   1313 C CG2 B VAL A 1 123 ? 33.979  5.405   -38.080 0.98 11.91 ? 116  VAL A CG2 1 
ATOM   1314 N N   . TYR A 1 124 ? 30.810  7.341   -40.960 1.00 9.43  ? 117  TYR A N   1 
ATOM   1315 C CA  . TYR A 1 124 ? 30.228  7.759   -42.254 1.00 9.28  ? 117  TYR A CA  1 
ATOM   1316 C C   . TYR A 1 124 ? 30.788  9.082   -42.741 1.00 10.93 ? 117  TYR A C   1 
ATOM   1317 O O   . TYR A 1 124 ? 30.904  10.042  -41.978 1.00 13.24 ? 117  TYR A O   1 
ATOM   1318 C CB  . TYR A 1 124 ? 28.710  7.899   -42.143 1.00 12.75 ? 117  TYR A CB  1 
ATOM   1319 C CG  . TYR A 1 124 ? 28.025  6.765   -41.425 1.00 13.29 ? 117  TYR A CG  1 
ATOM   1320 C CD1 . TYR A 1 124 ? 27.877  5.532   -42.032 1.00 13.05 ? 117  TYR A CD1 1 
ATOM   1321 C CD2 . TYR A 1 124 ? 27.475  6.944   -40.154 1.00 15.66 ? 117  TYR A CD2 1 
ATOM   1322 C CE1 . TYR A 1 124 ? 27.225  4.477   -41.385 1.00 11.42 ? 117  TYR A CE1 1 
ATOM   1323 C CE2 . TYR A 1 124 ? 26.827  5.923   -39.508 1.00 10.51 ? 117  TYR A CE2 1 
ATOM   1324 C CZ  . TYR A 1 124 ? 26.686  4.676   -40.123 1.00 11.36 ? 117  TYR A CZ  1 
ATOM   1325 O OH  . TYR A 1 124 ? 26.018  3.658   -39.472 1.00 13.96 ? 117  TYR A OH  1 
ATOM   1326 N N   . THR A 1 125 ? 31.057  9.163   -44.049 1.00 11.72 ? 118  THR A N   1 
ATOM   1327 C CA  . THR A 1 125 ? 31.467  10.411  -44.665 1.00 12.15 ? 118  THR A CA  1 
ATOM   1328 C C   . THR A 1 125 ? 31.308  10.326  -46.173 1.00 12.66 ? 118  THR A C   1 
ATOM   1329 O O   . THR A 1 125 ? 31.490  9.243   -46.767 1.00 13.39 ? 118  THR A O   1 
ATOM   1330 C CB  . THR A 1 125 ? 32.922  10.778  -44.342 1.00 19.41 ? 118  THR A CB  1 
ATOM   1331 O OG1 . THR A 1 125 ? 33.257  11.995  -45.029 1.00 17.24 ? 118  THR A OG1 1 
ATOM   1332 C CG2 . THR A 1 125 ? 33.864  9.677   -44.773 1.00 17.94 ? 118  THR A CG2 1 
ATOM   1333 N N   . ASN A 1 126 ? 30.987  11.466  -46.773 1.00 14.00 ? 119  ASN A N   1 
ATOM   1334 C CA  . ASN A 1 126 ? 30.761  11.535  -48.215 1.00 14.23 ? 119  ASN A CA  1 
ATOM   1335 C C   . ASN A 1 126 ? 32.068  11.609  -48.987 1.00 19.21 ? 119  ASN A C   1 
ATOM   1336 O O   . ASN A 1 126 ? 32.052  11.560  -50.210 1.00 19.49 ? 119  ASN A O   1 
ATOM   1337 C CB  . ASN A 1 126 ? 29.812  12.711  -48.575 1.00 14.28 ? 119  ASN A CB  1 
ATOM   1338 C CG  . ASN A 1 126 ? 30.436  14.100  -48.384 1.00 11.31 ? 119  ASN A CG  1 
ATOM   1339 O OD1 . ASN A 1 126 ? 31.642  14.283  -48.525 1.00 15.49 ? 119  ASN A OD1 1 
ATOM   1340 N ND2 . ASN A 1 126 ? 29.590  15.099  -48.070 1.00 15.16 ? 119  ASN A ND2 1 
ATOM   1341 N N   A ASN A 1 127 ? 33.187  11.722  -48.273 0.45 15.89 ? 120  ASN A N   1 
ATOM   1342 N N   B ASN A 1 127 ? 33.189  11.697  -48.273 0.55 15.91 ? 120  ASN A N   1 
ATOM   1343 C CA  A ASN A 1 127 ? 34.507  11.834  -48.898 0.45 21.44 ? 120  ASN A CA  1 
ATOM   1344 C CA  B ASN A 1 127 ? 34.501  11.833  -48.906 0.55 21.49 ? 120  ASN A CA  1 
ATOM   1345 C C   A ASN A 1 127 ? 35.619  11.393  -47.952 0.45 20.50 ? 120  ASN A C   1 
ATOM   1346 C C   B ASN A 1 127 ? 35.643  11.415  -47.981 0.55 20.43 ? 120  ASN A C   1 
ATOM   1347 O O   A ASN A 1 127 ? 35.906  12.063  -46.963 0.45 20.36 ? 120  ASN A O   1 
ATOM   1348 O O   B ASN A 1 127 ? 35.971  12.124  -47.034 0.55 20.44 ? 120  ASN A O   1 
ATOM   1349 C CB  A ASN A 1 127 ? 34.758  13.273  -49.350 0.45 15.27 ? 120  ASN A CB  1 
ATOM   1350 C CB  B ASN A 1 127 ? 34.710  13.276  -49.358 0.55 15.23 ? 120  ASN A CB  1 
ATOM   1351 C CG  A ASN A 1 127 ? 36.031  13.422  -50.176 0.45 21.80 ? 120  ASN A CG  1 
ATOM   1352 C CG  B ASN A 1 127 ? 35.883  13.427  -50.307 0.55 22.03 ? 120  ASN A CG  1 
ATOM   1353 O OD1 A ASN A 1 127 ? 36.882  12.531  -50.211 0.45 18.95 ? 120  ASN A OD1 1 
ATOM   1354 O OD1 B ASN A 1 127 ? 36.802  12.607  -50.324 0.55 19.42 ? 120  ASN A OD1 1 
ATOM   1355 N ND2 A ASN A 1 127 ? 36.167  14.564  -50.835 0.45 24.99 ? 120  ASN A ND2 1 
ATOM   1356 N ND2 B ASN A 1 127 ? 35.854  14.485  -51.106 0.55 26.59 ? 120  ASN A ND2 1 
ATOM   1357 N N   . LEU A 1 128 ? 36.253  10.272  -48.275 1.00 21.04 ? 121  LEU A N   1 
ATOM   1358 C CA  . LEU A 1 128 ? 37.295  9.712   -47.425 1.00 22.83 ? 121  LEU A CA  1 
ATOM   1359 C C   . LEU A 1 128 ? 38.626  10.455  -47.513 1.00 21.88 ? 121  LEU A C   1 
ATOM   1360 O O   . LEU A 1 128 ? 39.440  10.395  -46.589 1.00 26.54 ? 121  LEU A O   1 
ATOM   1361 C CB  . LEU A 1 128 ? 37.489  8.243   -47.767 1.00 24.99 ? 121  LEU A CB  1 
ATOM   1362 C CG  . LEU A 1 128 ? 36.539  7.329   -46.996 1.00 20.09 ? 121  LEU A CG  1 
ATOM   1363 C CD1 . LEU A 1 128 ? 36.508  5.957   -47.624 1.00 17.69 ? 121  LEU A CD1 1 
ATOM   1364 C CD2 . LEU A 1 128 ? 36.955  7.248   -45.525 1.00 16.04 ? 121  LEU A CD2 1 
ATOM   1365 N N   . ASN A 1 129 ? 38.835  11.183  -48.600 1.00 24.12 ? 122  ASN A N   1 
ATOM   1366 C CA  . ASN A 1 129 ? 40.075  11.936  -48.768 1.00 27.73 ? 122  ASN A CA  1 
ATOM   1367 C C   . ASN A 1 129 ? 39.813  13.401  -49.108 1.00 19.67 ? 122  ASN A C   1 
ATOM   1368 O O   . ASN A 1 129 ? 40.034  13.829  -50.242 1.00 34.12 ? 122  ASN A O   1 
ATOM   1369 C CB  . ASN A 1 129 ? 40.931  11.286  -49.857 1.00 42.16 ? 122  ASN A CB  1 
ATOM   1370 C CG  . ASN A 1 129 ? 42.362  11.783  -49.848 1.00 45.72 ? 122  ASN A CG  1 
ATOM   1371 O OD1 . ASN A 1 129 ? 42.907  12.118  -48.796 1.00 52.57 ? 122  ASN A OD1 1 
ATOM   1372 N ND2 . ASN A 1 129 ? 42.979  11.837  -51.024 1.00 73.00 ? 122  ASN A ND2 1 
ATOM   1373 N N   A PRO A 1 130 ? 39.338  14.176  -48.122 0.26 18.72 ? 123  PRO A N   1 
ATOM   1374 N N   B PRO A 1 130 ? 39.337  14.178  -48.128 0.74 18.43 ? 123  PRO A N   1 
ATOM   1375 C CA  A PRO A 1 130 ? 39.007  15.588  -48.329 0.26 28.25 ? 123  PRO A CA  1 
ATOM   1376 C CA  B PRO A 1 130 ? 38.990  15.585  -48.345 0.74 28.10 ? 123  PRO A CA  1 
ATOM   1377 C C   A PRO A 1 130 ? 40.259  16.455  -48.399 0.26 27.87 ? 123  PRO A C   1 
ATOM   1378 C C   B PRO A 1 130 ? 40.234  16.473  -48.356 0.74 27.86 ? 123  PRO A C   1 
ATOM   1379 O O   A PRO A 1 130 ? 41.312  16.038  -47.918 0.26 23.32 ? 123  PRO A O   1 
ATOM   1380 O O   B PRO A 1 130 ? 41.255  16.081  -47.788 0.74 22.75 ? 123  PRO A O   1 
ATOM   1381 C CB  A PRO A 1 130 ? 38.167  15.930  -47.098 0.26 23.06 ? 123  PRO A CB  1 
ATOM   1382 C CB  B PRO A 1 130 ? 38.084  15.904  -47.152 0.74 23.09 ? 123  PRO A CB  1 
ATOM   1383 C CG  A PRO A 1 130 ? 38.710  15.039  -46.035 0.26 18.29 ? 123  PRO A CG  1 
ATOM   1384 C CG  B PRO A 1 130 ? 38.594  15.018  -46.066 0.74 17.91 ? 123  PRO A CG  1 
ATOM   1385 C CD  A PRO A 1 130 ? 39.115  13.760  -46.724 0.26 20.50 ? 123  PRO A CD  1 
ATOM   1386 C CD  B PRO A 1 130 ? 39.098  13.761  -46.733 0.74 20.51 ? 123  PRO A CD  1 
ATOM   1387 N N   . GLU A 1 131 ? 40.141  17.640  -48.991 1.00 27.60 ? 124  GLU A N   1 
ATOM   1388 C CA  . GLU A 1 131 ? 41.273  18.560  -49.099 1.00 41.17 ? 124  GLU A CA  1 
ATOM   1389 C C   . GLU A 1 131 ? 41.703  19.059  -47.729 1.00 37.63 ? 124  GLU A C   1 
ATOM   1390 O O   . GLU A 1 131 ? 42.884  19.313  -47.480 1.00 31.31 ? 124  GLU A O   1 
ATOM   1391 C CB  . GLU A 1 131 ? 40.917  19.753  -49.991 1.00 45.59 ? 124  GLU A CB  1 
ATOM   1392 C CG  . GLU A 1 131 ? 41.527  19.706  -51.388 1.00 53.89 ? 124  GLU A CG  1 
ATOM   1393 C CD  . GLU A 1 131 ? 40.918  18.624  -52.266 1.00 73.18 ? 124  GLU A CD  1 
ATOM   1394 O OE1 . GLU A 1 131 ? 39.682  18.446  -52.218 1.00 77.63 ? 124  GLU A OE1 1 
ATOM   1395 O OE2 . GLU A 1 131 ? 41.673  17.967  -53.018 1.00 59.58 ? 124  GLU A OE2 1 
ATOM   1396 N N   . THR A 1 132 ? 40.721  19.217  -46.851 1.00 38.03 ? 125  THR A N   1 
ATOM   1397 C CA  . THR A 1 132 ? 40.952  19.660  -45.485 1.00 30.05 ? 125  THR A CA  1 
ATOM   1398 C C   . THR A 1 132 ? 40.274  18.683  -44.537 1.00 25.98 ? 125  THR A C   1 
ATOM   1399 O O   . THR A 1 132 ? 39.208  18.163  -44.855 1.00 27.17 ? 125  THR A O   1 
ATOM   1400 C CB  . THR A 1 132 ? 40.403  21.078  -45.254 1.00 34.16 ? 125  THR A CB  1 
ATOM   1401 O OG1 . THR A 1 132 ? 38.971  21.055  -45.329 1.00 46.10 ? 125  THR A OG1 1 
ATOM   1402 C CG2 . THR A 1 132 ? 40.943  22.030  -46.305 1.00 51.96 ? 125  THR A CG2 1 
ATOM   1403 N N   A LYS A 1 133 ? 40.887  18.445  -43.382 0.43 22.87 ? 126  LYS A N   1 
ATOM   1404 N N   B LYS A 1 133 ? 40.903  18.409  -43.394 0.57 22.85 ? 126  LYS A N   1 
ATOM   1405 C CA  A LYS A 1 133 ? 40.287  17.605  -42.353 0.43 18.55 ? 126  LYS A CA  1 
ATOM   1406 C CA  B LYS A 1 133 ? 40.332  17.494  -42.408 0.57 18.39 ? 126  LYS A CA  1 
ATOM   1407 C C   A LYS A 1 133 ? 38.909  18.143  -41.976 0.43 29.03 ? 126  LYS A C   1 
ATOM   1408 C C   B LYS A 1 133 ? 39.055  18.099  -41.829 0.57 29.25 ? 126  LYS A C   1 
ATOM   1409 O O   A LYS A 1 133 ? 38.698  19.356  -41.943 0.43 25.24 ? 126  LYS A O   1 
ATOM   1410 O O   B LYS A 1 133 ? 39.021  19.285  -41.490 0.57 20.72 ? 126  LYS A O   1 
ATOM   1411 C CB  A LYS A 1 133 ? 41.191  17.525  -41.120 0.43 24.27 ? 126  LYS A CB  1 
ATOM   1412 C CB  B LYS A 1 133 ? 41.334  17.188  -41.290 0.57 24.62 ? 126  LYS A CB  1 
ATOM   1413 C CG  A LYS A 1 133 ? 41.865  18.841  -40.731 0.43 30.47 ? 126  LYS A CG  1 
ATOM   1414 C CG  B LYS A 1 133 ? 42.598  16.463  -41.740 0.57 18.91 ? 126  LYS A CG  1 
ATOM   1415 C CD  A LYS A 1 133 ? 43.239  18.972  -41.374 0.43 34.24 ? 126  LYS A CD  1 
ATOM   1416 C CD  B LYS A 1 133 ? 42.375  14.962  -41.936 0.57 18.07 ? 126  LYS A CD  1 
ATOM   1417 C CE  A LYS A 1 133 ? 43.988  20.176  -40.841 0.43 22.32 ? 126  LYS A CE  1 
ATOM   1418 C CE  B LYS A 1 133 ? 43.705  14.258  -42.173 0.57 16.52 ? 126  LYS A CE  1 
ATOM   1419 N NZ  A LYS A 1 133 ? 44.179  20.098  -39.372 0.43 26.79 ? 126  LYS A NZ  1 
ATOM   1420 N NZ  B LYS A 1 133 ? 43.568  12.829  -42.541 0.57 19.93 ? 126  LYS A NZ  1 
ATOM   1421 N N   A ARG A 1 134 ? 37.973  17.238  -41.705 0.43 16.66 ? 127  ARG A N   1 
ATOM   1422 N N   B ARG A 1 134 ? 38.018  17.273  -41.705 0.57 16.66 ? 127  ARG A N   1 
ATOM   1423 C CA  A ARG A 1 134 ? 36.574  17.618  -41.518 0.43 15.24 ? 127  ARG A CA  1 
ATOM   1424 C CA  B ARG A 1 134 ? 36.658  17.760  -41.465 0.57 14.99 ? 127  ARG A CA  1 
ATOM   1425 C C   A ARG A 1 134 ? 36.183  17.660  -40.049 0.43 15.33 ? 127  ARG A C   1 
ATOM   1426 C C   B ARG A 1 134 ? 36.246  17.740  -40.004 0.57 15.23 ? 127  ARG A C   1 
ATOM   1427 O O   A ARG A 1 134 ? 36.768  16.938  -39.242 0.43 14.45 ? 127  ARG A O   1 
ATOM   1428 O O   B ARG A 1 134 ? 36.803  16.967  -39.223 0.57 14.56 ? 127  ARG A O   1 
ATOM   1429 C CB  A ARG A 1 134 ? 35.659  16.640  -42.258 0.43 15.58 ? 127  ARG A CB  1 
ATOM   1430 C CB  B ARG A 1 134 ? 35.667  16.917  -42.264 0.57 17.32 ? 127  ARG A CB  1 
ATOM   1431 C CG  A ARG A 1 134 ? 35.741  16.724  -43.766 0.43 18.13 ? 127  ARG A CG  1 
ATOM   1432 C CG  B ARG A 1 134 ? 35.664  17.205  -43.739 0.57 13.99 ? 127  ARG A CG  1 
ATOM   1433 C CD  A ARG A 1 134 ? 34.747  15.778  -44.407 0.43 15.42 ? 127  ARG A CD  1 
ATOM   1434 C CD  B ARG A 1 134 ? 34.754  16.245  -44.440 0.57 16.79 ? 127  ARG A CD  1 
ATOM   1435 N NE  A ARG A 1 134 ? 34.524  16.110  -45.811 0.43 20.87 ? 127  ARG A NE  1 
ATOM   1436 N NE  B ARG A 1 134 ? 34.605  16.609  -45.842 0.57 21.95 ? 127  ARG A NE  1 
ATOM   1437 C CZ  A ARG A 1 134 ? 33.653  15.491  -46.600 0.43 21.54 ? 127  ARG A CZ  1 
ATOM   1438 C CZ  B ARG A 1 134 ? 33.833  15.959  -46.703 0.57 23.02 ? 127  ARG A CZ  1 
ATOM   1439 N NH1 A ARG A 1 134 ? 32.913  14.491  -46.134 0.43 16.77 ? 127  ARG A NH1 1 
ATOM   1440 N NH1 B ARG A 1 134 ? 33.124  14.903  -46.312 0.57 21.44 ? 127  ARG A NH1 1 
ATOM   1441 N NH2 A ARG A 1 134 ? 33.522  15.873  -47.865 0.43 23.89 ? 127  ARG A NH2 1 
ATOM   1442 N NH2 B ARG A 1 134 ? 33.766  16.376  -47.961 0.57 22.10 ? 127  ARG A NH2 1 
ATOM   1443 N N   A PRO A 1 135 ? 35.192  18.503  -39.699 0.43 13.46 ? 128  PRO A N   1 
ATOM   1444 N N   B PRO A 1 135 ? 35.256  18.580  -39.637 0.57 13.37 ? 128  PRO A N   1 
ATOM   1445 C CA  A PRO A 1 135 ? 34.621  18.395  -38.353 0.43 14.55 ? 128  PRO A CA  1 
ATOM   1446 C CA  B PRO A 1 135 ? 34.627  18.421  -38.322 0.57 14.59 ? 128  PRO A CA  1 
ATOM   1447 C C   A PRO A 1 135 ? 34.076  16.995  -38.134 0.43 14.26 ? 128  PRO A C   1 
ATOM   1448 C C   B PRO A 1 135 ? 34.079  17.013  -38.161 0.57 14.30 ? 128  PRO A C   1 
ATOM   1449 O O   A PRO A 1 135 ? 33.496  16.397  -39.047 0.43 13.41 ? 128  PRO A O   1 
ATOM   1450 O O   B PRO A 1 135 ? 33.500  16.442  -39.095 0.57 13.22 ? 128  PRO A O   1 
ATOM   1451 C CB  A PRO A 1 135 ? 33.491  19.434  -38.350 0.43 15.71 ? 128  PRO A CB  1 
ATOM   1452 C CB  B PRO A 1 135 ? 33.488  19.450  -38.335 0.57 15.68 ? 128  PRO A CB  1 
ATOM   1453 C CG  A PRO A 1 135 ? 33.841  20.384  -39.446 0.43 18.59 ? 128  PRO A CG  1 
ATOM   1454 C CG  B PRO A 1 135 ? 33.895  20.455  -39.356 0.57 18.98 ? 128  PRO A CG  1 
ATOM   1455 C CD  A PRO A 1 135 ? 34.553  19.575  -40.486 0.43 15.17 ? 128  PRO A CD  1 
ATOM   1456 C CD  B PRO A 1 135 ? 34.669  19.704  -40.395 0.57 14.91 ? 128  PRO A CD  1 
ATOM   1457 N N   A VAL A 1 136 ? 34.276  16.478  -36.930 0.43 11.66 ? 129  VAL A N   1 
ATOM   1458 N N   B VAL A 1 136 ? 34.270  16.460  -36.971 0.57 11.68 ? 129  VAL A N   1 
ATOM   1459 C CA  A VAL A 1 136 ? 33.827  15.133  -36.589 0.43 12.79 ? 129  VAL A CA  1 
ATOM   1460 C CA  B VAL A 1 136 ? 33.784  15.121  -36.655 0.57 12.67 ? 129  VAL A CA  1 
ATOM   1461 C C   A VAL A 1 136 ? 32.633  15.225  -35.648 0.43 14.26 ? 129  VAL A C   1 
ATOM   1462 C C   B VAL A 1 136 ? 32.665  15.227  -35.632 0.57 14.28 ? 129  VAL A C   1 
ATOM   1463 O O   A VAL A 1 136 ? 32.714  15.885  -34.617 0.43 14.74 ? 129  VAL A O   1 
ATOM   1464 O O   B VAL A 1 136 ? 32.879  15.757  -34.547 0.57 14.88 ? 129  VAL A O   1 
ATOM   1465 C CB  A VAL A 1 136 ? 34.956  14.315  -35.929 0.43 10.90 ? 129  VAL A CB  1 
ATOM   1466 C CB  B VAL A 1 136 ? 34.902  14.225  -36.092 0.57 11.61 ? 129  VAL A CB  1 
ATOM   1467 C CG1 A VAL A 1 136 ? 34.427  12.999  -35.398 0.43 11.80 ? 129  VAL A CG1 1 
ATOM   1468 C CG1 B VAL A 1 136 ? 34.355  12.859  -35.748 0.57 12.12 ? 129  VAL A CG1 1 
ATOM   1469 C CG2 A VAL A 1 136 ? 36.077  14.060  -36.926 0.43 12.17 ? 129  VAL A CG2 1 
ATOM   1470 C CG2 B VAL A 1 136 ? 36.030  14.090  -37.093 0.57 12.17 ? 129  VAL A CG2 1 
ATOM   1471 N N   A LEU A 1 137 ? 31.526  14.592  -36.026 0.43 11.75 ? 130  LEU A N   1 
ATOM   1472 N N   B LEU A 1 137 ? 31.479  14.747  -35.992 0.57 11.74 ? 130  LEU A N   1 
ATOM   1473 C CA  A LEU A 1 137 ? 30.318  14.575  -35.196 0.43 11.02 ? 130  LEU A CA  1 
ATOM   1474 C CA  B LEU A 1 137 ? 30.330  14.741  -35.081 0.57 10.35 ? 130  LEU A CA  1 
ATOM   1475 C C   A LEU A 1 137 ? 30.116  13.185  -34.607 0.43 10.98 ? 130  LEU A C   1 
ATOM   1476 C C   B LEU A 1 137 ? 30.074  13.323  -34.585 0.57 10.93 ? 130  LEU A C   1 
ATOM   1477 O O   A LEU A 1 137 ? 30.109  12.190  -35.329 0.43 11.54 ? 130  LEU A O   1 
ATOM   1478 O O   B LEU A 1 137 ? 29.922  12.399  -35.379 0.57 12.40 ? 130  LEU A O   1 
ATOM   1479 C CB  A LEU A 1 137 ? 29.080  14.994  -36.004 0.43 13.38 ? 130  LEU A CB  1 
ATOM   1480 C CB  B LEU A 1 137 ? 29.073  15.293  -35.771 0.57 13.74 ? 130  LEU A CB  1 
ATOM   1481 C CG  A LEU A 1 137 ? 28.860  16.491  -36.259 0.43 14.78 ? 130  LEU A CG  1 
ATOM   1482 C CG  B LEU A 1 137 ? 28.988  16.795  -36.063 0.57 15.46 ? 130  LEU A CG  1 
ATOM   1483 C CD1 A LEU A 1 137 ? 29.947  17.081  -37.157 0.43 16.46 ? 130  LEU A CD1 1 
ATOM   1484 C CD1 B LEU A 1 137 ? 29.838  17.168  -37.274 0.57 16.47 ? 130  LEU A CD1 1 
ATOM   1485 C CD2 A LEU A 1 137 ? 27.483  16.747  -36.855 0.43 15.95 ? 130  LEU A CD2 1 
ATOM   1486 C CD2 B LEU A 1 137 ? 27.541  17.207  -36.287 0.57 21.63 ? 130  LEU A CD2 1 
ATOM   1487 N N   A VAL A 1 138 ? 29.965  13.125  -33.288 0.43 8.51  ? 131  VAL A N   1 
ATOM   1488 N N   B VAL A 1 138 ? 30.039  13.153  -33.267 0.57 8.62  ? 131  VAL A N   1 
ATOM   1489 C CA  A VAL A 1 138 ? 29.837  11.861  -32.576 0.43 9.99  ? 131  VAL A CA  1 
ATOM   1490 C CA  B VAL A 1 138 ? 29.833  11.843  -32.663 0.57 9.85  ? 131  VAL A CA  1 
ATOM   1491 C C   A VAL A 1 138 ? 28.486  11.802  -31.888 0.43 10.34 ? 131  VAL A C   1 
ATOM   1492 C C   B VAL A 1 138 ? 28.482  11.821  -31.978 0.57 10.35 ? 131  VAL A C   1 
ATOM   1493 O O   A VAL A 1 138 ? 28.259  12.489  -30.895 0.43 10.77 ? 131  VAL A O   1 
ATOM   1494 O O   B VAL A 1 138 ? 28.236  12.595  -31.055 0.57 10.81 ? 131  VAL A O   1 
ATOM   1495 C CB  A VAL A 1 138 ? 30.944  11.684  -31.512 0.43 9.50  ? 131  VAL A CB  1 
ATOM   1496 C CB  B VAL A 1 138 ? 30.923  11.502  -31.623 0.57 9.55  ? 131  VAL A CB  1 
ATOM   1497 C CG1 A VAL A 1 138 ? 30.830  10.315  -30.860 0.43 14.71 ? 131  VAL A CG1 1 
ATOM   1498 C CG1 B VAL A 1 138 ? 30.732  10.078  -31.107 0.57 13.02 ? 131  VAL A CG1 1 
ATOM   1499 C CG2 A VAL A 1 138 ? 32.323  11.900  -32.130 0.43 11.19 ? 131  VAL A CG2 1 
ATOM   1500 C CG2 B VAL A 1 138 ? 32.316  11.703  -32.220 0.57 11.86 ? 131  VAL A CG2 1 
ATOM   1501 N N   A TYR A 1 139 ? 27.583  10.991  -32.419 0.43 11.66 ? 132  TYR A N   1 
ATOM   1502 N N   B TYR A 1 139 ? 27.600  10.945  -32.436 0.57 11.65 ? 132  TYR A N   1 
ATOM   1503 C CA  A TYR A 1 139 ? 26.270  10.852  -31.813 0.43 9.41  ? 132  TYR A CA  1 
ATOM   1504 C CA  B TYR A 1 139 ? 26.295  10.836  -31.818 0.57 9.43  ? 132  TYR A CA  1 
ATOM   1505 C C   A TYR A 1 139 ? 26.235  9.693   -30.813 0.43 7.99  ? 132  TYR A C   1 
ATOM   1506 C C   B TYR A 1 139 ? 26.257  9.688   -30.806 0.57 7.90  ? 132  TYR A C   1 
ATOM   1507 O O   A TYR A 1 139 ? 26.592  8.551   -31.136 0.43 10.11 ? 132  TYR A O   1 
ATOM   1508 O O   B TYR A 1 139 ? 26.632  8.546   -31.115 0.57 10.10 ? 132  TYR A O   1 
ATOM   1509 C CB  A TYR A 1 139 ? 25.195  10.659  -32.887 0.43 10.06 ? 132  TYR A CB  1 
ATOM   1510 C CB  B TYR A 1 139 ? 25.203  10.654  -32.875 0.57 10.10 ? 132  TYR A CB  1 
ATOM   1511 C CG  A TYR A 1 139 ? 23.801  10.568  -32.304 0.43 8.91  ? 132  TYR A CG  1 
ATOM   1512 C CG  B TYR A 1 139 ? 23.832  10.774  -32.261 0.57 9.27  ? 132  TYR A CG  1 
ATOM   1513 C CD1 A TYR A 1 139 ? 23.135  11.707  -31.861 0.43 11.80 ? 132  TYR A CD1 1 
ATOM   1514 C CD1 B TYR A 1 139 ? 23.346  12.009  -31.848 0.57 9.72  ? 132  TYR A CD1 1 
ATOM   1515 C CD2 A TYR A 1 139 ? 23.155  9.344   -32.191 0.43 7.25  ? 132  TYR A CD2 1 
ATOM   1516 C CD2 B TYR A 1 139 ? 23.030  9.655   -32.071 0.57 7.90  ? 132  TYR A CD2 1 
ATOM   1517 C CE1 A TYR A 1 139 ? 21.860  11.624  -31.321 0.43 8.54  ? 132  TYR A CE1 1 
ATOM   1518 C CE1 B TYR A 1 139 ? 22.093  12.128  -31.259 0.57 6.51  ? 132  TYR A CE1 1 
ATOM   1519 C CE2 A TYR A 1 139 ? 21.878  9.250   -31.650 0.43 8.06  ? 132  TYR A CE2 1 
ATOM   1520 C CE2 B TYR A 1 139 ? 21.772  9.760   -31.476 0.57 9.00  ? 132  TYR A CE2 1 
ATOM   1521 C CZ  A TYR A 1 139 ? 21.242  10.387  -31.213 0.43 11.10 ? 132  TYR A CZ  1 
ATOM   1522 C CZ  B TYR A 1 139 ? 21.313  11.002  -31.084 0.57 9.76  ? 132  TYR A CZ  1 
ATOM   1523 O OH  A TYR A 1 139 ? 19.979  10.280  -30.674 0.43 17.19 ? 132  TYR A OH  1 
ATOM   1524 O OH  B TYR A 1 139 ? 20.082  11.123  -30.493 0.57 13.59 ? 132  TYR A OH  1 
ATOM   1525 N N   . ILE A 1 140 ? 25.799  10.009  -29.594 1.00 8.57  ? 133  ILE A N   1 
ATOM   1526 C CA  . ILE A 1 140 ? 25.510  9.015   -28.581 1.00 10.54 ? 133  ILE A CA  1 
ATOM   1527 C C   . ILE A 1 140 ? 23.991  8.877   -28.442 1.00 9.08  ? 133  ILE A C   1 
ATOM   1528 O O   . ILE A 1 140 ? 23.305  9.836   -28.093 1.00 10.07 ? 133  ILE A O   1 
ATOM   1529 C CB  . ILE A 1 140 ? 26.092  9.393   -27.219 1.00 9.08  ? 133  ILE A CB  1 
ATOM   1530 C CG1 . ILE A 1 140 ? 27.581  9.773   -27.360 1.00 9.33  ? 133  ILE A CG1 1 
ATOM   1531 C CG2 . ILE A 1 140 ? 25.846  8.246   -26.237 1.00 12.13 ? 133  ILE A CG2 1 
ATOM   1532 C CD1 . ILE A 1 140 ? 28.217  10.296  -26.080 1.00 11.90 ? 133  ILE A CD1 1 
ATOM   1533 N N   . HIS A 1 141 ? 23.463  7.687   -28.733 1.00 10.26 ? 134  HIS A N   1 
ATOM   1534 C CA  . HIS A 1 141 ? 22.023  7.503   -28.758 1.00 9.41  ? 134  HIS A CA  1 
ATOM   1535 C C   . HIS A 1 141 ? 21.461  7.479   -27.353 1.00 9.90  ? 134  HIS A C   1 
ATOM   1536 O O   . HIS A 1 141 ? 22.141  7.074   -26.400 1.00 13.24 ? 134  HIS A O   1 
ATOM   1537 C CB  . HIS A 1 141 ? 21.599  6.217   -29.479 1.00 9.24  ? 134  HIS A CB  1 
ATOM   1538 C CG  . HIS A 1 141 ? 21.981  4.967   -28.754 1.00 11.06 ? 134  HIS A CG  1 
ATOM   1539 N ND1 . HIS A 1 141 ? 21.239  4.453   -27.704 1.00 9.13  ? 134  HIS A ND1 1 
ATOM   1540 C CD2 . HIS A 1 141 ? 23.030  4.131   -28.921 1.00 8.33  ? 134  HIS A CD2 1 
ATOM   1541 C CE1 . HIS A 1 141 ? 21.822  3.355   -27.260 1.00 11.43 ? 134  HIS A CE1 1 
ATOM   1542 N NE2 . HIS A 1 141 ? 22.908  3.131   -27.989 1.00 11.65 ? 134  HIS A NE2 1 
ATOM   1543 N N   . GLY A 1 142 ? 20.213  7.911   -27.263 1.00 9.64  ? 135  GLY A N   1 
ATOM   1544 C CA  . GLY A 1 142 ? 19.436  7.804   -26.041 1.00 11.47 ? 135  GLY A CA  1 
ATOM   1545 C C   . GLY A 1 142 ? 18.614  6.527   -26.004 1.00 10.71 ? 135  GLY A C   1 
ATOM   1546 O O   . GLY A 1 142 ? 18.841  5.585   -26.769 1.00 12.07 ? 135  GLY A O   1 
ATOM   1547 N N   . GLY A 1 143 ? 17.671  6.462   -25.068 1.00 13.15 ? 136  GLY A N   1 
ATOM   1548 C CA  . GLY A 1 143 ? 16.987  5.207   -24.782 1.00 10.65 ? 136  GLY A CA  1 
ATOM   1549 C C   . GLY A 1 143 ? 17.020  4.802   -23.311 1.00 8.63  ? 136  GLY A C   1 
ATOM   1550 O O   . GLY A 1 143 ? 16.931  3.621   -22.978 1.00 12.44 ? 136  GLY A O   1 
ATOM   1551 N N   . GLY A 1 144 ? 17.118  5.790   -22.432 1.00 10.81 ? 137  GLY A N   1 
ATOM   1552 C CA  . GLY A 1 144 ? 17.050  5.556   -20.999 1.00 9.18  ? 137  GLY A CA  1 
ATOM   1553 C C   . GLY A 1 144 ? 18.182  4.722   -20.431 1.00 11.32 ? 137  GLY A C   1 
ATOM   1554 O O   . GLY A 1 144 ? 18.104  4.271   -19.283 1.00 13.36 ? 137  GLY A O   1 
ATOM   1555 N N   . PHE A 1 145 ? 19.250  4.538   -21.210 1.00 11.48 ? 138  PHE A N   1 
ATOM   1556 C CA  . PHE A 1 145 ? 20.351  3.607   -20.878 1.00 9.98  ? 138  PHE A CA  1 
ATOM   1557 C C   . PHE A 1 145 ? 19.865  2.166   -20.864 1.00 10.07 ? 138  PHE A C   1 
ATOM   1558 O O   . PHE A 1 145 ? 20.571  1.285   -20.361 1.00 14.18 ? 138  PHE A O   1 
ATOM   1559 C CB  . PHE A 1 145 ? 21.034  3.949   -19.522 1.00 12.30 ? 138  PHE A CB  1 
ATOM   1560 C CG  . PHE A 1 145 ? 21.631  5.341   -19.466 1.00 8.81  ? 138  PHE A CG  1 
ATOM   1561 C CD1 . PHE A 1 145 ? 22.836  5.637   -20.099 1.00 10.63 ? 138  PHE A CD1 1 
ATOM   1562 C CD2 . PHE A 1 145 ? 20.974  6.348   -18.768 1.00 11.98 ? 138  PHE A CD2 1 
ATOM   1563 C CE1 . PHE A 1 145 ? 23.376  6.939   -20.043 1.00 11.08 ? 138  PHE A CE1 1 
ATOM   1564 C CE2 . PHE A 1 145 ? 21.490  7.629   -18.721 1.00 11.26 ? 138  PHE A CE2 1 
ATOM   1565 C CZ  . PHE A 1 145 ? 22.700  7.923   -19.355 1.00 12.68 ? 138  PHE A CZ  1 
ATOM   1566 N N   . ILE A 1 146 ? 18.679  1.897   -21.434 1.00 11.26 ? 139  ILE A N   1 
ATOM   1567 C CA  . ILE A 1 146 ? 18.184  0.531   -21.511 1.00 14.23 ? 139  ILE A CA  1 
ATOM   1568 C C   . ILE A 1 146 ? 17.809  0.036   -22.907 1.00 14.09 ? 139  ILE A C   1 
ATOM   1569 O O   . ILE A 1 146 ? 17.690  -1.169  -23.103 1.00 11.00 ? 139  ILE A O   1 
ATOM   1570 C CB  . ILE A 1 146 ? 16.961  0.321   -20.613 1.00 9.16  ? 139  ILE A CB  1 
ATOM   1571 C CG1 . ILE A 1 146 ? 15.803  1.217   -21.050 1.00 12.28 ? 139  ILE A CG1 1 
ATOM   1572 C CG2 . ILE A 1 146 ? 17.372  0.572   -19.160 1.00 12.14 ? 139  ILE A CG2 1 
ATOM   1573 C CD1 . ILE A 1 146 ? 14.517  0.990   -20.251 1.00 14.48 ? 139  ILE A CD1 1 
ATOM   1574 N N   A ILE A 1 147 ? 17.619  0.947   -23.864 0.61 9.81  ? 140  ILE A N   1 
ATOM   1575 N N   B ILE A 1 147 ? 17.615  0.954   -23.856 0.39 9.94  ? 140  ILE A N   1 
ATOM   1576 C CA  A ILE A 1 147 ? 17.426  0.554   -25.261 0.61 11.03 ? 140  ILE A CA  1 
ATOM   1577 C CA  B ILE A 1 147 ? 17.408  0.584   -25.257 0.39 11.00 ? 140  ILE A CA  1 
ATOM   1578 C C   A ILE A 1 147 ? 18.218  1.462   -26.180 0.61 10.27 ? 140  ILE A C   1 
ATOM   1579 C C   B ILE A 1 147 ? 18.309  1.406   -26.163 0.39 10.36 ? 140  ILE A C   1 
ATOM   1580 O O   A ILE A 1 147 ? 18.735  2.509   -25.757 0.61 10.87 ? 140  ILE A O   1 
ATOM   1581 O O   B ILE A 1 147 ? 18.989  2.335   -25.713 0.39 10.34 ? 140  ILE A O   1 
ATOM   1582 C CB  A ILE A 1 147 ? 15.942  0.577   -25.701 0.61 9.96  ? 140  ILE A CB  1 
ATOM   1583 C CB  B ILE A 1 147 ? 15.947  0.782   -25.728 0.39 9.86  ? 140  ILE A CB  1 
ATOM   1584 C CG1 A ILE A 1 147 ? 15.326  1.967   -25.520 0.61 13.64 ? 140  ILE A CG1 1 
ATOM   1585 C CG1 B ILE A 1 147 ? 15.653  2.266   -25.973 0.39 10.73 ? 140  ILE A CG1 1 
ATOM   1586 C CG2 A ILE A 1 147 ? 15.129  -0.478  -24.937 0.61 12.94 ? 140  ILE A CG2 1 
ATOM   1587 C CG2 B ILE A 1 147 ? 14.955  0.157   -24.742 0.39 12.95 ? 140  ILE A CG2 1 
ATOM   1588 C CD1 A ILE A 1 147 ? 13.889  2.071   -26.091 0.61 11.69 ? 140  ILE A CD1 1 
ATOM   1589 C CD1 B ILE A 1 147 ? 14.384  2.516   -26.780 0.39 13.18 ? 140  ILE A CD1 1 
ATOM   1590 N N   . GLY A 1 148 ? 18.310  1.066   -27.448 1.00 10.89 ? 141  GLY A N   1 
ATOM   1591 C CA  . GLY A 1 148 ? 19.042  1.840   -28.429 1.00 11.83 ? 141  GLY A CA  1 
ATOM   1592 C C   . GLY A 1 148 ? 20.105  1.077   -29.188 1.00 13.24 ? 141  GLY A C   1 
ATOM   1593 O O   . GLY A 1 148 ? 20.464  -0.047  -28.836 1.00 11.56 ? 141  GLY A O   1 
ATOM   1594 N N   A GLU A 1 149 ? 20.588  1.692   -30.262 0.19 12.63 ? 142  GLU A N   1 
ATOM   1595 N N   B GLU A 1 149 ? 20.634  1.728   -30.220 0.81 12.41 ? 142  GLU A N   1 
ATOM   1596 C CA  A GLU A 1 149 ? 21.507  1.038   -31.183 0.19 14.86 ? 142  GLU A CA  1 
ATOM   1597 C CA  B GLU A 1 149 ? 21.530  1.087   -31.169 0.81 14.85 ? 142  GLU A CA  1 
ATOM   1598 C C   A GLU A 1 149 ? 22.082  2.048   -32.160 0.19 10.45 ? 142  GLU A C   1 
ATOM   1599 C C   B GLU A 1 149 ? 22.130  2.120   -32.092 0.81 9.98  ? 142  GLU A C   1 
ATOM   1600 O O   A GLU A 1 149 ? 21.663  3.206   -32.187 0.19 10.95 ? 142  GLU A O   1 
ATOM   1601 O O   B GLU A 1 149 ? 21.730  3.285   -32.073 0.81 10.90 ? 142  GLU A O   1 
ATOM   1602 C CB  A GLU A 1 149 ? 20.804  -0.085  -31.952 0.19 13.44 ? 142  GLU A CB  1 
ATOM   1603 C CB  B GLU A 1 149 ? 20.786  0.050   -32.000 0.81 13.11 ? 142  GLU A CB  1 
ATOM   1604 C CG  A GLU A 1 149 ? 19.641  0.380   -32.829 0.19 13.33 ? 142  GLU A CG  1 
ATOM   1605 C CG  B GLU A 1 149 ? 19.664  0.648   -32.857 0.81 11.84 ? 142  GLU A CG  1 
ATOM   1606 C CD  A GLU A 1 149 ? 18.388  0.689   -32.027 0.19 17.82 ? 142  GLU A CD  1 
ATOM   1607 C CD  B GLU A 1 149 ? 18.441  1.005   -32.026 0.81 15.33 ? 142  GLU A CD  1 
ATOM   1608 O OE1 A GLU A 1 149 ? 17.822  -0.241  -31.413 0.19 22.65 ? 142  GLU A OE1 1 
ATOM   1609 O OE1 B GLU A 1 149 ? 17.858  0.095   -31.394 0.81 23.92 ? 142  GLU A OE1 1 
ATOM   1610 O OE2 A GLU A 1 149 ? 17.975  1.866   -32.005 0.19 22.23 ? 142  GLU A OE2 1 
ATOM   1611 O OE2 B GLU A 1 149 ? 18.093  2.199   -31.971 0.81 24.39 ? 142  GLU A OE2 1 
ATOM   1612 N N   A ASN A 1 150 ? 23.033  1.603   -32.973 0.19 10.44 ? 143  ASN A N   1 
ATOM   1613 N N   B ASN A 1 150 ? 23.054  1.688   -32.938 0.81 10.28 ? 143  ASN A N   1 
ATOM   1614 C CA  A ASN A 1 150 ? 23.584  2.458   -34.017 0.19 10.88 ? 143  ASN A CA  1 
ATOM   1615 C CA  B ASN A 1 150 ? 23.501  2.554   -34.033 0.81 10.45 ? 143  ASN A CA  1 
ATOM   1616 C C   A ASN A 1 150 ? 23.153  2.012   -35.407 0.19 11.96 ? 143  ASN A C   1 
ATOM   1617 C C   B ASN A 1 150 ? 23.148  2.012   -35.405 0.81 11.93 ? 143  ASN A C   1 
ATOM   1618 O O   A ASN A 1 150 ? 23.728  2.450   -36.405 0.19 12.96 ? 143  ASN A O   1 
ATOM   1619 O O   B ASN A 1 150 ? 23.804  2.363   -36.392 0.81 13.11 ? 143  ASN A O   1 
ATOM   1620 C CB  A ASN A 1 150 ? 25.116  2.499   -33.936 0.19 11.16 ? 143  ASN A CB  1 
ATOM   1621 C CB  B ASN A 1 150 ? 25.017  2.791   -33.963 0.81 12.10 ? 143  ASN A CB  1 
ATOM   1622 C CG  A ASN A 1 150 ? 25.762  1.127   -34.105 0.19 9.51  ? 143  ASN A CG  1 
ATOM   1623 C CG  B ASN A 1 150 ? 25.832  1.513   -34.117 0.81 9.17  ? 143  ASN A CG  1 
ATOM   1624 O OD1 A ASN A 1 150 ? 25.095  0.137   -34.402 0.19 14.58 ? 143  ASN A OD1 1 
ATOM   1625 O OD1 B ASN A 1 150 ? 25.309  0.435   -34.388 0.81 15.71 ? 143  ASN A OD1 1 
ATOM   1626 N ND2 A ASN A 1 150 ? 27.078  1.071   -33.916 0.19 10.42 ? 143  ASN A ND2 1 
ATOM   1627 N ND2 B ASN A 1 150 ? 27.140  1.642   -33.928 0.81 10.10 ? 143  ASN A ND2 1 
ATOM   1628 N N   . HIS A 1 151 ? 22.155  1.135   -35.475 1.00 10.76 ? 144  HIS A N   1 
ATOM   1629 C CA  . HIS A 1 151 ? 21.724  0.592   -36.771 1.00 12.66 ? 144  HIS A CA  1 
ATOM   1630 C C   . HIS A 1 151 ? 21.092  1.682   -37.618 1.00 14.61 ? 144  HIS A C   1 
ATOM   1631 O O   . HIS A 1 151 ? 20.468  2.606   -37.092 1.00 13.57 ? 144  HIS A O   1 
ATOM   1632 C CB  . HIS A 1 151 ? 20.756  -0.566  -36.554 1.00 15.98 ? 144  HIS A CB  1 
ATOM   1633 C CG  . HIS A 1 151 ? 21.360  -1.717  -35.821 1.00 14.83 ? 144  HIS A CG  1 
ATOM   1634 N ND1 . HIS A 1 151 ? 20.651  -2.858  -35.515 1.00 23.79 ? 144  HIS A ND1 1 
ATOM   1635 C CD2 . HIS A 1 151 ? 22.609  -1.907  -35.335 1.00 15.51 ? 144  HIS A CD2 1 
ATOM   1636 C CE1 . HIS A 1 151 ? 21.433  -3.697  -34.863 1.00 25.62 ? 144  HIS A CE1 1 
ATOM   1637 N NE2 . HIS A 1 151 ? 22.627  -3.144  -34.739 1.00 23.30 ? 144  HIS A NE2 1 
ATOM   1638 N N   A ARG A 1 152 ? 21.270  1.614   -38.936 0.71 11.64 ? 145  ARG A N   1 
ATOM   1639 N N   B ARG A 1 152 ? 21.256  1.555   -38.932 0.29 11.74 ? 145  ARG A N   1 
ATOM   1640 C CA  A ARG A 1 152 ? 20.843  2.743   -39.766 0.71 13.80 ? 145  ARG A CA  1 
ATOM   1641 C CA  B ARG A 1 152 ? 20.802  2.577   -39.866 0.29 14.06 ? 145  ARG A CA  1 
ATOM   1642 C C   A ARG A 1 152 ? 19.339  2.758   -40.027 0.71 12.17 ? 145  ARG A C   1 
ATOM   1643 C C   B ARG A 1 152 ? 19.318  2.444   -40.198 0.29 13.46 ? 145  ARG A C   1 
ATOM   1644 O O   A ARG A 1 152 ? 18.805  3.752   -40.539 0.71 13.58 ? 145  ARG A O   1 
ATOM   1645 O O   B ARG A 1 152 ? 18.808  3.145   -41.066 0.29 16.59 ? 145  ARG A O   1 
ATOM   1646 C CB  A ARG A 1 152 ? 21.617  2.751   -41.083 0.71 13.15 ? 145  ARG A CB  1 
ATOM   1647 C CB  B ARG A 1 152 ? 21.639  2.524   -41.143 0.29 13.29 ? 145  ARG A CB  1 
ATOM   1648 C CG  A ARG A 1 152 ? 23.056  3.287   -40.930 0.71 13.05 ? 145  ARG A CG  1 
ATOM   1649 C CG  B ARG A 1 152 ? 23.103  2.926   -40.935 0.29 11.56 ? 145  ARG A CG  1 
ATOM   1650 C CD  A ARG A 1 152 ? 23.870  3.175   -42.240 0.71 14.83 ? 145  ARG A CD  1 
ATOM   1651 C CD  B ARG A 1 152 ? 23.938  2.745   -42.212 0.29 12.95 ? 145  ARG A CD  1 
ATOM   1652 N NE  A ARG A 1 152 ? 23.855  1.812   -42.774 0.71 13.22 ? 145  ARG A NE  1 
ATOM   1653 N NE  B ARG A 1 152 ? 23.955  1.356   -42.663 0.29 14.19 ? 145  ARG A NE  1 
ATOM   1654 C CZ  A ARG A 1 152 ? 23.110  1.413   -43.809 0.71 16.86 ? 145  ARG A CZ  1 
ATOM   1655 C CZ  B ARG A 1 152 ? 23.279  0.895   -43.712 0.29 17.04 ? 145  ARG A CZ  1 
ATOM   1656 N NH1 A ARG A 1 152 ? 22.311  2.270   -44.427 0.71 15.62 ? 145  ARG A NH1 1 
ATOM   1657 N NH1 B ARG A 1 152 ? 22.531  1.712   -44.440 0.29 10.36 ? 145  ARG A NH1 1 
ATOM   1658 N NH2 A ARG A 1 152 ? 23.146  0.150   -44.210 0.71 15.34 ? 145  ARG A NH2 1 
ATOM   1659 N NH2 B ARG A 1 152 ? 23.353  -0.388  -44.035 0.29 12.53 ? 145  ARG A NH2 1 
ATOM   1660 N N   A ASP A 1 153 ? 18.650  1.681   -39.652 0.71 13.91 ? 146  ASP A N   1 
ATOM   1661 N N   B ASP A 1 153 ? 18.627  1.540   -39.511 0.29 13.94 ? 146  ASP A N   1 
ATOM   1662 C CA  A ASP A 1 153 ? 17.194  1.669   -39.756 0.71 14.73 ? 146  ASP A CA  1 
ATOM   1663 C CA  B ASP A 1 153 ? 17.174  1.492   -39.612 0.29 14.82 ? 146  ASP A CA  1 
ATOM   1664 C C   A ASP A 1 153 ? 16.595  2.575   -38.678 0.71 16.35 ? 146  ASP A C   1 
ATOM   1665 C C   B ASP A 1 153 ? 16.581  2.490   -38.623 0.29 16.27 ? 146  ASP A C   1 
ATOM   1666 O O   A ASP A 1 153 ? 15.411  2.906   -38.732 0.71 13.24 ? 146  ASP A O   1 
ATOM   1667 O O   B ASP A 1 153 ? 15.398  2.822   -38.696 0.29 13.67 ? 146  ASP A O   1 
ATOM   1668 C CB  A ASP A 1 153 ? 16.621  0.248   -39.643 0.71 15.55 ? 146  ASP A CB  1 
ATOM   1669 C CB  B ASP A 1 153 ? 16.636  0.084   -39.342 0.29 16.65 ? 146  ASP A CB  1 
ATOM   1670 C CG  A ASP A 1 153 ? 17.133  -0.503  -38.426 0.71 26.29 ? 146  ASP A CG  1 
ATOM   1671 C CG  B ASP A 1 153 ? 16.682  -0.287  -37.870 0.29 20.00 ? 146  ASP A CG  1 
ATOM   1672 O OD1 A ASP A 1 153 ? 17.696  0.136   -37.510 0.71 24.25 ? 146  ASP A OD1 1 
ATOM   1673 O OD1 B ASP A 1 153 ? 15.704  0.005   -37.150 0.29 24.64 ? 146  ASP A OD1 1 
ATOM   1674 O OD2 A ASP A 1 153 ? 16.957  -1.741  -38.384 0.71 22.66 ? 146  ASP A OD2 1 
ATOM   1675 O OD2 B ASP A 1 153 ? 17.698  -0.868  -37.436 0.29 25.75 ? 146  ASP A OD2 1 
ATOM   1676 N N   A MET A 1 154 ? 17.366  2.885   -37.633 0.40 16.50 ? 147  MET A N   1 
ATOM   1677 N N   B MET A 1 154 ? 17.376  2.894   -37.646 0.60 16.83 ? 147  MET A N   1 
ATOM   1678 C CA  A MET A 1 154 ? 17.016  3.956   -36.675 0.40 16.37 ? 147  MET A CA  1 
ATOM   1679 C CA  B MET A 1 154 ? 17.036  3.938   -36.665 0.60 17.06 ? 147  MET A CA  1 
ATOM   1680 C C   A MET A 1 154 ? 17.823  5.254   -36.768 0.40 15.79 ? 147  MET A C   1 
ATOM   1681 C C   B MET A 1 154 ? 17.825  5.243   -36.778 0.60 16.10 ? 147  MET A C   1 
ATOM   1682 O O   A MET A 1 154 ? 17.261  6.342   -36.580 0.40 16.04 ? 147  MET A O   1 
ATOM   1683 O O   B MET A 1 154 ? 17.256  6.324   -36.608 0.60 16.33 ? 147  MET A O   1 
ATOM   1684 C CB  A MET A 1 154 ? 17.113  3.469   -35.230 0.40 16.70 ? 147  MET A CB  1 
ATOM   1685 C CB  B MET A 1 154 ? 17.208  3.415   -35.236 0.60 18.05 ? 147  MET A CB  1 
ATOM   1686 C CG  A MET A 1 154 ? 16.562  4.485   -34.229 0.40 16.75 ? 147  MET A CG  1 
ATOM   1687 C CG  B MET A 1 154 ? 16.665  2.005   -35.009 0.60 20.43 ? 147  MET A CG  1 
ATOM   1688 S SD  A MET A 1 154 ? 14.822  4.984   -34.413 0.40 19.62 ? 147  MET A SD  1 
ATOM   1689 S SD  B MET A 1 154 ? 14.858  1.834   -35.072 0.60 21.70 ? 147  MET A SD  1 
ATOM   1690 C CE  A MET A 1 154 ? 14.400  5.225   -32.703 0.40 17.47 ? 147  MET A CE  1 
ATOM   1691 C CE  B MET A 1 154 ? 14.721  0.049   -34.988 0.60 24.04 ? 147  MET A CE  1 
ATOM   1692 N N   A TYR A 1 155 ? 19.126  5.106   -36.993 0.54 12.90 ? 148  TYR A N   1 
ATOM   1693 N N   B TYR A 1 155 ? 19.122  5.085   -37.005 0.46 12.91 ? 148  TYR A N   1 
ATOM   1694 C CA  A TYR A 1 155 ? 19.976  6.294   -37.064 0.54 14.42 ? 148  TYR A CA  1 
ATOM   1695 C CA  B TYR A 1 155 ? 20.010  6.239   -37.076 0.46 14.47 ? 148  TYR A CA  1 
ATOM   1696 C C   A TYR A 1 155 ? 20.787  6.326   -38.368 0.54 16.16 ? 148  TYR A C   1 
ATOM   1697 C C   B TYR A 1 155 ? 20.793  6.263   -38.389 0.46 16.20 ? 148  TYR A C   1 
ATOM   1698 O O   A TYR A 1 155 ? 22.006  6.172   -38.369 0.54 15.27 ? 148  TYR A O   1 
ATOM   1699 O O   B TYR A 1 155 ? 22.003  6.045   -38.416 0.46 15.03 ? 148  TYR A O   1 
ATOM   1700 C CB  A TYR A 1 155 ? 20.890  6.365   -35.822 0.54 15.69 ? 148  TYR A CB  1 
ATOM   1701 C CB  B TYR A 1 155 ? 20.964  6.245   -35.873 0.46 15.61 ? 148  TYR A CB  1 
ATOM   1702 C CG  A TYR A 1 155 ? 20.086  6.494   -34.538 0.54 11.59 ? 148  TYR A CG  1 
ATOM   1703 C CG  B TYR A 1 155 ? 20.218  6.298   -34.561 0.46 13.84 ? 148  TYR A CG  1 
ATOM   1704 C CD1 A TYR A 1 155 ? 19.508  7.705   -34.183 0.54 14.73 ? 148  TYR A CD1 1 
ATOM   1705 C CD1 B TYR A 1 155 ? 19.689  7.491   -34.098 0.46 12.59 ? 148  TYR A CD1 1 
ATOM   1706 C CD2 A TYR A 1 155 ? 19.872  5.394   -33.707 0.54 14.06 ? 148  TYR A CD2 1 
ATOM   1707 C CD2 B TYR A 1 155 ? 20.025  5.150   -33.800 0.46 11.03 ? 148  TYR A CD2 1 
ATOM   1708 C CE1 A TYR A 1 155 ? 18.742  7.824   -33.024 0.54 12.16 ? 148  TYR A CE1 1 
ATOM   1709 C CE1 B TYR A 1 155 ? 18.980  7.545   -32.901 0.46 13.17 ? 148  TYR A CE1 1 
ATOM   1710 C CE2 A TYR A 1 155 ? 19.121  5.509   -32.547 0.54 13.19 ? 148  TYR A CE2 1 
ATOM   1711 C CE2 B TYR A 1 155 ? 19.334  5.197   -32.605 0.46 13.18 ? 148  TYR A CE2 1 
ATOM   1712 C CZ  A TYR A 1 155 ? 18.550  6.726   -32.214 0.54 14.04 ? 148  TYR A CZ  1 
ATOM   1713 C CZ  B TYR A 1 155 ? 18.811  6.392   -32.161 0.46 15.13 ? 148  TYR A CZ  1 
ATOM   1714 O OH  A TYR A 1 155 ? 17.788  6.857   -31.071 0.54 10.58 ? 148  TYR A OH  1 
ATOM   1715 O OH  B TYR A 1 155 ? 18.111  6.439   -30.977 0.46 21.46 ? 148  TYR A OH  1 
ATOM   1716 N N   . GLY A 1 156 ? 20.092  6.524   -39.484 1.00 12.14 ? 149  GLY A N   1 
ATOM   1717 C CA  . GLY A 1 156 ? 20.763  6.624   -40.783 1.00 12.60 ? 149  GLY A CA  1 
ATOM   1718 C C   . GLY A 1 156 ? 21.449  7.974   -40.970 1.00 11.53 ? 149  GLY A C   1 
ATOM   1719 O O   . GLY A 1 156 ? 20.886  9.012   -40.629 1.00 12.91 ? 149  GLY A O   1 
ATOM   1720 N N   A PRO A 1 157 ? 22.679  7.962   -41.515 0.57 10.39 ? 150  PRO A N   1 
ATOM   1721 N N   B PRO A 1 157 ? 22.671  7.973   -41.531 0.43 10.53 ? 150  PRO A N   1 
ATOM   1722 C CA  A PRO A 1 157 ? 23.454  9.193   -41.683 0.57 14.38 ? 150  PRO A CA  1 
ATOM   1723 C CA  B PRO A 1 157 ? 23.439  9.216   -41.667 0.43 14.26 ? 150  PRO A CA  1 
ATOM   1724 C C   A PRO A 1 157 ? 23.076  9.933   -42.961 0.57 11.49 ? 150  PRO A C   1 
ATOM   1725 C C   B PRO A 1 157 ? 23.068  10.037  -42.905 0.43 11.71 ? 150  PRO A C   1 
ATOM   1726 O O   A PRO A 1 157 ? 23.758  10.889  -43.322 0.57 13.66 ? 150  PRO A O   1 
ATOM   1727 O O   B PRO A 1 157 ? 23.728  11.038  -43.179 0.43 11.63 ? 150  PRO A O   1 
ATOM   1728 C CB  A PRO A 1 157 ? 24.890  8.679   -41.769 0.57 10.67 ? 150  PRO A CB  1 
ATOM   1729 C CB  B PRO A 1 157 ? 24.878  8.711   -41.780 0.43 10.73 ? 150  PRO A CB  1 
ATOM   1730 C CG  A PRO A 1 157 ? 24.732  7.354   -42.453 0.57 13.00 ? 150  PRO A CG  1 
ATOM   1731 C CG  B PRO A 1 157 ? 24.727  7.398   -42.483 0.43 13.02 ? 150  PRO A CG  1 
ATOM   1732 C CD  A PRO A 1 157 ? 23.448  6.769   -41.908 0.57 15.24 ? 150  PRO A CD  1 
ATOM   1733 C CD  B PRO A 1 157 ? 23.451  6.793   -41.944 0.43 15.27 ? 150  PRO A CD  1 
ATOM   1734 N N   A ASP A 1 158 ? 21.992  9.511   -43.601 0.57 11.54 ? 151  ASP A N   1 
ATOM   1735 N N   B ASP A 1 158 ? 22.009  9.642   -43.603 0.43 11.69 ? 151  ASP A N   1 
ATOM   1736 C CA  A ASP A 1 158 ? 21.666  9.956   -44.961 0.57 11.15 ? 151  ASP A CA  1 
ATOM   1737 C CA  B ASP A 1 158 ? 21.713  10.167  -44.943 0.43 11.03 ? 151  ASP A CA  1 
ATOM   1738 C C   A ASP A 1 158 ? 21.433  11.460  -45.100 0.57 13.82 ? 151  ASP A C   1 
ATOM   1739 C C   B ASP A 1 158 ? 21.546  11.686  -45.037 0.43 14.12 ? 151  ASP A C   1 
ATOM   1740 O O   A ASP A 1 158 ? 21.597  12.023  -46.190 0.57 15.13 ? 151  ASP A O   1 
ATOM   1741 O O   B ASP A 1 158 ? 21.865  12.292  -46.067 0.43 13.73 ? 151  ASP A O   1 
ATOM   1742 C CB  A ASP A 1 158 ? 20.435  9.209   -45.468 0.57 13.43 ? 151  ASP A CB  1 
ATOM   1743 C CB  B ASP A 1 158 ? 20.454  9.498   -45.485 0.43 13.62 ? 151  ASP A CB  1 
ATOM   1744 C CG  A ASP A 1 158 ? 20.585  7.705   -45.383 0.57 16.98 ? 151  ASP A CG  1 
ATOM   1745 C CG  B ASP A 1 158 ? 20.529  7.991   -45.430 0.43 13.80 ? 151  ASP A CG  1 
ATOM   1746 O OD1 A ASP A 1 158 ? 21.045  7.193   -44.332 0.57 15.08 ? 151  ASP A OD1 1 
ATOM   1747 O OD1 B ASP A 1 158 ? 21.020  7.454   -44.409 0.43 18.08 ? 151  ASP A OD1 1 
ATOM   1748 O OD2 A ASP A 1 158 ? 20.227  7.021   -46.368 0.57 15.19 ? 151  ASP A OD2 1 
ATOM   1749 O OD2 B ASP A 1 158 ? 20.092  7.337   -46.403 0.43 16.28 ? 151  ASP A OD2 1 
ATOM   1750 N N   A TYR A 1 159 ? 21.047  12.121  -44.017 0.57 13.76 ? 152  TYR A N   1 
ATOM   1751 N N   B TYR A 1 159 ? 21.034  12.309  -43.983 0.43 13.44 ? 152  TYR A N   1 
ATOM   1752 C CA  A TYR A 1 159 ? 20.832  13.561  -44.093 0.57 11.69 ? 152  TYR A CA  1 
ATOM   1753 C CA  B TYR A 1 159 ? 20.849  13.754  -44.015 0.43 11.96 ? 152  TYR A CA  1 
ATOM   1754 C C   A TYR A 1 159 ? 22.130  14.289  -43.790 0.57 10.42 ? 152  TYR A C   1 
ATOM   1755 C C   B TYR A 1 159 ? 22.174  14.463  -43.800 0.43 10.92 ? 152  TYR A C   1 
ATOM   1756 O O   A TYR A 1 159 ? 22.491  15.240  -44.474 0.57 12.77 ? 152  TYR A O   1 
ATOM   1757 O O   B TYR A 1 159 ? 22.544  15.341  -44.566 0.43 13.17 ? 152  TYR A O   1 
ATOM   1758 C CB  A TYR A 1 159 ? 19.740  14.024  -43.120 0.57 12.11 ? 152  TYR A CB  1 
ATOM   1759 C CB  B TYR A 1 159 ? 19.842  14.210  -42.954 0.43 11.27 ? 152  TYR A CB  1 
ATOM   1760 C CG  A TYR A 1 159 ? 18.439  13.269  -43.201 0.57 14.10 ? 152  TYR A CG  1 
ATOM   1761 C CG  B TYR A 1 159 ? 18.464  13.611  -43.089 0.43 12.68 ? 152  TYR A CG  1 
ATOM   1762 C CD1 A TYR A 1 159 ? 18.068  12.565  -44.344 0.57 13.21 ? 152  TYR A CD1 1 
ATOM   1763 C CD1 B TYR A 1 159 ? 17.964  13.207  -44.317 0.43 13.90 ? 152  TYR A CD1 1 
ATOM   1764 C CD2 A TYR A 1 159 ? 17.574  13.249  -42.113 0.57 10.14 ? 152  TYR A CD2 1 
ATOM   1765 C CD2 B TYR A 1 159 ? 17.657  13.449  -41.972 0.43 12.73 ? 152  TYR A CD2 1 
ATOM   1766 C CE1 A TYR A 1 159 ? 16.881  11.876  -44.395 0.57 10.04 ? 152  TYR A CE1 1 
ATOM   1767 C CE1 B TYR A 1 159 ? 16.698  12.658  -44.425 0.43 14.56 ? 152  TYR A CE1 1 
ATOM   1768 C CE2 A TYR A 1 159 ? 16.388  12.570  -42.155 0.57 12.00 ? 152  TYR A CE2 1 
ATOM   1769 C CE2 B TYR A 1 159 ? 16.396  12.906  -42.066 0.43 10.19 ? 152  TYR A CE2 1 
ATOM   1770 C CZ  A TYR A 1 159 ? 16.036  11.886  -43.299 0.57 12.96 ? 152  TYR A CZ  1 
ATOM   1771 C CZ  B TYR A 1 159 ? 15.915  12.513  -43.296 0.43 8.10  ? 152  TYR A CZ  1 
ATOM   1772 O OH  A TYR A 1 159 ? 14.841  11.203  -43.328 0.57 11.76 ? 152  TYR A OH  1 
ATOM   1773 O OH  B TYR A 1 159 ? 14.658  11.971  -43.397 0.43 13.78 ? 152  TYR A OH  1 
ATOM   1774 N N   A PHE A 1 160 ? 22.839  13.843  -42.758 0.57 11.41 ? 153  PHE A N   1 
ATOM   1775 N N   B PHE A 1 160 ? 22.895  14.079  -42.754 0.43 11.28 ? 153  PHE A N   1 
ATOM   1776 C CA  A PHE A 1 160 ? 24.096  14.480  -42.389 0.57 9.58  ? 153  PHE A CA  1 
ATOM   1777 C CA  B PHE A 1 160 ? 24.142  14.751  -42.419 0.43 7.80  ? 153  PHE A CA  1 
ATOM   1778 C C   A PHE A 1 160 ? 25.166  14.423  -43.496 0.57 14.51 ? 153  PHE A C   1 
ATOM   1779 C C   B PHE A 1 160 ? 25.248  14.591  -43.478 0.43 14.17 ? 153  PHE A C   1 
ATOM   1780 O O   A PHE A 1 160 ? 25.958  15.351  -43.627 0.57 13.89 ? 153  PHE A O   1 
ATOM   1781 O O   B PHE A 1 160 ? 26.103  15.464  -43.597 0.43 14.83 ? 153  PHE A O   1 
ATOM   1782 C CB  A PHE A 1 160 ? 24.651  13.839  -41.116 0.57 12.36 ? 153  PHE A CB  1 
ATOM   1783 C CB  B PHE A 1 160 ? 24.646  14.245  -41.069 0.43 9.34  ? 153  PHE A CB  1 
ATOM   1784 C CG  A PHE A 1 160 ? 24.211  14.506  -39.854 0.57 9.74  ? 153  PHE A CG  1 
ATOM   1785 C CG  B PHE A 1 160 ? 24.228  15.092  -39.912 0.43 9.42  ? 153  PHE A CG  1 
ATOM   1786 C CD1 A PHE A 1 160 ? 24.617  15.798  -39.567 0.57 12.07 ? 153  PHE A CD1 1 
ATOM   1787 C CD1 B PHE A 1 160 ? 24.710  16.384  -39.777 0.43 10.73 ? 153  PHE A CD1 1 
ATOM   1788 C CD2 A PHE A 1 160 ? 23.436  13.826  -38.922 0.57 8.29  ? 153  PHE A CD2 1 
ATOM   1789 C CD2 B PHE A 1 160 ? 23.364  14.596  -38.946 0.43 16.64 ? 153  PHE A CD2 1 
ATOM   1790 C CE1 A PHE A 1 160 ? 24.227  16.419  -38.387 0.57 14.20 ? 153  PHE A CE1 1 
ATOM   1791 C CE1 B PHE A 1 160 ? 24.334  17.165  -38.697 0.43 13.14 ? 153  PHE A CE1 1 
ATOM   1792 C CE2 A PHE A 1 160 ? 23.041  14.446  -37.744 0.57 11.23 ? 153  PHE A CE2 1 
ATOM   1793 C CE2 B PHE A 1 160 ? 22.984  15.375  -37.862 0.43 12.25 ? 153  PHE A CE2 1 
ATOM   1794 C CZ  A PHE A 1 160 ? 23.438  15.745  -37.480 0.57 7.85  ? 153  PHE A CZ  1 
ATOM   1795 C CZ  B PHE A 1 160 ? 23.466  16.655  -37.738 0.43 15.13 ? 153  PHE A CZ  1 
ATOM   1796 N N   A ILE A 1 161 ? 25.183  13.353  -44.292 0.57 15.61 ? 154  ILE A N   1 
ATOM   1797 N N   B ILE A 1 161 ? 25.231  13.500  -44.245 0.43 15.64 ? 154  ILE A N   1 
ATOM   1798 C CA  A ILE A 1 161 ? 26.233  13.207  -45.301 0.57 13.97 ? 154  ILE A CA  1 
ATOM   1799 C CA  B ILE A 1 161 ? 26.275  13.292  -45.251 0.43 14.09 ? 154  ILE A CA  1 
ATOM   1800 C C   A ILE A 1 161 ? 26.030  14.138  -46.510 0.57 14.89 ? 154  ILE A C   1 
ATOM   1801 C C   B ILE A 1 161 ? 26.069  14.194  -46.472 0.43 14.99 ? 154  ILE A C   1 
ATOM   1802 O O   A ILE A 1 161 ? 26.844  14.139  -47.434 0.57 16.58 ? 154  ILE A O   1 
ATOM   1803 O O   B ILE A 1 161 ? 26.906  14.221  -47.376 0.43 16.14 ? 154  ILE A O   1 
ATOM   1804 C CB  A ILE A 1 161 ? 26.380  11.721  -45.764 0.57 14.87 ? 154  ILE A CB  1 
ATOM   1805 C CB  B ILE A 1 161 ? 26.384  11.799  -45.686 0.43 14.57 ? 154  ILE A CB  1 
ATOM   1806 C CG1 A ILE A 1 161 ? 25.082  11.167  -46.355 0.57 14.70 ? 154  ILE A CG1 1 
ATOM   1807 C CG1 B ILE A 1 161 ? 25.036  11.228  -46.133 0.43 15.92 ? 154  ILE A CG1 1 
ATOM   1808 C CG2 A ILE A 1 161 ? 26.893  10.827  -44.609 0.57 14.37 ? 154  ILE A CG2 1 
ATOM   1809 C CG2 B ILE A 1 161 ? 27.002  10.946  -44.560 0.43 14.46 ? 154  ILE A CG2 1 
ATOM   1810 C CD1 A ILE A 1 161 ? 25.010  11.285  -47.855 0.57 17.95 ? 154  ILE A CD1 1 
ATOM   1811 C CD1 B ILE A 1 161 ? 24.793  11.333  -47.618 0.43 18.80 ? 154  ILE A CD1 1 
ATOM   1812 N N   . LYS A 1 162 ? 24.974  14.950  -46.480 1.00 15.79 ? 155  LYS A N   1 
ATOM   1813 C CA  . LYS A 1 162 ? 24.847  16.088  -47.386 1.00 16.57 ? 155  LYS A CA  1 
ATOM   1814 C C   . LYS A 1 162 ? 25.826  17.189  -46.993 1.00 21.76 ? 155  LYS A C   1 
ATOM   1815 O O   . LYS A 1 162 ? 26.123  18.098  -47.778 1.00 19.14 ? 155  LYS A O   1 
ATOM   1816 C CB  A LYS A 1 162 ? 23.428  16.647  -47.372 0.28 16.30 ? 155  LYS A CB  1 
ATOM   1817 C CB  B LYS A 1 162 ? 23.425  16.654  -47.371 0.72 16.42 ? 155  LYS A CB  1 
ATOM   1818 C CG  A LYS A 1 162 ? 22.423  15.820  -48.115 0.28 16.08 ? 155  LYS A CG  1 
ATOM   1819 C CG  B LYS A 1 162 ? 22.373  15.796  -48.011 0.72 16.05 ? 155  LYS A CG  1 
ATOM   1820 C CD  A LYS A 1 162 ? 21.085  16.529  -48.121 0.28 18.78 ? 155  LYS A CD  1 
ATOM   1821 C CD  B LYS A 1 162 ? 20.995  16.432  -47.805 0.72 17.75 ? 155  LYS A CD  1 
ATOM   1822 C CE  A LYS A 1 162 ? 20.102  15.834  -49.034 0.28 26.29 ? 155  LYS A CE  1 
ATOM   1823 C CE  B LYS A 1 162 ? 19.929  15.813  -48.706 0.72 28.61 ? 155  LYS A CE  1 
ATOM   1824 N NZ  A LYS A 1 162 ? 18.823  16.564  -49.084 0.28 25.36 ? 155  LYS A NZ  1 
ATOM   1825 N NZ  B LYS A 1 162 ? 20.197  16.062  -50.152 0.72 22.11 ? 155  LYS A NZ  1 
ATOM   1826 N N   A LYS A 1 163 ? 26.300  17.127  -45.753 0.36 13.89 ? 156  LYS A N   1 
ATOM   1827 N N   B LYS A 1 163 ? 26.314  17.115  -45.760 0.64 13.74 ? 156  LYS A N   1 
ATOM   1828 C CA  A LYS A 1 163 ? 27.151  18.180  -45.218 0.36 19.62 ? 156  LYS A CA  1 
ATOM   1829 C CA  B LYS A 1 163 ? 27.297  18.072  -45.281 0.64 19.09 ? 156  LYS A CA  1 
ATOM   1830 C C   A LYS A 1 163 ? 28.609  17.756  -45.232 0.36 13.96 ? 156  LYS A C   1 
ATOM   1831 C C   B LYS A 1 163 ? 28.676  17.445  -45.285 0.64 14.88 ? 156  LYS A C   1 
ATOM   1832 O O   A LYS A 1 163 ? 28.921  16.576  -45.392 0.36 15.42 ? 156  LYS A O   1 
ATOM   1833 O O   B LYS A 1 163 ? 28.813  16.226  -45.265 0.64 15.69 ? 156  LYS A O   1 
ATOM   1834 C CB  A LYS A 1 163 ? 26.719  18.548  -43.797 0.36 17.29 ? 156  LYS A CB  1 
ATOM   1835 C CB  B LYS A 1 163 ? 26.932  18.558  -43.878 0.64 17.30 ? 156  LYS A CB  1 
ATOM   1836 C CG  A LYS A 1 163 ? 25.213  18.539  -43.589 0.36 12.26 ? 156  LYS A CG  1 
ATOM   1837 C CG  B LYS A 1 163 ? 25.601  19.276  -43.817 0.64 18.65 ? 156  LYS A CG  1 
ATOM   1838 C CD  A LYS A 1 163 ? 24.510  19.537  -44.494 0.36 15.17 ? 156  LYS A CD  1 
ATOM   1839 C CD  B LYS A 1 163 ? 25.642  20.544  -44.642 0.64 29.36 ? 156  LYS A CD  1 
ATOM   1840 C CE  A LYS A 1 163 ? 24.930  20.962  -44.200 0.36 24.12 ? 156  LYS A CE  1 
ATOM   1841 C CE  B LYS A 1 163 ? 24.691  21.579  -44.090 0.64 32.82 ? 156  LYS A CE  1 
ATOM   1842 N NZ  A LYS A 1 163 ? 24.155  21.932  -45.023 0.36 26.78 ? 156  LYS A NZ  1 
ATOM   1843 N NZ  B LYS A 1 163 ? 24.783  22.882  -44.806 0.64 38.70 ? 156  LYS A NZ  1 
ATOM   1844 N N   A ASP A 1 164 ? 29.503  18.725  -45.064 0.36 11.65 ? 157  ASP A N   1 
ATOM   1845 N N   B ASP A 1 164 ? 29.703  18.285  -45.335 0.64 17.85 ? 157  ASP A N   1 
ATOM   1846 C CA  A ASP A 1 164 ? 30.932  18.466  -45.193 0.36 16.89 ? 157  ASP A CA  1 
ATOM   1847 C CA  B ASP A 1 164 ? 31.072  17.798  -45.400 0.64 13.86 ? 157  ASP A CA  1 
ATOM   1848 C C   A ASP A 1 164 ? 31.581  18.072  -43.864 0.36 14.35 ? 157  ASP A C   1 
ATOM   1849 C C   B ASP A 1 164 ? 31.634  17.575  -43.996 0.64 17.31 ? 157  ASP A C   1 
ATOM   1850 O O   A ASP A 1 164 ? 32.460  18.772  -43.353 0.36 16.25 ? 157  ASP A O   1 
ATOM   1851 O O   B ASP A 1 164 ? 32.489  18.330  -43.511 0.64 18.37 ? 157  ASP A O   1 
ATOM   1852 C CB  A ASP A 1 164 ? 31.630  19.691  -45.786 0.36 17.95 ? 157  ASP A CB  1 
ATOM   1853 C CB  B ASP A 1 164 ? 31.945  18.770  -46.193 0.64 17.76 ? 157  ASP A CB  1 
ATOM   1854 C CG  A ASP A 1 164 ? 31.224  19.949  -47.222 0.36 23.09 ? 157  ASP A CG  1 
ATOM   1855 C CG  B ASP A 1 164 ? 31.637  18.743  -47.679 0.64 24.49 ? 157  ASP A CG  1 
ATOM   1856 O OD1 A ASP A 1 164 ? 30.777  18.994  -47.887 0.36 18.70 ? 157  ASP A OD1 1 
ATOM   1857 O OD1 B ASP A 1 164 ? 30.997  17.768  -48.132 0.64 16.77 ? 157  ASP A OD1 1 
ATOM   1858 O OD2 A ASP A 1 164 ? 31.362  21.097  -47.692 0.36 29.46 ? 157  ASP A OD2 1 
ATOM   1859 O OD2 B ASP A 1 164 ? 32.041  19.688  -48.392 0.64 21.34 ? 157  ASP A OD2 1 
ATOM   1860 N N   A VAL A 1 165 ? 31.151  16.935  -43.321 0.36 13.05 ? 158  VAL A N   1 
ATOM   1861 N N   B VAL A 1 165 ? 31.130  16.518  -43.366 0.64 13.96 ? 158  VAL A N   1 
ATOM   1862 C CA  A VAL A 1 165 ? 31.663  16.439  -42.047 0.36 13.36 ? 158  VAL A CA  1 
ATOM   1863 C CA  B VAL A 1 165 ? 31.481  16.142  -42.007 0.64 11.80 ? 158  VAL A CA  1 
ATOM   1864 C C   A VAL A 1 165 ? 31.830  14.923  -42.034 0.36 14.70 ? 158  VAL A C   1 
ATOM   1865 C C   B VAL A 1 165 ? 31.826  14.655  -41.936 0.64 15.09 ? 158  VAL A C   1 
ATOM   1866 O O   A VAL A 1 165 ? 31.569  14.244  -43.027 0.36 17.03 ? 158  VAL A O   1 
ATOM   1867 O O   B VAL A 1 165 ? 31.530  13.891  -42.861 0.64 17.51 ? 158  VAL A O   1 
ATOM   1868 C CB  A VAL A 1 165 ? 30.739  16.827  -40.877 0.36 16.40 ? 158  VAL A CB  1 
ATOM   1869 C CB  B VAL A 1 165 ? 30.326  16.434  -41.024 0.64 14.30 ? 158  VAL A CB  1 
ATOM   1870 C CG1 A VAL A 1 165 ? 30.802  18.327  -40.616 0.36 14.89 ? 158  VAL A CG1 1 
ATOM   1871 C CG1 B VAL A 1 165 ? 29.957  17.917  -41.043 0.64 13.78 ? 158  VAL A CG1 1 
ATOM   1872 C CG2 A VAL A 1 165 ? 29.314  16.365  -41.149 0.36 15.85 ? 158  VAL A CG2 1 
ATOM   1873 C CG2 B VAL A 1 165 ? 29.116  15.563  -41.361 0.64 14.26 ? 158  VAL A CG2 1 
ATOM   1874 N N   A VAL A 1 166 ? 32.276  14.405  -40.895 0.36 9.80  ? 159  VAL A N   1 
ATOM   1875 N N   B VAL A 1 166 ? 32.468  14.253  -40.844 0.64 8.66  ? 159  VAL A N   1 
ATOM   1876 C CA  A VAL A 1 166 ? 32.317  12.971  -40.655 0.36 12.70 ? 159  VAL A CA  1 
ATOM   1877 C CA  B VAL A 1 166 ? 32.542  12.844  -40.487 0.64 10.21 ? 159  VAL A CA  1 
ATOM   1878 C C   A VAL A 1 166 ? 31.400  12.663  -39.481 0.36 15.24 ? 159  VAL A C   1 
ATOM   1879 C C   B VAL A 1 166 ? 31.511  12.635  -39.388 0.64 15.63 ? 159  VAL A C   1 
ATOM   1880 O O   A VAL A 1 166 ? 31.463  13.329  -38.453 0.36 14.40 ? 159  VAL A O   1 
ATOM   1881 O O   B VAL A 1 166 ? 31.465  13.399  -38.436 0.64 14.61 ? 159  VAL A O   1 
ATOM   1882 C CB  A VAL A 1 166 ? 33.738  12.478  -40.352 0.36 13.86 ? 159  VAL A CB  1 
ATOM   1883 C CB  B VAL A 1 166 ? 33.943  12.432  -40.006 0.64 9.85  ? 159  VAL A CB  1 
ATOM   1884 C CG1 A VAL A 1 166 ? 33.756  10.956  -40.235 0.36 13.50 ? 159  VAL A CG1 1 
ATOM   1885 C CG1 B VAL A 1 166 ? 33.938  10.969  -39.574 0.64 14.54 ? 159  VAL A CG1 1 
ATOM   1886 C CG2 A VAL A 1 166 ? 34.697  12.955  -41.433 0.36 11.36 ? 159  VAL A CG2 1 
ATOM   1887 C CG2 B VAL A 1 166 ? 34.977  12.686  -41.116 0.64 13.54 ? 159  VAL A CG2 1 
ATOM   1888 N N   A LEU A 1 167 ? 30.539  11.670  -39.648 0.36 11.15 ? 160  LEU A N   1 
ATOM   1889 N N   B LEU A 1 167 ? 30.649  11.645  -39.562 0.64 11.11 ? 160  LEU A N   1 
ATOM   1890 C CA  A LEU A 1 167 ? 29.593  11.304  -38.603 0.36 8.91  ? 160  LEU A CA  1 
ATOM   1891 C CA  B LEU A 1 167 ? 29.655  11.319  -38.547 0.64 8.65  ? 160  LEU A CA  1 
ATOM   1892 C C   A LEU A 1 167 ? 29.902  9.924   -38.053 0.36 10.57 ? 160  LEU A C   1 
ATOM   1893 C C   B LEU A 1 167 ? 29.921  9.934   -38.012 0.64 10.48 ? 160  LEU A C   1 
ATOM   1894 O O   A LEU A 1 167 ? 30.118  8.980   -38.803 0.36 10.29 ? 160  LEU A O   1 
ATOM   1895 O O   B LEU A 1 167 ? 30.126  8.996   -38.764 0.64 10.03 ? 160  LEU A O   1 
ATOM   1896 C CB  A LEU A 1 167 ? 28.165  11.358  -39.142 0.36 12.29 ? 160  LEU A CB  1 
ATOM   1897 C CB  B LEU A 1 167 ? 28.241  11.418  -39.119 0.64 12.24 ? 160  LEU A CB  1 
ATOM   1898 C CG  A LEU A 1 167 ? 27.016  11.050  -38.182 0.36 12.57 ? 160  LEU A CG  1 
ATOM   1899 C CG  B LEU A 1 167 ? 27.044  11.044  -38.240 0.64 12.72 ? 160  LEU A CG  1 
ATOM   1900 C CD1 A LEU A 1 167 ? 26.965  12.060  -37.056 0.36 14.27 ? 160  LEU A CD1 1 
ATOM   1901 C CD1 B LEU A 1 167 ? 27.036  11.835  -36.959 0.64 15.32 ? 160  LEU A CD1 1 
ATOM   1902 C CD2 A LEU A 1 167 ? 25.715  11.054  -38.955 0.36 12.38 ? 160  LEU A CD2 1 
ATOM   1903 C CD2 B LEU A 1 167 ? 25.779  11.317  -39.029 0.64 11.29 ? 160  LEU A CD2 1 
ATOM   1904 N N   A ILE A 1 168 ? 29.916  9.810   -36.731 0.36 10.22 ? 161  ILE A N   1 
ATOM   1905 N N   B ILE A 1 168 ? 29.908  9.806   -36.695 0.64 10.20 ? 161  ILE A N   1 
ATOM   1906 C CA  A ILE A 1 168 ? 30.179  8.536   -36.078 0.36 10.91 ? 161  ILE A CA  1 
ATOM   1907 C CA  B ILE A 1 168 ? 30.200  8.538   -36.048 0.64 10.79 ? 161  ILE A CA  1 
ATOM   1908 C C   A ILE A 1 168 ? 29.099  8.240   -35.047 0.36 10.04 ? 161  ILE A C   1 
ATOM   1909 C C   B ILE A 1 168 ? 29.096  8.241   -35.046 0.64 9.90  ? 161  ILE A C   1 
ATOM   1910 O O   A ILE A 1 168 ? 28.802  9.080   -34.202 0.36 14.34 ? 161  ILE A O   1 
ATOM   1911 O O   B ILE A 1 168 ? 28.758  9.101   -34.240 0.64 14.47 ? 161  ILE A O   1 
ATOM   1912 C CB  A ILE A 1 168 ? 31.564  8.523   -35.400 0.36 11.36 ? 161  ILE A CB  1 
ATOM   1913 C CB  B ILE A 1 168 ? 31.576  8.574   -35.344 0.64 11.17 ? 161  ILE A CB  1 
ATOM   1914 C CG1 A ILE A 1 168 ? 32.673  8.602   -36.464 0.36 10.30 ? 161  ILE A CG1 1 
ATOM   1915 C CG1 B ILE A 1 168 ? 32.665  9.008   -36.350 0.64 10.77 ? 161  ILE A CG1 1 
ATOM   1916 C CG2 A ILE A 1 168 ? 31.725  7.283   -34.526 0.36 13.07 ? 161  ILE A CG2 1 
ATOM   1917 C CG2 B ILE A 1 168 ? 31.900  7.217   -34.731 0.64 13.36 ? 161  ILE A CG2 1 
ATOM   1918 C CD1 A ILE A 1 168 ? 34.091  8.620   -35.898 0.36 12.23 ? 161  ILE A CD1 1 
ATOM   1919 C CD1 B ILE A 1 168 ? 34.028  9.290   -35.740 0.64 13.54 ? 161  ILE A CD1 1 
ATOM   1920 N N   . ASN A 1 169 ? 28.498  7.058   -35.146 1.00 10.11 ? 162  ASN A N   1 
ATOM   1921 C CA  . ASN A 1 169 ? 27.467  6.633   -34.195 1.00 9.63  ? 162  ASN A CA  1 
ATOM   1922 C C   . ASN A 1 169 ? 27.986  5.476   -33.360 1.00 10.84 ? 162  ASN A C   1 
ATOM   1923 O O   . ASN A 1 169 ? 28.360  4.443   -33.900 1.00 11.13 ? 162  ASN A O   1 
ATOM   1924 C CB  . ASN A 1 169 ? 26.162  6.218   -34.914 1.00 9.53  ? 162  ASN A CB  1 
ATOM   1925 C CG  . ASN A 1 169 ? 25.494  7.364   -35.658 1.00 11.66 ? 162  ASN A CG  1 
ATOM   1926 O OD1 . ASN A 1 169 ? 26.032  7.887   -36.633 1.00 12.93 ? 162  ASN A OD1 1 
ATOM   1927 N ND2 . ASN A 1 169 ? 24.296  7.737   -35.222 1.00 12.70 ? 162  ASN A ND2 1 
ATOM   1928 N N   . ILE A 1 170 ? 28.017  5.640   -32.030 1.00 10.84 ? 163  ILE A N   1 
ATOM   1929 C CA  . ILE A 1 170 ? 28.538  4.583   -31.182 1.00 13.03 ? 163  ILE A CA  1 
ATOM   1930 C C   . ILE A 1 170 ? 27.453  3.741   -30.484 1.00 12.18 ? 163  ILE A C   1 
ATOM   1931 O O   . ILE A 1 170 ? 26.300  4.162   -30.349 1.00 11.34 ? 163  ILE A O   1 
ATOM   1932 C CB  . ILE A 1 170 ? 29.478  5.155   -30.103 1.00 11.05 ? 163  ILE A CB  1 
ATOM   1933 C CG1 . ILE A 1 170 ? 28.728  5.989   -29.075 1.00 10.53 ? 163  ILE A CG1 1 
ATOM   1934 C CG2 . ILE A 1 170 ? 30.564  6.034   -30.739 1.00 12.00 ? 163  ILE A CG2 1 
ATOM   1935 C CD1 . ILE A 1 170 ? 29.622  6.367   -27.869 1.00 12.98 ? 163  ILE A CD1 1 
ATOM   1936 N N   A GLN A 1 171 ? 27.831  2.527   -30.092 0.85 11.89 ? 164  GLN A N   1 
ATOM   1937 N N   B GLN A 1 171 ? 27.859  2.554   -30.041 0.15 11.84 ? 164  GLN A N   1 
ATOM   1938 C CA  A GLN A 1 171 ? 27.050  1.730   -29.138 0.85 11.20 ? 164  GLN A CA  1 
ATOM   1939 C CA  B GLN A 1 171 ? 27.058  1.737   -29.136 0.15 11.27 ? 164  GLN A CA  1 
ATOM   1940 C C   A GLN A 1 171 ? 27.817  1.669   -27.810 0.85 13.36 ? 164  GLN A C   1 
ATOM   1941 C C   B GLN A 1 171 ? 27.806  1.541   -27.821 0.15 12.58 ? 164  GLN A C   1 
ATOM   1942 O O   A GLN A 1 171 ? 28.954  2.128   -27.719 0.85 12.15 ? 164  GLN A O   1 
ATOM   1943 O O   B GLN A 1 171 ? 29.034  1.586   -27.782 0.15 9.38  ? 164  GLN A O   1 
ATOM   1944 C CB  A GLN A 1 171 ? 26.763  0.325   -29.675 0.85 14.55 ? 164  GLN A CB  1 
ATOM   1945 C CB  B GLN A 1 171 ? 26.728  0.381   -29.758 0.15 14.36 ? 164  GLN A CB  1 
ATOM   1946 C CG  A GLN A 1 171 ? 25.659  0.344   -30.752 0.85 10.85 ? 164  GLN A CG  1 
ATOM   1947 C CG  B GLN A 1 171 ? 25.695  0.445   -30.867 0.15 11.04 ? 164  GLN A CG  1 
ATOM   1948 C CD  A GLN A 1 171 ? 25.167  -1.016  -31.256 0.85 14.41 ? 164  GLN A CD  1 
ATOM   1949 C CD  B GLN A 1 171 ? 25.213  -0.925  -31.306 0.15 14.39 ? 164  GLN A CD  1 
ATOM   1950 O OE1 A GLN A 1 171 ? 24.167  -1.074  -31.984 0.85 15.08 ? 164  GLN A OE1 1 
ATOM   1951 O OE1 B GLN A 1 171 ? 24.245  -1.040  -32.060 0.15 15.06 ? 164  GLN A OE1 1 
ATOM   1952 N NE2 A GLN A 1 171 ? 25.854  -2.099  -30.896 0.85 11.92 ? 164  GLN A NE2 1 
ATOM   1953 N NE2 B GLN A 1 171 ? 25.885  -1.972  -30.839 0.15 12.32 ? 164  GLN A NE2 1 
ATOM   1954 N N   A TYR A 1 172 ? 27.157  1.125   -26.791 0.85 9.45  ? 165  TYR A N   1 
ATOM   1955 N N   B TYR A 1 172 ? 27.049  1.321   -26.752 0.15 10.44 ? 165  TYR A N   1 
ATOM   1956 C CA  A TYR A 1 172 ? 27.652  1.057   -25.417 0.85 9.00  ? 165  TYR A CA  1 
ATOM   1957 C CA  B TYR A 1 172 ? 27.595  1.108   -25.416 0.15 9.35  ? 165  TYR A CA  1 
ATOM   1958 C C   A TYR A 1 172 ? 26.687  0.167   -24.659 0.85 9.57  ? 165  TYR A C   1 
ATOM   1959 C C   B TYR A 1 172 ? 26.675  0.156   -24.665 0.15 9.77  ? 165  TYR A C   1 
ATOM   1960 O O   A TYR A 1 172 ? 25.517  0.067   -25.016 0.85 10.51 ? 165  TYR A O   1 
ATOM   1961 O O   B TYR A 1 172 ? 25.513  0.005   -25.038 0.15 10.40 ? 165  TYR A O   1 
ATOM   1962 C CB  A TYR A 1 172 ? 27.739  2.449   -24.757 0.85 10.74 ? 165  TYR A CB  1 
ATOM   1963 C CB  B TYR A 1 172 ? 27.736  2.436   -24.667 0.15 10.74 ? 165  TYR A CB  1 
ATOM   1964 C CG  A TYR A 1 172 ? 26.409  3.201   -24.673 0.85 9.47  ? 165  TYR A CG  1 
ATOM   1965 C CG  B TYR A 1 172 ? 26.464  3.264   -24.629 0.15 9.69  ? 165  TYR A CG  1 
ATOM   1966 C CD1 A TYR A 1 172 ? 25.579  3.095   -23.547 0.85 9.13  ? 165  TYR A CD1 1 
ATOM   1967 C CD1 B TYR A 1 172 ? 25.583  3.178   -23.555 0.15 9.33  ? 165  TYR A CD1 1 
ATOM   1968 C CD2 A TYR A 1 172 ? 26.011  4.047   -25.694 0.85 9.41  ? 165  TYR A CD2 1 
ATOM   1969 C CD2 B TYR A 1 172 ? 26.148  4.134   -25.665 0.15 9.36  ? 165  TYR A CD2 1 
ATOM   1970 C CE1 A TYR A 1 172 ? 24.384  3.776   -23.479 0.85 12.68 ? 165  TYR A CE1 1 
ATOM   1971 C CE1 B TYR A 1 172 ? 24.425  3.932   -23.520 0.15 12.35 ? 165  TYR A CE1 1 
ATOM   1972 C CE2 A TYR A 1 172 ? 24.808  4.737   -25.639 0.85 12.16 ? 165  TYR A CE2 1 
ATOM   1973 C CE2 B TYR A 1 172 ? 24.991  4.889   -25.640 0.15 11.69 ? 165  TYR A CE2 1 
ATOM   1974 C CZ  A TYR A 1 172 ? 24.006  4.609   -24.525 0.85 13.41 ? 165  TYR A CZ  1 
ATOM   1975 C CZ  B TYR A 1 172 ? 24.136  4.787   -24.565 0.15 12.49 ? 165  TYR A CZ  1 
ATOM   1976 O OH  A TYR A 1 172 ? 22.812  5.293   -24.463 0.85 11.72 ? 165  TYR A OH  1 
ATOM   1977 O OH  B TYR A 1 172 ? 22.986  5.541   -24.542 0.15 11.18 ? 165  TYR A OH  1 
ATOM   1978 N N   . ARG A 1 173 ? 27.181  -0.489  -23.617 1.00 10.07 ? 166  ARG A N   1 
ATOM   1979 C CA  . ARG A 1 173 ? 26.359  -1.441  -22.901 1.00 9.44  ? 166  ARG A CA  1 
ATOM   1980 C C   . ARG A 1 173 ? 25.169  -0.773  -22.199 1.00 11.52 ? 166  ARG A C   1 
ATOM   1981 O O   . ARG A 1 173 ? 25.289  0.302   -21.601 1.00 11.25 ? 166  ARG A O   1 
ATOM   1982 C CB  . ARG A 1 173 ? 27.190  -2.219  -21.892 1.00 10.16 ? 166  ARG A CB  1 
ATOM   1983 C CG  . ARG A 1 173 ? 27.983  -3.318  -22.547 1.00 10.70 ? 166  ARG A CG  1 
ATOM   1984 C CD  . ARG A 1 173 ? 28.912  -3.976  -21.516 1.00 9.92  ? 166  ARG A CD  1 
ATOM   1985 N NE  . ARG A 1 173 ? 30.096  -3.155  -21.309 1.00 14.08 ? 166  ARG A NE  1 
ATOM   1986 C CZ  . ARG A 1 173 ? 31.037  -3.429  -20.415 1.00 9.75  ? 166  ARG A CZ  1 
ATOM   1987 N NH1 . ARG A 1 173 ? 30.875  -4.465  -19.594 1.00 9.94  ? 166  ARG A NH1 1 
ATOM   1988 N NH2 . ARG A 1 173 ? 32.095  -2.638  -20.300 1.00 10.08 ? 166  ARG A NH2 1 
ATOM   1989 N N   . LEU A 1 174 ? 24.038  -1.464  -22.268 1.00 11.02 ? 167  LEU A N   1 
ATOM   1990 C CA  . LEU A 1 174 ? 22.775  -1.002  -21.725 1.00 11.21 ? 167  LEU A CA  1 
ATOM   1991 C C   . LEU A 1 174 ? 22.314  -1.820  -20.520 1.00 14.60 ? 167  LEU A C   1 
ATOM   1992 O O   . LEU A 1 174 ? 22.745  -2.955  -20.294 1.00 11.42 ? 167  LEU A O   1 
ATOM   1993 C CB  . LEU A 1 174 ? 21.680  -1.060  -22.784 1.00 9.88  ? 167  LEU A CB  1 
ATOM   1994 C CG  . LEU A 1 174 ? 22.012  -0.305  -24.072 1.00 9.55  ? 167  LEU A CG  1 
ATOM   1995 C CD1 . LEU A 1 174 ? 20.923  -0.529  -25.115 1.00 11.27 ? 167  LEU A CD1 1 
ATOM   1996 C CD2 . LEU A 1 174 ? 22.157  1.143   -23.771 1.00 11.12 ? 167  LEU A CD2 1 
ATOM   1997 N N   . GLY A 1 175 ? 21.402  -1.237  -19.759 1.00 11.90 ? 168  GLY A N   1 
ATOM   1998 C CA  . GLY A 1 175 ? 20.741  -2.007  -18.718 1.00 11.93 ? 168  GLY A CA  1 
ATOM   1999 C C   . GLY A 1 175 ? 21.674  -2.500  -17.623 1.00 9.43  ? 168  GLY A C   1 
ATOM   2000 O O   . GLY A 1 175 ? 22.722  -1.907  -17.359 1.00 11.00 ? 168  GLY A O   1 
ATOM   2001 N N   . ALA A 1 176 ? 21.274  -3.575  -16.961 1.00 10.39 ? 169  ALA A N   1 
ATOM   2002 C CA  . ALA A 1 176 ? 22.087  -4.106  -15.884 1.00 10.39 ? 169  ALA A CA  1 
ATOM   2003 C C   . ALA A 1 176 ? 23.462  -4.523  -16.388 1.00 10.59 ? 169  ALA A C   1 
ATOM   2004 O O   . ALA A 1 176 ? 24.442  -4.416  -15.666 1.00 10.13 ? 169  ALA A O   1 
ATOM   2005 C CB  . ALA A 1 176 ? 21.395  -5.270  -15.221 1.00 15.27 ? 169  ALA A CB  1 
ATOM   2006 N N   . LEU A 1 177 ? 23.555  -4.932  -17.652 1.00 13.24 ? 170  LEU A N   1 
ATOM   2007 C CA  . LEU A 1 177 ? 24.854  -5.352  -18.178 1.00 11.18 ? 170  LEU A CA  1 
ATOM   2008 C C   . LEU A 1 177 ? 25.828  -4.172  -18.331 1.00 9.43  ? 170  LEU A C   1 
ATOM   2009 O O   . LEU A 1 177 ? 27.046  -4.346  -18.230 1.00 15.18 ? 170  LEU A O   1 
ATOM   2010 C CB  . LEU A 1 177 ? 24.672  -6.073  -19.519 1.00 12.37 ? 170  LEU A CB  1 
ATOM   2011 C CG  . LEU A 1 177 ? 23.989  -7.437  -19.371 1.00 11.72 ? 170  LEU A CG  1 
ATOM   2012 C CD1 . LEU A 1 177 ? 23.686  -8.032  -20.729 1.00 13.99 ? 170  LEU A CD1 1 
ATOM   2013 C CD2 . LEU A 1 177 ? 24.897  -8.390  -18.605 1.00 21.22 ? 170  LEU A CD2 1 
ATOM   2014 N N   . GLY A 1 178 ? 25.291  -2.970  -18.517 1.00 11.33 ? 171  GLY A N   1 
ATOM   2015 C CA  . GLY A 1 178 ? 26.098  -1.766  -18.571 1.00 10.97 ? 171  GLY A CA  1 
ATOM   2016 C C   . GLY A 1 178 ? 26.197  -0.981  -17.262 1.00 9.37  ? 171  GLY A C   1 
ATOM   2017 O O   . GLY A 1 178 ? 27.087  -0.157  -17.105 1.00 9.66  ? 171  GLY A O   1 
ATOM   2018 N N   . PHE A 1 179 ? 25.267  -1.199  -16.330 1.00 9.02  ? 172  PHE A N   1 
ATOM   2019 C CA  . PHE A 1 179 ? 25.220  -0.301  -15.182 1.00 10.48 ? 172  PHE A CA  1 
ATOM   2020 C C   . PHE A 1 179 ? 25.038  -0.954  -13.806 1.00 12.61 ? 172  PHE A C   1 
ATOM   2021 O O   . PHE A 1 179 ? 24.707  -0.274  -12.828 1.00 11.97 ? 172  PHE A O   1 
ATOM   2022 C CB  . PHE A 1 179 ? 24.136  0.750   -15.448 1.00 10.30 ? 172  PHE A CB  1 
ATOM   2023 C CG  . PHE A 1 179 ? 24.517  1.669   -16.567 1.00 8.82  ? 172  PHE A CG  1 
ATOM   2024 C CD1 . PHE A 1 179 ? 25.362  2.744   -16.330 1.00 10.05 ? 172  PHE A CD1 1 
ATOM   2025 C CD2 . PHE A 1 179 ? 24.119  1.399   -17.868 1.00 11.99 ? 172  PHE A CD2 1 
ATOM   2026 C CE1 . PHE A 1 179 ? 25.753  3.567   -17.357 1.00 10.89 ? 172  PHE A CE1 1 
ATOM   2027 C CE2 . PHE A 1 179 ? 24.524  2.230   -18.917 1.00 12.14 ? 172  PHE A CE2 1 
ATOM   2028 C CZ  . PHE A 1 179 ? 25.343  3.308   -18.654 1.00 10.15 ? 172  PHE A CZ  1 
ATOM   2029 N N   . LEU A 1 180 ? 25.361  -2.230  -13.711 1.00 8.26  ? 173  LEU A N   1 
ATOM   2030 C CA  . LEU A 1 180 ? 25.387  -2.885  -12.401 1.00 10.40 ? 173  LEU A CA  1 
ATOM   2031 C C   . LEU A 1 180 ? 26.440  -2.224  -11.549 1.00 13.68 ? 173  LEU A C   1 
ATOM   2032 O O   . LEU A 1 180 ? 27.500  -1.853  -12.047 1.00 13.55 ? 173  LEU A O   1 
ATOM   2033 C CB  . LEU A 1 180 ? 25.683  -4.380  -12.524 1.00 14.48 ? 173  LEU A CB  1 
ATOM   2034 C CG  . LEU A 1 180 ? 25.228  -5.239  -11.339 1.00 10.86 ? 173  LEU A CG  1 
ATOM   2035 C CD1 . LEU A 1 180 ? 23.784  -5.605  -11.599 1.00 13.51 ? 173  LEU A CD1 1 
ATOM   2036 C CD2 . LEU A 1 180 ? 26.127  -6.472  -11.176 1.00 12.13 ? 173  LEU A CD2 1 
ATOM   2037 N N   . SER A 1 181 ? 26.150  -2.057  -10.266 1.00 11.23 ? 174  SER A N   1 
ATOM   2038 C CA  . SER A 1 181 ? 27.103  -1.407  -9.365  1.00 11.99 ? 174  SER A CA  1 
ATOM   2039 C C   . SER A 1 181 ? 27.125  -2.112  -8.023  1.00 13.43 ? 174  SER A C   1 
ATOM   2040 O O   . SER A 1 181 ? 26.078  -2.351  -7.439  1.00 12.39 ? 174  SER A O   1 
ATOM   2041 C CB  . SER A 1 181 ? 26.756  0.079   -9.157  1.00 11.63 ? 174  SER A CB  1 
ATOM   2042 O OG  . SER A 1 181 ? 27.669  0.689   -8.232  1.00 12.06 ? 174  SER A OG  1 
ATOM   2043 N N   . LEU A 1 182 ? 28.315  -2.410  -7.525  1.00 11.38 ? 175  LEU A N   1 
ATOM   2044 C CA  . LEU A 1 182 ? 28.392  -3.078  -6.226  1.00 13.33 ? 175  LEU A CA  1 
ATOM   2045 C C   . LEU A 1 182 ? 29.354  -2.351  -5.329  1.00 13.06 ? 175  LEU A C   1 
ATOM   2046 O O   . LEU A 1 182 ? 30.463  -1.987  -5.739  1.00 14.87 ? 175  LEU A O   1 
ATOM   2047 C CB  . LEU A 1 182 ? 28.817  -4.531  -6.386  1.00 10.48 ? 175  LEU A CB  1 
ATOM   2048 C CG  . LEU A 1 182 ? 27.884  -5.432  -7.199  1.00 15.78 ? 175  LEU A CG  1 
ATOM   2049 C CD1 . LEU A 1 182 ? 28.596  -6.740  -7.507  1.00 19.40 ? 175  LEU A CD1 1 
ATOM   2050 C CD2 . LEU A 1 182 ? 26.606  -5.708  -6.430  1.00 16.81 ? 175  LEU A CD2 1 
ATOM   2051 N N   . ASN A 1 183 ? 28.950  -2.190  -4.074  1.00 11.17 ? 176  ASN A N   1 
ATOM   2052 C CA  . ASN A 1 183 ? 29.798  -1.487  -3.129  1.00 12.58 ? 176  ASN A CA  1 
ATOM   2053 C C   . ASN A 1 183 ? 31.195  -2.094  -2.882  1.00 12.86 ? 176  ASN A C   1 
ATOM   2054 O O   . ASN A 1 183 ? 32.147  -1.349  -2.707  1.00 13.49 ? 176  ASN A O   1 
ATOM   2055 C CB  . ASN A 1 183 ? 29.058  -1.375  -1.799  1.00 10.51 ? 176  ASN A CB  1 
ATOM   2056 C CG  . ASN A 1 183 ? 27.970  -0.335  -1.841  1.00 14.26 ? 176  ASN A CG  1 
ATOM   2057 O OD1 . ASN A 1 183 ? 28.184  0.783   -2.309  1.00 19.99 ? 176  ASN A OD1 1 
ATOM   2058 N ND2 . ASN A 1 183 ? 26.795  -0.692  -1.348  1.00 18.96 ? 176  ASN A ND2 1 
ATOM   2059 N N   . SER A 1 184 ? 31.314  -3.420  -2.861  1.00 12.46 ? 177  SER A N   1 
ATOM   2060 C CA  . SER A 1 184 ? 32.542  -4.067  -2.401  1.00 11.66 ? 177  SER A CA  1 
ATOM   2061 C C   . SER A 1 184 ? 33.725  -3.877  -3.346  1.00 15.86 ? 177  SER A C   1 
ATOM   2062 O O   . SER A 1 184 ? 33.707  -4.350  -4.480  1.00 14.47 ? 177  SER A O   1 
ATOM   2063 C CB  . SER A 1 184 ? 32.295  -5.565  -2.189  1.00 14.86 ? 177  SER A CB  1 
ATOM   2064 O OG  . SER A 1 184 ? 33.475  -6.176  -1.687  1.00 23.76 ? 177  SER A OG  1 
ATOM   2065 N N   . GLU A 1 185 ? 34.762  -3.216  -2.852  1.00 14.42 ? 178  GLU A N   1 
ATOM   2066 C CA  . GLU A 1 185 ? 35.861  -2.784  -3.714  1.00 15.07 ? 178  GLU A CA  1 
ATOM   2067 C C   . GLU A 1 185 ? 36.592  -3.983  -4.327  1.00 17.57 ? 178  GLU A C   1 
ATOM   2068 O O   . GLU A 1 185 ? 37.119  -3.904  -5.441  1.00 20.59 ? 178  GLU A O   1 
ATOM   2069 C CB  . GLU A 1 185 ? 36.825  -1.875  -2.929  1.00 16.22 ? 178  GLU A CB  1 
ATOM   2070 C CG  . GLU A 1 185 ? 37.937  -1.286  -3.768  1.00 16.54 ? 178  GLU A CG  1 
ATOM   2071 C CD  . GLU A 1 185 ? 38.632  -0.099  -3.109  1.00 17.10 ? 178  GLU A CD  1 
ATOM   2072 O OE1 . GLU A 1 185 ? 38.142  0.402   -2.070  1.00 21.76 ? 178  GLU A OE1 1 
ATOM   2073 O OE2 . GLU A 1 185 ? 39.671  0.336   -3.657  1.00 23.27 ? 178  GLU A OE2 1 
ATOM   2074 N N   . ASP A 1 186 ? 36.581  -5.107  -3.627  1.00 17.91 ? 179  ASP A N   1 
ATOM   2075 C CA  . ASP A 1 186 ? 37.313  -6.282  -4.079  1.00 19.00 ? 179  ASP A CA  1 
ATOM   2076 C C   . ASP A 1 186 ? 36.769  -6.871  -5.382  1.00 18.18 ? 179  ASP A C   1 
ATOM   2077 O O   . ASP A 1 186 ? 37.467  -7.604  -6.079  1.00 19.31 ? 179  ASP A O   1 
ATOM   2078 C CB  . ASP A 1 186 ? 37.296  -7.347  -2.985  1.00 29.34 ? 179  ASP A CB  1 
ATOM   2079 C CG  . ASP A 1 186 ? 37.768  -6.808  -1.642  1.00 58.11 ? 179  ASP A CG  1 
ATOM   2080 O OD1 . ASP A 1 186 ? 38.884  -6.244  -1.577  1.00 46.32 ? 179  ASP A OD1 1 
ATOM   2081 O OD2 . ASP A 1 186 ? 37.017  -6.945  -0.654  1.00 60.15 ? 179  ASP A OD2 1 
ATOM   2082 N N   A LEU A 1 187 ? 35.531  -6.535  -5.722  0.63 14.87 ? 180  LEU A N   1 
ATOM   2083 N N   B LEU A 1 187 ? 35.523  -6.548  -5.715  0.37 14.96 ? 180  LEU A N   1 
ATOM   2084 C CA  A LEU A 1 187 ? 34.899  -7.151  -6.888  0.63 13.91 ? 180  LEU A CA  1 
ATOM   2085 C CA  B LEU A 1 187 ? 34.839  -7.224  -6.822  0.37 14.00 ? 180  LEU A CA  1 
ATOM   2086 C C   A LEU A 1 187 ? 35.090  -6.367  -8.188  0.63 13.16 ? 180  LEU A C   1 
ATOM   2087 C C   B LEU A 1 187 ? 35.028  -6.569  -8.190  0.37 14.29 ? 180  LEU A C   1 
ATOM   2088 O O   A LEU A 1 187 ? 34.816  -6.892  -9.262  0.63 14.93 ? 180  LEU A O   1 
ATOM   2089 O O   B LEU A 1 187 ? 34.694  -7.170  -9.211  0.37 15.06 ? 180  LEU A O   1 
ATOM   2090 C CB  A LEU A 1 187 ? 33.402  -7.358  -6.635  0.63 14.95 ? 180  LEU A CB  1 
ATOM   2091 C CB  B LEU A 1 187 ? 33.343  -7.327  -6.528  0.37 15.04 ? 180  LEU A CB  1 
ATOM   2092 C CG  A LEU A 1 187 ? 33.083  -8.165  -5.377  0.63 15.10 ? 180  LEU A CG  1 
ATOM   2093 C CG  B LEU A 1 187 ? 32.989  -7.964  -5.186  0.37 13.55 ? 180  LEU A CG  1 
ATOM   2094 C CD1 A LEU A 1 187 ? 31.594  -8.239  -5.140  0.63 12.43 ? 180  LEU A CD1 1 
ATOM   2095 C CD1 B LEU A 1 187 ? 31.492  -8.025  -5.005  0.37 13.86 ? 180  LEU A CD1 1 
ATOM   2096 C CD2 A LEU A 1 187 ? 33.657  -9.562  -5.488  0.63 17.72 ? 180  LEU A CD2 1 
ATOM   2097 C CD2 B LEU A 1 187 ? 33.590  -9.355  -5.080  0.37 16.46 ? 180  LEU A CD2 1 
ATOM   2098 N N   A ASN A 1 188 ? 35.559  -5.127  -8.090  0.63 15.62 ? 181  ASN A N   1 
ATOM   2099 N N   B ASN A 1 188 ? 35.547  -5.346  -8.204  0.37 15.24 ? 181  ASN A N   1 
ATOM   2100 C CA  A ASN A 1 188 ? 35.804  -4.286  -9.270  0.63 14.00 ? 181  ASN A CA  1 
ATOM   2101 C CA  B ASN A 1 188 ? 35.819  -4.613  -9.445  0.37 15.67 ? 181  ASN A CA  1 
ATOM   2102 C C   A ASN A 1 188 ? 34.594  -4.185  -10.207 0.63 13.60 ? 181  ASN A C   1 
ATOM   2103 C C   B ASN A 1 188 ? 34.581  -4.398  -10.313 0.37 14.10 ? 181  ASN A C   1 
ATOM   2104 O O   A ASN A 1 188 ? 34.731  -4.193  -11.441 0.63 15.03 ? 181  ASN A O   1 
ATOM   2105 O O   B ASN A 1 188 ? 34.644  -4.474  -11.546 0.37 13.78 ? 181  ASN A O   1 
ATOM   2106 C CB  A ASN A 1 188 ? 37.018  -4.796  -10.052 0.63 13.20 ? 181  ASN A CB  1 
ATOM   2107 C CB  B ASN A 1 188 ? 36.895  -5.329  -10.269 0.37 11.21 ? 181  ASN A CB  1 
ATOM   2108 C CG  A ASN A 1 188 ? 37.522  -3.783  -11.060 0.63 15.54 ? 181  ASN A CG  1 
ATOM   2109 C CG  B ASN A 1 188 ? 37.594  -4.400  -11.233 0.37 16.16 ? 181  ASN A CG  1 
ATOM   2110 O OD1 A ASN A 1 188 ? 37.310  -2.582  -10.903 0.63 21.05 ? 181  ASN A OD1 1 
ATOM   2111 O OD1 B ASN A 1 188 ? 38.009  -3.305  -10.855 0.37 17.50 ? 181  ASN A OD1 1 
ATOM   2112 N ND2 A ASN A 1 188 ? 38.175  -4.262  -12.113 0.63 16.34 ? 181  ASN A ND2 1 
ATOM   2113 N ND2 B ASN A 1 188 ? 37.734  -4.831  -12.486 0.37 13.00 ? 181  ASN A ND2 1 
ATOM   2114 N N   A VAL A 1 189 ? 33.411  -4.091  -9.614  0.63 11.71 ? 182  VAL A N   1 
ATOM   2115 N N   B VAL A 1 189 ? 33.452  -4.140  -9.665  0.37 11.60 ? 182  VAL A N   1 
ATOM   2116 C CA  A VAL A 1 189 ? 32.189  -3.714  -10.330 0.63 12.78 ? 182  VAL A CA  1 
ATOM   2117 C CA  B VAL A 1 189 ? 32.245  -3.701  -10.363 0.37 13.02 ? 182  VAL A CA  1 
ATOM   2118 C C   A VAL A 1 189 ? 31.638  -2.400  -9.739  0.63 11.37 ? 182  VAL A C   1 
ATOM   2119 C C   B VAL A 1 189 ? 31.701  -2.432  -9.695  0.37 11.46 ? 182  VAL A C   1 
ATOM   2120 O O   A VAL A 1 189 ? 30.554  -2.378  -9.151  0.63 11.18 ? 182  VAL A O   1 
ATOM   2121 O O   B VAL A 1 189 ? 30.685  -2.480  -9.002  0.37 11.57 ? 182  VAL A O   1 
ATOM   2122 C CB  A VAL A 1 189 ? 31.129  -4.849  -10.263 0.63 10.90 ? 182  VAL A CB  1 
ATOM   2123 C CB  B VAL A 1 189 ? 31.158  -4.805  -10.378 0.37 10.87 ? 182  VAL A CB  1 
ATOM   2124 C CG1 A VAL A 1 189 ? 29.896  -4.537  -11.110 0.63 11.14 ? 182  VAL A CG1 1 
ATOM   2125 C CG1 B VAL A 1 189 ? 29.959  -4.387  -11.225 0.37 11.94 ? 182  VAL A CG1 1 
ATOM   2126 C CG2 A VAL A 1 189 ? 31.744  -6.158  -10.721 0.63 17.15 ? 182  VAL A CG2 1 
ATOM   2127 C CG2 B VAL A 1 189 ? 31.733  -6.110  -10.904 0.37 16.92 ? 182  VAL A CG2 1 
ATOM   2128 N N   . PRO A 1 190 ? 32.390  -1.289  -9.886  1.00 11.73 ? 183  PRO A N   1 
ATOM   2129 C CA  . PRO A 1 190 ? 31.966  -0.022  -9.274  1.00 13.28 ? 183  PRO A CA  1 
ATOM   2130 C C   . PRO A 1 190 ? 30.743  0.615   -9.914  1.00 10.75 ? 183  PRO A C   1 
ATOM   2131 O O   . PRO A 1 190 ? 30.071  1.437   -9.282  1.00 11.56 ? 183  PRO A O   1 
ATOM   2132 C CB  . PRO A 1 190 ? 33.194  0.876   -9.462  1.00 14.92 ? 183  PRO A CB  1 
ATOM   2133 C CG  . PRO A 1 190 ? 33.801  0.380   -10.725 1.00 15.51 ? 183  PRO A CG  1 
ATOM   2134 C CD  . PRO A 1 190 ? 33.631  -1.118  -10.665 1.00 12.10 ? 183  PRO A CD  1 
ATOM   2135 N N   . GLY A 1 191 ? 30.451  0.223   -11.147 1.00 10.09 ? 184  GLY A N   1 
ATOM   2136 C CA  . GLY A 1 191 ? 29.359  0.792   -11.892 1.00 10.48 ? 184  GLY A CA  1 
ATOM   2137 C C   . GLY A 1 191 ? 29.836  1.515   -13.132 1.00 13.08 ? 184  GLY A C   1 
ATOM   2138 O O   . GLY A 1 191 ? 31.043  1.591   -13.408 1.00 12.95 ? 184  GLY A O   1 
ATOM   2139 N N   A ASN A 1 192 ? 28.870  2.074   -13.855 0.66 10.66 ? 185  ASN A N   1 
ATOM   2140 N N   B ASN A 1 192 ? 28.864  2.031   -13.880 0.34 10.85 ? 185  ASN A N   1 
ATOM   2141 C CA  A ASN A 1 192 ? 29.092  2.881   -15.054 0.66 11.93 ? 185  ASN A CA  1 
ATOM   2142 C CA  B ASN A 1 192 ? 29.087  2.846   -15.072 0.34 11.92 ? 185  ASN A CA  1 
ATOM   2143 C C   A ASN A 1 192 ? 29.910  2.243   -16.165 0.66 12.40 ? 185  ASN A C   1 
ATOM   2144 C C   B ASN A 1 192 ? 29.894  2.183   -16.181 0.34 12.23 ? 185  ASN A C   1 
ATOM   2145 O O   A ASN A 1 192 ? 30.529  2.971   -16.951 0.66 9.64  ? 185  ASN A O   1 
ATOM   2146 O O   B ASN A 1 192 ? 30.554  2.879   -16.955 0.34 9.85  ? 185  ASN A O   1 
ATOM   2147 C CB  A ASN A 1 192 ? 29.743  4.206   -14.668 0.66 9.77  ? 185  ASN A CB  1 
ATOM   2148 C CB  B ASN A 1 192 ? 29.762  4.158   -14.676 0.34 9.90  ? 185  ASN A CB  1 
ATOM   2149 C CG  A ASN A 1 192 ? 28.885  5.000   -13.723 0.66 10.98 ? 185  ASN A CG  1 
ATOM   2150 C CG  B ASN A 1 192 ? 28.920  4.965   -13.717 0.34 10.95 ? 185  ASN A CG  1 
ATOM   2151 O OD1 A ASN A 1 192 ? 27.657  4.892   -13.749 0.66 11.29 ? 185  ASN A OD1 1 
ATOM   2152 O OD1 B ASN A 1 192 ? 27.695  5.008   -13.837 0.34 11.27 ? 185  ASN A OD1 1 
ATOM   2153 N ND2 A ASN A 1 192 ? 29.516  5.797   -12.880 0.66 11.60 ? 185  ASN A ND2 1 
ATOM   2154 N ND2 B ASN A 1 192 ? 29.566  5.594   -12.749 0.34 10.88 ? 185  ASN A ND2 1 
ATOM   2155 N N   A ALA A 1 193 ? 29.891  0.916   -16.259 0.66 9.24  ? 186  ALA A N   1 
ATOM   2156 N N   B ALA A 1 193 ? 29.817  0.857   -16.281 0.34 9.29  ? 186  ALA A N   1 
ATOM   2157 C CA  A ALA A 1 193 ? 30.632  0.266   -17.335 0.66 10.39 ? 186  ALA A CA  1 
ATOM   2158 C CA  B ALA A 1 193 ? 30.546  0.144   -17.328 0.34 10.34 ? 186  ALA A CA  1 
ATOM   2159 C C   A ALA A 1 193 ? 30.233  0.860   -18.685 0.66 10.27 ? 186  ALA A C   1 
ATOM   2160 C C   B ALA A 1 193 ? 30.186  0.671   -18.717 0.34 10.78 ? 186  ALA A C   1 
ATOM   2161 O O   A ALA A 1 193 ? 31.096  1.141   -19.508 0.66 10.68 ? 186  ALA A O   1 
ATOM   2162 O O   B ALA A 1 193 ? 31.027  0.697   -19.604 0.34 10.91 ? 186  ALA A O   1 
ATOM   2163 C CB  A ALA A 1 193 ? 30.409  -1.238  -17.315 0.66 11.69 ? 186  ALA A CB  1 
ATOM   2164 C CB  B ALA A 1 193 ? 30.280  -1.351  -17.242 0.34 12.02 ? 186  ALA A CB  1 
ATOM   2165 N N   . GLY A 1 194 ? 28.938  1.095   -18.896 1.00 8.91  ? 187  GLY A N   1 
ATOM   2166 C CA  . GLY A 1 194 ? 28.490  1.656   -20.172 1.00 8.58  ? 187  GLY A CA  1 
ATOM   2167 C C   . GLY A 1 194 ? 29.035  3.043   -20.484 1.00 10.97 ? 187  GLY A C   1 
ATOM   2168 O O   . GLY A 1 194 ? 29.206  3.412   -21.667 1.00 11.58 ? 187  GLY A O   1 
ATOM   2169 N N   A LEU A 1 195 ? 29.295  3.827   -19.446 0.47 10.15 ? 188  LEU A N   1 
ATOM   2170 N N   B LEU A 1 195 ? 29.270  3.843   -19.451 0.53 10.13 ? 188  LEU A N   1 
ATOM   2171 C CA  A LEU A 1 195 ? 29.913  5.136   -19.633 0.47 12.43 ? 188  LEU A CA  1 
ATOM   2172 C CA  B LEU A 1 195 ? 29.841  5.173   -19.655 0.53 12.42 ? 188  LEU A CA  1 
ATOM   2173 C C   A LEU A 1 195 ? 31.386  4.954   -19.968 0.47 9.73  ? 188  LEU A C   1 
ATOM   2174 C C   B LEU A 1 195 ? 31.326  5.040   -19.951 0.53 9.75  ? 188  LEU A C   1 
ATOM   2175 O O   A LEU A 1 195 ? 31.930  5.654   -20.815 0.47 11.16 ? 188  LEU A O   1 
ATOM   2176 O O   B LEU A 1 195 ? 31.885  5.816   -20.718 0.53 11.60 ? 188  LEU A O   1 
ATOM   2177 C CB  A LEU A 1 195 ? 29.755  6.011   -18.389 0.47 13.85 ? 188  LEU A CB  1 
ATOM   2178 C CB  B LEU A 1 195 ? 29.612  6.077   -18.439 0.53 14.03 ? 188  LEU A CB  1 
ATOM   2179 C CG  A LEU A 1 195 ? 28.320  6.346   -17.976 0.47 11.23 ? 188  LEU A CG  1 
ATOM   2180 C CG  B LEU A 1 195 ? 28.200  6.664   -18.310 0.53 7.66  ? 188  LEU A CG  1 
ATOM   2181 C CD1 A LEU A 1 195 ? 28.331  7.425   -16.903 0.47 9.65  ? 188  LEU A CD1 1 
ATOM   2182 C CD1 B LEU A 1 195 ? 28.029  7.431   -16.999 0.53 9.72  ? 188  LEU A CD1 1 
ATOM   2183 C CD2 A LEU A 1 195 ? 27.521  6.789   -19.180 0.47 11.22 ? 188  LEU A CD2 1 
ATOM   2184 C CD2 B LEU A 1 195 ? 27.886  7.554   -19.504 0.53 9.73  ? 188  LEU A CD2 1 
ATOM   2185 N N   A LYS A 1 196 ? 32.009  3.980   -19.317 0.47 10.42 ? 189  LYS A N   1 
ATOM   2186 N N   B LYS A 1 196 ? 31.945  4.026   -19.359 0.53 10.30 ? 189  LYS A N   1 
ATOM   2187 C CA  A LYS A 1 196 ? 33.400  3.641   -19.585 0.47 8.50  ? 189  LYS A CA  1 
ATOM   2188 C CA  B LYS A 1 196 ? 33.347  3.731   -19.617 0.53 8.53  ? 189  LYS A CA  1 
ATOM   2189 C C   A LYS A 1 196 ? 33.558  3.142   -21.024 0.47 9.62  ? 189  LYS A C   1 
ATOM   2190 C C   B LYS A 1 196 ? 33.506  3.248   -21.058 0.53 9.54  ? 189  LYS A C   1 
ATOM   2191 O O   A LYS A 1 196 ? 34.603  3.337   -21.654 0.47 10.68 ? 189  LYS A O   1 
ATOM   2192 O O   B LYS A 1 196 ? 34.498  3.557   -21.725 0.53 9.93  ? 189  LYS A O   1 
ATOM   2193 C CB  A LYS A 1 196 ? 33.898  2.610   -18.558 0.47 10.07 ? 189  LYS A CB  1 
ATOM   2194 C CB  B LYS A 1 196 ? 33.869  2.711   -18.596 0.53 10.27 ? 189  LYS A CB  1 
ATOM   2195 C CG  A LYS A 1 196 ? 34.100  3.244   -17.200 0.47 13.42 ? 189  LYS A CG  1 
ATOM   2196 C CG  B LYS A 1 196 ? 33.672  3.220   -17.185 0.53 10.91 ? 189  LYS A CG  1 
ATOM   2197 C CD  A LYS A 1 196 ? 34.016  2.293   -16.027 0.47 11.73 ? 189  LYS A CD  1 
ATOM   2198 C CD  B LYS A 1 196 ? 34.237  2.321   -16.113 0.53 11.53 ? 189  LYS A CD  1 
ATOM   2199 C CE  A LYS A 1 196 ? 33.890  3.129   -14.766 0.47 10.41 ? 189  LYS A CE  1 
ATOM   2200 C CE  B LYS A 1 196 ? 34.018  3.006   -14.784 0.53 10.26 ? 189  LYS A CE  1 
ATOM   2201 N NZ  A LYS A 1 196 ? 33.774  2.345   -13.506 0.47 7.74  ? 189  LYS A NZ  1 
ATOM   2202 N NZ  B LYS A 1 196 ? 34.515  2.220   -13.628 0.53 11.30 ? 189  LYS A NZ  1 
ATOM   2203 N N   . ASP A 1 197 ? 32.507  2.522   -21.547 1.00 10.02 ? 190  ASP A N   1 
ATOM   2204 C CA  . ASP A 1 197 ? 32.444  2.144   -22.953 1.00 11.38 ? 190  ASP A CA  1 
ATOM   2205 C C   . ASP A 1 197 ? 32.498  3.382   -23.828 1.00 10.46 ? 190  ASP A C   1 
ATOM   2206 O O   . ASP A 1 197 ? 33.297  3.451   -24.776 1.00 13.22 ? 190  ASP A O   1 
ATOM   2207 C CB  . ASP A 1 197 ? 31.148  1.369   -23.255 1.00 9.76  ? 190  ASP A CB  1 
ATOM   2208 C CG  . ASP A 1 197 ? 31.105  -0.010  -22.612 1.00 10.32 ? 190  ASP A CG  1 
ATOM   2209 O OD1 . ASP A 1 197 ? 32.174  -0.532  -22.209 1.00 11.25 ? 190  ASP A OD1 1 
ATOM   2210 O OD2 . ASP A 1 197 ? 29.991  -0.583  -22.529 1.00 10.30 ? 190  ASP A OD2 1 
ATOM   2211 N N   A GLN A 1 198 ? 31.632  4.354   -23.524 0.83 10.06 ? 191  GLN A N   1 
ATOM   2212 N N   B GLN A 1 198 ? 31.659  4.367   -23.510 0.17 10.14 ? 191  GLN A N   1 
ATOM   2213 C CA  A GLN A 1 198 ? 31.632  5.616   -24.248 0.83 8.50  ? 191  GLN A CA  1 
ATOM   2214 C CA  B GLN A 1 198 ? 31.638  5.625   -24.248 0.17 8.79  ? 191  GLN A CA  1 
ATOM   2215 C C   A GLN A 1 198 ? 33.008  6.291   -24.213 0.83 10.63 ? 191  GLN A C   1 
ATOM   2216 C C   B GLN A 1 198 ? 32.997  6.320   -24.210 0.17 10.89 ? 191  GLN A C   1 
ATOM   2217 O O   A GLN A 1 198 ? 33.477  6.785   -25.235 0.83 10.26 ? 191  GLN A O   1 
ATOM   2218 O O   B GLN A 1 198 ? 33.426  6.912   -25.200 0.17 10.68 ? 191  GLN A O   1 
ATOM   2219 C CB  A GLN A 1 198 ? 30.569  6.555   -23.689 0.83 10.76 ? 191  GLN A CB  1 
ATOM   2220 C CB  B GLN A 1 198 ? 30.559  6.554   -23.692 0.17 10.87 ? 191  GLN A CB  1 
ATOM   2221 C CG  A GLN A 1 198 ? 29.186  5.947   -23.740 0.83 9.15  ? 191  GLN A CG  1 
ATOM   2222 C CG  B GLN A 1 198 ? 29.159  5.973   -23.754 0.17 9.35  ? 191  GLN A CG  1 
ATOM   2223 C CD  A GLN A 1 198 ? 28.132  6.879   -23.185 0.83 10.76 ? 191  GLN A CD  1 
ATOM   2224 C CD  B GLN A 1 198 ? 28.122  6.900   -23.152 0.17 11.03 ? 191  GLN A CD  1 
ATOM   2225 O OE1 A GLN A 1 198 ? 28.416  8.034   -22.840 0.83 12.61 ? 191  GLN A OE1 1 
ATOM   2226 O OE1 B GLN A 1 198 ? 28.442  8.003   -22.705 0.17 12.45 ? 191  GLN A OE1 1 
ATOM   2227 N NE2 A GLN A 1 198 ? 26.898  6.379   -23.086 0.83 11.56 ? 191  GLN A NE2 1 
ATOM   2228 N NE2 B GLN A 1 198 ? 26.869  6.454   -23.135 0.17 11.56 ? 191  GLN A NE2 1 
ATOM   2229 N N   A VAL A 1 199 ? 33.660  6.295   -23.051 0.83 9.70  ? 192  VAL A N   1 
ATOM   2230 N N   B VAL A 1 199 ? 33.675  6.238   -23.068 0.17 10.07 ? 192  VAL A N   1 
ATOM   2231 C CA  A VAL A 1 199 ? 34.999  6.856   -22.935 0.83 9.66  ? 192  VAL A CA  1 
ATOM   2232 C CA  B VAL A 1 199 ? 34.995  6.840   -22.922 0.17 9.91  ? 192  VAL A CA  1 
ATOM   2233 C C   A VAL A 1 199 ? 35.989  6.172   -23.882 0.83 12.27 ? 192  VAL A C   1 
ATOM   2234 C C   B VAL A 1 199 ? 36.010  6.172   -23.848 0.17 12.41 ? 192  VAL A C   1 
ATOM   2235 O O   A VAL A 1 199 ? 36.736  6.850   -24.593 0.83 13.47 ? 192  VAL A O   1 
ATOM   2236 O O   B VAL A 1 199 ? 36.796  6.853   -24.508 0.17 13.48 ? 192  VAL A O   1 
ATOM   2237 C CB  A VAL A 1 199 ? 35.524  6.760   -21.490 0.83 12.20 ? 192  VAL A CB  1 
ATOM   2238 C CB  B VAL A 1 199 ? 35.496  6.758   -21.466 0.17 12.17 ? 192  VAL A CB  1 
ATOM   2239 C CG1 A VAL A 1 199 ? 37.021  7.010   -21.455 0.83 13.75 ? 192  VAL A CG1 1 
ATOM   2240 C CG1 B VAL A 1 199 ? 36.936  7.239   -21.369 0.17 13.04 ? 192  VAL A CG1 1 
ATOM   2241 C CG2 A VAL A 1 199 ? 34.817  7.777   -20.621 0.83 10.04 ? 192  VAL A CG2 1 
ATOM   2242 C CG2 B VAL A 1 199 ? 34.601  7.581   -20.555 0.17 10.98 ? 192  VAL A CG2 1 
ATOM   2243 N N   . MET A 1 200 ? 35.987  4.843   -23.903 1.00 11.37 ? 193  MET A N   1 
ATOM   2244 C CA  . MET A 1 200 ? 36.892  4.124   -24.783 1.00 11.61 ? 193  MET A CA  1 
ATOM   2245 C C   . MET A 1 200 ? 36.569  4.432   -26.247 1.00 12.57 ? 193  MET A C   1 
ATOM   2246 O O   . MET A 1 200 ? 37.474  4.572   -27.072 1.00 13.40 ? 193  MET A O   1 
ATOM   2247 C CB  . MET A 1 200 ? 36.825  2.626   -24.518 1.00 12.68 ? 193  MET A CB  1 
ATOM   2248 C CG  . MET A 1 200 ? 37.885  1.828   -25.291 1.00 12.81 ? 193  MET A CG  1 
ATOM   2249 S SD  . MET A 1 200 ? 38.185  0.177   -24.620 1.00 15.72 ? 193  MET A SD  1 
ATOM   2250 C CE  . MET A 1 200 ? 38.855  0.613   -23.033 1.00 15.35 ? 193  MET A CE  1 
ATOM   2251 N N   A ALA A 1 201 ? 35.284  4.512   -26.573 0.37 11.77 ? 194  ALA A N   1 
ATOM   2252 N N   B ALA A 1 201 ? 35.290  4.594   -26.567 0.63 11.87 ? 194  ALA A N   1 
ATOM   2253 C CA  A ALA A 1 201 ? 34.878  4.826   -27.941 0.37 11.38 ? 194  ALA A CA  1 
ATOM   2254 C CA  B ALA A 1 201 ? 34.900  4.997   -27.922 0.63 11.29 ? 194  ALA A CA  1 
ATOM   2255 C C   A ALA A 1 201 ? 35.353  6.219   -28.347 0.37 10.12 ? 194  ALA A C   1 
ATOM   2256 C C   B ALA A 1 201 ? 35.425  6.388   -28.302 0.63 9.54  ? 194  ALA A C   1 
ATOM   2257 O O   A ALA A 1 201 ? 35.820  6.421   -29.468 0.37 11.27 ? 194  ALA A O   1 
ATOM   2258 O O   B ALA A 1 201 ? 35.920  6.593   -29.410 0.63 11.18 ? 194  ALA A O   1 
ATOM   2259 C CB  A ALA A 1 201 ? 33.368  4.718   -28.085 0.37 13.75 ? 194  ALA A CB  1 
ATOM   2260 C CB  B ALA A 1 201 ? 33.380  4.961   -28.063 0.63 14.14 ? 194  ALA A CB  1 
ATOM   2261 N N   A LEU A 1 202 ? 35.224  7.182   -27.444 0.37 10.23 ? 195  LEU A N   1 
ATOM   2262 N N   B LEU A 1 202 ? 35.293  7.351   -27.405 0.63 10.37 ? 195  LEU A N   1 
ATOM   2263 C CA  A LEU A 1 202 ? 35.698  8.531   -27.720 0.37 11.11 ? 195  LEU A CA  1 
ATOM   2264 C CA  B LEU A 1 202 ? 35.759  8.701   -27.687 0.63 11.46 ? 195  LEU A CA  1 
ATOM   2265 C C   A LEU A 1 202 ? 37.206  8.554   -27.957 0.37 10.05 ? 195  LEU A C   1 
ATOM   2266 C C   B LEU A 1 202 ? 37.277  8.758   -27.816 0.63 8.41  ? 195  LEU A C   1 
ATOM   2267 O O   A LEU A 1 202 ? 37.657  9.161   -28.926 0.37 7.69  ? 195  LEU A O   1 
ATOM   2268 O O   B LEU A 1 202 ? 37.815  9.576   -28.577 0.63 11.84 ? 195  LEU A O   1 
ATOM   2269 C CB  A LEU A 1 202 ? 35.333  9.487   -26.586 0.37 12.01 ? 195  LEU A CB  1 
ATOM   2270 C CB  B LEU A 1 202 ? 35.299  9.669   -26.608 0.63 12.84 ? 195  LEU A CB  1 
ATOM   2271 C CG  A LEU A 1 202 ? 33.878  9.964   -26.532 0.37 12.65 ? 195  LEU A CG  1 
ATOM   2272 C CG  B LEU A 1 202 ? 33.798  9.962   -26.561 0.63 12.62 ? 195  LEU A CG  1 
ATOM   2273 C CD1 A LEU A 1 202 ? 33.715  11.012  -25.435 0.37 11.06 ? 195  LEU A CD1 1 
ATOM   2274 C CD1 B LEU A 1 202 ? 33.550  11.108  -25.579 0.63 11.59 ? 195  LEU A CD1 1 
ATOM   2275 C CD2 A LEU A 1 202 ? 33.429  10.530  -27.869 0.37 10.66 ? 195  LEU A CD2 1 
ATOM   2276 C CD2 B LEU A 1 202 ? 33.234  10.295  -27.939 0.63 11.95 ? 195  LEU A CD2 1 
ATOM   2277 N N   . ARG A 1 203 ? 37.971  7.891   -27.090 1.00 12.63 ? 196  ARG A N   1 
ATOM   2278 C CA  . ARG A 1 203 ? 39.426  7.765   -27.262 1.00 11.25 ? 196  ARG A CA  1 
ATOM   2279 C C   . ARG A 1 203 ? 39.778  7.148   -28.619 1.00 11.87 ? 196  ARG A C   1 
ATOM   2280 O O   . ARG A 1 203 ? 40.730  7.600   -29.281 1.00 16.33 ? 196  ARG A O   1 
ATOM   2281 C CB  . ARG A 1 203 ? 40.038  6.944   -26.118 1.00 10.75 ? 196  ARG A CB  1 
ATOM   2282 C CG  . ARG A 1 203 ? 40.029  7.709   -24.806 1.00 13.92 ? 196  ARG A CG  1 
ATOM   2283 C CD  . ARG A 1 203 ? 40.351  6.841   -23.593 1.00 12.63 ? 196  ARG A CD  1 
ATOM   2284 N NE  . ARG A 1 203 ? 40.500  7.678   -22.406 1.00 11.31 ? 196  ARG A NE  1 
ATOM   2285 C CZ  . ARG A 1 203 ? 40.484  7.231   -21.153 1.00 14.00 ? 196  ARG A CZ  1 
ATOM   2286 N NH1 . ARG A 1 203 ? 40.299  5.941   -20.890 1.00 15.68 ? 196  ARG A NH1 1 
ATOM   2287 N NH2 . ARG A 1 203 ? 40.629  8.091   -20.156 1.00 16.55 ? 196  ARG A NH2 1 
ATOM   2288 N N   A TRP A 1 204 ? 39.021  6.138   -29.038 0.31 11.65 ? 197  TRP A N   1 
ATOM   2289 N N   B TRP A 1 204 ? 39.015  6.143   -29.045 0.69 11.64 ? 197  TRP A N   1 
ATOM   2290 C CA  A TRP A 1 204 ? 39.252  5.517   -30.339 0.31 10.77 ? 197  TRP A CA  1 
ATOM   2291 C CA  B TRP A 1 204 ? 39.216  5.542   -30.368 0.69 10.67 ? 197  TRP A CA  1 
ATOM   2292 C C   A TRP A 1 204 ? 39.017  6.530   -31.451 0.31 14.28 ? 197  TRP A C   1 
ATOM   2293 C C   B TRP A 1 204 ? 39.043  6.601   -31.440 0.69 14.48 ? 197  TRP A C   1 
ATOM   2294 O O   A TRP A 1 204 ? 39.723  6.535   -32.460 0.31 13.26 ? 197  TRP A O   1 
ATOM   2295 O O   B TRP A 1 204 ? 39.820  6.671   -32.391 0.69 13.37 ? 197  TRP A O   1 
ATOM   2296 C CB  A TRP A 1 204 ? 38.344  4.297   -30.537 0.31 12.50 ? 197  TRP A CB  1 
ATOM   2297 C CB  B TRP A 1 204 ? 38.230  4.383   -30.617 0.69 12.43 ? 197  TRP A CB  1 
ATOM   2298 C CG  A TRP A 1 204 ? 38.659  3.515   -31.786 0.31 12.71 ? 197  TRP A CG  1 
ATOM   2299 C CG  B TRP A 1 204 ? 38.437  3.677   -31.952 0.69 11.60 ? 197  TRP A CG  1 
ATOM   2300 C CD1 A TRP A 1 204 ? 39.434  2.395   -31.880 0.31 17.15 ? 197  TRP A CD1 1 
ATOM   2301 C CD1 B TRP A 1 204 ? 39.091  2.495   -32.164 0.69 15.79 ? 197  TRP A CD1 1 
ATOM   2302 C CD2 A TRP A 1 204 ? 38.220  3.809   -33.118 0.31 11.05 ? 197  TRP A CD2 1 
ATOM   2303 C CD2 B TRP A 1 204 ? 38.009  4.132   -33.242 0.69 9.35  ? 197  TRP A CD2 1 
ATOM   2304 N NE1 A TRP A 1 204 ? 39.500  1.969   -33.186 0.31 18.47 ? 197  TRP A NE1 1 
ATOM   2305 N NE1 B TRP A 1 204 ? 39.093  2.183   -33.508 0.69 14.85 ? 197  TRP A NE1 1 
ATOM   2306 C CE2 A TRP A 1 204 ? 38.762  2.819   -33.966 0.31 11.10 ? 197  TRP A CE2 1 
ATOM   2307 C CE2 B TRP A 1 204 ? 38.425  3.165   -34.187 0.69 10.78 ? 197  TRP A CE2 1 
ATOM   2308 C CE3 A TRP A 1 204 ? 37.417  4.810   -33.677 0.31 13.04 ? 197  TRP A CE3 1 
ATOM   2309 C CE3 B TRP A 1 204 ? 37.294  5.247   -33.691 0.69 10.52 ? 197  TRP A CE3 1 
ATOM   2310 C CZ2 A TRP A 1 204 ? 38.531  2.803   -35.340 0.31 13.28 ? 197  TRP A CZ2 1 
ATOM   2311 C CZ2 B TRP A 1 204 ? 38.168  3.295   -35.551 0.69 12.09 ? 197  TRP A CZ2 1 
ATOM   2312 C CZ3 A TRP A 1 204 ? 37.185  4.790   -35.037 0.31 15.51 ? 197  TRP A CZ3 1 
ATOM   2313 C CZ3 B TRP A 1 204 ? 37.032  5.370   -35.040 0.69 13.55 ? 197  TRP A CZ3 1 
ATOM   2314 C CH2 A TRP A 1 204 ? 37.742  3.794   -35.856 0.31 11.69 ? 197  TRP A CH2 1 
ATOM   2315 C CH2 B TRP A 1 204 ? 37.472  4.399   -35.959 0.69 17.92 ? 197  TRP A CH2 1 
ATOM   2316 N N   A ILE A 1 205 ? 38.017  7.387   -31.258 0.31 11.67 ? 198  ILE A N   1 
ATOM   2317 N N   B ILE A 1 205 ? 38.003  7.418   -31.282 0.69 11.60 ? 198  ILE A N   1 
ATOM   2318 C CA  A ILE A 1 205 ? 37.650  8.382   -32.260 0.31 10.08 ? 198  ILE A CA  1 
ATOM   2319 C CA  B ILE A 1 205 ? 37.641  8.416   -32.284 0.69 9.87  ? 198  ILE A CA  1 
ATOM   2320 C C   A ILE A 1 205 ? 38.729  9.449   -32.382 0.31 13.55 ? 198  ILE A C   1 
ATOM   2321 C C   B ILE A 1 205 ? 38.727  9.473   -32.388 0.69 13.67 ? 198  ILE A C   1 
ATOM   2322 O O   A ILE A 1 205 ? 39.143  9.789   -33.490 0.31 13.21 ? 198  ILE A O   1 
ATOM   2323 O O   B ILE A 1 205 ? 39.162  9.814   -33.488 0.69 13.06 ? 198  ILE A O   1 
ATOM   2324 C CB  A ILE A 1 205 ? 36.293  9.032   -31.932 0.31 10.31 ? 198  ILE A CB  1 
ATOM   2325 C CB  B ILE A 1 205 ? 36.285  9.056   -31.955 0.69 10.15 ? 198  ILE A CB  1 
ATOM   2326 C CG1 A ILE A 1 205 ? 35.176  8.008   -32.136 0.31 11.33 ? 198  ILE A CG1 1 
ATOM   2327 C CG1 B ILE A 1 205 ? 35.189  8.004   -32.132 0.69 11.23 ? 198  ILE A CG1 1 
ATOM   2328 C CG2 A ILE A 1 205 ? 36.048  10.240  -32.820 0.31 12.02 ? 198  ILE A CG2 1 
ATOM   2329 C CG2 B ILE A 1 205 ? 36.016  10.235  -32.866 0.69 12.07 ? 198  ILE A CG2 1 
ATOM   2330 C CD1 A ILE A 1 205 ? 33.816  8.466   -31.626 0.31 10.59 ? 198  ILE A CD1 1 
ATOM   2331 C CD1 B ILE A 1 205 ? 33.829  8.423   -31.554 0.69 10.52 ? 198  ILE A CD1 1 
ATOM   2332 N N   . LYS A 1 206 ? 39.211  9.964   -31.253 1.00 12.94 ? 199  LYS A N   1 
ATOM   2333 C CA  . LYS A 1 206 ? 40.270  10.959  -31.317 1.00 14.61 ? 199  LYS A CA  1 
ATOM   2334 C C   . LYS A 1 206 ? 41.532  10.363  -31.972 1.00 15.53 ? 199  LYS A C   1 
ATOM   2335 O O   . LYS A 1 206 ? 42.227  11.049  -32.727 1.00 15.69 ? 199  LYS A O   1 
ATOM   2336 C CB  A LYS A 1 206 ? 40.608  11.562  -29.955 0.66 18.96 ? 199  LYS A CB  1 
ATOM   2337 C CB  B LYS A 1 206 ? 40.587  11.472  -29.909 0.34 18.88 ? 199  LYS A CB  1 
ATOM   2338 C CG  A LYS A 1 206 ? 41.369  12.882  -30.133 0.66 26.17 ? 199  LYS A CG  1 
ATOM   2339 C CG  B LYS A 1 206 ? 41.753  12.440  -29.820 0.34 25.09 ? 199  LYS A CG  1 
ATOM   2340 C CD  A LYS A 1 206 ? 41.441  13.729  -28.875 0.66 22.80 ? 199  LYS A CD  1 
ATOM   2341 C CD  B LYS A 1 206 ? 41.291  13.880  -29.991 0.34 14.01 ? 199  LYS A CD  1 
ATOM   2342 C CE  A LYS A 1 206 ? 41.732  15.188  -29.216 0.66 15.21 ? 199  LYS A CE  1 
ATOM   2343 C CE  B LYS A 1 206 ? 42.428  14.861  -29.769 0.34 20.91 ? 199  LYS A CE  1 
ATOM   2344 N NZ  A LYS A 1 206 ? 43.076  15.418  -29.820 0.66 31.36 ? 199  LYS A NZ  1 
ATOM   2345 N NZ  B LYS A 1 206 ? 42.485  15.371  -28.372 0.34 20.89 ? 199  LYS A NZ  1 
ATOM   2346 N N   A ASN A 1 207 ? 41.785  9.081   -31.728 0.41 14.87 ? 200  ASN A N   1 
ATOM   2347 N N   B ASN A 1 207 ? 41.806  9.088   -31.712 0.59 14.97 ? 200  ASN A N   1 
ATOM   2348 C CA  A ASN A 1 207 ? 42.956  8.417   -32.293 0.41 13.87 ? 200  ASN A CA  1 
ATOM   2349 C CA  B ASN A 1 207 ? 43.031  8.467   -32.210 0.59 14.00 ? 200  ASN A CA  1 
ATOM   2350 C C   A ASN A 1 207 ? 42.838  8.087   -33.777 0.41 14.98 ? 200  ASN A C   1 
ATOM   2351 C C   B ASN A 1 207 ? 42.900  7.870   -33.603 0.59 14.31 ? 200  ASN A C   1 
ATOM   2352 O O   A ASN A 1 207 ? 43.840  8.087   -34.493 0.41 14.82 ? 200  ASN A O   1 
ATOM   2353 O O   B ASN A 1 207 ? 43.894  7.444   -34.188 0.59 13.58 ? 200  ASN A O   1 
ATOM   2354 C CB  A ASN A 1 207 ? 43.262  7.129   -31.521 0.41 14.05 ? 200  ASN A CB  1 
ATOM   2355 C CB  B ASN A 1 207 ? 43.509  7.380   -31.239 0.59 13.30 ? 200  ASN A CB  1 
ATOM   2356 C CG  A ASN A 1 207 ? 43.708  7.395   -30.098 0.41 24.74 ? 200  ASN A CG  1 
ATOM   2357 C CG  B ASN A 1 207 ? 44.978  7.032   -31.426 0.59 22.52 ? 200  ASN A CG  1 
ATOM   2358 O OD1 A ASN A 1 207 ? 44.038  8.526   -29.740 0.41 21.20 ? 200  ASN A OD1 1 
ATOM   2359 O OD1 B ASN A 1 207 ? 45.829  7.918   -31.539 0.59 23.31 ? 200  ASN A OD1 1 
ATOM   2360 N ND2 A ASN A 1 207 ? 43.736  6.344   -29.279 0.41 13.75 ? 200  ASN A ND2 1 
ATOM   2361 N ND2 B ASN A 1 207 ? 45.278  5.738   -31.481 0.59 15.46 ? 200  ASN A ND2 1 
ATOM   2362 N N   A ASN A 1 208 ? 41.623  7.811   -34.245 0.41 12.48 ? 201  ASN A N   1 
ATOM   2363 N N   B ASN A 1 208 ? 41.689  7.832   -34.150 0.59 12.27 ? 201  ASN A N   1 
ATOM   2364 C CA  A ASN A 1 208 ? 41.454  7.248   -35.585 0.41 13.54 ? 201  ASN A CA  1 
ATOM   2365 C CA  B ASN A 1 208 ? 41.517  7.199   -35.457 0.59 13.70 ? 201  ASN A CA  1 
ATOM   2366 C C   A ASN A 1 208 ? 40.707  8.107   -36.619 0.41 13.54 ? 201  ASN A C   1 
ATOM   2367 C C   B ASN A 1 208 ? 40.707  7.971   -36.510 0.59 12.93 ? 201  ASN A C   1 
ATOM   2368 O O   A ASN A 1 208 ? 40.803  7.840   -37.818 0.41 13.24 ? 201  ASN A O   1 
ATOM   2369 O O   B ASN A 1 208 ? 40.683  7.564   -37.674 0.59 13.96 ? 201  ASN A O   1 
ATOM   2370 C CB  A ASN A 1 208 ? 40.752  5.888   -35.473 0.41 12.69 ? 201  ASN A CB  1 
ATOM   2371 C CB  B ASN A 1 208 ? 40.896  5.806   -35.274 0.59 12.36 ? 201  ASN A CB  1 
ATOM   2372 C CG  A ASN A 1 208 ? 41.613  4.839   -34.785 0.41 15.99 ? 201  ASN A CG  1 
ATOM   2373 C CG  B ASN A 1 208 ? 41.852  4.821   -34.619 0.59 16.62 ? 201  ASN A CG  1 
ATOM   2374 O OD1 A ASN A 1 208 ? 42.314  4.065   -35.441 0.41 18.01 ? 201  ASN A OD1 1 
ATOM   2375 O OD1 B ASN A 1 208 ? 42.733  4.265   -35.279 0.59 14.90 ? 201  ASN A OD1 1 
ATOM   2376 N ND2 A ASN A 1 208 ? 41.565  4.810   -33.458 0.41 14.79 ? 201  ASN A ND2 1 
ATOM   2377 N ND2 B ASN A 1 208 ? 41.672  4.584   -33.323 0.59 12.74 ? 201  ASN A ND2 1 
ATOM   2378 N N   A CYS A 1 209 ? 39.977  9.133   -36.179 0.41 14.41 ? 202  CYS A N   1 
ATOM   2379 N N   B CYS A 1 209 ? 40.061  9.079   -36.140 0.59 14.50 ? 202  CYS A N   1 
ATOM   2380 C CA  A CYS A 1 209 ? 39.118  9.886   -37.101 0.41 12.72 ? 202  CYS A CA  1 
ATOM   2381 C CA  B CYS A 1 209 ? 39.206  9.776   -37.109 0.59 12.65 ? 202  CYS A CA  1 
ATOM   2382 C C   A CYS A 1 209 ? 39.884  10.531  -38.260 0.41 12.16 ? 202  CYS A C   1 
ATOM   2383 C C   B CYS A 1 209 ? 39.997  10.386  -38.272 0.59 12.12 ? 202  CYS A C   1 
ATOM   2384 O O   A CYS A 1 209 ? 39.340  10.679  -39.344 0.41 15.16 ? 202  CYS A O   1 
ATOM   2385 O O   B CYS A 1 209 ? 39.430  10.651  -39.315 0.59 14.90 ? 202  CYS A O   1 
ATOM   2386 C CB  A CYS A 1 209 ? 38.324  10.965  -36.352 0.41 14.56 ? 202  CYS A CB  1 
ATOM   2387 C CB  B CYS A 1 209 ? 38.360  10.867  -36.430 0.59 14.95 ? 202  CYS A CB  1 
ATOM   2388 S SG  A CYS A 1 209 ? 39.328  12.260  -35.619 0.41 16.39 ? 202  CYS A SG  1 
ATOM   2389 S SG  B CYS A 1 209 ? 39.287  12.177  -35.638 0.59 16.34 ? 202  CYS A SG  1 
ATOM   2390 N N   A ALA A 1 210 ? 41.142  10.898  -38.030 0.41 12.96 ? 203  ALA A N   1 
ATOM   2391 N N   B ALA A 1 210 ? 41.300  10.586  -38.092 0.59 16.07 ? 203  ALA A N   1 
ATOM   2392 C CA  A ALA A 1 210 ? 41.980  11.467  -39.084 0.41 15.66 ? 203  ALA A CA  1 
ATOM   2393 C CA  B ALA A 1 210 ? 42.162  11.029  -39.186 0.59 15.86 ? 203  ALA A CA  1 
ATOM   2394 C C   A ALA A 1 210 ? 42.134  10.526  -40.277 0.41 17.18 ? 203  ALA A C   1 
ATOM   2395 C C   B ALA A 1 210 ? 42.134  10.062  -40.370 0.59 13.81 ? 203  ALA A C   1 
ATOM   2396 O O   A ALA A 1 210 ? 42.341  10.977  -41.409 0.41 14.98 ? 203  ALA A O   1 
ATOM   2397 O O   B ALA A 1 210 ? 42.257  10.485  -41.522 0.59 16.82 ? 203  ALA A O   1 
ATOM   2398 C CB  A ALA A 1 210 ? 43.346  11.835  -38.528 0.41 14.47 ? 203  ALA A CB  1 
ATOM   2399 C CB  B ALA A 1 210 ? 43.589  11.201  -38.695 0.59 12.75 ? 203  ALA A CB  1 
ATOM   2400 N N   A ASN A 1 211 ? 42.021  9.224   -40.025 0.41 10.61 ? 204  ASN A N   1 
ATOM   2401 N N   B ASN A 1 211 ? 41.981  8.770   -40.093 0.59 14.13 ? 204  ASN A N   1 
ATOM   2402 C CA  A ASN A 1 211 ? 42.189  8.223   -41.076 0.41 17.56 ? 204  ASN A CA  1 
ATOM   2403 C CA  B ASN A 1 211 ? 41.994  7.772   -41.163 0.59 18.69 ? 204  ASN A CA  1 
ATOM   2404 C C   A ASN A 1 211 ? 40.957  8.122   -41.969 0.41 12.90 ? 204  ASN A C   1 
ATOM   2405 C C   B ASN A 1 211 ? 40.769  7.870   -42.072 0.59 14.79 ? 204  ASN A C   1 
ATOM   2406 O O   A ASN A 1 211 ? 40.974  7.445   -43.000 0.41 17.66 ? 204  ASN A O   1 
ATOM   2407 O O   B ASN A 1 211 ? 40.719  7.248   -43.138 0.59 17.21 ? 204  ASN A O   1 
ATOM   2408 C CB  A ASN A 1 211 ? 42.504  6.855   -40.469 0.41 15.48 ? 204  ASN A CB  1 
ATOM   2409 C CB  B ASN A 1 211 ? 42.083  6.358   -40.586 0.59 14.15 ? 204  ASN A CB  1 
ATOM   2410 C CG  A ASN A 1 211 ? 43.643  6.910   -39.468 0.41 19.10 ? 204  ASN A CG  1 
ATOM   2411 C CG  B ASN A 1 211 ? 43.375  6.108   -39.845 0.59 21.61 ? 204  ASN A CG  1 
ATOM   2412 O OD1 A ASN A 1 211 ? 44.554  7.725   -39.591 0.41 19.99 ? 204  ASN A OD1 1 
ATOM   2413 O OD1 B ASN A 1 211 ? 44.450  6.470   -40.315 0.59 16.87 ? 204  ASN A OD1 1 
ATOM   2414 N ND2 A ASN A 1 211 ? 43.593  6.039   -38.470 0.41 14.90 ? 204  ASN A ND2 1 
ATOM   2415 N ND2 B ASN A 1 211 ? 43.277  5.488   -38.674 0.59 19.18 ? 204  ASN A ND2 1 
ATOM   2416 N N   A PHE A 1 212 ? 39.890  8.803   -41.564 0.41 13.85 ? 205  PHE A N   1 
ATOM   2417 N N   B PHE A 1 212 ? 39.780  8.653   -41.649 0.59 12.58 ? 205  PHE A N   1 
ATOM   2418 C CA  A PHE A 1 212 ? 38.649  8.833   -42.323 0.41 13.90 ? 205  PHE A CA  1 
ATOM   2419 C CA  B PHE A 1 212 ? 38.552  8.831   -42.407 0.59 13.91 ? 205  PHE A CA  1 
ATOM   2420 C C   A PHE A 1 212 ? 38.377  10.245  -42.823 0.41 15.67 ? 205  PHE A C   1 
ATOM   2421 C C   B PHE A 1 212 ? 38.338  10.294  -42.780 0.59 15.69 ? 205  PHE A C   1 
ATOM   2422 O O   A PHE A 1 212 ? 37.265  10.568  -43.241 0.41 18.48 ? 205  PHE A O   1 
ATOM   2423 O O   B PHE A 1 212 ? 37.214  10.708  -43.061 0.59 18.83 ? 205  PHE A O   1 
ATOM   2424 C CB  A PHE A 1 212 ? 37.482  8.335   -41.466 0.41 15.24 ? 205  PHE A CB  1 
ATOM   2425 C CB  B PHE A 1 212 ? 37.348  8.320   -41.608 0.59 15.01 ? 205  PHE A CB  1 
ATOM   2426 C CG  A PHE A 1 212 ? 37.654  6.930   -40.981 0.41 13.27 ? 205  PHE A CG  1 
ATOM   2427 C CG  B PHE A 1 212 ? 37.471  6.890   -41.183 0.59 12.90 ? 205  PHE A CG  1 
ATOM   2428 C CD1 A PHE A 1 212 ? 37.107  5.874   -41.689 0.41 13.36 ? 205  PHE A CD1 1 
ATOM   2429 C CD1 B PHE A 1 212 ? 36.901  5.880   -41.938 0.59 13.43 ? 205  PHE A CD1 1 
ATOM   2430 C CD2 A PHE A 1 212 ? 38.378  6.658   -39.826 0.41 10.96 ? 205  PHE A CD2 1 
ATOM   2431 C CD2 B PHE A 1 212 ? 38.163  6.553   -40.029 0.59 13.40 ? 205  PHE A CD2 1 
ATOM   2432 C CE1 A PHE A 1 212 ? 37.267  4.578   -41.258 0.41 12.74 ? 205  PHE A CE1 1 
ATOM   2433 C CE1 B PHE A 1 212 ? 37.020  4.567   -41.555 0.59 12.31 ? 205  PHE A CE1 1 
ATOM   2434 C CE2 A PHE A 1 212 ? 38.534  5.360   -39.389 0.41 15.59 ? 205  PHE A CE2 1 
ATOM   2435 C CE2 B PHE A 1 212 ? 38.274  5.242   -39.642 0.59 14.56 ? 205  PHE A CE2 1 
ATOM   2436 C CZ  A PHE A 1 212 ? 37.981  4.319   -40.105 0.41 17.13 ? 205  PHE A CZ  1 
ATOM   2437 C CZ  B PHE A 1 212 ? 37.703  4.247   -40.400 0.59 17.61 ? 205  PHE A CZ  1 
ATOM   2438 N N   . GLY A 1 213 ? 39.413  11.076  -42.775 1.00 14.83 ? 206  GLY A N   1 
ATOM   2439 C CA  . GLY A 1 213 ? 39.319  12.475  -43.169 1.00 19.91 ? 206  GLY A CA  1 
ATOM   2440 C C   . GLY A 1 213 ? 38.835  13.438  -42.098 1.00 18.39 ? 206  GLY A C   1 
ATOM   2441 O O   . GLY A 1 213 ? 38.592  14.606  -42.377 1.00 17.35 ? 206  GLY A O   1 
ATOM   2442 N N   . GLY A 1 214 ? 38.699  12.947  -40.865 1.00 14.44 ? 207  GLY A N   1 
ATOM   2443 C CA  . GLY A 1 214 ? 38.293  13.777  -39.738 1.00 14.41 ? 207  GLY A CA  1 
ATOM   2444 C C   . GLY A 1 214 ? 39.394  14.581  -39.053 1.00 18.19 ? 207  GLY A C   1 
ATOM   2445 O O   . GLY A 1 214 ? 40.541  14.141  -38.984 1.00 20.39 ? 207  GLY A O   1 
ATOM   2446 N N   A ASN A 1 215 ? 39.032  15.765  -38.555 0.69 16.50 ? 208  ASN A N   1 
ATOM   2447 N N   B ASN A 1 215 ? 39.044  15.765  -38.560 0.31 16.52 ? 208  ASN A N   1 
ATOM   2448 C CA  A ASN A 1 215 ? 39.926  16.622  -37.768 0.69 17.55 ? 208  ASN A CA  1 
ATOM   2449 C CA  B ASN A 1 215 ? 39.978  16.586  -37.796 0.31 17.42 ? 208  ASN A CA  1 
ATOM   2450 C C   A ASN A 1 215 ? 39.900  16.232  -36.285 0.69 14.56 ? 208  ASN A C   1 
ATOM   2451 C C   B ASN A 1 215 ? 39.914  16.235  -36.313 0.31 14.71 ? 208  ASN A C   1 
ATOM   2452 O O   A ASN A 1 215 ? 38.906  16.485  -35.595 0.69 14.40 ? 208  ASN A O   1 
ATOM   2453 O O   B ASN A 1 215 ? 38.913  16.514  -35.649 0.31 14.57 ? 208  ASN A O   1 
ATOM   2454 C CB  A ASN A 1 215 ? 39.510  18.094  -37.925 0.69 14.57 ? 208  ASN A CB  1 
ATOM   2455 C CB  B ASN A 1 215 ? 39.676  18.075  -37.999 0.31 15.11 ? 208  ASN A CB  1 
ATOM   2456 C CG  A ASN A 1 215 ? 40.534  19.076  -37.369 0.69 15.98 ? 208  ASN A CG  1 
ATOM   2457 C CG  B ASN A 1 215 ? 40.703  18.979  -37.339 0.31 16.20 ? 208  ASN A CG  1 
ATOM   2458 O OD1 A ASN A 1 215 ? 41.534  18.695  -36.764 0.69 18.75 ? 208  ASN A OD1 1 
ATOM   2459 O OD1 B ASN A 1 215 ? 41.789  18.538  -36.964 0.31 18.67 ? 208  ASN A OD1 1 
ATOM   2460 N ND2 A ASN A 1 215 ? 40.275  20.361  -37.579 0.69 22.39 ? 208  ASN A ND2 1 
ATOM   2461 N ND2 B ASN A 1 215 ? 40.364  20.257  -37.204 0.31 23.31 ? 208  ASN A ND2 1 
ATOM   2462 N N   . PRO A 1 216 ? 40.983  15.621  -35.784 1.00 15.42 ? 209  PRO A N   1 
ATOM   2463 C CA  . PRO A 1 216 ? 40.952  15.206  -34.374 1.00 14.81 ? 209  PRO A CA  1 
ATOM   2464 C C   . PRO A 1 216 ? 40.988  16.388  -33.436 1.00 14.05 ? 209  PRO A C   1 
ATOM   2465 O O   . PRO A 1 216 ? 40.809  16.208  -32.240 1.00 18.67 ? 209  PRO A O   1 
ATOM   2466 C CB  . PRO A 1 216 ? 42.212  14.360  -34.228 1.00 18.93 ? 209  PRO A CB  1 
ATOM   2467 C CG  . PRO A 1 216 ? 43.138  14.944  -35.257 1.00 19.66 ? 209  PRO A CG  1 
ATOM   2468 C CD  . PRO A 1 216 ? 42.257  15.267  -36.435 1.00 15.59 ? 209  PRO A CD  1 
ATOM   2469 N N   . ASP A 1 217 ? 41.194  17.584  -33.970 1.00 16.63 ? 210  ASP A N   1 
ATOM   2470 C CA  . ASP A 1 217 ? 41.176  18.793  -33.163 1.00 16.50 ? 210  ASP A CA  1 
ATOM   2471 C C   . ASP A 1 217 ? 39.868  19.595  -33.311 1.00 15.48 ? 210  ASP A C   1 
ATOM   2472 O O   . ASP A 1 217 ? 39.779  20.752  -32.863 1.00 16.48 ? 210  ASP A O   1 
ATOM   2473 C CB  . ASP A 1 217 ? 42.386  19.659  -33.512 1.00 22.71 ? 210  ASP A CB  1 
ATOM   2474 C CG  . ASP A 1 217 ? 43.702  18.987  -33.152 1.00 33.09 ? 210  ASP A CG  1 
ATOM   2475 O OD1 . ASP A 1 217 ? 43.741  18.224  -32.158 1.00 24.96 ? 210  ASP A OD1 1 
ATOM   2476 O OD2 . ASP A 1 217 ? 44.703  19.228  -33.858 1.00 38.60 ? 210  ASP A OD2 1 
ATOM   2477 N N   A ASN A 1 218 ? 38.859  18.988  -33.935 0.61 16.04 ? 211  ASN A N   1 
ATOM   2478 N N   B ASN A 1 218 ? 38.876  18.972  -33.945 0.39 16.00 ? 211  ASN A N   1 
ATOM   2479 C CA  A ASN A 1 218 ? 37.531  19.607  -34.012 0.61 14.36 ? 211  ASN A CA  1 
ATOM   2480 C CA  B ASN A 1 218 ? 37.542  19.553  -34.082 0.39 14.47 ? 211  ASN A CA  1 
ATOM   2481 C C   A ASN A 1 218 ? 36.417  18.570  -33.971 0.61 14.15 ? 211  ASN A C   1 
ATOM   2482 C C   B ASN A 1 218 ? 36.469  18.473  -34.006 0.39 14.19 ? 211  ASN A C   1 
ATOM   2483 O O   A ASN A 1 218 ? 35.747  18.330  -34.963 0.61 11.73 ? 211  ASN A O   1 
ATOM   2484 O O   B ASN A 1 218 ? 35.879  18.098  -35.014 0.39 12.67 ? 211  ASN A O   1 
ATOM   2485 C CB  A ASN A 1 218 ? 37.398  20.455  -35.281 0.61 13.49 ? 211  ASN A CB  1 
ATOM   2486 C CB  B ASN A 1 218 ? 37.420  20.323  -35.400 0.39 13.72 ? 211  ASN A CB  1 
ATOM   2487 C CG  A ASN A 1 218 ? 36.288  21.491  -35.182 0.61 17.38 ? 211  ASN A CG  1 
ATOM   2488 C CG  B ASN A 1 218 ? 36.166  21.179  -35.469 0.39 16.55 ? 211  ASN A CG  1 
ATOM   2489 O OD1 A ASN A 1 218 ? 35.837  21.829  -34.086 0.61 19.40 ? 211  ASN A OD1 1 
ATOM   2490 O OD1 B ASN A 1 218 ? 35.651  21.628  -34.444 0.39 21.54 ? 211  ASN A OD1 1 
ATOM   2491 N ND2 A ASN A 1 218 ? 35.836  21.990  -36.330 0.61 22.37 ? 211  ASN A ND2 1 
ATOM   2492 N ND2 B ASN A 1 218 ? 35.676  21.418  -36.683 0.39 13.73 ? 211  ASN A ND2 1 
ATOM   2493 N N   . ILE A 1 219 ? 36.233  17.968  -32.799 1.00 17.62 ? 212  ILE A N   1 
ATOM   2494 C CA  . ILE A 1 219 ? 35.248  16.924  -32.569 1.00 13.63 ? 212  ILE A CA  1 
ATOM   2495 C C   . ILE A 1 219 ? 34.069  17.479  -31.760 1.00 14.13 ? 212  ILE A C   1 
ATOM   2496 O O   . ILE A 1 219 ? 34.276  18.211  -30.779 1.00 13.84 ? 212  ILE A O   1 
ATOM   2497 C CB  . ILE A 1 219 ? 35.875  15.735  -31.796 1.00 12.44 ? 212  ILE A CB  1 
ATOM   2498 C CG1 . ILE A 1 219 ? 37.011  15.109  -32.600 1.00 12.06 ? 212  ILE A CG1 1 
ATOM   2499 C CG2 . ILE A 1 219 ? 34.826  14.679  -31.444 1.00 14.31 ? 212  ILE A CG2 1 
ATOM   2500 C CD1 . ILE A 1 219 ? 37.803  14.097  -31.792 1.00 15.57 ? 212  ILE A CD1 1 
ATOM   2501 N N   . THR A 1 220 ? 32.853  17.142  -32.183 1.00 9.18  ? 213  THR A N   1 
ATOM   2502 C CA  . THR A 1 220 ? 31.640  17.530  -31.481 1.00 14.35 ? 213  THR A CA  1 
ATOM   2503 C C   . THR A 1 220 ? 30.941  16.254  -31.028 1.00 12.86 ? 213  THR A C   1 
ATOM   2504 O O   . THR A 1 220 ? 30.803  15.323  -31.803 1.00 12.48 ? 213  THR A O   1 
ATOM   2505 C CB  . THR A 1 220 ? 30.708  18.367  -32.394 1.00 11.44 ? 213  THR A CB  1 
ATOM   2506 O OG1 . THR A 1 220 ? 31.341  19.611  -32.714 1.00 13.51 ? 213  THR A OG1 1 
ATOM   2507 C CG2 . THR A 1 220 ? 29.370  18.635  -31.719 1.00 13.27 ? 213  THR A CG2 1 
ATOM   2508 N N   . VAL A 1 221 ? 30.544  16.207  -29.756 1.00 9.64  ? 214  VAL A N   1 
ATOM   2509 C CA  . VAL A 1 221 ? 29.752  15.106  -29.233 1.00 7.96  ? 214  VAL A CA  1 
ATOM   2510 C C   . VAL A 1 221 ? 28.336  15.613  -29.021 1.00 12.63 ? 214  VAL A C   1 
ATOM   2511 O O   . VAL A 1 221 ? 28.148  16.708  -28.498 1.00 9.79  ? 214  VAL A O   1 
ATOM   2512 C CB  . VAL A 1 221 ? 30.337  14.573  -27.925 1.00 9.44  ? 214  VAL A CB  1 
ATOM   2513 C CG1 . VAL A 1 221 ? 29.498  13.401  -27.380 1.00 12.98 ? 214  VAL A CG1 1 
ATOM   2514 C CG2 . VAL A 1 221 ? 31.776  14.163  -28.174 1.00 12.69 ? 214  VAL A CG2 1 
ATOM   2515 N N   . PHE A 1 222 ? 27.340  14.837  -29.430 1.00 10.75 ? 215  PHE A N   1 
ATOM   2516 C CA  . PHE A 1 222 ? 25.941  15.220  -29.218 1.00 9.42  ? 215  PHE A CA  1 
ATOM   2517 C C   . PHE A 1 222 ? 25.110  13.964  -29.009 1.00 9.55  ? 215  PHE A C   1 
ATOM   2518 O O   . PHE A 1 222 ? 25.540  12.872  -29.346 1.00 11.12 ? 215  PHE A O   1 
ATOM   2519 C CB  . PHE A 1 222 ? 25.406  16.106  -30.370 1.00 10.82 ? 215  PHE A CB  1 
ATOM   2520 C CG  . PHE A 1 222 ? 25.172  15.402  -31.710 1.00 13.71 ? 215  PHE A CG  1 
ATOM   2521 C CD1 . PHE A 1 222 ? 23.909  15.439  -32.295 1.00 10.29 ? 215  PHE A CD1 1 
ATOM   2522 C CD2 . PHE A 1 222 ? 26.203  14.794  -32.407 1.00 10.46 ? 215  PHE A CD2 1 
ATOM   2523 C CE1 . PHE A 1 222 ? 23.670  14.853  -33.544 1.00 10.90 ? 215  PHE A CE1 1 
ATOM   2524 C CE2 . PHE A 1 222 ? 25.969  14.195  -33.668 1.00 12.80 ? 215  PHE A CE2 1 
ATOM   2525 C CZ  . PHE A 1 222 ? 24.705  14.211  -34.221 1.00 15.43 ? 215  PHE A CZ  1 
ATOM   2526 N N   . GLY A 1 223 ? 23.949  14.135  -28.391 1.00 9.91  ? 216  GLY A N   1 
ATOM   2527 C CA  . GLY A 1 223 ? 23.058  13.043  -28.084 1.00 10.42 ? 216  GLY A CA  1 
ATOM   2528 C C   . GLY A 1 223 ? 21.737  13.606  -27.597 1.00 10.36 ? 216  GLY A C   1 
ATOM   2529 O O   . GLY A 1 223 ? 21.663  14.768  -27.189 1.00 11.93 ? 216  GLY A O   1 
ATOM   2530 N N   . GLU A 1 224 ? 20.702  12.780  -27.655 1.00 10.77 ? 217  GLU A N   1 
ATOM   2531 C CA  . GLU A 1 224 ? 19.360  13.169  -27.229 1.00 12.73 ? 217  GLU A CA  1 
ATOM   2532 C C   . GLU A 1 224 ? 18.925  12.316  -26.056 1.00 14.55 ? 217  GLU A C   1 
ATOM   2533 O O   . GLU A 1 224 ? 19.194  11.120  -26.042 1.00 10.66 ? 217  GLU A O   1 
ATOM   2534 C CB  . GLU A 1 224 ? 18.354  13.044  -28.390 1.00 14.08 ? 217  GLU A CB  1 
ATOM   2535 C CG  . GLU A 1 224 ? 16.946  13.616  -28.091 1.00 14.09 ? 217  GLU A CG  1 
ATOM   2536 C CD  . GLU A 1 224 ? 15.974  12.560  -27.610 1.00 18.14 ? 217  GLU A CD  1 
ATOM   2537 O OE1 . GLU A 1 224 ? 16.327  11.361  -27.633 1.00 21.14 ? 217  GLU A OE1 1 
ATOM   2538 O OE2 . GLU A 1 224 ? 14.850  12.927  -27.218 1.00 19.43 ? 217  GLU A OE2 1 
ATOM   2539 N N   . SER A 1 225 ? 18.235  12.930  -25.091 1.00 10.41 ? 218  SER A N   1 
ATOM   2540 C CA  . SER A 1 225 ? 17.732  12.261  -23.895 1.00 8.80  ? 218  SER A CA  1 
ATOM   2541 C C   . SER A 1 225 ? 18.907  11.588  -23.166 1.00 11.89 ? 218  SER A C   1 
ATOM   2542 O O   . SER A 1 225 ? 19.827  12.291  -22.776 1.00 11.85 ? 218  SER A O   1 
ATOM   2543 C CB  . SER A 1 225 ? 16.622  11.271  -24.267 1.00 14.62 ? 218  SER A CB  1 
ATOM   2544 O OG  . SER A 1 225 ? 15.940  10.808  -23.105 1.00 14.54 ? 218  SER A OG  1 
ATOM   2545 N N   . ALA A 1 226 ? 18.911  10.260  -22.992 1.00 11.92 ? 219  ALA A N   1 
ATOM   2546 C CA  . ALA A 1 226 ? 20.042  9.595   -22.327 1.00 10.99 ? 219  ALA A CA  1 
ATOM   2547 C C   . ALA A 1 226 ? 21.356  9.791   -23.079 1.00 9.11  ? 219  ALA A C   1 
ATOM   2548 O O   . ALA A 1 226 ? 22.417  9.683   -22.497 1.00 12.60 ? 219  ALA A O   1 
ATOM   2549 C CB  . ALA A 1 226 ? 19.770  8.105   -22.152 1.00 11.35 ? 219  ALA A CB  1 
ATOM   2550 N N   . GLY A 1 227 ? 21.285  10.046  -24.379 1.00 9.53  ? 220  GLY A N   1 
ATOM   2551 C CA  . GLY A 1 227 ? 22.474  10.391  -25.132 1.00 9.57  ? 220  GLY A CA  1 
ATOM   2552 C C   . GLY A 1 227 ? 22.948  11.798  -24.790 1.00 12.81 ? 220  GLY A C   1 
ATOM   2553 O O   . GLY A 1 227 ? 24.139  12.099  -24.910 1.00 10.53 ? 220  GLY A O   1 
ATOM   2554 N N   A ALA A 1 228 ? 22.024  12.667  -24.375 0.82 12.16 ? 221  ALA A N   1 
ATOM   2555 N N   B ALA A 1 228 ? 22.021  12.656  -24.366 0.18 12.16 ? 221  ALA A N   1 
ATOM   2556 C CA  A ALA A 1 228 ? 22.397  14.014  -23.942 0.82 10.87 ? 221  ALA A CA  1 
ATOM   2557 C CA  B ALA A 1 228 ? 22.370  14.011  -23.943 0.18 11.02 ? 221  ALA A CA  1 
ATOM   2558 C C   A ALA A 1 228 ? 23.011  13.953  -22.554 0.82 9.66  ? 221  ALA A C   1 
ATOM   2559 C C   B ALA A 1 228 ? 22.975  13.987  -22.548 0.18 9.75  ? 221  ALA A C   1 
ATOM   2560 O O   A ALA A 1 228 ? 24.023  14.596  -22.291 0.82 9.35  ? 221  ALA A O   1 
ATOM   2561 O O   B ALA A 1 228 ? 23.936  14.702  -22.268 0.18 9.61  ? 221  ALA A O   1 
ATOM   2562 C CB  A ALA A 1 228 ? 21.208  14.935  -23.935 0.82 11.89 ? 221  ALA A CB  1 
ATOM   2563 C CB  B ALA A 1 228 ? 21.154  14.918  -23.973 0.18 11.90 ? 221  ALA A CB  1 
ATOM   2564 N N   . ALA A 1 229 ? 22.405  13.163  -21.675 1.00 10.52 ? 222  ALA A N   1 
ATOM   2565 C CA  . ALA A 1 229 ? 22.988  12.933  -20.352 1.00 11.08 ? 222  ALA A CA  1 
ATOM   2566 C C   . ALA A 1 229 ? 24.381  12.352  -20.542 1.00 9.82  ? 222  ALA A C   1 
ATOM   2567 O O   . ALA A 1 229 ? 25.306  12.717  -19.839 1.00 11.48 ? 222  ALA A O   1 
ATOM   2568 C CB  . ALA A 1 229 ? 22.104  11.986  -19.510 1.00 8.38  ? 222  ALA A CB  1 
ATOM   2569 N N   . SER A 1 230 ? 24.525  11.459  -21.517 1.00 9.59  ? 223  SER A N   1 
ATOM   2570 C CA  . SER A 1 230 ? 25.833  10.850  -21.813 1.00 10.66 ? 223  SER A CA  1 
ATOM   2571 C C   . SER A 1 230 ? 26.855  11.873  -22.299 1.00 11.84 ? 223  SER A C   1 
ATOM   2572 O O   . SER A 1 230 ? 27.986  11.905  -21.811 1.00 10.17 ? 223  SER A O   1 
ATOM   2573 C CB  . SER A 1 230 ? 25.700  9.740   -22.864 1.00 8.52  ? 223  SER A CB  1 
ATOM   2574 O OG  . SER A 1 230 ? 24.990  8.632   -22.336 1.00 10.12 ? 223  SER A OG  1 
ATOM   2575 N N   . THR A 1 231 ? 26.459  12.674  -23.290 1.00 10.58 ? 224  THR A N   1 
ATOM   2576 C CA  . THR A 1 231 ? 27.308  13.750  -23.779 1.00 12.36 ? 224  THR A CA  1 
ATOM   2577 C C   . THR A 1 231 ? 27.759  14.624  -22.607 1.00 14.24 ? 224  THR A C   1 
ATOM   2578 O O   . THR A 1 231 ? 28.938  14.972  -22.474 1.00 10.07 ? 224  THR A O   1 
ATOM   2579 C CB  . THR A 1 231 ? 26.586  14.602  -24.830 1.00 11.91 ? 224  THR A CB  1 
ATOM   2580 O OG1 . THR A 1 231 ? 26.285  13.785  -25.974 1.00 13.20 ? 224  THR A OG1 1 
ATOM   2581 C CG2 . THR A 1 231 ? 27.441  15.765  -25.268 1.00 13.96 ? 224  THR A CG2 1 
ATOM   2582 N N   . HIS A 1 232 ? 26.823  14.958  -21.728 1.00 8.67  ? 225  HIS A N   1 
ATOM   2583 C CA  . HIS A 1 232 ? 27.192  15.765  -20.583 1.00 12.01 ? 225  HIS A CA  1 
ATOM   2584 C C   . HIS A 1 232 ? 28.168  15.048  -19.626 1.00 11.80 ? 225  HIS A C   1 
ATOM   2585 O O   . HIS A 1 232 ? 29.125  15.662  -19.191 1.00 13.13 ? 225  HIS A O   1 
ATOM   2586 C CB  . HIS A 1 232 ? 25.940  16.207  -19.861 1.00 8.86  ? 225  HIS A CB  1 
ATOM   2587 C CG  . HIS A 1 232 ? 26.190  17.245  -18.815 1.00 11.69 ? 225  HIS A CG  1 
ATOM   2588 N ND1 . HIS A 1 232 ? 25.425  17.340  -17.680 1.00 12.48 ? 225  HIS A ND1 1 
ATOM   2589 C CD2 . HIS A 1 232 ? 27.136  18.209  -18.725 1.00 12.20 ? 225  HIS A CD2 1 
ATOM   2590 C CE1 . HIS A 1 232 ? 25.880  18.330  -16.930 1.00 14.43 ? 225  HIS A CE1 1 
ATOM   2591 N NE2 . HIS A 1 232 ? 26.919  18.869  -17.539 1.00 13.46 ? 225  HIS A NE2 1 
ATOM   2592 N N   . TYR A 1 233 ? 27.945  13.766  -19.316 1.00 10.05 ? 226  TYR A N   1 
ATOM   2593 C CA  . TYR A 1 233 ? 28.909  13.006  -18.506 1.00 10.79 ? 226  TYR A CA  1 
ATOM   2594 C C   . TYR A 1 233 ? 30.296  13.048  -19.146 1.00 10.08 ? 226  TYR A C   1 
ATOM   2595 O O   . TYR A 1 233 ? 31.292  13.217  -18.465 1.00 13.15 ? 226  TYR A O   1 
ATOM   2596 C CB  . TYR A 1 233 ? 28.453  11.543  -18.324 1.00 10.75 ? 226  TYR A CB  1 
ATOM   2597 C CG  . TYR A 1 233 ? 27.322  11.346  -17.329 1.00 10.23 ? 226  TYR A CG  1 
ATOM   2598 C CD1 . TYR A 1 233 ? 27.417  11.842  -16.035 1.00 13.49 ? 226  TYR A CD1 1 
ATOM   2599 C CD2 . TYR A 1 233 ? 26.163  10.686  -17.697 1.00 11.89 ? 226  TYR A CD2 1 
ATOM   2600 C CE1 . TYR A 1 233 ? 26.374  11.677  -15.134 1.00 12.68 ? 226  TYR A CE1 1 
ATOM   2601 C CE2 . TYR A 1 233 ? 25.106  10.516  -16.797 1.00 12.66 ? 226  TYR A CE2 1 
ATOM   2602 C CZ  . TYR A 1 233 ? 25.236  11.012  -15.517 1.00 15.63 ? 226  TYR A CZ  1 
ATOM   2603 O OH  . TYR A 1 233 ? 24.209  10.841  -14.611 1.00 16.52 ? 226  TYR A OH  1 
ATOM   2604 N N   . MET A 1 234 ? 30.339  12.919  -20.473 1.00 11.35 ? 227  MET A N   1 
ATOM   2605 C CA  . MET A 1 234 ? 31.591  12.957  -21.215 1.00 9.42  ? 227  MET A CA  1 
ATOM   2606 C C   . MET A 1 234 ? 32.232  14.350  -21.142 1.00 14.52 ? 227  MET A C   1 
ATOM   2607 O O   . MET A 1 234 ? 33.441  14.486  -21.341 1.00 13.14 ? 227  MET A O   1 
ATOM   2608 C CB  . MET A 1 234 ? 31.369  12.537  -22.687 1.00 9.78  ? 227  MET A CB  1 
ATOM   2609 C CG  . MET A 1 234 ? 30.943  11.083  -22.901 1.00 13.59 ? 227  MET A CG  1 
ATOM   2610 S SD  . MET A 1 234 ? 32.085  9.892   -22.194 1.00 13.45 ? 227  MET A SD  1 
ATOM   2611 C CE  . MET A 1 234 ? 31.115  9.308   -20.788 1.00 13.67 ? 227  MET A CE  1 
ATOM   2612 N N   . MET A 1 235 ? 31.427  15.373  -20.840 1.00 13.16 ? 228  MET A N   1 
ATOM   2613 C CA  . MET A 1 235 ? 31.935  16.730  -20.643 1.00 14.24 ? 228  MET A CA  1 
ATOM   2614 C C   . MET A 1 235 ? 32.354  16.971  -19.187 1.00 14.71 ? 228  MET A C   1 
ATOM   2615 O O   . MET A 1 235 ? 33.050  17.930  -18.892 1.00 14.18 ? 228  MET A O   1 
ATOM   2616 C CB  . MET A 1 235 ? 30.872  17.757  -21.056 1.00 12.36 ? 228  MET A CB  1 
ATOM   2617 C CG  . MET A 1 235 ? 30.616  17.740  -22.542 1.00 12.75 ? 228  MET A CG  1 
ATOM   2618 S SD  . MET A 1 235 ? 29.212  18.779  -23.002 1.00 16.75 ? 228  MET A SD  1 
ATOM   2619 C CE  . MET A 1 235 ? 29.981  20.380  -22.883 1.00 19.67 ? 228  MET A CE  1 
ATOM   2620 N N   . LEU A 1 236 ? 31.896  16.107  -18.284 1.00 14.08 ? 229  LEU A N   1 
ATOM   2621 C CA  . LEU A 1 236 ? 32.153  16.281  -16.846 1.00 11.09 ? 229  LEU A CA  1 
ATOM   2622 C C   . LEU A 1 236 ? 33.375  15.517  -16.372 1.00 12.74 ? 229  LEU A C   1 
ATOM   2623 O O   . LEU A 1 236 ? 34.122  15.999  -15.521 1.00 15.94 ? 229  LEU A O   1 
ATOM   2624 C CB  . LEU A 1 236 ? 30.946  15.823  -16.021 1.00 12.27 ? 229  LEU A CB  1 
ATOM   2625 C CG  . LEU A 1 236 ? 29.682  16.651  -16.186 1.00 15.11 ? 229  LEU A CG  1 
ATOM   2626 C CD1 . LEU A 1 236 ? 28.580  16.005  -15.385 1.00 11.73 ? 229  LEU A CD1 1 
ATOM   2627 C CD2 . LEU A 1 236 ? 29.864  18.099  -15.753 1.00 16.99 ? 229  LEU A CD2 1 
ATOM   2628 N N   . THR A 1 237 ? 33.569  14.309  -16.886 1.00 11.52 ? 230  THR A N   1 
ATOM   2629 C CA  . THR A 1 237 ? 34.611  13.435  -16.345 1.00 11.60 ? 230  THR A CA  1 
ATOM   2630 C C   . THR A 1 237 ? 36.030  13.853  -16.755 1.00 13.36 ? 230  THR A C   1 
ATOM   2631 O O   . THR A 1 237 ? 36.252  14.304  -17.880 1.00 12.24 ? 230  THR A O   1 
ATOM   2632 C CB  . THR A 1 237 ? 34.384  11.968  -16.755 1.00 15.86 ? 230  THR A CB  1 
ATOM   2633 O OG1 . THR A 1 237 ? 35.366  11.135  -16.134 1.00 15.18 ? 230  THR A OG1 1 
ATOM   2634 C CG2 . THR A 1 237 ? 34.469  11.770  -18.269 1.00 12.80 ? 230  THR A CG2 1 
ATOM   2635 N N   . GLU A 1 238 ? 36.992  13.710  -15.833 1.00 13.79 ? 231  GLU A N   1 
ATOM   2636 C CA  . GLU A 1 238 ? 38.392  13.989  -16.166 1.00 11.40 ? 231  GLU A CA  1 
ATOM   2637 C C   . GLU A 1 238 ? 38.938  12.984  -17.174 1.00 13.44 ? 231  GLU A C   1 
ATOM   2638 O O   . GLU A 1 238 ? 39.938  13.267  -17.841 1.00 12.86 ? 231  GLU A O   1 
ATOM   2639 C CB  . GLU A 1 238 ? 39.273  13.963  -14.923 1.00 12.50 ? 231  GLU A CB  1 
ATOM   2640 C CG  . GLU A 1 238 ? 39.017  15.097  -13.992 1.00 14.06 ? 231  GLU A CG  1 
ATOM   2641 C CD  . GLU A 1 238 ? 39.497  16.412  -14.556 1.00 15.71 ? 231  GLU A CD  1 
ATOM   2642 O OE1 . GLU A 1 238 ? 40.531  16.421  -15.273 1.00 18.49 ? 231  GLU A OE1 1 
ATOM   2643 O OE2 . GLU A 1 238 ? 38.830  17.434  -14.290 1.00 21.34 ? 231  GLU A OE2 1 
ATOM   2644 N N   . GLN A 1 239 ? 38.292  11.827  -17.294 1.00 14.28 ? 232  GLN A N   1 
ATOM   2645 C CA  . GLN A 1 239 ? 38.783  10.774  -18.195 1.00 12.68 ? 232  GLN A CA  1 
ATOM   2646 C C   . GLN A 1 239 ? 38.848  11.245  -19.635 1.00 13.80 ? 232  GLN A C   1 
ATOM   2647 O O   . GLN A 1 239 ? 39.636  10.723  -20.422 1.00 14.98 ? 232  GLN A O   1 
ATOM   2648 C CB  A GLN A 1 239 ? 37.902  9.528   -18.102 0.18 11.20 ? 232  GLN A CB  1 
ATOM   2649 C CB  B GLN A 1 239 ? 37.899  9.534   -18.130 0.82 10.96 ? 232  GLN A CB  1 
ATOM   2650 C CG  A GLN A 1 239 ? 38.216  8.626   -16.909 0.18 13.88 ? 232  GLN A CG  1 
ATOM   2651 C CG  B GLN A 1 239 ? 37.892  8.849   -16.757 0.82 13.32 ? 232  GLN A CG  1 
ATOM   2652 C CD  A GLN A 1 239 ? 39.598  7.995   -16.984 0.18 13.61 ? 232  GLN A CD  1 
ATOM   2653 C CD  B GLN A 1 239 ? 39.189  8.092   -16.441 0.82 15.38 ? 232  GLN A CD  1 
ATOM   2654 O OE1 A GLN A 1 239 ? 39.773  6.922   -17.560 0.18 14.00 ? 232  GLN A OE1 1 
ATOM   2655 O OE1 B GLN A 1 239 ? 40.110  8.039   -17.261 0.82 13.45 ? 232  GLN A OE1 1 
ATOM   2656 N NE2 A GLN A 1 239 ? 40.587  8.660   -16.394 0.18 18.86 ? 232  GLN A NE2 1 
ATOM   2657 N NE2 B GLN A 1 239 ? 39.267  7.516   -15.229 0.82 13.19 ? 232  GLN A NE2 1 
ATOM   2658 N N   . THR A 1 240 ? 38.009  12.224  -19.973 1.00 14.67 ? 233  THR A N   1 
ATOM   2659 C CA  . THR A 1 240 ? 37.890  12.669  -21.354 1.00 14.16 ? 233  THR A CA  1 
ATOM   2660 C C   . THR A 1 240 ? 38.459  14.062  -21.602 1.00 13.60 ? 233  THR A C   1 
ATOM   2661 O O   . THR A 1 240 ? 38.259  14.614  -22.679 1.00 14.15 ? 233  THR A O   1 
ATOM   2662 C CB  A THR A 1 240 ? 36.425  12.664  -21.785 1.00 15.53 ? 233  THR A CB  1 
ATOM   2663 O OG1 A THR A 1 240 ? 35.681  13.454  -20.854 1.00 14.17 ? 233  THR A OG1 1 
ATOM   2664 C CG2 A THR A 1 240 ? 35.875  11.240  -21.791 1.00 12.27 ? 233  THR A CG2 1 
ATOM   2665 N N   . ARG A 1 241 ? 39.161  14.627  -20.608 1.00 13.41 ? 234  ARG A N   1 
ATOM   2666 C CA  . ARG A 1 241 ? 39.597  16.023  -20.691 1.00 15.02 ? 234  ARG A CA  1 
ATOM   2667 C C   . ARG A 1 241 ? 40.287  16.330  -22.020 1.00 15.09 ? 234  ARG A C   1 
ATOM   2668 O O   . ARG A 1 241 ? 41.226  15.647  -22.411 1.00 18.30 ? 234  ARG A O   1 
ATOM   2669 C CB  . ARG A 1 241 ? 40.522  16.383  -19.519 1.00 15.66 ? 234  ARG A CB  1 
ATOM   2670 C CG  . ARG A 1 241 ? 41.011  17.822  -19.612 1.00 18.46 ? 234  ARG A CG  1 
ATOM   2671 C CD  . ARG A 1 241 ? 41.885  18.182  -18.421 1.00 17.73 ? 234  ARG A CD  1 
ATOM   2672 N NE  . ARG A 1 241 ? 41.081  18.324  -17.214 1.00 18.04 ? 234  ARG A NE  1 
ATOM   2673 C CZ  . ARG A 1 241 ? 40.579  19.483  -16.810 1.00 18.10 ? 234  ARG A CZ  1 
ATOM   2674 N NH1 . ARG A 1 241 ? 40.821  20.565  -17.520 1.00 18.46 ? 234  ARG A NH1 1 
ATOM   2675 N NH2 . ARG A 1 241 ? 39.850  19.559  -15.703 1.00 20.60 ? 234  ARG A NH2 1 
ATOM   2676 N N   . GLY A 1 242 ? 39.761  17.332  -22.730 1.00 15.83 ? 235  GLY A N   1 
ATOM   2677 C CA  . GLY A 1 242 ? 40.306  17.752  -24.011 1.00 23.58 ? 235  GLY A CA  1 
ATOM   2678 C C   . GLY A 1 242 ? 40.135  16.811  -25.199 1.00 23.09 ? 235  GLY A C   1 
ATOM   2679 O O   . GLY A 1 242 ? 40.742  17.043  -26.250 1.00 17.50 ? 235  GLY A O   1 
ATOM   2680 N N   . LEU A 1 243 ? 39.311  15.769  -25.065 1.00 15.54 ? 236  LEU A N   1 
ATOM   2681 C CA  . LEU A 1 243 ? 39.145  14.817  -26.165 1.00 11.65 ? 236  LEU A CA  1 
ATOM   2682 C C   . LEU A 1 243 ? 38.295  15.403  -27.281 1.00 18.02 ? 236  LEU A C   1 
ATOM   2683 O O   . LEU A 1 243 ? 38.466  15.042  -28.444 1.00 20.48 ? 236  LEU A O   1 
ATOM   2684 C CB  A LEU A 1 243 ? 38.520  13.516  -25.650 0.29 15.95 ? 236  LEU A CB  1 
ATOM   2685 C CB  B LEU A 1 243 ? 38.507  13.512  -25.687 0.71 15.81 ? 236  LEU A CB  1 
ATOM   2686 C CG  A LEU A 1 243 ? 38.733  12.200  -26.403 0.29 10.85 ? 236  LEU A CG  1 
ATOM   2687 C CG  B LEU A 1 243 ? 39.367  12.484  -24.952 0.71 11.91 ? 236  LEU A CG  1 
ATOM   2688 C CD1 A LEU A 1 243 ? 38.445  11.034  -25.475 0.29 15.67 ? 236  LEU A CD1 1 
ATOM   2689 C CD1 B LEU A 1 243 ? 38.488  11.307  -24.508 0.71 16.87 ? 236  LEU A CD1 1 
ATOM   2690 C CD2 A LEU A 1 243 ? 37.845  12.107  -27.631 0.29 10.49 ? 236  LEU A CD2 1 
ATOM   2691 C CD2 B LEU A 1 243 ? 40.514  11.985  -25.811 0.71 12.69 ? 236  LEU A CD2 1 
ATOM   2692 N N   . PHE A 1 244 ? 37.355  16.275  -26.934 1.00 14.57 ? 237  PHE A N   1 
ATOM   2693 C CA  . PHE A 1 244 ? 36.545  16.913  -27.962 1.00 13.39 ? 237  PHE A CA  1 
ATOM   2694 C C   . PHE A 1 244 ? 36.303  18.403  -27.649 1.00 12.01 ? 237  PHE A C   1 
ATOM   2695 O O   . PHE A 1 244 ? 36.787  18.917  -26.622 1.00 16.04 ? 237  PHE A O   1 
ATOM   2696 C CB  . PHE A 1 244 ? 35.228  16.127  -28.167 1.00 9.40  ? 237  PHE A CB  1 
ATOM   2697 C CG  . PHE A 1 244 ? 34.400  15.959  -26.913 1.00 11.15 ? 237  PHE A CG  1 
ATOM   2698 C CD1 . PHE A 1 244 ? 33.351  16.835  -26.651 1.00 10.04 ? 237  PHE A CD1 1 
ATOM   2699 C CD2 . PHE A 1 244 ? 34.656  14.934  -26.006 1.00 10.67 ? 237  PHE A CD2 1 
ATOM   2700 C CE1 . PHE A 1 244 ? 32.581  16.706  -25.525 1.00 10.78 ? 237  PHE A CE1 1 
ATOM   2701 C CE2 . PHE A 1 244 ? 33.880  14.803  -24.860 1.00 11.49 ? 237  PHE A CE2 1 
ATOM   2702 C CZ  . PHE A 1 244 ? 32.830  15.705  -24.620 1.00 9.99  ? 237  PHE A CZ  1 
ATOM   2703 N N   . HIS A 1 245 ? 35.589  19.105  -28.535 1.00 11.87 ? 238  HIS A N   1 
ATOM   2704 C CA  . HIS A 1 245 ? 35.716  20.564  -28.622 1.00 9.25  ? 238  HIS A CA  1 
ATOM   2705 C C   . HIS A 1 245 ? 34.418  21.357  -28.681 1.00 14.02 ? 238  HIS A C   1 
ATOM   2706 O O   . HIS A 1 245 ? 34.444  22.598  -28.607 1.00 15.11 ? 238  HIS A O   1 
ATOM   2707 C CB  . HIS A 1 245 ? 36.550  20.892  -29.867 1.00 14.59 ? 238  HIS A CB  1 
ATOM   2708 C CG  . HIS A 1 245 ? 37.812  20.106  -29.941 1.00 16.67 ? 238  HIS A CG  1 
ATOM   2709 N ND1 . HIS A 1 245 ? 37.870  18.862  -30.526 1.00 15.45 ? 238  HIS A ND1 1 
ATOM   2710 C CD2 . HIS A 1 245 ? 39.051  20.357  -29.455 1.00 16.09 ? 238  HIS A CD2 1 
ATOM   2711 C CE1 . HIS A 1 245 ? 39.099  18.388  -30.419 1.00 17.59 ? 238  HIS A CE1 1 
ATOM   2712 N NE2 . HIS A 1 245 ? 39.831  19.272  -29.766 1.00 17.31 ? 238  HIS A NE2 1 
ATOM   2713 N N   . ARG A 1 246 ? 33.304  20.646  -28.868 1.00 12.69 ? 239  ARG A N   1 
ATOM   2714 C CA  . ARG A 1 246 ? 31.948  21.211  -28.753 1.00 10.86 ? 239  ARG A CA  1 
ATOM   2715 C C   . ARG A 1 246 ? 31.067  20.136  -28.176 1.00 11.50 ? 239  ARG A C   1 
ATOM   2716 O O   . ARG A 1 246 ? 31.335  18.938  -28.378 1.00 10.67 ? 239  ARG A O   1 
ATOM   2717 C CB  . ARG A 1 246 ? 31.360  21.638  -30.100 1.00 13.81 ? 239  ARG A CB  1 
ATOM   2718 C CG  . ARG A 1 246 ? 32.013  22.813  -30.830 1.00 14.28 ? 239  ARG A CG  1 
ATOM   2719 C CD  . ARG A 1 246 ? 33.151  22.326  -31.678 1.00 15.15 ? 239  ARG A CD  1 
ATOM   2720 N NE  . ARG A 1 246 ? 33.673  23.320  -32.616 1.00 16.61 ? 239  ARG A NE  1 
ATOM   2721 C CZ  . ARG A 1 246 ? 34.507  24.302  -32.287 1.00 17.33 ? 239  ARG A CZ  1 
ATOM   2722 N NH1 . ARG A 1 246 ? 34.898  24.470  -31.021 1.00 18.28 ? 239  ARG A NH1 1 
ATOM   2723 N NH2 . ARG A 1 246 ? 34.952  25.122  -33.235 1.00 21.70 ? 239  ARG A NH2 1 
ATOM   2724 N N   . GLY A 1 247 ? 30.006  20.534  -27.489 1.00 13.72 ? 240  GLY A N   1 
ATOM   2725 C CA  . GLY A 1 247 ? 28.990  19.579  -27.087 1.00 9.98  ? 240  GLY A CA  1 
ATOM   2726 C C   . GLY A 1 247 ? 27.585  20.093  -27.331 1.00 13.54 ? 240  GLY A C   1 
ATOM   2727 O O   . GLY A 1 247 ? 27.350  21.284  -27.226 1.00 11.32 ? 240  GLY A O   1 
ATOM   2728 N N   . ILE A 1 248 ? 26.665  19.192  -27.674 1.00 10.57 ? 241  ILE A N   1 
ATOM   2729 C CA  . ILE A 1 248 ? 25.255  19.550  -27.847 1.00 12.30 ? 241  ILE A CA  1 
ATOM   2730 C C   . ILE A 1 248 ? 24.382  18.615  -27.008 1.00 11.94 ? 241  ILE A C   1 
ATOM   2731 O O   . ILE A 1 248 ? 24.399  17.387  -27.185 1.00 11.01 ? 241  ILE A O   1 
ATOM   2732 C CB  . ILE A 1 248 ? 24.792  19.493  -29.320 1.00 10.20 ? 241  ILE A CB  1 
ATOM   2733 C CG1 . ILE A 1 248 ? 25.789  20.218  -30.247 1.00 12.24 ? 241  ILE A CG1 1 
ATOM   2734 C CG2 . ILE A 1 248 ? 23.370  20.089  -29.428 1.00 14.56 ? 241  ILE A CG2 1 
ATOM   2735 C CD1 . ILE A 1 248 ? 25.488  20.037  -31.748 1.00 11.81 ? 241  ILE A CD1 1 
ATOM   2736 N N   . LEU A 1 249 ? 23.636  19.207  -26.082 1.00 11.93 ? 242  LEU A N   1 
ATOM   2737 C CA  . LEU A 1 249 ? 22.727  18.473  -25.202 1.00 12.17 ? 242  LEU A CA  1 
ATOM   2738 C C   . LEU A 1 249 ? 21.274  18.648  -25.639 1.00 12.22 ? 242  LEU A C   1 
ATOM   2739 O O   . LEU A 1 249 ? 20.667  19.682  -25.391 1.00 14.04 ? 242  LEU A O   1 
ATOM   2740 C CB  . LEU A 1 249 ? 22.899  18.928  -23.749 1.00 12.83 ? 242  LEU A CB  1 
ATOM   2741 C CG  . LEU A 1 249 ? 24.340  18.997  -23.209 1.00 12.62 ? 242  LEU A CG  1 
ATOM   2742 C CD1 . LEU A 1 249 ? 24.378  19.428  -21.738 1.00 11.97 ? 242  LEU A CD1 1 
ATOM   2743 C CD2 . LEU A 1 249 ? 25.069  17.663  -23.384 1.00 11.79 ? 242  LEU A CD2 1 
ATOM   2744 N N   . MET A 1 250 ? 20.730  17.609  -26.262 1.00 14.20 ? 243  MET A N   1 
ATOM   2745 C CA  . MET A 1 250 ? 19.377  17.634  -26.797 1.00 10.72 ? 243  MET A CA  1 
ATOM   2746 C C   . MET A 1 250 ? 18.418  16.931  -25.837 1.00 10.26 ? 243  MET A C   1 
ATOM   2747 O O   . MET A 1 250 ? 18.445  15.723  -25.699 1.00 11.81 ? 243  MET A O   1 
ATOM   2748 C CB  . MET A 1 250 ? 19.349  16.969  -28.172 1.00 12.37 ? 243  MET A CB  1 
ATOM   2749 C CG  . MET A 1 250 ? 20.424  17.482  -29.116 1.00 11.67 ? 243  MET A CG  1 
ATOM   2750 S SD  . MET A 1 250 ? 20.602  16.483  -30.613 1.00 15.19 ? 243  MET A SD  1 
ATOM   2751 C CE  . MET A 1 250 ? 19.017  16.754  -31.392 1.00 17.14 ? 243  MET A CE  1 
ATOM   2752 N N   . SER A 1 251 ? 17.578  17.719  -25.186 1.00 11.16 ? 244  SER A N   1 
ATOM   2753 C CA  . SER A 1 251 ? 16.597  17.238  -24.227 1.00 9.75  ? 244  SER A CA  1 
ATOM   2754 C C   . SER A 1 251 ? 17.233  16.333  -23.186 1.00 10.59 ? 244  SER A C   1 
ATOM   2755 O O   . SER A 1 251 ? 16.844  15.166  -23.022 1.00 12.30 ? 244  SER A O   1 
ATOM   2756 C CB  . SER A 1 251 ? 15.451  16.517  -24.929 1.00 13.09 ? 244  SER A CB  1 
ATOM   2757 O OG  . SER A 1 251 ? 14.802  17.374  -25.868 1.00 13.07 ? 244  SER A OG  1 
ATOM   2758 N N   . GLY A 1 252 ? 18.208  16.877  -22.468 1.00 11.20 ? 245  GLY A N   1 
ATOM   2759 C CA  . GLY A 1 252 ? 18.769  16.182  -21.316 1.00 11.40 ? 245  GLY A CA  1 
ATOM   2760 C C   . GLY A 1 252 ? 20.128  16.654  -20.878 1.00 11.67 ? 245  GLY A C   1 
ATOM   2761 O O   . GLY A 1 252 ? 20.811  17.411  -21.581 1.00 11.95 ? 245  GLY A O   1 
ATOM   2762 N N   . ASN A 1 253 ? 20.505  16.201  -19.682 1.00 11.75 ? 246  ASN A N   1 
ATOM   2763 C CA  . ASN A 1 253 ? 21.813  16.467  -19.099 1.00 11.77 ? 246  ASN A CA  1 
ATOM   2764 C C   . ASN A 1 253 ? 21.925  15.614  -17.843 1.00 12.79 ? 246  ASN A C   1 
ATOM   2765 O O   . ASN A 1 253 ? 20.969  14.968  -17.457 1.00 12.65 ? 246  ASN A O   1 
ATOM   2766 C CB  . ASN A 1 253 ? 21.994  17.950  -18.794 1.00 10.23 ? 246  ASN A CB  1 
ATOM   2767 C CG  . ASN A 1 253 ? 21.014  18.471  -17.753 1.00 15.78 ? 246  ASN A CG  1 
ATOM   2768 O OD1 . ASN A 1 253 ? 21.042  18.052  -16.609 1.00 18.61 ? 246  ASN A OD1 1 
ATOM   2769 N ND2 . ASN A 1 253 ? 20.168  19.421  -18.150 1.00 16.56 ? 246  ASN A ND2 1 
ATOM   2770 N N   A ALA A 1 254 ? 23.087  15.632  -17.199 0.30 12.14 ? 247  ALA A N   1 
ATOM   2771 N N   B ALA A 1 254 ? 23.083  15.630  -17.193 0.70 11.89 ? 247  ALA A N   1 
ATOM   2772 C CA  A ALA A 1 254 ? 23.354  14.729  -16.077 0.30 13.33 ? 247  ALA A CA  1 
ATOM   2773 C CA  B ALA A 1 254 ? 23.337  14.710  -16.077 0.70 13.32 ? 247  ALA A CA  1 
ATOM   2774 C C   A ALA A 1 254 ? 22.617  15.105  -14.789 0.30 16.80 ? 247  ALA A C   1 
ATOM   2775 C C   B ALA A 1 254 ? 22.671  15.130  -14.759 0.70 17.01 ? 247  ALA A C   1 
ATOM   2776 O O   A ALA A 1 254 ? 22.522  14.296  -13.866 0.30 16.24 ? 247  ALA A O   1 
ATOM   2777 O O   B ALA A 1 254 ? 22.661  14.366  -13.791 0.70 16.05 ? 247  ALA A O   1 
ATOM   2778 C CB  A ALA A 1 254 ? 24.857  14.663  -15.815 0.30 14.55 ? 247  ALA A CB  1 
ATOM   2779 C CB  B ALA A 1 254 ? 24.853  14.549  -15.875 0.70 14.52 ? 247  ALA A CB  1 
ATOM   2780 N N   A ILE A 1 255 ? 22.102  16.329  -14.726 0.30 13.29 ? 248  ILE A N   1 
ATOM   2781 N N   B ILE A 1 255 ? 22.117  16.340  -14.728 0.70 12.99 ? 248  ILE A N   1 
ATOM   2782 C CA  A ILE A 1 255 ? 21.398  16.813  -13.534 0.30 14.42 ? 248  ILE A CA  1 
ATOM   2783 C CA  B ILE A 1 255 ? 21.389  16.857  -13.554 0.70 14.30 ? 248  ILE A CA  1 
ATOM   2784 C C   A ILE A 1 255 ? 19.930  16.367  -13.555 0.30 14.20 ? 248  ILE A C   1 
ATOM   2785 C C   B ILE A 1 255 ? 19.933  16.374  -13.560 0.70 14.34 ? 248  ILE A C   1 
ATOM   2786 O O   A ILE A 1 255 ? 19.220  16.471  -12.554 0.30 14.06 ? 248  ILE A O   1 
ATOM   2787 O O   B ILE A 1 255 ? 19.230  16.473  -12.556 0.70 14.00 ? 248  ILE A O   1 
ATOM   2788 C CB  A ILE A 1 255 ? 21.509  18.364  -13.422 0.30 14.50 ? 248  ILE A CB  1 
ATOM   2789 C CB  B ILE A 1 255 ? 21.433  18.424  -13.513 0.70 14.81 ? 248  ILE A CB  1 
ATOM   2790 C CG1 A ILE A 1 255 ? 22.977  18.787  -13.454 0.30 20.22 ? 248  ILE A CG1 1 
ATOM   2791 C CG1 B ILE A 1 255 ? 22.850  18.927  -13.786 0.70 22.08 ? 248  ILE A CG1 1 
ATOM   2792 C CG2 A ILE A 1 255 ? 20.850  18.908  -12.144 0.30 16.19 ? 248  ILE A CG2 1 
ATOM   2793 C CG2 B ILE A 1 255 ? 20.882  19.004  -12.184 0.70 15.98 ? 248  ILE A CG2 1 
ATOM   2794 C CD1 A ILE A 1 255 ? 23.208  20.231  -13.066 0.30 15.62 ? 248  ILE A CD1 1 
ATOM   2795 C CD1 B ILE A 1 255 ? 23.869  18.439  -12.785 0.70 15.34 ? 248  ILE A CD1 1 
ATOM   2796 N N   . CYS A 1 256 ? 19.478  15.843  -14.692 1.00 14.77 ? 249  CYS A N   1 
ATOM   2797 C CA  . CYS A 1 256 ? 18.102  15.360  -14.793 1.00 14.25 ? 249  CYS A CA  1 
ATOM   2798 C C   . CYS A 1 256 ? 17.847  14.240  -13.786 1.00 15.55 ? 249  CYS A C   1 
ATOM   2799 O O   . CYS A 1 256 ? 18.714  13.405  -13.543 1.00 13.04 ? 249  CYS A O   1 
ATOM   2800 C CB  . CYS A 1 256 ? 17.817  14.871  -16.208 1.00 12.57 ? 249  CYS A CB  1 
ATOM   2801 S SG  . CYS A 1 256 ? 17.857  16.207  -17.463 1.00 13.43 ? 249  CYS A SG  1 
ATOM   2802 N N   . PRO A 1 257 ? 16.660  14.215  -13.181 1.00 13.89 ? 250  PRO A N   1 
ATOM   2803 C CA  . PRO A 1 257 ? 16.456  13.220  -12.116 1.00 15.77 ? 250  PRO A CA  1 
ATOM   2804 C C   . PRO A 1 257 ? 16.530  11.770  -12.615 1.00 14.41 ? 250  PRO A C   1 
ATOM   2805 O O   . PRO A 1 257 ? 16.851  10.859  -11.848 1.00 20.35 ? 250  PRO A O   1 
ATOM   2806 C CB  . PRO A 1 257 ? 15.058  13.552  -11.592 1.00 14.86 ? 250  PRO A CB  1 
ATOM   2807 C CG  . PRO A 1 257 ? 14.391  14.284  -12.681 1.00 20.22 ? 250  PRO A CG  1 
ATOM   2808 C CD  . PRO A 1 257 ? 15.454  15.020  -13.444 1.00 12.07 ? 250  PRO A CD  1 
ATOM   2809 N N   A TRP A 1 258 ? 16.266  11.571  -13.900 0.22 11.75 ? 251  TRP A N   1 
ATOM   2810 N N   B TRP A 1 258 ? 16.245  11.572  -13.898 0.78 11.59 ? 251  TRP A N   1 
ATOM   2811 C CA  A TRP A 1 258 ? 16.298  10.241  -14.491 0.22 13.32 ? 251  TRP A CA  1 
ATOM   2812 C CA  B TRP A 1 258 ? 16.301  10.250  -14.508 0.78 13.40 ? 251  TRP A CA  1 
ATOM   2813 C C   A TRP A 1 258 ? 17.691  9.825   -14.964 0.22 13.19 ? 251  TRP A C   1 
ATOM   2814 C C   B TRP A 1 258 ? 17.696  9.826   -14.957 0.78 13.34 ? 251  TRP A C   1 
ATOM   2815 O O   A TRP A 1 258 ? 17.879  8.699   -15.417 0.22 15.70 ? 251  TRP A O   1 
ATOM   2816 O O   B TRP A 1 258 ? 17.885  8.701   -15.387 0.78 15.68 ? 251  TRP A O   1 
ATOM   2817 C CB  A TRP A 1 258 ? 15.324  10.177  -15.668 0.22 12.79 ? 251  TRP A CB  1 
ATOM   2818 C CB  B TRP A 1 258 ? 15.360  10.198  -15.719 0.78 12.85 ? 251  TRP A CB  1 
ATOM   2819 C CG  A TRP A 1 258 ? 15.559  11.266  -16.670 0.22 12.78 ? 251  TRP A CG  1 
ATOM   2820 C CG  B TRP A 1 258 ? 15.540  11.350  -16.680 0.78 12.76 ? 251  TRP A CG  1 
ATOM   2821 C CD1 A TRP A 1 258 ? 14.924  12.475  -16.734 0.22 15.25 ? 251  TRP A CD1 1 
ATOM   2822 C CD1 B TRP A 1 258 ? 14.803  12.509  -16.723 0.78 15.39 ? 251  TRP A CD1 1 
ATOM   2823 C CD2 A TRP A 1 258 ? 16.513  11.258  -17.738 0.22 13.33 ? 251  TRP A CD2 1 
ATOM   2824 C CD2 B TRP A 1 258 ? 16.524  11.466  -17.715 0.78 12.55 ? 251  TRP A CD2 1 
ATOM   2825 N NE1 A TRP A 1 258 ? 15.413  13.214  -17.786 0.22 14.96 ? 251  TRP A NE1 1 
ATOM   2826 N NE1 B TRP A 1 258 ? 15.257  13.327  -17.735 0.78 13.98 ? 251  TRP A NE1 1 
ATOM   2827 C CE2 A TRP A 1 258 ? 16.390  12.489  -18.418 0.22 12.65 ? 251  TRP A CE2 1 
ATOM   2828 C CE2 B TRP A 1 258 ? 16.316  12.713  -18.355 0.78 11.87 ? 251  TRP A CE2 1 
ATOM   2829 C CE3 A TRP A 1 258 ? 17.449  10.326  -18.195 0.22 14.29 ? 251  TRP A CE3 1 
ATOM   2830 C CE3 B TRP A 1 258 ? 17.556  10.642  -18.172 0.78 14.02 ? 251  TRP A CE3 1 
ATOM   2831 C CZ2 A TRP A 1 258 ? 17.174  12.811  -19.523 0.22 11.84 ? 251  TRP A CZ2 1 
ATOM   2832 C CZ2 B TRP A 1 258 ? 17.100  13.146  -19.417 0.78 11.06 ? 251  TRP A CZ2 1 
ATOM   2833 C CZ3 A TRP A 1 258 ? 18.225  10.649  -19.291 0.22 16.27 ? 251  TRP A CZ3 1 
ATOM   2834 C CZ3 B TRP A 1 258 ? 18.330  11.079  -19.229 0.78 15.51 ? 251  TRP A CZ3 1 
ATOM   2835 C CH2 A TRP A 1 258 ? 18.083  11.880  -19.942 0.22 15.01 ? 251  TRP A CH2 1 
ATOM   2836 C CH2 B TRP A 1 258 ? 18.097  12.318  -19.837 0.78 13.58 ? 251  TRP A CH2 1 
ATOM   2837 N N   . ALA A 1 259 ? 18.664  10.727  -14.867 1.00 10.84 ? 252  ALA A N   1 
ATOM   2838 C CA  . ALA A 1 259 ? 19.976  10.487  -15.493 1.00 11.33 ? 252  ALA A CA  1 
ATOM   2839 C C   . ALA A 1 259 ? 21.014  9.800   -14.621 1.00 15.55 ? 252  ALA A C   1 
ATOM   2840 O O   . ALA A 1 259 ? 22.098  9.475   -15.087 1.00 12.41 ? 252  ALA A O   1 
ATOM   2841 C CB  . ALA A 1 259 ? 20.541  11.800  -16.014 1.00 12.89 ? 252  ALA A CB  1 
ATOM   2842 N N   A ASN A 1 260 ? 20.673  9.539   -13.364 0.44 13.65 ? 253  ASN A N   1 
ATOM   2843 N N   B ASN A 1 260 ? 20.688  9.592   -13.352 0.20 13.59 ? 253  ASN A N   1 
ATOM   2844 N N   C ASN A 1 260 ? 20.681  9.630   -13.345 0.35 13.66 ? 253  ASN A N   1 
ATOM   2845 C CA  A ASN A 1 260 ? 21.541  8.755   -12.499 0.44 13.75 ? 253  ASN A CA  1 
ATOM   2846 C CA  B ASN A 1 260 ? 21.538  8.789   -12.487 0.20 13.81 ? 253  ASN A CA  1 
ATOM   2847 C CA  C ASN A 1 260 ? 21.630  9.164   -12.346 0.35 13.32 ? 253  ASN A CA  1 
ATOM   2848 C C   A ASN A 1 260 ? 20.735  8.145   -11.363 0.44 13.50 ? 253  ASN A C   1 
ATOM   2849 C C   B ASN A 1 260 ? 20.765  8.280   -11.284 0.20 13.49 ? 253  ASN A C   1 
ATOM   2850 C C   C ASN A 1 260 ? 20.873  8.559   -11.169 0.35 13.27 ? 253  ASN A C   1 
ATOM   2851 O O   A ASN A 1 260 ? 19.580  8.519   -11.153 0.44 12.60 ? 253  ASN A O   1 
ATOM   2852 O O   B ASN A 1 260 ? 19.692  8.791   -10.958 0.20 13.39 ? 253  ASN A O   1 
ATOM   2853 O O   C ASN A 1 260 ? 19.785  9.028   -10.821 0.35 13.86 ? 253  ASN A O   1 
ATOM   2854 C CB  A ASN A 1 260 ? 22.685  9.610   -11.949 0.44 12.73 ? 253  ASN A CB  1 
ATOM   2855 C CB  B ASN A 1 260 ? 22.773  9.576   -12.030 0.20 12.72 ? 253  ASN A CB  1 
ATOM   2856 C CB  C ASN A 1 260 ? 22.527  10.321  -11.885 0.35 9.20  ? 253  ASN A CB  1 
ATOM   2857 C CG  A ASN A 1 260 ? 22.194  10.859  -11.274 0.44 14.77 ? 253  ASN A CG  1 
ATOM   2858 C CG  B ASN A 1 260 ? 22.420  10.819  -11.253 0.20 13.72 ? 253  ASN A CG  1 
ATOM   2859 C CG  C ASN A 1 260 ? 23.693  9.862   -11.039 0.35 13.00 ? 253  ASN A CG  1 
ATOM   2860 O OD1 A ASN A 1 260 ? 21.969  10.873  -10.066 0.44 13.82 ? 253  ASN A OD1 1 
ATOM   2861 O OD1 B ASN A 1 260 ? 22.114  10.753  -10.064 0.20 13.60 ? 253  ASN A OD1 1 
ATOM   2862 O OD1 C ASN A 1 260 ? 23.535  9.554   -9.857  0.35 18.87 ? 253  ASN A OD1 1 
ATOM   2863 N ND2 A ASN A 1 260 ? 22.009  11.920  -12.052 0.44 16.98 ? 253  ASN A ND2 1 
ATOM   2864 N ND2 B ASN A 1 260 ? 22.476  11.969  -11.915 0.20 15.04 ? 253  ASN A ND2 1 
ATOM   2865 N ND2 C ASN A 1 260 ? 24.884  9.839   -11.633 0.35 12.46 ? 253  ASN A ND2 1 
ATOM   2866 N N   A THR A 1 261 ? 21.342  7.210   -10.639 0.44 12.10 ? 254  THR A N   1 
ATOM   2867 N N   B THR A 1 261 ? 21.317  7.264   -10.633 0.20 12.20 ? 254  THR A N   1 
ATOM   2868 N N   C THR A 1 261 ? 21.432  7.515   -10.566 0.35 11.34 ? 254  THR A N   1 
ATOM   2869 C CA  A THR A 1 261 ? 20.649  6.508   -9.559  0.44 12.57 ? 254  THR A CA  1 
ATOM   2870 C CA  B THR A 1 261 ? 20.661  6.637   -9.495  0.20 12.62 ? 254  THR A CA  1 
ATOM   2871 C CA  C THR A 1 261 ? 20.766  6.845   -9.448  0.35 11.79 ? 254  THR A CA  1 
ATOM   2872 C C   A THR A 1 261 ? 21.612  5.698   -8.696  0.44 13.63 ? 254  THR A C   1 
ATOM   2873 C C   B THR A 1 261 ? 21.661  5.823   -8.688  0.20 13.22 ? 254  THR A C   1 
ATOM   2874 C C   C THR A 1 261 ? 21.749  5.984   -8.658  0.35 12.76 ? 254  THR A C   1 
ATOM   2875 O O   A THR A 1 261 ? 22.478  5.003   -9.211  0.44 13.04 ? 254  THR A O   1 
ATOM   2876 O O   B THR A 1 261 ? 22.599  5.255   -9.238  0.20 13.11 ? 254  THR A O   1 
ATOM   2877 O O   C THR A 1 261 ? 22.746  5.521   -9.194  0.35 12.00 ? 254  THR A O   1 
ATOM   2878 C CB  A THR A 1 261 ? 19.548  5.562   -10.118 0.44 13.56 ? 254  THR A CB  1 
ATOM   2879 C CB  B THR A 1 261 ? 19.497  5.723   -9.946  0.20 14.88 ? 254  THR A CB  1 
ATOM   2880 C CB  C THR A 1 261 ? 19.585  5.967   -9.944  0.35 15.68 ? 254  THR A CB  1 
ATOM   2881 O OG1 A THR A 1 261 ? 18.902  4.878   -9.036  0.44 16.93 ? 254  THR A OG1 1 
ATOM   2882 O OG1 B THR A 1 261 ? 18.935  5.059   -8.808  0.20 16.56 ? 254  THR A OG1 1 
ATOM   2883 O OG1 C THR A 1 261 ? 18.869  5.427   -8.824  0.35 17.78 ? 254  THR A OG1 1 
ATOM   2884 C CG2 A THR A 1 261 ? 20.127  4.540   -11.091 0.44 15.75 ? 254  THR A CG2 1 
ATOM   2885 C CG2 B THR A 1 261 ? 19.981  4.681   -10.945 0.20 15.39 ? 254  THR A CG2 1 
ATOM   2886 C CG2 C THR A 1 261 ? 20.085  4.830   -10.823 0.35 15.86 ? 254  THR A CG2 1 
ATOM   2887 N N   . GLN A 1 262 ? 21.463  5.775   -7.376  1.00 15.06 ? 255  GLN A N   1 
ATOM   2888 C CA  . GLN A 1 262 ? 22.306  4.947   -6.527  1.00 12.35 ? 255  GLN A CA  1 
ATOM   2889 C C   . GLN A 1 262 ? 21.695  3.553   -6.479  1.00 14.81 ? 255  GLN A C   1 
ATOM   2890 O O   . GLN A 1 262 ? 20.858  3.255   -5.628  1.00 15.93 ? 255  GLN A O   1 
ATOM   2891 C CB  A GLN A 1 262 ? 22.408  5.519   -5.107  0.17 13.32 ? 255  GLN A CB  1 
ATOM   2892 C CB  B GLN A 1 262 ? 22.466  5.575   -5.143  0.83 13.27 ? 255  GLN A CB  1 
ATOM   2893 C CG  A GLN A 1 262 ? 23.424  6.635   -4.923  0.17 16.21 ? 255  GLN A CG  1 
ATOM   2894 C CG  B GLN A 1 262 ? 23.156  6.953   -5.228  0.83 13.88 ? 255  GLN A CG  1 
ATOM   2895 C CD  A GLN A 1 262 ? 24.717  6.151   -4.286  0.17 17.54 ? 255  GLN A CD  1 
ATOM   2896 C CD  B GLN A 1 262 ? 24.451  6.912   -6.044  0.83 19.19 ? 255  GLN A CD  1 
ATOM   2897 O OE1 A GLN A 1 262 ? 24.749  5.770   -3.109  0.17 20.03 ? 255  GLN A OE1 1 
ATOM   2898 O OE1 B GLN A 1 262 ? 24.554  7.512   -7.121  0.83 16.74 ? 255  GLN A OE1 1 
ATOM   2899 N NE2 A GLN A 1 262 ? 25.792  6.162   -5.062  0.17 22.57 ? 255  GLN A NE2 1 
ATOM   2900 N NE2 B GLN A 1 262 ? 25.439  6.199   -5.533  0.83 21.16 ? 255  GLN A NE2 1 
ATOM   2901 N N   . CYS A 1 263 ? 22.124  2.701   -7.409  1.00 13.92 ? 256  CYS A N   1 
ATOM   2902 C CA  . CYS A 1 263 ? 21.478  1.414   -7.662  1.00 14.04 ? 256  CYS A CA  1 
ATOM   2903 C C   . CYS A 1 263 ? 22.214  0.216   -7.050  1.00 12.94 ? 256  CYS A C   1 
ATOM   2904 O O   . CYS A 1 263 ? 21.969  -0.910  -7.439  1.00 13.06 ? 256  CYS A O   1 
ATOM   2905 C CB  . CYS A 1 263 ? 21.338  1.195   -9.174  1.00 12.23 ? 256  CYS A CB  1 
ATOM   2906 S SG  . CYS A 1 263 ? 22.877  1.397   -10.136 1.00 15.76 ? 256  CYS A SG  1 
ATOM   2907 N N   . GLN A 1 264 ? 23.065  0.466   -6.057  1.00 12.37 ? 257  GLN A N   1 
ATOM   2908 C CA  . GLN A 1 264 ? 23.917  -0.569  -5.487  1.00 15.01 ? 257  GLN A CA  1 
ATOM   2909 C C   . GLN A 1 264 ? 23.162  -1.744  -4.846  1.00 16.36 ? 257  GLN A C   1 
ATOM   2910 O O   . GLN A 1 264 ? 23.678  -2.858  -4.808  1.00 20.26 ? 257  GLN A O   1 
ATOM   2911 C CB  . GLN A 1 264 ? 24.868  0.050   -4.449  1.00 12.71 ? 257  GLN A CB  1 
ATOM   2912 C CG  . GLN A 1 264 ? 25.990  0.942   -5.042  1.00 12.47 ? 257  GLN A CG  1 
ATOM   2913 C CD  . GLN A 1 264 ? 25.475  2.232   -5.642  1.00 10.81 ? 257  GLN A CD  1 
ATOM   2914 O OE1 . GLN A 1 264 ? 24.533  2.829   -5.127  1.00 14.21 ? 257  GLN A OE1 1 
ATOM   2915 N NE2 . GLN A 1 264 ? 26.082  2.662   -6.759  1.00 10.76 ? 257  GLN A NE2 1 
ATOM   2916 N N   A HIS A 1 265 ? 21.952  -1.485  -4.357  0.32 15.46 ? 258  HIS A N   1 
ATOM   2917 N N   B HIS A 1 265 ? 21.948  -1.520  -4.349  0.68 15.46 ? 258  HIS A N   1 
ATOM   2918 C CA  A HIS A 1 265 ? 21.142  -2.512  -3.710  0.32 13.41 ? 258  HIS A CA  1 
ATOM   2919 C CA  B HIS A 1 265 ? 21.212  -2.621  -3.730  0.68 13.28 ? 258  HIS A CA  1 
ATOM   2920 C C   A HIS A 1 265 ? 20.325  -3.319  -4.722  0.32 14.35 ? 258  HIS A C   1 
ATOM   2921 C C   B HIS A 1 265 ? 20.353  -3.408  -4.730  0.68 14.08 ? 258  HIS A C   1 
ATOM   2922 O O   A HIS A 1 265 ? 19.788  -4.382  -4.404  0.32 17.66 ? 258  HIS A O   1 
ATOM   2923 O O   B HIS A 1 265 ? 19.827  -4.481  -4.415  0.68 17.54 ? 258  HIS A O   1 
ATOM   2924 C CB  A HIS A 1 265 ? 20.218  -1.860  -2.673  0.32 13.74 ? 258  HIS A CB  1 
ATOM   2925 C CB  B HIS A 1 265 ? 20.344  -2.087  -2.583  0.68 13.63 ? 258  HIS A CB  1 
ATOM   2926 C CG  A HIS A 1 265 ? 19.338  -2.826  -1.944  0.32 19.60 ? 258  HIS A CG  1 
ATOM   2927 C CG  B HIS A 1 265 ? 19.605  -3.154  -1.836  0.68 21.48 ? 258  HIS A CG  1 
ATOM   2928 N ND1 A HIS A 1 265 ? 19.834  -3.911  -1.253  0.32 20.60 ? 258  HIS A ND1 1 
ATOM   2929 N ND1 B HIS A 1 265 ? 20.238  -4.230  -1.247  0.68 18.32 ? 258  HIS A ND1 1 
ATOM   2930 C CD2 A HIS A 1 265 ? 17.992  -2.868  -1.793  0.32 19.55 ? 258  HIS A CD2 1 
ATOM   2931 C CD2 B HIS A 1 265 ? 18.283  -3.318  -1.592  0.68 22.19 ? 258  HIS A CD2 1 
ATOM   2932 C CE1 A HIS A 1 265 ? 18.832  -4.581  -0.711  0.32 19.05 ? 258  HIS A CE1 1 
ATOM   2933 C CE1 B HIS A 1 265 ? 19.338  -5.006  -0.670  0.68 20.85 ? 258  HIS A CE1 1 
ATOM   2934 N NE2 A HIS A 1 265 ? 17.704  -3.968  -1.022  0.32 20.24 ? 258  HIS A NE2 1 
ATOM   2935 N NE2 B HIS A 1 265 ? 18.145  -4.474  -0.864  0.68 20.28 ? 258  HIS A NE2 1 
ATOM   2936 N N   A ARG A 1 266 ? 20.247  -2.818  -5.952  0.32 12.05 ? 259  ARG A N   1 
ATOM   2937 N N   B ARG A 1 266 ? 20.216  -2.891  -5.951  0.68 11.65 ? 259  ARG A N   1 
ATOM   2938 C CA  A ARG A 1 266 ? 19.344  -3.394  -6.940  0.32 14.63 ? 259  ARG A CA  1 
ATOM   2939 C CA  B ARG A 1 266 ? 19.273  -3.493  -6.884  0.68 14.47 ? 259  ARG A CA  1 
ATOM   2940 C C   A ARG A 1 266 ? 19.891  -4.678  -7.582  0.32 13.45 ? 259  ARG A C   1 
ATOM   2941 C C   B ARG A 1 266 ? 19.886  -4.701  -7.612  0.68 13.33 ? 259  ARG A C   1 
ATOM   2942 O O   A ARG A 1 266 ? 19.125  -5.465  -8.132  0.32 12.95 ? 259  ARG A O   1 
ATOM   2943 O O   B ARG A 1 266 ? 19.165  -5.465  -8.245  0.68 13.15 ? 259  ARG A O   1 
ATOM   2944 C CB  A ARG A 1 266 ? 19.015  -2.346  -8.014  0.32 13.59 ? 259  ARG A CB  1 
ATOM   2945 C CB  B ARG A 1 266 ? 18.752  -2.432  -7.870  0.68 11.92 ? 259  ARG A CB  1 
ATOM   2946 C CG  A ARG A 1 266 ? 18.582  -0.993  -7.441  0.32 18.15 ? 259  ARG A CG  1 
ATOM   2947 C CG  B ARG A 1 266 ? 18.207  -1.185  -7.172  0.68 15.99 ? 259  ARG A CG  1 
ATOM   2948 C CD  A ARG A 1 266 ? 17.403  -0.392  -8.206  0.32 14.10 ? 259  ARG A CD  1 
ATOM   2949 C CD  B ARG A 1 266 ? 17.382  -0.282  -8.097  0.68 14.13 ? 259  ARG A CD  1 
ATOM   2950 N NE  A ARG A 1 266 ? 16.879  0.814   -7.563  0.32 13.70 ? 259  ARG A NE  1 
ATOM   2951 N NE  B ARG A 1 266 ? 16.881  0.873   -7.356  0.68 14.95 ? 259  ARG A NE  1 
ATOM   2952 C CZ  A ARG A 1 266 ? 17.133  2.054   -7.965  0.32 14.60 ? 259  ARG A CZ  1 
ATOM   2953 C CZ  B ARG A 1 266 ? 17.248  2.130   -7.561  0.68 15.36 ? 259  ARG A CZ  1 
ATOM   2954 N NH1 A ARG A 1 266 ? 17.895  2.267   -9.032  0.32 8.39  ? 259  ARG A NH1 1 
ATOM   2955 N NH1 B ARG A 1 266 ? 18.080  2.431   -8.555  0.68 14.93 ? 259  ARG A NH1 1 
ATOM   2956 N NH2 A ARG A 1 266 ? 16.613  3.085   -7.308  0.32 20.05 ? 259  ARG A NH2 1 
ATOM   2957 N NH2 B ARG A 1 266 ? 16.741  3.096   -6.791  0.68 11.92 ? 259  ARG A NH2 1 
ATOM   2958 N N   . ALA A 1 267 ? 21.204  -4.901  -7.499  1.00 13.09 ? 260  ALA A N   1 
ATOM   2959 C CA  . ALA A 1 267 ? 21.797  -6.132  -8.025  1.00 9.98  ? 260  ALA A CA  1 
ATOM   2960 C C   . ALA A 1 267 ? 21.221  -7.336  -7.264  1.00 9.98  ? 260  ALA A C   1 
ATOM   2961 O O   . ALA A 1 267 ? 20.841  -8.347  -7.859  1.00 12.82 ? 260  ALA A O   1 
ATOM   2962 C CB  . ALA A 1 267 ? 23.327  -6.111  -7.932  1.00 13.13 ? 260  ALA A CB  1 
ATOM   2963 N N   . PHE A 1 268 ? 21.167  -7.200  -5.941  1.00 13.61 ? 261  PHE A N   1 
ATOM   2964 C CA  . PHE A 1 268 ? 20.554  -8.181  -5.071  1.00 12.26 ? 261  PHE A CA  1 
ATOM   2965 C C   . PHE A 1 268 ? 19.106  -8.429  -5.454  1.00 12.07 ? 261  PHE A C   1 
ATOM   2966 O O   . PHE A 1 268 ? 18.679  -9.577  -5.563  1.00 13.30 ? 261  PHE A O   1 
ATOM   2967 C CB  . PHE A 1 268 ? 20.644  -7.702  -3.621  1.00 9.83  ? 261  PHE A CB  1 
ATOM   2968 C CG  . PHE A 1 268 ? 19.829  -8.525  -2.646  1.00 14.22 ? 261  PHE A CG  1 
ATOM   2969 C CD1 . PHE A 1 268 ? 20.257  -9.780  -2.243  1.00 15.25 ? 261  PHE A CD1 1 
ATOM   2970 C CD2 . PHE A 1 268 ? 18.639  -8.035  -2.130  1.00 21.27 ? 261  PHE A CD2 1 
ATOM   2971 C CE1 . PHE A 1 268 ? 19.520  -10.527 -1.334  1.00 16.76 ? 261  PHE A CE1 1 
ATOM   2972 C CE2 . PHE A 1 268 ? 17.895  -8.780  -1.230  1.00 15.59 ? 261  PHE A CE2 1 
ATOM   2973 C CZ  . PHE A 1 268 ? 18.342  -10.022 -0.831  1.00 16.86 ? 261  PHE A CZ  1 
ATOM   2974 N N   . THR A 1 269 ? 18.355  -7.350  -5.645  1.00 11.08 ? 262  THR A N   1 
ATOM   2975 C CA  . THR A 1 269 ? 16.949  -7.474  -6.008  1.00 12.72 ? 262  THR A CA  1 
ATOM   2976 C C   . THR A 1 269 ? 16.770  -8.219  -7.347  1.00 9.84  ? 262  THR A C   1 
ATOM   2977 O O   . THR A 1 269 ? 15.925  -9.098  -7.464  1.00 16.87 ? 262  THR A O   1 
ATOM   2978 C CB  . THR A 1 269 ? 16.274  -6.102  -6.054  1.00 13.31 ? 262  THR A CB  1 
ATOM   2979 O OG1 . THR A 1 269 ? 16.388  -5.511  -4.749  1.00 16.31 ? 262  THR A OG1 1 
ATOM   2980 C CG2 . THR A 1 269 ? 14.818  -6.246  -6.409  1.00 13.27 ? 262  THR A CG2 1 
ATOM   2981 N N   A LEU A 1 270 ? 17.577  -7.858  -8.337  0.38 9.85  ? 263  LEU A N   1 
ATOM   2982 N N   B LEU A 1 270 ? 17.567  -7.866  -8.348  0.62 9.66  ? 263  LEU A N   1 
ATOM   2983 C CA  A LEU A 1 270 ? 17.572  -8.515  -9.633  0.38 11.61 ? 263  LEU A CA  1 
ATOM   2984 C CA  B LEU A 1 270 ? 17.530  -8.541  -9.632  0.62 11.52 ? 263  LEU A CA  1 
ATOM   2985 C C   A LEU A 1 270 ? 17.889  -10.002 -9.489  0.38 14.28 ? 263  LEU A C   1 
ATOM   2986 C C   B LEU A 1 270 ? 17.871  -10.021 -9.470  0.62 14.45 ? 263  LEU A C   1 
ATOM   2987 O O   A LEU A 1 270 ? 17.221  -10.851 -10.072 0.38 15.73 ? 263  LEU A O   1 
ATOM   2988 O O   B LEU A 1 270 ? 17.196  -10.886 -10.017 0.62 15.65 ? 263  LEU A O   1 
ATOM   2989 C CB  A LEU A 1 270 ? 18.582  -7.839  -10.560 0.38 10.40 ? 263  LEU A CB  1 
ATOM   2990 C CB  B LEU A 1 270 ? 18.502  -7.871  -10.599 0.62 10.41 ? 263  LEU A CB  1 
ATOM   2991 C CG  A LEU A 1 270 ? 18.740  -8.400  -11.971 0.38 12.47 ? 263  LEU A CG  1 
ATOM   2992 C CG  B LEU A 1 270 ? 18.723  -8.587  -11.928 0.62 12.17 ? 263  LEU A CG  1 
ATOM   2993 C CD1 A LEU A 1 270 ? 17.521  -8.071  -12.818 0.38 12.37 ? 263  LEU A CD1 1 
ATOM   2994 C CD1 B LEU A 1 270 ? 17.405  -8.772  -12.675 0.62 13.55 ? 263  LEU A CD1 1 
ATOM   2995 C CD2 A LEU A 1 270 ? 20.005  -7.839  -12.603 0.38 13.34 ? 263  LEU A CD2 1 
ATOM   2996 C CD2 B LEU A 1 270 ? 19.718  -7.791  -12.762 0.62 14.50 ? 263  LEU A CD2 1 
ATOM   2997 N N   . ALA A 1 271 ? 18.900  -10.313 -8.688  1.00 13.20 ? 264  ALA A N   1 
ATOM   2998 C CA  . ALA A 1 271 ? 19.289  -11.702 -8.453  1.00 11.64 ? 264  ALA A CA  1 
ATOM   2999 C C   . ALA A 1 271 ? 18.131  -12.510 -7.874  1.00 13.06 ? 264  ALA A C   1 
ATOM   3000 O O   . ALA A 1 271 ? 17.844  -13.607 -8.358  1.00 12.77 ? 264  ALA A O   1 
ATOM   3001 C CB  . ALA A 1 271 ? 20.483  -11.772 -7.530  1.00 12.63 ? 264  ALA A CB  1 
ATOM   3002 N N   A LYS A 1 272 ? 17.472  -11.961 -6.850  0.68 13.95 ? 265  LYS A N   1 
ATOM   3003 N N   B LYS A 1 272 ? 17.476  -11.956 -6.855  0.32 13.93 ? 265  LYS A N   1 
ATOM   3004 C CA  A LYS A 1 272 ? 16.341  -12.628 -6.207  0.68 13.00 ? 265  LYS A CA  1 
ATOM   3005 C CA  B LYS A 1 272 ? 16.338  -12.599 -6.207  0.32 12.94 ? 265  LYS A CA  1 
ATOM   3006 C C   A LYS A 1 272 ? 15.240  -12.905 -7.232  0.68 12.98 ? 265  LYS A C   1 
ATOM   3007 C C   B LYS A 1 272 ? 15.234  -12.895 -7.219  0.32 13.22 ? 265  LYS A C   1 
ATOM   3008 O O   A LYS A 1 272 ? 14.634  -13.976 -7.222  0.68 18.72 ? 265  LYS A O   1 
ATOM   3009 O O   B LYS A 1 272 ? 14.616  -13.958 -7.182  0.32 18.64 ? 265  LYS A O   1 
ATOM   3010 C CB  A LYS A 1 272 ? 15.791  -11.797 -5.033  0.68 14.34 ? 265  LYS A CB  1 
ATOM   3011 C CB  B LYS A 1 272 ? 15.798  -11.722 -5.072  0.32 14.30 ? 265  LYS A CB  1 
ATOM   3012 C CG  A LYS A 1 272 ? 16.734  -11.718 -3.825  0.68 15.79 ? 265  LYS A CG  1 
ATOM   3013 C CG  B LYS A 1 272 ? 15.932  -12.339 -3.684  0.32 16.56 ? 265  LYS A CG  1 
ATOM   3014 C CD  A LYS A 1 272 ? 17.015  -13.087 -3.221  0.68 18.93 ? 265  LYS A CD  1 
ATOM   3015 C CD  B LYS A 1 272 ? 17.327  -12.889 -3.463  0.32 17.85 ? 265  LYS A CD  1 
ATOM   3016 C CE  A LYS A 1 272 ? 15.907  -13.544 -2.287  0.68 23.53 ? 265  LYS A CE  1 
ATOM   3017 C CE  B LYS A 1 272 ? 17.539  -13.324 -2.021  0.32 9.62  ? 265  LYS A CE  1 
ATOM   3018 N NZ  A LYS A 1 272 ? 16.173  -13.186 -0.845  0.68 13.61 ? 265  LYS A NZ  1 
ATOM   3019 N NZ  B LYS A 1 272 ? 16.583  -14.375 -1.580  0.32 11.60 ? 265  LYS A NZ  1 
ATOM   3020 N N   . LEU A 1 273 ? 15.003  -11.959 -8.133  1.00 15.12 ? 266  LEU A N   1 
ATOM   3021 C CA  . LEU A 1 273 ? 13.984  -12.133 -9.169  1.00 16.60 ? 266  LEU A CA  1 
ATOM   3022 C C   . LEU A 1 273 ? 14.327  -13.257 -10.126 1.00 15.65 ? 266  LEU A C   1 
ATOM   3023 O O   . LEU A 1 273 ? 13.435  -13.887 -10.703 1.00 22.22 ? 266  LEU A O   1 
ATOM   3024 C CB  . LEU A 1 273 ? 13.814  -10.850 -9.979  1.00 22.06 ? 266  LEU A CB  1 
ATOM   3025 C CG  . LEU A 1 273 ? 12.896  -9.800  -9.383  1.00 22.88 ? 266  LEU A CG  1 
ATOM   3026 C CD1 . LEU A 1 273 ? 13.129  -8.457  -10.078 1.00 20.70 ? 266  LEU A CD1 1 
ATOM   3027 C CD2 . LEU A 1 273 ? 11.462  -10.264 -9.538  1.00 25.37 ? 266  LEU A CD2 1 
ATOM   3028 N N   A ALA A 1 274 ? 15.623  -13.495 -10.304 0.40 15.54 ? 267  ALA A N   1 
ATOM   3029 N N   B ALA A 1 274 ? 15.625  -13.485 -10.303 0.60 15.52 ? 267  ALA A N   1 
ATOM   3030 C CA  A ALA A 1 274 ? 16.117  -14.534 -11.199 0.40 14.79 ? 267  ALA A CA  1 
ATOM   3031 C CA  B ALA A 1 274 ? 16.139  -14.522 -11.190 0.60 14.67 ? 267  ALA A CA  1 
ATOM   3032 C C   A ALA A 1 274 ? 16.205  -15.896 -10.517 0.40 17.46 ? 267  ALA A C   1 
ATOM   3033 C C   B ALA A 1 274 ? 16.335  -15.861 -10.481 0.60 17.56 ? 267  ALA A C   1 
ATOM   3034 O O   A ALA A 1 274 ? 16.536  -16.895 -11.153 0.40 21.28 ? 267  ALA A O   1 
ATOM   3035 O O   B ALA A 1 274 ? 16.873  -16.802 -11.061 0.60 20.56 ? 267  ALA A O   1 
ATOM   3036 C CB  A ALA A 1 274 ? 17.479  -14.138 -11.755 0.40 20.53 ? 267  ALA A CB  1 
ATOM   3037 C CB  B ALA A 1 274 ? 17.452  -14.062 -11.814 0.60 20.58 ? 267  ALA A CB  1 
ATOM   3038 N N   . GLY A 1 275 ? 15.921  -15.934 -9.222  1.00 17.42 ? 268  GLY A N   1 
ATOM   3039 C CA  . GLY A 1 275 ? 15.916  -17.196 -8.498  1.00 17.16 ? 268  GLY A CA  1 
ATOM   3040 C C   . GLY A 1 275 ? 17.047  -17.440 -7.521  1.00 18.28 ? 268  GLY A C   1 
ATOM   3041 O O   . GLY A 1 275 ? 17.134  -18.520 -6.932  1.00 18.84 ? 268  GLY A O   1 
ATOM   3042 N N   . TYR A 1 276 ? 17.914  -16.449 -7.349  1.00 14.73 ? 269  TYR A N   1 
ATOM   3043 C CA  . TYR A 1 276 ? 18.931  -16.499 -6.310  1.00 12.20 ? 269  TYR A CA  1 
ATOM   3044 C C   . TYR A 1 276 ? 18.351  -16.750 -4.923  1.00 12.90 ? 269  TYR A C   1 
ATOM   3045 O O   . TYR A 1 276 ? 17.358  -16.132 -4.520  1.00 15.86 ? 269  TYR A O   1 
ATOM   3046 C CB  . TYR A 1 276 ? 19.726  -15.194 -6.314  1.00 22.31 ? 269  TYR A CB  1 
ATOM   3047 C CG  . TYR A 1 276 ? 20.714  -15.014 -5.179  1.00 13.56 ? 269  TYR A CG  1 
ATOM   3048 C CD1 . TYR A 1 276 ? 21.913  -15.711 -5.164  1.00 15.93 ? 269  TYR A CD1 1 
ATOM   3049 C CD2 . TYR A 1 276 ? 20.460  -14.107 -4.150  1.00 16.18 ? 269  TYR A CD2 1 
ATOM   3050 C CE1 . TYR A 1 276 ? 22.822  -15.531 -4.147  1.00 11.97 ? 269  TYR A CE1 1 
ATOM   3051 C CE2 . TYR A 1 276 ? 21.355  -13.922 -3.131  1.00 14.30 ? 269  TYR A CE2 1 
ATOM   3052 C CZ  . TYR A 1 276 ? 22.533  -14.638 -3.127  1.00 16.91 ? 269  TYR A CZ  1 
ATOM   3053 O OH  . TYR A 1 276 ? 23.449  -14.447 -2.126  1.00 15.16 ? 269  TYR A OH  1 
ATOM   3054 N N   . LYS A 1 277 ? 18.971  -17.676 -4.205  1.00 10.63 ? 270  LYS A N   1 
ATOM   3055 C CA  . LYS A 1 277 ? 18.720  -17.851 -2.774  1.00 11.57 ? 270  LYS A CA  1 
ATOM   3056 C C   . LYS A 1 277 ? 20.017  -17.660 -2.022  1.00 16.32 ? 270  LYS A C   1 
ATOM   3057 O O   . LYS A 1 277 ? 21.022  -18.318 -2.312  1.00 18.15 ? 270  LYS A O   1 
ATOM   3058 C CB  . LYS A 1 277 ? 18.145  -19.231 -2.479  1.00 15.27 ? 270  LYS A CB  1 
ATOM   3059 C CG  . LYS A 1 277 ? 16.993  -19.622 -3.381  1.00 23.87 ? 270  LYS A CG  1 
ATOM   3060 C CD  . LYS A 1 277 ? 15.836  -18.654 -3.222  1.00 23.75 ? 270  LYS A CD  1 
ATOM   3061 C CE  . LYS A 1 277 ? 14.770  -18.916 -4.293  1.00 34.36 ? 270  LYS A CE  1 
ATOM   3062 N NZ  . LYS A 1 277 ? 13.487  -18.225 -4.020  1.00 33.58 ? 270  LYS A NZ  1 
ATOM   3063 N N   . GLY A 1 278 ? 20.001  -16.766 -1.043  1.00 13.05 ? 271  GLY A N   1 
ATOM   3064 C CA  . GLY A 1 278 ? 21.199  -16.522 -0.270  1.00 17.98 ? 271  GLY A CA  1 
ATOM   3065 C C   . GLY A 1 278 ? 21.093  -15.182 0.413   1.00 17.62 ? 271  GLY A C   1 
ATOM   3066 O O   . GLY A 1 278 ? 20.028  -14.570 0.425   1.00 17.48 ? 271  GLY A O   1 
ATOM   3067 N N   A GLU A 1 279 ? 22.219  -14.727 0.955   0.61 19.19 ? 272  GLU A N   1 
ATOM   3068 N N   B GLU A 1 279 ? 22.195  -14.708 0.983   0.39 19.12 ? 272  GLU A N   1 
ATOM   3069 C CA  A GLU A 1 279 ? 22.292  -13.458 1.661   0.61 23.12 ? 272  GLU A CA  1 
ATOM   3070 C CA  B GLU A 1 279 ? 22.169  -13.455 1.728   0.39 23.19 ? 272  GLU A CA  1 
ATOM   3071 C C   A GLU A 1 279 ? 22.391  -12.264 0.725   0.61 16.32 ? 272  GLU A C   1 
ATOM   3072 C C   B GLU A 1 279 ? 22.441  -12.241 0.846   0.39 16.06 ? 272  GLU A C   1 
ATOM   3073 O O   A GLU A 1 279 ? 22.729  -12.399 -0.465  0.61 15.31 ? 272  GLU A O   1 
ATOM   3074 O O   B GLU A 1 279 ? 22.837  -12.370 -0.324  0.39 17.20 ? 272  GLU A O   1 
ATOM   3075 C CB  A GLU A 1 279 ? 23.498  -13.448 2.605   0.61 19.32 ? 272  GLU A CB  1 
ATOM   3076 C CB  B GLU A 1 279 ? 23.189  -13.496 2.869   0.39 18.32 ? 272  GLU A CB  1 
ATOM   3077 C CG  A GLU A 1 279 ? 23.543  -14.600 3.581   0.61 21.13 ? 272  GLU A CG  1 
ATOM   3078 C CG  B GLU A 1 279 ? 22.980  -14.622 3.867   0.39 22.52 ? 272  GLU A CG  1 
ATOM   3079 C CD  A GLU A 1 279 ? 22.365  -14.617 4.537   0.61 17.22 ? 272  GLU A CD  1 
ATOM   3080 C CD  B GLU A 1 279 ? 21.929  -14.309 4.920   0.39 25.63 ? 272  GLU A CD  1 
ATOM   3081 O OE1 A GLU A 1 279 ? 21.826  -13.533 4.851   0.61 32.64 ? 272  GLU A OE1 1 
ATOM   3082 O OE1 B GLU A 1 279 ? 21.019  -13.497 4.647   0.39 22.74 ? 272  GLU A OE1 1 
ATOM   3083 O OE2 A GLU A 1 279 ? 21.979  -15.722 4.970   0.61 26.32 ? 272  GLU A OE2 1 
ATOM   3084 O OE2 B GLU A 1 279 ? 22.019  -14.874 6.032   0.39 38.45 ? 272  GLU A OE2 1 
ATOM   3085 N N   A ASP A 1 280 ? 22.103  -11.089 1.273   0.61 16.93 ? 273  ASP A N   1 
ATOM   3086 N N   B ASP A 1 280 ? 22.217  -11.059 1.414   0.39 17.55 ? 273  ASP A N   1 
ATOM   3087 C CA  A ASP A 1 280 ? 22.411  -9.834  0.607   0.61 20.06 ? 273  ASP A CA  1 
ATOM   3088 C CA  B ASP A 1 280 ? 22.631  -9.806  0.794   0.39 21.17 ? 273  ASP A CA  1 
ATOM   3089 C C   A ASP A 1 280 ? 23.889  -9.531  0.816   0.61 19.36 ? 273  ASP A C   1 
ATOM   3090 C C   B ASP A 1 280 ? 24.142  -9.693  0.907   0.39 19.32 ? 273  ASP A C   1 
ATOM   3091 O O   A ASP A 1 280 ? 24.282  -8.907  1.813   0.61 16.15 ? 273  ASP A O   1 
ATOM   3092 O O   B ASP A 1 280 ? 24.672  -9.016  1.796   0.39 18.90 ? 273  ASP A O   1 
ATOM   3093 C CB  A ASP A 1 280 ? 21.547  -8.698  1.143   0.61 24.18 ? 273  ASP A CB  1 
ATOM   3094 C CB  B ASP A 1 280 ? 21.949  -8.607  1.455   0.39 17.06 ? 273  ASP A CB  1 
ATOM   3095 C CG  A ASP A 1 280 ? 21.770  -7.402  0.402   0.61 18.66 ? 273  ASP A CG  1 
ATOM   3096 C CG  B ASP A 1 280 ? 22.407  -7.278  0.878   0.39 29.38 ? 273  ASP A CG  1 
ATOM   3097 O OD1 A ASP A 1 280 ? 22.432  -7.427  -0.658  0.61 26.04 ? 273  ASP A OD1 1 
ATOM   3098 O OD1 B ASP A 1 280 ? 22.924  -7.261  -0.258  0.39 19.49 ? 273  ASP A OD1 1 
ATOM   3099 O OD2 A ASP A 1 280 ? 21.287  -6.357  0.886   0.61 27.51 ? 273  ASP A OD2 1 
ATOM   3100 O OD2 B ASP A 1 280 ? 22.251  -6.249  1.569   0.39 23.79 ? 273  ASP A OD2 1 
ATOM   3101 N N   A ASN A 1 281 ? 24.693  -9.995  -0.134  0.61 13.21 ? 274  ASN A N   1 
ATOM   3102 N N   B ASN A 1 281 ? 24.820  -10.383 -0.002  0.39 17.44 ? 274  ASN A N   1 
ATOM   3103 C CA  A ASN A 1 281 ? 26.138  -9.960  -0.040  0.61 11.27 ? 274  ASN A CA  1 
ATOM   3104 C CA  B ASN A 1 281 ? 26.267  -10.452 -0.037  0.39 13.42 ? 274  ASN A CA  1 
ATOM   3105 C C   A ASN A 1 281 ? 26.678  -9.860  -1.447  0.61 14.35 ? 274  ASN A C   1 
ATOM   3106 C C   B ASN A 1 281 ? 26.710  -10.192 -1.463  0.39 14.14 ? 274  ASN A C   1 
ATOM   3107 O O   A ASN A 1 281 ? 26.343  -10.698 -2.282  0.61 17.19 ? 274  ASN A O   1 
ATOM   3108 O O   B ASN A 1 281 ? 26.397  -10.984 -2.352  0.39 16.43 ? 274  ASN A O   1 
ATOM   3109 C CB  A ASN A 1 281 ? 26.665  -11.211 0.656   0.61 15.96 ? 274  ASN A CB  1 
ATOM   3110 C CB  B ASN A 1 281 ? 26.753  -11.816 0.448   0.39 16.84 ? 274  ASN A CB  1 
ATOM   3111 C CG  A ASN A 1 281 ? 28.174  -11.286 0.654   0.61 25.74 ? 274  ASN A CG  1 
ATOM   3112 C CG  B ASN A 1 281 ? 28.248  -11.988 0.307   0.39 21.69 ? 274  ASN A CG  1 
ATOM   3113 O OD1 A ASN A 1 281 ? 28.774  -11.918 -0.218  0.61 20.97 ? 274  ASN A OD1 1 
ATOM   3114 O OD1 B ASN A 1 281 ? 28.736  -12.405 -0.740  0.39 15.98 ? 274  ASN A OD1 1 
ATOM   3115 N ND2 A ASN A 1 281 ? 28.801  -10.641 1.631   0.61 28.21 ? 274  ASN A ND2 1 
ATOM   3116 N ND2 B ASN A 1 281 ? 28.985  -11.667 1.364   0.39 21.96 ? 274  ASN A ND2 1 
ATOM   3117 N N   A ASP A 1 282 ? 27.492  -8.834  -1.695  0.61 15.08 ? 275  ASP A N   1 
ATOM   3118 N N   B ASP A 1 282 ? 27.407  -9.075  -1.670  0.39 13.90 ? 275  ASP A N   1 
ATOM   3119 C CA  A ASP A 1 282 ? 27.915  -8.469  -3.051  0.61 13.02 ? 275  ASP A CA  1 
ATOM   3120 C CA  B ASP A 1 282 ? 27.786  -8.617  -3.009  0.39 13.21 ? 275  ASP A CA  1 
ATOM   3121 C C   A ASP A 1 282 ? 28.576  -9.632  -3.804  0.61 16.99 ? 275  ASP A C   1 
ATOM   3122 C C   B ASP A 1 282 ? 28.515  -9.704  -3.787  0.39 16.89 ? 275  ASP A C   1 
ATOM   3123 O O   A ASP A 1 282 ? 28.259  -9.885  -4.964  0.61 16.27 ? 275  ASP A O   1 
ATOM   3124 O O   B ASP A 1 282 ? 28.201  -9.962  -4.948  0.39 16.08 ? 275  ASP A O   1 
ATOM   3125 C CB  A ASP A 1 282 ? 28.878  -7.265  -3.014  0.61 14.93 ? 275  ASP A CB  1 
ATOM   3126 C CB  B ASP A 1 282 ? 28.668  -7.362  -2.933  0.39 13.51 ? 275  ASP A CB  1 
ATOM   3127 C CG  A ASP A 1 282 ? 28.185  -5.937  -2.676  0.61 15.77 ? 275  ASP A CG  1 
ATOM   3128 C CG  B ASP A 1 282 ? 27.910  -6.120  -2.481  0.39 18.43 ? 275  ASP A CG  1 
ATOM   3129 O OD1 A ASP A 1 282 ? 26.937  -5.865  -2.694  0.61 19.80 ? 275  ASP A OD1 1 
ATOM   3130 O OD1 B ASP A 1 282 ? 26.682  -6.200  -2.255  0.39 19.12 ? 275  ASP A OD1 1 
ATOM   3131 O OD2 A ASP A 1 282 ? 28.906  -4.946  -2.393  0.61 18.25 ? 275  ASP A OD2 1 
ATOM   3132 O OD2 B ASP A 1 282 ? 28.553  -5.053  -2.358  0.39 21.06 ? 275  ASP A OD2 1 
ATOM   3133 N N   . LYS A 1 283 ? 29.491  -10.338 -3.148  1.00 12.72 ? 276  LYS A N   1 
ATOM   3134 C CA  . LYS A 1 283 ? 30.207  -11.441 -3.791  1.00 15.30 ? 276  LYS A CA  1 
ATOM   3135 C C   . LYS A 1 283 ? 29.270  -12.595 -4.221  1.00 14.93 ? 276  LYS A C   1 
ATOM   3136 O O   . LYS A 1 283 ? 29.349  -13.048 -5.363  1.00 16.95 ? 276  LYS A O   1 
ATOM   3137 C CB  A LYS A 1 283 ? 31.294  -11.979 -2.849  0.45 21.28 ? 276  LYS A CB  1 
ATOM   3138 C CB  B LYS A 1 283 ? 31.318  -11.974 -2.879  0.55 21.34 ? 276  LYS A CB  1 
ATOM   3139 C CG  A LYS A 1 283 ? 31.978  -13.261 -3.323  0.45 17.96 ? 276  LYS A CG  1 
ATOM   3140 C CG  B LYS A 1 283 ? 32.186  -13.020 -3.566  0.55 19.02 ? 276  LYS A CG  1 
ATOM   3141 C CD  A LYS A 1 283 ? 32.942  -13.783 -2.260  0.45 19.41 ? 276  LYS A CD  1 
ATOM   3142 C CD  B LYS A 1 283 ? 33.467  -13.302 -2.800  0.55 18.10 ? 276  LYS A CD  1 
ATOM   3143 C CE  A LYS A 1 283 ? 33.662  -15.044 -2.713  0.45 13.30 ? 276  LYS A CE  1 
ATOM   3144 C CE  B LYS A 1 283 ? 34.202  -14.476 -3.429  0.55 20.45 ? 276  LYS A CE  1 
ATOM   3145 N NZ  A LYS A 1 283 ? 34.471  -15.623 -1.601  0.45 26.56 ? 276  LYS A NZ  1 
ATOM   3146 N NZ  B LYS A 1 283 ? 35.404  -14.893 -2.654  0.55 20.58 ? 276  LYS A NZ  1 
ATOM   3147 N N   . ASP A 1 284 ? 28.389  -13.062 -3.330  1.00 15.94 ? 277  ASP A N   1 
ATOM   3148 C CA  . ASP A 1 284 ? 27.489  -14.166 -3.691  1.00 22.53 ? 277  ASP A CA  1 
ATOM   3149 C C   . ASP A 1 284 ? 26.488  -13.746 -4.764  1.00 16.57 ? 277  ASP A C   1 
ATOM   3150 O O   . ASP A 1 284 ? 26.117  -14.552 -5.625  1.00 17.37 ? 277  ASP A O   1 
ATOM   3151 C CB  . ASP A 1 284 ? 26.716  -14.700 -2.472  1.00 21.73 ? 277  ASP A CB  1 
ATOM   3152 C CG  . ASP A 1 284 ? 27.622  -15.314 -1.409  1.00 36.51 ? 277  ASP A CG  1 
ATOM   3153 O OD1 . ASP A 1 284 ? 28.747  -15.750 -1.740  1.00 30.46 ? 277  ASP A OD1 1 
ATOM   3154 O OD2 . ASP A 1 284 ? 27.188  -15.375 -0.235  1.00 27.36 ? 277  ASP A OD2 1 
ATOM   3155 N N   . VAL A 1 285 ? 26.041  -12.492 -4.702  1.00 15.13 ? 278  VAL A N   1 
ATOM   3156 C CA  . VAL A 1 285 ? 25.129  -11.959 -5.716  1.00 17.34 ? 278  VAL A CA  1 
ATOM   3157 C C   . VAL A 1 285 ? 25.822  -11.818 -7.069  1.00 15.27 ? 278  VAL A C   1 
ATOM   3158 O O   . VAL A 1 285 ? 25.249  -12.190 -8.096  1.00 14.85 ? 278  VAL A O   1 
ATOM   3159 C CB  . VAL A 1 285 ? 24.527  -10.615 -5.279  1.00 13.91 ? 278  VAL A CB  1 
ATOM   3160 C CG1 . VAL A 1 285 ? 23.800  -9.935  -6.431  1.00 14.11 ? 278  VAL A CG1 1 
ATOM   3161 C CG2 . VAL A 1 285 ? 23.549  -10.875 -4.158  1.00 13.19 ? 278  VAL A CG2 1 
ATOM   3162 N N   A LEU A 1 286 ? 27.039  -11.280 -7.068  0.53 15.76 ? 279  LEU A N   1 
ATOM   3163 N N   B LEU A 1 286 ? 27.055  -11.323 -7.072  0.47 15.72 ? 279  LEU A N   1 
ATOM   3164 C CA  A LEU A 1 286 ? 27.796  -11.145 -8.314  0.53 11.73 ? 279  LEU A CA  1 
ATOM   3165 C CA  B LEU A 1 286 ? 27.808  -11.253 -8.323  0.47 11.77 ? 279  LEU A CA  1 
ATOM   3166 C C   A LEU A 1 286 ? 28.032  -12.516 -8.941  0.53 15.23 ? 279  LEU A C   1 
ATOM   3167 C C   B LEU A 1 286 ? 28.021  -12.653 -8.902  0.47 15.18 ? 279  LEU A C   1 
ATOM   3168 O O   A LEU A 1 286 ? 27.779  -12.710 -10.132 0.53 16.20 ? 279  LEU A O   1 
ATOM   3169 O O   B LEU A 1 286 ? 27.902  -12.846 -10.111 0.47 15.54 ? 279  LEU A O   1 
ATOM   3170 C CB  A LEU A 1 286 ? 29.130  -10.441 -8.072  0.53 12.50 ? 279  LEU A CB  1 
ATOM   3171 C CB  B LEU A 1 286 ? 29.152  -10.553 -8.120  0.47 12.25 ? 279  LEU A CB  1 
ATOM   3172 C CG  A LEU A 1 286 ? 30.001  -10.243 -9.309  0.53 10.43 ? 279  LEU A CG  1 
ATOM   3173 C CG  B LEU A 1 286 ? 29.976  -10.372 -9.396  0.47 10.55 ? 279  LEU A CG  1 
ATOM   3174 C CD1 A LEU A 1 286 ? 29.278  -9.452  -10.385 0.53 11.74 ? 279  LEU A CD1 1 
ATOM   3175 C CD1 B LEU A 1 286 ? 29.133  -9.812  -10.537 0.47 10.58 ? 279  LEU A CD1 1 
ATOM   3176 C CD2 A LEU A 1 286 ? 31.313  -9.565  -8.923  0.53 15.71 ? 279  LEU A CD2 1 
ATOM   3177 C CD2 B LEU A 1 286 ? 31.193  -9.487  -9.127  0.47 16.44 ? 279  LEU A CD2 1 
ATOM   3178 N N   A GLU A 1 287 ? 28.513  -13.463 -8.139  0.53 15.41 ? 280  GLU A N   1 
ATOM   3179 N N   B GLU A 1 287 ? 28.323  -13.626 -8.045  0.47 15.79 ? 280  GLU A N   1 
ATOM   3180 C CA  A GLU A 1 287 ? 28.778  -14.812 -8.632  0.53 16.60 ? 280  GLU A CA  1 
ATOM   3181 C CA  B GLU A 1 287 ? 28.533  -14.996 -8.510  0.47 16.68 ? 280  GLU A CA  1 
ATOM   3182 C C   A GLU A 1 287 ? 27.525  -15.446 -9.236  0.53 18.76 ? 280  GLU A C   1 
ATOM   3183 C C   B GLU A 1 287 ? 27.327  -15.511 -9.296  0.47 18.91 ? 280  GLU A C   1 
ATOM   3184 O O   A GLU A 1 287 ? 27.611  -16.214 -10.197 0.53 19.06 ? 280  GLU A O   1 
ATOM   3185 O O   B GLU A 1 287 ? 27.485  -16.123 -10.352 0.47 19.40 ? 280  GLU A O   1 
ATOM   3186 C CB  A GLU A 1 287 ? 29.342  -15.695 -7.510  0.53 17.76 ? 280  GLU A CB  1 
ATOM   3187 C CB  B GLU A 1 287 ? 28.833  -15.939 -7.335  0.47 17.75 ? 280  GLU A CB  1 
ATOM   3188 C CG  A GLU A 1 287 ? 30.787  -15.357 -7.142  0.53 15.90 ? 280  GLU A CG  1 
ATOM   3189 C CG  B GLU A 1 287 ? 29.296  -17.330 -7.767  0.47 21.78 ? 280  GLU A CG  1 
ATOM   3190 C CD  A GLU A 1 287 ? 31.301  -16.112 -5.930  0.53 19.66 ? 280  GLU A CD  1 
ATOM   3191 C CD  B GLU A 1 287 ? 29.464  -18.302 -6.607  0.47 22.78 ? 280  GLU A CD  1 
ATOM   3192 O OE1 A GLU A 1 287 ? 30.525  -16.854 -5.295  0.53 19.94 ? 280  GLU A OE1 1 
ATOM   3193 O OE1 B GLU A 1 287 ? 28.641  -18.276 -5.663  0.47 26.78 ? 280  GLU A OE1 1 
ATOM   3194 O OE2 A GLU A 1 287 ? 32.492  -15.947 -5.598  0.53 17.93 ? 280  GLU A OE2 1 
ATOM   3195 O OE2 B GLU A 1 287 ? 30.419  -19.109 -6.648  0.47 36.04 ? 280  GLU A OE2 1 
ATOM   3196 N N   A PHE A 1 288 ? 26.364  -15.117 -8.679  0.53 15.26 ? 281  PHE A N   1 
ATOM   3197 N N   B PHE A 1 288 ? 26.126  -15.248 -8.790  0.47 15.70 ? 281  PHE A N   1 
ATOM   3198 C CA  A PHE A 1 288 ? 25.102  -15.583 -9.236  0.53 13.68 ? 281  PHE A CA  1 
ATOM   3199 C CA  B PHE A 1 288 ? 24.906  -15.720 -9.440  0.47 11.33 ? 281  PHE A CA  1 
ATOM   3200 C C   A PHE A 1 288 ? 24.856  -14.947 -10.605 0.53 14.24 ? 281  PHE A C   1 
ATOM   3201 C C   B PHE A 1 288 ? 24.653  -14.974 -10.755 0.47 14.05 ? 281  PHE A C   1 
ATOM   3202 O O   A PHE A 1 288 ? 24.571  -15.636 -11.578 0.53 14.79 ? 281  PHE A O   1 
ATOM   3203 O O   B PHE A 1 288 ? 24.210  -15.558 -11.747 0.47 13.70 ? 281  PHE A O   1 
ATOM   3204 C CB  A PHE A 1 288 ? 23.948  -15.271 -8.274  0.53 11.08 ? 281  PHE A CB  1 
ATOM   3205 C CB  B PHE A 1 288 ? 23.711  -15.556 -8.492  0.47 12.96 ? 281  PHE A CB  1 
ATOM   3206 C CG  A PHE A 1 288 ? 22.585  -15.544 -8.849  0.53 10.35 ? 281  PHE A CG  1 
ATOM   3207 C CG  B PHE A 1 288 ? 22.470  -16.257 -8.957  0.47 13.80 ? 281  PHE A CG  1 
ATOM   3208 C CD1 A PHE A 1 288 ? 22.004  -16.797 -8.722  0.53 12.79 ? 281  PHE A CD1 1 
ATOM   3209 C CD1 B PHE A 1 288 ? 22.216  -17.560 -8.570  0.47 18.49 ? 281  PHE A CD1 1 
ATOM   3210 C CD2 A PHE A 1 288 ? 21.883  -14.548 -9.502  0.53 16.63 ? 281  PHE A CD2 1 
ATOM   3211 C CD2 B PHE A 1 288 ? 21.560  -15.617 -9.781  0.47 14.81 ? 281  PHE A CD2 1 
ATOM   3212 C CE1 A PHE A 1 288 ? 20.753  -17.058 -9.249  0.53 13.80 ? 281  PHE A CE1 1 
ATOM   3213 C CE1 B PHE A 1 288 ? 21.078  -18.213 -8.999  0.47 23.65 ? 281  PHE A CE1 1 
ATOM   3214 C CE2 A PHE A 1 288 ? 20.627  -14.798 -10.038 0.53 15.24 ? 281  PHE A CE2 1 
ATOM   3215 C CE2 B PHE A 1 288 ? 20.419  -16.266 -10.215 0.47 15.58 ? 281  PHE A CE2 1 
ATOM   3216 C CZ  A PHE A 1 288 ? 20.057  -16.056 -9.911  0.53 16.42 ? 281  PHE A CZ  1 
ATOM   3217 C CZ  B PHE A 1 288 ? 20.177  -17.566 -9.818  0.47 14.75 ? 281  PHE A CZ  1 
ATOM   3218 N N   A LEU A 1 289 ? 24.979  -13.628 -10.669 0.53 13.90 ? 282  LEU A N   1 
ATOM   3219 N N   B LEU A 1 289 ? 24.930  -13.677 -10.754 0.47 13.75 ? 282  LEU A N   1 
ATOM   3220 C CA  A LEU A 1 289 ? 24.640  -12.888 -11.875 0.53 12.75 ? 282  LEU A CA  1 
ATOM   3221 C CA  B LEU A 1 289 ? 24.640  -12.849 -11.913 0.47 12.77 ? 282  LEU A CA  1 
ATOM   3222 C C   A LEU A 1 289 ? 25.608  -13.204 -13.008 0.53 16.26 ? 282  LEU A C   1 
ATOM   3223 C C   B LEU A 1 289 ? 25.640  -13.124 -13.024 0.47 16.27 ? 282  LEU A C   1 
ATOM   3224 O O   A LEU A 1 289 ? 25.250  -13.108 -14.179 0.53 16.63 ? 282  LEU A O   1 
ATOM   3225 O O   B LEU A 1 289 ? 25.336  -12.928 -14.198 0.47 16.33 ? 282  LEU A O   1 
ATOM   3226 C CB  A LEU A 1 289 ? 24.625  -11.382 -11.595 0.53 11.26 ? 282  LEU A CB  1 
ATOM   3227 C CB  B LEU A 1 289 ? 24.646  -11.365 -11.539 0.47 11.39 ? 282  LEU A CB  1 
ATOM   3228 C CG  A LEU A 1 289 ? 23.572  -10.895 -10.591 0.53 10.98 ? 282  LEU A CG  1 
ATOM   3229 C CG  B LEU A 1 289 ? 23.508  -10.917 -10.612 0.47 10.95 ? 282  LEU A CG  1 
ATOM   3230 C CD1 A LEU A 1 289 ? 23.909  -9.492  -10.122 0.53 14.72 ? 282  LEU A CD1 1 
ATOM   3231 C CD1 B LEU A 1 289 ? 23.707  -9.475  -10.187 0.47 16.22 ? 282  LEU A CD1 1 
ATOM   3232 C CD2 A LEU A 1 289 ? 22.178  -10.950 -11.215 0.53 12.53 ? 282  LEU A CD2 1 
ATOM   3233 C CD2 B LEU A 1 289 ? 22.153  -11.108 -11.294 0.47 12.05 ? 282  LEU A CD2 1 
ATOM   3234 N N   . MET A 1 290 ? 26.832  -13.576 -12.650 1.00 15.07 ? 283  MET A N   1 
ATOM   3235 C CA  . MET A 1 290 ? 27.862  -13.910 -13.642 1.00 13.35 ? 283  MET A CA  1 
ATOM   3236 C C   . MET A 1 290 ? 27.532  -15.194 -14.424 1.00 23.94 ? 283  MET A C   1 
ATOM   3237 O O   . MET A 1 290 ? 28.017  -15.378 -15.539 1.00 20.85 ? 283  MET A O   1 
ATOM   3238 C CB  . MET A 1 290 ? 29.228  -14.043 -12.965 1.00 14.30 ? 283  MET A CB  1 
ATOM   3239 C CG  . MET A 1 290 ? 29.919  -12.728 -12.532 1.00 13.97 ? 283  MET A CG  1 
ATOM   3240 S SD  . MET A 1 290 ? 30.329  -11.606 -13.890 1.00 16.44 ? 283  MET A SD  1 
ATOM   3241 C CE  . MET A 1 290 ? 31.796  -12.420 -14.553 1.00 13.22 ? 283  MET A CE  1 
ATOM   3242 N N   A LYS A 1 291 ? 26.721  -16.082 -13.864 0.41 16.09 ? 284  LYS A N   1 
ATOM   3243 N N   B LYS A 1 291 ? 26.709  -16.061 -13.828 0.59 16.01 ? 284  LYS A N   1 
ATOM   3244 C CA  A LYS A 1 291 ? 26.447  -17.334 -14.563 0.41 17.75 ? 284  LYS A CA  1 
ATOM   3245 C CA  B LYS A 1 291 ? 26.287  -17.325 -14.449 0.59 18.00 ? 284  LYS A CA  1 
ATOM   3246 C C   A LYS A 1 291 ? 25.071  -17.352 -15.235 0.41 13.72 ? 284  LYS A C   1 
ATOM   3247 C C   B LYS A 1 291 ? 25.056  -17.185 -15.342 0.59 13.87 ? 284  LYS A C   1 
ATOM   3248 O O   A LYS A 1 291 ? 24.700  -18.338 -15.870 0.41 17.50 ? 284  LYS A O   1 
ATOM   3249 O O   B LYS A 1 291 ? 24.876  -17.961 -16.279 0.59 17.98 ? 284  LYS A O   1 
ATOM   3250 C CB  A LYS A 1 291 ? 26.578  -18.513 -13.600 0.41 19.87 ? 284  LYS A CB  1 
ATOM   3251 C CB  B LYS A 1 291 ? 25.978  -18.382 -13.381 0.59 14.98 ? 284  LYS A CB  1 
ATOM   3252 C CG  A LYS A 1 291 ? 25.440  -18.633 -12.621 0.41 14.02 ? 284  LYS A CG  1 
ATOM   3253 C CG  B LYS A 1 291 ? 26.997  -18.493 -12.276 0.59 19.54 ? 284  LYS A CG  1 
ATOM   3254 C CD  A LYS A 1 291 ? 25.560  -19.914 -11.805 0.41 12.10 ? 284  LYS A CD  1 
ATOM   3255 C CD  B LYS A 1 291 ? 26.691  -19.688 -11.378 0.59 18.70 ? 284  LYS A CD  1 
ATOM   3256 C CE  A LYS A 1 291 ? 24.281  -20.194 -11.020 0.41 11.86 ? 284  LYS A CE  1 
ATOM   3257 C CE  B LYS A 1 291 ? 27.456  -19.614 -10.059 0.59 19.00 ? 284  LYS A CE  1 
ATOM   3258 N NZ  A LYS A 1 291 ? 23.092  -20.348 -11.913 0.41 19.37 ? 284  LYS A NZ  1 
ATOM   3259 N NZ  B LYS A 1 291 ? 26.711  -18.843 -9.024  0.59 26.41 ? 284  LYS A NZ  1 
ATOM   3260 N N   A ALA A 1 292 ? 24.326  -16.255 -15.111 0.41 18.18 ? 285  ALA A N   1 
ATOM   3261 N N   B ALA A 1 292 ? 24.207  -16.207 -15.035 0.59 18.18 ? 285  ALA A N   1 
ATOM   3262 C CA  A ALA A 1 292 ? 22.983  -16.165 -15.684 0.41 19.11 ? 285  ALA A CA  1 
ATOM   3263 C CA  B ALA A 1 292 ? 22.896  -16.085 -15.668 0.59 19.04 ? 285  ALA A CA  1 
ATOM   3264 C C   A ALA A 1 292 ? 23.010  -15.876 -17.184 0.41 15.72 ? 285  ALA A C   1 
ATOM   3265 C C   B ALA A 1 292 ? 22.973  -15.824 -17.166 0.59 15.78 ? 285  ALA A C   1 
ATOM   3266 O O   A ALA A 1 292 ? 23.966  -15.296 -17.698 0.41 18.82 ? 285  ALA A O   1 
ATOM   3267 O O   B ALA A 1 292 ? 23.928  -15.224 -17.659 0.59 18.82 ? 285  ALA A O   1 
ATOM   3268 C CB  A ALA A 1 292 ? 22.176  -15.097 -14.970 0.41 19.89 ? 285  ALA A CB  1 
ATOM   3269 C CB  B ALA A 1 292 ? 22.095  -14.985 -15.007 0.59 19.76 ? 285  ALA A CB  1 
ATOM   3270 N N   . LYS A 1 293 ? 21.950  -16.281 -17.874 1.00 21.50 ? 286  LYS A N   1 
ATOM   3271 C CA  . LYS A 1 293 ? 21.802  -16.002 -19.286 1.00 20.59 ? 286  LYS A CA  1 
ATOM   3272 C C   . LYS A 1 293 ? 21.504  -14.533 -19.384 1.00 18.32 ? 286  LYS A C   1 
ATOM   3273 O O   . LYS A 1 293 ? 20.665  -14.031 -18.647 1.00 15.25 ? 286  LYS A O   1 
ATOM   3274 C CB  . LYS A 1 293 ? 20.682  -16.850 -19.910 1.00 24.66 ? 286  LYS A CB  1 
ATOM   3275 C CG  . LYS A 1 293 ? 21.062  -18.310 -20.038 1.00 28.38 ? 286  LYS A CG  1 
ATOM   3276 C CD  . LYS A 1 293 ? 19.872  -19.204 -20.352 1.00 45.33 ? 286  LYS A CD  1 
ATOM   3277 C CE  . LYS A 1 293 ? 19.566  -19.210 -21.836 1.00 35.43 ? 286  LYS A CE  1 
ATOM   3278 N NZ  . LYS A 1 293 ? 20.757  -19.598 -22.644 1.00 53.94 ? 286  LYS A NZ  1 
ATOM   3279 N N   . PRO A 1 294 ? 22.206  -13.825 -20.277 1.00 18.19 ? 287  PRO A N   1 
ATOM   3280 C CA  . PRO A 1 294 ? 22.044  -12.367 -20.326 1.00 18.95 ? 287  PRO A CA  1 
ATOM   3281 C C   . PRO A 1 294 ? 20.600  -11.949 -20.565 1.00 14.30 ? 287  PRO A C   1 
ATOM   3282 O O   . PRO A 1 294 ? 20.121  -10.982 -19.961 1.00 17.95 ? 287  PRO A O   1 
ATOM   3283 C CB  . PRO A 1 294 ? 22.928  -11.951 -21.504 1.00 13.49 ? 287  PRO A CB  1 
ATOM   3284 C CG  . PRO A 1 294 ? 23.102  -13.194 -22.320 1.00 19.06 ? 287  PRO A CG  1 
ATOM   3285 C CD  . PRO A 1 294 ? 23.071  -14.335 -21.356 1.00 19.46 ? 287  PRO A CD  1 
ATOM   3286 N N   A GLN A 1 295 ? 19.890  -12.680 -21.418 0.43 16.26 ? 288  GLN A N   1 
ATOM   3287 N N   B GLN A 1 295 ? 19.923  -12.679 -21.445 0.57 16.29 ? 288  GLN A N   1 
ATOM   3288 C CA  A GLN A 1 295 ? 18.512  -12.324 -21.740 0.43 19.53 ? 288  GLN A CA  1 
ATOM   3289 C CA  B GLN A 1 295 ? 18.525  -12.430 -21.765 0.57 19.77 ? 288  GLN A CA  1 
ATOM   3290 C C   A GLN A 1 295 ? 17.558  -12.565 -20.567 0.43 18.57 ? 288  GLN A C   1 
ATOM   3291 C C   B GLN A 1 295 ? 17.633  -12.503 -20.532 0.57 18.48 ? 288  GLN A C   1 
ATOM   3292 O O   A GLN A 1 295 ? 16.480  -11.965 -20.506 0.43 21.70 ? 288  GLN A O   1 
ATOM   3293 O O   B GLN A 1 295 ? 16.680  -11.730 -20.400 0.57 21.08 ? 288  GLN A O   1 
ATOM   3294 C CB  A GLN A 1 295 ? 18.033  -13.096 -22.973 0.43 17.86 ? 288  GLN A CB  1 
ATOM   3295 C CB  B GLN A 1 295 ? 18.035  -13.437 -22.809 0.57 16.46 ? 288  GLN A CB  1 
ATOM   3296 C CG  A GLN A 1 295 ? 17.335  -14.412 -22.684 0.43 21.58 ? 288  GLN A CG  1 
ATOM   3297 C CG  B GLN A 1 295 ? 18.767  -13.377 -24.145 0.57 23.27 ? 288  GLN A CG  1 
ATOM   3298 C CD  A GLN A 1 295 ? 18.258  -15.609 -22.774 0.43 25.61 ? 288  GLN A CD  1 
ATOM   3299 C CD  B GLN A 1 295 ? 20.084  -14.145 -24.156 0.57 30.07 ? 288  GLN A CD  1 
ATOM   3300 O OE1 A GLN A 1 295 ? 19.480  -15.470 -22.852 0.43 29.71 ? 288  GLN A OE1 1 
ATOM   3301 O OE1 B GLN A 1 295 ? 20.403  -14.891 -23.222 0.57 12.91 ? 288  GLN A OE1 1 
ATOM   3302 N NE2 A GLN A 1 295 ? 17.671  -16.801 -22.772 0.43 31.09 ? 288  GLN A NE2 1 
ATOM   3303 N NE2 B GLN A 1 295 ? 20.850  -13.975 -25.230 0.57 32.74 ? 288  GLN A NE2 1 
ATOM   3304 N N   . ASP A 1 296 ? 17.948  -13.437 -19.642 1.00 17.52 ? 289  ASP A N   1 
ATOM   3305 C CA  . ASP A 1 296 ? 17.130  -13.695 -18.459 1.00 19.57 ? 289  ASP A CA  1 
ATOM   3306 C C   . ASP A 1 296 ? 17.161  -12.493 -17.542 1.00 20.62 ? 289  ASP A C   1 
ATOM   3307 O O   . ASP A 1 296 ? 16.146  -12.114 -16.977 1.00 24.63 ? 289  ASP A O   1 
ATOM   3308 C CB  . ASP A 1 296 ? 17.611  -14.939 -17.705 1.00 25.66 ? 289  ASP A CB  1 
ATOM   3309 C CG  . ASP A 1 296 ? 17.257  -16.233 -18.415 1.00 38.41 ? 289  ASP A CG  1 
ATOM   3310 O OD1 . ASP A 1 296 ? 16.506  -16.190 -19.412 1.00 35.51 ? 289  ASP A OD1 1 
ATOM   3311 O OD2 . ASP A 1 296 ? 17.720  -17.303 -17.963 1.00 32.23 ? 289  ASP A OD2 1 
ATOM   3312 N N   A LEU A 1 297 ? 18.339  -11.897 -17.399 0.58 17.92 ? 290  LEU A N   1 
ATOM   3313 N N   B LEU A 1 297 ? 18.340  -11.899 -17.399 0.42 17.95 ? 290  LEU A N   1 
ATOM   3314 C CA  A LEU A 1 297 ? 18.498  -10.709 -16.571 0.58 18.51 ? 290  LEU A CA  1 
ATOM   3315 C CA  B LEU A 1 297 ? 18.499  -10.708 -16.576 0.42 18.49 ? 290  LEU A CA  1 
ATOM   3316 C C   A LEU A 1 297 ? 17.774  -9.502  -17.159 0.58 20.40 ? 290  LEU A C   1 
ATOM   3317 C C   B LEU A 1 297 ? 17.755  -9.515  -17.164 0.42 20.38 ? 290  LEU A C   1 
ATOM   3318 O O   A LEU A 1 297 ? 17.068  -8.799  -16.444 0.58 17.37 ? 290  LEU A O   1 
ATOM   3319 O O   B LEU A 1 297 ? 17.019  -8.835  -16.455 0.42 17.25 ? 290  LEU A O   1 
ATOM   3320 C CB  A LEU A 1 297 ? 19.982  -10.387 -16.372 0.58 21.14 ? 290  LEU A CB  1 
ATOM   3321 C CB  B LEU A 1 297 ? 19.981  -10.367 -16.398 0.42 21.17 ? 290  LEU A CB  1 
ATOM   3322 C CG  A LEU A 1 297 ? 20.792  -11.489 -15.687 0.58 18.29 ? 290  LEU A CG  1 
ATOM   3323 C CG  B LEU A 1 297 ? 20.816  -11.428 -15.681 0.42 18.24 ? 290  LEU A CG  1 
ATOM   3324 C CD1 A LEU A 1 297 ? 22.199  -11.015 -15.365 0.58 19.28 ? 290  LEU A CD1 1 
ATOM   3325 C CD1 B LEU A 1 297 ? 22.216  -10.914 -15.391 0.42 19.29 ? 290  LEU A CD1 1 
ATOM   3326 C CD2 A LEU A 1 297 ? 20.084  -11.977 -14.429 0.58 20.32 ? 290  LEU A CD2 1 
ATOM   3327 C CD2 B LEU A 1 297 ? 20.128  -11.881 -14.400 0.42 20.43 ? 290  LEU A CD2 1 
ATOM   3328 N N   . ILE A 1 298 ? 17.933  -9.268  -18.460 1.00 14.68 ? 291  ILE A N   1 
ATOM   3329 C CA  . ILE A 1 298 ? 17.304  -8.112  -19.103 1.00 14.31 ? 291  ILE A CA  1 
ATOM   3330 C C   . ILE A 1 298 ? 15.770  -8.209  -19.072 1.00 15.44 ? 291  ILE A C   1 
ATOM   3331 O O   . ILE A 1 298 ? 15.077  -7.201  -18.918 1.00 15.31 ? 291  ILE A O   1 
ATOM   3332 C CB  . ILE A 1 298 ? 17.818  -7.966  -20.559 1.00 18.57 ? 291  ILE A CB  1 
ATOM   3333 C CG1 . ILE A 1 298 ? 19.319  -7.648  -20.556 1.00 16.21 ? 291  ILE A CG1 1 
ATOM   3334 C CG2 . ILE A 1 298 ? 17.060  -6.899  -21.317 1.00 20.58 ? 291  ILE A CG2 1 
ATOM   3335 C CD1 . ILE A 1 298 ? 19.777  -6.502  -19.643 1.00 18.92 ? 291  ILE A CD1 1 
ATOM   3336 N N   A LYS A 1 299 ? 15.224  -9.412  -19.206 0.55 13.97 ? 292  LYS A N   1 
ATOM   3337 N N   B LYS A 1 299 ? 15.279  -9.438  -19.210 0.45 14.10 ? 292  LYS A N   1 
ATOM   3338 C CA  A LYS A 1 299 ? 13.768  -9.548  -19.198 0.55 16.14 ? 292  LYS A CA  1 
ATOM   3339 C CA  B LYS A 1 299 ? 13.857  -9.757  -19.136 0.45 17.24 ? 292  LYS A CA  1 
ATOM   3340 C C   A LYS A 1 299 ? 13.176  -9.184  -17.838 0.55 20.13 ? 292  LYS A C   1 
ATOM   3341 C C   B LYS A 1 299 ? 13.241  -9.333  -17.804 0.45 20.05 ? 292  LYS A C   1 
ATOM   3342 O O   A LYS A 1 299 ? 12.058  -8.680  -17.755 0.55 20.36 ? 292  LYS A O   1 
ATOM   3343 O O   B LYS A 1 299 ? 12.057  -9.004  -17.737 0.45 16.79 ? 292  LYS A O   1 
ATOM   3344 C CB  A LYS A 1 299 ? 13.348  -10.971 -19.585 0.55 20.70 ? 292  LYS A CB  1 
ATOM   3345 C CB  B LYS A 1 299 ? 13.652  -11.266 -19.359 0.45 20.00 ? 292  LYS A CB  1 
ATOM   3346 C CG  A LYS A 1 299 ? 11.842  -11.126 -19.781 0.55 25.21 ? 292  LYS A CG  1 
ATOM   3347 C CG  B LYS A 1 299 ? 12.289  -11.809 -18.948 0.45 18.95 ? 292  LYS A CG  1 
ATOM   3348 C CD  A LYS A 1 299 ? 11.294  -9.987  -20.640 0.55 32.34 ? 292  LYS A CD  1 
ATOM   3349 C CD  B LYS A 1 299 ? 12.186  -13.317 -19.161 0.45 25.00 ? 292  LYS A CD  1 
ATOM   3350 C CE  A LYS A 1 299 ? 9.883   -10.262 -21.121 0.55 35.47 ? 292  LYS A CE  1 
ATOM   3351 C CE  B LYS A 1 299 ? 11.937  -13.680 -20.620 0.45 21.91 ? 292  LYS A CE  1 
ATOM   3352 N NZ  A LYS A 1 299 ? 9.511   -9.325  -22.220 0.55 38.00 ? 292  LYS A NZ  1 
ATOM   3353 N NZ  B LYS A 1 299 ? 11.093  -14.901 -20.743 0.45 33.39 ? 292  LYS A NZ  1 
ATOM   3354 N N   A LEU A 1 300 ? 13.933  -9.433  -16.774 0.55 18.44 ? 293  LEU A N   1 
ATOM   3355 N N   B LEU A 1 300 ? 14.047  -9.332  -16.746 0.45 18.24 ? 293  LEU A N   1 
ATOM   3356 C CA  A LEU A 1 300 ? 13.439  -9.182  -15.423 0.55 21.95 ? 293  LEU A CA  1 
ATOM   3357 C CA  B LEU A 1 300 ? 13.534  -9.027  -15.413 0.45 21.85 ? 293  LEU A CA  1 
ATOM   3358 C C   A LEU A 1 300 ? 13.608  -7.732  -14.973 0.55 17.80 ? 293  LEU A C   1 
ATOM   3359 C C   B LEU A 1 300 ? 13.785  -7.583  -14.966 0.45 19.09 ? 293  LEU A C   1 
ATOM   3360 O O   A LEU A 1 300 ? 13.036  -7.321  -13.966 0.55 16.73 ? 293  LEU A O   1 
ATOM   3361 O O   B LEU A 1 300 ? 13.347  -7.183  -13.886 0.45 17.06 ? 293  LEU A O   1 
ATOM   3362 C CB  A LEU A 1 300 ? 14.149  -10.100 -14.433 0.55 15.47 ? 293  LEU A CB  1 
ATOM   3363 C CB  B LEU A 1 300 ? 14.139  -9.995  -14.398 0.45 15.55 ? 293  LEU A CB  1 
ATOM   3364 C CG  A LEU A 1 300 ? 13.988  -11.593 -14.683 0.55 20.96 ? 293  LEU A CG  1 
ATOM   3365 C CG  B LEU A 1 300 ? 13.577  -11.414 -14.457 0.45 15.14 ? 293  LEU A CG  1 
ATOM   3366 C CD1 A LEU A 1 300 ? 15.007  -12.353 -13.859 0.55 16.51 ? 293  LEU A CD1 1 
ATOM   3367 C CD1 B LEU A 1 300 ? 14.485  -12.362 -13.695 0.45 24.49 ? 293  LEU A CD1 1 
ATOM   3368 C CD2 A LEU A 1 300 ? 12.585  -12.027 -14.342 0.55 24.67 ? 293  LEU A CD2 1 
ATOM   3369 C CD2 B LEU A 1 300 ? 12.166  -11.441 -13.888 0.45 18.17 ? 293  LEU A CD2 1 
ATOM   3370 N N   A GLU A 1 301 ? 14.395  -6.958  -15.713 0.55 16.94 ? 294  GLU A N   1 
ATOM   3371 N N   B GLU A 1 301 ? 14.474  -6.804  -15.797 0.45 17.12 ? 294  GLU A N   1 
ATOM   3372 C CA  A GLU A 1 301 ? 14.798  -5.634  -15.248 0.55 19.31 ? 294  GLU A CA  1 
ATOM   3373 C CA  B GLU A 1 301 ? 14.858  -5.440  -15.428 0.45 19.82 ? 294  GLU A CA  1 
ATOM   3374 C C   A GLU A 1 301 ? 13.604  -4.691  -15.024 0.55 17.20 ? 294  GLU A C   1 
ATOM   3375 C C   B GLU A 1 301 ? 13.673  -4.578  -14.985 0.45 17.39 ? 294  GLU A C   1 
ATOM   3376 O O   A GLU A 1 301 ? 13.645  -3.830  -14.147 0.55 16.99 ? 294  GLU A O   1 
ATOM   3377 O O   B GLU A 1 301 ? 13.733  -3.911  -13.953 0.45 16.91 ? 294  GLU A O   1 
ATOM   3378 C CB  A GLU A 1 301 ? 15.791  -5.016  -16.236 0.55 19.58 ? 294  GLU A CB  1 
ATOM   3379 C CB  B GLU A 1 301 ? 15.579  -4.762  -16.597 0.45 24.51 ? 294  GLU A CB  1 
ATOM   3380 C CG  A GLU A 1 301 ? 16.713  -3.974  -15.636 0.55 16.21 ? 294  GLU A CG  1 
ATOM   3381 C CG  B GLU A 1 301 ? 15.837  -3.269  -16.417 0.45 23.57 ? 294  GLU A CG  1 
ATOM   3382 C CD  A GLU A 1 301 ? 17.780  -3.498  -16.617 0.55 10.78 ? 294  GLU A CD  1 
ATOM   3383 C CD  B GLU A 1 301 ? 14.934  -2.403  -17.282 0.45 24.91 ? 294  GLU A CD  1 
ATOM   3384 O OE1 A GLU A 1 301 ? 18.704  -4.279  -16.921 0.55 14.18 ? 294  GLU A OE1 1 
ATOM   3385 O OE1 B GLU A 1 301 ? 14.453  -2.892  -18.327 0.45 37.23 ? 294  GLU A OE1 1 
ATOM   3386 O OE2 A GLU A 1 301 ? 17.682  -2.346  -17.079 0.55 33.17 ? 294  GLU A OE2 1 
ATOM   3387 O OE2 B GLU A 1 301 ? 14.721  -1.227  -16.925 0.45 19.88 ? 294  GLU A OE2 1 
ATOM   3388 N N   A GLU A 1 302 ? 12.538  -4.863  -15.799 0.55 18.55 ? 295  GLU A N   1 
ATOM   3389 N N   B GLU A 1 302 ? 12.600  -4.603  -15.766 0.45 18.35 ? 295  GLU A N   1 
ATOM   3390 C CA  A GLU A 1 302 ? 11.366  -3.993  -15.677 0.55 23.11 ? 295  GLU A CA  1 
ATOM   3391 C CA  B GLU A 1 302 ? 11.443  -3.750  -15.508 0.45 20.05 ? 295  GLU A CA  1 
ATOM   3392 C C   A GLU A 1 302 ? 10.595  -4.232  -14.376 0.55 20.75 ? 295  GLU A C   1 
ATOM   3393 C C   B GLU A 1 302 ? 10.706  -4.106  -14.218 0.45 21.67 ? 295  GLU A C   1 
ATOM   3394 O O   A GLU A 1 302 ? 9.690   -3.470  -14.035 0.55 20.91 ? 295  GLU A O   1 
ATOM   3395 O O   B GLU A 1 302 ? 9.898   -3.308  -13.737 0.45 26.89 ? 295  GLU A O   1 
ATOM   3396 C CB  A GLU A 1 302 ? 10.432  -4.188  -16.876 0.55 30.12 ? 295  GLU A CB  1 
ATOM   3397 C CB  B GLU A 1 302 ? 10.462  -3.813  -16.683 0.45 30.95 ? 295  GLU A CB  1 
ATOM   3398 C CG  A GLU A 1 302 ? 9.860   -5.595  -16.997 0.55 30.79 ? 295  GLU A CG  1 
ATOM   3399 C CG  B GLU A 1 302 ? 9.682   -5.119  -16.774 0.45 28.36 ? 295  GLU A CG  1 
ATOM   3400 C CD  A GLU A 1 302 ? 9.121   -5.821  -18.308 0.55 31.89 ? 295  GLU A CD  1 
ATOM   3401 C CD  B GLU A 1 302 ? 10.578  -6.316  -17.015 0.45 33.14 ? 295  GLU A CD  1 
ATOM   3402 O OE1 A GLU A 1 302 ? 9.787   -6.119  -19.326 0.55 35.84 ? 295  GLU A OE1 1 
ATOM   3403 O OE1 B GLU A 1 302 ? 10.884  -6.602  -18.193 0.45 36.22 ? 295  GLU A OE1 1 
ATOM   3404 O OE2 A GLU A 1 302 ? 7.877   -5.710  -18.320 0.55 34.86 ? 295  GLU A OE2 1 
ATOM   3405 O OE2 B GLU A 1 302 ? 10.991  -6.957  -16.026 0.45 36.98 ? 295  GLU A OE2 1 
ATOM   3406 N N   . LYS A 1 303 ? 10.968  -5.289  -13.659 1.00 18.28 ? 296  LYS A N   1 
ATOM   3407 C CA  . LYS A 1 303 ? 10.317  -5.670  -12.395 1.00 15.92 ? 296  LYS A CA  1 
ATOM   3408 C C   . LYS A 1 303 ? 11.133  -5.293  -11.144 1.00 19.01 ? 296  LYS A C   1 
ATOM   3409 O O   . LYS A 1 303 ? 10.694  -5.538  -10.029 1.00 17.35 ? 296  LYS A O   1 
ATOM   3410 C CB  A LYS A 1 303 ? 10.049  -7.178  -12.374 0.53 25.49 ? 296  LYS A CB  1 
ATOM   3411 C CB  B LYS A 1 303 ? 10.030  -7.175  -12.385 0.47 25.49 ? 296  LYS A CB  1 
ATOM   3412 C CG  A LYS A 1 303 ? 9.329   -7.724  -13.602 0.53 22.27 ? 296  LYS A CG  1 
ATOM   3413 C CG  B LYS A 1 303 ? 8.675   -7.552  -12.979 0.47 22.63 ? 296  LYS A CG  1 
ATOM   3414 C CD  A LYS A 1 303 ? 9.298   -9.253  -13.591 0.53 23.21 ? 296  LYS A CD  1 
ATOM   3415 C CD  B LYS A 1 303 ? 8.496   -9.067  -13.096 0.47 27.96 ? 296  LYS A CD  1 
ATOM   3416 C CE  A LYS A 1 303 ? 8.742   -9.830  -14.892 0.53 32.50 ? 296  LYS A CE  1 
ATOM   3417 C CE  B LYS A 1 303 ? 8.680   -9.776  -11.758 0.47 26.20 ? 296  LYS A CE  1 
ATOM   3418 N NZ  A LYS A 1 303 ? 9.654   -9.632  -16.064 0.53 28.78 ? 296  LYS A NZ  1 
ATOM   3419 N NZ  B LYS A 1 303 ? 7.780   -9.271  -10.673 0.47 29.33 ? 296  LYS A NZ  1 
ATOM   3420 N N   . VAL A 1 304 ? 12.303  -4.680  -11.319 1.00 15.90 ? 297  VAL A N   1 
ATOM   3421 C CA  . VAL A 1 304 ? 13.214  -4.478  -10.197 1.00 12.14 ? 297  VAL A CA  1 
ATOM   3422 C C   . VAL A 1 304 ? 12.806  -3.322  -9.286  1.00 19.00 ? 297  VAL A C   1 
ATOM   3423 O O   . VAL A 1 304 ? 12.861  -3.450  -8.063  1.00 16.88 ? 297  VAL A O   1 
ATOM   3424 C CB  . VAL A 1 304 ? 14.673  -4.264  -10.702 1.00 13.60 ? 297  VAL A CB  1 
ATOM   3425 C CG1 . VAL A 1 304 ? 15.577  -3.760  -9.576  1.00 14.14 ? 297  VAL A CG1 1 
ATOM   3426 C CG2 . VAL A 1 304 ? 15.213  -5.558  -11.277 1.00 15.08 ? 297  VAL A CG2 1 
ATOM   3427 N N   . LEU A 1 305 ? 12.391  -2.199  -9.861  1.00 13.16 ? 298  LEU A N   1 
ATOM   3428 C CA  . LEU A 1 305 ? 11.997  -1.058  -9.036  1.00 14.93 ? 298  LEU A CA  1 
ATOM   3429 C C   . LEU A 1 305 ? 10.796  -1.389  -8.149  1.00 15.43 ? 298  LEU A C   1 
ATOM   3430 O O   . LEU A 1 305 ? 9.828   -1.998  -8.596  1.00 16.34 ? 298  LEU A O   1 
ATOM   3431 C CB  . LEU A 1 305 ? 11.690  0.155   -9.914  1.00 17.64 ? 298  LEU A CB  1 
ATOM   3432 C CG  . LEU A 1 305 ? 12.890  0.826   -10.609 1.00 12.96 ? 298  LEU A CG  1 
ATOM   3433 C CD1 . LEU A 1 305 ? 12.414  1.844   -11.623 1.00 15.42 ? 298  LEU A CD1 1 
ATOM   3434 C CD2 . LEU A 1 305 ? 13.852  1.481   -9.641  1.00 18.64 ? 298  LEU A CD2 1 
ATOM   3435 N N   . THR A 1 306 ? 10.884  -0.984  -6.889  1.00 17.24 ? 299  THR A N   1 
ATOM   3436 C CA  . THR A 1 306 ? 9.754   -1.104  -5.970  1.00 19.11 ? 299  THR A CA  1 
ATOM   3437 C C   . THR A 1 306 ? 8.693   -0.057  -6.230  1.00 22.51 ? 299  THR A C   1 
ATOM   3438 O O   . THR A 1 306 ? 8.938   0.934   -6.930  1.00 20.57 ? 299  THR A O   1 
ATOM   3439 C CB  . THR A 1 306 ? 10.204  -0.955  -4.521  1.00 16.51 ? 299  THR A CB  1 
ATOM   3440 O OG1 . THR A 1 306 ? 10.688  0.376   -4.306  1.00 16.73 ? 299  THR A OG1 1 
ATOM   3441 C CG2 . THR A 1 306 ? 11.312  -1.953  -4.204  1.00 26.92 ? 299  THR A CG2 1 
ATOM   3442 N N   A LEU A 1 307 ? 7.501   -0.282  -5.675  0.67 20.25 ? 300  LEU A N   1 
ATOM   3443 N N   B LEU A 1 307 ? 7.528   -0.255  -5.621  0.33 20.13 ? 300  LEU A N   1 
ATOM   3444 C CA  A LEU A 1 307 ? 6.410   0.685   -5.756  0.67 19.98 ? 300  LEU A CA  1 
ATOM   3445 C CA  B LEU A 1 307 ? 6.459   0.732   -5.659  0.33 19.99 ? 300  LEU A CA  1 
ATOM   3446 C C   A LEU A 1 307 ? 6.857   2.052   -5.253  0.67 16.44 ? 300  LEU A C   1 
ATOM   3447 C C   B LEU A 1 307 ? 6.900   2.067   -5.058  0.33 15.87 ? 300  LEU A C   1 
ATOM   3448 O O   A LEU A 1 307 ? 6.615   3.061   -5.918  0.67 18.13 ? 300  LEU A O   1 
ATOM   3449 O O   B LEU A 1 307 ? 6.570   3.122   -5.596  0.33 21.24 ? 300  LEU A O   1 
ATOM   3450 C CB  A LEU A 1 307 ? 5.197   0.211   -4.943  0.67 20.38 ? 300  LEU A CB  1 
ATOM   3451 C CB  B LEU A 1 307 ? 5.224   0.213   -4.921  0.33 20.43 ? 300  LEU A CB  1 
ATOM   3452 C CG  A LEU A 1 307 ? 3.793   0.493   -5.491  0.67 31.32 ? 300  LEU A CG  1 
ATOM   3453 C CG  B LEU A 1 307 ? 4.012   1.142   -4.938  0.33 21.63 ? 300  LEU A CG  1 
ATOM   3454 C CD1 A LEU A 1 307 ? 2.736   0.176   -4.443  0.67 26.09 ? 300  LEU A CD1 1 
ATOM   3455 C CD1 B LEU A 1 307 ? 3.679   1.559   -6.367  0.33 29.75 ? 300  LEU A CD1 1 
ATOM   3456 C CD2 A LEU A 1 307 ? 3.633   1.922   -6.001  0.67 33.48 ? 300  LEU A CD2 1 
ATOM   3457 C CD2 B LEU A 1 307 ? 2.818   0.468   -4.278  0.33 25.70 ? 300  LEU A CD2 1 
ATOM   3458 N N   A GLU A 1 308 ? 7.504   2.062   -4.089  0.67 18.82 ? 301  GLU A N   1 
ATOM   3459 N N   B GLU A 1 308 ? 7.641   2.018   -3.953  0.33 18.65 ? 301  GLU A N   1 
ATOM   3460 C CA  A GLU A 1 308 ? 7.999   3.282   -3.469  0.67 21.60 ? 301  GLU A CA  1 
ATOM   3461 C CA  B GLU A 1 308 ? 8.146   3.235   -3.327  0.33 21.60 ? 301  GLU A CA  1 
ATOM   3462 C C   A GLU A 1 308 ? 8.961   4.007   -4.405  0.67 21.21 ? 301  GLU A C   1 
ATOM   3463 C C   B GLU A 1 308 ? 9.030   3.999   -4.304  0.33 20.84 ? 301  GLU A C   1 
ATOM   3464 O O   A GLU A 1 308 ? 8.834   5.212   -4.617  0.67 15.75 ? 301  GLU A O   1 
ATOM   3465 O O   B GLU A 1 308 ? 8.912   5.215   -4.451  0.33 17.72 ? 301  GLU A O   1 
ATOM   3466 C CB  A GLU A 1 308 ? 8.680   2.972   -2.128  0.67 18.92 ? 301  GLU A CB  1 
ATOM   3467 C CB  B GLU A 1 308 ? 8.929   2.919   -2.047  0.33 18.90 ? 301  GLU A CB  1 
ATOM   3468 C CG  A GLU A 1 308 ? 9.104   4.225   -1.349  0.67 24.05 ? 301  GLU A CG  1 
ATOM   3469 C CG  B GLU A 1 308 ? 9.544   4.160   -1.397  0.33 20.71 ? 301  GLU A CG  1 
ATOM   3470 C CD  A GLU A 1 308 ? 9.467   3.950   0.108   0.67 40.72 ? 301  GLU A CD  1 
ATOM   3471 C CD  B GLU A 1 308 ? 10.446  3.843   -0.215  0.33 36.49 ? 301  GLU A CD  1 
ATOM   3472 O OE1 A GLU A 1 308 ? 8.880   3.026   0.718   0.67 40.41 ? 301  GLU A OE1 1 
ATOM   3473 O OE1 B GLU A 1 308 ? 10.285  2.763   0.394   0.33 42.83 ? 301  GLU A OE1 1 
ATOM   3474 O OE2 A GLU A 1 308 ? 10.343  4.667   0.645   0.67 40.78 ? 301  GLU A OE2 1 
ATOM   3475 O OE2 B GLU A 1 308 ? 11.316  4.683   0.107   0.33 29.12 ? 301  GLU A OE2 1 
ATOM   3476 N N   . GLU A 1 309 ? 9.902   3.266   -4.987  1.00 17.88 ? 302  GLU A N   1 
ATOM   3477 C CA  . GLU A 1 309 ? 10.854  3.874   -5.911  1.00 18.12 ? 302  GLU A CA  1 
ATOM   3478 C C   . GLU A 1 309 ? 10.153  4.497   -7.107  1.00 17.00 ? 302  GLU A C   1 
ATOM   3479 O O   . GLU A 1 309 ? 10.485  5.619   -7.511  1.00 14.54 ? 302  GLU A O   1 
ATOM   3480 C CB  A GLU A 1 309 ? 11.885  2.834   -6.351  0.25 15.39 ? 302  GLU A CB  1 
ATOM   3481 C CB  B GLU A 1 309 ? 11.873  2.824   -6.379  0.75 15.26 ? 302  GLU A CB  1 
ATOM   3482 C CG  A GLU A 1 309 ? 12.825  2.452   -5.215  0.25 16.25 ? 302  GLU A CG  1 
ATOM   3483 C CG  B GLU A 1 309 ? 12.947  2.544   -5.338  0.75 16.38 ? 302  GLU A CG  1 
ATOM   3484 C CD  A GLU A 1 309 ? 13.514  1.122   -5.432  0.25 20.39 ? 302  GLU A CD  1 
ATOM   3485 C CD  B GLU A 1 309 ? 13.795  1.316   -5.642  0.75 17.75 ? 302  GLU A CD  1 
ATOM   3486 O OE1 A GLU A 1 309 ? 13.822  0.799   -6.591  0.25 15.10 ? 302  GLU A OE1 1 
ATOM   3487 O OE1 B GLU A 1 309 ? 13.294  0.383   -6.296  0.75 18.17 ? 302  GLU A OE1 1 
ATOM   3488 O OE2 A GLU A 1 309 ? 13.737  0.394   -4.440  0.25 25.31 ? 302  GLU A OE2 1 
ATOM   3489 O OE2 B GLU A 1 309 ? 14.962  1.285   -5.200  0.75 16.60 ? 302  GLU A OE2 1 
ATOM   3490 N N   . ARG A 1 310 ? 9.169   3.791   -7.652  1.00 13.01 ? 303  ARG A N   1 
ATOM   3491 C CA  . ARG A 1 310 ? 8.402   4.308   -8.797  1.00 15.40 ? 303  ARG A CA  1 
ATOM   3492 C C   . ARG A 1 310 ? 7.595   5.538   -8.388  1.00 20.07 ? 303  ARG A C   1 
ATOM   3493 O O   . ARG A 1 310 ? 7.501   6.519   -9.131  1.00 19.41 ? 303  ARG A O   1 
ATOM   3494 C CB  . ARG A 1 310 ? 7.475   3.230   -9.357  1.00 22.54 ? 303  ARG A CB  1 
ATOM   3495 C CG  . ARG A 1 310 ? 8.206   1.994   -9.826  1.00 22.80 ? 303  ARG A CG  1 
ATOM   3496 C CD  . ARG A 1 310 ? 7.238   0.851   -10.099 1.00 29.52 ? 303  ARG A CD  1 
ATOM   3497 N NE  . ARG A 1 310 ? 7.928   -0.422  -10.277 1.00 34.53 ? 303  ARG A NE  1 
ATOM   3498 C CZ  . ARG A 1 310 ? 8.351   -0.892  -11.447 1.00 36.46 ? 303  ARG A CZ  1 
ATOM   3499 N NH1 . ARG A 1 310 ? 8.150   -0.187  -12.554 1.00 31.70 ? 303  ARG A NH1 1 
ATOM   3500 N NH2 . ARG A 1 310 ? 8.977   -2.068  -11.507 1.00 23.23 ? 303  ARG A NH2 1 
ATOM   3501 N N   . THR A 1 311 ? 7.020   5.481   -7.194  1.00 25.28 ? 304  THR A N   1 
ATOM   3502 C CA  . THR A 1 311 ? 6.304   6.622   -6.634  1.00 21.95 ? 304  THR A CA  1 
ATOM   3503 C C   . THR A 1 311 ? 7.205   7.844   -6.500  1.00 20.44 ? 304  THR A C   1 
ATOM   3504 O O   . THR A 1 311 ? 6.774   8.967   -6.758  1.00 21.97 ? 304  THR A O   1 
ATOM   3505 C CB  . THR A 1 311 ? 5.715   6.279   -5.262  1.00 22.81 ? 304  THR A CB  1 
ATOM   3506 O OG1 . THR A 1 311 ? 4.781   5.204   -5.415  1.00 24.77 ? 304  THR A OG1 1 
ATOM   3507 C CG2 . THR A 1 311 ? 5.018   7.491   -4.641  1.00 26.54 ? 304  THR A CG2 1 
ATOM   3508 N N   A ASN A 1 312 ? 8.452   7.605   -6.097  0.71 16.65 ? 305  ASN A N   1 
ATOM   3509 N N   B ASN A 1 312 ? 8.456   7.637   -6.103  0.29 16.72 ? 305  ASN A N   1 
ATOM   3510 C CA  A ASN A 1 312 ? 9.454   8.656   -5.947  0.71 15.33 ? 305  ASN A CA  1 
ATOM   3511 C CA  B ASN A 1 312 ? 9.385   8.753   -5.946  0.29 15.32 ? 305  ASN A CA  1 
ATOM   3512 C C   A ASN A 1 312 ? 10.093  9.075   -7.279  0.71 14.64 ? 305  ASN A C   1 
ATOM   3513 C C   B ASN A 1 312 ? 10.089  9.127   -7.250  0.29 14.72 ? 305  ASN A C   1 
ATOM   3514 O O   A ASN A 1 312 ? 11.051  9.850   -7.294  0.71 19.78 ? 305  ASN A O   1 
ATOM   3515 O O   B ASN A 1 312 ? 11.110  9.816   -7.240  0.29 19.48 ? 305  ASN A O   1 
ATOM   3516 C CB  A ASN A 1 312 ? 10.560  8.209   -4.990  0.71 19.69 ? 305  ASN A CB  1 
ATOM   3517 C CB  B ASN A 1 312 ? 10.421  8.438   -4.870  0.29 19.81 ? 305  ASN A CB  1 
ATOM   3518 C CG  A ASN A 1 312 ? 10.195  8.424   -3.527  0.71 21.88 ? 305  ASN A CG  1 
ATOM   3519 C CG  B ASN A 1 312 ? 9.836   8.484   -3.471  0.29 20.51 ? 305  ASN A CG  1 
ATOM   3520 O OD1 A ASN A 1 312 ? 10.539  9.448   -2.936  0.71 18.37 ? 305  ASN A OD1 1 
ATOM   3521 O OD1 B ASN A 1 312 ? 8.886   9.223   -3.210  0.29 23.60 ? 305  ASN A OD1 1 
ATOM   3522 N ND2 A ASN A 1 312 ? 9.505   7.448   -2.937  0.71 15.26 ? 305  ASN A ND2 1 
ATOM   3523 N ND2 B ASN A 1 312 ? 10.401  7.694   -2.565  0.29 16.98 ? 305  ASN A ND2 1 
ATOM   3524 N N   A LYS A 1 313 ? 9.554   8.537   -8.369  0.71 15.04 ? 306  LYS A N   1 
ATOM   3525 N N   B LYS A 1 313 ? 9.523   8.666   -8.361  0.29 15.13 ? 306  LYS A N   1 
ATOM   3526 C CA  A LYS A 1 313 ? 9.892   8.931   -9.735  0.71 14.50 ? 306  LYS A CA  1 
ATOM   3527 C CA  B LYS A 1 313 ? 9.984   9.014   -9.702  0.29 14.37 ? 306  LYS A CA  1 
ATOM   3528 C C   A LYS A 1 313 ? 11.257  8.436   -10.196 0.71 17.03 ? 306  LYS A C   1 
ATOM   3529 C C   B LYS A 1 313 ? 11.438  8.631   -9.959  0.29 16.94 ? 306  LYS A C   1 
ATOM   3530 O O   A LYS A 1 313 ? 11.799  8.959   -11.171 0.71 17.26 ? 306  LYS A O   1 
ATOM   3531 O O   B LYS A 1 313 ? 12.204  9.402   -10.536 0.29 14.80 ? 306  LYS A O   1 
ATOM   3532 C CB  A LYS A 1 313 ? 9.816   10.456  -9.893  0.71 18.76 ? 306  LYS A CB  1 
ATOM   3533 C CB  B LYS A 1 313 ? 9.775   10.508  -9.963  0.29 18.83 ? 306  LYS A CB  1 
ATOM   3534 C CG  A LYS A 1 313 ? 8.430   11.042  -9.596  0.71 17.23 ? 306  LYS A CG  1 
ATOM   3535 C CG  B LYS A 1 313 ? 8.307   10.878  -10.158 0.29 24.48 ? 306  LYS A CG  1 
ATOM   3536 C CD  A LYS A 1 313 ? 7.389   10.546  -10.610 0.71 21.88 ? 306  LYS A CD  1 
ATOM   3537 C CD  B LYS A 1 313 ? 7.691   10.052  -11.284 0.29 22.08 ? 306  LYS A CD  1 
ATOM   3538 C CE  A LYS A 1 313 ? 5.954   10.843  -10.178 0.71 19.36 ? 306  LYS A CE  1 
ATOM   3539 C CE  B LYS A 1 313 ? 6.251   9.643   -10.987 0.29 25.65 ? 306  LYS A CE  1 
ATOM   3540 N NZ  A LYS A 1 313 ? 5.398   9.766   -9.308  0.71 24.41 ? 306  LYS A NZ  1 
ATOM   3541 N NZ  B LYS A 1 313 ? 5.315   10.798  -10.894 0.29 10.07 ? 306  LYS A NZ  1 
ATOM   3542 N N   . VAL A 1 314 ? 11.808  7.436   -9.514  1.00 14.04 ? 307  VAL A N   1 
ATOM   3543 C CA  . VAL A 1 314 ? 13.010  6.772   -10.002 1.00 13.47 ? 307  VAL A CA  1 
ATOM   3544 C C   . VAL A 1 314 ? 12.569  6.085   -11.294 1.00 14.92 ? 307  VAL A C   1 
ATOM   3545 O O   . VAL A 1 314 ? 11.630  5.285   -11.283 1.00 16.08 ? 307  VAL A O   1 
ATOM   3546 C CB  . VAL A 1 314 ? 13.565  5.740   -9.014  1.00 19.49 ? 307  VAL A CB  1 
ATOM   3547 C CG1 . VAL A 1 314 ? 14.759  4.999   -9.632  1.00 13.42 ? 307  VAL A CG1 1 
ATOM   3548 C CG2 . VAL A 1 314 ? 13.926  6.415   -7.703  1.00 18.64 ? 307  VAL A CG2 1 
ATOM   3549 N N   . MET A 1 315 ? 13.206  6.413   -12.419 1.00 13.62 ? 308  MET A N   1 
ATOM   3550 C CA  . MET A 1 315 ? 12.716  5.938   -13.716 1.00 12.79 ? 308  MET A CA  1 
ATOM   3551 C C   . MET A 1 315 ? 13.279  4.572   -14.152 1.00 14.63 ? 308  MET A C   1 
ATOM   3552 O O   . MET A 1 315 ? 12.568  3.761   -14.753 1.00 17.34 ? 308  MET A O   1 
ATOM   3553 C CB  . MET A 1 315 ? 13.004  6.986   -14.783 1.00 17.30 ? 308  MET A CB  1 
ATOM   3554 C CG  . MET A 1 315 ? 12.126  6.825   -15.994 1.00 17.87 ? 308  MET A CG  1 
ATOM   3555 S SD  . MET A 1 315 ? 12.480  8.024   -17.283 1.00 21.58 ? 308  MET A SD  1 
ATOM   3556 C CE  . MET A 1 315 ? 11.297  7.504   -18.530 1.00 64.21 ? 308  MET A CE  1 
ATOM   3557 N N   . PHE A 1 316 ? 14.554  4.320   -13.853 1.00 10.91 ? 309  PHE A N   1 
ATOM   3558 C CA  . PHE A 1 316 ? 15.209  3.072   -14.267 1.00 13.87 ? 309  PHE A CA  1 
ATOM   3559 C C   . PHE A 1 316 ? 15.939  2.430   -13.090 1.00 13.53 ? 309  PHE A C   1 
ATOM   3560 O O   . PHE A 1 316 ? 16.516  3.148   -12.285 1.00 14.25 ? 309  PHE A O   1 
ATOM   3561 C CB  . PHE A 1 316 ? 16.198  3.327   -15.413 1.00 13.90 ? 309  PHE A CB  1 
ATOM   3562 C CG  . PHE A 1 316 ? 15.643  4.172   -16.533 1.00 12.04 ? 309  PHE A CG  1 
ATOM   3563 C CD1 . PHE A 1 316 ? 14.826  3.616   -17.486 1.00 14.84 ? 309  PHE A CD1 1 
ATOM   3564 C CD2 . PHE A 1 316 ? 15.978  5.519   -16.640 1.00 14.04 ? 309  PHE A CD2 1 
ATOM   3565 C CE1 . PHE A 1 316 ? 14.314  4.384   -18.526 1.00 12.94 ? 309  PHE A CE1 1 
ATOM   3566 C CE2 . PHE A 1 316 ? 15.466  6.303   -17.672 1.00 14.82 ? 309  PHE A CE2 1 
ATOM   3567 C CZ  . PHE A 1 316 ? 14.633  5.720   -18.623 1.00 14.89 ? 309  PHE A CZ  1 
ATOM   3568 N N   . PRO A 1 317 ? 15.931  1.083   -12.997 1.00 13.01 ? 310  PRO A N   1 
ATOM   3569 C CA  . PRO A 1 317 ? 16.610  0.437   -11.864 1.00 12.20 ? 310  PRO A CA  1 
ATOM   3570 C C   . PRO A 1 317 ? 18.132  0.518   -11.951 1.00 11.63 ? 310  PRO A C   1 
ATOM   3571 O O   . PRO A 1 317 ? 18.801  0.631   -10.927 1.00 13.01 ? 310  PRO A O   1 
ATOM   3572 C CB  . PRO A 1 317 ? 16.137  -1.018  -11.942 1.00 12.97 ? 310  PRO A CB  1 
ATOM   3573 C CG  . PRO A 1 317 ? 15.715  -1.221  -13.364 1.00 12.04 ? 310  PRO A CG  1 
ATOM   3574 C CD  . PRO A 1 317 ? 15.195  0.114   -13.836 1.00 17.30 ? 310  PRO A CD  1 
ATOM   3575 N N   A PHE A 1 318 ? 18.675  0.465   -13.165 0.67 12.24 ? 311  PHE A N   1 
ATOM   3576 N N   B PHE A 1 318 ? 18.672  0.466   -13.166 0.33 12.13 ? 311  PHE A N   1 
ATOM   3577 C CA  A PHE A 1 318 ? 20.116  0.581   -13.352 0.67 9.97  ? 311  PHE A CA  1 
ATOM   3578 C CA  B PHE A 1 318 ? 20.114  0.572   -13.360 0.33 10.09 ? 311  PHE A CA  1 
ATOM   3579 C C   A PHE A 1 318 ? 20.441  1.727   -14.292 0.67 13.28 ? 311  PHE A C   1 
ATOM   3580 C C   B PHE A 1 318 ? 20.453  1.713   -14.308 0.33 13.14 ? 311  PHE A C   1 
ATOM   3581 O O   A PHE A 1 318 ? 19.767  1.921   -15.299 0.67 13.31 ? 311  PHE A O   1 
ATOM   3582 O O   B PHE A 1 318 ? 19.799  1.897   -15.332 0.33 13.44 ? 311  PHE A O   1 
ATOM   3583 C CB  A PHE A 1 318 ? 20.697  -0.726  -13.892 0.67 10.46 ? 311  PHE A CB  1 
ATOM   3584 C CB  B PHE A 1 318 ? 20.684  -0.743  -13.895 0.33 10.54 ? 311  PHE A CB  1 
ATOM   3585 C CG  A PHE A 1 318 ? 20.421  -1.906  -13.015 0.67 10.44 ? 311  PHE A CG  1 
ATOM   3586 C CG  B PHE A 1 318 ? 20.451  -1.911  -12.986 0.33 10.46 ? 311  PHE A CG  1 
ATOM   3587 C CD1 A PHE A 1 318 ? 21.237  -2.190  -11.915 0.67 8.22  ? 311  PHE A CD1 1 
ATOM   3588 C CD1 B PHE A 1 318 ? 21.290  -2.150  -11.902 0.33 8.20  ? 311  PHE A CD1 1 
ATOM   3589 C CD2 A PHE A 1 318 ? 19.341  -2.725  -13.283 0.67 10.37 ? 311  PHE A CD2 1 
ATOM   3590 C CD2 B PHE A 1 318 ? 19.388  -2.766  -13.210 0.33 10.77 ? 311  PHE A CD2 1 
ATOM   3591 C CE1 A PHE A 1 318 ? 20.972  -3.275  -11.096 0.67 9.20  ? 311  PHE A CE1 1 
ATOM   3592 C CE1 B PHE A 1 318 ? 21.070  -3.225  -11.059 0.33 9.33  ? 311  PHE A CE1 1 
ATOM   3593 C CE2 A PHE A 1 318 ? 19.067  -3.833  -12.456 0.67 11.90 ? 311  PHE A CE2 1 
ATOM   3594 C CE2 B PHE A 1 318 ? 19.161  -3.852  -12.365 0.33 11.77 ? 311  PHE A CE2 1 
ATOM   3595 C CZ  A PHE A 1 318 ? 19.887  -4.094  -11.363 0.67 11.70 ? 311  PHE A CZ  1 
ATOM   3596 C CZ  B PHE A 1 318 ? 20.004  -4.075  -11.289 0.33 11.24 ? 311  PHE A CZ  1 
ATOM   3597 N N   . GLY A 1 319 ? 21.489  2.468   -13.961 1.00 9.53  ? 312  GLY A N   1 
ATOM   3598 C CA  . GLY A 1 319 ? 21.893  3.615   -14.747 1.00 13.05 ? 312  GLY A CA  1 
ATOM   3599 C C   . GLY A 1 319 ? 23.177  4.200   -14.201 1.00 13.10 ? 312  GLY A C   1 
ATOM   3600 O O   . GLY A 1 319 ? 23.776  3.633   -13.277 1.00 11.60 ? 312  GLY A O   1 
ATOM   3601 N N   . PRO A 1 320 ? 23.588  5.353   -14.736 1.00 11.44 ? 313  PRO A N   1 
ATOM   3602 C CA  . PRO A 1 320 ? 24.775  6.042   -14.232 1.00 8.86  ? 313  PRO A CA  1 
ATOM   3603 C C   . PRO A 1 320 ? 24.664  6.232   -12.736 1.00 10.48 ? 313  PRO A C   1 
ATOM   3604 O O   . PRO A 1 320 ? 23.564  6.472   -12.242 1.00 10.67 ? 313  PRO A O   1 
ATOM   3605 C CB  . PRO A 1 320 ? 24.742  7.379   -14.979 1.00 8.49  ? 313  PRO A CB  1 
ATOM   3606 C CG  . PRO A 1 320 ? 24.125  7.001   -16.311 1.00 8.80  ? 313  PRO A CG  1 
ATOM   3607 C CD  . PRO A 1 320 ? 23.037  6.019   -15.931 1.00 11.07 ? 313  PRO A CD  1 
ATOM   3608 N N   . THR A 1 321 ? 25.777  6.111   -12.032 1.00 10.15 ? 314  THR A N   1 
ATOM   3609 C CA  . THR A 1 321 ? 25.752  6.158   -10.579 1.00 12.79 ? 314  THR A CA  1 
ATOM   3610 C C   . THR A 1 321 ? 27.007  6.852   -10.062 1.00 11.37 ? 314  THR A C   1 
ATOM   3611 O O   . THR A 1 321 ? 28.004  6.984   -10.766 1.00 10.85 ? 314  THR A O   1 
ATOM   3612 C CB  . THR A 1 321 ? 25.651  4.721   -9.983  1.00 11.23 ? 314  THR A CB  1 
ATOM   3613 O OG1 . THR A 1 321 ? 25.206  4.784   -8.617  1.00 13.06 ? 314  THR A OG1 1 
ATOM   3614 C CG2 . THR A 1 321 ? 26.990  3.988   -10.050 1.00 12.00 ? 314  THR A CG2 1 
ATOM   3615 N N   . VAL A 1 322 ? 26.965  7.352   -8.836  1.00 11.75 ? 315  VAL A N   1 
ATOM   3616 C CA  . VAL A 1 322 ? 28.193  7.804   -8.216  1.00 11.95 ? 315  VAL A CA  1 
ATOM   3617 C C   . VAL A 1 322 ? 28.931  6.562   -7.726  1.00 10.89 ? 315  VAL A C   1 
ATOM   3618 O O   . VAL A 1 322 ? 28.392  5.794   -6.933  1.00 13.19 ? 315  VAL A O   1 
ATOM   3619 C CB  . VAL A 1 322 ? 27.898  8.785   -7.055  1.00 13.14 ? 315  VAL A CB  1 
ATOM   3620 C CG1 . VAL A 1 322 ? 29.193  9.218   -6.409  1.00 16.79 ? 315  VAL A CG1 1 
ATOM   3621 C CG2 . VAL A 1 322 ? 27.146  9.987   -7.595  1.00 18.01 ? 315  VAL A CG2 1 
ATOM   3622 N N   . GLU A 1 323 ? 30.161  6.356   -8.191  1.00 11.78 ? 316  GLU A N   1 
ATOM   3623 C CA  . GLU A 1 323 ? 30.890  5.127   -7.902  1.00 8.67  ? 316  GLU A CA  1 
ATOM   3624 C C   . GLU A 1 323 ? 31.342  5.049   -6.439  1.00 12.70 ? 316  GLU A C   1 
ATOM   3625 O O   . GLU A 1 323 ? 31.849  6.031   -5.904  1.00 19.51 ? 316  GLU A O   1 
ATOM   3626 C CB  . GLU A 1 323 ? 32.081  4.991   -8.860  1.00 14.77 ? 316  GLU A CB  1 
ATOM   3627 C CG  . GLU A 1 323 ? 31.576  4.924   -10.321 1.00 14.19 ? 316  GLU A CG  1 
ATOM   3628 C CD  . GLU A 1 323 ? 32.661  4.810   -11.394 1.00 13.98 ? 316  GLU A CD  1 
ATOM   3629 O OE1 . GLU A 1 323 ? 33.555  3.942   -11.284 1.00 14.31 ? 316  GLU A OE1 1 
ATOM   3630 O OE2 . GLU A 1 323 ? 32.578  5.566   -12.397 1.00 12.38 ? 316  GLU A OE2 1 
ATOM   3631 N N   . PRO A 1 324 ? 31.124  3.892   -5.797  1.00 16.27 ? 317  PRO A N   1 
ATOM   3632 C CA  . PRO A 1 324 ? 31.349  3.761   -4.345  1.00 12.87 ? 317  PRO A CA  1 
ATOM   3633 C C   . PRO A 1 324 ? 32.806  3.878   -3.916  1.00 21.59 ? 317  PRO A C   1 
ATOM   3634 O O   . PRO A 1 324 ? 33.090  4.146   -2.746  1.00 17.83 ? 317  PRO A O   1 
ATOM   3635 C CB  . PRO A 1 324 ? 30.793  2.364   -4.023  1.00 11.87 ? 317  PRO A CB  1 
ATOM   3636 C CG  . PRO A 1 324 ? 30.666  1.658   -5.325  1.00 17.97 ? 317  PRO A CG  1 
ATOM   3637 C CD  . PRO A 1 324 ? 30.436  2.710   -6.354  1.00 20.36 ? 317  PRO A CD  1 
ATOM   3638 N N   A TYR A 1 325 ? 33.714  3.678   -4.862  0.53 14.55 ? 318  TYR A N   1 
ATOM   3639 N N   B TYR A 1 325 ? 33.724  3.682   -4.848  0.47 14.55 ? 318  TYR A N   1 
ATOM   3640 C CA  A TYR A 1 325 ? 35.146  3.786   -4.607  0.53 12.39 ? 318  TYR A CA  1 
ATOM   3641 C CA  B TYR A 1 325 ? 35.140  3.839   -4.549  0.47 12.42 ? 318  TYR A CA  1 
ATOM   3642 C C   A TYR A 1 325 ? 35.862  4.210   -5.890  0.53 17.73 ? 318  TYR A C   1 
ATOM   3643 C C   B TYR A 1 325 ? 35.866  4.335   -5.790  0.47 17.85 ? 318  TYR A C   1 
ATOM   3644 O O   A TYR A 1 325 ? 35.397  3.912   -6.992  0.53 14.48 ? 318  TYR A O   1 
ATOM   3645 O O   B TYR A 1 325 ? 35.246  4.560   -6.831  0.47 22.87 ? 318  TYR A O   1 
ATOM   3646 C CB  A TYR A 1 325 ? 35.712  2.458   -4.084  0.53 18.12 ? 318  TYR A CB  1 
ATOM   3647 C CB  B TYR A 1 325 ? 35.747  2.521   -4.051  0.47 18.03 ? 318  TYR A CB  1 
ATOM   3648 C CG  A TYR A 1 325 ? 35.393  1.267   -4.967  0.53 14.16 ? 318  TYR A CG  1 
ATOM   3649 C CG  B TYR A 1 325 ? 35.461  1.338   -4.950  0.47 14.15 ? 318  TYR A CG  1 
ATOM   3650 C CD1 A TYR A 1 325 ? 36.239  0.903   -6.009  0.53 12.20 ? 318  TYR A CD1 1 
ATOM   3651 C CD1 B TYR A 1 325 ? 36.326  1.001   -5.982  0.47 12.36 ? 318  TYR A CD1 1 
ATOM   3652 C CD2 A TYR A 1 325 ? 34.239  0.518   -4.769  0.53 14.00 ? 318  TYR A CD2 1 
ATOM   3653 C CD2 B TYR A 1 325 ? 34.319  0.565   -4.774  0.47 13.86 ? 318  TYR A CD2 1 
ATOM   3654 C CE1 A TYR A 1 325 ? 35.953  -0.173  -6.822  0.53 15.61 ? 318  TYR A CE1 1 
ATOM   3655 C CE1 B TYR A 1 325 ? 36.070  -0.068  -6.809  0.47 15.47 ? 318  TYR A CE1 1 
ATOM   3656 C CE2 A TYR A 1 325 ? 33.935  -0.570  -5.588  0.53 11.20 ? 318  TYR A CE2 1 
ATOM   3657 C CE2 B TYR A 1 325 ? 34.045  -0.517  -5.608  0.47 11.77 ? 318  TYR A CE2 1 
ATOM   3658 C CZ  A TYR A 1 325 ? 34.804  -0.906  -6.615  0.53 13.93 ? 318  TYR A CZ  1 
ATOM   3659 C CZ  B TYR A 1 325 ? 34.934  -0.825  -6.626  0.47 13.98 ? 318  TYR A CZ  1 
ATOM   3660 O OH  A TYR A 1 325 ? 34.538  -1.976  -7.437  0.53 15.61 ? 318  TYR A OH  1 
ATOM   3661 O OH  B TYR A 1 325 ? 34.700  -1.889  -7.465  0.47 14.56 ? 318  TYR A OH  1 
ATOM   3662 N N   A GLN A 1 326 ? 36.995  4.896   -5.747  0.53 18.45 ? 319  GLN A N   1 
ATOM   3663 N N   B GLN A 1 326 ? 37.179  4.509   -5.677  0.47 18.33 ? 319  GLN A N   1 
ATOM   3664 C CA  A GLN A 1 326 ? 37.735  5.384   -6.910  0.53 18.52 ? 319  GLN A CA  1 
ATOM   3665 C CA  B GLN A 1 326 ? 37.965  4.975   -6.808  0.47 18.87 ? 319  GLN A CA  1 
ATOM   3666 C C   A GLN A 1 326 ? 38.651  4.319   -7.493  0.53 23.02 ? 319  GLN A C   1 
ATOM   3667 C C   B GLN A 1 326 ? 38.684  3.827   -7.504  0.47 18.76 ? 319  GLN A C   1 
ATOM   3668 O O   A GLN A 1 326 ? 39.313  3.582   -6.766  0.53 18.33 ? 319  GLN A O   1 
ATOM   3669 O O   B GLN A 1 326 ? 39.066  2.834   -6.878  0.47 11.20 ? 319  GLN A O   1 
ATOM   3670 C CB  A GLN A 1 326 ? 38.550  6.632   -6.553  0.53 25.03 ? 319  GLN A CB  1 
ATOM   3671 C CB  B GLN A 1 326 ? 38.977  6.037   -6.370  0.47 23.21 ? 319  GLN A CB  1 
ATOM   3672 C CG  A GLN A 1 326 ? 37.799  7.936   -6.762  0.53 28.15 ? 319  GLN A CG  1 
ATOM   3673 C CG  B GLN A 1 326 ? 40.192  5.491   -5.644  0.47 25.82 ? 319  GLN A CG  1 
ATOM   3674 C CD  A GLN A 1 326 ? 36.463  7.950   -6.054  0.53 27.92 ? 319  GLN A CD  1 
ATOM   3675 C CD  B GLN A 1 326 ? 41.376  6.438   -5.704  0.47 40.86 ? 319  GLN A CD  1 
ATOM   3676 O OE1 A GLN A 1 326 ? 35.415  7.780   -6.677  0.53 36.40 ? 319  GLN A OE1 1 
ATOM   3677 O OE1 B GLN A 1 326 ? 41.694  6.988   -6.762  0.47 31.83 ? 319  GLN A OE1 1 
ATOM   3678 N NE2 A GLN A 1 326 ? 36.493  8.141   -4.739  0.53 40.20 ? 319  GLN A NE2 1 
ATOM   3679 N NE2 B GLN A 1 326 ? 42.028  6.640   -4.565  0.47 32.79 ? 319  GLN A NE2 1 
ATOM   3680 N N   A THR A 1 327 ? 38.659  4.250   -8.820  0.53 20.64 ? 320  THR A N   1 
ATOM   3681 N N   B THR A 1 327 ? 38.825  3.975   -8.817  0.47 20.19 ? 320  THR A N   1 
ATOM   3682 C CA  A THR A 1 327 ? 39.546  3.379   -9.583  0.53 17.86 ? 320  THR A CA  1 
ATOM   3683 C CA  B THR A 1 327 ? 39.625  3.097   -9.665  0.47 16.01 ? 320  THR A CA  1 
ATOM   3684 C C   A THR A 1 327 ? 40.199  4.217   -10.678 0.53 15.45 ? 320  THR A C   1 
ATOM   3685 C C   B THR A 1 327 ? 40.305  3.978   -10.706 0.47 16.03 ? 320  THR A C   1 
ATOM   3686 O O   A THR A 1 327 ? 39.803  5.363   -10.900 0.53 15.22 ? 320  THR A O   1 
ATOM   3687 O O   B THR A 1 327 ? 39.966  5.156   -10.839 0.47 16.46 ? 320  THR A O   1 
ATOM   3688 C CB  A THR A 1 327 ? 38.792  2.219   -10.239 0.53 18.62 ? 320  THR A CB  1 
ATOM   3689 C CB  B THR A 1 327 ? 38.779  2.043   -10.393 0.47 18.33 ? 320  THR A CB  1 
ATOM   3690 O OG1 A THR A 1 327 ? 37.802  2.762   -11.115 0.53 15.17 ? 320  THR A OG1 1 
ATOM   3691 O OG1 B THR A 1 327 ? 37.819  2.717   -11.210 0.47 15.41 ? 320  THR A OG1 1 
ATOM   3692 C CG2 A THR A 1 327 ? 38.099  1.356   -9.199  0.53 16.74 ? 320  THR A CG2 1 
ATOM   3693 C CG2 B THR A 1 327 ? 38.046  1.137   -9.416  0.47 14.65 ? 320  THR A CG2 1 
ATOM   3694 N N   A ALA A 1 328 ? 41.172  3.636   -11.375 0.53 17.64 ? 321  ALA A N   1 
ATOM   3695 N N   B ALA A 1 328 ? 41.239  3.406   -11.459 0.47 18.20 ? 321  ALA A N   1 
ATOM   3696 C CA  A ALA A 1 328 ? 41.842  4.312   -12.480 0.53 14.41 ? 321  ALA A CA  1 
ATOM   3697 C CA  B ALA A 1 328 ? 41.879  4.131   -12.549 0.47 14.37 ? 321  ALA A CA  1 
ATOM   3698 C C   A ALA A 1 328 ? 40.879  4.768   -13.572 0.53 16.96 ? 321  ALA A C   1 
ATOM   3699 C C   B ALA A 1 328 ? 40.891  4.500   -13.652 0.47 15.77 ? 321  ALA A C   1 
ATOM   3700 O O   A ALA A 1 328 ? 41.052  5.848   -14.141 0.53 17.13 ? 321  ALA A O   1 
ATOM   3701 O O   B ALA A 1 328 ? 41.033  5.541   -14.290 0.47 19.09 ? 321  ALA A O   1 
ATOM   3702 C CB  A ALA A 1 328 ? 42.910  3.404   -13.078 0.53 21.64 ? 321  ALA A CB  1 
ATOM   3703 C CB  B ALA A 1 328 ? 43.027  3.315   -13.128 0.47 21.63 ? 321  ALA A CB  1 
ATOM   3704 N N   A ASP A 1 329 ? 39.868  3.951   -13.853 0.53 20.49 ? 322  ASP A N   1 
ATOM   3705 N N   B ASP A 1 329 ? 39.890  3.652   -13.872 0.47 17.09 ? 322  ASP A N   1 
ATOM   3706 C CA  A ASP A 1 329 ? 38.926  4.236   -14.936 0.53 14.98 ? 322  ASP A CA  1 
ATOM   3707 C CA  B ASP A 1 329 ? 38.922  3.897   -14.941 0.47 14.43 ? 322  ASP A CA  1 
ATOM   3708 C C   A ASP A 1 329 ? 37.623  4.880   -14.451 0.53 15.08 ? 322  ASP A C   1 
ATOM   3709 C C   B ASP A 1 329 ? 37.632  4.580   -14.477 0.47 15.13 ? 322  ASP A C   1 
ATOM   3710 O O   A ASP A 1 329 ? 36.655  4.962   -15.203 0.53 15.15 ? 322  ASP A O   1 
ATOM   3711 O O   B ASP A 1 329 ? 36.707  4.746   -15.268 0.47 15.96 ? 322  ASP A O   1 
ATOM   3712 C CB  A ASP A 1 329 ? 38.610  2.950   -15.698 0.53 19.29 ? 322  ASP A CB  1 
ATOM   3713 C CB  B ASP A 1 329 ? 38.577  2.586   -15.644 0.47 21.16 ? 322  ASP A CB  1 
ATOM   3714 C CG  A ASP A 1 329 ? 39.854  2.167   -16.056 0.53 21.88 ? 322  ASP A CG  1 
ATOM   3715 C CG  B ASP A 1 329 ? 39.636  2.164   -16.642 0.47 25.59 ? 322  ASP A CG  1 
ATOM   3716 O OD1 A ASP A 1 329 ? 40.831  2.786   -16.535 0.53 25.51 ? 322  ASP A OD1 1 
ATOM   3717 O OD1 B ASP A 1 329 ? 40.482  3.009   -17.008 0.47 25.71 ? 322  ASP A OD1 1 
ATOM   3718 O OD2 A ASP A 1 329 ? 39.861  0.934   -15.845 0.53 29.11 ? 322  ASP A OD2 1 
ATOM   3719 O OD2 B ASP A 1 329 ? 39.620  0.987   -17.064 0.47 20.27 ? 322  ASP A OD2 1 
ATOM   3720 N N   A CYS A 1 330 ? 37.611  5.332   -13.198 0.53 13.12 ? 323  CYS A N   1 
ATOM   3721 N N   B CYS A 1 330 ? 37.573  4.978   -13.207 0.47 13.70 ? 323  CYS A N   1 
ATOM   3722 C CA  A CYS A 1 330 ? 36.445  5.974   -12.589 0.53 14.98 ? 323  CYS A CA  1 
ATOM   3723 C CA  B CYS A 1 330 ? 36.401  5.663   -12.652 0.47 14.68 ? 323  CYS A CA  1 
ATOM   3724 C C   A CYS A 1 330 ? 35.902  7.121   -13.436 0.53 14.17 ? 323  CYS A C   1 
ATOM   3725 C C   B CYS A 1 330 ? 35.981  6.853   -13.512 0.47 13.04 ? 323  CYS A C   1 
ATOM   3726 O O   A CYS A 1 330 ? 36.618  8.079   -13.728 0.53 11.81 ? 323  CYS A O   1 
ATOM   3727 O O   B CYS A 1 330 ? 36.832  7.629   -13.947 0.47 11.39 ? 323  CYS A O   1 
ATOM   3728 C CB  A CYS A 1 330 ? 36.805  6.489   -11.194 0.53 12.80 ? 323  CYS A CB  1 
ATOM   3729 C CB  B CYS A 1 330 ? 36.691  6.140   -11.226 0.47 15.46 ? 323  CYS A CB  1 
ATOM   3730 S SG  A CYS A 1 330 ? 35.460  7.320   -10.353 0.53 16.62 ? 323  CYS A SG  1 
ATOM   3731 S SG  B CYS A 1 330 ? 35.288  6.920   -10.408 0.47 14.74 ? 323  CYS A SG  1 
ATOM   3732 N N   A VAL A 1 331 ? 34.632  7.023   -13.820 0.53 13.30 ? 324  VAL A N   1 
ATOM   3733 N N   B VAL A 1 331 ? 34.678  6.997   -13.760 0.47 13.28 ? 324  VAL A N   1 
ATOM   3734 C CA  A VAL A 1 331 ? 34.009  8.058   -14.632 0.53 12.14 ? 324  VAL A CA  1 
ATOM   3735 C CA  B VAL A 1 331 ? 34.192  8.142   -14.526 0.47 12.43 ? 324  VAL A CA  1 
ATOM   3736 C C   A VAL A 1 331 ? 33.317  9.088   -13.749 0.53 14.23 ? 324  VAL A C   1 
ATOM   3737 C C   B VAL A 1 331 ? 33.378  9.119   -13.684 0.47 14.15 ? 324  VAL A C   1 
ATOM   3738 O O   A VAL A 1 331 ? 33.470  10.294  -13.965 0.53 14.65 ? 324  VAL A O   1 
ATOM   3739 O O   B VAL A 1 331 ? 33.481  10.331  -13.893 0.47 14.67 ? 324  VAL A O   1 
ATOM   3740 C CB  A VAL A 1 331 ? 32.987  7.471   -15.633 0.53 11.53 ? 324  VAL A CB  1 
ATOM   3741 C CB  B VAL A 1 331 ? 33.331  7.722   -15.744 0.47 13.90 ? 324  VAL A CB  1 
ATOM   3742 C CG1 A VAL A 1 331 ? 32.180  8.577   -16.293 0.53 10.29 ? 324  VAL A CG1 1 
ATOM   3743 C CG1 B VAL A 1 331 ? 34.201  7.110   -16.839 0.47 11.94 ? 324  VAL A CG1 1 
ATOM   3744 C CG2 A VAL A 1 331 ? 33.694  6.660   -16.695 0.53 12.35 ? 324  VAL A CG2 1 
ATOM   3745 C CG2 B VAL A 1 331 ? 32.207  6.787   -15.332 0.47 18.38 ? 324  VAL A CG2 1 
ATOM   3746 N N   . LEU A 1 332 ? 32.558  8.613   -12.757 1.00 11.60 ? 325  LEU A N   1 
ATOM   3747 C CA  . LEU A 1 332 ? 31.771  9.494   -11.883 1.00 15.00 ? 325  LEU A CA  1 
ATOM   3748 C C   . LEU A 1 332 ? 32.119  9.337   -10.410 1.00 13.84 ? 325  LEU A C   1 
ATOM   3749 O O   . LEU A 1 332 ? 31.487  8.583   -9.695  1.00 14.56 ? 325  LEU A O   1 
ATOM   3750 C CB  . LEU A 1 332 ? 30.276  9.236   -12.042 1.00 11.47 ? 325  LEU A CB  1 
ATOM   3751 C CG  . LEU A 1 332 ? 29.741  9.278   -13.473 1.00 13.81 ? 325  LEU A CG  1 
ATOM   3752 C CD1 . LEU A 1 332 ? 28.249  9.030   -13.436 1.00 16.82 ? 325  LEU A CD1 1 
ATOM   3753 C CD2 . LEU A 1 332 ? 30.049  10.623  -14.132 1.00 16.73 ? 325  LEU A CD2 1 
ATOM   3754 N N   . PRO A 1 333 ? 33.117  10.074  -9.940  1.00 12.17 ? 326  PRO A N   1 
ATOM   3755 C CA  . PRO A 1 333 ? 33.528  9.929   -8.536  1.00 10.66 ? 326  PRO A CA  1 
ATOM   3756 C C   . PRO A 1 333 ? 32.654  10.715  -7.555  1.00 16.13 ? 326  PRO A C   1 
ATOM   3757 O O   . PRO A 1 333 ? 32.703  10.497  -6.338  1.00 13.68 ? 326  PRO A O   1 
ATOM   3758 C CB  . PRO A 1 333 ? 34.943  10.494  -8.546  1.00 13.23 ? 326  PRO A CB  1 
ATOM   3759 C CG  . PRO A 1 333 ? 34.891  11.543  -9.637  1.00 14.39 ? 326  PRO A CG  1 
ATOM   3760 C CD  . PRO A 1 333 ? 34.047  10.910  -10.709 1.00 13.18 ? 326  PRO A CD  1 
ATOM   3761 N N   . LYS A 1 334 ? 31.867  11.642  -8.090  1.00 14.25 ? 327  LYS A N   1 
ATOM   3762 C CA  . LYS A 1 334 ? 30.986  12.485  -7.288  1.00 14.09 ? 327  LYS A CA  1 
ATOM   3763 C C   . LYS A 1 334 ? 29.650  12.673  -7.988  1.00 15.42 ? 327  LYS A C   1 
ATOM   3764 O O   . LYS A 1 334 ? 29.510  12.336  -9.162  1.00 15.56 ? 327  LYS A O   1 
ATOM   3765 C CB  . LYS A 1 334 ? 31.603  13.871  -7.037  1.00 15.01 ? 327  LYS A CB  1 
ATOM   3766 C CG  . LYS A 1 334 ? 32.862  13.890  -6.186  1.00 20.66 ? 327  LYS A CG  1 
ATOM   3767 C CD  . LYS A 1 334 ? 33.172  15.313  -5.721  1.00 25.61 ? 327  LYS A CD  1 
ATOM   3768 C CE  . LYS A 1 334 ? 33.848  15.301  -4.364  1.00 35.10 ? 327  LYS A CE  1 
ATOM   3769 N NZ  . LYS A 1 334 ? 34.732  14.115  -4.233  1.00 32.04 ? 327  LYS A NZ  1 
ATOM   3770 N N   . HIS A 1 335 ? 28.684  13.246  -7.279  1.00 15.10 ? 328  HIS A N   1 
ATOM   3771 C CA  . HIS A 1 335 ? 27.412  13.610  -7.897  1.00 13.31 ? 328  HIS A CA  1 
ATOM   3772 C C   . HIS A 1 335 ? 27.648  14.653  -9.008  1.00 10.67 ? 328  HIS A C   1 
ATOM   3773 O O   . HIS A 1 335 ? 28.569  15.476  -8.909  1.00 13.44 ? 328  HIS A O   1 
ATOM   3774 C CB  . HIS A 1 335 ? 26.421  14.109  -6.836  1.00 14.83 ? 328  HIS A CB  1 
ATOM   3775 C CG  . HIS A 1 335 ? 25.798  12.998  -6.052  1.00 17.40 ? 328  HIS A CG  1 
ATOM   3776 N ND1 . HIS A 1 335 ? 24.627  12.382  -6.441  1.00 24.77 ? 328  HIS A ND1 1 
ATOM   3777 C CD2 . HIS A 1 335 ? 26.225  12.335  -4.949  1.00 19.96 ? 328  HIS A CD2 1 
ATOM   3778 C CE1 . HIS A 1 335 ? 24.339  11.413  -5.589  1.00 29.92 ? 328  HIS A CE1 1 
ATOM   3779 N NE2 . HIS A 1 335 ? 25.293  11.363  -4.675  1.00 36.24 ? 328  HIS A NE2 1 
ATOM   3780 N N   A PRO A 1 336 ? 26.810  14.615  -10.062 0.33 15.58 ? 329  PRO A N   1 
ATOM   3781 N N   B PRO A 1 336 ? 26.844  14.582  -10.083 0.67 15.62 ? 329  PRO A N   1 
ATOM   3782 C CA  A PRO A 1 336 ? 26.956  15.489  -11.233 0.33 15.51 ? 329  PRO A CA  1 
ATOM   3783 C CA  B PRO A 1 336 ? 26.946  15.483  -11.237 0.67 15.54 ? 329  PRO A CA  1 
ATOM   3784 C C   A PRO A 1 336 ? 27.105  16.963  -10.883 0.33 12.52 ? 329  PRO A C   1 
ATOM   3785 C C   B PRO A 1 336 ? 27.102  16.959  -10.884 0.67 12.27 ? 329  PRO A C   1 
ATOM   3786 O O   A PRO A 1 336 ? 27.923  17.642  -11.496 0.33 14.86 ? 329  PRO A O   1 
ATOM   3787 O O   B PRO A 1 336 ? 27.915  17.639  -11.497 0.67 14.67 ? 329  PRO A O   1 
ATOM   3788 C CB  A PRO A 1 336 ? 25.655  15.252  -12.021 0.33 19.33 ? 329  PRO A CB  1 
ATOM   3789 C CB  B PRO A 1 336 ? 25.627  15.236  -11.973 0.67 19.52 ? 329  PRO A CB  1 
ATOM   3790 C CG  A PRO A 1 336 ? 24.748  14.499  -11.100 0.33 13.23 ? 329  PRO A CG  1 
ATOM   3791 C CG  B PRO A 1 336 ? 25.362  13.778  -11.728 0.67 18.57 ? 329  PRO A CG  1 
ATOM   3792 C CD  A PRO A 1 336 ? 25.648  13.725  -10.195 0.33 15.46 ? 329  PRO A CD  1 
ATOM   3793 C CD  B PRO A 1 336 ? 25.882  13.493  -10.326 0.67 16.60 ? 329  PRO A CD  1 
ATOM   3794 N N   . ARG A 1 337 ? 26.331  17.451  -9.918  1.00 19.15 ? 330  ARG A N   1 
ATOM   3795 C CA  . ARG A 1 337 ? 26.412  18.856  -9.546  1.00 15.88 ? 330  ARG A CA  1 
ATOM   3796 C C   . ARG A 1 337 ? 27.794  19.198  -8.991  1.00 15.84 ? 330  ARG A C   1 
ATOM   3797 O O   . ARG A 1 337 ? 28.316  20.262  -9.271  1.00 19.06 ? 330  ARG A O   1 
ATOM   3798 C CB  . ARG A 1 337 ? 25.332  19.222  -8.523  1.00 18.30 ? 330  ARG A CB  1 
ATOM   3799 C CG  . ARG A 1 337 ? 23.942  19.408  -9.103  1.00 15.08 ? 330  ARG A CG  1 
ATOM   3800 C CD  . ARG A 1 337 ? 22.941  19.946  -8.036  1.00 16.02 ? 330  ARG A CD  1 
ATOM   3801 N NE  . ARG A 1 337 ? 23.243  21.304  -7.597  1.00 19.16 ? 330  ARG A NE  1 
ATOM   3802 C CZ  . ARG A 1 337 ? 23.785  21.597  -6.419  1.00 22.21 ? 330  ARG A CZ  1 
ATOM   3803 N NH1 . ARG A 1 337 ? 24.082  20.625  -5.569  1.00 21.22 ? 330  ARG A NH1 1 
ATOM   3804 N NH2 . ARG A 1 337 ? 24.045  22.859  -6.100  1.00 19.01 ? 330  ARG A NH2 1 
ATOM   3805 N N   . GLU A 1 338 ? 28.382  18.285  -8.216  1.00 17.27 ? 331  GLU A N   1 
ATOM   3806 C CA  . GLU A 1 338 ? 29.727  18.517  -7.700  1.00 15.53 ? 331  GLU A CA  1 
ATOM   3807 C C   . GLU A 1 338 ? 30.734  18.466  -8.849  1.00 13.76 ? 331  GLU A C   1 
ATOM   3808 O O   . GLU A 1 338 ? 31.696  19.236  -8.878  1.00 16.70 ? 331  GLU A O   1 
ATOM   3809 C CB  . GLU A 1 338 ? 30.099  17.492  -6.618  1.00 14.43 ? 331  GLU A CB  1 
ATOM   3810 C CG  . GLU A 1 338 ? 29.114  17.439  -5.455  1.00 31.09 ? 331  GLU A CG  1 
ATOM   3811 C CD  . GLU A 1 338 ? 28.833  18.806  -4.850  1.00 39.03 ? 331  GLU A CD  1 
ATOM   3812 O OE1 . GLU A 1 338 ? 29.789  19.600  -4.694  1.00 26.51 ? 331  GLU A OE1 1 
ATOM   3813 O OE2 . GLU A 1 338 ? 27.653  19.084  -4.536  1.00 41.71 ? 331  GLU A OE2 1 
ATOM   3814 N N   . MET A 1 339 ? 30.498  17.567  -9.804  1.00 11.88 ? 332  MET A N   1 
ATOM   3815 C CA  . MET A 1 339 ? 31.411  17.416  -10.932 1.00 16.66 ? 332  MET A CA  1 
ATOM   3816 C C   . MET A 1 339 ? 31.383  18.659  -11.823 1.00 13.95 ? 332  MET A C   1 
ATOM   3817 O O   . MET A 1 339 ? 32.399  19.040  -12.401 1.00 15.27 ? 332  MET A O   1 
ATOM   3818 C CB  . MET A 1 339 ? 31.083  16.146  -11.737 1.00 16.13 ? 332  MET A CB  1 
ATOM   3819 C CG  . MET A 1 339 ? 31.408  14.826  -10.981 1.00 15.18 ? 332  MET A CG  1 
ATOM   3820 S SD  . MET A 1 339 ? 31.217  13.318  -11.951 1.00 19.32 ? 332  MET A SD  1 
ATOM   3821 C CE  . MET A 1 339 ? 32.490  13.513  -13.210 1.00 15.50 ? 332  MET A CE  1 
ATOM   3822 N N   . VAL A 1 340 ? 30.238  19.329  -11.890 1.00 11.58 ? 333  VAL A N   1 
ATOM   3823 C CA  . VAL A 1 340 ? 30.145  20.536  -12.708 1.00 12.66 ? 333  VAL A CA  1 
ATOM   3824 C C   . VAL A 1 340 ? 31.133  21.613  -12.202 1.00 12.96 ? 333  VAL A C   1 
ATOM   3825 O O   . VAL A 1 340 ? 31.688  22.370  -12.983 1.00 16.67 ? 333  VAL A O   1 
ATOM   3826 C CB  . VAL A 1 340 ? 28.697  21.112  -12.720 1.00 15.54 ? 333  VAL A CB  1 
ATOM   3827 C CG1 . VAL A 1 340 ? 28.668  22.470  -13.385 1.00 14.26 ? 333  VAL A CG1 1 
ATOM   3828 C CG2 . VAL A 1 340 ? 27.718  20.155  -13.389 1.00 13.50 ? 333  VAL A CG2 1 
ATOM   3829 N N   . LYS A 1 341 ? 31.374  21.655  -10.892 1.00 15.13 ? 334  LYS A N   1 
ATOM   3830 C CA  . LYS A 1 341 ? 32.222  22.693  -10.327 1.00 14.50 ? 334  LYS A CA  1 
ATOM   3831 C C   . LYS A 1 341 ? 33.663  22.647  -10.821 1.00 21.54 ? 334  LYS A C   1 
ATOM   3832 O O   . LYS A 1 341 ? 34.352  23.652  -10.731 1.00 21.27 ? 334  LYS A O   1 
ATOM   3833 C CB  . LYS A 1 341 ? 32.224  22.607  -8.798  1.00 22.26 ? 334  LYS A CB  1 
ATOM   3834 C CG  . LYS A 1 341 ? 30.875  22.895  -8.171  1.00 23.63 ? 334  LYS A CG  1 
ATOM   3835 C CD  . LYS A 1 341 ? 30.876  22.568  -6.677  1.00 27.56 ? 334  LYS A CD  1 
ATOM   3836 C CE  . LYS A 1 341 ? 29.500  22.771  -6.069  1.00 25.57 ? 334  LYS A CE  1 
ATOM   3837 N NZ  . LYS A 1 341 ? 29.563  22.750  -4.573  1.00 38.73 ? 334  LYS A NZ  1 
ATOM   3838 N N   . THR A 1 342 ? 34.110  21.500  -11.340 1.00 16.89 ? 335  THR A N   1 
ATOM   3839 C CA  . THR A 1 342 ? 35.495  21.342  -11.812 1.00 18.26 ? 335  THR A CA  1 
ATOM   3840 C C   . THR A 1 342 ? 35.583  20.811  -13.241 1.00 20.04 ? 335  THR A C   1 
ATOM   3841 O O   . THR A 1 342 ? 36.657  20.421  -13.693 1.00 19.78 ? 335  THR A O   1 
ATOM   3842 C CB  . THR A 1 342 ? 36.308  20.376  -10.911 1.00 16.26 ? 335  THR A CB  1 
ATOM   3843 O OG1 . THR A 1 342 ? 35.648  19.103  -10.843 1.00 17.00 ? 335  THR A OG1 1 
ATOM   3844 C CG2 . THR A 1 342 ? 36.471  20.946  -9.494  1.00 23.11 ? 335  THR A CG2 1 
ATOM   3845 N N   . ALA A 1 343 ? 34.463  20.820  -13.961 1.00 12.95 ? 336  ALA A N   1 
ATOM   3846 C CA  . ALA A 1 343 ? 34.366  20.112  -15.236 1.00 13.85 ? 336  ALA A CA  1 
ATOM   3847 C C   . ALA A 1 343 ? 35.107  20.778  -16.392 1.00 13.89 ? 336  ALA A C   1 
ATOM   3848 O O   . ALA A 1 343 ? 34.925  21.966  -16.678 1.00 14.81 ? 336  ALA A O   1 
ATOM   3849 C CB  . ALA A 1 343 ? 32.914  19.953  -15.605 1.00 14.34 ? 336  ALA A CB  1 
ATOM   3850 N N   . TRP A 1 344 ? 35.915  19.993  -17.092 1.00 12.38 ? 337  TRP A N   1 
ATOM   3851 C CA  . TRP A 1 344 ? 36.662  20.552  -18.216 1.00 12.88 ? 337  TRP A CA  1 
ATOM   3852 C C   . TRP A 1 344 ? 35.724  21.029  -19.337 1.00 12.25 ? 337  TRP A C   1 
ATOM   3853 O O   . TRP A 1 344 ? 36.046  21.980  -20.058 1.00 14.91 ? 337  TRP A O   1 
ATOM   3854 C CB  . TRP A 1 344 ? 37.669  19.527  -18.765 1.00 13.06 ? 337  TRP A CB  1 
ATOM   3855 C CG  . TRP A 1 344 ? 37.060  18.412  -19.524 1.00 13.95 ? 337  TRP A CG  1 
ATOM   3856 C CD1 . TRP A 1 344 ? 36.681  17.217  -19.027 1.00 10.80 ? 337  TRP A CD1 1 
ATOM   3857 C CD2 . TRP A 1 344 ? 36.755  18.390  -20.921 1.00 13.04 ? 337  TRP A CD2 1 
ATOM   3858 N NE1 . TRP A 1 344 ? 36.167  16.426  -20.029 1.00 11.51 ? 337  TRP A NE1 1 
ATOM   3859 C CE2 . TRP A 1 344 ? 36.188  17.136  -21.198 1.00 9.26  ? 337  TRP A CE2 1 
ATOM   3860 C CE3 . TRP A 1 344 ? 36.905  19.310  -21.963 1.00 13.26 ? 337  TRP A CE3 1 
ATOM   3861 C CZ2 . TRP A 1 344 ? 35.764  16.770  -22.478 1.00 12.17 ? 337  TRP A CZ2 1 
ATOM   3862 C CZ3 . TRP A 1 344 ? 36.488  18.943  -23.245 1.00 14.31 ? 337  TRP A CZ3 1 
ATOM   3863 C CH2 . TRP A 1 344 ? 35.925  17.687  -23.489 1.00 11.32 ? 337  TRP A CH2 1 
ATOM   3864 N N   . GLY A 1 345 ? 34.576  20.367  -19.466 1.00 13.28 ? 338  GLY A N   1 
ATOM   3865 C CA  . GLY A 1 345 ? 33.621  20.647  -20.523 1.00 13.76 ? 338  GLY A CA  1 
ATOM   3866 C C   . GLY A 1 345 ? 32.853  21.945  -20.355 1.00 18.71 ? 338  GLY A C   1 
ATOM   3867 O O   . GLY A 1 345 ? 32.175  22.399  -21.271 1.00 14.33 ? 338  GLY A O   1 
ATOM   3868 N N   A ASN A 1 346 ? 32.944  22.558  -19.177 0.74 14.85 ? 339  ASN A N   1 
ATOM   3869 N N   B ASN A 1 346 ? 32.969  22.571  -19.191 0.26 14.85 ? 339  ASN A N   1 
ATOM   3870 C CA  A ASN A 1 346 ? 32.327  23.868  -18.973 0.74 16.52 ? 339  ASN A CA  1 
ATOM   3871 C CA  B ASN A 1 346 ? 32.403  23.901  -19.025 0.26 16.53 ? 339  ASN A CA  1 
ATOM   3872 C C   A ASN A 1 346 ? 32.927  24.915  -19.907 0.74 17.46 ? 339  ASN A C   1 
ATOM   3873 C C   B ASN A 1 346 ? 33.195  24.911  -19.860 0.26 17.96 ? 339  ASN A C   1 
ATOM   3874 O O   A ASN A 1 346 ? 32.332  25.959  -20.168 0.74 15.21 ? 339  ASN A O   1 
ATOM   3875 O O   B ASN A 1 346 ? 32.765  26.045  -20.062 0.26 18.42 ? 339  ASN A O   1 
ATOM   3876 C CB  A ASN A 1 346 ? 32.503  24.340  -17.524 0.74 15.38 ? 339  ASN A CB  1 
ATOM   3877 C CB  B ASN A 1 346 ? 32.390  24.296  -17.547 0.26 15.67 ? 339  ASN A CB  1 
ATOM   3878 C CG  A ASN A 1 346 ? 31.693  23.531  -16.531 0.74 16.09 ? 339  ASN A CG  1 
ATOM   3879 C CG  B ASN A 1 346 ? 31.586  23.330  -16.693 0.26 14.94 ? 339  ASN A CG  1 
ATOM   3880 O OD1 A ASN A 1 346 ? 30.771  22.819  -16.899 0.74 15.50 ? 339  ASN A OD1 1 
ATOM   3881 O OD1 B ASN A 1 346 ? 31.108  22.307  -17.180 0.26 16.92 ? 339  ASN A OD1 1 
ATOM   3882 N ND2 A ASN A 1 346 ? 32.033  23.658  -15.247 0.74 14.59 ? 339  ASN A ND2 1 
ATOM   3883 N ND2 B ASN A 1 346 ? 31.450  23.641  -15.407 0.26 16.63 ? 339  ASN A ND2 1 
ATOM   3884 N N   A SER A 1 347 ? 34.121  24.622  -20.405 0.74 14.83 ? 340  SER A N   1 
ATOM   3885 N N   B SER A 1 347 ? 34.347  24.473  -20.362 0.26 14.50 ? 340  SER A N   1 
ATOM   3886 C CA  A SER A 1 347 ? 34.892  25.603  -21.133 0.74 11.04 ? 340  SER A CA  1 
ATOM   3887 C CA  B SER A 1 347 ? 35.236  25.333  -21.130 0.26 13.25 ? 340  SER A CA  1 
ATOM   3888 C C   A SER A 1 347 ? 35.081  25.231  -22.604 0.74 19.00 ? 340  SER A C   1 
ATOM   3889 C C   B SER A 1 347 ? 35.202  25.079  -22.639 0.26 18.79 ? 340  SER A C   1 
ATOM   3890 O O   A SER A 1 347 ? 36.057  25.621  -23.236 0.74 22.73 ? 340  SER A O   1 
ATOM   3891 O O   B SER A 1 347 ? 36.150  25.423  -23.341 0.26 20.73 ? 340  SER A O   1 
ATOM   3892 C CB  A SER A 1 347 ? 36.226  25.801  -20.425 0.74 16.61 ? 340  SER A CB  1 
ATOM   3893 C CB  B SER A 1 347 ? 36.673  25.172  -20.628 0.26 14.10 ? 340  SER A CB  1 
ATOM   3894 O OG  A SER A 1 347 ? 35.986  26.258  -19.103 0.74 20.66 ? 340  SER A OG  1 
ATOM   3895 O OG  B SER A 1 347 ? 36.793  25.558  -19.272 0.26 21.42 ? 340  SER A OG  1 
ATOM   3896 N N   . ILE A 1 348 ? 34.129  24.479  -23.148 1.00 15.83 ? 341  ILE A N   1 
ATOM   3897 C CA  . ILE A 1 348 ? 34.002  24.331  -24.605 1.00 16.40 ? 341  ILE A CA  1 
ATOM   3898 C C   . ILE A 1 348 ? 32.633  24.840  -25.048 1.00 13.26 ? 341  ILE A C   1 
ATOM   3899 O O   . ILE A 1 348 ? 31.700  24.838  -24.256 1.00 14.63 ? 341  ILE A O   1 
ATOM   3900 C CB  . ILE A 1 348 ? 34.185  22.869  -25.090 1.00 17.19 ? 341  ILE A CB  1 
ATOM   3901 C CG1 . ILE A 1 348 ? 33.019  21.991  -24.615 1.00 16.45 ? 341  ILE A CG1 1 
ATOM   3902 C CG2 . ILE A 1 348 ? 35.571  22.329  -24.683 1.00 20.22 ? 341  ILE A CG2 1 
ATOM   3903 C CD1 . ILE A 1 348 ? 33.127  20.529  -25.008 1.00 15.24 ? 341  ILE A CD1 1 
ATOM   3904 N N   . PRO A 1 349 ? 32.531  25.327  -26.296 1.00 12.61 ? 342  PRO A N   1 
ATOM   3905 C CA  . PRO A 1 349 ? 31.246  25.808  -26.816 1.00 15.36 ? 342  PRO A CA  1 
ATOM   3906 C C   . PRO A 1 349 ? 30.159  24.739  -26.676 1.00 11.47 ? 342  PRO A C   1 
ATOM   3907 O O   . PRO A 1 349 ? 30.401  23.563  -26.948 1.00 14.33 ? 342  PRO A O   1 
ATOM   3908 C CB  . PRO A 1 349 ? 31.555  26.119  -28.293 1.00 16.48 ? 342  PRO A CB  1 
ATOM   3909 C CG  . PRO A 1 349 ? 33.012  26.425  -28.292 1.00 15.88 ? 342  PRO A CG  1 
ATOM   3910 C CD  . PRO A 1 349 ? 33.642  25.574  -27.235 1.00 14.85 ? 342  PRO A CD  1 
ATOM   3911 N N   . THR A 1 350 ? 28.970  25.153  -26.247 1.00 9.95  ? 343  THR A N   1 
ATOM   3912 C CA  . THR A 1 350 ? 27.923  24.220  -25.876 1.00 12.77 ? 343  THR A CA  1 
ATOM   3913 C C   . THR A 1 350 ? 26.607  24.735  -26.411 1.00 17.36 ? 343  THR A C   1 
ATOM   3914 O O   . THR A 1 350 ? 26.355  25.940  -26.403 1.00 13.29 ? 343  THR A O   1 
ATOM   3915 C CB  . THR A 1 350 ? 27.818  24.074  -24.346 1.00 17.64 ? 343  THR A CB  1 
ATOM   3916 O OG1 . THR A 1 350 ? 29.029  23.513  -23.829 1.00 18.53 ? 343  THR A OG1 1 
ATOM   3917 C CG2 . THR A 1 350 ? 26.648  23.186  -23.956 1.00 15.78 ? 343  THR A CG2 1 
ATOM   3918 N N   . MET A 1 351 ? 25.768  23.825  -26.877 1.00 10.15 ? 344  MET A N   1 
ATOM   3919 C CA  . MET A 1 351 ? 24.414  24.177  -27.283 1.00 11.31 ? 344  MET A CA  1 
ATOM   3920 C C   . MET A 1 351 ? 23.478  23.219  -26.556 1.00 11.27 ? 344  MET A C   1 
ATOM   3921 O O   . MET A 1 351 ? 23.752  22.024  -26.477 1.00 13.62 ? 344  MET A O   1 
ATOM   3922 C CB  . MET A 1 351 ? 24.255  24.098  -28.812 1.00 14.06 ? 344  MET A CB  1 
ATOM   3923 C CG  . MET A 1 351 ? 22.847  24.469  -29.297 1.00 14.17 ? 344  MET A CG  1 
ATOM   3924 S SD  . MET A 1 351 ? 22.785  24.868  -31.061 1.00 18.27 ? 344  MET A SD  1 
ATOM   3925 C CE  . MET A 1 351 ? 23.442  23.368  -31.770 1.00 14.95 ? 344  MET A CE  1 
ATOM   3926 N N   . MET A 1 352 ? 22.394  23.761  -26.008 1.00 16.95 ? 345  MET A N   1 
ATOM   3927 C CA  . MET A 1 352 ? 21.386  22.988  -25.300 1.00 13.54 ? 345  MET A CA  1 
ATOM   3928 C C   . MET A 1 352 ? 20.019  23.340  -25.814 1.00 13.65 ? 345  MET A C   1 
ATOM   3929 O O   . MET A 1 352 ? 19.790  24.467  -26.248 1.00 13.39 ? 345  MET A O   1 
ATOM   3930 C CB  . MET A 1 352 ? 21.425  23.246  -23.792 1.00 14.44 ? 345  MET A CB  1 
ATOM   3931 C CG  . MET A 1 352 ? 22.773  23.131  -23.183 1.00 17.05 ? 345  MET A CG  1 
ATOM   3932 S SD  . MET A 1 352 ? 22.557  23.428  -21.420 1.00 19.21 ? 345  MET A SD  1 
ATOM   3933 C CE  . MET A 1 352 ? 24.272  23.421  -20.909 1.00 25.35 ? 345  MET A CE  1 
ATOM   3934 N N   . GLY A 1 353 ? 19.088  22.402  -25.719 1.00 11.33 ? 346  GLY A N   1 
ATOM   3935 C CA  . GLY A 1 353 ? 17.731  22.733  -26.083 1.00 14.98 ? 346  GLY A CA  1 
ATOM   3936 C C   . GLY A 1 353 ? 16.755  21.661  -25.708 1.00 13.59 ? 346  GLY A C   1 
ATOM   3937 O O   . GLY A 1 353 ? 17.146  20.574  -25.296 1.00 14.74 ? 346  GLY A O   1 
ATOM   3938 N N   A ASN A 1 354 ? 15.475  21.984  -25.859 0.60 9.36  ? 347  ASN A N   1 
ATOM   3939 N N   B ASN A 1 354 ? 15.471  21.987  -25.832 0.40 9.42  ? 347  ASN A N   1 
ATOM   3940 C CA  A ASN A 1 354 ? 14.374  21.075  -25.580 0.60 12.92 ? 347  ASN A CA  1 
ATOM   3941 C CA  B ASN A 1 354 ? 14.367  21.078  -25.540 0.40 12.76 ? 347  ASN A CA  1 
ATOM   3942 C C   A ASN A 1 354 ? 13.313  21.262  -26.651 0.60 11.38 ? 347  ASN A C   1 
ATOM   3943 C C   B ASN A 1 354 ? 13.240  21.336  -26.528 0.40 11.14 ? 347  ASN A C   1 
ATOM   3944 O O   A ASN A 1 354 ? 13.403  22.183  -27.461 0.60 11.52 ? 347  ASN A O   1 
ATOM   3945 O O   B ASN A 1 354 ? 13.209  22.391  -27.154 0.40 12.73 ? 347  ASN A O   1 
ATOM   3946 C CB  A ASN A 1 354 ? 13.778  21.347  -24.192 0.60 12.42 ? 347  ASN A CB  1 
ATOM   3947 C CB  B ASN A 1 354 ? 13.852  21.270  -24.106 0.40 12.51 ? 347  ASN A CB  1 
ATOM   3948 C CG  A ASN A 1 354 ? 14.812  21.279  -23.090 0.60 10.31 ? 347  ASN A CG  1 
ATOM   3949 C CG  B ASN A 1 354 ? 14.881  20.895  -23.057 0.40 13.71 ? 347  ASN A CG  1 
ATOM   3950 O OD1 A ASN A 1 354 ? 15.487  20.261  -22.921 0.60 17.23 ? 347  ASN A OD1 1 
ATOM   3951 O OD1 B ASN A 1 354 ? 15.026  19.724  -22.715 0.40 14.22 ? 347  ASN A OD1 1 
ATOM   3952 N ND2 A ASN A 1 354 ? 14.944  22.365  -22.336 0.60 12.98 ? 347  ASN A ND2 1 
ATOM   3953 N ND2 B ASN A 1 354 ? 15.585  21.888  -22.529 0.40 15.53 ? 347  ASN A ND2 1 
ATOM   3954 N N   . THR A 1 355 ? 12.312  20.392  -26.667 1.00 10.61 ? 348  THR A N   1 
ATOM   3955 C CA  . THR A 1 355 ? 11.150  20.635  -27.523 1.00 10.53 ? 348  THR A CA  1 
ATOM   3956 C C   . THR A 1 355 ? 10.124  21.520  -26.805 1.00 13.68 ? 348  THR A C   1 
ATOM   3957 O O   . THR A 1 355 ? 10.238  21.796  -25.595 1.00 12.25 ? 348  THR A O   1 
ATOM   3958 C CB  . THR A 1 355 ? 10.463  19.333  -27.971 1.00 14.33 ? 348  THR A CB  1 
ATOM   3959 O OG1 . THR A 1 355 ? 9.774   18.741  -26.864 1.00 15.09 ? 348  THR A OG1 1 
ATOM   3960 C CG2 . THR A 1 355 ? 11.475  18.330  -28.525 1.00 14.45 ? 348  THR A CG2 1 
ATOM   3961 N N   B SER A 1 356 ? 9.129   21.982  -27.555 0.17 11.74 ? 349  SER A N   1 
ATOM   3962 N N   C SER A 1 356 ? 9.110   21.944  -27.548 0.83 11.71 ? 349  SER A N   1 
ATOM   3963 C CA  B SER A 1 356 ? 8.121   22.885  -27.008 0.17 13.14 ? 349  SER A CA  1 
ATOM   3964 C CA  C SER A 1 356 ? 8.085   22.832  -27.005 0.83 13.13 ? 349  SER A CA  1 
ATOM   3965 C C   B SER A 1 356 ? 7.279   22.221  -25.928 0.17 11.83 ? 349  SER A C   1 
ATOM   3966 C C   C SER A 1 356 ? 6.990   22.123  -26.199 0.83 13.59 ? 349  SER A C   1 
ATOM   3967 O O   B SER A 1 356 ? 7.063   22.802  -24.870 0.17 16.12 ? 349  SER A O   1 
ATOM   3968 O O   C SER A 1 356 ? 6.166   22.799  -25.580 0.83 12.13 ? 349  SER A O   1 
ATOM   3969 C CB  B SER A 1 356 ? 7.214   23.412  -28.114 0.17 15.69 ? 349  SER A CB  1 
ATOM   3970 C CB  C SER A 1 356 ? 7.439   23.643  -28.127 0.83 14.86 ? 349  SER A CB  1 
ATOM   3971 O OG  B SER A 1 356 ? 7.673   24.666  -28.580 0.17 19.93 ? 349  SER A OG  1 
ATOM   3972 O OG  C SER A 1 356 ? 6.905   22.799  -29.144 0.83 12.60 ? 349  SER A OG  1 
ATOM   3973 N N   B TYR A 1 357 ? 6.800   21.011  -26.199 0.17 12.04 ? 350  TYR A N   1 
ATOM   3974 N N   C TYR A 1 357 ? 6.951   20.789  -26.209 0.83 11.15 ? 350  TYR A N   1 
ATOM   3975 C CA  B TYR A 1 357 ? 6.024   20.259  -25.215 0.17 12.68 ? 350  TYR A CA  1 
ATOM   3976 C CA  C TYR A 1 357 ? 6.020   20.050  -25.339 0.83 13.14 ? 350  TYR A CA  1 
ATOM   3977 C C   B TYR A 1 357 ? 6.611   18.865  -25.009 0.17 12.30 ? 350  TYR A C   1 
ATOM   3978 C C   C TYR A 1 357 ? 6.586   18.666  -24.968 0.83 12.04 ? 350  TYR A C   1 
ATOM   3979 O O   B TYR A 1 357 ? 6.129   17.887  -25.575 0.17 14.58 ? 350  TYR A O   1 
ATOM   3980 O O   C TYR A 1 357 ? 6.019   17.621  -25.289 0.83 12.03 ? 350  TYR A O   1 
ATOM   3981 C CB  B TYR A 1 357 ? 4.554   20.165  -25.641 0.17 13.03 ? 350  TYR A CB  1 
ATOM   3982 C CB  C TYR A 1 357 ? 4.640   19.927  -26.010 0.83 13.43 ? 350  TYR A CB  1 
ATOM   3983 C CG  B TYR A 1 357 ? 3.712   21.338  -25.185 0.17 15.13 ? 350  TYR A CG  1 
ATOM   3984 C CG  C TYR A 1 357 ? 3.485   19.656  -25.048 0.83 12.02 ? 350  TYR A CG  1 
ATOM   3985 C CD1 B TYR A 1 357 ? 4.179   22.211  -24.210 0.17 11.42 ? 350  TYR A CD1 1 
ATOM   3986 C CD1 C TYR A 1 357 ? 3.708   19.367  -23.706 0.83 10.66 ? 350  TYR A CD1 1 
ATOM   3987 C CD2 B TYR A 1 357 ? 2.452   21.568  -25.720 0.17 15.29 ? 350  TYR A CD2 1 
ATOM   3988 C CD2 C TYR A 1 357 ? 2.166   19.711  -25.487 0.83 10.76 ? 350  TYR A CD2 1 
ATOM   3989 C CE1 B TYR A 1 357 ? 3.422   23.283  -23.784 0.17 15.09 ? 350  TYR A CE1 1 
ATOM   3990 C CE1 C TYR A 1 357 ? 2.645   19.114  -22.830 0.83 13.93 ? 350  TYR A CE1 1 
ATOM   3991 C CE2 B TYR A 1 357 ? 1.683   22.643  -25.295 0.17 19.53 ? 350  TYR A CE2 1 
ATOM   3992 C CE2 C TYR A 1 357 ? 1.104   19.465  -24.632 0.83 14.21 ? 350  TYR A CE2 1 
ATOM   3993 C CZ  B TYR A 1 357 ? 2.178   23.494  -24.327 0.17 15.64 ? 350  TYR A CZ  1 
ATOM   3994 C CZ  C TYR A 1 357 ? 1.341   19.159  -23.301 0.83 15.83 ? 350  TYR A CZ  1 
ATOM   3995 O OH  B TYR A 1 357 ? 1.429   24.563  -23.897 0.17 25.00 ? 350  TYR A OH  1 
ATOM   3996 O OH  C TYR A 1 357 ? 0.245   18.922  -22.479 0.83 16.64 ? 350  TYR A OH  1 
ATOM   3997 N N   B GLU A 1 358 ? 7.654   18.789  -24.189 0.17 10.17 ? 351  GLU A N   1 
ATOM   3998 N N   C GLU A 1 358 ? 7.700   18.682  -24.253 0.83 10.05 ? 351  GLU A N   1 
ATOM   3999 C CA  B GLU A 1 358 ? 8.372   17.540  -23.949 0.17 9.15  ? 351  GLU A CA  1 
ATOM   4000 C CA  C GLU A 1 358 ? 8.430   17.456  -23.933 0.83 8.84  ? 351  GLU A CA  1 
ATOM   4001 C C   B GLU A 1 358 ? 7.469   16.427  -23.421 0.17 9.50  ? 351  GLU A C   1 
ATOM   4002 C C   C GLU A 1 358 ? 7.554   16.363  -23.340 0.83 9.51  ? 351  GLU A C   1 
ATOM   4003 O O   B GLU A 1 358 ? 7.429   15.336  -23.981 0.17 10.38 ? 351  GLU A O   1 
ATOM   4004 O O   C GLU A 1 358 ? 7.644   15.213  -23.748 0.83 11.25 ? 351  GLU A O   1 
ATOM   4005 C CB  B GLU A 1 358 ? 9.525   17.778  -22.968 0.17 10.78 ? 351  GLU A CB  1 
ATOM   4006 C CB  C GLU A 1 358 ? 9.578   17.756  -22.965 0.83 10.67 ? 351  GLU A CB  1 
ATOM   4007 C CG  B GLU A 1 358 ? 10.675  18.614  -23.527 0.17 11.39 ? 351  GLU A CG  1 
ATOM   4008 C CG  C GLU A 1 358 ? 10.726  18.610  -23.530 0.83 11.28 ? 351  GLU A CG  1 
ATOM   4009 C CD  B GLU A 1 358 ? 11.694  17.778  -24.278 0.17 12.74 ? 351  GLU A CD  1 
ATOM   4010 C CD  C GLU A 1 358 ? 11.772  17.782  -24.247 0.83 12.60 ? 351  GLU A CD  1 
ATOM   4011 O OE1 B GLU A 1 358 ? 11.666  16.536  -24.140 0.17 13.07 ? 351  GLU A OE1 1 
ATOM   4012 O OE1 C GLU A 1 358 ? 11.609  16.534  -24.348 0.83 12.90 ? 351  GLU A OE1 1 
ATOM   4013 O OE2 B GLU A 1 358 ? 12.521  18.358  -25.008 0.17 11.90 ? 351  GLU A OE2 1 
ATOM   4014 O OE2 C GLU A 1 358 ? 12.764  18.373  -24.701 0.83 13.43 ? 351  GLU A OE2 1 
ATOM   4015 N N   . GLY A 1 359 ? 6.738   16.715  -22.348 1.00 10.51 ? 352  GLY A N   1 
ATOM   4016 C CA  . GLY A 1 359 ? 5.939   15.705  -21.648 1.00 13.36 ? 352  GLY A CA  1 
ATOM   4017 C C   . GLY A 1 359 ? 4.757   14.953  -22.241 1.00 10.11 ? 352  GLY A C   1 
ATOM   4018 O O   . GLY A 1 359 ? 3.914   14.502  -21.610 1.00 19.72 ? 352  GLY A O   1 
ATOM   4019 N N   A LEU A 1 360 ? 4.622   15.340  -23.511 0.31 14.86 ? 353  LEU A N   1 
ATOM   4020 N N   B LEU A 1 360 ? 4.606   15.388  -23.496 0.69 15.07 ? 353  LEU A N   1 
ATOM   4021 C CA  A LEU A 1 360 ? 3.522   14.992  -24.379 0.31 15.52 ? 353  LEU A CA  1 
ATOM   4022 C CA  B LEU A 1 360 ? 3.534   15.027  -24.391 0.69 15.50 ? 353  LEU A CA  1 
ATOM   4023 C C   A LEU A 1 360 ? 3.859   13.610  -24.798 0.31 15.97 ? 353  LEU A C   1 
ATOM   4024 C C   B LEU A 1 360 ? 3.857   13.625  -24.768 0.69 16.10 ? 353  LEU A C   1 
ATOM   4025 O O   A LEU A 1 360 ? 2.989   12.826  -25.176 0.31 14.26 ? 353  LEU A O   1 
ATOM   4026 O O   B LEU A 1 360 ? 2.966   12.840  -25.086 0.69 13.85 ? 353  LEU A O   1 
ATOM   4027 C CB  A LEU A 1 360 ? 3.411   15.942  -25.580 0.31 13.62 ? 353  LEU A CB  1 
ATOM   4028 C CB  B LEU A 1 360 ? 3.473   15.958  -25.617 0.69 13.47 ? 353  LEU A CB  1 
ATOM   4029 C CG  A LEU A 1 360 ? 2.293   15.656  -26.587 0.31 18.04 ? 353  LEU A CG  1 
ATOM   4030 C CG  B LEU A 1 360 ? 2.373   15.734  -26.658 0.69 18.69 ? 353  LEU A CG  1 
ATOM   4031 C CD1 A LEU A 1 360 ? 0.932   15.991  -25.993 0.31 16.90 ? 353  LEU A CD1 1 
ATOM   4032 C CD1 B LEU A 1 360 ? 0.989   15.749  -26.018 0.69 16.97 ? 353  LEU A CD1 1 
ATOM   4033 C CD2 A LEU A 1 360 ? 2.533   16.431  -27.876 0.31 17.17 ? 353  LEU A CD2 1 
ATOM   4034 C CD2 B LEU A 1 360 ? 2.487   16.816  -27.732 0.69 16.05 ? 353  LEU A CD2 1 
ATOM   4035 N N   . PHE A 1 361 ? 5.153   13.310  -24.723 1.00 15.04 ? 354  PHE A N   1 
ATOM   4036 C CA  . PHE A 1 361 ? 5.525   11.896  -24.713 1.00 12.53 ? 354  PHE A CA  1 
ATOM   4037 C C   . PHE A 1 361 ? 4.727   10.934  -23.827 1.00 16.05 ? 354  PHE A C   1 
ATOM   4038 O O   . PHE A 1 361 ? 4.548   9.776   -24.190 1.00 17.03 ? 354  PHE A O   1 
ATOM   4039 C CB  . PHE A 1 361 ? 7.003   11.816  -24.288 1.00 12.87 ? 354  PHE A CB  1 
ATOM   4040 C CG  . PHE A 1 361 ? 7.673   10.530  -24.643 1.00 12.03 ? 354  PHE A CG  1 
ATOM   4041 C CD1 . PHE A 1 361 ? 8.345   10.402  -25.848 1.00 16.68 ? 354  PHE A CD1 1 
ATOM   4042 C CD2 . PHE A 1 361 ? 7.636   9.444   -23.782 1.00 32.25 ? 354  PHE A CD2 1 
ATOM   4043 C CE1 . PHE A 1 361 ? 8.968   9.207   -26.191 1.00 18.37 ? 354  PHE A CE1 1 
ATOM   4044 C CE2 . PHE A 1 361 ? 8.254   8.255   -24.122 1.00 23.50 ? 354  PHE A CE2 1 
ATOM   4045 C CZ  . PHE A 1 361 ? 8.922   8.138   -25.323 1.00 27.85 ? 354  PHE A CZ  1 
ATOM   4046 N N   A PHE A 1 362 ? 4.258   11.404  -22.676 0.52 14.74 ? 355  PHE A N   1 
ATOM   4047 N N   B PHE A 1 362 ? 4.252   11.409  -22.677 0.48 14.73 ? 355  PHE A N   1 
ATOM   4048 C CA  A PHE A 1 362 ? 3.577   10.515  -21.741 0.52 16.47 ? 355  PHE A CA  1 
ATOM   4049 C CA  B PHE A 1 362 ? 3.585   10.532  -21.712 0.48 16.49 ? 355  PHE A CA  1 
ATOM   4050 C C   A PHE A 1 362 ? 2.057   10.518  -21.924 0.52 19.83 ? 355  PHE A C   1 
ATOM   4051 C C   B PHE A 1 362 ? 2.100   10.292  -21.989 0.48 19.27 ? 355  PHE A C   1 
ATOM   4052 O O   A PHE A 1 362 ? 1.321   10.162  -21.004 0.52 20.30 ? 355  PHE A O   1 
ATOM   4053 O O   B PHE A 1 362 ? 1.416   9.692   -21.157 0.48 13.17 ? 355  PHE A O   1 
ATOM   4054 C CB  A PHE A 1 362 ? 3.954   10.884  -20.298 0.52 15.53 ? 355  PHE A CB  1 
ATOM   4055 C CB  B PHE A 1 362 ? 3.743   11.089  -20.290 0.48 15.22 ? 355  PHE A CB  1 
ATOM   4056 C CG  A PHE A 1 362 ? 5.446   11.017  -20.079 0.52 22.85 ? 355  PHE A CG  1 
ATOM   4057 C CG  B PHE A 1 362 ? 5.121   10.893  -19.706 0.48 17.00 ? 355  PHE A CG  1 
ATOM   4058 C CD1 A PHE A 1 362 ? 6.276   9.902   -20.124 0.52 22.89 ? 355  PHE A CD1 1 
ATOM   4059 C CD1 B PHE A 1 362 ? 5.521   9.648   -19.247 0.48 23.69 ? 355  PHE A CD1 1 
ATOM   4060 C CD2 A PHE A 1 362 ? 6.020   12.259  -19.851 0.52 18.61 ? 355  PHE A CD2 1 
ATOM   4061 C CD2 B PHE A 1 362 ? 6.013   11.952  -19.610 0.48 18.60 ? 355  PHE A CD2 1 
ATOM   4062 C CE1 A PHE A 1 362 ? 7.648   10.028  -19.933 0.52 20.63 ? 355  PHE A CE1 1 
ATOM   4063 C CE1 B PHE A 1 362 ? 6.783   9.458   -18.708 0.48 21.20 ? 355  PHE A CE1 1 
ATOM   4064 C CE2 A PHE A 1 362 ? 7.388   12.384  -19.660 0.52 17.54 ? 355  PHE A CE2 1 
ATOM   4065 C CE2 B PHE A 1 362 ? 7.279   11.767  -19.070 0.48 12.69 ? 355  PHE A CE2 1 
ATOM   4066 C CZ  A PHE A 1 362 ? 8.200   11.273  -19.701 0.52 19.06 ? 355  PHE A CZ  1 
ATOM   4067 C CZ  B PHE A 1 362 ? 7.661   10.515  -18.620 0.48 20.53 ? 355  PHE A CZ  1 
ATOM   4068 N N   A THR A 1 363 ? 1.592   10.898  -23.114 0.52 15.79 ? 356  THR A N   1 
ATOM   4069 N N   B THR A 1 363 ? 1.607   10.743  -23.142 0.48 16.19 ? 356  THR A N   1 
ATOM   4070 C CA  A THR A 1 363 ? 0.168   10.837  -23.447 0.52 20.03 ? 356  THR A CA  1 
ATOM   4071 C CA  B THR A 1 363 ? 0.194   10.590  -23.502 0.48 20.03 ? 356  THR A CA  1 
ATOM   4072 C C   A THR A 1 363 ? -0.430  9.440   -23.243 0.52 18.75 ? 356  THR A C   1 
ATOM   4073 C C   B THR A 1 363 ? -0.357  9.179   -23.269 0.48 18.70 ? 356  THR A C   1 
ATOM   4074 O O   A THR A 1 363 ? -1.493  9.299   -22.624 0.52 22.75 ? 356  THR A O   1 
ATOM   4075 O O   B THR A 1 363 ? -1.334  9.006   -22.531 0.48 21.42 ? 356  THR A O   1 
ATOM   4076 C CB  A THR A 1 363 ? -0.095  11.272  -24.911 0.52 17.07 ? 356  THR A CB  1 
ATOM   4077 C CB  B THR A 1 363 ? -0.053  10.970  -24.979 0.48 17.20 ? 356  THR A CB  1 
ATOM   4078 O OG1 A THR A 1 363 ? 0.031   12.695  -25.021 0.52 15.99 ? 356  THR A OG1 1 
ATOM   4079 O OG1 B THR A 1 363 ? 0.284   12.348  -25.182 0.48 19.49 ? 356  THR A OG1 1 
ATOM   4080 C CG2 A THR A 1 363 ? -1.499  10.867  -25.353 0.52 21.95 ? 356  THR A CG2 1 
ATOM   4081 C CG2 B THR A 1 363 ? -1.515  10.758  -25.346 0.48 21.97 ? 356  THR A CG2 1 
ATOM   4082 N N   A SER A 1 364 ? 0.245   8.412   -23.755 0.52 22.14 ? 357  SER A N   1 
ATOM   4083 N N   B SER A 1 364 ? 0.267   8.174   -23.881 0.48 21.70 ? 357  SER A N   1 
ATOM   4084 C CA  A SER A 1 364 ? -0.286  7.050   -23.707 0.52 23.69 ? 357  SER A CA  1 
ATOM   4085 C CA  B SER A 1 364 ? -0.210  6.797   -23.762 0.48 23.45 ? 357  SER A CA  1 
ATOM   4086 C C   A SER A 1 364 ? -0.284  6.487   -22.289 0.52 20.86 ? 357  SER A C   1 
ATOM   4087 C C   B SER A 1 364 ? -0.179  6.295   -22.323 0.48 21.24 ? 357  SER A C   1 
ATOM   4088 O O   A SER A 1 364 ? -1.209  5.782   -21.889 0.52 22.66 ? 357  SER A O   1 
ATOM   4089 O O   B SER A 1 364 ? -0.994  5.464   -21.928 0.48 23.04 ? 357  SER A O   1 
ATOM   4090 C CB  A SER A 1 364 ? 0.510   6.122   -24.631 0.52 20.33 ? 357  SER A CB  1 
ATOM   4091 C CB  B SER A 1 364 ? 0.616   5.860   -24.648 0.48 20.08 ? 357  SER A CB  1 
ATOM   4092 O OG  A SER A 1 364 ? 1.739   5.724   -24.040 0.52 16.63 ? 357  SER A OG  1 
ATOM   4093 O OG  B SER A 1 364 ? 0.376   4.500   -24.322 0.48 22.67 ? 357  SER A OG  1 
ATOM   4094 N N   . ILE A 1 365 ? 0.763   6.798   -21.535 1.00 20.56 ? 358  ILE A N   1 
ATOM   4095 C CA  . ILE A 1 365 ? 0.874   6.345   -20.158 1.00 24.26 ? 358  ILE A CA  1 
ATOM   4096 C C   . ILE A 1 365 ? -0.298  6.850   -19.319 1.00 24.27 ? 358  ILE A C   1 
ATOM   4097 O O   . ILE A 1 365 ? -0.846  6.108   -18.506 1.00 22.86 ? 358  ILE A O   1 
ATOM   4098 C CB  A ILE A 1 365 ? 2.191   6.824   -19.509 0.47 21.75 ? 358  ILE A CB  1 
ATOM   4099 C CB  B ILE A 1 365 ? 2.226   6.764   -19.552 0.53 21.78 ? 358  ILE A CB  1 
ATOM   4100 C CG1 A ILE A 1 365 ? 3.359   6.642   -20.476 0.47 24.92 ? 358  ILE A CG1 1 
ATOM   4101 C CG1 B ILE A 1 365 ? 3.309   5.820   -20.077 0.53 18.04 ? 358  ILE A CG1 1 
ATOM   4102 C CG2 A ILE A 1 365 ? 2.450   6.093   -18.205 0.47 24.14 ? 358  ILE A CG2 1 
ATOM   4103 C CG2 B ILE A 1 365 ? 2.194   6.688   -18.041 0.53 29.30 ? 358  ILE A CG2 1 
ATOM   4104 C CD1 A ILE A 1 365 ? 3.650   5.198   -20.816 0.47 29.90 ? 358  ILE A CD1 1 
ATOM   4105 C CD1 B ILE A 1 365 ? 4.707   6.360   -19.999 0.53 18.00 ? 358  ILE A CD1 1 
ATOM   4106 N N   A LEU A 1 366 ? -0.697  8.099   -19.539 0.40 23.36 ? 359  LEU A N   1 
ATOM   4107 N N   B LEU A 1 366 ? -0.676  8.109   -19.526 0.60 23.33 ? 359  LEU A N   1 
ATOM   4108 C CA  A LEU A 1 366 ? -1.831  8.669   -18.815 0.40 21.26 ? 359  LEU A CA  1 
ATOM   4109 C CA  B LEU A 1 366 ? -1.775  8.709   -18.772 0.60 21.21 ? 359  LEU A CA  1 
ATOM   4110 C C   A LEU A 1 366 ? -3.160  7.993   -19.168 0.40 30.23 ? 359  LEU A C   1 
ATOM   4111 C C   B LEU A 1 366 ? -3.145  8.144   -19.164 0.60 30.52 ? 359  LEU A C   1 
ATOM   4112 O O   A LEU A 1 366 ? -4.066  7.927   -18.338 0.40 25.44 ? 359  LEU A O   1 
ATOM   4113 O O   B LEU A 1 366 ? -4.070  8.138   -18.353 0.60 26.17 ? 359  LEU A O   1 
ATOM   4114 C CB  A LEU A 1 366 ? -1.921  10.171  -19.075 0.40 24.93 ? 359  LEU A CB  1 
ATOM   4115 C CB  B LEU A 1 366 ? -1.762  10.227  -18.940 0.60 24.88 ? 359  LEU A CB  1 
ATOM   4116 C CG  A LEU A 1 366 ? -0.863  10.989  -18.335 0.40 19.89 ? 359  LEU A CG  1 
ATOM   4117 C CG  B LEU A 1 366 ? -0.630  10.909  -18.169 0.60 19.86 ? 359  LEU A CG  1 
ATOM   4118 C CD1 A LEU A 1 366 ? -0.935  12.445  -18.754 0.40 19.98 ? 359  LEU A CD1 1 
ATOM   4119 C CD1 B LEU A 1 366 ? -0.526  12.382  -18.531 0.60 18.25 ? 359  LEU A CD1 1 
ATOM   4120 C CD2 A LEU A 1 366 ? -1.029  10.841  -16.822 0.40 19.27 ? 359  LEU A CD2 1 
ATOM   4121 C CD2 B LEU A 1 366 ? -0.824  10.728  -16.661 0.60 18.31 ? 359  LEU A CD2 1 
ATOM   4122 N N   A LYS A 1 367 ? -3.280  7.493   -20.394 0.40 21.87 ? 360  LYS A N   1 
ATOM   4123 N N   B LYS A 1 367 ? -3.279  7.666   -20.397 0.60 21.29 ? 360  LYS A N   1 
ATOM   4124 C CA  A LYS A 1 367 ? -4.467  6.737   -20.780 0.40 27.32 ? 360  LYS A CA  1 
ATOM   4125 C CA  B LYS A 1 367 ? -4.511  7.004   -20.799 0.60 27.19 ? 360  LYS A CA  1 
ATOM   4126 C C   A LYS A 1 367 ? -4.428  5.341   -20.164 0.40 25.76 ? 360  LYS A C   1 
ATOM   4127 C C   B LYS A 1 367 ? -4.616  5.628   -20.145 0.60 24.83 ? 360  LYS A C   1 
ATOM   4128 O O   A LYS A 1 367 ? -5.467  4.765   -19.831 0.40 30.05 ? 360  LYS A O   1 
ATOM   4129 O O   B LYS A 1 367 ? -5.706  5.205   -19.744 0.60 22.20 ? 360  LYS A O   1 
ATOM   4130 C CB  A LYS A 1 367 ? -4.582  6.642   -22.302 0.40 26.53 ? 360  LYS A CB  1 
ATOM   4131 C CB  B LYS A 1 367 ? -4.593  6.874   -22.319 0.60 26.75 ? 360  LYS A CB  1 
ATOM   4132 C CG  A LYS A 1 367 ? -4.665  7.990   -23.003 0.40 30.48 ? 360  LYS A CG  1 
ATOM   4133 C CG  B LYS A 1 367 ? -4.669  8.203   -23.055 0.60 30.59 ? 360  LYS A CG  1 
ATOM   4134 C CD  A LYS A 1 367 ? -4.799  7.815   -24.507 0.40 29.72 ? 360  LYS A CD  1 
ATOM   4135 C CD  B LYS A 1 367 ? -4.814  7.975   -24.550 0.60 29.31 ? 360  LYS A CD  1 
ATOM   4136 C CE  A LYS A 1 367 ? -4.750  9.147   -25.227 0.40 32.59 ? 360  LYS A CE  1 
ATOM   4137 C CE  B LYS A 1 367 ? -4.766  9.273   -25.319 0.60 33.04 ? 360  LYS A CE  1 
ATOM   4138 N NZ  A LYS A 1 367 ? -4.761  8.967   -26.707 0.40 37.08 ? 360  LYS A NZ  1 
ATOM   4139 N NZ  B LYS A 1 367 ? -4.728  9.029   -26.789 0.60 37.13 ? 360  LYS A NZ  1 
ATOM   4140 N N   A GLN A 1 368 ? -3.219  4.809   -20.012 0.40 21.47 ? 361  GLN A N   1 
ATOM   4141 N N   B GLN A 1 368 ? -3.481  4.938   -20.031 0.60 22.79 ? 361  GLN A N   1 
ATOM   4142 C CA  A GLN A 1 368 ? -3.002  3.504   -19.409 0.40 26.73 ? 361  GLN A CA  1 
ATOM   4143 C CA  B GLN A 1 368 ? -3.439  3.612   -19.429 0.60 23.84 ? 361  GLN A CA  1 
ATOM   4144 C C   A GLN A 1 368 ? -3.273  3.540   -17.909 0.40 28.00 ? 361  GLN A C   1 
ATOM   4145 C C   B GLN A 1 368 ? -3.539  3.653   -17.907 0.60 27.39 ? 361  GLN A C   1 
ATOM   4146 O O   A GLN A 1 368 ? -3.779  2.578   -17.328 0.40 27.21 ? 361  GLN A O   1 
ATOM   4147 O O   B GLN A 1 368 ? -4.140  2.765   -17.299 0.60 25.70 ? 361  GLN A O   1 
ATOM   4148 C CB  A GLN A 1 368 ? -1.566  3.037   -19.680 0.40 30.53 ? 361  GLN A CB  1 
ATOM   4149 C CB  B GLN A 1 368 ? -2.157  2.876   -19.832 0.60 27.95 ? 361  GLN A CB  1 
ATOM   4150 C CG  A GLN A 1 368 ? -1.094  1.844   -18.854 0.40 35.52 ? 361  GLN A CG  1 
ATOM   4151 C CG  B GLN A 1 368 ? -2.274  2.054   -21.109 0.60 38.30 ? 361  GLN A CG  1 
ATOM   4152 C CD  A GLN A 1 368 ? 0.350   1.469   -19.153 0.40 28.89 ? 361  GLN A CD  1 
ATOM   4153 C CD  B GLN A 1 368 ? -1.741  0.641   -20.941 0.60 34.30 ? 361  GLN A CD  1 
ATOM   4154 O OE1 A GLN A 1 368 ? 0.901   1.853   -20.185 0.40 38.05 ? 361  GLN A OE1 1 
ATOM   4155 O OE1 B GLN A 1 368 ? -0.764  0.255   -21.581 0.60 41.39 ? 361  GLN A OE1 1 
ATOM   4156 N NE2 A GLN A 1 368 ? 0.971   0.717   -18.246 0.40 28.50 ? 361  GLN A NE2 1 
ATOM   4157 N NE2 B GLN A 1 368 ? -2.386  -0.137  -20.079 0.60 29.59 ? 361  GLN A NE2 1 
ATOM   4158 N N   . MET A 1 369 ? -2.937  4.666   -17.289 1.00 24.95 ? 362  MET A N   1 
ATOM   4159 C CA  . MET A 1 369 ? -2.998  4.791   -15.840 1.00 32.66 ? 362  MET A CA  1 
ATOM   4160 C C   . MET A 1 369 ? -3.496  6.175   -15.442 1.00 19.73 ? 362  MET A C   1 
ATOM   4161 O O   . MET A 1 369 ? -2.720  6.997   -14.967 1.00 21.85 ? 362  MET A O   1 
ATOM   4162 C CB  A MET A 1 369 ? -1.625  4.515   -15.227 0.56 26.12 ? 362  MET A CB  1 
ATOM   4163 C CB  B MET A 1 369 ? -1.625  4.511   -15.214 0.44 26.14 ? 362  MET A CB  1 
ATOM   4164 C CG  A MET A 1 369 ? -1.217  3.046   -15.256 0.56 22.61 ? 362  MET A CG  1 
ATOM   4165 C CG  B MET A 1 369 ? -1.684  4.103   -13.741 0.44 25.30 ? 362  MET A CG  1 
ATOM   4166 S SD  A MET A 1 369 ? 0.505   2.819   -14.813 0.56 33.97 ? 362  MET A SD  1 
ATOM   4167 S SD  B MET A 1 369 ? -0.148  3.417   -13.084 0.44 36.67 ? 362  MET A SD  1 
ATOM   4168 C CE  A MET A 1 369 ? 1.322   3.386   -16.295 0.56 43.42 ? 362  MET A CE  1 
ATOM   4169 C CE  B MET A 1 369 ? -0.542  3.285   -11.339 0.44 28.73 ? 362  MET A CE  1 
ATOM   4170 N N   . PRO A 1 370 ? -4.802  6.423   -15.628 1.00 25.66 ? 363  PRO A N   1 
ATOM   4171 C CA  . PRO A 1 370 ? -5.399  7.751   -15.453 1.00 27.98 ? 363  PRO A CA  1 
ATOM   4172 C C   . PRO A 1 370 ? -5.285  8.257   -14.029 1.00 18.53 ? 363  PRO A C   1 
ATOM   4173 O O   . PRO A 1 370 ? -5.373  9.455   -13.811 1.00 25.44 ? 363  PRO A O   1 
ATOM   4174 C CB  A PRO A 1 370 ? -6.872  7.530   -15.823 0.31 24.08 ? 363  PRO A CB  1 
ATOM   4175 C CB  B PRO A 1 370 ? -6.865  7.533   -15.840 0.69 24.11 ? 363  PRO A CB  1 
ATOM   4176 C CG  A PRO A 1 370 ? -6.902  6.248   -16.584 0.31 26.93 ? 363  PRO A CG  1 
ATOM   4177 C CG  B PRO A 1 370 ? -7.108  6.092   -15.616 0.69 27.95 ? 363  PRO A CG  1 
ATOM   4178 C CD  A PRO A 1 370 ? -5.810  5.417   -16.003 0.31 26.77 ? 363  PRO A CD  1 
ATOM   4179 C CD  B PRO A 1 370 ? -5.818  5.409   -15.964 0.69 26.84 ? 363  PRO A CD  1 
ATOM   4180 N N   . LEU A 1 371 ? -5.075  7.356   -13.077 1.00 18.89 ? 364  LEU A N   1 
ATOM   4181 C CA  . LEU A 1 371 ? -5.019  7.759   -11.679 1.00 17.98 ? 364  LEU A CA  1 
ATOM   4182 C C   . LEU A 1 371 ? -3.719  8.503   -11.359 1.00 17.88 ? 364  LEU A C   1 
ATOM   4183 O O   . LEU A 1 371 ? -3.581  9.071   -10.281 1.00 22.11 ? 364  LEU A O   1 
ATOM   4184 C CB  . LEU A 1 371 ? -5.184  6.549   -10.755 1.00 20.64 ? 364  LEU A CB  1 
ATOM   4185 C CG  . LEU A 1 371 ? -6.593  5.959   -10.678 1.00 19.58 ? 364  LEU A CG  1 
ATOM   4186 C CD1 . LEU A 1 371 ? -6.643  4.787   -9.710  1.00 32.79 ? 364  LEU A CD1 1 
ATOM   4187 C CD2 . LEU A 1 371 ? -7.614  7.025   -10.286 1.00 26.14 ? 364  LEU A CD2 1 
ATOM   4188 N N   A LEU A 1 372 ? -2.757  8.474   -12.276 0.45 21.74 ? 365  LEU A N   1 
ATOM   4189 N N   B LEU A 1 372 ? -2.788  8.523   -12.311 0.55 21.79 ? 365  LEU A N   1 
ATOM   4190 C CA  A LEU A 1 372 ? -1.493  9.173   -12.059 0.45 17.74 ? 365  LEU A CA  1 
ATOM   4191 C CA  B LEU A 1 372 ? -1.584  9.345   -12.197 0.55 18.82 ? 365  LEU A CA  1 
ATOM   4192 C C   A LEU A 1 372 ? -1.721  10.684  -11.968 0.45 16.26 ? 365  LEU A C   1 
ATOM   4193 C C   B LEU A 1 372 ? -1.920  10.829  -12.052 0.55 15.08 ? 365  LEU A C   1 
ATOM   4194 O O   A LEU A 1 372 ? -0.949  11.403  -11.335 0.45 23.73 ? 365  LEU A O   1 
ATOM   4195 O O   B LEU A 1 372 ? -1.249  11.556  -11.322 0.55 19.16 ? 365  LEU A O   1 
ATOM   4196 C CB  A LEU A 1 372 ? -0.493  8.850   -13.175 0.45 21.19 ? 365  LEU A CB  1 
ATOM   4197 C CB  B LEU A 1 372 ? -0.672  9.155   -13.416 0.55 19.43 ? 365  LEU A CB  1 
ATOM   4198 C CG  A LEU A 1 372 ? -0.128  7.371   -13.322 0.45 24.24 ? 365  LEU A CG  1 
ATOM   4199 C CG  B LEU A 1 372 ? 0.250   7.939   -13.442 0.55 26.06 ? 365  LEU A CG  1 
ATOM   4200 C CD1 A LEU A 1 372 ? 0.832   7.153   -14.489 0.45 25.60 ? 365  LEU A CD1 1 
ATOM   4201 C CD1 B LEU A 1 372 ? 1.059   7.921   -14.735 0.55 20.49 ? 365  LEU A CD1 1 
ATOM   4202 C CD2 A LEU A 1 372 ? 0.454   6.828   -12.028 0.45 27.54 ? 365  LEU A CD2 1 
ATOM   4203 C CD2 B LEU A 1 372 ? 1.163   7.934   -12.228 0.55 16.63 ? 365  LEU A CD2 1 
ATOM   4204 N N   A VAL A 1 373 ? -2.791  11.161  -12.594 0.45 18.32 ? 366  VAL A N   1 
ATOM   4205 N N   B VAL A 1 373 ? -2.959  11.281  -12.746 0.55 18.30 ? 366  VAL A N   1 
ATOM   4206 C CA  A VAL A 1 373 ? -3.134  12.578  -12.538 0.45 17.20 ? 366  VAL A CA  1 
ATOM   4207 C CA  B VAL A 1 373 ? -3.317  12.699  -12.724 0.55 17.41 ? 366  VAL A CA  1 
ATOM   4208 C C   A VAL A 1 373 ? -3.576  12.968  -11.126 0.45 20.88 ? 366  VAL A C   1 
ATOM   4209 C C   B VAL A 1 373 ? -3.554  13.196  -11.299 0.55 19.48 ? 366  VAL A C   1 
ATOM   4210 O O   A VAL A 1 373 ? -3.510  14.139  -10.738 0.45 19.68 ? 366  VAL A O   1 
ATOM   4211 O O   B VAL A 1 373 ? -3.289  14.362  -10.985 0.55 18.20 ? 366  VAL A O   1 
ATOM   4212 C CB  A VAL A 1 373 ? -4.233  12.915  -13.560 0.45 18.75 ? 366  VAL A CB  1 
ATOM   4213 C CB  B VAL A 1 373 ? -4.560  12.973  -13.596 0.55 18.11 ? 366  VAL A CB  1 
ATOM   4214 C CG1 A VAL A 1 373 ? -4.412  14.421  -13.688 0.45 17.18 ? 366  VAL A CG1 1 
ATOM   4215 C CG1 B VAL A 1 373 ? -5.005  14.425  -13.472 0.55 22.14 ? 366  VAL A CG1 1 
ATOM   4216 C CG2 A VAL A 1 373 ? -3.872  12.319  -14.907 0.45 17.04 ? 366  VAL A CG2 1 
ATOM   4217 C CG2 B VAL A 1 373 ? -4.253  12.645  -15.047 0.55 18.60 ? 366  VAL A CG2 1 
ATOM   4218 N N   A LYS A 1 374 ? -4.007  11.973  -10.353 0.45 19.59 ? 367  LYS A N   1 
ATOM   4219 N N   B LYS A 1 374 ? -4.005  12.300  -10.423 0.55 22.26 ? 367  LYS A N   1 
ATOM   4220 C CA  A LYS A 1 374 ? -4.374  12.179  -8.955  0.45 20.08 ? 367  LYS A CA  1 
ATOM   4221 C CA  B LYS A 1 374 ? -4.270  12.663  -9.034  0.55 17.31 ? 367  LYS A CA  1 
ATOM   4222 C C   A LYS A 1 374 ? -3.180  12.684  -8.141  0.45 16.04 ? 367  LYS A C   1 
ATOM   4223 C C   B LYS A 1 374 ? -2.990  12.965  -8.246  0.55 18.88 ? 367  LYS A C   1 
ATOM   4224 O O   A LYS A 1 374 ? -3.351  13.380  -7.137  0.45 18.61 ? 367  LYS A O   1 
ATOM   4225 O O   B LYS A 1 374 ? -3.055  13.458  -7.118  0.55 17.58 ? 367  LYS A O   1 
ATOM   4226 C CB  A LYS A 1 374 ? -4.931  10.877  -8.364  0.45 22.04 ? 367  LYS A CB  1 
ATOM   4227 C CB  B LYS A 1 374 ? -5.079  11.560  -8.343  0.55 21.37 ? 367  LYS A CB  1 
ATOM   4228 C CG  A LYS A 1 374 ? -5.003  10.796  -6.854  0.45 25.23 ? 367  LYS A CG  1 
ATOM   4229 C CG  B LYS A 1 374 ? -6.526  11.495  -8.820  0.55 26.69 ? 367  LYS A CG  1 
ATOM   4230 C CD  A LYS A 1 374 ? -6.395  11.126  -6.341  0.45 22.87 ? 367  LYS A CD  1 
ATOM   4231 C CD  B LYS A 1 374 ? -7.425  10.769  -7.832  0.55 33.87 ? 367  LYS A CD  1 
ATOM   4232 C CE  A LYS A 1 374 ? -6.410  11.138  -4.826  0.45 26.31 ? 367  LYS A CE  1 
ATOM   4233 C CE  B LYS A 1 374 ? -8.874  10.805  -8.296  0.55 32.13 ? 367  LYS A CE  1 
ATOM   4234 N NZ  A LYS A 1 374 ? -5.259  11.923  -4.300  0.45 27.41 ? 367  LYS A NZ  1 
ATOM   4235 N NZ  B LYS A 1 374 ? -9.024  10.188  -9.637  0.55 31.01 ? 367  LYS A NZ  1 
ATOM   4236 N N   A GLU A 1 375 ? -1.970  12.365  -8.594  0.45 15.57 ? 368  GLU A N   1 
ATOM   4237 N N   B GLU A 1 375 ? -1.829  12.695  -8.841  0.55 16.60 ? 368  GLU A N   1 
ATOM   4238 C CA  A GLU A 1 375 ? -0.754  12.784  -7.898  0.45 17.84 ? 368  GLU A CA  1 
ATOM   4239 C CA  B GLU A 1 375 ? -0.561  13.097  -8.234  0.55 16.55 ? 368  GLU A CA  1 
ATOM   4240 C C   A GLU A 1 375 ? -0.545  14.301  -7.945  0.45 14.01 ? 368  GLU A C   1 
ATOM   4241 C C   B GLU A 1 375 ? -0.420  14.612  -8.158  0.55 12.23 ? 368  GLU A C   1 
ATOM   4242 O O   A GLU A 1 375 ? 0.284   14.850  -7.207  0.45 15.10 ? 368  GLU A O   1 
ATOM   4243 O O   B GLU A 1 375 ? 0.391   15.133  -7.377  0.55 13.88 ? 368  GLU A O   1 
ATOM   4244 C CB  A GLU A 1 375 ? 0.465   12.065  -8.483  0.45 19.53 ? 368  GLU A CB  1 
ATOM   4245 C CB  B GLU A 1 375 ? 0.629   12.519  -9.004  0.55 17.81 ? 368  GLU A CB  1 
ATOM   4246 C CG  A GLU A 1 375 ? 0.315   10.552  -8.494  0.45 14.94 ? 368  GLU A CG  1 
ATOM   4247 C CG  B GLU A 1 375 ? 0.990   11.100  -8.632  0.55 18.21 ? 368  GLU A CG  1 
ATOM   4248 C CD  A GLU A 1 375 ? 1.596   9.837   -8.851  0.45 27.84 ? 368  GLU A CD  1 
ATOM   4249 C CD  B GLU A 1 375 ? 2.321   10.681  -9.220  0.55 23.46 ? 368  GLU A CD  1 
ATOM   4250 O OE1 A GLU A 1 375 ? 2.637   10.514  -8.990  0.45 22.62 ? 368  GLU A OE1 1 
ATOM   4251 O OE1 B GLU A 1 375 ? 2.689   11.218  -10.287 0.55 25.71 ? 368  GLU A OE1 1 
ATOM   4252 O OE2 A GLU A 1 375 ? 1.562   8.596   -8.981  0.45 22.19 ? 368  GLU A OE2 1 
ATOM   4253 O OE2 B GLU A 1 375 ? 3.003   9.827   -8.616  0.55 30.23 ? 368  GLU A OE2 1 
ATOM   4254 N N   A LEU A 1 376 ? -1.313  14.975  -8.792  0.45 13.50 ? 369  LEU A N   1 
ATOM   4255 N N   B LEU A 1 376 ? -1.194  15.331  -8.963  0.55 15.62 ? 369  LEU A N   1 
ATOM   4256 C CA  A LEU A 1 376 ? -1.213  16.426  -8.941  0.45 14.14 ? 369  LEU A CA  1 
ATOM   4257 C CA  B LEU A 1 376 ? -1.090  16.788  -8.962  0.55 13.41 ? 369  LEU A CA  1 
ATOM   4258 C C   A LEU A 1 376 ? -1.951  17.207  -7.846  0.45 15.07 ? 369  LEU A C   1 
ATOM   4259 C C   B LEU A 1 376 ? -2.021  17.421  -7.923  0.55 14.12 ? 369  LEU A C   1 
ATOM   4260 O O   A LEU A 1 376 ? -1.749  18.408  -7.699  0.45 14.05 ? 369  LEU A O   1 
ATOM   4261 O O   B LEU A 1 376 ? -2.060  18.638  -7.784  0.55 16.37 ? 369  LEU A O   1 
ATOM   4262 C CB  A LEU A 1 376 ? -1.750  16.844  -10.307 0.45 19.78 ? 369  LEU A CB  1 
ATOM   4263 C CB  B LEU A 1 376 ? -1.379  17.369  -10.351 0.55 13.58 ? 369  LEU A CB  1 
ATOM   4264 C CG  A LEU A 1 376 ? -0.748  17.304  -11.360 0.45 19.00 ? 369  LEU A CG  1 
ATOM   4265 C CG  B LEU A 1 376 ? -0.136  17.484  -11.252 0.55 11.22 ? 369  LEU A CG  1 
ATOM   4266 C CD1 A LEU A 1 376 ? 0.435   16.370  -11.393 0.45 18.20 ? 369  LEU A CD1 1 
ATOM   4267 C CD1 B LEU A 1 376 ? 0.514   16.135  -11.489 0.55 20.15 ? 369  LEU A CD1 1 
ATOM   4268 C CD2 A LEU A 1 376 ? -1.432  17.338  -12.710 0.45 12.30 ? 369  LEU A CD2 1 
ATOM   4269 C CD2 B LEU A 1 376 ? -0.468  18.177  -12.578 0.55 12.74 ? 369  LEU A CD2 1 
ATOM   4270 N N   A GLU A 1 377 ? -2.807  16.536  -7.085  0.45 16.74 ? 370  GLU A N   1 
ATOM   4271 N N   B GLU A 1 377 ? -2.760  16.591  -7.197  0.55 16.57 ? 370  GLU A N   1 
ATOM   4272 C CA  A GLU A 1 377 ? -3.558  17.239  -6.054  0.45 18.89 ? 370  GLU A CA  1 
ATOM   4273 C CA  B GLU A 1 377 ? -3.577  17.092  -6.103  0.55 18.61 ? 370  GLU A CA  1 
ATOM   4274 C C   A GLU A 1 377 ? -2.638  17.855  -5.005  0.45 17.23 ? 370  GLU A C   1 
ATOM   4275 C C   B GLU A 1 377 ? -2.689  17.682  -5.010  0.55 16.92 ? 370  GLU A C   1 
ATOM   4276 O O   A GLU A 1 377 ? -2.946  18.919  -4.472  0.45 18.91 ? 370  GLU A O   1 
ATOM   4277 O O   B GLU A 1 377 ? -3.051  18.693  -4.410  0.55 19.28 ? 370  GLU A O   1 
ATOM   4278 C CB  A GLU A 1 377 ? -4.570  16.315  -5.390  0.45 20.46 ? 370  GLU A CB  1 
ATOM   4279 C CB  B GLU A 1 377 ? -4.485  15.992  -5.549  0.55 20.69 ? 370  GLU A CB  1 
ATOM   4280 C CG  A GLU A 1 377 ? -6.006  16.625  -5.786  0.45 31.28 ? 370  GLU A CG  1 
ATOM   4281 C CG  B GLU A 1 377 ? -5.681  15.698  -6.456  0.55 15.25 ? 370  GLU A CG  1 
ATOM   4282 C CD  A GLU A 1 377 ? -6.470  17.988  -5.297  0.45 22.06 ? 370  GLU A CD  1 
ATOM   4283 C CD  B GLU A 1 377 ? -6.520  14.520  -5.992  0.55 29.64 ? 370  GLU A CD  1 
ATOM   4284 O OE1 A GLU A 1 377 ? -6.516  18.207  -4.065  0.45 23.60 ? 370  GLU A OE1 1 
ATOM   4285 O OE1 B GLU A 1 377 ? -6.339  14.054  -4.849  0.55 23.57 ? 370  GLU A OE1 1 
ATOM   4286 O OE2 A GLU A 1 377 ? -6.798  18.842  -6.145  0.45 34.52 ? 370  GLU A OE2 1 
ATOM   4287 O OE2 B GLU A 1 377 ? -7.372  14.059  -6.781  0.55 29.00 ? 370  GLU A OE2 1 
ATOM   4288 N N   A THR A 1 378 ? -1.512  17.204  -4.710  0.45 16.01 ? 371  THR A N   1 
ATOM   4289 N N   B THR A 1 378 ? -1.524  17.076  -4.764  0.55 15.54 ? 371  THR A N   1 
ATOM   4290 C CA  A THR A 1 378 ? -0.519  17.812  -3.817  0.45 16.45 ? 371  THR A CA  1 
ATOM   4291 C CA  B THR A 1 378 ? -0.556  17.653  -3.818  0.55 16.27 ? 371  THR A CA  1 
ATOM   4292 C C   A THR A 1 378 ? 0.860   17.956  -4.465  0.45 15.35 ? 371  THR A C   1 
ATOM   4293 C C   B THR A 1 378 ? 0.822   17.909  -4.447  0.55 15.36 ? 371  THR A C   1 
ATOM   4294 O O   A THR A 1 378 ? 1.687   18.728  -3.982  0.45 16.46 ? 371  THR A O   1 
ATOM   4295 O O   B THR A 1 378 ? 1.599   18.715  -3.942  0.55 16.40 ? 371  THR A O   1 
ATOM   4296 C CB  A THR A 1 378 ? -0.348  17.020  -2.498  0.45 16.56 ? 371  THR A CB  1 
ATOM   4297 C CB  B THR A 1 378 ? -0.356  16.757  -2.576  0.55 16.22 ? 371  THR A CB  1 
ATOM   4298 O OG1 A THR A 1 378 ? 0.242   15.739  -2.758  0.45 17.10 ? 371  THR A OG1 1 
ATOM   4299 O OG1 B THR A 1 378 ? 0.270   15.523  -2.955  0.55 18.25 ? 371  THR A OG1 1 
ATOM   4300 C CG2 A THR A 1 378 ? -1.684  16.843  -1.797  0.45 14.47 ? 371  THR A CG2 1 
ATOM   4301 C CG2 B THR A 1 378 ? -1.687  16.477  -1.898  0.55 15.43 ? 371  THR A CG2 1 
ATOM   4302 N N   . CYS A 1 379 ? 1.109   17.208  -5.540  1.00 13.61 ? 372  CYS A N   1 
ATOM   4303 C CA  . CYS A 1 379 ? 2.415   17.229  -6.231  1.00 14.93 ? 372  CYS A CA  1 
ATOM   4304 C C   . CYS A 1 379 ? 3.642   16.828  -5.405  1.00 13.64 ? 372  CYS A C   1 
ATOM   4305 O O   . CYS A 1 379 ? 4.770   17.085  -5.820  1.00 12.53 ? 372  CYS A O   1 
ATOM   4306 C CB  . CYS A 1 379 ? 2.671   18.614  -6.849  1.00 11.79 ? 372  CYS A CB  1 
ATOM   4307 S SG  . CYS A 1 379 ? 1.562   19.044  -8.242  1.00 14.32 ? 372  CYS A SG  1 
ATOM   4308 N N   . VAL A 1 380 ? 3.442   16.195  -4.252  1.00 12.60 ? 373  VAL A N   1 
ATOM   4309 C CA  . VAL A 1 380 ? 4.583   15.808  -3.422  1.00 14.56 ? 373  VAL A CA  1 
ATOM   4310 C C   . VAL A 1 380 ? 5.579   14.874  -4.112  1.00 15.98 ? 373  VAL A C   1 
ATOM   4311 O O   . VAL A 1 380 ? 6.774   14.920  -3.813  1.00 14.19 ? 373  VAL A O   1 
ATOM   4312 C CB  . VAL A 1 380 ? 4.110   15.143  -2.106  1.00 16.01 ? 373  VAL A CB  1 
ATOM   4313 C CG1 . VAL A 1 380 ? 3.325   16.167  -1.268  1.00 20.43 ? 373  VAL A CG1 1 
ATOM   4314 C CG2 . VAL A 1 380 ? 3.258   13.875  -2.378  1.00 16.30 ? 373  VAL A CG2 1 
ATOM   4315 N N   A ASN A 1 381 ? 5.107   14.040  -5.034  0.77 14.65 ? 374  ASN A N   1 
ATOM   4316 N N   B ASN A 1 381 ? 5.090   14.038  -5.026  0.23 14.74 ? 374  ASN A N   1 
ATOM   4317 C CA  A ASN A 1 381 ? 5.990   13.062  -5.655  0.77 14.11 ? 374  ASN A CA  1 
ATOM   4318 C CA  B ASN A 1 381 ? 5.939   13.058  -5.694  0.23 14.17 ? 374  ASN A CA  1 
ATOM   4319 C C   A ASN A 1 381 ? 7.000   13.717  -6.613  0.77 12.56 ? 374  ASN A C   1 
ATOM   4320 C C   B ASN A 1 381 ? 6.925   13.703  -6.665  0.23 12.80 ? 374  ASN A C   1 
ATOM   4321 O O   A ASN A 1 381 ? 8.021   13.116  -6.970  0.77 15.20 ? 374  ASN A O   1 
ATOM   4322 O O   B ASN A 1 381 ? 7.937   13.101  -7.029  0.23 15.25 ? 374  ASN A O   1 
ATOM   4323 C CB  A ASN A 1 381 ? 5.171   12.005  -6.392  0.77 13.32 ? 374  ASN A CB  1 
ATOM   4324 C CB  B ASN A 1 381 ? 5.086   12.029  -6.440  0.23 13.56 ? 374  ASN A CB  1 
ATOM   4325 C CG  A ASN A 1 381 ? 4.375   11.105  -5.451  0.77 13.03 ? 374  ASN A CG  1 
ATOM   4326 C CG  B ASN A 1 381 ? 4.250   11.168  -5.508  0.23 13.52 ? 374  ASN A CG  1 
ATOM   4327 O OD1 A ASN A 1 381 ? 4.662   11.023  -4.253  0.77 18.92 ? 374  ASN A OD1 1 
ATOM   4328 O OD1 B ASN A 1 381 ? 4.520   11.084  -4.309  0.23 18.57 ? 374  ASN A OD1 1 
ATOM   4329 N ND2 A ASN A 1 381 ? 3.381   10.403  -6.003  0.77 16.90 ? 374  ASN A ND2 1 
ATOM   4330 N ND2 B ASN A 1 381 ? 3.233   10.513  -6.063  0.23 17.18 ? 374  ASN A ND2 1 
ATOM   4331 N N   A PHE A 1 382 ? 6.723   14.957  -7.001  0.77 12.59 ? 375  PHE A N   1 
ATOM   4332 N N   B PHE A 1 382 ? 6.629   14.930  -7.078  0.23 12.94 ? 375  PHE A N   1 
ATOM   4333 C CA  A PHE A 1 382 ? 7.596   15.658  -7.935  0.77 13.01 ? 375  PHE A CA  1 
ATOM   4334 C CA  B PHE A 1 382 ? 7.470   15.619  -8.048  0.23 13.27 ? 375  PHE A CA  1 
ATOM   4335 C C   A PHE A 1 382 ? 8.582   16.616  -7.277  0.77 13.91 ? 375  PHE A C   1 
ATOM   4336 C C   B PHE A 1 382 ? 8.456   16.575  -7.391  0.23 13.06 ? 375  PHE A C   1 
ATOM   4337 O O   A PHE A 1 382 ? 9.415   17.208  -7.960  0.77 13.92 ? 375  PHE A O   1 
ATOM   4338 O O   B PHE A 1 382 ? 9.254   17.217  -8.072  0.23 13.94 ? 375  PHE A O   1 
ATOM   4339 C CB  A PHE A 1 382 ? 6.764   16.406  -8.965  0.77 15.38 ? 375  PHE A CB  1 
ATOM   4340 C CB  B PHE A 1 382 ? 6.604   16.366  -9.057  0.23 15.77 ? 375  PHE A CB  1 
ATOM   4341 C CG  A PHE A 1 382 ? 6.145   15.514  -9.993  0.77 14.40 ? 375  PHE A CG  1 
ATOM   4342 C CG  B PHE A 1 382 ? 5.792   15.463  -9.932  0.23 15.07 ? 375  PHE A CG  1 
ATOM   4343 C CD1 A PHE A 1 382 ? 6.919   14.968  -11.005 0.77 15.50 ? 375  PHE A CD1 1 
ATOM   4344 C CD1 B PHE A 1 382 ? 6.386   14.784  -10.983 0.23 16.73 ? 375  PHE A CD1 1 
ATOM   4345 C CD2 A PHE A 1 382 ? 4.795   15.233  -9.962  0.77 22.32 ? 375  PHE A CD2 1 
ATOM   4346 C CD2 B PHE A 1 382 ? 4.438   15.286  -9.705  0.23 19.45 ? 375  PHE A CD2 1 
ATOM   4347 C CE1 A PHE A 1 382 ? 6.356   14.154  -11.969 0.77 20.61 ? 375  PHE A CE1 1 
ATOM   4348 C CE1 B PHE A 1 382 ? 5.645   13.952  -11.796 0.23 24.61 ? 375  PHE A CE1 1 
ATOM   4349 C CE2 A PHE A 1 382 ? 4.226   14.413  -10.917 0.77 19.69 ? 375  PHE A CE2 1 
ATOM   4350 C CE2 B PHE A 1 382 ? 3.693   14.452  -10.515 0.23 22.63 ? 375  PHE A CE2 1 
ATOM   4351 C CZ  A PHE A 1 382 ? 4.999   13.877  -11.922 0.77 20.51 ? 375  PHE A CZ  1 
ATOM   4352 C CZ  B PHE A 1 382 ? 4.299   13.785  -11.561 0.23 20.65 ? 375  PHE A CZ  1 
ATOM   4353 N N   A VAL A 1 383 ? 8.516   16.756  -5.951  0.77 11.29 ? 376  VAL A N   1 
ATOM   4354 N N   B VAL A 1 383 ? 8.408   16.666  -6.065  0.23 12.03 ? 376  VAL A N   1 
ATOM   4355 C CA  A VAL A 1 383 ? 9.490   17.592  -5.264  0.77 13.41 ? 376  VAL A CA  1 
ATOM   4356 C CA  B VAL A 1 383 ? 9.389   17.457  -5.340  0.23 13.55 ? 376  VAL A CA  1 
ATOM   4357 C C   A VAL A 1 383 ? 10.872  16.997  -5.469  0.77 14.43 ? 376  VAL A C   1 
ATOM   4358 C C   B VAL A 1 383 ? 10.748  16.781  -5.464  0.23 13.77 ? 376  VAL A C   1 
ATOM   4359 O O   A VAL A 1 383 ? 11.038  15.784  -5.355  0.77 12.87 ? 376  VAL A O   1 
ATOM   4360 O O   B VAL A 1 383 ? 10.859  15.578  -5.229  0.23 14.80 ? 376  VAL A O   1 
ATOM   4361 C CB  A VAL A 1 383 ? 9.171   17.704  -3.765  0.77 10.74 ? 376  VAL A CB  1 
ATOM   4362 C CB  B VAL A 1 383 ? 9.006   17.618  -3.857  0.23 11.37 ? 376  VAL A CB  1 
ATOM   4363 C CG1 A VAL A 1 383 ? 10.280  18.459  -3.032  0.77 11.04 ? 376  VAL A CG1 1 
ATOM   4364 C CG1 B VAL A 1 383 ? 10.121  18.307  -3.085  0.23 11.55 ? 376  VAL A CG1 1 
ATOM   4365 C CG2 A VAL A 1 383 ? 7.790   18.356  -3.579  0.77 12.59 ? 376  VAL A CG2 1 
ATOM   4366 C CG2 B VAL A 1 383 ? 7.693   18.386  -3.733  0.23 11.82 ? 376  VAL A CG2 1 
ATOM   4367 N N   A PRO A 1 384 ? 11.868  17.839  -5.810  0.77 14.42 ? 377  PRO A N   1 
ATOM   4368 N N   B PRO A 1 384 ? 11.780  17.547  -5.865  0.23 14.67 ? 377  PRO A N   1 
ATOM   4369 C CA  A PRO A 1 384 ? 13.228  17.312  -5.963  0.77 14.92 ? 377  PRO A CA  1 
ATOM   4370 C CA  B PRO A 1 384 ? 13.148  17.032  -5.996  0.23 15.14 ? 377  PRO A CA  1 
ATOM   4371 C C   A PRO A 1 384 ? 13.640  16.448  -4.769  0.77 16.75 ? 377  PRO A C   1 
ATOM   4372 C C   B PRO A 1 384 ? 13.567  16.200  -4.789  0.23 16.70 ? 377  PRO A C   1 
ATOM   4373 O O   A PRO A 1 384 ? 13.595  16.913  -3.627  0.77 16.37 ? 377  PRO A O   1 
ATOM   4374 O O   B PRO A 1 384 ? 13.424  16.643  -3.649  0.23 13.77 ? 377  PRO A O   1 
ATOM   4375 C CB  A PRO A 1 384 ? 14.078  18.576  -6.064  0.77 18.34 ? 377  PRO A CB  1 
ATOM   4376 C CB  B PRO A 1 384 ? 13.983  18.305  -6.113  0.23 17.04 ? 377  PRO A CB  1 
ATOM   4377 C CG  A PRO A 1 384 ? 13.171  19.564  -6.724  0.77 18.86 ? 377  PRO A CG  1 
ATOM   4378 C CG  B PRO A 1 384 ? 13.078  19.254  -6.817  0.23 18.26 ? 377  PRO A CG  1 
ATOM   4379 C CD  A PRO A 1 384 ? 11.789  19.268  -6.168  0.77 18.17 ? 377  PRO A CD  1 
ATOM   4380 C CD  B PRO A 1 384 ? 11.686  18.951  -6.300  0.23 17.48 ? 377  PRO A CD  1 
ATOM   4381 N N   A SER A 1 385 ? 13.988  15.191  -5.035  0.77 12.26 ? 378  SER A N   1 
ATOM   4382 N N   B SER A 1 385 ? 14.058  14.993  -5.053  0.23 12.91 ? 378  SER A N   1 
ATOM   4383 C CA  A SER A 1 385 ? 14.164  14.209  -3.965  0.77 14.04 ? 378  SER A CA  1 
ATOM   4384 C CA  B SER A 1 385 ? 14.335  14.022  -4.001  0.23 14.54 ? 378  SER A CA  1 
ATOM   4385 C C   A SER A 1 385 ? 15.153  14.643  -2.879  0.77 15.79 ? 378  SER A C   1 
ATOM   4386 C C   B SER A 1 385 ? 15.236  14.550  -2.893  0.23 15.96 ? 378  SER A C   1 
ATOM   4387 O O   A SER A 1 385 ? 15.010  14.241  -1.724  0.77 17.71 ? 378  SER A O   1 
ATOM   4388 O O   B SER A 1 385 ? 15.107  14.135  -1.741  0.23 17.84 ? 378  SER A O   1 
ATOM   4389 C CB  A SER A 1 385 ? 14.588  12.851  -4.551  0.77 14.91 ? 378  SER A CB  1 
ATOM   4390 C CB  B SER A 1 385 ? 14.961  12.762  -4.601  0.23 16.22 ? 378  SER A CB  1 
ATOM   4391 O OG  A SER A 1 385 ? 15.840  12.934  -5.208  0.77 23.57 ? 378  SER A OG  1 
ATOM   4392 O OG  B SER A 1 385 ? 14.111  12.200  -5.580  0.23 15.56 ? 378  SER A OG  1 
ATOM   4393 N N   . GLU A 1 386 ? 16.147  15.461  -3.226  1.00 11.94 ? 379  GLU A N   1 
ATOM   4394 C CA  . GLU A 1 386 ? 17.115  15.922  -2.208  1.00 16.77 ? 379  GLU A CA  1 
ATOM   4395 C C   . GLU A 1 386 ? 16.468  16.833  -1.184  1.00 19.99 ? 379  GLU A C   1 
ATOM   4396 O O   . GLU A 1 386 ? 17.026  17.052  -0.110  1.00 15.95 ? 379  GLU A O   1 
ATOM   4397 C CB  . GLU A 1 386 ? 18.328  16.633  -2.837  1.00 16.60 ? 379  GLU A CB  1 
ATOM   4398 C CG  . GLU A 1 386 ? 17.998  17.802  -3.748  1.00 17.41 ? 379  GLU A CG  1 
ATOM   4399 C CD  . GLU A 1 386 ? 18.022  17.441  -5.242  1.00 24.03 ? 379  GLU A CD  1 
ATOM   4400 O OE1 . GLU A 1 386 ? 17.257  16.557  -5.670  1.00 21.75 ? 379  GLU A OE1 1 
ATOM   4401 O OE2 . GLU A 1 386 ? 18.804  18.055  -5.995  1.00 39.35 ? 379  GLU A OE2 1 
ATOM   4402 N N   . LEU A 1 387 ? 15.279  17.342  -1.496  1.00 15.43 ? 380  LEU A N   1 
ATOM   4403 C CA  . LEU A 1 387 ? 14.566  18.218  -0.573  1.00 14.89 ? 380  LEU A CA  1 
ATOM   4404 C C   . LEU A 1 387 ? 13.412  17.516  0.135   1.00 22.76 ? 380  LEU A C   1 
ATOM   4405 O O   . LEU A 1 387 ? 12.872  18.038  1.109   1.00 23.28 ? 380  LEU A O   1 
ATOM   4406 C CB  . LEU A 1 387 ? 14.023  19.450  -1.324  1.00 16.86 ? 380  LEU A CB  1 
ATOM   4407 C CG  . LEU A 1 387 ? 14.978  20.366  -2.097  1.00 14.44 ? 380  LEU A CG  1 
ATOM   4408 C CD1 . LEU A 1 387 ? 14.210  21.534  -2.777  1.00 15.53 ? 380  LEU A CD1 1 
ATOM   4409 C CD2 . LEU A 1 387 ? 16.124  20.900  -1.192  1.00 16.76 ? 380  LEU A CD2 1 
ATOM   4410 N N   A ALA A 1 388 ? 13.034  16.339  -0.358  0.16 17.35 ? 381  ALA A N   1 
ATOM   4411 N N   B ALA A 1 388 ? 13.036  16.340  -0.358  0.84 17.25 ? 381  ALA A N   1 
ATOM   4412 C CA  A ALA A 1 388 ? 11.842  15.645  0.130   0.16 21.01 ? 381  ALA A CA  1 
ATOM   4413 C CA  B ALA A 1 388 ? 11.850  15.640  0.136   0.84 20.85 ? 381  ALA A CA  1 
ATOM   4414 C C   A ALA A 1 388 ? 12.166  14.327  0.832   0.16 22.60 ? 381  ALA A C   1 
ATOM   4415 C C   B ALA A 1 388 ? 12.206  14.475  1.060   0.84 21.40 ? 381  ALA A C   1 
ATOM   4416 O O   A ALA A 1 388 ? 13.280  13.817  0.734   0.16 24.02 ? 381  ALA A O   1 
ATOM   4417 O O   B ALA A 1 388 ? 13.375  14.222  1.341   0.84 22.19 ? 381  ALA A O   1 
ATOM   4418 C CB  A ALA A 1 388 ? 10.882  15.395  -1.019  0.16 19.09 ? 381  ALA A CB  1 
ATOM   4419 C CB  B ALA A 1 388 ? 11.016  15.138  -1.025  0.84 17.60 ? 381  ALA A CB  1 
ATOM   4420 N N   . ASP A 1 389 ? 11.176  13.772  1.528   1.00 33.35 ? 382  ASP A N   1 
ATOM   4421 C CA  . ASP A 1 389 ? 11.347  12.503  2.230   1.00 29.22 ? 382  ASP A CA  1 
ATOM   4422 C C   . ASP A 1 389 ? 10.760  11.352  1.413   1.00 30.74 ? 382  ASP A C   1 
ATOM   4423 O O   . ASP A 1 389 ? 9.765   11.532  0.717   1.00 25.52 ? 382  ASP A O   1 
ATOM   4424 C CB  A ASP A 1 389 ? 10.701  12.554  3.613   0.42 30.57 ? 382  ASP A CB  1 
ATOM   4425 C CB  B ASP A 1 389 ? 10.671  12.556  3.599   0.58 30.59 ? 382  ASP A CB  1 
ATOM   4426 C CG  A ASP A 1 389 ? 10.894  11.271  4.391   0.42 36.64 ? 382  ASP A CG  1 
ATOM   4427 C CG  B ASP A 1 389 ? 9.162   12.711  3.492   0.58 33.45 ? 382  ASP A CG  1 
ATOM   4428 O OD1 A ASP A 1 389 ? 11.922  11.145  5.093   0.42 33.94 ? 382  ASP A OD1 1 
ATOM   4429 O OD1 B ASP A 1 389 ? 8.711   13.650  2.800   0.58 28.68 ? 382  ASP A OD1 1 
ATOM   4430 O OD2 A ASP A 1 389 ? 10.023  10.383  4.294   0.42 39.66 ? 382  ASP A OD2 1 
ATOM   4431 O OD2 B ASP A 1 389 ? 8.428   11.898  4.093   0.58 21.08 ? 382  ASP A OD2 1 
ATOM   4432 N N   . ALA A 1 390 ? 11.361  10.168  1.502   1.00 27.37 ? 383  ALA A N   1 
ATOM   4433 C CA  . ALA A 1 390 ? 10.901  9.015   0.721   1.00 25.19 ? 383  ALA A CA  1 
ATOM   4434 C C   . ALA A 1 390 ? 9.403   8.742   0.905   1.00 33.49 ? 383  ALA A C   1 
ATOM   4435 O O   . ALA A 1 390 ? 8.723   8.320   -0.034  1.00 19.38 ? 383  ALA A O   1 
ATOM   4436 C CB  . ALA A 1 390 ? 11.707  7.776   1.084   1.00 52.81 ? 383  ALA A CB  1 
ATOM   4437 N N   . GLU A 1 391 ? 8.908   9.004   2.114   1.00 26.88 ? 384  GLU A N   1 
ATOM   4438 C CA  . GLU A 1 391 ? 7.496   8.871   2.462   1.00 45.42 ? 384  GLU A CA  1 
ATOM   4439 C C   . GLU A 1 391 ? 6.632   9.898   1.743   1.00 29.42 ? 384  GLU A C   1 
ATOM   4440 O O   . GLU A 1 391 ? 5.459   9.642   1.445   1.00 29.99 ? 384  GLU A O   1 
ATOM   4441 C CB  . GLU A 1 391 ? 7.328   9.036   3.977   1.00 48.22 ? 384  GLU A CB  1 
ATOM   4442 C CG  . GLU A 1 391 ? 6.911   7.797   4.772   1.00 56.84 ? 384  GLU A CG  1 
ATOM   4443 C CD  . GLU A 1 391 ? 6.274   8.176   6.105   1.00 65.40 ? 384  GLU A CD  1 
ATOM   4444 O OE1 . GLU A 1 391 ? 5.283   8.940   6.108   1.00 74.30 ? 384  GLU A OE1 1 
ATOM   4445 O OE2 . GLU A 1 391 ? 6.789   7.732   7.155   1.00 69.14 ? 384  GLU A OE2 1 
ATOM   4446 N N   A ARG A 1 392 ? 7.228   11.061  1.496   0.86 29.21 ? 385  ARG A N   1 
ATOM   4447 N N   B ARG A 1 392 ? 7.224   11.059  1.471   0.14 29.01 ? 385  ARG A N   1 
ATOM   4448 C CA  A ARG A 1 392 ? 6.569   12.197  0.857   0.86 20.72 ? 385  ARG A CA  1 
ATOM   4449 C CA  B ARG A 1 392 ? 6.530   12.198  0.869   0.14 21.05 ? 385  ARG A CA  1 
ATOM   4450 C C   A ARG A 1 392 ? 5.394   12.720  1.685   0.86 27.06 ? 385  ARG A C   1 
ATOM   4451 C C   B ARG A 1 392 ? 5.317   12.619  1.697   0.14 27.10 ? 385  ARG A C   1 
ATOM   4452 O O   A ARG A 1 392 ? 4.376   13.149  1.140   0.86 24.70 ? 385  ARG A O   1 
ATOM   4453 O O   B ARG A 1 392 ? 4.241   12.875  1.155   0.14 24.92 ? 385  ARG A O   1 
ATOM   4454 C CB  A ARG A 1 392 ? 6.115   11.817  -0.558  0.86 17.05 ? 385  ARG A CB  1 
ATOM   4455 C CB  B ARG A 1 392 ? 6.102   11.883  -0.569  0.14 17.34 ? 385  ARG A CB  1 
ATOM   4456 C CG  A ARG A 1 392 ? 7.255   11.310  -1.444  0.86 19.20 ? 385  ARG A CG  1 
ATOM   4457 C CG  B ARG A 1 392 ? 7.262   11.637  -1.524  0.14 19.66 ? 385  ARG A CG  1 
ATOM   4458 C CD  A ARG A 1 392 ? 7.998   12.457  -2.077  0.86 22.70 ? 385  ARG A CD  1 
ATOM   4459 C CD  B ARG A 1 392 ? 8.170   12.853  -1.609  0.14 16.86 ? 385  ARG A CD  1 
ATOM   4460 N NE  A ARG A 1 392 ? 9.245   12.029  -2.716  0.86 16.86 ? 385  ARG A NE  1 
ATOM   4461 N NE  B ARG A 1 392 ? 9.424   12.556  -2.297  0.14 19.28 ? 385  ARG A NE  1 
ATOM   4462 C CZ  A ARG A 1 392 ? 9.912   12.753  -3.609  0.86 14.48 ? 385  ARG A CZ  1 
ATOM   4463 C CZ  B ARG A 1 392 ? 9.730   12.984  -3.517  0.14 14.60 ? 385  ARG A CZ  1 
ATOM   4464 N NH1 A ARG A 1 392 ? 9.438   13.924  -4.018  0.86 15.00 ? 385  ARG A NH1 1 
ATOM   4465 N NH1 B ARG A 1 392 ? 8.877   13.740  -4.191  0.14 16.03 ? 385  ARG A NH1 1 
ATOM   4466 N NH2 A ARG A 1 392 ? 11.036  12.283  -4.127  0.86 16.70 ? 385  ARG A NH2 1 
ATOM   4467 N NH2 B ARG A 1 392 ? 10.896  12.663  -4.059  0.14 15.95 ? 385  ARG A NH2 1 
ATOM   4468 N N   A THR A 1 393 ? 5.551   12.685  3.007   0.86 26.21 ? 386  THR A N   1 
ATOM   4469 N N   B THR A 1 393 ? 5.500   12.687  3.013   0.14 26.33 ? 386  THR A N   1 
ATOM   4470 C CA  A THR A 1 393 ? 4.480   13.096  3.909   0.86 31.33 ? 386  THR A CA  1 
ATOM   4471 C CA  B THR A 1 393 ? 4.421   13.061  3.921   0.14 31.23 ? 386  THR A CA  1 
ATOM   4472 C C   A THR A 1 393 ? 4.888   14.243  4.829   0.86 32.88 ? 386  THR A C   1 
ATOM   4473 C C   B THR A 1 393 ? 4.795   14.258  4.790   0.14 32.46 ? 386  THR A C   1 
ATOM   4474 O O   A THR A 1 393 ? 4.048   14.817  5.525   0.86 28.97 ? 386  THR A O   1 
ATOM   4475 O O   B THR A 1 393 ? 3.921   14.913  5.360   0.14 29.10 ? 386  THR A O   1 
ATOM   4476 C CB  A THR A 1 393 ? 3.985   11.910  4.778   0.86 31.31 ? 386  THR A CB  1 
ATOM   4477 C CB  B THR A 1 393 ? 4.023   11.889  4.841   0.14 31.31 ? 386  THR A CB  1 
ATOM   4478 O OG1 A THR A 1 393 ? 5.092   11.299  5.452   0.86 35.74 ? 386  THR A OG1 1 
ATOM   4479 O OG1 B THR A 1 393 ? 5.129   11.541  5.684   0.14 34.78 ? 386  THR A OG1 1 
ATOM   4480 C CG2 A THR A 1 393 ? 3.281   10.872  3.918   0.86 34.49 ? 386  THR A CG2 1 
ATOM   4481 C CG2 B THR A 1 393 ? 3.602   10.678  4.019   0.14 33.12 ? 386  THR A CG2 1 
ATOM   4482 N N   A ALA A 1 394 ? 6.172   14.582  4.831   0.86 27.61 ? 387  ALA A N   1 
ATOM   4483 N N   B ALA A 1 394 ? 6.093   14.534  4.887   0.14 27.89 ? 387  ALA A N   1 
ATOM   4484 C CA  A ALA A 1 394 ? 6.660   15.674  5.660   0.86 24.33 ? 387  ALA A CA  1 
ATOM   4485 C CA  B ALA A 1 394 ? 6.600   15.638  5.699   0.14 24.54 ? 387  ALA A CA  1 
ATOM   4486 C C   A ALA A 1 394 ? 5.966   16.985  5.284   0.86 29.35 ? 387  ALA A C   1 
ATOM   4487 C C   B ALA A 1 394 ? 5.961   16.965  5.296   0.14 28.84 ? 387  ALA A C   1 
ATOM   4488 O O   A ALA A 1 394 ? 5.623   17.204  4.116   0.86 19.95 ? 387  ALA A O   1 
ATOM   4489 O O   B ALA A 1 394 ? 5.666   17.179  4.119   0.14 20.57 ? 387  ALA A O   1 
ATOM   4490 C CB  A ALA A 1 394 ? 8.172   15.803  5.530   0.86 25.54 ? 387  ALA A CB  1 
ATOM   4491 C CB  B ALA A 1 394 ? 8.117   15.720  5.586   0.14 25.74 ? 387  ALA A CB  1 
ATOM   4492 N N   . PRO A 1 395 ? 5.737   17.858  6.275   1.00 25.51 ? 388  PRO A N   1 
ATOM   4493 C CA  . PRO A 1 395 ? 5.072   19.133  6.002   1.00 21.31 ? 388  PRO A CA  1 
ATOM   4494 C C   . PRO A 1 395 ? 5.829   19.997  4.992   1.00 21.09 ? 388  PRO A C   1 
ATOM   4495 O O   . PRO A 1 395 ? 5.199   20.653  4.173   1.00 22.23 ? 388  PRO A O   1 
ATOM   4496 C CB  . PRO A 1 395 ? 5.025   19.806  7.380   1.00 34.14 ? 388  PRO A CB  1 
ATOM   4497 C CG  . PRO A 1 395 ? 5.114   18.696  8.346   1.00 30.80 ? 388  PRO A CG  1 
ATOM   4498 C CD  . PRO A 1 395 ? 6.025   17.691  7.710   1.00 39.56 ? 388  PRO A CD  1 
ATOM   4499 N N   A GLU A 1 396 ? 7.158   19.999  5.038   0.44 19.65 ? 389  GLU A N   1 
ATOM   4500 N N   B GLU A 1 396 ? 7.154   19.962  5.044   0.56 19.65 ? 389  GLU A N   1 
ATOM   4501 C CA  A GLU A 1 396 ? 7.921   20.803  4.088   0.44 21.84 ? 389  GLU A CA  1 
ATOM   4502 C CA  B GLU A 1 396 ? 7.984   20.732  4.134   0.56 21.80 ? 389  GLU A CA  1 
ATOM   4503 C C   A GLU A 1 396 ? 7.722   20.276  2.666   0.44 17.97 ? 389  GLU A C   1 
ATOM   4504 C C   B GLU A 1 396 ? 7.789   20.261  2.692   0.56 17.88 ? 389  GLU A C   1 
ATOM   4505 O O   A GLU A 1 396 ? 7.687   21.052  1.709   0.44 24.21 ? 389  GLU A O   1 
ATOM   4506 O O   B GLU A 1 396 ? 7.827   21.059  1.752   0.56 24.80 ? 389  GLU A O   1 
ATOM   4507 C CB  A GLU A 1 396 ? 9.409   20.827  4.447   0.44 25.68 ? 389  GLU A CB  1 
ATOM   4508 C CB  B GLU A 1 396 ? 9.448   20.613  4.541   0.56 26.05 ? 389  GLU A CB  1 
ATOM   4509 C CG  A GLU A 1 396 ? 10.280  21.527  3.408   0.44 25.70 ? 389  GLU A CG  1 
ATOM   4510 C CG  B GLU A 1 396 ? 10.342  21.672  3.961   0.56 24.92 ? 389  GLU A CG  1 
ATOM   4511 C CD  A GLU A 1 396 ? 11.355  22.406  4.025   0.44 30.51 ? 389  GLU A CD  1 
ATOM   4512 C CD  B GLU A 1 396 ? 11.672  21.737  4.680   0.56 36.32 ? 389  GLU A CD  1 
ATOM   4513 O OE1 A GLU A 1 396 ? 11.084  23.038  5.068   0.44 42.65 ? 389  GLU A OE1 1 
ATOM   4514 O OE1 B GLU A 1 396 ? 11.860  20.972  5.652   0.56 43.24 ? 389  GLU A OE1 1 
ATOM   4515 O OE2 A GLU A 1 396 ? 12.473  22.461  3.469   0.44 41.90 ? 389  GLU A OE2 1 
ATOM   4516 O OE2 B GLU A 1 396 ? 12.533  22.548  4.276   0.56 44.14 ? 389  GLU A OE2 1 
ATOM   4517 N N   . THR A 1 397 ? 7.570   18.963  2.532   1.00 22.95 ? 390  THR A N   1 
ATOM   4518 C CA  . THR A 1 397 ? 7.350   18.375  1.212   1.00 21.13 ? 390  THR A CA  1 
ATOM   4519 C C   . THR A 1 397 ? 5.997   18.812  0.657   1.00 14.89 ? 390  THR A C   1 
ATOM   4520 O O   . THR A 1 397 ? 5.891   19.148  -0.527  1.00 13.61 ? 390  THR A O   1 
ATOM   4521 C CB  . THR A 1 397 ? 7.434   16.837  1.258   1.00 17.59 ? 390  THR A CB  1 
ATOM   4522 O OG1 . THR A 1 397 ? 8.648   16.462  1.911   1.00 19.76 ? 390  THR A OG1 1 
ATOM   4523 C CG2 . THR A 1 397 ? 7.423   16.237  -0.148  1.00 18.05 ? 390  THR A CG2 1 
ATOM   4524 N N   . LEU A 1 398 ? 4.976   18.812  1.507   1.00 17.43 ? 391  LEU A N   1 
ATOM   4525 C CA  . LEU A 1 398 ? 3.675   19.347  1.141   1.00 17.72 ? 391  LEU A CA  1 
ATOM   4526 C C   . LEU A 1 398 ? 3.750   20.810  0.698   1.00 17.62 ? 391  LEU A C   1 
ATOM   4527 O O   . LEU A 1 398 ? 3.138   21.190  -0.297  1.00 16.21 ? 391  LEU A O   1 
ATOM   4528 C CB  . LEU A 1 398 ? 2.716   19.198  2.317   1.00 20.94 ? 391  LEU A CB  1 
ATOM   4529 C CG  . LEU A 1 398 ? 1.997   17.860  2.310   1.00 20.18 ? 391  LEU A CG  1 
ATOM   4530 C CD1 . LEU A 1 398 ? 1.191   17.729  3.592   1.00 33.96 ? 391  LEU A CD1 1 
ATOM   4531 C CD2 . LEU A 1 398 ? 1.086   17.790  1.110   1.00 24.32 ? 391  LEU A CD2 1 
ATOM   4532 N N   . GLU A 1 399 ? 4.508   21.626  1.431   1.00 16.23 ? 392  GLU A N   1 
ATOM   4533 C CA  . GLU A 1 399 ? 4.673   23.044  1.096   1.00 14.04 ? 392  GLU A CA  1 
ATOM   4534 C C   . GLU A 1 399 ? 5.337   23.230  -0.275  1.00 16.94 ? 392  GLU A C   1 
ATOM   4535 O O   . GLU A 1 399 ? 4.883   24.022  -1.102  1.00 18.06 ? 392  GLU A O   1 
ATOM   4536 C CB  . GLU A 1 399 ? 5.499   23.752  2.177   1.00 18.15 ? 392  GLU A CB  1 
ATOM   4537 C CG  . GLU A 1 399 ? 4.825   23.843  3.546   1.00 28.76 ? 392  GLU A CG  1 
ATOM   4538 C CD  . GLU A 1 399 ? 5.813   24.146  4.666   1.00 28.24 ? 392  GLU A CD  1 
ATOM   4539 O OE1 . GLU A 1 399 ? 7.002   24.408  4.373   1.00 43.81 ? 392  GLU A OE1 1 
ATOM   4540 O OE2 . GLU A 1 399 ? 5.397   24.111  5.844   1.00 40.20 ? 392  GLU A OE2 1 
ATOM   4541 N N   . MET A 1 400 ? 6.418   22.491  -0.513  1.00 16.56 ? 393  MET A N   1 
ATOM   4542 C CA  . MET A 1 400 ? 7.087   22.576  -1.802  1.00 15.53 ? 393  MET A CA  1 
ATOM   4543 C C   . MET A 1 400 ? 6.183   21.990  -2.908  1.00 13.82 ? 393  MET A C   1 
ATOM   4544 O O   . MET A 1 400 ? 6.150   22.517  -4.016  1.00 13.45 ? 393  MET A O   1 
ATOM   4545 C CB  . MET A 1 400 ? 8.463   21.894  -1.734  1.00 16.56 ? 393  MET A CB  1 
ATOM   4546 C CG  . MET A 1 400 ? 9.523   22.752  -1.002  1.00 15.24 ? 393  MET A CG  1 
ATOM   4547 S SD  . MET A 1 400 ? 11.007  21.782  -0.799  1.00 38.99 ? 393  MET A SD  1 
ATOM   4548 C CE  . MET A 1 400 ? 11.945  22.830  0.316   1.00 49.85 ? 393  MET A CE  1 
ATOM   4549 N N   . GLY A 1 401 ? 5.395   20.965  -2.593  1.00 14.79 ? 394  GLY A N   1 
ATOM   4550 C CA  . GLY A 1 401 ? 4.487   20.401  -3.590  1.00 14.66 ? 394  GLY A CA  1 
ATOM   4551 C C   . GLY A 1 401 ? 3.420   21.406  -3.987  1.00 12.92 ? 394  GLY A C   1 
ATOM   4552 O O   . GLY A 1 401 ? 2.988   21.442  -5.136  1.00 14.76 ? 394  GLY A O   1 
ATOM   4553 N N   . ALA A 1 402 ? 3.001   22.240  -3.033  1.00 15.82 ? 395  ALA A N   1 
ATOM   4554 C CA  . ALA A 1 402 ? 2.008   23.283  -3.297  1.00 15.35 ? 395  ALA A CA  1 
ATOM   4555 C C   . ALA A 1 402 ? 2.539   24.322  -4.292  1.00 14.68 ? 395  ALA A C   1 
ATOM   4556 O O   . ALA A 1 402 ? 1.785   24.859  -5.115  1.00 15.96 ? 395  ALA A O   1 
ATOM   4557 C CB  . ALA A 1 402 ? 1.582   23.959  -1.991  1.00 15.63 ? 395  ALA A CB  1 
ATOM   4558 N N   . LYS A 1 403 ? 3.839   24.598  -4.212  1.00 12.37 ? 396  LYS A N   1 
ATOM   4559 C CA  . LYS A 1 403 ? 4.511   25.489  -5.160  1.00 15.48 ? 396  LYS A CA  1 
ATOM   4560 C C   . LYS A 1 403 ? 4.470   24.930  -6.587  1.00 17.95 ? 396  LYS A C   1 
ATOM   4561 O O   . LYS A 1 403 ? 4.161   25.650  -7.548  1.00 15.40 ? 396  LYS A O   1 
ATOM   4562 C CB  . LYS A 1 403 ? 5.963   25.711  -4.740  1.00 17.24 ? 396  LYS A CB  1 
ATOM   4563 C CG  . LYS A 1 403 ? 6.123   26.510  -3.457  1.00 25.76 ? 396  LYS A CG  1 
ATOM   4564 C CD  . LYS A 1 403 ? 7.599   26.872  -3.200  1.00 20.69 ? 396  LYS A CD  1 
ATOM   4565 C CE  . LYS A 1 403 ? 7.699   27.921  -2.091  1.00 41.04 ? 396  LYS A CE  1 
ATOM   4566 N NZ  . LYS A 1 403 ? 9.087   28.416  -1.852  1.00 54.81 ? 396  LYS A NZ  1 
ATOM   4567 N N   A ILE A 1 404 ? 4.798   23.650  -6.724  0.83 13.68 ? 397  ILE A N   1 
ATOM   4568 N N   B ILE A 1 404 ? 4.780   23.645  -6.722  0.17 13.88 ? 397  ILE A N   1 
ATOM   4569 C CA  A ILE A 1 404 ? 4.769   22.996  -8.028  0.83 14.94 ? 397  ILE A CA  1 
ATOM   4570 C CA  B ILE A 1 404 ? 4.745   22.987  -8.023  0.17 14.91 ? 397  ILE A CA  1 
ATOM   4571 C C   A ILE A 1 404 ? 3.350   23.005  -8.570  0.83 13.94 ? 397  ILE A C   1 
ATOM   4572 C C   B ILE A 1 404 ? 3.320   22.955  -8.565  0.17 13.98 ? 397  ILE A C   1 
ATOM   4573 O O   A ILE A 1 404 ? 3.124   23.278  -9.747  0.83 16.34 ? 397  ILE A O   1 
ATOM   4574 O O   B ILE A 1 404 ? 3.095   23.133  -9.763  0.17 15.89 ? 397  ILE A O   1 
ATOM   4575 C CB  A ILE A 1 404 ? 5.271   21.546  -7.940  0.83 14.68 ? 397  ILE A CB  1 
ATOM   4576 C CB  B ILE A 1 404 ? 5.308   21.553  -7.943  0.17 14.36 ? 397  ILE A CB  1 
ATOM   4577 C CG1 A ILE A 1 404 ? 6.732   21.505  -7.482  0.83 14.32 ? 397  ILE A CG1 1 
ATOM   4578 C CG1 B ILE A 1 404 ? 6.798   21.592  -7.605  0.17 14.39 ? 397  ILE A CG1 1 
ATOM   4579 C CG2 A ILE A 1 404 ? 5.093   20.854  -9.270  0.83 15.20 ? 397  ILE A CG2 1 
ATOM   4580 C CG2 B ILE A 1 404 ? 5.094   20.814  -9.252  0.17 15.17 ? 397  ILE A CG2 1 
ATOM   4581 C CD1 A ILE A 1 404 ? 7.254   20.113  -7.244  0.83 17.48 ? 397  ILE A CD1 1 
ATOM   4582 C CD1 B ILE A 1 404 ? 7.615   22.413  -8.581  0.17 10.46 ? 397  ILE A CD1 1 
ATOM   4583 N N   A LYS A 1 405 ? 2.383   22.731  -7.696  0.83 18.00 ? 398  LYS A N   1 
ATOM   4584 N N   B LYS A 1 405 ? 2.357   22.749  -7.672  0.17 17.50 ? 398  LYS A N   1 
ATOM   4585 C CA  A LYS A 1 405 ? 0.976   22.694  -8.107  0.83 11.95 ? 398  LYS A CA  1 
ATOM   4586 C CA  B LYS A 1 405 ? 0.951   22.703  -8.061  0.17 12.43 ? 398  LYS A CA  1 
ATOM   4587 C C   A LYS A 1 405 ? 0.522   24.051  -8.647  0.83 14.24 ? 398  LYS A C   1 
ATOM   4588 C C   B LYS A 1 405 ? 0.483   24.048  -8.612  0.17 14.11 ? 398  LYS A C   1 
ATOM   4589 O O   A LYS A 1 405 ? -0.183  24.116  -9.654  0.83 14.66 ? 398  LYS A O   1 
ATOM   4590 O O   B LYS A 1 405 ? -0.286  24.099  -9.573  0.17 14.77 ? 398  LYS A O   1 
ATOM   4591 C CB  A LYS A 1 405 ? 0.079   22.255  -6.943  0.83 13.20 ? 398  LYS A CB  1 
ATOM   4592 C CB  B LYS A 1 405 ? 0.081   22.287  -6.874  0.17 13.36 ? 398  LYS A CB  1 
ATOM   4593 C CG  A LYS A 1 405 ? -1.379  22.022  -7.364  0.83 12.47 ? 398  LYS A CG  1 
ATOM   4594 C CG  B LYS A 1 405 ? -1.383  22.083  -7.229  0.17 12.90 ? 398  LYS A CG  1 
ATOM   4595 C CD  A LYS A 1 405 ? -2.271  21.523  -6.201  0.83 12.23 ? 398  LYS A CD  1 
ATOM   4596 C CD  B LYS A 1 405 ? -2.171  21.544  -6.042  0.17 12.85 ? 398  LYS A CD  1 
ATOM   4597 C CE  A LYS A 1 405 ? -3.722  21.405  -6.673  0.83 18.00 ? 398  LYS A CE  1 
ATOM   4598 C CE  B LYS A 1 405 ? -3.624  21.300  -6.415  0.17 17.76 ? 398  LYS A CE  1 
ATOM   4599 N NZ  A LYS A 1 405 ? -4.682  20.996  -5.595  0.83 16.57 ? 398  LYS A NZ  1 
ATOM   4600 N NZ  B LYS A 1 405 ? -4.408  20.750  -5.272  0.17 16.80 ? 398  LYS A NZ  1 
ATOM   4601 N N   . LYS A 1 406 ? 0.950   25.134  -8.004  1.00 15.25 ? 399  LYS A N   1 
ATOM   4602 C CA  . LYS A 1 406 ? 0.635   26.475  -8.495  1.00 14.12 ? 399  LYS A CA  1 
ATOM   4603 C C   . LYS A 1 406 ? 1.201   26.725  -9.894  1.00 16.02 ? 399  LYS A C   1 
ATOM   4604 O O   . LYS A 1 406 ? 0.611   27.463  -10.679 1.00 19.13 ? 399  LYS A O   1 
ATOM   4605 C CB  . LYS A 1 406 ? 1.156   27.541  -7.530  1.00 20.62 ? 399  LYS A CB  1 
ATOM   4606 C CG  . LYS A 1 406 ? 0.267   27.759  -6.320  1.00 21.57 ? 399  LYS A CG  1 
ATOM   4607 C CD  . LYS A 1 406 ? 0.786   28.905  -5.458  1.00 20.87 ? 399  LYS A CD  1 
ATOM   4608 C CE  . LYS A 1 406 ? -0.056  29.102  -4.206  1.00 34.30 ? 399  LYS A CE  1 
ATOM   4609 N NZ  . LYS A 1 406 ? 0.095   27.992  -3.218  1.00 35.69 ? 399  LYS A NZ  1 
ATOM   4610 N N   A ALA A 1 407 ? 2.339   26.101  -10.197 0.90 15.72 ? 400  ALA A N   1 
ATOM   4611 N N   B ALA A 1 407 ? 2.333   26.100  -10.198 0.10 15.44 ? 400  ALA A N   1 
ATOM   4612 C CA  A ALA A 1 407 ? 3.017   26.314  -11.470 0.90 13.09 ? 400  ALA A CA  1 
ATOM   4613 C CA  B ALA A 1 407 ? 3.030   26.355  -11.452 0.10 13.39 ? 400  ALA A CA  1 
ATOM   4614 C C   A ALA A 1 407 ? 2.328   25.605  -12.636 0.90 14.37 ? 400  ALA A C   1 
ATOM   4615 C C   B ALA A 1 407 ? 2.397   25.644  -12.646 0.10 14.64 ? 400  ALA A C   1 
ATOM   4616 O O   A ALA A 1 407 ? 2.429   26.063  -13.777 0.90 19.32 ? 400  ALA A O   1 
ATOM   4617 O O   B ALA A 1 407 ? 2.628   26.032  -13.791 0.10 17.55 ? 400  ALA A O   1 
ATOM   4618 C CB  A ALA A 1 407 ? 4.478   25.857  -11.374 0.90 13.78 ? 400  ALA A CB  1 
ATOM   4619 C CB  B ALA A 1 407 ? 4.494   25.951  -11.324 0.10 13.76 ? 400  ALA A CB  1 
ATOM   4620 N N   A HIS A 1 408 ? 1.613   24.510  -12.362 0.90 13.86 ? 401  HIS A N   1 
ATOM   4621 N N   B HIS A 1 408 ? 1.593   24.615  -12.390 0.10 13.98 ? 401  HIS A N   1 
ATOM   4622 C CA  A HIS A 1 408 ? 1.127   23.665  -13.466 0.90 14.18 ? 401  HIS A CA  1 
ATOM   4623 C CA  B HIS A 1 408 ? 1.097   23.786  -13.487 0.10 14.00 ? 401  HIS A CA  1 
ATOM   4624 C C   A HIS A 1 408 ? -0.360  23.298  -13.466 0.90 18.79 ? 401  HIS A C   1 
ATOM   4625 C C   B HIS A 1 408 ? -0.414  23.539  -13.491 0.10 18.05 ? 401  HIS A C   1 
ATOM   4626 O O   A HIS A 1 408 ? -0.904  22.931  -14.505 0.90 19.18 ? 401  HIS A O   1 
ATOM   4627 O O   B HIS A 1 408 ? -1.023  23.493  -14.559 0.10 16.94 ? 401  HIS A O   1 
ATOM   4628 C CB  A HIS A 1 408 ? 1.951   22.375  -13.526 0.90 12.94 ? 401  HIS A CB  1 
ATOM   4629 C CB  B HIS A 1 408 ? 1.836   22.446  -13.489 0.10 13.25 ? 401  HIS A CB  1 
ATOM   4630 C CG  A HIS A 1 408 ? 3.419   22.614  -13.686 0.90 10.07 ? 401  HIS A CG  1 
ATOM   4631 C CG  B HIS A 1 408 ? 3.303   22.573  -13.755 0.10 10.89 ? 401  HIS A CG  1 
ATOM   4632 N ND1 A HIS A 1 408 ? 3.983   23.007  -14.880 0.90 12.99 ? 401  HIS A ND1 1 
ATOM   4633 N ND1 B HIS A 1 408 ? 3.809   22.880  -15.000 0.10 12.79 ? 401  HIS A ND1 1 
ATOM   4634 C CD2 A HIS A 1 408 ? 4.438   22.528  -12.795 0.90 12.85 ? 401  HIS A CD2 1 
ATOM   4635 C CD2 B HIS A 1 408 ? 4.373   22.446  -12.935 0.10 13.31 ? 401  HIS A CD2 1 
ATOM   4636 C CE1 A HIS A 1 408 ? 5.289   23.152  -14.721 0.90 12.24 ? 401  HIS A CE1 1 
ATOM   4637 C CE1 B HIS A 1 408 ? 5.128   22.932  -14.936 0.10 13.11 ? 401  HIS A CE1 1 
ATOM   4638 N NE2 A HIS A 1 408 ? 5.591   22.865  -13.467 0.90 12.39 ? 401  HIS A NE2 1 
ATOM   4639 N NE2 B HIS A 1 408 ? 5.496   22.672  -13.695 0.10 12.88 ? 401  HIS A NE2 1 
ATOM   4640 N N   . VAL A 1 409 ? -1.025  23.371  -12.320 1.00 14.85 ? 402  VAL A N   1 
ATOM   4641 C CA  . VAL A 1 409 ? -2.459  23.140  -12.280 1.00 13.95 ? 402  VAL A CA  1 
ATOM   4642 C C   . VAL A 1 409 ? -3.165  24.462  -12.569 1.00 20.67 ? 402  VAL A C   1 
ATOM   4643 O O   . VAL A 1 409 ? -3.054  25.431  -11.810 1.00 19.82 ? 402  VAL A O   1 
ATOM   4644 C CB  . VAL A 1 409 ? -2.903  22.536  -10.944 1.00 15.28 ? 402  VAL A CB  1 
ATOM   4645 C CG1 . VAL A 1 409 ? -4.411  22.403  -10.909 1.00 17.03 ? 402  VAL A CG1 1 
ATOM   4646 C CG2 . VAL A 1 409 ? -2.259  21.161  -10.763 1.00 17.64 ? 402  VAL A CG2 1 
ATOM   4647 N N   . THR A 1 410 ? -3.876  24.497  -13.691 1.00 18.91 ? 403  THR A N   1 
ATOM   4648 C CA  . THR A 1 410 ? -4.382  25.754  -14.228 1.00 18.85 ? 403  THR A CA  1 
ATOM   4649 C C   . THR A 1 410 ? -5.810  26.053  -13.778 1.00 22.71 ? 403  THR A C   1 
ATOM   4650 O O   . THR A 1 410 ? -6.229  27.208  -13.777 1.00 21.81 ? 403  THR A O   1 
ATOM   4651 C CB  . THR A 1 410 ? -4.338  25.748  -15.773 1.00 18.98 ? 403  THR A CB  1 
ATOM   4652 O OG1 . THR A 1 410 ? -4.893  24.513  -16.253 1.00 21.69 ? 403  THR A OG1 1 
ATOM   4653 C CG2 . THR A 1 410 ? -2.901  25.871  -16.246 1.00 25.05 ? 403  THR A CG2 1 
ATOM   4654 N N   . GLY A 1 411 ? -6.550  25.008  -13.416 1.00 18.22 ? 404  GLY A N   1 
ATOM   4655 C CA  . GLY A 1 411 ? -7.920  25.155  -12.945 1.00 26.25 ? 404  GLY A CA  1 
ATOM   4656 C C   . GLY A 1 411 ? -8.184  24.380  -11.664 1.00 21.91 ? 404  GLY A C   1 
ATOM   4657 O O   . GLY A 1 411 ? -7.262  23.987  -10.962 1.00 21.13 ? 404  GLY A O   1 
ATOM   4658 N N   . GLU A 1 412 ? -9.455  24.146  -11.353 1.00 29.23 ? 405  GLU A N   1 
ATOM   4659 C CA  . GLU A 1 412 ? -9.797  23.568  -10.061 1.00 24.03 ? 405  GLU A CA  1 
ATOM   4660 C C   . GLU A 1 412 ? -9.566  22.050  -9.991  1.00 21.13 ? 405  GLU A C   1 
ATOM   4661 O O   . GLU A 1 412 ? -9.515  21.473  -8.907  1.00 24.56 ? 405  GLU A O   1 
ATOM   4662 C CB  A GLU A 1 412 ? -11.257 23.872  -9.703  0.46 28.71 ? 405  GLU A CB  1 
ATOM   4663 C CB  B GLU A 1 412 ? -11.251 23.917  -9.711  0.54 28.68 ? 405  GLU A CB  1 
ATOM   4664 C CG  A GLU A 1 412 ? -11.541 23.765  -8.208  0.46 30.49 ? 405  GLU A CG  1 
ATOM   4665 C CG  B GLU A 1 412 ? -11.447 25.409  -9.431  0.54 28.85 ? 405  GLU A CG  1 
ATOM   4666 C CD  A GLU A 1 412 ? -12.955 23.314  -7.896  0.46 33.17 ? 405  GLU A CD  1 
ATOM   4667 C CD  B GLU A 1 412 ? -12.888 25.794  -9.132  0.54 39.04 ? 405  GLU A CD  1 
ATOM   4668 O OE1 A GLU A 1 412 ? -13.908 23.968  -8.367  0.46 30.19 ? 405  GLU A OE1 1 
ATOM   4669 O OE1 B GLU A 1 412 ? -13.802 25.296  -9.824  0.54 29.25 ? 405  GLU A OE1 1 
ATOM   4670 O OE2 A GLU A 1 412 ? -13.111 22.305  -7.171  0.46 32.17 ? 405  GLU A OE2 1 
ATOM   4671 O OE2 B GLU A 1 412 ? -13.103 26.604  -8.203  0.54 36.11 ? 405  GLU A OE2 1 
ATOM   4672 N N   A THR A 1 413 ? -9.405  21.390  -11.129 0.26 19.63 ? 406  THR A N   1 
ATOM   4673 N N   B THR A 1 413 ? -9.428  21.424  -11.156 0.74 19.74 ? 406  THR A N   1 
ATOM   4674 C CA  A THR A 1 413 ? -9.035  19.983  -11.069 0.26 17.70 ? 406  THR A CA  1 
ATOM   4675 C CA  B THR A 1 413 ? -9.208  19.989  -11.246 0.74 17.38 ? 406  THR A CA  1 
ATOM   4676 C C   A THR A 1 413 ? -7.792  19.720  -11.913 0.26 14.95 ? 406  THR A C   1 
ATOM   4677 C C   B THR A 1 413 ? -7.978  19.681  -12.088 0.74 13.79 ? 406  THR A C   1 
ATOM   4678 O O   A THR A 1 413 ? -7.593  20.353  -12.950 0.26 16.65 ? 406  THR A O   1 
ATOM   4679 O O   B THR A 1 413 ? -7.955  20.000  -13.268 0.74 16.53 ? 406  THR A O   1 
ATOM   4680 C CB  A THR A 1 413 ? -10.199 19.060  -11.512 0.26 19.05 ? 406  THR A CB  1 
ATOM   4681 C CB  B THR A 1 413 ? -10.423 19.270  -11.868 0.74 14.46 ? 406  THR A CB  1 
ATOM   4682 O OG1 A THR A 1 413 ? -10.041 17.765  -10.917 0.26 20.39 ? 406  THR A OG1 1 
ATOM   4683 O OG1 B THR A 1 413 ? -11.588 19.514  -11.068 0.74 16.23 ? 406  THR A OG1 1 
ATOM   4684 C CG2 A THR A 1 413 ? -10.255 18.920  -13.015 0.26 14.53 ? 406  THR A CG2 1 
ATOM   4685 C CG2 B THR A 1 413 ? -10.177 17.772  -11.944 0.74 14.35 ? 406  THR A CG2 1 
ATOM   4686 N N   A PRO A 1 414 ? -6.923  18.816  -11.438 0.26 15.43 ? 407  PRO A N   1 
ATOM   4687 N N   B PRO A 1 414 ? -6.950  19.066  -11.483 0.74 15.94 ? 407  PRO A N   1 
ATOM   4688 C CA  A PRO A 1 414 ? -5.749  18.418  -12.218 0.26 15.73 ? 407  PRO A CA  1 
ATOM   4689 C CA  B PRO A 1 414 ? -5.785  18.705  -12.299 0.74 15.02 ? 407  PRO A CA  1 
ATOM   4690 C C   A PRO A 1 414 ? -6.141  17.740  -13.519 0.26 15.94 ? 407  PRO A C   1 
ATOM   4691 C C   B PRO A 1 414 ? -6.142  17.825  -13.495 0.74 15.86 ? 407  PRO A C   1 
ATOM   4692 O O   A PRO A 1 414 ? -7.061  16.918  -13.527 0.26 17.53 ? 407  PRO A O   1 
ATOM   4693 O O   B PRO A 1 414 ? -7.010  16.949  -13.407 0.74 17.33 ? 407  PRO A O   1 
ATOM   4694 C CB  A PRO A 1 414 ? -5.030  17.431  -11.297 0.26 15.81 ? 407  PRO A CB  1 
ATOM   4695 C CB  B PRO A 1 414 ? -4.891  17.935  -11.327 0.74 17.14 ? 407  PRO A CB  1 
ATOM   4696 C CG  A PRO A 1 414 ? -5.491  17.786  -9.926  0.26 16.27 ? 407  PRO A CG  1 
ATOM   4697 C CG  B PRO A 1 414 ? -5.293  18.431  -9.974  0.74 19.14 ? 407  PRO A CG  1 
ATOM   4698 C CD  A PRO A 1 414 ? -6.918  18.214  -10.094 0.26 15.80 ? 407  PRO A CD  1 
ATOM   4699 C CD  B PRO A 1 414 ? -6.773  18.705  -10.066 0.74 18.08 ? 407  PRO A CD  1 
ATOM   4700 N N   . THR A 1 415 ? -5.456  18.078  -14.605 1.00 13.87 ? 408  THR A N   1 
ATOM   4701 C CA  . THR A 1 415 ? -5.748  17.451  -15.881 1.00 13.69 ? 408  THR A CA  1 
ATOM   4702 C C   . THR A 1 415 ? -4.525  16.723  -16.422 1.00 18.64 ? 408  THR A C   1 
ATOM   4703 O O   . THR A 1 415 ? -3.396  16.954  -15.973 1.00 15.27 ? 408  THR A O   1 
ATOM   4704 C CB  . THR A 1 415 ? -6.186  18.483  -16.937 1.00 15.86 ? 408  THR A CB  1 
ATOM   4705 O OG1 . THR A 1 415 ? -5.074  19.304  -17.302 1.00 19.43 ? 408  THR A OG1 1 
ATOM   4706 C CG2 . THR A 1 415 ? -7.311  19.381  -16.386 1.00 15.96 ? 408  THR A CG2 1 
ATOM   4707 N N   . ALA A 1 416 ? -4.748  15.889  -17.428 1.00 17.12 ? 409  ALA A N   1 
ATOM   4708 C CA  . ALA A 1 416 ? -3.644  15.235  -18.122 1.00 16.52 ? 409  ALA A CA  1 
ATOM   4709 C C   . ALA A 1 416 ? -2.685  16.254  -18.733 1.00 16.06 ? 409  ALA A C   1 
ATOM   4710 O O   . ALA A 1 416 ? -1.474  16.088  -18.658 1.00 12.33 ? 409  ALA A O   1 
ATOM   4711 C CB  . ALA A 1 416 ? -4.182  14.297  -19.198 1.00 17.14 ? 409  ALA A CB  1 
ATOM   4712 N N   A ASP A 1 417 ? -3.216  17.304  -19.343 0.57 18.53 ? 410  ASP A N   1 
ATOM   4713 N N   B ASP A 1 417 ? -3.229  17.301  -19.337 0.43 18.41 ? 410  ASP A N   1 
ATOM   4714 C CA  A ASP A 1 417 ? -2.357  18.331  -19.923 0.57 14.59 ? 410  ASP A CA  1 
ATOM   4715 C CA  B ASP A 1 417 ? -2.399  18.344  -19.925 0.43 14.66 ? 410  ASP A CA  1 
ATOM   4716 C C   A ASP A 1 417 ? -1.460  18.945  -18.852 0.57 10.71 ? 410  ASP A C   1 
ATOM   4717 C C   B ASP A 1 417 ? -1.485  18.966  -18.868 0.43 10.90 ? 410  ASP A C   1 
ATOM   4718 O O   A ASP A 1 417 ? -0.274  19.194  -19.084 0.57 14.69 ? 410  ASP A O   1 
ATOM   4719 O O   B ASP A 1 417 ? -0.307  19.231  -19.124 0.43 14.72 ? 410  ASP A O   1 
ATOM   4720 C CB  A ASP A 1 417 ? -3.192  19.422  -20.605 0.57 16.25 ? 410  ASP A CB  1 
ATOM   4721 C CB  B ASP A 1 417 ? -3.275  19.418  -20.584 0.43 16.33 ? 410  ASP A CB  1 
ATOM   4722 C CG  A ASP A 1 417 ? -3.500  19.101  -22.061 0.57 26.83 ? 410  ASP A CG  1 
ATOM   4723 C CG  B ASP A 1 417 ? -4.207  18.844  -21.648 0.43 29.15 ? 410  ASP A CG  1 
ATOM   4724 O OD1 A ASP A 1 417 ? -3.927  17.963  -22.343 0.57 33.48 ? 410  ASP A OD1 1 
ATOM   4725 O OD1 B ASP A 1 417 ? -4.014  17.674  -22.048 0.43 29.88 ? 410  ASP A OD1 1 
ATOM   4726 O OD2 A ASP A 1 417 ? -3.320  19.987  -22.924 0.57 30.97 ? 410  ASP A OD2 1 
ATOM   4727 O OD2 B ASP A 1 417 ? -5.135  19.558  -22.083 0.43 21.91 ? 410  ASP A OD2 1 
ATOM   4728 N N   . ASN A 1 418 ? -2.041  19.207  -17.684 1.00 13.26 ? 411  ASN A N   1 
ATOM   4729 C CA  . ASN A 1 418 ? -1.274  19.761  -16.567 1.00 13.99 ? 411  ASN A CA  1 
ATOM   4730 C C   . ASN A 1 418 ? -0.156  18.809  -16.182 1.00 12.06 ? 411  ASN A C   1 
ATOM   4731 O O   . ASN A 1 418 ? 0.982   19.236  -15.929 1.00 11.84 ? 411  ASN A O   1 
ATOM   4732 C CB  . ASN A 1 418 ? -2.154  20.000  -15.332 1.00 12.10 ? 411  ASN A CB  1 
ATOM   4733 C CG  . ASN A 1 418 ? -3.214  21.086  -15.538 1.00 18.75 ? 411  ASN A CG  1 
ATOM   4734 O OD1 . ASN A 1 418 ? -3.199  21.845  -16.512 1.00 18.02 ? 411  ASN A OD1 1 
ATOM   4735 N ND2 . ASN A 1 418 ? -4.142  21.159  -14.592 1.00 13.21 ? 411  ASN A ND2 1 
ATOM   4736 N N   A PHE A 1 419 ? -0.488  17.521  -16.124 0.19 12.03 ? 412  PHE A N   1 
ATOM   4737 N N   B PHE A 1 419 ? -0.486  17.520  -16.131 0.81 11.66 ? 412  PHE A N   1 
ATOM   4738 C CA  A PHE A 1 419 ? 0.475   16.486  -15.769 0.19 13.07 ? 412  PHE A CA  1 
ATOM   4739 C CA  B PHE A 1 419 ? 0.485   16.498  -15.758 0.81 12.95 ? 412  PHE A CA  1 
ATOM   4740 C C   A PHE A 1 419 ? 1.642   16.487  -16.749 0.19 13.52 ? 412  PHE A C   1 
ATOM   4741 C C   B PHE A 1 419 ? 1.653   16.527  -16.752 0.81 13.48 ? 412  PHE A C   1 
ATOM   4742 O O   A PHE A 1 419 ? 2.805   16.378  -16.351 0.19 13.92 ? 412  PHE A O   1 
ATOM   4743 O O   B PHE A 1 419 ? 2.832   16.475  -16.370 0.81 13.85 ? 412  PHE A O   1 
ATOM   4744 C CB  A PHE A 1 419 ? -0.197  15.107  -15.745 0.19 13.57 ? 412  PHE A CB  1 
ATOM   4745 C CB  B PHE A 1 419 ? -0.172  15.106  -15.724 0.81 13.39 ? 412  PHE A CB  1 
ATOM   4746 C CG  A PHE A 1 419 ? 0.728   13.980  -15.367 0.19 15.20 ? 412  PHE A CG  1 
ATOM   4747 C CG  B PHE A 1 419 ? 0.708   14.023  -15.161 0.81 15.26 ? 412  PHE A CG  1 
ATOM   4748 C CD1 A PHE A 1 419 ? 0.833   13.566  -14.049 0.19 18.45 ? 412  PHE A CD1 1 
ATOM   4749 C CD1 B PHE A 1 419 ? 0.509   13.559  -13.870 0.81 19.42 ? 412  PHE A CD1 1 
ATOM   4750 C CD2 A PHE A 1 419 ? 1.488   13.329  -16.330 0.19 15.80 ? 412  PHE A CD2 1 
ATOM   4751 C CD2 B PHE A 1 419 ? 1.726   13.463  -15.919 0.81 15.94 ? 412  PHE A CD2 1 
ATOM   4752 C CE1 A PHE A 1 419 ? 1.677   12.529  -13.697 0.19 18.90 ? 412  PHE A CE1 1 
ATOM   4753 C CE1 B PHE A 1 419 ? 1.300   12.558  -13.344 0.81 16.15 ? 412  PHE A CE1 1 
ATOM   4754 C CE2 A PHE A 1 419 ? 2.334   12.294  -15.982 0.19 18.87 ? 412  PHE A CE2 1 
ATOM   4755 C CE2 B PHE A 1 419 ? 2.527   12.459  -15.389 0.81 17.99 ? 412  PHE A CE2 1 
ATOM   4756 C CZ  A PHE A 1 419 ? 2.429   11.895  -14.665 0.19 17.04 ? 412  PHE A CZ  1 
ATOM   4757 C CZ  B PHE A 1 419 ? 2.314   12.011  -14.103 0.81 17.76 ? 412  PHE A CZ  1 
ATOM   4758 N N   . MET A 1 420 ? 1.329   16.609  -18.033 1.00 11.89 ? 413  MET A N   1 
ATOM   4759 C CA  . MET A 1 420 ? 2.365   16.539  -19.057 1.00 13.21 ? 413  MET A CA  1 
ATOM   4760 C C   . MET A 1 420 ? 3.234   17.786  -19.054 1.00 16.64 ? 413  MET A C   1 
ATOM   4761 O O   . MET A 1 420 ? 4.452   17.700  -19.262 1.00 12.55 ? 413  MET A O   1 
ATOM   4762 C CB  . MET A 1 420 ? 1.732   16.281  -20.419 1.00 12.60 ? 413  MET A CB  1 
ATOM   4763 C CG  . MET A 1 420 ? 1.085   14.897  -20.486 1.00 13.10 ? 413  MET A CG  1 
ATOM   4764 S SD  . MET A 1 420 ? 0.554   14.355  -22.133 1.00 16.38 ? 413  MET A SD  1 
ATOM   4765 C CE  . MET A 1 420 ? -0.979  15.239  -22.284 1.00 15.40 ? 413  MET A CE  1 
ATOM   4766 N N   A ASP A 1 421 ? 2.615   18.939  -18.827 0.48 11.22 ? 414  ASP A N   1 
ATOM   4767 N N   B ASP A 1 421 ? 2.614   18.940  -18.831 0.52 11.14 ? 414  ASP A N   1 
ATOM   4768 C CA  A ASP A 1 421 ? 3.355   20.186  -18.671 0.48 12.21 ? 414  ASP A CA  1 
ATOM   4769 C CA  B ASP A 1 421 ? 3.352   20.187  -18.671 0.52 12.22 ? 414  ASP A CA  1 
ATOM   4770 C C   A ASP A 1 421 ? 4.342   20.092  -17.505 0.48 11.48 ? 414  ASP A C   1 
ATOM   4771 C C   B ASP A 1 421 ? 4.342   20.092  -17.505 0.52 11.47 ? 414  ASP A C   1 
ATOM   4772 O O   A ASP A 1 421 ? 5.519   20.440  -17.639 0.48 10.37 ? 414  ASP A O   1 
ATOM   4773 O O   B ASP A 1 421 ? 5.520   20.436  -17.640 0.52 10.37 ? 414  ASP A O   1 
ATOM   4774 C CB  A ASP A 1 421 ? 2.389   21.358  -18.464 0.48 14.53 ? 414  ASP A CB  1 
ATOM   4775 C CB  B ASP A 1 421 ? 2.384   21.356  -18.459 0.52 14.53 ? 414  ASP A CB  1 
ATOM   4776 C CG  A ASP A 1 421 ? 3.100   22.696  -18.409 0.48 12.81 ? 414  ASP A CG  1 
ATOM   4777 C CG  B ASP A 1 421 ? 3.087   22.700  -18.437 0.52 12.87 ? 414  ASP A CG  1 
ATOM   4778 O OD1 A ASP A 1 421 ? 3.971   22.947  -19.271 0.48 17.06 ? 414  ASP A OD1 1 
ATOM   4779 O OD1 B ASP A 1 421 ? 4.001   22.912  -19.263 0.52 17.08 ? 414  ASP A OD1 1 
ATOM   4780 O OD2 A ASP A 1 421 ? 2.780   23.508  -17.517 0.48 14.66 ? 414  ASP A OD2 1 
ATOM   4781 O OD2 B ASP A 1 421 ? 2.716   23.558  -17.607 0.52 14.66 ? 414  ASP A OD2 1 
ATOM   4782 N N   . LEU A 1 422 ? 3.858   19.606  -16.366 1.00 12.11 ? 415  LEU A N   1 
ATOM   4783 C CA  . LEU A 1 422 ? 4.710   19.396  -15.200 1.00 12.09 ? 415  LEU A CA  1 
ATOM   4784 C C   . LEU A 1 422 ? 5.906   18.515  -15.585 1.00 11.84 ? 415  LEU A C   1 
ATOM   4785 O O   . LEU A 1 422 ? 7.045   18.855  -15.282 1.00 14.16 ? 415  LEU A O   1 
ATOM   4786 C CB  . LEU A 1 422 ? 3.895   18.764  -14.063 1.00 11.24 ? 415  LEU A CB  1 
ATOM   4787 C CG  . LEU A 1 422 ? 4.521   18.790  -12.665 1.00 15.61 ? 415  LEU A CG  1 
ATOM   4788 C CD1 . LEU A 1 422 ? 3.433   18.537  -11.656 1.00 15.03 ? 415  LEU A CD1 1 
ATOM   4789 C CD2 . LEU A 1 422 ? 5.626   17.744  -12.507 1.00 18.24 ? 415  LEU A CD2 1 
ATOM   4790 N N   . CYS A 1 423 ? 5.637   17.402  -16.264 1.00 14.16 ? 416  CYS A N   1 
ATOM   4791 C CA  . CYS A 1 423 ? 6.694   16.497  -16.696 1.00 14.06 ? 416  CYS A CA  1 
ATOM   4792 C C   . CYS A 1 423 ? 7.762   17.188  -17.545 1.00 12.87 ? 416  CYS A C   1 
ATOM   4793 O O   . CYS A 1 423 ? 8.939   16.864  -17.415 1.00 13.87 ? 416  CYS A O   1 
ATOM   4794 C CB  . CYS A 1 423 ? 6.108   15.312  -17.467 1.00 12.20 ? 416  CYS A CB  1 
ATOM   4795 S SG  . CYS A 1 423 ? 5.330   14.124  -16.362 1.00 18.12 ? 416  CYS A SG  1 
ATOM   4796 N N   . SER A 1 424 ? 7.362   18.107  -18.426 1.00 9.57  ? 417  SER A N   1 
ATOM   4797 C CA  . SER A 1 424 ? 8.343   18.861  -19.227 1.00 9.39  ? 417  SER A CA  1 
ATOM   4798 C C   . SER A 1 424 ? 9.353   19.576  -18.333 1.00 11.08 ? 417  SER A C   1 
ATOM   4799 O O   . SER A 1 424 ? 10.558  19.653  -18.638 1.00 11.68 ? 417  SER A O   1 
ATOM   4800 C CB  . SER A 1 424 ? 7.642   19.885  -20.129 1.00 15.02 ? 417  SER A CB  1 
ATOM   4801 O OG  . SER A 1 424 ? 6.653   19.285  -20.966 1.00 11.18 ? 417  SER A OG  1 
ATOM   4802 N N   . HIS A 1 425 ? 8.872   20.077  -17.200 1.00 10.85 ? 418  HIS A N   1 
ATOM   4803 C CA  . HIS A 1 425 ? 9.733   20.820  -16.289 1.00 10.53 ? 418  HIS A CA  1 
ATOM   4804 C C   . HIS A 1 425 ? 10.530  19.930  -15.347 1.00 8.64  ? 418  HIS A C   1 
ATOM   4805 O O   . HIS A 1 425 ? 11.750  20.109  -15.190 1.00 12.65 ? 418  HIS A O   1 
ATOM   4806 C CB  . HIS A 1 425 ? 8.884   21.834  -15.505 1.00 11.81 ? 418  HIS A CB  1 
ATOM   4807 C CG  . HIS A 1 425 ? 8.453   22.981  -16.359 1.00 11.33 ? 418  HIS A CG  1 
ATOM   4808 N ND1 . HIS A 1 425 ? 9.165   24.162  -16.438 1.00 11.26 ? 418  HIS A ND1 1 
ATOM   4809 C CD2 . HIS A 1 425 ? 7.458   23.075  -17.276 1.00 13.12 ? 418  HIS A CD2 1 
ATOM   4810 C CE1 . HIS A 1 425 ? 8.602   24.945  -17.341 1.00 12.92 ? 418  HIS A CE1 1 
ATOM   4811 N NE2 . HIS A 1 425 ? 7.563   24.311  -17.860 1.00 12.18 ? 418  HIS A NE2 1 
ATOM   4812 N N   A PHE A 1 426 ? 9.853   18.976  -14.717 0.67 11.67 ? 419  PHE A N   1 
ATOM   4813 N N   B PHE A 1 426 ? 9.845   18.955  -14.754 0.33 11.79 ? 419  PHE A N   1 
ATOM   4814 C CA  A PHE A 1 426 ? 10.530  18.030  -13.824 0.67 13.25 ? 419  PHE A CA  1 
ATOM   4815 C CA  B PHE A 1 426 ? 10.462  18.003  -13.828 0.33 13.22 ? 419  PHE A CA  1 
ATOM   4816 C C   A PHE A 1 426 ? 11.676  17.319  -14.530 0.67 10.32 ? 419  PHE A C   1 
ATOM   4817 C C   B PHE A 1 426 ? 11.577  17.181  -14.465 0.33 10.19 ? 419  PHE A C   1 
ATOM   4818 O O   A PHE A 1 426 ? 12.807  17.253  -14.018 0.67 11.31 ? 419  PHE A O   1 
ATOM   4819 O O   B PHE A 1 426 ? 12.583  16.878  -13.823 0.33 13.24 ? 419  PHE A O   1 
ATOM   4820 C CB  A PHE A 1 426 ? 9.531   17.005  -13.296 0.67 14.92 ? 419  PHE A CB  1 
ATOM   4821 C CB  B PHE A 1 426 ? 9.397   17.062  -13.265 0.33 15.16 ? 419  PHE A CB  1 
ATOM   4822 C CG  A PHE A 1 426 ? 10.121  16.004  -12.345 0.67 12.39 ? 419  PHE A CG  1 
ATOM   4823 C CG  B PHE A 1 426 ? 9.929   16.057  -12.283 0.33 13.02 ? 419  PHE A CG  1 
ATOM   4824 C CD1 A PHE A 1 426 ? 10.429  16.359  -11.039 0.67 15.75 ? 419  PHE A CD1 1 
ATOM   4825 C CD1 B PHE A 1 426 ? 10.524  16.471  -11.102 0.33 14.61 ? 419  PHE A CD1 1 
ATOM   4826 C CD2 A PHE A 1 426 ? 10.342  14.705  -12.751 0.67 18.00 ? 419  PHE A CD2 1 
ATOM   4827 C CD2 B PHE A 1 426 ? 9.814   14.701  -12.530 0.33 18.91 ? 419  PHE A CD2 1 
ATOM   4828 C CE1 A PHE A 1 426 ? 10.958  15.422  -10.160 0.67 14.58 ? 419  PHE A CE1 1 
ATOM   4829 C CE1 B PHE A 1 426 ? 11.007  15.545  -10.193 0.33 14.71 ? 419  PHE A CE1 1 
ATOM   4830 C CE2 A PHE A 1 426 ? 10.868  13.760  -11.879 0.67 20.14 ? 419  PHE A CE2 1 
ATOM   4831 C CE2 B PHE A 1 426 ? 10.292  13.770  -11.626 0.33 16.28 ? 419  PHE A CE2 1 
ATOM   4832 C CZ  A PHE A 1 426 ? 11.177  14.125  -10.580 0.67 14.55 ? 419  PHE A CZ  1 
ATOM   4833 C CZ  B PHE A 1 426 ? 10.888  14.194  -10.455 0.33 14.09 ? 419  PHE A CZ  1 
ATOM   4834 N N   . TYR A 1 427 ? 11.405  16.818  -15.729 1.00 9.98  ? 420  TYR A N   1 
ATOM   4835 C CA  . TYR A 1 427 ? 12.403  15.988  -16.384 1.00 11.90 ? 420  TYR A CA  1 
ATOM   4836 C C   . TYR A 1 427 ? 13.401  16.718  -17.280 1.00 9.28  ? 420  TYR A C   1 
ATOM   4837 O O   . TYR A 1 427 ? 14.474  16.162  -17.576 1.00 12.25 ? 420  TYR A O   1 
ATOM   4838 C CB  . TYR A 1 427 ? 11.717  14.902  -17.217 1.00 13.35 ? 420  TYR A CB  1 
ATOM   4839 C CG  . TYR A 1 427 ? 10.977  13.853  -16.407 1.00 14.12 ? 420  TYR A CG  1 
ATOM   4840 C CD1 . TYR A 1 427 ? 11.650  13.033  -15.501 1.00 20.02 ? 420  TYR A CD1 1 
ATOM   4841 C CD2 . TYR A 1 427 ? 9.608   13.682  -16.551 1.00 15.17 ? 420  TYR A CD2 1 
ATOM   4842 C CE1 . TYR A 1 427 ? 10.969  12.070  -14.766 1.00 19.07 ? 420  TYR A CE1 1 
ATOM   4843 C CE2 . TYR A 1 427 ? 8.924   12.728  -15.814 1.00 16.88 ? 420  TYR A CE2 1 
ATOM   4844 C CZ  . TYR A 1 427 ? 9.609   11.926  -14.936 1.00 17.43 ? 420  TYR A CZ  1 
ATOM   4845 O OH  . TYR A 1 427 ? 8.919   10.973  -14.228 1.00 24.14 ? 420  TYR A OH  1 
ATOM   4846 N N   A PHE A 1 428 ? 13.086  17.943  -17.697 0.17 9.90  ? 421  PHE A N   1 
ATOM   4847 N N   B PHE A 1 428 ? 13.091  17.944  -17.697 0.83 9.71  ? 421  PHE A N   1 
ATOM   4848 C CA  A PHE A 1 428 ? 13.927  18.614  -18.688 0.17 10.52 ? 421  PHE A CA  1 
ATOM   4849 C CA  B PHE A 1 428 ? 13.922  18.609  -18.706 0.83 10.45 ? 421  PHE A CA  1 
ATOM   4850 C C   A PHE A 1 428 ? 14.240  20.091  -18.412 0.17 9.50  ? 421  PHE A C   1 
ATOM   4851 C C   B PHE A 1 428 ? 14.238  20.090  -18.439 0.83 9.18  ? 421  PHE A C   1 
ATOM   4852 O O   A PHE A 1 428 ? 15.410  20.446  -18.278 0.17 10.72 ? 421  PHE A O   1 
ATOM   4853 O O   B PHE A 1 428 ? 15.406  20.449  -18.320 0.83 10.85 ? 421  PHE A O   1 
ATOM   4854 C CB  A PHE A 1 428 ? 13.288  18.467  -20.074 0.17 12.67 ? 421  PHE A CB  1 
ATOM   4855 C CB  B PHE A 1 428 ? 13.267  18.446  -20.090 0.83 12.57 ? 421  PHE A CB  1 
ATOM   4856 C CG  A PHE A 1 428 ? 13.112  17.037  -20.499 0.17 11.40 ? 421  PHE A CG  1 
ATOM   4857 C CG  B PHE A 1 428 ? 13.080  17.008  -20.489 0.83 11.34 ? 421  PHE A CG  1 
ATOM   4858 C CD1 A PHE A 1 428 ? 14.203  16.278  -20.893 0.17 12.75 ? 421  PHE A CD1 1 
ATOM   4859 C CD1 B PHE A 1 428 ? 14.160  16.236  -20.896 0.83 12.73 ? 421  PHE A CD1 1 
ATOM   4860 C CD2 A PHE A 1 428 ? 11.859  16.445  -20.492 0.17 15.86 ? 421  PHE A CD2 1 
ATOM   4861 C CD2 B PHE A 1 428 ? 11.821  16.420  -20.456 0.83 16.04 ? 421  PHE A CD2 1 
ATOM   4862 C CE1 A PHE A 1 428 ? 14.045  14.956  -21.273 0.17 12.92 ? 421  PHE A CE1 1 
ATOM   4863 C CE1 B PHE A 1 428 ? 13.981  14.893  -21.239 0.83 12.77 ? 421  PHE A CE1 1 
ATOM   4864 C CE2 A PHE A 1 428 ? 11.694  15.127  -20.875 0.17 12.54 ? 421  PHE A CE2 1 
ATOM   4865 C CE2 B PHE A 1 428 ? 11.636  15.096  -20.817 0.83 12.64 ? 421  PHE A CE2 1 
ATOM   4866 C CZ  A PHE A 1 428 ? 12.789  14.380  -21.265 0.17 14.27 ? 421  PHE A CZ  1 
ATOM   4867 C CZ  B PHE A 1 428 ? 12.717  14.326  -21.203 0.83 13.97 ? 421  PHE A CZ  1 
ATOM   4868 N N   . TRP A 1 429 ? 13.229  20.955  -18.330 1.00 10.87 ? 422  TRP A N   1 
ATOM   4869 C CA  . TRP A 1 429 ? 13.515  22.390  -18.232 1.00 10.40 ? 422  TRP A CA  1 
ATOM   4870 C C   . TRP A 1 429 ? 14.156  22.806  -16.912 1.00 9.89  ? 422  TRP A C   1 
ATOM   4871 O O   . TRP A 1 429 ? 15.088  23.587  -16.905 1.00 10.95 ? 422  TRP A O   1 
ATOM   4872 C CB  . TRP A 1 429 ? 12.251  23.215  -18.457 1.00 11.66 ? 422  TRP A CB  1 
ATOM   4873 C CG  . TRP A 1 429 ? 11.783  23.199  -19.868 1.00 11.39 ? 422  TRP A CG  1 
ATOM   4874 C CD1 . TRP A 1 429 ? 10.751  22.470  -20.368 1.00 13.71 ? 422  TRP A CD1 1 
ATOM   4875 C CD2 . TRP A 1 429 ? 12.319  23.961  -20.979 1.00 13.01 ? 422  TRP A CD2 1 
ATOM   4876 N NE1 . TRP A 1 429 ? 10.601  22.721  -21.722 1.00 15.96 ? 422  TRP A NE1 1 
ATOM   4877 C CE2 . TRP A 1 429 ? 11.546  23.633  -22.113 1.00 12.36 ? 422  TRP A CE2 1 
ATOM   4878 C CE3 . TRP A 1 429 ? 13.357  24.887  -21.113 1.00 15.41 ? 422  TRP A CE3 1 
ATOM   4879 C CZ2 . TRP A 1 429 ? 11.784  24.200  -23.374 1.00 11.93 ? 422  TRP A CZ2 1 
ATOM   4880 C CZ3 . TRP A 1 429 ? 13.605  25.448  -22.370 1.00 17.14 ? 422  TRP A CZ3 1 
ATOM   4881 C CH2 . TRP A 1 429 ? 12.818  25.098  -23.482 1.00 19.40 ? 422  TRP A CH2 1 
ATOM   4882 N N   . PHE A 1 430 ? 13.667  22.272  -15.807 1.00 11.69 ? 423  PHE A N   1 
ATOM   4883 C CA  . PHE A 1 430 ? 14.256  22.633  -14.531 1.00 11.46 ? 423  PHE A CA  1 
ATOM   4884 C C   . PHE A 1 430 ? 15.726  22.161  -14.435 1.00 9.34  ? 423  PHE A C   1 
ATOM   4885 O O   . PHE A 1 430 ? 16.588  22.985  -14.108 1.00 11.75 ? 423  PHE A O   1 
ATOM   4886 C CB  . PHE A 1 430 ? 13.416  22.114  -13.352 1.00 9.34  ? 423  PHE A CB  1 
ATOM   4887 C CG  . PHE A 1 430 ? 13.866  22.683  -12.036 1.00 15.90 ? 423  PHE A CG  1 
ATOM   4888 C CD1 . PHE A 1 430 ? 14.091  24.056  -11.934 1.00 11.93 ? 423  PHE A CD1 1 
ATOM   4889 C CD2 . PHE A 1 430 ? 14.113  21.871  -10.932 1.00 11.73 ? 423  PHE A CD2 1 
ATOM   4890 C CE1 . PHE A 1 430 ? 14.530  24.650  -10.742 1.00 10.68 ? 423  PHE A CE1 1 
ATOM   4891 C CE2 . PHE A 1 430 ? 14.558  22.458  -9.728  1.00 13.59 ? 423  PHE A CE2 1 
ATOM   4892 C CZ  . PHE A 1 430 ? 14.763  23.848  -9.645  1.00 17.98 ? 423  PHE A CZ  1 
ATOM   4893 N N   A PRO A 1 431 ? 16.017  20.863  -14.701 0.50 13.14 ? 424  PRO A N   1 
ATOM   4894 N N   B PRO A 1 431 ? 16.010  20.861  -14.722 0.50 13.13 ? 424  PRO A N   1 
ATOM   4895 C CA  A PRO A 1 431 ? 17.441  20.491  -14.636 0.50 10.55 ? 424  PRO A CA  1 
ATOM   4896 C CA  B PRO A 1 431 ? 17.418  20.431  -14.706 0.50 10.50 ? 424  PRO A CA  1 
ATOM   4897 C C   A PRO A 1 431 ? 18.334  21.253  -15.621 0.50 10.85 ? 424  PRO A C   1 
ATOM   4898 C C   B PRO A 1 431 ? 18.311  21.279  -15.601 0.50 10.83 ? 424  PRO A C   1 
ATOM   4899 O O   A PRO A 1 431 ? 19.507  21.438  -15.317 0.50 13.45 ? 424  PRO A O   1 
ATOM   4900 O O   B PRO A 1 431 ? 19.447  21.549  -15.229 0.50 12.96 ? 424  PRO A O   1 
ATOM   4901 C CB  A PRO A 1 431 ? 17.437  18.987  -14.952 0.50 17.09 ? 424  PRO A CB  1 
ATOM   4902 C CB  B PRO A 1 431 ? 17.359  18.994  -15.229 0.50 19.02 ? 424  PRO A CB  1 
ATOM   4903 C CG  A PRO A 1 431 ? 16.064  18.682  -15.494 0.50 9.70  ? 424  PRO A CG  1 
ATOM   4904 C CG  B PRO A 1 431 ? 16.001  18.523  -14.910 0.50 11.95 ? 424  PRO A CG  1 
ATOM   4905 C CD  A PRO A 1 431 ? 15.156  19.675  -14.848 0.50 11.37 ? 424  PRO A CD  1 
ATOM   4906 C CD  B PRO A 1 431 ? 15.103  19.723  -14.977 0.50 11.65 ? 424  PRO A CD  1 
ATOM   4907 N N   . MET A 1 432 ? 17.803  21.703  -16.755 1.00 11.24 ? 425  MET A N   1 
ATOM   4908 C CA  . MET A 1 432 ? 18.583  22.568  -17.640 1.00 11.56 ? 425  MET A CA  1 
ATOM   4909 C C   . MET A 1 432 ? 18.920  23.902  -16.955 1.00 15.82 ? 425  MET A C   1 
ATOM   4910 O O   . MET A 1 432 ? 20.056  24.368  -17.015 1.00 12.23 ? 425  MET A O   1 
ATOM   4911 C CB  A MET A 1 432 ? 17.857  22.830  -18.954 0.47 13.33 ? 425  MET A CB  1 
ATOM   4912 C CB  B MET A 1 432 ? 17.813  22.832  -18.944 0.53 13.28 ? 425  MET A CB  1 
ATOM   4913 C CG  A MET A 1 432 ? 18.549  23.911  -19.757 0.47 14.98 ? 425  MET A CG  1 
ATOM   4914 C CG  B MET A 1 432 ? 18.547  23.726  -19.939 0.53 14.46 ? 425  MET A CG  1 
ATOM   4915 S SD  A MET A 1 432 ? 17.845  24.159  -21.381 0.47 18.51 ? 425  MET A SD  1 
ATOM   4916 S SD  B MET A 1 432 ? 17.481  24.492  -21.197 0.53 21.17 ? 425  MET A SD  1 
ATOM   4917 C CE  A MET A 1 432 ? 18.208  22.596  -22.132 0.47 25.23 ? 425  MET A CE  1 
ATOM   4918 C CE  B MET A 1 432 ? 16.883  25.952  -20.359 0.53 22.26 ? 425  MET A CE  1 
ATOM   4919 N N   . HIS A 1 433 ? 17.938  24.503  -16.291 1.00 13.99 ? 426  HIS A N   1 
ATOM   4920 C CA  . HIS A 1 433 ? 18.146  25.765  -15.603 1.00 13.06 ? 426  HIS A CA  1 
ATOM   4921 C C   . HIS A 1 433 ? 19.194  25.626  -14.504 1.00 13.32 ? 426  HIS A C   1 
ATOM   4922 O O   . HIS A 1 433 ? 20.107  26.454  -14.378 1.00 12.56 ? 426  HIS A O   1 
ATOM   4923 C CB  . HIS A 1 433 ? 16.818  26.253  -15.022 1.00 10.65 ? 426  HIS A CB  1 
ATOM   4924 C CG  . HIS A 1 433 ? 16.921  27.493  -14.190 1.00 11.87 ? 426  HIS A CG  1 
ATOM   4925 N ND1 . HIS A 1 433 ? 17.492  28.660  -14.646 1.00 16.13 ? 426  HIS A ND1 1 
ATOM   4926 C CD2 . HIS A 1 433 ? 16.474  27.756  -12.937 1.00 11.16 ? 426  HIS A CD2 1 
ATOM   4927 C CE1 . HIS A 1 433 ? 17.404  29.585  -13.703 1.00 15.00 ? 426  HIS A CE1 1 
ATOM   4928 N NE2 . HIS A 1 433 ? 16.786  29.061  -12.660 1.00 15.92 ? 426  HIS A NE2 1 
ATOM   4929 N N   . ARG A 1 434 ? 19.069  24.557  -13.725 1.00 12.30 ? 427  ARG A N   1 
ATOM   4930 C CA  . ARG A 1 434 ? 20.034  24.256  -12.676 1.00 14.27 ? 427  ARG A CA  1 
ATOM   4931 C C   . ARG A 1 434 ? 21.428  24.136  -13.242 1.00 16.42 ? 427  ARG A C   1 
ATOM   4932 O O   . ARG A 1 434 ? 22.388  24.667  -12.692 1.00 14.71 ? 427  ARG A O   1 
ATOM   4933 C CB  A ARG A 1 434 ? 19.671  22.961  -11.964 1.00 10.94 ? 427  ARG A CB  1 
ATOM   4934 C CG  A ARG A 1 434 ? 18.388  23.018  -11.216 1.00 14.07 ? 427  ARG A CG  1 
ATOM   4935 C CD  A ARG A 1 434 ? 18.085  21.692  -10.556 1.00 14.83 ? 427  ARG A CD  1 
ATOM   4936 N NE  A ARG A 1 434 ? 18.822  21.512  -9.311  1.00 14.36 ? 427  ARG A NE  1 
ATOM   4937 C CZ  A ARG A 1 434 ? 18.520  20.568  -8.429  1.00 15.99 ? 427  ARG A CZ  1 
ATOM   4938 N NH1 A ARG A 1 434 ? 17.521  19.751  -8.675  1.00 19.77 ? 427  ARG A NH1 1 
ATOM   4939 N NH2 A ARG A 1 434 ? 19.218  20.439  -7.298  1.00 16.19 ? 427  ARG A NH2 1 
ATOM   4940 N N   . LEU A 1 435 ? 21.543  23.418  -14.343 1.00 11.70 ? 428  LEU A N   1 
ATOM   4941 C CA  . LEU A 1 435 ? 22.847  23.241  -14.954 1.00 10.95 ? 428  LEU A CA  1 
ATOM   4942 C C   . LEU A 1 435 ? 23.412  24.569  -15.456 1.00 11.89 ? 428  LEU A C   1 
ATOM   4943 O O   . LEU A 1 435 ? 24.592  24.875  -15.216 1.00 13.34 ? 428  LEU A O   1 
ATOM   4944 C CB  . LEU A 1 435 ? 22.772  22.241  -16.109 1.00 12.70 ? 428  LEU A CB  1 
ATOM   4945 C CG  . LEU A 1 435 ? 24.036  22.203  -16.948 1.00 11.96 ? 428  LEU A CG  1 
ATOM   4946 C CD1 . LEU A 1 435 ? 25.237  21.820  -16.099 1.00 12.97 ? 428  LEU A CD1 1 
ATOM   4947 C CD2 . LEU A 1 435 ? 23.875  21.208  -18.068 1.00 15.68 ? 428  LEU A CD2 1 
ATOM   4948 N N   A LEU A 1 436 ? 22.570  25.345  -16.137 0.11 12.86 ? 429  LEU A N   1 
ATOM   4949 N N   B LEU A 1 436 ? 22.601  25.348  -16.173 0.89 12.68 ? 429  LEU A N   1 
ATOM   4950 C CA  A LEU A 1 436 ? 22.958  26.646  -16.680 0.11 13.38 ? 429  LEU A CA  1 
ATOM   4951 C CA  B LEU A 1 436 ? 23.085  26.631  -16.694 0.89 13.22 ? 429  LEU A CA  1 
ATOM   4952 C C   A LEU A 1 436 ? 23.545  27.553  -15.615 0.11 14.28 ? 429  LEU A C   1 
ATOM   4953 C C   B LEU A 1 436 ? 23.615  27.518  -15.570 0.89 14.18 ? 429  LEU A C   1 
ATOM   4954 O O   A LEU A 1 436 ? 24.574  28.195  -15.825 0.11 14.80 ? 429  LEU A O   1 
ATOM   4955 O O   B LEU A 1 436 ? 24.695  28.092  -15.685 0.89 14.59 ? 429  LEU A O   1 
ATOM   4956 C CB  A LEU A 1 436 ? 21.754  27.339  -17.326 0.11 13.41 ? 429  LEU A CB  1 
ATOM   4957 C CB  B LEU A 1 436 ? 21.983  27.354  -17.465 0.89 13.00 ? 429  LEU A CB  1 
ATOM   4958 C CG  A LEU A 1 436 ? 21.663  27.225  -18.844 0.11 14.32 ? 429  LEU A CG  1 
ATOM   4959 C CG  B LEU A 1 436 ? 21.651  26.676  -18.782 0.89 12.29 ? 429  LEU A CG  1 
ATOM   4960 C CD1 A LEU A 1 436 ? 21.923  25.807  -19.238 0.11 12.88 ? 429  LEU A CD1 1 
ATOM   4961 C CD1 B LEU A 1 436 ? 20.296  27.174  -19.287 0.89 12.91 ? 429  LEU A CD1 1 
ATOM   4962 C CD2 A LEU A 1 436 ? 20.302  27.663  -19.354 0.11 14.22 ? 429  LEU A CD2 1 
ATOM   4963 C CD2 B LEU A 1 436 ? 22.743  26.958  -19.818 0.89 13.58 ? 429  LEU A CD2 1 
ATOM   4964 N N   . GLN A 1 437 ? 22.886  27.594  -14.466 1.00 12.18 ? 430  GLN A N   1 
ATOM   4965 C CA  . GLN A 1 437 ? 23.286  28.518  -13.415 1.00 16.82 ? 430  GLN A CA  1 
ATOM   4966 C C   . GLN A 1 437 ? 24.572  28.042  -12.716 1.00 17.65 ? 430  GLN A C   1 
ATOM   4967 O O   . GLN A 1 437 ? 25.455  28.840  -12.412 1.00 13.74 ? 430  GLN A O   1 
ATOM   4968 C CB  A GLN A 1 437 ? 22.158  28.692  -12.395 0.13 12.48 ? 430  GLN A CB  1 
ATOM   4969 C CB  B GLN A 1 437 ? 22.128  28.715  -12.449 0.87 12.17 ? 430  GLN A CB  1 
ATOM   4970 C CG  A GLN A 1 437 ? 20.937  29.446  -12.924 0.13 15.76 ? 430  GLN A CG  1 
ATOM   4971 C CG  B GLN A 1 437 ? 20.951  29.471  -13.102 0.87 15.37 ? 430  GLN A CG  1 
ATOM   4972 C CD  A GLN A 1 437 ? 21.131  30.954  -12.950 0.13 18.85 ? 430  GLN A CD  1 
ATOM   4973 C CD  B GLN A 1 437 ? 21.389  30.788  -13.729 0.87 15.92 ? 430  GLN A CD  1 
ATOM   4974 O OE1 A GLN A 1 437 ? 22.258  31.453  -12.961 0.13 17.91 ? 430  GLN A OE1 1 
ATOM   4975 O OE1 B GLN A 1 437 ? 22.103  31.583  -13.102 0.87 18.16 ? 430  GLN A OE1 1 
ATOM   4976 N NE2 A GLN A 1 437 ? 20.025  31.689  -12.957 0.13 19.82 ? 430  GLN A NE2 1 
ATOM   4977 N NE2 B GLN A 1 437 ? 21.004  31.009  -14.982 0.87 16.18 ? 430  GLN A NE2 1 
ATOM   4978 N N   A LEU A 1 438 ? 24.694  26.739  -12.520 0.68 15.76 ? 431  LEU A N   1 
ATOM   4979 N N   B LEU A 1 438 ? 24.681  26.739  -12.482 0.32 15.92 ? 431  LEU A N   1 
ATOM   4980 C CA  A LEU A 1 438 ? 25.879  26.173  -11.886 0.68 19.04 ? 431  LEU A CA  1 
ATOM   4981 C CA  B LEU A 1 438 ? 25.896  26.165  -11.902 0.32 18.82 ? 431  LEU A CA  1 
ATOM   4982 C C   A LEU A 1 438 ? 27.117  26.296  -12.779 0.68 14.47 ? 431  LEU A C   1 
ATOM   4983 C C   B LEU A 1 438 ? 27.103  26.390  -12.797 0.32 14.62 ? 431  LEU A C   1 
ATOM   4984 O O   A LEU A 1 438 ? 28.222  26.557  -12.302 0.68 17.79 ? 431  LEU A O   1 
ATOM   4985 O O   B LEU A 1 438 ? 28.170  26.794  -12.338 0.32 16.16 ? 431  LEU A O   1 
ATOM   4986 C CB  A LEU A 1 438 ? 25.617  24.713  -11.537 0.68 17.87 ? 431  LEU A CB  1 
ATOM   4987 C CB  B LEU A 1 438 ? 25.721  24.668  -11.661 0.32 17.56 ? 431  LEU A CB  1 
ATOM   4988 C CG  A LEU A 1 438 ? 26.642  24.035  -10.645 0.68 13.34 ? 431  LEU A CG  1 
ATOM   4989 C CG  B LEU A 1 438 ? 25.004  24.257  -10.382 0.32 14.99 ? 431  LEU A CG  1 
ATOM   4990 C CD1 A LEU A 1 438 ? 26.849  24.858  -9.387  0.68 16.99 ? 431  LEU A CD1 1 
ATOM   4991 C CD1 B LEU A 1 438 ? 24.619  22.792  -10.447 0.32 19.61 ? 431  LEU A CD1 1 
ATOM   4992 C CD2 A LEU A 1 438 ? 26.147  22.651  -10.306 0.68 14.05 ? 431  LEU A CD2 1 
ATOM   4993 C CD2 B LEU A 1 438 ? 25.881  24.538  -9.169  0.32 20.55 ? 431  LEU A CD2 1 
ATOM   4994 N N   . ARG A 1 439 ? 26.918  26.122  -14.084 1.00 10.92 ? 432  ARG A N   1 
ATOM   4995 C CA  . ARG A 1 439 ? 27.998  26.204  -15.046 1.00 16.40 ? 432  ARG A CA  1 
ATOM   4996 C C   . ARG A 1 439 ? 28.553  27.624  -15.158 1.00 15.57 ? 432  ARG A C   1 
ATOM   4997 O O   . ARG A 1 439 ? 29.755  27.814  -15.302 1.00 18.77 ? 432  ARG A O   1 
ATOM   4998 C CB  . ARG A 1 439 ? 27.486  25.703  -16.397 1.00 12.61 ? 432  ARG A CB  1 
ATOM   4999 C CG  . ARG A 1 439 ? 28.517  25.730  -17.503 1.00 18.92 ? 432  ARG A CG  1 
ATOM   5000 C CD  . ARG A 1 439 ? 27.834  25.667  -18.850 1.00 14.68 ? 432  ARG A CD  1 
ATOM   5001 N NE  . ARG A 1 439 ? 28.773  25.975  -19.928 1.00 16.28 ? 432  ARG A NE  1 
ATOM   5002 C CZ  . ARG A 1 439 ? 29.111  27.203  -20.305 1.00 25.99 ? 432  ARG A CZ  1 
ATOM   5003 N NH1 . ARG A 1 439 ? 28.562  28.265  -19.725 1.00 20.91 ? 432  ARG A NH1 1 
ATOM   5004 N NH2 . ARG A 1 439 ? 29.974  27.372  -21.292 1.00 26.54 ? 432  ARG A NH2 1 
ATOM   5005 N N   A PHE A 1 440 ? 27.678  28.621  -15.064 0.01 16.61 ? 433  PHE A N   1 
ATOM   5006 N N   B PHE A 1 440 ? 27.676  28.622  -15.082 0.99 16.59 ? 433  PHE A N   1 
ATOM   5007 C CA  A PHE A 1 440 ? 28.107  30.018  -15.120 0.01 16.94 ? 433  PHE A CA  1 
ATOM   5008 C CA  B PHE A 1 440 ? 28.125  30.014  -15.177 0.99 16.62 ? 433  PHE A CA  1 
ATOM   5009 C C   A PHE A 1 440 ? 29.074  30.369  -13.991 0.01 17.07 ? 433  PHE A C   1 
ATOM   5010 C C   B PHE A 1 440 ? 29.157  30.358  -14.096 0.99 16.40 ? 433  PHE A C   1 
ATOM   5011 O O   A PHE A 1 440 ? 29.861  31.309  -14.106 0.01 19.74 ? 433  PHE A O   1 
ATOM   5012 O O   B PHE A 1 440 ? 30.040  31.179  -14.315 0.99 19.29 ? 433  PHE A O   1 
ATOM   5013 C CB  A PHE A 1 440 ? 26.897  30.953  -15.074 0.01 15.26 ? 433  PHE A CB  1 
ATOM   5014 C CB  B PHE A 1 440 ? 26.937  30.979  -15.068 0.99 14.83 ? 433  PHE A CB  1 
ATOM   5015 C CG  A PHE A 1 440 ? 26.253  31.180  -16.411 0.01 17.24 ? 433  PHE A CG  1 
ATOM   5016 C CG  B PHE A 1 440 ? 26.218  31.212  -16.358 0.99 17.39 ? 433  PHE A CG  1 
ATOM   5017 C CD1 A PHE A 1 440 ? 27.022  31.262  -17.560 0.01 18.55 ? 433  PHE A CD1 1 
ATOM   5018 C CD1 B PHE A 1 440 ? 26.918  31.461  -17.521 0.99 18.05 ? 433  PHE A CD1 1 
ATOM   5019 C CD2 A PHE A 1 440 ? 24.879  31.313  -16.519 0.01 17.93 ? 433  PHE A CD2 1 
ATOM   5020 C CD2 B PHE A 1 440 ? 24.831  31.233  -16.399 0.99 18.42 ? 433  PHE A CD2 1 
ATOM   5021 C CE1 A PHE A 1 440 ? 26.432  31.473  -18.793 0.01 19.31 ? 433  PHE A CE1 1 
ATOM   5022 C CE1 B PHE A 1 440 ? 26.244  31.703  -18.713 0.99 19.47 ? 433  PHE A CE1 1 
ATOM   5023 C CE2 A PHE A 1 440 ? 24.283  31.523  -17.748 0.01 16.17 ? 433  PHE A CE2 1 
ATOM   5024 C CE2 B PHE A 1 440 ? 24.161  31.467  -17.580 0.99 15.29 ? 433  PHE A CE2 1 
ATOM   5025 C CZ  A PHE A 1 440 ? 25.061  31.603  -18.886 0.01 18.95 ? 433  PHE A CZ  1 
ATOM   5026 C CZ  B PHE A 1 440 ? 24.877  31.702  -18.747 0.99 20.03 ? 433  PHE A CZ  1 
ATOM   5027 N N   A ASN A 1 441 ? 29.013  29.607  -12.904 0.01 19.46 ? 434  ASN A N   1 
ATOM   5028 N N   B ASN A 1 441 ? 29.036  29.706  -12.949 0.99 19.65 ? 434  ASN A N   1 
ATOM   5029 C CA  A ASN A 1 441 ? 29.883  29.830  -11.756 0.01 21.04 ? 434  ASN A CA  1 
ATOM   5030 C CA  B ASN A 1 441 ? 29.939  29.927  -11.825 0.99 20.80 ? 434  ASN A CA  1 
ATOM   5031 C C   A ASN A 1 441 ? 31.263  29.200  -11.928 0.01 21.60 ? 434  ASN A C   1 
ATOM   5032 C C   B ASN A 1 441 ? 31.267  29.210  -11.938 0.99 21.63 ? 434  ASN A C   1 
ATOM   5033 O O   A ASN A 1 441 ? 32.186  29.502  -11.171 0.01 26.61 ? 434  ASN A O   1 
ATOM   5034 O O   B ASN A 1 441 ? 32.156  29.431  -11.106 0.99 27.07 ? 434  ASN A O   1 
ATOM   5035 C CB  A ASN A 1 441 ? 29.229  29.283  -10.484 0.01 23.88 ? 434  ASN A CB  1 
ATOM   5036 C CB  B ASN A 1 441 ? 29.275  29.495  -10.522 0.99 24.14 ? 434  ASN A CB  1 
ATOM   5037 C CG  A ASN A 1 441 ? 27.918  29.970  -10.155 0.01 27.37 ? 434  ASN A CG  1 
ATOM   5038 C CG  B ASN A 1 441 ? 28.172  30.434  -10.096 0.99 29.59 ? 434  ASN A CG  1 
ATOM   5039 O OD1 A ASN A 1 441 ? 27.798  31.189  -10.266 0.01 29.41 ? 434  ASN A OD1 1 
ATOM   5040 O OD1 B ASN A 1 441 ? 28.077  31.562  -10.584 0.99 34.21 ? 434  ASN A OD1 1 
ATOM   5041 N ND2 A ASN A 1 441 ? 26.925  29.186  -9.750  0.01 26.32 ? 434  ASN A ND2 1 
ATOM   5042 N ND2 B ASN A 1 441 ? 27.335  29.978  -9.171  0.99 38.18 ? 434  ASN A ND2 1 
ATOM   5043 N N   . HIS A 1 442 ? 31.402  28.325  -12.921 1.00 20.79 ? 435  HIS A N   1 
ATOM   5044 C CA  . HIS A 1 442 ? 32.616  27.521  -13.068 1.00 17.28 ? 435  HIS A CA  1 
ATOM   5045 C C   . HIS A 1 442 ? 33.072  27.321  -14.513 1.00 24.74 ? 435  HIS A C   1 
ATOM   5046 O O   . HIS A 1 442 ? 33.334  26.195  -14.944 1.00 25.57 ? 435  HIS A O   1 
ATOM   5047 C CB  . HIS A 1 442 ? 32.400  26.161  -12.400 1.00 23.35 ? 435  HIS A CB  1 
ATOM   5048 C CG  . HIS A 1 442 ? 31.991  26.265  -10.966 1.00 26.49 ? 435  HIS A CG  1 
ATOM   5049 N ND1 . HIS A 1 442 ? 30.688  26.097  -10.544 1.00 27.40 ? 435  HIS A ND1 1 
ATOM   5050 C CD2 . HIS A 1 442 ? 32.710  26.568  -9.860  1.00 18.33 ? 435  HIS A CD2 1 
ATOM   5051 C CE1 . HIS A 1 442 ? 30.628  26.271  -9.235  1.00 34.58 ? 435  HIS A CE1 1 
ATOM   5052 N NE2 . HIS A 1 442 ? 31.841  26.559  -8.797  1.00 22.27 ? 435  HIS A NE2 1 
ATOM   5053 N N   . THR A 1 443 ? 33.204  28.417  -15.253 1.00 23.80 ? 436  THR A N   1 
ATOM   5054 C CA  . THR A 1 443 ? 33.545  28.334  -16.672 1.00 27.17 ? 436  THR A CA  1 
ATOM   5055 C C   . THR A 1 443 ? 34.532  29.408  -17.115 1.00 37.26 ? 436  THR A C   1 
ATOM   5056 O O   . THR A 1 443 ? 34.653  30.450  -16.478 1.00 27.50 ? 436  THR A O   1 
ATOM   5057 C CB  A THR A 1 443 ? 32.287  28.436  -17.547 0.38 24.91 ? 436  THR A CB  1 
ATOM   5058 C CB  B THR A 1 443 ? 32.298  28.452  -17.544 0.62 24.82 ? 436  THR A CB  1 
ATOM   5059 O OG1 A THR A 1 443 ? 32.623  28.141  -18.908 0.38 29.67 ? 436  THR A OG1 1 
ATOM   5060 O OG1 B THR A 1 443 ? 32.687  28.485  -18.923 0.62 26.80 ? 436  THR A OG1 1 
ATOM   5061 C CG2 A THR A 1 443 ? 31.688  29.835  -17.463 0.38 29.86 ? 436  THR A CG2 1 
ATOM   5062 C CG2 B THR A 1 443 ? 31.547  29.735  -17.210 0.62 30.22 ? 436  THR A CG2 1 
ATOM   5063 N N   A SER A 1 444 ? 35.225  29.151  -18.220 0.60 37.18 ? 437  SER A N   1 
ATOM   5064 N N   B SER A 1 444 ? 35.229  29.149  -18.216 0.40 36.96 ? 437  SER A N   1 
ATOM   5065 C CA  A SER A 1 444 ? 36.179  30.112  -18.770 0.60 31.45 ? 437  SER A CA  1 
ATOM   5066 C CA  B SER A 1 444 ? 36.176  30.114  -18.766 0.40 31.52 ? 437  SER A CA  1 
ATOM   5067 C C   A SER A 1 444 ? 35.476  31.261  -19.487 0.60 37.27 ? 437  SER A C   1 
ATOM   5068 C C   B SER A 1 444 ? 35.459  31.282  -19.438 0.40 37.26 ? 437  SER A C   1 
ATOM   5069 O O   A SER A 1 444 ? 36.081  32.295  -19.759 0.60 40.15 ? 437  SER A O   1 
ATOM   5070 O O   B SER A 1 444 ? 36.038  32.349  -19.626 0.40 40.04 ? 437  SER A O   1 
ATOM   5071 C CB  A SER A 1 444 ? 37.144  29.418  -19.733 0.60 35.22 ? 437  SER A CB  1 
ATOM   5072 C CB  B SER A 1 444 ? 37.113  29.437  -19.767 0.40 35.12 ? 437  SER A CB  1 
ATOM   5073 O OG  A SER A 1 444 ? 36.506  29.108  -20.960 0.60 26.52 ? 437  SER A OG  1 
ATOM   5074 O OG  B SER A 1 444 ? 38.024  30.372  -20.322 0.40 36.90 ? 437  SER A OG  1 
ATOM   5075 N N   . GLY A 1 445 ? 34.197  31.072  -19.800 1.00 35.74 ? 438  GLY A N   1 
ATOM   5076 C CA  . GLY A 1 445 ? 33.418  32.100  -20.464 1.00 37.96 ? 438  GLY A CA  1 
ATOM   5077 C C   . GLY A 1 445 ? 32.996  31.711  -21.867 1.00 29.36 ? 438  GLY A C   1 
ATOM   5078 O O   . GLY A 1 445 ? 32.388  32.516  -22.590 1.00 27.99 ? 438  GLY A O   1 
ATOM   5079 N N   . THR A 1 446 ? 33.337  30.486  -22.269 1.00 25.14 ? 439  THR A N   1 
ATOM   5080 C CA  . THR A 1 446 ? 32.907  29.977  -23.563 1.00 23.49 ? 439  THR A CA  1 
ATOM   5081 C C   . THR A 1 446 ? 31.377  29.954  -23.616 1.00 20.18 ? 439  THR A C   1 
ATOM   5082 O O   . THR A 1 446 ? 30.712  29.642  -22.620 1.00 23.06 ? 439  THR A O   1 
ATOM   5083 C CB  . THR A 1 446 ? 33.488  28.572  -23.860 1.00 20.29 ? 439  THR A CB  1 
ATOM   5084 O OG1 . THR A 1 446 ? 33.168  27.684  -22.785 1.00 21.13 ? 439  THR A OG1 1 
ATOM   5085 C CG2 . THR A 1 446 ? 35.008  28.658  -24.022 1.00 31.12 ? 439  THR A CG2 1 
ATOM   5086 N N   A PRO A 1 447 ? 30.817  30.257  -24.794 0.72 19.37 ? 440  PRO A N   1 
ATOM   5087 N N   B PRO A 1 447 ? 30.815  30.314  -24.779 0.28 19.45 ? 440  PRO A N   1 
ATOM   5088 C CA  A PRO A 1 447 ? 29.377  30.457  -24.943 0.72 16.79 ? 440  PRO A CA  1 
ATOM   5089 C CA  B PRO A 1 447 ? 29.379  30.561  -24.932 0.28 16.88 ? 440  PRO A CA  1 
ATOM   5090 C C   A PRO A 1 447 ? 28.536  29.191  -24.826 0.72 18.44 ? 440  PRO A C   1 
ATOM   5091 C C   B PRO A 1 447 ? 28.500  29.313  -24.905 0.28 18.75 ? 440  PRO A C   1 
ATOM   5092 O O   A PRO A 1 447 ? 28.979  28.088  -25.178 0.72 15.79 ? 440  PRO A O   1 
ATOM   5093 O O   B PRO A 1 447 ? 28.896  28.253  -25.397 0.28 17.28 ? 440  PRO A O   1 
ATOM   5094 C CB  A PRO A 1 447 ? 29.261  31.024  -26.358 0.72 19.65 ? 440  PRO A CB  1 
ATOM   5095 C CB  B PRO A 1 447 ? 29.295  31.230  -26.307 0.28 19.84 ? 440  PRO A CB  1 
ATOM   5096 C CG  A PRO A 1 447 ? 30.375  30.397  -27.079 0.72 16.83 ? 440  PRO A CG  1 
ATOM   5097 C CG  B PRO A 1 447 ? 30.448  30.683  -27.049 0.28 17.71 ? 440  PRO A CG  1 
ATOM   5098 C CD  A PRO A 1 447 ? 31.510  30.369  -26.091 0.72 19.67 ? 440  PRO A CD  1 
ATOM   5099 C CD  B PRO A 1 447 ? 31.546  30.560  -26.035 0.28 19.67 ? 440  PRO A CD  1 
ATOM   5100 N N   A VAL A 1 448 ? 27.315  29.382  -24.336 0.72 16.61 ? 441  VAL A N   1 
ATOM   5101 N N   B VAL A 1 448 ? 27.313  29.462  -24.322 0.28 16.84 ? 441  VAL A N   1 
ATOM   5102 C CA  A VAL A 1 448 ? 26.261  28.379  -24.434 0.72 16.67 ? 441  VAL A CA  1 
ATOM   5103 C CA  B VAL A 1 448 ? 26.240  28.483  -24.465 0.28 16.79 ? 441  VAL A CA  1 
ATOM   5104 C C   A VAL A 1 448 ? 25.065  28.993  -25.160 0.72 17.43 ? 441  VAL A C   1 
ATOM   5105 C C   B VAL A 1 448 ? 25.114  29.081  -25.261 0.28 17.23 ? 441  VAL A C   1 
ATOM   5106 O O   A VAL A 1 448 ? 24.597  30.074  -24.791 0.72 17.90 ? 441  VAL A O   1 
ATOM   5107 O O   B VAL A 1 448 ? 24.704  30.208  -25.003 0.28 19.09 ? 441  VAL A O   1 
ATOM   5108 C CB  A VAL A 1 448 ? 25.815  27.843  -23.050 0.72 19.78 ? 441  VAL A CB  1 
ATOM   5109 C CB  B VAL A 1 448 ? 25.641  28.040  -23.135 0.28 18.76 ? 441  VAL A CB  1 
ATOM   5110 C CG1 A VAL A 1 448 ? 25.526  28.985  -22.067 0.72 15.41 ? 441  VAL A CG1 1 
ATOM   5111 C CG1 B VAL A 1 448 ? 24.971  26.676  -23.282 0.28 17.53 ? 441  VAL A CG1 1 
ATOM   5112 C CG2 A VAL A 1 448 ? 24.604  26.922  -23.196 0.72 18.25 ? 441  VAL A CG2 1 
ATOM   5113 C CG2 B VAL A 1 448 ? 26.688  27.994  -22.114 0.28 18.12 ? 441  VAL A CG2 1 
ATOM   5114 N N   . TYR A 1 449 ? 24.589  28.312  -26.199 1.00 14.39 ? 442  TYR A N   1 
ATOM   5115 C CA  . TYR A 1 449 ? 23.436  28.757  -26.965 1.00 13.45 ? 442  TYR A CA  1 
ATOM   5116 C C   . TYR A 1 449 ? 22.239  27.860  -26.701 1.00 12.04 ? 442  TYR A C   1 
ATOM   5117 O O   . TYR A 1 449 ? 22.402  26.653  -26.521 1.00 17.61 ? 442  TYR A O   1 
ATOM   5118 C CB  . TYR A 1 449 ? 23.741  28.748  -28.459 1.00 20.71 ? 442  TYR A CB  1 
ATOM   5119 C CG  . TYR A 1 449 ? 24.870  29.660  -28.894 1.00 22.74 ? 442  TYR A CG  1 
ATOM   5120 C CD1 . TYR A 1 449 ? 24.610  30.944  -29.386 1.00 16.10 ? 442  TYR A CD1 1 
ATOM   5121 C CD2 . TYR A 1 449 ? 26.190  29.233  -28.848 1.00 16.29 ? 442  TYR A CD2 1 
ATOM   5122 C CE1 . TYR A 1 449 ? 25.643  31.772  -29.804 1.00 19.98 ? 442  TYR A CE1 1 
ATOM   5123 C CE2 . TYR A 1 449 ? 27.230  30.059  -29.263 1.00 17.83 ? 442  TYR A CE2 1 
ATOM   5124 C CZ  . TYR A 1 449 ? 26.951  31.322  -29.736 1.00 22.91 ? 442  TYR A CZ  1 
ATOM   5125 O OH  . TYR A 1 449 ? 27.988  32.128  -30.148 1.00 21.78 ? 442  TYR A OH  1 
ATOM   5126 N N   . LEU A 1 450 ? 21.036  28.444  -26.693 1.00 14.47 ? 443  LEU A N   1 
ATOM   5127 C CA  . LEU A 1 450 ? 19.808  27.701  -26.426 1.00 16.72 ? 443  LEU A CA  1 
ATOM   5128 C C   . LEU A 1 450 ? 18.904  27.624  -27.646 1.00 13.49 ? 443  LEU A C   1 
ATOM   5129 O O   . LEU A 1 450 ? 18.694  28.642  -28.314 1.00 12.38 ? 443  LEU A O   1 
ATOM   5130 C CB  A LEU A 1 450 ? 19.020  28.339  -25.283 0.69 14.83 ? 443  LEU A CB  1 
ATOM   5131 C CB  B LEU A 1 450 ? 19.038  28.347  -25.270 0.31 14.78 ? 443  LEU A CB  1 
ATOM   5132 C CG  A LEU A 1 450 ? 19.601  28.252  -23.876 0.69 12.72 ? 443  LEU A CG  1 
ATOM   5133 C CG  B LEU A 1 450 ? 19.303  27.885  -23.835 0.31 17.70 ? 443  LEU A CG  1 
ATOM   5134 C CD1 A LEU A 1 450 ? 18.607  28.854  -22.883 0.69 16.77 ? 443  LEU A CD1 1 
ATOM   5135 C CD1 B LEU A 1 450 ? 20.783  27.915  -23.491 0.31 22.55 ? 443  LEU A CD1 1 
ATOM   5136 C CD2 A LEU A 1 450 ? 19.956  26.813  -23.504 0.69 18.36 ? 443  LEU A CD2 1 
ATOM   5137 C CD2 B LEU A 1 450 ? 18.509  28.751  -22.864 0.31 16.62 ? 443  LEU A CD2 1 
ATOM   5138 N N   . TYR A 1 451 ? 18.381  26.430  -27.937 1.00 13.07 ? 444  TYR A N   1 
ATOM   5139 C CA  . TYR A 1 451 ? 17.310  26.317  -28.938 1.00 11.49 ? 444  TYR A CA  1 
ATOM   5140 C C   . TYR A 1 451 ? 16.040  25.742  -28.320 1.00 10.59 ? 444  TYR A C   1 
ATOM   5141 O O   . TYR A 1 451 ? 16.079  25.101  -27.262 1.00 12.60 ? 444  TYR A O   1 
ATOM   5142 C CB  . TYR A 1 451 ? 17.743  25.447  -30.133 1.00 11.73 ? 444  TYR A CB  1 
ATOM   5143 C CG  . TYR A 1 451 ? 17.876  23.984  -29.789 1.00 12.61 ? 444  TYR A CG  1 
ATOM   5144 C CD1 . TYR A 1 451 ? 16.776  23.121  -29.864 1.00 13.89 ? 444  TYR A CD1 1 
ATOM   5145 C CD2 . TYR A 1 451 ? 19.095  23.463  -29.384 1.00 14.97 ? 444  TYR A CD2 1 
ATOM   5146 C CE1 . TYR A 1 451 ? 16.887  21.786  -29.512 1.00 12.41 ? 444  TYR A CE1 1 
ATOM   5147 C CE2 . TYR A 1 451 ? 19.228  22.117  -29.043 1.00 13.66 ? 444  TYR A CE2 1 
ATOM   5148 C CZ  . TYR A 1 451 ? 18.123  21.292  -29.109 1.00 12.85 ? 444  TYR A CZ  1 
ATOM   5149 O OH  . TYR A 1 451 ? 18.261  19.978  -28.754 1.00 16.41 ? 444  TYR A OH  1 
ATOM   5150 N N   . ARG A 1 452 ? 14.927  25.932  -29.013 1.00 11.74 ? 445  ARG A N   1 
ATOM   5151 C CA  . ARG A 1 452 ? 13.661  25.325  -28.610 1.00 10.50 ? 445  ARG A CA  1 
ATOM   5152 C C   . ARG A 1 452 ? 13.017  24.749  -29.862 1.00 11.39 ? 445  ARG A C   1 
ATOM   5153 O O   . ARG A 1 452 ? 12.681  25.480  -30.785 1.00 15.00 ? 445  ARG A O   1 
ATOM   5154 C CB  . ARG A 1 452 ? 12.760  26.347  -27.941 1.00 15.10 ? 445  ARG A CB  1 
ATOM   5155 C CG  . ARG A 1 452 ? 11.419  25.844  -27.426 1.00 13.39 ? 445  ARG A CG  1 
ATOM   5156 C CD  . ARG A 1 452 ? 10.758  27.029  -26.707 1.00 16.55 ? 445  ARG A CD  1 
ATOM   5157 N NE  . ARG A 1 452 ? 9.521   26.728  -26.005 1.00 16.29 ? 445  ARG A NE  1 
ATOM   5158 C CZ  . ARG A 1 452 ? 8.308   26.849  -26.546 1.00 12.35 ? 445  ARG A CZ  1 
ATOM   5159 N NH1 . ARG A 1 452 ? 8.170   27.242  -27.809 1.00 14.21 ? 445  ARG A NH1 1 
ATOM   5160 N NH2 . ARG A 1 452 ? 7.220   26.582  -25.832 1.00 17.90 ? 445  ARG A NH2 1 
ATOM   5161 N N   . PHE A 1 453 ? 12.878  23.437  -29.919 1.00 13.13 ? 446  PHE A N   1 
ATOM   5162 C CA  . PHE A 1 453 ? 12.364  22.838  -31.140 1.00 13.02 ? 446  PHE A CA  1 
ATOM   5163 C C   . PHE A 1 453 ? 10.839  22.764  -31.112 1.00 14.37 ? 446  PHE A C   1 
ATOM   5164 O O   . PHE A 1 453 ? 10.242  22.105  -30.255 1.00 13.56 ? 446  PHE A O   1 
ATOM   5165 C CB  . PHE A 1 453 ? 12.965  21.476  -31.350 1.00 11.22 ? 446  PHE A CB  1 
ATOM   5166 C CG  . PHE A 1 453 ? 12.620  20.884  -32.666 1.00 14.18 ? 446  PHE A CG  1 
ATOM   5167 C CD1 . PHE A 1 453 ? 13.337  21.236  -33.798 1.00 13.24 ? 446  PHE A CD1 1 
ATOM   5168 C CD2 . PHE A 1 453 ? 11.553  20.005  -32.782 1.00 14.99 ? 446  PHE A CD2 1 
ATOM   5169 C CE1 . PHE A 1 453 ? 13.000  20.685  -35.027 1.00 16.49 ? 446  PHE A CE1 1 
ATOM   5170 C CE2 . PHE A 1 453 ? 11.213  19.453  -34.008 1.00 11.24 ? 446  PHE A CE2 1 
ATOM   5171 C CZ  . PHE A 1 453 ? 11.936  19.799  -35.119 1.00 14.52 ? 446  PHE A CZ  1 
ATOM   5172 N N   . ASP A 1 454 ? 10.224  23.422  -32.086 1.00 12.92 ? 447  ASP A N   1 
ATOM   5173 C CA  . ASP A 1 454 ? 8.803   23.721  -32.053 1.00 10.43 ? 447  ASP A CA  1 
ATOM   5174 C C   . ASP A 1 454 ? 8.187   23.489  -33.441 1.00 11.26 ? 447  ASP A C   1 
ATOM   5175 O O   . ASP A 1 454 ? 7.272   24.192  -33.848 1.00 17.82 ? 447  ASP A O   1 
ATOM   5176 C CB  . ASP A 1 454 ? 8.615   25.169  -31.578 1.00 14.79 ? 447  ASP A CB  1 
ATOM   5177 C CG  . ASP A 1 454 ? 7.163   25.538  -31.348 1.00 16.56 ? 447  ASP A CG  1 
ATOM   5178 O OD1 . ASP A 1 454 ? 6.371   24.643  -30.990 1.00 16.52 ? 447  ASP A OD1 1 
ATOM   5179 O OD2 . ASP A 1 454 ? 6.826   26.731  -31.525 1.00 20.90 ? 447  ASP A OD2 1 
ATOM   5180 N N   . PHE A 1 455 ? 8.711   22.499  -34.157 1.00 13.54 ? 448  PHE A N   1 
ATOM   5181 C CA  . PHE A 1 455 ? 8.206   22.164  -35.492 1.00 13.74 ? 448  PHE A CA  1 
ATOM   5182 C C   . PHE A 1 455 ? 7.422   20.866  -35.462 1.00 17.92 ? 448  PHE A C   1 
ATOM   5183 O O   . PHE A 1 455 ? 7.982   19.813  -35.154 1.00 15.04 ? 448  PHE A O   1 
ATOM   5184 C CB  . PHE A 1 455 ? 9.359   22.030  -36.487 1.00 16.32 ? 448  PHE A CB  1 
ATOM   5185 C CG  . PHE A 1 455 ? 8.918   21.643  -37.875 1.00 12.55 ? 448  PHE A CG  1 
ATOM   5186 C CD1 . PHE A 1 455 ? 8.520   22.619  -38.773 1.00 15.89 ? 448  PHE A CD1 1 
ATOM   5187 C CD2 . PHE A 1 455 ? 8.897   20.318  -38.275 1.00 13.49 ? 448  PHE A CD2 1 
ATOM   5188 C CE1 . PHE A 1 455 ? 8.103   22.269  -40.063 1.00 16.85 ? 448  PHE A CE1 1 
ATOM   5189 C CE2 . PHE A 1 455 ? 8.497   19.968  -39.563 1.00 14.73 ? 448  PHE A CE2 1 
ATOM   5190 C CZ  . PHE A 1 455 ? 8.094   20.937  -40.454 1.00 12.83 ? 448  PHE A CZ  1 
ATOM   5191 N N   . ASP A 1 456 ? 6.135   20.941  -35.806 1.00 17.64 ? 449  ASP A N   1 
ATOM   5192 C CA  . ASP A 1 456 ? 5.250   19.784  -35.712 1.00 10.96 ? 449  ASP A CA  1 
ATOM   5193 C C   . ASP A 1 456 ? 4.833   19.280  -37.083 1.00 17.08 ? 449  ASP A C   1 
ATOM   5194 O O   . ASP A 1 456 ? 4.332   20.046  -37.902 1.00 20.62 ? 449  ASP A O   1 
ATOM   5195 C CB  . ASP A 1 456 ? 4.003   20.119  -34.896 1.00 19.20 ? 449  ASP A CB  1 
ATOM   5196 C CG  . ASP A 1 456 ? 3.164   18.889  -34.562 1.00 16.87 ? 449  ASP A CG  1 
ATOM   5197 O OD1 . ASP A 1 456 ? 3.666   17.749  -34.647 1.00 28.43 ? 449  ASP A OD1 1 
ATOM   5198 O OD2 . ASP A 1 456 ? 1.983   19.074  -34.174 1.00 22.76 ? 449  ASP A OD2 1 
ATOM   5199 N N   A SER A 1 457 ? 5.076   18.000  -37.335 0.51 14.11 ? 450  SER A N   1 
ATOM   5200 N N   B SER A 1 457 ? 5.037   17.989  -37.328 0.49 14.26 ? 450  SER A N   1 
ATOM   5201 C CA  A SER A 1 457 ? 4.583   17.355  -38.549 0.51 14.52 ? 450  SER A CA  1 
ATOM   5202 C CA  B SER A 1 457 ? 4.555   17.373  -38.563 0.49 14.57 ? 450  SER A CA  1 
ATOM   5203 C C   A SER A 1 457 ? 4.337   15.880  -38.294 0.51 19.60 ? 450  SER A C   1 
ATOM   5204 C C   B SER A 1 457 ? 4.019   15.960  -38.354 0.49 17.75 ? 450  SER A C   1 
ATOM   5205 O O   A SER A 1 457 ? 5.011   15.264  -37.470 0.51 19.17 ? 450  SER A O   1 
ATOM   5206 O O   B SER A 1 457 ? 4.468   15.225  -37.468 0.49 13.93 ? 450  SER A O   1 
ATOM   5207 C CB  A SER A 1 457 ? 5.569   17.526  -39.705 0.51 15.93 ? 450  SER A CB  1 
ATOM   5208 C CB  B SER A 1 457 ? 5.661   17.341  -39.618 0.49 17.01 ? 450  SER A CB  1 
ATOM   5209 O OG  A SER A 1 457 ? 5.239   16.650  -40.777 0.51 20.19 ? 450  SER A OG  1 
ATOM   5210 O OG  B SER A 1 457 ? 5.242   16.609  -40.763 0.49 20.02 ? 450  SER A OG  1 
ATOM   5211 N N   A GLU A 1 458 ? 3.366   15.312  -38.998 0.51 21.69 ? 451  GLU A N   1 
ATOM   5212 N N   B GLU A 1 458 ? 3.052   15.587  -39.184 0.49 19.60 ? 451  GLU A N   1 
ATOM   5213 C CA  A GLU A 1 458 ? 3.175   13.873  -38.970 0.51 20.15 ? 451  GLU A CA  1 
ATOM   5214 C CA  B GLU A 1 458 ? 2.541   14.225  -39.204 0.49 19.35 ? 451  GLU A CA  1 
ATOM   5215 C C   A GLU A 1 458 ? 3.351   13.302  -40.367 0.51 18.96 ? 451  GLU A C   1 
ATOM   5216 C C   B GLU A 1 458 ? 2.894   13.539  -40.525 0.49 16.44 ? 451  GLU A C   1 
ATOM   5217 O O   A GLU A 1 458 ? 3.098   12.121  -40.603 0.51 27.30 ? 451  GLU A O   1 
ATOM   5218 O O   B GLU A 1 458 ? 2.359   12.476  -40.839 0.49 31.47 ? 451  GLU A O   1 
ATOM   5219 C CB  A GLU A 1 458 ? 1.805   13.516  -38.402 0.51 24.21 ? 451  GLU A CB  1 
ATOM   5220 C CB  B GLU A 1 458 ? 1.024   14.207  -39.000 0.49 25.47 ? 451  GLU A CB  1 
ATOM   5221 C CG  A GLU A 1 458 ? 1.743   13.660  -36.891 0.51 26.04 ? 451  GLU A CG  1 
ATOM   5222 C CG  B GLU A 1 458 ? 0.547   14.788  -37.675 0.49 21.02 ? 451  GLU A CG  1 
ATOM   5223 C CD  A GLU A 1 458 ? 0.342   13.526  -36.338 0.51 30.96 ? 451  GLU A CD  1 
ATOM   5224 C CD  B GLU A 1 458 ? -0.927  14.509  -37.418 0.49 33.64 ? 451  GLU A CD  1 
ATOM   5225 O OE1 A GLU A 1 458 ? -0.598  13.290  -37.127 0.51 40.64 ? 451  GLU A OE1 1 
ATOM   5226 O OE1 B GLU A 1 458 ? -1.384  13.391  -37.739 0.49 36.13 ? 451  GLU A OE1 1 
ATOM   5227 O OE2 A GLU A 1 458 ? 0.181   13.672  -35.110 0.51 30.59 ? 451  GLU A OE2 1 
ATOM   5228 O OE2 B GLU A 1 458 ? -1.630  15.406  -36.903 0.49 27.88 ? 451  GLU A OE2 1 
ATOM   5229 N N   . ASP A 1 459 ? 3.799   14.150  -41.286 1.00 18.56 ? 452  ASP A N   1 
ATOM   5230 C CA  . ASP A 1 459 ? 4.128   13.684  -42.636 1.00 20.77 ? 452  ASP A CA  1 
ATOM   5231 C C   . ASP A 1 459 ? 5.426   12.893  -42.640 1.00 19.28 ? 452  ASP A C   1 
ATOM   5232 O O   . ASP A 1 459 ? 5.694   12.133  -43.554 1.00 25.02 ? 452  ASP A O   1 
ATOM   5233 C CB  . ASP A 1 459 ? 4.232   14.864  -43.607 1.00 20.10 ? 452  ASP A CB  1 
ATOM   5234 C CG  . ASP A 1 459 ? 2.879   15.263  -44.195 1.00 31.12 ? 452  ASP A CG  1 
ATOM   5235 O OD1 . ASP A 1 459 ? 1.841   14.720  -43.752 1.00 33.73 ? 452  ASP A OD1 1 
ATOM   5236 O OD2 . ASP A 1 459 ? 2.856   16.127  -45.100 1.00 51.31 ? 452  ASP A OD2 1 
ATOM   5237 N N   . LEU A 1 460 ? 6.228   13.089  -41.600 1.00 14.27 ? 453  LEU A N   1 
ATOM   5238 C CA  . LEU A 1 460 ? 7.511   12.422  -41.443 1.00 14.37 ? 453  LEU A CA  1 
ATOM   5239 C C   . LEU A 1 460 ? 7.681   12.109  -39.967 1.00 12.43 ? 453  LEU A C   1 
ATOM   5240 O O   . LEU A 1 460 ? 7.540   13.012  -39.135 1.00 18.42 ? 453  LEU A O   1 
ATOM   5241 C CB  A LEU A 1 460 ? 8.644   13.298  -41.977 0.74 19.47 ? 453  LEU A CB  1 
ATOM   5242 C CB  B LEU A 1 460 ? 8.664   13.313  -41.908 0.26 19.64 ? 453  LEU A CB  1 
ATOM   5243 C CG  A LEU A 1 460 ? 9.987   12.609  -42.202 0.74 15.14 ? 453  LEU A CG  1 
ATOM   5244 C CG  B LEU A 1 460 ? 9.427   13.079  -43.207 0.26 21.49 ? 453  LEU A CG  1 
ATOM   5245 C CD1 A LEU A 1 460 ? 9.930   11.555  -43.311 0.74 19.29 ? 453  LEU A CD1 1 
ATOM   5246 C CD1 B LEU A 1 460 ? 10.631  14.007  -43.217 0.26 19.02 ? 453  LEU A CD1 1 
ATOM   5247 C CD2 A LEU A 1 460 ? 11.062  13.647  -42.493 0.74 22.59 ? 453  LEU A CD2 1 
ATOM   5248 C CD2 B LEU A 1 460 ? 9.859   11.628  -43.362 0.26 18.94 ? 453  LEU A CD2 1 
ATOM   5249 N N   . ILE A 1 461 ? 7.931   10.847  -39.629 1.00 15.04 ? 454  ILE A N   1 
ATOM   5250 C CA  . ILE A 1 461 ? 8.051   10.492  -38.210 1.00 14.76 ? 454  ILE A CA  1 
ATOM   5251 C C   . ILE A 1 461 ? 9.228   9.565   -37.919 1.00 16.68 ? 454  ILE A C   1 
ATOM   5252 O O   . ILE A 1 461 ? 9.977   9.211   -38.824 1.00 13.49 ? 454  ILE A O   1 
ATOM   5253 C CB  . ILE A 1 461 ? 6.769   9.827   -37.693 1.00 15.86 ? 454  ILE A CB  1 
ATOM   5254 C CG1 . ILE A 1 461 ? 6.523   8.502   -38.411 1.00 19.80 ? 454  ILE A CG1 1 
ATOM   5255 C CG2 . ILE A 1 461 ? 5.555   10.759  -37.840 1.00 13.21 ? 454  ILE A CG2 1 
ATOM   5256 C CD1 . ILE A 1 461 ? 5.539   7.636   -37.681 1.00 17.04 ? 454  ILE A CD1 1 
ATOM   5257 N N   A ASN A 1 462 ? 9.369   9.174   -36.655 0.19 13.34 ? 455  ASN A N   1 
ATOM   5258 N N   B ASN A 1 462 ? 9.403   9.191   -36.653 0.81 13.12 ? 455  ASN A N   1 
ATOM   5259 C CA  A ASN A 1 462 ? 10.412  8.246   -36.233 0.19 14.36 ? 455  ASN A CA  1 
ATOM   5260 C CA  B ASN A 1 462 ? 10.430  8.215   -36.293 0.81 14.11 ? 455  ASN A CA  1 
ATOM   5261 C C   A ASN A 1 462 ? 9.825   7.173   -35.313 0.19 13.99 ? 455  ASN A C   1 
ATOM   5262 C C   B ASN A 1 462 ? 9.833   7.171   -35.345 0.81 13.95 ? 455  ASN A C   1 
ATOM   5263 O O   A ASN A 1 462 ? 8.751   7.372   -34.741 0.19 12.43 ? 455  ASN A O   1 
ATOM   5264 O O   B ASN A 1 462 ? 8.739   7.377   -34.803 0.81 12.23 ? 455  ASN A O   1 
ATOM   5265 C CB  A ASN A 1 462 ? 11.555  9.006   -35.548 0.19 14.23 ? 455  ASN A CB  1 
ATOM   5266 C CB  B ASN A 1 462 ? 11.686  8.921   -35.716 0.81 15.39 ? 455  ASN A CB  1 
ATOM   5267 C CG  A ASN A 1 462 ? 11.122  9.690   -34.268 0.19 13.36 ? 455  ASN A CG  1 
ATOM   5268 C CG  B ASN A 1 462 ? 11.509  9.444   -34.300 0.81 12.53 ? 455  ASN A CG  1 
ATOM   5269 O OD1 A ASN A 1 462 ? 11.257  9.134   -33.181 0.19 12.63 ? 455  ASN A OD1 1 
ATOM   5270 O OD1 B ASN A 1 462 ? 11.281  8.678   -33.372 0.81 15.56 ? 455  ASN A OD1 1 
ATOM   5271 N ND2 A ASN A 1 462 ? 10.602  10.906  -34.391 0.19 18.85 ? 455  ASN A ND2 1 
ATOM   5272 N ND2 B ASN A 1 462 ? 11.703  10.747  -34.120 0.81 11.80 ? 455  ASN A ND2 1 
ATOM   5273 N N   . PRO A 1 463 ? 10.511  6.022   -35.187 1.00 14.35 ? 456  PRO A N   1 
ATOM   5274 C CA  . PRO A 1 463 ? 9.993   4.892   -34.406 1.00 13.34 ? 456  PRO A CA  1 
ATOM   5275 C C   . PRO A 1 463 ? 9.588   5.176   -32.959 1.00 13.30 ? 456  PRO A C   1 
ATOM   5276 O O   . PRO A 1 463 ? 8.777   4.416   -32.414 1.00 14.19 ? 456  PRO A O   1 
ATOM   5277 C CB  . PRO A 1 463 ? 11.152  3.913   -34.428 1.00 11.76 ? 456  PRO A CB  1 
ATOM   5278 C CG  . PRO A 1 463 ? 11.724  4.120   -35.774 1.00 18.47 ? 456  PRO A CG  1 
ATOM   5279 C CD  . PRO A 1 463 ? 11.715  5.612   -35.942 1.00 13.48 ? 456  PRO A CD  1 
ATOM   5280 N N   . TYR A 1 464 ? 10.129  6.223   -32.347 1.00 11.96 ? 457  TYR A N   1 
ATOM   5281 C CA  . TYR A 1 464 ? 9.718   6.510   -30.985 1.00 13.93 ? 457  TYR A CA  1 
ATOM   5282 C C   . TYR A 1 464 ? 8.242   6.879   -30.951 1.00 18.79 ? 457  TYR A C   1 
ATOM   5283 O O   . TYR A 1 464 ? 7.577   6.657   -29.945 1.00 17.99 ? 457  TYR A O   1 
ATOM   5284 C CB  . TYR A 1 464 ? 10.531  7.638   -30.386 1.00 13.20 ? 457  TYR A CB  1 
ATOM   5285 C CG  . TYR A 1 464 ? 11.877  7.287   -29.787 1.00 23.47 ? 457  TYR A CG  1 
ATOM   5286 C CD1 . TYR A 1 464 ? 11.967  6.528   -28.633 1.00 29.09 ? 457  TYR A CD1 1 
ATOM   5287 C CD2 . TYR A 1 464 ? 13.051  7.798   -30.326 1.00 20.36 ? 457  TYR A CD2 1 
ATOM   5288 C CE1 . TYR A 1 464 ? 13.190  6.250   -28.066 1.00 26.16 ? 457  TYR A CE1 1 
ATOM   5289 C CE2 . TYR A 1 464 ? 14.275  7.537   -29.759 1.00 21.26 ? 457  TYR A CE2 1 
ATOM   5290 C CZ  . TYR A 1 464 ? 14.340  6.757   -28.634 1.00 22.19 ? 457  TYR A CZ  1 
ATOM   5291 O OH  . TYR A 1 464 ? 15.566  6.492   -28.069 1.00 26.98 ? 457  TYR A OH  1 
ATOM   5292 N N   . ARG A 1 465 ? 7.723   7.428   -32.050 1.00 14.64 ? 458  ARG A N   1 
ATOM   5293 C CA  . ARG A 1 465 ? 6.305   7.769   -32.090 1.00 16.26 ? 458  ARG A CA  1 
ATOM   5294 C C   . ARG A 1 465 ? 5.443   6.502   -32.072 1.00 13.10 ? 458  ARG A C   1 
ATOM   5295 O O   . ARG A 1 465 ? 4.336   6.511   -31.524 1.00 19.21 ? 458  ARG A O   1 
ATOM   5296 C CB  . ARG A 1 465 ? 5.984   8.636   -33.305 1.00 14.95 ? 458  ARG A CB  1 
ATOM   5297 C CG  . ARG A 1 465 ? 4.545   9.169   -33.293 1.00 20.63 ? 458  ARG A CG  1 
ATOM   5298 C CD  . ARG A 1 465 ? 4.292   10.078  -34.471 1.00 21.65 ? 458  ARG A CD  1 
ATOM   5299 N NE  . ARG A 1 465 ? 5.159   11.253  -34.433 1.00 17.83 ? 458  ARG A NE  1 
ATOM   5300 C CZ  . ARG A 1 465 ? 4.723   12.504  -34.315 1.00 22.03 ? 458  ARG A CZ  1 
ATOM   5301 N NH1 . ARG A 1 465 ? 3.425   12.758  -34.216 1.00 28.58 ? 458  ARG A NH1 1 
ATOM   5302 N NH2 . ARG A 1 465 ? 5.584   13.504  -34.286 1.00 21.85 ? 458  ARG A NH2 1 
ATOM   5303 N N   . ILE A 1 466 ? 5.950   5.415   -32.647 1.00 15.14 ? 459  ILE A N   1 
ATOM   5304 C CA  . ILE A 1 466 ? 5.231   4.151   -32.613 1.00 18.58 ? 459  ILE A CA  1 
ATOM   5305 C C   . ILE A 1 466 ? 5.313   3.571   -31.216 1.00 21.31 ? 459  ILE A C   1 
ATOM   5306 O O   . ILE A 1 466 ? 4.308   3.105   -30.661 1.00 20.44 ? 459  ILE A O   1 
ATOM   5307 C CB  . ILE A 1 466 ? 5.799   3.137   -33.632 1.00 12.61 ? 459  ILE A CB  1 
ATOM   5308 C CG1 . ILE A 1 466 ? 5.776   3.724   -35.039 1.00 14.78 ? 459  ILE A CG1 1 
ATOM   5309 C CG2 . ILE A 1 466 ? 5.054   1.792   -33.549 1.00 21.72 ? 459  ILE A CG2 1 
ATOM   5310 C CD1 . ILE A 1 466 ? 4.469   4.379   -35.414 1.00 27.19 ? 459  ILE A CD1 1 
ATOM   5311 N N   . MET A 1 467 ? 6.520   3.611   -30.652 1.00 16.00 ? 460  MET A N   1 
ATOM   5312 C CA  . MET A 1 467 ? 6.754   3.118   -29.298 1.00 16.59 ? 460  MET A CA  1 
ATOM   5313 C C   . MET A 1 467 ? 5.798   3.726   -28.291 1.00 19.28 ? 460  MET A C   1 
ATOM   5314 O O   . MET A 1 467 ? 5.323   3.032   -27.395 1.00 24.15 ? 460  MET A O   1 
ATOM   5315 C CB  . MET A 1 467 ? 8.184   3.412   -28.852 1.00 16.87 ? 460  MET A CB  1 
ATOM   5316 C CG  . MET A 1 467 ? 8.550   2.768   -27.526 1.00 27.75 ? 460  MET A CG  1 
ATOM   5317 S SD  . MET A 1 467 ? 10.135  3.375   -26.905 1.00 33.27 ? 460  MET A SD  1 
ATOM   5318 C CE  . MET A 1 467 ? 9.671   5.039   -26.482 1.00 25.18 ? 460  MET A CE  1 
ATOM   5319 N N   A ARG A 1 468 ? 5.528   5.022   -28.448 0.35 16.92 ? 461  ARG A N   1 
ATOM   5320 N N   B ARG A 1 468 ? 5.505   5.009   -28.464 0.44 16.85 ? 461  ARG A N   1 
ATOM   5321 N N   C ARG A 1 468 ? 5.518   5.018   -28.413 0.21 17.05 ? 461  ARG A N   1 
ATOM   5322 C CA  A ARG A 1 468 ? 4.724   5.775   -27.485 0.35 20.57 ? 461  ARG A CA  1 
ATOM   5323 C CA  B ARG A 1 468 ? 4.706   5.751   -27.498 0.44 20.59 ? 461  ARG A CA  1 
ATOM   5324 C CA  C ARG A 1 468 ? 4.665   5.679   -27.428 0.21 20.55 ? 461  ARG A CA  1 
ATOM   5325 C C   A ARG A 1 468 ? 3.253   5.843   -27.879 0.35 18.98 ? 461  ARG A C   1 
ATOM   5326 C C   B ARG A 1 468 ? 3.227   5.786   -27.867 0.44 18.97 ? 461  ARG A C   1 
ATOM   5327 C C   C ARG A 1 468 ? 3.201   5.691   -27.851 0.21 19.06 ? 461  ARG A C   1 
ATOM   5328 O O   A ARG A 1 468 ? 2.468   6.513   -27.210 0.35 22.41 ? 461  ARG A O   1 
ATOM   5329 O O   B ARG A 1 468 ? 2.435   6.410   -27.166 0.44 22.27 ? 461  ARG A O   1 
ATOM   5330 O O   C ARG A 1 468 ? 2.351   6.206   -27.125 0.21 21.31 ? 461  ARG A O   1 
ATOM   5331 C CB  A ARG A 1 468 ? 5.274   7.205   -27.302 0.35 20.09 ? 461  ARG A CB  1 
ATOM   5332 C CB  B ARG A 1 468 ? 5.235   7.184   -27.358 0.44 19.92 ? 461  ARG A CB  1 
ATOM   5333 C CB  C ARG A 1 468 ? 5.137   7.115   -27.167 0.21 20.41 ? 461  ARG A CB  1 
ATOM   5334 C CG  A ARG A 1 468 ? 5.109   8.162   -28.490 0.35 22.65 ? 461  ARG A CG  1 
ATOM   5335 C CG  B ARG A 1 468 ? 4.885   8.108   -28.508 0.44 22.83 ? 461  ARG A CG  1 
ATOM   5336 C CG  C ARG A 1 468 ? 5.148   8.029   -28.382 0.21 22.28 ? 461  ARG A CG  1 
ATOM   5337 C CD  A ARG A 1 468 ? 5.590   9.589   -28.143 0.35 17.87 ? 461  ARG A CD  1 
ATOM   5338 C CD  B ARG A 1 468 ? 5.478   9.498   -28.311 0.44 17.94 ? 461  ARG A CD  1 
ATOM   5339 C CD  C ARG A 1 468 ? 5.475   9.465   -27.982 0.21 18.62 ? 461  ARG A CD  1 
ATOM   5340 N NE  A ARG A 1 468 ? 5.934   10.388  -29.322 0.35 12.68 ? 461  ARG A NE  1 
ATOM   5341 N NE  B ARG A 1 468 ? 4.526   10.537  -28.686 0.44 31.35 ? 461  ARG A NE  1 
ATOM   5342 N NE  C ARG A 1 468 ? 6.473   10.083  -28.852 0.21 17.29 ? 461  ARG A NE  1 
ATOM   5343 C CZ  A ARG A 1 468 ? 5.194   11.381  -29.814 0.35 21.23 ? 461  ARG A CZ  1 
ATOM   5344 C CZ  B ARG A 1 468 ? 4.718   11.413  -29.666 0.44 29.13 ? 461  ARG A CZ  1 
ATOM   5345 C CZ  C ARG A 1 468 ? 6.206   10.967  -29.809 0.21 13.42 ? 461  ARG A CZ  1 
ATOM   5346 N NH1 A ARG A 1 468 ? 4.051   11.722  -29.232 0.35 29.07 ? 461  ARG A NH1 1 
ATOM   5347 N NH1 B ARG A 1 468 ? 5.836   11.373  -30.371 0.44 8.36  ? 461  ARG A NH1 1 
ATOM   5348 N NH1 C ARG A 1 468 ? 4.963   11.357  -30.043 0.21 21.75 ? 461  ARG A NH1 1 
ATOM   5349 N NH2 A ARG A 1 468 ? 5.592   12.043  -30.890 0.35 17.74 ? 461  ARG A NH2 1 
ATOM   5350 N NH2 B ARG A 1 468 ? 3.790   12.325  -29.936 0.44 21.41 ? 461  ARG A NH2 1 
ATOM   5351 N NH2 C ARG A 1 468 ? 7.193   11.467  -30.535 0.21 21.54 ? 461  ARG A NH2 1 
ATOM   5352 N N   A SER A 1 469 ? 2.884   5.148   -28.952 0.35 22.70 ? 462  SER A N   1 
ATOM   5353 N N   B SER A 1 469 ? 2.858   5.117   -28.957 0.44 22.71 ? 462  SER A N   1 
ATOM   5354 N N   C SER A 1 469 ? 2.912   5.104   -29.009 0.21 22.67 ? 462  SER A N   1 
ATOM   5355 C CA  A SER A 1 469 ? 1.516   5.189   -29.471 0.35 23.31 ? 462  SER A CA  1 
ATOM   5356 C CA  B SER A 1 469 ? 1.492   5.179   -29.479 0.44 23.33 ? 462  SER A CA  1 
ATOM   5357 C CA  C SER A 1 469 ? 1.575   5.146   -29.602 0.21 23.21 ? 462  SER A CA  1 
ATOM   5358 C C   A SER A 1 469 ? 1.064   6.627   -29.724 0.35 20.77 ? 462  SER A C   1 
ATOM   5359 C C   B SER A 1 469 ? 1.057   6.627   -29.731 0.44 20.75 ? 462  SER A C   1 
ATOM   5360 C C   C SER A 1 469 ? 1.090   6.591   -29.738 0.21 20.83 ? 462  SER A C   1 
ATOM   5361 O O   A SER A 1 469 ? -0.059  7.002   -29.390 0.35 26.61 ? 462  SER A O   1 
ATOM   5362 O O   B SER A 1 469 ? -0.065  7.009   -29.403 0.44 26.64 ? 462  SER A O   1 
ATOM   5363 O O   C SER A 1 469 ? -0.020  6.931   -29.332 0.21 26.54 ? 462  SER A O   1 
ATOM   5364 C CB  A SER A 1 469 ? 0.547   4.493   -28.505 0.35 21.56 ? 462  SER A CB  1 
ATOM   5365 C CB  B SER A 1 469 ? 0.503   4.497   -28.518 0.44 21.57 ? 462  SER A CB  1 
ATOM   5366 C CB  C SER A 1 469 ? 0.579   4.314   -28.781 0.21 22.38 ? 462  SER A CB  1 
ATOM   5367 O OG  A SER A 1 469 ? -0.804  4.713   -28.879 0.35 25.43 ? 462  SER A OG  1 
ATOM   5368 O OG  B SER A 1 469 ? 0.736   3.101   -28.412 0.44 11.93 ? 462  SER A OG  1 
ATOM   5369 O OG  C SER A 1 469 ? 0.453   4.802   -27.457 0.21 22.70 ? 462  SER A OG  1 
ATOM   5370 N N   . GLY A 1 470 ? 1.943   7.427   -30.323 1.00 22.76 ? 463  GLY A N   1 
ATOM   5371 C CA  . GLY A 1 470 ? 1.678   8.842   -30.506 1.00 17.69 ? 463  GLY A CA  1 
ATOM   5372 C C   . GLY A 1 470 ? 1.243   9.326   -31.874 1.00 19.22 ? 463  GLY A C   1 
ATOM   5373 O O   . GLY A 1 470 ? 1.341   10.514  -32.167 1.00 24.20 ? 463  GLY A O   1 
ATOM   5374 N N   A ARG A 1 471 ? 0.755   8.416   -32.708 0.46 22.51 ? 464  ARG A N   1 
ATOM   5375 N N   B ARG A 1 471 ? 0.787   8.414   -32.725 0.54 22.52 ? 464  ARG A N   1 
ATOM   5376 C CA  A ARG A 1 471 ? 0.267   8.798   -34.021 0.46 25.40 ? 464  ARG A CA  1 
ATOM   5377 C CA  B ARG A 1 471 ? 0.268   8.824   -34.016 0.54 25.41 ? 464  ARG A CA  1 
ATOM   5378 C C   A ARG A 1 471 ? -0.994  9.647   -33.868 0.46 23.74 ? 464  ARG A C   1 
ATOM   5379 C C   B ARG A 1 471 ? -0.954  9.701   -33.799 0.54 23.75 ? 464  ARG A C   1 
ATOM   5380 O O   A ARG A 1 471 ? -1.896  9.300   -33.106 0.46 27.67 ? 464  ARG A O   1 
ATOM   5381 O O   B ARG A 1 471 ? -1.777  9.433   -32.924 0.54 25.68 ? 464  ARG A O   1 
ATOM   5382 C CB  A ARG A 1 471 ? -0.006  7.559   -34.878 0.46 26.03 ? 464  ARG A CB  1 
ATOM   5383 C CB  B ARG A 1 471 ? -0.078  7.618   -34.890 0.54 25.98 ? 464  ARG A CB  1 
ATOM   5384 C CG  A ARG A 1 471 ? 0.033   7.832   -36.362 0.46 18.12 ? 464  ARG A CG  1 
ATOM   5385 C CG  B ARG A 1 471 ? 1.122   6.989   -35.575 0.54 31.28 ? 464  ARG A CG  1 
ATOM   5386 C CD  A ARG A 1 471 ? -0.400  6.632   -37.196 0.46 35.52 ? 464  ARG A CD  1 
ATOM   5387 C CD  B ARG A 1 471 ? 0.689   6.072   -36.706 0.54 28.15 ? 464  ARG A CD  1 
ATOM   5388 N NE  A ARG A 1 471 ? 0.429   5.440   -37.012 0.46 24.69 ? 464  ARG A NE  1 
ATOM   5389 N NE  B ARG A 1 471 ? 1.810   5.643   -37.537 0.54 44.11 ? 464  ARG A NE  1 
ATOM   5390 C CZ  A ARG A 1 471 ? 1.490   5.147   -37.760 0.46 38.24 ? 464  ARG A CZ  1 
ATOM   5391 C CZ  B ARG A 1 471 ? 2.256   6.317   -38.593 0.54 28.65 ? 464  ARG A CZ  1 
ATOM   5392 N NH1 A ARG A 1 471 ? 1.874   5.971   -38.722 0.46 33.61 ? 464  ARG A NH1 1 
ATOM   5393 N NH1 B ARG A 1 471 ? 1.677   7.457   -38.948 0.54 36.92 ? 464  ARG A NH1 1 
ATOM   5394 N NH2 A ARG A 1 471 ? 2.178   4.037   -37.540 0.46 34.43 ? 464  ARG A NH2 1 
ATOM   5395 N NH2 B ARG A 1 471 ? 3.279   5.850   -39.297 0.54 35.95 ? 464  ARG A NH2 1 
ATOM   5396 N N   . GLY A 1 472 ? -1.043  10.773  -34.573 1.00 24.57 ? 465  GLY A N   1 
ATOM   5397 C CA  . GLY A 1 472 ? -2.179  11.676  -34.499 1.00 25.69 ? 465  GLY A CA  1 
ATOM   5398 C C   . GLY A 1 472 ? -2.199  12.638  -33.317 1.00 23.50 ? 465  GLY A C   1 
ATOM   5399 O O   . GLY A 1 472 ? -3.132  13.424  -33.176 1.00 23.22 ? 465  GLY A O   1 
ATOM   5400 N N   A VAL A 1 473 ? -1.179  12.570  -32.467 0.45 22.51 ? 466  VAL A N   1 
ATOM   5401 N N   B VAL A 1 473 ? -1.176  12.581  -32.468 0.55 22.51 ? 466  VAL A N   1 
ATOM   5402 C CA  A VAL A 1 473 ? -1.081  13.475  -31.326 0.45 18.04 ? 466  VAL A CA  1 
ATOM   5403 C CA  B VAL A 1 473 ? -1.099  13.473  -31.314 0.55 18.00 ? 466  VAL A CA  1 
ATOM   5404 C C   A VAL A 1 473 ? -0.373  14.758  -31.739 0.45 19.74 ? 466  VAL A C   1 
ATOM   5405 C C   B VAL A 1 473 ? -0.368  14.759  -31.690 0.55 19.62 ? 466  VAL A C   1 
ATOM   5406 O O   A VAL A 1 473 ? 0.803   14.739  -32.102 0.45 22.25 ? 466  VAL A O   1 
ATOM   5407 O O   B VAL A 1 473 ? 0.826   14.739  -31.982 0.55 22.32 ? 466  VAL A O   1 
ATOM   5408 C CB  A VAL A 1 473 ? -0.328  12.832  -30.145 0.45 19.05 ? 466  VAL A CB  1 
ATOM   5409 C CB  B VAL A 1 473 ? -0.387  12.804  -30.122 0.55 18.89 ? 466  VAL A CB  1 
ATOM   5410 C CG1 A VAL A 1 473 ? -0.069  13.862  -29.049 0.45 19.89 ? 466  VAL A CG1 1 
ATOM   5411 C CG1 B VAL A 1 473 ? -0.336  13.747  -28.925 0.55 20.14 ? 466  VAL A CG1 1 
ATOM   5412 C CG2 A VAL A 1 473 ? -1.099  11.635  -29.611 0.45 22.33 ? 466  VAL A CG2 1 
ATOM   5413 C CG2 B VAL A 1 473 ? -1.073  11.493  -29.764 0.55 22.02 ? 466  VAL A CG2 1 
ATOM   5414 N N   . LYS A 1 474 ? -1.101  15.869  -31.695 1.00 20.52 ? 467  LYS A N   1 
ATOM   5415 C CA  . LYS A 1 474 ? -0.561  17.152  -32.119 1.00 13.98 ? 467  LYS A CA  1 
ATOM   5416 C C   . LYS A 1 474 ? 0.307   17.812  -31.036 1.00 19.10 ? 467  LYS A C   1 
ATOM   5417 O O   . LYS A 1 474 ? -0.026  17.779  -29.845 1.00 20.51 ? 467  LYS A O   1 
ATOM   5418 C CB  . LYS A 1 474 ? -1.709  18.070  -32.547 1.00 23.00 ? 467  LYS A CB  1 
ATOM   5419 C CG  . LYS A 1 474 ? -2.507  17.531  -33.742 1.00 25.50 ? 467  LYS A CG  1 
ATOM   5420 C CD  . LYS A 1 474 ? -3.590  18.506  -34.180 1.00 45.25 ? 467  LYS A CD  1 
ATOM   5421 C CE  . LYS A 1 474 ? -4.382  17.950  -35.355 1.00 49.16 ? 467  LYS A CE  1 
ATOM   5422 N NZ  . LYS A 1 474 ? -4.976  16.618  -35.058 1.00 31.06 ? 467  LYS A NZ  1 
ATOM   5423 N N   . GLY A 1 475 ? 1.424   18.413  -31.453 1.00 13.63 ? 468  GLY A N   1 
ATOM   5424 C CA  . GLY A 1 475 ? 2.384   18.975  -30.510 1.00 19.45 ? 468  GLY A CA  1 
ATOM   5425 C C   . GLY A 1 475 ? 3.754   18.342  -30.681 1.00 18.32 ? 468  GLY A C   1 
ATOM   5426 O O   . GLY A 1 475 ? 3.876   17.280  -31.298 1.00 15.96 ? 468  GLY A O   1 
ATOM   5427 N N   A VAL A 1 476 ? 4.783   18.939  -30.088 0.62 14.85 ? 469  VAL A N   1 
ATOM   5428 N N   B VAL A 1 476 ? 4.778   19.017  -30.161 0.38 15.17 ? 469  VAL A N   1 
ATOM   5429 C CA  A VAL A 1 476 ? 6.134   18.431  -30.284 0.62 14.94 ? 469  VAL A CA  1 
ATOM   5430 C CA  B VAL A 1 476 ? 6.160   18.620  -30.395 0.38 14.92 ? 469  VAL A CA  1 
ATOM   5431 C C   A VAL A 1 476 ? 6.662   17.726  -29.033 0.62 12.38 ? 469  VAL A C   1 
ATOM   5432 C C   B VAL A 1 476 ? 6.728   17.959  -29.145 0.38 12.76 ? 469  VAL A C   1 
ATOM   5433 O O   A VAL A 1 476 ? 7.160   18.362  -28.095 0.62 15.87 ? 469  VAL A O   1 
ATOM   5434 O O   B VAL A 1 476 ? 7.301   18.612  -28.263 0.38 13.18 ? 469  VAL A O   1 
ATOM   5435 C CB  A VAL A 1 476 ? 7.097   19.555  -30.707 0.62 15.37 ? 469  VAL A CB  1 
ATOM   5436 C CB  B VAL A 1 476 ? 7.036   19.818  -30.821 0.38 14.73 ? 469  VAL A CB  1 
ATOM   5437 C CG1 A VAL A 1 476 ? 8.456   18.971  -31.084 0.62 15.76 ? 469  VAL A CG1 1 
ATOM   5438 C CG1 B VAL A 1 476 ? 8.398   19.340  -31.298 0.38 12.60 ? 469  VAL A CG1 1 
ATOM   5439 C CG2 A VAL A 1 476 ? 6.525   20.313  -31.900 0.62 16.50 ? 469  VAL A CG2 1 
ATOM   5440 C CG2 B VAL A 1 476 ? 6.356   20.602  -31.940 0.38 15.64 ? 469  VAL A CG2 1 
ATOM   5441 N N   A SER A 1 477 ? 6.549   16.399  -29.052 0.62 13.42 ? 470  SER A N   1 
ATOM   5442 N N   B SER A 1 477 ? 6.543   16.644  -29.105 0.38 11.65 ? 470  SER A N   1 
ATOM   5443 C CA  A SER A 1 477 ? 6.956   15.541  -27.942 0.62 12.02 ? 470  SER A CA  1 
ATOM   5444 C CA  B SER A 1 477 ? 6.940   15.783  -28.003 0.38 13.68 ? 470  SER A CA  1 
ATOM   5445 C C   A SER A 1 477 ? 8.452   15.369  -27.883 0.62 11.28 ? 470  SER A C   1 
ATOM   5446 C C   B SER A 1 477 ? 8.446   15.693  -27.871 0.38 10.77 ? 470  SER A C   1 
ATOM   5447 O O   A SER A 1 477 ? 9.162   15.568  -28.876 0.62 10.60 ? 470  SER A O   1 
ATOM   5448 O O   B SER A 1 477 ? 9.185   15.998  -28.811 0.38 9.79  ? 470  SER A O   1 
ATOM   5449 C CB  A SER A 1 477 ? 6.323   14.151  -28.067 0.62 10.92 ? 470  SER A CB  1 
ATOM   5450 C CB  B SER A 1 477 ? 6.352   14.383  -28.224 0.38 11.23 ? 470  SER A CB  1 
ATOM   5451 O OG  A SER A 1 477 ? 4.902   14.203  -28.011 0.62 14.14 ? 470  SER A OG  1 
ATOM   5452 O OG  B SER A 1 477 ? 6.821   13.434  -27.286 0.38 8.53  ? 470  SER A OG  1 
ATOM   5453 N N   A HIS A 1 478 ? 8.919   14.987  -26.701 0.62 12.64 ? 471  HIS A N   1 
ATOM   5454 N N   B HIS A 1 478 ? 8.886   15.296  -26.682 0.38 10.10 ? 471  HIS A N   1 
ATOM   5455 C CA  A HIS A 1 478 ? 10.210  14.337  -26.545 0.62 13.02 ? 471  HIS A CA  1 
ATOM   5456 C CA  B HIS A 1 478 ? 10.210  14.728  -26.489 0.38 9.24  ? 471  HIS A CA  1 
ATOM   5457 C C   A HIS A 1 478 ? 10.437  13.326  -27.673 0.62 11.99 ? 471  HIS A C   1 
ATOM   5458 C C   B HIS A 1 478 ? 10.512  13.775  -27.638 0.38 11.80 ? 471  HIS A C   1 
ATOM   5459 O O   A HIS A 1 478 ? 9.571   12.477  -27.949 0.62 10.68 ? 471  HIS A O   1 
ATOM   5460 O O   B HIS A 1 478 ? 9.672   12.919  -27.950 0.38 15.00 ? 471  HIS A O   1 
ATOM   5461 C CB  A HIS A 1 478 ? 10.279  13.631  -25.191 0.62 12.97 ? 471  HIS A CB  1 
ATOM   5462 C CB  B HIS A 1 478 ? 10.263  13.981  -25.153 0.38 13.29 ? 471  HIS A CB  1 
ATOM   5463 C CG  A HIS A 1 478 ? 11.650  13.154  -24.818 0.62 13.02 ? 471  HIS A CG  1 
ATOM   5464 C CG  B HIS A 1 478 ? 11.595  13.368  -24.840 0.38 13.37 ? 471  HIS A CG  1 
ATOM   5465 N ND1 A HIS A 1 478 ? 12.713  14.012  -24.650 0.62 14.48 ? 471  HIS A ND1 1 
ATOM   5466 N ND1 B HIS A 1 478 ? 12.733  14.119  -24.645 0.38 14.43 ? 471  HIS A ND1 1 
ATOM   5467 C CD2 A HIS A 1 478 ? 12.123  11.911  -24.555 0.62 15.91 ? 471  HIS A CD2 1 
ATOM   5468 C CD2 B HIS A 1 478 ? 11.962  12.076  -24.665 0.38 15.09 ? 471  HIS A CD2 1 
ATOM   5469 C CE1 A HIS A 1 478 ? 13.786  13.318  -24.310 0.62 12.43 ? 471  HIS A CE1 1 
ATOM   5470 C CE1 B HIS A 1 478 ? 13.746  13.315  -24.371 0.38 12.55 ? 471  HIS A CE1 1 
ATOM   5471 N NE2 A HIS A 1 478 ? 13.454  12.041  -24.241 0.62 14.85 ? 471  HIS A NE2 1 
ATOM   5472 N NE2 B HIS A 1 478 ? 13.304  12.070  -24.375 0.38 16.25 ? 471  HIS A NE2 1 
ATOM   5473 N N   A THR A 1 479 ? 11.617  13.446  -28.286 0.62 11.31 ? 472  THR A N   1 
ATOM   5474 N N   B THR A 1 479 ? 11.675  13.978  -28.269 0.38 8.54  ? 472  THR A N   1 
ATOM   5475 C CA  A THR A 1 479 ? 12.142  12.650  -29.418 0.62 9.96  ? 472  THR A CA  1 
ATOM   5476 C CA  B THR A 1 479 ? 12.278  13.075  -29.269 0.38 16.94 ? 472  THR A CA  1 
ATOM   5477 C C   A THR A 1 479 ? 11.636  13.078  -30.800 0.62 12.38 ? 472  THR A C   1 
ATOM   5478 C C   B THR A 1 479 ? 11.900  13.432  -30.719 0.38 10.64 ? 472  THR A C   1 
ATOM   5479 O O   A THR A 1 479 ? 12.069  12.505  -31.793 0.62 10.15 ? 472  THR A O   1 
ATOM   5480 O O   B THR A 1 479 ? 12.666  13.176  -31.658 0.38 17.15 ? 472  THR A O   1 
ATOM   5481 C CB  A THR A 1 479 ? 11.861  11.123  -29.306 0.62 11.18 ? 472  THR A CB  1 
ATOM   5482 C CB  B THR A 1 479 ? 11.925  11.597  -28.970 0.38 18.81 ? 472  THR A CB  1 
ATOM   5483 O OG1 A THR A 1 479 ? 10.493  10.864  -29.607 0.62 7.52  ? 472  THR A OG1 1 
ATOM   5484 O OG1 B THR A 1 479 ? 12.867  11.060  -28.029 0.38 16.48 ? 472  THR A OG1 1 
ATOM   5485 C CG2 A THR A 1 479 ? 12.217  10.574  -27.925 0.62 9.92  ? 472  THR A CG2 1 
ATOM   5486 C CG2 B THR A 1 479 ? 11.929  10.782  -30.214 0.38 24.85 ? 472  THR A CG2 1 
ATOM   5487 N N   . ASP A 1 480 ? 10.747  14.063  -30.891 1.00 10.81 ? 473  ASP A N   1 
ATOM   5488 C CA  . ASP A 1 480 ? 10.236  14.417  -32.230 1.00 12.71 ? 473  ASP A CA  1 
ATOM   5489 C C   . ASP A 1 480 ? 11.267  15.077  -33.150 1.00 11.60 ? 473  ASP A C   1 
ATOM   5490 O O   . ASP A 1 480 ? 11.140  15.006  -34.377 1.00 13.14 ? 473  ASP A O   1 
ATOM   5491 C CB  . ASP A 1 480 ? 9.028   15.338  -32.113 1.00 15.75 ? 473  ASP A CB  1 
ATOM   5492 C CG  . ASP A 1 480 ? 7.755   14.589  -31.783 1.00 17.87 ? 473  ASP A CG  1 
ATOM   5493 O OD1 . ASP A 1 480 ? 7.795   13.347  -31.732 1.00 16.69 ? 473  ASP A OD1 1 
ATOM   5494 O OD2 . ASP A 1 480 ? 6.707   15.243  -31.589 1.00 15.91 ? 473  ASP A OD2 1 
ATOM   5495 N N   . GLU A 1 481 ? 12.287  15.717  -32.593 1.00 10.84 ? 474  GLU A N   1 
ATOM   5496 C CA  . GLU A 1 481 ? 13.268  16.388  -33.428 1.00 14.89 ? 474  GLU A CA  1 
ATOM   5497 C C   . GLU A 1 481 ? 14.191  15.407  -34.170 1.00 13.00 ? 474  GLU A C   1 
ATOM   5498 O O   . GLU A 1 481 ? 14.779  15.768  -35.191 1.00 14.00 ? 474  GLU A O   1 
ATOM   5499 C CB  . GLU A 1 481 ? 14.102  17.371  -32.600 1.00 17.44 ? 474  GLU A CB  1 
ATOM   5500 C CG  . GLU A 1 481 ? 15.286  16.757  -31.858 1.00 16.75 ? 474  GLU A CG  1 
ATOM   5501 C CD  . GLU A 1 481 ? 14.929  16.183  -30.501 1.00 17.38 ? 474  GLU A CD  1 
ATOM   5502 O OE1 . GLU A 1 481 ? 13.856  15.591  -30.349 1.00 21.31 ? 474  GLU A OE1 1 
ATOM   5503 O OE2 . GLU A 1 481 ? 15.754  16.313  -29.584 1.00 20.42 ? 474  GLU A OE2 1 
ATOM   5504 N N   A LEU A 1 482 ? 14.324  14.187  -33.651 0.14 12.30 ? 475  LEU A N   1 
ATOM   5505 N N   B LEU A 1 482 ? 14.292  14.176  -33.670 0.28 12.28 ? 475  LEU A N   1 
ATOM   5506 N N   C LEU A 1 482 ? 14.311  14.182  -33.670 0.58 12.18 ? 475  LEU A N   1 
ATOM   5507 C CA  A LEU A 1 482 ? 15.237  13.195  -34.229 0.14 11.56 ? 475  LEU A CA  1 
ATOM   5508 C CA  B LEU A 1 482 ? 15.190  13.171  -34.246 0.28 11.50 ? 475  LEU A CA  1 
ATOM   5509 C CA  C LEU A 1 482 ? 15.279  13.230  -34.222 0.58 11.35 ? 475  LEU A CA  1 
ATOM   5510 C C   A LEU A 1 482 ? 14.880  12.869  -35.674 0.14 10.88 ? 475  LEU A C   1 
ATOM   5511 C C   B LEU A 1 482 ? 14.890  12.877  -35.715 0.28 10.83 ? 475  LEU A C   1 
ATOM   5512 C C   C LEU A 1 482 ? 15.010  12.901  -35.684 0.58 10.83 ? 475  LEU A C   1 
ATOM   5513 O O   A LEU A 1 482 ? 15.722  12.414  -36.449 0.14 11.83 ? 475  LEU A O   1 
ATOM   5514 O O   B LEU A 1 482 ? 15.757  12.417  -36.458 0.28 11.76 ? 475  LEU A O   1 
ATOM   5515 O O   C LEU A 1 482 ? 15.935  12.681  -36.465 0.58 10.55 ? 475  LEU A O   1 
ATOM   5516 C CB  A LEU A 1 482 ? 15.238  11.909  -33.396 0.14 12.40 ? 475  LEU A CB  1 
ATOM   5517 C CB  B LEU A 1 482 ? 15.123  11.867  -33.443 0.28 12.44 ? 475  LEU A CB  1 
ATOM   5518 C CB  C LEU A 1 482 ? 15.292  11.953  -33.384 0.58 12.35 ? 475  LEU A CB  1 
ATOM   5519 C CG  A LEU A 1 482 ? 16.096  11.868  -32.129 0.14 15.90 ? 475  LEU A CG  1 
ATOM   5520 C CG  B LEU A 1 482 ? 15.774  11.816  -32.058 0.28 15.93 ? 475  LEU A CG  1 
ATOM   5521 C CG  C LEU A 1 482 ? 15.910  12.158  -32.001 0.58 16.90 ? 475  LEU A CG  1 
ATOM   5522 C CD1 A LEU A 1 482 ? 15.992  10.499  -31.485 0.14 18.19 ? 475  LEU A CD1 1 
ATOM   5523 C CD1 B LEU A 1 482 ? 15.591  10.433  -31.459 0.28 17.86 ? 475  LEU A CD1 1 
ATOM   5524 C CD1 C LEU A 1 482 ? 15.804  10.887  -31.218 0.58 20.30 ? 475  LEU A CD1 1 
ATOM   5525 C CD2 A LEU A 1 482 ? 17.552  12.211  -32.435 0.14 14.40 ? 475  LEU A CD2 1 
ATOM   5526 C CD2 B LEU A 1 482 ? 17.253  12.179  -32.131 0.28 15.81 ? 475  LEU A CD2 1 
ATOM   5527 C CD2 C LEU A 1 482 ? 17.373  12.603  -32.111 0.58 15.28 ? 475  LEU A CD2 1 
ATOM   5528 N N   A THR A 1 483 ? 13.621  13.104  -36.016 0.14 11.23 ? 476  THR A N   1 
ATOM   5529 N N   B THR A 1 483 ? 13.660  13.155  -36.127 0.28 11.34 ? 476  THR A N   1 
ATOM   5530 N N   C THR A 1 483 ? 13.736  12.893  -36.039 0.58 10.44 ? 476  THR A N   1 
ATOM   5531 C CA  A THR A 1 483 ? 13.115  12.909  -37.367 0.14 10.99 ? 476  THR A CA  1 
ATOM   5532 C CA  B THR A 1 483 ? 13.216  12.888  -37.492 0.28 10.83 ? 476  THR A CA  1 
ATOM   5533 C CA  C THR A 1 483 ? 13.288  12.688  -37.414 0.58 10.30 ? 476  THR A CA  1 
ATOM   5534 C C   A THR A 1 483 ? 13.912  13.695  -38.405 0.14 14.02 ? 476  THR A C   1 
ATOM   5535 C C   B THR A 1 483 ? 13.843  13.850  -38.502 0.28 13.84 ? 476  THR A C   1 
ATOM   5536 C C   C THR A 1 483 ? 13.985  13.573  -38.440 0.58 14.49 ? 476  THR A C   1 
ATOM   5537 O O   A THR A 1 483 ? 14.138  13.225  -39.522 0.14 14.87 ? 476  THR A O   1 
ATOM   5538 O O   B THR A 1 483 ? 13.698  13.686  -39.714 0.28 9.67  ? 476  THR A O   1 
ATOM   5539 O O   C THR A 1 483 ? 14.118  13.200  -39.605 0.58 15.09 ? 476  THR A O   1 
ATOM   5540 C CB  A THR A 1 483 ? 11.634  13.323  -37.443 0.14 11.34 ? 476  THR A CB  1 
ATOM   5541 C CB  B THR A 1 483 ? 11.683  12.984  -37.585 0.28 12.17 ? 476  THR A CB  1 
ATOM   5542 C CB  C THR A 1 483 ? 11.781  12.939  -37.500 0.58 11.91 ? 476  THR A CB  1 
ATOM   5543 O OG1 A THR A 1 483 ? 10.850  12.438  -36.634 0.14 12.86 ? 476  THR A OG1 1 
ATOM   5544 O OG1 B THR A 1 483 ? 11.100  12.320  -36.460 0.28 12.96 ? 476  THR A OG1 1 
ATOM   5545 O OG1 C THR A 1 483 ? 11.120  12.134  -36.521 0.58 12.96 ? 476  THR A OG1 1 
ATOM   5546 C CG2 A THR A 1 483 ? 11.122  13.276  -38.871 0.14 12.40 ? 476  THR A CG2 1 
ATOM   5547 C CG2 B THR A 1 483 ? 11.162  12.334  -38.863 0.28 14.15 ? 476  THR A CG2 1 
ATOM   5548 C CG2 C THR A 1 483 ? 11.231  12.589  -38.886 0.58 14.37 ? 476  THR A CG2 1 
ATOM   5549 N N   A TYR A 1 484 ? 14.351  14.887  -38.021 0.14 12.49 ? 477  TYR A N   1 
ATOM   5550 N N   B TYR A 1 484 ? 14.553  14.852  -38.005 0.28 12.56 ? 477  TYR A N   1 
ATOM   5551 N N   C TYR A 1 484 ? 14.426  14.748  -38.015 0.58 12.59 ? 477  TYR A N   1 
ATOM   5552 C CA  A TYR A 1 484 ? 14.969  15.811  -38.962 0.14 11.32 ? 477  TYR A CA  1 
ATOM   5553 C CA  B TYR A 1 484 ? 15.100  15.875  -38.885 0.28 11.56 ? 477  TYR A CA  1 
ATOM   5554 C CA  C TYR A 1 484 ? 14.983  15.717  -38.952 0.58 11.08 ? 477  TYR A CA  1 
ATOM   5555 C C   A TYR A 1 484 ? 16.488  15.813  -38.852 0.14 12.82 ? 477  TYR A C   1 
ATOM   5556 C C   B TYR A 1 484 ? 16.614  15.947  -38.788 0.28 12.66 ? 477  TYR A C   1 
ATOM   5557 C C   C TYR A 1 484 ? 16.505  15.699  -38.952 0.58 13.14 ? 477  TYR A C   1 
ATOM   5558 O O   A TYR A 1 484 ? 17.157  16.689  -39.397 0.14 12.59 ? 477  TYR A O   1 
ATOM   5559 O O   B TYR A 1 484 ? 17.240  16.851  -39.336 0.28 12.92 ? 477  TYR A O   1 
ATOM   5560 O O   C TYR A 1 484 ? 17.146  16.406  -39.727 0.58 10.95 ? 477  TYR A O   1 
ATOM   5561 C CB  A TYR A 1 484 ? 14.409  17.214  -38.737 0.14 14.36 ? 477  TYR A CB  1 
ATOM   5562 C CB  B TYR A 1 484 ? 14.449  17.217  -38.565 0.28 14.25 ? 477  TYR A CB  1 
ATOM   5563 C CB  C TYR A 1 484 ? 14.435  17.100  -38.620 0.58 14.48 ? 477  TYR A CB  1 
ATOM   5564 C CG  A TYR A 1 484 ? 12.910  17.198  -38.567 0.14 13.02 ? 477  TYR A CG  1 
ATOM   5565 C CG  B TYR A 1 484 ? 12.956  17.121  -38.741 0.28 13.48 ? 477  TYR A CG  1 
ATOM   5566 C CG  C TYR A 1 484 ? 12.933  17.040  -38.547 0.58 12.91 ? 477  TYR A CG  1 
ATOM   5567 C CD1 A TYR A 1 484 ? 12.067  17.140  -39.671 0.14 13.17 ? 477  TYR A CD1 1 
ATOM   5568 C CD1 B TYR A 1 484 ? 12.386  17.229  -40.002 0.28 12.32 ? 477  TYR A CD1 1 
ATOM   5569 C CD1 C TYR A 1 484 ? 12.172  16.945  -39.708 0.58 13.16 ? 477  TYR A CD1 1 
ATOM   5570 C CD2 A TYR A 1 484 ? 12.336  17.202  -37.303 0.14 13.88 ? 477  TYR A CD2 1 
ATOM   5571 C CD2 B TYR A 1 484 ? 12.121  16.857  -37.663 0.28 13.33 ? 477  TYR A CD2 1 
ATOM   5572 C CD2 C TYR A 1 484 ? 12.275  17.004  -37.327 0.58 14.20 ? 477  TYR A CD2 1 
ATOM   5573 C CE1 A TYR A 1 484 ? 10.698  17.106  -39.517 0.14 13.74 ? 477  TYR A CE1 1 
ATOM   5574 C CE1 B TYR A 1 484 ? 11.028  17.112  -40.179 0.28 10.81 ? 477  TYR A CE1 1 
ATOM   5575 C CE1 C TYR A 1 484 ? 10.806  16.847  -39.651 0.58 12.95 ? 477  TYR A CE1 1 
ATOM   5576 C CE2 A TYR A 1 484 ? 10.969  17.168  -37.141 0.14 12.13 ? 477  TYR A CE2 1 
ATOM   5577 C CE2 B TYR A 1 484 ? 10.761  16.739  -37.831 0.28 12.04 ? 477  TYR A CE2 1 
ATOM   5578 C CE2 C TYR A 1 484 ? 10.909  16.912  -37.263 0.58 11.30 ? 477  TYR A CE2 1 
ATOM   5579 C CZ  A TYR A 1 484 ? 10.155  17.123  -38.248 0.14 14.82 ? 477  TYR A CZ  1 
ATOM   5580 C CZ  B TYR A 1 484 ? 10.220  16.864  -39.092 0.28 15.33 ? 477  TYR A CZ  1 
ATOM   5581 C CZ  C TYR A 1 484 ? 10.179  16.835  -38.422 0.58 16.50 ? 477  TYR A CZ  1 
ATOM   5582 O OH  A TYR A 1 484 ? 8.791   17.091  -38.082 0.14 14.43 ? 477  TYR A OH  1 
ATOM   5583 O OH  B TYR A 1 484 ? 8.862   16.747  -39.263 0.28 14.18 ? 477  TYR A OH  1 
ATOM   5584 O OH  C TYR A 1 484 ? 8.812   16.743  -38.347 0.58 17.29 ? 477  TYR A OH  1 
ATOM   5585 N N   A PHE A 1 485 ? 17.023  14.818  -38.150 0.14 11.41 ? 478  PHE A N   1 
ATOM   5586 N N   B PHE A 1 485 ? 17.188  14.966  -38.099 0.28 11.10 ? 478  PHE A N   1 
ATOM   5587 N N   C PHE A 1 485 ? 17.069  14.845  -38.102 0.58 11.34 ? 478  PHE A N   1 
ATOM   5588 C CA  A PHE A 1 485 ? 18.464  14.641  -38.028 0.14 11.92 ? 478  PHE A CA  1 
ATOM   5589 C CA  B PHE A 1 485 ? 18.629  14.773  -38.061 0.28 12.05 ? 478  PHE A CA  1 
ATOM   5590 C CA  C PHE A 1 485 ? 18.504  14.617  -38.055 0.58 11.87 ? 478  PHE A CA  1 
ATOM   5591 C C   A PHE A 1 485 ? 18.927  13.347  -38.679 0.14 10.11 ? 478  PHE A C   1 
ATOM   5592 C C   B PHE A 1 485 ? 19.019  13.441  -38.685 0.28 10.15 ? 478  PHE A C   1 
ATOM   5593 C C   C PHE A 1 485 ? 18.915  13.312  -38.713 0.58 9.76  ? 478  PHE A C   1 
ATOM   5594 O O   A PHE A 1 485 ? 19.954  13.315  -39.354 0.14 13.31 ? 478  PHE A O   1 
ATOM   5595 O O   B PHE A 1 485 ? 20.040  13.340  -39.359 0.28 13.35 ? 478  PHE A O   1 
ATOM   5596 O O   C PHE A 1 485 ? 19.964  13.235  -39.344 0.58 13.38 ? 478  PHE A O   1 
ATOM   5597 C CB  A PHE A 1 485 ? 18.888  14.646  -36.559 0.14 12.87 ? 478  PHE A CB  1 
ATOM   5598 C CB  B PHE A 1 485 ? 19.148  14.835  -36.626 0.28 12.85 ? 478  PHE A CB  1 
ATOM   5599 C CB  C PHE A 1 485 ? 18.994  14.608  -36.609 0.58 12.94 ? 478  PHE A CB  1 
ATOM   5600 C CG  A PHE A 1 485 ? 18.912  16.008  -35.940 0.14 12.43 ? 478  PHE A CG  1 
ATOM   5601 C CG  B PHE A 1 485 ? 19.169  16.214  -36.049 0.28 12.50 ? 478  PHE A CG  1 
ATOM   5602 C CG  C PHE A 1 485 ? 19.045  15.960  -35.984 0.58 12.46 ? 478  PHE A CG  1 
ATOM   5603 C CD1 A PHE A 1 485 ? 20.008  16.837  -36.107 0.14 12.10 ? 478  PHE A CD1 1 
ATOM   5604 C CD1 B PHE A 1 485 ? 20.149  17.116  -36.421 0.28 11.39 ? 478  PHE A CD1 1 
ATOM   5605 C CD1 C PHE A 1 485 ? 20.133  16.791  -36.192 0.58 12.30 ? 478  PHE A CD1 1 
ATOM   5606 C CD2 A PHE A 1 485 ? 17.843  16.459  -35.186 0.14 13.40 ? 478  PHE A CD2 1 
ATOM   5607 C CD2 B PHE A 1 485 ? 18.218  16.606  -35.126 0.28 14.52 ? 478  PHE A CD2 1 
ATOM   5608 C CD2 C PHE A 1 485 ? 18.007  16.406  -35.188 0.58 14.02 ? 478  PHE A CD2 1 
ATOM   5609 C CE1 A PHE A 1 485 ? 20.036  18.091  -35.536 0.14 13.81 ? 478  PHE A CE1 1 
ATOM   5610 C CE1 B PHE A 1 485 ? 20.175  18.385  -35.889 0.28 13.44 ? 478  PHE A CE1 1 
ATOM   5611 C CE1 C PHE A 1 485 ? 20.186  18.039  -35.613 0.58 14.51 ? 478  PHE A CE1 1 
ATOM   5612 C CE2 A PHE A 1 485 ? 17.867  17.713  -34.612 0.14 14.99 ? 478  PHE A CE2 1 
ATOM   5613 C CE2 B PHE A 1 485 ? 18.243  17.876  -34.590 0.28 14.08 ? 478  PHE A CE2 1 
ATOM   5614 C CE2 C PHE A 1 485 ? 18.061  17.655  -34.607 0.58 15.09 ? 478  PHE A CE2 1 
ATOM   5615 C CZ  A PHE A 1 485 ? 18.967  18.527  -34.785 0.14 13.84 ? 478  PHE A CZ  1 
ATOM   5616 C CZ  B PHE A 1 485 ? 19.226  18.763  -34.971 0.28 14.97 ? 478  PHE A CZ  1 
ATOM   5617 C CZ  C PHE A 1 485 ? 19.154  18.465  -34.815 0.58 13.81 ? 478  PHE A CZ  1 
ATOM   5618 N N   A PHE A 1 486 ? 18.169  12.278  -38.460 0.14 11.99 ? 479  PHE A N   1 
ATOM   5619 N N   B PHE A 1 486 ? 18.202  12.418  -38.449 0.28 12.01 ? 479  PHE A N   1 
ATOM   5620 N N   C PHE A 1 486 ? 18.103  12.277  -38.532 0.58 12.02 ? 479  PHE A N   1 
ATOM   5621 C CA  A PHE A 1 486 ? 18.565  10.953  -38.914 0.14 9.74  ? 479  PHE A CA  1 
ATOM   5622 C CA  B PHE A 1 486 ? 18.525  11.063  -38.881 0.28 9.72  ? 479  PHE A CA  1 
ATOM   5623 C CA  C PHE A 1 486 ? 18.470  10.933  -38.951 0.58 9.56  ? 479  PHE A CA  1 
ATOM   5624 C C   A PHE A 1 486 ? 17.514  10.293  -39.796 0.14 13.31 ? 479  PHE A C   1 
ATOM   5625 C C   B PHE A 1 486 ? 17.452  10.451  -39.774 0.28 12.97 ? 479  PHE A C   1 
ATOM   5626 C C   C PHE A 1 486 ? 17.437  10.261  -39.846 0.58 13.43 ? 479  PHE A C   1 
ATOM   5627 O O   A PHE A 1 486 ? 16.312  10.422  -39.561 0.14 12.16 ? 479  PHE A O   1 
ATOM   5628 O O   B PHE A 1 486 ? 16.255  10.645  -39.555 0.28 12.24 ? 479  PHE A O   1 
ATOM   5629 O O   C PHE A 1 486 ? 16.231  10.339  -39.604 0.58 11.95 ? 479  PHE A O   1 
ATOM   5630 C CB  A PHE A 1 486 ? 18.855  10.047  -37.716 0.14 10.98 ? 479  PHE A CB  1 
ATOM   5631 C CB  B PHE A 1 486 ? 18.738  10.154  -37.669 0.28 10.84 ? 479  PHE A CB  1 
ATOM   5632 C CB  C PHE A 1 486 ? 18.702  10.045  -37.728 0.58 10.73 ? 479  PHE A CB  1 
ATOM   5633 C CG  A PHE A 1 486 ? 19.969  10.537  -36.844 0.14 12.42 ? 479  PHE A CG  1 
ATOM   5634 C CG  B PHE A 1 486 ? 19.738  10.677  -36.687 0.28 13.51 ? 479  PHE A CG  1 
ATOM   5635 C CG  C PHE A 1 486 ? 19.836  10.488  -36.872 0.58 12.22 ? 479  PHE A CG  1 
ATOM   5636 C CD1 A PHE A 1 486 ? 21.289  10.305  -37.192 0.14 11.56 ? 479  PHE A CD1 1 
ATOM   5637 C CD1 B PHE A 1 486 ? 21.084  10.726  -37.007 0.28 11.50 ? 479  PHE A CD1 1 
ATOM   5638 C CD1 C PHE A 1 486 ? 21.145  10.234  -37.249 0.58 11.69 ? 479  PHE A CD1 1 
ATOM   5639 C CD2 A PHE A 1 486 ? 19.699  11.232  -35.675 0.14 12.83 ? 479  PHE A CD2 1 
ATOM   5640 C CD2 B PHE A 1 486 ? 19.333  11.117  -35.435 0.28 12.27 ? 479  PHE A CD2 1 
ATOM   5641 C CD2 C PHE A 1 486 ? 19.599  11.183  -35.690 0.58 12.97 ? 479  PHE A CD2 1 
ATOM   5642 C CE1 A PHE A 1 486 ? 22.319  10.754  -36.389 0.14 9.72  ? 479  PHE A CE1 1 
ATOM   5643 C CE1 B PHE A 1 486 ? 22.004  11.206  -36.100 0.28 10.74 ? 479  PHE A CE1 1 
ATOM   5644 C CE1 C PHE A 1 486 ? 22.195  10.651  -36.457 0.58 9.39  ? 479  PHE A CE1 1 
ATOM   5645 C CE2 A PHE A 1 486 ? 20.723  11.682  -34.867 0.14 12.08 ? 479  PHE A CE2 1 
ATOM   5646 C CE2 B PHE A 1 486 ? 20.253  11.595  -34.522 0.28 10.05 ? 479  PHE A CE2 1 
ATOM   5647 C CE2 C PHE A 1 486 ? 20.642  11.596  -34.894 0.58 12.20 ? 479  PHE A CE2 1 
ATOM   5648 C CZ  A PHE A 1 486 ? 22.034  11.446  -35.225 0.14 9.73  ? 479  PHE A CZ  1 
ATOM   5649 C CZ  B PHE A 1 486 ? 21.590  11.643  -34.858 0.28 9.90  ? 479  PHE A CZ  1 
ATOM   5650 C CZ  C PHE A 1 486 ? 21.938  11.340  -35.278 0.58 9.23  ? 479  PHE A CZ  1 
ATOM   5651 N N   A TRP A 1 487 ? 17.980  9.577   -40.813 0.14 13.07 ? 480  TRP A N   1 
ATOM   5652 N N   B TRP A 1 487 ? 17.890  9.695   -40.775 0.28 13.23 ? 480  TRP A N   1 
ATOM   5653 N N   C TRP A 1 487 ? 17.926  9.580   -40.875 0.58 13.03 ? 480  TRP A N   1 
ATOM   5654 C CA  A TRP A 1 487 ? 17.097  8.752   -41.617 0.14 11.91 ? 480  TRP A CA  1 
ATOM   5655 C CA  B TRP A 1 487 ? 16.967  8.939   -41.604 0.28 11.89 ? 480  TRP A CA  1 
ATOM   5656 C CA  C TRP A 1 487 ? 17.068  8.695   -41.634 0.58 11.64 ? 480  TRP A CA  1 
ATOM   5657 C C   A TRP A 1 487 ? 16.728  7.499   -40.827 0.14 13.28 ? 480  TRP A C   1 
ATOM   5658 C C   B TRP A 1 487 ? 16.570  7.662   -40.857 0.28 13.89 ? 480  TRP A C   1 
ATOM   5659 C C   C TRP A 1 487 ? 16.680  7.525   -40.722 0.58 13.07 ? 480  TRP A C   1 
ATOM   5660 O O   A TRP A 1 487 ? 17.571  6.914   -40.148 0.14 15.21 ? 480  TRP A O   1 
ATOM   5661 O O   B TRP A 1 487 ? 17.403  7.035   -40.206 0.28 14.96 ? 480  TRP A O   1 
ATOM   5662 O O   C TRP A 1 487 ? 17.414  7.182   -39.798 0.58 14.98 ? 480  TRP A O   1 
ATOM   5663 C CB  A TRP A 1 487 ? 17.760  8.387   -42.949 0.14 14.22 ? 480  TRP A CB  1 
ATOM   5664 C CB  B TRP A 1 487 ? 17.599  8.616   -42.964 0.28 13.91 ? 480  TRP A CB  1 
ATOM   5665 C CB  C TRP A 1 487 ? 17.771  8.211   -42.905 0.58 15.63 ? 480  TRP A CB  1 
ATOM   5666 C CG  A TRP A 1 487 ? 17.048  7.303   -43.703 0.14 13.63 ? 480  TRP A CG  1 
ATOM   5667 C CG  B TRP A 1 487 ? 16.600  8.229   -44.009 0.28 15.17 ? 480  TRP A CG  1 
ATOM   5668 C CG  C TRP A 1 487 ? 16.999  7.158   -43.631 0.58 13.02 ? 480  TRP A CG  1 
ATOM   5669 C CD1 A TRP A 1 487 ? 17.259  5.956   -43.602 0.14 14.54 ? 480  TRP A CD1 1 
ATOM   5670 C CD1 B TRP A 1 487 ? 15.941  9.068   -44.861 0.28 17.50 ? 480  TRP A CD1 1 
ATOM   5671 C CD1 C TRP A 1 487 ? 17.110  5.798   -43.483 0.58 13.35 ? 480  TRP A CD1 1 
ATOM   5672 C CD2 A TRP A 1 487 ? 16.012  7.474   -44.679 0.14 11.97 ? 480  TRP A CD2 1 
ATOM   5673 C CD2 B TRP A 1 487 ? 16.140  6.906   -44.314 0.28 15.79 ? 480  TRP A CD2 1 
ATOM   5674 C CD2 C TRP A 1 487 ? 15.981  7.371   -44.620 0.58 11.34 ? 480  TRP A CD2 1 
ATOM   5675 N NE1 A TRP A 1 487 ? 16.416  5.280   -44.453 0.14 18.69 ? 480  TRP A NE1 1 
ATOM   5676 N NE1 B TRP A 1 487 ? 15.101  8.350   -45.676 0.28 17.80 ? 480  TRP A NE1 1 
ATOM   5677 N NE1 C TRP A 1 487 ? 16.223  5.157   -44.323 0.58 20.50 ? 480  TRP A NE1 1 
ATOM   5678 C CE2 A TRP A 1 487 ? 15.642  6.188   -45.124 0.14 15.50 ? 480  TRP A CE2 1 
ATOM   5679 C CE2 B TRP A 1 487 ? 15.204  7.020   -45.361 0.28 17.14 ? 480  TRP A CE2 1 
ATOM   5680 C CE2 C TRP A 1 487 ? 15.522  6.099   -45.027 0.58 14.88 ? 480  TRP A CE2 1 
ATOM   5681 C CE3 A TRP A 1 487 ? 15.361  8.587   -45.218 0.14 14.69 ? 480  TRP A CE3 1 
ATOM   5682 C CE3 B TRP A 1 487 ? 16.429  5.635   -43.802 0.28 19.15 ? 480  TRP A CE3 1 
ATOM   5683 C CE3 C TRP A 1 487 ? 15.414  8.510   -45.194 0.58 14.54 ? 480  TRP A CE3 1 
ATOM   5684 C CZ2 A TRP A 1 487 ? 14.649  5.987   -46.082 0.14 19.08 ? 480  TRP A CZ2 1 
ATOM   5685 C CZ2 B TRP A 1 487 ? 14.554  5.913   -45.908 0.28 19.28 ? 480  TRP A CZ2 1 
ATOM   5686 C CZ2 C TRP A 1 487 ? 14.519  5.943   -45.989 0.58 19.42 ? 480  TRP A CZ2 1 
ATOM   5687 C CZ3 A TRP A 1 487 ? 14.377  8.385   -46.171 0.14 16.03 ? 480  TRP A CZ3 1 
ATOM   5688 C CZ3 B TRP A 1 487 ? 15.781  4.536   -44.345 0.28 14.26 ? 480  TRP A CZ3 1 
ATOM   5689 C CZ3 C TRP A 1 487 ? 14.424  8.351   -46.154 0.58 16.05 ? 480  TRP A CZ3 1 
ATOM   5690 C CH2 A TRP A 1 487 ? 14.030  7.096   -46.590 0.14 14.19 ? 480  TRP A CH2 1 
ATOM   5691 C CH2 B TRP A 1 487 ? 14.855  4.684   -45.388 0.28 19.23 ? 480  TRP A CH2 1 
ATOM   5692 C CH2 C TRP A 1 487 ? 13.985  7.080   -46.533 0.58 14.00 ? 480  TRP A CH2 1 
ATOM   5693 N N   A ASN A 1 488 ? 15.462  7.104   -40.899 0.14 13.87 ? 481  ASN A N   1 
ATOM   5694 N N   B ASN A 1 488 ? 15.291  7.302   -40.926 0.28 13.55 ? 481  ASN A N   1 
ATOM   5695 N N   C ASN A 1 488 ? 15.504  6.951   -40.966 0.58 14.04 ? 481  ASN A N   1 
ATOM   5696 C CA  A ASN A 1 488 ? 15.019  5.853   -40.293 0.14 12.58 ? 481  ASN A CA  1 
ATOM   5697 C CA  B ASN A 1 488 ? 14.799  6.078   -40.292 0.28 13.91 ? 481  ASN A CA  1 
ATOM   5698 C CA  C ASN A 1 488 ? 15.045  5.748   -40.270 0.58 12.13 ? 481  ASN A CA  1 
ATOM   5699 C C   A ASN A 1 488 ? 14.111  5.108   -41.257 0.14 15.78 ? 481  ASN A C   1 
ATOM   5700 C C   B ASN A 1 488 ? 14.024  5.234   -41.290 0.28 15.78 ? 481  ASN A C   1 
ATOM   5701 C C   C ASN A 1 488 ? 14.046  5.041   -41.159 0.58 16.50 ? 481  ASN A C   1 
ATOM   5702 O O   A ASN A 1 488 ? 13.698  5.661   -42.276 0.14 14.26 ? 481  ASN A O   1 
ATOM   5703 O O   B ASN A 1 488 ? 13.655  5.725   -42.352 0.28 14.23 ? 481  ASN A O   1 
ATOM   5704 O O   C ASN A 1 488 ? 13.501  5.662   -42.076 0.58 13.77 ? 481  ASN A O   1 
ATOM   5705 C CB  A ASN A 1 488 ? 14.301  6.106   -38.962 0.14 12.67 ? 481  ASN A CB  1 
ATOM   5706 C CB  B ASN A 1 488 ? 13.915  6.404   -39.083 0.28 13.30 ? 481  ASN A CB  1 
ATOM   5707 C CB  C ASN A 1 488 ? 14.403  6.083   -38.916 0.58 12.56 ? 481  ASN A CB  1 
ATOM   5708 C CG  A ASN A 1 488 ? 12.969  6.814   -39.137 0.14 12.73 ? 481  ASN A CG  1 
ATOM   5709 C CG  B ASN A 1 488 ? 12.746  7.309   -39.436 0.28 12.66 ? 481  ASN A CG  1 
ATOM   5710 C CG  C ASN A 1 488 ? 13.019  6.722   -39.056 0.58 12.68 ? 481  ASN A CG  1 
ATOM   5711 O OD1 A ASN A 1 488 ? 11.955  6.185   -39.430 0.14 12.29 ? 481  ASN A OD1 1 
ATOM   5712 O OD1 B ASN A 1 488 ? 11.887  6.949   -40.239 0.28 12.14 ? 481  ASN A OD1 1 
ATOM   5713 O OD1 C ASN A 1 488 ? 12.036  6.050   -39.369 0.58 12.30 ? 481  ASN A OD1 1 
ATOM   5714 N ND2 A ASN A 1 488 ? 12.964  8.126   -38.941 0.14 14.62 ? 481  ASN A ND2 1 
ATOM   5715 N ND2 B ASN A 1 488 ? 12.694  8.481   -38.816 0.28 13.52 ? 481  ASN A ND2 1 
ATOM   5716 N ND2 C ASN A 1 488 ? 12.935  8.016   -38.784 0.58 14.48 ? 481  ASN A ND2 1 
ATOM   5717 N N   A GLN A 1 489 ? 13.790  3.859   -40.933 0.14 12.94 ? 482  GLN A N   1 
ATOM   5718 N N   B GLN A 1 489 ? 13.753  3.976   -40.950 0.28 13.06 ? 482  GLN A N   1 
ATOM   5719 N N   C GLN A 1 489 ? 13.752  3.775   -40.863 0.58 12.28 ? 482  GLN A N   1 
ATOM   5720 C CA  A GLN A 1 489 ? 13.044  3.006   -41.853 0.14 14.45 ? 482  GLN A CA  1 
ATOM   5721 C CA  B GLN A 1 489 ? 13.085  3.094   -41.901 0.28 14.38 ? 482  GLN A CA  1 
ATOM   5722 C CA  C GLN A 1 489 ? 13.020  2.944   -41.817 0.58 14.44 ? 482  GLN A CA  1 
ATOM   5723 C C   A GLN A 1 489 ? 11.640  3.524   -42.165 0.14 12.59 ? 482  GLN A C   1 
ATOM   5724 C C   B GLN A 1 489 ? 11.639  3.518   -42.162 0.28 12.54 ? 482  GLN A C   1 
ATOM   5725 C C   C GLN A 1 489 ? 11.532  3.278   -41.968 0.58 13.14 ? 482  GLN A C   1 
ATOM   5726 O O   A GLN A 1 489 ? 11.095  3.240   -43.234 0.14 11.98 ? 482  GLN A O   1 
ATOM   5727 O O   B GLN A 1 489 ? 11.060  3.159   -43.190 0.28 11.99 ? 482  GLN A O   1 
ATOM   5728 O O   C GLN A 1 489 ? 10.823  2.614   -42.736 0.58 14.86 ? 482  GLN A O   1 
ATOM   5729 C CB  A GLN A 1 489 ? 12.967  1.583   -41.294 0.14 14.02 ? 482  GLN A CB  1 
ATOM   5730 C CB  B GLN A 1 489 ? 13.138  1.640   -41.421 0.28 13.65 ? 482  GLN A CB  1 
ATOM   5731 C CB  C GLN A 1 489 ? 13.176  1.467   -41.446 0.58 13.21 ? 482  GLN A CB  1 
ATOM   5732 C CG  A GLN A 1 489 ? 12.657  1.512   -39.809 0.14 13.78 ? 482  GLN A CG  1 
ATOM   5733 C CG  B GLN A 1 489 ? 12.272  1.324   -40.214 0.28 14.86 ? 482  GLN A CG  1 
ATOM   5734 C CG  C GLN A 1 489 ? 12.400  1.036   -40.210 0.58 15.68 ? 482  GLN A CG  1 
ATOM   5735 C CD  A GLN A 1 489 ? 12.966  0.151   -39.221 0.14 15.06 ? 482  GLN A CD  1 
ATOM   5736 C CD  B GLN A 1 489 ? 12.242  -0.164  -39.914 0.28 17.52 ? 482  GLN A CD  1 
ATOM   5737 C CD  C GLN A 1 489 ? 12.456  -0.467  -40.007 0.58 17.48 ? 482  GLN A CD  1 
ATOM   5738 O OE1 A GLN A 1 489 ? 12.580  -0.878  -39.775 0.14 18.15 ? 482  GLN A OE1 1 
ATOM   5739 O OE1 B GLN A 1 489 ? 13.177  -0.892  -40.242 0.28 17.49 ? 482  GLN A OE1 1 
ATOM   5740 O OE1 C GLN A 1 489 ? 13.318  -1.144  -40.566 0.58 19.66 ? 482  GLN A OE1 1 
ATOM   5741 N NE2 A GLN A 1 489 ? 13.678  0.137   -38.100 0.14 20.65 ? 482  GLN A NE2 1 
ATOM   5742 N NE2 B GLN A 1 489 ? 11.152  -0.627  -39.313 0.28 16.05 ? 482  GLN A NE2 1 
ATOM   5743 N NE2 C GLN A 1 489 ? 11.518  -1.002  -39.231 0.58 15.51 ? 482  GLN A NE2 1 
ATOM   5744 N N   . LEU A 1 490 ? 11.057  4.289   -41.248 1.00 13.84 ? 483  LEU A N   1 
ATOM   5745 C CA  . LEU A 1 490 ? 9.709   4.831   -41.468 1.00 10.04 ? 483  LEU A CA  1 
ATOM   5746 C C   . LEU A 1 490 ? 9.715   6.083   -42.349 1.00 13.49 ? 483  LEU A C   1 
ATOM   5747 O O   . LEU A 1 490 ? 8.659   6.610   -42.696 1.00 16.28 ? 483  LEU A O   1 
ATOM   5748 C CB  . LEU A 1 490 ? 9.028   5.157   -40.134 1.00 12.64 ? 483  LEU A CB  1 
ATOM   5749 C CG  . LEU A 1 490 ? 8.977   4.052   -39.095 1.00 12.92 ? 483  LEU A CG  1 
ATOM   5750 C CD1 . LEU A 1 490 ? 8.182   4.531   -37.868 1.00 12.31 ? 483  LEU A CD1 1 
ATOM   5751 C CD2 . LEU A 1 490 ? 8.389   2.759   -39.646 1.00 13.79 ? 483  LEU A CD2 1 
ATOM   5752 N N   A ALA A 1 491 ? 10.904  6.538   -42.733 0.40 16.17 ? 484  ALA A N   1 
ATOM   5753 N N   B ALA A 1 491 ? 10.900  6.558   -42.716 0.60 16.07 ? 484  ALA A N   1 
ATOM   5754 C CA  A ALA A 1 491 ? 11.048  7.787   -43.474 0.40 14.56 ? 484  ALA A CA  1 
ATOM   5755 C CA  B ALA A 1 491 ? 11.013  7.795   -43.476 0.60 14.52 ? 484  ALA A CA  1 
ATOM   5756 C C   A ALA A 1 491 ? 10.866  7.605   -44.982 0.40 15.83 ? 484  ALA A C   1 
ATOM   5757 C C   B ALA A 1 491 ? 10.634  7.596   -44.940 0.60 14.44 ? 484  ALA A C   1 
ATOM   5758 O O   A ALA A 1 491 ? 11.012  6.498   -45.511 0.40 12.36 ? 484  ALA A O   1 
ATOM   5759 O O   B ALA A 1 491 ? 10.426  6.473   -45.395 0.60 19.15 ? 484  ALA A O   1 
ATOM   5760 C CB  A ALA A 1 491 ? 12.412  8.413   -43.180 0.40 15.90 ? 484  ALA A CB  1 
ATOM   5761 C CB  B ALA A 1 491 ? 12.439  8.357   -43.370 0.60 15.97 ? 484  ALA A CB  1 
ATOM   5762 N N   . LYS A 1 492 ? 10.558  8.701   -45.668 1.00 17.66 ? 485  LYS A N   1 
ATOM   5763 C CA  . LYS A 1 492 ? 10.389  8.676   -47.119 1.00 18.77 ? 485  LYS A CA  1 
ATOM   5764 C C   . LYS A 1 492 ? 11.055  9.892   -47.715 1.00 19.13 ? 485  LYS A C   1 
ATOM   5765 O O   . LYS A 1 492 ? 11.327  10.851  -47.005 1.00 16.26 ? 485  LYS A O   1 
ATOM   5766 C CB  A LYS A 1 492 ? 8.904   8.658   -47.477 0.39 18.66 ? 485  LYS A CB  1 
ATOM   5767 C CB  B LYS A 1 492 ? 8.913   8.628   -47.520 0.61 18.70 ? 485  LYS A CB  1 
ATOM   5768 C CG  A LYS A 1 492 ? 8.089   9.674   -46.675 0.39 19.71 ? 485  LYS A CG  1 
ATOM   5769 C CG  B LYS A 1 492 ? 8.082   9.847   -47.127 0.61 17.11 ? 485  LYS A CG  1 
ATOM   5770 C CD  A LYS A 1 492 ? 6.608   9.646   -47.025 0.39 28.16 ? 485  LYS A CD  1 
ATOM   5771 C CD  B LYS A 1 492 ? 6.676   9.742   -47.716 0.61 27.21 ? 485  LYS A CD  1 
ATOM   5772 C CE  A LYS A 1 492 ? 6.340   10.324  -48.361 0.39 23.56 ? 485  LYS A CE  1 
ATOM   5773 C CE  B LYS A 1 492 ? 5.711   10.728  -47.075 0.61 21.25 ? 485  LYS A CE  1 
ATOM   5774 N NZ  A LYS A 1 492 ? 4.889   10.603  -48.560 0.39 29.23 ? 485  LYS A NZ  1 
ATOM   5775 N NZ  B LYS A 1 492 ? 5.452   10.397  -45.648 0.61 32.95 ? 485  LYS A NZ  1 
ATOM   5776 N N   A ARG A 1 493 ? 11.337  9.848   -49.018 0.57 17.64 ? 486  ARG A N   1 
ATOM   5777 N N   B ARG A 1 493 ? 11.310  9.849   -49.019 0.43 17.58 ? 486  ARG A N   1 
ATOM   5778 C CA  A ARG A 1 493 ? 11.872  11.014  -49.701 0.57 16.59 ? 486  ARG A CA  1 
ATOM   5779 C CA  B ARG A 1 493 ? 11.838  10.996  -49.738 0.43 16.72 ? 486  ARG A CA  1 
ATOM   5780 C C   A ARG A 1 493 ? 10.835  12.122  -49.667 0.57 16.97 ? 486  ARG A C   1 
ATOM   5781 C C   B ARG A 1 493 ? 10.833  12.141  -49.715 0.43 17.03 ? 486  ARG A C   1 
ATOM   5782 O O   A ARG A 1 493 ? 9.688   11.918  -50.073 0.57 21.22 ? 486  ARG A O   1 
ATOM   5783 O O   B ARG A 1 493 ? 9.703   11.985  -50.181 0.43 21.34 ? 486  ARG A O   1 
ATOM   5784 C CB  A ARG A 1 493 ? 12.259  10.694  -51.157 0.57 16.09 ? 486  ARG A CB  1 
ATOM   5785 C CB  B ARG A 1 493 ? 12.167  10.603  -51.184 0.43 15.96 ? 486  ARG A CB  1 
ATOM   5786 C CG  A ARG A 1 493 ? 13.214  11.728  -51.757 0.57 22.79 ? 486  ARG A CG  1 
ATOM   5787 C CG  B ARG A 1 493 ? 12.823  11.697  -52.003 0.43 23.44 ? 486  ARG A CG  1 
ATOM   5788 C CD  A ARG A 1 493 ? 13.241  11.735  -53.287 0.57 23.27 ? 486  ARG A CD  1 
ATOM   5789 C CD  B ARG A 1 493 ? 13.206  11.177  -53.384 0.43 25.83 ? 486  ARG A CD  1 
ATOM   5790 N NE  A ARG A 1 493 ? 13.979  12.899  -53.773 0.57 20.76 ? 486  ARG A NE  1 
ATOM   5791 N NE  B ARG A 1 493 ? 14.024  12.135  -54.120 0.43 28.89 ? 486  ARG A NE  1 
ATOM   5792 C CZ  A ARG A 1 493 ? 14.980  12.855  -54.650 0.57 19.15 ? 486  ARG A CZ  1 
ATOM   5793 C CZ  B ARG A 1 493 ? 14.892  11.802  -55.072 0.43 21.11 ? 486  ARG A CZ  1 
ATOM   5794 N NH1 A ARG A 1 493 ? 15.360  11.699  -55.172 0.57 20.20 ? 486  ARG A NH1 1 
ATOM   5795 N NH1 B ARG A 1 493 ? 15.058  10.530  -55.406 0.43 30.40 ? 486  ARG A NH1 1 
ATOM   5796 N NH2 A ARG A 1 493 ? 15.593  13.972  -55.009 0.57 31.16 ? 486  ARG A NH2 1 
ATOM   5797 N NH2 B ARG A 1 493 ? 15.598  12.740  -55.685 0.43 27.02 ? 486  ARG A NH2 1 
ATOM   5798 N N   . MET A 1 494 ? 11.231  13.287  -49.170 1.00 15.27 ? 487  MET A N   1 
ATOM   5799 C CA  . MET A 1 494 ? 10.332  14.424  -49.114 1.00 15.93 ? 487  MET A CA  1 
ATOM   5800 C C   . MET A 1 494 ? 10.667  15.369  -50.252 1.00 17.35 ? 487  MET A C   1 
ATOM   5801 O O   . MET A 1 494 ? 11.825  15.437  -50.666 1.00 19.46 ? 487  MET A O   1 
ATOM   5802 C CB  . MET A 1 494 ? 10.433  15.135  -47.763 1.00 19.77 ? 487  MET A CB  1 
ATOM   5803 C CG  . MET A 1 494 ? 9.980   14.301  -46.577 1.00 21.54 ? 487  MET A CG  1 
ATOM   5804 S SD  . MET A 1 494 ? 8.321   13.598  -46.704 1.00 22.50 ? 487  MET A SD  1 
ATOM   5805 C CE  . MET A 1 494 ? 7.317   15.027  -46.279 1.00 26.45 ? 487  MET A CE  1 
ATOM   5806 N N   . PRO A 1 495 ? 9.648   16.065  -50.791 1.00 18.30 ? 488  PRO A N   1 
ATOM   5807 C CA  . PRO A 1 495 ? 9.859   17.106  -51.800 1.00 19.11 ? 488  PRO A CA  1 
ATOM   5808 C C   . PRO A 1 495 ? 10.708  18.217  -51.225 1.00 19.88 ? 488  PRO A C   1 
ATOM   5809 O O   . PRO A 1 495 ? 10.550  18.534  -50.044 1.00 16.69 ? 488  PRO A O   1 
ATOM   5810 C CB  . PRO A 1 495 ? 8.439   17.593  -52.111 1.00 24.43 ? 488  PRO A CB  1 
ATOM   5811 C CG  . PRO A 1 495 ? 7.578   16.445  -51.760 1.00 23.81 ? 488  PRO A CG  1 
ATOM   5812 C CD  . PRO A 1 495 ? 8.217   15.851  -50.529 1.00 21.03 ? 488  PRO A CD  1 
ATOM   5813 N N   . LYS A 1 496 ? 11.589  18.791  -52.035 1.00 20.68 ? 489  LYS A N   1 
ATOM   5814 C CA  . LYS A 1 496 ? 12.500  19.824  -51.559 1.00 14.19 ? 489  LYS A CA  1 
ATOM   5815 C C   . LYS A 1 496 ? 11.791  21.091  -51.071 1.00 18.24 ? 489  LYS A C   1 
ATOM   5816 O O   . LYS A 1 496 ? 12.322  21.818  -50.227 1.00 24.44 ? 489  LYS A O   1 
ATOM   5817 C CB  . LYS A 1 496 ? 13.513  20.190  -52.642 1.00 28.51 ? 489  LYS A CB  1 
ATOM   5818 C CG  . LYS A 1 496 ? 14.589  19.149  -52.822 1.00 37.92 ? 489  LYS A CG  1 
ATOM   5819 C CD  . LYS A 1 496 ? 15.769  19.710  -53.594 1.00 51.69 ? 489  LYS A CD  1 
ATOM   5820 C CE  . LYS A 1 496 ? 15.342  20.280  -54.927 1.00 51.51 ? 489  LYS A CE  1 
ATOM   5821 N NZ  . LYS A 1 496 ? 16.318  21.298  -55.399 1.00 64.03 ? 489  LYS A NZ  1 
ATOM   5822 N N   . GLU A 1 497 ? 10.580  21.344  -51.555 1.00 17.67 ? 490  GLU A N   1 
ATOM   5823 C CA  . GLU A 1 497 ? 9.867   22.527  -51.115 1.00 22.80 ? 490  GLU A CA  1 
ATOM   5824 C C   . GLU A 1 497 ? 9.012   22.266  -49.876 1.00 21.82 ? 490  GLU A C   1 
ATOM   5825 O O   . GLU A 1 497 ? 8.399   23.190  -49.355 1.00 26.93 ? 490  GLU A O   1 
ATOM   5826 C CB  . GLU A 1 497 ? 8.999   23.072  -52.247 1.00 29.91 ? 490  GLU A CB  1 
ATOM   5827 C CG  . GLU A 1 497 ? 9.520   22.737  -53.637 1.00 36.12 ? 490  GLU A CG  1 
ATOM   5828 C CD  . GLU A 1 497 ? 9.106   21.346  -54.086 1.00 39.71 ? 490  GLU A CD  1 
ATOM   5829 O OE1 . GLU A 1 497 ? 7.917   20.998  -53.924 1.00 53.37 ? 490  GLU A OE1 1 
ATOM   5830 O OE2 . GLU A 1 497 ? 9.974   20.593  -54.575 1.00 37.98 ? 490  GLU A OE2 1 
ATOM   5831 N N   . SER A 1 498 ? 8.979   21.019  -49.411 1.00 20.90 ? 491  SER A N   1 
ATOM   5832 C CA  . SER A 1 498 ? 8.178   20.668  -48.239 1.00 15.85 ? 491  SER A CA  1 
ATOM   5833 C C   . SER A 1 498 ? 8.757   21.244  -46.946 1.00 20.95 ? 491  SER A C   1 
ATOM   5834 O O   . SER A 1 498 ? 9.978   21.382  -46.797 1.00 19.79 ? 491  SER A O   1 
ATOM   5835 C CB  . SER A 1 498 ? 8.045   19.146  -48.107 1.00 13.53 ? 491  SER A CB  1 
ATOM   5836 O OG  . SER A 1 498 ? 9.264   18.527  -47.718 1.00 16.98 ? 491  SER A OG  1 
ATOM   5837 N N   . ARG A 1 499 ? 7.871   21.563  -46.008 1.00 17.73 ? 492  ARG A N   1 
ATOM   5838 C CA  . ARG A 1 499 ? 8.304   22.092  -44.720 1.00 15.57 ? 492  ARG A CA  1 
ATOM   5839 C C   . ARG A 1 499 ? 9.195   21.101  -44.001 1.00 14.87 ? 492  ARG A C   1 
ATOM   5840 O O   . ARG A 1 499 ? 10.114  21.508  -43.285 1.00 15.82 ? 492  ARG A O   1 
ATOM   5841 C CB  . ARG A 1 499 ? 7.104   22.471  -43.844 1.00 15.88 ? 492  ARG A CB  1 
ATOM   5842 C CG  . ARG A 1 499 ? 6.037   21.439  -43.706 1.00 18.54 ? 492  ARG A CG  1 
ATOM   5843 C CD  . ARG A 1 499 ? 4.766   22.088  -43.163 1.00 15.92 ? 492  ARG A CD  1 
ATOM   5844 N NE  . ARG A 1 499 ? 4.970   22.642  -41.828 1.00 19.28 ? 492  ARG A NE  1 
ATOM   5845 C CZ  . ARG A 1 499 ? 4.741   21.952  -40.714 1.00 20.20 ? 492  ARG A CZ  1 
ATOM   5846 N NH1 . ARG A 1 499 ? 4.317   20.698  -40.802 1.00 16.47 ? 492  ARG A NH1 1 
ATOM   5847 N NH2 . ARG A 1 499 ? 4.947   22.507  -39.520 1.00 21.11 ? 492  ARG A NH2 1 
ATOM   5848 N N   . GLU A 1 500 ? 8.946   19.807  -44.185 1.00 15.82 ? 493  GLU A N   1 
ATOM   5849 C CA  . GLU A 1 500 ? 9.815   18.805  -43.562 1.00 16.22 ? 493  GLU A CA  1 
ATOM   5850 C C   . GLU A 1 500 ? 11.245  18.823  -44.123 1.00 11.55 ? 493  GLU A C   1 
ATOM   5851 O O   . GLU A 1 500 ? 12.207  18.776  -43.362 1.00 13.81 ? 493  GLU A O   1 
ATOM   5852 C CB  . GLU A 1 500 ? 9.238   17.404  -43.713 1.00 16.37 ? 493  GLU A CB  1 
ATOM   5853 C CG  . GLU A 1 500 ? 7.934   17.131  -42.966 1.00 15.69 ? 493  GLU A CG  1 
ATOM   5854 C CD  . GLU A 1 500 ? 6.709   17.746  -43.623 1.00 17.49 ? 493  GLU A CD  1 
ATOM   5855 O OE1 . GLU A 1 500 ? 6.782   18.168  -44.811 1.00 18.95 ? 493  GLU A OE1 1 
ATOM   5856 O OE2 . GLU A 1 500 ? 5.646   17.767  -42.965 1.00 19.64 ? 493  GLU A OE2 1 
ATOM   5857 N N   . TYR A 1 501 ? 11.399  18.847  -45.447 1.00 13.72 ? 494  TYR A N   1 
ATOM   5858 C CA  . TYR A 1 501 ? 12.742  18.902  -46.030 1.00 13.60 ? 494  TYR A CA  1 
ATOM   5859 C C   . TYR A 1 501 ? 13.491  20.160  -45.595 1.00 17.56 ? 494  TYR A C   1 
ATOM   5860 O O   . TYR A 1 501 ? 14.699  20.115  -45.311 1.00 13.94 ? 494  TYR A O   1 
ATOM   5861 C CB  . TYR A 1 501 ? 12.682  18.827  -47.572 1.00 17.17 ? 494  TYR A CB  1 
ATOM   5862 C CG  . TYR A 1 501 ? 14.044  18.739  -48.234 1.00 18.29 ? 494  TYR A CG  1 
ATOM   5863 C CD1 . TYR A 1 501 ? 14.616  17.498  -48.511 1.00 20.35 ? 494  TYR A CD1 1 
ATOM   5864 C CD2 . TYR A 1 501 ? 14.758  19.882  -48.568 1.00 16.90 ? 494  TYR A CD2 1 
ATOM   5865 C CE1 . TYR A 1 501 ? 15.872  17.402  -49.114 1.00 22.94 ? 494  TYR A CE1 1 
ATOM   5866 C CE2 . TYR A 1 501 ? 16.014  19.798  -49.179 1.00 18.55 ? 494  TYR A CE2 1 
ATOM   5867 C CZ  . TYR A 1 501 ? 16.562  18.556  -49.447 1.00 29.57 ? 494  TYR A CZ  1 
ATOM   5868 O OH  . TYR A 1 501 ? 17.804  18.465  -50.045 1.00 26.83 ? 494  TYR A OH  1 
ATOM   5869 N N   . LYS A 1 502 ? 12.783  21.285  -45.554 1.00 14.49 ? 495  LYS A N   1 
ATOM   5870 C CA  . LYS A 1 502 ? 13.379  22.534  -45.113 1.00 13.65 ? 495  LYS A CA  1 
ATOM   5871 C C   . LYS A 1 502 ? 13.861  22.395  -43.678 1.00 16.88 ? 495  LYS A C   1 
ATOM   5872 O O   . LYS A 1 502 ? 14.926  22.896  -43.330 1.00 15.64 ? 495  LYS A O   1 
ATOM   5873 C CB  . LYS A 1 502 ? 12.395  23.700  -45.238 1.00 16.09 ? 495  LYS A CB  1 
ATOM   5874 C CG  . LYS A 1 502 ? 12.217  24.169  -46.677 1.00 24.40 ? 495  LYS A CG  1 
ATOM   5875 C CD  . LYS A 1 502 ? 11.082  25.161  -46.801 1.00 29.65 ? 495  LYS A CD  1 
ATOM   5876 C CE  . LYS A 1 502 ? 10.866  25.524  -48.259 1.00 30.86 ? 495  LYS A CE  1 
ATOM   5877 N NZ  . LYS A 1 502 ? 12.168  25.706  -48.947 1.00 36.58 ? 495  LYS A NZ  1 
ATOM   5878 N N   . THR A 1 503 ? 13.100  21.678  -42.863 1.00 14.33 ? 496  THR A N   1 
ATOM   5879 C CA  . THR A 1 503 ? 13.527  21.527  -41.473 1.00 14.55 ? 496  THR A CA  1 
ATOM   5880 C C   . THR A 1 503 ? 14.745  20.585  -41.370 1.00 14.55 ? 496  THR A C   1 
ATOM   5881 O O   . THR A 1 503 ? 15.621  20.828  -40.545 1.00 13.17 ? 496  THR A O   1 
ATOM   5882 C CB  . THR A 1 503 ? 12.372  21.074  -40.589 1.00 13.12 ? 496  THR A CB  1 
ATOM   5883 O OG1 . THR A 1 503 ? 11.327  22.044  -40.687 1.00 19.41 ? 496  THR A OG1 1 
ATOM   5884 C CG2 . THR A 1 503 ? 12.800  20.991  -39.118 1.00 14.39 ? 496  THR A CG2 1 
ATOM   5885 N N   A ILE A 1 504 ? 14.809  19.560  -42.221 0.27 11.85 ? 497  ILE A N   1 
ATOM   5886 N N   B ILE A 1 504 ? 14.818  19.543  -42.205 0.73 11.75 ? 497  ILE A N   1 
ATOM   5887 C CA  A ILE A 1 504 ? 15.986  18.693  -42.273 0.27 11.44 ? 497  ILE A CA  1 
ATOM   5888 C CA  B ILE A 1 504 ? 16.020  18.702  -42.238 0.73 11.31 ? 497  ILE A CA  1 
ATOM   5889 C C   A ILE A 1 504 ? 17.241  19.504  -42.596 0.27 13.06 ? 497  ILE A C   1 
ATOM   5890 C C   B ILE A 1 504 ? 17.246  19.550  -42.559 0.73 13.11 ? 497  ILE A C   1 
ATOM   5891 O O   A ILE A 1 504 ? 18.269  19.356  -41.932 0.27 12.91 ? 497  ILE A O   1 
ATOM   5892 O O   B ILE A 1 504 ? 18.264  19.475  -41.859 0.73 12.62 ? 497  ILE A O   1 
ATOM   5893 C CB  A ILE A 1 504 ? 15.829  17.561  -43.317 0.27 15.19 ? 497  ILE A CB  1 
ATOM   5894 C CB  B ILE A 1 504 ? 15.916  17.553  -43.271 0.73 15.44 ? 497  ILE A CB  1 
ATOM   5895 C CG1 A ILE A 1 504 ? 14.633  16.672  -42.968 0.27 13.90 ? 497  ILE A CG1 1 
ATOM   5896 C CG1 B ILE A 1 504 ? 14.871  16.532  -42.829 0.73 12.16 ? 497  ILE A CG1 1 
ATOM   5897 C CG2 A ILE A 1 504 ? 17.105  16.719  -43.396 0.27 14.59 ? 497  ILE A CG2 1 
ATOM   5898 C CG2 B ILE A 1 504 ? 17.270  16.841  -43.434 0.73 14.44 ? 497  ILE A CG2 1 
ATOM   5899 C CD1 A ILE A 1 504 ? 14.400  15.541  -43.963 0.27 15.92 ? 497  ILE A CD1 1 
ATOM   5900 C CD1 B ILE A 1 504 ? 14.530  15.491  -43.914 0.73 16.32 ? 497  ILE A CD1 1 
ATOM   5901 N N   . GLU A 1 505 ? 17.152  20.367  -43.608 1.00 13.60 ? 498  GLU A N   1 
ATOM   5902 C CA  . GLU A 1 505 ? 18.288  21.212  -43.985 1.00 12.67 ? 498  GLU A CA  1 
ATOM   5903 C C   . GLU A 1 505 ? 18.674  22.182  -42.881 1.00 15.26 ? 498  GLU A C   1 
ATOM   5904 O O   . GLU A 1 505 ? 19.858  22.370  -42.623 1.00 17.11 ? 498  GLU A O   1 
ATOM   5905 C CB  A GLU A 1 505 ? 18.017  21.945  -45.296 0.60 15.65 ? 498  GLU A CB  1 
ATOM   5906 C CB  B GLU A 1 505 ? 17.983  22.072  -45.219 0.40 15.87 ? 498  GLU A CB  1 
ATOM   5907 C CG  A GLU A 1 505 ? 17.977  20.997  -46.496 0.60 21.16 ? 498  GLU A CG  1 
ATOM   5908 C CG  B GLU A 1 505 ? 17.569  21.388  -46.497 0.40 24.52 ? 498  GLU A CG  1 
ATOM   5909 C CD  A GLU A 1 505 ? 19.355  20.652  -47.067 0.60 21.55 ? 498  GLU A CD  1 
ATOM   5910 C CD  B GLU A 1 505 ? 17.413  22.399  -47.635 0.40 22.45 ? 498  GLU A CD  1 
ATOM   5911 O OE1 A GLU A 1 505 ? 20.334  20.520  -46.299 0.60 26.52 ? 498  GLU A OE1 1 
ATOM   5912 O OE1 B GLU A 1 505 ? 16.356  23.074  -47.711 0.40 11.63 ? 498  GLU A OE1 1 
ATOM   5913 O OE2 A GLU A 1 505 ? 19.452  20.506  -48.301 0.60 22.28 ? 498  GLU A OE2 1 
ATOM   5914 O OE2 B GLU A 1 505 ? 18.363  22.529  -48.438 0.40 17.30 ? 498  GLU A OE2 1 
ATOM   5915 N N   . ARG A 1 506 ? 17.679  22.811  -42.252 1.00 13.60 ? 499  ARG A N   1 
ATOM   5916 C CA  . ARG A 1 506 ? 17.942  23.691  -41.117 1.00 16.09 ? 499  ARG A CA  1 
ATOM   5917 C C   . ARG A 1 506 ? 18.610  22.995  -39.938 1.00 14.97 ? 499  ARG A C   1 
ATOM   5918 O O   . ARG A 1 506 ? 19.611  23.491  -39.419 1.00 17.69 ? 499  ARG A O   1 
ATOM   5919 C CB  . ARG A 1 506 ? 16.638  24.344  -40.646 1.00 16.15 ? 499  ARG A CB  1 
ATOM   5920 C CG  . ARG A 1 506 ? 16.156  25.459  -41.565 1.00 15.88 ? 499  ARG A CG  1 
ATOM   5921 C CD  . ARG A 1 506 ? 14.719  25.842  -41.281 1.00 18.71 ? 499  ARG A CD  1 
ATOM   5922 N NE  . ARG A 1 506 ? 14.357  27.019  -42.052 1.00 21.29 ? 499  ARG A NE  1 
ATOM   5923 C CZ  . ARG A 1 506 ? 13.170  27.610  -42.012 1.00 31.81 ? 499  ARG A CZ  1 
ATOM   5924 N NH1 . ARG A 1 506 ? 12.214  27.129  -41.231 1.00 22.87 ? 499  ARG A NH1 1 
ATOM   5925 N NH2 . ARG A 1 506 ? 12.943  28.682  -42.765 1.00 30.64 ? 499  ARG A NH2 1 
ATOM   5926 N N   . MET A 1 507 ? 18.063  21.866  -39.495 1.00 12.90 ? 500  MET A N   1 
ATOM   5927 C CA  . MET A 1 507 ? 18.608  21.220  -38.303 1.00 13.63 ? 500  MET A CA  1 
ATOM   5928 C C   . MET A 1 507 ? 20.009  20.695  -38.561 1.00 13.58 ? 500  MET A C   1 
ATOM   5929 O O   . MET A 1 507 ? 20.915  20.905  -37.757 1.00 14.80 ? 500  MET A O   1 
ATOM   5930 C CB  . MET A 1 507 ? 17.703  20.082  -37.824 1.00 14.09 ? 500  MET A CB  1 
ATOM   5931 C CG  . MET A 1 507 ? 16.315  20.541  -37.362 1.00 11.46 ? 500  MET A CG  1 
ATOM   5932 S SD  . MET A 1 507 ? 16.280  21.967  -36.238 1.00 17.44 ? 500  MET A SD  1 
ATOM   5933 C CE  . MET A 1 507 ? 16.789  21.270  -34.666 1.00 17.16 ? 500  MET A CE  1 
ATOM   5934 N N   . THR A 1 508 ? 20.215  20.020  -39.687 1.00 11.30 ? 501  THR A N   1 
ATOM   5935 C CA  . THR A 1 508 ? 21.567  19.503  -39.945 1.00 13.29 ? 501  THR A CA  1 
ATOM   5936 C C   . THR A 1 508 ? 22.530  20.656  -40.258 1.00 15.55 ? 501  THR A C   1 
ATOM   5937 O O   . THR A 1 508 ? 23.714  20.610  -39.898 1.00 16.01 ? 501  THR A O   1 
ATOM   5938 C CB  . THR A 1 508 ? 21.587  18.452  -41.102 1.00 13.47 ? 501  THR A CB  1 
ATOM   5939 O OG1 . THR A 1 508 ? 21.018  19.009  -42.296 1.00 16.26 ? 501  THR A OG1 1 
ATOM   5940 C CG2 . THR A 1 508 ? 20.839  17.155  -40.712 1.00 14.11 ? 501  THR A CG2 1 
ATOM   5941 N N   . GLY A 1 509 ? 22.026  21.707  -40.895 1.00 14.02 ? 502  GLY A N   1 
ATOM   5942 C CA  . GLY A 1 509 ? 22.846  22.883  -41.140 1.00 15.77 ? 502  GLY A CA  1 
ATOM   5943 C C   . GLY A 1 509 ? 23.319  23.576  -39.863 1.00 10.75 ? 502  GLY A C   1 
ATOM   5944 O O   . GLY A 1 509 ? 24.494  23.944  -39.740 1.00 13.12 ? 502  GLY A O   1 
ATOM   5945 N N   . ILE A 1 510 ? 22.403  23.771  -38.918 1.00 11.90 ? 503  ILE A N   1 
ATOM   5946 C CA  . ILE A 1 510 ? 22.754  24.393  -37.657 1.00 10.85 ? 503  ILE A CA  1 
ATOM   5947 C C   . ILE A 1 510 ? 23.747  23.536  -36.874 1.00 12.98 ? 503  ILE A C   1 
ATOM   5948 O O   . ILE A 1 510 ? 24.741  24.048  -36.344 1.00 13.43 ? 503  ILE A O   1 
ATOM   5949 C CB  A ILE A 1 510 ? 21.514  24.612  -36.774 0.31 11.26 ? 503  ILE A CB  1 
ATOM   5950 C CB  B ILE A 1 510 ? 21.498  24.679  -36.811 0.69 11.25 ? 503  ILE A CB  1 
ATOM   5951 C CG1 A ILE A 1 510 ? 20.591  25.648  -37.409 0.31 14.54 ? 503  ILE A CG1 1 
ATOM   5952 C CG1 B ILE A 1 510 ? 20.697  25.807  -37.483 0.69 13.79 ? 503  ILE A CG1 1 
ATOM   5953 C CG2 A ILE A 1 510 ? 21.920  25.050  -35.367 0.31 14.67 ? 503  ILE A CG2 1 
ATOM   5954 C CG2 B ILE A 1 510 ? 21.886  25.052  -35.377 0.69 14.67 ? 503  ILE A CG2 1 
ATOM   5955 C CD1 A ILE A 1 510 ? 21.265  26.954  -37.668 0.31 16.97 ? 503  ILE A CD1 1 
ATOM   5956 C CD1 B ILE A 1 510 ? 19.373  26.199  -36.797 0.69 13.91 ? 503  ILE A CD1 1 
ATOM   5957 N N   A TRP A 1 511 ? 23.485  22.233  -36.803 0.78 10.90 ? 504  TRP A N   1 
ATOM   5958 N N   B TRP A 1 511 ? 23.489  22.233  -36.808 0.22 11.14 ? 504  TRP A N   1 
ATOM   5959 C CA  A TRP A 1 511 ? 24.365  21.337  -36.050 0.78 14.54 ? 504  TRP A CA  1 
ATOM   5960 C CA  B TRP A 1 511 ? 24.359  21.325  -36.063 0.22 14.53 ? 504  TRP A CA  1 
ATOM   5961 C C   A TRP A 1 511 ? 25.750  21.287  -36.692 0.78 14.68 ? 504  TRP A C   1 
ATOM   5962 C C   B TRP A 1 511 ? 25.746  21.231  -36.695 0.22 14.49 ? 504  TRP A C   1 
ATOM   5963 O O   A TRP A 1 511 ? 26.760  21.324  -35.990 0.78 13.72 ? 504  TRP A O   1 
ATOM   5964 O O   B TRP A 1 511 ? 26.750  21.173  -35.987 0.22 13.64 ? 504  TRP A O   1 
ATOM   5965 C CB  A TRP A 1 511 ? 23.767  19.922  -35.952 0.78 10.83 ? 504  TRP A CB  1 
ATOM   5966 C CB  B TRP A 1 511 ? 23.723  19.934  -35.964 0.22 11.09 ? 504  TRP A CB  1 
ATOM   5967 C CG  A TRP A 1 511 ? 22.986  19.640  -34.670 0.78 11.07 ? 504  TRP A CG  1 
ATOM   5968 C CG  B TRP A 1 511 ? 22.993  19.684  -34.665 0.22 11.24 ? 504  TRP A CG  1 
ATOM   5969 C CD1 A TRP A 1 511 ? 23.157  18.576  -33.830 0.78 12.98 ? 504  TRP A CD1 1 
ATOM   5970 C CD1 B TRP A 1 511 ? 23.185  18.637  -33.810 0.22 12.93 ? 504  TRP A CD1 1 
ATOM   5971 C CD2 A TRP A 1 511 ? 21.937  20.438  -34.097 0.78 11.59 ? 504  TRP A CD2 1 
ATOM   5972 C CD2 B TRP A 1 511 ? 21.967  20.498  -34.076 0.22 11.72 ? 504  TRP A CD2 1 
ATOM   5973 N NE1 A TRP A 1 511 ? 22.276  18.649  -32.773 0.78 10.23 ? 504  TRP A NE1 1 
ATOM   5974 N NE1 B TRP A 1 511 ? 22.341  18.743  -32.729 0.22 10.73 ? 504  TRP A NE1 1 
ATOM   5975 C CE2 A TRP A 1 511 ? 21.521  19.786  -32.908 0.78 11.05 ? 504  TRP A CE2 1 
ATOM   5976 C CE2 B TRP A 1 511 ? 21.585  19.878  -32.867 0.22 11.38 ? 504  TRP A CE2 1 
ATOM   5977 C CE3 A TRP A 1 511 ? 21.306  21.631  -34.469 0.78 13.87 ? 504  TRP A CE3 1 
ATOM   5978 C CE3 B TRP A 1 511 ? 21.331  21.685  -34.454 0.22 13.88 ? 504  TRP A CE3 1 
ATOM   5979 C CZ2 A TRP A 1 511 ? 20.506  20.292  -32.096 0.78 13.85 ? 504  TRP A CZ2 1 
ATOM   5980 C CZ2 B TRP A 1 511 ? 20.599  20.407  -32.035 0.22 13.83 ? 504  TRP A CZ2 1 
ATOM   5981 C CZ3 A TRP A 1 511 ? 20.294  22.133  -33.665 0.78 13.58 ? 504  TRP A CZ3 1 
ATOM   5982 C CZ3 B TRP A 1 511 ? 20.352  22.210  -33.627 0.22 13.58 ? 504  TRP A CZ3 1 
ATOM   5983 C CH2 A TRP A 1 511 ? 19.909  21.467  -32.485 0.78 15.54 ? 504  TRP A CH2 1 
ATOM   5984 C CH2 B TRP A 1 511 ? 19.997  21.571  -32.431 0.22 15.15 ? 504  TRP A CH2 1 
ATOM   5985 N N   . THR A 1 512 ? 25.802  21.225  -38.024 1.00 12.56 ? 505  THR A N   1 
ATOM   5986 C CA  . THR A 1 512 ? 27.079  21.219  -38.726 1.00 15.10 ? 505  THR A CA  1 
ATOM   5987 C C   . THR A 1 512 ? 27.834  22.545  -38.557 1.00 16.21 ? 505  THR A C   1 
ATOM   5988 O O   . THR A 1 512 ? 29.049  22.564  -38.352 1.00 15.29 ? 505  THR A O   1 
ATOM   5989 C CB  A THR A 1 512 ? 26.866  20.973  -40.231 0.47 17.41 ? 505  THR A CB  1 
ATOM   5990 C CB  B THR A 1 512 ? 26.880  20.876  -40.207 0.53 17.38 ? 505  THR A CB  1 
ATOM   5991 O OG1 A THR A 1 512 ? 25.989  19.859  -40.414 0.47 20.43 ? 505  THR A OG1 1 
ATOM   5992 O OG1 B THR A 1 512 ? 26.704  19.458  -40.317 0.53 15.51 ? 505  THR A OG1 1 
ATOM   5993 C CG2 A THR A 1 512 ? 28.187  20.708  -40.928 0.47 22.97 ? 505  THR A CG2 1 
ATOM   5994 C CG2 B THR A 1 512 ? 28.094  21.285  -41.025 0.53 24.48 ? 505  THR A CG2 1 
ATOM   5995 N N   . GLN A 1 513 ? 27.104  23.656  -38.606 1.00 14.22 ? 506  GLN A N   1 
ATOM   5996 C CA  . GLN A 1 513 ? 27.691  24.969  -38.409 1.00 14.05 ? 506  GLN A CA  1 
ATOM   5997 C C   . GLN A 1 513 ? 28.297  25.079  -37.018 1.00 16.72 ? 506  GLN A C   1 
ATOM   5998 O O   . GLN A 1 513 ? 29.438  25.518  -36.855 1.00 15.64 ? 506  GLN A O   1 
ATOM   5999 C CB  A GLN A 1 513 ? 26.651  26.072  -38.624 0.31 15.41 ? 506  GLN A CB  1 
ATOM   6000 C CB  B GLN A 1 513 ? 26.631  26.052  -38.625 0.69 15.46 ? 506  GLN A CB  1 
ATOM   6001 C CG  A GLN A 1 513 ? 27.190  27.488  -38.428 0.31 19.99 ? 506  GLN A CG  1 
ATOM   6002 C CG  B GLN A 1 513 ? 27.071  27.453  -38.255 0.69 19.89 ? 506  GLN A CG  1 
ATOM   6003 C CD  A GLN A 1 513 ? 28.045  27.977  -39.591 0.31 19.26 ? 506  GLN A CD  1 
ATOM   6004 C CD  B GLN A 1 513 ? 28.275  27.924  -39.046 0.69 21.07 ? 506  GLN A CD  1 
ATOM   6005 O OE1 A GLN A 1 513 ? 28.455  27.200  -40.452 0.31 23.09 ? 506  GLN A OE1 1 
ATOM   6006 O OE1 B GLN A 1 513 ? 29.180  28.550  -38.495 0.69 33.47 ? 506  GLN A OE1 1 
ATOM   6007 N NE2 A GLN A 1 513 ? 28.314  29.278  -39.617 0.31 23.37 ? 506  GLN A NE2 1 
ATOM   6008 N NE2 B GLN A 1 513 ? 28.285  27.639  -40.345 0.69 19.86 ? 506  GLN A NE2 1 
ATOM   6009 N N   A PHE A 1 514 ? 27.532  24.649  -36.023 0.46 12.97 ? 507  PHE A N   1 
ATOM   6010 N N   B PHE A 1 514 ? 27.543  24.656  -36.011 0.54 12.96 ? 507  PHE A N   1 
ATOM   6011 C CA  A PHE A 1 514 ? 28.001  24.664  -34.646 0.46 12.60 ? 507  PHE A CA  1 
ATOM   6012 C CA  B PHE A 1 514 ? 28.055  24.709  -34.645 0.54 12.44 ? 507  PHE A CA  1 
ATOM   6013 C C   A PHE A 1 514 ? 29.247  23.799  -34.473 0.46 14.26 ? 507  PHE A C   1 
ATOM   6014 C C   B PHE A 1 514 ? 29.272  23.800  -34.472 0.54 14.25 ? 507  PHE A C   1 
ATOM   6015 O O   A PHE A 1 514 ? 30.219  24.199  -33.814 0.46 14.32 ? 507  PHE A O   1 
ATOM   6016 O O   B PHE A 1 514 ? 30.255  24.172  -33.810 0.54 14.29 ? 507  PHE A O   1 
ATOM   6017 C CB  A PHE A 1 514 ? 26.887  24.187  -33.712 0.46 12.26 ? 507  PHE A CB  1 
ATOM   6018 C CB  B PHE A 1 514 ? 26.958  24.327  -33.646 0.54 12.76 ? 507  PHE A CB  1 
ATOM   6019 C CG  A PHE A 1 514 ? 27.257  24.247  -32.265 0.46 10.86 ? 507  PHE A CG  1 
ATOM   6020 C CG  B PHE A 1 514 ? 27.418  24.369  -32.219 0.54 10.44 ? 507  PHE A CG  1 
ATOM   6021 C CD1 A PHE A 1 514 ? 27.236  25.450  -31.586 0.46 8.86  ? 507  PHE A CD1 1 
ATOM   6022 C CD1 B PHE A 1 514 ? 27.789  25.566  -31.634 0.54 14.97 ? 507  PHE A CD1 1 
ATOM   6023 C CD2 A PHE A 1 514 ? 27.640  23.097  -31.588 0.46 12.16 ? 507  PHE A CD2 1 
ATOM   6024 C CD2 B PHE A 1 514 ? 27.507  23.204  -31.473 0.54 12.26 ? 507  PHE A CD2 1 
ATOM   6025 C CE1 A PHE A 1 514 ? 27.590  25.502  -30.247 0.46 13.53 ? 507  PHE A CE1 1 
ATOM   6026 C CE1 B PHE A 1 514 ? 28.233  25.600  -30.318 0.54 11.58 ? 507  PHE A CE1 1 
ATOM   6027 C CE2 A PHE A 1 514 ? 27.995  23.144  -30.254 0.46 12.44 ? 507  PHE A CE2 1 
ATOM   6028 C CE2 B PHE A 1 514 ? 27.948  23.235  -30.160 0.54 12.42 ? 507  PHE A CE2 1 
ATOM   6029 C CZ  A PHE A 1 514 ? 27.972  24.345  -29.586 0.46 12.78 ? 507  PHE A CZ  1 
ATOM   6030 C CZ  B PHE A 1 514 ? 28.310  24.433  -29.586 0.54 12.51 ? 507  PHE A CZ  1 
ATOM   6031 N N   . ALA A 1 515 ? 29.213  22.615  -35.070 1.00 15.39 ? 508  ALA A N   1 
ATOM   6032 C CA  . ALA A 1 515 ? 30.329  21.664  -34.971 1.00 14.32 ? 508  ALA A CA  1 
ATOM   6033 C C   . ALA A 1 515 ? 31.580  22.276  -35.572 1.00 20.86 ? 508  ALA A C   1 
ATOM   6034 O O   . ALA A 1 515 ? 32.696  22.106  -35.068 1.00 15.44 ? 508  ALA A O   1 
ATOM   6035 C CB  . ALA A 1 515 ? 29.990  20.350  -35.672 1.00 14.43 ? 508  ALA A CB  1 
ATOM   6036 N N   A THR A 1 516 ? 31.392  23.009  -36.660 0.42 15.09 ? 509  THR A N   1 
ATOM   6037 N N   B THR A 1 516 ? 31.388  23.013  -36.655 0.58 14.95 ? 509  THR A N   1 
ATOM   6038 C CA  A THR A 1 516 ? 32.515  23.629  -37.339 0.42 15.48 ? 509  THR A CA  1 
ATOM   6039 C CA  B THR A 1 516 ? 32.511  23.622  -37.343 0.58 15.52 ? 509  THR A CA  1 
ATOM   6040 C C   A THR A 1 516 ? 33.136  24.767  -36.525 0.42 16.64 ? 509  THR A C   1 
ATOM   6041 C C   B THR A 1 516 ? 33.137  24.778  -36.551 0.58 16.80 ? 509  THR A C   1 
ATOM   6042 O O   A THR A 1 516 ? 34.341  24.759  -36.251 0.42 21.74 ? 509  THR A O   1 
ATOM   6043 O O   B THR A 1 516 ? 34.351  24.791  -36.315 0.58 21.80 ? 509  THR A O   1 
ATOM   6044 C CB  A THR A 1 516 ? 32.093  24.168  -38.711 0.42 14.34 ? 509  THR A CB  1 
ATOM   6045 C CB  B THR A 1 516 ? 32.081  24.126  -38.725 0.58 14.23 ? 509  THR A CB  1 
ATOM   6046 O OG1 A THR A 1 516 ? 31.591  23.089  -39.512 0.42 19.20 ? 509  THR A OG1 1 
ATOM   6047 O OG1 B THR A 1 516 ? 31.586  23.023  -39.498 0.58 19.44 ? 509  THR A OG1 1 
ATOM   6048 C CG2 A THR A 1 516 ? 33.282  24.796  -39.421 0.42 16.00 ? 509  THR A CG2 1 
ATOM   6049 C CG2 B THR A 1 516 ? 33.264  24.743  -39.454 0.58 15.95 ? 509  THR A CG2 1 
ATOM   6050 N N   . THR A 1 517 ? 32.312  25.734  -36.128 1.00 16.74 ? 510  THR A N   1 
ATOM   6051 C CA  . THR A 1 517 ? 32.826  26.976  -35.550 1.00 16.36 ? 510  THR A CA  1 
ATOM   6052 C C   . THR A 1 517 ? 32.543  27.237  -34.074 1.00 18.33 ? 510  THR A C   1 
ATOM   6053 O O   . THR A 1 517 ? 33.148  28.126  -33.494 1.00 17.01 ? 510  THR A O   1 
ATOM   6054 C CB  . THR A 1 517 ? 32.282  28.201  -36.317 1.00 24.73 ? 510  THR A CB  1 
ATOM   6055 O OG1 . THR A 1 517 ? 30.887  28.384  -36.017 1.00 26.50 ? 510  THR A OG1 1 
ATOM   6056 C CG2 . THR A 1 517 ? 32.454  28.001  -37.812 1.00 28.64 ? 510  THR A CG2 1 
ATOM   6057 N N   . GLY A 1 518 ? 31.618  26.499  -33.469 1.00 15.73 ? 511  GLY A N   1 
ATOM   6058 C CA  . GLY A 1 518 ? 31.274  26.759  -32.078 1.00 16.15 ? 511  GLY A CA  1 
ATOM   6059 C C   . GLY A 1 518 ? 30.226  27.855  -31.960 1.00 21.87 ? 511  GLY A C   1 
ATOM   6060 O O   . GLY A 1 518 ? 29.907  28.327  -30.860 1.00 19.60 ? 511  GLY A O   1 
ATOM   6061 N N   . ASN A 1 519 ? 29.683  28.245  -33.113 1.00 18.53 ? 512  ASN A N   1 
ATOM   6062 C CA  . ASN A 1 519 ? 28.632  29.251  -33.198 1.00 20.79 ? 512  ASN A CA  1 
ATOM   6063 C C   . ASN A 1 519 ? 27.561  28.729  -34.135 1.00 14.15 ? 512  ASN A C   1 
ATOM   6064 O O   . ASN A 1 519 ? 27.850  28.471  -35.298 1.00 17.44 ? 512  ASN A O   1 
ATOM   6065 C CB  . ASN A 1 519 ? 29.195  30.584  -33.702 1.00 24.82 ? 512  ASN A CB  1 
ATOM   6066 C CG  . ASN A 1 519 ? 28.152  31.701  -33.741 1.00 25.23 ? 512  ASN A CG  1 
ATOM   6067 O OD1 . ASN A 1 519 ? 26.948  31.455  -33.760 1.00 20.71 ? 512  ASN A OD1 1 
ATOM   6068 N ND2 . ASN A 1 519 ? 28.625  32.942  -33.765 1.00 31.37 ? 512  ASN A ND2 1 
ATOM   6069 N N   . PRO A 1 520 ? 26.326  28.566  -33.630 1.00 15.63 ? 513  PRO A N   1 
ATOM   6070 C CA  . PRO A 1 520 ? 25.316  27.889  -34.449 1.00 18.25 ? 513  PRO A CA  1 
ATOM   6071 C C   . PRO A 1 520 ? 24.688  28.752  -35.542 1.00 17.72 ? 513  PRO A C   1 
ATOM   6072 O O   . PRO A 1 520 ? 23.885  28.248  -36.326 1.00 25.16 ? 513  PRO A O   1 
ATOM   6073 C CB  . PRO A 1 520 ? 24.257  27.485  -33.412 1.00 16.32 ? 513  PRO A CB  1 
ATOM   6074 C CG  . PRO A 1 520 ? 24.363  28.527  -32.352 1.00 17.14 ? 513  PRO A CG  1 
ATOM   6075 C CD  . PRO A 1 520 ? 25.840  28.843  -32.263 1.00 16.01 ? 513  PRO A CD  1 
ATOM   6076 N N   A TYR A 1 521 ? 25.040  30.031  -35.603 0.63 21.87 ? 514  TYR A N   1 
ATOM   6077 N N   B TYR A 1 521 ? 25.036  30.033  -35.589 0.37 21.82 ? 514  TYR A N   1 
ATOM   6078 C CA  A TYR A 1 521 ? 24.454  30.915  -36.608 0.63 24.45 ? 514  TYR A CA  1 
ATOM   6079 C CA  B TYR A 1 521 ? 24.412  30.933  -36.550 0.37 24.35 ? 514  TYR A CA  1 
ATOM   6080 C C   A TYR A 1 521 ? 25.129  30.770  -37.973 0.63 19.75 ? 514  TYR A C   1 
ATOM   6081 C C   B TYR A 1 521 ? 25.214  31.060  -37.843 0.37 20.60 ? 514  TYR A C   1 
ATOM   6082 O O   A TYR A 1 521 ? 26.351  30.649  -38.061 0.63 24.66 ? 514  TYR A O   1 
ATOM   6083 O O   B TYR A 1 521 ? 26.432  31.243  -37.817 0.37 18.74 ? 514  TYR A O   1 
ATOM   6084 C CB  A TYR A 1 521 ? 24.525  32.380  -36.153 0.63 21.37 ? 514  TYR A CB  1 
ATOM   6085 C CB  B TYR A 1 521 ? 24.208  32.323  -35.939 0.37 24.55 ? 514  TYR A CB  1 
ATOM   6086 C CG  A TYR A 1 521 ? 24.289  33.366  -37.278 0.63 29.67 ? 514  TYR A CG  1 
ATOM   6087 C CG  B TYR A 1 521 ? 23.540  33.280  -36.898 0.37 26.89 ? 514  TYR A CG  1 
ATOM   6088 C CD1 A TYR A 1 521 ? 23.017  33.553  -37.805 0.63 29.58 ? 514  TYR A CD1 1 
ATOM   6089 C CD1 B TYR A 1 521 ? 22.171  33.220  -37.123 0.37 22.87 ? 514  TYR A CD1 1 
ATOM   6090 C CD2 A TYR A 1 521 ? 25.338  34.100  -37.820 0.63 29.40 ? 514  TYR A CD2 1 
ATOM   6091 C CD2 B TYR A 1 521 ? 24.278  34.226  -37.596 0.37 26.82 ? 514  TYR A CD2 1 
ATOM   6092 C CE1 A TYR A 1 521 ? 22.793  34.444  -38.842 0.63 29.43 ? 514  TYR A CE1 1 
ATOM   6093 C CE1 B TYR A 1 521 ? 21.556  34.077  -38.006 0.37 28.35 ? 514  TYR A CE1 1 
ATOM   6094 C CE2 A TYR A 1 521 ? 25.125  34.997  -38.856 0.63 25.55 ? 514  TYR A CE2 1 
ATOM   6095 C CE2 B TYR A 1 521 ? 23.670  35.090  -38.485 0.37 35.67 ? 514  TYR A CE2 1 
ATOM   6096 C CZ  A TYR A 1 521 ? 23.853  35.164  -39.363 0.63 29.31 ? 514  TYR A CZ  1 
ATOM   6097 C CZ  B TYR A 1 521 ? 22.307  35.008  -38.686 0.37 29.91 ? 514  TYR A CZ  1 
ATOM   6098 O OH  A TYR A 1 521 ? 23.636  36.052  -40.392 0.63 41.85 ? 514  TYR A OH  1 
ATOM   6099 O OH  B TYR A 1 521 ? 21.689  35.869  -39.568 0.37 33.21 ? 514  TYR A OH  1 
ATOM   6100 N N   A SER A 1 522 ? 24.328  30.778  -39.035 0.63 23.41 ? 515  SER A N   1 
ATOM   6101 N N   B SER A 1 522 ? 24.514  30.964  -38.969 0.37 25.32 ? 515  SER A N   1 
ATOM   6102 C CA  A SER A 1 522 ? 24.860  30.860  -40.391 0.63 23.11 ? 515  SER A CA  1 
ATOM   6103 C CA  B SER A 1 522 ? 25.108  31.206  -40.278 0.37 22.11 ? 515  SER A CA  1 
ATOM   6104 C C   A SER A 1 522 ? 23.886  31.580  -41.319 0.63 28.88 ? 515  SER A C   1 
ATOM   6105 C C   B SER A 1 522 ? 24.052  31.733  -41.246 0.37 29.98 ? 515  SER A C   1 
ATOM   6106 O O   A SER A 1 522 ? 22.704  31.250  -41.363 0.63 26.92 ? 515  SER A O   1 
ATOM   6107 O O   B SER A 1 522 ? 22.898  31.309  -41.206 0.37 26.26 ? 515  SER A O   1 
ATOM   6108 C CB  A SER A 1 522 ? 25.172  29.469  -40.947 0.63 20.08 ? 515  SER A CB  1 
ATOM   6109 C CB  B SER A 1 522 ? 25.745  29.933  -40.833 0.37 25.07 ? 515  SER A CB  1 
ATOM   6110 O OG  A SER A 1 522 ? 25.367  29.528  -42.350 0.63 27.46 ? 515  SER A OG  1 
ATOM   6111 O OG  B SER A 1 522 ? 26.257  30.160  -42.134 0.37 28.64 ? 515  SER A OG  1 
ATOM   6112 N N   A ASN A 1 523 ? 24.397  32.556  -42.063 0.63 39.06 ? 516  ASN A N   1 
ATOM   6113 N N   B ASN A 1 523 ? 24.450  32.651  -42.121 0.37 38.62 ? 516  ASN A N   1 
ATOM   6114 C CA  A ASN A 1 523 ? 23.601  33.276  -43.051 0.63 40.85 ? 516  ASN A CA  1 
ATOM   6115 C CA  B ASN A 1 523 ? 23.503  33.271  -43.041 0.37 40.49 ? 516  ASN A CA  1 
ATOM   6116 C C   A ASN A 1 523 ? 23.198  32.391  -44.225 0.63 38.68 ? 516  ASN A C   1 
ATOM   6117 C C   B ASN A 1 523 ? 23.211  32.406  -44.266 0.37 38.53 ? 516  ASN A C   1 
ATOM   6118 O O   A ASN A 1 523 ? 22.281  32.718  -44.977 0.63 42.45 ? 516  ASN A O   1 
ATOM   6119 O O   B ASN A 1 523 ? 22.376  32.760  -45.097 0.37 41.76 ? 516  ASN A O   1 
ATOM   6120 C CB  A ASN A 1 523 ? 24.375  34.485  -43.569 0.63 35.06 ? 516  ASN A CB  1 
ATOM   6121 C CB  B ASN A 1 523 ? 24.014  34.640  -43.487 0.37 35.99 ? 516  ASN A CB  1 
ATOM   6122 C CG  A ASN A 1 523 ? 25.762  34.118  -44.052 0.63 43.86 ? 516  ASN A CG  1 
ATOM   6123 C CG  B ASN A 1 523 ? 22.890  35.624  -43.745 0.37 37.32 ? 516  ASN A CG  1 
ATOM   6124 O OD1 A ASN A 1 523 ? 25.935  33.618  -45.165 0.63 37.26 ? 516  ASN A OD1 1 
ATOM   6125 O OD1 B ASN A 1 523 ? 21.746  35.233  -43.975 0.37 42.89 ? 516  ASN A OD1 1 
ATOM   6126 N ND2 A ASN A 1 523 ? 26.763  34.359  -43.211 0.63 47.84 ? 516  ASN A ND2 1 
ATOM   6127 N ND2 B ASN A 1 523 ? 23.211  36.911  -43.708 0.37 42.57 ? 516  ASN A ND2 1 
ATOM   6128 N N   . GLU A 1 524 ? 23.890  31.271  -44.380 1.00 25.68 ? 517  GLU A N   1 
ATOM   6129 C CA  . GLU A 1 524 ? 23.639  30.369  -45.491 1.00 30.14 ? 517  GLU A CA  1 
ATOM   6130 C C   . GLU A 1 524 ? 22.520  29.373  -45.143 1.00 33.36 ? 517  GLU A C   1 
ATOM   6131 O O   . GLU A 1 524 ? 22.106  28.562  -45.974 1.00 37.26 ? 517  GLU A O   1 
ATOM   6132 C CB  . GLU A 1 524 ? 24.937  29.659  -45.898 1.00 46.35 ? 517  GLU A CB  1 
ATOM   6133 C CG  . GLU A 1 524 ? 24.821  28.735  -47.116 1.00 60.49 ? 517  GLU A CG  1 
ATOM   6134 C CD  . GLU A 1 524 ? 24.456  29.465  -48.412 1.00 83.95 ? 517  GLU A CD  1 
ATOM   6135 O OE1 . GLU A 1 524 ? 24.528  30.716  -48.459 1.00 75.16 ? 517  GLU A OE1 1 
ATOM   6136 O OE2 . GLU A 1 524 ? 24.080  28.777  -49.386 1.00 82.62 ? 517  GLU A OE2 1 
ATOM   6137 N N   A ILE A 1 525 ? 22.013  29.456  -43.920 0.29 29.29 ? 518  ILE A N   1 
ATOM   6138 N N   B ILE A 1 525 ? 22.029  29.455  -43.914 0.31 29.29 ? 518  ILE A N   1 
ATOM   6139 N N   C ILE A 1 525 ? 22.041  29.441  -43.909 0.39 29.28 ? 518  ILE A N   1 
ATOM   6140 C CA  A ILE A 1 525 ? 20.861  28.651  -43.526 0.29 29.40 ? 518  ILE A CA  1 
ATOM   6141 C CA  B ILE A 1 525 ? 20.896  28.643  -43.492 0.31 29.42 ? 518  ILE A CA  1 
ATOM   6142 C CA  C ILE A 1 525 ? 20.920  28.614  -43.488 0.39 29.41 ? 518  ILE A CA  1 
ATOM   6143 C C   A ILE A 1 525 ? 19.567  29.425  -43.775 0.29 25.01 ? 518  ILE A C   1 
ATOM   6144 C C   B ILE A 1 525 ? 19.597  29.413  -43.710 0.31 25.00 ? 518  ILE A C   1 
ATOM   6145 C C   C ILE A 1 525 ? 19.621  29.387  -43.691 0.39 24.94 ? 518  ILE A C   1 
ATOM   6146 O O   A ILE A 1 525 ? 19.392  30.532  -43.265 0.29 28.67 ? 518  ILE A O   1 
ATOM   6147 O O   B ILE A 1 525 ? 19.415  30.508  -43.176 0.31 28.71 ? 518  ILE A O   1 
ATOM   6148 O O   C ILE A 1 525 ? 19.433  30.458  -43.114 0.39 28.75 ? 518  ILE A O   1 
ATOM   6149 C CB  A ILE A 1 525 ? 20.942  28.231  -42.045 0.29 28.61 ? 518  ILE A CB  1 
ATOM   6150 C CB  B ILE A 1 525 ? 21.025  28.223  -42.018 0.31 28.59 ? 518  ILE A CB  1 
ATOM   6151 C CB  C ILE A 1 525 ? 21.062  28.179  -42.019 0.39 28.61 ? 518  ILE A CB  1 
ATOM   6152 C CG1 A ILE A 1 525 ? 22.248  27.482  -41.776 0.29 27.97 ? 518  ILE A CG1 1 
ATOM   6153 C CG1 B ILE A 1 525 ? 22.305  27.410  -41.822 0.31 27.99 ? 518  ILE A CG1 1 
ATOM   6154 C CG1 C ILE A 1 525 ? 22.373  27.414  -41.829 0.39 28.02 ? 518  ILE A CG1 1 
ATOM   6155 C CG2 A ILE A 1 525 ? 19.749  27.371  -41.667 0.29 26.79 ? 518  ILE A CG2 1 
ATOM   6156 C CG2 B ILE A 1 525 ? 19.814  27.416  -41.584 0.31 26.72 ? 518  ILE A CG2 1 
ATOM   6157 C CG2 C ILE A 1 525 ? 19.884  27.319  -41.598 0.39 26.68 ? 518  ILE A CG2 1 
ATOM   6158 C CD1 A ILE A 1 525 ? 22.397  26.197  -42.565 0.29 23.34 ? 518  ILE A CD1 1 
ATOM   6159 C CD1 B ILE A 1 525 ? 22.545  26.972  -40.399 0.31 25.27 ? 518  ILE A CD1 1 
ATOM   6160 C CD1 C ILE A 1 525 ? 22.610  26.939  -40.416 0.39 25.25 ? 518  ILE A CD1 1 
ATOM   6161 N N   A GLU A 1 526 ? 18.667  28.840  -44.560 0.29 29.83 ? 519  GLU A N   1 
ATOM   6162 N N   B GLU A 1 526 ? 18.700  28.835  -44.503 0.31 29.81 ? 519  GLU A N   1 
ATOM   6163 N N   C GLU A 1 526 ? 18.735  28.844  -44.521 0.39 29.84 ? 519  GLU A N   1 
ATOM   6164 C CA  A GLU A 1 526 ? 17.411  29.496  -44.923 0.29 28.43 ? 519  GLU A CA  1 
ATOM   6165 C CA  B GLU A 1 526 ? 17.463  29.504  -44.893 0.31 28.42 ? 519  GLU A CA  1 
ATOM   6166 C CA  C GLU A 1 526 ? 17.492  29.525  -44.871 0.39 28.41 ? 519  GLU A CA  1 
ATOM   6167 C C   A GLU A 1 526 ? 16.556  29.827  -43.704 0.29 26.90 ? 519  GLU A C   1 
ATOM   6168 C C   B GLU A 1 526 ? 16.564  29.828  -43.700 0.31 26.90 ? 519  GLU A C   1 
ATOM   6169 C C   C GLU A 1 526 ? 16.638  29.853  -43.651 0.39 26.90 ? 519  GLU A C   1 
ATOM   6170 O O   A GLU A 1 526 ? 16.273  28.961  -42.874 0.29 30.09 ? 519  GLU A O   1 
ATOM   6171 O O   B GLU A 1 526 ? 16.255  28.955  -42.886 0.31 30.11 ? 519  GLU A O   1 
ATOM   6172 O O   C GLU A 1 526 ? 16.429  29.010  -42.776 0.39 30.14 ? 519  GLU A O   1 
ATOM   6173 C CB  A GLU A 1 526 ? 16.611  28.620  -45.893 0.29 30.11 ? 519  GLU A CB  1 
ATOM   6174 C CB  B GLU A 1 526 ? 16.701  28.645  -45.905 0.31 30.11 ? 519  GLU A CB  1 
ATOM   6175 C CB  C GLU A 1 526 ? 16.676  28.683  -45.853 0.39 30.12 ? 519  GLU A CB  1 
ATOM   6176 C CG  A GLU A 1 526 ? 15.121  28.957  -45.968 0.29 29.28 ? 519  GLU A CG  1 
ATOM   6177 C CG  B GLU A 1 526 ? 15.352  29.213  -46.308 0.31 29.00 ? 519  GLU A CG  1 
ATOM   6178 C CG  C GLU A 1 526 ? 16.945  28.989  -47.316 0.39 29.40 ? 519  GLU A CG  1 
ATOM   6179 C CD  A GLU A 1 526 ? 14.846  30.318  -46.587 0.29 25.84 ? 519  GLU A CD  1 
ATOM   6180 C CD  B GLU A 1 526 ? 14.195  28.399  -45.765 0.31 30.94 ? 519  GLU A CD  1 
ATOM   6181 C CD  C GLU A 1 526 ? 15.822  28.517  -48.219 0.39 25.52 ? 519  GLU A CD  1 
ATOM   6182 O OE1 A GLU A 1 526 ? 15.603  30.729  -47.489 0.29 30.49 ? 519  GLU A OE1 1 
ATOM   6183 O OE1 B GLU A 1 526 ? 14.343  27.163  -45.635 0.31 28.27 ? 519  GLU A OE1 1 
ATOM   6184 O OE1 C GLU A 1 526 ? 14.902  27.838  -47.716 0.39 35.75 ? 519  GLU A OE1 1 
ATOM   6185 O OE2 A GLU A 1 526 ? 13.871  30.979  -46.174 0.29 19.42 ? 519  GLU A OE2 1 
ATOM   6186 O OE2 B GLU A 1 526 ? 13.143  28.998  -45.459 0.31 21.52 ? 519  GLU A OE2 1 
ATOM   6187 O OE2 C GLU A 1 526 ? 15.855  28.823  -49.430 0.39 31.65 ? 519  GLU A OE2 1 
ATOM   6188 N N   . GLY A 1 527 ? 16.153  31.089  -43.603 1.00 23.20 ? 520  GLY A N   1 
ATOM   6189 C CA  . GLY A 1 527 ? 15.287  31.534  -42.526 1.00 29.16 ? 520  GLY A CA  1 
ATOM   6190 C C   . GLY A 1 527 ? 15.970  32.256  -41.379 1.00 20.10 ? 520  GLY A C   1 
ATOM   6191 O O   . GLY A 1 527 ? 15.305  32.700  -40.433 1.00 22.77 ? 520  GLY A O   1 
ATOM   6192 N N   A MET A 1 528 ? 17.288  32.396  -41.470 0.22 21.70 ? 521  MET A N   1 
ATOM   6193 N N   B MET A 1 528 ? 17.290  32.383  -41.443 0.78 21.51 ? 521  MET A N   1 
ATOM   6194 C CA  A MET A 1 528 ? 18.068  33.021  -40.406 0.22 24.78 ? 521  MET A CA  1 
ATOM   6195 C CA  B MET A 1 528 ? 18.031  33.016  -40.348 0.78 24.80 ? 521  MET A CA  1 
ATOM   6196 C C   A MET A 1 528 ? 18.516  34.445  -40.730 0.22 21.19 ? 521  MET A C   1 
ATOM   6197 C C   B MET A 1 528 ? 18.374  34.504  -40.588 0.78 19.39 ? 521  MET A C   1 
ATOM   6198 O O   A MET A 1 528 ? 19.492  34.934  -40.162 0.22 24.97 ? 521  MET A O   1 
ATOM   6199 O O   B MET A 1 528 ? 19.129  35.094  -39.810 0.78 19.07 ? 521  MET A O   1 
ATOM   6200 C CB  A MET A 1 528 ? 19.293  32.168  -40.091 0.22 20.42 ? 521  MET A CB  1 
ATOM   6201 C CB  B MET A 1 528 ? 19.312  32.217  -40.065 0.78 20.06 ? 521  MET A CB  1 
ATOM   6202 C CG  A MET A 1 528 ? 19.214  31.442  -38.768 0.22 31.25 ? 521  MET A CG  1 
ATOM   6203 C CG  B MET A 1 528 ? 19.212  31.238  -38.876 0.78 32.96 ? 521  MET A CG  1 
ATOM   6204 S SD  A MET A 1 528 ? 20.826  30.824  -38.264 0.22 35.39 ? 521  MET A SD  1 
ATOM   6205 S SD  B MET A 1 528 ? 20.646  30.135  -38.672 0.78 31.23 ? 521  MET A SD  1 
ATOM   6206 C CE  A MET A 1 528 ? 20.426  30.226  -36.632 0.22 22.19 ? 521  MET A CE  1 
ATOM   6207 C CE  B MET A 1 528 ? 20.496  29.673  -36.938 0.78 19.94 ? 521  MET A CE  1 
ATOM   6208 N N   . GLU A 1 529 ? 17.804  35.107  -41.636 1.00 21.40 ? 522  GLU A N   1 
ATOM   6209 C CA  . GLU A 1 529 ? 18.160  36.472  -42.047 1.00 25.90 ? 522  GLU A CA  1 
ATOM   6210 C C   . GLU A 1 529 ? 18.058  37.510  -40.932 1.00 23.89 ? 522  GLU A C   1 
ATOM   6211 O O   . GLU A 1 529 ? 18.881  38.426  -40.839 1.00 19.85 ? 522  GLU A O   1 
ATOM   6212 C CB  . GLU A 1 529 ? 17.276  36.924  -43.210 1.00 34.86 ? 522  GLU A CB  1 
ATOM   6213 C CG  . GLU A 1 529 ? 17.587  36.261  -44.543 1.00 47.26 ? 522  GLU A CG  1 
ATOM   6214 C CD  . GLU A 1 529 ? 16.898  34.921  -44.708 1.00 47.41 ? 522  GLU A CD  1 
ATOM   6215 O OE1 . GLU A 1 529 ? 16.271  34.445  -43.738 1.00 31.87 ? 522  GLU A OE1 1 
ATOM   6216 O OE2 . GLU A 1 529 ? 16.975  34.351  -45.816 1.00 47.96 ? 522  GLU A OE2 1 
ATOM   6217 N N   . ASN A 1 530 ? 17.049  37.369  -40.082 1.00 18.39 ? 523  ASN A N   1 
ATOM   6218 C CA  . ASN A 1 530 ? 16.855  38.336  -39.008 1.00 20.22 ? 523  ASN A CA  1 
ATOM   6219 C C   . ASN A 1 530 ? 17.069  37.748  -37.630 1.00 24.06 ? 523  ASN A C   1 
ATOM   6220 O O   . ASN A 1 530 ? 16.604  38.299  -36.635 1.00 22.00 ? 523  ASN A O   1 
ATOM   6221 C CB  . ASN A 1 530 ? 15.467  38.947  -39.121 1.00 23.92 ? 523  ASN A CB  1 
ATOM   6222 C CG  . ASN A 1 530 ? 15.378  39.909  -40.287 1.00 25.51 ? 523  ASN A CG  1 
ATOM   6223 O OD1 . ASN A 1 530 ? 16.245  40.767  -40.442 1.00 27.49 ? 523  ASN A OD1 1 
ATOM   6224 N ND2 . ASN A 1 530 ? 14.367  39.751  -41.131 1.00 23.15 ? 523  ASN A ND2 1 
ATOM   6225 N N   . VAL A 1 531 ? 17.793  36.633  -37.582 1.00 18.19 ? 524  VAL A N   1 
ATOM   6226 C CA  . VAL A 1 531 ? 18.097  35.960  -36.331 1.00 19.86 ? 524  VAL A CA  1 
ATOM   6227 C C   . VAL A 1 531 ? 19.353  36.533  -35.683 1.00 21.24 ? 524  VAL A C   1 
ATOM   6228 O O   . VAL A 1 531 ? 20.443  36.475  -36.259 1.00 23.91 ? 524  VAL A O   1 
ATOM   6229 C CB  . VAL A 1 531 ? 18.273  34.432  -36.557 1.00 16.91 ? 524  VAL A CB  1 
ATOM   6230 C CG1 . VAL A 1 531 ? 18.930  33.769  -35.344 1.00 15.69 ? 524  VAL A CG1 1 
ATOM   6231 C CG2 . VAL A 1 531 ? 16.916  33.794  -36.855 1.00 22.65 ? 524  VAL A CG2 1 
ATOM   6232 N N   . SER A 1 532 ? 19.195  37.112  -34.496 1.00 17.47 ? 525  SER A N   1 
ATOM   6233 C CA  . SER A 1 532 ? 20.354  37.538  -33.709 1.00 31.91 ? 525  SER A CA  1 
ATOM   6234 C C   . SER A 1 532 ? 20.538  36.596  -32.526 1.00 22.80 ? 525  SER A C   1 
ATOM   6235 O O   . SER A 1 532 ? 20.030  36.870  -31.439 1.00 27.57 ? 525  SER A O   1 
ATOM   6236 C CB  . SER A 1 532 ? 20.185  38.978  -33.221 1.00 19.89 ? 525  SER A CB  1 
ATOM   6237 O OG  . SER A 1 532 ? 20.074  39.862  -34.322 1.00 32.02 ? 525  SER A OG  1 
ATOM   6238 N N   . TRP A 1 533 ? 21.245  35.487  -32.753 1.00 19.39 ? 526  TRP A N   1 
ATOM   6239 C CA  . TRP A 1 533 ? 21.343  34.393  -31.779 1.00 15.14 ? 526  TRP A CA  1 
ATOM   6240 C C   . TRP A 1 533 ? 22.531  34.556  -30.833 1.00 18.46 ? 526  TRP A C   1 
ATOM   6241 O O   . TRP A 1 533 ? 23.629  34.084  -31.120 1.00 21.54 ? 526  TRP A O   1 
ATOM   6242 C CB  . TRP A 1 533 ? 21.443  33.051  -32.517 1.00 20.03 ? 526  TRP A CB  1 
ATOM   6243 C CG  . TRP A 1 533 ? 21.142  31.821  -31.668 1.00 16.73 ? 526  TRP A CG  1 
ATOM   6244 C CD1 . TRP A 1 533 ? 20.921  31.782  -30.319 1.00 22.60 ? 526  TRP A CD1 1 
ATOM   6245 C CD2 . TRP A 1 533 ? 21.013  30.464  -32.133 1.00 15.07 ? 526  TRP A CD2 1 
ATOM   6246 N NE1 . TRP A 1 533 ? 20.674  30.487  -29.917 1.00 15.69 ? 526  TRP A NE1 1 
ATOM   6247 C CE2 . TRP A 1 533 ? 20.724  29.660  -31.008 1.00 14.26 ? 526  TRP A CE2 1 
ATOM   6248 C CE3 . TRP A 1 533 ? 21.123  29.849  -33.388 1.00 15.51 ? 526  TRP A CE3 1 
ATOM   6249 C CZ2 . TRP A 1 533 ? 20.547  28.278  -31.095 1.00 22.66 ? 526  TRP A CZ2 1 
ATOM   6250 C CZ3 . TRP A 1 533 ? 20.948  28.474  -33.481 1.00 19.45 ? 526  TRP A CZ3 1 
ATOM   6251 C CH2 . TRP A 1 533 ? 20.657  27.698  -32.329 1.00 19.29 ? 526  TRP A CH2 1 
ATOM   6252 N N   . ASP A 1 534 ? 22.309  35.227  -29.706 1.00 23.16 ? 527  ASP A N   1 
ATOM   6253 C CA  . ASP A 1 534 ? 23.373  35.473  -28.744 1.00 17.33 ? 527  ASP A CA  1 
ATOM   6254 C C   . ASP A 1 534 ? 23.403  34.361  -27.719 1.00 18.24 ? 527  ASP A C   1 
ATOM   6255 O O   . ASP A 1 534 ? 22.352  33.838  -27.349 1.00 21.28 ? 527  ASP A O   1 
ATOM   6256 C CB  . ASP A 1 534 ? 23.177  36.816  -28.031 1.00 25.23 ? 527  ASP A CB  1 
ATOM   6257 C CG  . ASP A 1 534 ? 23.289  37.999  -28.966 1.00 32.71 ? 527  ASP A CG  1 
ATOM   6258 O OD1 . ASP A 1 534 ? 24.055  37.918  -29.949 1.00 38.29 ? 527  ASP A OD1 1 
ATOM   6259 O OD2 . ASP A 1 534 ? 22.604  39.013  -28.711 1.00 38.51 ? 527  ASP A OD2 1 
ATOM   6260 N N   A PRO A 1 535 ? 24.605  33.988  -27.260 0.16 20.96 ? 528  PRO A N   1 
ATOM   6261 N N   B PRO A 1 535 ? 24.605  34.009  -27.243 0.84 21.09 ? 528  PRO A N   1 
ATOM   6262 C CA  A PRO A 1 535 ? 24.705  32.991  -26.192 0.16 17.38 ? 528  PRO A CA  1 
ATOM   6263 C CA  B PRO A 1 535 ? 24.707  33.056  -26.135 0.84 17.08 ? 528  PRO A CA  1 
ATOM   6264 C C   A PRO A 1 535 ? 24.180  33.560  -24.884 0.16 20.42 ? 528  PRO A C   1 
ATOM   6265 C C   B PRO A 1 535 ? 24.097  33.608  -24.859 0.84 20.83 ? 528  PRO A C   1 
ATOM   6266 O O   A PRO A 1 535 ? 24.192  34.780  -24.716 0.16 24.14 ? 528  PRO A O   1 
ATOM   6267 O O   B PRO A 1 535 ? 23.957  34.826  -24.721 0.84 24.05 ? 528  PRO A O   1 
ATOM   6268 C CB  A PRO A 1 535 ? 26.204  32.712  -26.111 0.16 20.99 ? 528  PRO A CB  1 
ATOM   6269 C CB  B PRO A 1 535 ? 26.212  32.858  -25.974 0.84 20.59 ? 528  PRO A CB  1 
ATOM   6270 C CG  A PRO A 1 535 ? 26.840  33.974  -26.594 0.16 26.61 ? 528  PRO A CG  1 
ATOM   6271 C CG  B PRO A 1 535 ? 26.817  34.102  -26.538 0.84 27.67 ? 528  PRO A CG  1 
ATOM   6272 C CD  A PRO A 1 535 ? 25.925  34.508  -27.660 0.16 21.20 ? 528  PRO A CD  1 
ATOM   6273 C CD  B PRO A 1 535 ? 25.926  34.501  -27.672 0.84 21.01 ? 528  PRO A CD  1 
ATOM   6274 N N   A ILE A 1 536 ? 23.716  32.704  -23.980 0.16 17.43 ? 529  ILE A N   1 
ATOM   6275 N N   B ILE A 1 536 ? 23.724  32.718  -23.946 0.84 17.23 ? 529  ILE A N   1 
ATOM   6276 C CA  A ILE A 1 536 ? 23.228  33.188  -22.696 0.16 16.91 ? 529  ILE A CA  1 
ATOM   6277 C CA  B ILE A 1 536 ? 23.192  33.134  -22.654 0.84 17.01 ? 529  ILE A CA  1 
ATOM   6278 C C   A ILE A 1 536 ? 24.356  33.840  -21.918 0.16 19.55 ? 529  ILE A C   1 
ATOM   6279 C C   B ILE A 1 536 ? 24.296  33.686  -21.755 0.84 19.42 ? 529  ILE A C   1 
ATOM   6280 O O   A ILE A 1 536 ? 25.526  33.501  -22.094 0.16 23.10 ? 529  ILE A O   1 
ATOM   6281 O O   B ILE A 1 536 ? 25.395  33.127  -21.690 0.84 17.74 ? 529  ILE A O   1 
ATOM   6282 C CB  A ILE A 1 536 ? 22.641  32.072  -21.820 0.16 17.47 ? 529  ILE A CB  1 
ATOM   6283 C CB  B ILE A 1 536 ? 22.502  31.968  -21.937 0.84 17.20 ? 529  ILE A CB  1 
ATOM   6284 C CG1 A ILE A 1 536 ? 22.197  30.879  -22.661 0.16 18.33 ? 529  ILE A CG1 1 
ATOM   6285 C CG1 B ILE A 1 536 ? 21.460  31.334  -22.854 0.84 17.72 ? 529  ILE A CG1 1 
ATOM   6286 C CG2 A ILE A 1 536 ? 21.498  32.610  -20.966 0.16 17.03 ? 529  ILE A CG2 1 
ATOM   6287 C CG2 B ILE A 1 536 ? 21.886  32.418  -20.615 0.84 16.81 ? 529  ILE A CG2 1 
ATOM   6288 C CD1 A ILE A 1 536 ? 22.011  29.645  -21.829 0.16 17.68 ? 529  ILE A CD1 1 
ATOM   6289 C CD1 B ILE A 1 536 ? 20.459  32.326  -23.409 0.84 19.93 ? 529  ILE A CD1 1 
ATOM   6290 N N   . GLU A 1 537 ? 23.996  34.774  -21.052 1.00 21.11 ? 530  GLU A N   1 
ATOM   6291 C CA  . GLU A 1 537 ? 24.965  35.380  -20.157 1.00 20.87 ? 530  GLU A CA  1 
ATOM   6292 C C   . GLU A 1 537 ? 24.560  35.163  -18.705 1.00 20.20 ? 530  GLU A C   1 
ATOM   6293 O O   . GLU A 1 537 ? 23.393  34.954  -18.405 1.00 17.63 ? 530  GLU A O   1 
ATOM   6294 C CB  . GLU A 1 537 ? 25.108  36.862  -20.474 1.00 28.36 ? 530  GLU A CB  1 
ATOM   6295 C CG  . GLU A 1 537 ? 26.080  37.162  -21.625 1.00 38.17 ? 530  GLU A CG  1 
ATOM   6296 C CD  . GLU A 1 537 ? 27.406  36.415  -21.527 1.00 51.35 ? 530  GLU A CD  1 
ATOM   6297 O OE1 . GLU A 1 537 ? 27.844  36.075  -20.404 1.00 64.46 ? 530  GLU A OE1 1 
ATOM   6298 O OE2 . GLU A 1 537 ? 28.010  36.158  -22.589 1.00 54.72 ? 530  GLU A OE2 1 
ATOM   6299 N N   A LYS A 1 538 ? 25.534  35.205  -17.802 0.58 19.92 ? 531  LYS A N   1 
ATOM   6300 N N   B LYS A 1 538 ? 25.534  35.202  -17.802 0.42 19.99 ? 531  LYS A N   1 
ATOM   6301 C CA  A LYS A 1 538 ? 25.252  34.991  -16.392 0.58 26.85 ? 531  LYS A CA  1 
ATOM   6302 C CA  B LYS A 1 538 ? 25.258  34.992  -16.388 0.42 26.74 ? 531  LYS A CA  1 
ATOM   6303 C C   A LYS A 1 538 ? 24.275  36.041  -15.861 0.58 22.77 ? 531  LYS A C   1 
ATOM   6304 C C   B LYS A 1 538 ? 24.285  36.043  -15.853 0.42 22.84 ? 531  LYS A C   1 
ATOM   6305 O O   A LYS A 1 538 ? 23.421  35.747  -15.027 0.58 24.76 ? 531  LYS A O   1 
ATOM   6306 O O   B LYS A 1 538 ? 23.440  35.753  -15.006 0.42 24.72 ? 531  LYS A O   1 
ATOM   6307 C CB  A LYS A 1 538 ? 26.549  35.010  -15.586 0.58 27.99 ? 531  LYS A CB  1 
ATOM   6308 C CB  B LYS A 1 538 ? 26.562  35.011  -15.591 0.42 27.93 ? 531  LYS A CB  1 
ATOM   6309 C CG  A LYS A 1 538 ? 26.389  34.505  -14.169 0.58 23.41 ? 531  LYS A CG  1 
ATOM   6310 C CG  B LYS A 1 538 ? 26.387  34.746  -14.111 0.42 23.98 ? 531  LYS A CG  1 
ATOM   6311 C CD  A LYS A 1 538 ? 27.712  34.515  -13.435 0.58 28.61 ? 531  LYS A CD  1 
ATOM   6312 C CD  B LYS A 1 538 ? 27.734  34.619  -13.427 0.42 28.60 ? 531  LYS A CD  1 
ATOM   6313 C CE  A LYS A 1 538 ? 27.599  33.754  -12.134 0.58 29.57 ? 531  LYS A CE  1 
ATOM   6314 C CE  B LYS A 1 538 ? 27.570  34.399  -11.939 0.42 31.76 ? 531  LYS A CE  1 
ATOM   6315 N NZ  A LYS A 1 538 ? 26.448  34.221  -11.310 0.58 31.55 ? 531  LYS A NZ  1 
ATOM   6316 N NZ  B LYS A 1 538 ? 28.866  34.069  -11.284 0.42 25.65 ? 531  LYS A NZ  1 
ATOM   6317 N N   . SER A 1 539 ? 24.401  37.259  -16.372 1.00 22.35 ? 532  SER A N   1 
ATOM   6318 C CA  . SER A 1 539 ? 23.571  38.361  -15.939 1.00 22.97 ? 532  SER A CA  1 
ATOM   6319 C C   . SER A 1 539 ? 22.121  38.238  -16.416 1.00 20.27 ? 532  SER A C   1 
ATOM   6320 O O   . SER A 1 539 ? 21.231  38.856  -15.839 1.00 27.21 ? 532  SER A O   1 
ATOM   6321 C CB  . SER A 1 539 ? 24.163  39.679  -16.435 1.00 26.85 ? 532  SER A CB  1 
ATOM   6322 O OG  . SER A 1 539 ? 24.264  39.681  -17.847 1.00 30.44 ? 532  SER A OG  1 
ATOM   6323 N N   . ASP A 1 540 ? 21.866  37.454  -17.461 1.00 19.28 ? 533  ASP A N   1 
ATOM   6324 C CA  . ASP A 1 540 ? 20.495  37.373  -17.987 1.00 16.96 ? 533  ASP A CA  1 
ATOM   6325 C C   . ASP A 1 540 ? 19.487  36.824  -16.960 1.00 18.22 ? 533  ASP A C   1 
ATOM   6326 O O   . ASP A 1 540 ? 19.674  35.749  -16.408 1.00 23.02 ? 533  ASP A O   1 
ATOM   6327 C CB  A ASP A 1 540 ? 20.447  36.501  -19.252 0.62 19.85 ? 533  ASP A CB  1 
ATOM   6328 C CB  B ASP A 1 540 ? 20.459  36.517  -19.260 0.38 19.91 ? 533  ASP A CB  1 
ATOM   6329 C CG  A ASP A 1 540 ? 21.340  37.019  -20.361 0.62 20.57 ? 533  ASP A CG  1 
ATOM   6330 C CG  B ASP A 1 540 ? 21.023  37.241  -20.471 0.38 19.91 ? 533  ASP A CG  1 
ATOM   6331 O OD1 A ASP A 1 540 ? 21.831  38.159  -20.241 0.62 23.45 ? 533  ASP A OD1 1 
ATOM   6332 O OD1 B ASP A 1 540 ? 21.056  38.488  -20.455 0.38 29.75 ? 533  ASP A OD1 1 
ATOM   6333 O OD2 A ASP A 1 540 ? 21.542  36.284  -21.360 0.62 21.15 ? 533  ASP A OD2 1 
ATOM   6334 O OD2 B ASP A 1 540 ? 21.424  36.562  -21.445 0.38 22.68 ? 533  ASP A OD2 1 
ATOM   6335 N N   A GLU A 1 541 ? 18.428  37.594  -16.715 0.59 21.26 ? 534  GLU A N   1 
ATOM   6336 N N   B GLU A 1 541 ? 18.415  37.563  -16.701 0.41 21.11 ? 534  GLU A N   1 
ATOM   6337 C CA  A GLU A 1 541 ? 17.318  37.157  -15.880 0.59 17.14 ? 534  GLU A CA  1 
ATOM   6338 C CA  B GLU A 1 541 ? 17.370  37.043  -15.830 0.41 17.19 ? 534  GLU A CA  1 
ATOM   6339 C C   A GLU A 1 541 ? 16.422  36.197  -16.639 0.59 18.47 ? 534  GLU A C   1 
ATOM   6340 C C   B GLU A 1 541 ? 16.452  36.123  -16.621 0.41 18.48 ? 534  GLU A C   1 
ATOM   6341 O O   A GLU A 1 541 ? 15.818  35.300  -16.050 0.59 23.40 ? 534  GLU A O   1 
ATOM   6342 O O   B GLU A 1 541 ? 15.896  35.169  -16.077 0.41 23.15 ? 534  GLU A O   1 
ATOM   6343 C CB  A GLU A 1 541 ? 16.489  38.354  -15.402 0.59 23.48 ? 534  GLU A CB  1 
ATOM   6344 C CB  B GLU A 1 541 ? 16.568  38.178  -15.184 0.41 25.36 ? 534  GLU A CB  1 
ATOM   6345 C CG  A GLU A 1 541 ? 17.158  39.201  -14.336 0.59 25.56 ? 534  GLU A CG  1 
ATOM   6346 C CG  B GLU A 1 541 ? 15.528  37.711  -14.165 0.41 24.69 ? 534  GLU A CG  1 
ATOM   6347 C CD  A GLU A 1 541 ? 16.154  39.957  -13.488 0.59 40.83 ? 534  GLU A CD  1 
ATOM   6348 C CD  B GLU A 1 541 ? 16.136  37.196  -12.865 0.41 26.25 ? 534  GLU A CD  1 
ATOM   6349 O OE1 A GLU A 1 541 ? 15.004  39.482  -13.371 0.59 35.70 ? 534  GLU A OE1 1 
ATOM   6350 O OE1 B GLU A 1 541 ? 17.378  37.177  -12.735 0.41 23.24 ? 534  GLU A OE1 1 
ATOM   6351 O OE2 A GLU A 1 541 ? 16.514  41.018  -12.935 0.59 42.20 ? 534  GLU A OE2 1 
ATOM   6352 O OE2 B GLU A 1 541 ? 15.364  36.807  -11.963 0.41 26.82 ? 534  GLU A OE2 1 
ATOM   6353 N N   A VAL A 1 542 ? 16.331  36.403  -17.949 0.59 17.24 ? 535  VAL A N   1 
ATOM   6354 N N   B VAL A 1 542 ? 16.309  36.409  -17.912 0.41 17.33 ? 535  VAL A N   1 
ATOM   6355 C CA  A VAL A 1 542 ? 15.461  35.607  -18.802 0.59 15.67 ? 535  VAL A CA  1 
ATOM   6356 C CA  B VAL A 1 542 ? 15.466  35.609  -18.791 0.41 15.72 ? 535  VAL A CA  1 
ATOM   6357 C C   A VAL A 1 542 ? 16.276  35.026  -19.943 0.59 11.92 ? 535  VAL A C   1 
ATOM   6358 C C   B VAL A 1 542 ? 16.300  35.023  -19.922 0.41 12.04 ? 535  VAL A C   1 
ATOM   6359 O O   A VAL A 1 542 ? 16.992  35.753  -20.623 0.59 18.26 ? 535  VAL A O   1 
ATOM   6360 O O   B VAL A 1 542 ? 17.054  35.741  -20.575 0.41 18.37 ? 535  VAL A O   1 
ATOM   6361 C CB  A VAL A 1 542 ? 14.293  36.435  -19.383 0.59 18.76 ? 535  VAL A CB  1 
ATOM   6362 C CB  B VAL A 1 542 ? 14.308  36.436  -19.391 0.41 18.70 ? 535  VAL A CB  1 
ATOM   6363 C CG1 A VAL A 1 542 ? 13.475  35.595  -20.346 0.59 21.63 ? 535  VAL A CG1 1 
ATOM   6364 C CG1 B VAL A 1 542 ? 13.481  35.585  -20.339 0.41 21.60 ? 535  VAL A CG1 1 
ATOM   6365 C CG2 A VAL A 1 542 ? 13.412  36.979  -18.270 0.59 17.13 ? 535  VAL A CG2 1 
ATOM   6366 C CG2 B VAL A 1 542 ? 13.432  37.008  -18.288 0.41 17.20 ? 535  VAL A CG2 1 
ATOM   6367 N N   . TYR A 1 543 ? 16.167  33.720  -20.142 1.00 15.88 ? 536  TYR A N   1 
ATOM   6368 C CA  . TYR A 1 543 ? 16.866  33.036  -21.231 1.00 12.36 ? 536  TYR A CA  1 
ATOM   6369 C C   . TYR A 1 543 ? 16.255  33.375  -22.585 1.00 13.48 ? 536  TYR A C   1 
ATOM   6370 O O   . TYR A 1 543 ? 15.027  33.387  -22.753 1.00 17.41 ? 536  TYR A O   1 
ATOM   6371 C CB  . TYR A 1 543 ? 16.804  31.517  -21.054 1.00 17.58 ? 536  TYR A CB  1 
ATOM   6372 C CG  . TYR A 1 543 ? 17.445  30.951  -19.804 1.00 16.31 ? 536  TYR A CG  1 
ATOM   6373 C CD1 . TYR A 1 543 ? 18.637  31.464  -19.309 1.00 17.69 ? 536  TYR A CD1 1 
ATOM   6374 C CD2 . TYR A 1 543 ? 16.863  29.882  -19.148 1.00 13.82 ? 536  TYR A CD2 1 
ATOM   6375 C CE1 . TYR A 1 543 ? 19.226  30.923  -18.178 1.00 17.75 ? 536  TYR A CE1 1 
ATOM   6376 C CE2 . TYR A 1 543 ? 17.435  29.341  -18.014 1.00 14.82 ? 536  TYR A CE2 1 
ATOM   6377 C CZ  . TYR A 1 543 ? 18.608  29.868  -17.530 1.00 14.06 ? 536  TYR A CZ  1 
ATOM   6378 O OH  . TYR A 1 543 ? 19.186  29.312  -16.414 1.00 13.83 ? 536  TYR A OH  1 
ATOM   6379 N N   . LYS A 1 544 ? 17.130  33.646  -23.540 1.00 13.46 ? 537  LYS A N   1 
ATOM   6380 C CA  . LYS A 1 544 ? 16.745  33.732  -24.947 1.00 19.10 ? 537  LYS A CA  1 
ATOM   6381 C C   . LYS A 1 544 ? 17.069  32.440  -25.687 1.00 13.57 ? 537  LYS A C   1 
ATOM   6382 O O   . LYS A 1 544 ? 18.077  31.783  -25.413 1.00 17.36 ? 537  LYS A O   1 
ATOM   6383 C CB  . LYS A 1 544 ? 17.449  34.905  -25.625 1.00 15.38 ? 537  LYS A CB  1 
ATOM   6384 C CG  . LYS A 1 544 ? 16.987  36.251  -25.100 1.00 32.42 ? 537  LYS A CG  1 
ATOM   6385 C CD  . LYS A 1 544 ? 17.632  37.409  -25.837 1.00 36.37 ? 537  LYS A CD  1 
ATOM   6386 C CE  . LYS A 1 544 ? 17.205  38.732  -25.214 1.00 46.59 ? 537  LYS A CE  1 
ATOM   6387 N NZ  . LYS A 1 544 ? 15.778  38.694  -24.783 1.00 42.23 ? 537  LYS A NZ  1 
ATOM   6388 N N   . CYS A 1 545 ? 16.216  32.070  -26.636 1.00 17.19 ? 538  CYS A N   1 
ATOM   6389 C CA  . CYS A 1 545 ? 16.420  30.838  -27.396 1.00 13.56 ? 538  CYS A CA  1 
ATOM   6390 C C   . CYS A 1 545 ? 16.024  31.025  -28.850 1.00 14.05 ? 538  CYS A C   1 
ATOM   6391 O O   . CYS A 1 545 ? 15.177  31.862  -29.167 1.00 13.83 ? 538  CYS A O   1 
ATOM   6392 C CB  . CYS A 1 545 ? 15.620  29.693  -26.783 1.00 16.98 ? 538  CYS A CB  1 
ATOM   6393 S SG  . CYS A 1 545 ? 13.822  29.885  -26.922 1.00 18.20 ? 538  CYS A SG  1 
ATOM   6394 N N   . LEU A 1 546 ? 16.627  30.244  -29.739 1.00 10.74 ? 539  LEU A N   1 
ATOM   6395 C CA  . LEU A 1 546 ? 16.101  30.147  -31.102 1.00 10.68 ? 539  LEU A CA  1 
ATOM   6396 C C   . LEU A 1 546 ? 14.941  29.148  -31.130 1.00 12.23 ? 539  LEU A C   1 
ATOM   6397 O O   . LEU A 1 546 ? 15.126  27.934  -30.978 1.00 16.22 ? 539  LEU A O   1 
ATOM   6398 C CB  . LEU A 1 546 ? 17.188  29.732  -32.093 1.00 15.08 ? 539  LEU A CB  1 
ATOM   6399 C CG  . LEU A 1 546 ? 16.676  29.604  -33.528 1.00 15.42 ? 539  LEU A CG  1 
ATOM   6400 C CD1 . LEU A 1 546 ? 16.305  30.967  -34.084 1.00 19.58 ? 539  LEU A CD1 1 
ATOM   6401 C CD2 . LEU A 1 546 ? 17.733  28.972  -34.430 1.00 18.33 ? 539  LEU A CD2 1 
ATOM   6402 N N   . ASN A 1 547 ? 13.736  29.671  -31.300 1.00 15.53 ? 540  ASN A N   1 
ATOM   6403 C CA  . ASN A 1 547 ? 12.568  28.830  -31.475 1.00 14.88 ? 540  ASN A CA  1 
ATOM   6404 C C   . ASN A 1 547 ? 12.487  28.379  -32.918 1.00 14.88 ? 540  ASN A C   1 
ATOM   6405 O O   . ASN A 1 547 ? 12.428  29.194  -33.834 1.00 15.99 ? 540  ASN A O   1 
ATOM   6406 C CB  . ASN A 1 547 ? 11.309  29.579  -31.086 1.00 13.07 ? 540  ASN A CB  1 
ATOM   6407 C CG  . ASN A 1 547 ? 10.145  28.660  -30.827 1.00 15.82 ? 540  ASN A CG  1 
ATOM   6408 O OD1 . ASN A 1 547 ? 10.080  28.011  -29.782 1.00 14.53 ? 540  ASN A OD1 1 
ATOM   6409 N ND2 . ASN A 1 547 ? 9.206   28.609  -31.765 1.00 14.37 ? 540  ASN A ND2 1 
ATOM   6410 N N   . ILE A 1 548 ? 12.514  27.075  -33.112 1.00 11.26 ? 541  ILE A N   1 
ATOM   6411 C CA  . ILE A 1 548 ? 12.533  26.501  -34.452 1.00 11.12 ? 541  ILE A CA  1 
ATOM   6412 C C   . ILE A 1 548 ? 11.135  25.965  -34.807 1.00 16.08 ? 541  ILE A C   1 
ATOM   6413 O O   . ILE A 1 548 ? 10.725  24.916  -34.329 1.00 13.65 ? 541  ILE A O   1 
ATOM   6414 C CB  . ILE A 1 548 ? 13.613  25.388  -34.529 1.00 16.10 ? 541  ILE A CB  1 
ATOM   6415 C CG1 . ILE A 1 548 ? 14.997  25.952  -34.217 1.00 18.59 ? 541  ILE A CG1 1 
ATOM   6416 C CG2 . ILE A 1 548 ? 13.596  24.690  -35.889 1.00 20.63 ? 541  ILE A CG2 1 
ATOM   6417 C CD1 . ILE A 1 548 ? 16.042  24.888  -33.860 1.00 17.81 ? 541  ILE A CD1 1 
ATOM   6418 N N   A SER A 1 549 ? 10.382  26.729  -35.601 0.40 16.35 ? 542  SER A N   1 
ATOM   6419 N N   B SER A 1 549 ? 10.422  26.687  -35.665 0.60 16.28 ? 542  SER A N   1 
ATOM   6420 C CA  A SER A 1 549 ? 9.043   26.315  -36.036 0.40 12.11 ? 542  SER A CA  1 
ATOM   6421 C CA  B SER A 1 549 ? 9.127   26.234  -36.158 0.60 12.00 ? 542  SER A CA  1 
ATOM   6422 C C   A SER A 1 549 ? 9.011   26.341  -37.558 0.40 16.36 ? 542  SER A C   1 
ATOM   6423 C C   B SER A 1 549 ? 9.220   26.264  -37.677 0.60 14.70 ? 542  SER A C   1 
ATOM   6424 O O   A SER A 1 549 ? 9.994   25.966  -38.192 0.40 17.99 ? 542  SER A O   1 
ATOM   6425 O O   B SER A 1 549 ? 10.277  25.944  -38.223 0.60 16.42 ? 542  SER A O   1 
ATOM   6426 C CB  A SER A 1 549 ? 7.954   27.223  -35.442 0.40 14.82 ? 542  SER A CB  1 
ATOM   6427 C CB  B SER A 1 549 ? 8.007   27.125  -35.633 0.60 14.95 ? 542  SER A CB  1 
ATOM   6428 O OG  A SER A 1 549 ? 8.004   28.549  -35.961 0.40 9.89  ? 542  SER A OG  1 
ATOM   6429 O OG  B SER A 1 549 ? 6.744   26.628  -36.021 0.60 23.22 ? 542  SER A OG  1 
ATOM   6430 N N   A ASP A 1 550 ? 7.892   26.771  -38.140 0.40 16.08 ? 543  ASP A N   1 
ATOM   6431 N N   B ASP A 1 550 ? 8.140   26.647  -38.358 0.60 17.45 ? 543  ASP A N   1 
ATOM   6432 C CA  A ASP A 1 550 ? 7.851   27.043  -39.575 0.40 20.15 ? 543  ASP A CA  1 
ATOM   6433 C CA  B ASP A 1 550 ? 8.231   26.924  -39.791 0.60 18.16 ? 543  ASP A CA  1 
ATOM   6434 C C   A ASP A 1 550 ? 8.851   28.147  -39.898 0.40 19.32 ? 543  ASP A C   1 
ATOM   6435 C C   B ASP A 1 550 ? 9.072   28.178  -40.001 0.60 21.48 ? 543  ASP A C   1 
ATOM   6436 O O   A ASP A 1 550 ? 9.477   28.150  -40.961 0.40 22.93 ? 543  ASP A O   1 
ATOM   6437 O O   B ASP A 1 550 ? 9.715   28.349  -41.039 0.60 20.01 ? 543  ASP A O   1 
ATOM   6438 C CB  A ASP A 1 550 ? 6.444   27.448  -40.022 0.40 21.80 ? 543  ASP A CB  1 
ATOM   6439 C CB  B ASP A 1 550 ? 6.849   27.094  -40.424 0.60 21.17 ? 543  ASP A CB  1 
ATOM   6440 C CG  A ASP A 1 550 ? 5.486   26.271  -40.086 0.40 25.38 ? 543  ASP A CG  1 
ATOM   6441 C CG  B ASP A 1 550 ? 6.109   25.781  -40.568 0.60 14.93 ? 543  ASP A CG  1 
ATOM   6442 O OD1 A ASP A 1 550 ? 5.793   25.218  -39.491 0.40 23.44 ? 543  ASP A OD1 1 
ATOM   6443 O OD1 B ASP A 1 550 ? 6.269   25.106  -41.608 0.60 16.51 ? 543  ASP A OD1 1 
ATOM   6444 O OD2 A ASP A 1 550 ? 4.418   26.403  -40.725 0.40 36.58 ? 543  ASP A OD2 1 
ATOM   6445 O OD2 B ASP A 1 550 ? 5.365   25.419  -39.633 0.60 29.84 ? 543  ASP A OD2 1 
ATOM   6446 N N   A GLU A 1 551 ? 8.994   29.085  -38.969 0.40 15.64 ? 544  GLU A N   1 
ATOM   6447 N N   B GLU A 1 551 ? 9.061   29.062  -39.011 0.60 15.63 ? 544  GLU A N   1 
ATOM   6448 C CA  A GLU A 1 551 ? 10.016  30.122  -39.058 0.40 18.58 ? 544  GLU A CA  1 
ATOM   6449 C CA  B GLU A 1 551 ? 9.980   30.193  -39.000 0.60 18.61 ? 544  GLU A CA  1 
ATOM   6450 C C   A GLU A 1 551 ? 11.023  30.008  -37.916 0.40 17.66 ? 544  GLU A C   1 
ATOM   6451 C C   B GLU A 1 551 ? 11.008  30.043  -37.888 0.60 17.73 ? 544  GLU A C   1 
ATOM   6452 O O   A GLU A 1 551 ? 10.785  29.301  -36.933 0.40 17.15 ? 544  GLU A O   1 
ATOM   6453 O O   B GLU A 1 551 ? 10.777  29.330  -36.905 0.60 17.08 ? 544  GLU A O   1 
ATOM   6454 C CB  A GLU A 1 551 ? 9.373   31.509  -39.052 0.40 25.43 ? 544  GLU A CB  1 
ATOM   6455 C CB  B GLU A 1 551 ? 9.217   31.505  -38.834 0.60 25.01 ? 544  GLU A CB  1 
ATOM   6456 C CG  A GLU A 1 551 ? 8.535   31.812  -40.286 0.40 18.46 ? 544  GLU A CG  1 
ATOM   6457 C CG  B GLU A 1 551 ? 8.823   31.826  -37.406 0.60 31.56 ? 544  GLU A CG  1 
ATOM   6458 C CD  A GLU A 1 551 ? 7.046   31.795  -40.005 0.40 31.44 ? 544  GLU A CD  1 
ATOM   6459 C CD  B GLU A 1 551 ? 7.802   32.934  -37.333 0.60 30.24 ? 544  GLU A CD  1 
ATOM   6460 O OE1 A GLU A 1 551 ? 6.649   32.151  -38.876 0.40 30.15 ? 544  GLU A OE1 1 
ATOM   6461 O OE1 B GLU A 1 551 ? 7.475   33.498  -38.400 0.60 39.28 ? 544  GLU A OE1 1 
ATOM   6462 O OE2 A GLU A 1 551 ? 6.273   31.423  -40.913 0.40 36.68 ? 544  GLU A OE2 1 
ATOM   6463 O OE2 B GLU A 1 551 ? 7.315   33.232  -36.220 0.60 24.24 ? 544  GLU A OE2 1 
ATOM   6464 N N   . LEU A 1 552 ? 12.148  30.703  -38.058 1.00 19.60 ? 545  LEU A N   1 
ATOM   6465 C CA  . LEU A 1 552 ? 13.182  30.738  -37.026 1.00 15.54 ? 545  LEU A CA  1 
ATOM   6466 C C   . LEU A 1 552 ? 13.121  32.100  -36.360 1.00 24.58 ? 545  LEU A C   1 
ATOM   6467 O O   . LEU A 1 552 ? 13.256  33.132  -37.015 1.00 18.13 ? 545  LEU A O   1 
ATOM   6468 C CB  . LEU A 1 552 ? 14.568  30.462  -37.619 1.00 12.23 ? 545  LEU A CB  1 
ATOM   6469 C CG  . LEU A 1 552 ? 14.702  29.245  -38.545 1.00 13.95 ? 545  LEU A CG  1 
ATOM   6470 C CD1 . LEU A 1 552 ? 16.123  29.191  -39.113 1.00 17.34 ? 545  LEU A CD1 1 
ATOM   6471 C CD2 . LEU A 1 552 ? 14.359  27.926  -37.863 1.00 17.06 ? 545  LEU A CD2 1 
ATOM   6472 N N   . LYS A 1 553 ? 12.897  32.114  -35.053 1.00 17.37 ? 546  LYS A N   1 
ATOM   6473 C CA  . LYS A 1 553 ? 12.703  33.367  -34.366 1.00 15.49 ? 546  LYS A CA  1 
ATOM   6474 C C   . LYS A 1 553 ? 13.334  33.303  -32.989 1.00 15.99 ? 546  LYS A C   1 
ATOM   6475 O O   . LYS A 1 553 ? 13.123  32.335  -32.257 1.00 19.98 ? 546  LYS A O   1 
ATOM   6476 C CB  A LYS A 1 553 ? 11.211  33.685  -34.265 0.53 21.06 ? 546  LYS A CB  1 
ATOM   6477 C CB  B LYS A 1 553 ? 11.211  33.694  -34.248 0.47 21.01 ? 546  LYS A CB  1 
ATOM   6478 C CG  A LYS A 1 553 ? 10.890  35.151  -34.055 0.53 20.14 ? 546  LYS A CG  1 
ATOM   6479 C CG  B LYS A 1 553 ? 10.916  34.952  -33.448 0.47 12.21 ? 546  LYS A CG  1 
ATOM   6480 C CD  A LYS A 1 553 ? 9.662   35.542  -34.866 0.53 28.76 ? 546  LYS A CD  1 
ATOM   6481 C CD  B LYS A 1 553 ? 9.441   35.310  -33.461 0.47 14.32 ? 546  LYS A CD  1 
ATOM   6482 C CE  A LYS A 1 553 ? 9.916   35.354  -36.353 0.53 34.11 ? 546  LYS A CE  1 
ATOM   6483 C CE  B LYS A 1 553 ? 9.175   36.566  -32.644 0.47 21.41 ? 546  LYS A CE  1 
ATOM   6484 N NZ  A LYS A 1 553 ? 8.769   35.814  -37.179 0.53 30.20 ? 546  LYS A NZ  1 
ATOM   6485 N NZ  B LYS A 1 553 ? 7.797   37.070  -32.877 0.47 22.12 ? 546  LYS A NZ  1 
ATOM   6486 N N   . MET A 1 554 ? 14.112  34.329  -32.650 1.00 15.14 ? 547  MET A N   1 
ATOM   6487 C CA  . MET A 1 554 ? 14.616  34.481  -31.286 1.00 14.23 ? 547  MET A CA  1 
ATOM   6488 C C   . MET A 1 554 ? 13.502  34.951  -30.364 1.00 20.01 ? 547  MET A C   1 
ATOM   6489 O O   . MET A 1 554 ? 12.816  35.935  -30.651 1.00 17.90 ? 547  MET A O   1 
ATOM   6490 C CB  A MET A 1 554 ? 15.784  35.463  -31.248 0.53 16.90 ? 547  MET A CB  1 
ATOM   6491 C CB  B MET A 1 554 ? 15.788  35.460  -31.243 0.47 16.91 ? 547  MET A CB  1 
ATOM   6492 C CG  A MET A 1 554 ? 17.001  34.984  -32.025 0.53 14.52 ? 547  MET A CG  1 
ATOM   6493 C CG  B MET A 1 554 ? 17.029  34.967  -31.978 0.47 14.44 ? 547  MET A CG  1 
ATOM   6494 S SD  A MET A 1 554 ? 17.692  33.464  -31.370 0.53 17.80 ? 547  MET A SD  1 
ATOM   6495 S SD  B MET A 1 554 ? 17.664  33.406  -31.356 0.47 17.80 ? 547  MET A SD  1 
ATOM   6496 C CE  A MET A 1 554 ? 17.927  33.908  -29.646 0.53 15.35 ? 547  MET A CE  1 
ATOM   6497 C CE  B MET A 1 554 ? 17.951  33.807  -29.629 0.47 15.27 ? 547  MET A CE  1 
ATOM   6498 N N   A ILE A 1 555 ? 13.307  34.228  -29.267 0.72 15.11 ? 548  ILE A N   1 
ATOM   6499 N N   B ILE A 1 555 ? 13.293  34.224  -29.271 0.28 15.16 ? 548  ILE A N   1 
ATOM   6500 C CA  A ILE A 1 555 ? 12.273  34.575  -28.302 0.72 14.79 ? 548  ILE A CA  1 
ATOM   6501 C CA  B ILE A 1 555 ? 12.264  34.582  -28.301 0.28 14.86 ? 548  ILE A CA  1 
ATOM   6502 C C   A ILE A 1 555 ? 12.755  34.352  -26.871 0.72 16.57 ? 548  ILE A C   1 
ATOM   6503 C C   B ILE A 1 555 ? 12.744  34.342  -26.875 0.28 16.58 ? 548  ILE A C   1 
ATOM   6504 O O   A ILE A 1 555 ? 13.736  33.649  -26.636 0.72 17.21 ? 548  ILE A O   1 
ATOM   6505 O O   B ILE A 1 555 ? 13.712  33.617  -26.647 0.28 16.92 ? 548  ILE A O   1 
ATOM   6506 C CB  A ILE A 1 555 ? 10.984  33.751  -28.522 0.72 12.29 ? 548  ILE A CB  1 
ATOM   6507 C CB  B ILE A 1 555 ? 10.956  33.780  -28.510 0.28 11.96 ? 548  ILE A CB  1 
ATOM   6508 C CG1 A ILE A 1 555 ? 11.175  32.299  -28.071 0.72 14.35 ? 548  ILE A CG1 1 
ATOM   6509 C CG1 B ILE A 1 555 ? 11.194  32.284  -28.277 0.28 14.58 ? 548  ILE A CG1 1 
ATOM   6510 C CG2 A ILE A 1 555 ? 10.523  33.818  -29.991 0.72 17.40 ? 548  ILE A CG2 1 
ATOM   6511 C CG2 B ILE A 1 555 ? 10.352  34.045  -29.895 0.28 16.75 ? 548  ILE A CG2 1 
ATOM   6512 C CD1 A ILE A 1 555 ? 9.940   31.451  -28.227 0.72 15.37 ? 548  ILE A CD1 1 
ATOM   6513 C CD1 B ILE A 1 555 ? 9.928   31.461  -28.259 0.28 15.50 ? 548  ILE A CD1 1 
ATOM   6514 N N   . ASP A 1 556 ? 12.058  34.952  -25.915 1.00 15.70 ? 549  ASP A N   1 
ATOM   6515 C CA  . ASP A 1 556 ? 12.295  34.642  -24.514 1.00 13.37 ? 549  ASP A CA  1 
ATOM   6516 C C   . ASP A 1 556 ? 11.693  33.261  -24.285 1.00 13.51 ? 549  ASP A C   1 
ATOM   6517 O O   . ASP A 1 556 ? 10.618  32.964  -24.806 1.00 14.53 ? 549  ASP A O   1 
ATOM   6518 C CB  . ASP A 1 556 ? 11.674  35.705  -23.589 1.00 14.27 ? 549  ASP A CB  1 
ATOM   6519 C CG  . ASP A 1 556 ? 12.490  37.006  -23.554 1.00 42.41 ? 549  ASP A CG  1 
ATOM   6520 O OD1 . ASP A 1 556 ? 13.697  36.968  -23.878 1.00 26.34 ? 549  ASP A OD1 1 
ATOM   6521 O OD2 . ASP A 1 556 ? 11.935  38.071  -23.198 1.00 27.96 ? 549  ASP A OD2 1 
ATOM   6522 N N   . VAL A 1 557 ? 12.410  32.397  -23.570 1.00 13.21 ? 550  VAL A N   1 
ATOM   6523 C CA  . VAL A 1 557 ? 11.922  31.042  -23.334 1.00 13.78 ? 550  VAL A CA  1 
ATOM   6524 C C   . VAL A 1 557 ? 10.555  31.111  -22.654 1.00 15.00 ? 550  VAL A C   1 
ATOM   6525 O O   . VAL A 1 557 ? 10.440  31.630  -21.549 1.00 15.76 ? 550  VAL A O   1 
ATOM   6526 C CB  . VAL A 1 557 ? 12.910  30.250  -22.443 1.00 15.95 ? 550  VAL A CB  1 
ATOM   6527 C CG1 . VAL A 1 557 ? 12.272  28.964  -21.911 1.00 20.89 ? 550  VAL A CG1 1 
ATOM   6528 C CG2 . VAL A 1 557 ? 14.238  29.990  -23.178 1.00 14.19 ? 550  VAL A CG2 1 
ATOM   6529 N N   . PRO A 1 558 ? 9.508   30.594  -23.306 1.00 13.29 ? 551  PRO A N   1 
ATOM   6530 C CA  . PRO A 1 558 ? 8.146   30.681  -22.758 1.00 16.31 ? 551  PRO A CA  1 
ATOM   6531 C C   . PRO A 1 558 ? 8.039   30.011  -21.385 1.00 14.99 ? 551  PRO A C   1 
ATOM   6532 O O   . PRO A 1 558 ? 7.178   30.376  -20.575 1.00 20.40 ? 551  PRO A O   1 
ATOM   6533 C CB  . PRO A 1 558 ? 7.304   29.955  -23.810 1.00 19.27 ? 551  PRO A CB  1 
ATOM   6534 C CG  . PRO A 1 558 ? 8.131   30.021  -25.072 1.00 15.85 ? 551  PRO A CG  1 
ATOM   6535 C CD  . PRO A 1 558 ? 9.550   29.944  -24.627 1.00 16.65 ? 551  PRO A CD  1 
ATOM   6536 N N   . GLU A 1 559 ? 8.930   29.063  -21.130 1.00 14.56 ? 552  GLU A N   1 
ATOM   6537 C CA  . GLU A 1 559 ? 8.929   28.268  -19.904 1.00 12.80 ? 552  GLU A CA  1 
ATOM   6538 C C   . GLU A 1 559 ? 9.553   28.989  -18.702 1.00 20.78 ? 552  GLU A C   1 
ATOM   6539 O O   . GLU A 1 559 ? 9.566   28.444  -17.595 1.00 15.23 ? 552  GLU A O   1 
ATOM   6540 C CB  . GLU A 1 559 ? 9.687   26.955  -20.166 1.00 13.46 ? 552  GLU A CB  1 
ATOM   6541 C CG  . GLU A 1 559 ? 8.967   25.889  -21.001 1.00 11.88 ? 552  GLU A CG  1 
ATOM   6542 C CD  . GLU A 1 559 ? 8.873   26.180  -22.490 1.00 16.93 ? 552  GLU A CD  1 
ATOM   6543 O OE1 . GLU A 1 559 ? 9.629   27.029  -23.011 1.00 16.25 ? 552  GLU A OE1 1 
ATOM   6544 O OE2 . GLU A 1 559 ? 7.997   25.565  -23.137 1.00 18.10 ? 552  GLU A OE2 1 
ATOM   6545 N N   . MET A 1 560 ? 10.069  30.202  -18.913 1.00 12.55 ? 553  MET A N   1 
ATOM   6546 C CA  . MET A 1 560 ? 10.845  30.918  -17.875 1.00 12.75 ? 553  MET A CA  1 
ATOM   6547 C C   . MET A 1 560 ? 10.114  31.105  -16.570 1.00 14.13 ? 553  MET A C   1 
ATOM   6548 O O   . MET A 1 560 ? 10.716  30.943  -15.503 1.00 12.75 ? 553  MET A O   1 
ATOM   6549 C CB  A MET A 1 560 ? 11.260  32.296  -18.392 0.23 14.36 ? 553  MET A CB  1 
ATOM   6550 C CB  B MET A 1 560 ? 11.313  32.283  -18.380 0.77 14.28 ? 553  MET A CB  1 
ATOM   6551 C CG  A MET A 1 560 ? 12.314  32.982  -17.541 0.23 16.84 ? 553  MET A CG  1 
ATOM   6552 C CG  B MET A 1 560 ? 12.566  32.785  -17.663 0.77 19.24 ? 553  MET A CG  1 
ATOM   6553 S SD  A MET A 1 560 ? 13.880  32.116  -17.713 0.23 24.03 ? 553  MET A SD  1 
ATOM   6554 S SD  B MET A 1 560 ? 14.049  31.828  -18.103 0.77 11.88 ? 553  MET A SD  1 
ATOM   6555 C CE  A MET A 1 560 ? 13.819  31.786  -19.461 0.23 19.99 ? 553  MET A CE  1 
ATOM   6556 C CE  B MET A 1 560 ? 15.051  32.034  -16.627 0.77 20.87 ? 553  MET A CE  1 
ATOM   6557 N N   . GLY A 1 561 ? 8.836   31.473  -16.651 1.00 13.80 ? 554  GLY A N   1 
ATOM   6558 C CA  . GLY A 1 561 ? 8.059   31.730  -15.451 1.00 13.55 ? 554  GLY A CA  1 
ATOM   6559 C C   . GLY A 1 561 ? 7.957   30.516  -14.550 1.00 14.20 ? 554  GLY A C   1 
ATOM   6560 O O   . GLY A 1 561 ? 8.090   30.618  -13.319 1.00 15.91 ? 554  GLY A O   1 
ATOM   6561 N N   A LYS A 1 562 ? 7.711   29.362  -15.149 0.69 13.64 ? 555  LYS A N   1 
ATOM   6562 N N   B LYS A 1 562 ? 7.719   29.358  -15.151 0.31 13.77 ? 555  LYS A N   1 
ATOM   6563 C CA  A LYS A 1 562 ? 7.590   28.142  -14.376 0.69 11.40 ? 555  LYS A CA  1 
ATOM   6564 C CA  B LYS A 1 562 ? 7.591   28.129  -14.384 0.31 11.38 ? 555  LYS A CA  1 
ATOM   6565 C C   A LYS A 1 562 ? 8.960   27.713  -13.853 0.69 14.99 ? 555  LYS A C   1 
ATOM   6566 C C   B LYS A 1 562 ? 8.953   27.661  -13.877 0.31 14.75 ? 555  LYS A C   1 
ATOM   6567 O O   A LYS A 1 562 ? 9.078   27.244  -12.717 0.69 14.60 ? 555  LYS A O   1 
ATOM   6568 O O   B LYS A 1 562 ? 9.055   27.094  -12.787 0.31 14.86 ? 555  LYS A O   1 
ATOM   6569 C CB  A LYS A 1 562 ? 6.921   27.060  -15.224 0.69 12.00 ? 555  LYS A CB  1 
ATOM   6570 C CB  B LYS A 1 562 ? 6.909   27.054  -15.230 0.31 12.12 ? 555  LYS A CB  1 
ATOM   6571 C CG  A LYS A 1 562 ? 5.454   27.367  -15.486 0.69 13.88 ? 555  LYS A CG  1 
ATOM   6572 C CG  B LYS A 1 562 ? 5.462   27.392  -15.548 0.31 14.01 ? 555  LYS A CG  1 
ATOM   6573 C CD  A LYS A 1 562 ? 4.915   26.557  -16.650 0.69 14.92 ? 555  LYS A CD  1 
ATOM   6574 C CD  B LYS A 1 562 ? 4.857   26.412  -16.535 0.31 15.00 ? 555  LYS A CD  1 
ATOM   6575 C CE  A LYS A 1 562 ? 3.489   26.952  -17.000 0.69 15.42 ? 555  LYS A CE  1 
ATOM   6576 C CE  B LYS A 1 562 ? 3.424   26.790  -16.865 0.31 15.52 ? 555  LYS A CE  1 
ATOM   6577 N NZ  A LYS A 1 562 ? 3.078   26.304  -18.273 0.69 14.75 ? 555  LYS A NZ  1 
ATOM   6578 N NZ  B LYS A 1 562 ? 2.856   25.909  -17.915 0.31 16.06 ? 555  LYS A NZ  1 
ATOM   6579 N N   . ILE A 1 563 ? 9.997   27.918  -14.659 1.00 12.91 ? 556  ILE A N   1 
ATOM   6580 C CA  . ILE A 1 563 ? 11.356  27.622  -14.233 1.00 10.96 ? 556  ILE A CA  1 
ATOM   6581 C C   . ILE A 1 563 ? 11.697  28.366  -12.938 1.00 14.28 ? 556  ILE A C   1 
ATOM   6582 O O   . ILE A 1 563 ? 12.250  27.793  -12.006 1.00 14.67 ? 556  ILE A O   1 
ATOM   6583 C CB  A ILE A 1 563 ? 12.345  27.973  -15.349 1.00 11.92 ? 556  ILE A CB  1 
ATOM   6584 C CG1 A ILE A 1 563 ? 12.195  26.965  -16.490 1.00 11.01 ? 556  ILE A CG1 1 
ATOM   6585 C CG2 A ILE A 1 563 ? 13.739  27.970  -14.831 1.00 12.77 ? 556  ILE A CG2 1 
ATOM   6586 C CD1 A ILE A 1 563 ? 13.014  27.318  -17.724 1.00 13.45 ? 556  ILE A CD1 1 
ATOM   6587 N N   . LYS A 1 564 ? 11.319  29.633  -12.858 1.00 14.67 ? 557  LYS A N   1 
ATOM   6588 C CA  . LYS A 1 564 ? 11.623  30.430  -11.671 1.00 12.61 ? 557  LYS A CA  1 
ATOM   6589 C C   . LYS A 1 564 ? 10.795  29.951  -10.473 1.00 15.14 ? 557  LYS A C   1 
ATOM   6590 O O   . LYS A 1 564 ? 11.254  29.996  -9.337  1.00 14.84 ? 557  LYS A O   1 
ATOM   6591 C CB  . LYS A 1 564 ? 11.359  31.921  -11.944 1.00 18.82 ? 557  LYS A CB  1 
ATOM   6592 C CG  . LYS A 1 564 ? 12.283  32.559  -12.980 1.00 15.32 ? 557  LYS A CG  1 
ATOM   6593 C CD  . LYS A 1 564 ? 13.752  32.360  -12.659 1.00 16.19 ? 557  LYS A CD  1 
ATOM   6594 C CE  . LYS A 1 564 ? 14.197  33.206  -11.456 1.00 27.44 ? 557  LYS A CE  1 
ATOM   6595 N NZ  . LYS A 1 564 ? 15.680  33.332  -11.294 1.00 24.05 ? 557  LYS A NZ  1 
ATOM   6596 N N   . GLN A 1 565 ? 9.574   29.497  -10.724 1.00 15.23 ? 558  GLN A N   1 
ATOM   6597 C CA  . GLN A 1 565 ? 8.759   28.950  -9.641  1.00 14.34 ? 558  GLN A CA  1 
ATOM   6598 C C   . GLN A 1 565 ? 9.383   27.673  -9.069  1.00 15.24 ? 558  GLN A C   1 
ATOM   6599 O O   . GLN A 1 565 ? 9.385   27.477  -7.855  1.00 15.13 ? 558  GLN A O   1 
ATOM   6600 C CB  A GLN A 1 565 ? 7.340   28.686  -10.123 1.00 12.64 ? 558  GLN A CB  1 
ATOM   6601 C CG  A GLN A 1 565 ? 6.564   29.962  -10.456 1.00 18.56 ? 558  GLN A CG  1 
ATOM   6602 C CD  A GLN A 1 565 ? 5.205   29.671  -11.051 1.00 19.14 ? 558  GLN A CD  1 
ATOM   6603 O OE1 A GLN A 1 565 ? 4.994   29.834  -12.260 1.00 22.23 ? 558  GLN A OE1 1 
ATOM   6604 N NE2 A GLN A 1 565 ? 4.274   29.230  -10.216 1.00 22.34 ? 558  GLN A NE2 1 
ATOM   6605 N N   A TRP A 1 566 ? 9.907   26.808  -9.931  0.44 15.13 ? 559  TRP A N   1 
ATOM   6606 N N   C TRP A 1 566 ? 9.912   26.807  -9.926  0.56 15.07 ? 559  TRP A N   1 
ATOM   6607 C CA  A TRP A 1 566 ? 10.602  25.614  -9.455  0.44 14.92 ? 559  TRP A CA  1 
ATOM   6608 C CA  C TRP A 1 566 ? 10.593  25.612  -9.431  0.56 14.87 ? 559  TRP A CA  1 
ATOM   6609 C C   A TRP A 1 566 ? 11.807  26.004  -8.600  0.44 12.32 ? 559  TRP A C   1 
ATOM   6610 C C   C TRP A 1 566 ? 11.829  26.009  -8.615  0.56 12.29 ? 559  TRP A C   1 
ATOM   6611 O O   A TRP A 1 566 ? 12.019  25.450  -7.518  0.44 14.88 ? 559  TRP A O   1 
ATOM   6612 O O   C TRP A 1 566 ? 12.083  25.444  -7.547  0.56 15.00 ? 559  TRP A O   1 
ATOM   6613 C CB  A TRP A 1 566 ? 11.043  24.733  -10.633 0.44 12.80 ? 559  TRP A CB  1 
ATOM   6614 C CB  C TRP A 1 566 ? 10.971  24.677  -10.593 0.56 12.79 ? 559  TRP A CB  1 
ATOM   6615 C CG  A TRP A 1 566 ? 9.976   23.812  -11.129 0.44 14.43 ? 559  TRP A CG  1 
ATOM   6616 C CG  C TRP A 1 566 ? 9.818   23.841  -11.080 0.56 14.55 ? 559  TRP A CG  1 
ATOM   6617 C CD1 A TRP A 1 566 ? 8.911   24.140  -11.920 0.44 13.49 ? 559  TRP A CD1 1 
ATOM   6618 C CD1 C TRP A 1 566 ? 8.742   24.268  -11.813 0.56 14.19 ? 559  TRP A CD1 1 
ATOM   6619 C CD2 A TRP A 1 566 ? 9.874   22.398  -10.886 0.44 12.33 ? 559  TRP A CD2 1 
ATOM   6620 C CD2 C TRP A 1 566 ? 9.626   22.426  -10.880 0.56 12.50 ? 559  TRP A CD2 1 
ATOM   6621 N NE1 A TRP A 1 566 ? 8.141   23.022  -12.162 0.44 15.05 ? 559  TRP A NE1 1 
ATOM   6622 N NE1 C TRP A 1 566 ? 7.887   23.213  -12.061 0.56 12.37 ? 559  TRP A NE1 1 
ATOM   6623 C CE2 A TRP A 1 566 ? 8.716   21.943  -11.546 0.44 12.33 ? 559  TRP A CE2 1 
ATOM   6624 C CE2 C TRP A 1 566 ? 8.413   22.075  -11.509 0.56 12.35 ? 559  TRP A CE2 1 
ATOM   6625 C CE3 A TRP A 1 566 ? 10.649  21.477  -10.171 0.44 13.49 ? 559  TRP A CE3 1 
ATOM   6626 C CE3 C TRP A 1 566 ? 10.362  21.427  -10.230 0.56 12.85 ? 559  TRP A CE3 1 
ATOM   6627 C CZ2 A TRP A 1 566 ? 8.317   20.608  -11.513 0.44 14.40 ? 559  TRP A CZ2 1 
ATOM   6628 C CZ2 C TRP A 1 566 ? 7.922   20.768  -11.504 0.56 15.02 ? 559  TRP A CZ2 1 
ATOM   6629 C CZ3 A TRP A 1 566 ? 10.246  20.158  -10.132 0.44 14.29 ? 559  TRP A CZ3 1 
ATOM   6630 C CZ3 C TRP A 1 566 ? 9.871   20.136  -10.224 0.56 14.10 ? 559  TRP A CZ3 1 
ATOM   6631 C CH2 A TRP A 1 566 ? 9.093   19.732  -10.802 0.44 13.73 ? 559  TRP A CH2 1 
ATOM   6632 C CH2 C TRP A 1 566 ? 8.663   19.815  -10.856 0.56 14.43 ? 559  TRP A CH2 1 
ATOM   6633 N N   A GLU A 1 567 ? 12.577  26.979  -9.080  0.44 14.94 ? 560  GLU A N   1 
ATOM   6634 N N   C GLU A 1 567 ? 12.572  27.006  -9.098  0.56 14.96 ? 560  GLU A N   1 
ATOM   6635 C CA  A GLU A 1 567 ? 13.780  27.435  -8.386  0.44 13.88 ? 560  GLU A CA  1 
ATOM   6636 C CA  C GLU A 1 567 ? 13.777  27.480  -8.412  0.56 13.80 ? 560  GLU A CA  1 
ATOM   6637 C C   A GLU A 1 567 ? 13.462  27.927  -6.977  0.44 13.76 ? 560  GLU A C   1 
ATOM   6638 C C   C GLU A 1 567 ? 13.463  27.938  -6.988  0.56 13.79 ? 560  GLU A C   1 
ATOM   6639 O O   A GLU A 1 567 ? 14.280  27.799  -6.066  0.44 16.35 ? 560  GLU A O   1 
ATOM   6640 O O   C GLU A 1 567 ? 14.286  27.801  -6.082  0.56 16.33 ? 560  GLU A O   1 
ATOM   6641 C CB  A GLU A 1 567 ? 14.465  28.543  -9.180  0.44 15.21 ? 560  GLU A CB  1 
ATOM   6642 C CB  C GLU A 1 567 ? 14.427  28.622  -9.191  0.56 15.23 ? 560  GLU A CB  1 
ATOM   6643 C CG  A GLU A 1 567 ? 15.730  29.073  -8.527  0.44 15.80 ? 560  GLU A CG  1 
ATOM   6644 C CG  C GLU A 1 567 ? 15.649  29.201  -8.496  0.56 16.12 ? 560  GLU A CG  1 
ATOM   6645 C CD  A GLU A 1 567 ? 16.310  30.267  -9.259  0.44 16.88 ? 560  GLU A CD  1 
ATOM   6646 C CD  C GLU A 1 567 ? 16.314  30.319  -9.279  0.56 16.91 ? 560  GLU A CD  1 
ATOM   6647 O OE1 A GLU A 1 567 ? 16.020  30.429  -10.466 0.44 15.47 ? 560  GLU A OE1 1 
ATOM   6648 O OE1 C GLU A 1 567 ? 15.844  30.647  -10.393 0.56 16.41 ? 560  GLU A OE1 1 
ATOM   6649 O OE2 A GLU A 1 567 ? 17.048  31.046  -8.623  0.44 15.63 ? 560  GLU A OE2 1 
ATOM   6650 O OE2 C GLU A 1 567 ? 17.305  30.878  -8.765  0.56 18.09 ? 560  GLU A OE2 1 
ATOM   6651 N N   . SER A 1 568 ? 12.273  28.492  -6.801  1.00 17.47 ? 561  SER A N   1 
ATOM   6652 C CA  . SER A 1 568 ? 11.904  29.085  -5.520  1.00 18.78 ? 561  SER A CA  1 
ATOM   6653 C C   . SER A 1 568 ? 11.877  28.054  -4.400  1.00 21.22 ? 561  SER A C   1 
ATOM   6654 O O   . SER A 1 568 ? 11.940  28.423  -3.230  1.00 20.24 ? 561  SER A O   1 
ATOM   6655 C CB  A SER A 1 568 ? 10.536  29.765  -5.620  0.35 18.95 ? 561  SER A CB  1 
ATOM   6656 C CB  C SER A 1 568 ? 10.556  29.788  -5.614  0.65 19.05 ? 561  SER A CB  1 
ATOM   6657 O OG  A SER A 1 568 ? 10.502  30.750  -6.642  0.35 26.93 ? 561  SER A OG  1 
ATOM   6658 O OG  C SER A 1 568 ? 9.493   28.862  -5.684  0.65 15.91 ? 561  SER A OG  1 
ATOM   6659 N N   A MET A 1 569 ? 11.784  26.769  -4.747  0.71 14.75 ? 562  MET A N   1 
ATOM   6660 N N   B MET A 1 569 ? 11.802  26.774  -4.753  0.29 14.62 ? 562  MET A N   1 
ATOM   6661 C CA  A MET A 1 569 ? 11.785  25.709  -3.728  0.71 11.98 ? 562  MET A CA  1 
ATOM   6662 C CA  B MET A 1 569 ? 11.782  25.719  -3.739  0.29 12.27 ? 562  MET A CA  1 
ATOM   6663 C C   A MET A 1 569 ? 13.116  25.645  -2.995  0.71 15.36 ? 562  MET A C   1 
ATOM   6664 C C   B MET A 1 569 ? 13.122  25.597  -3.026  0.29 15.17 ? 562  MET A C   1 
ATOM   6665 O O   A MET A 1 569 ? 13.189  25.132  -1.880  0.71 17.25 ? 562  MET A O   1 
ATOM   6666 O O   B MET A 1 569 ? 13.209  24.991  -1.958  0.29 17.77 ? 562  MET A O   1 
ATOM   6667 C CB  A MET A 1 569 ? 11.475  24.337  -4.351  0.71 16.99 ? 562  MET A CB  1 
ATOM   6668 C CB  B MET A 1 569 ? 11.404  24.372  -4.361  0.29 17.09 ? 562  MET A CB  1 
ATOM   6669 C CG  A MET A 1 569 ? 10.000  24.078  -4.646  0.71 21.80 ? 562  MET A CG  1 
ATOM   6670 C CG  B MET A 1 569 ? 9.995   24.310  -4.929  0.29 18.69 ? 562  MET A CG  1 
ATOM   6671 S SD  A MET A 1 569 ? 9.689   22.437  -5.338  0.71 18.37 ? 562  MET A SD  1 
ATOM   6672 S SD  B MET A 1 569 ? 9.544   22.626  -5.386  0.29 19.06 ? 562  MET A SD  1 
ATOM   6673 C CE  A MET A 1 569 ? 10.215  22.735  -7.026  0.71 15.11 ? 562  MET A CE  1 
ATOM   6674 C CE  B MET A 1 569 ? 10.749  22.326  -6.677  0.29 18.01 ? 562  MET A CE  1 
ATOM   6675 N N   . PHE A 1 570 ? 14.161  26.182  -3.611  1.00 17.39 ? 563  PHE A N   1 
ATOM   6676 C CA  . PHE A 1 570 ? 15.489  26.125  -3.023  1.00 15.93 ? 563  PHE A CA  1 
ATOM   6677 C C   . PHE A 1 570 ? 15.834  27.398  -2.237  1.00 14.66 ? 563  PHE A C   1 
ATOM   6678 O O   . PHE A 1 570 ? 16.991  27.609  -1.875  1.00 17.43 ? 563  PHE A O   1 
ATOM   6679 C CB  . PHE A 1 570 ? 16.539  25.873  -4.107  1.00 14.77 ? 563  PHE A CB  1 
ATOM   6680 C CG  . PHE A 1 570 ? 16.495  24.475  -4.672  1.00 13.65 ? 563  PHE A CG  1 
ATOM   6681 C CD1 . PHE A 1 570 ? 17.354  23.491  -4.198  1.00 17.27 ? 563  PHE A CD1 1 
ATOM   6682 C CD2 . PHE A 1 570 ? 15.582  24.142  -5.665  1.00 18.68 ? 563  PHE A CD2 1 
ATOM   6683 C CE1 . PHE A 1 570 ? 17.315  22.198  -4.718  1.00 15.41 ? 563  PHE A CE1 1 
ATOM   6684 C CE2 . PHE A 1 570 ? 15.540  22.863  -6.188  1.00 15.49 ? 563  PHE A CE2 1 
ATOM   6685 C CZ  . PHE A 1 570 ? 16.400  21.885  -5.701  1.00 15.11 ? 563  PHE A CZ  1 
ATOM   6686 N N   . GLU A 1 571 ? 14.838  28.234  -1.953  1.00 19.32 ? 564  GLU A N   1 
ATOM   6687 C CA  . GLU A 1 571 ? 15.114  29.537  -1.336  1.00 26.52 ? 564  GLU A CA  1 
ATOM   6688 C C   . GLU A 1 571 ? 15.852  29.400  0.002   1.00 22.83 ? 564  GLU A C   1 
ATOM   6689 O O   . GLU A 1 571 ? 16.728  30.209  0.316   1.00 26.05 ? 564  GLU A O   1 
ATOM   6690 C CB  A GLU A 1 571 ? 13.818  30.330  -1.143  0.45 29.55 ? 564  GLU A CB  1 
ATOM   6691 C CB  B GLU A 1 571 ? 13.804  30.305  -1.151  0.55 29.64 ? 564  GLU A CB  1 
ATOM   6692 C CG  A GLU A 1 571 ? 14.021  31.767  -0.668  0.45 34.13 ? 564  GLU A CG  1 
ATOM   6693 C CG  B GLU A 1 571 ? 13.945  31.746  -0.702  0.55 34.32 ? 564  GLU A CG  1 
ATOM   6694 C CD  A GLU A 1 571 ? 13.888  31.918  0.838   0.45 37.37 ? 564  GLU A CD  1 
ATOM   6695 C CD  B GLU A 1 571 ? 12.605  32.463  -0.691  0.55 38.38 ? 564  GLU A CD  1 
ATOM   6696 O OE1 A GLU A 1 571 ? 12.766  31.732  1.361   0.45 42.20 ? 564  GLU A OE1 1 
ATOM   6697 O OE1 B GLU A 1 571 ? 11.803  32.228  -1.624  0.55 34.66 ? 564  GLU A OE1 1 
ATOM   6698 O OE2 A GLU A 1 571 ? 14.902  32.231  1.498   0.45 34.23 ? 564  GLU A OE2 1 
ATOM   6699 O OE2 B GLU A 1 571 ? 12.351  33.248  0.246   0.55 42.72 ? 564  GLU A OE2 1 
ATOM   6700 N N   A LYS A 1 572 ? 15.500  28.358  0.753   0.53 16.41 ? 565  LYS A N   1 
ATOM   6701 N N   B LYS A 1 572 ? 15.534  28.367  0.772   0.47 16.44 ? 565  LYS A N   1 
ATOM   6702 C CA  A LYS A 1 572 ? 16.104  28.062  2.052   0.53 20.12 ? 565  LYS A CA  1 
ATOM   6703 C CA  B LYS A 1 572 ? 16.185  28.186  2.068   0.47 20.21 ? 565  LYS A CA  1 
ATOM   6704 C C   A LYS A 1 572 ? 17.344  27.190  1.912   0.53 23.19 ? 565  LYS A C   1 
ATOM   6705 C C   B LYS A 1 572 ? 17.298  27.142  2.015   0.47 22.84 ? 565  LYS A C   1 
ATOM   6706 O O   A LYS A 1 572 ? 18.090  26.998  2.874   0.53 20.26 ? 565  LYS A O   1 
ATOM   6707 O O   B LYS A 1 572 ? 17.836  26.747  3.050   0.47 21.35 ? 565  LYS A O   1 
ATOM   6708 C CB  A LYS A 1 572 ? 15.088  27.362  2.963   0.53 21.25 ? 565  LYS A CB  1 
ATOM   6709 C CB  B LYS A 1 572 ? 15.155  27.804  3.132   0.47 25.27 ? 565  LYS A CB  1 
ATOM   6710 C CG  A LYS A 1 572 ? 13.857  28.195  3.272   0.53 20.65 ? 565  LYS A CG  1 
ATOM   6711 C CG  B LYS A 1 572 ? 14.102  28.873  3.369   0.47 19.48 ? 565  LYS A CG  1 
ATOM   6712 C CD  A LYS A 1 572 ? 12.619  27.331  3.469   0.53 30.37 ? 565  LYS A CD  1 
ATOM   6713 C CD  B LYS A 1 572 ? 14.731  30.241  3.627   0.47 34.66 ? 565  LYS A CD  1 
ATOM   6714 C CE  A LYS A 1 572 ? 12.758  26.372  4.636   0.53 34.44 ? 565  LYS A CE  1 
ATOM   6715 C CE  B LYS A 1 572 ? 13.680  31.349  3.635   0.47 33.40 ? 565  LYS A CE  1 
ATOM   6716 N NZ  A LYS A 1 572 ? 11.534  25.524  4.791   0.53 25.41 ? 565  LYS A NZ  1 
ATOM   6717 N NZ  B LYS A 1 572 ? 14.290  32.697  3.820   0.47 26.32 ? 565  LYS A NZ  1 
ATOM   6718 N N   A HIS A 1 573 ? 17.555  26.661  0.709   0.53 18.39 ? 566  HIS A N   1 
ATOM   6719 N N   B HIS A 1 573 ? 17.643  26.703  0.805   0.47 18.86 ? 566  HIS A N   1 
ATOM   6720 C CA  A HIS A 1 573 ? 18.590  25.660  0.483   0.53 18.05 ? 566  HIS A CA  1 
ATOM   6721 C CA  B HIS A 1 573 ? 18.713  25.726  0.619   0.47 18.76 ? 566  HIS A CA  1 
ATOM   6722 C C   A HIS A 1 573 ? 19.395  26.005  -0.765  0.53 19.07 ? 566  HIS A C   1 
ATOM   6723 C C   B HIS A 1 573 ? 19.427  26.000  -0.695  0.47 18.93 ? 566  HIS A C   1 
ATOM   6724 O O   A HIS A 1 573 ? 19.553  25.174  -1.669  0.53 18.50 ? 566  HIS A O   1 
ATOM   6725 O O   B HIS A 1 573 ? 19.545  25.130  -1.565  0.47 18.94 ? 566  HIS A O   1 
ATOM   6726 C CB  A HIS A 1 573 ? 17.968  24.262  0.342   0.53 22.08 ? 566  HIS A CB  1 
ATOM   6727 C CB  B HIS A 1 573 ? 18.166  24.297  0.653   0.47 22.89 ? 566  HIS A CB  1 
ATOM   6728 C CG  A HIS A 1 573 ? 16.969  23.919  1.409   0.53 17.31 ? 566  HIS A CG  1 
ATOM   6729 C CG  B HIS A 1 573 ? 17.623  23.892  1.989   0.47 24.06 ? 566  HIS A CG  1 
ATOM   6730 N ND1 A HIS A 1 573 ? 17.337  23.464  2.656   0.53 26.03 ? 566  HIS A ND1 1 
ATOM   6731 N ND1 B HIS A 1 573 ? 18.431  23.455  3.018   0.47 27.90 ? 566  HIS A ND1 1 
ATOM   6732 C CD2 A HIS A 1 573 ? 15.615  23.937  1.401   0.53 27.52 ? 566  HIS A CD2 1 
ATOM   6733 C CD2 B HIS A 1 573 ? 16.357  23.862  2.466   0.47 25.23 ? 566  HIS A CD2 1 
ATOM   6734 C CE1 A HIS A 1 573 ? 16.254  23.232  3.377   0.53 28.57 ? 566  HIS A CE1 1 
ATOM   6735 C CE1 B HIS A 1 573 ? 17.684  23.171  4.071   0.47 27.01 ? 566  HIS A CE1 1 
ATOM   6736 N NE2 A HIS A 1 573 ? 15.195  23.508  2.638   0.53 27.61 ? 566  HIS A NE2 1 
ATOM   6737 N NE2 B HIS A 1 573 ? 16.421  23.409  3.762   0.47 25.94 ? 566  HIS A NE2 1 
ATOM   6738 N N   . ARG A 1 574 ? 19.900  27.230  -0.825  1.00 18.23 ? 567  ARG A N   1 
ATOM   6739 C CA  . ARG A 1 574 ? 20.490  27.709  -2.063  1.00 17.49 ? 567  ARG A CA  1 
ATOM   6740 C C   . ARG A 1 574 ? 21.745  26.961  -2.474  1.00 19.69 ? 567  ARG A C   1 
ATOM   6741 O O   . ARG A 1 574 ? 22.062  26.895  -3.662  1.00 18.04 ? 567  ARG A O   1 
ATOM   6742 C CB  . ARG A 1 574 ? 20.788  29.198  -1.958  1.00 19.21 ? 567  ARG A CB  1 
ATOM   6743 C CG  . ARG A 1 574 ? 19.531  30.042  -1.998  1.00 20.24 ? 567  ARG A CG  1 
ATOM   6744 C CD  . ARG A 1 574 ? 18.842  29.954  -3.359  1.00 19.97 ? 567  ARG A CD  1 
ATOM   6745 N NE  . ARG A 1 574 ? 19.660  30.577  -4.392  1.00 20.68 ? 567  ARG A NE  1 
ATOM   6746 C CZ  . ARG A 1 574 ? 19.327  30.634  -5.678  1.00 36.37 ? 567  ARG A CZ  1 
ATOM   6747 N NH1 . ARG A 1 574 ? 18.187  30.096  -6.100  1.00 22.63 ? 567  ARG A NH1 1 
ATOM   6748 N NH2 . ARG A 1 574 ? 20.140  31.228  -6.545  1.00 29.94 ? 567  ARG A NH2 1 
ATOM   6749 N N   . ASP A 1 575 ? 22.441  26.380  -1.504  1.00 18.99 ? 568  ASP A N   1 
ATOM   6750 C CA  . ASP A 1 575 ? 23.634  25.601  -1.811  1.00 16.97 ? 568  ASP A CA  1 
ATOM   6751 C C   . ASP A 1 575 ? 23.308  24.350  -2.619  1.00 16.00 ? 568  ASP A C   1 
ATOM   6752 O O   . ASP A 1 575 ? 24.199  23.778  -3.242  1.00 23.71 ? 568  ASP A O   1 
ATOM   6753 C CB  . ASP A 1 575 ? 24.379  25.217  -0.518  1.00 16.41 ? 568  ASP A CB  1 
ATOM   6754 C CG  . ASP A 1 575 ? 23.506  24.451  0.470   1.00 38.59 ? 568  ASP A CG  1 
ATOM   6755 O OD1 . ASP A 1 575 ? 22.374  24.896  0.769   1.00 26.89 ? 568  ASP A OD1 1 
ATOM   6756 O OD2 . ASP A 1 575 ? 23.957  23.384  0.940   1.00 49.61 ? 568  ASP A OD2 1 
ATOM   6757 N N   . LEU A 1 576 ? 22.035  23.957  -2.642  1.00 13.92 ? 569  LEU A N   1 
ATOM   6758 C CA  . LEU A 1 576 ? 21.615  22.707  -3.291  1.00 14.02 ? 569  LEU A CA  1 
ATOM   6759 C C   . LEU A 1 576 ? 21.045  22.955  -4.665  1.00 15.58 ? 569  LEU A C   1 
ATOM   6760 O O   . LEU A 1 576 ? 20.733  22.005  -5.381  1.00 18.85 ? 569  LEU A O   1 
ATOM   6761 C CB  . LEU A 1 576 ? 20.567  21.972  -2.466  1.00 17.20 ? 569  LEU A CB  1 
ATOM   6762 C CG  . LEU A 1 576 ? 21.021  21.556  -1.076  1.00 15.43 ? 569  LEU A CG  1 
ATOM   6763 C CD1 . LEU A 1 576 ? 19.878  20.875  -0.383  1.00 16.72 ? 569  LEU A CD1 1 
ATOM   6764 C CD2 . LEU A 1 576 ? 22.206  20.634  -1.204  1.00 20.24 ? 569  LEU A CD2 1 
ATOM   6765 N N   . PHE A 1 577 ? 20.887  24.226  -5.012  1.00 15.92 ? 570  PHE A N   1 
ATOM   6766 C CA  . PHE A 1 577 ? 20.248  24.589  -6.274  1.00 18.73 ? 570  PHE A CA  1 
ATOM   6767 C C   . PHE A 1 577 ? 21.178  24.239  -7.438  1.00 31.75 ? 570  PHE A C   1 
ATOM   6768 O O   . PHE A 1 577 ? 22.316  24.701  -7.456  1.00 29.21 ? 570  PHE A O   1 
ATOM   6769 C CB  . PHE A 1 577 ? 19.865  26.082  -6.275  1.00 14.33 ? 570  PHE A CB  1 
ATOM   6770 C CG  . PHE A 1 577 ? 19.448  26.607  -7.628  1.00 13.30 ? 570  PHE A CG  1 
ATOM   6771 C CD1 . PHE A 1 577 ? 18.403  26.023  -8.327  1.00 15.58 ? 570  PHE A CD1 1 
ATOM   6772 C CD2 . PHE A 1 577 ? 20.100  27.677  -8.195  1.00 14.60 ? 570  PHE A CD2 1 
ATOM   6773 C CE1 . PHE A 1 577 ? 18.022  26.485  -9.558  1.00 14.28 ? 570  PHE A CE1 1 
ATOM   6774 C CE2 . PHE A 1 577 ? 19.721  28.148  -9.447  1.00 17.28 ? 570  PHE A CE2 1 
ATOM   6775 C CZ  . PHE A 1 577 ? 18.690  27.551  -10.130 1.00 16.11 ? 570  PHE A CZ  1 
ATOM   6776 O OXT . PHE A 1 577 ? 20.832  23.487  -8.374  1.00 22.70 ? 570  PHE A OXT 1 
HETATM 6777 O O4  . DPF B 2 .   ? 16.667  8.418   -23.237 1.00 13.20 ? 601  DPF A O4  1 
HETATM 6778 P P1  . DPF B 2 .   ? 15.516  9.333   -22.924 1.00 14.55 ? 601  DPF A P1  1 
HETATM 6779 O O3  . DPF B 2 .   ? 15.173  9.308   -21.379 1.00 23.88 ? 601  DPF A O3  1 
HETATM 6780 C C1  . DPF B 2 .   ? 14.273  10.321  -20.989 1.00 19.76 ? 601  DPF A C1  1 
HETATM 6781 C C4  . DPF B 2 .   ? 13.874  10.199  -19.548 1.00 25.90 ? 601  DPF A C4  1 
HETATM 6782 O O1  . DPF B 2 .   ? 14.240  8.832   -23.669 1.00 21.51 ? 601  DPF A O1  1 
HETATM 6783 C C2  . DPF B 2 .   ? 14.254  8.673   -25.059 1.00 14.86 ? 601  DPF A C2  1 
HETATM 6784 C C3  . DPF B 2 .   ? 12.863  8.166   -25.365 1.00 29.94 ? 601  DPF A C3  1 
HETATM 6785 O O   . HOH C 3 .   ? 6.735   23.437  -22.903 1.00 18.71 ? 701  HOH A O   1 
HETATM 6786 O O   . HOH C 3 .   ? 19.275  38.014  -12.282 1.00 37.21 ? 702  HOH A O   1 
HETATM 6787 O O   . HOH C 3 .   ? 4.935   26.631  -37.155 1.00 31.91 ? 703  HOH A O   1 
HETATM 6788 O O   . HOH C 3 .   ? 18.723  8.965   -29.553 1.00 14.22 ? 704  HOH A O   1 
HETATM 6789 O O   . HOH C 3 .   ? 8.855   10.832  -31.731 1.00 16.83 ? 705  HOH A O   1 
HETATM 6790 O O   . HOH C 3 .   ? 45.398  -0.332  -40.019 1.00 28.66 ? 706  HOH A O   1 
HETATM 6791 O O   . HOH C 3 .   ? 35.534  5.370   -54.507 1.00 22.79 ? 707  HOH A O   1 
HETATM 6792 O O   . HOH C 3 .   ? -6.920  20.722  -7.226  1.00 27.71 ? 708  HOH A O   1 
HETATM 6793 O O   . HOH C 3 .   ? 6.213   9.640   -43.757 1.00 34.81 ? 709  HOH A O   1 
HETATM 6794 O O   . HOH C 3 .   ? 15.319  2.599   -54.588 1.00 36.39 ? 710  HOH A O   1 
HETATM 6795 O O   . HOH C 3 .   ? 22.504  9.121   -7.961  1.00 24.05 ? 711  HOH A O   1 
HETATM 6796 O O   . HOH C 3 .   ? 21.593  37.836  -38.566 1.00 31.22 ? 712  HOH A O   1 
HETATM 6797 O O   . HOH C 3 .   ? 33.300  -9.262  -34.452 1.00 37.57 ? 713  HOH A O   1 
HETATM 6798 O O   . HOH C 3 .   ? 12.424  32.650  -3.725  1.00 31.35 ? 714  HOH A O   1 
HETATM 6799 O O   . HOH C 3 .   ? 36.616  1.534   -13.268 1.00 18.14 ? 715  HOH A O   1 
HETATM 6800 O O   . HOH C 3 .   ? 2.840   11.143  -27.335 1.00 21.51 ? 716  HOH A O   1 
HETATM 6801 O O   . HOH C 3 .   ? 37.653  -7.933  -12.639 1.00 38.77 ? 717  HOH A O   1 
HETATM 6802 O O   . HOH C 3 .   ? 32.139  6.459   -58.088 1.00 21.77 ? 718  HOH A O   1 
HETATM 6803 O O   . HOH C 3 .   ? 14.267  22.560  5.759   1.00 33.93 ? 719  HOH A O   1 
HETATM 6804 O O   . HOH C 3 .   ? 12.946  -5.693  -18.621 1.00 21.38 ? 720  HOH A O   1 
HETATM 6805 O O   . HOH C 3 .   ? -6.457  22.059  -14.065 1.00 21.20 ? 721  HOH A O   1 
HETATM 6806 O O   . HOH C 3 .   ? 39.176  -8.691  -37.533 1.00 29.80 ? 722  HOH A O   1 
HETATM 6807 O O   . HOH C 3 .   ? 13.587  9.596   5.707   1.00 25.37 ? 723  HOH A O   1 
HETATM 6808 O O   . HOH C 3 .   ? 34.983  8.306   -2.922  1.00 35.19 ? 724  HOH A O   1 
HETATM 6809 O O   . HOH C 3 .   ? 36.403  24.271  -17.307 1.00 26.21 ? 725  HOH A O   1 
HETATM 6810 O O   . HOH C 3 .   ? 12.920  1.690   -45.422 1.00 30.63 ? 726  HOH A O   1 
HETATM 6811 O O   . HOH C 3 .   ? 14.569  -2.845  -39.446 1.00 33.73 ? 727  HOH A O   1 
HETATM 6812 O O   . HOH C 3 .   ? 17.432  5.937   -6.976  1.00 34.00 ? 728  HOH A O   1 
HETATM 6813 O O   . HOH C 3 .   ? 9.453   3.958   -44.827 1.00 23.14 ? 729  HOH A O   1 
HETATM 6814 O O   . HOH C 3 .   ? 24.174  3.508   -2.478  1.00 23.07 ? 730  HOH A O   1 
HETATM 6815 O O   . HOH C 3 .   ? 42.872  9.011   -27.674 1.00 27.66 ? 731  HOH A O   1 
HETATM 6816 O O   . HOH C 3 .   ? 1.781   8.778   -26.630 1.00 32.39 ? 732  HOH A O   1 
HETATM 6817 O O   . HOH C 3 .   ? 13.438  12.287  -45.719 1.00 17.62 ? 733  HOH A O   1 
HETATM 6818 O O   . HOH C 3 .   ? 38.923  21.040  -13.011 1.00 28.86 ? 734  HOH A O   1 
HETATM 6819 O O   . HOH C 3 .   ? 42.371  4.380   -28.766 1.00 16.59 ? 735  HOH A O   1 
HETATM 6820 O O   . HOH C 3 .   ? 33.558  20.960  -43.468 1.00 23.47 ? 736  HOH A O   1 
HETATM 6821 O O   . HOH C 3 .   ? 23.235  0.473   -55.315 1.00 14.60 ? 737  HOH A O   1 
HETATM 6822 O O   . HOH C 3 .   ? 14.579  -1.660  -6.745  1.00 19.12 ? 738  HOH A O   1 
HETATM 6823 O O   . HOH C 3 .   ? 21.182  -11.105 4.069   1.00 23.79 ? 739  HOH A O   1 
HETATM 6824 O O   . HOH C 3 .   ? 22.290  37.095  -23.697 1.00 29.66 ? 740  HOH A O   1 
HETATM 6825 O O   . HOH C 3 .   ? 7.104   14.098  -36.865 1.00 25.85 ? 741  HOH A O   1 
HETATM 6826 O O   . HOH C 3 .   ? 21.750  22.188  -44.460 1.00 24.35 ? 742  HOH A O   1 
HETATM 6827 O O   . HOH C 3 .   ? 21.121  -7.218  -32.585 1.00 24.71 ? 743  HOH A O   1 
HETATM 6828 O O   . HOH C 3 .   ? 4.821   4.203   -40.347 1.00 29.95 ? 744  HOH A O   1 
HETATM 6829 O O   . HOH C 3 .   ? 36.820  -0.000  -0.000  0.50 27.82 ? 745  HOH A O   1 
HETATM 6830 O O   . HOH C 3 .   ? 14.322  9.701   -11.809 1.00 29.30 ? 746  HOH A O   1 
HETATM 6831 O O   . HOH C 3 .   ? 2.510   2.507   -26.766 1.00 40.11 ? 747  HOH A O   1 
HETATM 6832 O O   . HOH C 3 .   ? 21.119  4.387   -43.859 1.00 18.97 ? 748  HOH A O   1 
HETATM 6833 O O   . HOH C 3 .   ? 30.207  -5.820  -53.981 1.00 33.66 ? 749  HOH A O   1 
HETATM 6834 O O   . HOH C 3 .   ? 34.326  18.259  -8.884  1.00 24.36 ? 750  HOH A O   1 
HETATM 6835 O O   . HOH C 3 .   ? 3.366   7.581   -23.581 1.00 35.09 ? 751  HOH A O   1 
HETATM 6836 O O   . HOH C 3 .   ? 16.324  3.369   -30.622 1.00 27.78 ? 752  HOH A O   1 
HETATM 6837 O O   . HOH C 3 .   ? 26.641  -9.098  3.358   1.00 23.48 ? 753  HOH A O   1 
HETATM 6838 O O   . HOH C 3 .   ? 10.125  9.011   -13.217 1.00 24.23 ? 754  HOH A O   1 
HETATM 6839 O O   . HOH C 3 .   ? 34.926  -9.639  -9.664  1.00 20.10 ? 755  HOH A O   1 
HETATM 6840 O O   . HOH C 3 .   ? 24.467  -7.316  -2.727  1.00 20.91 ? 756  HOH A O   1 
HETATM 6841 O O   . HOH C 3 .   ? 15.277  -3.388  -30.725 1.00 36.75 ? 757  HOH A O   1 
HETATM 6842 O O   . HOH C 3 .   ? 45.164  -5.224  -40.609 1.00 15.60 ? 758  HOH A O   1 
HETATM 6843 O O   . HOH C 3 .   ? 44.894  -4.351  -28.288 1.00 23.95 ? 759  HOH A O   1 
HETATM 6844 O O   . HOH C 3 .   ? 33.257  -4.431  -55.339 1.00 25.82 ? 760  HOH A O   1 
HETATM 6845 O O   . HOH C 3 .   ? 17.938  7.712   -47.697 1.00 19.28 ? 761  HOH A O   1 
HETATM 6846 O O   . HOH C 3 .   ? 10.409  37.960  -21.158 1.00 23.59 ? 762  HOH A O   1 
HETATM 6847 O O   . HOH C 3 .   ? -8.737  15.624  -14.948 1.00 27.44 ? 763  HOH A O   1 
HETATM 6848 O O   . HOH C 3 .   ? 27.475  31.990  -22.748 1.00 20.99 ? 764  HOH A O   1 
HETATM 6849 O O   . HOH C 3 .   ? 16.832  8.861   -27.557 1.00 20.44 ? 765  HOH A O   1 
HETATM 6850 O O   . HOH C 3 .   ? 47.165  -1.020  -29.357 1.00 23.02 ? 766  HOH A O   1 
HETATM 6851 O O   . HOH C 3 .   ? 18.162  -12.934 1.031   1.00 22.27 ? 767  HOH A O   1 
HETATM 6852 O O   . HOH C 3 .   ? 16.043  16.076  -53.627 1.00 37.39 ? 768  HOH A O   1 
HETATM 6853 O O   . HOH C 3 .   ? 21.263  23.339  2.467   1.00 30.48 ? 769  HOH A O   1 
HETATM 6854 O O   . HOH C 3 .   ? 35.878  12.690  -44.479 1.00 20.60 ? 770  HOH A O   1 
HETATM 6855 O O   . HOH C 3 .   ? 25.496  36.954  -25.108 1.00 34.56 ? 771  HOH A O   1 
HETATM 6856 O O   . HOH C 3 .   ? 13.346  26.266  0.418   1.00 24.87 ? 772  HOH A O   1 
HETATM 6857 O O   . HOH C 3 .   ? 10.719  17.389  3.113   1.00 36.06 ? 773  HOH A O   1 
HETATM 6858 O O   . HOH C 3 .   ? 14.680  -1.862  -28.485 1.00 23.44 ? 774  HOH A O   1 
HETATM 6859 O O   . HOH C 3 .   ? 32.493  -3.395  -6.779  1.00 12.40 ? 775  HOH A O   1 
HETATM 6860 O O   . HOH C 3 .   ? 4.561   28.191  -7.699  1.00 20.11 ? 776  HOH A O   1 
HETATM 6861 O O   . HOH C 3 .   ? 19.857  -17.446 -16.528 1.00 30.74 ? 777  HOH A O   1 
HETATM 6862 O O   . HOH C 3 .   ? 2.617   27.762  -2.714  1.00 27.44 ? 778  HOH A O   1 
HETATM 6863 O O   . HOH C 3 .   ? 8.916   13.615  -35.384 1.00 14.39 ? 779  HOH A O   1 
HETATM 6864 O O   . HOH C 3 .   ? 16.730  16.435  -8.199  1.00 25.59 ? 780  HOH A O   1 
HETATM 6865 O O   . HOH C 3 .   ? 21.308  18.037  -44.679 1.00 23.01 ? 781  HOH A O   1 
HETATM 6866 O O   . HOH C 3 .   ? 28.610  -0.391  -43.733 1.00 17.13 ? 782  HOH A O   1 
HETATM 6867 O O   . HOH C 3 .   ? -7.977  6.461   -19.819 1.00 30.09 ? 783  HOH A O   1 
HETATM 6868 O O   . HOH C 3 .   ? 1.942   17.150  -40.937 1.00 25.74 ? 784  HOH A O   1 
HETATM 6869 O O   . HOH C 3 .   ? 25.462  -2.798  -33.921 1.00 25.45 ? 785  HOH A O   1 
HETATM 6870 O O   . HOH C 3 .   ? 11.869  24.770  -39.913 1.00 27.40 ? 786  HOH A O   1 
HETATM 6871 O O   . HOH C 3 .   ? -4.842  22.662  -3.561  1.00 24.98 ? 787  HOH A O   1 
HETATM 6872 O O   . HOH C 3 .   ? 37.696  17.646  -11.950 1.00 23.77 ? 788  HOH A O   1 
HETATM 6873 O O   . HOH C 3 .   ? 13.883  15.311  -27.653 1.00 21.15 ? 789  HOH A O   1 
HETATM 6874 O O   . HOH C 3 .   ? 13.143  15.306  -52.916 1.00 24.39 ? 790  HOH A O   1 
HETATM 6875 O O   . HOH C 3 .   ? 37.972  22.626  -32.655 1.00 22.42 ? 791  HOH A O   1 
HETATM 6876 O O   . HOH C 3 .   ? 3.313   18.944  -42.959 1.00 26.09 ? 792  HOH A O   1 
HETATM 6877 O O   . HOH C 3 .   ? 9.474   30.027  -34.380 1.00 19.69 ? 793  HOH A O   1 
HETATM 6878 O O   . HOH C 3 .   ? 14.699  -15.953 -5.489  1.00 26.85 ? 794  HOH A O   1 
HETATM 6879 O O   . HOH C 3 .   ? 24.936  6.322   -30.926 1.00 11.42 ? 795  HOH A O   1 
HETATM 6880 O O   . HOH C 3 .   ? 32.905  -5.714  -38.429 1.00 24.37 ? 796  HOH A O   1 
HETATM 6881 O O   . HOH C 3 .   ? 7.989   11.021  -34.556 1.00 15.29 ? 797  HOH A O   1 
HETATM 6882 O O   . HOH C 3 .   ? 25.491  17.586  -4.599  1.00 37.46 ? 798  HOH A O   1 
HETATM 6883 O O   . HOH C 3 .   ? 26.409  -13.884 -24.232 1.00 22.10 ? 799  HOH A O   1 
HETATM 6884 O O   . HOH C 3 .   ? 15.667  0.482   -29.987 1.00 23.75 ? 800  HOH A O   1 
HETATM 6885 O O   . HOH C 3 .   ? 39.880  1.340   -28.541 1.00 15.32 ? 801  HOH A O   1 
HETATM 6886 O O   . HOH C 3 .   ? 13.498  12.040  -1.197  1.00 25.50 ? 802  HOH A O   1 
HETATM 6887 O O   . HOH C 3 .   ? 40.315  0.875   -13.247 1.00 19.51 ? 803  HOH A O   1 
HETATM 6888 O O   . HOH C 3 .   ? 15.938  25.080  -45.335 1.00 28.15 ? 804  HOH A O   1 
HETATM 6889 O O   . HOH C 3 .   ? 16.056  18.629  -28.214 1.00 14.52 ? 805  HOH A O   1 
HETATM 6890 O O   . HOH C 3 .   ? 8.710   21.349  -23.403 1.00 12.66 ? 806  HOH A O   1 
HETATM 6891 O O   . HOH C 3 .   ? 37.482  -1.264  -13.186 1.00 18.93 ? 807  HOH A O   1 
HETATM 6892 O O   . HOH C 3 .   ? 5.118   27.585  -33.351 1.00 33.74 ? 808  HOH A O   1 
HETATM 6893 O O   . HOH C 3 .   ? 26.104  -17.542 -5.773  1.00 25.72 ? 809  HOH A O   1 
HETATM 6894 O O   . HOH C 3 .   ? 23.020  12.880  -8.484  1.00 26.86 ? 810  HOH A O   1 
HETATM 6895 O O   . HOH C 3 .   ? 3.452   9.807   -2.233  1.00 26.73 ? 811  HOH A O   1 
HETATM 6896 O O   . HOH C 3 .   ? 12.080  0.504   -2.053  1.00 27.64 ? 812  HOH A O   1 
HETATM 6897 O O   . HOH C 3 .   ? 10.228  38.985  -25.010 1.00 20.54 ? 813  HOH A O   1 
HETATM 6898 O O   . HOH C 3 .   ? 21.377  11.848  -41.109 1.00 11.95 ? 814  HOH A O   1 
HETATM 6899 O O   . HOH C 3 .   ? 35.274  -2.721  -13.581 1.00 15.23 ? 815  HOH A O   1 
HETATM 6900 O O   . HOH C 3 .   ? 2.390   15.467  -34.180 1.00 26.94 ? 816  HOH A O   1 
HETATM 6901 O O   . HOH C 3 .   ? 35.621  3.653   -9.639  1.00 15.89 ? 817  HOH A O   1 
HETATM 6902 O O   . HOH C 3 .   ? 0.129   23.552  -16.998 1.00 17.82 ? 818  HOH A O   1 
HETATM 6903 O O   . HOH C 3 .   ? 4.558   17.942  -46.253 1.00 25.06 ? 819  HOH A O   1 
HETATM 6904 O O   . HOH C 3 .   ? 23.775  -0.865  -9.393  1.00 48.23 ? 820  HOH A O   1 
HETATM 6905 O O   . HOH C 3 .   ? 29.722  23.430  -21.225 1.00 15.06 ? 821  HOH A O   1 
HETATM 6906 O O   . HOH C 3 .   ? 20.712  12.399  -48.672 1.00 16.29 ? 822  HOH A O   1 
HETATM 6907 O O   . HOH C 3 .   ? 38.018  -4.813  -17.049 1.00 20.27 ? 823  HOH A O   1 
HETATM 6908 O O   . HOH C 3 .   ? 22.758  -0.439  -40.031 1.00 18.08 ? 824  HOH A O   1 
HETATM 6909 O O   . HOH C 3 .   ? 26.242  -5.054  -54.746 1.00 26.77 ? 825  HOH A O   1 
HETATM 6910 O O   . HOH C 3 .   ? 30.019  13.617  -45.115 1.00 15.26 ? 826  HOH A O   1 
HETATM 6911 O O   . HOH C 3 .   ? 13.676  10.891  -40.940 1.00 14.15 ? 827  HOH A O   1 
HETATM 6912 O O   . HOH C 3 .   ? 28.621  -1.234  -14.398 1.00 14.03 ? 828  HOH A O   1 
HETATM 6913 O O   . HOH C 3 .   ? 17.784  0.023   -15.834 1.00 17.90 ? 829  HOH A O   1 
HETATM 6914 O O   . HOH C 3 .   ? -2.235  14.010  -25.577 1.00 24.67 ? 830  HOH A O   1 
HETATM 6915 O O   . HOH C 3 .   ? 11.542  -16.915 -5.314  1.00 30.57 ? 831  HOH A O   1 
HETATM 6916 O O   . HOH C 3 .   ? -6.747  10.728  -15.726 1.00 42.08 ? 832  HOH A O   1 
HETATM 6917 O O   . HOH C 3 .   ? -3.393  0.749   -33.630 1.00 21.94 ? 833  HOH A O   1 
HETATM 6918 O O   . HOH C 3 .   ? 15.283  -4.203  -41.873 1.00 32.41 ? 834  HOH A O   1 
HETATM 6919 O O   . HOH C 3 .   ? 27.321  3.319   -2.093  1.00 27.51 ? 835  HOH A O   1 
HETATM 6920 O O   . HOH C 3 .   ? 24.519  -2.746  -42.602 1.00 22.69 ? 836  HOH A O   1 
HETATM 6921 O O   . HOH C 3 .   ? 37.362  10.392  -12.574 1.00 24.45 ? 837  HOH A O   1 
HETATM 6922 O O   . HOH C 3 .   ? 18.707  0.447   -43.475 1.00 32.09 ? 838  HOH A O   1 
HETATM 6923 O O   . HOH C 3 .   ? 25.502  34.211  -33.048 1.00 31.03 ? 839  HOH A O   1 
HETATM 6924 O O   . HOH C 3 .   ? 25.710  0.599   -37.714 1.00 18.43 ? 840  HOH A O   1 
HETATM 6925 O O   . HOH C 3 .   ? 28.761  -0.351  -35.559 1.00 13.59 ? 841  HOH A O   1 
HETATM 6926 O O   . HOH C 3 .   ? 15.825  29.572  -4.749  1.00 18.99 ? 842  HOH A O   1 
HETATM 6927 O O   . HOH C 3 .   ? 31.138  -1.898  -13.382 1.00 14.94 ? 843  HOH A O   1 
HETATM 6928 O O   . HOH C 3 .   ? 33.211  19.224  -34.753 1.00 16.15 ? 844  HOH A O   1 
HETATM 6929 O O   . HOH C 3 .   ? 27.656  -8.261  -32.606 1.00 23.47 ? 845  HOH A O   1 
HETATM 6930 O O   . HOH C 3 .   ? 21.754  4.915   -47.212 1.00 16.00 ? 846  HOH A O   1 
HETATM 6931 O O   . HOH C 3 .   ? 39.354  3.831   -22.291 1.00 24.67 ? 847  HOH A O   1 
HETATM 6932 O O   . HOH C 3 .   ? 24.277  0.894   -27.330 1.00 12.35 ? 848  HOH A O   1 
HETATM 6933 O O   . HOH C 3 .   ? 7.581   8.949   -41.871 1.00 21.72 ? 849  HOH A O   1 
HETATM 6934 O O   . HOH C 3 .   ? 4.279   0.611   -36.941 1.00 19.89 ? 850  HOH A O   1 
HETATM 6935 O O   . HOH C 3 .   ? 36.600  17.410  -15.824 1.00 15.14 ? 851  HOH A O   1 
HETATM 6936 O O   . HOH C 3 .   ? 5.844   16.294  -33.955 1.00 23.34 ? 852  HOH A O   1 
HETATM 6937 O O   . HOH C 3 .   ? 7.797   17.051  -35.562 1.00 23.50 ? 853  HOH A O   1 
HETATM 6938 O O   . HOH C 3 .   ? 5.208   21.734  -21.384 1.00 16.49 ? 854  HOH A O   1 
HETATM 6939 O O   . HOH C 3 .   ? 14.871  -6.392  -2.681  1.00 23.71 ? 855  HOH A O   1 
HETATM 6940 O O   . HOH C 3 .   ? 47.456  -4.298  -41.688 1.00 28.60 ? 856  HOH A O   1 
HETATM 6941 O O   . HOH C 3 .   ? 24.297  4.833   -37.573 1.00 12.74 ? 857  HOH A O   1 
HETATM 6942 O O   . HOH C 3 .   ? 4.874   23.279  -36.364 1.00 26.82 ? 858  HOH A O   1 
HETATM 6943 O O   . HOH C 3 .   ? 45.576  -11.067 -37.012 1.00 30.31 ? 859  HOH A O   1 
HETATM 6944 O O   . HOH C 3 .   ? 24.570  -5.981  -23.685 1.00 15.85 ? 860  HOH A O   1 
HETATM 6945 O O   . HOH C 3 .   ? 23.083  -5.488  -4.475  1.00 15.91 ? 861  HOH A O   1 
HETATM 6946 O O   . HOH C 3 .   ? 14.500  36.287  -34.498 1.00 22.12 ? 862  HOH A O   1 
HETATM 6947 O O   . HOH C 3 .   ? 35.813  -5.355  -22.762 1.00 13.94 ? 863  HOH A O   1 
HETATM 6948 O O   . HOH C 3 .   ? 34.480  17.120  -13.067 1.00 17.18 ? 864  HOH A O   1 
HETATM 6949 O O   . HOH C 3 .   ? 47.260  1.100   -30.942 1.00 28.32 ? 865  HOH A O   1 
HETATM 6950 O O   . HOH C 3 .   ? 36.911  3.415   -20.212 1.00 18.94 ? 866  HOH A O   1 
HETATM 6951 O O   . HOH C 3 .   ? 22.121  -17.537 2.944   1.00 30.58 ? 867  HOH A O   1 
HETATM 6952 O O   . HOH C 3 .   ? 47.353  -2.920  -33.364 1.00 21.01 ? 868  HOH A O   1 
HETATM 6953 O O   . HOH C 3 .   ? 5.659   25.035  -19.746 1.00 17.60 ? 869  HOH A O   1 
HETATM 6954 O O   . HOH C 3 .   ? 4.348   21.844  -29.218 1.00 19.27 ? 870  HOH A O   1 
HETATM 6955 O O   . HOH C 3 .   ? 36.806  23.824  -27.993 1.00 21.27 ? 871  HOH A O   1 
HETATM 6956 O O   . HOH C 3 .   ? 22.966  -1.253  -28.647 1.00 12.34 ? 872  HOH A O   1 
HETATM 6957 O O   . HOH C 3 .   ? 1.578   13.498  1.311   1.00 28.48 ? 873  HOH A O   1 
HETATM 6958 O O   . HOH C 3 .   ? 26.559  14.083  -50.158 1.00 28.28 ? 874  HOH A O   1 
HETATM 6959 O O   . HOH C 3 .   ? 28.203  -8.059  -20.989 1.00 14.73 ? 875  HOH A O   1 
HETATM 6960 O O   . HOH C 3 .   ? 28.724  -6.351  -19.060 1.00 11.88 ? 876  HOH A O   1 
HETATM 6961 O O   . HOH C 3 .   ? 17.265  -3.545  -19.511 1.00 22.38 ? 877  HOH A O   1 
HETATM 6962 O O   . HOH C 3 .   ? 19.736  33.409  -43.570 1.00 38.20 ? 878  HOH A O   1 
HETATM 6963 O O   . HOH C 3 .   ? 33.667  -5.265  -29.696 1.00 17.49 ? 879  HOH A O   1 
HETATM 6964 O O   . HOH C 3 .   ? 29.443  -13.666 -17.423 1.00 21.18 ? 880  HOH A O   1 
HETATM 6965 O O   . HOH C 3 .   ? 30.546  9.829   -51.924 1.00 26.97 ? 881  HOH A O   1 
HETATM 6966 O O   . HOH C 3 .   ? 2.283   13.560  -5.821  1.00 16.94 ? 882  HOH A O   1 
HETATM 6967 O O   . HOH C 3 .   ? 25.898  28.422  -18.232 1.00 16.37 ? 883  HOH A O   1 
HETATM 6968 O O   . HOH C 3 .   ? 8.395   34.488  -25.394 1.00 18.77 ? 884  HOH A O   1 
HETATM 6969 O O   . HOH C 3 .   ? 44.974  6.405   -43.025 1.00 28.31 ? 885  HOH A O   1 
HETATM 6970 O O   . HOH C 3 .   ? 1.907   2.883   -32.006 1.00 23.83 ? 886  HOH A O   1 
HETATM 6971 O O   . HOH C 3 .   ? 16.084  -2.770  -4.612  1.00 20.34 ? 887  HOH A O   1 
HETATM 6972 O O   . HOH C 3 .   ? 29.910  -17.614 -10.818 1.00 24.88 ? 888  HOH A O   1 
HETATM 6973 O O   . HOH C 3 .   ? -5.952  21.661  -18.449 1.00 25.58 ? 889  HOH A O   1 
HETATM 6974 O O   . HOH C 3 .   ? -0.027  13.897  -0.713  1.00 30.78 ? 890  HOH A O   1 
HETATM 6975 O O   . HOH C 3 .   ? 15.080  35.452  -39.771 1.00 22.48 ? 891  HOH A O   1 
HETATM 6976 O O   . HOH C 3 .   ? 24.710  31.563  -11.685 1.00 31.53 ? 892  HOH A O   1 
HETATM 6977 O O   . HOH C 3 .   ? 2.551   28.810  -14.087 1.00 21.25 ? 893  HOH A O   1 
HETATM 6978 O O   . HOH C 3 .   ? 39.537  -0.285  -34.906 1.00 20.96 ? 894  HOH A O   1 
HETATM 6979 O O   . HOH C 3 .   ? 4.443   28.185  -19.787 1.00 25.64 ? 895  HOH A O   1 
HETATM 6980 O O   . HOH C 3 .   ? 22.311  25.721  -10.044 1.00 21.91 ? 896  HOH A O   1 
HETATM 6981 O O   . HOH C 3 .   ? 0.935   20.145  -1.638  1.00 17.16 ? 897  HOH A O   1 
HETATM 6982 O O   . HOH C 3 .   ? 28.325  5.237   -4.207  1.00 21.04 ? 898  HOH A O   1 
HETATM 6983 O O   . HOH C 3 .   ? 14.717  9.647   -37.300 1.00 15.72 ? 899  HOH A O   1 
HETATM 6984 O O   . HOH C 3 .   ? 19.012  -3.292  -21.631 1.00 15.14 ? 900  HOH A O   1 
HETATM 6985 O O   . HOH C 3 .   ? 40.084  3.607   -27.270 1.00 15.97 ? 901  HOH A O   1 
HETATM 6986 O O   . HOH C 3 .   ? 15.995  13.721  -58.267 1.00 43.71 ? 902  HOH A O   1 
HETATM 6987 O O   . HOH C 3 .   ? 23.987  8.410   -38.460 1.00 14.86 ? 903  HOH A O   1 
HETATM 6988 O O   . HOH C 3 .   ? 3.338   -7.815  -41.275 1.00 31.32 ? 904  HOH A O   1 
HETATM 6989 O O   . HOH C 3 .   ? 12.284  -1.813  -12.764 1.00 16.89 ? 905  HOH A O   1 
HETATM 6990 O O   . HOH C 3 .   ? 22.747  0.677   -48.233 1.00 20.30 ? 906  HOH A O   1 
HETATM 6991 O O   . HOH C 3 .   ? 10.821  13.053  -7.045  1.00 16.38 ? 907  HOH A O   1 
HETATM 6992 O O   . HOH C 3 .   ? 8.749   33.727  -20.773 1.00 18.31 ? 908  HOH A O   1 
HETATM 6993 O O   . HOH C 3 .   ? 41.450  22.112  -31.064 1.00 30.38 ? 909  HOH A O   1 
HETATM 6994 O O   . HOH C 3 .   ? 13.793  35.880  -37.233 1.00 21.61 ? 910  HOH A O   1 
HETATM 6995 O O   . HOH C 3 .   ? 21.432  33.565  -16.593 1.00 20.37 ? 911  HOH A O   1 
HETATM 6996 O O   . HOH C 3 .   ? 33.460  -10.646 -31.854 1.00 30.80 ? 912  HOH A O   1 
HETATM 6997 O O   . HOH C 3 .   ? 31.631  -6.286  -28.312 1.00 14.27 ? 913  HOH A O   1 
HETATM 6998 O O   . HOH C 3 .   ? -1.500  7.794   -27.097 1.00 31.45 ? 914  HOH A O   1 
HETATM 6999 O O   . HOH C 3 .   ? 42.795  5.239   -43.715 1.00 27.14 ? 915  HOH A O   1 
HETATM 7000 O O   . HOH C 3 .   ? 31.756  -11.180 1.195   1.00 27.13 ? 916  HOH A O   1 
HETATM 7001 O O   . HOH C 3 .   ? 24.550  -12.289 -25.879 1.00 23.59 ? 917  HOH A O   1 
HETATM 7002 O O   . HOH C 3 .   ? -0.920  24.937  -4.310  1.00 18.96 ? 918  HOH A O   1 
HETATM 7003 O O   . HOH C 3 .   ? 22.537  -5.200  -21.994 1.00 17.35 ? 919  HOH A O   1 
HETATM 7004 O O   . HOH C 3 .   ? 42.562  -2.520  -22.118 1.00 22.41 ? 920  HOH A O   1 
HETATM 7005 O O   . HOH C 3 .   ? 33.357  -0.337  -14.286 1.00 13.81 ? 921  HOH A O   1 
HETATM 7006 O O   . HOH C 3 .   ? -11.417 18.397  -8.479  1.00 37.01 ? 922  HOH A O   1 
HETATM 7007 O O   . HOH C 3 .   ? 24.456  0.844   -0.955  1.00 23.08 ? 923  HOH A O   1 
HETATM 7008 O O   . HOH C 3 .   ? 3.931   26.612  -0.493  1.00 25.51 ? 924  HOH A O   1 
HETATM 7009 O O   . HOH C 3 .   ? 23.620  -2.904  -8.723  1.00 14.23 ? 925  HOH A O   1 
HETATM 7010 O O   . HOH C 3 .   ? 38.973  20.473  -25.719 1.00 16.45 ? 926  HOH A O   1 
HETATM 7011 O O   . HOH C 3 .   ? -3.238  11.447  -22.017 1.00 24.23 ? 927  HOH A O   1 
HETATM 7012 O O   . HOH C 3 .   ? 20.134  4.488   -23.984 1.00 12.17 ? 928  HOH A O   1 
HETATM 7013 O O   . HOH C 3 .   ? 21.291  18.942  -4.951  1.00 27.20 ? 929  HOH A O   1 
HETATM 7014 O O   . HOH C 3 .   ? 20.696  2.307   -46.763 1.00 22.58 ? 930  HOH A O   1 
HETATM 7015 O O   . HOH C 3 .   ? 10.178  24.257  -42.573 1.00 22.60 ? 931  HOH A O   1 
HETATM 7016 O O   . HOH C 3 .   ? 19.086  4.435   -16.621 1.00 15.46 ? 932  HOH A O   1 
HETATM 7017 O O   . HOH C 3 .   ? 19.592  -5.554  -46.916 1.00 27.74 ? 933  HOH A O   1 
HETATM 7018 O O   . HOH C 3 .   ? 15.540  -2.910  -22.439 1.00 16.37 ? 934  HOH A O   1 
HETATM 7019 O O   . HOH C 3 .   ? 14.326  23.783  -49.744 1.00 28.43 ? 935  HOH A O   1 
HETATM 7020 O O   . HOH C 3 .   ? 23.705  -4.824  -48.723 1.00 27.71 ? 936  HOH A O   1 
HETATM 7021 O O   . HOH C 3 .   ? 26.188  2.199   -12.783 1.00 11.96 ? 937  HOH A O   1 
HETATM 7022 O O   . HOH C 3 .   ? 19.128  19.885  -23.001 1.00 20.12 ? 938  HOH A O   1 
HETATM 7023 O O   . HOH C 3 .   ? 28.959  -4.308  -52.012 1.00 25.05 ? 939  HOH A O   1 
HETATM 7024 O O   . HOH C 3 .   ? 19.120  6.245   -14.623 1.00 15.26 ? 940  HOH A O   1 
HETATM 7025 O O   . HOH C 3 .   ? 28.404  21.311  -17.419 1.00 22.04 ? 941  HOH A O   1 
HETATM 7026 O O   . HOH C 3 .   ? 20.632  31.265  -26.856 1.00 17.36 ? 942  HOH A O   1 
HETATM 7027 O O   . HOH C 3 .   ? 20.079  0.752   -4.495  1.00 27.73 ? 943  HOH A O   1 
HETATM 7028 O O   . HOH C 3 .   ? 16.961  5.936   -12.723 1.00 16.13 ? 944  HOH A O   1 
HETATM 7029 O O   . HOH C 3 .   ? -0.008  21.463  -21.193 1.00 19.62 ? 945  HOH A O   1 
HETATM 7030 O O   . HOH C 3 .   ? 13.988  18.050  -11.539 1.00 17.98 ? 946  HOH A O   1 
HETATM 7031 O O   . HOH C 3 .   ? 40.219  -12.186 -28.999 1.00 36.86 ? 947  HOH A O   1 
HETATM 7032 O O   . HOH C 3 .   ? 32.465  0.990   -1.084  1.00 19.15 ? 948  HOH A O   1 
HETATM 7033 O O   . HOH C 3 .   ? 42.667  18.693  -29.543 1.00 26.60 ? 949  HOH A O   1 
HETATM 7034 O O   . HOH C 3 .   ? -9.965  21.906  -14.004 1.00 33.53 ? 950  HOH A O   1 
HETATM 7035 O O   . HOH C 3 .   ? 4.063   -0.705  -43.252 1.00 24.16 ? 951  HOH A O   1 
HETATM 7036 O O   . HOH C 3 .   ? 5.069   -4.244  -27.542 1.00 34.16 ? 952  HOH A O   1 
HETATM 7037 O O   . HOH C 3 .   ? -7.508  15.134  -17.690 1.00 23.73 ? 953  HOH A O   1 
HETATM 7038 O O   . HOH C 3 .   ? 26.250  -3.176  -3.441  1.00 15.58 ? 954  HOH A O   1 
HETATM 7039 O O   . HOH C 3 .   ? 0.074   26.609  -17.727 1.00 21.15 ? 955  HOH A O   1 
HETATM 7040 O O   . HOH C 3 .   ? 12.863  32.118  -8.252  1.00 27.76 ? 956  HOH A O   1 
HETATM 7041 O O   . HOH C 3 .   ? 42.453  1.028   -10.390 1.00 28.26 ? 957  HOH A O   1 
HETATM 7042 O O   . HOH C 3 .   ? 13.280  13.887  -7.756  1.00 21.56 ? 958  HOH A O   1 
HETATM 7043 O O   . HOH C 3 .   ? 27.217  -6.549  -23.108 1.00 15.34 ? 959  HOH A O   1 
HETATM 7044 O O   . HOH C 3 .   ? 27.834  -3.230  -15.696 1.00 20.69 ? 960  HOH A O   1 
HETATM 7045 O O   . HOH C 3 .   ? 29.093  -14.312 -21.289 1.00 23.67 ? 961  HOH A O   1 
HETATM 7046 O O   . HOH C 3 .   ? 36.039  -15.010 -19.480 1.00 17.36 ? 962  HOH A O   1 
HETATM 7047 O O   . HOH C 3 .   ? 0.172   1.223   -30.533 1.00 26.70 ? 963  HOH A O   1 
HETATM 7048 O O   . HOH C 3 .   ? 6.328   29.647  -17.918 1.00 17.47 ? 964  HOH A O   1 
HETATM 7049 O O   . HOH C 3 .   ? -1.551  14.131  -4.705  1.00 21.42 ? 965  HOH A O   1 
HETATM 7050 O O   . HOH C 3 .   ? 8.472   -1.044  -15.289 1.00 30.78 ? 966  HOH A O   1 
HETATM 7051 O O   . HOH C 3 .   ? 36.646  9.446   -51.022 1.00 23.65 ? 967  HOH A O   1 
HETATM 7052 O O   . HOH C 3 .   ? 41.528  19.783  -26.765 1.00 25.90 ? 968  HOH A O   1 
HETATM 7053 O O   . HOH C 3 .   ? 37.773  0.891   -19.294 1.00 19.98 ? 969  HOH A O   1 
HETATM 7054 O O   . HOH C 3 .   ? 16.937  19.366  -20.531 1.00 27.23 ? 970  HOH A O   1 
HETATM 7055 O O   . HOH C 3 .   ? 11.069  24.276  -14.253 1.00 16.07 ? 971  HOH A O   1 
HETATM 7056 O O   . HOH C 3 .   ? 32.332  -15.916 -16.717 1.00 22.75 ? 972  HOH A O   1 
HETATM 7057 O O   . HOH C 3 .   ? 36.143  12.842  -13.195 1.00 15.78 ? 973  HOH A O   1 
HETATM 7058 O O   . HOH C 3 .   ? 11.106  -5.367  -6.762  1.00 26.82 ? 974  HOH A O   1 
HETATM 7059 O O   . HOH C 3 .   ? 31.387  3.099   -0.633  1.00 16.95 ? 975  HOH A O   1 
HETATM 7060 O O   . HOH C 3 .   ? 24.471  -16.446 0.269   1.00 21.76 ? 976  HOH A O   1 
HETATM 7061 O O   . HOH C 3 .   ? 22.299  -17.606 -12.555 1.00 22.20 ? 977  HOH A O   1 
HETATM 7062 O O   . HOH C 3 .   ? 5.218   21.989  -47.142 1.00 20.89 ? 978  HOH A O   1 
HETATM 7063 O O   . HOH C 3 .   ? 7.269   32.897  -18.667 1.00 14.19 ? 979  HOH A O   1 
HETATM 7064 O O   . HOH C 3 .   ? 42.833  10.658  -35.602 1.00 21.81 ? 980  HOH A O   1 
HETATM 7065 O O   . HOH C 3 .   ? 34.743  -2.001  -0.190  1.00 19.61 ? 981  HOH A O   1 
HETATM 7066 O O   . HOH C 3 .   ? 37.292  5.390   -18.067 1.00 20.46 ? 982  HOH A O   1 
HETATM 7067 O O   . HOH C 3 .   ? 6.007   10.667  -14.067 1.00 28.23 ? 983  HOH A O   1 
HETATM 7068 O O   . HOH C 3 .   ? 6.965   -2.887  -4.431  1.00 26.58 ? 984  HOH A O   1 
HETATM 7069 O O   . HOH C 3 .   ? 33.485  -11.221 -11.331 1.00 23.87 ? 985  HOH A O   1 
HETATM 7070 O O   . HOH C 3 .   ? 20.411  20.863  -20.701 1.00 26.59 ? 986  HOH A O   1 
HETATM 7071 O O   . HOH C 3 .   ? 19.374  7.363   -6.046  1.00 23.66 ? 987  HOH A O   1 
HETATM 7072 O O   . HOH C 3 .   ? 15.972  8.474   -35.007 1.00 22.08 ? 988  HOH A O   1 
HETATM 7073 O O   . HOH C 3 .   ? -3.023  -5.071  -29.873 1.00 24.77 ? 989  HOH A O   1 
HETATM 7074 O O   . HOH C 3 .   ? 17.941  11.665  -3.568  1.00 29.71 ? 990  HOH A O   1 
HETATM 7075 O O   . HOH C 3 .   ? 16.668  18.766  -11.327 1.00 21.21 ? 991  HOH A O   1 
HETATM 7076 O O   . HOH C 3 .   ? 20.048  29.094  1.470   1.00 25.87 ? 992  HOH A O   1 
HETATM 7077 O O   . HOH C 3 .   ? 19.197  -6.910  2.910   1.00 29.42 ? 993  HOH A O   1 
HETATM 7078 O O   . HOH C 3 .   ? 33.359  -9.142  -1.748  1.00 24.78 ? 994  HOH A O   1 
HETATM 7079 O O   . HOH C 3 .   ? 38.662  22.648  -21.293 1.00 28.10 ? 995  HOH A O   1 
HETATM 7080 O O   . HOH C 3 .   ? -3.912  15.989  -30.740 1.00 26.95 ? 996  HOH A O   1 
HETATM 7081 O O   . HOH C 3 .   ? 16.452  37.899  -33.656 1.00 27.43 ? 997  HOH A O   1 
HETATM 7082 O O   . HOH C 3 .   ? 34.501  -5.615  -20.169 1.00 16.11 ? 998  HOH A O   1 
HETATM 7083 O O   . HOH C 3 .   ? 0.285   5.473   -32.557 1.00 27.51 ? 999  HOH A O   1 
HETATM 7084 O O   . HOH C 3 .   ? 18.488  40.545  -17.170 1.00 32.98 ? 1000 HOH A O   1 
HETATM 7085 O O   . HOH C 3 .   ? 30.387  -17.197 -15.532 1.00 24.53 ? 1001 HOH A O   1 
HETATM 7086 O O   . HOH C 3 .   ? 42.168  22.531  -36.490 1.00 36.87 ? 1002 HOH A O   1 
HETATM 7087 O O   . HOH C 3 .   ? 42.288  21.179  -20.060 1.00 28.94 ? 1003 HOH A O   1 
HETATM 7088 O O   . HOH C 3 .   ? 24.158  16.101  -8.351  1.00 23.02 ? 1004 HOH A O   1 
HETATM 7089 O O   . HOH C 3 .   ? 15.314  -5.658  -0.332  1.00 29.10 ? 1005 HOH A O   1 
HETATM 7090 O O   . HOH C 3 .   ? 41.740  10.573  -44.659 1.00 33.50 ? 1006 HOH A O   1 
HETATM 7091 O O   . HOH C 3 .   ? 0.183   17.969  -36.316 1.00 41.94 ? 1007 HOH A O   1 
HETATM 7092 O O   . HOH C 3 .   ? 42.131  -10.309 -44.875 1.00 26.48 ? 1008 HOH A O   1 
HETATM 7093 O O   . HOH C 3 .   ? -1.502  22.392  -18.937 1.00 16.68 ? 1009 HOH A O   1 
HETATM 7094 O O   . HOH C 3 .   ? 30.753  -9.366  -0.592  1.00 18.75 ? 1010 HOH A O   1 
HETATM 7095 O O   . HOH C 3 .   ? 7.044   -5.166  -47.132 1.00 30.39 ? 1011 HOH A O   1 
HETATM 7096 O O   . HOH C 3 .   ? 41.732  10.424  -22.605 1.00 27.98 ? 1012 HOH A O   1 
HETATM 7097 O O   . HOH C 3 .   ? 23.568  27.104  2.460   1.00 24.99 ? 1013 HOH A O   1 
HETATM 7098 O O   . HOH C 3 .   ? 23.288  5.695   -33.039 1.00 13.36 ? 1014 HOH A O   1 
HETATM 7099 O O   . HOH C 3 .   ? 34.852  -7.298  -31.439 1.00 22.02 ? 1015 HOH A O   1 
HETATM 7100 O O   . HOH C 3 .   ? 31.217  11.009  -3.745  1.00 27.68 ? 1016 HOH A O   1 
HETATM 7101 O O   . HOH C 3 .   ? 26.630  -1.831  -36.211 1.00 22.09 ? 1017 HOH A O   1 
HETATM 7102 O O   . HOH C 3 .   ? 29.401  13.913  -4.385  1.00 22.85 ? 1018 HOH A O   1 
HETATM 7103 O O   . HOH C 3 .   ? 40.329  1.867   -50.784 1.00 25.61 ? 1019 HOH A O   1 
HETATM 7104 O O   . HOH C 3 .   ? 8.183   26.048  -43.801 1.00 28.33 ? 1020 HOH A O   1 
HETATM 7105 O O   . HOH C 3 .   ? 30.946  23.955  -46.660 1.00 41.10 ? 1021 HOH A O   1 
HETATM 7106 O O   . HOH C 3 .   ? 11.349  7.199   -50.565 1.00 27.19 ? 1022 HOH A O   1 
HETATM 7107 O O   . HOH C 3 .   ? 21.138  -19.383 -5.559  1.00 25.12 ? 1023 HOH A O   1 
HETATM 7108 O O   . HOH C 3 .   ? 31.347  7.974   -3.571  1.00 31.43 ? 1024 HOH A O   1 
HETATM 7109 O O   . HOH C 3 .   ? -6.358  17.189  -20.103 1.00 23.84 ? 1025 HOH A O   1 
HETATM 7110 O O   . HOH C 3 .   ? -4.783  4.251   -12.988 1.00 24.73 ? 1026 HOH A O   1 
HETATM 7111 O O   . HOH C 3 .   ? 11.481  -1.304  -24.835 1.00 30.03 ? 1027 HOH A O   1 
HETATM 7112 O O   . HOH C 3 .   ? 5.172   1.046   -39.272 1.00 24.35 ? 1028 HOH A O   1 
HETATM 7113 O O   . HOH C 3 .   ? 9.641   36.917  -26.375 1.00 21.48 ? 1029 HOH A O   1 
HETATM 7114 O O   . HOH C 3 .   ? 33.298  16.343  -51.101 1.00 31.11 ? 1030 HOH A O   1 
HETATM 7115 O O   . HOH C 3 .   ? 28.459  -6.879  0.593   1.00 26.94 ? 1031 HOH A O   1 
HETATM 7116 O O   . HOH C 3 .   ? 25.922  -16.668 -19.965 1.00 32.15 ? 1032 HOH A O   1 
HETATM 7117 O O   . HOH C 3 .   ? 21.565  31.596  -9.806  1.00 29.87 ? 1033 HOH A O   1 
HETATM 7118 O O   . HOH C 3 .   ? 25.044  36.321  -46.830 1.00 50.56 ? 1034 HOH A O   1 
HETATM 7119 O O   . HOH C 3 .   ? 27.312  38.392  -17.471 1.00 31.78 ? 1035 HOH A O   1 
HETATM 7120 O O   . HOH C 3 .   ? 40.819  -10.388 -19.444 1.00 30.85 ? 1036 HOH A O   1 
HETATM 7121 O O   . HOH C 3 .   ? -1.715  -3.534  -40.058 1.00 37.03 ? 1037 HOH A O   1 
HETATM 7122 O O   . HOH C 3 .   ? -4.365  19.744  -1.545  1.00 32.71 ? 1038 HOH A O   1 
HETATM 7123 O O   . HOH C 3 .   ? 16.060  5.060   -4.176  1.00 40.81 ? 1039 HOH A O   1 
HETATM 7124 O O   . HOH C 3 .   ? 35.997  5.022   -57.681 1.00 48.72 ? 1040 HOH A O   1 
HETATM 7125 O O   . HOH C 3 .   ? 38.202  24.645  -30.419 1.00 30.67 ? 1041 HOH A O   1 
HETATM 7126 O O   . HOH C 3 .   ? 28.670  19.965  -1.432  1.00 39.47 ? 1042 HOH A O   1 
HETATM 7127 O O   . HOH C 3 .   ? 28.687  -7.595  3.188   1.00 30.03 ? 1043 HOH A O   1 
HETATM 7128 O O   . HOH C 3 .   ? 0.418   12.318  -4.219  1.00 22.12 ? 1044 HOH A O   1 
HETATM 7129 O O   . HOH C 3 .   ? 6.378   -11.184 -45.270 1.00 42.83 ? 1045 HOH A O   1 
HETATM 7130 O O   . HOH C 3 .   ? 23.900  27.598  -8.965  1.00 26.65 ? 1046 HOH A O   1 
HETATM 7131 O O   . HOH C 3 .   ? 40.130  10.167  -13.081 1.00 24.86 ? 1047 HOH A O   1 
HETATM 7132 O O   . HOH C 3 .   ? 26.196  25.332  -42.492 1.00 34.10 ? 1048 HOH A O   1 
HETATM 7133 O O   . HOH C 3 .   ? 28.599  -16.050 -18.982 1.00 24.56 ? 1049 HOH A O   1 
HETATM 7134 O O   . HOH C 3 .   ? 13.244  -1.026  -52.470 1.00 27.07 ? 1050 HOH A O   1 
HETATM 7135 O O   . HOH C 3 .   ? 14.194  38.145  -44.388 1.00 40.84 ? 1051 HOH A O   1 
HETATM 7136 O O   . HOH C 3 .   ? 36.172  -11.429 -3.700  1.00 31.07 ? 1052 HOH A O   1 
HETATM 7137 O O   . HOH C 3 .   ? 13.954  31.911  -5.976  1.00 37.86 ? 1053 HOH A O   1 
HETATM 7138 O O   . HOH C 3 .   ? -3.860  23.378  -19.851 1.00 25.67 ? 1054 HOH A O   1 
HETATM 7139 O O   . HOH C 3 .   ? 4.748   33.188  -20.220 1.00 33.26 ? 1055 HOH A O   1 
HETATM 7140 O O   . HOH C 3 .   ? 13.036  1.198   -53.559 1.00 30.81 ? 1056 HOH A O   1 
HETATM 7141 O O   . HOH C 3 .   ? 17.051  24.212  -36.742 1.00 51.06 ? 1057 HOH A O   1 
HETATM 7142 O O   . HOH C 3 .   ? 19.653  -17.225 -13.588 1.00 34.37 ? 1058 HOH A O   1 
HETATM 7143 O O   . HOH C 3 .   ? -5.415  13.323  -36.864 1.00 26.88 ? 1059 HOH A O   1 
HETATM 7144 O O   . HOH C 3 .   ? 20.094  -8.414  -40.298 1.00 46.78 ? 1060 HOH A O   1 
HETATM 7145 O O   . HOH C 3 .   ? 20.681  -10.041 6.266   1.00 22.75 ? 1061 HOH A O   1 
HETATM 7146 O O   . HOH C 3 .   ? 31.944  -13.371 -9.915  1.00 28.65 ? 1062 HOH A O   1 
HETATM 7147 O O   . HOH C 3 .   ? 35.333  -10.339 -1.463  1.00 28.57 ? 1063 HOH A O   1 
HETATM 7148 O O   . HOH C 3 .   ? 39.334  24.191  -34.598 1.00 35.17 ? 1064 HOH A O   1 
HETATM 7149 O O   . HOH C 3 .   ? 23.370  30.509  -8.912  1.00 30.12 ? 1065 HOH A O   1 
HETATM 7150 O O   . HOH C 3 .   ? 38.158  -11.931 -34.618 1.00 30.94 ? 1066 HOH A O   1 
HETATM 7151 O O   . HOH C 3 .   ? 45.575  11.422  -35.624 1.00 30.73 ? 1067 HOH A O   1 
HETATM 7152 O O   . HOH C 3 .   ? 29.853  32.918  -19.208 1.00 28.68 ? 1068 HOH A O   1 
HETATM 7153 O O   . HOH C 3 .   ? 33.217  -16.306 -22.778 1.00 20.32 ? 1069 HOH A O   1 
HETATM 7154 O O   . HOH C 3 .   ? 41.616  3.122   -24.735 1.00 20.92 ? 1070 HOH A O   1 
HETATM 7155 O O   . HOH C 3 .   ? -2.577  16.906  -26.028 1.00 26.54 ? 1071 HOH A O   1 
HETATM 7156 O O   . HOH C 3 .   ? 1.428   9.111   1.494   1.00 40.43 ? 1072 HOH A O   1 
HETATM 7157 O O   . HOH C 3 .   ? 46.622  -3.448  -30.462 1.00 20.03 ? 1073 HOH A O   1 
HETATM 7158 O O   . HOH C 3 .   ? 2.916   22.316  -31.697 1.00 27.45 ? 1074 HOH A O   1 
HETATM 7159 O O   . HOH C 3 .   ? 22.197  43.042  -29.276 1.00 27.78 ? 1075 HOH A O   1 
HETATM 7160 O O   . HOH C 3 .   ? 24.257  29.269  0.826   1.00 27.91 ? 1076 HOH A O   1 
HETATM 7161 O O   . HOH C 3 .   ? 38.295  9.460   -10.181 1.00 23.29 ? 1077 HOH A O   1 
HETATM 7162 O O   . HOH C 3 .   ? -5.788  11.197  -20.721 1.00 29.88 ? 1078 HOH A O   1 
HETATM 7163 O O   . HOH C 3 .   ? 14.053  16.479  -9.288  1.00 18.23 ? 1079 HOH A O   1 
HETATM 7164 O O   . HOH C 3 .   ? -11.873 13.913  -10.469 1.00 40.79 ? 1080 HOH A O   1 
HETATM 7165 O O   . HOH C 3 .   ? 5.181   19.401  -50.596 1.00 33.84 ? 1081 HOH A O   1 
HETATM 7166 O O   . HOH C 3 .   ? 24.234  38.678  -11.951 1.00 40.54 ? 1082 HOH A O   1 
HETATM 7167 O O   . HOH C 3 .   ? 35.672  14.835  -11.518 1.00 25.94 ? 1083 HOH A O   1 
HETATM 7168 O O   . HOH C 3 .   ? 30.671  34.750  -37.181 1.00 43.25 ? 1084 HOH A O   1 
HETATM 7169 O O   . HOH C 3 .   ? 5.585   -4.755  -12.961 1.00 40.00 ? 1085 HOH A O   1 
HETATM 7170 O O   . HOH C 3 .   ? 34.485  15.237  -8.983  1.00 30.71 ? 1086 HOH A O   1 
HETATM 7171 O O   . HOH C 3 .   ? 43.872  5.271   -24.720 1.00 25.24 ? 1087 HOH A O   1 
HETATM 7172 O O   . HOH C 3 .   ? 38.043  11.854  -1.755  1.00 41.46 ? 1088 HOH A O   1 
HETATM 7173 O O   . HOH C 3 .   ? 1.458   -2.106  -43.741 1.00 27.96 ? 1089 HOH A O   1 
HETATM 7174 O O   . HOH C 3 .   ? 2.605   -4.958  -24.473 1.00 44.55 ? 1090 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -6  ?   ?   ?   A . n 
A 1 2   HIS 2   -5  ?   ?   ?   A . n 
A 1 3   HIS 3   -4  ?   ?   ?   A . n 
A 1 4   HIS 4   -3  ?   ?   ?   A . n 
A 1 5   HIS 5   -2  ?   ?   ?   A . n 
A 1 6   HIS 6   -1  ?   ?   ?   A . n 
A 1 7   HIS 7   0   ?   ?   ?   A . n 
A 1 8   MET 8   1   ?   ?   ?   A . n 
A 1 9   ASN 9   2   ?   ?   ?   A . n 
A 1 10  PHE 10  3   ?   ?   ?   A . n 
A 1 11  ASN 11  4   ?   ?   ?   A . n 
A 1 12  VAL 12  5   5   VAL VAL A . n 
A 1 13  SER 13  6   6   SER SER A . n 
A 1 14  LEU 14  7   7   LEU LEU A . n 
A 1 15  MET 15  8   8   MET MET A . n 
A 1 16  GLU 16  9   9   GLU GLU A . n 
A 1 17  LYS 17  10  10  LYS LYS A . n 
A 1 18  LEU 18  11  11  LEU LEU A . n 
A 1 19  LYS 19  12  12  LYS LYS A . n 
A 1 20  TRP 20  13  13  TRP TRP A . n 
A 1 21  LYS 21  14  14  LYS LYS A . n 
A 1 22  ILE 22  15  15  ILE ILE A . n 
A 1 23  LYS 23  16  16  LYS LYS A . n 
A 1 24  CYS 24  17  17  CYS CYS A . n 
A 1 25  ILE 25  18  18  ILE ILE A . n 
A 1 26  GLU 26  19  19  GLU GLU A . n 
A 1 27  ASN 27  20  20  ASN ASN A . n 
A 1 28  LYS 28  21  21  LYS LYS A . n 
A 1 29  PHE 29  22  22  PHE PHE A . n 
A 1 30  LEU 30  23  23  LEU LEU A . n 
A 1 31  ASN 31  24  24  ASN ASN A . n 
A 1 32  TYR 32  25  25  TYR TYR A . n 
A 1 33  ARG 33  26  26  ARG ARG A . n 
A 1 34  LEU 34  27  27  LEU LEU A . n 
A 1 35  THR 35  28  28  THR THR A . n 
A 1 36  THR 36  29  29  THR THR A . n 
A 1 37  ASN 37  30  30  ASN ASN A . n 
A 1 38  GLU 38  31  31  GLU GLU A . n 
A 1 39  THR 39  32  32  THR THR A . n 
A 1 40  VAL 40  33  33  VAL VAL A . n 
A 1 41  VAL 41  34  34  VAL VAL A . n 
A 1 42  ALA 42  35  35  ALA ALA A . n 
A 1 43  GLU 43  36  36  GLU GLU A . n 
A 1 44  THR 44  37  37  THR THR A . n 
A 1 45  GLU 45  38  38  GLU GLU A . n 
A 1 46  TYR 46  39  39  TYR TYR A . n 
A 1 47  GLY 47  40  40  GLY GLY A . n 
A 1 48  LYS 48  41  41  LYS LYS A . n 
A 1 49  VAL 49  42  42  VAL VAL A . n 
A 1 50  LYS 50  43  43  LYS LYS A . n 
A 1 51  GLY 51  44  44  GLY GLY A . n 
A 1 52  VAL 52  45  45  VAL VAL A . n 
A 1 53  LYS 53  46  46  LYS LYS A . n 
A 1 54  ARG 54  47  47  ARG ARG A . n 
A 1 55  LEU 55  48  48  LEU LEU A . n 
A 1 56  THR 56  49  49  THR THR A . n 
A 1 57  VAL 57  50  50  VAL VAL A . n 
A 1 58  TYR 58  51  51  TYR TYR A . n 
A 1 59  ASP 59  52  52  ASP ASP A . n 
A 1 60  ASP 60  53  53  ASP ASP A . n 
A 1 61  SER 61  54  54  SER SER A . n 
A 1 62  TYR 62  55  55  TYR TYR A . n 
A 1 63  TYR 63  56  56  TYR TYR A . n 
A 1 64  SER 64  57  57  SER SER A . n 
A 1 65  PHE 65  58  58  PHE PHE A . n 
A 1 66  GLU 66  59  59  GLU GLU A . n 
A 1 67  GLY 67  60  60  GLY GLY A . n 
A 1 68  ILE 68  61  61  ILE ILE A . n 
A 1 69  PRO 69  62  62  PRO PRO A . n 
A 1 70  TYR 70  63  63  TYR TYR A . n 
A 1 71  ALA 71  64  64  ALA ALA A . n 
A 1 72  GLN 72  65  65  GLN GLN A . n 
A 1 73  PRO 73  66  66  PRO PRO A . n 
A 1 74  PRO 74  67  67  PRO PRO A . n 
A 1 75  VAL 75  68  68  VAL VAL A . n 
A 1 76  GLY 76  69  69  GLY GLY A . n 
A 1 77  GLU 77  70  70  GLU GLU A . n 
A 1 78  LEU 78  71  71  LEU LEU A . n 
A 1 79  ARG 79  72  72  ARG ARG A . n 
A 1 80  PHE 80  73  73  PHE PHE A . n 
A 1 81  LYS 81  74  74  LYS LYS A . n 
A 1 82  ALA 82  75  75  ALA ALA A . n 
A 1 83  PRO 83  76  76  PRO PRO A . n 
A 1 84  GLN 84  77  77  GLN GLN A . n 
A 1 85  ARG 85  78  78  ARG ARG A . n 
A 1 86  PRO 86  79  79  PRO PRO A . n 
A 1 87  THR 87  80  80  THR THR A . n 
A 1 88  PRO 88  81  81  PRO PRO A . n 
A 1 89  TRP 89  82  82  TRP TRP A . n 
A 1 90  ALA 90  83  83  ALA ALA A . n 
A 1 91  GLY 91  84  84  GLY GLY A . n 
A 1 92  VAL 92  85  85  VAL VAL A . n 
A 1 93  ARG 93  86  86  ARG ARG A . n 
A 1 94  ASP 94  87  87  ASP ASP A . n 
A 1 95  CYS 95  88  88  CYS CYS A . n 
A 1 96  CYS 96  89  89  CYS CYS A . n 
A 1 97  ASN 97  90  90  ASN ASN A . n 
A 1 98  HIS 98  91  91  HIS HIS A . n 
A 1 99  LYS 99  92  92  LYS LYS A . n 
A 1 100 ASP 100 93  93  ASP ASP A . n 
A 1 101 LYS 101 94  94  LYS LYS A . n 
A 1 102 SER 102 95  95  SER SER A . n 
A 1 103 VAL 103 96  96  VAL VAL A . n 
A 1 104 GLN 104 97  97  GLN GLN A . n 
A 1 105 VAL 105 98  98  VAL VAL A . n 
A 1 106 ASP 106 99  99  ASP ASP A . n 
A 1 107 PHE 107 100 100 PHE PHE A . n 
A 1 108 ILE 108 101 101 ILE ILE A . n 
A 1 109 THR 109 102 102 THR THR A . n 
A 1 110 GLY 110 103 103 GLY GLY A . n 
A 1 111 LYS 111 104 104 LYS LYS A . n 
A 1 112 VAL 112 105 105 VAL VAL A . n 
A 1 113 CYS 113 106 106 CYS CYS A . n 
A 1 114 GLY 114 107 107 GLY GLY A . n 
A 1 115 SER 115 108 108 SER SER A . n 
A 1 116 GLU 116 109 109 GLU GLU A . n 
A 1 117 ASP 117 110 110 ASP ASP A . n 
A 1 118 CYS 118 111 111 CYS CYS A . n 
A 1 119 LEU 119 112 112 LEU LEU A . n 
A 1 120 TYR 120 113 113 TYR TYR A . n 
A 1 121 LEU 121 114 114 LEU LEU A . n 
A 1 122 SER 122 115 115 SER SER A . n 
A 1 123 VAL 123 116 116 VAL VAL A . n 
A 1 124 TYR 124 117 117 TYR TYR A . n 
A 1 125 THR 125 118 118 THR THR A . n 
A 1 126 ASN 126 119 119 ASN ASN A . n 
A 1 127 ASN 127 120 120 ASN ASN A . n 
A 1 128 LEU 128 121 121 LEU LEU A . n 
A 1 129 ASN 129 122 122 ASN ASN A . n 
A 1 130 PRO 130 123 123 PRO PRO A . n 
A 1 131 GLU 131 124 124 GLU GLU A . n 
A 1 132 THR 132 125 125 THR THR A . n 
A 1 133 LYS 133 126 126 LYS LYS A . n 
A 1 134 ARG 134 127 127 ARG ARG A . n 
A 1 135 PRO 135 128 128 PRO PRO A . n 
A 1 136 VAL 136 129 129 VAL VAL A . n 
A 1 137 LEU 137 130 130 LEU LEU A . n 
A 1 138 VAL 138 131 131 VAL VAL A . n 
A 1 139 TYR 139 132 132 TYR TYR A . n 
A 1 140 ILE 140 133 133 ILE ILE A . n 
A 1 141 HIS 141 134 134 HIS HIS A . n 
A 1 142 GLY 142 135 135 GLY GLY A . n 
A 1 143 GLY 143 136 136 GLY GLY A . n 
A 1 144 GLY 144 137 137 GLY GLY A . n 
A 1 145 PHE 145 138 138 PHE PHE A . n 
A 1 146 ILE 146 139 139 ILE ILE A . n 
A 1 147 ILE 147 140 140 ILE ILE A . n 
A 1 148 GLY 148 141 141 GLY GLY A . n 
A 1 149 GLU 149 142 142 GLU GLU A . n 
A 1 150 ASN 150 143 143 ASN ASN A . n 
A 1 151 HIS 151 144 144 HIS HIS A . n 
A 1 152 ARG 152 145 145 ARG ARG A . n 
A 1 153 ASP 153 146 146 ASP ASP A . n 
A 1 154 MET 154 147 147 MET MET A . n 
A 1 155 TYR 155 148 148 TYR TYR A . n 
A 1 156 GLY 156 149 149 GLY GLY A . n 
A 1 157 PRO 157 150 150 PRO PRO A . n 
A 1 158 ASP 158 151 151 ASP ASP A . n 
A 1 159 TYR 159 152 152 TYR TYR A . n 
A 1 160 PHE 160 153 153 PHE PHE A . n 
A 1 161 ILE 161 154 154 ILE ILE A . n 
A 1 162 LYS 162 155 155 LYS LYS A . n 
A 1 163 LYS 163 156 156 LYS LYS A . n 
A 1 164 ASP 164 157 157 ASP ASP A . n 
A 1 165 VAL 165 158 158 VAL VAL A . n 
A 1 166 VAL 166 159 159 VAL VAL A . n 
A 1 167 LEU 167 160 160 LEU LEU A . n 
A 1 168 ILE 168 161 161 ILE ILE A . n 
A 1 169 ASN 169 162 162 ASN ASN A . n 
A 1 170 ILE 170 163 163 ILE ILE A . n 
A 1 171 GLN 171 164 164 GLN GLN A . n 
A 1 172 TYR 172 165 165 TYR TYR A . n 
A 1 173 ARG 173 166 166 ARG ARG A . n 
A 1 174 LEU 174 167 167 LEU LEU A . n 
A 1 175 GLY 175 168 168 GLY GLY A . n 
A 1 176 ALA 176 169 169 ALA ALA A . n 
A 1 177 LEU 177 170 170 LEU LEU A . n 
A 1 178 GLY 178 171 171 GLY GLY A . n 
A 1 179 PHE 179 172 172 PHE PHE A . n 
A 1 180 LEU 180 173 173 LEU LEU A . n 
A 1 181 SER 181 174 174 SER SER A . n 
A 1 182 LEU 182 175 175 LEU LEU A . n 
A 1 183 ASN 183 176 176 ASN ASN A . n 
A 1 184 SER 184 177 177 SER SER A . n 
A 1 185 GLU 185 178 178 GLU GLU A . n 
A 1 186 ASP 186 179 179 ASP ASP A . n 
A 1 187 LEU 187 180 180 LEU LEU A . n 
A 1 188 ASN 188 181 181 ASN ASN A . n 
A 1 189 VAL 189 182 182 VAL VAL A . n 
A 1 190 PRO 190 183 183 PRO PRO A . n 
A 1 191 GLY 191 184 184 GLY GLY A . n 
A 1 192 ASN 192 185 185 ASN ASN A . n 
A 1 193 ALA 193 186 186 ALA ALA A . n 
A 1 194 GLY 194 187 187 GLY GLY A . n 
A 1 195 LEU 195 188 188 LEU LEU A . n 
A 1 196 LYS 196 189 189 LYS LYS A . n 
A 1 197 ASP 197 190 190 ASP ASP A . n 
A 1 198 GLN 198 191 191 GLN GLN A . n 
A 1 199 VAL 199 192 192 VAL VAL A . n 
A 1 200 MET 200 193 193 MET MET A . n 
A 1 201 ALA 201 194 194 ALA ALA A . n 
A 1 202 LEU 202 195 195 LEU LEU A . n 
A 1 203 ARG 203 196 196 ARG ARG A . n 
A 1 204 TRP 204 197 197 TRP TRP A . n 
A 1 205 ILE 205 198 198 ILE ILE A . n 
A 1 206 LYS 206 199 199 LYS LYS A . n 
A 1 207 ASN 207 200 200 ASN ASN A . n 
A 1 208 ASN 208 201 201 ASN ASN A . n 
A 1 209 CYS 209 202 202 CYS CYS A . n 
A 1 210 ALA 210 203 203 ALA ALA A . n 
A 1 211 ASN 211 204 204 ASN ASN A . n 
A 1 212 PHE 212 205 205 PHE PHE A . n 
A 1 213 GLY 213 206 206 GLY GLY A . n 
A 1 214 GLY 214 207 207 GLY GLY A . n 
A 1 215 ASN 215 208 208 ASN ASN A . n 
A 1 216 PRO 216 209 209 PRO PRO A . n 
A 1 217 ASP 217 210 210 ASP ASP A . n 
A 1 218 ASN 218 211 211 ASN ASN A . n 
A 1 219 ILE 219 212 212 ILE ILE A . n 
A 1 220 THR 220 213 213 THR THR A . n 
A 1 221 VAL 221 214 214 VAL VAL A . n 
A 1 222 PHE 222 215 215 PHE PHE A . n 
A 1 223 GLY 223 216 216 GLY GLY A . n 
A 1 224 GLU 224 217 217 GLU GLU A . n 
A 1 225 SER 225 218 218 SER SER A . n 
A 1 226 ALA 226 219 219 ALA ALA A . n 
A 1 227 GLY 227 220 220 GLY GLY A . n 
A 1 228 ALA 228 221 221 ALA ALA A . n 
A 1 229 ALA 229 222 222 ALA ALA A . n 
A 1 230 SER 230 223 223 SER SER A . n 
A 1 231 THR 231 224 224 THR THR A . n 
A 1 232 HIS 232 225 225 HIS HIS A . n 
A 1 233 TYR 233 226 226 TYR TYR A . n 
A 1 234 MET 234 227 227 MET MET A . n 
A 1 235 MET 235 228 228 MET MET A . n 
A 1 236 LEU 236 229 229 LEU LEU A . n 
A 1 237 THR 237 230 230 THR THR A . n 
A 1 238 GLU 238 231 231 GLU GLU A . n 
A 1 239 GLN 239 232 232 GLN GLN A . n 
A 1 240 THR 240 233 233 THR THR A . n 
A 1 241 ARG 241 234 234 ARG ARG A . n 
A 1 242 GLY 242 235 235 GLY GLY A . n 
A 1 243 LEU 243 236 236 LEU LEU A . n 
A 1 244 PHE 244 237 237 PHE PHE A . n 
A 1 245 HIS 245 238 238 HIS HIS A . n 
A 1 246 ARG 246 239 239 ARG ARG A . n 
A 1 247 GLY 247 240 240 GLY GLY A . n 
A 1 248 ILE 248 241 241 ILE ILE A . n 
A 1 249 LEU 249 242 242 LEU LEU A . n 
A 1 250 MET 250 243 243 MET MET A . n 
A 1 251 SER 251 244 244 SER SER A . n 
A 1 252 GLY 252 245 245 GLY GLY A . n 
A 1 253 ASN 253 246 246 ASN ASN A . n 
A 1 254 ALA 254 247 247 ALA ALA A . n 
A 1 255 ILE 255 248 248 ILE ILE A . n 
A 1 256 CYS 256 249 249 CYS CYS A . n 
A 1 257 PRO 257 250 250 PRO PRO A . n 
A 1 258 TRP 258 251 251 TRP TRP A . n 
A 1 259 ALA 259 252 252 ALA ALA A . n 
A 1 260 ASN 260 253 253 ASN ASN A . n 
A 1 261 THR 261 254 254 THR THR A . n 
A 1 262 GLN 262 255 255 GLN GLN A . n 
A 1 263 CYS 263 256 256 CYS CYS A . n 
A 1 264 GLN 264 257 257 GLN GLN A . n 
A 1 265 HIS 265 258 258 HIS HIS A . n 
A 1 266 ARG 266 259 259 ARG ARG A . n 
A 1 267 ALA 267 260 260 ALA ALA A . n 
A 1 268 PHE 268 261 261 PHE PHE A . n 
A 1 269 THR 269 262 262 THR THR A . n 
A 1 270 LEU 270 263 263 LEU LEU A . n 
A 1 271 ALA 271 264 264 ALA ALA A . n 
A 1 272 LYS 272 265 265 LYS LYS A . n 
A 1 273 LEU 273 266 266 LEU LEU A . n 
A 1 274 ALA 274 267 267 ALA ALA A . n 
A 1 275 GLY 275 268 268 GLY GLY A . n 
A 1 276 TYR 276 269 269 TYR TYR A . n 
A 1 277 LYS 277 270 270 LYS LYS A . n 
A 1 278 GLY 278 271 271 GLY GLY A . n 
A 1 279 GLU 279 272 272 GLU GLU A . n 
A 1 280 ASP 280 273 273 ASP ASP A . n 
A 1 281 ASN 281 274 274 ASN ASN A . n 
A 1 282 ASP 282 275 275 ASP ASP A . n 
A 1 283 LYS 283 276 276 LYS LYS A . n 
A 1 284 ASP 284 277 277 ASP ASP A . n 
A 1 285 VAL 285 278 278 VAL VAL A . n 
A 1 286 LEU 286 279 279 LEU LEU A . n 
A 1 287 GLU 287 280 280 GLU GLU A . n 
A 1 288 PHE 288 281 281 PHE PHE A . n 
A 1 289 LEU 289 282 282 LEU LEU A . n 
A 1 290 MET 290 283 283 MET MET A . n 
A 1 291 LYS 291 284 284 LYS LYS A . n 
A 1 292 ALA 292 285 285 ALA ALA A . n 
A 1 293 LYS 293 286 286 LYS LYS A . n 
A 1 294 PRO 294 287 287 PRO PRO A . n 
A 1 295 GLN 295 288 288 GLN GLN A . n 
A 1 296 ASP 296 289 289 ASP ASP A . n 
A 1 297 LEU 297 290 290 LEU LEU A . n 
A 1 298 ILE 298 291 291 ILE ILE A . n 
A 1 299 LYS 299 292 292 LYS LYS A . n 
A 1 300 LEU 300 293 293 LEU LEU A . n 
A 1 301 GLU 301 294 294 GLU GLU A . n 
A 1 302 GLU 302 295 295 GLU GLU A . n 
A 1 303 LYS 303 296 296 LYS LYS A . n 
A 1 304 VAL 304 297 297 VAL VAL A . n 
A 1 305 LEU 305 298 298 LEU LEU A . n 
A 1 306 THR 306 299 299 THR THR A . n 
A 1 307 LEU 307 300 300 LEU LEU A . n 
A 1 308 GLU 308 301 301 GLU GLU A . n 
A 1 309 GLU 309 302 302 GLU GLU A . n 
A 1 310 ARG 310 303 303 ARG ARG A . n 
A 1 311 THR 311 304 304 THR THR A . n 
A 1 312 ASN 312 305 305 ASN ASN A . n 
A 1 313 LYS 313 306 306 LYS LYS A . n 
A 1 314 VAL 314 307 307 VAL VAL A . n 
A 1 315 MET 315 308 308 MET MET A . n 
A 1 316 PHE 316 309 309 PHE PHE A . n 
A 1 317 PRO 317 310 310 PRO PRO A . n 
A 1 318 PHE 318 311 311 PHE PHE A . n 
A 1 319 GLY 319 312 312 GLY GLY A . n 
A 1 320 PRO 320 313 313 PRO PRO A . n 
A 1 321 THR 321 314 314 THR THR A . n 
A 1 322 VAL 322 315 315 VAL VAL A . n 
A 1 323 GLU 323 316 316 GLU GLU A . n 
A 1 324 PRO 324 317 317 PRO PRO A . n 
A 1 325 TYR 325 318 318 TYR TYR A . n 
A 1 326 GLN 326 319 319 GLN GLN A . n 
A 1 327 THR 327 320 320 THR THR A . n 
A 1 328 ALA 328 321 321 ALA ALA A . n 
A 1 329 ASP 329 322 322 ASP ASP A . n 
A 1 330 CYS 330 323 323 CYS CYS A . n 
A 1 331 VAL 331 324 324 VAL VAL A . n 
A 1 332 LEU 332 325 325 LEU LEU A . n 
A 1 333 PRO 333 326 326 PRO PRO A . n 
A 1 334 LYS 334 327 327 LYS LYS A . n 
A 1 335 HIS 335 328 328 HIS HIS A . n 
A 1 336 PRO 336 329 329 PRO PRO A . n 
A 1 337 ARG 337 330 330 ARG ARG A . n 
A 1 338 GLU 338 331 331 GLU GLU A . n 
A 1 339 MET 339 332 332 MET MET A . n 
A 1 340 VAL 340 333 333 VAL VAL A . n 
A 1 341 LYS 341 334 334 LYS LYS A . n 
A 1 342 THR 342 335 335 THR THR A . n 
A 1 343 ALA 343 336 336 ALA ALA A . n 
A 1 344 TRP 344 337 337 TRP TRP A . n 
A 1 345 GLY 345 338 338 GLY GLY A . n 
A 1 346 ASN 346 339 339 ASN ASN A . n 
A 1 347 SER 347 340 340 SER SER A . n 
A 1 348 ILE 348 341 341 ILE ILE A . n 
A 1 349 PRO 349 342 342 PRO PRO A . n 
A 1 350 THR 350 343 343 THR THR A . n 
A 1 351 MET 351 344 344 MET MET A . n 
A 1 352 MET 352 345 345 MET MET A . n 
A 1 353 GLY 353 346 346 GLY GLY A . n 
A 1 354 ASN 354 347 347 ASN ASN A . n 
A 1 355 THR 355 348 348 THR THR A . n 
A 1 356 SER 356 349 349 SER SER A . n 
A 1 357 TYR 357 350 350 TYR TYR A . n 
A 1 358 GLU 358 351 351 GLU GLU A . n 
A 1 359 GLY 359 352 352 GLY GLY A . n 
A 1 360 LEU 360 353 353 LEU LEU A . n 
A 1 361 PHE 361 354 354 PHE PHE A . n 
A 1 362 PHE 362 355 355 PHE PHE A . n 
A 1 363 THR 363 356 356 THR THR A . n 
A 1 364 SER 364 357 357 SER SER A . n 
A 1 365 ILE 365 358 358 ILE ILE A . n 
A 1 366 LEU 366 359 359 LEU LEU A . n 
A 1 367 LYS 367 360 360 LYS LYS A . n 
A 1 368 GLN 368 361 361 GLN GLN A . n 
A 1 369 MET 369 362 362 MET MET A . n 
A 1 370 PRO 370 363 363 PRO PRO A . n 
A 1 371 LEU 371 364 364 LEU LEU A . n 
A 1 372 LEU 372 365 365 LEU LEU A . n 
A 1 373 VAL 373 366 366 VAL VAL A . n 
A 1 374 LYS 374 367 367 LYS LYS A . n 
A 1 375 GLU 375 368 368 GLU GLU A . n 
A 1 376 LEU 376 369 369 LEU LEU A . n 
A 1 377 GLU 377 370 370 GLU GLU A . n 
A 1 378 THR 378 371 371 THR THR A . n 
A 1 379 CYS 379 372 372 CYS CYS A . n 
A 1 380 VAL 380 373 373 VAL VAL A . n 
A 1 381 ASN 381 374 374 ASN ASN A . n 
A 1 382 PHE 382 375 375 PHE PHE A . n 
A 1 383 VAL 383 376 376 VAL VAL A . n 
A 1 384 PRO 384 377 377 PRO PRO A . n 
A 1 385 SER 385 378 378 SER SER A . n 
A 1 386 GLU 386 379 379 GLU GLU A . n 
A 1 387 LEU 387 380 380 LEU LEU A . n 
A 1 388 ALA 388 381 381 ALA ALA A . n 
A 1 389 ASP 389 382 382 ASP ASP A . n 
A 1 390 ALA 390 383 383 ALA ALA A . n 
A 1 391 GLU 391 384 384 GLU GLU A . n 
A 1 392 ARG 392 385 385 ARG ARG A . n 
A 1 393 THR 393 386 386 THR THR A . n 
A 1 394 ALA 394 387 387 ALA ALA A . n 
A 1 395 PRO 395 388 388 PRO PRO A . n 
A 1 396 GLU 396 389 389 GLU GLU A . n 
A 1 397 THR 397 390 390 THR THR A . n 
A 1 398 LEU 398 391 391 LEU LEU A . n 
A 1 399 GLU 399 392 392 GLU GLU A . n 
A 1 400 MET 400 393 393 MET MET A . n 
A 1 401 GLY 401 394 394 GLY GLY A . n 
A 1 402 ALA 402 395 395 ALA ALA A . n 
A 1 403 LYS 403 396 396 LYS LYS A . n 
A 1 404 ILE 404 397 397 ILE ILE A . n 
A 1 405 LYS 405 398 398 LYS LYS A . n 
A 1 406 LYS 406 399 399 LYS LYS A . n 
A 1 407 ALA 407 400 400 ALA ALA A . n 
A 1 408 HIS 408 401 401 HIS HIS A . n 
A 1 409 VAL 409 402 402 VAL VAL A . n 
A 1 410 THR 410 403 403 THR THR A . n 
A 1 411 GLY 411 404 404 GLY GLY A . n 
A 1 412 GLU 412 405 405 GLU GLU A . n 
A 1 413 THR 413 406 406 THR THR A . n 
A 1 414 PRO 414 407 407 PRO PRO A . n 
A 1 415 THR 415 408 408 THR THR A . n 
A 1 416 ALA 416 409 409 ALA ALA A . n 
A 1 417 ASP 417 410 410 ASP ASP A . n 
A 1 418 ASN 418 411 411 ASN ASN A . n 
A 1 419 PHE 419 412 412 PHE PHE A . n 
A 1 420 MET 420 413 413 MET MET A . n 
A 1 421 ASP 421 414 414 ASP ASP A . n 
A 1 422 LEU 422 415 415 LEU LEU A . n 
A 1 423 CYS 423 416 416 CYS CYS A . n 
A 1 424 SER 424 417 417 SER SER A . n 
A 1 425 HIS 425 418 418 HIS HIS A . n 
A 1 426 PHE 426 419 419 PHE PHE A . n 
A 1 427 TYR 427 420 420 TYR TYR A . n 
A 1 428 PHE 428 421 421 PHE PHE A . n 
A 1 429 TRP 429 422 422 TRP TRP A . n 
A 1 430 PHE 430 423 423 PHE PHE A . n 
A 1 431 PRO 431 424 424 PRO PRO A . n 
A 1 432 MET 432 425 425 MET MET A . n 
A 1 433 HIS 433 426 426 HIS HIS A . n 
A 1 434 ARG 434 427 427 ARG ARG A . n 
A 1 435 LEU 435 428 428 LEU LEU A . n 
A 1 436 LEU 436 429 429 LEU LEU A . n 
A 1 437 GLN 437 430 430 GLN GLN A . n 
A 1 438 LEU 438 431 431 LEU LEU A . n 
A 1 439 ARG 439 432 432 ARG ARG A . n 
A 1 440 PHE 440 433 433 PHE PHE A . n 
A 1 441 ASN 441 434 434 ASN ASN A . n 
A 1 442 HIS 442 435 435 HIS HIS A . n 
A 1 443 THR 443 436 436 THR THR A . n 
A 1 444 SER 444 437 437 SER SER A . n 
A 1 445 GLY 445 438 438 GLY GLY A . n 
A 1 446 THR 446 439 439 THR THR A . n 
A 1 447 PRO 447 440 440 PRO PRO A . n 
A 1 448 VAL 448 441 441 VAL VAL A . n 
A 1 449 TYR 449 442 442 TYR TYR A . n 
A 1 450 LEU 450 443 443 LEU LEU A . n 
A 1 451 TYR 451 444 444 TYR TYR A . n 
A 1 452 ARG 452 445 445 ARG ARG A . n 
A 1 453 PHE 453 446 446 PHE PHE A . n 
A 1 454 ASP 454 447 447 ASP ASP A . n 
A 1 455 PHE 455 448 448 PHE PHE A . n 
A 1 456 ASP 456 449 449 ASP ASP A . n 
A 1 457 SER 457 450 450 SER SER A . n 
A 1 458 GLU 458 451 451 GLU GLU A . n 
A 1 459 ASP 459 452 452 ASP ASP A . n 
A 1 460 LEU 460 453 453 LEU LEU A . n 
A 1 461 ILE 461 454 454 ILE ILE A . n 
A 1 462 ASN 462 455 455 ASN ASN A . n 
A 1 463 PRO 463 456 456 PRO PRO A . n 
A 1 464 TYR 464 457 457 TYR TYR A . n 
A 1 465 ARG 465 458 458 ARG ARG A . n 
A 1 466 ILE 466 459 459 ILE ILE A . n 
A 1 467 MET 467 460 460 MET MET A . n 
A 1 468 ARG 468 461 461 ARG ARG A . n 
A 1 469 SER 469 462 462 SER SER A . n 
A 1 470 GLY 470 463 463 GLY GLY A . n 
A 1 471 ARG 471 464 464 ARG ARG A . n 
A 1 472 GLY 472 465 465 GLY GLY A . n 
A 1 473 VAL 473 466 466 VAL VAL A . n 
A 1 474 LYS 474 467 467 LYS LYS A . n 
A 1 475 GLY 475 468 468 GLY GLY A . n 
A 1 476 VAL 476 469 469 VAL VAL A . n 
A 1 477 SER 477 470 470 SER SER A . n 
A 1 478 HIS 478 471 471 HIS HIS A . n 
A 1 479 THR 479 472 472 THR THR A . n 
A 1 480 ASP 480 473 473 ASP ASP A . n 
A 1 481 GLU 481 474 474 GLU GLU A . n 
A 1 482 LEU 482 475 475 LEU LEU A . n 
A 1 483 THR 483 476 476 THR THR A . n 
A 1 484 TYR 484 477 477 TYR TYR A . n 
A 1 485 PHE 485 478 478 PHE PHE A . n 
A 1 486 PHE 486 479 479 PHE PHE A . n 
A 1 487 TRP 487 480 480 TRP TRP A . n 
A 1 488 ASN 488 481 481 ASN ASN A . n 
A 1 489 GLN 489 482 482 GLN GLN A . n 
A 1 490 LEU 490 483 483 LEU LEU A . n 
A 1 491 ALA 491 484 484 ALA ALA A . n 
A 1 492 LYS 492 485 485 LYS LYS A . n 
A 1 493 ARG 493 486 486 ARG ARG A . n 
A 1 494 MET 494 487 487 MET MET A . n 
A 1 495 PRO 495 488 488 PRO PRO A . n 
A 1 496 LYS 496 489 489 LYS LYS A . n 
A 1 497 GLU 497 490 490 GLU GLU A . n 
A 1 498 SER 498 491 491 SER SER A . n 
A 1 499 ARG 499 492 492 ARG ARG A . n 
A 1 500 GLU 500 493 493 GLU GLU A . n 
A 1 501 TYR 501 494 494 TYR TYR A . n 
A 1 502 LYS 502 495 495 LYS LYS A . n 
A 1 503 THR 503 496 496 THR THR A . n 
A 1 504 ILE 504 497 497 ILE ILE A . n 
A 1 505 GLU 505 498 498 GLU GLU A . n 
A 1 506 ARG 506 499 499 ARG ARG A . n 
A 1 507 MET 507 500 500 MET MET A . n 
A 1 508 THR 508 501 501 THR THR A . n 
A 1 509 GLY 509 502 502 GLY GLY A . n 
A 1 510 ILE 510 503 503 ILE ILE A . n 
A 1 511 TRP 511 504 504 TRP TRP A . n 
A 1 512 THR 512 505 505 THR THR A . n 
A 1 513 GLN 513 506 506 GLN GLN A . n 
A 1 514 PHE 514 507 507 PHE PHE A . n 
A 1 515 ALA 515 508 508 ALA ALA A . n 
A 1 516 THR 516 509 509 THR THR A . n 
A 1 517 THR 517 510 510 THR THR A . n 
A 1 518 GLY 518 511 511 GLY GLY A . n 
A 1 519 ASN 519 512 512 ASN ASN A . n 
A 1 520 PRO 520 513 513 PRO PRO A . n 
A 1 521 TYR 521 514 514 TYR TYR A . n 
A 1 522 SER 522 515 515 SER SER A . n 
A 1 523 ASN 523 516 516 ASN ASN A . n 
A 1 524 GLU 524 517 517 GLU GLU A . n 
A 1 525 ILE 525 518 518 ILE ILE A . n 
A 1 526 GLU 526 519 519 GLU GLU A . n 
A 1 527 GLY 527 520 520 GLY GLY A . n 
A 1 528 MET 528 521 521 MET MET A . n 
A 1 529 GLU 529 522 522 GLU GLU A . n 
A 1 530 ASN 530 523 523 ASN ASN A . n 
A 1 531 VAL 531 524 524 VAL VAL A . n 
A 1 532 SER 532 525 525 SER SER A . n 
A 1 533 TRP 533 526 526 TRP TRP A . n 
A 1 534 ASP 534 527 527 ASP ASP A . n 
A 1 535 PRO 535 528 528 PRO PRO A . n 
A 1 536 ILE 536 529 529 ILE ILE A . n 
A 1 537 GLU 537 530 530 GLU GLU A . n 
A 1 538 LYS 538 531 531 LYS LYS A . n 
A 1 539 SER 539 532 532 SER SER A . n 
A 1 540 ASP 540 533 533 ASP ASP A . n 
A 1 541 GLU 541 534 534 GLU GLU A . n 
A 1 542 VAL 542 535 535 VAL VAL A . n 
A 1 543 TYR 543 536 536 TYR TYR A . n 
A 1 544 LYS 544 537 537 LYS LYS A . n 
A 1 545 CYS 545 538 538 CYS CYS A . n 
A 1 546 LEU 546 539 539 LEU LEU A . n 
A 1 547 ASN 547 540 540 ASN ASN A . n 
A 1 548 ILE 548 541 541 ILE ILE A . n 
A 1 549 SER 549 542 542 SER SER A . n 
A 1 550 ASP 550 543 543 ASP ASP A . n 
A 1 551 GLU 551 544 544 GLU GLU A . n 
A 1 552 LEU 552 545 545 LEU LEU A . n 
A 1 553 LYS 553 546 546 LYS LYS A . n 
A 1 554 MET 554 547 547 MET MET A . n 
A 1 555 ILE 555 548 548 ILE ILE A . n 
A 1 556 ASP 556 549 549 ASP ASP A . n 
A 1 557 VAL 557 550 550 VAL VAL A . n 
A 1 558 PRO 558 551 551 PRO PRO A . n 
A 1 559 GLU 559 552 552 GLU GLU A . n 
A 1 560 MET 560 553 553 MET MET A . n 
A 1 561 GLY 561 554 554 GLY GLY A . n 
A 1 562 LYS 562 555 555 LYS LYS A . n 
A 1 563 ILE 563 556 556 ILE ILE A . n 
A 1 564 LYS 564 557 557 LYS LYS A . n 
A 1 565 GLN 565 558 558 GLN GLN A . n 
A 1 566 TRP 566 559 559 TRP TRP A . n 
A 1 567 GLU 567 560 560 GLU GLU A . n 
A 1 568 SER 568 561 561 SER SER A . n 
A 1 569 MET 569 562 562 MET MET A . n 
A 1 570 PHE 570 563 563 PHE PHE A . n 
A 1 571 GLU 571 564 564 GLU GLU A . n 
A 1 572 LYS 572 565 565 LYS LYS A . n 
A 1 573 HIS 573 566 566 HIS HIS A . n 
A 1 574 ARG 574 567 567 ARG ARG A . n 
A 1 575 ASP 575 568 568 ASP ASP A . n 
A 1 576 LEU 576 569 569 LEU LEU A . n 
A 1 577 PHE 577 570 570 PHE PHE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 DPF 1   601  601 DPF DPF A . 
C 3 HOH 1   701  70  HOH HOH A . 
C 3 HOH 2   702  377 HOH HOH A . 
C 3 HOH 3   703  305 HOH HOH A . 
C 3 HOH 4   704  101 HOH HOH A . 
C 3 HOH 5   705  21  HOH HOH A . 
C 3 HOH 6   706  349 HOH HOH A . 
C 3 HOH 7   707  224 HOH HOH A . 
C 3 HOH 8   708  294 HOH HOH A . 
C 3 HOH 9   709  351 HOH HOH A . 
C 3 HOH 10  710  392 HOH HOH A . 
C 3 HOH 11  711  258 HOH HOH A . 
C 3 HOH 12  712  331 HOH HOH A . 
C 3 HOH 13  713  244 HOH HOH A . 
C 3 HOH 14  714  352 HOH HOH A . 
C 3 HOH 15  715  150 HOH HOH A . 
C 3 HOH 16  716  36  HOH HOH A . 
C 3 HOH 17  717  341 HOH HOH A . 
C 3 HOH 18  718  199 HOH HOH A . 
C 3 HOH 19  719  388 HOH HOH A . 
C 3 HOH 20  720  59  HOH HOH A . 
C 3 HOH 21  721  169 HOH HOH A . 
C 3 HOH 22  722  366 HOH HOH A . 
C 3 HOH 23  723  364 HOH HOH A . 
C 3 HOH 24  724  327 HOH HOH A . 
C 3 HOH 25  725  361 HOH HOH A . 
C 3 HOH 26  726  229 HOH HOH A . 
C 3 HOH 27  727  279 HOH HOH A . 
C 3 HOH 28  728  235 HOH HOH A . 
C 3 HOH 29  729  269 HOH HOH A . 
C 3 HOH 30  730  197 HOH HOH A . 
C 3 HOH 31  731  333 HOH HOH A . 
C 3 HOH 32  732  399 HOH HOH A . 
C 3 HOH 33  733  10  HOH HOH A . 
C 3 HOH 34  734  75  HOH HOH A . 
C 3 HOH 35  735  134 HOH HOH A . 
C 3 HOH 36  736  97  HOH HOH A . 
C 3 HOH 37  737  118 HOH HOH A . 
C 3 HOH 38  738  123 HOH HOH A . 
C 3 HOH 39  739  237 HOH HOH A . 
C 3 HOH 40  740  371 HOH HOH A . 
C 3 HOH 41  741  212 HOH HOH A . 
C 3 HOH 42  742  168 HOH HOH A . 
C 3 HOH 43  743  126 HOH HOH A . 
C 3 HOH 44  744  234 HOH HOH A . 
C 3 HOH 45  745  46  HOH HOH A . 
C 3 HOH 46  746  317 HOH HOH A . 
C 3 HOH 47  747  207 HOH HOH A . 
C 3 HOH 48  748  152 HOH HOH A . 
C 3 HOH 49  749  268 HOH HOH A . 
C 3 HOH 50  750  386 HOH HOH A . 
C 3 HOH 51  751  337 HOH HOH A . 
C 3 HOH 52  752  255 HOH HOH A . 
C 3 HOH 53  753  281 HOH HOH A . 
C 3 HOH 54  754  143 HOH HOH A . 
C 3 HOH 55  755  127 HOH HOH A . 
C 3 HOH 56  756  166 HOH HOH A . 
C 3 HOH 57  757  389 HOH HOH A . 
C 3 HOH 58  758  58  HOH HOH A . 
C 3 HOH 59  759  379 HOH HOH A . 
C 3 HOH 60  760  266 HOH HOH A . 
C 3 HOH 61  761  160 HOH HOH A . 
C 3 HOH 62  762  276 HOH HOH A . 
C 3 HOH 63  763  151 HOH HOH A . 
C 3 HOH 64  764  69  HOH HOH A . 
C 3 HOH 65  765  165 HOH HOH A . 
C 3 HOH 66  766  288 HOH HOH A . 
C 3 HOH 67  767  137 HOH HOH A . 
C 3 HOH 68  768  206 HOH HOH A . 
C 3 HOH 69  769  67  HOH HOH A . 
C 3 HOH 70  770  86  HOH HOH A . 
C 3 HOH 71  771  358 HOH HOH A . 
C 3 HOH 72  772  202 HOH HOH A . 
C 3 HOH 73  773  242 HOH HOH A . 
C 3 HOH 74  774  313 HOH HOH A . 
C 3 HOH 75  775  7   HOH HOH A . 
C 3 HOH 76  776  16  HOH HOH A . 
C 3 HOH 77  777  217 HOH HOH A . 
C 3 HOH 78  778  370 HOH HOH A . 
C 3 HOH 79  779  87  HOH HOH A . 
C 3 HOH 80  780  397 HOH HOH A . 
C 3 HOH 81  781  145 HOH HOH A . 
C 3 HOH 82  782  25  HOH HOH A . 
C 3 HOH 83  783  252 HOH HOH A . 
C 3 HOH 84  784  381 HOH HOH A . 
C 3 HOH 85  785  398 HOH HOH A . 
C 3 HOH 86  786  163 HOH HOH A . 
C 3 HOH 87  787  93  HOH HOH A . 
C 3 HOH 88  788  115 HOH HOH A . 
C 3 HOH 89  789  51  HOH HOH A . 
C 3 HOH 90  790  253 HOH HOH A . 
C 3 HOH 91  791  216 HOH HOH A . 
C 3 HOH 92  792  171 HOH HOH A . 
C 3 HOH 93  793  66  HOH HOH A . 
C 3 HOH 94  794  265 HOH HOH A . 
C 3 HOH 95  795  31  HOH HOH A . 
C 3 HOH 96  796  380 HOH HOH A . 
C 3 HOH 97  797  62  HOH HOH A . 
C 3 HOH 98  798  180 HOH HOH A . 
C 3 HOH 99  799  65  HOH HOH A . 
C 3 HOH 100 800  270 HOH HOH A . 
C 3 HOH 101 801  79  HOH HOH A . 
C 3 HOH 102 802  339 HOH HOH A . 
C 3 HOH 103 803  84  HOH HOH A . 
C 3 HOH 104 804  326 HOH HOH A . 
C 3 HOH 105 805  9   HOH HOH A . 
C 3 HOH 106 806  27  HOH HOH A . 
C 3 HOH 107 807  298 HOH HOH A . 
C 3 HOH 108 808  306 HOH HOH A . 
C 3 HOH 109 809  179 HOH HOH A . 
C 3 HOH 110 810  80  HOH HOH A . 
C 3 HOH 111 811  153 HOH HOH A . 
C 3 HOH 112 812  241 HOH HOH A . 
C 3 HOH 113 813  85  HOH HOH A . 
C 3 HOH 114 814  3   HOH HOH A . 
C 3 HOH 115 815  45  HOH HOH A . 
C 3 HOH 116 816  334 HOH HOH A . 
C 3 HOH 117 817  11  HOH HOH A . 
C 3 HOH 118 818  76  HOH HOH A . 
C 3 HOH 119 819  225 HOH HOH A . 
C 3 HOH 120 820  272 HOH HOH A . 
C 3 HOH 121 821  44  HOH HOH A . 
C 3 HOH 122 822  12  HOH HOH A . 
C 3 HOH 123 823  136 HOH HOH A . 
C 3 HOH 124 824  34  HOH HOH A . 
C 3 HOH 125 825  228 HOH HOH A . 
C 3 HOH 126 826  30  HOH HOH A . 
C 3 HOH 127 827  83  HOH HOH A . 
C 3 HOH 128 828  50  HOH HOH A . 
C 3 HOH 129 829  23  HOH HOH A . 
C 3 HOH 130 830  88  HOH HOH A . 
C 3 HOH 131 831  172 HOH HOH A . 
C 3 HOH 132 832  365 HOH HOH A . 
C 3 HOH 133 833  55  HOH HOH A . 
C 3 HOH 134 834  261 HOH HOH A . 
C 3 HOH 135 835  189 HOH HOH A . 
C 3 HOH 136 836  247 HOH HOH A . 
C 3 HOH 137 837  214 HOH HOH A . 
C 3 HOH 138 838  104 HOH HOH A . 
C 3 HOH 139 839  195 HOH HOH A . 
C 3 HOH 140 840  215 HOH HOH A . 
C 3 HOH 141 841  28  HOH HOH A . 
C 3 HOH 142 842  124 HOH HOH A . 
C 3 HOH 143 843  106 HOH HOH A . 
C 3 HOH 144 844  4   HOH HOH A . 
C 3 HOH 145 845  146 HOH HOH A . 
C 3 HOH 146 846  42  HOH HOH A . 
C 3 HOH 147 847  209 HOH HOH A . 
C 3 HOH 148 848  37  HOH HOH A . 
C 3 HOH 149 849  271 HOH HOH A . 
C 3 HOH 150 850  129 HOH HOH A . 
C 3 HOH 151 851  119 HOH HOH A . 
C 3 HOH 152 852  122 HOH HOH A . 
C 3 HOH 153 853  170 HOH HOH A . 
C 3 HOH 154 854  156 HOH HOH A . 
C 3 HOH 155 855  182 HOH HOH A . 
C 3 HOH 156 856  219 HOH HOH A . 
C 3 HOH 157 857  6   HOH HOH A . 
C 3 HOH 158 858  284 HOH HOH A . 
C 3 HOH 159 859  155 HOH HOH A . 
C 3 HOH 160 860  81  HOH HOH A . 
C 3 HOH 161 861  132 HOH HOH A . 
C 3 HOH 162 862  264 HOH HOH A . 
C 3 HOH 163 863  73  HOH HOH A . 
C 3 HOH 164 864  72  HOH HOH A . 
C 3 HOH 165 865  257 HOH HOH A . 
C 3 HOH 166 866  174 HOH HOH A . 
C 3 HOH 167 867  227 HOH HOH A . 
C 3 HOH 168 868  82  HOH HOH A . 
C 3 HOH 169 869  53  HOH HOH A . 
C 3 HOH 170 870  125 HOH HOH A . 
C 3 HOH 171 871  286 HOH HOH A . 
C 3 HOH 172 872  52  HOH HOH A . 
C 3 HOH 173 873  292 HOH HOH A . 
C 3 HOH 174 874  196 HOH HOH A . 
C 3 HOH 175 875  57  HOH HOH A . 
C 3 HOH 176 876  40  HOH HOH A . 
C 3 HOH 177 877  48  HOH HOH A . 
C 3 HOH 178 878  347 HOH HOH A . 
C 3 HOH 179 879  98  HOH HOH A . 
C 3 HOH 180 880  158 HOH HOH A . 
C 3 HOH 181 881  296 HOH HOH A . 
C 3 HOH 182 882  60  HOH HOH A . 
C 3 HOH 183 883  20  HOH HOH A . 
C 3 HOH 184 884  8   HOH HOH A . 
C 3 HOH 185 885  178 HOH HOH A . 
C 3 HOH 186 886  245 HOH HOH A . 
C 3 HOH 187 887  147 HOH HOH A . 
C 3 HOH 188 888  142 HOH HOH A . 
C 3 HOH 189 889  275 HOH HOH A . 
C 3 HOH 190 890  204 HOH HOH A . 
C 3 HOH 191 891  128 HOH HOH A . 
C 3 HOH 192 892  328 HOH HOH A . 
C 3 HOH 193 893  61  HOH HOH A . 
C 3 HOH 194 894  110 HOH HOH A . 
C 3 HOH 195 895  251 HOH HOH A . 
C 3 HOH 196 896  193 HOH HOH A . 
C 3 HOH 197 897  47  HOH HOH A . 
C 3 HOH 198 898  363 HOH HOH A . 
C 3 HOH 199 899  24  HOH HOH A . 
C 3 HOH 200 900  32  HOH HOH A . 
C 3 HOH 201 901  26  HOH HOH A . 
C 3 HOH 202 902  177 HOH HOH A . 
C 3 HOH 203 903  14  HOH HOH A . 
C 3 HOH 204 904  141 HOH HOH A . 
C 3 HOH 205 905  49  HOH HOH A . 
C 3 HOH 206 906  78  HOH HOH A . 
C 3 HOH 207 907  130 HOH HOH A . 
C 3 HOH 208 908  117 HOH HOH A . 
C 3 HOH 209 909  184 HOH HOH A . 
C 3 HOH 210 910  213 HOH HOH A . 
C 3 HOH 211 911  140 HOH HOH A . 
C 3 HOH 212 912  290 HOH HOH A . 
C 3 HOH 213 913  1   HOH HOH A . 
C 3 HOH 214 914  111 HOH HOH A . 
C 3 HOH 215 915  188 HOH HOH A . 
C 3 HOH 216 916  373 HOH HOH A . 
C 3 HOH 217 917  354 HOH HOH A . 
C 3 HOH 218 918  107 HOH HOH A . 
C 3 HOH 219 919  96  HOH HOH A . 
C 3 HOH 220 920  68  HOH HOH A . 
C 3 HOH 221 921  89  HOH HOH A . 
C 3 HOH 222 922  260 HOH HOH A . 
C 3 HOH 223 923  220 HOH HOH A . 
C 3 HOH 224 924  91  HOH HOH A . 
C 3 HOH 225 925  18  HOH HOH A . 
C 3 HOH 226 926  54  HOH HOH A . 
C 3 HOH 227 927  164 HOH HOH A . 
C 3 HOH 228 928  5   HOH HOH A . 
C 3 HOH 229 929  175 HOH HOH A . 
C 3 HOH 230 930  362 HOH HOH A . 
C 3 HOH 231 931  246 HOH HOH A . 
C 3 HOH 232 932  74  HOH HOH A . 
C 3 HOH 233 933  231 HOH HOH A . 
C 3 HOH 234 934  38  HOH HOH A . 
C 3 HOH 235 935  316 HOH HOH A . 
C 3 HOH 236 936  210 HOH HOH A . 
C 3 HOH 237 937  2   HOH HOH A . 
C 3 HOH 238 938  287 HOH HOH A . 
C 3 HOH 239 939  378 HOH HOH A . 
C 3 HOH 240 940  99  HOH HOH A . 
C 3 HOH 241 941  181 HOH HOH A . 
C 3 HOH 242 942  35  HOH HOH A . 
C 3 HOH 243 943  282 HOH HOH A . 
C 3 HOH 244 944  90  HOH HOH A . 
C 3 HOH 245 945  121 HOH HOH A . 
C 3 HOH 246 946  222 HOH HOH A . 
C 3 HOH 247 947  369 HOH HOH A . 
C 3 HOH 248 948  113 HOH HOH A . 
C 3 HOH 249 949  201 HOH HOH A . 
C 3 HOH 250 950  190 HOH HOH A . 
C 3 HOH 251 951  277 HOH HOH A . 
C 3 HOH 252 952  342 HOH HOH A . 
C 3 HOH 253 953  330 HOH HOH A . 
C 3 HOH 254 954  19  HOH HOH A . 
C 3 HOH 255 955  186 HOH HOH A . 
C 3 HOH 256 956  250 HOH HOH A . 
C 3 HOH 257 957  157 HOH HOH A . 
C 3 HOH 258 958  280 HOH HOH A . 
C 3 HOH 259 959  100 HOH HOH A . 
C 3 HOH 260 960  120 HOH HOH A . 
C 3 HOH 261 961  108 HOH HOH A . 
C 3 HOH 262 962  56  HOH HOH A . 
C 3 HOH 263 963  355 HOH HOH A . 
C 3 HOH 264 964  41  HOH HOH A . 
C 3 HOH 265 965  194 HOH HOH A . 
C 3 HOH 266 966  310 HOH HOH A . 
C 3 HOH 267 967  226 HOH HOH A . 
C 3 HOH 268 968  300 HOH HOH A . 
C 3 HOH 269 969  205 HOH HOH A . 
C 3 HOH 270 970  183 HOH HOH A . 
C 3 HOH 271 971  15  HOH HOH A . 
C 3 HOH 272 972  149 HOH HOH A . 
C 3 HOH 273 973  43  HOH HOH A . 
C 3 HOH 274 974  239 HOH HOH A . 
C 3 HOH 275 975  203 HOH HOH A . 
C 3 HOH 276 976  159 HOH HOH A . 
C 3 HOH 277 977  148 HOH HOH A . 
C 3 HOH 278 978  301 HOH HOH A . 
C 3 HOH 279 979  22  HOH HOH A . 
C 3 HOH 280 980  63  HOH HOH A . 
C 3 HOH 281 981  211 HOH HOH A . 
C 3 HOH 282 982  103 HOH HOH A . 
C 3 HOH 283 983  320 HOH HOH A . 
C 3 HOH 284 984  223 HOH HOH A . 
C 3 HOH 285 985  105 HOH HOH A . 
C 3 HOH 286 986  114 HOH HOH A . 
C 3 HOH 287 987  131 HOH HOH A . 
C 3 HOH 288 988  95  HOH HOH A . 
C 3 HOH 289 989  230 HOH HOH A . 
C 3 HOH 290 990  135 HOH HOH A . 
C 3 HOH 291 991  112 HOH HOH A . 
C 3 HOH 292 992  191 HOH HOH A . 
C 3 HOH 293 993  232 HOH HOH A . 
C 3 HOH 294 994  176 HOH HOH A . 
C 3 HOH 295 995  340 HOH HOH A . 
C 3 HOH 296 996  208 HOH HOH A . 
C 3 HOH 297 997  162 HOH HOH A . 
C 3 HOH 298 998  17  HOH HOH A . 
C 3 HOH 299 999  395 HOH HOH A . 
C 3 HOH 300 1000 283 HOH HOH A . 
C 3 HOH 301 1001 299 HOH HOH A . 
C 3 HOH 302 1002 308 HOH HOH A . 
C 3 HOH 303 1003 403 HOH HOH A . 
C 3 HOH 304 1004 64  HOH HOH A . 
C 3 HOH 305 1005 267 HOH HOH A . 
C 3 HOH 306 1006 321 HOH HOH A . 
C 3 HOH 307 1007 221 HOH HOH A . 
C 3 HOH 308 1008 218 HOH HOH A . 
C 3 HOH 309 1009 33  HOH HOH A . 
C 3 HOH 310 1010 139 HOH HOH A . 
C 3 HOH 311 1011 323 HOH HOH A . 
C 3 HOH 312 1012 71  HOH HOH A . 
C 3 HOH 313 1013 256 HOH HOH A . 
C 3 HOH 314 1014 13  HOH HOH A . 
C 3 HOH 315 1015 102 HOH HOH A . 
C 3 HOH 316 1016 94  HOH HOH A . 
C 3 HOH 317 1017 372 HOH HOH A . 
C 3 HOH 318 1018 138 HOH HOH A . 
C 3 HOH 319 1019 29  HOH HOH A . 
C 3 HOH 320 1020 274 HOH HOH A . 
C 3 HOH 321 1021 240 HOH HOH A . 
C 3 HOH 322 1022 382 HOH HOH A . 
C 3 HOH 323 1023 109 HOH HOH A . 
C 3 HOH 324 1024 314 HOH HOH A . 
C 3 HOH 325 1025 192 HOH HOH A . 
C 3 HOH 326 1026 173 HOH HOH A . 
C 3 HOH 327 1027 198 HOH HOH A . 
C 3 HOH 328 1028 144 HOH HOH A . 
C 3 HOH 329 1029 396 HOH HOH A . 
C 3 HOH 330 1030 332 HOH HOH A . 
C 3 HOH 331 1031 359 HOH HOH A . 
C 3 HOH 332 1032 384 HOH HOH A . 
C 3 HOH 333 1033 318 HOH HOH A . 
C 3 HOH 334 1034 336 HOH HOH A . 
C 3 HOH 335 1035 307 HOH HOH A . 
C 3 HOH 336 1036 367 HOH HOH A . 
C 3 HOH 337 1037 293 HOH HOH A . 
C 3 HOH 338 1038 356 HOH HOH A . 
C 3 HOH 339 1039 402 HOH HOH A . 
C 3 HOH 340 1040 233 HOH HOH A . 
C 3 HOH 341 1041 329 HOH HOH A . 
C 3 HOH 342 1042 343 HOH HOH A . 
C 3 HOH 343 1043 324 HOH HOH A . 
C 3 HOH 344 1044 161 HOH HOH A . 
C 3 HOH 345 1045 291 HOH HOH A . 
C 3 HOH 346 1046 273 HOH HOH A . 
C 3 HOH 347 1047 375 HOH HOH A . 
C 3 HOH 348 1048 383 HOH HOH A . 
C 3 HOH 349 1049 259 HOH HOH A . 
C 3 HOH 350 1050 345 HOH HOH A . 
C 3 HOH 351 1051 391 HOH HOH A . 
C 3 HOH 352 1052 187 HOH HOH A . 
C 3 HOH 353 1053 248 HOH HOH A . 
C 3 HOH 354 1054 312 HOH HOH A . 
C 3 HOH 355 1055 304 HOH HOH A . 
C 3 HOH 356 1056 249 HOH HOH A . 
C 3 HOH 357 1057 390 HOH HOH A . 
C 3 HOH 358 1058 335 HOH HOH A . 
C 3 HOH 359 1059 302 HOH HOH A . 
C 3 HOH 360 1060 376 HOH HOH A . 
C 3 HOH 361 1061 238 HOH HOH A . 
C 3 HOH 362 1062 322 HOH HOH A . 
C 3 HOH 363 1063 315 HOH HOH A . 
C 3 HOH 364 1064 116 HOH HOH A . 
C 3 HOH 365 1065 243 HOH HOH A . 
C 3 HOH 366 1066 360 HOH HOH A . 
C 3 HOH 367 1067 400 HOH HOH A . 
C 3 HOH 368 1068 285 HOH HOH A . 
C 3 HOH 369 1069 133 HOH HOH A . 
C 3 HOH 370 1070 92  HOH HOH A . 
C 3 HOH 371 1071 357 HOH HOH A . 
C 3 HOH 372 1072 393 HOH HOH A . 
C 3 HOH 373 1073 154 HOH HOH A . 
C 3 HOH 374 1074 401 HOH HOH A . 
C 3 HOH 375 1075 368 HOH HOH A . 
C 3 HOH 376 1076 297 HOH HOH A . 
C 3 HOH 377 1077 303 HOH HOH A . 
C 3 HOH 378 1078 295 HOH HOH A . 
C 3 HOH 379 1079 167 HOH HOH A . 
C 3 HOH 380 1080 387 HOH HOH A . 
C 3 HOH 381 1081 311 HOH HOH A . 
C 3 HOH 382 1082 200 HOH HOH A . 
C 3 HOH 383 1083 278 HOH HOH A . 
C 3 HOH 384 1084 185 HOH HOH A . 
C 3 HOH 385 1085 263 HOH HOH A . 
C 3 HOH 386 1086 319 HOH HOH A . 
C 3 HOH 387 1087 236 HOH HOH A . 
C 3 HOH 388 1088 338 HOH HOH A . 
C 3 HOH 389 1089 394 HOH HOH A . 
C 3 HOH 390 1090 262 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     745 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-15 
2 'Structure model' 1 1 2016-06-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? 1.9_1692 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A SER 349 ? B O A HOH 701 ? ? 2.09 
2  1 OE1 A GLU 534 ? B O A HOH 702 ? ? 2.12 
3  1 OG  A SER 542 ? B O A HOH 703 ? ? 2.14 
4  1 OH  A TYR 132 ? A O A HOH 704 ? ? 2.14 
5  1 NH2 A ARG 461 ? C O A HOH 705 ? ? 2.14 
6  1 O   A HOH 820 ? ? O A HOH 925 ? ? 2.15 
7  1 OE1 A GLU 36  ? A O A HOH 706 ? ? 2.17 
8  1 OE1 A GLU 31  ? A O A HOH 707 ? ? 2.17 
9  1 OE2 A GLU 370 ? A O A HOH 708 ? ? 2.17 
10 1 NZ  A LYS 485 ? B O A HOH 709 ? ? 2.17 
11 1 NH1 A ARG 26  ? B O A HOH 710 ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 73  ? A 78.43   -19.98  
2  1 LYS A 92  ? B -96.98  -153.19 
3  1 VAL A 182 ? A -117.91 65.20   
4  1 SER A 218 ? ? 56.25   -119.01 
5  1 TYR A 350 ? C -151.07 63.70   
6  1 CYS A 372 ? ? 59.77   15.61   
7  1 CYS A 372 ? ? 58.04   15.61   
8  1 HIS A 401 ? B -130.33 -37.26  
9  1 PHE A 421 ? A -136.20 -60.35  
10 1 PHE A 421 ? B -136.67 -59.48  
11 1 HIS A 435 ? ? -141.37 52.04   
12 1 HIS A 435 ? ? -140.63 52.04   
13 1 THR A 472 ? A 80.89   -2.73   
14 1 THR A 472 ? B 92.73   -26.60  
15 1 SER A 542 ? A -124.08 -141.63 
16 1 SER A 542 ? B -125.67 -142.46 
17 1 HIS A 566 ? B -146.87 55.29   
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 GLY A 352 ? ? 10.83 
2 1 GLY A 352 ? ? 11.82 
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     ALA 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      83 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     CB 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    A 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    ALA 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     90 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    CB 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -6 ? A MET 1  
2  1 Y 1 A HIS -5 ? A HIS 2  
3  1 Y 1 A HIS -4 ? A HIS 3  
4  1 Y 1 A HIS -3 ? A HIS 4  
5  1 Y 1 A HIS -2 ? A HIS 5  
6  1 Y 1 A HIS -1 ? A HIS 6  
7  1 Y 1 A HIS 0  ? A HIS 7  
8  1 Y 1 A MET 1  ? A MET 8  
9  1 Y 1 A ASN 2  ? A ASN 9  
10 1 Y 1 A PHE 3  ? A PHE 10 
11 1 Y 1 A ASN 4  ? A ASN 11 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'DIETHYL HYDROGEN PHOSPHATE' DPF 
3 water                        HOH 
#