data_5IVK
# 
_entry.id   5IVK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5IVK         
WWPDB D_1000219498 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 5IVH unspecified 
PDB . 5IVI unspecified 
PDB . 5IVD unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5IVK 
_pdbx_database_status.recvd_initial_deposition_date   2016-03-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Correy, G.J.'  1 
'Jackson, C.J.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            24 
_citation.language                  ? 
_citation.page_first                977 
_citation.page_last                 987 
_citation.title                     
;Mapping the Accessible Conformational Landscape of an Insect Carboxylesterase Using Conformational Ensemble Analysis and Kinetic Crystallography.
;
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2016.04.009 
_citation.pdbx_database_id_PubMed   27210287 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Correy, G.J.'  1 
primary 'Carr, P.D.'    2 
primary 'Meirelles, T.' 3 
primary 'Mabbitt, P.D.' 4 
primary 'Fraser, N.J.'  5 
primary 'Weik, M.'      6 
primary 'Jackson, C.J.' 7 
# 
_cell.entry_id           5IVK 
_cell.length_a           51.816 
_cell.length_b           101.254 
_cell.length_c           225.818 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5IVK 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Carboxylic ester hydrolase' 66432.844 1   3.1.1.- ? ? ? 
2 non-polymer man 'DIETHYL HYDROGEN PHOSPHATE' 154.102   1   ?       ? ? ? 
3 water       nat water                        18.015    399 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHMNFNVSLMEKLKWKIKCIENKFLNYRLTTNETVVAETEYGKVKGVKRLTVYDDSYYSFEGIPYAQPPVGELRF
KAPQRPTPWDGVRDCCNHKDKSVQVDFITGKVCGSEDCLYLSVYTNNLNPETKRPVLVYIHGGGFIIGENHRDMYGPDYF
IKKDVVLINIQYRLGALGFLSLNSEDLNVPGNAGLKDQVMALRWIKNNCANFGGNPDNITVFGESAGAASTHYMMLTEQT
RGLFHRGILMSGNAICPWANTQCQHRAFTLAKLAGYKGEDNDKDVLEFLMKAKPQDLIKLEEKVLTLEERTNKVMFPFGP
TVEPYQTADCVLPKHPREMVKTAWGNSIPTMMGNTSYEGLFFTSILKQMPLLVKELETCVNFVPSELADAERTAPETLEM
GAKIKKAHVTGETPTADNFMDLCSHFYFWFPMHRLLQLRFNHTSGTPVYLYRFDFDSEDLINPYRIMRSGRGVKGVSHTD
ELTYFFWNQLAKRMPKESREYKTIERMTGIWTQFATTGNPYSNEIEGMENVSWDPIEKSDEVYKCLNISDELKMIDVPEM
GKIKQWESMFEKHRDLF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHMNFNVSLMEKLKWKIKCIENKFLNYRLTTNETVVAETEYGKVKGVKRLTVYDDSYYSFEGIPYAQPPVGELRF
KAPQRPTPWDGVRDCCNHKDKSVQVDFITGKVCGSEDCLYLSVYTNNLNPETKRPVLVYIHGGGFIIGENHRDMYGPDYF
IKKDVVLINIQYRLGALGFLSLNSEDLNVPGNAGLKDQVMALRWIKNNCANFGGNPDNITVFGESAGAASTHYMMLTEQT
RGLFHRGILMSGNAICPWANTQCQHRAFTLAKLAGYKGEDNDKDVLEFLMKAKPQDLIKLEEKVLTLEERTNKVMFPFGP
TVEPYQTADCVLPKHPREMVKTAWGNSIPTMMGNTSYEGLFFTSILKQMPLLVKELETCVNFVPSELADAERTAPETLEM
GAKIKKAHVTGETPTADNFMDLCSHFYFWFPMHRLLQLRFNHTSGTPVYLYRFDFDSEDLINPYRIMRSGRGVKGVSHTD
ELTYFFWNQLAKRMPKESREYKTIERMTGIWTQFATTGNPYSNEIEGMENVSWDPIEKSDEVYKCLNISDELKMIDVPEM
GKIKQWESMFEKHRDLF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   MET n 
1 9   ASN n 
1 10  PHE n 
1 11  ASN n 
1 12  VAL n 
1 13  SER n 
1 14  LEU n 
1 15  MET n 
1 16  GLU n 
1 17  LYS n 
1 18  LEU n 
1 19  LYS n 
1 20  TRP n 
1 21  LYS n 
1 22  ILE n 
1 23  LYS n 
1 24  CYS n 
1 25  ILE n 
1 26  GLU n 
1 27  ASN n 
1 28  LYS n 
1 29  PHE n 
1 30  LEU n 
1 31  ASN n 
1 32  TYR n 
1 33  ARG n 
1 34  LEU n 
1 35  THR n 
1 36  THR n 
1 37  ASN n 
1 38  GLU n 
1 39  THR n 
1 40  VAL n 
1 41  VAL n 
1 42  ALA n 
1 43  GLU n 
1 44  THR n 
1 45  GLU n 
1 46  TYR n 
1 47  GLY n 
1 48  LYS n 
1 49  VAL n 
1 50  LYS n 
1 51  GLY n 
1 52  VAL n 
1 53  LYS n 
1 54  ARG n 
1 55  LEU n 
1 56  THR n 
1 57  VAL n 
1 58  TYR n 
1 59  ASP n 
1 60  ASP n 
1 61  SER n 
1 62  TYR n 
1 63  TYR n 
1 64  SER n 
1 65  PHE n 
1 66  GLU n 
1 67  GLY n 
1 68  ILE n 
1 69  PRO n 
1 70  TYR n 
1 71  ALA n 
1 72  GLN n 
1 73  PRO n 
1 74  PRO n 
1 75  VAL n 
1 76  GLY n 
1 77  GLU n 
1 78  LEU n 
1 79  ARG n 
1 80  PHE n 
1 81  LYS n 
1 82  ALA n 
1 83  PRO n 
1 84  GLN n 
1 85  ARG n 
1 86  PRO n 
1 87  THR n 
1 88  PRO n 
1 89  TRP n 
1 90  ASP n 
1 91  GLY n 
1 92  VAL n 
1 93  ARG n 
1 94  ASP n 
1 95  CYS n 
1 96  CYS n 
1 97  ASN n 
1 98  HIS n 
1 99  LYS n 
1 100 ASP n 
1 101 LYS n 
1 102 SER n 
1 103 VAL n 
1 104 GLN n 
1 105 VAL n 
1 106 ASP n 
1 107 PHE n 
1 108 ILE n 
1 109 THR n 
1 110 GLY n 
1 111 LYS n 
1 112 VAL n 
1 113 CYS n 
1 114 GLY n 
1 115 SER n 
1 116 GLU n 
1 117 ASP n 
1 118 CYS n 
1 119 LEU n 
1 120 TYR n 
1 121 LEU n 
1 122 SER n 
1 123 VAL n 
1 124 TYR n 
1 125 THR n 
1 126 ASN n 
1 127 ASN n 
1 128 LEU n 
1 129 ASN n 
1 130 PRO n 
1 131 GLU n 
1 132 THR n 
1 133 LYS n 
1 134 ARG n 
1 135 PRO n 
1 136 VAL n 
1 137 LEU n 
1 138 VAL n 
1 139 TYR n 
1 140 ILE n 
1 141 HIS n 
1 142 GLY n 
1 143 GLY n 
1 144 GLY n 
1 145 PHE n 
1 146 ILE n 
1 147 ILE n 
1 148 GLY n 
1 149 GLU n 
1 150 ASN n 
1 151 HIS n 
1 152 ARG n 
1 153 ASP n 
1 154 MET n 
1 155 TYR n 
1 156 GLY n 
1 157 PRO n 
1 158 ASP n 
1 159 TYR n 
1 160 PHE n 
1 161 ILE n 
1 162 LYS n 
1 163 LYS n 
1 164 ASP n 
1 165 VAL n 
1 166 VAL n 
1 167 LEU n 
1 168 ILE n 
1 169 ASN n 
1 170 ILE n 
1 171 GLN n 
1 172 TYR n 
1 173 ARG n 
1 174 LEU n 
1 175 GLY n 
1 176 ALA n 
1 177 LEU n 
1 178 GLY n 
1 179 PHE n 
1 180 LEU n 
1 181 SER n 
1 182 LEU n 
1 183 ASN n 
1 184 SER n 
1 185 GLU n 
1 186 ASP n 
1 187 LEU n 
1 188 ASN n 
1 189 VAL n 
1 190 PRO n 
1 191 GLY n 
1 192 ASN n 
1 193 ALA n 
1 194 GLY n 
1 195 LEU n 
1 196 LYS n 
1 197 ASP n 
1 198 GLN n 
1 199 VAL n 
1 200 MET n 
1 201 ALA n 
1 202 LEU n 
1 203 ARG n 
1 204 TRP n 
1 205 ILE n 
1 206 LYS n 
1 207 ASN n 
1 208 ASN n 
1 209 CYS n 
1 210 ALA n 
1 211 ASN n 
1 212 PHE n 
1 213 GLY n 
1 214 GLY n 
1 215 ASN n 
1 216 PRO n 
1 217 ASP n 
1 218 ASN n 
1 219 ILE n 
1 220 THR n 
1 221 VAL n 
1 222 PHE n 
1 223 GLY n 
1 224 GLU n 
1 225 SER n 
1 226 ALA n 
1 227 GLY n 
1 228 ALA n 
1 229 ALA n 
1 230 SER n 
1 231 THR n 
1 232 HIS n 
1 233 TYR n 
1 234 MET n 
1 235 MET n 
1 236 LEU n 
1 237 THR n 
1 238 GLU n 
1 239 GLN n 
1 240 THR n 
1 241 ARG n 
1 242 GLY n 
1 243 LEU n 
1 244 PHE n 
1 245 HIS n 
1 246 ARG n 
1 247 GLY n 
1 248 ILE n 
1 249 LEU n 
1 250 MET n 
1 251 SER n 
1 252 GLY n 
1 253 ASN n 
1 254 ALA n 
1 255 ILE n 
1 256 CYS n 
1 257 PRO n 
1 258 TRP n 
1 259 ALA n 
1 260 ASN n 
1 261 THR n 
1 262 GLN n 
1 263 CYS n 
1 264 GLN n 
1 265 HIS n 
1 266 ARG n 
1 267 ALA n 
1 268 PHE n 
1 269 THR n 
1 270 LEU n 
1 271 ALA n 
1 272 LYS n 
1 273 LEU n 
1 274 ALA n 
1 275 GLY n 
1 276 TYR n 
1 277 LYS n 
1 278 GLY n 
1 279 GLU n 
1 280 ASP n 
1 281 ASN n 
1 282 ASP n 
1 283 LYS n 
1 284 ASP n 
1 285 VAL n 
1 286 LEU n 
1 287 GLU n 
1 288 PHE n 
1 289 LEU n 
1 290 MET n 
1 291 LYS n 
1 292 ALA n 
1 293 LYS n 
1 294 PRO n 
1 295 GLN n 
1 296 ASP n 
1 297 LEU n 
1 298 ILE n 
1 299 LYS n 
1 300 LEU n 
1 301 GLU n 
1 302 GLU n 
1 303 LYS n 
1 304 VAL n 
1 305 LEU n 
1 306 THR n 
1 307 LEU n 
1 308 GLU n 
1 309 GLU n 
1 310 ARG n 
1 311 THR n 
1 312 ASN n 
1 313 LYS n 
1 314 VAL n 
1 315 MET n 
1 316 PHE n 
1 317 PRO n 
1 318 PHE n 
1 319 GLY n 
1 320 PRO n 
1 321 THR n 
1 322 VAL n 
1 323 GLU n 
1 324 PRO n 
1 325 TYR n 
1 326 GLN n 
1 327 THR n 
1 328 ALA n 
1 329 ASP n 
1 330 CYS n 
1 331 VAL n 
1 332 LEU n 
1 333 PRO n 
1 334 LYS n 
1 335 HIS n 
1 336 PRO n 
1 337 ARG n 
1 338 GLU n 
1 339 MET n 
1 340 VAL n 
1 341 LYS n 
1 342 THR n 
1 343 ALA n 
1 344 TRP n 
1 345 GLY n 
1 346 ASN n 
1 347 SER n 
1 348 ILE n 
1 349 PRO n 
1 350 THR n 
1 351 MET n 
1 352 MET n 
1 353 GLY n 
1 354 ASN n 
1 355 THR n 
1 356 SER n 
1 357 TYR n 
1 358 GLU n 
1 359 GLY n 
1 360 LEU n 
1 361 PHE n 
1 362 PHE n 
1 363 THR n 
1 364 SER n 
1 365 ILE n 
1 366 LEU n 
1 367 LYS n 
1 368 GLN n 
1 369 MET n 
1 370 PRO n 
1 371 LEU n 
1 372 LEU n 
1 373 VAL n 
1 374 LYS n 
1 375 GLU n 
1 376 LEU n 
1 377 GLU n 
1 378 THR n 
1 379 CYS n 
1 380 VAL n 
1 381 ASN n 
1 382 PHE n 
1 383 VAL n 
1 384 PRO n 
1 385 SER n 
1 386 GLU n 
1 387 LEU n 
1 388 ALA n 
1 389 ASP n 
1 390 ALA n 
1 391 GLU n 
1 392 ARG n 
1 393 THR n 
1 394 ALA n 
1 395 PRO n 
1 396 GLU n 
1 397 THR n 
1 398 LEU n 
1 399 GLU n 
1 400 MET n 
1 401 GLY n 
1 402 ALA n 
1 403 LYS n 
1 404 ILE n 
1 405 LYS n 
1 406 LYS n 
1 407 ALA n 
1 408 HIS n 
1 409 VAL n 
1 410 THR n 
1 411 GLY n 
1 412 GLU n 
1 413 THR n 
1 414 PRO n 
1 415 THR n 
1 416 ALA n 
1 417 ASP n 
1 418 ASN n 
1 419 PHE n 
1 420 MET n 
1 421 ASP n 
1 422 LEU n 
1 423 CYS n 
1 424 SER n 
1 425 HIS n 
1 426 PHE n 
1 427 TYR n 
1 428 PHE n 
1 429 TRP n 
1 430 PHE n 
1 431 PRO n 
1 432 MET n 
1 433 HIS n 
1 434 ARG n 
1 435 LEU n 
1 436 LEU n 
1 437 GLN n 
1 438 LEU n 
1 439 ARG n 
1 440 PHE n 
1 441 ASN n 
1 442 HIS n 
1 443 THR n 
1 444 SER n 
1 445 GLY n 
1 446 THR n 
1 447 PRO n 
1 448 VAL n 
1 449 TYR n 
1 450 LEU n 
1 451 TYR n 
1 452 ARG n 
1 453 PHE n 
1 454 ASP n 
1 455 PHE n 
1 456 ASP n 
1 457 SER n 
1 458 GLU n 
1 459 ASP n 
1 460 LEU n 
1 461 ILE n 
1 462 ASN n 
1 463 PRO n 
1 464 TYR n 
1 465 ARG n 
1 466 ILE n 
1 467 MET n 
1 468 ARG n 
1 469 SER n 
1 470 GLY n 
1 471 ARG n 
1 472 GLY n 
1 473 VAL n 
1 474 LYS n 
1 475 GLY n 
1 476 VAL n 
1 477 SER n 
1 478 HIS n 
1 479 THR n 
1 480 ASP n 
1 481 GLU n 
1 482 LEU n 
1 483 THR n 
1 484 TYR n 
1 485 PHE n 
1 486 PHE n 
1 487 TRP n 
1 488 ASN n 
1 489 GLN n 
1 490 LEU n 
1 491 ALA n 
1 492 LYS n 
1 493 ARG n 
1 494 MET n 
1 495 PRO n 
1 496 LYS n 
1 497 GLU n 
1 498 SER n 
1 499 ARG n 
1 500 GLU n 
1 501 TYR n 
1 502 LYS n 
1 503 THR n 
1 504 ILE n 
1 505 GLU n 
1 506 ARG n 
1 507 MET n 
1 508 THR n 
1 509 GLY n 
1 510 ILE n 
1 511 TRP n 
1 512 THR n 
1 513 GLN n 
1 514 PHE n 
1 515 ALA n 
1 516 THR n 
1 517 THR n 
1 518 GLY n 
1 519 ASN n 
1 520 PRO n 
1 521 TYR n 
1 522 SER n 
1 523 ASN n 
1 524 GLU n 
1 525 ILE n 
1 526 GLU n 
1 527 GLY n 
1 528 MET n 
1 529 GLU n 
1 530 ASN n 
1 531 VAL n 
1 532 SER n 
1 533 TRP n 
1 534 ASP n 
1 535 PRO n 
1 536 ILE n 
1 537 GLU n 
1 538 LYS n 
1 539 SER n 
1 540 ASP n 
1 541 GLU n 
1 542 VAL n 
1 543 TYR n 
1 544 LYS n 
1 545 CYS n 
1 546 LEU n 
1 547 ASN n 
1 548 ILE n 
1 549 SER n 
1 550 ASP n 
1 551 GLU n 
1 552 LEU n 
1 553 LYS n 
1 554 MET n 
1 555 ILE n 
1 556 ASP n 
1 557 VAL n 
1 558 PRO n 
1 559 GLU n 
1 560 MET n 
1 561 GLY n 
1 562 LYS n 
1 563 ILE n 
1 564 LYS n 
1 565 GLN n 
1 566 TRP n 
1 567 GLU n 
1 568 SER n 
1 569 MET n 
1 570 PHE n 
1 571 GLU n 
1 572 LYS n 
1 573 HIS n 
1 574 ARG n 
1 575 ASP n 
1 576 LEU n 
1 577 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   577 
_entity_src_gen.gene_src_common_name               'Green bottle fly' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 LcaE7 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Lucilia cuprina' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7375 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q25252_LUCCU 
_struct_ref.pdbx_db_accession          Q25252 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNFNVSLMEKLKWKIKCIENKFLNYRLTTNETVVAETEYGKVKGVKRLTVYDDSYYSFEGIPYAQPPVGELRFKAPQRPT
PWDGVRDCCNHKDKSVQVDFITGKVCGSEDCLYLSVYTNNLNPETKRPVLVYIHGGGFIIGENHRDMYGPDYFIKKDVVL
INIQYRLGALGFLSLNSEDLNVPGNAGLKDQVMALRWIKNNCANFGGNPDNITVFGESAGAASTHYMMLTEQTRGLFHRG
ILMSGNAICPWANTQCQHRAFTLAKLAGYKGEDNDKDVLEFLMKAKPQDLIKLEEKVLTLEERTNKVMFPFGPTVEPYQT
ADCVLPKHPREMVKTAWGNSIPTMMGNTSYEGLFFTSILKQMPMLVKELETCVNFVPSELADAERTAPETLEMGAKIKKA
HVTGETPTADNFMDLCSHIYFWFPMHRLLQLRFNHTSGTPVYLYRFDFDSEDLINPYRIMRSGRGVKGVSHADELTYFFW
NQLAKRMPKESREYKTIERMTGIWIQFATTGNPYSNEIEGMENVSWDPIKKSDEVYKCLNISDELKMIDVPEMDKIKQWE
SMFEKHRDLF
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5IVK 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 577 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q25252 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  570 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       570 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5IVK MET A 1   ? UNP Q25252 ?   ?   'initiating methionine' -6  1  
1 5IVK HIS A 2   ? UNP Q25252 ?   ?   'expression tag'        -5  2  
1 5IVK HIS A 3   ? UNP Q25252 ?   ?   'expression tag'        -4  3  
1 5IVK HIS A 4   ? UNP Q25252 ?   ?   'expression tag'        -3  4  
1 5IVK HIS A 5   ? UNP Q25252 ?   ?   'expression tag'        -2  5  
1 5IVK HIS A 6   ? UNP Q25252 ?   ?   'expression tag'        -1  6  
1 5IVK HIS A 7   ? UNP Q25252 ?   ?   'expression tag'        0   7  
1 5IVK LEU A 371 ? UNP Q25252 MET 364 conflict                364 8  
1 5IVK PHE A 426 ? UNP Q25252 ILE 419 conflict                419 9  
1 5IVK THR A 479 ? UNP Q25252 ALA 472 conflict                472 10 
1 5IVK THR A 512 ? UNP Q25252 ILE 505 conflict                505 11 
1 5IVK GLU A 537 ? UNP Q25252 LYS 530 conflict                530 12 
1 5IVK GLY A 561 ? UNP Q25252 ASP 554 conflict                554 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'   121.158 
DPF non-polymer         . 'DIETHYL HYDROGEN PHOSPHATE' ? 'C4 H11 O4 P'    154.102 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                        ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5IVK 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.26 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.62 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100mM sodium acetate pH 4.5, PEG 2K MME' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2010-05-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8266 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.8266 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5IVK 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             42.000 
_reflns.d_resolution_high            1.530 
_reflns.number_obs                   89882 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.6000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              12.70 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.53 
_reflns_shell.d_res_low              1.56 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           1.79000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.400 
_reflns_shell.pdbx_redundancy        12.00 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5IVK 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     89888 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             42.01 
_refine.ls_d_res_high                            1.53 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.183 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.181 
_refine.ls_R_factor_R_free                       0.220 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.010 
_refine.ls_number_reflns_R_free                  4499 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.150 
_refine.pdbx_overall_phase_error                 21.810 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4557 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             399 
_refine_hist.number_atoms_total               4964 
_refine_hist.d_res_high                       1.53 
_refine_hist.d_res_low                        42.01 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.013  ? ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          1.332  ? ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.880 ? ? ? 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.061  ? ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      0.009  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.5300 1.5474  2821 0.2918 100.00 0.3189 . . 137 . . 
'X-RAY DIFFRACTION' . 1.5474 1.5656  2819 0.2831 100.00 0.3088 . . 139 . . 
'X-RAY DIFFRACTION' . 1.5656 1.5847  2823 0.2685 100.00 0.3117 . . 137 . . 
'X-RAY DIFFRACTION' . 1.5847 1.6048  2799 0.2507 100.00 0.2957 . . 154 . . 
'X-RAY DIFFRACTION' . 1.6048 1.6259  2864 0.2422 100.00 0.3134 . . 152 . . 
'X-RAY DIFFRACTION' . 1.6259 1.6481  2764 0.2304 100.00 0.2842 . . 150 . . 
'X-RAY DIFFRACTION' . 1.6481 1.6717  2852 0.2251 100.00 0.2876 . . 156 . . 
'X-RAY DIFFRACTION' . 1.6717 1.6966  2749 0.2235 100.00 0.2942 . . 162 . . 
'X-RAY DIFFRACTION' . 1.6966 1.7232  2887 0.2141 100.00 0.2649 . . 159 . . 
'X-RAY DIFFRACTION' . 1.7232 1.7514  2759 0.2008 100.00 0.2641 . . 154 . . 
'X-RAY DIFFRACTION' . 1.7514 1.7816  2856 0.1934 100.00 0.2540 . . 160 . . 
'X-RAY DIFFRACTION' . 1.7816 1.8140  2764 0.1961 100.00 0.2487 . . 167 . . 
'X-RAY DIFFRACTION' . 1.8140 1.8489  2848 0.1893 100.00 0.2483 . . 156 . . 
'X-RAY DIFFRACTION' . 1.8489 1.8866  2800 0.1984 100.00 0.2308 . . 149 . . 
'X-RAY DIFFRACTION' . 1.8866 1.9277  2825 0.1988 100.00 0.2849 . . 134 . . 
'X-RAY DIFFRACTION' . 1.9277 1.9725  2875 0.1904 100.00 0.2043 . . 144 . . 
'X-RAY DIFFRACTION' . 1.9725 2.0218  2801 0.1862 100.00 0.2440 . . 178 . . 
'X-RAY DIFFRACTION' . 2.0218 2.0765  2818 0.1803 100.00 0.2401 . . 146 . . 
'X-RAY DIFFRACTION' . 2.0765 2.1376  2854 0.1835 100.00 0.2173 . . 138 . . 
'X-RAY DIFFRACTION' . 2.1376 2.2066  2866 0.1788 100.00 0.2326 . . 130 . . 
'X-RAY DIFFRACTION' . 2.2066 2.2854  2845 0.1824 100.00 0.2397 . . 146 . . 
'X-RAY DIFFRACTION' . 2.2854 2.3769  2884 0.1826 100.00 0.2080 . . 143 . . 
'X-RAY DIFFRACTION' . 2.3769 2.4851  2846 0.1774 100.00 0.2620 . . 148 . . 
'X-RAY DIFFRACTION' . 2.4851 2.6161  2841 0.1755 100.00 0.2036 . . 159 . . 
'X-RAY DIFFRACTION' . 2.6161 2.7800  2856 0.1695 100.00 0.1938 . . 144 . . 
'X-RAY DIFFRACTION' . 2.7800 2.9946  2908 0.1738 100.00 0.2148 . . 144 . . 
'X-RAY DIFFRACTION' . 2.9946 3.2958  2877 0.1782 100.00 0.2278 . . 148 . . 
'X-RAY DIFFRACTION' . 3.2958 3.7725  2921 0.1689 100.00 0.1908 . . 137 . . 
'X-RAY DIFFRACTION' . 3.7725 4.7519  2938 0.1483 100.00 0.1596 . . 154 . . 
'X-RAY DIFFRACTION' . 4.7519 42.0250 3029 0.1507 100.00 0.1742 . . 174 . . 
# 
_struct.entry_id                     5IVK 
_struct.title                        
'The alpha-esterase-7 carboxylesterase, E3, from the blowfly Lucilia cuprina: phosphorylated-enzyme ensemble refinement' 
_struct.pdbx_descriptor              'Carboxylic ester hydrolase (E.C.3.1.1.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5IVK 
_struct_keywords.text            'carboxylesterase, organophosphate, protein dynamics, acetylcholinesterase, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 13  ? LEU A 34  ? SER A 6   LEU A 27  1 ? 22 
HELX_P HELX_P2  AA2 VAL A 75  ? ARG A 79  ? VAL A 68  ARG A 72  5 ? 5  
HELX_P HELX_P3  AA3 TYR A 159 ? LYS A 163 ? TYR A 152 LYS A 156 5 ? 5  
HELX_P HELX_P4  AA4 LEU A 174 ? LEU A 180 ? LEU A 167 LEU A 173 1 ? 7  
HELX_P HELX_P5  AA5 SER A 184 ? ASN A 188 ? SER A 177 ASN A 181 5 ? 5  
HELX_P HELX_P6  AA6 ASN A 192 ? CYS A 209 ? ASN A 185 CYS A 202 1 ? 18 
HELX_P HELX_P7  AA7 ALA A 210 ? PHE A 212 ? ALA A 203 PHE A 205 5 ? 3  
HELX_P HELX_P8  AA8 SER A 225 ? THR A 237 ? SER A 218 THR A 230 1 ? 13 
HELX_P HELX_P9  AA9 GLU A 238 ? ARG A 241 ? GLU A 231 ARG A 234 5 ? 4  
HELX_P HELX_P10 AB1 CYS A 256 ? ASN A 260 ? CYS A 249 ASN A 253 5 ? 5  
HELX_P HELX_P11 AB2 HIS A 265 ? ALA A 274 ? HIS A 258 ALA A 267 1 ? 10 
HELX_P HELX_P12 AB3 ASN A 281 ? ALA A 292 ? ASN A 274 ALA A 285 1 ? 12 
HELX_P HELX_P13 AB4 LYS A 293 ? LEU A 300 ? LYS A 286 LEU A 293 1 ? 8  
HELX_P HELX_P14 AB5 GLU A 301 ? VAL A 304 ? GLU A 294 VAL A 297 5 ? 4  
HELX_P HELX_P15 AB6 THR A 306 ? ASN A 312 ? THR A 299 ASN A 305 1 ? 7  
HELX_P HELX_P16 AB7 HIS A 335 ? ALA A 343 ? HIS A 328 ALA A 336 1 ? 9  
HELX_P HELX_P17 AB8 TRP A 344 ? ILE A 348 ? TRP A 337 ILE A 341 5 ? 5  
HELX_P HELX_P18 AB9 TYR A 357 ? THR A 363 ? TYR A 350 THR A 356 5 ? 7  
HELX_P HELX_P19 AC1 SER A 364 ? MET A 369 ? SER A 357 MET A 362 1 ? 6  
HELX_P HELX_P20 AC2 PRO A 370 ? THR A 378 ? PRO A 363 THR A 371 5 ? 9  
HELX_P HELX_P21 AC3 CYS A 379 ? VAL A 383 ? CYS A 372 VAL A 376 5 ? 5  
HELX_P HELX_P22 AC4 PRO A 384 ? ALA A 388 ? PRO A 377 ALA A 381 5 ? 5  
HELX_P HELX_P23 AC5 ALA A 394 ? VAL A 409 ? ALA A 387 VAL A 402 1 ? 16 
HELX_P HELX_P24 AC6 THR A 415 ? PHE A 428 ? THR A 408 PHE A 421 1 ? 14 
HELX_P HELX_P25 AC7 PHE A 428 ? PHE A 440 ? PHE A 421 PHE A 433 1 ? 13 
HELX_P HELX_P26 AC8 PRO A 463 ? ARG A 468 ? PRO A 456 ARG A 461 1 ? 6  
HELX_P HELX_P27 AC9 THR A 479 ? PHE A 485 ? THR A 472 PHE A 478 5 ? 7  
HELX_P HELX_P28 AD1 SER A 498 ? GLY A 518 ? SER A 491 GLY A 511 1 ? 21 
HELX_P HELX_P29 AD2 GLU A 559 ? SER A 568 ? GLU A 552 SER A 561 1 ? 10 
HELX_P HELX_P30 AD3 MET A 569 ? GLU A 571 ? MET A 562 GLU A 564 5 ? 3  
HELX_P HELX_P31 AD4 HIS A 573 ? PHE A 577 ? HIS A 566 PHE A 570 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        none 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           SER 
_struct_conn.ptnr1_label_seq_id            225 
_struct_conn.ptnr1_label_atom_id           OG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           DPF 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           P1 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            SER 
_struct_conn.ptnr1_auth_seq_id             218 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            DPF 
_struct_conn.ptnr2_auth_seq_id             601 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.634 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 12 ? 
AA3 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? anti-parallel 
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? parallel      
AA2 11 12 ? anti-parallel 
AA3 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  THR A 35  ? THR A 44  ? THR A 28  THR A 37  
AA1 2  GLY A 47  ? LEU A 55  ? GLY A 40  LEU A 48  
AA1 3  VAL A 92  ? ASP A 94  ? VAL A 85  ASP A 87  
AA2 1  THR A 35  ? THR A 44  ? THR A 28  THR A 37  
AA2 2  GLY A 47  ? LEU A 55  ? GLY A 40  LEU A 48  
AA2 3  SER A 61  ? PRO A 69  ? SER A 54  PRO A 62  
AA2 4  TYR A 120 ? THR A 125 ? TYR A 113 THR A 118 
AA2 5  VAL A 166 ? ILE A 170 ? VAL A 159 ILE A 163 
AA2 6  ARG A 134 ? ILE A 140 ? ARG A 127 ILE A 133 
AA2 7  GLY A 214 ? GLU A 224 ? GLY A 207 GLU A 217 
AA2 8  ARG A 246 ? MET A 250 ? ARG A 239 MET A 243 
AA2 9  THR A 350 ? THR A 355 ? THR A 343 THR A 348 
AA2 10 VAL A 448 ? PHE A 453 ? VAL A 441 PHE A 446 
AA2 11 LYS A 544 ? ILE A 548 ? LYS A 537 ILE A 541 
AA2 12 LEU A 552 ? ASP A 556 ? LEU A 545 ASP A 549 
AA3 1  GLN A 104 ? VAL A 105 ? GLN A 97  VAL A 98  
AA3 2  VAL A 112 ? CYS A 113 ? VAL A 105 CYS A 106 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 40  ? N VAL A 33  O GLY A 51  ? O GLY A 44  
AA1 2  3  N LYS A 48  ? N LYS A 41  O ARG A 93  ? O ARG A 86  
AA2 1  2  N VAL A 40  ? N VAL A 33  O GLY A 51  ? O GLY A 44  
AA2 2  3  N ARG A 54  ? N ARG A 47  O TYR A 62  ? O TYR A 55  
AA2 3  4  N TYR A 63  ? N TYR A 56  O THR A 125 ? O THR A 118 
AA2 4  5  N TYR A 124 ? N TYR A 117 O LEU A 167 ? O LEU A 160 
AA2 5  6  O VAL A 166 ? O VAL A 159 N LEU A 137 ? N LEU A 130 
AA2 6  7  N VAL A 136 ? N VAL A 129 O THR A 220 ? O THR A 213 
AA2 7  8  N GLY A 223 ? N GLY A 216 O MET A 250 ? O MET A 243 
AA2 8  9  N LEU A 249 ? N LEU A 242 O MET A 351 ? O MET A 344 
AA2 9  10 N ASN A 354 ? N ASN A 347 O PHE A 453 ? O PHE A 446 
AA2 10 11 N ARG A 452 ? N ARG A 445 O ILE A 548 ? O ILE A 541 
AA2 11 12 N CYS A 545 ? N CYS A 538 O ILE A 555 ? O ILE A 548 
AA3 1  2  N GLN A 104 ? N GLN A 97  O CYS A 113 ? O CYS A 106 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    DPF 
_struct_site.pdbx_auth_seq_id     601 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'binding site for residue DPF A 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 GLY A 143 ? GLY A 136 . ? 1_555 ? 
2 AC1 6 GLY A 144 ? GLY A 137 . ? 1_555 ? 
3 AC1 6 SER A 225 ? SER A 218 . ? 1_555 ? 
4 AC1 6 ALA A 226 ? ALA A 219 . ? 1_555 ? 
5 AC1 6 TYR A 464 ? TYR A 457 . ? 1_555 ? 
6 AC1 6 HIS A 478 ? HIS A 471 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5IVK 
_atom_sites.fract_transf_matrix[1][1]   0.019299 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009876 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004428 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N N    . VAL A 1 12  ? 2.595   -2.324  -28.062 0.02 19.91 ?  5    VAL A N    1  
ATOM   2      C CA   . VAL A 1 12  ? 2.219   -1.717  -29.336 0.02 20.03 ?  5    VAL A CA   1  
ATOM   3      C C    . VAL A 1 12  ? 1.060   -2.518  -29.957 0.02 20.51 ?  5    VAL A C    1  
ATOM   4      O O    . VAL A 1 12  ? 1.055   -3.750  -29.969 0.02 20.70 ?  5    VAL A O    1  
ATOM   5      C CB   . VAL A 1 12  ? 3.466   -1.631  -30.283 0.02 19.78 ?  5    VAL A CB   1  
ATOM   6      C CG1  . VAL A 1 12  ? 3.081   -1.423  -31.725 0.02 20.00 ?  5    VAL A CG1  1  
ATOM   7      C CG2  . VAL A 1 12  ? 4.394   -0.484  -29.840 0.02 19.36 ?  5    VAL A CG2  1  
ATOM   8      H HA   . VAL A 1 12  ? 1.926   -0.818  -29.177 0.02 19.98 ?  5    VAL A HA   1  
ATOM   9      H HB   . VAL A 1 12  ? 3.966   -2.459  -30.226 0.02 19.77 ?  5    VAL A HB   1  
ATOM   10     H HG11 . VAL A 1 12  ? 3.893   -1.426  -32.255 0.02 19.84 ?  5    VAL A HG11 1  
ATOM   11     H HG12 . VAL A 1 12  ? 2.497   -2.135  -32.028 0.02 20.27 ?  5    VAL A HG12 1  
ATOM   12     H HG13 . VAL A 1 12  ? 2.643   -0.564  -31.801 0.02 20.03 ?  5    VAL A HG13 1  
ATOM   13     H HG21 . VAL A 1 12  ? 5.303   -0.706  -30.095 0.02 19.20 ?  5    VAL A HG21 1  
ATOM   14     H HG22 . VAL A 1 12  ? 4.119   0.339   -30.275 0.02 19.37 ?  5    VAL A HG22 1  
ATOM   15     H HG23 . VAL A 1 12  ? 4.339   -0.382  -28.876 0.02 19.29 ?  5    VAL A HG23 1  
ATOM   16     N N    . SER A 1 13  ? 0.060   -1.818  -30.462 0.02 20.74 ?  6    SER A N    1  
ATOM   17     C CA   . SER A 1 13  ? -1.092  -2.502  -31.012 0.02 21.24 ?  6    SER A CA   1  
ATOM   18     C C    . SER A 1 13  ? -0.647  -3.505  -32.071 0.02 21.38 ?  6    SER A C    1  
ATOM   19     O O    . SER A 1 13  ? 0.390   -3.336  -32.731 0.02 21.13 ?  6    SER A O    1  
ATOM   20     C CB   . SER A 1 13  ? -2.059  -1.501  -31.620 0.02 21.45 ?  6    SER A CB   1  
ATOM   21     O OG   . SER A 1 13  ? -1.484  -0.878  -32.766 0.02 21.33 ?  6    SER A OG   1  
ATOM   22     H H    . SER A 1 13  ? 0.030   -0.960  -30.506 0.02 20.63 ?  6    SER A H    1  
ATOM   23     H HA   . SER A 1 13  ? -1.547  -2.974  -30.303 0.02 21.38 ?  6    SER A HA   1  
ATOM   24     H HB2  . SER A 1 13  ? -2.863  -1.972  -31.887 0.02 21.80 ?  6    SER A HB2  1  
ATOM   25     H HB3  . SER A 1 13  ? -2.278  -0.826  -30.960 0.02 21.35 ?  6    SER A HB3  1  
ATOM   26     H HG   . SER A 1 13  ? -0.648  -0.918  -32.726 0.02 21.05 ?  6    SER A HG   1  
ATOM   27     N N    . LEU A 1 14  ? -1.428  -4.576  -32.214 0.02 21.82 ?  7    LEU A N    1  
ATOM   28     C CA   . LEU A 1 14  ? -1.169  -5.529  -33.288 0.02 22.05 ?  7    LEU A CA   1  
ATOM   29     C C    . LEU A 1 14  ? -1.038  -4.823  -34.633 0.02 22.03 ?  7    LEU A C    1  
ATOM   30     O O    . LEU A 1 14  ? -0.208  -5.208  -35.465 0.02 21.95 ?  7    LEU A O    1  
ATOM   31     C CB   . LEU A 1 14  ? -2.274  -6.589  -33.352 0.02 22.62 ?  7    LEU A CB   1  
ATOM   32     C CG   . LEU A 1 14  ? -2.151  -7.530  -34.555 0.02 22.92 ?  7    LEU A CG   1  
ATOM   33     C CD1  . LEU A 1 14  ? -0.881  -8.360  -34.426 0.02 22.69 ?  7    LEU A CD1  1  
ATOM   34     C CD2  . LEU A 1 14  ? -3.344  -8.428  -34.673 0.02 23.54 ?  7    LEU A CD2  1  
ATOM   35     H H    . LEU A 1 14  ? -2.099  -4.771  -31.712 0.02 22.01 ?  7    LEU A H    1  
ATOM   36     H HA   . LEU A 1 14  ? -0.330  -5.977  -33.103 0.02 21.86 ?  7    LEU A HA   1  
ATOM   37     H HB2  . LEU A 1 14  ? -2.235  -7.133  -32.551 0.02 22.64 ?  7    LEU A HB2  1  
ATOM   38     H HB3  . LEU A 1 14  ? -3.138  -6.152  -33.407 0.02 22.82 ?  7    LEU A HB3  1  
ATOM   39     H HG   . LEU A 1 14  ? -2.092  -7.016  -35.373 0.02 22.90 ?  7    LEU A HG   1  
ATOM   40     H HD11 . LEU A 1 14  ? -0.109  -7.777  -34.499 0.02 22.31 ?  7    LEU A HD11 1  
ATOM   41     H HD12 . LEU A 1 14  ? -0.876  -8.801  -33.562 0.02 22.76 ?  7    LEU A HD12 1  
ATOM   42     H HD13 . LEU A 1 14  ? -0.865  -9.021  -35.139 0.02 22.87 ?  7    LEU A HD13 1  
ATOM   43     H HD21 . LEU A 1 14  ? -3.350  -8.828  -35.557 0.02 23.73 ?  7    LEU A HD21 1  
ATOM   44     H HD22 . LEU A 1 14  ? -3.284  -9.121  -33.997 0.02 23.59 ?  7    LEU A HD22 1  
ATOM   45     H HD23 . LEU A 1 14  ? -4.150  -7.903  -34.545 0.02 23.70 ?  7    LEU A HD23 1  
ATOM   46     N N    . MET A 1 15  ? -1.848  -3.797  -34.877 0.02 22.14 ?  8    MET A N    1  
ATOM   47     C CA   . MET A 1 15  ? -1.779  -3.126  -36.169 0.02 22.20 ?  8    MET A CA   1  
ATOM   48     C C    . MET A 1 15  ? -0.431  -2.452  -36.351 0.02 21.72 ?  8    MET A C    1  
ATOM   49     O O    . MET A 1 15  ? 0.174   -2.530  -37.426 0.02 21.73 ?  8    MET A O    1  
ATOM   50     C CB   . MET A 1 15  ? -2.898  -2.107  -36.287 0.02 22.42 ?  8    MET A CB   1  
ATOM   51     C CG   . MET A 1 15  ? -4.265  -2.728  -36.387 0.02 22.99 ?  8    MET A CG   1  
ATOM   52     S SD   . MET A 1 15  ? -4.361  -3.739  -37.857 0.02 23.41 ?  8    MET A SD   1  
ATOM   53     C CE   . MET A 1 15  ? -4.136  -2.443  -39.056 0.02 23.30 ?  8    MET A CE   1  
ATOM   54     H H    . MET A 1 15  ? -2.426  -3.473  -34.332 0.02 22.20 ?  8    MET A H    1  
ATOM   55     H HA   . MET A 1 15  ? -1.887  -3.787  -36.868 0.02 22.46 ?  8    MET A HA   1  
ATOM   56     H HB2  . MET A 1 15  ? -2.893  -1.556  -35.490 0.02 22.23 ?  8    MET A HB2  1  
ATOM   57     H HB3  . MET A 1 15  ? -2.742  -1.553  -37.064 0.02 22.39 ?  8    MET A HB3  1  
ATOM   58     H HG2  . MET A 1 15  ? -4.424  -3.291  -35.618 0.02 23.03 ?  8    MET A HG2  1  
ATOM   59     H HG3  . MET A 1 15  ? -4.931  -2.027  -36.440 0.02 23.13 ?  8    MET A HG3  1  
ATOM   60     H HE1  . MET A 1 15  ? -4.533  -1.624  -38.715 0.02 23.32 ?  8    MET A HE1  1  
ATOM   61     H HE2  . MET A 1 15  ? -3.184  -2.311  -39.193 0.02 22.95 ?  8    MET A HE2  1  
ATOM   62     H HE3  . MET A 1 15  ? -4.560  -2.699  -39.894 0.02 23.61 ?  8    MET A HE3  1  
ATOM   63     N N    . GLU A 1 16  ? 0.061   -1.800  -35.305 0.02 21.31 ?  9    GLU A N    1  
ATOM   64     C CA   . GLU A 1 16  ? 1.328   -1.101  -35.426 0.02 20.87 ?  9    GLU A CA   1  
ATOM   65     C C    . GLU A 1 16  ? 2.498   -2.076  -35.399 0.02 20.72 ?  9    GLU A C    1  
ATOM   66     O O    . GLU A 1 16  ? 3.614   -1.710  -35.777 0.02 20.49 ?  9    GLU A O    1  
ATOM   67     C CB   . GLU A 1 16  ? 1.436   -0.032  -34.333 0.02 20.52 ?  9    GLU A CB   1  
ATOM   68     C CG   . GLU A 1 16  ? 0.305   1.004   -34.353 0.02 20.67 ?  9    GLU A CG   1  
ATOM   69     C CD   . GLU A 1 16  ? 0.787   2.359   -34.785 0.02 20.46 ?  9    GLU A CD   1  
ATOM   70     O OE1  . GLU A 1 16  ? 0.103   3.028   -35.573 0.02 20.71 ?  9    GLU A OE1  1  
ATOM   71     O OE2  . GLU A 1 16  ? 1.875   2.763   -34.341 0.02 20.07 -1 9    GLU A OE2  1  
ATOM   72     H H    . GLU A 1 16  ? -0.308  -1.745  -34.533 0.02 21.30 ?  9    GLU A H    1  
ATOM   73     H HA   . GLU A 1 16  ? 1.344   -0.645  -36.282 0.02 20.91 ?  9    GLU A HA   1  
ATOM   74     H HB2  . GLU A 1 16  ? 1.405   -0.468  -33.472 0.02 20.48 ?  9    GLU A HB2  1  
ATOM   75     H HB3  . GLU A 1 16  ? 2.272   0.447   -34.442 0.02 20.26 ?  9    GLU A HB3  1  
ATOM   76     H HG2  . GLU A 1 16  ? -0.389  0.714   -34.963 0.02 20.99 ?  9    GLU A HG2  1  
ATOM   77     H HG3  . GLU A 1 16  ? -0.059  1.091   -33.456 0.02 20.60 ?  9    GLU A HG3  1  
ATOM   78     N N    . LYS A 1 17  ? 2.268   -3.339  -35.060 0.02 20.88 ?  10   LYS A N    1  
ATOM   79     C CA   . LYS A 1 17  ? 3.363   -4.296  -35.169 0.02 20.78 ?  10   LYS A CA   1  
ATOM   80     C C    . LYS A 1 17  ? 3.432   -4.898  -36.563 0.02 21.04 ?  10   LYS A C    1  
ATOM   81     O O    . LYS A 1 17  ? 4.523   -5.188  -37.059 0.02 20.87 ?  10   LYS A O    1  
ATOM   82     C CB   . LYS A 1 17  ? 3.230   -5.409  -34.154 0.02 20.91 ?  10   LYS A CB   1  
ATOM   83     C CG   . LYS A 1 17  ? 3.202   -5.028  -32.710 0.02 20.71 ?  10   LYS A CG   1  
ATOM   84     C CD   . LYS A 1 17  ? 2.828   -6.274  -31.906 0.02 20.91 ?  10   LYS A CD   1  
ATOM   85     C CE   . LYS A 1 17  ? 3.676   -7.501  -32.355 0.02 20.89 ?  10   LYS A CE   1  
ATOM   86     N NZ   . LYS A 1 17  ? 3.268   -8.260  -33.624 0.02 21.32 ?  10   LYS A NZ   1  
ATOM   87     H H    . LYS A 1 17  ? 1.520   -3.664  -34.793 0.02 21.07 ?  10   LYS A H    1  
ATOM   88     H HA   . LYS A 1 17  ? 4.202   -3.845  -34.997 0.02 20.46 ?  10   LYS A HA   1  
ATOM   89     H HB2  . LYS A 1 17  ? 2.418   -5.901  -34.347 0.02 21.25 ?  10   LYS A HB2  1  
ATOM   90     H HB3  . LYS A 1 17  ? 4.005   -5.974  -34.288 0.02 20.83 ?  10   LYS A HB3  1  
ATOM   91     H HG2  . LYS A 1 17  ? 4.078   -4.730  -32.424 0.02 20.39 ?  10   LYS A HG2  1  
ATOM   92     H HG3  . LYS A 1 17  ? 2.537   -4.339  -32.566 0.02 20.80 ?  10   LYS A HG3  1  
ATOM   93     H HD2  . LYS A 1 17  ? 2.993   -6.119  -30.962 0.02 20.74 ?  10   LYS A HD2  1  
ATOM   94     H HD3  . LYS A 1 17  ? 1.892   -6.474  -32.052 0.02 21.23 ?  10   LYS A HD3  1  
ATOM   95     H HE2  . LYS A 1 17  ? 4.589   -7.201  -32.485 0.02 20.62 ?  10   LYS A HE2  1  
ATOM   96     H HE3  . LYS A 1 17  ? 3.660   -8.149  -31.632 0.02 20.88 ?  10   LYS A HE3  1  
ATOM   97     H HZ1  . LYS A 1 17  ? 3.913   -8.829  -33.848 0.02 21.27 ?  10   LYS A HZ1  1  
ATOM   98     H HZ2  . LYS A 1 17  ? 2.524   -8.726  -33.472 0.02 21.58 ?  10   LYS A HZ2  1  
ATOM   99     H HZ3  . LYS A 1 17  ? 3.127   -7.721  -34.308 0.02 21.38 ?  10   LYS A HZ3  1  
ATOM   100    N N    . LEU A 1 18  ? 2.277   -5.162  -37.183 0.02 21.48 ?  11   LEU A N    1  
ATOM   101    C CA   . LEU A 1 18  ? 2.265   -5.559  -38.588 0.02 21.78 ?  11   LEU A CA   1  
ATOM   102    C C    . LEU A 1 18  ? 2.936   -4.503  -39.457 0.02 21.57 ?  11   LEU A C    1  
ATOM   103    O O    . LEU A 1 18  ? 3.851   -4.806  -40.233 0.02 21.54 ?  11   LEU A O    1  
ATOM   104    C CB   . LEU A 1 18  ? 0.834   -5.767  -39.042 0.02 22.32 ?  11   LEU A CB   1  
ATOM   105    C CG   . LEU A 1 18  ? 0.066   -7.056  -38.687 0.02 22.71 ?  11   LEU A CG   1  
ATOM   106    C CD1  . LEU A 1 18  ? 0.573   -7.790  -37.472 0.02 22.47 ?  11   LEU A CD1  1  
ATOM   107    C CD2  . LEU A 1 18  ? -1.424  -6.726  -38.545 0.02 23.06 ?  11   LEU A CD2  1  
ATOM   108    H H    . LEU A 1 18  ? 1.503   -5.120  -36.820 0.02 21.64 ?  11   LEU A H    1  
ATOM   109    H HA   . LEU A 1 18  ? 2.743   -6.396  -38.699 0.02 21.80 ?  11   LEU A HA   1  
ATOM   110    H HB2  . LEU A 1 18  ? 0.326   -5.019  -38.698 0.02 22.30 ?  11   LEU A HB2  1  
ATOM   111    H HB3  . LEU A 1 18  ? 0.838   -5.721  -40.012 0.02 22.50 ?  11   LEU A HB3  1  
ATOM   112    H HG   . LEU A 1 18  ? 0.147   -7.668  -39.436 0.02 22.95 ?  11   LEU A HG   1  
ATOM   113    H HD11 . LEU A 1 18  ? 1.527   -7.929  -37.568 0.02 22.27 ?  11   LEU A HD11 1  
ATOM   114    H HD12 . LEU A 1 18  ? 0.389   -7.260  -36.682 0.02 22.24 ?  11   LEU A HD12 1  
ATOM   115    H HD13 . LEU A 1 18  ? 0.125   -8.650  -37.400 0.02 22.76 ?  11   LEU A HD13 1  
ATOM   116    H HD21 . LEU A 1 18  ? -1.870  -7.451  -38.095 0.02 23.24 ?  11   LEU A HD21 1  
ATOM   117    H HD22 . LEU A 1 18  ? -1.518  -5.919  -38.010 0.02 22.84 ?  11   LEU A HD22 1  
ATOM   118    H HD23 . LEU A 1 18  ? -1.805  -6.596  -39.431 0.02 23.34 ?  11   LEU A HD23 1  
ATOM   119    N N    . LYS A 1 19  ? 2.473   -3.257  -39.352 0.02 21.46 ?  12   LYS A N    1  
ATOM   120    C CA   . LYS A 1 19  ? 3.072   -2.175  -40.125 0.02 21.26 ?  12   LYS A CA   1  
ATOM   121    C C    . LYS A 1 19  ? 4.577   -2.117  -39.912 0.02 20.83 ?  12   LYS A C    1  
ATOM   122    O O    . LYS A 1 19  ? 5.338   -1.887  -40.858 0.02 20.78 ?  12   LYS A O    1  
ATOM   123    C CB   . LYS A 1 19  ? 2.442   -0.846  -39.736 0.02 21.18 ?  12   LYS A CB   1  
ATOM   124    C CG   . LYS A 1 19  ? 1.063   -0.623  -40.335 0.02 21.65 ?  12   LYS A CG   1  
ATOM   125    C CD   . LYS A 1 19  ? 0.075   -0.069  -39.361 0.02 21.70 ?  12   LYS A CD   1  
ATOM   126    C CE   . LYS A 1 19  ? 0.549   1.143   -38.576 0.02 21.35 ?  12   LYS A CE   1  
ATOM   127    N NZ   . LYS A 1 19  ? -0.538  1.476   -37.623 0.02 21.34 ?  12   LYS A NZ   1  
ATOM   128    H H    . LYS A 1 19  ? 1.824   -3.017  -38.846 0.02 21.52 ?  12   LYS A H    1  
ATOM   129    H HA   . LYS A 1 19  ? 2.905   -2.328  -41.068 0.02 21.50 ?  12   LYS A HA   1  
ATOM   130    H HB2  . LYS A 1 19  ? 2.371   -0.826  -38.772 0.02 21.02 ?  12   LYS A HB2  1  
ATOM   131    H HB3  . LYS A 1 19  ? 3.015   -0.131  -40.048 0.02 21.00 ?  12   LYS A HB3  1  
ATOM   132    H HG2  . LYS A 1 19  ? 1.124   -0.013  -41.086 0.02 21.71 ?  12   LYS A HG2  1  
ATOM   133    H HG3  . LYS A 1 19  ? 0.724   -1.479  -40.636 0.02 21.91 ?  12   LYS A HG3  1  
ATOM   134    H HD2  . LYS A 1 19  ? -0.716  0.202   -39.856 0.02 22.03 ?  12   LYS A HD2  1  
ATOM   135    H HD3  . LYS A 1 19  ? -0.170  -0.759  -38.728 0.02 21.66 ?  12   LYS A HD3  1  
ATOM   136    H HE2  . LYS A 1 19  ? 1.359   0.953   -38.082 0.02 21.04 ?  12   LYS A HE2  1  
ATOM   137    H HE3  . LYS A 1 19  ? 0.677   1.892   -39.180 0.02 21.47 ?  12   LYS A HE3  1  
ATOM   138    H HZ1  . LYS A 1 19  ? -0.554  0.881   -36.962 0.02 21.29 ?  12   LYS A HZ1  1  
ATOM   139    H HZ2  . LYS A 1 19  ? -0.408  2.287   -37.279 0.02 21.13 ?  12   LYS A HZ2  1  
ATOM   140    H HZ3  . LYS A 1 19  ? -1.323  1.460   -38.041 0.02 21.63 ?  12   LYS A HZ3  1  
ATOM   141    N N    . TRP A 1 20  ? 5.016   -2.288  -38.662 0.02 20.55 ?  13   TRP A N    1  
ATOM   142    C CA   . TRP A 1 20  ? 6.436   -2.441  -38.376 0.02 20.17 ?  13   TRP A CA   1  
ATOM   143    C C    . TRP A 1 20  ? 7.037   -3.561  -39.206 0.02 20.31 ?  13   TRP A C    1  
ATOM   144    O O    . TRP A 1 20  ? 8.064   -3.372  -39.864 0.02 20.16 ?  13   TRP A O    1  
ATOM   145    C CB   . TRP A 1 20  ? 6.640   -2.731  -36.894 0.02 19.93 ?  13   TRP A CB   1  
ATOM   146    C CG   . TRP A 1 20  ? 8.084   -2.738  -36.517 0.02 19.57 ?  13   TRP A CG   1  
ATOM   147    C CD1  . TRP A 1 20  ? 8.835   -3.804  -36.141 0.02 19.53 ?  13   TRP A CD1  1  
ATOM   148    C CD2  . TRP A 1 20  ? 8.943   -1.608  -36.492 0.02 19.24 ?  13   TRP A CD2  1  
ATOM   149    N NE1  . TRP A 1 20  ? 10.127  -3.402  -35.878 0.02 19.18 ?  13   TRP A NE1  1  
ATOM   150    C CE2  . TRP A 1 20  ? 10.208  -2.051  -36.083 0.02 19.00 ?  13   TRP A CE2  1  
ATOM   151    C CE3  . TRP A 1 20  ? 8.766   -0.254  -36.767 0.02 19.14 ?  13   TRP A CE3  1  
ATOM   152    C CZ2  . TRP A 1 20  ? 11.281  -1.192  -35.960 0.02 18.68 ?  13   TRP A CZ2  1  
ATOM   153    C CZ3  . TRP A 1 20  ? 9.818   0.587   -36.638 0.02 18.83 ?  13   TRP A CZ3  1  
ATOM   154    C CH2  . TRP A 1 20  ? 11.073  0.120   -36.239 0.02 18.60 ?  13   TRP A CH2  1  
ATOM   155    H H    . TRP A 1 20  ? 4.515   -2.312  -37.966 0.02 20.59 ?  13   TRP A H    1  
ATOM   156    H HA   . TRP A 1 20  ? 6.894   -1.613  -38.585 0.02 20.00 ?  13   TRP A HA   1  
ATOM   157    H HB2  . TRP A 1 20  ? 6.186   -2.054  -36.373 0.02 19.86 ?  13   TRP A HB2  1  
ATOM   158    H HB3  . TRP A 1 20  ? 6.271   -3.605  -36.691 0.02 20.12 ?  13   TRP A HB3  1  
ATOM   159    H HD1  . TRP A 1 20  ? 8.521   -4.677  -36.072 0.02 19.72 ?  13   TRP A HD1  1  
ATOM   160    H HE1  . TRP A 1 20  ? 10.771  -3.910  -35.623 0.02 19.10 ?  13   TRP A HE1  1  
ATOM   161    H HE3  . TRP A 1 20  ? 7.937   0.070   -37.037 0.02 19.31 ?  13   TRP A HE3  1  
ATOM   162    H HZ2  . TRP A 1 20  ? 12.114  -1.502  -35.688 0.02 18.54 ?  13   TRP A HZ2  1  
ATOM   163    H HZ3  . TRP A 1 20  ? 9.706   1.491   -36.825 0.02 18.78 ?  13   TRP A HZ3  1  
ATOM   164    H HH2  . TRP A 1 20  ? 11.776  0.719   -36.158 0.02 18.41 ?  13   TRP A HH2  1  
ATOM   165    N N    . LYS A 1 21  ? 6.382   -4.731  -39.196 0.02 20.64 ?  14   LYS A N    1  
ATOM   166    C CA   . LYS A 1 21  ? 6.892   -5.909  -39.881 0.02 20.83 ?  14   LYS A CA   1  
ATOM   167    C C    . LYS A 1 21  ? 7.068   -5.633  -41.359 0.02 21.01 ?  14   LYS A C    1  
ATOM   168    O O    . LYS A 1 21  ? 8.125   -5.918  -41.937 0.02 20.92 ?  14   LYS A O    1  
ATOM   169    C CB   . LYS A 1 21  ? 5.923   -7.074  -39.674 0.02 21.24 ?  14   LYS A CB   1  
ATOM   170    C CG   . LYS A 1 21  ? 6.553   -8.401  -39.277 0.02 21.32 ?  14   LYS A CG   1  
ATOM   171    C CD   . LYS A 1 21  ? 5.461   -9.445  -39.044 0.02 21.70 ?  14   LYS A CD   1  
ATOM   172    C CE   . LYS A 1 21  ? 5.741   -10.781 -39.751 0.02 22.12 ?  14   LYS A CE   1  
ATOM   173    N NZ   . LYS A 1 21  ? 6.725   -11.600 -38.998 0.02 21.98 ?  14   LYS A NZ   1  
ATOM   174    H H    . LYS A 1 21  ? 5.635   -4.861  -38.796 0.02 20.78 ?  14   LYS A H    1  
ATOM   175    H HA   . LYS A 1 21  ? 7.755   -6.154  -39.512 0.02 20.61 ?  14   LYS A HA   1  
ATOM   176    H HB2  . LYS A 1 21  ? 5.283   -6.837  -38.986 0.02 21.22 ?  14   LYS A HB2  1  
ATOM   177    H HB3  . LYS A 1 21  ? 5.451   -7.221  -40.507 0.02 21.53 ?  14   LYS A HB3  1  
ATOM   178    H HG2  . LYS A 1 21  ? 7.132   -8.714  -39.991 0.02 21.46 ?  14   LYS A HG2  1  
ATOM   179    H HG3  . LYS A 1 21  ? 7.053   -8.290  -38.451 0.02 21.03 ?  14   LYS A HG3  1  
ATOM   180    H HD2  . LYS A 1 21  ? 5.390   -9.618  -38.092 0.02 21.54 ?  14   LYS A HD2  1  
ATOM   181    H HD3  . LYS A 1 21  ? 4.621   -9.100  -39.386 0.02 21.86 ?  14   LYS A HD3  1  
ATOM   182    H HE2  . LYS A 1 21  ? 4.913   -11.283 -39.805 0.02 22.42 ?  14   LYS A HE2  1  
ATOM   183    H HE3  . LYS A 1 21  ? 6.087   -10.617 -40.641 0.02 22.21 ?  14   LYS A HE3  1  
ATOM   184    H HZ1  . LYS A 1 21  ? 6.301   -12.144 -38.434 0.02 21.94 ?  14   LYS A HZ1  1  
ATOM   185    H HZ2  . LYS A 1 21  ? 7.211   -12.085 -39.564 0.02 22.23 ?  14   LYS A HZ2  1  
ATOM   186    H HZ3  . LYS A 1 21  ? 7.273   -11.072 -38.534 0.02 21.70 ?  14   LYS A HZ3  1  
ATOM   187    N N    . ILE A 1 22  ? 6.037   -5.096  -41.994 0.02 21.30 ?  15   ILE A N    1  
ATOM   188    C CA   . ILE A 1 22  ? 6.145   -4.775  -43.408 0.02 21.51 ?  15   ILE A CA   1  
ATOM   189    C C    . ILE A 1 22  ? 7.316   -3.825  -43.651 0.02 21.15 ?  15   ILE A C    1  
ATOM   190    O O    . ILE A 1 22  ? 8.130   -4.048  -44.560 0.02 21.24 ?  15   ILE A O    1  
ATOM   191    C CB   . ILE A 1 22  ? 4.804   -4.222  -43.929 0.02 21.86 ?  15   ILE A CB   1  
ATOM   192    C CG1  . ILE A 1 22  ? 3.748   -5.337  -43.850 0.02 22.31 ?  15   ILE A CG1  1  
ATOM   193    C CG2  . ILE A 1 22  ? 4.931   -3.711  -45.352 0.02 22.04 ?  15   ILE A CG2  1  
ATOM   194    C CD1  . ILE A 1 22  ? 2.644   -5.311  -44.914 0.02 22.82 ?  15   ILE A CD1  1  
ATOM   195    H H    . ILE A 1 22  ? 5.275   -4.914  -41.638 0.02 21.39 ?  15   ILE A H    1  
ATOM   196    H HA   . ILE A 1 22  ? 6.331   -5.592  -43.893 0.02 21.72 ?  15   ILE A HA   1  
ATOM   197    H HB   . ILE A 1 22  ? 4.531   -3.488  -43.356 0.02 21.68 ?  15   ILE A HB   1  
ATOM   198    H HG12 . ILE A 1 22  ? 4.197   -6.192  -43.929 0.02 22.41 ?  15   ILE A HG12 1  
ATOM   199    H HG13 . ILE A 1 22  ? 3.315   -5.281  -42.983 0.02 22.22 ?  15   ILE A HG13 1  
ATOM   200    H HG21 . ILE A 1 22  ? 5.679   -3.104  -45.432 0.02 21.77 ?  15   ILE A HG21 1  
ATOM   201    H HG22 . ILE A 1 22  ? 5.042   -4.469  -45.941 0.02 22.25 ?  15   ILE A HG22 1  
ATOM   202    H HG23 . ILE A 1 22  ? 4.117   -3.240  -45.586 0.02 22.25 ?  15   ILE A HG23 1  
ATOM   203    H HD11 . ILE A 1 22  ? 1.957   -5.950  -44.665 0.02 23.10 ?  15   ILE A HD11 1  
ATOM   204    H HD12 . ILE A 1 22  ? 2.261   -4.421  -44.959 0.02 22.75 ?  15   ILE A HD12 1  
ATOM   205    H HD13 . ILE A 1 22  ? 3.024   -5.554  -45.772 0.02 22.94 ?  15   ILE A HD13 1  
ATOM   206    N N    . LYS A 1 23  ? 7.455   -2.774  -42.837 0.02 20.76 ?  16   LYS A N    1  
ATOM   207    C CA   . LYS A 1 23  ? 8.566   -1.863  -43.098 0.02 20.46 ?  16   LYS A CA   1  
ATOM   208    C C    . LYS A 1 23  ? 9.937   -2.506  -42.834 0.02 20.19 ?  16   LYS A C    1  
ATOM   209    O O    . LYS A 1 23  ? 10.884  -2.205  -43.563 0.02 20.10 ?  16   LYS A O    1  
ATOM   210    C CB   . LYS A 1 23  ? 8.427   -0.549  -42.312 0.02 20.19 ?  16   LYS A CB   1  
ATOM   211    C CG   . LYS A 1 23  ? 7.301   0.492   -42.784 0.02 20.47 ?  16   LYS A CG   1  
ATOM   212    C CD   . LYS A 1 23  ? 6.766   0.406   -44.302 0.02 20.84 ?  16   LYS A CD   1  
ATOM   213    C CE   . LYS A 1 23  ? 7.161   1.653   -45.152 0.02 20.71 ?  16   LYS A CE   1  
ATOM   214    N NZ   . LYS A 1 23  ? 6.817   1.533   -46.632 0.02 21.12 ?  16   LYS A NZ   1  
ATOM   215    H H    . LYS A 1 23  ? 6.954   -2.574  -42.172 0.02 20.68 ?  16   LYS A H    1  
ATOM   216    H HA   . LYS A 1 23  ? 8.539   -1.652  -44.029 0.02 20.64 ?  16   LYS A HA   1  
ATOM   217    H HB2  . LYS A 1 23  ? 8.240   -0.775  -41.389 0.02 20.05 ?  16   LYS A HB2  1  
ATOM   218    H HB3  . LYS A 1 23  ? 9.279   -0.085  -42.352 0.02 20.00 ?  16   LYS A HB3  1  
ATOM   219    H HG2  . LYS A 1 23  ? 6.539   0.393   -42.192 0.02 20.62 ?  16   LYS A HG2  1  
ATOM   220    H HG3  . LYS A 1 23  ? 7.668   1.384   -42.678 0.02 20.29 ?  16   LYS A HG3  1  
ATOM   221    H HD2  . LYS A 1 23  ? 7.115   -0.376  -44.745 0.02 20.98 ?  16   LYS A HD2  1  
ATOM   222    H HD3  . LYS A 1 23  ? 5.800   0.375   -44.298 0.02 21.08 ?  16   LYS A HD3  1  
ATOM   223    H HE2  . LYS A 1 23  ? 6.693   2.428   -44.801 0.02 20.60 ?  16   LYS A HE2  1  
ATOM   224    H HE3  . LYS A 1 23  ? 8.119   1.790   -45.080 0.02 20.49 ?  16   LYS A HE3  1  
ATOM   225    H HZ1  . LYS A 1 23  ? 7.424   1.965   -47.119 0.02 21.06 ?  16   LYS A HZ1  1  
ATOM   226    H HZ2  . LYS A 1 23  ? 6.806   0.678   -46.878 0.02 21.33 ?  16   LYS A HZ2  1  
ATOM   227    H HZ3  . LYS A 1 23  ? 6.015   1.883   -46.790 0.02 21.26 ?  16   LYS A HZ3  1  
ATOM   228    N N    . CYS A 1 24  ? 10.098  -3.384  -41.832 0.02 20.08 ?  17   CYS A N    1  
ATOM   229    C CA   . CYS A 1 24  ? 11.384  -4.079  -41.721 0.02 19.90 ?  17   CYS A CA   1  
ATOM   230    C C    . CYS A 1 24  ? 11.732  -4.768  -43.028 0.02 20.19 ?  17   CYS A C    1  
ATOM   231    O O    . CYS A 1 24  ? 12.885  -4.727  -43.483 0.02 20.07 ?  17   CYS A O    1  
ATOM   232    C CB   . CYS A 1 24  ? 11.377  -5.110  -40.590 0.02 19.83 ?  17   CYS A CB   1  
ATOM   233    S SG   . CYS A 1 24  ? 11.217  -4.430  -38.930 0.02 19.54 ?  17   CYS A SG   1  
ATOM   234    H H    . CYS A 1 24  ? 9.514   -3.592  -41.238 0.02 20.12 ?  17   CYS A H    1  
ATOM   235    H HA   . CYS A 1 24  ? 12.081  -3.432  -41.530 0.02 19.65 ?  17   CYS A HA   1  
ATOM   236    H HB2  . CYS A 1 24  ? 10.649  -5.734  -40.735 0.02 20.10 ?  17   CYS A HB2  1  
ATOM   237    H HB3  . CYS A 1 24  ? 12.226  -5.583  -40.612 0.02 19.71 ?  17   CYS A HB3  1  
ATOM   238    H HG   . CYS A 1 24  ? 10.422  -3.543  -39.067 0.02 19.62 ?  17   CYS A HG   1  
ATOM   239    N N    . ILE A 1 25  ? 10.753  -5.422  -43.640 0.02 20.60 ?  18   ILE A N    1  
ATOM   240    C CA   . ILE A 1 25  ? 11.045  -6.213  -44.825 0.02 20.94 ?  18   ILE A CA   1  
ATOM   241    C C    . ILE A 1 25  ? 11.355  -5.299  -45.995 0.02 21.03 ?  18   ILE A C    1  
ATOM   242    O O    . ILE A 1 25  ? 12.094  -5.682  -46.905 0.02 21.18 ?  18   ILE A O    1  
ATOM   243    C CB   . ILE A 1 25  ? 9.880   -7.171  -45.136 0.02 21.40 ?  18   ILE A CB   1  
ATOM   244    C CG1  . ILE A 1 25  ? 9.568   -8.069  -43.946 0.02 21.34 ?  18   ILE A CG1  1  
ATOM   245    C CG2  . ILE A 1 25  ? 10.251  -8.071  -46.309 0.02 21.76 ?  18   ILE A CG2  1  
ATOM   246    C CD1  . ILE A 1 25  ? 8.073   -8.319  -43.722 0.02 21.71 ?  18   ILE A CD1  1  
ATOM   247    H H    . ILE A 1 25  ? 9.927   -5.419  -43.400 0.02 20.72 ?  18   ILE A H    1  
ATOM   248    H HA   . ILE A 1 25  ? 11.831  -6.755  -44.661 0.02 20.84 ?  18   ILE A HA   1  
ATOM   249    H HB   . ILE A 1 25  ? 9.093   -6.651  -45.359 0.02 21.54 ?  18   ILE A HB   1  
ATOM   250    H HG12 . ILE A 1 25  ? 9.990   -8.927  -44.099 0.02 21.39 ?  18   ILE A HG12 1  
ATOM   251    H HG13 . ILE A 1 25  ? 9.923   -7.672  -43.137 0.02 21.03 ?  18   ILE A HG13 1  
ATOM   252    H HG21 . ILE A 1 25  ? 10.312  -7.540  -47.115 0.02 21.86 ?  18   ILE A HG21 1  
ATOM   253    H HG22 . ILE A 1 25  ? 11.103  -8.490  -46.121 0.02 21.62 ?  18   ILE A HG22 1  
ATOM   254    H HG23 . ILE A 1 25  ? 9.565   -8.747  -46.406 0.02 22.05 ?  18   ILE A HG23 1  
ATOM   255    H HD11 . ILE A 1 25  ? 7.736   -8.868  -44.448 0.02 22.02 ?  18   ILE A HD11 1  
ATOM   256    H HD12 . ILE A 1 25  ? 7.947   -8.777  -42.876 0.02 21.61 ?  18   ILE A HD12 1  
ATOM   257    H HD13 . ILE A 1 25  ? 7.609   -7.466  -43.709 0.02 21.75 ?  18   ILE A HD13 1  
ATOM   258    N N    . GLU A 1 26  ? 10.833  -4.064  -45.984 0.02 20.96 ?  19   GLU A N    1  
ATOM   259    C CA   . GLU A 1 26  ? 11.080  -3.167  -47.111 0.02 21.05 ?  19   GLU A CA   1  
ATOM   260    C C    . GLU A 1 26  ? 12.363  -2.354  -46.928 0.02 20.67 ?  19   GLU A C    1  
ATOM   261    O O    . GLU A 1 26  ? 13.000  -1.971  -47.914 0.02 20.75 ?  19   GLU A O    1  
ATOM   262    C CB   . GLU A 1 26  ? 9.895   -2.241  -47.339 0.02 21.21 ?  19   GLU A CB   1  
ATOM   263    C CG   . GLU A 1 26  ? 9.799   -1.099  -46.387 0.02 20.86 ?  19   GLU A CG   1  
ATOM   264    C CD   . GLU A 1 26  ? 9.512   0.230   -47.056 0.02 20.89 ?  19   GLU A CD   1  
ATOM   265    O OE1  . GLU A 1 26  ? 8.302   0.505   -47.232 0.02 21.19 ?  19   GLU A OE1  1  
ATOM   266    O OE2  . GLU A 1 26  ? 10.485  1.003   -47.345 0.02 20.61 -1 19   GLU A OE2  1  
ATOM   267    H H    . GLU A 1 26  ? 10.349  -3.733  -45.356 0.02 20.88 ?  19   GLU A H    1  
ATOM   268    H HA   . GLU A 1 26  ? 11.185  -3.696  -47.916 0.02 21.30 ?  19   GLU A HA   1  
ATOM   269    H HB2  . GLU A 1 26  ? 9.960   -1.874  -48.236 0.02 21.35 ?  19   GLU A HB2  1  
ATOM   270    H HB3  . GLU A 1 26  ? 9.075   -2.755  -47.258 0.02 21.46 ?  19   GLU A HB3  1  
ATOM   271    H HG2  . GLU A 1 26  ? 9.034   -1.280  -45.831 0.02 20.93 ?  19   GLU A HG2  1  
ATOM   272    H HG3  . GLU A 1 26  ? 10.588  -1.004  -45.838 0.02 20.57 ?  19   GLU A HG3  1  
ATOM   273    N N    . ASN A 1 27  ? 12.747  -2.036  -45.691 0.02 20.27 ?  20   ASN A N    1  
ATOM   274    C CA   . ASN A 1 27  ? 14.080  -1.465  -45.520 0.02 19.95 ?  20   ASN A CA   1  
ATOM   275    C C    . ASN A 1 27  ? 15.137  -2.493  -45.911 0.02 20.01 ?  20   ASN A C    1  
ATOM   276    O O    . ASN A 1 27  ? 16.271  -2.134  -46.248 0.02 19.90 ?  20   ASN A O    1  
ATOM   277    C CB   . ASN A 1 27  ? 14.300  -0.980  -44.093 0.02 19.55 ?  20   ASN A CB   1  
ATOM   278    C CG   . ASN A 1 27  ? 15.470  0.008   -43.979 0.02 19.26 ?  20   ASN A CG   1  
ATOM   279    O OD1  . ASN A 1 27  ? 15.413  1.128   -44.474 0.02 19.27 ?  20   ASN A OD1  1  
ATOM   280    N ND2  . ASN A 1 27  ? 16.492  -0.394  -43.273 0.02 19.04 ?  20   ASN A ND2  1  
ATOM   281    H H    . ASN A 1 27  ? 12.284  -2.127  -44.974 0.02 20.20 ?  20   ASN A H    1  
ATOM   282    H HA   . ASN A 1 27  ? 14.172  -0.695  -46.102 0.02 19.99 ?  20   ASN A HA   1  
ATOM   283    H HB2  . ASN A 1 27  ? 13.501  -0.522  -43.789 0.02 19.56 ?  20   ASN A HB2  1  
ATOM   284    H HB3  . ASN A 1 27  ? 14.483  -1.741  -43.520 0.02 19.50 ?  20   ASN A HB3  1  
ATOM   285    H HD21 . ASN A 1 27  ? 17.125  0.156   -43.080 0.02 18.91 ?  20   ASN A HD21 1  
ATOM   286    H HD22 . ASN A 1 27  ? 16.529  -1.211  -43.002 0.02 19.03 ?  20   ASN A HD22 1  
ATOM   287    N N    . LYS A 1 28  ? 14.758  -3.767  -45.892 0.02 20.23 ?  21   LYS A N    1  
ATOM   288    C CA   . LYS A 1 28  ? 15.651  -4.846  -46.299 0.02 20.34 ?  21   LYS A CA   1  
ATOM   289    C C    . LYS A 1 28  ? 15.894  -4.802  -47.804 0.02 20.68 ?  21   LYS A C    1  
ATOM   290    O O    . LYS A 1 28  ? 17.045  -4.712  -48.260 0.02 20.65 ?  21   LYS A O    1  
ATOM   291    C CB   . LYS A 1 28  ? 15.021  -6.179  -45.889 0.02 20.51 ?  21   LYS A CB   1  
ATOM   292    C CG   . LYS A 1 28  ? 15.872  -7.120  -44.998 0.02 20.39 ?  21   LYS A CG   1  
ATOM   293    C CD   . LYS A 1 28  ? 16.709  -8.103  -45.840 0.02 20.70 ?  21   LYS A CD   1  
ATOM   294    C CE   . LYS A 1 28  ? 15.870  -9.099  -46.689 0.02 21.19 ?  21   LYS A CE   1  
ATOM   295    N NZ   . LYS A 1 28  ? 16.652  -9.541  -47.910 0.02 21.54 ?  21   LYS A NZ   1  
ATOM   296    H H    . LYS A 1 28  ? 13.977  -4.033  -45.659 0.02 20.34 ?  21   LYS A H    1  
ATOM   297    H HA   . LYS A 1 28  ? 16.501  -4.750  -45.846 0.02 20.10 ?  21   LYS A HA   1  
ATOM   298    H HB2  . LYS A 1 28  ? 14.209  -5.991  -45.394 0.02 20.41 ?  21   LYS A HB2  1  
ATOM   299    H HB3  . LYS A 1 28  ? 14.793  -6.653  -46.701 0.02 20.82 ?  21   LYS A HB3  1  
ATOM   300    H HG2  . LYS A 1 28  ? 16.477  -6.584  -44.462 0.02 20.12 ?  21   LYS A HG2  1  
ATOM   301    H HG3  . LYS A 1 28  ? 15.289  -7.631  -44.416 0.02 20.42 ?  21   LYS A HG3  1  
ATOM   302    H HD2  . LYS A 1 28  ? 17.271  -7.596  -46.445 0.02 20.71 ?  21   LYS A HD2  1  
ATOM   303    H HD3  . LYS A 1 28  ? 17.263  -8.632  -45.244 0.02 20.62 ?  21   LYS A HD3  1  
ATOM   304    H HE2  . LYS A 1 28  ? 15.676  -9.885  -46.157 0.02 21.20 ?  21   LYS A HE2  1  
ATOM   305    H HE3  . LYS A 1 28  ? 15.045  -8.691  -46.988 0.02 21.29 ?  21   LYS A HE3  1  
ATOM   306    H HZ1  . LYS A 1 28  ? 16.856  -8.836  -48.418 0.02 21.65 ?  21   LYS A HZ1  1  
ATOM   307    H HZ2  . LYS A 1 28  ? 17.408  -9.938  -47.655 0.02 21.42 ?  21   LYS A HZ2  1  
ATOM   308    H HZ3  . LYS A 1 28  ? 16.171  -10.115 -48.394 0.02 21.78 ?  21   LYS A HZ3  1  
ATOM   309    N N    . PHE A 1 29  ? 14.815  -4.895  -48.585 0.02 21.04 ?  22   PHE A N    1  
ATOM   310    C CA   . PHE A 1 29  ? 14.880  -4.713  -50.030 0.02 21.40 ?  22   PHE A CA   1  
ATOM   311    C C    . PHE A 1 29  ? 15.577  -3.407  -50.396 0.02 21.24 ?  22   PHE A C    1  
ATOM   312    O O    . PHE A 1 29  ? 16.387  -3.374  -51.335 0.02 21.40 ?  22   PHE A O    1  
ATOM   313    C CB   . PHE A 1 29  ? 13.469  -4.701  -50.634 0.02 21.80 ?  22   PHE A CB   1  
ATOM   314    C CG   . PHE A 1 29  ? 12.810  -6.075  -50.837 0.02 22.17 ?  22   PHE A CG   1  
ATOM   315    C CD1  . PHE A 1 29  ? 11.966  -6.625  -49.875 0.02 22.11 ?  22   PHE A CD1  1  
ATOM   316    C CD2  . PHE A 1 29  ? 12.947  -6.750  -52.042 0.02 22.63 ?  22   PHE A CD2  1  
ATOM   317    C CE1  . PHE A 1 29  ? 11.348  -7.839  -50.077 0.02 22.49 ?  22   PHE A CE1  1  
ATOM   318    C CE2  . PHE A 1 29  ? 12.306  -7.966  -52.260 0.02 23.01 ?  22   PHE A CE2  1  
ATOM   319    C CZ   . PHE A 1 29  ? 11.503  -8.509  -51.288 0.02 22.95 ?  22   PHE A CZ   1  
ATOM   320    H H    . PHE A 1 29  ? 14.027  -5.075  -48.296 0.02 21.11 ?  22   PHE A H    1  
ATOM   321    H HA   . PHE A 1 29  ? 15.375  -5.450  -50.424 0.02 21.54 ?  22   PHE A HA   1  
ATOM   322    H HB2  . PHE A 1 29  ? 12.896  -4.187  -50.044 0.02 21.65 ?  22   PHE A HB2  1  
ATOM   323    H HB3  . PHE A 1 29  ? 13.509  -4.268  -51.502 0.02 21.98 ?  22   PHE A HB3  1  
ATOM   324    H HD1  . PHE A 1 29  ? 11.848  -6.189  -49.063 0.02 21.82 ?  22   PHE A HD1  1  
ATOM   325    H HD2  . PHE A 1 29  ? 13.482  -6.390  -52.712 0.02 22.70 ?  22   PHE A HD2  1  
ATOM   326    H HE1  . PHE A 1 29  ? 10.803  -8.197  -49.414 0.02 22.46 ?  22   PHE A HE1  1  
ATOM   327    H HE2  . PHE A 1 29  ? 12.424  -8.415  -53.065 0.02 23.34 ?  22   PHE A HE2  1  
ATOM   328    H HZ   . PHE A 1 29  ? 11.088  -9.330  -51.430 0.02 23.22 ?  22   PHE A HZ   1  
ATOM   329    N N    . LEU A 1 30  ? 15.259  -2.316  -49.682 0.02 20.95 ?  23   LEU A N    1  
ATOM   330    C CA   . LEU A 1 30  ? 15.676  -0.976  -50.096 0.02 20.85 ?  23   LEU A CA   1  
ATOM   331    C C    . LEU A 1 30  ? 17.164  -0.747  -49.847 0.02 20.57 ?  23   LEU A C    1  
ATOM   332    O O    . LEU A 1 30  ? 17.875  -0.232  -50.714 0.02 20.66 ?  23   LEU A O    1  
ATOM   333    C CB   . LEU A 1 30  ? 14.828  0.088   -49.382 0.02 20.66 ?  23   LEU A CB   1  
ATOM   334    C CG   . LEU A 1 30  ? 15.187  1.566   -49.630 0.02 20.51 ?  23   LEU A CG   1  
ATOM   335    C CD1  . LEU A 1 30  ? 15.530  1.837   -51.083 0.02 20.85 ?  23   LEU A CD1  1  
ATOM   336    C CD2  . LEU A 1 30  ? 14.032  2.491   -49.197 0.02 20.41 ?  23   LEU A CD2  1  
ATOM   337    H H    . LEU A 1 30  ? 14.801  -2.328  -48.955 0.02 20.83 ?  23   LEU A H    1  
ATOM   338    H HA   . LEU A 1 30  ? 15.518  -0.886  -51.048 0.02 21.13 ?  23   LEU A HA   1  
ATOM   339    H HB2  . LEU A 1 30  ? 13.901  -0.033  -49.638 0.02 20.88 ?  23   LEU A HB2  1  
ATOM   340    H HB3  . LEU A 1 30  ? 14.916  -0.054  -48.425 0.02 20.42 ?  23   LEU A HB3  1  
ATOM   341    H HG   . LEU A 1 30  ? 15.963  1.790   -49.094 0.02 20.26 ?  23   LEU A HG   1  
ATOM   342    H HD11 . LEU A 1 30  ? 15.661  2.790   -51.193 0.02 20.77 ?  23   LEU A HD11 1  
ATOM   343    H HD12 . LEU A 1 30  ? 16.339  1.366   -51.323 0.02 20.88 ?  23   LEU A HD12 1  
ATOM   344    H HD13 . LEU A 1 30  ? 14.795  1.540   -51.640 0.02 21.12 ?  23   LEU A HD13 1  
ATOM   345    H HD21 . LEU A 1 30  ? 13.618  2.128   -48.398 0.02 20.21 ?  23   LEU A HD21 1  
ATOM   346    H HD22 . LEU A 1 30  ? 14.384  3.375   -49.012 0.02 20.32 ?  23   LEU A HD22 1  
ATOM   347    H HD23 . LEU A 1 30  ? 13.381  2.538   -49.912 0.02 20.67 ?  23   LEU A HD23 1  
ATOM   348    N N    . ASN A 1 31  ? 17.674  -1.142  -48.691 0.02 20.25 ?  24   ASN A N    1  
ATOM   349    C CA   . ASN A 1 31  ? 19.076  -0.846  -48.423 0.02 20.01 ?  24   ASN A CA   1  
ATOM   350    C C    . ASN A 1 31  ? 19.989  -1.663  -49.350 0.02 20.26 ?  24   ASN A C    1  
ATOM   351    O O    . ASN A 1 31  ? 21.076  -1.203  -49.719 0.02 20.22 ?  24   ASN A O    1  
ATOM   352    C CB   . ASN A 1 31  ? 19.380  -1.054  -46.931 0.02 19.64 ?  24   ASN A CB   1  
ATOM   353    C CG   . ASN A 1 31  ? 20.644  -0.311  -46.469 0.02 19.32 ?  24   ASN A CG   1  
ATOM   354    O OD1  . ASN A 1 31  ? 21.459  -0.870  -45.740 0.02 19.15 ?  24   ASN A OD1  1  
ATOM   355    N ND2  . ASN A 1 31  ? 20.794  0.966   -46.878 0.02 19.28 ?  24   ASN A ND2  1  
ATOM   356    H H    . ASN A 1 31  ? 17.257  -1.576  -48.080 0.02 20.20 ?  24   ASN A H    1  
ATOM   357    H HA   . ASN A 1 31  ? 19.223  0.090   -48.621 0.02 19.95 ?  24   ASN A HA   1  
ATOM   358    H HB2  . ASN A 1 31  ? 18.636  -0.700  -46.419 0.02 19.56 ?  24   ASN A HB2  1  
ATOM   359    H HB3  . ASN A 1 31  ? 19.491  -1.999  -46.747 0.02 19.68 ?  24   ASN A HB3  1  
ATOM   360    H HD21 . ASN A 1 31  ? 21.477  1.427   -46.646 0.02 19.35 ?  24   ASN A HD21 1  
ATOM   361    H HD22 . ASN A 1 31  ? 20.207  1.318   -47.397 0.02 19.19 ?  24   ASN A HD22 1  
ATOM   362    N N    . TYR A 1 32  ? 19.537  -2.854  -49.778 0.02 20.56 ?  25   TYR A N    1  
ATOM   363    C CA   . TYR A 1 32  ? 20.206  -3.583  -50.866 0.02 20.89 ?  25   TYR A CA   1  
ATOM   364    C C    . TYR A 1 32  ? 20.287  -2.723  -52.114 0.02 21.13 ?  25   TYR A C    1  
ATOM   365    O O    . TYR A 1 32  ? 21.369  -2.557  -52.705 0.02 21.17 ?  25   TYR A O    1  
ATOM   366    C CB   . TYR A 1 32  ? 19.465  -4.892  -51.175 0.02 21.23 ?  25   TYR A CB   1  
ATOM   367    C CG   . TYR A 1 32  ? 19.817  -5.626  -52.491 0.02 21.68 ?  25   TYR A CG   1  
ATOM   368    C CD1  . TYR A 1 32  ? 20.594  -6.782  -52.486 0.02 21.79 ?  25   TYR A CD1  1  
ATOM   369    C CD2  . TYR A 1 32  ? 19.297  -5.209  -53.725 0.02 22.05 ?  25   TYR A CD2  1  
ATOM   370    C CE1  . TYR A 1 32  ? 20.891  -7.473  -53.671 0.02 22.24 ?  25   TYR A CE1  1  
ATOM   371    C CE2  . TYR A 1 32  ? 19.604  -5.890  -54.915 0.02 22.50 ?  25   TYR A CE2  1  
ATOM   372    C CZ   . TYR A 1 32  ? 20.395  -7.027  -54.872 0.02 22.59 ?  25   TYR A CZ   1  
ATOM   373    O OH   . TYR A 1 32  ? 20.686  -7.719  -56.025 0.02 23.05 ?  25   TYR A OH   1  
ATOM   374    H H    . TYR A 1 32  ? 18.845  -3.253  -49.464 0.02 20.61 ?  25   TYR A H    1  
ATOM   375    H HA   . TYR A 1 32  ? 21.108  -3.805  -50.592 0.02 20.77 ?  25   TYR A HA   1  
ATOM   376    H HB2  . TYR A 1 32  ? 19.641  -5.511  -50.448 0.02 21.10 ?  25   TYR A HB2  1  
ATOM   377    H HB3  . TYR A 1 32  ? 18.516  -4.700  -51.203 0.02 21.30 ?  25   TYR A HB3  1  
ATOM   378    H HD1  . TYR A 1 32  ? 20.940  -7.093  -51.682 0.02 21.57 ?  25   TYR A HD1  1  
ATOM   379    H HD2  . TYR A 1 32  ? 18.768  -4.444  -53.764 0.02 22.01 ?  25   TYR A HD2  1  
ATOM   380    H HE1  . TYR A 1 32  ? 21.423  -8.234  -53.647 0.02 22.31 ?  25   TYR A HE1  1  
ATOM   381    H HE2  . TYR A 1 32  ? 19.261  -5.593  -55.726 0.02 22.76 ?  25   TYR A HE2  1  
ATOM   382    H HH   . TYR A 1 32  ? 21.070  -8.441  -55.833 0.02 23.08 ?  25   TYR A HH   1  
ATOM   383    N N    . ARG A 1 33  ? 19.150  -2.158  -52.526 0.02 21.29 ?  26   ARG A N    1  
ATOM   384    C CA   . ARG A 1 33  ? 19.142  -1.306  -53.706 0.02 21.54 ?  26   ARG A CA   1  
ATOM   385    C C    . ARG A 1 33  ? 20.135  -0.170  -53.557 0.02 21.28 ?  26   ARG A C    1  
ATOM   386    O O    . ARG A 1 33  ? 20.727  0.275   -54.538 0.02 21.50 ?  26   ARG A O    1  
ATOM   387    C CB   . ARG A 1 33  ? 17.737  -0.746  -53.961 0.02 21.70 ?  26   ARG A CB   1  
ATOM   388    C CG   . ARG A 1 33  ? 16.834  -1.563  -54.885 0.02 22.18 ?  26   ARG A CG   1  
ATOM   389    C CD   . ARG A 1 33  ? 15.494  -0.834  -55.174 0.02 22.37 ?  26   ARG A CD   1  
ATOM   390    N NE   . ARG A 1 33  ? 15.623  0.294   -56.099 0.02 22.55 ?  26   ARG A NE   1  
ATOM   391    C CZ   . ARG A 1 33  ? 15.660  0.165   -57.420 0.02 23.01 ?  26   ARG A CZ   1  
ATOM   392    N NH1  . ARG A 1 33  ? 15.557  -1.040  -57.970 0.02 23.34 ?  26   ARG A NH1  1  
ATOM   393    N NH2  . ARG A 1 33  ? 15.788  1.237   -58.184 0.02 23.16 ?  26   ARG A NH2  1  
ATOM   394    H H    . ARG A 1 33  ? 18.388  -2.246  -52.140 0.02 21.28 ?  26   ARG A H    1  
ATOM   395    H HA   . ARG A 1 33  ? 19.402  -1.832  -54.477 0.02 21.82 ?  26   ARG A HA   1  
ATOM   396    H HB2  . ARG A 1 33  ? 17.280  -0.683  -53.110 0.02 21.47 ?  26   ARG A HB2  1  
ATOM   397    H HB3  . ARG A 1 33  ? 17.823  0.138   -54.352 0.02 21.75 ?  26   ARG A HB3  1  
ATOM   398    H HG2  . ARG A 1 33  ? 17.288  -1.704  -55.731 0.02 22.42 ?  26   ARG A HG2  1  
ATOM   399    H HG3  . ARG A 1 33  ? 16.633  -2.414  -54.467 0.02 22.15 ?  26   ARG A HG3  1  
ATOM   400    H HD2  . ARG A 1 33  ? 14.876  -1.468  -55.568 0.02 22.66 ?  26   ARG A HD2  1  
ATOM   401    H HD3  . ARG A 1 33  ? 15.130  -0.498  -54.342 0.02 22.12 ?  26   ARG A HD3  1  
ATOM   402    H HE   . ARG A 1 33  ? 15.494  1.084   -55.788 0.02 22.40 ?  26   ARG A HE   1  
ATOM   403    H HH11 . ARG A 1 33  ? 15.478  -1.741  -57.482 0.02 23.25 ?  26   ARG A HH11 1  
ATOM   404    H HH12 . ARG A 1 33  ? 15.580  -1.120  -58.823 0.02 23.65 ?  26   ARG A HH12 1  
ATOM   405    H HH21 . ARG A 1 33  ? 15.848  2.015   -57.827 0.02 22.97 ?  26   ARG A HH21 1  
ATOM   406    H HH22 . ARG A 1 33  ? 15.805  1.157   -59.040 0.02 23.47 ?  26   ARG A HH22 1  
ATOM   407    N N    . LEU A 1 34  ? 20.352  0.302   -52.339 0.02 20.85 ?  27   LEU A N    1  
ATOM   408    C CA   . LEU A 1 34  ? 21.155  1.493   -52.118 0.02 20.63 ?  27   LEU A CA   1  
ATOM   409    C C    . LEU A 1 34  ? 22.622  1.171   -51.892 0.02 20.49 ?  27   LEU A C    1  
ATOM   410    O O    . LEU A 1 34  ? 23.435  2.093   -51.870 0.02 20.40 ?  27   LEU A O    1  
ATOM   411    C CB   . LEU A 1 34  ? 20.605  2.289   -50.919 0.02 20.27 ?  27   LEU A CB   1  
ATOM   412    C CG   . LEU A 1 34  ? 19.231  2.963   -51.076 0.02 20.39 ?  27   LEU A CG   1  
ATOM   413    C CD1  . LEU A 1 34  ? 18.644  3.383   -49.740 0.02 20.05 ?  27   LEU A CD1  1  
ATOM   414    C CD2  . LEU A 1 34  ? 19.270  4.189   -51.986 0.02 20.56 ?  27   LEU A CD2  1  
ATOM   415    H H    . LEU A 1 34  ? 20.044  -0.054  -51.623 0.02 20.71 ?  27   LEU A H    1  
ATOM   416    H HA   . LEU A 1 34  ? 21.091  2.067   -52.892 0.02 20.82 ?  27   LEU A HA   1  
ATOM   417    H HB2  . LEU A 1 34  ? 20.535  1.670   -50.179 0.02 20.12 ?  27   LEU A HB2  1  
ATOM   418    H HB3  . LEU A 1 34  ? 21.242  2.983   -50.692 0.02 20.11 ?  27   LEU A HB3  1  
ATOM   419    H HG   . LEU A 1 34  ? 18.621  2.324   -51.477 0.02 20.61 ?  27   LEU A HG   1  
ATOM   420    H HD11 . LEU A 1 34  ? 18.857  4.317   -49.582 0.02 19.91 ?  27   LEU A HD11 1  
ATOM   421    H HD12 . LEU A 1 34  ? 17.681  3.265   -49.764 0.02 20.18 ?  27   LEU A HD12 1  
ATOM   422    H HD13 . LEU A 1 34  ? 19.029  2.832   -49.040 0.02 19.89 ?  27   LEU A HD13 1  
ATOM   423    H HD21 . LEU A 1 34  ? 18.536  4.777   -51.755 0.02 20.50 ?  27   LEU A HD21 1  
ATOM   424    H HD22 . LEU A 1 34  ? 20.114  4.649   -51.854 0.02 20.46 ?  27   LEU A HD22 1  
ATOM   425    H HD23 . LEU A 1 34  ? 19.188  3.903   -52.908 0.02 20.86 ?  27   LEU A HD23 1  
ATOM   426    N N    . THR A 1 35  ? 22.974  -0.097  -51.705 0.02 20.51 ?  28   THR A N    1  
ATOM   427    C CA   . THR A 1 35  ? 24.369  -0.492  -51.607 0.02 20.45 ?  28   THR A CA   1  
ATOM   428    C C    . THR A 1 35  ? 25.013  -0.344  -52.976 0.02 20.81 ?  28   THR A C    1  
ATOM   429    O O    . THR A 1 35  ? 24.355  -0.549  -53.999 0.02 21.17 ?  28   THR A O    1  
ATOM   430    C CB   . THR A 1 35  ? 24.480  -1.936  -51.131 0.02 20.46 ?  28   THR A CB   1  
ATOM   431    O OG1  . THR A 1 35  ? 23.897  -2.062  -49.832 0.02 20.15 ?  28   THR A OG1  1  
ATOM   432    C CG2  . THR A 1 35  ? 25.958  -2.395  -51.108 0.02 20.43 ?  28   THR A CG2  1  
ATOM   433    H H    . THR A 1 35  ? 22.425  -0.752  -51.637 0.02 20.57 ?  28   THR A H    1  
ATOM   434    H HA   . THR A 1 35  ? 24.836  0.076   -50.975 0.02 20.21 ?  28   THR A HA   1  
ATOM   435    H HB   . THR A 1 35  ? 23.995  -2.506  -51.748 0.02 20.72 ?  28   THR A HB   1  
ATOM   436    H HG1  . THR A 1 35  ? 23.173  -1.636  -49.802 0.02 20.15 ?  28   THR A HG1  1  
ATOM   437    H HG21 . THR A 1 35  ? 26.046  -3.193  -50.566 0.02 20.48 ?  28   THR A HG21 1  
ATOM   438    H HG22 . THR A 1 35  ? 26.260  -2.583  -52.010 0.02 20.64 ?  28   THR A HG22 1  
ATOM   439    H HG23 . THR A 1 35  ? 26.514  -1.694  -50.733 0.02 20.17 ?  28   THR A HG23 1  
ATOM   440    N N    . THR A 1 36  ? 26.283  0.027   -53.003 0.02 20.76 ?  29   THR A N    1  
ATOM   441    C CA   . THR A 1 36  ? 27.028  0.011   -54.252 0.02 21.13 ?  29   THR A CA   1  
ATOM   442    C C    . THR A 1 36  ? 28.097  -1.065  -54.170 0.02 21.18 ?  29   THR A C    1  
ATOM   443    O O    . THR A 1 36  ? 28.254  -1.758  -53.162 0.02 20.95 ?  29   THR A O    1  
ATOM   444    C CB   . THR A 1 36  ? 27.650  1.374   -54.565 0.02 21.13 ?  29   THR A CB   1  
ATOM   445    O OG1  . THR A 1 36  ? 28.855  1.579   -53.811 0.02 20.88 ?  29   THR A OG1  1  
ATOM   446    C CG2  . THR A 1 36  ? 26.669  2.523   -54.307 0.02 20.99 ?  29   THR A CG2  1  
ATOM   447    H H    . THR A 1 36  ? 26.736  0.291   -52.324 0.02 20.53 ?  29   THR A H    1  
ATOM   448    H HA   . THR A 1 36  ? 26.431  -0.219  -54.976 0.02 21.38 ?  29   THR A HA   1  
ATOM   449    H HB   . THR A 1 36  ? 27.876  1.395   -55.507 0.02 21.42 ?  29   THR A HB   1  
ATOM   450    H HG1  . THR A 1 36  ? 28.903  1.037   -53.174 0.02 20.72 ?  29   THR A HG1  1  
ATOM   451    H HG21 . THR A 1 36  ? 27.045  3.360   -54.618 0.02 21.05 ?  29   THR A HG21 1  
ATOM   452    H HG22 . THR A 1 36  ? 25.838  2.360   -54.780 0.02 21.15 ?  29   THR A HG22 1  
ATOM   453    H HG23 . THR A 1 36  ? 26.483  2.593   -53.358 0.02 20.69 ?  29   THR A HG23 1  
ATOM   454    N N    . ASN A 1 37  ? 28.855  -1.192  -55.259 0.02 21.53 ?  30   ASN A N    1  
ATOM   455    C CA   . ASN A 1 37  ? 29.984  -2.099  -55.333 0.02 21.65 ?  30   ASN A CA   1  
ATOM   456    C C    . ASN A 1 37  ? 31.318  -1.399  -55.089 0.02 21.54 ?  30   ASN A C    1  
ATOM   457    O O    . ASN A 1 37  ? 32.369  -2.018  -55.288 0.02 21.69 ?  30   ASN A O    1  
ATOM   458    C CB   . ASN A 1 37  ? 30.003  -2.799  -56.699 0.02 22.16 ?  30   ASN A CB   1  
ATOM   459    C CG   . ASN A 1 37  ? 28.891  -3.826  -56.852 0.02 22.29 ?  30   ASN A CG   1  
ATOM   460    O OD1  . ASN A 1 37  ? 28.537  -4.526  -55.915 0.02 22.05 ?  30   ASN A OD1  1  
ATOM   461    N ND2  . ASN A 1 37  ? 28.351  -3.925  -58.056 0.02 22.71 ?  30   ASN A ND2  1  
ATOM   462    H H    . ASN A 1 37  ? 28.726  -0.741  -55.977 0.02 21.71 ?  30   ASN A H    1  
ATOM   463    H HA   . ASN A 1 37  ? 29.880  -2.786  -54.658 0.02 21.50 ?  30   ASN A HA   1  
ATOM   464    H HB2  . ASN A 1 37  ? 29.902  -2.138  -57.400 0.02 22.33 ?  30   ASN A HB2  1  
ATOM   465    H HB3  . ASN A 1 37  ? 30.849  -3.264  -56.797 0.02 22.27 ?  30   ASN A HB3  1  
ATOM   466    H HD21 . ASN A 1 37  ? 28.849  -3.879  -58.756 0.02 22.95 ?  30   ASN A HD21 1  
ATOM   467    H HD22 . ASN A 1 37  ? 27.503  -4.049  -58.136 0.02 22.77 ?  30   ASN A HD22 1  
ATOM   468    N N    . GLU A 1 38  ? 31.309  -0.129  -54.664 0.02 21.32 ?  31   GLU A N    1  
ATOM   469    C CA   . GLU A 1 38  ? 32.553  0.583   -54.339 0.02 21.23 ?  31   GLU A CA   1  
ATOM   470    C C    . GLU A 1 38  ? 32.914  0.307   -52.883 0.02 20.82 ?  31   GLU A C    1  
ATOM   471    O O    . GLU A 1 38  ? 32.656  1.112   -51.987 0.02 20.50 ?  31   GLU A O    1  
ATOM   472    C CB   . GLU A 1 38  ? 32.436  2.087   -54.582 0.02 21.22 ?  31   GLU A CB   1  
ATOM   473    C CG   . GLU A 1 38  ? 32.305  2.463   -56.052 0.02 21.65 ?  31   GLU A CG   1  
ATOM   474    C CD   . GLU A 1 38  ? 33.372  3.424   -56.612 0.02 21.91 ?  31   GLU A CD   1  
ATOM   475    O OE1  . GLU A 1 38  ? 33.000  4.075   -57.628 0.02 22.14 ?  31   GLU A OE1  1  
ATOM   476    O OE2  . GLU A 1 38  ? 34.539  3.517   -56.138 0.02 21.91 -1 31   GLU A OE2  1  
ATOM   477    H H    . GLU A 1 38  ? 30.600  0.342   -54.563 0.02 21.23 ?  31   GLU A H    1  
ATOM   478    H HA   . GLU A 1 38  ? 33.272  0.240   -54.888 0.02 21.45 ?  31   GLU A HA   1  
ATOM   479    H HB2  . GLU A 1 38  ? 31.645  2.418   -54.129 0.02 21.00 ?  31   GLU A HB2  1  
ATOM   480    H HB3  . GLU A 1 38  ? 33.225  2.527   -54.234 0.02 21.18 ?  31   GLU A HB3  1  
ATOM   481    H HG2  . GLU A 1 38  ? 32.336  1.647   -56.573 0.02 21.85 ?  31   GLU A HG2  1  
ATOM   482    H HG3  . GLU A 1 38  ? 31.447  2.897   -56.176 0.02 21.60 ?  31   GLU A HG3  1  
ATOM   483    N N    . THR A 1 39  ? 33.527  -0.856  -52.667 0.02 20.87 ?  32   THR A N    1  
ATOM   484    C CA   . THR A 1 39  ? 34.169  -1.167  -51.403 0.02 20.56 ?  32   THR A CA   1  
ATOM   485    C C    . THR A 1 39  ? 35.477  -0.398  -51.289 0.02 20.56 ?  32   THR A C    1  
ATOM   486    O O    . THR A 1 39  ? 36.137  -0.090  -52.290 0.02 20.87 ?  32   THR A O    1  
ATOM   487    C CB   . THR A 1 39  ? 34.454  -2.665  -51.294 0.02 20.67 ?  32   THR A CB   1  
ATOM   488    O OG1  . THR A 1 39  ? 35.224  -3.084  -52.427 0.02 21.07 ?  32   THR A OG1  1  
ATOM   489    C CG2  . THR A 1 39  ? 33.158  -3.466  -51.246 0.02 20.69 ?  32   THR A CG2  1  
ATOM   490    H H    . THR A 1 39  ? 33.579  -1.489  -53.243 0.02 21.09 ?  32   THR A H    1  
ATOM   491    H HA   . THR A 1 39  ? 33.592  -0.904  -50.673 0.02 20.31 ?  32   THR A HA   1  
ATOM   492    H HB   . THR A 1 39  ? 34.954  -2.844  -50.484 0.02 20.49 ?  32   THR A HB   1  
ATOM   493    H HG1  . THR A 1 39  ? 35.983  -2.728  -52.405 0.02 21.08 ?  32   THR A HG1  1  
ATOM   494    H HG21 . THR A 1 39  ? 32.652  -3.222  -50.455 0.02 20.43 ?  32   THR A HG21 1  
ATOM   495    H HG22 . THR A 1 39  ? 32.622  -3.284  -52.033 0.02 20.88 ?  32   THR A HG22 1  
ATOM   496    H HG23 . THR A 1 39  ? 33.354  -4.415  -51.213 0.02 20.77 ?  32   THR A HG23 1  
ATOM   497    N N    . VAL A 1 40  ? 35.862  -0.084  -50.052 0.02 20.24 ?  33   VAL A N    1  
ATOM   498    C CA   . VAL A 1 40  ? 37.096  0.650   -49.807 0.02 20.24 ?  33   VAL A CA   1  
ATOM   499    C C    . VAL A 1 40  ? 37.653  0.279   -48.450 0.02 19.97 ?  33   VAL A C    1  
ATOM   500    O O    . VAL A 1 40  ? 36.929  -0.175  -47.568 0.02 19.72 ?  33   VAL A O    1  
ATOM   501    C CB   . VAL A 1 40  ? 36.901  2.161   -49.875 0.02 20.19 ?  33   VAL A CB   1  
ATOM   502    C CG1  . VAL A 1 40  ? 36.557  2.560   -51.310 0.02 20.53 ?  33   VAL A CG1  1  
ATOM   503    C CG2  . VAL A 1 40  ? 35.830  2.619   -48.890 0.02 19.83 ?  33   VAL A CG2  1  
ATOM   504    H H    . VAL A 1 40  ? 35.428  -0.298  -49.345 0.02 20.03 ?  33   VAL A H    1  
ATOM   505    H HA   . VAL A 1 40  ? 37.754  0.397   -50.471 0.02 20.50 ?  33   VAL A HA   1  
ATOM   506    H HB   . VAL A 1 40  ? 37.737  2.587   -49.631 0.02 20.19 ?  33   VAL A HB   1  
ATOM   507    H HG11 . VAL A 1 40  ? 37.149  2.086   -51.911 0.02 20.77 ?  33   VAL A HG11 1  
ATOM   508    H HG12 . VAL A 1 40  ? 35.637  2.321   -51.497 0.02 20.52 ?  33   VAL A HG12 1  
ATOM   509    H HG13 . VAL A 1 40  ? 36.684  3.515   -51.408 0.02 20.55 ?  33   VAL A HG13 1  
ATOM   510    H HG21 . VAL A 1 40  ? 35.467  1.851   -48.422 0.02 19.72 ?  33   VAL A HG21 1  
ATOM   511    H HG22 . VAL A 1 40  ? 36.232  3.232   -48.258 0.02 19.68 ?  33   VAL A HG22 1  
ATOM   512    H HG23 . VAL A 1 40  ? 35.125  3.067   -49.381 0.02 19.90 ?  33   VAL A HG23 1  
ATOM   513    N N    . VAL A 1 41  ? 38.957  0.502   -48.294 0.02 20.06 ?  34   VAL A N    1  
ATOM   514    C CA   . VAL A 1 41  ? 39.693  0.062   -47.118 0.02 19.90 ?  34   VAL A CA   1  
ATOM   515    C C    . VAL A 1 41  ? 40.280  1.268   -46.413 0.02 19.76 ?  34   VAL A C    1  
ATOM   516    O O    . VAL A 1 41  ? 40.951  2.096   -47.034 0.02 19.96 ?  34   VAL A O    1  
ATOM   517    C CB   . VAL A 1 41  ? 40.796  -0.950  -47.481 0.02 20.19 ?  34   VAL A CB   1  
ATOM   518    C CG1  . VAL A 1 41  ? 41.627  -1.276  -46.238 0.02 20.04 ?  34   VAL A CG1  1  
ATOM   519    C CG2  . VAL A 1 41  ? 40.182  -2.221  -48.073 0.02 20.35 ?  34   VAL A CG2  1  
ATOM   520    H H    . VAL A 1 41  ? 39.443  0.920   -48.864 0.02 20.24 ?  34   VAL A H    1  
ATOM   521    H HA   . VAL A 1 41  ? 39.080  -0.365  -46.501 0.02 19.71 ?  34   VAL A HA   1  
ATOM   522    H HB   . VAL A 1 41  ? 41.385  -0.559  -48.144 0.02 20.39 ?  34   VAL A HB   1  
ATOM   523    H HG11 . VAL A 1 41  ? 42.194  -2.038  -46.440 0.02 20.22 ?  34   VAL A HG11 1  
ATOM   524    H HG12 . VAL A 1 41  ? 42.170  -0.507  -46.003 0.02 20.01 ?  34   VAL A HG12 1  
ATOM   525    H HG13 . VAL A 1 41  ? 41.035  -1.496  -45.505 0.02 19.81 ?  34   VAL A HG13 1  
ATOM   526    H HG21 . VAL A 1 41  ? 40.881  -2.879  -48.218 0.02 20.49 ?  34   VAL A HG21 1  
ATOM   527    H HG22 . VAL A 1 41  ? 39.526  -2.572  -47.454 0.02 20.16 ?  34   VAL A HG22 1  
ATOM   528    H HG23 . VAL A 1 41  ? 39.755  -2.003  -48.917 0.02 20.53 ?  34   VAL A HG23 1  
ATOM   529    N N    . ALA A 1 42  ? 40.051  1.346   -45.109 0.02 19.45 ?  35   ALA A N    1  
ATOM   530    C CA   . ALA A 1 42  ? 40.624  2.365   -44.256 0.02 19.32 ?  35   ALA A CA   1  
ATOM   531    C C    . ALA A 1 42  ? 41.414  1.668   -43.167 0.02 19.24 ?  35   ALA A C    1  
ATOM   532    O O    . ALA A 1 42  ? 41.128  0.533   -42.807 0.02 19.16 ?  35   ALA A O    1  
ATOM   533    C CB   . ALA A 1 42  ? 39.542  3.263   -43.648 0.02 19.04 ?  35   ALA A CB   1  
ATOM   534    H H    . ALA A 1 42  ? 39.559  0.788   -44.682 0.02 19.32 ?  35   ALA A H    1  
ATOM   535    H HA   . ALA A 1 42  ? 41.233  2.916   -44.768 0.02 19.50 ?  35   ALA A HA   1  
ATOM   536    H HB1  . ALA A 1 42  ? 39.948  3.884   -43.026 0.02 18.98 ?  35   ALA A HB1  1  
ATOM   537    H HB2  . ALA A 1 42  ? 39.107  3.751   -44.362 0.02 19.12 ?  35   ALA A HB2  1  
ATOM   538    H HB3  . ALA A 1 42  ? 38.905  2.701   -43.183 0.02 18.87 ?  35   ALA A HB3  1  
ATOM   539    N N    . GLU A 1 43  ? 42.443  2.323   -42.679 0.02 19.30 ?  36   GLU A N    1  
ATOM   540    C CA   . GLU A 1 43  ? 43.384  1.667   -41.797 0.02 19.30 ?  36   GLU A CA   1  
ATOM   541    C C    . GLU A 1 43  ? 43.195  2.239   -40.376 0.02 19.00 ?  36   GLU A C    1  
ATOM   542    O O    . GLU A 1 43  ? 43.081  3.456   -40.207 0.02 18.91 ?  36   GLU A O    1  
ATOM   543    C CB   . GLU A 1 43  ? 44.800  1.840   -42.423 0.02 19.65 ?  36   GLU A CB   1  
ATOM   544    C CG   . GLU A 1 43  ? 44.811  1.552   -44.017 0.02 19.96 ?  36   GLU A CG   1  
ATOM   545    C CD   . GLU A 1 43  ? 46.157  1.725   -44.761 0.02 20.37 ?  36   GLU A CD   1  
ATOM   546    O OE1  . GLU A 1 43  ? 46.747  0.709   -45.243 0.02 20.60 ?  36   GLU A OE1  1  
ATOM   547    O OE2  . GLU A 1 43  ? 46.620  2.879   -44.934 0.02 20.49 -1 36   GLU A OE2  1  
ATOM   548    H H    . GLU A 1 43  ? 42.616  3.148   -42.838 0.02 19.36 ?  36   GLU A H    1  
ATOM   549    H HA   . GLU A 1 43  ? 43.203  0.716   -41.771 0.02 19.30 ?  36   GLU A HA   1  
ATOM   550    H HB2  . GLU A 1 43  ? 45.104  2.751   -42.284 0.02 19.64 ?  36   GLU A HB2  1  
ATOM   551    H HB3  . GLU A 1 43  ? 45.414  1.230   -42.010 0.02 19.71 ?  36   GLU A HB3  1  
ATOM   552    H HG2  . GLU A 1 43  ? 44.533  0.635   -44.172 0.02 19.96 ?  36   GLU A HG2  1  
ATOM   553    H HG3  . GLU A 1 43  ? 44.186  2.160   -44.445 0.02 19.93 ?  36   GLU A HG3  1  
ATOM   554    N N    . THR A 1 44  ? 43.023  1.351   -39.376 0.02 18.86 ?  37   THR A N    1  
ATOM   555    C CA   . THR A 1 44  ? 42.785  1.744   -37.975 0.02 18.61 ?  37   THR A CA   1  
ATOM   556    C C    . THR A 1 44  ? 43.929  1.254   -37.110 0.02 18.70 ?  37   THR A C    1  
ATOM   557    O O    . THR A 1 44  ? 44.693  0.374   -37.501 0.02 18.92 ?  37   THR A O    1  
ATOM   558    C CB   . THR A 1 44  ? 41.469  1.200   -37.351 0.02 18.33 ?  37   THR A CB   1  
ATOM   559    O OG1  . THR A 1 44  ? 41.623  -0.147  -36.864 0.02 18.34 ?  37   THR A OG1  1  
ATOM   560    C CG2  . THR A 1 44  ? 40.317  1.244   -38.318 0.02 18.30 ?  37   THR A CG2  1  
ATOM   561    H H    . THR A 1 44  ? 43.054  0.500   -39.487 0.02 18.93 ?  37   THR A H    1  
ATOM   562    H HA   . THR A 1 44  ? 42.766  2.711   -37.914 0.02 18.58 ?  37   THR A HA   1  
ATOM   563    H HB   . THR A 1 44  ? 41.229  1.766   -36.599 0.02 18.18 ?  37   THR A HB   1  
ATOM   564    H HG1  . THR A 1 44  ? 40.945  -0.371  -36.427 0.02 18.20 ?  37   THR A HG1  1  
ATOM   565    H HG21 . THR A 1 44  ? 39.621  0.641   -38.018 0.02 18.18 ?  37   THR A HG21 1  
ATOM   566    H HG22 . THR A 1 44  ? 39.958  2.144   -38.364 0.02 18.24 ?  37   THR A HG22 1  
ATOM   567    H HG23 . THR A 1 44  ? 40.609  0.971   -39.202 0.02 18.48 ?  37   THR A HG23 1  
ATOM   568    N N    . GLU A 1 45  ? 43.968  1.755   -35.873 0.02 18.55 ?  38   GLU A N    1  
ATOM   569    C CA   . GLU A 1 45  ? 45.069  1.409   -34.991 0.02 18.68 ?  38   GLU A CA   1  
ATOM   570    C C    . GLU A 1 45  ? 45.109  -0.077  -34.700 0.02 18.71 ?  38   GLU A C    1  
ATOM   571    O O    . GLU A 1 45  ? 46.134  -0.593  -34.239 0.02 18.89 ?  38   GLU A O    1  
ATOM   572    C CB   . GLU A 1 45  ? 44.983  2.204   -33.683 0.02 18.52 ?  38   GLU A CB   1  
ATOM   573    C CG   . GLU A 1 45  ? 43.973  1.749   -32.646 0.02 18.24 ?  38   GLU A CG   1  
ATOM   574    C CD   . GLU A 1 45  ? 44.052  2.612   -31.396 0.02 18.12 ?  38   GLU A CD   1  
ATOM   575    O OE1  . GLU A 1 45  ? 45.010  2.456   -30.592 0.02 18.26 ?  38   GLU A OE1  1  
ATOM   576    O OE2  . GLU A 1 45  ? 43.173  3.488   -31.258 0.02 17.92 -1 38   GLU A OE2  1  
ATOM   577    H H    . GLU A 1 45  ? 43.380  2.275   -35.527 0.02 18.40 ?  38   GLU A H    1  
ATOM   578    H HA   . GLU A 1 45  ? 45.903  1.644   -35.429 0.02 18.88 ?  38   GLU A HA   1  
ATOM   579    H HB2  . GLU A 1 45  ? 45.850  2.164   -33.254 0.02 18.65 ?  38   GLU A HB2  1  
ATOM   580    H HB3  . GLU A 1 45  ? 44.778  3.126   -33.896 0.02 18.49 ?  38   GLU A HB3  1  
ATOM   581    H HG2  . GLU A 1 45  ? 43.082  1.824   -33.019 0.02 18.12 ?  38   GLU A HG2  1  
ATOM   582    H HG3  . GLU A 1 45  ? 44.154  0.836   -32.385 0.02 18.29 ?  38   GLU A HG3  1  
ATOM   583    N N    . TYR A 1 46  ? 44.008  -0.765  -34.940 0.02 18.56 ?  39   TYR A N    1  
ATOM   584    C CA   . TYR A 1 46  ? 43.876  -2.166  -34.626 0.02 18.59 ?  39   TYR A CA   1  
ATOM   585    C C    . TYR A 1 46  ? 43.852  -3.041  -35.862 0.02 18.78 ?  39   TYR A C    1  
ATOM   586    O O    . TYR A 1 46  ? 43.832  -4.271  -35.725 0.02 18.87 ?  39   TYR A O    1  
ATOM   587    C CB   . TYR A 1 46  ? 42.594  -2.384  -33.830 0.02 18.32 ?  39   TYR A CB   1  
ATOM   588    C CG   . TYR A 1 46  ? 42.579  -1.699  -32.487 0.02 18.16 ?  39   TYR A CG   1  
ATOM   589    C CD1  . TYR A 1 46  ? 43.385  -2.135  -31.441 0.02 18.24 ?  39   TYR A CD1  1  
ATOM   590    C CD2  . TYR A 1 46  ? 41.719  -0.634  -32.249 0.02 17.95 ?  39   TYR A CD2  1  
ATOM   591    C CE1  . TYR A 1 46  ? 43.342  -1.520  -30.208 0.02 18.13 ?  39   TYR A CE1  1  
ATOM   592    C CE2  . TYR A 1 46  ? 41.660  -0.013  -31.007 0.02 17.83 ?  39   TYR A CE2  1  
ATOM   593    C CZ   . TYR A 1 46  ? 42.492  -0.455  -29.992 0.02 17.92 ?  39   TYR A CZ   1  
ATOM   594    O OH   . TYR A 1 46  ? 42.417  0.156   -28.752 0.02 17.83 ?  39   TYR A OH   1  
ATOM   595    H H    . TYR A 1 46  ? 43.301  -0.429  -35.294 0.02 18.46 ?  39   TYR A H    1  
ATOM   596    H HA   . TYR A 1 46  ? 44.619  -2.445  -34.072 0.02 18.69 ?  39   TYR A HA   1  
ATOM   597    H HB2  . TYR A 1 46  ? 41.849  -2.035  -34.342 0.02 18.22 ?  39   TYR A HB2  1  
ATOM   598    H HB3  . TYR A 1 46  ? 42.474  -3.332  -33.679 0.02 18.36 ?  39   TYR A HB3  1  
ATOM   599    H HD1  . TYR A 1 46  ? 43.969  -2.849  -31.573 0.02 18.40 ?  39   TYR A HD1  1  
ATOM   600    H HD2  . TYR A 1 46  ? 41.165  -0.337  -32.936 0.02 17.91 ?  39   TYR A HD2  1  
ATOM   601    H HE1  . TYR A 1 46  ? 43.893  -1.826  -29.522 0.02 18.21 ?  39   TYR A HE1  1  
ATOM   602    H HE2  . TYR A 1 46  ? 41.086  0.702   -30.863 0.02 17.71 ?  39   TYR A HE2  1  
ATOM   603    H HH   . TYR A 1 46  ? 41.842  0.768   -28.766 0.02 17.74 ?  39   TYR A HH   1  
ATOM   604    N N    . GLY A 1 47  ? 43.854  -2.438  -37.056 0.02 18.88 ?  40   GLY A N    1  
ATOM   605    C CA   . GLY A 1 47  ? 43.846  -3.192  -38.298 0.02 19.10 ?  40   GLY A CA   1  
ATOM   606    C C    . GLY A 1 47  ? 43.001  -2.516  -39.357 0.02 19.06 ?  40   GLY A C    1  
ATOM   607    O O    . GLY A 1 47  ? 42.335  -1.512  -39.082 0.02 18.84 ?  40   GLY A O    1  
ATOM   608    H H    . GLY A 1 47  ? 43.849  -1.588  -37.169 0.02 18.84 ?  40   GLY A H    1  
ATOM   609    H HA2  . GLY A 1 47  ? 44.751  -3.269  -38.633 0.02 19.31 ?  40   GLY A HA2  1  
ATOM   610    H HA3  . GLY A 1 47  ? 43.499  -4.083  -38.145 0.02 19.10 ?  40   GLY A HA3  1  
ATOM   611    N N    . LYS A 1 48  ? 43.078  -3.027  -40.588 0.02 19.30 ?  41   LYS A N    1  
ATOM   612    C CA   . LYS A 1 48  ? 42.345  -2.473  -41.709 0.02 19.33 ?  41   LYS A CA   1  
ATOM   613    C C    . LYS A 1 48  ? 40.874  -2.862  -41.655 0.02 19.14 ?  41   LYS A C    1  
ATOM   614    O O    . LYS A 1 48  ? 40.520  -3.974  -41.259 0.02 19.14 ?  41   LYS A O    1  
ATOM   615    C CB   . LYS A 1 48  ? 42.935  -2.961  -43.035 0.02 19.70 ?  41   LYS A CB   1  
ATOM   616    C CG   . LYS A 1 48  ? 44.326  -2.488  -43.381 0.02 19.95 ?  41   LYS A CG   1  
ATOM   617    C CD   . LYS A 1 48  ? 44.660  -2.957  -44.834 0.02 20.33 ?  41   LYS A CD   1  
ATOM   618    C CE   . LYS A 1 48  ? 46.158  -3.163  -45.170 0.02 20.69 ?  41   LYS A CE   1  
ATOM   619    N NZ   . LYS A 1 48  ? 46.366  -3.602  -46.628 0.02 21.07 ?  41   LYS A NZ   1  
ATOM   620    H H    . LYS A 1 48  ? 43.567  -3.704  -40.795 0.02 19.48 ?  41   LYS A H    1  
ATOM   621    H HA   . LYS A 1 48  ? 42.415  -1.507  -41.688 0.02 19.27 ?  41   LYS A HA   1  
ATOM   622    H HB2  . LYS A 1 48  ? 42.960  -3.929  -43.021 0.02 19.78 ?  41   LYS A HB2  1  
ATOM   623    H HB3  . LYS A 1 48  ? 42.347  -2.669  -43.748 0.02 19.72 ?  41   LYS A HB3  1  
ATOM   624    H HG2  . LYS A 1 48  ? 44.358  -1.519  -43.344 0.02 19.88 ?  41   LYS A HG2  1  
ATOM   625    H HG3  . LYS A 1 48  ? 44.967  -2.876  -42.768 0.02 19.99 ?  41   LYS A HG3  1  
ATOM   626    H HD2  . LYS A 1 48  ? 44.220  -3.805  -44.988 0.02 20.35 ?  41   LYS A HD2  1  
ATOM   627    H HD3  . LYS A 1 48  ? 44.311  -2.299  -45.457 0.02 20.34 ?  41   LYS A HD3  1  
ATOM   628    H HE2  . LYS A 1 48  ? 46.633  -2.329  -45.029 0.02 20.70 ?  41   LYS A HE2  1  
ATOM   629    H HE3  . LYS A 1 48  ? 46.521  -3.854  -44.595 0.02 20.69 ?  41   LYS A HE3  1  
ATOM   630    H HZ1  . LYS A 1 48  ? 45.947  -3.039  -47.175 0.02 21.09 ?  41   LYS A HZ1  1  
ATOM   631    H HZ2  . LYS A 1 48  ? 47.234  -3.609  -46.826 0.02 21.29 ?  41   LYS A HZ2  1  
ATOM   632    H HZ3  . LYS A 1 48  ? 46.036  -4.420  -46.756 0.02 21.08 ?  41   LYS A HZ3  1  
ATOM   633    N N    . VAL A 1 49  ? 40.028  -1.967  -42.131 0.02 19.04 ?  42   VAL A N    1  
ATOM   634    C CA   . VAL A 1 49  ? 38.594  -2.206  -42.208 0.02 18.90 ?  42   VAL A CA   1  
ATOM   635    C C    . VAL A 1 49  ? 38.093  -1.913  -43.619 0.02 19.10 ?  42   VAL A C    1  
ATOM   636    O O    . VAL A 1 49  ? 38.447  -0.900  -44.227 0.02 19.18 ?  42   VAL A O    1  
ATOM   637    C CB   . VAL A 1 49  ? 37.812  -1.359  -41.183 0.02 18.58 ?  42   VAL A CB   1  
ATOM   638    C CG1  . VAL A 1 49  ? 38.101  -1.842  -39.774 0.02 18.40 ?  42   VAL A CG1  1  
ATOM   639    C CG2  . VAL A 1 49  ? 38.130  0.122   -41.348 0.02 18.54 ?  42   VAL A CG2  1  
ATOM   640    H H    . VAL A 1 49  ? 40.264  -1.193  -42.422 0.02 19.06 ?  42   VAL A H    1  
ATOM   641    H HA   . VAL A 1 49  ? 38.425  -3.143  -42.023 0.02 18.93 ?  42   VAL A HA   1  
ATOM   642    H HB   . VAL A 1 49  ? 36.863  -1.480  -41.341 0.02 18.52 ?  42   VAL A HB   1  
ATOM   643    H HG11 . VAL A 1 49  ? 37.456  -1.439  -39.174 0.02 18.22 ?  42   VAL A HG11 1  
ATOM   644    H HG12 . VAL A 1 49  ? 38.019  -2.807  -39.750 0.02 18.48 ?  42   VAL A HG12 1  
ATOM   645    H HG13 . VAL A 1 49  ? 39.001  -1.577  -39.529 0.02 18.44 ?  42   VAL A HG13 1  
ATOM   646    H HG21 . VAL A 1 49  ? 37.627  0.629   -40.696 0.02 18.35 ?  42   VAL A HG21 1  
ATOM   647    H HG22 . VAL A 1 49  ? 39.078  0.264   -41.216 0.02 18.62 ?  42   VAL A HG22 1  
ATOM   648    H HG23 . VAL A 1 49  ? 37.878  0.397   -42.241 0.02 18.66 ?  42   VAL A HG23 1  
ATOM   649    N N    . LYS A 1 50  ? 37.179  -2.752  -44.077 0.02 19.18 ?  43   LYS A N    1  
ATOM   650    C CA   . LYS A 1 50  ? 36.660  -2.695  -45.430 0.02 19.38 ?  43   LYS A CA   1  
ATOM   651    C C    . LYS A 1 50  ? 35.241  -2.152  -45.322 0.02 19.17 ?  43   LYS A C    1  
ATOM   652    O O    . LYS A 1 50  ? 34.433  -2.689  -44.562 0.02 18.99 ?  43   LYS A O    1  
ATOM   653    C CB   . LYS A 1 50  ? 36.757  -4.099  -46.047 0.02 19.66 ?  43   LYS A CB   1  
ATOM   654    C CG   . LYS A 1 50  ? 36.255  -4.327  -47.454 0.02 19.89 ?  43   LYS A CG   1  
ATOM   655    C CD   . LYS A 1 50  ? 34.791  -4.297  -47.477 0.02 19.74 ?  43   LYS A CD   1  
ATOM   656    C CE   . LYS A 1 50  ? 34.024  -5.545  -48.151 0.02 20.02 ?  43   LYS A CE   1  
ATOM   657    N NZ   . LYS A 1 50  ? 34.713  -6.667  -48.887 0.02 20.35 ?  43   LYS A NZ   1  
ATOM   658    H H    . LYS A 1 50  ? 36.819  -3.370  -43.607 0.02 19.14 ?  43   LYS A H    1  
ATOM   659    H HA   . LYS A 1 50  ? 37.189  -2.076  -45.955 0.02 19.49 ?  43   LYS A HA   1  
ATOM   660    H HB2  . LYS A 1 50  ? 37.699  -4.299  -46.095 0.02 19.81 ?  43   LYS A HB2  1  
ATOM   661    H HB3  . LYS A 1 50  ? 36.329  -4.746  -45.468 0.02 19.57 ?  43   LYS A HB3  1  
ATOM   662    H HG2  . LYS A 1 50  ? 36.586  -3.629  -48.034 0.02 19.93 ?  43   LYS A HG2  1  
ATOM   663    H HG3  . LYS A 1 50  ? 36.541  -5.198  -47.772 0.02 20.12 ?  43   LYS A HG3  1  
ATOM   664    H HD2  . LYS A 1 50  ? 34.473  -4.230  -46.565 0.02 19.54 ?  43   LYS A HD2  1  
ATOM   665    H HD3  . LYS A 1 50  ? 34.539  -3.494  -47.962 0.02 19.67 ?  43   LYS A HD3  1  
ATOM   666    H HE2  . LYS A 1 50  ? 33.510  -5.977  -47.450 0.02 19.93 ?  43   LYS A HE2  1  
ATOM   667    H HE3  . LYS A 1 50  ? 33.399  -5.171  -48.792 0.02 20.11 ?  43   LYS A HE3  1  
ATOM   668    H HZ1  . LYS A 1 50  ? 34.124  -7.307  -49.076 0.02 20.48 ?  43   LYS A HZ1  1  
ATOM   669    H HZ2  . LYS A 1 50  ? 35.066  -6.368  -49.648 0.02 20.50 ?  43   LYS A HZ2  1  
ATOM   670    H HZ3  . LYS A 1 50  ? 35.360  -7.010  -48.382 0.02 20.28 ?  43   LYS A HZ3  1  
ATOM   671    N N    . GLY A 1 51  ? 34.973  -1.039  -46.001 0.02 19.22 ?  44   GLY A N    1  
ATOM   672    C CA   . GLY A 1 51  ? 33.688  -0.361  -45.985 0.02 19.09 ?  44   GLY A CA   1  
ATOM   673    C C    . GLY A 1 51  ? 33.098  -0.283  -47.379 0.02 19.38 ?  44   GLY A C    1  
ATOM   674    O O    . GLY A 1 51  ? 33.647  -0.893  -48.290 0.02 19.67 ?  44   GLY A O    1  
ATOM   675    H H    . GLY A 1 51  ? 35.547  -0.646  -46.501 0.02 19.35 ?  44   GLY A H    1  
ATOM   676    H HA2  . GLY A 1 51  ? 33.066  -0.828  -45.408 0.02 18.97 ?  44   GLY A HA2  1  
ATOM   677    H HA3  . GLY A 1 51  ? 33.798  0.545   -45.657 0.02 18.97 ?  44   GLY A HA3  1  
ATOM   678    N N    . VAL A 1 52  ? 31.997  0.443   -47.565 0.02 19.33 ?  45   VAL A N    1  
ATOM   679    C CA   . VAL A 1 52  ? 31.341  0.491   -48.869 0.02 19.63 ?  45   VAL A CA   1  
ATOM   680    C C    . VAL A 1 52  ? 30.574  1.799   -49.051 0.02 19.57 ?  45   VAL A C    1  
ATOM   681    O O    . VAL A 1 52  ? 30.017  2.366   -48.105 0.02 19.29 ?  45   VAL A O    1  
ATOM   682    C CB   . VAL A 1 52  ? 30.415  -0.724  -49.051 0.02 19.73 ?  45   VAL A CB   1  
ATOM   683    C CG1  . VAL A 1 52  ? 29.250  -0.669  -48.069 0.02 19.46 ?  45   VAL A CG1  1  
ATOM   684    C CG2  . VAL A 1 52  ? 29.912  -0.758  -50.498 0.02 20.11 ?  45   VAL A CG2  1  
ATOM   685    H H    . VAL A 1 52  ? 31.607  0.911   -46.962 0.02 19.15 ?  45   VAL A H    1  
ATOM   686    H HA   . VAL A 1 52  ? 32.028  0.446   -49.552 0.02 19.83 ?  45   VAL A HA   1  
ATOM   687    H HB   . VAL A 1 52  ? 30.923  -1.533  -48.892 0.02 19.76 ?  45   VAL A HB   1  
ATOM   688    H HG11 . VAL A 1 52  ? 29.076  -1.560  -47.735 0.02 19.46 ?  45   VAL A HG11 1  
ATOM   689    H HG12 . VAL A 1 52  ? 29.479  -0.087  -47.331 0.02 19.24 ?  45   VAL A HG12 1  
ATOM   690    H HG13 . VAL A 1 52  ? 28.471  -0.321  -48.530 0.02 19.54 ?  45   VAL A HG13 1  
ATOM   691    H HG21 . VAL A 1 52  ? 29.480  -1.608  -50.669 0.02 20.22 ?  45   VAL A HG21 1  
ATOM   692    H HG22 . VAL A 1 52  ? 29.276  -0.037  -50.623 0.02 20.09 ?  45   VAL A HG22 1  
ATOM   693    H HG23 . VAL A 1 52  ? 30.663  -0.643  -51.098 0.02 20.27 ?  45   VAL A HG23 1  
ATOM   694    N N    . LYS A 1 53  ? 30.557  2.293   -50.287 0.02 19.87 ?  46   LYS A N    1  
ATOM   695    C CA   . LYS A 1 53  ? 29.693  3.408   -50.652 0.02 19.90 ?  46   LYS A CA   1  
ATOM   696    C C    . LYS A 1 53  ? 28.242  2.958   -50.694 0.02 19.91 ?  46   LYS A C    1  
ATOM   697    O O    . LYS A 1 53  ? 27.919  1.924   -51.274 0.02 20.12 ?  46   LYS A O    1  
ATOM   698    C CB   . LYS A 1 53  ? 30.080  3.984   -52.024 0.02 20.27 ?  46   LYS A CB   1  
ATOM   699    C CG   . LYS A 1 53  ? 29.203  5.183   -52.419 0.02 20.35 ?  46   LYS A CG   1  
ATOM   700    C CD   . LYS A 1 53  ? 29.619  5.835   -53.748 0.02 20.75 ?  46   LYS A CD   1  
ATOM   701    C CE   . LYS A 1 53  ? 30.541  6.995   -53.508 0.02 20.71 ?  46   LYS A CE   1  
ATOM   702    N NZ   . LYS A 1 53  ? 31.167  7.417   -54.803 0.02 21.13 ?  46   LYS A NZ   1  
ATOM   703    H H    . LYS A 1 53  ? 31.043  2.000   -50.929 0.02 20.07 ?  46   LYS A H    1  
ATOM   704    H HA   . LYS A 1 53  ? 29.777  4.117   -49.999 0.02 19.70 ?  46   LYS A HA   1  
ATOM   705    H HB2  . LYS A 1 53  ? 31.001  4.283   -51.998 0.02 20.29 ?  46   LYS A HB2  1  
ATOM   706    H HB3  . LYS A 1 53  ? 29.974  3.289   -52.683 0.02 20.48 ?  46   LYS A HB3  1  
ATOM   707    H HG2  . LYS A 1 53  ? 28.285  4.887   -52.514 0.02 20.36 ?  46   LYS A HG2  1  
ATOM   708    H HG3  . LYS A 1 53  ? 29.263  5.858   -51.728 0.02 20.14 ?  46   LYS A HG3  1  
ATOM   709    H HD2  . LYS A 1 53  ? 30.083  5.182   -54.295 0.02 20.93 ?  46   LYS A HD2  1  
ATOM   710    H HD3  . LYS A 1 53  ? 28.832  6.163   -54.210 0.02 20.88 ?  46   LYS A HD3  1  
ATOM   711    H HE2  . LYS A 1 53  ? 30.039  7.741   -53.148 0.02 20.61 ?  46   LYS A HE2  1  
ATOM   712    H HE3  . LYS A 1 53  ? 31.247  6.731   -52.897 0.02 20.54 ?  46   LYS A HE3  1  
ATOM   713    H HZ1  . LYS A 1 53  ? 31.258  8.301   -54.820 0.02 21.16 ?  46   LYS A HZ1  1  
ATOM   714    H HZ2  . LYS A 1 53  ? 31.969  7.040   -54.894 0.02 21.19 ?  46   LYS A HZ2  1  
ATOM   715    H HZ3  . LYS A 1 53  ? 30.648  7.164   -55.481 0.02 21.33 ?  46   LYS A HZ3  1  
ATOM   716    N N    . ARG A 1 54  ? 27.365  3.768   -50.107 0.02 19.71 ?  47   ARG A N    1  
ATOM   717    C CA   . ARG A 1 54  ? 25.929  3.564   -50.134 0.02 19.74 ?  47   ARG A CA   1  
ATOM   718    C C    . ARG A 1 54  ? 25.278  4.823   -50.690 0.02 19.86 ?  47   ARG A C    1  
ATOM   719    O O    . ARG A 1 54  ? 25.820  5.921   -50.567 0.02 19.79 ?  47   ARG A O    1  
ATOM   720    C CB   . ARG A 1 54  ? 25.396  3.276   -48.703 0.02 19.39 ?  47   ARG A CB   1  
ATOM   721    C CG   . ARG A 1 54  ? 26.009  2.065   -48.004 0.02 19.25 ?  47   ARG A CG   1  
ATOM   722    C CD   . ARG A 1 54  ? 25.295  1.692   -46.671 0.02 18.98 ?  47   ARG A CD   1  
ATOM   723    N NE   . ARG A 1 54  ? 25.988  0.564   -46.041 0.02 18.90 ?  47   ARG A NE   1  
ATOM   724    C CZ   . ARG A 1 54  ? 25.799  -0.714  -46.340 0.02 19.07 ?  47   ARG A CZ   1  
ATOM   725    N NH1  . ARG A 1 54  ? 24.886  -1.062  -47.220 0.02 19.34 ?  47   ARG A NH1  1  
ATOM   726    N NH2  . ARG A 1 54  ? 26.515  -1.651  -45.741 0.02 19.01 ?  47   ARG A NH2  1  
ATOM   727    H H    . ARG A 1 54  ? 27.590  4.474   -49.678 0.02 19.57 ?  47   ARG A H    1  
ATOM   728    H HA   . ARG A 1 54  ? 25.706  2.816   -50.707 0.02 19.93 ?  47   ARG A HA   1  
ATOM   729    H HB2  . ARG A 1 54  ? 25.584  4.055   -48.164 0.02 19.22 ?  47   ARG A HB2  1  
ATOM   730    H HB3  . ARG A 1 54  ? 24.439  3.134   -48.757 0.02 19.44 ?  47   ARG A HB3  1  
ATOM   731    H HG2  . ARG A 1 54  ? 25.941  1.297   -48.592 0.02 19.45 ?  47   ARG A HG2  1  
ATOM   732    H HG3  . ARG A 1 54  ? 26.939  2.247   -47.805 0.02 19.17 ?  47   ARG A HG3  1  
ATOM   733    H HD2  . ARG A 1 54  ? 25.331  2.452   -46.070 0.02 18.79 ?  47   ARG A HD2  1  
ATOM   734    H HD3  . ARG A 1 54  ? 24.379  1.441   -46.851 0.02 19.07 ?  47   ARG A HD3  1  
ATOM   735    H HE   . ARG A 1 54  ? 26.585  0.745   -45.457 0.02 18.77 ?  47   ARG A HE   1  
ATOM   736    H HH11 . ARG A 1 54  ? 24.423  -0.463  -47.619 0.02 19.40 ?  47   ARG A HH11 1  
ATOM   737    H HH12 . ARG A 1 54  ? 24.764  -1.892  -47.397 0.02 19.47 ?  47   ARG A HH12 1  
ATOM   738    H HH21 . ARG A 1 54  ? 27.102  -1.428  -45.158 0.02 18.85 ?  47   ARG A HH21 1  
ATOM   739    H HH22 . ARG A 1 54  ? 26.374  -2.479  -45.918 0.02 19.14 ?  47   ARG A HH22 1  
ATOM   740    N N    . LEU A 1 55  ? 24.106  4.679   -51.298 0.02 20.07 ?  48   LEU A N    1  
ATOM   741    C CA   . LEU A 1 55  ? 23.359  5.845   -51.744 0.02 20.19 ?  48   LEU A CA   1  
ATOM   742    C C    . LEU A 1 55  ? 22.243  6.160   -50.769 0.02 19.96 ?  48   LEU A C    1  
ATOM   743    O O    . LEU A 1 55  ? 21.950  5.389   -49.862 0.02 19.74 ?  48   LEU A O    1  
ATOM   744    C CB   . LEU A 1 55  ? 22.776  5.615   -53.135 0.02 20.64 ?  48   LEU A CB   1  
ATOM   745    C CG   . LEU A 1 55  ? 23.828  5.295   -54.189 0.02 20.93 ?  48   LEU A CG   1  
ATOM   746    C CD1  . LEU A 1 55  ? 23.072  5.089   -55.482 0.02 21.38 ?  48   LEU A CD1  1  
ATOM   747    C CD2  . LEU A 1 55  ? 24.882  6.407   -54.290 0.02 20.91 ?  48   LEU A CD2  1  
ATOM   748    H H    . LEU A 1 55  ? 23.731  3.925   -51.468 0.02 20.16 ?  48   LEU A H    1  
ATOM   749    H HA   . LEU A 1 55  ? 23.943  6.614   -51.781 0.02 20.17 ?  48   LEU A HA   1  
ATOM   750    H HB2  . LEU A 1 55  ? 22.160  4.868   -53.100 0.02 20.68 ?  48   LEU A HB2  1  
ATOM   751    H HB3  . LEU A 1 55  ? 22.310  6.418   -53.410 0.02 20.72 ?  48   LEU A HB3  1  
ATOM   752    H HG   . LEU A 1 55  ? 24.273  4.465   -53.963 0.02 20.88 ?  48   LEU A HG   1  
ATOM   753    H HD11 . LEU A 1 55  ? 22.197  5.503   -55.411 0.02 21.39 ?  48   LEU A HD11 1  
ATOM   754    H HD12 . LEU A 1 55  ? 23.575  5.496   -56.207 0.02 21.59 ?  48   LEU A HD12 1  
ATOM   755    H HD13 . LEU A 1 55  ? 22.969  4.137   -55.633 0.02 21.46 ?  48   LEU A HD13 1  
ATOM   756    H HD21 . LEU A 1 55  ? 25.468  6.222   -55.039 0.02 21.15 ?  48   LEU A HD21 1  
ATOM   757    H HD22 . LEU A 1 55  ? 24.433  7.259   -54.417 0.02 20.94 ?  48   LEU A HD22 1  
ATOM   758    H HD23 . LEU A 1 55  ? 25.402  6.426   -53.472 0.02 20.65 ?  48   LEU A HD23 1  
ATOM   759    N N    . THR A 1 56  ? 21.638  7.320   -50.962 0.02 20.03 ?  49   THR A N    1  
ATOM   760    C CA   . THR A 1 56  ? 20.450  7.696   -50.216 0.02 19.89 ?  49   THR A CA   1  
ATOM   761    C C    . THR A 1 56  ? 19.289  7.803   -51.193 0.02 20.24 ?  49   THR A C    1  
ATOM   762    O O    . THR A 1 56  ? 19.455  7.716   -52.416 0.02 20.59 ?  49   THR A O    1  
ATOM   763    C CB   . THR A 1 56  ? 20.634  9.025   -49.451 0.02 19.67 ?  49   THR A CB   1  
ATOM   764    O OG1  . THR A 1 56  ? 20.591  10.133  -50.350 0.02 19.93 ?  49   THR A OG1  1  
ATOM   765    C CG2  . THR A 1 56  ? 21.948  9.055   -48.723 0.02 19.41 ?  49   THR A CG2  1  
ATOM   766    H H    . THR A 1 56  ? 21.889  7.910   -51.530 0.02 20.18 ?  49   THR A H    1  
ATOM   767    H HA   . THR A 1 56  ? 20.243  7.000   -49.577 0.02 19.73 ?  49   THR A HA   1  
ATOM   768    H HB   . THR A 1 56  ? 19.925  9.120   -48.799 0.02 19.54 ?  49   THR A HB   1  
ATOM   769    H HG1  . THR A 1 56  ? 20.703  10.850  -49.932 0.02 19.83 ?  49   THR A HG1  1  
ATOM   770    H HG21 . THR A 1 56  ? 21.860  9.548   -47.893 0.02 19.20 ?  49   THR A HG21 1  
ATOM   771    H HG22 . THR A 1 56  ? 22.233  8.149   -48.521 0.02 19.34 ?  49   THR A HG22 1  
ATOM   772    H HG23 . THR A 1 56  ? 22.624  9.483   -49.270 0.02 19.53 ?  49   THR A HG23 1  
ATOM   773    N N    . VAL A 1 57  ? 18.093  7.997   -50.632 0.02 20.18 ?  50   VAL A N    1  
ATOM   774    C CA   . VAL A 1 57  ? 16.928  8.240   -51.467 0.02 20.53 ?  50   VAL A CA   1  
ATOM   775    C C    . VAL A 1 57  ? 16.948  9.616   -52.107 0.02 20.72 ?  50   VAL A C    1  
ATOM   776    O O    . VAL A 1 57  ? 16.194  9.855   -53.059 0.02 21.09 ?  50   VAL A O    1  
ATOM   777    C CB   . VAL A 1 57  ? 15.616  8.127   -50.681 0.02 20.44 ?  50   VAL A CB   1  
ATOM   778    C CG1  . VAL A 1 57  ? 15.511  6.793   -49.944 0.02 20.31 ?  50   VAL A CG1  1  
ATOM   779    C CG2  . VAL A 1 57  ? 15.452  9.352   -49.780 0.02 20.18 ?  50   VAL A CG2  1  
ATOM   780    H H    . VAL A 1 57  ? 17.933  7.998   -49.788 0.02 19.96 ?  50   VAL A H    1  
ATOM   781    H HA   . VAL A 1 57  ? 16.908  7.581   -52.176 0.02 20.74 ?  50   VAL A HA   1  
ATOM   782    H HB   . VAL A 1 57  ? 14.911  8.138   -51.343 0.02 20.71 ?  50   VAL A HB   1  
ATOM   783    H HG11 . VAL A 1 57  ? 14.575  6.546   -49.884 0.02 20.40 ?  50   VAL A HG11 1  
ATOM   784    H HG12 . VAL A 1 57  ? 15.994  6.115   -50.442 0.02 20.44 ?  50   VAL A HG12 1  
ATOM   785    H HG13 . VAL A 1 57  ? 15.893  6.884   -49.056 0.02 20.02 ?  50   VAL A HG13 1  
ATOM   786    H HG21 . VAL A 1 57  ? 14.832  9.139   -49.066 0.02 19.98 ?  50   VAL A HG21 1  
ATOM   787    H HG22 . VAL A 1 57  ? 16.317  9.589   -49.408 0.02 20.05 ?  50   VAL A HG22 1  
ATOM   788    H HG23 . VAL A 1 57  ? 15.113  10.092  -50.304 0.02 20.34 ?  50   VAL A HG23 1  
ATOM   789    N N    . TYR A 1 58  ? 17.776  10.528  -51.608 0.02 20.52 ?  51   TYR A N    1  
ATOM   790    C CA   . TYR A 1 58  ? 17.931  11.839  -52.215 0.02 20.72 ?  51   TYR A CA   1  
ATOM   791    C C    . TYR A 1 58  ? 19.014  11.842  -53.280 0.02 20.95 ?  51   TYR A C    1  
ATOM   792    O O    . TYR A 1 58  ? 19.383  12.911  -53.781 0.02 21.11 ?  51   TYR A O    1  
ATOM   793    C CB   . TYR A 1 58  ? 18.233  12.887  -51.147 0.02 20.43 ?  51   TYR A CB   1  
ATOM   794    C CG   . TYR A 1 58  ? 17.063  13.116  -50.225 0.02 20.28 ?  51   TYR A CG   1  
ATOM   795    C CD1  . TYR A 1 58  ? 15.948  13.814  -50.669 0.02 20.53 ?  51   TYR A CD1  1  
ATOM   796    C CD2  . TYR A 1 58  ? 17.066  12.649  -48.938 0.02 19.94 ?  51   TYR A CD2  1  
ATOM   797    C CE1  . TYR A 1 58  ? 14.878  14.034  -49.856 0.02 20.43 ?  51   TYR A CE1  1  
ATOM   798    C CE2  . TYR A 1 58  ? 15.982  12.862  -48.116 0.02 19.84 ?  51   TYR A CE2  1  
ATOM   799    C CZ   . TYR A 1 58  ? 14.903  13.562  -48.580 0.02 20.08 ?  51   TYR A CZ   1  
ATOM   800    O OH   . TYR A 1 58  ? 13.796  13.779  -47.779 0.02 20.01 ?  51   TYR A OH   1  
ATOM   801    H H    . TYR A 1 58  ? 18.273  10.403  -50.922 0.02 20.28 ?  51   TYR A H    1  
ATOM   802    H HA   . TYR A 1 58  ? 17.097  12.087  -52.646 0.02 20.94 ?  51   TYR A HA   1  
ATOM   803    H HB2  . TYR A 1 58  ? 18.989  12.598  -50.615 0.02 20.21 ?  51   TYR A HB2  1  
ATOM   804    H HB3  . TYR A 1 58  ? 18.433  13.728  -51.582 0.02 20.59 ?  51   TYR A HB3  1  
ATOM   805    H HD1  . TYR A 1 58  ? 15.930  14.140  -51.537 0.02 20.78 ?  51   TYR A HD1  1  
ATOM   806    H HD2  . TYR A 1 58  ? 17.800  12.178  -48.620 0.02 19.78 ?  51   TYR A HD2  1  
ATOM   807    H HE1  . TYR A 1 58  ? 14.139  14.501  -50.168 0.02 20.61 ?  51   TYR A HE1  1  
ATOM   808    H HE2  . TYR A 1 58  ? 15.991  12.541  -47.242 0.02 19.62 ?  51   TYR A HE2  1  
ATOM   809    H HH   . TYR A 1 58  ? 13.942  13.471  -47.014 0.02 19.80 ?  51   TYR A HH   1  
ATOM   810    N N    . ASP A 1 59  ? 19.515  10.665  -53.638 0.02 21.01 ?  52   ASP A N    1  
ATOM   811    C CA   . ASP A 1 59  ? 20.588  10.493  -54.606 0.02 21.24 ?  52   ASP A CA   1  
ATOM   812    C C    . ASP A 1 59  ? 21.882  11.145  -54.166 0.02 21.04 ?  52   ASP A C    1  
ATOM   813    O O    . ASP A 1 59  ? 22.594  11.750  -54.968 0.02 21.28 ?  52   ASP A O    1  
ATOM   814    C CB   . ASP A 1 59  ? 20.154  11.007  -55.976 0.02 21.73 ?  52   ASP A CB   1  
ATOM   815    C CG   . ASP A 1 59  ? 19.107  10.111  -56.608 0.02 22.04 ?  52   ASP A CG   1  
ATOM   816    O OD1  . ASP A 1 59  ? 18.804  10.306  -57.788 0.02 22.49 ?  52   ASP A OD1  1  
ATOM   817    O OD2  . ASP A 1 59  ? 18.619  9.179   -55.941 0.02 21.87 -1 52   ASP A OD2  1  
ATOM   818    H H    . ASP A 1 59  ? 19.230  9.918   -53.327 0.02 20.92 ?  52   ASP A H    1  
ATOM   819    H HA   . ASP A 1 59  ? 20.766  9.545   -54.695 0.02 21.25 ?  52   ASP A HA   1  
ATOM   820    H HB2  . ASP A 1 59  ? 19.795  11.901  -55.895 0.02 21.75 ?  52   ASP A HB2  1  
ATOM   821    H HB3  . ASP A 1 59  ? 20.926  11.009  -56.560 0.02 21.87 ?  52   ASP A HB3  1  
ATOM   822    N N    . ASP A 1 60  ? 22.191  11.040  -52.890 0.02 20.62 ?  53   ASP A N    1  
ATOM   823    C CA   . ASP A 1 60  ? 23.522  11.344  -52.392 0.02 20.42 ?  53   ASP A CA   1  
ATOM   824    C C    . ASP A 1 60  ? 24.254  10.040  -52.085 0.02 20.27 ?  53   ASP A C    1  
ATOM   825    O O    . ASP A 1 60  ? 23.664  8.964   -52.094 0.02 20.29 ?  53   ASP A O    1  
ATOM   826    C CB   . ASP A 1 60  ? 23.414  12.241  -51.169 0.02 20.11 ?  53   ASP A CB   1  
ATOM   827    C CG   . ASP A 1 60  ? 22.574  13.474  -51.449 0.02 20.29 ?  53   ASP A CG   1  
ATOM   828    O OD1  . ASP A 1 60  ? 21.934  14.017  -50.526 0.02 20.10 ?  53   ASP A OD1  1  
ATOM   829    O OD2  . ASP A 1 60  ? 22.546  13.888  -52.625 0.02 20.65 -1 53   ASP A OD2  1  
ATOM   830    H H    . ASP A 1 60  ? 21.636  10.795  -52.284 0.02 20.47 ?  53   ASP A H    1  
ATOM   831    H HA   . ASP A 1 60  ? 24.024  11.818  -53.071 0.02 20.63 ?  53   ASP A HA   1  
ATOM   832    H HB2  . ASP A 1 60  ? 22.997  11.741  -50.452 0.02 19.90 ?  53   ASP A HB2  1  
ATOM   833    H HB3  . ASP A 1 60  ? 24.302  12.527  -50.905 0.02 20.03 ?  53   ASP A HB3  1  
ATOM   834    N N    . SER A 1 61  ? 25.557  10.136  -51.844 0.02 20.17 ?  54   SER A N    1  
ATOM   835    C CA   . SER A 1 61  ? 26.366  8.951   -51.580 0.02 20.07 ?  54   SER A CA   1  
ATOM   836    C C    . SER A 1 61  ? 27.278  9.213   -50.402 0.02 19.75 ?  54   SER A C    1  
ATOM   837    O O    . SER A 1 61  ? 27.657  10.344  -50.137 0.02 19.71 ?  54   SER A O    1  
ATOM   838    C CB   . SER A 1 61  ? 27.222  8.542   -52.774 0.02 20.41 ?  54   SER A CB   1  
ATOM   839    O OG   . SER A 1 61  ? 28.196  9.522   -53.065 0.02 20.50 ?  54   SER A OG   1  
ATOM   840    H H    . SER A 1 61  ? 25.995  10.874  -51.830 0.02 20.16 ?  54   SER A H    1  
ATOM   841    H HA   . SER A 1 61  ? 25.792  8.206   -51.353 0.02 20.00 ?  54   SER A HA   1  
ATOM   842    H HB2  . SER A 1 61  ? 27.672  7.713   -52.559 0.02 20.36 ?  54   SER A HB2  1  
ATOM   843    H HB3  . SER A 1 61  ? 26.657  8.424   -53.552 0.02 20.65 ?  54   SER A HB3  1  
ATOM   844    H HG   . SER A 1 61  ? 28.741  9.227   -53.631 0.02 20.69 ?  54   SER A HG   1  
ATOM   845    N N    . TYR A 1 62  ? 27.641  8.137   -49.710 0.02 19.55 ?  55   TYR A N    1  
ATOM   846    C CA   . TYR A 1 62  ? 28.553  8.231   -48.579 0.02 19.28 ?  55   TYR A CA   1  
ATOM   847    C C    . TYR A 1 62  ? 29.256  6.902   -48.388 0.02 19.24 ?  55   TYR A C    1  
ATOM   848    O O    . TYR A 1 62  ? 28.723  5.847   -48.724 0.02 19.32 ?  55   TYR A O    1  
ATOM   849    C CB   . TYR A 1 62  ? 27.793  8.643   -47.309 0.02 18.95 ?  55   TYR A CB   1  
ATOM   850    C CG   . TYR A 1 62  ? 26.774  7.644   -46.845 0.02 18.82 ?  55   TYR A CG   1  
ATOM   851    C CD1  . TYR A 1 62  ? 25.532  7.575   -47.432 0.02 18.97 ?  55   TYR A CD1  1  
ATOM   852    C CD2  . TYR A 1 62  ? 27.044  6.806   -45.782 0.02 18.58 ?  55   TYR A CD2  1  
ATOM   853    C CE1  . TYR A 1 62  ? 24.586  6.642   -47.007 0.02 18.89 ?  55   TYR A CE1  1  
ATOM   854    C CE2  . TYR A 1 62  ? 26.121  5.886   -45.348 0.02 18.50 ?  55   TYR A CE2  1  
ATOM   855    C CZ   . TYR A 1 62  ? 24.888  5.817   -45.958 0.02 18.65 ?  55   TYR A CZ   1  
ATOM   856    O OH   . TYR A 1 62  ? 23.944  4.915   -45.550 0.02 18.61 ?  55   TYR A OH   1  
ATOM   857    H H    . TYR A 1 62  ? 27.365  7.340   -49.866 0.02 19.59 ?  55   TYR A H    1  
ATOM   858    H HA   . TYR A 1 62  ? 29.231  8.893   -48.765 0.02 19.35 ?  55   TYR A HA   1  
ATOM   859    H HB2  . TYR A 1 62  ? 28.427  8.770   -46.587 0.02 18.80 ?  55   TYR A HB2  1  
ATOM   860    H HB3  . TYR A 1 62  ? 27.325  9.472   -47.489 0.02 19.00 ?  55   TYR A HB3  1  
ATOM   861    H HD1  . TYR A 1 62  ? 25.336  8.133   -48.150 0.02 19.14 ?  55   TYR A HD1  1  
ATOM   862    H HD2  . TYR A 1 62  ? 27.877  6.849   -45.372 0.02 18.50 ?  55   TYR A HD2  1  
ATOM   863    H HE1  . TYR A 1 62  ? 23.755  6.591   -47.414 0.02 19.00 ?  55   TYR A HE1  1  
ATOM   864    H HE2  . TYR A 1 62  ? 26.326  5.323   -44.639 0.02 18.36 ?  55   TYR A HE2  1  
ATOM   865    H HH   . TYR A 1 62  ? 24.229  4.484   -44.890 0.02 18.47 ?  55   TYR A HH   1  
ATOM   866    N N    . TYR A 1 63  ? 30.457  6.953   -47.832 0.02 19.14 ?  56   TYR A N    1  
ATOM   867    C CA   . TYR A 1 63  ? 31.122  5.733   -47.429 0.02 19.07 ?  56   TYR A CA   1  
ATOM   868    C C    . TYR A 1 63  ? 30.688  5.357   -46.020 0.02 18.73 ?  56   TYR A C    1  
ATOM   869    O O    . TYR A 1 63  ? 30.490  6.231   -45.173 0.02 18.53 ?  56   TYR A O    1  
ATOM   870    C CB   . TYR A 1 63  ? 32.630  5.897   -47.532 0.02 19.17 ?  56   TYR A CB   1  
ATOM   871    C CG   . TYR A 1 63  ? 33.051  6.096   -48.970 0.02 19.55 ?  56   TYR A CG   1  
ATOM   872    C CD1  . TYR A 1 63  ? 33.263  5.006   -49.796 0.02 19.79 ?  56   TYR A CD1  1  
ATOM   873    C CD2  . TYR A 1 63  ? 33.211  7.362   -49.487 0.02 19.71 ?  56   TYR A CD2  1  
ATOM   874    C CE1  . TYR A 1 63  ? 33.657  5.173   -51.117 0.02 20.17 ?  56   TYR A CE1  1  
ATOM   875    C CE2  . TYR A 1 63  ? 33.583  7.546   -50.818 0.02 20.09 ?  56   TYR A CE2  1  
ATOM   876    C CZ   . TYR A 1 63  ? 33.797  6.460   -51.611 0.02 20.31 ?  56   TYR A CZ   1  
ATOM   877    O OH   . TYR A 1 63  ? 34.191  6.675   -52.921 0.02 20.71 ?  56   TYR A OH   1  
ATOM   878    H H    . TYR A 1 63  ? 30.898  7.672   -47.676 0.02 19.12 ?  56   TYR A H    1  
ATOM   879    H HA   . TYR A 1 63  ? 30.856  5.013   -48.019 0.02 19.21 ?  56   TYR A HA   1  
ATOM   880    H HB2  . TYR A 1 63  ? 32.905  6.678   -47.028 0.02 19.07 ?  56   TYR A HB2  1  
ATOM   881    H HB3  . TYR A 1 63  ? 33.062  5.099   -47.195 0.02 19.13 ?  56   TYR A HB3  1  
ATOM   882    H HD1  . TYR A 1 63  ? 33.161  4.147   -49.457 0.02 19.71 ?  56   TYR A HD1  1  
ATOM   883    H HD2  . TYR A 1 63  ? 33.059  8.103   -48.946 0.02 19.57 ?  56   TYR A HD2  1  
ATOM   884    H HE1  . TYR A 1 63  ? 33.798  4.435   -51.661 0.02 20.34 ?  56   TYR A HE1  1  
ATOM   885    H HE2  . TYR A 1 63  ? 33.696  8.405   -51.157 0.02 20.21 ?  56   TYR A HE2  1  
ATOM   886    H HH   . TYR A 1 63  ? 34.050  7.476   -53.134 0.02 20.78 ?  56   TYR A HH   1  
ATOM   887    N N    . SER A 1 64  ? 30.541  4.050   -45.806 0.02 18.70 ?  57   SER A N    1  
ATOM   888    C CA   . SER A 1 64  ? 29.905  3.460   -44.630 0.02 18.44 ?  57   SER A CA   1  
ATOM   889    C C    . SER A 1 64  ? 30.808  2.374   -44.071 0.02 18.40 ?  57   SER A C    1  
ATOM   890    O O    . SER A 1 64  ? 31.164  1.432   -44.777 0.02 18.60 ?  57   SER A O    1  
ATOM   891    C CB   . SER A 1 64  ? 28.542  2.868   -45.010 0.02 18.52 ?  57   SER A CB   1  
ATOM   892    O OG   . SER A 1 64  ? 27.911  2.228   -43.902 0.02 18.30 ?  57   SER A OG   1  
ATOM   893    H H    . SER A 1 64  ? 30.815  3.452   -46.356 0.02 18.85 ?  57   SER A H    1  
ATOM   894    H HA   . SER A 1 64  ? 29.780  4.147   -43.960 0.02 18.28 ?  57   SER A HA   1  
ATOM   895    H HB2  . SER A 1 64  ? 27.969  3.580   -45.335 0.02 18.57 ?  57   SER A HB2  1  
ATOM   896    H HB3  . SER A 1 64  ? 28.667  2.208   -45.710 0.02 18.70 ?  57   SER A HB3  1  
ATOM   897    H HG   . SER A 1 64  ? 27.637  1.468   -44.127 0.02 18.39 ?  57   SER A HG   1  
ATOM   898    N N    . PHE A 1 65  ? 31.168  2.484   -42.797 0.02 18.16 ?  58   PHE A N    1  
ATOM   899    C CA   . PHE A 1 65  ? 31.922  1.452   -42.106 0.02 18.11 ?  58   PHE A CA   1  
ATOM   900    C C    . PHE A 1 65  ? 31.128  1.124   -40.857 0.02 17.87 ?  58   PHE A C    1  
ATOM   901    O O    . PHE A 1 65  ? 30.968  1.995   -40.007 0.02 17.67 ?  58   PHE A O    1  
ATOM   902    C CB   . PHE A 1 65  ? 33.312  1.933   -41.687 0.02 18.09 ?  58   PHE A CB   1  
ATOM   903    C CG   . PHE A 1 65  ? 34.206  2.317   -42.811 0.02 18.35 ?  58   PHE A CG   1  
ATOM   904    C CD1  . PHE A 1 65  ? 34.155  3.597   -43.313 0.02 18.40 ?  58   PHE A CD1  1  
ATOM   905    C CD2  . PHE A 1 65  ? 35.146  1.440   -43.310 0.02 18.56 ?  58   PHE A CD2  1  
ATOM   906    C CE1  . PHE A 1 65  ? 34.979  4.000   -44.351 0.02 18.67 ?  58   PHE A CE1  1  
ATOM   907    C CE2  . PHE A 1 65  ? 35.991  1.832   -44.364 0.02 18.83 ?  58   PHE A CE2  1  
ATOM   908    C CZ   . PHE A 1 65  ? 35.891  3.126   -44.866 0.02 18.88 ?  58   PHE A CZ   1  
ATOM   909    H H    . PHE A 1 65  ? 30.980  3.161   -42.308 0.02 18.03 ?  58   PHE A H    1  
ATOM   910    H HA   . PHE A 1 65  ? 32.005  0.658   -42.651 0.02 18.26 ?  58   PHE A HA   1  
ATOM   911    H HB2  . PHE A 1 65  ? 33.199  2.718   -41.132 0.02 17.95 ?  58   PHE A HB2  1  
ATOM   912    H HB3  . PHE A 1 65  ? 33.745  1.226   -41.186 0.02 18.06 ?  58   PHE A HB3  1  
ATOM   913    H HD1  . PHE A 1 65  ? 33.530  4.192   -42.973 0.02 18.28 ?  58   PHE A HD1  1  
ATOM   914    H HD2  . PHE A 1 65  ? 35.199  0.576   -42.974 0.02 18.54 ?  58   PHE A HD2  1  
ATOM   915    H HE1  . PHE A 1 65  ? 34.916  4.863   -44.685 0.02 18.72 ?  58   PHE A HE1  1  
ATOM   916    H HE2  . PHE A 1 65  ? 36.613  1.238   -44.711 0.02 18.99 ?  58   PHE A HE2  1  
ATOM   917    H HZ   . PHE A 1 65  ? 36.447  3.403   -45.555 0.02 19.07 ?  58   PHE A HZ   1  
ATOM   918    N N    . GLU A 1 66  ? 30.628  -0.100  -40.755 0.02 17.92 ?  59   GLU A N    1  
ATOM   919    C CA   . GLU A 1 66  ? 29.817  -0.485  -39.609 0.02 17.74 ?  59   GLU A CA   1  
ATOM   920    C C    . GLU A 1 66  ? 30.432  -1.663  -38.874 0.02 17.74 ?  59   GLU A C    1  
ATOM   921    O O    . GLU A 1 66  ? 31.008  -2.574  -39.469 0.02 17.93 ?  59   GLU A O    1  
ATOM   922    C CB   . GLU A 1 66  ? 28.380  -0.822  -40.055 0.02 17.84 ?  59   GLU A CB   1  
ATOM   923    C CG   . GLU A 1 66  ? 27.575  0.411   -40.409 0.02 17.88 ?  59   GLU A CG   1  
ATOM   924    C CD   . GLU A 1 66  ? 26.224  0.065   -40.965 0.02 18.00 ?  59   GLU A CD   1  
ATOM   925    O OE1  . GLU A 1 66  ? 26.155  -0.322  -42.157 0.02 18.25 ?  59   GLU A OE1  1  
ATOM   926    O OE2  . GLU A 1 66  ? 25.249  0.130   -40.193 0.02 17.86 -1 59   GLU A OE2  1  
ATOM   927    H H    . GLU A 1 66  ? 30.734  -0.725  -41.329 0.02 18.07 ?  59   GLU A H    1  
ATOM   928    H HA   . GLU A 1 66  ? 29.776  0.253   -38.986 0.02 17.59 ?  59   GLU A HA   1  
ATOM   929    H HB2  . GLU A 1 66  ? 28.405  -1.401  -40.831 0.02 18.01 ?  59   GLU A HB2  1  
ATOM   930    H HB3  . GLU A 1 66  ? 27.930  -1.272  -39.324 0.02 17.74 ?  59   GLU A HB3  1  
ATOM   931    H HG2  . GLU A 1 66  ? 27.446  0.937   -39.610 0.02 17.73 ?  59   GLU A HG2  1  
ATOM   932    H HG3  . GLU A 1 66  ? 28.048  0.925   -41.077 0.02 18.00 ?  59   GLU A HG3  1  
ATOM   933    N N    . GLY A 1 67  ? 30.298  -1.644  -37.545 0.02 17.55 ?  60   GLY A N    1  
ATOM   934    C CA   . GLY A 1 67  ? 30.818  -2.745  -36.775 0.02 17.58 ?  60   GLY A CA   1  
ATOM   935    C C    . GLY A 1 67  ? 32.307  -2.693  -36.553 0.02 17.60 ?  60   GLY A C    1  
ATOM   936    O O    . GLY A 1 67  ? 32.964  -3.738  -36.571 0.02 17.74 ?  60   GLY A O    1  
ATOM   937    H H    . GLY A 1 67  ? 29.936  -1.012  -37.095 0.02 17.42 ?  60   GLY A H    1  
ATOM   938    H HA2  . GLY A 1 67  ? 30.393  -2.763  -35.901 0.02 17.46 ?  60   GLY A HA2  1  
ATOM   939    H HA3  . GLY A 1 67  ? 30.611  -3.576  -37.228 0.02 17.72 ?  60   GLY A HA3  1  
ATOM   940    N N    . ILE A 1 68  ? 32.855  -1.509  -36.330 0.02 17.49 ?  61   ILE A N    1  
ATOM   941    C CA   . ILE A 1 68  ? 34.263  -1.372  -35.968 0.02 17.51 ?  61   ILE A CA   1  
ATOM   942    C C    . ILE A 1 68  ? 34.387  -1.609  -34.467 0.02 17.37 ?  61   ILE A C    1  
ATOM   943    O O    . ILE A 1 68  ? 33.791  -0.850  -33.695 0.02 17.19 ?  61   ILE A O    1  
ATOM   944    C CB   . ILE A 1 68  ? 34.803  0.007   -36.350 0.02 17.49 ?  61   ILE A CB   1  
ATOM   945    C CG1  . ILE A 1 68  ? 34.595  0.270   -37.841 0.02 17.65 ?  61   ILE A CG1  1  
ATOM   946    C CG2  . ILE A 1 68  ? 36.333  0.137   -36.018 0.02 17.58 ?  61   ILE A CG2  1  
ATOM   947    C CD1  . ILE A 1 68  ? 34.661  1.709   -38.168 0.02 17.62 ?  61   ILE A CD1  1  
ATOM   948    H H    . ILE A 1 68  ? 32.433  -0.763  -36.380 0.02 17.41 ?  61   ILE A H    1  
ATOM   949    H HA   . ILE A 1 68  ? 34.777  -2.045  -36.436 0.02 17.66 ?  61   ILE A HA   1  
ATOM   950    H HB   . ILE A 1 68  ? 34.312  0.676   -35.855 0.02 17.35 ?  61   ILE A HB   1  
ATOM   951    H HG12 . ILE A 1 68  ? 35.294  -0.180  -38.337 0.02 17.80 ?  61   ILE A HG12 1  
ATOM   952    H HG13 . ILE A 1 68  ? 33.727  -0.058  -38.118 0.02 17.65 ?  61   ILE A HG13 1  
ATOM   953    H HG21 . ILE A 1 68  ? 36.429  0.622   -35.185 0.02 17.46 ?  61   ILE A HG21 1  
ATOM   954    H HG22 . ILE A 1 68  ? 36.720  -0.748  -35.935 0.02 17.65 ?  61   ILE A HG22 1  
ATOM   955    H HG23 . ILE A 1 68  ? 36.771  0.631   -36.726 0.02 17.68 ?  61   ILE A HG23 1  
ATOM   956    H HD11 . ILE A 1 68  ? 34.343  1.834   -39.077 0.02 17.72 ?  61   ILE A HD11 1  
ATOM   957    H HD12 . ILE A 1 68  ? 34.100  2.199   -37.547 0.02 17.47 ?  61   ILE A HD12 1  
ATOM   958    H HD13 . ILE A 1 68  ? 35.582  2.007   -38.096 0.02 17.67 ?  61   ILE A HD13 1  
ATOM   959    N N    . PRO A 1 69  ? 35.143  -2.607  -34.002 0.02 17.47 ?  62   PRO A N    1  
ATOM   960    C CA   . PRO A 1 69  ? 35.268  -2.801  -32.549 0.02 17.37 ?  62   PRO A CA   1  
ATOM   961    C C    . PRO A 1 69  ? 36.147  -1.738  -31.922 0.02 17.30 ?  62   PRO A C    1  
ATOM   962    O O    . PRO A 1 69  ? 37.181  -1.368  -32.462 0.02 17.42 ?  62   PRO A O    1  
ATOM   963    C CB   . PRO A 1 69  ? 35.913  -4.187  -32.420 0.02 17.55 ?  62   PRO A CB   1  
ATOM   964    C CG   . PRO A 1 69  ? 36.703  -4.346  -33.659 0.02 17.75 ?  62   PRO A CG   1  
ATOM   965    C CD   . PRO A 1 69  ? 35.925  -3.613  -34.743 0.02 17.71 ?  62   PRO A CD   1  
ATOM   966    H HA   . PRO A 1 69  ? 34.398  -2.803  -32.123 0.02 17.27 ?  62   PRO A HA   1  
ATOM   967    H HB2  . PRO A 1 69  ? 36.490  -4.202  -31.643 0.02 17.55 ?  62   PRO A HB2  1  
ATOM   968    H HB3  . PRO A 1 69  ? 35.232  -4.871  -32.354 0.02 17.57 ?  62   PRO A HB3  1  
ATOM   969    H HG2  . PRO A 1 69  ? 37.579  -3.950  -33.532 0.02 17.78 ?  62   PRO A HG2  1  
ATOM   970    H HG3  . PRO A 1 69  ? 36.789  -5.289  -33.868 0.02 17.88 ?  62   PRO A HG3  1  
ATOM   971    H HD2  . PRO A 1 69  ? 36.532  -3.177  -35.359 0.02 17.79 ?  62   PRO A HD2  1  
ATOM   972    H HD3  . PRO A 1 69  ? 35.336  -4.230  -35.205 0.02 17.78 ?  62   PRO A HD3  1  
ATOM   973    N N    . TYR A 1 70  ? 35.728  -1.249  -30.754 0.02 17.14 ?  63   TYR A N    1  
ATOM   974    C CA   . TYR A 1 70  ? 36.570  -0.373  -29.964 0.02 17.11 ?  63   TYR A CA   1  
ATOM   975    C C    . TYR A 1 70  ? 36.915  -0.974  -28.611 0.02 17.12 ?  63   TYR A C    1  
ATOM   976    O O    . TYR A 1 70  ? 37.654  -0.350  -27.860 0.02 17.13 ?  63   TYR A O    1  
ATOM   977    C CB   . TYR A 1 70  ? 35.906  1.005   -29.779 0.02 16.95 ?  63   TYR A CB   1  
ATOM   978    C CG   . TYR A 1 70  ? 34.628  1.055   -28.945 0.02 16.79 ?  63   TYR A CG   1  
ATOM   979    C CD1  . TYR A 1 70  ? 34.693  1.108   -27.571 0.02 16.74 ?  63   TYR A CD1  1  
ATOM   980    C CD2  . TYR A 1 70  ? 33.381  1.105   -29.534 0.02 16.72 ?  63   TYR A CD2  1  
ATOM   981    C CE1  . TYR A 1 70  ? 33.558  1.180   -26.809 0.02 16.62 ?  63   TYR A CE1  1  
ATOM   982    C CE2  . TYR A 1 70  ? 32.217  1.141   -28.765 0.02 16.61 ?  63   TYR A CE2  1  
ATOM   983    C CZ   . TYR A 1 70  ? 32.323  1.194   -27.404 0.02 16.56 ?  63   TYR A CZ   1  
ATOM   984    O OH   . TYR A 1 70  ? 31.185  1.272   -26.631 0.02 16.47 ?  63   TYR A OH   1  
ATOM   985    H H    . TYR A 1 70  ? 34.964  -1.418  -30.404 0.02 17.06 ?  63   TYR A H    1  
ATOM   986    H HA   . TYR A 1 70  ? 37.405  -0.229  -30.430 0.02 17.21 ?  63   TYR A HA   1  
ATOM   987    H HB2  . TYR A 1 70  ? 36.544  1.597   -29.353 0.02 16.96 ?  63   TYR A HB2  1  
ATOM   988    H HB3  . TYR A 1 70  ? 35.684  1.351   -30.657 0.02 16.96 ?  63   TYR A HB3  1  
ATOM   989    H HD1  . TYR A 1 70  ? 35.523  1.091   -27.155 0.02 16.80 ?  63   TYR A HD1  1  
ATOM   990    H HD2  . TYR A 1 70  ? 33.315  1.066   -30.462 0.02 16.77 ?  63   TYR A HD2  1  
ATOM   991    H HE1  . TYR A 1 70  ? 33.627  1.200   -25.881 0.02 16.61 ?  63   TYR A HE1  1  
ATOM   992    H HE2  . TYR A 1 70  ? 31.385  1.173   -29.174 0.02 16.58 ?  63   TYR A HE2  1  
ATOM   993    H HH   . TYR A 1 70  ? 30.715  0.589   -26.739 0.02 16.49 ?  63   TYR A HH   1  
ATOM   994    N N    . ALA A 1 71  ? 36.431  -2.171  -28.300 0.02 17.15 ?  64   ALA A N    1  
ATOM   995    C CA   . ALA A 1 71  ? 36.739  -2.841  -27.043 0.02 17.20 ?  64   ALA A CA   1  
ATOM   996    C C    . ALA A 1 71  ? 36.567  -4.348  -27.227 0.02 17.34 ?  64   ALA A C    1  
ATOM   997    O O    . ALA A 1 71  ? 35.944  -4.800  -28.191 0.02 17.37 ?  64   ALA A O    1  
ATOM   998    C CB   . ALA A 1 71  ? 35.835  -2.304  -25.926 0.02 17.04 ?  64   ALA A CB   1  
ATOM   999    H H    . ALA A 1 71  ? 35.905  -2.622  -28.804 0.02 17.15 ?  64   ALA A H    1  
ATOM   1000   H HA   . ALA A 1 71  ? 37.660  -2.664  -26.801 0.02 17.27 ?  64   ALA A HA   1  
ATOM   1001   H HB1  . ALA A 1 71  ? 36.138  -2.646  -25.070 0.02 17.09 ?  64   ALA A HB1  1  
ATOM   1002   H HB2  . ALA A 1 71  ? 35.873  -1.337  -25.930 0.02 16.96 ?  64   ALA A HB2  1  
ATOM   1003   H HB3  . ALA A 1 71  ? 34.929  -2.594  -26.106 0.02 16.99 ?  64   ALA A HB3  1  
ATOM   1004   N N    . GLN A 1 72  ? 37.164  -5.128  -26.321 0.02 17.46 ?  65   GLN A N    1  
ATOM   1005   C CA   . GLN A 1 72  ? 36.939  -6.575  -26.283 0.02 17.62 ?  65   GLN A CA   1  
ATOM   1006   C C    . GLN A 1 72  ? 35.452  -6.863  -26.072 0.02 17.53 ?  65   GLN A C    1  
ATOM   1007   O O    . GLN A 1 72  ? 34.829  -6.243  -25.205 0.02 17.39 ?  65   GLN A O    1  
ATOM   1008   C CB   . GLN A 1 72  ? 37.706  -7.241  -25.125 0.02 17.77 ?  65   GLN A CB   1  
ATOM   1009   C CG   . GLN A 1 72  ? 39.193  -7.501  -25.320 0.02 17.97 ?  65   GLN A CG   1  
ATOM   1010   C CD   . GLN A 1 72  ? 39.532  -8.958  -25.691 0.02 18.22 ?  65   GLN A CD   1  
ATOM   1011   O OE1  . GLN A 1 72  ? 40.683  -9.369  -25.578 0.02 18.42 ?  65   GLN A OE1  1  
ATOM   1012   N NE2  . GLN A 1 72  ? 38.522  -9.739  -26.119 0.02 18.24 ?  65   GLN A NE2  1  
ATOM   1013   H H    . GLN A 1 72  ? 37.703  -4.838  -25.719 0.02 17.47 ?  65   GLN A H    1  
ATOM   1014   H HA   . GLN A 1 72  ? 37.241  -6.977  -27.109 0.02 17.72 ?  65   GLN A HA   1  
ATOM   1015   H HB2  . GLN A 1 72  ? 37.622  -6.666  -24.349 0.02 17.68 ?  65   GLN A HB2  1  
ATOM   1016   H HB3  . GLN A 1 72  ? 37.282  -8.090  -24.931 0.02 17.85 ?  65   GLN A HB3  1  
ATOM   1017   H HG2  . GLN A 1 72  ? 39.516  -6.924  -26.029 0.02 17.93 ?  65   GLN A HG2  1  
ATOM   1018   H HG3  . GLN A 1 72  ? 39.658  -7.297  -24.493 0.02 18.01 ?  65   GLN A HG3  1  
ATOM   1019   H HE21 . GLN A 1 72  ? 38.297  -9.750  -26.948 0.02 18.25 ?  65   GLN A HE21 1  
ATOM   1020   H HE22 . GLN A 1 72  ? 38.095  -10.226 -25.552 0.02 18.26 ?  65   GLN A HE22 1  
ATOM   1021   N N    . PRO A 1 73  ? 34.873  -7.826  -26.778 0.02 17.65 ?  66   PRO A N    1  
ATOM   1022   C CA   . PRO A 1 73  ? 33.512  -8.276  -26.451 0.02 17.63 ?  66   PRO A CA   1  
ATOM   1023   C C    . PRO A 1 73  ? 33.382  -8.566  -24.967 0.02 17.65 ?  66   PRO A C    1  
ATOM   1024   O O    . PRO A 1 73  ? 34.026  -9.491  -24.450 0.02 17.85 ?  66   PRO A O    1  
ATOM   1025   C CB   . PRO A 1 73  ? 33.352  -9.551  -27.286 0.02 17.85 ?  66   PRO A CB   1  
ATOM   1026   C CG   . PRO A 1 73  ? 34.219  -9.282  -28.486 0.02 17.90 ?  66   PRO A CG   1  
ATOM   1027   C CD   . PRO A 1 73  ? 35.403  -8.526  -27.965 0.02 17.84 ?  66   PRO A CD   1  
ATOM   1028   H HA   . PRO A 1 73  ? 32.864  -7.617  -26.739 0.02 17.50 ?  66   PRO A HA   1  
ATOM   1029   H HB2  . PRO A 1 73  ? 33.675  -10.317 -26.787 0.02 17.99 ?  66   PRO A HB2  1  
ATOM   1030   H HB3  . PRO A 1 73  ? 32.422  -9.668  -27.541 0.02 17.83 ?  66   PRO A HB3  1  
ATOM   1031   H HG2  . PRO A 1 73  ? 34.498  -10.120 -28.887 0.02 18.07 ?  66   PRO A HG2  1  
ATOM   1032   H HG3  . PRO A 1 73  ? 33.728  -8.746  -29.125 0.02 17.81 ?  66   PRO A HG3  1  
ATOM   1033   H HD2  . PRO A 1 73  ? 36.103  -9.143  -27.702 0.02 17.98 ?  66   PRO A HD2  1  
ATOM   1034   H HD3  . PRO A 1 73  ? 35.714  -7.881  -28.620 0.02 17.79 ?  66   PRO A HD3  1  
ATOM   1035   N N    . PRO A 1 74  ? 32.534  -7.798  -24.246 0.02 17.49 ?  67   PRO A N    1  
ATOM   1036   C CA   . PRO A 1 74  ? 32.531  -7.857  -22.767 0.02 17.51 ?  67   PRO A CA   1  
ATOM   1037   C C    . PRO A 1 74  ? 31.831  -9.108  -22.244 0.02 17.69 ?  67   PRO A C    1  
ATOM   1038   O O    . PRO A 1 74  ? 30.809  -9.051  -21.538 0.02 17.67 ?  67   PRO A O    1  
ATOM   1039   C CB   . PRO A 1 74  ? 31.807  -6.556  -22.392 0.02 17.29 ?  67   PRO A CB   1  
ATOM   1040   C CG   . PRO A 1 74  ? 30.876  -6.302  -23.520 0.02 17.20 ?  67   PRO A CG   1  
ATOM   1041   C CD   . PRO A 1 74  ? 31.622  -6.757  -24.758 0.02 17.29 ?  67   PRO A CD   1  
ATOM   1042   H HA   . PRO A 1 74  ? 33.438  -7.824  -22.429 0.02 17.56 ?  67   PRO A HA   1  
ATOM   1043   H HB2  . PRO A 1 74  ? 31.323  -6.676  -21.559 0.02 17.31 ?  67   PRO A HB2  1  
ATOM   1044   H HB3  . PRO A 1 74  ? 32.451  -5.836  -22.313 0.02 17.22 ?  67   PRO A HB3  1  
ATOM   1045   H HG2  . PRO A 1 74  ? 30.072  -6.827  -23.399 0.02 17.26 ?  67   PRO A HG2  1  
ATOM   1046   H HG3  . PRO A 1 74  ? 30.666  -5.359  -23.572 0.02 17.06 ?  67   PRO A HG3  1  
ATOM   1047   H HD2  . PRO A 1 74  ? 31.005  -7.138  -25.397 0.02 17.33 ?  67   PRO A HD2  1  
ATOM   1048   H HD3  . PRO A 1 74  ? 32.128  -6.025  -25.138 0.02 17.21 ?  67   PRO A HD3  1  
ATOM   1049   N N    . VAL A 1 75  ? 32.404  -10.259 -22.563 0.02 17.91 ?  68   VAL A N    1  
ATOM   1050   C CA   . VAL A 1 75  ? 31.766  -11.542 -22.317 0.02 18.14 ?  68   VAL A CA   1  
ATOM   1051   C C    . VAL A 1 75  ? 32.487  -12.275 -21.185 0.02 18.34 ?  68   VAL A C    1  
ATOM   1052   O O    . VAL A 1 75  ? 33.638  -11.985 -20.851 0.02 18.34 ?  68   VAL A O    1  
ATOM   1053   C CB   . VAL A 1 75  ? 31.721  -12.405 -23.593 0.02 18.29 ?  68   VAL A CB   1  
ATOM   1054   C CG1  . VAL A 1 75  ? 30.691  -11.858 -24.515 0.02 18.15 ?  68   VAL A CG1  1  
ATOM   1055   C CG2  . VAL A 1 75  ? 33.082  -12.436 -24.275 0.02 18.36 ?  68   VAL A CG2  1  
ATOM   1056   H H    . VAL A 1 75  ? 33.184  -10.315 -22.913 0.02 17.96 ?  68   VAL A H    1  
ATOM   1057   H HA   . VAL A 1 75  ? 30.854  -11.380 -22.044 0.02 18.08 ?  68   VAL A HA   1  
ATOM   1058   H HB   . VAL A 1 75  ? 31.477  -13.314 -23.358 0.02 18.48 ?  68   VAL A HB   1  
ATOM   1059   H HG11 . VAL A 1 75  ? 30.769  -12.298 -25.378 0.02 18.24 ?  68   VAL A HG11 1  
ATOM   1060   H HG12 . VAL A 1 75  ? 29.813  -12.020 -24.136 0.02 18.16 ?  68   VAL A HG12 1  
ATOM   1061   H HG13 . VAL A 1 75  ? 30.839  -10.905 -24.620 0.02 17.97 ?  68   VAL A HG13 1  
ATOM   1062   H HG21 . VAL A 1 75  ? 33.751  -12.019 -23.713 0.02 18.25 ?  68   VAL A HG21 1  
ATOM   1063   H HG22 . VAL A 1 75  ? 33.324  -13.363 -24.428 0.02 18.56 ?  68   VAL A HG22 1  
ATOM   1064   H HG23 . VAL A 1 75  ? 33.013  -11.966 -25.122 0.02 18.36 ?  68   VAL A HG23 1  
ATOM   1065   N N    . GLY A 1 76  ? 31.807  -13.276 -20.637 0.02 18.54 ?  69   GLY A N    1  
ATOM   1066   C CA   . GLY A 1 76  ? 32.415  -14.155 -19.640 0.02 18.80 ?  69   GLY A CA   1  
ATOM   1067   C C    . GLY A 1 76  ? 32.806  -13.404 -18.389 0.02 18.72 ?  69   GLY A C    1  
ATOM   1068   O O    . GLY A 1 76  ? 31.980  -12.726 -17.764 0.02 18.57 ?  69   GLY A O    1  
ATOM   1069   H H    . GLY A 1 76  ? 30.996  -13.475 -20.831 0.02 18.55 ?  69   GLY A H    1  
ATOM   1070   H HA2  . GLY A 1 76  ? 31.790  -14.855 -19.398 0.02 18.95 ?  69   GLY A HA2  1  
ATOM   1071   H HA3  . GLY A 1 76  ? 33.216  -14.562 -20.006 0.02 18.91 ?  69   GLY A HA3  1  
ATOM   1072   N N    . GLU A 1 77  ? 34.088  -13.502 -18.006 0.02 18.84 ?  70   GLU A N    1  
ATOM   1073   C CA   . GLU A 1 77  ? 34.557  -12.791 -16.816 0.02 18.81 ?  70   GLU A CA   1  
ATOM   1074   C C    . GLU A 1 77  ? 34.618  -11.282 -17.040 0.02 18.50 ?  70   GLU A C    1  
ATOM   1075   O O    . GLU A 1 77  ? 34.743  -10.531 -16.069 0.02 18.45 ?  70   GLU A O    1  
ATOM   1076   C CB   . GLU A 1 77  ? 35.930  -13.343 -16.356 0.02 19.06 ?  70   GLU A CB   1  
ATOM   1077   C CG   . GLU A 1 77  ? 36.098  -13.580 -14.790 0.02 19.27 ?  70   GLU A CG   1  
ATOM   1078   C CD   . GLU A 1 77  ? 34.974  -14.380 -14.149 0.02 19.41 ?  70   GLU A CD   1  
ATOM   1079   O OE1  . GLU A 1 77  ? 34.372  -15.251 -14.796 0.02 19.51 ?  70   GLU A OE1  1  
ATOM   1080   O OE2  . GLU A 1 77  ? 34.682  -14.100 -12.973 0.02 19.45 -1 70   GLU A OE2  1  
ATOM   1081   H H    . GLU A 1 77  ? 34.688  -13.962 -18.408 0.02 18.96 ?  70   GLU A H    1  
ATOM   1082   H HA   . GLU A 1 77  ? 33.924  -12.948 -16.102 0.02 18.85 ?  70   GLU A HA   1  
ATOM   1083   H HB2  . GLU A 1 77  ? 36.077  -14.200 -16.788 0.02 19.22 ?  70   GLU A HB2  1  
ATOM   1084   H HB3  . GLU A 1 77  ? 36.615  -12.714 -16.630 0.02 18.97 ?  70   GLU A HB3  1  
ATOM   1085   H HG2  . GLU A 1 77  ? 36.923  -14.061 -14.622 0.02 19.46 ?  70   GLU A HG2  1  
ATOM   1086   H HG3  . GLU A 1 77  ? 36.131  -12.717 -14.345 0.02 19.13 ?  70   GLU A HG3  1  
ATOM   1087   N N    . LEU A 1 78  ? 34.509  -10.813 -18.278 0.02 18.31 ?  71   LEU A N    1  
ATOM   1088   C CA   . LEU A 1 78  ? 34.438  -9.381  -18.539 0.02 18.03 ?  71   LEU A CA   1  
ATOM   1089   C C    . LEU A 1 78  ? 33.047  -8.804  -18.328 0.02 17.86 ?  71   LEU A C    1  
ATOM   1090   O O    . LEU A 1 78  ? 32.899  -7.577  -18.357 0.02 17.66 ?  71   LEU A O    1  
ATOM   1091   C CB   . LEU A 1 78  ? 34.896  -9.072  -19.969 0.02 17.93 ?  71   LEU A CB   1  
ATOM   1092   C CG   . LEU A 1 78  ? 36.412  -9.131  -20.130 0.02 18.05 ?  71   LEU A CG   1  
ATOM   1093   C CD1  . LEU A 1 78  ? 36.795  -9.072  -21.601 0.02 18.02 ?  71   LEU A CD1  1  
ATOM   1094   C CD2  . LEU A 1 78  ? 37.082  -8.016  -19.348 0.02 17.98 ?  71   LEU A CD2  1  
ATOM   1095   H H    . LEU A 1 78  ? 34.475  -11.306 -18.979 0.02 18.35 ?  71   LEU A H    1  
ATOM   1096   H HA   . LEU A 1 78  ? 35.031  -8.923  -17.930 0.02 18.04 ?  71   LEU A HA   1  
ATOM   1097   H HB2  . LEU A 1 78  ? 34.500  -9.721  -20.571 0.02 17.99 ?  71   LEU A HB2  1  
ATOM   1098   H HB3  . LEU A 1 78  ? 34.601  -8.184  -20.213 0.02 17.76 ?  71   LEU A HB3  1  
ATOM   1099   H HG   . LEU A 1 78  ? 36.729  -9.976  -19.777 0.02 18.24 ?  71   LEU A HG   1  
ATOM   1100   H HD11 . LEU A 1 78  ? 36.235  -9.681  -22.107 0.02 18.06 ?  71   LEU A HD11 1  
ATOM   1101   H HD12 . LEU A 1 78  ? 36.673  -8.163  -21.914 0.02 17.85 ?  71   LEU A HD12 1  
ATOM   1102   H HD13 . LEU A 1 78  ? 37.728  -9.331  -21.681 0.02 18.14 ?  71   LEU A HD13 1  
ATOM   1103   H HD21 . LEU A 1 78  ? 37.114  -8.257  -18.410 0.02 18.10 ?  71   LEU A HD21 1  
ATOM   1104   H HD22 . LEU A 1 78  ? 37.982  -7.893  -19.687 0.02 17.99 ?  71   LEU A HD22 1  
ATOM   1105   H HD23 . LEU A 1 78  ? 36.573  -7.199  -19.461 0.02 17.81 ?  71   LEU A HD23 1  
ATOM   1106   N N    . ARG A 1 79  ? 32.039  -9.645  -18.077 0.02 17.97 ?  72   ARG A N    1  
ATOM   1107   C CA   . ARG A 1 79  ? 30.697  -9.129  -17.817 0.02 17.85 ?  72   ARG A CA   1  
ATOM   1108   C C    . ARG A 1 79  ? 30.695  -8.259  -16.568 0.02 17.79 ?  72   ARG A C    1  
ATOM   1109   O O    . ARG A 1 79  ? 31.255  -8.641  -15.535 0.02 17.95 ?  72   ARG A O    1  
ATOM   1110   C CB   . ARG A 1 79  ? 29.677  -10.262 -17.659 0.02 18.04 ?  72   ARG A CB   1  
ATOM   1111   C CG   . ARG A 1 79  ? 28.245  -9.747  -17.414 0.02 17.95 ?  72   ARG A CG   1  
ATOM   1112   C CD   . ARG A 1 79  ? 27.284  -10.881 -17.120 0.02 18.20 ?  72   ARG A CD   1  
ATOM   1113   N NE   . ARG A 1 79  ? 26.976  -11.690 -18.285 0.02 18.29 ?  72   ARG A NE   1  
ATOM   1114   C CZ   . ARG A 1 79  ? 26.221  -12.781 -18.229 0.02 18.55 ?  72   ARG A CZ   1  
ATOM   1115   N NH1  . ARG A 1 79  ? 25.955  -13.504 -19.309 0.02 18.67 ?  72   ARG A NH1  1  
ATOM   1116   N NH2  . ARG A 1 79  ? 25.705  -13.146 -17.063 0.02 18.73 ?  72   ARG A NH2  1  
ATOM   1117   H H    . ARG A 1 79  ? 32.112  -10.499 -18.044 0.02 18.13 ?  72   ARG A H    1  
ATOM   1118   H HA   . ARG A 1 79  ? 30.412  -8.583  -18.565 0.02 17.70 ?  72   ARG A HA   1  
ATOM   1119   H HB2  . ARG A 1 79  ? 29.667  -10.791 -18.469 0.02 18.09 ?  72   ARG A HB2  1  
ATOM   1120   H HB3  . ARG A 1 79  ? 29.931  -10.820 -16.910 0.02 18.20 ?  72   ARG A HB3  1  
ATOM   1121   H HG2  . ARG A 1 79  ? 28.242  -9.139  -16.661 0.02 17.89 ?  72   ARG A HG2  1  
ATOM   1122   H HG3  . ARG A 1 79  ? 27.937  -9.283  -18.208 0.02 17.82 ?  72   ARG A HG3  1  
ATOM   1123   H HD2  . ARG A 1 79  ? 27.675  -11.461 -16.451 0.02 18.36 ?  72   ARG A HD2  1  
ATOM   1124   H HD3  . ARG A 1 79  ? 26.451  -10.512 -16.794 0.02 18.16 ?  72   ARG A HD3  1  
ATOM   1125   H HE   . ARG A 1 79  ? 27.005  -11.284 -19.040 0.02 18.17 ?  72   ARG A HE   1  
ATOM   1126   H HH11 . ARG A 1 79  ? 26.280  -13.282 -20.071 0.02 18.57 ?  72   ARG A HH11 1  
ATOM   1127   H HH12 . ARG A 1 79  ? 25.459  -14.203 -19.243 0.02 18.85 ?  72   ARG A HH12 1  
ATOM   1128   H HH21 . ARG A 1 79  ? 25.865  -12.685 -16.358 0.02 18.67 ?  72   ARG A HH21 1  
ATOM   1129   H HH22 . ARG A 1 79  ? 25.212  -13.846 -17.017 0.02 18.91 ?  72   ARG A HH22 1  
ATOM   1130   N N    . PHE A 1 80  ? 30.037  -7.107  -16.681 0.02 17.57 ?  73   PHE A N    1  
ATOM   1131   C CA   . PHE A 1 80  ? 29.890  -6.054  -15.670 0.02 17.49 ?  73   PHE A CA   1  
ATOM   1132   C C    . PHE A 1 80  ? 31.188  -5.302  -15.407 0.02 17.45 ?  73   PHE A C    1  
ATOM   1133   O O    . PHE A 1 80  ? 31.246  -4.494  -14.477 0.02 17.40 ?  73   PHE A O    1  
ATOM   1134   C CB   . PHE A 1 80  ? 29.378  -6.578  -14.311 0.02 17.69 ?  73   PHE A CB   1  
ATOM   1135   C CG   . PHE A 1 80  ? 28.113  -7.395  -14.376 0.02 17.80 ?  73   PHE A CG   1  
ATOM   1136   C CD1  . PHE A 1 80  ? 26.919  -6.842  -14.807 0.02 17.67 ?  73   PHE A CD1  1  
ATOM   1137   C CD2  . PHE A 1 80  ? 28.108  -8.707  -13.947 0.02 18.06 ?  73   PHE A CD2  1  
ATOM   1138   C CE1  . PHE A 1 80  ? 25.753  -7.601  -14.834 0.02 17.81 ?  73   PHE A CE1  1  
ATOM   1139   C CE2  . PHE A 1 80  ? 26.960  -9.453  -13.966 0.02 18.20 ?  73   PHE A CE2  1  
ATOM   1140   C CZ   . PHE A 1 80  ? 25.779  -8.890  -14.413 0.02 18.07 ?  73   PHE A CZ   1  
ATOM   1141   H H    . PHE A 1 80  ? 29.630  -6.900  -17.406 0.02 17.48 ?  73   PHE A H    1  
ATOM   1142   H HA   . PHE A 1 80  ? 29.251  -5.407  -15.996 0.02 17.37 ?  73   PHE A HA   1  
ATOM   1143   H HB2  . PHE A 1 80  ? 30.064  -7.131  -13.912 0.02 17.83 ?  73   PHE A HB2  1  
ATOM   1144   H HB3  . PHE A 1 80  ? 29.204  -5.815  -13.745 0.02 17.63 ?  73   PHE A HB3  1  
ATOM   1145   H HD1  . PHE A 1 80  ? 26.900  -5.957  -15.089 0.02 17.51 ?  73   PHE A HD1  1  
ATOM   1146   H HD2  . PHE A 1 80  ? 28.897  -9.091  -13.646 0.02 18.16 ?  73   PHE A HD2  1  
ATOM   1147   H HE1  . PHE A 1 80  ? 24.957  -7.228  -15.130 0.02 17.74 ?  73   PHE A HE1  1  
ATOM   1148   H HE2  . PHE A 1 80  ? 26.972  -10.336 -13.690 0.02 18.39 ?  73   PHE A HE2  1  
ATOM   1149   H HZ   . PHE A 1 80  ? 25.003  -9.398  -14.436 0.02 18.18 ?  73   PHE A HZ   1  
ATOM   1150   N N    . LYS A 1 81  ? 32.246  -5.566  -16.153 0.02 17.49 ?  74   LYS A N    1  
ATOM   1151   C CA   . LYS A 1 81  ? 33.532  -4.934  -15.920 0.02 17.51 ?  74   LYS A CA   1  
ATOM   1152   C C    . LYS A 1 81  ? 33.808  -3.827  -16.927 0.02 17.31 ?  74   LYS A C    1  
ATOM   1153   O O    . LYS A 1 81  ? 33.218  -3.767  -18.006 0.02 17.19 ?  74   LYS A O    1  
ATOM   1154   C CB   . LYS A 1 81  ? 34.666  -5.958  -15.992 0.02 17.71 ?  74   LYS A CB   1  
ATOM   1155   C CG   . LYS A 1 81  ? 34.438  -7.208  -15.172 0.02 17.95 ?  74   LYS A CG   1  
ATOM   1156   C CD   . LYS A 1 81  ? 34.409  -6.848  -13.686 0.02 18.04 ?  74   LYS A CD   1  
ATOM   1157   C CE   . LYS A 1 81  ? 34.031  -8.020  -12.806 0.02 18.30 ?  74   LYS A CE   1  
ATOM   1158   N NZ   . LYS A 1 81  ? 33.993  -7.742  -11.353 0.02 18.43 ?  74   LYS A NZ   1  
ATOM   1159   H H    . LYS A 1 81  ? 32.239  -6.116  -16.807 0.02 17.54 ?  74   LYS A H    1  
ATOM   1160   H HA   . LYS A 1 81  ? 33.544  -4.540  -15.034 0.02 17.54 ?  74   LYS A HA   1  
ATOM   1161   H HB2  . LYS A 1 81  ? 34.779  -6.227  -16.918 0.02 17.69 ?  74   LYS A HB2  1  
ATOM   1162   H HB3  . LYS A 1 81  ? 35.480  -5.544  -15.670 0.02 17.75 ?  74   LYS A HB3  1  
ATOM   1163   H HG2  . LYS A 1 81  ? 33.592  -7.613  -15.417 0.02 17.93 ?  74   LYS A HG2  1  
ATOM   1164   H HG3  . LYS A 1 81  ? 35.166  -7.828  -15.330 0.02 18.08 ?  74   LYS A HG3  1  
ATOM   1165   H HD2  . LYS A 1 81  ? 35.290  -6.544  -13.421 0.02 18.09 ?  74   LYS A HD2  1  
ATOM   1166   H HD3  . LYS A 1 81  ? 33.754  -6.148  -13.549 0.02 17.92 ?  74   LYS A HD3  1  
ATOM   1167   H HE2  . LYS A 1 81  ? 33.131  -8.270  -13.052 0.02 18.27 ?  74   LYS A HE2  1  
ATOM   1168   H HE3  . LYS A 1 81  ? 34.644  -8.753  -12.965 0.02 18.45 ?  74   LYS A HE3  1  
ATOM   1169   H HZ1  . LYS A 1 81  ? 33.252  -8.084  -10.995 0.02 18.51 ?  74   LYS A HZ1  1  
ATOM   1170   H HZ2  . LYS A 1 81  ? 34.700  -8.111  -10.955 0.02 18.58 ?  74   LYS A HZ2  1  
ATOM   1171   H HZ3  . LYS A 1 81  ? 34.010  -6.863  -11.214 0.02 18.30 ?  74   LYS A HZ3  1  
ATOM   1172   N N    . ALA A 1 82  ? 34.740  -2.952  -16.556 0.02 17.32 ?  75   ALA A N    1  
ATOM   1173   C CA   . ALA A 1 82  ? 35.212  -1.889  -17.423 0.02 17.19 ?  75   ALA A CA   1  
ATOM   1174   C C    . ALA A 1 82  ? 35.681  -2.498  -18.738 0.02 17.20 ?  75   ALA A C    1  
ATOM   1175   O O    . ALA A 1 82  ? 36.190  -3.617  -18.759 0.02 17.36 ?  75   ALA A O    1  
ATOM   1176   C CB   . ALA A 1 82  ? 36.353  -1.116  -16.751 0.02 17.29 ?  75   ALA A CB   1  
ATOM   1177   H H    . ALA A 1 82  ? 35.128  -2.964  -15.792 0.02 17.41 ?  75   ALA A H    1  
ATOM   1178   H HA   . ALA A 1 82  ? 34.485  -1.277  -17.604 0.02 17.06 ?  75   ALA A HA   1  
ATOM   1179   H HB1  . ALA A 1 82  ? 36.671  -0.429  -17.356 0.02 17.23 ?  75   ALA A HB1  1  
ATOM   1180   H HB2  . ALA A 1 82  ? 36.020  -0.704  -15.939 0.02 17.29 ?  75   ALA A HB2  1  
ATOM   1181   H HB3  . ALA A 1 82  ? 37.065  -1.735  -16.540 0.02 17.43 ?  75   ALA A HB3  1  
ATOM   1182   N N    . PRO A 1 83  ? 35.499  -1.811  -19.852 0.02 17.06 ?  76   PRO A N    1  
ATOM   1183   C CA   . PRO A 1 83  ? 35.975  -2.359  -21.121 0.02 17.10 ?  76   PRO A CA   1  
ATOM   1184   C C    . PRO A 1 83  ? 37.493  -2.454  -21.174 0.02 17.26 ?  76   PRO A C    1  
ATOM   1185   O O    . PRO A 1 83  ? 38.215  -1.632  -20.594 0.02 17.30 ?  76   PRO A O    1  
ATOM   1186   C CB   . PRO A 1 83  ? 35.441  -1.352  -22.151 0.02 16.93 ?  76   PRO A CB   1  
ATOM   1187   C CG   . PRO A 1 83  ? 35.373  -0.056  -21.382 0.02 16.86 ?  76   PRO A CG   1  
ATOM   1188   C CD   . PRO A 1 83  ? 34.886  -0.492  -20.011 0.02 16.90 ?  76   PRO A CD   1  
ATOM   1189   H HA   . PRO A 1 83  ? 35.587  -3.233  -21.275 0.02 17.14 ?  76   PRO A HA   1  
ATOM   1190   H HB2  . PRO A 1 83  ? 36.057  -1.292  -22.897 0.02 16.97 ?  76   PRO A HB2  1  
ATOM   1191   H HB3  . PRO A 1 83  ? 34.560  -1.622  -22.445 0.02 16.87 ?  76   PRO A HB3  1  
ATOM   1192   H HG2  . PRO A 1 83  ? 36.258  0.331   -21.314 0.02 16.92 ?  76   PRO A HG2  1  
ATOM   1193   H HG3  . PRO A 1 83  ? 34.757  0.564   -21.797 0.02 16.75 ?  76   PRO A HG3  1  
ATOM   1194   H HD2  . PRO A 1 83  ? 35.206  0.113   -19.329 0.02 16.93 ?  76   PRO A HD2  1  
ATOM   1195   H HD3  . PRO A 1 83  ? 33.923  -0.570  -19.998 0.02 16.82 ?  76   PRO A HD3  1  
ATOM   1196   N N    . GLN A 1 84  ? 37.978  -3.472  -21.897 0.02 17.38 ?  77   GLN A N    1  
ATOM   1197   C CA   . GLN A 1 84  ? 39.378  -3.549  -22.304 0.02 17.56 ?  77   GLN A CA   1  
ATOM   1198   C C    . GLN A 1 84  ? 39.502  -3.336  -23.806 0.02 17.53 ?  77   GLN A C    1  
ATOM   1199   O O    . GLN A 1 84  ? 38.586  -3.617  -24.581 0.02 17.44 ?  77   GLN A O    1  
ATOM   1200   C CB   . GLN A 1 84  ? 40.012  -4.897  -21.943 0.02 17.78 ?  77   GLN A CB   1  
ATOM   1201   C CG   . GLN A 1 84  ? 41.555  -5.072  -22.321 0.02 18.00 ?  77   GLN A CG   1  
ATOM   1202   C CD   . GLN A 1 84  ? 42.088  -6.416  -21.846 0.02 18.25 ?  77   GLN A CD   1  
ATOM   1203   O OE1  . GLN A 1 84  ? 43.236  -6.803  -22.100 0.02 18.47 ?  77   GLN A OE1  1  
ATOM   1204   N NE2  . GLN A 1 84  ? 41.233  -7.136  -21.117 0.02 18.26 ?  77   GLN A NE2  1  
ATOM   1205   H H    . GLN A 1 84  ? 37.512  -4.143  -22.149 0.02 17.39 ?  77   GLN A H    1  
ATOM   1206   H HA   . GLN A 1 84  ? 39.879  -2.849  -21.863 0.02 17.58 ?  77   GLN A HA   1  
ATOM   1207   H HB2  . GLN A 1 84  ? 39.920  -5.021  -20.982 0.02 17.82 ?  77   GLN A HB2  1  
ATOM   1208   H HB3  . GLN A 1 84  ? 39.521  -5.597  -22.399 0.02 17.77 ?  77   GLN A HB3  1  
ATOM   1209   H HG2  . GLN A 1 84  ? 41.673  -5.021  -23.282 0.02 17.99 ?  77   GLN A HG2  1  
ATOM   1210   H HG3  . GLN A 1 84  ? 42.070  -4.373  -21.884 0.02 18.00 ?  77   GLN A HG3  1  
ATOM   1211   H HE21 . GLN A 1 84  ? 41.056  -6.911  -20.304 0.02 18.23 ?  77   GLN A HE21 1  
ATOM   1212   H HE22 . GLN A 1 84  ? 40.844  -7.820  -21.467 0.02 18.30 ?  77   GLN A HE22 1  
ATOM   1213   N N    . ARG A 1 85  ? 40.669  -2.859  -24.204 0.02 17.64 ?  78   ARG A N    1  
ATOM   1214   C CA   . ARG A 1 85  ? 40.905  -2.587  -25.603 0.02 17.66 ?  78   ARG A CA   1  
ATOM   1215   C C    . ARG A 1 85  ? 40.759  -3.862  -26.437 0.02 17.77 ?  78   ARG A C    1  
ATOM   1216   O O    . ARG A 1 85  ? 41.003  -4.976  -25.958 0.02 17.91 ?  78   ARG A O    1  
ATOM   1217   C CB   . ARG A 1 85  ? 42.289  -1.967  -25.771 0.02 17.82 ?  78   ARG A CB   1  
ATOM   1218   C CG   . ARG A 1 85  ? 42.369  -0.538  -25.200 0.02 17.74 ?  78   ARG A CG   1  
ATOM   1219   C CD   . ARG A 1 85  ? 43.819  -0.094  -25.081 0.02 17.96 ?  78   ARG A CD   1  
ATOM   1220   N NE   . ARG A 1 85  ? 43.997  1.341   -24.876 0.02 17.93 ?  78   ARG A NE   1  
ATOM   1221   C CZ   . ARG A 1 85  ? 43.816  2.251   -25.834 0.02 17.91 ?  78   ARG A CZ   1  
ATOM   1222   N NH1  . ARG A 1 85  ? 43.418  1.868   -27.039 0.02 17.92 ?  78   ARG A NH1  1  
ATOM   1223   N NH2  . ARG A 1 85  ? 43.997  3.540   -25.585 0.02 17.91 ?  78   ARG A NH2  1  
ATOM   1224   H H    . ARG A 1 85  ? 41.330  -2.682  -23.688 0.02 17.72 ?  78   ARG A H    1  
ATOM   1225   H HA   . ARG A 1 85  ? 40.248  -1.945  -25.905 0.02 17.52 ?  78   ARG A HA   1  
ATOM   1226   H HB2  . ARG A 1 85  ? 42.927  -2.516  -25.292 0.02 17.96 ?  78   ARG A HB2  1  
ATOM   1227   H HB3  . ARG A 1 85  ? 42.521  -1.936  -26.709 0.02 17.88 ?  78   ARG A HB3  1  
ATOM   1228   H HG2  . ARG A 1 85  ? 41.898  0.081   -25.779 0.02 17.65 ?  78   ARG A HG2  1  
ATOM   1229   H HG3  . ARG A 1 85  ? 41.977  -0.530  -24.312 0.02 17.64 ?  78   ARG A HG3  1  
ATOM   1230   H HD2  . ARG A 1 85  ? 44.225  -0.557  -24.332 0.02 18.03 ?  78   ARG A HD2  1  
ATOM   1231   H HD3  . ARG A 1 85  ? 44.288  -0.320  -25.902 0.02 18.09 ?  78   ARG A HD3  1  
ATOM   1232   H HE   . ARG A 1 85  ? 44.452  1.581   -24.187 0.02 17.93 ?  78   ARG A HE   1  
ATOM   1233   H HH11 . ARG A 1 85  ? 43.289  1.037   -27.211 0.02 17.93 ?  78   ARG A HH11 1  
ATOM   1234   H HH12 . ARG A 1 85  ? 43.294  2.458   -27.649 0.02 17.92 ?  78   ARG A HH12 1  
ATOM   1235   H HH21 . ARG A 1 85  ? 44.255  3.789   -24.804 0.02 17.92 ?  78   ARG A HH21 1  
ATOM   1236   H HH22 . ARG A 1 85  ? 43.872  4.123   -26.205 0.02 17.92 ?  78   ARG A HH22 1  
ATOM   1237   N N    . PRO A 1 86  ? 40.373  -3.725  -27.700 0.02 17.73 ?  79   PRO A N    1  
ATOM   1238   C CA   . PRO A 1 86  ? 40.122  -4.894  -28.534 0.02 17.86 ?  79   PRO A CA   1  
ATOM   1239   C C    . PRO A 1 86  ? 41.398  -5.509  -29.080 0.02 18.12 ?  79   PRO A C    1  
ATOM   1240   O O    . PRO A 1 86  ? 42.499  -4.966  -28.984 0.02 18.21 ?  79   PRO A O    1  
ATOM   1241   C CB   . PRO A 1 86  ? 39.273  -4.323  -29.669 0.02 17.74 ?  79   PRO A CB   1  
ATOM   1242   C CG   . PRO A 1 86  ? 39.806  -2.921  -29.809 0.02 17.68 ?  79   PRO A CG   1  
ATOM   1243   C CD   . PRO A 1 86  ? 40.103  -2.471  -28.407 0.02 17.62 ?  79   PRO A CD   1  
ATOM   1244   H HA   . PRO A 1 86  ? 39.625  -5.571  -28.055 0.02 17.85 ?  79   PRO A HA   1  
ATOM   1245   H HB2  . PRO A 1 86  ? 39.405  -4.833  -30.478 0.02 17.86 ?  79   PRO A HB2  1  
ATOM   1246   H HB3  . PRO A 1 86  ? 38.340  -4.311  -29.406 0.02 17.62 ?  79   PRO A HB3  1  
ATOM   1247   H HG2  . PRO A 1 86  ? 40.610  -2.931  -30.347 0.02 17.82 ?  79   PRO A HG2  1  
ATOM   1248   H HG3  . PRO A 1 86  ? 39.128  -2.354  -30.207 0.02 17.57 ?  79   PRO A HG3  1  
ATOM   1249   H HD2  . PRO A 1 86  ? 40.886  -1.904  -28.397 0.02 17.68 ?  79   PRO A HD2  1  
ATOM   1250   H HD3  . PRO A 1 86  ? 39.336  -2.018  -28.029 0.02 17.46 ?  79   PRO A HD3  1  
ATOM   1251   N N    . THR A 1 87  ? 41.196  -6.633  -29.670 0.02 18.26 ?  80   THR A N    1  
ATOM   1252   C CA   . THR A 1 87  ? 42.248  -7.441  -30.249 0.02 18.55 ?  80   THR A CA   1  
ATOM   1253   C C    . THR A 1 87  ? 42.542  -6.920  -31.654 0.02 18.60 ?  80   THR A C    1  
ATOM   1254   O O    . THR A 1 87  ? 41.629  -6.842  -32.475 0.02 18.51 ?  80   THR A O    1  
ATOM   1255   C CB   . THR A 1 87  ? 41.791  -8.907  -30.258 0.02 18.71 ?  80   THR A CB   1  
ATOM   1256   O OG1  . THR A 1 87  ? 42.625  -9.728  -31.086 0.02 19.01 ?  80   THR A OG1  1  
ATOM   1257   C CG2  . THR A 1 87  ? 40.322  -9.001  -30.717 0.02 18.59 ?  80   THR A CG2  1  
ATOM   1258   H H    . THR A 1 87  ? 40.411  -6.958  -29.759 0.02 18.22 ?  80   THR A H    1  
ATOM   1259   H HA   . THR A 1 87  ? 43.042  -7.366  -29.700 0.02 18.63 ?  80   THR A HA   1  
ATOM   1260   H HB   . THR A 1 87  ? 41.840  -9.238  -29.348 0.02 18.70 ?  80   THR A HB   1  
ATOM   1261   H HG1  . THR A 1 87  ? 42.457  -10.538 -30.948 0.02 19.10 ?  80   THR A HG1  1  
ATOM   1262   H HG21 . THR A 1 87  ? 39.734  -8.919  -29.949 0.02 18.42 ?  80   THR A HG21 1  
ATOM   1263   H HG22 . THR A 1 87  ? 40.121  -8.289  -31.342 0.02 18.57 ?  80   THR A HG22 1  
ATOM   1264   H HG23 . THR A 1 87  ? 40.155  -9.855  -31.150 0.02 18.74 ?  80   THR A HG23 1  
ATOM   1265   N N    . PRO A 1 88  ? 43.773  -6.516  -31.959 0.02 18.77 ?  81   PRO A N    1  
ATOM   1266   C CA   . PRO A 1 88  ? 44.053  -6.024  -33.312 0.02 18.86 ?  81   PRO A CA   1  
ATOM   1267   C C    . PRO A 1 88  ? 43.916  -7.194  -34.271 0.02 19.06 ?  81   PRO A C    1  
ATOM   1268   O O    . PRO A 1 88  ? 43.630  -8.316  -33.863 0.02 19.12 ?  81   PRO A O    1  
ATOM   1269   C CB   . PRO A 1 88  ? 45.487  -5.513  -33.225 0.02 19.04 ?  81   PRO A CB   1  
ATOM   1270   C CG   . PRO A 1 88  ? 46.108  -6.431  -32.185 0.02 19.19 ?  81   PRO A CG   1  
ATOM   1271   C CD   . PRO A 1 88  ? 45.010  -6.681  -31.176 0.02 18.97 ?  81   PRO A CD   1  
ATOM   1272   H HA   . PRO A 1 88  ? 43.451  -5.307  -33.555 0.02 18.70 ?  81   PRO A HA   1  
ATOM   1273   H HB2  . PRO A 1 88  ? 45.932  -5.609  -34.082 0.02 19.21 ?  81   PRO A HB2  1  
ATOM   1274   H HB3  . PRO A 1 88  ? 45.495  -4.588  -32.932 0.02 18.93 ?  81   PRO A HB3  1  
ATOM   1275   H HG2  . PRO A 1 88  ? 46.383  -7.260  -32.607 0.02 19.38 ?  81   PRO A HG2  1  
ATOM   1276   H HG3  . PRO A 1 88  ? 46.863  -5.990  -31.767 0.02 19.26 ?  81   PRO A HG3  1  
ATOM   1277   H HD2  . PRO A 1 88  ? 45.074  -7.579  -30.816 0.02 19.08 ?  81   PRO A HD2  1  
ATOM   1278   H HD3  . PRO A 1 88  ? 45.042  -6.009  -30.477 0.02 18.86 ?  81   PRO A HD3  1  
ATOM   1279   N N    . TRP A 1 89  ? 44.130  -6.925  -35.556 0.02 19.20 ?  82   TRP A N    1  
ATOM   1280   C CA   . TRP A 1 89  ? 44.123  -7.989  -36.554 0.02 19.45 ?  82   TRP A CA   1  
ATOM   1281   C C    . TRP A 1 89  ? 44.978  -7.571  -37.740 0.02 19.69 ?  82   TRP A C    1  
ATOM   1282   O O    . TRP A 1 89  ? 45.247  -6.387  -37.941 0.02 19.61 ?  82   TRP A O    1  
ATOM   1283   C CB   . TRP A 1 89  ? 42.706  -8.320  -37.033 0.02 19.33 ?  82   TRP A CB   1  
ATOM   1284   C CG   . TRP A 1 89  ? 42.027  -7.126  -37.555 0.02 19.14 ?  82   TRP A CG   1  
ATOM   1285   C CD1  . TRP A 1 89  ? 42.032  -6.686  -38.844 0.02 19.25 ?  82   TRP A CD1  1  
ATOM   1286   C CD2  . TRP A 1 89  ? 41.267  -6.175  -36.808 0.02 18.82 ?  82   TRP A CD2  1  
ATOM   1287   N NE1  . TRP A 1 89  ? 41.348  -5.514  -38.948 0.02 19.03 ?  82   TRP A NE1  1  
ATOM   1288   C CE2  . TRP A 1 89  ? 40.842  -5.186  -37.715 0.02 18.76 ?  82   TRP A CE2  1  
ATOM   1289   C CE3  . TRP A 1 89  ? 40.892  -6.064  -35.461 0.02 18.61 ?  82   TRP A CE3  1  
ATOM   1290   C CZ2  . TRP A 1 89  ? 40.078  -4.102  -37.320 0.02 18.50 ?  82   TRP A CZ2  1  
ATOM   1291   C CZ3  . TRP A 1 89  ? 40.114  -4.992  -35.079 0.02 18.34 ?  82   TRP A CZ3  1  
ATOM   1292   C CH2  . TRP A 1 89  ? 39.726  -4.022  -35.996 0.02 18.29 ?  82   TRP A CH2  1  
ATOM   1293   H H    . TRP A 1 89  ? 44.278  -6.140  -35.871 0.02 19.18 ?  82   TRP A H    1  
ATOM   1294   H HA   . TRP A 1 89  ? 44.504  -8.789  -36.163 0.02 19.58 ?  82   TRP A HA   1  
ATOM   1295   H HB2  . TRP A 1 89  ? 42.759  -8.974  -37.745 0.02 19.52 ?  82   TRP A HB2  1  
ATOM   1296   H HB3  . TRP A 1 89  ? 42.190  -8.673  -36.292 0.02 19.22 ?  82   TRP A HB3  1  
ATOM   1297   H HD1  . TRP A 1 89  ? 42.477  -7.103  -39.546 0.02 19.47 ?  82   TRP A HD1  1  
ATOM   1298   H HE1  . TRP A 1 89  ? 41.221  -5.073  -39.673 0.02 19.07 ?  82   TRP A HE1  1  
ATOM   1299   H HE3  . TRP A 1 89  ? 41.154  -6.700  -34.837 0.02 18.66 ?  82   TRP A HE3  1  
ATOM   1300   H HZ2  . TRP A 1 89  ? 39.804  -3.461  -37.932 0.02 18.48 ?  82   TRP A HZ2  1  
ATOM   1301   H HZ3  . TRP A 1 89  ? 39.867  -4.904  -34.187 0.02 18.21 ?  82   TRP A HZ3  1  
ATOM   1302   H HH2  . TRP A 1 89  ? 39.205  -3.312  -35.705 0.02 18.13 ?  82   TRP A HH2  1  
ATOM   1303   N N    . ASP A 1 90  ? 45.412  -8.560  -38.533 0.02 20.00 ?  83   ASP A N    1  
ATOM   1304   C CA   . ASP A 1 90  ? 46.421  -8.316  -39.565 0.02 20.29 ?  83   ASP A CA   1  
ATOM   1305   C C    . ASP A 1 90  ? 45.870  -8.317  -40.983 0.02 20.41 ?  83   ASP A C    1  
ATOM   1306   O O    . ASP A 1 90  ? 46.590  -7.935  -41.912 0.02 20.66 ?  83   ASP A O    1  
ATOM   1307   C CB   . ASP A 1 90  ? 47.532  -9.367  -39.476 0.02 20.64 ?  83   ASP A CB   1  
ATOM   1308   H H    . ASP A 1 90  ? 45.139  -9.373  -38.489 0.02 20.08 ?  83   ASP A H    1  
ATOM   1309   H HA   . ASP A 1 90  ? 46.823  -7.449  -39.411 0.02 20.22 ?  83   ASP A HA   1  
ATOM   1310   N N    . GLY A 1 91  ? 44.647  -8.773  -41.179 0.02 20.29 ?  84   GLY A N    1  
ATOM   1311   C CA   . GLY A 1 91  ? 44.052  -8.719  -42.495 0.02 20.42 ?  84   GLY A CA   1  
ATOM   1312   C C    . GLY A 1 91  ? 43.159  -7.511  -42.631 0.02 20.14 ?  84   GLY A C    1  
ATOM   1313   O O    . GLY A 1 91  ? 43.410  -6.450  -42.051 0.02 19.94 ?  84   GLY A O    1  
ATOM   1314   H H    . GLY A 1 91  ? 44.142  -9.108  -40.569 0.02 20.15 ?  84   GLY A H    1  
ATOM   1315   H HA2  . GLY A 1 91  ? 44.745  -8.673  -43.168 0.02 20.64 ?  84   GLY A HA2  1  
ATOM   1316   H HA3  . GLY A 1 91  ? 43.521  -9.513  -42.652 0.02 20.48 ?  84   GLY A HA3  1  
ATOM   1317   N N    . VAL A 1 92  ? 42.100  -7.661  -43.404 0.02 20.16 ?  85   VAL A N    1  
ATOM   1318   C CA   . VAL A 1 92  ? 41.080  -6.625  -43.501 0.02 19.93 ?  85   VAL A CA   1  
ATOM   1319   C C    . VAL A 1 92  ? 39.801  -7.142  -42.876 0.02 19.71 ?  85   VAL A C    1  
ATOM   1320   O O    . VAL A 1 92  ? 39.336  -8.234  -43.209 0.02 19.86 ?  85   VAL A O    1  
ATOM   1321   C CB   . VAL A 1 92  ? 40.838  -6.169  -44.944 0.02 20.15 ?  85   VAL A CB   1  
ATOM   1322   C CG1  . VAL A 1 92  ? 39.950  -4.928  -44.938 0.02 19.92 ?  85   VAL A CG1  1  
ATOM   1323   C CG2  . VAL A 1 92  ? 42.160  -5.851  -45.620 0.02 20.42 ?  85   VAL A CG2  1  
ATOM   1324   H H    . VAL A 1 92  ? 41.942  -8.361  -43.875 0.02 20.32 ?  85   VAL A H    1  
ATOM   1325   H HA   . VAL A 1 92  ? 41.368  -5.848  -42.997 0.02 19.78 ?  85   VAL A HA   1  
ATOM   1326   H HB   . VAL A 1 92  ? 40.401  -6.876  -45.442 0.02 20.29 ?  85   VAL A HB   1  
ATOM   1327   H HG11 . VAL A 1 92  ? 39.759  -4.693  -45.858 0.02 20.07 ?  85   VAL A HG11 1  
ATOM   1328   H HG12 . VAL A 1 92  ? 39.130  -5.125  -44.464 0.02 19.83 ?  85   VAL A HG12 1  
ATOM   1329   H HG13 . VAL A 1 92  ? 40.420  -4.200  -44.506 0.02 19.73 ?  85   VAL A HG13 1  
ATOM   1330   H HG21 . VAL A 1 92  ? 41.977  -5.498  -46.503 0.02 20.57 ?  85   VAL A HG21 1  
ATOM   1331   H HG22 . VAL A 1 92  ? 42.620  -5.186  -45.090 0.02 20.29 ?  85   VAL A HG22 1  
ATOM   1332   H HG23 . VAL A 1 92  ? 42.697  -6.653  -45.690 0.02 20.58 ?  85   VAL A HG23 1  
ATOM   1333   N N    . ARG A 1 93  ? 39.240  -6.346  -41.965 0.02 19.38 ?  86   ARG A N    1  
ATOM   1334   C CA   . ARG A 1 93  ? 38.000  -6.665  -41.278 0.02 19.16 ?  86   ARG A CA   1  
ATOM   1335   C C    . ARG A 1 93  ? 36.802  -6.207  -42.102 0.02 19.12 ?  86   ARG A C    1  
ATOM   1336   O O    . ARG A 1 93  ? 36.683  -5.014  -42.408 0.02 19.04 ?  86   ARG A O    1  
ATOM   1337   C CB   . ARG A 1 93  ? 37.982  -5.987  -39.903 0.02 18.85 ?  86   ARG A CB   1  
ATOM   1338   C CG   . ARG A 1 93  ? 36.693  -6.215  -39.094 0.02 18.63 ?  86   ARG A CG   1  
ATOM   1339   C CD   . ARG A 1 93  ? 36.706  -5.442  -37.762 0.02 18.35 ?  86   ARG A CD   1  
ATOM   1340   N NE   . ARG A 1 93  ? 36.559  -6.280  -36.576 0.02 18.28 ?  86   ARG A NE   1  
ATOM   1341   C CZ   . ARG A 1 93  ? 37.486  -7.100  -36.106 0.02 18.43 ?  86   ARG A CZ   1  
ATOM   1342   N NH1  . ARG A 1 93  ? 38.653  -7.260  -36.738 0.02 18.67 ?  86   ARG A NH1  1  
ATOM   1343   N NH2  . ARG A 1 93  ? 37.236  -7.791  -34.997 0.02 18.36 ?  86   ARG A NH2  1  
ATOM   1344   H H    . ARG A 1 93  ? 39.571  -5.590  -41.730 0.02 19.29 ?  86   ARG A H    1  
ATOM   1345   H HA   . ARG A 1 93  ? 37.937  -7.625  -41.158 0.02 19.26 ?  86   ARG A HA   1  
ATOM   1346   H HB2  . ARG A 1 93  ? 38.723  -6.332  -39.384 0.02 18.89 ?  86   ARG A HB2  1  
ATOM   1347   H HB3  . ARG A 1 93  ? 38.097  -5.034  -40.030 0.02 18.77 ?  86   ARG A HB3  1  
ATOM   1348   H HG2  . ARG A 1 93  ? 35.931  -5.914  -39.609 0.02 18.60 ?  86   ARG A HG2  1  
ATOM   1349   H HG3  . ARG A 1 93  ? 36.611  -7.160  -38.891 0.02 18.71 ?  86   ARG A HG3  1  
ATOM   1350   H HD2  . ARG A 1 93  ? 37.546  -4.965  -37.684 0.02 18.38 ?  86   ARG A HD2  1  
ATOM   1351   H HD3  . ARG A 1 93  ? 35.975  -4.807  -37.758 0.02 18.22 ?  86   ARG A HD3  1  
ATOM   1352   H HE   . ARG A 1 93  ? 35.756  -6.416  -36.292 0.02 18.15 ?  86   ARG A HE   1  
ATOM   1353   H HH11 . ARG A 1 93  ? 38.822  -6.815  -37.453 0.02 18.73 ?  86   ARG A HH11 1  
ATOM   1354   H HH12 . ARG A 1 93  ? 39.240  -7.804  -36.422 0.02 18.77 ?  86   ARG A HH12 1  
ATOM   1355   H HH21 . ARG A 1 93  ? 36.483  -7.695  -34.595 0.02 18.22 ?  86   ARG A HH21 1  
ATOM   1356   H HH22 . ARG A 1 93  ? 37.822  -8.337  -34.690 0.02 18.47 ?  86   ARG A HH22 1  
ATOM   1357   N N    . ASP A 1 94  ? 35.895  -7.157  -42.400 0.02 19.17 ?  87   ASP A N    1  
ATOM   1358   C CA   . ASP A 1 94  ? 34.641  -6.902  -43.118 0.02 19.21 ?  87   ASP A CA   1  
ATOM   1359   C C    . ASP A 1 94  ? 33.689  -6.049  -42.274 0.02 18.90 ?  87   ASP A C    1  
ATOM   1360   O O    . ASP A 1 94  ? 33.017  -6.574  -41.377 0.02 18.77 ?  87   ASP A O    1  
ATOM   1361   C CB   . ASP A 1 94  ? 33.958  -8.236  -43.462 0.02 19.42 ?  87   ASP A CB   1  
ATOM   1362   C CG   . ASP A 1 94  ? 33.644  -8.404  -44.952 0.02 19.74 ?  87   ASP A CG   1  
ATOM   1363   O OD1  . ASP A 1 94  ? 34.449  -9.113  -45.577 0.02 20.02 ?  87   ASP A OD1  1  
ATOM   1364   O OD2  . ASP A 1 94  ? 32.612  -7.896  -45.483 0.02 19.76 -1 87   ASP A OD2  1  
ATOM   1365   H H    . ASP A 1 94  ? 35.995  -7.983  -42.186 0.02 19.19 ?  87   ASP A H    1  
ATOM   1366   H HA   . ASP A 1 94  ? 34.835  -6.428  -43.939 0.02 19.34 ?  87   ASP A HA   1  
ATOM   1367   H HB2  . ASP A 1 94  ? 34.549  -8.964  -43.211 0.02 19.50 ?  87   ASP A HB2  1  
ATOM   1368   H HB3  . ASP A 1 94  ? 33.126  -8.310  -42.971 0.02 19.29 ?  87   ASP A HB3  1  
ATOM   1369   N N    . CYS A 1 95  ? 33.610  -4.729  -42.592 0.02 18.79 ?  88   CYS A N    1  
ATOM   1370   C CA   . CYS A 1 95  ? 32.761  -3.738  -41.912 0.02 18.52 ?  88   CYS A CA   1  
ATOM   1371   C C    . CYS A 1 95  ? 31.624  -3.187  -42.813 0.02 18.59 ?  88   CYS A C    1  
ATOM   1372   O O    . CYS A 1 95  ? 31.217  -2.024  -42.679 0.02 18.46 ?  88   CYS A O    1  
ATOM   1373   C CB   . CYS A 1 95  ? 33.634  -2.597  -41.360 0.02 18.36 ?  88   CYS A CB   1  
ATOM   1374   S SG   . CYS A 1 95  ? 34.762  -3.028  -39.977 0.02 18.24 ?  88   CYS A SG   1  
ATOM   1375   H H    . CYS A 1 95  ? 34.071  -4.378  -43.224 0.02 18.89 ?  88   CYS A H    1  
ATOM   1376   H HA   . CYS A 1 95  ? 32.343  -4.167  -41.150 0.02 18.40 ?  88   CYS A HA   1  
ATOM   1377   H HB2  . CYS A 1 95  ? 34.195  -2.263  -42.077 0.02 18.50 ?  88   CYS A HB2  1  
ATOM   1378   H HB3  . CYS A 1 95  ? 33.055  -1.884  -41.052 0.02 18.21 ?  88   CYS A HB3  1  
ATOM   1379   H HG   . CYS A 1 95  ? 34.096  -3.252  -39.003 0.02 18.08 ?  88   CYS A HG   1  
ATOM   1380   N N    . CYS A 1 96  ? 31.047  -4.013  -43.693 0.02 18.82 ?  89   CYS A N    1  
ATOM   1381   C CA   . CYS A 1 96  ? 29.856  -3.637  -44.478 0.02 18.94 ?  89   CYS A CA   1  
ATOM   1382   C C    . CYS A 1 96  ? 28.519  -4.108  -43.876 0.02 18.86 ?  89   CYS A C    1  
ATOM   1383   O O    . CYS A 1 96  ? 27.468  -3.825  -44.462 0.02 18.91 ?  89   CYS A O    1  
ATOM   1384   C CB   . CYS A 1 96  ? 29.937  -4.179  -45.920 0.02 19.31 ?  89   CYS A CB   1  
ATOM   1385   S SG   . CYS A 1 96  ? 31.447  -3.707  -46.830 0.02 19.46 ?  89   CYS A SG   1  
ATOM   1386   H H    . CYS A 1 96  ? 31.335  -4.802  -43.866 0.02 18.92 ?  89   CYS A H    1  
ATOM   1387   H HA   . CYS A 1 96  ? 29.823  -2.673  -44.538 0.02 18.85 ?  89   CYS A HA   1  
ATOM   1388   H HB2  . CYS A 1 96  ? 29.884  -5.145  -45.895 0.02 19.42 ?  89   CYS A HB2  1  
ATOM   1389   H HB3  . CYS A 1 96  ? 29.182  -3.831  -46.419 0.02 19.41 ?  89   CYS A HB3  1  
ATOM   1390   H HG   . CYS A 1 96  ? 31.591  -2.715  -46.176 0.02 19.68 ?  89   CYS A HG   1  
ATOM   1391   N N    . ASN A 1 97  ? 28.515  -4.844  -42.762 0.02 18.73 ?  90   ASN A N    1  
ATOM   1392   C CA   . ASN A 1 97  ? 27.249  -5.199  -42.095 0.02 18.65 ?  90   ASN A CA   1  
ATOM   1393   C C    . ASN A 1 97  ? 27.259  -4.706  -40.663 0.02 18.33 ?  90   ASN A C    1  
ATOM   1394   O O    . ASN A 1 97  ? 28.287  -4.756  -39.996 0.02 18.20 ?  90   ASN A O    1  
ATOM   1395   C CB   . ASN A 1 97  ? 26.903  -6.718  -42.062 0.02 18.88 ?  90   ASN A CB   1  
ATOM   1396   C CG   . ASN A 1 97  ? 28.105  -7.657  -41.784 0.02 18.97 ?  90   ASN A CG   1  
ATOM   1397   O OD1  . ASN A 1 97  ? 28.961  -7.421  -40.919 0.02 18.78 ?  90   ASN A OD1  1  
ATOM   1398   N ND2  . ASN A 1 97  ? 28.116  -8.778  -42.503 0.02 19.28 ?  90   ASN A ND2  1  
ATOM   1399   H H    . ASN A 1 97  ? 29.221  -5.150  -42.379 0.02 18.69 ?  90   ASN A H    1  
ATOM   1400   H HA   . ASN A 1 97  ? 26.520  -4.749  -42.552 0.02 18.67 ?  90   ASN A HA   1  
ATOM   1401   H HB2  . ASN A 1 97  ? 26.261  -6.863  -41.351 0.02 18.80 ?  90   ASN A HB2  1  
ATOM   1402   H HB3  . ASN A 1 97  ? 26.506  -6.976  -42.910 0.02 19.08 ?  90   ASN A HB3  1  
ATOM   1403   H HD21 . ASN A 1 97  ? 27.695  -8.813  -43.251 0.02 19.43 ?  90   ASN A HD21 1  
ATOM   1404   H HD22 . ASN A 1 97  ? 28.539  -9.470  -42.215 0.02 19.36 ?  90   ASN A HD22 1  
ATOM   1405   N N    . HIS A 1 98  ? 26.098  -4.238  -40.185 0.02 18.23 ?  91   HIS A N    1  
ATOM   1406   C CA   . HIS A 1 98  ? 26.026  -3.897  -38.770 0.02 17.98 ?  91   HIS A CA   1  
ATOM   1407   C C    . HIS A 1 98  ? 26.240  -5.147  -37.923 0.02 18.02 ?  91   HIS A C    1  
ATOM   1408   O O    . HIS A 1 98  ? 26.143  -6.268  -38.398 0.02 18.26 ?  91   HIS A O    1  
ATOM   1409   C CB   . HIS A 1 98  ? 24.707  -3.173  -38.408 0.02 17.88 ?  91   HIS A CB   1  
ATOM   1410   C CG   . HIS A 1 98  ? 23.454  -4.011  -38.404 0.02 18.05 ?  91   HIS A CG   1  
ATOM   1411   N ND1  . HIS A 1 98  ? 22.293  -3.568  -39.004 0.02 18.16 ?  91   HIS A ND1  1  
ATOM   1412   C CD2  . HIS A 1 98  ? 23.134  -5.192  -37.812 0.02 18.16 ?  91   HIS A CD2  1  
ATOM   1413   C CE1  . HIS A 1 98  ? 21.326  -4.447  -38.810 0.02 18.34 ?  91   HIS A CE1  1  
ATOM   1414   N NE2  . HIS A 1 98  ? 21.810  -5.441  -38.086 0.02 18.34 ?  91   HIS A NE2  1  
ATOM   1415   H H    . HIS A 1 98  ? 25.379  -4.108  -40.637 0.02 18.33 ?  91   HIS A H    1  
ATOM   1416   H HA   . HIS A 1 98  ? 26.756  -3.291  -38.563 0.02 17.85 ?  91   HIS A HA   1  
ATOM   1417   H HB2  . HIS A 1 98  ? 24.807  -2.827  -37.507 0.02 17.71 ?  91   HIS A HB2  1  
ATOM   1418   H HB3  . HIS A 1 98  ? 24.574  -2.438  -39.023 0.02 17.89 ?  91   HIS A HB3  1  
ATOM   1419   H HD1  . HIS A 1 98  ? 22.212  -2.832  -39.441 0.02 18.14 ?  91   HIS A HD1  1  
ATOM   1420   H HD2  . HIS A 1 98  ? 23.703  -5.735  -37.324 0.02 18.15 ?  91   HIS A HD2  1  
ATOM   1421   H HE1  . HIS A 1 98  ? 20.458  -4.379  -39.139 0.02 18.45 ?  91   HIS A HE1  1  
ATOM   1422   N N    . LYS A 1 99  ? 26.595  -4.950  -36.658 0.02 17.82 ?  92   LYS A N    1  
ATOM   1423   C CA   . LYS A 1 99  ? 26.743  -6.096  -35.778 0.02 17.85 ?  92   LYS A CA   1  
ATOM   1424   C C    . LYS A 1 99  ? 25.482  -6.164  -34.905 0.02 17.77 ?  92   LYS A C    1  
ATOM   1425   O O    . LYS A 1 99  ? 24.371  -5.920  -35.378 0.02 17.80 ?  92   LYS A O    1  
ATOM   1426   C CB   . LYS A 1 99  ? 28.096  -5.997  -35.057 0.02 17.74 ?  92   LYS A CB   1  
ATOM   1427   C CG   . LYS A 1 99  ? 29.275  -6.827  -35.770 0.02 17.94 ?  92   LYS A CG   1  
ATOM   1428   C CD   . LYS A 1 99  ? 29.398  -6.668  -37.335 0.02 18.08 ?  92   LYS A CD   1  
ATOM   1429   C CE   . LYS A 1 99  ? 30.343  -7.759  -37.977 0.02 18.35 ?  92   LYS A CE   1  
ATOM   1430   N NZ   . LYS A 1 99  ? 31.699  -7.850  -37.349 0.02 18.33 ?  92   LYS A NZ   1  
ATOM   1431   H H    . LYS A 1 99  ? 26.751  -4.186  -36.295 0.02 17.68 ?  92   LYS A H    1  
ATOM   1432   H HA   . LYS A 1 99  ? 26.769  -6.909  -36.305 0.02 18.04 ?  92   LYS A HA   1  
ATOM   1433   H HB2  . LYS A 1 99  ? 28.367  -5.065  -35.024 0.02 17.62 ?  92   LYS A HB2  1  
ATOM   1434   H HB3  . LYS A 1 99  ? 28.011  -6.338  -34.155 0.02 17.66 ?  92   LYS A HB3  1  
ATOM   1435   H HG2  . LYS A 1 99  ? 30.117  -6.547  -35.391 0.02 17.88 ?  92   LYS A HG2  1  
ATOM   1436   H HG3  . LYS A 1 99  ? 29.141  -7.770  -35.596 0.02 18.09 ?  92   LYS A HG3  1  
ATOM   1437   H HD2  . LYS A 1 99  ? 28.524  -6.757  -37.746 0.02 18.14 ?  92   LYS A HD2  1  
ATOM   1438   H HD3  . LYS A 1 99  ? 29.770  -5.794  -37.526 0.02 17.98 ?  92   LYS A HD3  1  
ATOM   1439   H HE2  . LYS A 1 99  ? 29.923  -8.626  -37.874 0.02 18.43 ?  92   LYS A HE2  1  
ATOM   1440   H HE3  . LYS A 1 99  ? 30.458  -7.576  -38.919 0.02 18.49 ?  92   LYS A HE3  1  
ATOM   1441   H HZ1  . LYS A 1 99  ? 32.219  -8.405  -37.814 0.02 18.51 ?  92   LYS A HZ1  1  
ATOM   1442   H HZ2  . LYS A 1 99  ? 32.080  -7.044  -37.331 0.02 18.25 ?  92   LYS A HZ2  1  
ATOM   1443   H HZ3  . LYS A 1 99  ? 31.623  -8.152  -36.514 0.02 18.25 ?  92   LYS A HZ3  1  
ATOM   1444   N N    . ASP A 1 100 ? 25.618  -6.538  -33.647 0.02 17.70 ?  93   ASP A N    1  
ATOM   1445   C CA   . ASP A 1 100 ? 24.447  -6.582  -32.783 0.02 17.65 ?  93   ASP A CA   1  
ATOM   1446   C C    . ASP A 1 100 ? 24.205  -5.267  -32.061 0.02 17.40 ?  93   ASP A C    1  
ATOM   1447   O O    . ASP A 1 100 ? 25.101  -4.451  -31.884 0.02 17.24 ?  93   ASP A O    1  
ATOM   1448   C CB   . ASP A 1 100 ? 24.598  -7.635  -31.712 0.02 17.74 ?  93   ASP A CB   1  
ATOM   1449   C CG   . ASP A 1 100 ? 24.217  -8.980  -32.174 0.02 18.04 ?  93   ASP A CG   1  
ATOM   1450   O OD1  . ASP A 1 100 ? 23.057  -9.392  -31.895 0.02 18.13 ?  93   ASP A OD1  1  
ATOM   1451   O OD2  . ASP A 1 100 ? 25.083  -9.611  -32.786 0.02 18.20 -1 93   ASP A OD2  1  
ATOM   1452   H H    . ASP A 1 100 ? 26.350  -6.785  -33.274 0.02 17.69 ?  93   ASP A H    1  
ATOM   1453   H HA   . ASP A 1 100 ? 23.655  -6.789  -33.301 0.02 17.76 ?  93   ASP A HA   1  
ATOM   1454   H HB2  . ASP A 1 100 ? 25.520  -7.663  -31.407 0.02 17.72 ?  93   ASP A HB2  1  
ATOM   1455   H HB3  . ASP A 1 100 ? 24.008  -7.405  -30.973 0.02 17.66 ?  93   ASP A HB3  1  
ATOM   1456   N N    . LYS A 1 101 ? 22.982  -5.122  -31.561 0.02 17.39 ?  94   LYS A N    1  
ATOM   1457   C CA   . LYS A 1 101 ? 22.729  -4.119  -30.544 0.02 17.19 ?  94   LYS A CA   1  
ATOM   1458   C C    . LYS A 1 101 ? 22.913  -4.765  -29.178 0.02 17.19 ?  94   LYS A C    1  
ATOM   1459   O O    . LYS A 1 101 ? 22.918  -5.986  -29.037 0.02 17.35 ?  94   LYS A O    1  
ATOM   1460   C CB   . LYS A 1 101 ? 21.324  -3.516  -30.672 0.02 17.22 ?  94   LYS A CB   1  
ATOM   1461   C CG   . LYS A 1 101 ? 20.225  -4.523  -30.531 0.02 17.43 ?  94   LYS A CG   1  
ATOM   1462   C CD   . LYS A 1 101 ? 18.827  -3.890  -30.691 0.02 17.48 ?  94   LYS A CD   1  
ATOM   1463   C CE   . LYS A 1 101 ? 18.572  -3.383  -32.122 0.02 17.55 ?  94   LYS A CE   1  
ATOM   1464   N NZ   . LYS A 1 101 ? 17.297  -2.576  -32.288 0.02 17.68 ?  94   LYS A NZ   1  
ATOM   1465   H H    . LYS A 1 101 ? 22.302  -5.590  -31.785 0.02 17.51 ?  94   LYS A H    1  
ATOM   1466   H HA   . LYS A 1 101 ? 23.373  -3.399  -30.632 0.02 17.07 ?  94   LYS A HA   1  
ATOM   1467   H HB2  . LYS A 1 101 ? 21.209  -2.848  -29.980 0.02 17.10 ?  94   LYS A HB2  1  
ATOM   1468   H HB3  . LYS A 1 101 ? 21.242  -3.102  -31.543 0.02 17.24 ?  94   LYS A HB3  1  
ATOM   1469   H HG2  . LYS A 1 101 ? 20.330  -5.191  -31.222 0.02 17.57 ?  94   LYS A HG2  1  
ATOM   1470   H HG3  . LYS A 1 101 ? 20.275  -4.932  -29.655 0.02 17.42 ?  94   LYS A HG3  1  
ATOM   1471   H HD2  . LYS A 1 101 ? 18.145  -4.545  -30.473 0.02 17.63 ?  94   LYS A HD2  1  
ATOM   1472   H HD3  . LYS A 1 101 ? 18.756  -3.128  -30.096 0.02 17.35 ?  94   LYS A HD3  1  
ATOM   1473   H HE2  . LYS A 1 101 ? 19.307  -2.820  -32.396 0.02 17.41 ?  94   LYS A HE2  1  
ATOM   1474   H HE3  . LYS A 1 101 ? 18.509  -4.154  -32.709 0.02 17.68 ?  94   LYS A HE3  1  
ATOM   1475   H HZ1  . LYS A 1 101 ? 17.471  -1.705  -32.252 0.02 17.57 ?  94   LYS A HZ1  1  
ATOM   1476   H HZ2  . LYS A 1 101 ? 16.925  -2.764  -33.073 0.02 17.79 ?  94   LYS A HZ2  1  
ATOM   1477   H HZ3  . LYS A 1 101 ? 16.717  -2.786  -31.645 0.02 17.78 ?  94   LYS A HZ3  1  
ATOM   1478   N N    . SER A 1 102 ? 23.098  -3.920  -28.175 0.02 17.02 ?  95   SER A N    1  
ATOM   1479   C CA   . SER A 1 102 ? 23.219  -4.380  -26.804 0.02 17.02 ?  95   SER A CA   1  
ATOM   1480   C C    . SER A 1 102 ? 21.921  -5.058  -26.357 0.02 17.17 ?  95   SER A C    1  
ATOM   1481   O O    . SER A 1 102 ? 20.827  -4.704  -26.800 0.02 17.20 ?  95   SER A O    1  
ATOM   1482   C CB   . SER A 1 102 ? 23.544  -3.192  -25.917 0.02 16.83 ?  95   SER A CB   1  
ATOM   1483   O OG   . SER A 1 102 ? 23.680  -3.552  -24.540 0.02 16.84 ?  95   SER A OG   1  
ATOM   1484   H H    . SER A 1 102 ? 23.148  -3.066  -28.262 0.02 16.91 ?  95   SER A H    1  
ATOM   1485   H HA   . SER A 1 102 ? 23.948  -5.014  -26.739 0.02 17.07 ?  95   SER A HA   1  
ATOM   1486   H HB2  . SER A 1 102 ? 24.374  -2.799  -26.220 0.02 16.76 ?  95   SER A HB2  1  
ATOM   1487   H HB3  . SER A 1 102 ? 22.832  -2.541  -26.005 0.02 16.79 ?  95   SER A HB3  1  
ATOM   1488   H HG   . SER A 1 102 ? 23.050  -4.054  -24.307 0.02 16.93 ?  95   SER A HG   1  
ATOM   1489   N N    . VAL A 1 103 ? 22.052  -6.051  -25.467 0.02 17.30 ?  96   VAL A N    1  
ATOM   1490   C CA   . VAL A 1 103 ? 20.879  -6.781  -25.005 0.02 17.49 ?  96   VAL A CA   1  
ATOM   1491   C C    . VAL A 1 103 ? 19.844  -5.815  -24.448 0.02 17.41 ?  96   VAL A C    1  
ATOM   1492   O O    . VAL A 1 103 ? 20.121  -5.019  -23.541 0.02 17.26 ?  96   VAL A O    1  
ATOM   1493   C CB   . VAL A 1 103 ? 21.234  -7.826  -23.938 0.02 17.64 ?  96   VAL A CB   1  
ATOM   1494   C CG1  . VAL A 1 103 ? 19.998  -8.644  -23.605 0.02 17.89 ?  96   VAL A CG1  1  
ATOM   1495   C CG2  . VAL A 1 103 ? 22.364  -8.742  -24.384 0.02 17.73 ?  96   VAL A CG2  1  
ATOM   1496   H H    . VAL A 1 103 ? 22.794  -6.315  -25.131 0.02 17.30 ?  96   VAL A H    1  
ATOM   1497   H HA   . VAL A 1 103 ? 20.482  -7.244  -25.756 0.02 17.61 ?  96   VAL A HA   1  
ATOM   1498   H HB   . VAL A 1 103 ? 21.515  -7.369  -23.132 0.02 17.54 ?  96   VAL A HB   1  
ATOM   1499   H HG11 . VAL A 1 103 ? 20.258  -9.424  -23.094 0.02 18.00 ?  96   VAL A HG11 1  
ATOM   1500   H HG12 . VAL A 1 103 ? 19.389  -8.099  -23.086 0.02 17.84 ?  96   VAL A HG12 1  
ATOM   1501   H HG13 . VAL A 1 103 ? 19.569  -8.917  -24.432 0.02 18.00 ?  96   VAL A HG13 1  
ATOM   1502   H HG21 . VAL A 1 103 ? 22.407  -9.494  -23.776 0.02 17.85 ?  96   VAL A HG21 1  
ATOM   1503   H HG22 . VAL A 1 103 ? 22.186  -9.062  -25.282 0.02 17.82 ?  96   VAL A HG22 1  
ATOM   1504   H HG23 . VAL A 1 103 ? 23.197  -8.249  -24.359 0.02 17.59 ?  96   VAL A HG23 1  
ATOM   1505   N N    . GLN A 1 104 ? 18.609  -5.979  -24.906 0.02 17.55 ?  97   GLN A N    1  
ATOM   1506   C CA   . GLN A 1 104 ? 17.523  -5.080  -24.557 0.02 17.52 ?  97   GLN A CA   1  
ATOM   1507   C C    . GLN A 1 104 ? 16.202  -5.741  -24.901 0.02 17.78 ?  97   GLN A C    1  
ATOM   1508   O O    . GLN A 1 104 ? 16.150  -6.724  -25.639 0.02 17.96 ?  97   GLN A O    1  
ATOM   1509   C CB   . GLN A 1 104 ? 17.645  -3.763  -25.290 0.02 17.32 ?  97   GLN A CB   1  
ATOM   1510   C CG   . GLN A 1 104 ? 17.600  -3.910  -26.771 0.02 17.39 ?  97   GLN A CG   1  
ATOM   1511   C CD   . GLN A 1 104 ? 18.082  -2.675  -27.418 0.02 17.19 ?  97   GLN A CD   1  
ATOM   1512   O OE1  . GLN A 1 104 ? 17.325  -1.750  -27.696 0.02 17.17 ?  97   GLN A OE1  1  
ATOM   1513   N NE2  . GLN A 1 104 ? 19.371  -2.629  -27.632 0.02 17.08 ?  97   GLN A NE2  1  
ATOM   1514   H H    . GLN A 1 104 ? 18.370  -6.623  -25.416 0.02 17.69 ?  97   GLN A H    1  
ATOM   1515   H HA   . GLN A 1 104 ? 17.543  -4.894  -23.606 0.02 17.48 ?  97   GLN A HA   1  
ATOM   1516   H HB2  . GLN A 1 104 ? 16.918  -3.182  -25.030 0.02 17.32 ?  97   GLN A HB2  1  
ATOM   1517   H HB3  . GLN A 1 104 ? 18.494  -3.360  -25.062 0.02 17.18 ?  97   GLN A HB3  1  
ATOM   1518   H HG2  . GLN A 1 104 ? 18.172  -4.640  -27.045 0.02 17.44 ?  97   GLN A HG2  1  
ATOM   1519   H HG3  . GLN A 1 104 ? 16.688  -4.067  -27.057 0.02 17.52 ?  97   GLN A HG3  1  
ATOM   1520   H HE21 . GLN A 1 104 ? 19.889  -3.176  -27.224 0.02 17.10 ?  97   GLN A HE21 1  
ATOM   1521   H HE22 . GLN A 1 104 ? 19.697  -2.054  -28.177 0.02 17.00 ?  97   GLN A HE22 1  
ATOM   1522   N N    . VAL A 1 105 ? 15.125  -5.164  -24.384 0.02 17.81 ?  98   VAL A N    1  
ATOM   1523   C CA   . VAL A 1 105 ? 13.779  -5.553  -24.790 0.02 18.06 ?  98   VAL A CA   1  
ATOM   1524   C C    . VAL A 1 105 ? 13.434  -4.786  -26.054 0.02 18.02 ?  98   VAL A C    1  
ATOM   1525   O O    . VAL A 1 105 ? 13.469  -3.552  -26.055 0.02 17.82 ?  98   VAL A O    1  
ATOM   1526   C CB   . VAL A 1 105 ? 12.756  -5.262  -23.686 0.02 18.16 ?  98   VAL A CB   1  
ATOM   1527   C CG1  . VAL A 1 105 ? 11.348  -5.674  -24.144 0.02 18.45 ?  98   VAL A CG1  1  
ATOM   1528   C CG2  . VAL A 1 105 ? 13.131  -5.967  -22.421 0.02 18.24 ?  98   VAL A CG2  1  
ATOM   1529   H H    . VAL A 1 105 ? 15.143  -4.538  -23.799 0.02 17.70 ?  98   VAL A H    1  
ATOM   1530   H HA   . VAL A 1 105 ? 13.761  -6.502  -24.990 0.02 18.23 ?  98   VAL A HA   1  
ATOM   1531   H HB   . VAL A 1 105 ? 12.753  -4.309  -23.510 0.02 18.00 ?  98   VAL A HB   1  
ATOM   1532   H HG11 . VAL A 1 105 ? 10.780  -5.792  -23.366 0.02 18.55 ?  98   VAL A HG11 1  
ATOM   1533   H HG12 . VAL A 1 105 ? 10.989  -4.976  -24.714 0.02 18.39 ?  98   VAL A HG12 1  
ATOM   1534   H HG13 . VAL A 1 105 ? 11.403  -6.507  -24.638 0.02 18.60 ?  98   VAL A HG13 1  
ATOM   1535   H HG21 . VAL A 1 105 ? 12.516  -5.703  -21.719 0.02 18.33 ?  98   VAL A HG21 1  
ATOM   1536   H HG22 . VAL A 1 105 ? 13.083  -6.926  -22.562 0.02 18.39 ?  98   VAL A HG22 1  
ATOM   1537   H HG23 . VAL A 1 105 ? 14.034  -5.710  -22.181 0.02 18.06 ?  98   VAL A HG23 1  
ATOM   1538   N N    . ASP A 1 106 ? 13.068  -5.508  -27.111 0.02 18.24 ?  99   ASP A N    1  
ATOM   1539   C CA   . ASP A 1 106 ? 12.685  -4.872  -28.369 0.02 18.25 ?  99   ASP A CA   1  
ATOM   1540   C C    . ASP A 1 106 ? 11.453  -4.024  -28.126 0.02 18.31 ?  99   ASP A C    1  
ATOM   1541   O O    . ASP A 1 106 ? 10.429  -4.521  -27.637 0.02 18.55 ?  99   ASP A O    1  
ATOM   1542   C CB   . ASP A 1 106 ? 12.431  -5.921  -29.444 0.02 18.53 ?  99   ASP A CB   1  
ATOM   1543   C CG   . ASP A 1 106 ? 12.022  -5.305  -30.805 0.02 18.56 ?  99   ASP A CG   1  
ATOM   1544   O OD1  . ASP A 1 106 ? 11.310  -4.274  -30.825 0.02 18.55 ?  99   ASP A OD1  1  
ATOM   1545   O OD2  . ASP A 1 106 ? 12.394  -5.864  -31.879 0.02 18.62 -1 99   ASP A OD2  1  
ATOM   1546   H H    . ASP A 1 106 ? 13.037  -6.366  -27.129 0.02 18.41 ?  99   ASP A H    1  
ATOM   1547   H HA   . ASP A 1 106 ? 13.401  -4.290  -28.668 0.02 18.06 ?  99   ASP A HA   1  
ATOM   1548   H HB2  . ASP A 1 106 ? 13.237  -6.444  -29.575 0.02 18.50 ?  99   ASP A HB2  1  
ATOM   1549   H HB3  . ASP A 1 106 ? 11.717  -6.497  -29.131 0.02 18.73 ?  99   ASP A HB3  1  
ATOM   1550   N N    . PHE A 1 107 ? 11.571  -2.739  -28.432 0.02 18.10 ?  100  PHE A N    1  
ATOM   1551   C CA   . PHE A 1 107 ? 10.641  -1.733  -27.935 0.02 18.09 ?  100  PHE A CA   1  
ATOM   1552   C C    . PHE A 1 107 ? 9.325   -1.705  -28.702 0.02 18.36 ?  100  PHE A C    1  
ATOM   1553   O O    . PHE A 1 107 ? 8.392   -1.000  -28.295 0.02 18.42 ?  100  PHE A O    1  
ATOM   1554   C CB   . PHE A 1 107 ? 11.314  -0.347  -27.964 0.02 17.80 ?  100  PHE A CB   1  
ATOM   1555   C CG   . PHE A 1 107 ? 11.697  0.150   -29.357 0.02 17.77 ?  100  PHE A CG   1  
ATOM   1556   C CD1  . PHE A 1 107 ? 12.209  1.418   -29.541 0.02 17.58 ?  100  PHE A CD1  1  
ATOM   1557   C CD2  . PHE A 1 107 ? 11.568  -0.646  -30.460 0.02 17.95 ?  100  PHE A CD2  1  
ATOM   1558   C CE1  . PHE A 1 107 ? 12.561  1.865   -30.807 0.02 17.57 ?  100  PHE A CE1  1  
ATOM   1559   C CE2  . PHE A 1 107 ? 11.879  -0.204  -31.687 0.02 17.93 ?  100  PHE A CE2  1  
ATOM   1560   C CZ   . PHE A 1 107 ? 12.400  1.048   -31.874 0.02 17.74 ?  100  PHE A CZ   1  
ATOM   1561   H H    . PHE A 1 107 ? 12.199  -2.425  -28.922 0.02 17.96 ?  100  PHE A H    1  
ATOM   1562   H HA   . PHE A 1 107 ? 10.433  -1.942  -27.012 0.02 18.10 ?  100  PHE A HA   1  
ATOM   1563   H HB2  . PHE A 1 107 ? 10.705  0.304   -27.582 0.02 17.81 ?  100  PHE A HB2  1  
ATOM   1564   H HB3  . PHE A 1 107 ? 12.124  -0.385  -27.433 0.02 17.66 ?  100  PHE A HB3  1  
ATOM   1565   H HD1  . PHE A 1 107 ? 12.318  1.981   -28.811 0.02 17.47 ?  100  PHE A HD1  1  
ATOM   1566   H HD2  . PHE A 1 107 ? 11.220  -1.501  -30.374 0.02 18.10 ?  100  PHE A HD2  1  
ATOM   1567   H HE1  . PHE A 1 107 ? 12.901  2.723   -30.921 0.02 17.46 ?  100  PHE A HE1  1  
ATOM   1568   H HE2  . PHE A 1 107 ? 11.779  -0.778  -32.415 0.02 18.07 ?  100  PHE A HE2  1  
ATOM   1569   H HZ   . PHE A 1 107 ? 12.626  1.335   -32.727 0.02 17.75 ?  100  PHE A HZ   1  
ATOM   1570   N N    . ILE A 1 108 ? 9.243   -2.442  -29.803 0.02 18.55 ?  101  ILE A N    1  
ATOM   1571   C CA   . ILE A 1 108 ? 8.007   -2.544  -30.562 0.02 18.86 ?  101  ILE A CA   1  
ATOM   1572   C C    . ILE A 1 108 ? 7.553   -3.997  -30.594 0.02 19.19 ?  101  ILE A C    1  
ATOM   1573   O O    . ILE A 1 108 ? 6.353   -4.293  -30.614 0.02 19.49 ?  101  ILE A O    1  
ATOM   1574   C CB   . ILE A 1 108 ? 8.199   -1.971  -31.984 0.02 18.86 ?  101  ILE A CB   1  
ATOM   1575   C CG1  . ILE A 1 108 ? 8.594   -0.475  -31.947 0.02 18.59 ?  101  ILE A CG1  1  
ATOM   1576   C CG2  . ILE A 1 108 ? 6.931   -2.181  -32.828 0.02 19.21 ?  101  ILE A CG2  1  
ATOM   1577   C CD1  . ILE A 1 108 ? 9.053   0.107   -33.297 0.02 18.52 ?  101  ILE A CD1  1  
ATOM   1578   H H    . ILE A 1 108 ? 9.893   -2.898  -30.129 0.02 18.51 ?  101  ILE A H    1  
ATOM   1579   H HA   . ILE A 1 108 ? 7.313   -2.026  -30.128 0.02 18.90 ?  101  ILE A HA   1  
ATOM   1580   H HB   . ILE A 1 108 ? 8.919   -2.461  -32.408 0.02 18.82 ?  101  ILE A HB   1  
ATOM   1581   H HG12 . ILE A 1 108 ? 7.818   0.038   -31.677 0.02 18.69 ?  101  ILE A HG12 1  
ATOM   1582   H HG13 . ILE A 1 108 ? 9.282   -0.344  -31.291 0.02 18.39 ?  101  ILE A HG13 1  
ATOM   1583   H HG21 . ILE A 1 108 ? 6.719   -3.124  -32.874 0.02 19.41 ?  101  ILE A HG21 1  
ATOM   1584   H HG22 . ILE A 1 108 ? 6.194   -1.702  -32.416 0.02 19.26 ?  101  ILE A HG22 1  
ATOM   1585   H HG23 . ILE A 1 108 ? 7.088   -1.840  -33.721 0.02 19.22 ?  101  ILE A HG23 1  
ATOM   1586   H HD11 . ILE A 1 108 ? 8.373   -0.069  -33.965 0.02 18.73 ?  101  ILE A HD11 1  
ATOM   1587   H HD12 . ILE A 1 108 ? 9.172   1.064   -33.207 0.02 18.41 ?  101  ILE A HD12 1  
ATOM   1588   H HD13 . ILE A 1 108 ? 9.885   -0.307  -33.564 0.02 18.40 ?  101  ILE A HD13 1  
ATOM   1589   N N    . THR A 1 109 ? 8.504   -4.934  -30.580 0.02 19.15 ?  102  THR A N    1  
ATOM   1590   C CA   . THR A 1 109 ? 8.129   -6.338  -30.682 0.02 19.49 ?  102  THR A CA   1  
ATOM   1591   C C    . THR A 1 109 ? 7.878   -6.977  -29.332 0.02 19.56 ?  102  THR A C    1  
ATOM   1592   O O    . THR A 1 109 ? 7.102   -7.926  -29.260 0.02 19.90 ?  102  THR A O    1  
ATOM   1593   C CB   . THR A 1 109 ? 9.190   -7.151  -31.443 0.02 19.51 ?  102  THR A CB   1  
ATOM   1594   O OG1  . THR A 1 109 ? 10.327  -7.412  -30.611 0.02 19.28 ?  102  THR A OG1  1  
ATOM   1595   C CG2  . THR A 1 109 ? 9.632   -6.429  -32.696 0.02 19.41 ?  102  THR A CG2  1  
ATOM   1596   H H    . THR A 1 109 ? 9.349   -4.786  -30.513 0.02 18.96 ?  102  THR A H    1  
ATOM   1597   H HA   . THR A 1 109 ? 7.303   -6.407  -31.185 0.02 19.73 ?  102  THR A HA   1  
ATOM   1598   H HB   . THR A 1 109 ? 8.790   -7.982  -31.731 0.02 19.78 ?  102  THR A HB   1  
ATOM   1599   H HG1  . THR A 1 109 ? 10.888  -7.873  -31.030 0.02 19.30 ?  102  THR A HG1  1  
ATOM   1600   H HG21 . THR A 1 109 ? 9.946   -5.535  -32.486 0.02 19.15 ?  102  THR A HG21 1  
ATOM   1601   H HG22 . THR A 1 109 ? 10.345  -6.920  -33.135 0.02 19.46 ?  102  THR A HG22 1  
ATOM   1602   H HG23 . THR A 1 109 ? 8.879   -6.363  -33.303 0.02 19.59 ?  102  THR A HG23 1  
ATOM   1603   N N    . GLY A 1 110 ? 8.505   -6.476  -28.263 0.02 19.27 ?  103  GLY A N    1  
ATOM   1604   C CA   . GLY A 1 110 ? 8.457   -7.118  -26.970 0.02 19.33 ?  103  GLY A CA   1  
ATOM   1605   C C    . GLY A 1 110 ? 9.368   -8.318  -26.810 0.02 19.42 ?  103  GLY A C    1  
ATOM   1606   O O    . GLY A 1 110 ? 9.341   -8.969  -25.757 0.02 19.55 ?  103  GLY A O    1  
ATOM   1607   H H    . GLY A 1 110 ? 8.961   -5.750  -28.271 0.02 19.05 ?  103  GLY A H    1  
ATOM   1608   H HA2  . GLY A 1 110 ? 8.702   -6.471  -26.289 0.02 19.12 ?  103  GLY A HA2  1  
ATOM   1609   H HA3  . GLY A 1 110 ? 7.546   -7.403  -26.798 0.02 19.56 ?  103  GLY A HA3  1  
ATOM   1610   N N    . LYS A 1 111 ? 10.156  -8.661  -27.813 0.02 19.36 ?  104  LYS A N    1  
ATOM   1611   C CA   . LYS A 1 111 ? 11.068  -9.782  -27.685 0.02 19.43 ?  104  LYS A CA   1  
ATOM   1612   C C    . LYS A 1 111 ? 12.369  -9.287  -27.061 0.02 19.06 ?  104  LYS A C    1  
ATOM   1613   O O    . LYS A 1 111 ? 12.771  -8.154  -27.298 0.02 18.78 ?  104  LYS A O    1  
ATOM   1614   C CB   . LYS A 1 111 ? 11.353  -10.412 -29.054 0.02 19.62 ?  104  LYS A CB   1  
ATOM   1615   C CG   . LYS A 1 111 ? 10.159  -11.082 -29.735 0.02 20.05 ?  104  LYS A CG   1  
ATOM   1616   C CD   . LYS A 1 111 ? 9.767   -10.428 -31.075 0.02 20.09 ?  104  LYS A CD   1  
ATOM   1617   C CE   . LYS A 1 111 ? 9.182   -11.444 -32.112 0.02 20.49 ?  104  LYS A CE   1  
ATOM   1618   N NZ   . LYS A 1 111 ? 7.795   -12.043 -31.934 0.02 20.95 ?  104  LYS A NZ   1  
ATOM   1619   H H    . LYS A 1 111 ? 10.181  -8.263  -28.574 0.02 19.31 ?  104  LYS A H    1  
ATOM   1620   H HA   . LYS A 1 111 ? 10.679  -10.454 -27.106 0.02 19.61 ?  104  LYS A HA   1  
ATOM   1621   H HB2  . LYS A 1 111 ? 11.678  -9.718  -29.647 0.02 19.46 ?  104  LYS A HB2  1  
ATOM   1622   H HB3  . LYS A 1 111 ? 12.035  -11.091 -28.938 0.02 19.64 ?  104  LYS A HB3  1  
ATOM   1623   H HG2  . LYS A 1 111 ? 10.384  -12.008 -29.916 0.02 20.22 ?  104  LYS A HG2  1  
ATOM   1624   H HG3  . LYS A 1 111 ? 9.397   -11.032 -29.137 0.02 20.16 ?  104  LYS A HG3  1  
ATOM   1625   H HD2  . LYS A 1 111 ? 9.084   -9.772  -30.893 0.02 20.13 ?  104  LYS A HD2  1  
ATOM   1626   H HD3  . LYS A 1 111 ? 10.542  -10.004 -31.475 0.02 19.84 ?  104  LYS A HD3  1  
ATOM   1627   H HE2  . LYS A 1 111 ? 9.167   -10.993 -32.970 0.02 20.42 ?  104  LYS A HE2  1  
ATOM   1628   H HE3  . LYS A 1 111 ? 9.793   -12.195 -32.164 0.02 20.55 ?  104  LYS A HE3  1  
ATOM   1629   H HZ1  . LYS A 1 111 ? 7.734   -12.808 -32.385 0.02 21.17 ?  104  LYS A HZ1  1  
ATOM   1630   H HZ2  . LYS A 1 111 ? 7.635   -12.206 -31.073 0.02 21.01 ?  104  LYS A HZ2  1  
ATOM   1631   H HZ3  . LYS A 1 111 ? 7.176   -11.481 -32.240 0.02 20.95 ?  104  LYS A HZ3  1  
ATOM   1632   N N    . VAL A 1 112 ? 13.007  -10.133 -26.250 0.02 19.11 ?  105  VAL A N    1  
ATOM   1633   C CA   . VAL A 1 112 ? 14.378  -9.867  -25.837 0.02 18.82 ?  105  VAL A CA   1  
ATOM   1634   C C    . VAL A 1 112 ? 15.260  -10.070 -27.055 0.02 18.78 ?  105  VAL A C    1  
ATOM   1635   O O    . VAL A 1 112 ? 15.118  -11.064 -27.779 0.02 19.05 ?  105  VAL A O    1  
ATOM   1636   C CB   . VAL A 1 112 ? 14.799  -10.779 -24.673 0.02 18.90 ?  105  VAL A CB   1  
ATOM   1637   C CG1  . VAL A 1 112 ? 13.963  -10.500 -23.466 0.02 18.89 ?  105  VAL A CG1  1  
ATOM   1638   C CG2  . VAL A 1 112 ? 14.660  -12.246 -25.051 0.02 19.28 ?  105  VAL A CG2  1  
ATOM   1639   H H    . VAL A 1 112 ? 12.678  -10.865 -25.939 0.02 19.31 ?  105  VAL A H    1  
ATOM   1640   H HA   . VAL A 1 112 ? 14.462  -8.946  -25.545 0.02 18.60 ?  105  VAL A HA   1  
ATOM   1641   H HB   . VAL A 1 112 ? 15.729  -10.604 -24.447 0.02 18.74 ?  105  VAL A HB   1  
ATOM   1642   H HG11 . VAL A 1 112 ? 13.043  -10.378 -23.742 0.02 19.02 ?  105  VAL A HG11 1  
ATOM   1643   H HG12 . VAL A 1 112 ? 14.031  -11.246 -22.852 0.02 19.02 ?  105  VAL A HG12 1  
ATOM   1644   H HG13 . VAL A 1 112 ? 14.294  -9.694  -23.038 0.02 18.66 ?  105  VAL A HG13 1  
ATOM   1645   H HG21 . VAL A 1 112 ? 15.444  -12.720 -24.738 0.02 19.28 ?  105  VAL A HG21 1  
ATOM   1646   H HG22 . VAL A 1 112 ? 13.867  -12.615 -24.628 0.02 19.45 ?  105  VAL A HG22 1  
ATOM   1647   H HG23 . VAL A 1 112 ? 14.586  -12.335 -26.012 0.02 19.37 ?  105  VAL A HG23 1  
ATOM   1648   N N    . CYS A 1 113 ? 16.115  -9.097  -27.335 0.02 18.47 ?  106  CYS A N    1  
ATOM   1649   C CA   . CYS A 1 113 ? 16.914  -9.095  -28.553 0.02 18.42 ?  106  CYS A CA   1  
ATOM   1650   C C    . CYS A 1 113 ? 18.310  -8.598  -28.207 0.02 18.15 ?  106  CYS A C    1  
ATOM   1651   O O    . CYS A 1 113 ? 18.565  -8.146  -27.092 0.02 18.01 ?  106  CYS A O    1  
ATOM   1652   C CB   . CYS A 1 113 ? 16.300  -8.217  -29.667 0.02 18.38 ?  106  CYS A CB   1  
ATOM   1653   S SG   . CYS A 1 113 ? 16.248  -6.481  -29.312 0.02 18.05 ?  106  CYS A SG   1  
ATOM   1654   H H    . CYS A 1 113 ? 16.263  -8.427  -26.825 0.02 18.31 ?  106  CYS A H    1  
ATOM   1655   H HA   . CYS A 1 113 ? 16.979  -10.003 -28.882 0.02 18.61 ?  106  CYS A HA   1  
ATOM   1656   H HB2  . CYS A 1 113 ? 16.828  -8.329  -30.472 0.02 18.37 ?  106  CYS A HB2  1  
ATOM   1657   H HB3  . CYS A 1 113 ? 15.389  -8.504  -29.838 0.02 18.57 ?  106  CYS A HB3  1  
ATOM   1658   H HG   . CYS A 1 113 ? 17.399  -6.245  -29.082 0.02 17.85 ?  106  CYS A HG   1  
ATOM   1659   N N    . GLY A 1 114 ? 19.222  -8.679  -29.173 0.02 18.09 ?  107  GLY A N    1  
ATOM   1660   C CA   . GLY A 1 114 ? 20.564  -8.159  -28.984 0.02 17.87 ?  107  GLY A CA   1  
ATOM   1661   C C    . GLY A 1 114 ? 21.537  -9.160  -28.389 0.02 17.96 ?  107  GLY A C    1  
ATOM   1662   O O    . GLY A 1 114 ? 21.219  -10.316 -28.100 0.02 18.19 ?  107  GLY A O    1  
ATOM   1663   H H    . GLY A 1 114 ? 19.082  -9.027  -29.945 0.02 18.20 ?  107  GLY A H    1  
ATOM   1664   H HA2  . GLY A 1 114 ? 20.925  -7.872  -29.838 0.02 17.83 ?  107  GLY A HA2  1  
ATOM   1665   H HA3  . GLY A 1 114 ? 20.533  -7.387  -28.400 0.02 17.71 ?  107  GLY A HA3  1  
ATOM   1666   N N    . SER A 1 115 ? 22.760  -8.670  -28.181 0.02 17.78 ?  108  SER A N    1  
ATOM   1667   C CA   . SER A 1 115 ? 23.907  -9.511  -27.876 0.02 17.86 ?  108  SER A CA   1  
ATOM   1668   C C    . SER A 1 115 ? 24.797  -8.836  -26.839 0.02 17.66 ?  108  SER A C    1  
ATOM   1669   O O    . SER A 1 115 ? 24.898  -7.612  -26.819 0.02 17.44 ?  108  SER A O    1  
ATOM   1670   C CB   . SER A 1 115 ? 24.710  -9.742  -29.162 0.02 17.92 ?  108  SER A CB   1  
ATOM   1671   O OG   . SER A 1 115 ? 25.891  -10.412 -28.919 0.02 17.99 ?  108  SER A OG   1  
ATOM   1672   H H    . SER A 1 115 ? 22.950  -7.832  -28.229 0.02 17.62 ?  108  SER A H    1  
ATOM   1673   H HA   . SER A 1 115 ? 23.609  -10.369 -27.540 0.02 18.03 ?  108  SER A HA   1  
ATOM   1674   H HB2  . SER A 1 115 ? 24.177  -10.244 -29.796 0.02 18.07 ?  108  SER A HB2  1  
ATOM   1675   H HB3  . SER A 1 115 ? 24.934  -8.874  -29.520 0.02 17.76 ?  108  SER A HB3  1  
ATOM   1676   H HG   . SER A 1 115 ? 25.820  -10.864 -28.215 0.02 18.05 ?  108  SER A HG   1  
ATOM   1677   N N    . GLU A 1 116 ? 25.489  -9.631  -26.010 0.02 17.77 ?  109  GLU A N    1  
ATOM   1678   C CA   . GLU A 1 116 ? 26.503  -9.026  -25.151 0.02 17.62 ?  109  GLU A CA   1  
ATOM   1679   C C    . GLU A 1 116 ? 27.661  -8.479  -25.968 0.02 17.52 ?  109  GLU A C    1  
ATOM   1680   O O    . GLU A 1 116 ? 28.373  -7.577  -25.505 0.02 17.35 ?  109  GLU A O    1  
ATOM   1681   C CB   . GLU A 1 116 ? 27.033  -10.018 -24.129 0.02 17.78 ?  109  GLU A CB   1  
ATOM   1682   C CG   . GLU A 1 116 ? 26.018  -10.379 -23.088 0.02 17.87 ?  109  GLU A CG   1  
ATOM   1683   C CD   . GLU A 1 116 ? 26.635  -11.143 -21.947 0.02 18.03 ?  109  GLU A CD   1  
ATOM   1684   O OE1  . GLU A 1 116 ? 26.759  -12.406 -22.046 0.02 18.29 ?  109  GLU A OE1  1  
ATOM   1685   O OE2  . GLU A 1 116 ? 27.008  -10.459 -20.955 0.02 17.92 -1 109  GLU A OE2  1  
ATOM   1686   H H    . GLU A 1 116 ? 25.400  -10.480 -25.930 0.02 17.93 ?  109  GLU A H    1  
ATOM   1687   H HA   . GLU A 1 116 ? 26.099  -8.287  -24.673 0.02 17.49 ?  109  GLU A HA   1  
ATOM   1688   H HB2  . GLU A 1 116 ? 27.296  -10.831 -24.584 0.02 17.94 ?  109  GLU A HB2  1  
ATOM   1689   H HB3  . GLU A 1 116 ? 27.792  -9.622  -23.679 0.02 17.70 ?  109  GLU A HB3  1  
ATOM   1690   H HG2  . GLU A 1 116 ? 25.629  -9.568  -22.734 0.02 17.73 ?  109  GLU A HG2  1  
ATOM   1691   H HG3  . GLU A 1 116 ? 25.331  -10.926 -23.494 0.02 18.00 ?  109  GLU A HG3  1  
ATOM   1692   N N    . ASP A 1 117 ? 27.813  -8.982  -27.187 0.02 17.64 ?  110  ASP A N    1  
ATOM   1693   C CA   . ASP A 1 117 ? 28.850  -8.594  -28.134 0.02 17.59 ?  110  ASP A CA   1  
ATOM   1694   C C    . ASP A 1 117 ? 28.312  -7.411  -28.929 0.02 17.43 ?  110  ASP A C    1  
ATOM   1695   O O    . ASP A 1 117 ? 27.715  -7.557  -30.002 0.02 17.52 ?  110  ASP A O    1  
ATOM   1696   C CB   . ASP A 1 117 ? 29.181  -9.790  -29.017 0.02 17.83 ?  110  ASP A CB   1  
ATOM   1697   C CG   . ASP A 1 117 ? 30.358  -9.559  -29.935 0.02 17.83 ?  110  ASP A CG   1  
ATOM   1698   O OD1  . ASP A 1 117 ? 30.926  -8.467  -29.945 0.02 17.65 ?  110  ASP A OD1  1  
ATOM   1699   O OD2  . ASP A 1 117 ? 30.677  -10.515 -30.669 0.02 18.04 -1 110  ASP A OD2  1  
ATOM   1700   H H    . ASP A 1 117 ? 27.292  -9.584  -27.508 0.02 17.77 ?  110  ASP A H    1  
ATOM   1701   H HA   . ASP A 1 117 ? 29.648  -8.324  -27.656 0.02 17.52 ?  110  ASP A HA   1  
ATOM   1702   H HB2  . ASP A 1 117 ? 29.391  -10.550 -28.454 0.02 17.95 ?  110  ASP A HB2  1  
ATOM   1703   H HB3  . ASP A 1 117 ? 28.412  -9.991  -29.570 0.02 17.90 ?  110  ASP A HB3  1  
ATOM   1704   N N    . CYS A 1 118 ? 28.500  -6.207  -28.359 0.02 17.22 ?  111  CYS A N    1  
ATOM   1705   C CA   . CYS A 1 118 ? 27.876  -4.997  -28.870 0.02 17.08 ?  111  CYS A CA   1  
ATOM   1706   C C    . CYS A 1 118 ? 28.763  -3.761  -28.901 0.02 16.93 ?  111  CYS A C    1  
ATOM   1707   O O    . CYS A 1 118 ? 28.267  -2.687  -29.232 0.02 16.82 ?  111  CYS A O    1  
ATOM   1708   C CB   . CYS A 1 118 ? 26.621  -4.660  -28.044 0.02 17.01 ?  111  CYS A CB   1  
ATOM   1709   S SG   . CYS A 1 118 ? 26.960  -4.278  -26.265 0.02 16.90 ?  111  CYS A SG   1  
ATOM   1710   H H    . CYS A 1 118 ? 28.987  -6.077  -27.668 0.02 17.18 ?  111  CYS A H    1  
ATOM   1711   H HA   . CYS A 1 118 ? 27.588  -5.160  -29.781 0.02 17.15 ?  111  CYS A HA   1  
ATOM   1712   H HB2  . CYS A 1 118 ? 26.217  -3.867  -28.427 0.02 16.93 ?  111  CYS A HB2  1  
ATOM   1713   H HB3  . CYS A 1 118 ? 26.001  -5.403  -28.091 0.02 17.12 ?  111  CYS A HB3  1  
ATOM   1714   H HG   . CYS A 1 118 ? 27.476  -3.205  -26.159 0.02 16.76 ?  111  CYS A HG   1  
ATOM   1715   N N    . LEU A 1 119 ? 30.036  -3.857  -28.537 0.02 16.95 ?  112  LEU A N    1  
ATOM   1716   C CA   . LEU A 1 119 ? 30.871  -2.668  -28.382 0.02 16.84 ?  112  LEU A CA   1  
ATOM   1717   C C    . LEU A 1 119 ? 31.497  -2.313  -29.720 0.02 16.89 ?  112  LEU A C    1  
ATOM   1718   O O    . LEU A 1 119 ? 32.660  -2.606  -29.988 0.02 16.99 ?  112  LEU A O    1  
ATOM   1719   C CB   . LEU A 1 119 ? 31.933  -2.896  -27.323 0.02 16.86 ?  112  LEU A CB   1  
ATOM   1720   C CG   . LEU A 1 119 ? 31.302  -3.188  -25.971 0.02 16.83 ?  112  LEU A CG   1  
ATOM   1721   C CD1  . LEU A 1 119 ? 32.337  -3.252  -24.871 0.02 16.88 ?  112  LEU A CD1  1  
ATOM   1722   C CD2  . LEU A 1 119 ? 30.313  -2.108  -25.639 0.02 16.68 ?  112  LEU A CD2  1  
ATOM   1723   H H    . LEU A 1 119 ? 30.432  -4.597  -28.368 0.02 17.04 ?  112  LEU A H    1  
ATOM   1724   H HA   . LEU A 1 119 ? 30.324  -1.912  -28.133 0.02 16.73 ?  112  LEU A HA   1  
ATOM   1725   H HB2  . LEU A 1 119 ? 32.477  -3.654  -27.579 0.02 16.98 ?  112  LEU A HB2  1  
ATOM   1726   H HB3  . LEU A 1 119 ? 32.480  -2.104  -27.239 0.02 16.81 ?  112  LEU A HB3  1  
ATOM   1727   H HG   . LEU A 1 119 ? 30.838  -4.034  -26.014 0.02 16.91 ?  112  LEU A HG   1  
ATOM   1728   H HD11 . LEU A 1 119 ? 31.900  -3.457  -24.034 0.02 16.87 ?  112  LEU A HD11 1  
ATOM   1729   H HD12 . LEU A 1 119 ? 32.987  -3.937  -25.085 0.02 16.99 ?  112  LEU A HD12 1  
ATOM   1730   H HD13 . LEU A 1 119 ? 32.774  -2.390  -24.815 0.02 16.82 ?  112  LEU A HD13 1  
ATOM   1731   H HD21 . LEU A 1 119 ? 30.157  -2.115  -24.683 0.02 16.66 ?  112  LEU A HD21 1  
ATOM   1732   H HD22 . LEU A 1 119 ? 30.687  -1.258  -25.911 0.02 16.62 ?  112  LEU A HD22 1  
ATOM   1733   H HD23 . LEU A 1 119 ? 29.486  -2.274  -26.115 0.02 16.68 ?  112  LEU A HD23 1  
ATOM   1734   N N    . TYR A 1 120 ? 30.709  -1.606  -30.527 0.02 16.84 ?  113  TYR A N    1  
ATOM   1735   C CA   . TYR A 1 120 ? 31.041  -1.262  -31.904 0.02 16.92 ?  113  TYR A CA   1  
ATOM   1736   C C    . TYR A 1 120 ? 30.694  0.198   -32.178 0.02 16.82 ?  113  TYR A C    1  
ATOM   1737   O O    . TYR A 1 120 ? 29.827  0.792   -31.534 0.02 16.70 ?  113  TYR A O    1  
ATOM   1738   C CB   . TYR A 1 120 ? 30.306  -2.190  -32.894 0.02 17.07 ?  113  TYR A CB   1  
ATOM   1739   C CG   . TYR A 1 120 ? 30.720  -3.631  -32.761 0.02 17.22 ?  113  TYR A CG   1  
ATOM   1740   C CD1  . TYR A 1 120 ? 31.902  -4.093  -33.323 0.02 17.36 ?  113  TYR A CD1  1  
ATOM   1741   C CD2  . TYR A 1 120 ? 29.947  -4.532  -32.047 0.02 17.25 ?  113  TYR A CD2  1  
ATOM   1742   C CE1  . TYR A 1 120 ? 32.294  -5.426  -33.186 0.02 17.53 ?  113  TYR A CE1  1  
ATOM   1743   C CE2  . TYR A 1 120 ? 30.333  -5.837  -31.886 0.02 17.41 ?  113  TYR A CE2  1  
ATOM   1744   C CZ   . TYR A 1 120 ? 31.509  -6.293  -32.450 0.02 17.55 ?  113  TYR A CZ   1  
ATOM   1745   O OH   . TYR A 1 120 ? 31.850  -7.623  -32.275 0.02 17.74 ?  113  TYR A OH   1  
ATOM   1746   H H    . TYR A 1 120 ? 29.945  -1.302  -30.285 0.02 16.77 ?  113  TYR A H    1  
ATOM   1747   H HA   . TYR A 1 120 ? 31.995  -1.379  -32.037 0.02 16.99 ?  113  TYR A HA   1  
ATOM   1748   H HB2  . TYR A 1 120 ? 29.352  -2.136  -32.734 0.02 17.03 ?  113  TYR A HB2  1  
ATOM   1749   H HB3  . TYR A 1 120 ? 30.508  -1.903  -33.798 0.02 17.13 ?  113  TYR A HB3  1  
ATOM   1750   H HD1  . TYR A 1 120 ? 32.438  -3.508  -33.804 0.02 17.37 ?  113  TYR A HD1  1  
ATOM   1751   H HD2  . TYR A 1 120 ? 29.159  -4.238  -31.651 0.02 17.17 ?  113  TYR A HD2  1  
ATOM   1752   H HE1  . TYR A 1 120 ? 33.090  -5.719  -33.565 0.02 17.64 ?  113  TYR A HE1  1  
ATOM   1753   H HE2  . TYR A 1 120 ? 29.798  -6.422  -31.406 0.02 17.45 ?  113  TYR A HE2  1  
ATOM   1754   H HH   . TYR A 1 120 ? 32.675  -7.729  -32.383 0.02 17.80 ?  113  TYR A HH   1  
ATOM   1755   N N    . LEU A 1 121 ? 31.353  0.785   -33.184 0.02 16.89 ?  114  LEU A N    1  
ATOM   1756   C CA   . LEU A 1 121 ? 30.943  2.083   -33.683 0.02 16.85 ?  114  LEU A CA   1  
ATOM   1757   C C    . LEU A 1 121 ? 30.930  2.038   -35.206 0.02 17.01 ?  114  LEU A C    1  
ATOM   1758   O O    . LEU A 1 121 ? 31.433  1.107   -35.829 0.02 17.16 ?  114  LEU A O    1  
ATOM   1759   C CB   . LEU A 1 121 ? 31.849  3.222   -33.174 0.02 16.79 ?  114  LEU A CB   1  
ATOM   1760   C CG   . LEU A 1 121 ? 33.372  3.117   -33.276 0.02 16.90 ?  114  LEU A CG   1  
ATOM   1761   C CD1  . LEU A 1 121 ? 33.831  3.475   -34.702 0.02 17.07 ?  114  LEU A CD1  1  
ATOM   1762   C CD2  . LEU A 1 121 ? 34.080  4.012   -32.249 0.02 16.84 ?  114  LEU A CD2  1  
ATOM   1763   H H    . LEU A 1 121 ? 32.033  0.451   -33.580 0.02 16.98 ?  114  LEU A H    1  
ATOM   1764   H HA   . LEU A 1 121 ? 30.040  2.266   -33.394 0.02 16.78 ?  114  LEU A HA   1  
ATOM   1765   H HB2  . LEU A 1 121 ? 31.591  4.027   -33.645 0.02 16.80 ?  114  LEU A HB2  1  
ATOM   1766   H HB3  . LEU A 1 121 ? 31.653  3.339   -32.232 0.02 16.70 ?  114  LEU A HB3  1  
ATOM   1767   H HG   . LEU A 1 121 ? 33.626  2.201   -33.095 0.02 16.94 ?  114  LEU A HG   1  
ATOM   1768   H HD11 . LEU A 1 121 ? 34.513  4.161   -34.648 0.02 17.09 ?  114  LEU A HD11 1  
ATOM   1769   H HD12 . LEU A 1 121 ? 34.195  2.680   -35.112 0.02 17.17 ?  114  LEU A HD12 1  
ATOM   1770   H HD13 . LEU A 1 121 ? 33.080  3.806   -35.214 0.02 17.06 ?  114  LEU A HD13 1  
ATOM   1771   H HD21 . LEU A 1 121 ? 35.026  4.042   -32.451 0.02 16.93 ?  114  LEU A HD21 1  
ATOM   1772   H HD22 . LEU A 1 121 ? 33.709  4.905   -32.297 0.02 16.80 ?  114  LEU A HD22 1  
ATOM   1773   H HD23 . LEU A 1 121 ? 33.947  3.640   -31.365 0.02 16.76 ?  114  LEU A HD23 1  
ATOM   1774   N N    . SER A 1 122 ? 30.317  3.051   -35.788 0.02 17.01 ?  115  SER A N    1  
ATOM   1775   C CA   . SER A 1 122 ? 30.148  3.163   -37.235 0.02 17.18 ?  115  SER A CA   1  
ATOM   1776   C C    . SER A 1 122 ? 30.576  4.545   -37.672 0.02 17.21 ?  115  SER A C    1  
ATOM   1777   O O    . SER A 1 122 ? 30.290  5.529   -36.994 0.02 17.09 ?  115  SER A O    1  
ATOM   1778   C CB   . SER A 1 122 ? 28.695  2.942   -37.648 0.02 17.21 ?  115  SER A CB   1  
ATOM   1779   O OG   . SER A 1 122 ? 28.252  1.654   -37.283 0.02 17.22 ?  115  SER A OG   1  
ATOM   1780   H H    . SER A 1 122 ? 29.976  3.711   -35.362 0.02 16.92 ?  115  SER A H    1  
ATOM   1781   H HA   . SER A 1 122 ? 30.702  2.506   -37.679 0.02 17.29 ?  115  SER A HA   1  
ATOM   1782   H HB2  . SER A 1 122 ? 28.144  3.609   -37.214 0.02 17.11 ?  115  SER A HB2  1  
ATOM   1783   H HB3  . SER A 1 122 ? 28.623  3.040   -38.613 0.02 17.34 ?  115  SER A HB3  1  
ATOM   1784   H HG   . SER A 1 122 ? 27.495  1.510   -37.608 0.02 17.27 ?  115  SER A HG   1  
ATOM   1785   N N    . VAL A 1 123 ? 31.219  4.623   -38.838 0.02 17.41 ?  116  VAL A N    1  
ATOM   1786   C CA   . VAL A 1 123 ? 31.776  5.869   -39.346 0.02 17.50 ?  116  VAL A CA   1  
ATOM   1787   C C    . VAL A 1 123 ? 31.214  6.126   -40.734 0.02 17.70 ?  116  VAL A C    1  
ATOM   1788   O O    . VAL A 1 123 ? 31.213  5.219   -41.570 0.02 17.85 ?  116  VAL A O    1  
ATOM   1789   C CB   . VAL A 1 123 ? 33.315  5.818   -39.418 0.02 17.61 ?  116  VAL A CB   1  
ATOM   1790   C CG1  . VAL A 1 123 ? 33.873  7.154   -39.956 0.02 17.74 ?  116  VAL A CG1  1  
ATOM   1791   C CG2  . VAL A 1 123 ? 33.915  5.390   -38.068 0.02 17.46 ?  116  VAL A CG2  1  
ATOM   1792   H H    . VAL A 1 123 ? 31.345  3.948   -39.351 0.02 17.51 ?  116  VAL A H    1  
ATOM   1793   H HA   . VAL A 1 123 ? 31.506  6.605   -38.779 0.02 17.39 ?  116  VAL A HA   1  
ATOM   1794   H HB   . VAL A 1 123 ? 33.553  5.130   -40.053 0.02 17.74 ?  116  VAL A HB   1  
ATOM   1795   H HG11 . VAL A 1 123 ? 34.750  7.319   -39.579 0.02 17.75 ?  116  VAL A HG11 1  
ATOM   1796   H HG12 . VAL A 1 123 ? 33.931  7.088   -40.922 0.02 17.90 ?  116  VAL A HG12 1  
ATOM   1797   H HG13 . VAL A 1 123 ? 33.277  7.879   -39.721 0.02 17.66 ?  116  VAL A HG13 1  
ATOM   1798   H HG21 . VAL A 1 123 ? 34.876  5.297   -38.156 0.02 17.55 ?  116  VAL A HG21 1  
ATOM   1799   H HG22 . VAL A 1 123 ? 33.704  6.058   -37.402 0.02 17.34 ?  116  VAL A HG22 1  
ATOM   1800   H HG23 . VAL A 1 123 ? 33.533  4.537   -37.821 0.02 17.41 ?  116  VAL A HG23 1  
ATOM   1801   N N    . TYR A 1 124 ? 30.802  7.361   -40.984 0.02 17.72 ?  117  TYR A N    1  
ATOM   1802   C CA   . TYR A 1 124 ? 30.194  7.756   -42.260 0.02 17.93 ?  117  TYR A CA   1  
ATOM   1803   C C    . TYR A 1 124 ? 30.760  9.077   -42.760 0.02 18.07 ?  117  TYR A C    1  
ATOM   1804   O O    . TYR A 1 124 ? 30.855  10.052  -42.011 0.02 17.96 ?  117  TYR A O    1  
ATOM   1805   C CB   . TYR A 1 124 ? 28.690  7.903   -42.116 0.02 17.85 ?  117  TYR A CB   1  
ATOM   1806   C CG   . TYR A 1 124 ? 28.006  6.772   -41.407 0.02 17.70 ?  117  TYR A CG   1  
ATOM   1807   C CD1  . TYR A 1 124 ? 27.870  5.550   -41.992 0.02 17.82 ?  117  TYR A CD1  1  
ATOM   1808   C CD2  . TYR A 1 124 ? 27.450  6.951   -40.141 0.02 17.48 ?  117  TYR A CD2  1  
ATOM   1809   C CE1  . TYR A 1 124 ? 27.233  4.513   -41.358 0.02 17.73 ?  117  TYR A CE1  1  
ATOM   1810   C CE2  . TYR A 1 124 ? 26.814  5.943   -39.504 0.02 17.38 ?  117  TYR A CE2  1  
ATOM   1811   C CZ   . TYR A 1 124 ? 26.690  4.708   -40.101 0.02 17.50 ?  117  TYR A CZ   1  
ATOM   1812   O OH   . TYR A 1 124 ? 26.018  3.701   -39.453 0.02 17.44 ?  117  TYR A OH   1  
ATOM   1813   H H    . TYR A 1 124 ? 30.867  8.012   -40.433 0.02 17.63 ?  117  TYR A H    1  
ATOM   1814   H HA   . TYR A 1 124 ? 30.365  7.073   -42.919 0.02 18.05 ?  117  TYR A HA   1  
ATOM   1815   H HB2  . TYR A 1 124 ? 28.500  8.716   -41.627 0.02 17.77 ?  117  TYR A HB2  1  
ATOM   1816   H HB3  . TYR A 1 124 ? 28.306  7.967   -43.004 0.02 18.01 ?  117  TYR A HB3  1  
ATOM   1817   H HD1  . TYR A 1 124 ? 28.231  5.414   -42.837 0.02 17.99 ?  117  TYR A HD1  1  
ATOM   1818   H HD2  . TYR A 1 124 ? 27.523  7.779   -39.728 0.02 17.41 ?  117  TYR A HD2  1  
ATOM   1819   H HE1  . TYR A 1 124 ? 27.150  3.687   -41.776 0.02 17.83 ?  117  TYR A HE1  1  
ATOM   1820   H HE2  . TYR A 1 124 ? 26.451  6.090   -38.662 0.02 17.24 ?  117  TYR A HE2  1  
ATOM   1821   H HH   . TYR A 1 124 ? 26.194  2.960   -39.804 0.02 17.53 ?  117  TYR A HH   1  
ATOM   1822   N N    . THR A 1 125 ? 31.076  9.136   -44.059 0.02 18.35 ?  118  THR A N    1  
ATOM   1823   C CA   . THR A 1 125 ? 31.492  10.385  -44.674 0.02 18.54 ?  118  THR A CA   1  
ATOM   1824   C C    . THR A 1 125 ? 31.277  10.302  -46.177 0.02 18.85 ?  118  THR A C    1  
ATOM   1825   O O    . THR A 1 125 ? 31.480  9.252   -46.781 0.02 18.96 ?  118  THR A O    1  
ATOM   1826   C CB   . THR A 1 125 ? 32.962  10.701  -44.387 0.02 18.59 ?  118  THR A CB   1  
ATOM   1827   O OG1  . THR A 1 125 ? 33.353  11.890  -45.096 0.02 18.83 ?  118  THR A OG1  1  
ATOM   1828   C CG2  . THR A 1 125 ? 33.843  9.549   -44.800 0.02 18.70 ?  118  THR A CG2  1  
ATOM   1829   H H    . THR A 1 125 ? 31.063  8.466   -44.593 0.02 18.44 ?  118  THR A H    1  
ATOM   1830   H HA   . THR A 1 125 ? 30.948  11.108  -44.328 0.02 18.46 ?  118  THR A HA   1  
ATOM   1831   H HB   . THR A 1 125 ? 33.078  10.833  -43.432 0.02 18.41 ?  118  THR A HB   1  
ATOM   1832   H HG1  . THR A 1 125 ? 32.787  12.498  -44.975 0.02 18.79 ?  118  THR A HG1  1  
ATOM   1833   H HG21 . THR A 1 125 ? 34.774  9.794   -44.691 0.02 18.77 ?  118  THR A HG21 1  
ATOM   1834   H HG22 . THR A 1 125 ? 33.659  8.775   -44.248 0.02 18.55 ?  118  THR A HG22 1  
ATOM   1835   H HG23 . THR A 1 125 ? 33.683  9.321   -45.727 0.02 18.88 ?  118  THR A HG23 1  
ATOM   1836   N N    . ASN A 1 126 ? 30.930  11.438  -46.758 0.02 19.03 ?  119  ASN A N    1  
ATOM   1837   C CA   . ASN A 1 126 ? 30.690  11.534  -48.197 0.02 19.36 ?  119  ASN A CA   1  
ATOM   1838   C C    . ASN A 1 126 ? 31.958  11.663  -49.003 0.02 19.65 ?  119  ASN A C    1  
ATOM   1839   O O    . ASN A 1 126 ? 31.848  11.838  -50.216 0.02 19.97 ?  119  ASN A O    1  
ATOM   1840   C CB   . ASN A 1 126 ? 29.744  12.706  -48.535 0.02 19.47 ?  119  ASN A CB   1  
ATOM   1841   C CG   . ASN A 1 126 ? 30.384  14.094  -48.379 0.02 19.56 ?  119  ASN A CG   1  
ATOM   1842   O OD1  . ASN A 1 126 ? 31.590  14.271  -48.540 0.02 19.69 ?  119  ASN A OD1  1  
ATOM   1843   N ND2  . ASN A 1 126 ? 29.552  15.091  -48.067 0.02 19.53 ?  119  ASN A ND2  1  
ATOM   1844   H H    . ASN A 1 126 ? 30.832  12.182  -46.346 0.02 18.97 ?  119  ASN A H    1  
ATOM   1845   H HA   . ASN A 1 126 ? 30.256  10.721  -48.492 0.02 19.37 ?  119  ASN A HA   1  
ATOM   1846   H HB2  . ASN A 1 126 ? 29.459  12.615  -49.456 0.02 19.69 ?  119  ASN A HB2  1  
ATOM   1847   H HB3  . ASN A 1 126 ? 28.972  12.668  -47.952 0.02 19.29 ?  119  ASN A HB3  1  
ATOM   1848   H HD21 . ASN A 1 126 ? 29.861  15.856  -47.828 0.02 19.56 ?  119  ASN A HD21 1  
ATOM   1849   H HD22 . ASN A 1 126 ? 28.705  14.966  -48.098 0.02 19.49 ?  119  ASN A HD22 1  
ATOM   1850   N N    . ASN A 1 127 ? 33.135  11.572  -48.394 0.02 19.58 ?  120  ASN A N    1  
ATOM   1851   C CA   . ASN A 1 127 ? 34.377  11.772  -49.143 0.02 19.88 ?  120  ASN A CA   1  
ATOM   1852   C C    . ASN A 1 127 ? 35.538  11.403  -48.239 0.02 19.73 ?  120  ASN A C    1  
ATOM   1853   O O    . ASN A 1 127 ? 35.893  12.176  -47.345 0.02 19.59 ?  120  ASN A O    1  
ATOM   1854   C CB   . ASN A 1 127 ? 34.483  13.209  -49.617 0.02 20.12 ?  120  ASN A CB   1  
ATOM   1855   C CG   . ASN A 1 127 ? 35.794  13.502  -50.321 0.02 20.45 ?  120  ASN A CG   1  
ATOM   1856   O OD1  . ASN A 1 127 ? 36.683  12.644  -50.414 0.02 20.48 ?  120  ASN A OD1  1  
ATOM   1857   N ND2  . ASN A 1 127 ? 35.919  14.729  -50.819 0.02 20.72 ?  120  ASN A ND2  1  
ATOM   1858   H H    . ASN A 1 127 ? 33.248  11.399  -47.560 0.02 19.38 ?  120  ASN A H    1  
ATOM   1859   H HA   . ASN A 1 127 ? 34.392  11.192  -49.919 0.02 20.05 ?  120  ASN A HA   1  
ATOM   1860   H HB2  . ASN A 1 127 ? 33.759  13.394  -50.234 0.02 20.25 ?  120  ASN A HB2  1  
ATOM   1861   H HB3  . ASN A 1 127 ? 34.424  13.796  -48.851 0.02 19.96 ?  120  ASN A HB3  1  
ATOM   1862   H HD21 . ASN A 1 127 ? 35.269  15.077  -51.262 0.02 20.74 ?  120  ASN A HD21 1  
ATOM   1863   H HD22 . ASN A 1 127 ? 36.644  15.174  -50.696 0.02 20.88 ?  120  ASN A HD22 1  
ATOM   1864   N N    . LEU A 1 128 ? 36.135  10.242  -48.488 0.02 19.80 ?  121  LEU A N    1  
ATOM   1865   C CA   . LEU A 1 128 ? 37.276  9.818   -47.700 0.02 19.68 ?  121  LEU A CA   1  
ATOM   1866   C C    . LEU A 1 128 ? 38.561  10.561  -48.061 0.02 19.92 ?  121  LEU A C    1  
ATOM   1867   O O    . LEU A 1 128 ? 39.607  10.241  -47.505 0.02 19.83 ?  121  LEU A O    1  
ATOM   1868   C CB   . LEU A 1 128 ? 37.479  8.303   -47.856 0.02 19.72 ?  121  LEU A CB   1  
ATOM   1869   C CG   . LEU A 1 128 ? 36.529  7.375   -47.091 0.02 19.41 ?  121  LEU A CG   1  
ATOM   1870   C CD1  . LEU A 1 128 ? 36.478  5.958   -47.673 0.02 19.53 ?  121  LEU A CD1  1  
ATOM   1871   C CD2  . LEU A 1 128 ? 36.893  7.338   -45.598 0.02 19.10 ?  121  LEU A CD2  1  
ATOM   1872   H H    . LEU A 1 128 ? 35.901  9.688   -49.102 0.02 19.92 ?  121  LEU A H    1  
ATOM   1873   H HA   . LEU A 1 128 ? 37.090  9.996   -46.766 0.02 19.44 ?  121  LEU A HA   1  
ATOM   1874   H HB2  . LEU A 1 128 ? 37.405  8.084   -48.797 0.02 19.94 ?  121  LEU A HB2  1  
ATOM   1875   H HB3  . LEU A 1 128 ? 38.371  8.085   -47.546 0.02 19.74 ?  121  LEU A HB3  1  
ATOM   1876   H HG   . LEU A 1 128 ? 35.631  7.737   -47.154 0.02 19.36 ?  121  LEU A HG   1  
ATOM   1877   H HD11 . LEU A 1 128 ? 36.260  5.336   -46.962 0.02 19.34 ?  121  LEU A HD11 1  
ATOM   1878   H HD12 . LEU A 1 128 ? 35.802  5.921   -48.365 0.02 19.64 ?  121  LEU A HD12 1  
ATOM   1879   H HD13 . LEU A 1 128 ? 37.346  5.738   -48.049 0.02 19.70 ?  121  LEU A HD13 1  
ATOM   1880   H HD21 . LEU A 1 128 ? 36.981  8.249   -45.280 0.02 19.02 ?  121  LEU A HD21 1  
ATOM   1881   H HD22 . LEU A 1 128 ? 36.183  6.889   -45.116 0.02 18.93 ?  121  LEU A HD22 1  
ATOM   1882   H HD23 . LEU A 1 128 ? 37.729  6.863   -45.478 0.02 19.16 ?  121  LEU A HD23 1  
ATOM   1883   N N    . ASN A 1 129 ? 38.539  11.562  -48.939 0.02 20.23 ?  122  ASN A N    1  
ATOM   1884   C CA   . ASN A 1 129 ? 39.790  12.224  -49.328 0.02 20.53 ?  122  ASN A CA   1  
ATOM   1885   C C    . ASN A 1 129 ? 39.662  13.735  -49.521 0.02 20.67 ?  122  ASN A C    1  
ATOM   1886   O O    . ASN A 1 129 ? 39.993  14.274  -50.591 0.02 21.05 ?  122  ASN A O    1  
ATOM   1887   C CB   . ASN A 1 129 ? 40.360  11.527  -50.562 0.02 20.90 ?  122  ASN A CB   1  
ATOM   1888   C CG   . ASN A 1 129 ? 41.103  10.253  -50.169 0.02 20.87 ?  122  ASN A CG   1  
ATOM   1889   O OD1  . ASN A 1 129 ? 42.094  10.326  -49.458 0.02 20.97 ?  122  ASN A OD1  1  
ATOM   1890   N ND2  . ASN A 1 129 ? 40.591  9.095   -50.563 0.02 20.76 ?  122  ASN A ND2  1  
ATOM   1891   H H    . ASN A 1 129 ? 37.833  11.869  -49.323 0.02 20.30 ?  122  ASN A H    1  
ATOM   1892   H HA   . ASN A 1 129 ? 40.437  12.103  -48.616 0.02 20.42 ?  122  ASN A HA   1  
ATOM   1893   H HB2  . ASN A 1 129 ? 39.644  11.289  -51.171 0.02 20.95 ?  122  ASN A HB2  1  
ATOM   1894   H HB3  . ASN A 1 129 ? 40.987  12.121  -51.002 0.02 21.15 ?  122  ASN A HB3  1  
ATOM   1895   H HD21 . ASN A 1 129 ? 39.779  9.057   -50.842 0.02 20.77 ?  122  ASN A HD21 1  
ATOM   1896   H HD22 . ASN A 1 129 ? 41.068  8.381   -50.529 0.02 20.70 ?  122  ASN A HD22 1  
ATOM   1897   N N    . PRO A 1 130 ? 39.285  14.457  -48.466 0.02 20.43 ?  123  PRO A N    1  
ATOM   1898   C CA   . PRO A 1 130 ? 39.347  15.921  -48.521 0.02 20.60 ?  123  PRO A CA   1  
ATOM   1899   C C    . PRO A 1 130 ? 40.748  16.407  -48.157 0.02 20.82 ?  123  PRO A C    1  
ATOM   1900   O O    . PRO A 1 130 ? 41.483  15.772  -47.399 0.02 20.72 ?  123  PRO A O    1  
ATOM   1901   C CB   . PRO A 1 130 ? 38.290  16.351  -47.495 0.02 20.24 ?  123  PRO A CB   1  
ATOM   1902   C CG   . PRO A 1 130 ? 38.282  15.201  -46.453 0.02 19.90 ?  123  PRO A CG   1  
ATOM   1903   C CD   . PRO A 1 130 ? 38.854  13.970  -47.140 0.02 20.01 ?  123  PRO A CD   1  
ATOM   1904   H HA   . PRO A 1 130 ? 39.106  16.253  -49.399 0.02 20.81 ?  123  PRO A HA   1  
ATOM   1905   H HB2  . PRO A 1 130 ? 38.539  17.192  -47.081 0.02 20.29 ?  123  PRO A HB2  1  
ATOM   1906   H HB3  . PRO A 1 130 ? 37.427  16.422  -47.929 0.02 20.22 ?  123  PRO A HB3  1  
ATOM   1907   H HG2  . PRO A 1 130 ? 38.832  15.445  -45.695 0.02 19.87 ?  123  PRO A HG2  1  
ATOM   1908   H HG3  . PRO A 1 130 ? 37.371  15.035  -46.172 0.02 19.68 ?  123  PRO A HG3  1  
ATOM   1909   H HD2  . PRO A 1 130 ? 39.617  13.639  -46.640 0.02 19.99 ?  123  PRO A HD2  1  
ATOM   1910   H HD3  . PRO A 1 130 ? 38.166  13.292  -47.226 0.02 19.86 ?  123  PRO A HD3  1  
ATOM   1911   N N    . GLU A 1 131 ? 41.129  17.540  -48.743 0.02 21.15 ?  124  GLU A N    1  
ATOM   1912   C CA   . GLU A 1 131 ? 42.446  18.103  -48.458 0.02 21.44 ?  124  GLU A CA   1  
ATOM   1913   C C    . GLU A 1 131 ? 42.406  18.934  -47.202 0.02 21.29 ?  124  GLU A C    1  
ATOM   1914   O O    . GLU A 1 131 ? 43.317  19.714  -46.927 0.02 21.58 ?  124  GLU A O    1  
ATOM   1915   C CB   . GLU A 1 131 ? 42.920  18.969  -49.614 0.02 21.94 ?  124  GLU A CB   1  
ATOM   1916   C CG   . GLU A 1 131 ? 44.412  19.058  -49.733 0.02 22.31 ?  124  GLU A CG   1  
ATOM   1917   C CD   . GLU A 1 131 ? 44.917  17.955  -50.635 0.02 22.52 ?  124  GLU A CD   1  
ATOM   1918   O OE1  . GLU A 1 131 ? 44.515  17.961  -51.823 0.02 22.74 ?  124  GLU A OE1  1  
ATOM   1919   O OE2  . GLU A 1 131 ? 45.630  17.059  -50.143 0.02 22.47 -1 124  GLU A OE2  1  
ATOM   1920   H H    . GLU A 1 131 ? 40.651  18.000  -49.291 0.02 21.23 ?  124  GLU A H    1  
ATOM   1921   H HA   . GLU A 1 131 ? 43.085  17.385  -48.319 0.02 21.44 ?  124  GLU A HA   1  
ATOM   1922   H HB2  . GLU A 1 131 ? 42.592  18.580  -50.438 0.02 22.03 ?  124  GLU A HB2  1  
ATOM   1923   H HB3  . GLU A 1 131 ? 42.568  19.866  -49.506 0.02 21.98 ?  124  GLU A HB3  1  
ATOM   1924   H HG2  . GLU A 1 131 ? 44.657  19.912  -50.125 0.02 22.59 ?  124  GLU A HG2  1  
ATOM   1925   H HG3  . GLU A 1 131 ? 44.819  18.956  -48.858 0.02 22.16 ?  124  GLU A HG3  1  
ATOM   1926   N N    . THR A 1 132 ? 41.346  18.808  -46.459 0.02 20.87 ?  125  THR A N    1  
ATOM   1927   C CA   . THR A 1 132 ? 41.148  19.603  -45.280 0.02 20.70 ?  125  THR A CA   1  
ATOM   1928   C C    . THR A 1 132 ? 40.254  18.788  -44.371 0.02 20.24 ?  125  THR A C    1  
ATOM   1929   O O    . THR A 1 132 ? 39.041  18.710  -44.587 0.02 20.08 ?  125  THR A O    1  
ATOM   1930   C CB   . THR A 1 132 ? 40.541  20.938  -45.684 0.02 20.87 ?  125  THR A CB   1  
ATOM   1931   O OG1  . THR A 1 132 ? 39.965  21.588  -44.564 0.02 20.65 ?  125  THR A OG1  1  
ATOM   1932   C CG2  . THR A 1 132 ? 39.485  20.738  -46.770 0.02 20.85 ?  125  THR A CG2  1  
ATOM   1933   H H    . THR A 1 132 ? 40.700  18.269  -46.618 0.02 20.68 ?  125  THR A H    1  
ATOM   1934   H HA   . THR A 1 132 ? 41.995  19.758  -44.834 0.02 20.79 ?  125  THR A HA   1  
ATOM   1935   H HB   . THR A 1 132 ? 41.244  21.503  -46.049 0.02 21.18 ?  125  THR A HB   1  
ATOM   1936   H HG1  . THR A 1 132 ? 40.533  21.638  -43.946 0.02 20.65 ?  125  THR A HG1  1  
ATOM   1937   H HG21 . THR A 1 132 ? 38.823  20.092  -46.481 0.02 20.58 ?  125  THR A HG21 1  
ATOM   1938   H HG22 . THR A 1 132 ? 39.039  21.580  -46.950 0.02 20.94 ?  125  THR A HG22 1  
ATOM   1939   H HG23 . THR A 1 132 ? 39.900  20.422  -47.590 0.02 21.07 ?  125  THR A HG23 1  
ATOM   1940   N N    . LYS A 1 133 ? 40.872  18.134  -43.391 0.02 20.04 ?  126  LYS A N    1  
ATOM   1941   C CA   . LYS A 1 133 ? 40.118  17.289  -42.484 0.02 19.63 ?  126  LYS A CA   1  
ATOM   1942   C C    . LYS A 1 133 ? 38.897  18.044  -42.000 0.02 19.43 ?  126  LYS A C    1  
ATOM   1943   O O    . LYS A 1 133 ? 38.858  19.279  -42.026 0.02 19.57 ?  126  LYS A O    1  
ATOM   1944   C CB   . LYS A 1 133 ? 40.964  16.862  -41.291 0.02 19.52 ?  126  LYS A CB   1  
ATOM   1945   C CG   . LYS A 1 133 ? 42.172  16.011  -41.616 0.02 19.72 ?  126  LYS A CG   1  
ATOM   1946   C CD   . LYS A 1 133 ? 43.358  16.889  -41.870 0.02 20.12 ?  126  LYS A CD   1  
ATOM   1947   C CE   . LYS A 1 133 ? 43.798  16.820  -43.313 0.02 20.48 ?  126  LYS A CE   1  
ATOM   1948   N NZ   . LYS A 1 133 ? 44.899  17.785  -43.684 0.02 20.93 ?  126  LYS A NZ   1  
ATOM   1949   H H    . LYS A 1 133 ? 41.707  18.186  -43.222 0.02 20.16 ?  126  LYS A H    1  
ATOM   1950   H HA   . LYS A 1 133 ? 39.822  16.494  -42.948 0.02 19.58 ?  126  LYS A HA   1  
ATOM   1951   H HB2  . LYS A 1 133 ? 41.260  17.654  -40.821 0.02 19.60 ?  126  LYS A HB2  1  
ATOM   1952   H HB3  . LYS A 1 133 ? 40.381  16.369  -40.728 0.02 19.27 ?  126  LYS A HB3  1  
ATOM   1953   H HG2  . LYS A 1 133 ? 42.388  15.431  -40.871 0.02 19.58 ?  126  LYS A HG2  1  
ATOM   1954   H HG3  . LYS A 1 133 ? 42.002  15.481  -42.410 0.02 19.76 ?  126  LYS A HG3  1  
ATOM   1955   H HD2  . LYS A 1 133 ? 43.141  17.813  -41.667 0.02 20.17 ?  126  LYS A HD2  1  
ATOM   1956   H HD3  . LYS A 1 133 ? 44.092  16.586  -41.311 0.02 20.14 ?  126  LYS A HD3  1  
ATOM   1957   H HE2  . LYS A 1 133 ? 44.127  15.922  -43.475 0.02 20.52 ?  126  LYS A HE2  1  
ATOM   1958   H HE3  . LYS A 1 133 ? 43.044  16.997  -43.895 0.02 20.42 ?  126  LYS A HE3  1  
ATOM   1959   H HZ1  . LYS A 1 133 ? 45.611  17.645  -43.165 0.02 21.07 ?  126  LYS A HZ1  1  
ATOM   1960   H HZ2  . LYS A 1 133 ? 45.135  17.668  -44.535 0.02 21.08 ?  126  LYS A HZ2  1  
ATOM   1961   H HZ3  . LYS A 1 133 ? 44.617  18.624  -43.571 0.02 20.91 ?  126  LYS A HZ3  1  
ATOM   1962   N N    . ARG A 1 134 ? 37.949  17.325  -41.571 0.02 19.15 ?  127  ARG A N    1  
ATOM   1963   C CA   . ARG A 1 134 ? 36.617  17.878  -41.404 0.02 19.02 ?  127  ARG A CA   1  
ATOM   1964   C C    . ARG A 1 134 ? 36.189  17.814  -39.959 0.02 18.72 ?  127  ARG A C    1  
ATOM   1965   O O    . ARG A 1 134 ? 36.712  16.992  -39.197 0.02 18.56 ?  127  ARG A O    1  
ATOM   1966   C CB   . ARG A 1 134 ? 35.595  17.095  -42.224 0.02 18.95 ?  127  ARG A CB   1  
ATOM   1967   C CG   . ARG A 1 134 ? 35.557  17.494  -43.658 0.02 19.28 ?  127  ARG A CG   1  
ATOM   1968   C CD   . ARG A 1 134 ? 34.876  16.443  -44.435 0.02 19.22 ?  127  ARG A CD   1  
ATOM   1969   N NE   . ARG A 1 134 ? 34.723  16.848  -45.819 0.02 19.55 ?  127  ARG A NE   1  
ATOM   1970   C CZ   . ARG A 1 134 ? 33.915  16.248  -46.674 0.02 19.60 ?  127  ARG A CZ   1  
ATOM   1971   N NH1  . ARG A 1 134 ? 33.176  15.206  -46.293 0.02 19.34 ?  127  ARG A NH1  1  
ATOM   1972   N NH2  . ARG A 1 134 ? 33.843  16.701  -47.911 0.02 19.94 ?  127  ARG A NH2  1  
ATOM   1973   H H    . ARG A 1 134 ? 38.026  16.498  -41.356 0.02 19.04 ?  127  ARG A H    1  
ATOM   1974   H HA   . ARG A 1 134 ? 36.609  18.800  -41.696 0.02 19.20 ?  127  ARG A HA   1  
ATOM   1975   H HB2  . ARG A 1 134 ? 35.820  16.154  -42.188 0.02 18.83 ?  127  ARG A HB2  1  
ATOM   1976   H HB3  . ARG A 1 134 ? 34.712  17.237  -41.850 0.02 18.83 ?  127  ARG A HB3  1  
ATOM   1977   H HG2  . ARG A 1 134 ? 35.072  18.325  -43.763 0.02 19.39 ?  127  ARG A HG2  1  
ATOM   1978   H HG3  . ARG A 1 134 ? 36.465  17.584  -43.985 0.02 19.43 ?  127  ARG A HG3  1  
ATOM   1979   H HD2  . ARG A 1 134 ? 35.399  15.628  -44.406 0.02 19.18 ?  127  ARG A HD2  1  
ATOM   1980   H HD3  . ARG A 1 134 ? 33.994  16.293  -44.061 0.02 19.05 ?  127  ARG A HD3  1  
ATOM   1981   H HE   . ARG A 1 134 ? 35.222  17.483  -46.114 0.02 19.75 ?  127  ARG A HE   1  
ATOM   1982   H HH11 . ARG A 1 134 ? 33.221  14.909  -45.489 0.02 19.14 ?  127  ARG A HH11 1  
ATOM   1983   H HH12 . ARG A 1 134 ? 32.656  14.820  -46.858 0.02 19.40 ?  127  ARG A HH12 1  
ATOM   1984   H HH21 . ARG A 1 134 ? 34.322  17.373  -48.153 0.02 20.13 ?  127  ARG A HH21 1  
ATOM   1985   H HH22 . ARG A 1 134 ? 33.322  16.317  -48.477 0.02 19.99 ?  127  ARG A HH22 1  
ATOM   1986   N N    . PRO A 1 135 ? 35.200  18.633  -39.606 0.02 18.65 ?  128  PRO A N    1  
ATOM   1987   C CA   . PRO A 1 135 ? 34.551  18.472  -38.303 0.02 18.36 ?  128  PRO A CA   1  
ATOM   1988   C C    . PRO A 1 135 ? 34.032  17.054  -38.154 0.02 18.10 ?  128  PRO A C    1  
ATOM   1989   O O    . PRO A 1 135 ? 33.476  16.473  -39.085 0.02 18.13 ?  128  PRO A O    1  
ATOM   1990   C CB   . PRO A 1 135 ? 33.403  19.489  -38.346 0.02 18.38 ?  128  PRO A CB   1  
ATOM   1991   C CG   . PRO A 1 135 ? 33.770  20.453  -39.405 0.02 18.73 ?  128  PRO A CG   1  
ATOM   1992   C CD   . PRO A 1 135 ? 34.549  19.685  -40.406 0.02 18.86 ?  128  PRO A CD   1  
ATOM   1993   H HA   . PRO A 1 135 ? 35.156  18.692  -37.579 0.02 18.35 ?  128  PRO A HA   1  
ATOM   1994   H HB2  . PRO A 1 135 ? 32.584  19.036  -38.587 0.02 18.28 ?  128  PRO A HB2  1  
ATOM   1995   H HB3  . PRO A 1 135 ? 33.317  19.934  -37.490 0.02 18.31 ?  128  PRO A HB3  1  
ATOM   1996   H HG2  . PRO A 1 135 ? 32.965  20.820  -39.802 0.02 18.77 ?  128  PRO A HG2  1  
ATOM   1997   H HG3  . PRO A 1 135 ? 34.316  21.162  -39.026 0.02 18.83 ?  128  PRO A HG3  1  
ATOM   1998   H HD2  . PRO A 1 135 ? 33.956  19.289  -41.065 0.02 18.85 ?  128  PRO A HD2  1  
ATOM   1999   H HD3  . PRO A 1 135 ? 35.211  20.258  -40.823 0.02 19.09 ?  128  PRO A HD3  1  
ATOM   2000   N N    . VAL A 1 136 ? 34.195  16.513  -36.955 0.02 17.89 ?  129  VAL A N    1  
ATOM   2001   C CA   . VAL A 1 136 ? 33.774  15.153  -36.617 0.02 17.67 ?  129  VAL A CA   1  
ATOM   2002   C C    . VAL A 1 136 ? 32.632  15.265  -35.618 0.02 17.45 ?  129  VAL A C    1  
ATOM   2003   O O    . VAL A 1 136 ? 32.806  15.868  -34.559 0.02 17.41 ?  129  VAL A O    1  
ATOM   2004   C CB   . VAL A 1 136 ? 34.927  14.332  -36.014 0.02 17.63 ?  129  VAL A CB   1  
ATOM   2005   C CG1  . VAL A 1 136 ? 34.425  12.986  -35.558 0.02 17.42 ?  129  VAL A CG1  1  
ATOM   2006   C CG2  . VAL A 1 136 ? 36.055  14.123  -37.016 0.02 17.87 ?  129  VAL A CG2  1  
ATOM   2007   H H    . VAL A 1 136 ? 34.560  16.928  -36.300 0.02 17.89 ?  129  VAL A H    1  
ATOM   2008   H HA   . VAL A 1 136 ? 33.452  14.693  -37.403 0.02 17.70 ?  129  VAL A HA   1  
ATOM   2009   H HB   . VAL A 1 136 ? 35.279  14.805  -35.247 0.02 17.63 ?  129  VAL A HB   1  
ATOM   2010   H HG11 . VAL A 1 136 ? 35.180  12.389  -35.448 0.02 17.44 ?  129  VAL A HG11 1  
ATOM   2011   H HG12 . VAL A 1 136 ? 33.960  13.093  -34.713 0.02 17.29 ?  129  VAL A HG12 1  
ATOM   2012   H HG13 . VAL A 1 136 ? 33.823  12.633  -36.229 0.02 17.42 ?  129  VAL A HG13 1  
ATOM   2013   H HG21 . VAL A 1 136 ? 36.781  13.658  -36.576 0.02 17.86 ?  129  VAL A HG21 1  
ATOM   2014   H HG22 . VAL A 1 136 ? 35.723  13.588  -37.754 0.02 17.89 ?  129  VAL A HG22 1  
ATOM   2015   H HG23 . VAL A 1 136 ? 36.358  14.990  -37.328 0.02 18.03 ?  129  VAL A HG23 1  
ATOM   2016   N N    . LEU A 1 137 ? 31.476  14.701  -35.960 0.02 17.35 ?  130  LEU A N    1  
ATOM   2017   C CA   . LEU A 1 137 ? 30.296  14.681  -35.099 0.02 17.17 ?  130  LEU A CA   1  
ATOM   2018   C C    . LEU A 1 137 ? 30.081  13.261  -34.597 0.02 16.99 ?  130  LEU A C    1  
ATOM   2019   O O    . LEU A 1 137 ? 30.072  12.312  -35.376 0.02 17.02 ?  130  LEU A O    1  
ATOM   2020   C CB   . LEU A 1 137 ? 29.054  15.188  -35.847 0.02 17.23 ?  130  LEU A CB   1  
ATOM   2021   C CG   . LEU A 1 137 ? 28.935  16.714  -36.052 0.02 17.40 ?  130  LEU A CG   1  
ATOM   2022   C CD1  . LEU A 1 137 ? 29.842  17.243  -37.178 0.02 17.65 ?  130  LEU A CD1  1  
ATOM   2023   C CD2  . LEU A 1 137 ? 27.467  17.103  -36.294 0.02 17.44 ?  130  LEU A CD2  1  
ATOM   2024   H H    . LEU A 1 137 ? 31.348  14.310  -36.714 0.02 17.40 ?  130  LEU A H    1  
ATOM   2025   H HA   . LEU A 1 137 ? 30.444  15.260  -34.336 0.02 17.14 ?  130  LEU A HA   1  
ATOM   2026   H HB2  . LEU A 1 137 ? 29.047  14.775  -36.723 0.02 17.31 ?  130  LEU A HB2  1  
ATOM   2027   H HB3  . LEU A 1 137 ? 28.266  14.908  -35.360 0.02 17.12 ?  130  LEU A HB3  1  
ATOM   2028   H HG   . LEU A 1 137 ? 29.218  17.158  -35.240 0.02 17.36 ?  130  LEU A HG   1  
ATOM   2029   H HD11 . LEU A 1 137 ? 29.343  17.896  -37.693 0.02 17.77 ?  130  LEU A HD11 1  
ATOM   2030   H HD12 . LEU A 1 137 ? 30.628  17.656  -36.787 0.02 17.69 ?  130  LEU A HD12 1  
ATOM   2031   H HD13 . LEU A 1 137 ? 30.105  16.500  -37.745 0.02 17.65 ?  130  LEU A HD13 1  
ATOM   2032   H HD21 . LEU A 1 137 ? 26.966  16.951  -35.476 0.02 17.30 ?  130  LEU A HD21 1  
ATOM   2033   H HD22 . LEU A 1 137 ? 27.409  18.038  -36.551 0.02 17.53 ?  130  LEU A HD22 1  
ATOM   2034   H HD23 . LEU A 1 137 ? 27.112  16.540  -36.999 0.02 17.53 ?  130  LEU A HD23 1  
ATOM   2035   N N    . VAL A 1 138 ? 29.984  13.104  -33.279 0.02 16.84 ?  131  VAL A N    1  
ATOM   2036   C CA   . VAL A 1 138 ? 29.852  11.804  -32.641 0.02 16.70 ?  131  VAL A CA   1  
ATOM   2037   C C    . VAL A 1 138 ? 28.497  11.799  -31.959 0.02 16.58 ?  131  VAL A C    1  
ATOM   2038   O O    . VAL A 1 138 ? 28.261  12.591  -31.040 0.02 16.54 ?  131  VAL A O    1  
ATOM   2039   C CB   . VAL A 1 138 ? 30.969  11.528  -31.618 0.02 16.66 ?  131  VAL A CB   1  
ATOM   2040   C CG1  . VAL A 1 138 ? 30.797  10.123  -31.044 0.02 16.55 ?  131  VAL A CG1  1  
ATOM   2041   C CG2  . VAL A 1 138 ? 32.351  11.728  -32.235 0.02 16.82 ?  131  VAL A CG2  1  
ATOM   2042   H H    . VAL A 1 138 ? 30.000  13.758  -32.727 0.02 16.84 ?  131  VAL A H    1  
ATOM   2043   H HA   . VAL A 1 138 ? 29.871  11.103  -33.307 0.02 16.73 ?  131  VAL A HA   1  
ATOM   2044   H HB   . VAL A 1 138 ? 30.886  12.160  -30.891 0.02 16.64 ?  131  VAL A HB   1  
ATOM   2045   H HG11 . VAL A 1 138 ? 31.537  9.953   -30.439 0.02 16.55 ?  131  VAL A HG11 1  
ATOM   2046   H HG12 . VAL A 1 138 ? 29.964  10.079  -30.556 0.02 16.47 ?  131  VAL A HG12 1  
ATOM   2047   H HG13 . VAL A 1 138 ? 30.796  9.467   -31.756 0.02 16.58 ?  131  VAL A HG13 1  
ATOM   2048   H HG21 . VAL A 1 138 ? 33.027  11.489  -31.584 0.02 16.81 ?  131  VAL A HG21 1  
ATOM   2049   H HG22 . VAL A 1 138 ? 32.430  11.157  -33.013 0.02 16.86 ?  131  VAL A HG22 1  
ATOM   2050   H HG23 . VAL A 1 138 ? 32.455  12.656  -32.486 0.02 16.91 ?  131  VAL A HG23 1  
ATOM   2051   N N    . TYR A 1 139 ? 27.614  10.910  -32.394 0.02 16.55 ?  132  TYR A N    1  
ATOM   2052   C CA   . TYR A 1 139 ? 26.288  10.798  -31.818 0.02 16.48 ?  132  TYR A CA   1  
ATOM   2053   C C    . TYR A 1 139 ? 26.235  9.660   -30.809 0.02 16.37 ?  132  TYR A C    1  
ATOM   2054   O O    . TYR A 1 139 ? 26.559  8.512   -31.123 0.02 16.38 ?  132  TYR A O    1  
ATOM   2055   C CB   . TYR A 1 139 ? 25.229  10.572  -32.896 0.02 16.56 ?  132  TYR A CB   1  
ATOM   2056   C CG   . TYR A 1 139 ? 23.846  10.656  -32.290 0.02 16.52 ?  132  TYR A CG   1  
ATOM   2057   C CD1  . TYR A 1 139 ? 23.340  11.885  -31.901 0.02 16.53 ?  132  TYR A CD1  1  
ATOM   2058   C CD2  . TYR A 1 139 ? 23.082  9.532   -32.093 0.02 16.49 ?  132  TYR A CD2  1  
ATOM   2059   C CE1  . TYR A 1 139 ? 22.114  11.997  -31.327 0.02 16.52 ?  132  TYR A CE1  1  
ATOM   2060   C CE2  . TYR A 1 139 ? 21.819  9.630   -31.513 0.02 16.49 ?  132  TYR A CE2  1  
ATOM   2061   C CZ   . TYR A 1 139 ? 21.366  10.879  -31.140 0.02 16.50 ?  132  TYR A CZ   1  
ATOM   2062   O OH   . TYR A 1 139 ? 20.161  11.054  -30.532 0.02 16.51 ?  132  TYR A OH   1  
ATOM   2063   H H    . TYR A 1 139 ? 27.768  10.340  -33.016 0.02 16.60 ?  132  TYR A H    1  
ATOM   2064   H HA   . TYR A 1 139 ? 26.073  11.621  -31.358 0.02 16.47 ?  132  TYR A HA   1  
ATOM   2065   H HB2  . TYR A 1 139 ? 25.307  11.262  -33.568 0.02 16.65 ?  132  TYR A HB2  1  
ATOM   2066   H HB3  . TYR A 1 139 ? 25.346  9.691   -33.284 0.02 16.57 ?  132  TYR A HB3  1  
ATOM   2067   H HD1  . TYR A 1 139 ? 23.856  12.648  -32.026 0.02 16.57 ?  132  TYR A HD1  1  
ATOM   2068   H HD2  . TYR A 1 139 ? 23.407  8.703   -32.342 0.02 16.50 ?  132  TYR A HD2  1  
ATOM   2069   H HE1  . TYR A 1 139 ? 21.792  12.828  -31.068 0.02 16.55 ?  132  TYR A HE1  1  
ATOM   2070   H HE2  . TYR A 1 139 ? 21.305  8.875   -31.367 0.02 16.49 ?  132  TYR A HE2  1  
ATOM   2071   H HH   . TYR A 1 139 ? 20.227  11.654  -29.948 0.02 16.48 ?  132  TYR A HH   1  
ATOM   2072   N N    . ILE A 1 140 ? 25.797  9.993   -29.590 0.02 16.29 ?  133  ILE A N    1  
ATOM   2073   C CA   . ILE A 1 140 ? 25.502  9.015   -28.556 0.02 16.21 ?  133  ILE A CA   1  
ATOM   2074   C C    . ILE A 1 140 ? 23.994  8.893   -28.453 0.02 16.22 ?  133  ILE A C    1  
ATOM   2075   O O    . ILE A 1 140 ? 23.320  9.863   -28.110 0.02 16.23 ?  133  ILE A O    1  
ATOM   2076   C CB   . ILE A 1 140 ? 26.078  9.435   -27.203 0.02 16.17 ?  133  ILE A CB   1  
ATOM   2077   C CG1  . ILE A 1 140 ? 27.569  9.783   -27.366 0.02 16.20 ?  133  ILE A CG1  1  
ATOM   2078   C CG2  . ILE A 1 140 ? 25.826  8.303   -26.181 0.02 16.12 ?  133  ILE A CG2  1  
ATOM   2079   C CD1  . ILE A 1 140 ? 28.297  10.191  -26.060 0.02 16.20 ?  133  ILE A CD1  1  
ATOM   2080   H H    . ILE A 1 140 ? 25.672  10.800  -29.336 0.02 16.30 ?  133  ILE A H    1  
ATOM   2081   H HA   . ILE A 1 140 ? 25.870  8.156   -28.809 0.02 16.22 ?  133  ILE A HA   1  
ATOM   2082   H HB   . ILE A 1 140 ? 25.600  10.225  -26.911 0.02 16.17 ?  133  ILE A HB   1  
ATOM   2083   H HG12 . ILE A 1 140 ? 28.020  9.003   -27.715 0.02 16.21 ?  133  ILE A HG12 1  
ATOM   2084   H HG13 . ILE A 1 140 ? 27.659  10.518  -27.988 0.02 16.25 ?  133  ILE A HG13 1  
ATOM   2085   H HG21 . ILE A 1 140 ? 26.176  8.583   -25.322 0.02 16.11 ?  133  ILE A HG21 1  
ATOM   2086   H HG22 . ILE A 1 140 ? 24.878  8.136   -26.109 0.02 16.12 ?  133  ILE A HG22 1  
ATOM   2087   H HG23 . ILE A 1 140 ? 26.276  7.497   -26.473 0.02 16.13 ?  133  ILE A HG23 1  
ATOM   2088   H HD11 . ILE A 1 140 ? 29.212  10.427  -26.272 0.02 16.25 ?  133  ILE A HD11 1  
ATOM   2089   H HD12 . ILE A 1 140 ? 27.842  10.952  -25.674 0.02 16.20 ?  133  ILE A HD12 1  
ATOM   2090   H HD13 . ILE A 1 140 ? 28.291  9.446   -25.443 0.02 16.17 ?  133  ILE A HD13 1  
ATOM   2091   N N    . HIS A 1 141 ? 23.466  7.710   -28.751 0.02 16.24 ?  134  HIS A N    1  
ATOM   2092   C CA   . HIS A 1 141 ? 22.028  7.535   -28.756 0.02 16.29 ?  134  HIS A CA   1  
ATOM   2093   C C    . HIS A 1 141 ? 21.462  7.494   -27.344 0.02 16.25 ?  134  HIS A C    1  
ATOM   2094   O O    . HIS A 1 141 ? 22.128  7.090   -26.385 0.02 16.19 ?  134  HIS A O    1  
ATOM   2095   C CB   . HIS A 1 141 ? 21.605  6.252   -29.458 0.02 16.37 ?  134  HIS A CB   1  
ATOM   2096   C CG   . HIS A 1 141 ? 22.001  5.001   -28.742 0.02 16.35 ?  134  HIS A CG   1  
ATOM   2097   N ND1  . HIS A 1 141 ? 21.264  4.458   -27.707 0.02 16.36 ?  134  HIS A ND1  1  
ATOM   2098   C CD2  . HIS A 1 141 ? 23.049  4.171   -28.934 0.02 16.35 ?  134  HIS A CD2  1  
ATOM   2099   C CE1  . HIS A 1 141 ? 21.855  3.354   -27.288 0.02 16.37 ?  134  HIS A CE1  1  
ATOM   2100   N NE2  . HIS A 1 141 ? 22.934  3.152   -28.023 0.02 16.36 ?  134  HIS A NE2  1  
ATOM   2101   H H    . HIS A 1 141 ? 23.912  7.008   -28.961 0.02 16.25 ?  134  HIS A H    1  
ATOM   2102   H HA   . HIS A 1 141 ? 21.616  8.280   -29.218 0.02 16.32 ?  134  HIS A HA   1  
ATOM   2103   H HB2  . HIS A 1 141 ? 20.642  6.245   -29.527 0.02 16.42 ?  134  HIS A HB2  1  
ATOM   2104   H HB3  . HIS A 1 141 ? 22.001  6.228   -30.341 0.02 16.41 ?  134  HIS A HB3  1  
ATOM   2105   H HD1  . HIS A 1 141 ? 20.543  4.787   -27.386 0.02 16.37 ?  134  HIS A HD1  1  
ATOM   2106   H HD2  . HIS A 1 141 ? 23.722  4.266   -29.564 0.02 16.36 ?  134  HIS A HD2  1  
ATOM   2107   H HE1  . HIS A 1 141 ? 21.557  2.805   -26.602 0.02 16.39 ?  134  HIS A HE1  1  
ATOM   2108   H HE2  . HIS A 1 141 ? 23.485  2.501   -27.932 0.02 16.38 ?  134  HIS A HE2  1  
ATOM   2109   N N    . GLY A 1 142 ? 20.214  7.904   -27.252 0.02 16.30 ?  135  GLY A N    1  
ATOM   2110   C CA   . GLY A 1 142 ? 19.429  7.760   -26.040 0.02 16.31 ?  135  GLY A CA   1  
ATOM   2111   C C    . GLY A 1 142 ? 18.659  6.459   -26.025 0.02 16.39 ?  135  GLY A C    1  
ATOM   2112   O O    . GLY A 1 142 ? 18.938  5.533   -26.786 0.02 16.43 ?  135  GLY A O    1  
ATOM   2113   H H    . GLY A 1 142 ? 19.790  8.293   -27.886 0.02 16.35 ?  135  GLY A H    1  
ATOM   2114   H HA2  . GLY A 1 142 ? 20.020  7.770   -25.276 0.02 16.26 ?  135  GLY A HA2  1  
ATOM   2115   H HA3  . GLY A 1 142 ? 18.810  8.501   -25.963 0.02 16.34 ?  135  GLY A HA3  1  
ATOM   2116   N N    . GLY A 1 143 ? 17.690  6.374   -25.112 0.02 16.44 ?  136  GLY A N    1  
ATOM   2117   C CA   . GLY A 1 143 ? 17.061  5.099   -24.807 0.02 16.55 ?  136  GLY A CA   1  
ATOM   2118   C C    . GLY A 1 143 ? 17.052  4.737   -23.331 0.02 16.56 ?  136  GLY A C    1  
ATOM   2119   O O    . GLY A 1 143 ? 16.951  3.564   -22.979 0.02 16.64 ?  136  GLY A O    1  
ATOM   2120   H H    . GLY A 1 143 ? 17.386  7.039   -24.665 0.02 16.44 ?  136  GLY A H    1  
ATOM   2121   H HA2  . GLY A 1 143 ? 16.154  5.080   -25.135 0.02 16.64 ?  136  GLY A HA2  1  
ATOM   2122   H HA3  . GLY A 1 143 ? 17.547  4.396   -25.259 0.02 16.54 ?  136  GLY A HA3  1  
ATOM   2123   N N    . GLY A 1 144 ? 17.122  5.740   -22.472 0.02 16.51 ?  137  GLY A N    1  
ATOM   2124   C CA   . GLY A 1 144 ? 17.024  5.486   -21.041 0.02 16.55 ?  137  GLY A CA   1  
ATOM   2125   C C    . GLY A 1 144 ? 18.167  4.690   -20.464 0.02 16.50 ?  137  GLY A C    1  
ATOM   2126   O O    . GLY A 1 144 ? 18.078  4.218   -19.326 0.02 16.58 ?  137  GLY A O    1  
ATOM   2127   H H    . GLY A 1 144 ? 17.226  6.565   -22.687 0.02 16.47 ?  137  GLY A H    1  
ATOM   2128   H HA2  . GLY A 1 144 ? 16.968  6.326   -20.567 0.02 16.53 ?  137  GLY A HA2  1  
ATOM   2129   H HA3  . GLY A 1 144 ? 16.210  4.992   -20.867 0.02 16.65 ?  137  GLY A HA3  1  
ATOM   2130   N N    . PHE A 1 145 ? 19.266  4.558   -21.199 0.02 16.41 ?  138  PHE A N    1  
ATOM   2131   C CA   . PHE A 1 145 ? 20.349  3.638   -20.867 0.02 16.40 ?  138  PHE A CA   1  
ATOM   2132   C C    . PHE A 1 145 ? 19.879  2.190   -20.881 0.02 16.52 ?  138  PHE A C    1  
ATOM   2133   O O    . PHE A 1 145 ? 20.585  1.304   -20.394 0.02 16.56 ?  138  PHE A O    1  
ATOM   2134   C CB   . PHE A 1 145 ? 21.013  3.987   -19.517 0.02 16.39 ?  138  PHE A CB   1  
ATOM   2135   C CG   . PHE A 1 145 ? 21.589  5.384   -19.461 0.02 16.30 ?  138  PHE A CG   1  
ATOM   2136   C CD1  . PHE A 1 145 ? 22.800  5.693   -20.059 0.02 16.22 ?  138  PHE A CD1  1  
ATOM   2137   C CD2  . PHE A 1 145 ? 20.923  6.392   -18.788 0.02 16.33 ?  138  PHE A CD2  1  
ATOM   2138   C CE1  . PHE A 1 145 ? 23.311  6.976   -19.997 0.02 16.18 ?  138  PHE A CE1  1  
ATOM   2139   C CE2  . PHE A 1 145 ? 21.437  7.663   -18.739 0.02 16.28 ?  138  PHE A CE2  1  
ATOM   2140   C CZ   . PHE A 1 145 ? 22.644  7.946   -19.354 0.02 16.21 ?  138  PHE A CZ   1  
ATOM   2141   H H    . PHE A 1 145 ? 19.416  5.009   -21.913 0.02 16.36 ?  138  PHE A H    1  
ATOM   2142   H HA   . PHE A 1 145 ? 21.033  3.726   -21.550 0.02 16.34 ?  138  PHE A HA   1  
ATOM   2143   H HB2  . PHE A 1 145 ? 20.354  3.910   -18.815 0.02 16.46 ?  138  PHE A HB2  1  
ATOM   2144   H HB3  . PHE A 1 145 ? 21.737  3.366   -19.360 0.02 16.39 ?  138  PHE A HB3  1  
ATOM   2145   H HD1  . PHE A 1 145 ? 23.270  5.034   -20.515 0.02 16.22 ?  138  PHE A HD1  1  
ATOM   2146   H HD2  . PHE A 1 145 ? 20.109  6.211   -18.380 0.02 16.39 ?  138  PHE A HD2  1  
ATOM   2147   H HE1  . PHE A 1 145 ? 24.123  7.173   -20.409 0.02 16.15 ?  138  PHE A HE1  1  
ATOM   2148   H HE2  . PHE A 1 145 ? 20.976  8.330   -18.290 0.02 16.32 ?  138  PHE A HE2  1  
ATOM   2149   H HZ   . PHE A 1 145 ? 22.998  8.801   -19.316 0.02 16.20 ?  138  PHE A HZ   1  
ATOM   2150   N N    . ILE A 1 146 ? 18.717  1.915   -21.481 0.02 16.61 ?  139  ILE A N    1  
ATOM   2151   C CA   . ILE A 1 146 ? 18.177  0.560   -21.520 0.02 16.77 ?  139  ILE A CA   1  
ATOM   2152   C C    . ILE A 1 146 ? 17.820  0.084   -22.913 0.02 16.83 ?  139  ILE A C    1  
ATOM   2153   O O    . ILE A 1 146 ? 17.634  -1.129  -23.095 0.02 16.98 ?  139  ILE A O    1  
ATOM   2154   C CB   . ILE A 1 146 ? 16.944  0.413   -20.607 0.02 16.93 ?  139  ILE A CB   1  
ATOM   2155   C CG1  . ILE A 1 146 ? 15.867  1.433   -20.967 0.02 16.94 ?  139  ILE A CG1  1  
ATOM   2156   C CG2  . ILE A 1 146 ? 17.344  0.521   -19.146 0.02 16.93 ?  139  ILE A CG2  1  
ATOM   2157   C CD1  . ILE A 1 146 ? 14.525  1.149   -20.297 0.02 17.15 ?  139  ILE A CD1  1  
ATOM   2158   H H    . ILE A 1 146 ? 18.230  2.497   -21.878 0.02 16.60 ?  139  ILE A H    1  
ATOM   2159   H HA   . ILE A 1 146 ? 18.851  -0.049  -21.185 0.02 16.78 ?  139  ILE A HA   1  
ATOM   2160   H HB   . ILE A 1 146 ? 16.573  -0.469  -20.757 0.02 17.05 ?  139  ILE A HB   1  
ATOM   2161   H HG12 . ILE A 1 146 ? 16.164  2.315   -20.709 0.02 16.84 ?  139  ILE A HG12 1  
ATOM   2162   H HG13 . ILE A 1 146 ? 15.721  1.406   -21.924 0.02 16.94 ?  139  ILE A HG13 1  
ATOM   2163   H HG21 . ILE A 1 146 ? 16.563  0.735   -18.619 0.02 17.02 ?  139  ILE A HG21 1  
ATOM   2164   H HG22 . ILE A 1 146 ? 17.709  -0.330  -18.860 0.02 16.98 ?  139  ILE A HG22 1  
ATOM   2165   H HG23 . ILE A 1 146 ? 18.005  1.222   -19.051 0.02 16.81 ?  139  ILE A HG23 1  
ATOM   2166   H HD11 . ILE A 1 146 ? 13.885  1.827   -20.563 0.02 17.15 ?  139  ILE A HD11 1  
ATOM   2167   H HD12 . ILE A 1 146 ? 14.214  0.275   -20.575 0.02 17.26 ?  139  ILE A HD12 1  
ATOM   2168   H HD13 . ILE A 1 146 ? 14.641  1.169   -19.335 0.02 17.18 ?  139  ILE A HD13 1  
ATOM   2169   N N    . ILE A 1 147 ? 17.660  0.971   -23.901 0.02 16.76 ?  140  ILE A N    1  
ATOM   2170   C CA   . ILE A 1 147 ? 17.412  0.577   -25.287 0.02 16.84 ?  140  ILE A CA   1  
ATOM   2171   C C    . ILE A 1 147 ? 18.275  1.451   -26.178 0.02 16.70 ?  140  ILE A C    1  
ATOM   2172   O O    . ILE A 1 147 ? 18.804  2.474   -25.757 0.02 16.57 ?  140  ILE A O    1  
ATOM   2173   C CB   . ILE A 1 147 ? 15.936  0.705   -25.734 0.02 16.99 ?  140  ILE A CB   1  
ATOM   2174   C CG1  . ILE A 1 147 ? 15.470  2.165   -25.745 0.02 16.92 ?  140  ILE A CG1  1  
ATOM   2175   C CG2  . ILE A 1 147 ? 15.011  -0.181  -24.864 0.02 17.17 ?  140  ILE A CG2  1  
ATOM   2176   C CD1  . ILE A 1 147 ? 14.100  2.339   -26.455 0.02 17.10 ?  140  ILE A CD1  1  
ATOM   2177   H H    . ILE A 1 147 ? 17.709  1.820   -23.791 0.02 16.68 ?  140  ILE A H    1  
ATOM   2178   H HA   . ILE A 1 147 ? 17.682  -0.344  -25.413 0.02 16.91 ?  140  ILE A HA   1  
ATOM   2179   H HB   . ILE A 1 147 ? 15.882  0.375   -26.643 0.02 17.06 ?  140  ILE A HB   1  
ATOM   2180   H HG12 . ILE A 1 147 ? 15.377  2.469   -24.829 0.02 16.87 ?  140  ILE A HG12 1  
ATOM   2181   H HG13 . ILE A 1 147 ? 16.108  2.719   -26.213 0.02 16.82 ?  140  ILE A HG13 1  
ATOM   2182   H HG21 . ILE A 1 147 ? 14.256  -0.465  -25.398 0.02 17.31 ?  140  ILE A HG21 1  
ATOM   2183   H HG22 . ILE A 1 147 ? 15.506  -0.955  -24.556 0.02 17.18 ?  140  ILE A HG22 1  
ATOM   2184   H HG23 . ILE A 1 147 ? 14.704  0.330   -24.100 0.02 17.14 ?  140  ILE A HG23 1  
ATOM   2185   H HD11 . ILE A 1 147 ? 13.500  1.640   -26.158 0.02 17.22 ?  140  ILE A HD11 1  
ATOM   2186   H HD12 . ILE A 1 147 ? 13.732  3.208   -26.227 0.02 17.06 ?  140  ILE A HD12 1  
ATOM   2187   H HD13 . ILE A 1 147 ? 14.234  2.278   -27.412 0.02 17.14 ?  140  ILE A HD13 1  
ATOM   2188   N N    . GLY A 1 148 ? 18.349  1.065   -27.445 0.02 16.77 ?  141  GLY A N    1  
ATOM   2189   C CA   . GLY A 1 148 ? 19.010  1.849   -28.464 0.02 16.70 ?  141  GLY A CA   1  
ATOM   2190   C C    . GLY A 1 148 ? 20.097  1.065   -29.180 0.02 16.72 ?  141  GLY A C    1  
ATOM   2191   O O    . GLY A 1 148 ? 20.443  -0.057  -28.824 0.02 16.77 ?  141  GLY A O    1  
ATOM   2192   H H    . GLY A 1 148 ? 18.014  0.334   -27.736 0.02 16.88 ?  141  GLY A H    1  
ATOM   2193   H HA2  . GLY A 1 148 ? 18.349  2.100   -29.130 0.02 16.77 ?  141  GLY A HA2  1  
ATOM   2194   H HA3  . GLY A 1 148 ? 19.385  2.657   -28.090 0.02 16.60 ?  141  GLY A HA3  1  
ATOM   2195   N N    . GLU A 1 149 ? 20.602  1.690   -30.242 0.02 16.72 ?  142  GLU A N    1  
ATOM   2196   C CA   . GLU A 1 149 ? 21.483  1.028   -31.188 0.02 16.77 ?  142  GLU A CA   1  
ATOM   2197   C C    . GLU A 1 149 ? 22.074  2.079   -32.114 0.02 16.73 ?  142  GLU A C    1  
ATOM   2198   O O    . GLU A 1 149 ? 21.677  3.243   -32.096 0.02 16.67 ?  142  GLU A O    1  
ATOM   2199   C CB   . GLU A 1 149 ? 20.721  -0.033  -31.970 0.02 16.98 ?  142  GLU A CB   1  
ATOM   2200   C CG   . GLU A 1 149 ? 19.460  0.459   -32.721 0.02 17.09 ?  142  GLU A CG   1  
ATOM   2201   C CD   . GLU A 1 149 ? 18.208  0.779   -31.858 0.02 17.09 ?  142  GLU A CD   1  
ATOM   2202   O OE1  . GLU A 1 149 ? 17.621  -0.081  -31.102 0.02 17.18 ?  142  GLU A OE1  1  
ATOM   2203   O OE2  . GLU A 1 149 ? 17.813  1.950   -32.008 0.02 17.04 -1 142  GLU A OE2  1  
ATOM   2204   H H    . GLU A 1 149 ? 20.439  2.508   -30.438 0.02 16.70 ?  142  GLU A H    1  
ATOM   2205   H HA   . GLU A 1 149 ? 22.209  0.602   -30.708 0.02 16.73 ?  142  GLU A HA   1  
ATOM   2206   H HB2  . GLU A 1 149 ? 21.322  -0.412  -32.627 0.02 17.03 ?  142  GLU A HB2  1  
ATOM   2207   H HB3  . GLU A 1 149 ? 20.444  -0.729  -31.352 0.02 17.02 ?  142  GLU A HB3  1  
ATOM   2208   H HG2  . GLU A 1 149 ? 19.697  1.280   -33.174 0.02 17.04 ?  142  GLU A HG2  1  
ATOM   2209   H HG3  . GLU A 1 149 ? 19.201  -0.206  -33.377 0.02 17.24 ?  142  GLU A HG3  1  
ATOM   2210   N N    . ASN A 1 150 ? 22.997  1.650   -32.967 0.02 16.80 ?  143  ASN A N    1  
ATOM   2211   C CA   . ASN A 1 150 ? 23.490  2.540   -34.010 0.02 16.83 ?  143  ASN A CA   1  
ATOM   2212   C C    . ASN A 1 150 ? 23.120  2.045   -35.389 0.02 17.03 ?  143  ASN A C    1  
ATOM   2213   O O    . ASN A 1 150 ? 23.722  2.477   -36.372 0.02 17.11 ?  143  ASN A O    1  
ATOM   2214   C CB   . ASN A 1 150 ? 25.003  2.748   -33.910 0.02 16.77 ?  143  ASN A CB   1  
ATOM   2215   C CG   . ASN A 1 150 ? 25.809  1.482   -34.118 0.02 16.85 ?  143  ASN A CG   1  
ATOM   2216   O OD1  . ASN A 1 150 ? 25.309  0.421   -34.437 0.02 16.97 ?  143  ASN A OD1  1  
ATOM   2217   N ND2  . ASN A 1 150 ? 27.096  1.607   -33.897 0.02 16.81 ?  143  ASN A ND2  1  
ATOM   2218   H H    . ASN A 1 150 ? 23.331  0.863   -32.977 0.02 16.84 ?  143  ASN A H    1  
ATOM   2219   H HA   . ASN A 1 150 ? 23.077  3.409   -33.904 0.02 16.79 ?  143  ASN A HA   1  
ATOM   2220   H HB2  . ASN A 1 150 ? 25.280  3.394   -34.575 0.02 16.81 ?  143  ASN A HB2  1  
ATOM   2221   H HB3  . ASN A 1 150 ? 25.204  3.084   -33.023 0.02 16.66 ?  143  ASN A HB3  1  
ATOM   2222   H HD21 . ASN A 1 150 ? 27.446  2.385   -33.811 0.02 16.76 ?  143  ASN A HD21 1  
ATOM   2223   H HD22 . ASN A 1 150 ? 27.581  0.902   -33.830 0.02 16.86 ?  143  ASN A HD22 1  
ATOM   2224   N N    . HIS A 1 151 ? 22.137  1.162   -35.479 0.02 17.15 ?  144  HIS A N    1  
ATOM   2225   C CA   . HIS A 1 151 ? 21.692  0.663   -36.770 0.02 17.38 ?  144  HIS A CA   1  
ATOM   2226   C C    . HIS A 1 151 ? 21.051  1.774   -37.584 0.02 17.45 ?  144  HIS A C    1  
ATOM   2227   O O    . HIS A 1 151 ? 20.428  2.693   -37.056 0.02 17.36 ?  144  HIS A O    1  
ATOM   2228   C CB   . HIS A 1 151 ? 20.739  -0.501  -36.540 0.02 17.52 ?  144  HIS A CB   1  
ATOM   2229   C CG   . HIS A 1 151 ? 21.404  -1.663  -35.889 0.02 17.49 ?  144  HIS A CG   1  
ATOM   2230   N ND1  . HIS A 1 151 ? 20.796  -2.885  -35.735 0.02 17.63 ?  144  HIS A ND1  1  
ATOM   2231   C CD2  . HIS A 1 151 ? 22.646  -1.790  -35.368 0.02 17.36 ?  144  HIS A CD2  1  
ATOM   2232   C CE1  . HIS A 1 151 ? 21.633  -3.714  -35.135 0.02 17.59 ?  144  HIS A CE1  1  
ATOM   2233   N NE2  . HIS A 1 151 ? 22.763  -3.074  -34.908 0.02 17.42 ?  144  HIS A NE2  1  
ATOM   2234   H H    . HIS A 1 151 ? 21.702  0.842   -34.816 0.02 17.12 ?  144  HIS A H    1  
ATOM   2235   H HA   . HIS A 1 151 ? 22.452  0.335   -37.269 0.02 17.43 ?  144  HIS A HA   1  
ATOM   2236   H HB2  . HIS A 1 151 ? 20.015  -0.205  -35.965 0.02 17.48 ?  144  HIS A HB2  1  
ATOM   2237   H HB3  . HIS A 1 151 ? 20.380  -0.802  -37.393 0.02 17.69 ?  144  HIS A HB3  1  
ATOM   2238   H HD2  . HIS A 1 151 ? 23.297  -1.128  -35.330 0.02 17.26 ?  144  HIS A HD2  1  
ATOM   2239   H HE1  . HIS A 1 151 ? 21.459  -4.602  -34.914 0.02 17.68 ?  144  HIS A HE1  1  
ATOM   2240   H HE2  . HIS A 1 151 ? 23.457  -3.406  -34.523 0.02 17.38 ?  144  HIS A HE2  1  
ATOM   2241   N N    . ARG A 1 152 ? 21.266  1.711   -38.894 0.02 17.64 ?  145  ARG A N    1  
ATOM   2242   C CA   . ARG A 1 152 ? 20.854  2.813   -39.749 0.02 17.73 ?  145  ARG A CA   1  
ATOM   2243   C C    . ARG A 1 152 ? 19.357  2.813   -40.012 0.02 17.89 ?  145  ARG A C    1  
ATOM   2244   O O    . ARG A 1 152 ? 18.831  3.818   -40.515 0.02 17.97 ?  145  ARG A O    1  
ATOM   2245   C CB   . ARG A 1 152 ? 21.653  2.761   -41.060 0.02 17.91 ?  145  ARG A CB   1  
ATOM   2246   C CG   . ARG A 1 152 ? 23.168  3.068   -40.901 0.02 17.78 ?  145  ARG A CG   1  
ATOM   2247   C CD   . ARG A 1 152 ? 23.899  3.072   -42.255 0.02 17.99 ?  145  ARG A CD   1  
ATOM   2248   N NE   . ARG A 1 152 ? 23.878  1.728   -42.820 0.02 18.19 ?  145  ARG A NE   1  
ATOM   2249   C CZ   . ARG A 1 152 ? 23.115  1.334   -43.840 0.02 18.45 ?  145  ARG A CZ   1  
ATOM   2250   N NH1  . ARG A 1 152 ? 22.311  2.176   -44.454 0.02 18.56 ?  145  ARG A NH1  1  
ATOM   2251   N NH2  . ARG A 1 152 ? 23.140  0.068   -44.205 0.02 18.64 ?  145  ARG A NH2  1  
ATOM   2252   H H    . ARG A 1 152 ? 21.638  1.055   -39.294 0.02 17.72 ?  145  ARG A H    1  
ATOM   2253   H HA   . ARG A 1 152 ? 21.078  3.646   -39.311 0.02 17.60 ?  145  ARG A HA   1  
ATOM   2254   H HB2  . ARG A 1 152 ? 21.567  1.866   -41.418 0.02 18.03 ?  145  ARG A HB2  1  
ATOM   2255   H HB3  . ARG A 1 152 ? 21.282  3.408   -41.680 0.02 18.02 ?  145  ARG A HB3  1  
ATOM   2256   H HG2  . ARG A 1 152 ? 23.288  3.937   -40.490 0.02 17.69 ?  145  ARG A HG2  1  
ATOM   2257   H HG3  . ARG A 1 152 ? 23.574  2.386   -40.352 0.02 17.68 ?  145  ARG A HG3  1  
ATOM   2258   H HD2  . ARG A 1 152 ? 23.453  3.690   -42.852 0.02 18.10 ?  145  ARG A HD2  1  
ATOM   2259   H HD3  . ARG A 1 152 ? 24.819  3.338   -42.121 0.02 17.91 ?  145  ARG A HD3  1  
ATOM   2260   H HE   . ARG A 1 152 ? 24.529  1.209   -42.609 0.02 18.15 ?  145  ARG A HE   1  
ATOM   2261   H HH11 . ARG A 1 152 ? 22.268  2.999   -44.214 0.02 18.46 ?  145  ARG A HH11 1  
ATOM   2262   H HH12 . ARG A 1 152 ? 21.832  1.904   -45.098 0.02 18.75 ?  145  ARG A HH12 1  
ATOM   2263   H HH21 . ARG A 1 152 ? 23.667  -0.481  -43.806 0.02 18.58 ?  145  ARG A HH21 1  
ATOM   2264   H HH22 . ARG A 1 152 ? 22.669  -0.197  -44.871 0.02 18.83 ?  145  ARG A HH22 1  
ATOM   2265   N N    . ASP A 1 153 ? 18.646  1.745   -39.630 0.02 17.95 ?  146  ASP A N    1  
ATOM   2266   C CA   . ASP A 1 153 ? 17.186  1.742   -39.703 0.02 18.11 ?  146  ASP A CA   1  
ATOM   2267   C C    . ASP A 1 153 ? 16.532  2.611   -38.623 0.02 17.93 ?  146  ASP A C    1  
ATOM   2268   O O    . ASP A 1 153 ? 15.368  2.974   -38.790 0.02 18.06 ?  146  ASP A O    1  
ATOM   2269   C CB   . ASP A 1 153 ? 16.637  0.304   -39.648 0.02 18.28 ?  146  ASP A CB   1  
ATOM   2270   C CG   . ASP A 1 153 ? 16.479  -0.222  -38.242 0.02 18.11 ?  146  ASP A CG   1  
ATOM   2271   O OD1  . ASP A 1 153 ? 15.326  -0.394  -37.781 0.02 18.19 ?  146  ASP A OD1  1  
ATOM   2272   O OD2  . ASP A 1 153 ? 17.520  -0.475  -37.606 0.02 17.92 -1 146  ASP A OD2  1  
ATOM   2273   H H    . ASP A 1 153 ? 18.982  1.008   -39.344 0.02 17.93 ?  146  ASP A H    1  
ATOM   2274   H HA   . ASP A 1 153 ? 16.929  2.101   -40.565 0.02 18.26 ?  146  ASP A HA   1  
ATOM   2275   H HB2  . ASP A 1 153 ? 15.768  0.273   -40.080 0.02 18.44 ?  146  ASP A HB2  1  
ATOM   2276   H HB3  . ASP A 1 153 ? 17.251  -0.287  -40.111 0.02 18.37 ?  146  ASP A HB3  1  
ATOM   2277   N N    . MET A 1 154 ? 17.235  2.944   -37.517 0.02 17.67 ?  147  MET A N    1  
ATOM   2278   C CA   . MET A 1 154 ? 16.827  4.030   -36.619 0.02 17.51 ?  147  MET A CA   1  
ATOM   2279   C C    . MET A 1 154 ? 17.719  5.257   -36.727 0.02 17.38 ?  147  MET A C    1  
ATOM   2280   O O    . MET A 1 154 ? 17.242  6.387   -36.549 0.02 17.38 ?  147  MET A O    1  
ATOM   2281   C CB   . MET A 1 154 ? 16.816  3.587   -35.143 0.02 17.35 ?  147  MET A CB   1  
ATOM   2282   C CG   . MET A 1 154 ? 16.269  4.679   -34.166 0.02 17.27 ?  147  MET A CG   1  
ATOM   2283   S SD   . MET A 1 154 ? 14.489  4.556   -33.757 0.02 17.41 ?  147  MET A SD   1  
ATOM   2284   C CE   . MET A 1 154 ? 14.112  6.090   -32.893 0.02 17.30 ?  147  MET A CE   1  
ATOM   2285   H H    . MET A 1 154 ? 17.953  2.541   -37.273 0.02 17.60 ?  147  MET A H    1  
ATOM   2286   H HA   . MET A 1 154 ? 15.917  4.288   -36.837 0.02 17.62 ?  147  MET A HA   1  
ATOM   2287   H HB2  . MET A 1 154 ? 16.255  2.798   -35.053 0.02 17.45 ?  147  MET A HB2  1  
ATOM   2288   H HB3  . MET A 1 154 ? 17.722  3.377   -34.878 0.02 17.23 ?  147  MET A HB3  1  
ATOM   2289   H HG2  . MET A 1 154 ? 16.737  4.587   -33.329 0.02 17.12 ?  147  MET A HG2  1  
ATOM   2290   H HG3  . MET A 1 154 ? 16.428  5.560   -34.530 0.02 17.28 ?  147  MET A HG3  1  
ATOM   2291   H HE1  . MET A 1 154 ? 13.872  6.776   -33.536 0.02 17.40 ?  147  MET A HE1  1  
ATOM   2292   H HE2  . MET A 1 154 ? 13.358  5.932   -32.305 0.02 17.30 ?  147  MET A HE2  1  
ATOM   2293   H HE3  . MET A 1 154 ? 14.886  6.369   -32.379 0.02 17.15 ?  147  MET A HE3  1  
ATOM   2294   N N    . TYR A 1 155 ? 19.017  5.076   -37.005 0.02 17.32 ?  148  TYR A N    1  
ATOM   2295   C CA   . TYR A 1 155 ? 19.983  6.174   -37.019 0.02 17.22 ?  148  TYR A CA   1  
ATOM   2296   C C    . TYR A 1 155 ? 20.781  6.153   -38.334 0.02 17.36 ?  148  TYR A C    1  
ATOM   2297   O O    . TYR A 1 155 ? 21.973  5.845   -38.369 0.02 17.30 ?  148  TYR A O    1  
ATOM   2298   C CB   . TYR A 1 155 ? 20.898  6.105   -35.777 0.02 17.00 ?  148  TYR A CB   1  
ATOM   2299   C CG   . TYR A 1 155 ? 20.105  6.344   -34.512 0.02 16.89 ?  148  TYR A CG   1  
ATOM   2300   C CD1  . TYR A 1 155 ? 19.718  7.615   -34.140 0.02 16.86 ?  148  TYR A CD1  1  
ATOM   2301   C CD2  . TYR A 1 155 ? 19.712  5.278   -33.729 0.02 16.85 ?  148  TYR A CD2  1  
ATOM   2302   C CE1  . TYR A 1 155 ? 18.948  7.811   -32.990 0.02 16.79 ?  148  TYR A CE1  1  
ATOM   2303   C CE2  . TYR A 1 155 ? 18.983  5.471   -32.586 0.02 16.79 ?  148  TYR A CE2  1  
ATOM   2304   C CZ   . TYR A 1 155 ? 18.578  6.723   -32.234 0.02 16.76 ?  148  TYR A CZ   1  
ATOM   2305   O OH   . TYR A 1 155 ? 17.819  6.882   -31.102 0.02 16.72 ?  148  TYR A OH   1  
ATOM   2306   H H    . TYR A 1 155 ? 19.360  4.311   -37.181 0.02 17.35 ?  148  TYR A H    1  
ATOM   2307   H HA   . TYR A 1 155 ? 19.507  7.018   -36.983 0.02 17.24 ?  148  TYR A HA   1  
ATOM   2308   H HB2  . TYR A 1 155 ? 21.299  5.224   -35.722 0.02 16.99 ?  148  TYR A HB2  1  
ATOM   2309   H HB3  . TYR A 1 155 ? 21.584  6.788   -35.840 0.02 16.96 ?  148  TYR A HB3  1  
ATOM   2310   H HD1  . TYR A 1 155 ? 19.958  8.343   -34.663 0.02 16.90 ?  148  TYR A HD1  1  
ATOM   2311   H HD2  . TYR A 1 155 ? 19.968  4.421   -33.972 0.02 16.89 ?  148  TYR A HD2  1  
ATOM   2312   H HE1  . TYR A 1 155 ? 18.687  8.667   -32.742 0.02 16.79 ?  148  TYR A HE1  1  
ATOM   2313   H HE2  . TYR A 1 155 ? 18.717  4.739   -32.077 0.02 16.79 ?  148  TYR A HE2  1  
ATOM   2314   H HH   . TYR A 1 155 ? 17.586  6.131   -30.810 0.02 16.74 ?  148  TYR A HH   1  
ATOM   2315   N N    . GLY A 1 156 ? 20.117  6.531   -39.419 0.02 17.58 ?  149  GLY A N    1  
ATOM   2316   C CA   . GLY A 1 156 ? 20.767  6.601   -40.712 0.02 17.75 ?  149  GLY A CA   1  
ATOM   2317   C C    . GLY A 1 156 ? 21.459  7.935   -40.937 0.02 17.73 ?  149  GLY A C    1  
ATOM   2318   O O    . GLY A 1 156 ? 20.921  8.993   -40.610 0.02 17.69 ?  149  GLY A O    1  
ATOM   2319   H H    . GLY A 1 156 ? 19.290  6.754   -39.430 0.02 17.64 ?  149  GLY A H    1  
ATOM   2320   H HA2  . GLY A 1 156 ? 21.398  5.874   -40.777 0.02 17.75 ?  149  GLY A HA2  1  
ATOM   2321   H HA3  . GLY A 1 156 ? 20.102  6.488   -41.408 0.02 17.92 ?  149  GLY A HA3  1  
ATOM   2322   N N    . PRO A 1 157 ? 22.654  7.914   -41.531 0.02 17.78 ?  150  PRO A N    1  
ATOM   2323   C CA   . PRO A 1 157 ? 23.424  9.145   -41.709 0.02 17.79 ?  150  PRO A CA   1  
ATOM   2324   C C    . PRO A 1 157 ? 23.073  9.919   -42.965 0.02 18.06 ?  150  PRO A C    1  
ATOM   2325   O O    . PRO A 1 157 ? 23.751  10.896  -43.266 0.02 18.13 ?  150  PRO A O    1  
ATOM   2326   C CB   . PRO A 1 157 ? 24.862  8.615   -41.787 0.02 17.77 ?  150  PRO A CB   1  
ATOM   2327   C CG   . PRO A 1 157 ? 24.689  7.297   -42.455 0.02 17.90 ?  150  PRO A CG   1  
ATOM   2328   C CD   . PRO A 1 157 ? 23.461  6.719   -41.832 0.02 17.82 ?  150  PRO A CD   1  
ATOM   2329   H HA   . PRO A 1 157 ? 23.336  9.728   -40.941 0.02 17.67 ?  150  PRO A HA   1  
ATOM   2330   H HB2  . PRO A 1 157 ? 25.410  9.213   -42.310 0.02 17.87 ?  150  PRO A HB2  1  
ATOM   2331   H HB3  . PRO A 1 157 ? 25.218  8.505   -40.893 0.02 17.60 ?  150  PRO A HB3  1  
ATOM   2332   H HG2  . PRO A 1 157 ? 24.555  7.431   -43.405 0.02 18.09 ?  150  PRO A HG2  1  
ATOM   2333   H HG3  . PRO A 1 157 ? 25.454  6.733   -42.288 0.02 17.86 ?  150  PRO A HG3  1  
ATOM   2334   H HD2  . PRO A 1 157 ? 22.993  6.148   -42.458 0.02 17.97 ?  150  PRO A HD2  1  
ATOM   2335   H HD3  . PRO A 1 157 ? 23.688  6.243   -41.020 0.02 17.67 ?  150  PRO A HD3  1  
ATOM   2336   N N    . ASP A 1 158 ? 21.979  9.547   -43.621 0.02 18.23 ?  151  ASP A N    1  
ATOM   2337   C CA   . ASP A 1 158 ? 21.688  10.010  -44.973 0.02 18.54 ?  151  ASP A CA   1  
ATOM   2338   C C    . ASP A 1 158 ? 21.485  11.518  -45.068 0.02 18.61 ?  151  ASP A C    1  
ATOM   2339   O O    . ASP A 1 158 ? 21.666  12.100  -46.145 0.02 18.87 ?  151  ASP A O    1  
ATOM   2340   C CB   . ASP A 1 158 ? 20.445  9.282   -45.467 0.02 18.71 ?  151  ASP A CB   1  
ATOM   2341   C CG   . ASP A 1 158 ? 20.566  7.768   -45.377 0.02 18.68 ?  151  ASP A CG   1  
ATOM   2342   O OD1  . ASP A 1 158 ? 21.029  7.209   -44.335 0.02 18.42 ?  151  ASP A OD1  1  
ATOM   2343   O OD2  . ASP A 1 158 ? 20.150  7.100   -46.352 0.02 18.94 -1 151  ASP A OD2  1  
ATOM   2344   H H    . ASP A 1 158 ? 21.387  9.013   -43.304 0.02 18.19 ?  151  ASP A H    1  
ATOM   2345   H HA   . ASP A 1 158 ? 22.434  9.774   -45.542 0.02 18.63 ?  151  ASP A HA   1  
ATOM   2346   H HB2  . ASP A 1 158 ? 19.696  9.546   -44.911 0.02 18.63 ?  151  ASP A HB2  1  
ATOM   2347   H HB3  . ASP A 1 158 ? 20.269  9.526   -46.389 0.02 18.93 ?  151  ASP A HB3  1  
ATOM   2348   N N    . TYR A 1 159 ? 21.058  12.175  -43.992 0.02 18.42 ?  152  TYR A N    1  
ATOM   2349   C CA   . TYR A 1 159 ? 20.871  13.614  -44.086 0.02 18.52 ?  152  TYR A CA   1  
ATOM   2350   C C    . TYR A 1 159 ? 22.164  14.343  -43.785 0.02 18.45 ?  152  TYR A C    1  
ATOM   2351   O O    . TYR A 1 159 ? 22.507  15.312  -44.461 0.02 18.65 ?  152  TYR A O    1  
ATOM   2352   C CB   . TYR A 1 159 ? 19.765  14.098  -43.137 0.02 18.41 ?  152  TYR A CB   1  
ATOM   2353   C CG   . TYR A 1 159 ? 18.437  13.391  -43.225 0.02 18.48 ?  152  TYR A CG   1  
ATOM   2354   C CD1  . TYR A 1 159 ? 18.045  12.674  -44.339 0.02 18.72 ?  152  TYR A CD1  1  
ATOM   2355   C CD2  . TYR A 1 159 ? 17.574  13.413  -42.139 0.02 18.32 ?  152  TYR A CD2  1  
ATOM   2356   C CE1  . TYR A 1 159 ? 16.819  12.027  -44.378 0.02 18.81 ?  152  TYR A CE1  1  
ATOM   2357   C CE2  . TYR A 1 159 ? 16.369  12.785  -42.171 0.02 18.41 ?  152  TYR A CE2  1  
ATOM   2358   C CZ   . TYR A 1 159 ? 15.980  12.096  -43.281 0.02 18.66 ?  152  TYR A CZ   1  
ATOM   2359   O OH   . TYR A 1 159 ? 14.760  11.466  -43.290 0.02 18.78 ?  152  TYR A OH   1  
ATOM   2360   H H    . TYR A 1 159 ? 20.881  11.823  -43.231 0.02 18.26 ?  152  TYR A H    1  
ATOM   2361   H HA   . TYR A 1 159 ? 20.594  13.853  -44.984 0.02 18.74 ?  152  TYR A HA   1  
ATOM   2362   H HB2  . TYR A 1 159 ? 20.086  13.985  -42.231 0.02 18.20 ?  152  TYR A HB2  1  
ATOM   2363   H HB3  . TYR A 1 159 ? 19.612  15.037  -43.305 0.02 18.51 ?  152  TYR A HB3  1  
ATOM   2364   H HD1  . TYR A 1 159 ? 18.607  12.638  -45.078 0.02 18.84 ?  152  TYR A HD1  1  
ATOM   2365   H HD2  . TYR A 1 159 ? 17.822  13.888  -41.382 0.02 18.18 ?  152  TYR A HD2  1  
ATOM   2366   H HE1  . TYR A 1 159 ? 16.553  11.556  -45.133 0.02 18.99 ?  152  TYR A HE1  1  
ATOM   2367   H HE2  . TYR A 1 159 ? 15.802  12.825  -41.437 0.02 18.32 ?  152  TYR A HE2  1  
ATOM   2368   H HH   . TYR A 1 159 ? 14.147  12.040  -43.322 0.02 18.88 ?  152  TYR A HH   1  
ATOM   2369   N N    . PHE A 1 160 ? 22.906  13.895  -42.766 0.02 18.19 ?  153  PHE A N    1  
ATOM   2370   C CA   . PHE A 1 160 ? 24.125  14.600  -42.404 0.02 18.14 ?  153  PHE A CA   1  
ATOM   2371   C C    . PHE A 1 160 ? 25.209  14.490  -43.474 0.02 18.35 ?  153  PHE A C    1  
ATOM   2372   O O    . PHE A 1 160 ? 26.062  15.368  -43.554 0.02 18.44 ?  153  PHE A O    1  
ATOM   2373   C CB   . PHE A 1 160 ? 24.670  14.053  -41.089 0.02 17.86 ?  153  PHE A CB   1  
ATOM   2374   C CG   . PHE A 1 160 ? 24.199  14.768  -39.871 0.02 17.69 ?  153  PHE A CG   1  
ATOM   2375   C CD1  . PHE A 1 160 ? 24.589  16.065  -39.621 0.02 17.76 ?  153  PHE A CD1  1  
ATOM   2376   C CD2  . PHE A 1 160 ? 23.410  14.116  -38.940 0.02 17.50 ?  153  PHE A CD2  1  
ATOM   2377   C CE1  . PHE A 1 160 ? 24.178  16.710  -38.480 0.02 17.63 ?  153  PHE A CE1  1  
ATOM   2378   C CE2  . PHE A 1 160 ? 23.003  14.775  -37.786 0.02 17.38 ?  153  PHE A CE2  1  
ATOM   2379   C CZ   . PHE A 1 160 ? 23.381  16.055  -37.579 0.02 17.44 ?  153  PHE A CZ   1  
ATOM   2380   H H    . PHE A 1 160 ? 22.731  13.203  -42.294 0.02 18.06 ?  153  PHE A H    1  
ATOM   2381   H HA   . PHE A 1 160 ? 23.927  15.537  -42.280 0.02 18.19 ?  153  PHE A HA   1  
ATOM   2382   H HB2  . PHE A 1 160 ? 24.421  13.121  -40.999 0.02 17.79 ?  153  PHE A HB2  1  
ATOM   2383   H HB3  . PHE A 1 160 ? 25.637  14.136  -41.118 0.02 17.87 ?  153  PHE A HB3  1  
ATOM   2384   H HD1  . PHE A 1 160 ? 25.125  16.516  -40.232 0.02 17.90 ?  153  PHE A HD1  1  
ATOM   2385   H HD2  . PHE A 1 160 ? 23.151  13.237  -39.084 0.02 17.48 ?  153  PHE A HD2  1  
ATOM   2386   H HE1  . PHE A 1 160 ? 24.431  17.591  -38.324 0.02 17.69 ?  153  PHE A HE1  1  
ATOM   2387   H HE2  . PHE A 1 160 ? 22.460  14.341  -37.167 0.02 17.27 ?  153  PHE A HE2  1  
ATOM   2388   H HZ   . PHE A 1 160 ? 23.102  16.499  -36.812 0.02 17.37 ?  153  PHE A HZ   1  
ATOM   2389   N N    . ILE A 1 161 ? 25.210  13.431  -44.289 0.02 18.45 ?  154  ILE A N    1  
ATOM   2390   C CA   . ILE A 1 161 ? 26.291  13.297  -45.266 0.02 18.65 ?  154  ILE A CA   1  
ATOM   2391   C C    . ILE A 1 161 ? 26.055  14.162  -46.501 0.02 18.99 ?  154  ILE A C    1  
ATOM   2392   O O    . ILE A 1 161 ? 26.919  14.232  -47.378 0.02 19.21 ?  154  ILE A O    1  
ATOM   2393   C CB   . ILE A 1 161 ? 26.535  11.826  -45.653 0.02 18.65 ?  154  ILE A CB   1  
ATOM   2394   C CG1  . ILE A 1 161 ? 25.272  11.155  -46.225 0.02 18.75 ?  154  ILE A CG1  1  
ATOM   2395   C CG2  . ILE A 1 161 ? 27.104  11.055  -44.458 0.02 18.36 ?  154  ILE A CG2  1  
ATOM   2396   C CD1  . ILE A 1 161 ? 25.027  11.421  -47.680 0.02 19.11 ?  154  ILE A CD1  1  
ATOM   2397   H H    . ILE A 1 161 ? 24.626  12.802  -44.293 0.02 18.42 ?  154  ILE A H    1  
ATOM   2398   H HA   . ILE A 1 161 ? 27.110  13.620  -44.864 0.02 18.59 ?  154  ILE A HA   1  
ATOM   2399   H HB   . ILE A 1 161 ? 27.217  11.818  -46.345 0.02 18.82 ?  154  ILE A HB   1  
ATOM   2400   H HG12 . ILE A 1 161 ? 25.373  10.197  -46.131 0.02 18.68 ?  154  ILE A HG12 1  
ATOM   2401   H HG13 . ILE A 1 161 ? 24.492  11.451  -45.733 0.02 18.66 ?  154  ILE A HG13 1  
ATOM   2402   H HG21 . ILE A 1 161 ? 27.068  10.107  -44.654 0.02 18.35 ?  154  ILE A HG21 1  
ATOM   2403   H HG22 . ILE A 1 161 ? 28.020  11.333  -44.299 0.02 18.37 ?  154  ILE A HG22 1  
ATOM   2404   H HG23 . ILE A 1 161 ? 26.565  11.247  -43.679 0.02 18.20 ?  154  ILE A HG23 1  
ATOM   2405   H HD11 . ILE A 1 161 ? 24.346  10.807  -48.000 0.02 19.17 ?  154  ILE A HD11 1  
ATOM   2406   H HD12 . ILE A 1 161 ? 24.726  12.334  -47.794 0.02 19.19 ?  154  ILE A HD12 1  
ATOM   2407   H HD13 . ILE A 1 161 ? 25.853  11.274  -48.170 0.02 19.21 ?  154  ILE A HD13 1  
ATOM   2408   N N    . LYS A 1 162 ? 24.921  14.860  -46.563 0.02 19.06 ?  155  LYS A N    1  
ATOM   2409   C CA   . LYS A 1 162 ? 24.853  16.032  -47.416 0.02 19.36 ?  155  LYS A CA   1  
ATOM   2410   C C    . LYS A 1 162 ? 25.917  17.051  -47.039 0.02 19.38 ?  155  LYS A C    1  
ATOM   2411   O O    . LYS A 1 162 ? 26.335  17.855  -47.885 0.02 19.68 ?  155  LYS A O    1  
ATOM   2412   C CB   . LYS A 1 162 ? 23.471  16.667  -47.319 0.02 19.41 ?  155  LYS A CB   1  
ATOM   2413   C CG   . LYS A 1 162 ? 22.398  15.954  -48.092 0.02 19.55 ?  155  LYS A CG   1  
ATOM   2414   C CD   . LYS A 1 162 ? 21.016  16.563  -47.823 0.02 19.62 ?  155  LYS A CD   1  
ATOM   2415   C CE   . LYS A 1 162 ? 19.868  15.890  -48.602 0.02 19.87 ?  155  LYS A CE   1  
ATOM   2416   N NZ   . LYS A 1 162 ? 20.012  16.006  -50.081 0.02 20.25 ?  155  LYS A NZ   1  
ATOM   2417   H H    . LYS A 1 162 ? 24.197  14.673  -46.143 0.02 18.95 ?  155  LYS A H    1  
ATOM   2418   H HA   . LYS A 1 162 ? 24.989  15.768  -48.338 0.02 19.57 ?  155  LYS A HA   1  
ATOM   2419   H HB2  . LYS A 1 162 ? 23.203  16.655  -46.386 0.02 19.20 ?  155  LYS A HB2  1  
ATOM   2420   H HB3  . LYS A 1 162 ? 23.518  17.583  -47.635 0.02 19.60 ?  155  LYS A HB3  1  
ATOM   2421   H HG2  . LYS A 1 162 ? 22.584  16.043  -49.041 0.02 19.78 ?  155  LYS A HG2  1  
ATOM   2422   H HG3  . LYS A 1 162 ? 22.378  15.020  -47.838 0.02 19.38 ?  155  LYS A HG3  1  
ATOM   2423   H HD2  . LYS A 1 162 ? 20.825  16.477  -46.877 0.02 19.40 ?  155  LYS A HD2  1  
ATOM   2424   H HD3  . LYS A 1 162 ? 21.033  17.497  -48.076 0.02 19.75 ?  155  LYS A HD3  1  
ATOM   2425   H HE2  . LYS A 1 162 ? 19.846  14.945  -48.379 0.02 19.78 ?  155  LYS A HE2  1  
ATOM   2426   H HE3  . LYS A 1 162 ? 19.034  16.311  -48.355 0.02 19.91 ?  155  LYS A HE3  1  
ATOM   2427   H HZ1  . LYS A 1 162 ? 20.340  15.250  -50.415 0.02 20.25 ?  155  LYS A HZ1  1  
ATOM   2428   H HZ2  . LYS A 1 162 ? 19.219  16.164  -50.450 0.02 20.43 ?  155  LYS A HZ2  1  
ATOM   2429   H HZ3  . LYS A 1 162 ? 20.560  16.677  -50.282 0.02 20.34 ?  155  LYS A HZ3  1  
ATOM   2430   N N    . LYS A 1 163 ? 26.347  17.035  -45.786 0.02 19.09 ?  156  LYS A N    1  
ATOM   2431   C CA   . LYS A 1 163 ? 27.278  18.004  -45.244 0.02 19.10 ?  156  LYS A CA   1  
ATOM   2432   C C    . LYS A 1 163 ? 28.675  17.461  -45.254 0.02 19.07 ?  156  LYS A C    1  
ATOM   2433   O O    . LYS A 1 163 ? 28.899  16.258  -45.331 0.02 18.98 ?  156  LYS A O    1  
ATOM   2434   C CB   . LYS A 1 163 ? 26.906  18.343  -43.817 0.02 18.83 ?  156  LYS A CB   1  
ATOM   2435   C CG   . LYS A 1 163 ? 25.544  18.918  -43.754 0.02 18.86 ?  156  LYS A CG   1  
ATOM   2436   C CD   . LYS A 1 163 ? 25.431  20.158  -44.651 0.02 19.20 ?  156  LYS A CD   1  
ATOM   2437   C CE   . LYS A 1 163 ? 24.534  21.131  -44.087 0.02 19.21 ?  156  LYS A CE   1  
ATOM   2438   N NZ   . LYS A 1 163 ? 24.367  22.229  -45.105 0.02 19.55 ?  156  LYS A NZ   1  
ATOM   2439   H H    . LYS A 1 163 ? 26.102  16.449  -45.211 0.02 18.90 ?  156  LYS A H    1  
ATOM   2440   H HA   . LYS A 1 163 ? 27.267  18.811  -45.779 0.02 19.32 ?  156  LYS A HA   1  
ATOM   2441   H HB2  . LYS A 1 163 ? 26.925  17.530  -43.293 0.02 18.63 ?  156  LYS A HB2  1  
ATOM   2442   H HB3  . LYS A 1 163 ? 27.534  18.987  -43.460 0.02 18.87 ?  156  LYS A HB3  1  
ATOM   2443   H HG2  . LYS A 1 163 ? 24.909  18.262  -44.075 0.02 18.84 ?  156  LYS A HG2  1  
ATOM   2444   H HG3  . LYS A 1 163 ? 25.352  19.164  -42.838 0.02 18.69 ?  156  LYS A HG3  1  
ATOM   2445   H HD2  . LYS A 1 163 ? 26.308  20.556  -44.747 0.02 19.27 ?  156  LYS A HD2  1  
ATOM   2446   H HD3  . LYS A 1 163 ? 25.089  19.872  -45.515 0.02 19.37 ?  156  LYS A HD3  1  
ATOM   2447   H HE2  . LYS A 1 163 ? 23.730  20.642  -43.930 0.02 19.22 ?  156  LYS A HE2  1  
ATOM   2448   H HE3  . LYS A 1 163 ? 24.820  21.551  -43.243 0.02 19.02 ?  156  LYS A HE3  1  
ATOM   2449   H HZ1  . LYS A 1 163 ? 23.931  21.889  -45.799 0.02 19.73 ?  156  LYS A HZ1  1  
ATOM   2450   H HZ2  . LYS A 1 163 ? 23.876  22.885  -44.760 0.02 19.53 ?  156  LYS A HZ2  1  
ATOM   2451   H HZ3  . LYS A 1 163 ? 25.144  22.559  -45.393 0.02 19.62 ?  156  LYS A HZ3  1  
ATOM   2452   N N    . ASP A 1 164 ? 29.621  18.376  -45.115 0.02 19.18 ?  157  ASP A N    1  
ATOM   2453   C CA   . ASP A 1 164 ? 31.030  18.043  -45.280 0.02 19.25 ?  157  ASP A CA   1  
ATOM   2454   C C    . ASP A 1 164 ? 31.652  17.717  -43.926 0.02 18.96 ?  157  ASP A C    1  
ATOM   2455   O O    . ASP A 1 164 ? 32.562  18.393  -43.438 0.02 19.00 ?  157  ASP A O    1  
ATOM   2456   C CB   . ASP A 1 164 ? 31.729  19.200  -45.951 0.02 19.59 ?  157  ASP A CB   1  
ATOM   2457   C CG   . ASP A 1 164 ? 30.820  19.918  -46.849 0.02 19.85 ?  157  ASP A CG   1  
ATOM   2458   O OD1  . ASP A 1 164 ? 30.543  19.330  -47.896 0.02 20.00 ?  157  ASP A OD1  1  
ATOM   2459   O OD2  . ASP A 1 164 ? 30.307  21.008  -46.501 0.02 19.92 -1 157  ASP A OD2  1  
ATOM   2460   H H    . ASP A 1 164 ? 29.474  19.200  -44.918 0.02 19.23 ?  157  ASP A H    1  
ATOM   2461   H HA   . ASP A 1 164 ? 31.107  17.261  -45.846 0.02 19.30 ?  157  ASP A HA   1  
ATOM   2462   H HB2  . ASP A 1 164 ? 32.032  19.824  -45.274 0.02 19.54 ?  157  ASP A HB2  1  
ATOM   2463   H HB3  . ASP A 1 164 ? 32.477  18.858  -46.466 0.02 19.71 ?  157  ASP A HB3  1  
ATOM   2464   N N    . VAL A 1 165 ? 31.131  16.638  -43.345 0.02 18.70 ?  158  VAL A N    1  
ATOM   2465   C CA   . VAL A 1 165 ? 31.468  16.191  -42.003 0.02 18.41 ?  158  VAL A CA   1  
ATOM   2466   C C    . VAL A 1 165 ? 31.817  14.700  -42.012 0.02 18.30 ?  158  VAL A C    1  
ATOM   2467   O O    . VAL A 1 165 ? 31.551  13.968  -42.967 0.02 18.40 ?  158  VAL A O    1  
ATOM   2468   C CB   . VAL A 1 165 ? 30.310  16.463  -41.021 0.02 18.19 ?  158  VAL A CB   1  
ATOM   2469   C CG1  . VAL A 1 165 ? 30.002  17.950  -40.937 0.02 18.33 ?  158  VAL A CG1  1  
ATOM   2470   C CG2  . VAL A 1 165 ? 29.081  15.686  -41.441 0.02 18.11 ?  158  VAL A CG2  1  
ATOM   2471   H H    . VAL A 1 165 ? 30.557  16.131  -43.730 0.02 18.70 ?  158  VAL A H    1  
ATOM   2472   H HA   . VAL A 1 165 ? 32.242  16.684  -41.690 0.02 18.47 ?  158  VAL A HA   1  
ATOM   2473   H HB   . VAL A 1 165 ? 30.573  16.152  -40.138 0.02 18.03 ?  158  VAL A HB   1  
ATOM   2474   H HG11 . VAL A 1 165 ? 29.560  18.139  -40.096 0.02 18.19 ?  158  VAL A HG11 1  
ATOM   2475   H HG12 . VAL A 1 165 ? 30.835  18.447  -40.990 0.02 18.48 ?  158  VAL A HG12 1  
ATOM   2476   H HG13 . VAL A 1 165 ? 29.425  18.196  -41.677 0.02 18.43 ?  158  VAL A HG13 1  
ATOM   2477   H HG21 . VAL A 1 165 ? 28.370  15.857  -40.805 0.02 18.01 ?  158  VAL A HG21 1  
ATOM   2478   H HG22 . VAL A 1 165 ? 28.816  15.979  -42.327 0.02 18.28 ?  158  VAL A HG22 1  
ATOM   2479   H HG23 . VAL A 1 165 ? 29.290  14.741  -41.456 0.02 18.00 ?  158  VAL A HG23 1  
ATOM   2480   N N    . VAL A 1 166 ? 32.414  14.255  -40.909 0.02 18.11 ?  159  VAL A N    1  
ATOM   2481   C CA   . VAL A 1 166 ? 32.492  12.844  -40.553 0.02 17.95 ?  159  VAL A CA   1  
ATOM   2482   C C    . VAL A 1 166 ? 31.479  12.624  -39.450 0.02 17.69 ?  159  VAL A C    1  
ATOM   2483   O O    . VAL A 1 166 ? 31.437  13.399  -38.494 0.02 17.59 ?  159  VAL A O    1  
ATOM   2484   C CB   . VAL A 1 166 ? 33.896  12.443  -40.084 0.02 17.96 ?  159  VAL A CB   1  
ATOM   2485   C CG1  . VAL A 1 166 ? 33.898  10.998  -39.657 0.02 17.82 ?  159  VAL A CG1  1  
ATOM   2486   C CG2  . VAL A 1 166 ? 34.946  12.689  -41.189 0.02 18.27 ?  159  VAL A CG2  1  
ATOM   2487   H H    . VAL A 1 166 ? 32.787  14.766  -40.334 0.02 18.10 ?  159  VAL A H    1  
ATOM   2488   H HA   . VAL A 1 166 ? 32.247  12.288  -41.308 0.02 18.03 ?  159  VAL A HA   1  
ATOM   2489   H HB   . VAL A 1 166 ? 34.136  12.986  -39.319 0.02 17.90 ?  159  VAL A HB   1  
ATOM   2490   H HG11 . VAL A 1 166 ? 34.801  10.652  -39.719 0.02 17.89 ?  159  VAL A HG11 1  
ATOM   2491   H HG12 . VAL A 1 166 ? 33.591  10.942  -38.739 0.02 17.64 ?  159  VAL A HG12 1  
ATOM   2492   H HG13 . VAL A 1 166 ? 33.310  10.493  -40.240 0.02 17.85 ?  159  VAL A HG13 1  
ATOM   2493   H HG21 . VAL A 1 166 ? 35.790  12.919  -40.774 0.02 18.31 ?  159  VAL A HG21 1  
ATOM   2494   H HG22 . VAL A 1 166 ? 35.049  11.876  -41.704 0.02 18.32 ?  159  VAL A HG22 1  
ATOM   2495   H HG23 . VAL A 1 166 ? 34.655  13.417  -41.759 0.02 18.40 ?  159  VAL A HG23 1  
ATOM   2496   N N    . LEU A 1 167 ? 30.637  11.620  -39.604 0.02 17.60 ?  160  LEU A N    1  
ATOM   2497   C CA   . LEU A 1 167 ? 29.654  11.303  -38.578 0.02 17.38 ?  160  LEU A CA   1  
ATOM   2498   C C    . LEU A 1 167 ? 29.910  9.906   -38.041 0.02 17.26 ?  160  LEU A C    1  
ATOM   2499   O O    . LEU A 1 167 ? 30.129  8.965   -38.798 0.02 17.35 ?  160  LEU A O    1  
ATOM   2500   C CB   . LEU A 1 167 ? 28.232  11.431  -39.119 0.02 17.42 ?  160  LEU A CB   1  
ATOM   2501   C CG   . LEU A 1 167 ? 27.107  11.064  -38.167 0.02 17.23 ?  160  LEU A CG   1  
ATOM   2502   C CD1  . LEU A 1 167 ? 26.968  12.052  -37.040 0.02 17.10 ?  160  LEU A CD1  1  
ATOM   2503   C CD2  . LEU A 1 167 ? 25.824  11.010  -38.940 0.02 17.34 ?  160  LEU A CD2  1  
ATOM   2504   H H    . LEU A 1 167 ? 30.614  11.102  -40.288 0.02 17.69 ?  160  LEU A H    1  
ATOM   2505   H HA   . LEU A 1 167 ? 29.752  11.927  -37.849 0.02 17.31 ?  160  LEU A HA   1  
ATOM   2506   H HB2  . LEU A 1 167 ? 28.082  12.353  -39.374 0.02 17.49 ?  160  LEU A HB2  1  
ATOM   2507   H HB3  . LEU A 1 167 ? 28.158  10.866  -39.902 0.02 17.52 ?  160  LEU A HB3  1  
ATOM   2508   H HG   . LEU A 1 167 ? 27.280  10.190  -37.791 0.02 17.16 ?  160  LEU A HG   1  
ATOM   2509   H HD11 . LEU A 1 167 ? 27.839  12.425  -36.831 0.02 17.09 ?  160  LEU A HD11 1  
ATOM   2510   H HD12 . LEU A 1 167 ? 26.366  12.760  -37.313 0.02 17.17 ?  160  LEU A HD12 1  
ATOM   2511   H HD13 . LEU A 1 167 ? 26.615  11.589  -36.267 0.02 16.98 ?  160  LEU A HD13 1  
ATOM   2512   H HD21 . LEU A 1 167 ? 25.126  10.683  -38.350 0.02 17.24 ?  160  LEU A HD21 1  
ATOM   2513   H HD22 . LEU A 1 167 ? 25.598  11.897  -39.256 0.02 17.44 ?  160  LEU A HD22 1  
ATOM   2514   H HD23 . LEU A 1 167 ? 25.929  10.401  -39.685 0.02 17.42 ?  160  LEU A HD23 1  
ATOM   2515   N N    . ILE A 1 168 ? 29.887  9.771   -36.720 0.02 17.07 ?  161  ILE A N    1  
ATOM   2516   C CA   . ILE A 1 168 ? 30.188  8.503   -36.065 0.02 16.97 ?  161  ILE A CA   1  
ATOM   2517   C C    . ILE A 1 168 ? 29.091  8.205   -35.060 0.02 16.80 ?  161  ILE A C    1  
ATOM   2518   O O    . ILE A 1 168 ? 28.766  9.057   -34.231 0.02 16.71 ?  161  ILE A O    1  
ATOM   2519   C CB   . ILE A 1 168 ? 31.559  8.541   -35.367 0.02 16.96 ?  161  ILE A CB   1  
ATOM   2520   C CG1  . ILE A 1 168 ? 32.669  8.810   -36.407 0.02 17.17 ?  161  ILE A CG1  1  
ATOM   2521   C CG2  . ILE A 1 168 ? 31.783  7.248   -34.588 0.02 16.87 ?  161  ILE A CG2  1  
ATOM   2522   C CD1  . ILE A 1 168 ? 34.045  9.092   -35.813 0.02 17.21 ?  161  ILE A CD1  1  
ATOM   2523   H H    . ILE A 1 168 ? 29.707  10.411  -36.183 0.02 17.01 ?  161  ILE A H    1  
ATOM   2524   H HA   . ILE A 1 168 ? 30.198  7.795   -36.724 0.02 17.05 ?  161  ILE A HA   1  
ATOM   2525   H HB   . ILE A 1 168 ? 31.552  9.281   -34.743 0.02 16.91 ?  161  ILE A HB   1  
ATOM   2526   H HG12 . ILE A 1 168 ? 32.741  8.033   -36.983 0.02 17.23 ?  161  ILE A HG12 1  
ATOM   2527   H HG13 . ILE A 1 168 ? 32.420  9.590   -36.928 0.02 17.24 ?  161  ILE A HG13 1  
ATOM   2528   H HG21 . ILE A 1 168 ? 32.733  7.136   -34.435 0.02 16.91 ?  161  ILE A HG21 1  
ATOM   2529   H HG22 . ILE A 1 168 ? 31.308  7.299   -33.744 0.02 16.75 ?  161  ILE A HG22 1  
ATOM   2530   H HG23 . ILE A 1 168 ? 31.442  6.506   -35.107 0.02 16.90 ?  161  ILE A HG23 1  
ATOM   2531   H HD11 . ILE A 1 168 ? 34.600  9.524   -36.481 0.02 17.36 ?  161  ILE A HD11 1  
ATOM   2532   H HD12 . ILE A 1 168 ? 33.946  9.679   -35.048 0.02 17.14 ?  161  ILE A HD12 1  
ATOM   2533   H HD13 . ILE A 1 168 ? 34.453  8.253   -35.542 0.02 17.19 ?  161  ILE A HD13 1  
ATOM   2534   N N    . ASN A 1 169 ? 28.515  7.014   -35.139 0.02 16.79 ?  162  ASN A N    1  
ATOM   2535   C CA   . ASN A 1 169 ? 27.468  6.583   -34.212 0.02 16.67 ?  162  ASN A CA   1  
ATOM   2536   C C    . ASN A 1 169 ? 27.993  5.417   -33.383 0.02 16.61 ?  162  ASN A C    1  
ATOM   2537   O O    . ASN A 1 169 ? 28.360  4.385   -33.934 0.02 16.70 ?  162  ASN A O    1  
ATOM   2538   C CB   . ASN A 1 169 ? 26.197  6.175   -34.971 0.02 16.75 ?  162  ASN A CB   1  
ATOM   2539   C CG   . ASN A 1 169 ? 25.496  7.346   -35.661 0.02 16.82 ?  162  ASN A CG   1  
ATOM   2540   O OD1  . ASN A 1 169 ? 26.000  7.899   -36.633 0.02 16.94 ?  162  ASN A OD1  1  
ATOM   2541   N ND2  . ASN A 1 169 ? 24.293  7.682   -35.199 0.02 16.78 ?  162  ASN A ND2  1  
ATOM   2542   H H    . ASN A 1 169 ? 28.712  6.422   -35.725 0.02 16.87 ?  162  ASN A H    1  
ATOM   2543   H HA   . ASN A 1 169 ? 27.252  7.312   -33.612 0.02 16.60 ?  162  ASN A HA   1  
ATOM   2544   H HB2  . ASN A 1 169 ? 26.438  5.533   -35.656 0.02 16.84 ?  162  ASN A HB2  1  
ATOM   2545   H HB3  . ASN A 1 169 ? 25.576  5.765   -34.352 0.02 16.69 ?  162  ASN A HB3  1  
ATOM   2546   H HD21 . ASN A 1 169 ? 23.815  8.253   -35.626 0.02 16.84 ?  162  ASN A HD21 1  
ATOM   2547   H HD22 . ASN A 1 169 ? 23.990  7.317   -34.484 0.02 16.70 ?  162  ASN A HD22 1  
ATOM   2548   N N    . ILE A 1 170 ? 28.020  5.572   -32.045 0.02 16.48 ?  163  ILE A N    1  
ATOM   2549   C CA   . ILE A 1 170 ? 28.540  4.528   -31.176 0.02 16.45 ?  163  ILE A CA   1  
ATOM   2550   C C    . ILE A 1 170 ? 27.426  3.703   -30.526 0.02 16.42 ?  163  ILE A C    1  
ATOM   2551   O O    . ILE A 1 170 ? 26.280  4.132   -30.384 0.02 16.38 ?  163  ILE A O    1  
ATOM   2552   C CB   . ILE A 1 170 ? 29.454  5.115   -30.083 0.02 16.39 ?  163  ILE A CB   1  
ATOM   2553   C CG1  . ILE A 1 170 ? 28.678  5.934   -29.052 0.02 16.29 ?  163  ILE A CG1  1  
ATOM   2554   C CG2  . ILE A 1 170 ? 30.517  6.015   -30.682 0.02 16.46 ?  163  ILE A CG2  1  
ATOM   2555   C CD1  . ILE A 1 170 ? 29.527  6.282   -27.832 0.02 16.26 ?  163  ILE A CD1  1  
ATOM   2556   H H    . ILE A 1 170 ? 27.762  6.278   -31.634 0.02 16.44 ?  163  ILE A H    1  
ATOM   2557   H HA   . ILE A 1 170 ? 29.074  3.915   -31.707 0.02 16.53 ?  163  ILE A HA   1  
ATOM   2558   H HB   . ILE A 1 170 ? 29.892  4.378   -29.630 0.02 16.40 ?  163  ILE A HB   1  
ATOM   2559   H HG12 . ILE A 1 170 ? 28.386  6.765   -29.461 0.02 16.30 ?  163  ILE A HG12 1  
ATOM   2560   H HG13 . ILE A 1 170 ? 27.910  5.432   -28.737 0.02 16.26 ?  163  ILE A HG13 1  
ATOM   2561   H HG21 . ILE A 1 170 ? 31.111  5.476   -31.224 0.02 16.53 ?  163  ILE A HG21 1  
ATOM   2562   H HG22 . ILE A 1 170 ? 30.096  6.699   -31.225 0.02 16.48 ?  163  ILE A HG22 1  
ATOM   2563   H HG23 . ILE A 1 170 ? 31.017  6.435   -29.969 0.02 16.44 ?  163  ILE A HG23 1  
ATOM   2564   H HD11 . ILE A 1 170 ? 28.946  6.590   -27.116 0.02 16.21 ?  163  ILE A HD11 1  
ATOM   2565   H HD12 . ILE A 1 170 ? 29.997  5.482   -27.553 0.02 16.29 ?  163  ILE A HD12 1  
ATOM   2566   H HD13 . ILE A 1 170 ? 30.167  6.972   -28.057 0.02 16.30 ?  163  ILE A HD13 1  
ATOM   2567   N N    . GLN A 1 171 ? 27.799  2.507   -30.093 0.02 16.45 ?  164  GLN A N    1  
ATOM   2568   C CA   . GLN A 1 171 ? 27.041  1.707   -29.134 0.02 16.43 ?  164  GLN A CA   1  
ATOM   2569   C C    . GLN A 1 171 ? 27.812  1.656   -27.827 0.02 16.38 ?  164  GLN A C    1  
ATOM   2570   O O    . GLN A 1 171 ? 28.966  2.064   -27.749 0.02 16.38 ?  164  GLN A O    1  
ATOM   2571   C CB   . GLN A 1 171 ? 26.782  0.291   -29.665 0.02 16.56 ?  164  GLN A CB   1  
ATOM   2572   C CG   . GLN A 1 171 ? 25.721  0.317   -30.762 0.02 16.64 ?  164  GLN A CG   1  
ATOM   2573   C CD   . GLN A 1 171 ? 25.200  -1.037  -31.251 0.02 16.80 ?  164  GLN A CD   1  
ATOM   2574   O OE1  . GLN A 1 171 ? 24.200  -1.073  -31.994 0.02 16.89 ?  164  GLN A OE1  1  
ATOM   2575   N NE2  . GLN A 1 171 ? 25.840  -2.139  -30.868 0.02 16.87 ?  164  GLN A NE2  1  
ATOM   2576   H H    . GLN A 1 171 ? 28.527  2.128   -30.331 0.02 16.50 ?  164  GLN A H    1  
ATOM   2577   H HA   . GLN A 1 171 ? 26.192  2.130   -28.945 0.02 16.40 ?  164  GLN A HA   1  
ATOM   2578   H HB2  . GLN A 1 171 ? 27.599  -0.071  -30.036 0.02 16.62 ?  164  GLN A HB2  1  
ATOM   2579   H HB3  . GLN A 1 171 ? 26.460  -0.278  -28.947 0.02 16.57 ?  164  GLN A HB3  1  
ATOM   2580   H HG2  . GLN A 1 171 ? 24.967  0.829   -30.436 0.02 16.59 ?  164  GLN A HG2  1  
ATOM   2581   H HG3  . GLN A 1 171 ? 26.108  0.767   -31.526 0.02 16.66 ?  164  GLN A HG3  1  
ATOM   2582   H HE21 . GLN A 1 171 ? 26.054  -2.253  -30.045 0.02 16.83 ?  164  GLN A HE21 1  
ATOM   2583   H HE22 . GLN A 1 171 ? 26.011  -2.754  -31.439 0.02 16.98 ?  164  GLN A HE22 1  
ATOM   2584   N N    . TYR A 1 172 ? 27.127  1.161   -26.800 0.02 16.37 ?  165  TYR A N    1  
ATOM   2585   C CA   . TYR A 1 172 ? 27.623  1.056   -25.433 0.02 16.35 ?  165  TYR A CA   1  
ATOM   2586   C C    . TYR A 1 172 ? 26.664  0.151   -24.683 0.02 16.41 ?  165  TYR A C    1  
ATOM   2587   O O    . TYR A 1 172 ? 25.505  0.011   -25.061 0.02 16.43 ?  165  TYR A O    1  
ATOM   2588   C CB   . TYR A 1 172 ? 27.716  2.434   -24.743 0.02 16.26 ?  165  TYR A CB   1  
ATOM   2589   C CG   . TYR A 1 172 ? 26.403  3.199   -24.684 0.02 16.21 ?  165  TYR A CG   1  
ATOM   2590   C CD1  . TYR A 1 172 ? 25.564  3.079   -23.589 0.02 16.21 ?  165  TYR A CD1  1  
ATOM   2591   C CD2  . TYR A 1 172 ? 26.047  4.089   -25.673 0.02 16.19 ?  165  TYR A CD2  1  
ATOM   2592   C CE1  . TYR A 1 172 ? 24.387  3.736   -23.539 0.02 16.20 ?  165  TYR A CE1  1  
ATOM   2593   C CE2  . TYR A 1 172 ? 24.851  4.775   -25.626 0.02 16.17 ?  165  TYR A CE2  1  
ATOM   2594   C CZ   . TYR A 1 172 ? 24.037  4.616   -24.540 0.02 16.17 ?  165  TYR A CZ   1  
ATOM   2595   O OH   . TYR A 1 172 ? 22.850  5.296   -24.478 0.02 16.18 ?  165  TYR A OH   1  
ATOM   2596   H H    . TYR A 1 172 ? 26.331  0.857   -26.882 0.02 16.40 ?  165  TYR A H    1  
ATOM   2597   H HA   . TYR A 1 172 ? 28.498  0.642   -25.435 0.02 16.40 ?  165  TYR A HA   1  
ATOM   2598   H HB2  . TYR A 1 172 ? 28.015  2.296   -23.831 0.02 16.27 ?  165  TYR A HB2  1  
ATOM   2599   H HB3  . TYR A 1 172 ? 28.356  2.986   -25.215 0.02 16.25 ?  165  TYR A HB3  1  
ATOM   2600   H HD1  . TYR A 1 172 ? 25.785  2.484   -22.913 0.02 16.25 ?  165  TYR A HD1  1  
ATOM   2601   H HD2  . TYR A 1 172 ? 26.603  4.194   -26.412 0.02 16.20 ?  165  TYR A HD2  1  
ATOM   2602   H HE1  . TYR A 1 172 ? 23.831  3.630   -22.800 0.02 16.22 ?  165  TYR A HE1  1  
ATOM   2603   H HE2  . TYR A 1 172 ? 24.619  5.363   -26.304 0.02 16.17 ?  165  TYR A HE2  1  
ATOM   2604   H HH   . TYR A 1 172 ? 22.930  6.046   -24.840 0.02 16.15 ?  165  TYR A HH   1  
ATOM   2605   N N    . ARG A 1 173 ? 27.157  -0.459  -23.611 0.02 16.46 ?  166  ARG A N    1  
ATOM   2606   C CA   . ARG A 1 173 ? 26.355  -1.448  -22.915 0.02 16.56 ?  166  ARG A CA   1  
ATOM   2607   C C    . ARG A 1 173 ? 25.175  -0.810  -22.198 0.02 16.52 ?  166  ARG A C    1  
ATOM   2608   O O    . ARG A 1 173 ? 25.291  0.258   -21.602 0.02 16.43 ?  166  ARG A O    1  
ATOM   2609   C CB   . ARG A 1 173 ? 27.201  -2.207  -21.916 0.02 16.65 ?  166  ARG A CB   1  
ATOM   2610   C CG   . ARG A 1 173 ? 28.053  -3.251  -22.543 0.02 16.76 ?  166  ARG A CG   1  
ATOM   2611   C CD   . ARG A 1 173 ? 28.952  -3.889  -21.491 0.02 16.87 ?  166  ARG A CD   1  
ATOM   2612   N NE   . ARG A 1 173 ? 30.149  -3.121  -21.278 0.02 16.81 ?  166  ARG A NE   1  
ATOM   2613   C CZ   . ARG A 1 173 ? 31.086  -3.439  -20.403 0.02 16.91 ?  166  ARG A CZ   1  
ATOM   2614   N NH1  . ARG A 1 173 ? 30.927  -4.499  -19.625 0.02 17.07 ?  166  ARG A NH1  1  
ATOM   2615   N NH2  . ARG A 1 173 ? 32.163  -2.671  -20.280 0.02 16.89 ?  166  ARG A NH2  1  
ATOM   2616   H H    . ARG A 1 173 ? 27.936  -0.321  -23.285 0.02 16.46 ?  166  ARG A H    1  
ATOM   2617   H HA   . ARG A 1 173 ? 26.009  -2.081  -23.562 0.02 16.62 ?  166  ARG A HA   1  
ATOM   2618   H HB2  . ARG A 1 173 ? 27.785  -1.576  -21.473 0.02 16.60 ?  166  ARG A HB2  1  
ATOM   2619   H HB3  . ARG A 1 173 ? 26.620  -2.638  -21.274 0.02 16.71 ?  166  ARG A HB3  1  
ATOM   2620   H HG2  . ARG A 1 173 ? 27.486  -3.942  -22.916 0.02 16.83 ?  166  ARG A HG2  1  
ATOM   2621   H HG3  . ARG A 1 173 ? 28.606  -2.849  -23.229 0.02 16.71 ?  166  ARG A HG3  1  
ATOM   2622   H HD2  . ARG A 1 173 ? 28.473  -3.926  -20.653 0.02 16.89 ?  166  ARG A HD2  1  
ATOM   2623   H HD3  . ARG A 1 173 ? 29.206  -4.780  -21.765 0.02 16.98 ?  166  ARG A HD3  1  
ATOM   2624   H HE   . ARG A 1 173 ? 30.320  -2.488  -21.837 0.02 16.74 ?  166  ARG A HE   1  
ATOM   2625   H HH11 . ARG A 1 173 ? 30.232  -4.991  -19.702 0.02 17.10 ?  166  ARG A HH11 1  
ATOM   2626   H HH12 . ARG A 1 173 ? 31.529  -4.703  -19.052 0.02 17.15 ?  166  ARG A HH12 1  
ATOM   2627   H HH21 . ARG A 1 173 ? 32.256  -1.982  -20.778 0.02 16.81 ?  166  ARG A HH21 1  
ATOM   2628   H HH22 . ARG A 1 173 ? 32.768  -2.867  -19.708 0.02 16.97 ?  166  ARG A HH22 1  
ATOM   2629   N N    . LEU A 1 174 ? 24.057  -1.520  -22.209 0.02 16.61 ?  167  LEU A N    1  
ATOM   2630   C CA   . LEU A 1 174 ? 22.793  -1.039  -21.691 0.02 16.62 ?  167  LEU A CA   1  
ATOM   2631   C C    . LEU A 1 174 ? 22.339  -1.887  -20.511 0.02 16.76 ?  167  LEU A C    1  
ATOM   2632   O O    . LEU A 1 174 ? 22.773  -3.020  -20.307 0.02 16.88 ?  167  LEU A O    1  
ATOM   2633   C CB   . LEU A 1 174 ? 21.709  -1.083  -22.771 0.02 16.66 ?  167  LEU A CB   1  
ATOM   2634   C CG   . LEU A 1 174 ? 22.080  -0.341  -24.056 0.02 16.56 ?  167  LEU A CG   1  
ATOM   2635   C CD1  . LEU A 1 174 ? 21.033  -0.537  -25.122 0.02 16.65 ?  167  LEU A CD1  1  
ATOM   2636   C CD2  . LEU A 1 174 ? 22.257  1.103   -23.771 0.02 16.43 ?  167  LEU A CD2  1  
ATOM   2637   H H    . LEU A 1 174 ? 24.010  -2.317  -22.521 0.02 16.70 ?  167  LEU A H    1  
ATOM   2638   H HA   . LEU A 1 174 ? 22.890  -0.122  -21.398 0.02 16.53 ?  167  LEU A HA   1  
ATOM   2639   H HB2  . LEU A 1 174 ? 21.549  -2.008  -23.003 0.02 16.77 ?  167  LEU A HB2  1  
ATOM   2640   H HB3  . LEU A 1 174 ? 20.898  -0.689  -22.422 0.02 16.67 ?  167  LEU A HB3  1  
ATOM   2641   H HG   . LEU A 1 174 ? 22.919  -0.690  -24.389 0.02 16.56 ?  167  LEU A HG   1  
ATOM   2642   H HD11 . LEU A 1 174 ? 21.335  -0.109  -25.938 0.02 16.61 ?  167  LEU A HD11 1  
ATOM   2643   H HD12 . LEU A 1 174 ? 20.895  -1.485  -25.269 0.02 16.76 ?  167  LEU A HD12 1  
ATOM   2644   H HD13 . LEU A 1 174 ? 20.206  -0.130  -24.820 0.02 16.66 ?  167  LEU A HD13 1  
ATOM   2645   H HD21 . LEU A 1 174 ? 23.162  1.243   -23.451 0.02 16.38 ?  167  LEU A HD21 1  
ATOM   2646   H HD22 . LEU A 1 174 ? 22.118  1.615   -24.580 0.02 16.40 ?  167  LEU A HD22 1  
ATOM   2647   H HD23 . LEU A 1 174 ? 21.618  1.364   -23.094 0.02 16.44 ?  167  LEU A HD23 1  
ATOM   2648   N N    . GLY A 1 175 ? 21.431  -1.313  -19.743 0.02 16.77 ?  168  GLY A N    1  
ATOM   2649   C CA   . GLY A 1 175 ? 20.758  -2.113  -18.740 0.02 16.95 ?  168  GLY A CA   1  
ATOM   2650   C C    . GLY A 1 175 ? 21.690  -2.532  -17.619 0.02 17.01 ?  168  GLY A C    1  
ATOM   2651   O O    . GLY A 1 175 ? 22.719  -1.914  -17.360 0.02 16.90 ?  168  GLY A O    1  
ATOM   2652   H H    . GLY A 1 175 ? 21.198  -0.489  -19.781 0.02 16.70 ?  168  GLY A H    1  
ATOM   2653   H HA2  . GLY A 1 175 ? 20.022  -1.613  -18.363 0.02 16.96 ?  168  GLY A HA2  1  
ATOM   2654   H HA3  . GLY A 1 175 ? 20.417  -2.918  -19.159 0.02 17.05 ?  168  GLY A HA3  1  
ATOM   2655   N N    . ALA A 1 176 ? 21.308  -3.597  -16.928 0.02 17.21 ?  169  ALA A N    1  
ATOM   2656   C CA   . ALA A 1 176 ? 22.170  -4.072  -15.859 0.02 17.31 ?  169  ALA A CA   1  
ATOM   2657   C C    . ALA A 1 176 ? 23.517  -4.501  -16.396 0.02 17.26 ?  169  ALA A C    1  
ATOM   2658   O O    . ALA A 1 176 ? 24.500  -4.479  -15.667 0.02 17.29 ?  169  ALA A O    1  
ATOM   2659   C CB   . ALA A 1 176 ? 21.522  -5.224  -15.096 0.02 17.57 ?  169  ALA A CB   1  
ATOM   2660   H H    . ALA A 1 176 ? 20.591  -4.047  -17.054 0.02 17.31 ?  169  ALA A H    1  
ATOM   2661   H HA   . ALA A 1 176 ? 22.321  -3.351  -15.232 0.02 17.26 ?  169  ALA A HA   1  
ATOM   2662   H HB1  . ALA A 1 176 ? 22.214  -5.682  -14.597 0.02 17.65 ?  169  ALA A HB1  1  
ATOM   2663   H HB2  . ALA A 1 176 ? 20.851  -4.877  -14.489 0.02 17.62 ?  169  ALA A HB2  1  
ATOM   2664   H HB3  . ALA A 1 176 ? 21.120  -5.836  -15.729 0.02 17.64 ?  169  ALA A HB3  1  
ATOM   2665   N N    . LEU A 1 177 ? 23.602  -4.865  -17.676 0.02 17.22 ?  170  LEU A N    1  
ATOM   2666   C CA   . LEU A 1 177 ? 24.893  -5.310  -18.183 0.02 17.21 ?  170  LEU A CA   1  
ATOM   2667   C C    . LEU A 1 177 ? 25.851  -4.133  -18.336 0.02 17.02 ?  170  LEU A C    1  
ATOM   2668   O O    . LEU A 1 177 ? 27.075  -4.306  -18.252 0.02 17.04 ?  170  LEU A O    1  
ATOM   2669   C CB   . LEU A 1 177 ? 24.696  -6.054  -19.511 0.02 17.26 ?  170  LEU A CB   1  
ATOM   2670   C CG   . LEU A 1 177 ? 24.073  -7.456  -19.376 0.02 17.51 ?  170  LEU A CG   1  
ATOM   2671   C CD1  . LEU A 1 177 ? 23.735  -8.076  -20.744 0.02 17.58 ?  170  LEU A CD1  1  
ATOM   2672   C CD2  . LEU A 1 177 ? 24.990  -8.412  -18.593 0.02 17.68 ?  170  LEU A CD2  1  
ATOM   2673   H H    . LEU A 1 177 ? 22.960  -4.853  -18.243 0.02 17.21 ?  170  LEU A H    1  
ATOM   2674   H HA   . LEU A 1 177 ? 25.285  -5.924  -17.548 0.02 17.33 ?  170  LEU A HA   1  
ATOM   2675   H HB2  . LEU A 1 177 ? 24.091  -5.524  -20.050 0.02 17.18 ?  170  LEU A HB2  1  
ATOM   2676   H HB3  . LEU A 1 177 ? 25.553  -6.142  -19.955 0.02 17.23 ?  170  LEU A HB3  1  
ATOM   2677   H HG   . LEU A 1 177 ? 23.244  -7.380  -18.879 0.02 17.56 ?  170  LEU A HG   1  
ATOM   2678   H HD11 . LEU A 1 177 ? 23.162  -7.465  -21.229 0.02 17.49 ?  170  LEU A HD11 1  
ATOM   2679   H HD12 . LEU A 1 177 ? 24.554  -8.224  -21.237 0.02 17.54 ?  170  LEU A HD12 1  
ATOM   2680   H HD13 . LEU A 1 177 ? 23.277  -8.920  -20.609 0.02 17.76 ?  170  LEU A HD13 1  
ATOM   2681   H HD21 . LEU A 1 177 ? 24.588  -9.296  -18.598 0.02 17.86 ?  170  LEU A HD21 1  
ATOM   2682   H HD22 . LEU A 1 177 ? 25.862  -8.442  -19.017 0.02 17.64 ?  170  LEU A HD22 1  
ATOM   2683   H HD23 . LEU A 1 177 ? 25.077  -8.099  -17.679 0.02 17.68 ?  170  LEU A HD23 1  
ATOM   2684   N N    . GLY A 1 178 ? 25.314  -2.933  -18.517 0.02 16.87 ?  171  GLY A N    1  
ATOM   2685   C CA   . GLY A 1 178 ? 26.095  -1.723  -18.574 0.02 16.73 ?  171  GLY A CA   1  
ATOM   2686   C C    . GLY A 1 178 ? 26.226  -0.984  -17.252 0.02 16.73 ?  171  GLY A C    1  
ATOM   2687   O O    . GLY A 1 178 ? 27.118  -0.160  -17.100 0.02 16.67 ?  171  GLY A O    1  
ATOM   2688   H H    . GLY A 1 178 ? 24.473  -2.798  -18.614 0.02 16.87 ?  171  GLY A H    1  
ATOM   2689   H HA2  . GLY A 1 178 ? 26.984  -1.925  -18.904 0.02 16.73 ?  171  GLY A HA2  1  
ATOM   2690   H HA3  . GLY A 1 178 ? 25.670  -1.111  -19.191 0.02 16.64 ?  171  GLY A HA3  1  
ATOM   2691   N N    . PHE A 1 179 ? 25.301  -1.217  -16.311 0.02 16.83 ?  172  PHE A N    1  
ATOM   2692   C CA   . PHE A 1 179 ? 25.242  -0.303  -15.173 0.02 16.84 ?  172  PHE A CA   1  
ATOM   2693   C C    . PHE A 1 179 ? 25.059  -0.977  -13.809 0.02 17.04 ?  172  PHE A C    1  
ATOM   2694   O O    . PHE A 1 179 ? 24.741  -0.285  -12.832 0.02 17.08 ?  172  PHE A O    1  
ATOM   2695   C CB   . PHE A 1 179 ? 24.148  0.739   -15.443 0.02 16.75 ?  172  PHE A CB   1  
ATOM   2696   C CG   . PHE A 1 179 ? 24.519  1.660   -16.565 0.02 16.58 ?  172  PHE A CG   1  
ATOM   2697   C CD1  . PHE A 1 179 ? 25.303  2.758   -16.318 0.02 16.52 ?  172  PHE A CD1  1  
ATOM   2698   C CD2  . PHE A 1 179 ? 24.163  1.375   -17.871 0.02 16.52 ?  172  PHE A CD2  1  
ATOM   2699   C CE1  . PHE A 1 179 ? 25.688  3.586   -17.322 0.02 16.41 ?  172  PHE A CE1  1  
ATOM   2700   C CE2  . PHE A 1 179 ? 24.556  2.212   -18.883 0.02 16.40 ?  172  PHE A CE2  1  
ATOM   2701   C CZ   . PHE A 1 179 ? 25.324  3.305   -18.612 0.02 16.34 ?  172  PHE A CZ   1  
ATOM   2702   H H    . PHE A 1 179 ? 24.739  -1.862  -16.307 0.02 16.91 ?  172  PHE A H    1  
ATOM   2703   H HA   . PHE A 1 179 ? 26.080  0.178   -15.122 0.02 16.80 ?  172  PHE A HA   1  
ATOM   2704   H HB2  . PHE A 1 179 ? 23.330  0.282   -15.686 0.02 16.79 ?  172  PHE A HB2  1  
ATOM   2705   H HB3  . PHE A 1 179 ? 24.011  1.275   -14.650 0.02 16.78 ?  172  PHE A HB3  1  
ATOM   2706   H HD1  . PHE A 1 179 ? 25.557  2.943   -15.444 0.02 16.58 ?  172  PHE A HD1  1  
ATOM   2707   H HD2  . PHE A 1 179 ? 23.649  0.625   -18.062 0.02 16.58 ?  172  PHE A HD2  1  
ATOM   2708   H HE1  . PHE A 1 179 ? 26.206  4.334   -17.139 0.02 16.39 ?  172  PHE A HE1  1  
ATOM   2709   H HE2  . PHE A 1 179 ? 24.307  2.026   -19.760 0.02 16.38 ?  172  PHE A HE2  1  
ATOM   2710   H HZ   . PHE A 1 179 ? 25.577  3.872   -19.302 0.02 16.28 ?  172  PHE A HZ   1  
ATOM   2711   N N    . LEU A 1 180 ? 25.341  -2.260  -13.692 0.02 17.18 ?  173  LEU A N    1  
ATOM   2712   C CA   . LEU A 1 180 ? 25.388  -2.896  -12.377 0.02 17.40 ?  173  LEU A CA   1  
ATOM   2713   C C    . LEU A 1 180 ? 26.453  -2.230  -11.531 0.02 17.42 ?  173  LEU A C    1  
ATOM   2714   O O    . LEU A 1 180 ? 27.523  -1.899  -12.020 0.02 17.33 ?  173  LEU A O    1  
ATOM   2715   C CB   . LEU A 1 180 ? 25.713  -4.377  -12.511 0.02 17.57 ?  173  LEU A CB   1  
ATOM   2716   C CG   . LEU A 1 180 ? 25.202  -5.241  -11.370 0.02 17.84 ?  173  LEU A CG   1  
ATOM   2717   C CD1  . LEU A 1 180 ? 23.763  -5.544  -11.638 0.02 17.89 ?  173  LEU A CD1  1  
ATOM   2718   C CD2  . LEU A 1 180 ? 26.021  -6.515  -11.217 0.02 18.03 ?  173  LEU A CD2  1  
ATOM   2719   H H    . LEU A 1 180 ? 25.516  -2.785  -14.345 0.02 17.17 ?  173  LEU A H    1  
ATOM   2720   H HA   . LEU A 1 180 ? 24.532  -2.803  -11.933 0.02 17.46 ?  173  LEU A HA   1  
ATOM   2721   H HB2  . LEU A 1 180 ? 25.314  -4.707  -13.330 0.02 17.53 ?  173  LEU A HB2  1  
ATOM   2722   H HB3  . LEU A 1 180 ? 26.675  -4.489  -12.541 0.02 17.57 ?  173  LEU A HB3  1  
ATOM   2723   H HG   . LEU A 1 180 ? 25.266  -4.736  -10.544 0.02 17.87 ?  173  LEU A HG   1  
ATOM   2724   H HD11 . LEU A 1 180 ? 23.416  -6.085  -10.912 0.02 18.07 ?  173  LEU A HD11 1  
ATOM   2725   H HD12 . LEU A 1 180 ? 23.275  -4.710  -11.692 0.02 17.76 ?  173  LEU A HD12 1  
ATOM   2726   H HD13 . LEU A 1 180 ? 23.685  -6.026  -12.471 0.02 17.89 ?  173  LEU A HD13 1  
ATOM   2727   H HD21 . LEU A 1 180 ? 25.602  -7.083  -10.555 0.02 18.22 ?  173  LEU A HD21 1  
ATOM   2728   H HD22 . LEU A 1 180 ? 26.051  -6.973  -12.072 0.02 17.99 ?  173  LEU A HD22 1  
ATOM   2729   H HD23 . LEU A 1 180 ? 26.919  -6.284  -10.938 0.02 18.04 ?  173  LEU A HD23 1  
ATOM   2730   N N    . SER A 1 181 ? 26.170  -2.046  -10.240 0.02 17.58 ?  174  SER A N    1  
ATOM   2731   C CA   . SER A 1 181 ? 27.127  -1.388  -9.354  0.02 17.64 ?  174  SER A CA   1  
ATOM   2732   C C    . SER A 1 181 ? 27.132  -2.086  -8.008  0.02 17.92 ?  174  SER A C    1  
ATOM   2733   O O    . SER A 1 181 ? 26.069  -2.306  -7.435  0.02 18.04 ?  174  SER A O    1  
ATOM   2734   C CB   . SER A 1 181 ? 26.781  0.091   -9.155  0.02 17.53 ?  174  SER A CB   1  
ATOM   2735   O OG   . SER A 1 181 ? 27.676  0.705   -8.217  0.02 17.64 ?  174  SER A OG   1  
ATOM   2736   H H    . SER A 1 181 ? 25.438  -2.282  -9.867  0.02 17.66 ?  174  SER A H    1  
ATOM   2737   H HA   . SER A 1 181 ? 28.018  -1.449  -9.725  0.02 17.61 ?  174  SER A HA   1  
ATOM   2738   H HB2  . SER A 1 181 ? 26.864  0.547   -10.006 0.02 17.37 ?  174  SER A HB2  1  
ATOM   2739   H HB3  . SER A 1 181 ? 25.872  0.163   -8.831  0.02 17.57 ?  174  SER A HB3  1  
ATOM   2740   H HG   . SER A 1 181 ? 28.461  0.456   -8.365  0.02 17.65 ?  174  SER A HG   1  
ATOM   2741   N N    . LEU A 1 182 ? 28.315  -2.425  -7.507  0.02 18.06 ?  175  LEU A N    1  
ATOM   2742   C CA   . LEU A 1 182 ? 28.401  -3.105  -6.224  0.02 18.37 ?  175  LEU A CA   1  
ATOM   2743   C C    . LEU A 1 182 ? 29.369  -2.372  -5.325  0.02 18.49 ?  175  LEU A C    1  
ATOM   2744   O O    . LEU A 1 182 ? 30.473  -2.003  -5.722  0.02 18.42 ?  175  LEU A O    1  
ATOM   2745   C CB   . LEU A 1 182 ? 28.824  -4.556  -6.367  0.02 18.53 ?  175  LEU A CB   1  
ATOM   2746   C CG   . LEU A 1 182 ? 27.964  -5.484  -7.226  0.02 18.47 ?  175  LEU A CG   1  
ATOM   2747   C CD1  . LEU A 1 182 ? 28.681  -6.813  -7.396  0.02 18.64 ?  175  LEU A CD1  1  
ATOM   2748   C CD2  . LEU A 1 182 ? 26.593  -5.698  -6.587  0.02 18.61 ?  175  LEU A CD2  1  
ATOM   2749   H H    . LEU A 1 182 ? 29.072  -2.266  -7.873  0.02 18.01 ?  175  LEU A H    1  
ATOM   2750   H HA   . LEU A 1 182 ? 27.532  -3.085  -5.794  0.02 18.43 ?  175  LEU A HA   1  
ATOM   2751   H HB2  . LEU A 1 182 ? 29.718  -4.563  -6.739  0.02 18.50 ?  175  LEU A HB2  1  
ATOM   2752   H HB3  . LEU A 1 182 ? 28.844  -4.950  -5.484  0.02 18.75 ?  175  LEU A HB3  1  
ATOM   2753   H HG   . LEU A 1 182 ? 27.840  -5.080  -8.099  0.02 18.27 ?  175  LEU A HG   1  
ATOM   2754   H HD11 . LEU A 1 182 ? 28.399  -7.418  -6.694  0.02 18.82 ?  175  LEU A HD11 1  
ATOM   2755   H HD12 . LEU A 1 182 ? 28.459  -7.188  -8.262  0.02 18.51 ?  175  LEU A HD12 1  
ATOM   2756   H HD13 . LEU A 1 182 ? 29.638  -6.670  -7.340  0.02 18.71 ?  175  LEU A HD13 1  
ATOM   2757   H HD21 . LEU A 1 182 ? 25.977  -5.985  -7.277  0.02 18.54 ?  175  LEU A HD21 1  
ATOM   2758   H HD22 . LEU A 1 182 ? 26.659  -6.376  -5.896  0.02 18.84 ?  175  LEU A HD22 1  
ATOM   2759   H HD23 . LEU A 1 182 ? 26.285  -4.864  -6.204  0.02 18.56 ?  175  LEU A HD23 1  
ATOM   2760   N N    . ASN A 1 183 ? 28.954  -2.233  -4.075  0.02 18.71 ?  176  ASN A N    1  
ATOM   2761   C CA   . ASN A 1 183 ? 29.778  -1.551  -3.094  0.02 18.87 ?  176  ASN A CA   1  
ATOM   2762   C C    . ASN A 1 183 ? 31.176  -2.169  -2.918  0.02 19.04 ?  176  ASN A C    1  
ATOM   2763   O O    . ASN A 1 183 ? 32.149  -1.428  -2.752  0.02 19.06 ?  176  ASN A O    1  
ATOM   2764   C CB   . ASN A 1 183 ? 29.032  -1.541  -1.764  0.02 19.14 ?  176  ASN A CB   1  
ATOM   2765   C CG   . ASN A 1 183 ? 27.961  -0.491  -1.726  0.02 19.01 ?  176  ASN A CG   1  
ATOM   2766   O OD1  . ASN A 1 183 ? 28.158  0.606   -2.200  0.02 18.85 ?  176  ASN A OD1  1  
ATOM   2767   N ND2  . ASN A 1 183 ? 26.824  -0.820  -1.142  0.02 19.12 ?  176  ASN A ND2  1  
ATOM   2768   H H    . ASN A 1 183 ? 28.194  -2.505  -3.790  0.02 18.78 ?  176  ASN A H    1  
ATOM   2769   H HA   . ASN A 1 183 ? 29.893  -0.632  -3.383  0.02 18.73 ?  176  ASN A HA   1  
ATOM   2770   H HB2  . ASN A 1 183 ? 28.613  -2.404  -1.636  0.02 19.23 ?  176  ASN A HB2  1  
ATOM   2771   H HB3  . ASN A 1 183 ? 29.660  -1.363  -1.052  0.02 19.31 ?  176  ASN A HB3  1  
ATOM   2772   H HD21 . ASN A 1 183 ? 26.214  -0.223  -1.037  0.02 19.09 ?  176  ASN A HD21 1  
ATOM   2773   H HD22 . ASN A 1 183 ? 26.697  -1.624  -0.863  0.02 19.23 ?  176  ASN A HD22 1  
ATOM   2774   N N    . SER A 1 184 ? 31.304  -3.502  -2.909  0.02 19.20 ?  177  SER A N    1  
ATOM   2775   C CA   . SER A 1 184 ? 32.538  -4.129  -2.435  0.02 19.45 ?  177  SER A CA   1  
ATOM   2776   C C    . SER A 1 184 ? 33.706  -3.909  -3.392  0.02 19.30 ?  177  SER A C    1  
ATOM   2777   O O    . SER A 1 184 ? 33.704  -4.398  -4.523  0.02 19.12 ?  177  SER A O    1  
ATOM   2778   C CB   . SER A 1 184 ? 32.328  -5.625  -2.213  0.02 19.67 ?  177  SER A CB   1  
ATOM   2779   O OG   . SER A 1 184 ? 33.506  -6.234  -1.703  0.02 19.94 ?  177  SER A OG   1  
ATOM   2780   H H    . SER A 1 184 ? 30.701  -4.063  -3.149  0.02 19.18 ?  177  SER A H    1  
ATOM   2781   H HA   . SER A 1 184 ? 32.785  -3.734  -1.587  0.02 19.62 ?  177  SER A HA   1  
ATOM   2782   H HB2  . SER A 1 184 ? 31.605  -5.760  -1.584  0.02 19.81 ?  177  SER A HB2  1  
ATOM   2783   H HB3  . SER A 1 184 ? 32.116  -6.040  -3.062  0.02 19.52 ?  177  SER A HB3  1  
ATOM   2784   H HG   . SER A 1 184 ? 33.436  -7.071  -1.747  0.02 20.05 ?  177  SER A HG   1  
ATOM   2785   N N    . GLU A 1 185 ? 34.746  -3.251  -2.892  0.02 19.43 ?  178  GLU A N    1  
ATOM   2786   C CA   . GLU A 1 185 ? 35.871  -2.888  -3.757  0.02 19.31 ?  178  GLU A CA   1  
ATOM   2787   C C    . GLU A 1 185 ? 36.598  -4.112  -4.348  0.02 19.41 ?  178  GLU A C    1  
ATOM   2788   O O    . GLU A 1 185 ? 37.114  -4.016  -5.457  0.02 19.25 ?  178  GLU A O    1  
ATOM   2789   C CB   . GLU A 1 185 ? 36.826  -1.957  -2.987  0.02 19.48 ?  178  GLU A CB   1  
ATOM   2790   C CG   . GLU A 1 185 ? 38.046  -1.511  -3.771  0.02 19.42 ?  178  GLU A CG   1  
ATOM   2791   C CD   . GLU A 1 185 ? 38.688  -0.234  -3.225  0.02 19.55 ?  178  GLU A CD   1  
ATOM   2792   O OE1  . GLU A 1 185 ? 39.590  0.296   -3.924  0.02 19.44 ?  178  GLU A OE1  1  
ATOM   2793   O OE2  . GLU A 1 185 ? 38.293  0.238   -2.130  0.02 19.78 -1 178  GLU A OE2  1  
ATOM   2794   H H    . GLU A 1 185 ? 34.812  -2.979  -2.081  0.02 19.59 ?  178  GLU A H    1  
ATOM   2795   H HA   . GLU A 1 185 ? 35.524  -2.388  -4.508  0.02 19.07 ?  178  GLU A HA   1  
ATOM   2796   H HB2  . GLU A 1 185 ? 36.340  -1.163  -2.721  0.02 19.40 ?  178  GLU A HB2  1  
ATOM   2797   H HB3  . GLU A 1 185 ? 37.145  -2.421  -2.199  0.02 19.74 ?  178  GLU A HB3  1  
ATOM   2798   H HG2  . GLU A 1 185 ? 38.708  -2.218  -3.736  0.02 19.56 ?  178  GLU A HG2  1  
ATOM   2799   H HG3  . GLU A 1 185 ? 37.782  -1.345  -4.690  0.02 19.18 ?  178  GLU A HG3  1  
ATOM   2800   N N    . ASP A 1 186 ? 36.567  -5.272  -3.666  0.02 19.68 ?  179  ASP A N    1  
ATOM   2801   C CA   . ASP A 1 186 ? 37.161  -6.539  -4.084  0.02 19.82 ?  179  ASP A CA   1  
ATOM   2802   C C    . ASP A 1 186 ? 36.720  -6.933  -5.468  0.02 19.55 ?  179  ASP A C    1  
ATOM   2803   O O    . ASP A 1 186 ? 37.454  -7.627  -6.192  0.02 19.60 ?  179  ASP A O    1  
ATOM   2804   C CB   . ASP A 1 186 ? 36.761  -7.608  -3.091  0.02 20.19 ?  179  ASP A CB   1  
ATOM   2805   C CG   . ASP A 1 186 ? 37.835  -8.715  -2.987  0.02 20.46 ?  179  ASP A CG   1  
ATOM   2806   O OD1  . ASP A 1 186 ? 37.622  -9.899  -2.627  0.02 20.67 ?  179  ASP A OD1  1  
ATOM   2807   O OD2  . ASP A 1 186 ? 39.003  -8.235  -3.278  0.02 20.50 -1 179  ASP A OD2  1  
ATOM   2808   H H    . ASP A 1 186 ? 36.184  -5.332  -2.911  0.02 19.81 ?  179  ASP A H    1  
ATOM   2809   H HA   . ASP A 1 186 ? 38.102  -6.435  -4.136  0.02 19.90 ?  179  ASP A HA   1  
ATOM   2810   H HB2  . ASP A 1 186 ? 36.615  -7.119  -2.246  0.02 20.34 ?  179  ASP A HB2  1  
ATOM   2811   H HB3  . ASP A 1 186 ? 35.977  -8.213  -3.341  0.02 20.13 ?  179  ASP A HB3  1  
ATOM   2812   N N    . LEU A 1 187 ? 35.537  -6.511  -5.866  0.02 19.30 ?  180  LEU A N    1  
ATOM   2813   C CA   . LEU A 1 187 ? 34.896  -7.153  -6.999  0.02 19.12 ?  180  LEU A CA   1  
ATOM   2814   C C    . LEU A 1 187 ? 35.075  -6.375  -8.302  0.02 18.80 ?  180  LEU A C    1  
ATOM   2815   O O    . LEU A 1 187 ? 34.836  -6.922  -9.377  0.02 18.68 ?  180  LEU A O    1  
ATOM   2816   C CB   . LEU A 1 187 ? 33.417  -7.368  -6.710  0.02 19.07 ?  180  LEU A CB   1  
ATOM   2817   C CG   . LEU A 1 187 ? 33.108  -8.059  -5.390  0.02 19.41 ?  180  LEU A CG   1  
ATOM   2818   C CD1  . LEU A 1 187 ? 31.626  -8.045  -5.151  0.02 19.36 ?  180  LEU A CD1  1  
ATOM   2819   C CD2  . LEU A 1 187 ? 33.628  -9.477  -5.387  0.02 19.68 ?  180  LEU A CD2  1  
ATOM   2820   H H    . LEU A 1 187 ? 35.096  -5.860  -5.517  0.02 19.26 ?  180  LEU A H    1  
ATOM   2821   H HA   . LEU A 1 187 ? 35.290  -8.033  -7.096  0.02 19.26 ?  180  LEU A HA   1  
ATOM   2822   H HB2  . LEU A 1 187 ? 32.969  -6.508  -6.711  0.02 18.92 ?  180  LEU A HB2  1  
ATOM   2823   H HB3  . LEU A 1 187 ? 33.054  -7.929  -7.408  0.02 19.00 ?  180  LEU A HB3  1  
ATOM   2824   H HG   . LEU A 1 187 ? 33.537  -7.582  -4.663  0.02 19.51 ?  180  LEU A HG   1  
ATOM   2825   H HD11 . LEU A 1 187 ? 31.397  -8.711  -4.485  0.02 19.60 ?  180  LEU A HD11 1  
ATOM   2826   H HD12 . LEU A 1 187 ? 31.368  -7.163  -4.843  0.02 19.23 ?  180  LEU A HD12 1  
ATOM   2827   H HD13 . LEU A 1 187 ? 31.175  -8.255  -5.983  0.02 19.25 ?  180  LEU A HD13 1  
ATOM   2828   H HD21 . LEU A 1 187 ? 32.956  -10.060 -4.999  0.02 19.81 ?  180  LEU A HD21 1  
ATOM   2829   H HD22 . LEU A 1 187 ? 33.808  -9.749  -6.300  0.02 19.56 ?  180  LEU A HD22 1  
ATOM   2830   H HD23 . LEU A 1 187 ? 34.443  -9.517  -4.864  0.02 19.85 ?  180  LEU A HD23 1  
ATOM   2831   N N    . ASN A 1 188 ? 35.525  -5.130  -8.232  0.02 18.68 ?  181  ASN A N    1  
ATOM   2832   C CA   . ASN A 1 188 ? 35.755  -4.311  -9.422  0.02 18.40 ?  181  ASN A CA   1  
ATOM   2833   C C    . ASN A 1 188 ? 34.518  -4.256  -10.307 0.02 18.15 ?  181  ASN A C    1  
ATOM   2834   O O    . ASN A 1 188 ? 34.610  -4.348  -11.534 0.02 18.00 ?  181  ASN A O    1  
ATOM   2835   C CB   . ASN A 1 188 ? 36.968  -4.816  -10.215 0.02 18.45 ?  181  ASN A CB   1  
ATOM   2836   C CG   . ASN A 1 188 ? 37.489  -3.778  -11.209 0.02 18.23 ?  181  ASN A CG   1  
ATOM   2837   O OD1  . ASN A 1 188 ? 37.787  -4.087  -12.376 0.02 18.12 ?  181  ASN A OD1  1  
ATOM   2838   N ND2  . ASN A 1 188 ? 37.584  -2.534  -10.757 0.02 18.18 ?  181  ASN A ND2  1  
ATOM   2839   H H    . ASN A 1 188 ? 35.725  -4.729  -7.502  0.02 18.78 ?  181  ASN A H    1  
ATOM   2840   H HA   . ASN A 1 188 ? 35.938  -3.409  -9.135  0.02 18.36 ?  181  ASN A HA   1  
ATOM   2841   H HB2  . ASN A 1 188 ? 37.683  -5.002  -9.586  0.02 18.64 ?  181  ASN A HB2  1  
ATOM   2842   H HB3  . ASN A 1 188 ? 36.739  -5.625  -10.697 0.02 18.46 ?  181  ASN A HB3  1  
ATOM   2843   H HD21 . ASN A 1 188 ? 37.232  -2.310  -10.008 0.02 18.23 ?  181  ASN A HD21 1  
ATOM   2844   H HD22 . ASN A 1 188 ? 37.997  -1.942  -11.224 0.02 18.12 ?  181  ASN A HD22 1  
ATOM   2845   N N    . VAL A 1 189 ? 33.353  -4.094  -9.683  0.02 18.14 ?  182  VAL A N    1  
ATOM   2846   C CA   . VAL A 1 189 ? 32.127  -3.702  -10.373 0.02 17.91 ?  182  VAL A CA   1  
ATOM   2847   C C    . VAL A 1 189 ? 31.647  -2.401  -9.743  0.02 17.83 ?  182  VAL A C    1  
ATOM   2848   O O    . VAL A 1 189 ? 30.600  -2.389  -9.085  0.02 17.88 ?  182  VAL A O    1  
ATOM   2849   C CB   . VAL A 1 189 ? 31.049  -4.797  -10.293 0.02 17.99 ?  182  VAL A CB   1  
ATOM   2850   C CG1  . VAL A 1 189 ? 29.793  -4.387  -11.070 0.02 17.78 ?  182  VAL A CG1  1  
ATOM   2851   C CG2  . VAL A 1 189 ? 31.579  -6.117  -10.806 0.02 18.12 ?  182  VAL A CG2  1  
ATOM   2852   H H    . VAL A 1 189 ? 33.241  -4.227  -8.842  0.02 18.28 ?  182  VAL A H    1  
ATOM   2853   H HA   . VAL A 1 189 ? 32.326  -3.532  -11.307 0.02 17.77 ?  182  VAL A HA   1  
ATOM   2854   H HB   . VAL A 1 189 ? 30.785  -4.913  -9.367  0.02 18.13 ?  182  VAL A HB   1  
ATOM   2855   H HG11 . VAL A 1 189 ? 29.542  -5.111  -11.662 0.02 17.80 ?  182  VAL A HG11 1  
ATOM   2856   H HG12 . VAL A 1 189 ? 29.073  -4.213  -10.445 0.02 17.82 ?  182  VAL A HG12 1  
ATOM   2857   H HG13 . VAL A 1 189 ? 29.991  -3.588  -11.581 0.02 17.62 ?  182  VAL A HG13 1  
ATOM   2858   H HG21 . VAL A 1 189 ? 30.905  -6.799  -10.669 0.02 18.21 ?  182  VAL A HG21 1  
ATOM   2859   H HG22 . VAL A 1 189 ? 31.784  -6.036  -11.750 0.02 18.00 ?  182  VAL A HG22 1  
ATOM   2860   H HG23 . VAL A 1 189 ? 32.377  -6.347  -10.307 0.02 18.27 ?  182  VAL A HG23 1  
ATOM   2861   N N    . PRO A 1 190 ? 32.371  -1.291  -9.906  0.02 17.75 ?  183  PRO A N    1  
ATOM   2862   C CA   . PRO A 1 190 ? 31.945  -0.041  -9.267  0.02 17.72 ?  183  PRO A CA   1  
ATOM   2863   C C    . PRO A 1 190 ? 30.719  0.586   -9.886  0.02 17.50 ?  183  PRO A C    1  
ATOM   2864   O O    . PRO A 1 190 ? 30.064  1.402   -9.231  0.02 17.51 ?  183  PRO A O    1  
ATOM   2865   C CB   . PRO A 1 190 ? 33.168  0.865   -9.436  0.02 17.71 ?  183  PRO A CB   1  
ATOM   2866   C CG   . PRO A 1 190 ? 33.807  0.351   -10.706 0.02 17.61 ?  183  PRO A CG   1  
ATOM   2867   C CD   . PRO A 1 190 ? 33.675  -1.138  -10.584 0.02 17.73 ?  183  PRO A CD   1  
ATOM   2868   H HA   . PRO A 1 190 ? 31.785  -0.184  -8.320  0.02 17.87 ?  183  PRO A HA   1  
ATOM   2869   H HB2  . PRO A 1 190 ? 32.891  1.789   -9.525  0.02 17.63 ?  183  PRO A HB2  1  
ATOM   2870   H HB3  . PRO A 1 190 ? 33.761  0.754   -8.679  0.02 17.89 ?  183  PRO A HB3  1  
ATOM   2871   H HG2  . PRO A 1 190 ? 33.314  0.683   -11.472 0.02 17.44 ?  183  PRO A HG2  1  
ATOM   2872   H HG3  . PRO A 1 190 ? 34.738  0.615   -10.744 0.02 17.67 ?  183  PRO A HG3  1  
ATOM   2873   H HD2  . PRO A 1 190 ? 33.665  -1.560  -11.453 0.02 17.64 ?  183  PRO A HD2  1  
ATOM   2874   H HD3  . PRO A 1 190 ? 34.382  -1.491  -10.024 0.02 17.90 ?  183  PRO A HD3  1  
ATOM   2875   N N    . GLY A 1 191 ? 30.402  0.243   -11.123 0.02 17.34 ?  184  GLY A N    1  
ATOM   2876   C CA   . GLY A 1 191 ? 29.329  0.866   -11.864 0.02 17.15 ?  184  GLY A CA   1  
ATOM   2877   C C    . GLY A 1 191 ? 29.833  1.541   -13.123 0.02 16.98 ?  184  GLY A C    1  
ATOM   2878   O O    . GLY A 1 191 ? 31.031  1.629   -13.384 0.02 17.00 ?  184  GLY A O    1  
ATOM   2879   H H    . GLY A 1 191 ? 30.809  -0.372  -11.559 0.02 17.35 ?  184  GLY A H    1  
ATOM   2880   H HA2  . GLY A 1 191 ? 28.676  0.198   -12.120 0.02 17.15 ?  184  GLY A HA2  1  
ATOM   2881   H HA3  . GLY A 1 191 ? 28.892  1.530   -11.313 0.02 17.16 ?  184  GLY A HA3  1  
ATOM   2882   N N    . ASN A 1 192 ? 28.860  2.021   -13.905 0.02 16.83 ?  185  ASN A N    1  
ATOM   2883   C CA   . ASN A 1 192 ? 29.072  2.873   -15.078 0.02 16.68 ?  185  ASN A CA   1  
ATOM   2884   C C    . ASN A 1 192 ? 29.899  2.221   -16.177 0.02 16.65 ?  185  ASN A C    1  
ATOM   2885   O O    . ASN A 1 192 ? 30.541  2.930   -16.949 0.02 16.58 ?  185  ASN A O    1  
ATOM   2886   C CB   . ASN A 1 192 ? 29.720  4.199   -14.693 0.02 16.68 ?  185  ASN A CB   1  
ATOM   2887   C CG   . ASN A 1 192 ? 28.874  4.988   -13.734 0.02 16.72 ?  185  ASN A CG   1  
ATOM   2888   O OD1  . ASN A 1 192 ? 27.653  4.935   -13.780 0.02 16.68 ?  185  ASN A OD1  1  
ATOM   2889   N ND2  . ASN A 1 192 ? 29.524  5.709   -12.848 0.02 16.82 ?  185  ASN A ND2  1  
ATOM   2890   H H    . ASN A 1 192 ? 28.031  1.849   -13.768 0.02 16.83 ?  185  ASN A H    1  
ATOM   2891   H HA   . ASN A 1 192 ? 28.204  3.076   -15.459 0.02 16.61 ?  185  ASN A HA   1  
ATOM   2892   H HB2  . ASN A 1 192 ? 30.573  4.022   -14.276 0.02 16.77 ?  185  ASN A HB2  1  
ATOM   2893   H HB3  . ASN A 1 192 ? 29.842  4.736   -15.487 0.02 16.60 ?  185  ASN A HB3  1  
ATOM   2894   H HD21 . ASN A 1 192 ? 30.355  5.555   -12.695 0.02 16.89 ?  185  ASN A HD21 1  
ATOM   2895   H HD22 . ASN A 1 192 ? 29.114  6.328   -12.420 0.02 16.84 ?  185  ASN A HD22 1  
ATOM   2896   N N    . ALA A 1 193 ? 29.878  0.895   -16.283 0.02 16.72 ?  186  ALA A N    1  
ATOM   2897   C CA   . ALA A 1 193 ? 30.640  0.275   -17.351 0.02 16.72 ?  186  ALA A CA   1  
ATOM   2898   C C    . ALA A 1 193 ? 30.222  0.840   -18.702 0.02 16.57 ?  186  ALA A C    1  
ATOM   2899   O O    . ALA A 1 193 ? 31.065  1.059   -19.566 0.02 16.55 ?  186  ALA A O    1  
ATOM   2900   C CB   . ALA A 1 193 ? 30.466  -1.236  -17.305 0.02 16.83 ?  186  ALA A CB   1  
ATOM   2901   H H    . ALA A 1 193 ? 29.448  0.351   -15.783 0.02 16.78 ?  186  ALA A H    1  
ATOM   2902   H HA   . ALA A 1 193 ? 31.578  0.485   -17.227 0.02 16.76 ?  186  ALA A HA   1  
ATOM   2903   H HB1  . ALA A 1 193 ? 30.933  -1.632  -18.056 0.02 16.84 ?  186  ALA A HB1  1  
ATOM   2904   H HB2  . ALA A 1 193 ? 30.835  -1.571  -16.477 0.02 16.94 ?  186  ALA A HB2  1  
ATOM   2905   H HB3  . ALA A 1 193 ? 29.523  -1.446  -17.363 0.02 16.82 ?  186  ALA A HB3  1  
ATOM   2906   N N    . GLY A 1 194 ? 28.932  1.134   -18.876 0.02 16.50 ?  187  GLY A N    1  
ATOM   2907   C CA   . GLY A 1 194 ? 28.476  1.678   -20.151 0.02 16.39 ?  187  GLY A CA   1  
ATOM   2908   C C    . GLY A 1 194 ? 29.022  3.061   -20.476 0.02 16.32 ?  187  GLY A C    1  
ATOM   2909   O O    . GLY A 1 194 ? 29.156  3.419   -21.656 0.02 16.27 ?  187  GLY A O    1  
ATOM   2910   H H    . GLY A 1 194 ? 28.319  1.024   -18.292 0.02 16.52 ?  187  GLY A H    1  
ATOM   2911   H HA2  . GLY A 1 194 ? 28.724  1.065   -20.856 0.02 16.41 ?  187  GLY A HA2  1  
ATOM   2912   H HA3  . GLY A 1 194 ? 27.511  1.736   -20.145 0.02 16.37 ?  187  GLY A HA3  1  
ATOM   2913   N N    . LEU A 1 195 ? 29.281  3.884   -19.461 0.02 16.34 ?  188  LEU A N    1  
ATOM   2914   C CA   . LEU A 1 195 ? 29.902  5.185   -19.712 0.02 16.31 ?  188  LEU A CA   1  
ATOM   2915   C C    . LEU A 1 195 ? 31.388  5.011   -19.967 0.02 16.38 ?  188  LEU A C    1  
ATOM   2916   O O    . LEU A 1 195 ? 31.968  5.747   -20.760 0.02 16.38 ?  188  LEU A O    1  
ATOM   2917   C CB   . LEU A 1 195 ? 29.680  6.156   -18.541 0.02 16.34 ?  188  LEU A CB   1  
ATOM   2918   C CG   . LEU A 1 195 ? 28.225  6.607   -18.340 0.02 16.29 ?  188  LEU A CG   1  
ATOM   2919   C CD1  . LEU A 1 195 ? 28.045  7.262   -17.004 0.02 16.36 ?  188  LEU A CD1  1  
ATOM   2920   C CD2  . LEU A 1 195 ? 27.830  7.566   -19.430 0.02 16.22 ?  188  LEU A CD2  1  
ATOM   2921   H H    . LEU A 1 195 ? 29.128  3.710   -18.638 0.02 16.38 ?  188  LEU A H    1  
ATOM   2922   H HA   . LEU A 1 195 ? 29.508  5.588   -20.497 0.02 16.25 ?  188  LEU A HA   1  
ATOM   2923   H HB2  . LEU A 1 195 ? 29.976  5.726   -17.725 0.02 16.41 ?  188  LEU A HB2  1  
ATOM   2924   H HB3  . LEU A 1 195 ? 30.206  6.952   -18.694 0.02 16.36 ?  188  LEU A HB3  1  
ATOM   2925   H HG   . LEU A 1 195 ? 27.636  5.840   -18.385 0.02 16.27 ?  188  LEU A HG   1  
ATOM   2926   H HD11 . LEU A 1 195 ? 28.247  6.613   -16.312 0.02 16.42 ?  188  LEU A HD11 1  
ATOM   2927   H HD12 . LEU A 1 195 ? 28.641  8.021   -16.936 0.02 16.40 ?  188  LEU A HD12 1  
ATOM   2928   H HD13 . LEU A 1 195 ? 27.122  7.550   -16.927 0.02 16.34 ?  188  LEU A HD13 1  
ATOM   2929   H HD21 . LEU A 1 195 ? 26.888  7.773   -19.339 0.02 16.20 ?  188  LEU A HD21 1  
ATOM   2930   H HD22 . LEU A 1 195 ? 28.354  8.377   -19.338 0.02 16.25 ?  188  LEU A HD22 1  
ATOM   2931   H HD23 . LEU A 1 195 ? 27.998  7.161   -20.295 0.02 16.19 ?  188  LEU A HD23 1  
ATOM   2932   N N    . LYS A 1 196 ? 31.987  4.003   -19.338 0.02 16.48 ?  189  LYS A N    1  
ATOM   2933   C CA   . LYS A 1 196 ? 33.372  3.680   -19.615 0.02 16.58 ?  189  LYS A CA   1  
ATOM   2934   C C    . LYS A 1 196 ? 33.509  3.171   -21.039 0.02 16.55 ?  189  LYS A C    1  
ATOM   2935   O O    . LYS A 1 196 ? 34.532  3.418   -21.682 0.02 16.61 ?  189  LYS A O    1  
ATOM   2936   C CB   . LYS A 1 196 ? 33.876  2.692   -18.561 0.02 16.71 ?  189  LYS A CB   1  
ATOM   2937   C CG   . LYS A 1 196 ? 33.813  3.323   -17.200 0.02 16.77 ?  189  LYS A CG   1  
ATOM   2938   C CD   . LYS A 1 196 ? 34.140  2.371   -16.079 0.02 16.93 ?  189  LYS A CD   1  
ATOM   2939   C CE   . LYS A 1 196 ? 33.981  3.118   -14.789 0.02 17.00 ?  189  LYS A CE   1  
ATOM   2940   N NZ   . LYS A 1 196 ? 34.012  2.276   -13.556 0.02 17.17 ?  189  LYS A NZ   1  
ATOM   2941   H H    . LYS A 1 196 ? 31.610  3.491   -18.764 0.02 16.50 ?  189  LYS A H    1  
ATOM   2942   H HA   . LYS A 1 196 ? 33.899  4.489   -19.543 0.02 16.60 ?  189  LYS A HA   1  
ATOM   2943   H HB2  . LYS A 1 196 ? 33.299  1.915   -18.542 0.02 16.70 ?  189  LYS A HB2  1  
ATOM   2944   H HB3  . LYS A 1 196 ? 34.788  2.430   -18.749 0.02 16.79 ?  189  LYS A HB3  1  
ATOM   2945   H HG2  . LYS A 1 196 ? 34.439  4.059   -17.164 0.02 16.80 ?  189  LYS A HG2  1  
ATOM   2946   H HG3  . LYS A 1 196 ? 32.914  3.648   -17.051 0.02 16.70 ?  189  LYS A HG3  1  
ATOM   2947   H HD2  . LYS A 1 196 ? 33.530  1.620   -16.093 0.02 16.92 ?  189  LYS A HD2  1  
ATOM   2948   H HD3  . LYS A 1 196 ? 35.059  2.072   -16.157 0.02 17.02 ?  189  LYS A HD3  1  
ATOM   2949   H HE2  . LYS A 1 196 ? 34.701  3.762   -14.718 0.02 17.04 ?  189  LYS A HE2  1  
ATOM   2950   H HE3  . LYS A 1 196 ? 33.133  3.583   -14.798 0.02 16.91 ?  189  LYS A HE3  1  
ATOM   2951   H HZ1  . LYS A 1 196 ? 34.136  2.803   -12.853 0.02 17.22 ?  189  LYS A HZ1  1  
ATOM   2952   H HZ2  . LYS A 1 196 ? 33.244  1.846   -13.462 0.02 17.15 ?  189  LYS A HZ2  1  
ATOM   2953   H HZ3  . LYS A 1 196 ? 34.679  1.675   -13.599 0.02 17.27 ?  189  LYS A HZ3  1  
ATOM   2954   N N    . ASP A 1 197 ? 32.472  2.506   -21.552 0.02 16.48 ?  190  ASP A N    1  
ATOM   2955   C CA   . ASP A 1 197 ? 32.427  2.144   -22.965 0.02 16.47 ?  190  ASP A CA   1  
ATOM   2956   C C    . ASP A 1 197 ? 32.500  3.395   -23.826 0.02 16.41 ?  190  ASP A C    1  
ATOM   2957   O O    . ASP A 1 197 ? 33.291  3.473   -24.783 0.02 16.47 ?  190  ASP A O    1  
ATOM   2958   C CB   . ASP A 1 197 ? 31.122  1.373   -23.263 0.02 16.43 ?  190  ASP A CB   1  
ATOM   2959   C CG   . ASP A 1 197 ? 31.068  -0.034  -22.631 0.02 16.53 ?  190  ASP A CG   1  
ATOM   2960   O OD1  . ASP A 1 197 ? 32.122  -0.583  -22.240 0.02 16.64 ?  190  ASP A OD1  1  
ATOM   2961   O OD2  . ASP A 1 197 ? 29.955  -0.593  -22.542 0.02 16.53 -1 190  ASP A OD2  1  
ATOM   2962   H H    . ASP A 1 197 ? 31.782  2.258   -21.112 0.02 16.46 ?  190  ASP A H    1  
ATOM   2963   H HA   . ASP A 1 197 ? 33.180  1.574   -23.176 0.02 16.55 ?  190  ASP A HA   1  
ATOM   2964   H HB2  . ASP A 1 197 ? 30.380  1.881   -22.910 0.02 16.37 ?  190  ASP A HB2  1  
ATOM   2965   H HB3  . ASP A 1 197 ? 31.015  1.277   -24.221 0.02 16.43 ?  190  ASP A HB3  1  
ATOM   2966   N N    . GLN A 1 198 ? 31.654  4.381   -23.514 0.02 16.33 ?  191  GLN A N    1  
ATOM   2967   C CA   . GLN A 1 198 ? 31.651  5.624   -24.265 0.02 16.30 ?  191  GLN A CA   1  
ATOM   2968   C C    . GLN A 1 198 ? 33.018  6.291   -24.219 0.02 16.39 ?  191  GLN A C    1  
ATOM   2969   O O    . GLN A 1 198 ? 33.494  6.808   -25.226 0.02 16.44 ?  191  GLN A O    1  
ATOM   2970   C CB   . GLN A 1 198 ? 30.580  6.562   -23.719 0.02 16.23 ?  191  GLN A CB   1  
ATOM   2971   C CG   . GLN A 1 198 ? 29.197  5.965   -23.767 0.02 16.17 ?  191  GLN A CG   1  
ATOM   2972   C CD   . GLN A 1 198 ? 28.144  6.891   -23.193 0.02 16.13 ?  191  GLN A CD   1  
ATOM   2973   O OE1  . GLN A 1 198 ? 28.428  8.036   -22.841 0.02 16.15 ?  191  GLN A OE1  1  
ATOM   2974   N NE2  . GLN A 1 198 ? 26.912  6.396   -23.115 0.02 16.11 ?  191  GLN A NE2  1  
ATOM   2975   H H    . GLN A 1 198 ? 31.081  4.351   -22.880 0.02 16.30 ?  191  GLN A H    1  
ATOM   2976   H HA   . GLN A 1 198 ? 31.436  5.433   -25.189 0.02 16.30 ?  191  GLN A HA   1  
ATOM   2977   H HB2  . GLN A 1 198 ? 30.786  6.776   -22.798 0.02 16.25 ?  191  GLN A HB2  1  
ATOM   2978   H HB3  . GLN A 1 198 ? 30.577  7.372   -24.246 0.02 16.23 ?  191  GLN A HB3  1  
ATOM   2979   H HG2  . GLN A 1 198 ? 28.955  5.804   -24.691 0.02 16.17 ?  191  GLN A HG2  1  
ATOM   2980   H HG3  . GLN A 1 198 ? 29.176  5.132   -23.278 0.02 16.19 ?  191  GLN A HG3  1  
ATOM   2981   H HE21 . GLN A 1 198 ? 26.718  5.654   -23.500 0.02 16.12 ?  191  GLN A HE21 1  
ATOM   2982   H HE22 . GLN A 1 198 ? 26.313  6.814   -22.672 0.02 16.10 ?  191  GLN A HE22 1  
ATOM   2983   N N    . VAL A 1 199 ? 33.654  6.306   -23.051 0.02 16.45 ?  192  VAL A N    1  
ATOM   2984   C CA   . VAL A 1 199 ? 35.005  6.854   -22.944 0.02 16.58 ?  192  VAL A CA   1  
ATOM   2985   C C    . VAL A 1 199 ? 35.963  6.135   -23.891 0.02 16.67 ?  192  VAL A C    1  
ATOM   2986   O O    . VAL A 1 199 ? 36.758  6.774   -24.588 0.02 16.76 ?  192  VAL A O    1  
ATOM   2987   C CB   . VAL A 1 199 ? 35.510  6.780   -21.493 0.02 16.66 ?  192  VAL A CB   1  
ATOM   2988   C CG1  . VAL A 1 199 ? 36.970  7.110   -21.462 0.02 16.84 ?  192  VAL A CG1  1  
ATOM   2989   C CG2  . VAL A 1 199 ? 34.781  7.775   -20.623 0.02 16.63 ?  192  VAL A CG2  1  
ATOM   2990   H H    . VAL A 1 199 ? 33.330  6.009   -22.316 0.02 16.44 ?  192  VAL A H    1  
ATOM   2991   H HA   . VAL A 1 199 ? 34.992  7.788   -23.198 0.02 16.59 ?  192  VAL A HA   1  
ATOM   2992   H HB   . VAL A 1 199 ? 35.382  5.886   -21.146 0.02 16.66 ?  192  VAL A HB   1  
ATOM   2993   H HG11 . VAL A 1 199 ? 37.221  7.326   -20.551 0.02 16.90 ?  192  VAL A HG11 1  
ATOM   2994   H HG12 . VAL A 1 199 ? 37.484  6.346   -21.770 0.02 16.89 ?  192  VAL A HG12 1  
ATOM   2995   H HG13 . VAL A 1 199 ? 37.129  7.877   -22.033 0.02 16.85 ?  192  VAL A HG13 1  
ATOM   2996   H HG21 . VAL A 1 199 ? 35.097  7.693   -19.712 0.02 16.70 ?  192  VAL A HG21 1  
ATOM   2997   H HG22 . VAL A 1 199 ? 34.956  8.670   -20.949 0.02 16.65 ?  192  VAL A HG22 1  
ATOM   2998   H HG23 . VAL A 1 199 ? 33.831  7.584   -20.659 0.02 16.53 ?  192  VAL A HG23 1  
ATOM   2999   N N    . MET A 1 200 ? 35.955  4.804   -23.895 0.02 16.68 ?  193  MET A N    1  
ATOM   3000   C CA   . MET A 1 200 ? 36.880  4.109   -24.779 0.02 16.79 ?  193  MET A CA   1  
ATOM   3001   C C    . MET A 1 200 ? 36.562  4.433   -26.232 0.02 16.77 ?  193  MET A C    1  
ATOM   3002   O O    . MET A 1 200 ? 37.473  4.596   -27.053 0.02 16.89 ?  193  MET A O    1  
ATOM   3003   C CB   . MET A 1 200 ? 36.846  2.606   -24.516 0.02 16.83 ?  193  MET A CB   1  
ATOM   3004   C CG   . MET A 1 200 ? 37.946  1.819   -25.247 0.02 16.99 ?  193  MET A CG   1  
ATOM   3005   S SD   . MET A 1 200 ? 38.171  0.112   -24.655 0.02 17.11 ?  193  MET A SD   1  
ATOM   3006   C CE   . MET A 1 200 ? 38.940  0.365   -23.104 0.02 17.20 ?  193  MET A CE   1  
ATOM   3007   H H    . MET A 1 200 ? 35.453  4.296   -23.420 0.02 16.64 ?  193  MET A H    1  
ATOM   3008   H HA   . MET A 1 200 ? 37.778  4.419   -24.588 0.02 16.90 ?  193  MET A HA   1  
ATOM   3009   H HB2  . MET A 1 200 ? 36.970  2.457   -23.566 0.02 16.85 ?  193  MET A HB2  1  
ATOM   3010   H HB3  . MET A 1 200 ? 35.989  2.250   -24.800 0.02 16.75 ?  193  MET A HB3  1  
ATOM   3011   H HG2  . MET A 1 200 ? 37.732  1.782   -26.192 0.02 16.98 ?  193  MET A HG2  1  
ATOM   3012   H HG3  . MET A 1 200 ? 38.789  2.282   -25.121 0.02 17.08 ?  193  MET A HG3  1  
ATOM   3013   H HE1  . MET A 1 200 ? 39.038  -0.496  -22.666 0.02 17.27 ?  193  MET A HE1  1  
ATOM   3014   H HE2  . MET A 1 200 ? 39.814  0.764   -23.254 0.02 17.30 ?  193  MET A HE2  1  
ATOM   3015   H HE3  . MET A 1 200 ? 38.389  0.957   -22.571 0.02 17.11 ?  193  MET A HE3  1  
ATOM   3016   N N    . ALA A 1 201 ? 35.281  4.597   -26.552 0.02 16.64 ?  194  ALA A N    1  
ATOM   3017   C CA   . ALA A 1 201 ? 34.901  4.934   -27.925 0.02 16.64 ?  194  ALA A CA   1  
ATOM   3018   C C    . ALA A 1 201 ? 35.407  6.322   -28.310 0.02 16.69 ?  194  ALA A C    1  
ATOM   3019   O O    . ALA A 1 201 ? 35.896  6.524   -29.426 0.02 16.80 ?  194  ALA A O    1  
ATOM   3020   C CB   . ALA A 1 201 ? 33.376  4.852   -28.094 0.02 16.52 ?  194  ALA A CB   1  
ATOM   3021   H H    . ALA A 1 201 ? 34.626  4.519   -26.009 0.02 16.57 ?  194  ALA A H    1  
ATOM   3022   H HA   . ALA A 1 201 ? 35.293  4.277   -28.520 0.02 16.71 ?  194  ALA A HA   1  
ATOM   3023   H HB1  . ALA A 1 201 ? 33.143  5.071   -29.007 0.02 16.54 ?  194  ALA A HB1  1  
ATOM   3024   H HB2  . ALA A 1 201 ? 33.078  3.956   -27.885 0.02 16.51 ?  194  ALA A HB2  1  
ATOM   3025   H HB3  . ALA A 1 201 ? 32.961  5.486   -27.489 0.02 16.45 ?  194  ALA A HB3  1  
ATOM   3026   N N    . LEU A 1 202 ? 35.258  7.302   -27.428 0.02 16.65 ?  195  LEU A N    1  
ATOM   3027   C CA   . LEU A 1 202 ? 35.738  8.641   -27.741 0.02 16.74 ?  195  LEU A CA   1  
ATOM   3028   C C    . LEU A 1 202 ? 37.249  8.670   -27.899 0.02 16.93 ?  195  LEU A C    1  
ATOM   3029   O O    . LEU A 1 202 ? 37.775  9.450   -28.701 0.02 17.06 ?  195  LEU A O    1  
ATOM   3030   C CB   . LEU A 1 202 ? 35.327  9.638   -26.665 0.02 16.70 ?  195  LEU A CB   1  
ATOM   3031   C CG   . LEU A 1 202 ? 33.823  9.900   -26.548 0.02 16.55 ?  195  LEU A CG   1  
ATOM   3032   C CD1  . LEU A 1 202 ? 33.605  10.976  -25.475 0.02 16.56 ?  195  LEU A CD1  1  
ATOM   3033   C CD2  . LEU A 1 202 ? 33.184  10.326  -27.845 0.02 16.56 ?  195  LEU A CD2  1  
ATOM   3034   H H    . LEU A 1 202 ? 34.880  7.224   -26.661 0.02 16.59 ?  195  LEU A H    1  
ATOM   3035   H HA   . LEU A 1 202 ? 35.346  8.923   -28.580 0.02 16.74 ?  195  LEU A HA   1  
ATOM   3036   H HB2  . LEU A 1 202 ? 35.645  9.317   -25.809 0.02 16.70 ?  195  LEU A HB2  1  
ATOM   3037   H HB3  . LEU A 1 202 ? 35.750  10.484  -26.867 0.02 16.78 ?  195  LEU A HB3  1  
ATOM   3038   H HG   . LEU A 1 202 ? 33.387  9.092   -26.249 0.02 16.48 ?  195  LEU A HG   1  
ATOM   3039   H HD11 . LEU A 1 202 ? 32.662  11.191  -25.417 0.02 16.49 ?  195  LEU A HD11 1  
ATOM   3040   H HD12 . LEU A 1 202 ? 33.922  10.636  -24.626 0.02 16.57 ?  195  LEU A HD12 1  
ATOM   3041   H HD13 . LEU A 1 202 ? 34.105  11.770  -25.717 0.02 16.66 ?  195  LEU A HD13 1  
ATOM   3042   H HD21 . LEU A 1 202 ? 32.247  10.517  -27.685 0.02 16.48 ?  195  LEU A HD21 1  
ATOM   3043   H HD22 . LEU A 1 202 ? 33.630  11.125  -28.157 0.02 16.65 ?  195  LEU A HD22 1  
ATOM   3044   H HD23 . LEU A 1 202 ? 33.272  9.617   -28.501 0.02 16.56 ?  195  LEU A HD23 1  
ATOM   3045   N N    . ARG A 1 203 ? 37.969  7.853   -27.122 0.02 16.97 ?  196  ARG A N    1  
ATOM   3046   C CA   . ARG A 1 203 ? 39.417  7.778   -27.282 0.02 17.18 ?  196  ARG A CA   1  
ATOM   3047   C C    . ARG A 1 203 ? 39.774  7.158   -28.628 0.02 17.27 ?  196  ARG A C    1  
ATOM   3048   O O    . ARG A 1 203 ? 40.709  7.614   -29.308 0.02 17.45 ?  196  ARG A O    1  
ATOM   3049   C CB   . ARG A 1 203 ? 40.038  6.985   -26.124 0.02 17.23 ?  196  ARG A CB   1  
ATOM   3050   C CG   . ARG A 1 203 ? 39.930  7.681   -24.770 0.02 17.21 ?  196  ARG A CG   1  
ATOM   3051   C CD   . ARG A 1 203 ? 40.422  6.809   -23.605 0.02 17.28 ?  196  ARG A CD   1  
ATOM   3052   N NE   . ARG A 1 203 ? 40.553  7.645   -22.412 0.02 17.34 ?  196  ARG A NE   1  
ATOM   3053   C CZ   . ARG A 1 203 ? 40.521  7.213   -21.155 0.02 17.36 ?  196  ARG A CZ   1  
ATOM   3054   N NH1  . ARG A 1 203 ? 40.379  5.930   -20.862 0.02 17.33 ?  196  ARG A NH1  1  
ATOM   3055   N NH2  . ARG A 1 203 ? 40.631  8.102   -20.189 0.02 17.44 ?  196  ARG A NH2  1  
ATOM   3056   H H    . ARG A 1 203 ? 37.650  7.340   -26.514 0.02 16.90 ?  196  ARG A H    1  
ATOM   3057   H HA   . ARG A 1 203 ? 39.782  8.675   -27.254 0.02 17.26 ?  196  ARG A HA   1  
ATOM   3058   H HB2  . ARG A 1 203 ? 39.589  6.131   -26.057 0.02 17.15 ?  196  ARG A HB2  1  
ATOM   3059   H HB3  . ARG A 1 203 ? 40.977  6.840   -26.310 0.02 17.38 ?  196  ARG A HB3  1  
ATOM   3060   H HG2  . ARG A 1 203 ? 40.473  8.484   -24.778 0.02 17.32 ?  196  ARG A HG2  1  
ATOM   3061   H HG3  . ARG A 1 203 ? 39.004  7.912   -24.598 0.02 17.08 ?  196  ARG A HG3  1  
ATOM   3062   H HD2  . ARG A 1 203 ? 39.779  6.109   -23.426 0.02 17.17 ?  196  ARG A HD2  1  
ATOM   3063   H HD3  . ARG A 1 203 ? 41.288  6.430   -23.823 0.02 17.41 ?  196  ARG A HD3  1  
ATOM   3064   H HE   . ARG A 1 203 ? 40.752  8.471   -22.535 0.02 17.39 ?  196  ARG A HE   1  
ATOM   3065   H HH11 . ARG A 1 203 ? 40.301  5.350   -21.491 0.02 17.29 ?  196  ARG A HH11 1  
ATOM   3066   H HH12 . ARG A 1 203 ? 40.364  5.674   -20.043 0.02 17.36 ?  196  ARG A HH12 1  
ATOM   3067   H HH21 . ARG A 1 203 ? 40.729  8.934   -20.384 0.02 17.48 ?  196  ARG A HH21 1  
ATOM   3068   H HH22 . ARG A 1 203 ? 40.626  7.850   -19.365 0.02 17.47 ?  196  ARG A HH22 1  
ATOM   3069   N N    . TRP A 1 204 ? 39.035  6.129   -29.036 0.02 17.16 ?  197  TRP A N    1  
ATOM   3070   C CA   . TRP A 1 204 ? 39.239  5.562   -30.366 0.02 17.26 ?  197  TRP A CA   1  
ATOM   3071   C C    . TRP A 1 204 ? 39.015  6.621   -31.435 0.02 17.30 ?  197  TRP A C    1  
ATOM   3072   O O    . TRP A 1 204 ? 39.780  6.711   -32.404 0.02 17.49 ?  197  TRP A O    1  
ATOM   3073   C CB   . TRP A 1 204 ? 38.299  4.364   -30.576 0.02 17.15 ?  197  TRP A CB   1  
ATOM   3074   C CG   . TRP A 1 204 ? 38.538  3.614   -31.898 0.02 17.29 ?  197  TRP A CG   1  
ATOM   3075   C CD1  . TRP A 1 204 ? 39.251  2.453   -32.074 0.02 17.42 ?  197  TRP A CD1  1  
ATOM   3076   C CD2  . TRP A 1 204 ? 38.101  4.009   -33.205 0.02 17.33 ?  197  TRP A CD2  1  
ATOM   3077   N NE1  . TRP A 1 204 ? 39.273  2.106   -33.412 0.02 17.55 ?  197  TRP A NE1  1  
ATOM   3078   C CE2  . TRP A 1 204 ? 38.579  3.041   -34.116 0.02 17.50 ?  197  TRP A CE2  1  
ATOM   3079   C CE3  . TRP A 1 204 ? 37.357  5.087   -33.699 0.02 17.27 ?  197  TRP A CE3  1  
ATOM   3080   C CZ2  . TRP A 1 204 ? 38.327  3.116   -35.477 0.02 17.60 ?  197  TRP A CZ2  1  
ATOM   3081   C CZ3  . TRP A 1 204 ? 37.099  5.146   -35.036 0.02 17.38 ?  197  TRP A CZ3  1  
ATOM   3082   C CH2  . TRP A 1 204 ? 37.598  4.175   -35.919 0.02 17.55 ?  197  TRP A CH2  1  
ATOM   3083   H H    . TRP A 1 204 ? 38.424  5.744   -28.580 0.02 17.06 ?  197  TRP A H    1  
ATOM   3084   H HA   . TRP A 1 204 ? 40.149  5.242   -30.438 0.02 17.40 ?  197  TRP A HA   1  
ATOM   3085   H HB2  . TRP A 1 204 ? 38.425  3.738   -29.849 0.02 17.14 ?  197  TRP A HB2  1  
ATOM   3086   H HB3  . TRP A 1 204 ? 37.386  4.684   -30.579 0.02 17.04 ?  197  TRP A HB3  1  
ATOM   3087   H HD1  . TRP A 1 204 ? 39.668  1.972   -31.398 0.02 17.45 ?  197  TRP A HD1  1  
ATOM   3088   H HE1  . TRP A 1 204 ? 39.658  1.414   -33.743 0.02 17.66 ?  197  TRP A HE1  1  
ATOM   3089   H HE3  . TRP A 1 204 ? 37.027  5.741   -33.130 0.02 17.18 ?  197  TRP A HE3  1  
ATOM   3090   H HZ2  . TRP A 1 204 ? 38.647  2.463   -36.055 0.02 17.73 ?  197  TRP A HZ2  1  
ATOM   3091   H HZ3  . TRP A 1 204 ? 36.611  5.859   -35.372 0.02 17.36 ?  197  TRP A HZ3  1  
ATOM   3092   H HH2  . TRP A 1 204 ? 37.407  4.248   -36.826 0.02 17.63 ?  197  TRP A HH2  1  
ATOM   3093   N N    . ILE A 1 205 ? 37.961  7.423   -31.281 0.02 17.16 ?  198  ILE A N    1  
ATOM   3094   C CA   . ILE A 1 205 ? 37.615  8.411   -32.294 0.02 17.22 ?  198  ILE A CA   1  
ATOM   3095   C C    . ILE A 1 205 ? 38.708  9.454   -32.387 0.02 17.41 ?  198  ILE A C    1  
ATOM   3096   O O    . ILE A 1 205 ? 39.199  9.777   -33.470 0.02 17.58 ?  198  ILE A O    1  
ATOM   3097   C CB   . ILE A 1 205 ? 36.248  9.038   -31.966 0.02 17.05 ?  198  ILE A CB   1  
ATOM   3098   C CG1  . ILE A 1 205 ? 35.170  7.983   -32.190 0.02 16.92 ?  198  ILE A CG1  1  
ATOM   3099   C CG2  . ILE A 1 205 ? 36.003  10.269  -32.808 0.02 17.14 ?  198  ILE A CG2  1  
ATOM   3100   C CD1  . ILE A 1 205 ? 33.779  8.406   -31.701 0.02 16.76 ?  198  ILE A CD1  1  
ATOM   3101   H H    . ILE A 1 205 ? 37.436  7.419   -30.605 0.02 17.05 ?  198  ILE A H    1  
ATOM   3102   H HA   . ILE A 1 205 ? 37.533  7.976   -33.156 0.02 17.27 ?  198  ILE A HA   1  
ATOM   3103   H HB   . ILE A 1 205 ? 36.239  9.297   -31.034 0.02 16.99 ?  198  ILE A HB   1  
ATOM   3104   H HG12 . ILE A 1 205 ? 35.106  7.798   -33.141 0.02 16.99 ?  198  ILE A HG12 1  
ATOM   3105   H HG13 . ILE A 1 205 ? 35.420  7.176   -31.716 0.02 16.90 ?  198  ILE A HG13 1  
ATOM   3106   H HG21 . ILE A 1 205 ? 35.055  10.467  -32.811 0.02 17.05 ?  198  ILE A HG21 1  
ATOM   3107   H HG22 . ILE A 1 205 ? 36.487  11.019  -32.436 0.02 17.19 ?  198  ILE A HG22 1  
ATOM   3108   H HG23 . ILE A 1 205 ? 36.302  10.092  -33.713 0.02 17.26 ?  198  ILE A HG23 1  
ATOM   3109   H HD11 . ILE A 1 205 ? 33.410  9.059   -32.315 0.02 16.80 ?  198  ILE A HD11 1  
ATOM   3110   H HD12 . ILE A 1 205 ? 33.207  7.625   -31.675 0.02 16.70 ?  198  ILE A HD12 1  
ATOM   3111   H HD13 . ILE A 1 205 ? 33.861  8.795   -30.817 0.02 16.72 ?  198  ILE A HD13 1  
ATOM   3112   N N    . LYS A 1 206 ? 39.135  9.962   -31.237 0.02 17.40 ?  199  LYS A N    1  
ATOM   3113   C CA   . LYS A 1 206 ? 40.225  10.921  -31.195 0.02 17.62 ?  199  LYS A CA   1  
ATOM   3114   C C    . LYS A 1 206 ? 41.476  10.367  -31.875 0.02 17.84 ?  199  LYS A C    1  
ATOM   3115   O O    . LYS A 1 206 ? 42.190  11.095  -32.579 0.02 18.06 ?  199  LYS A O    1  
ATOM   3116   C CB   . LYS A 1 206 ? 40.492  11.266  -29.728 0.02 17.60 ?  199  LYS A CB   1  
ATOM   3117   C CG   . LYS A 1 206 ? 41.683  12.103  -29.445 0.02 17.85 ?  199  LYS A CG   1  
ATOM   3118   C CD   . LYS A 1 206 ? 41.463  13.537  -29.889 0.02 17.93 ?  199  LYS A CD   1  
ATOM   3119   C CE   . LYS A 1 206 ? 41.653  14.479  -28.743 0.02 17.98 ?  199  LYS A CE   1  
ATOM   3120   N NZ   . LYS A 1 206 ? 42.287  15.751  -29.081 0.02 18.21 ?  199  LYS A NZ   1  
ATOM   3121   H H    . LYS A 1 206 ? 38.804  9.769   -30.469 0.02 17.29 ?  199  LYS A H    1  
ATOM   3122   H HA   . LYS A 1 206 ? 39.960  11.728  -31.658 0.02 17.67 ?  199  LYS A HA   1  
ATOM   3123   H HB2  . LYS A 1 206 ? 39.720  11.733  -29.376 0.02 17.49 ?  199  LYS A HB2  1  
ATOM   3124   H HB3  . LYS A 1 206 ? 40.615  10.436  -29.243 0.02 17.56 ?  199  LYS A HB3  1  
ATOM   3125   H HG2  . LYS A 1 206 ? 41.846  12.085  -28.492 0.02 17.85 ?  199  LYS A HG2  1  
ATOM   3126   H HG3  . LYS A 1 206 ? 42.454  11.756  -29.921 0.02 18.00 ?  199  LYS A HG3  1  
ATOM   3127   H HD2  . LYS A 1 206 ? 42.111  13.756  -30.576 0.02 18.12 ?  199  LYS A HD2  1  
ATOM   3128   H HD3  . LYS A 1 206 ? 40.565  13.643  -30.230 0.02 17.80 ?  199  LYS A HD3  1  
ATOM   3129   H HE2  . LYS A 1 206 ? 40.779  14.689  -28.385 0.02 17.81 ?  199  LYS A HE2  1  
ATOM   3130   H HE3  . LYS A 1 206 ? 42.194  14.059  -28.061 0.02 18.05 ?  199  LYS A HE3  1  
ATOM   3131   H HZ1  . LYS A 1 206 ? 41.689  16.303  -29.438 0.02 18.14 ?  199  LYS A HZ1  1  
ATOM   3132   H HZ2  . LYS A 1 206 ? 42.621  16.125  -28.345 0.02 18.31 ?  199  LYS A HZ2  1  
ATOM   3133   H HZ3  . LYS A 1 206 ? 42.948  15.620  -29.664 0.02 18.34 ?  199  LYS A HZ3  1  
ATOM   3134   N N    . ASN A 1 207 ? 41.720  9.067   -31.723 0.02 17.81 ?  200  ASN A N    1  
ATOM   3135   C CA   . ASN A 1 207 ? 42.947  8.454   -32.211 0.02 18.04 ?  200  ASN A CA   1  
ATOM   3136   C C    . ASN A 1 207 ? 42.869  8.079   -33.682 0.02 18.13 ?  200  ASN A C    1  
ATOM   3137   O O    . ASN A 1 207 ? 43.906  7.989   -34.343 0.02 18.39 ?  200  ASN A O    1  
ATOM   3138   C CB   . ASN A 1 207 ? 43.255  7.211   -31.373 0.02 18.00 ?  200  ASN A CB   1  
ATOM   3139   C CG   . ASN A 1 207 ? 44.459  6.451   -31.877 0.02 18.26 ?  200  ASN A CG   1  
ATOM   3140   O OD1  . ASN A 1 207 ? 44.371  5.679   -32.823 0.02 18.31 ?  200  ASN A OD1  1  
ATOM   3141   N ND2  . ASN A 1 207 ? 45.600  6.682   -31.247 0.02 18.46 ?  200  ASN A ND2  1  
ATOM   3142   H H    . ASN A 1 207 ? 41.191  8.515   -31.335 0.02 17.67 ?  200  ASN A H    1  
ATOM   3143   H HA   . ASN A 1 207 ? 43.678  9.078   -32.096 0.02 18.19 ?  200  ASN A HA   1  
ATOM   3144   H HB2  . ASN A 1 207 ? 43.437  7.488   -30.461 0.02 17.96 ?  200  ASN A HB2  1  
ATOM   3145   H HB3  . ASN A 1 207 ? 42.488  6.621   -31.395 0.02 17.86 ?  200  ASN A HB3  1  
ATOM   3146   H HD21 . ASN A 1 207 ? 45.606  6.779   -30.394 0.02 18.42 ?  200  ASN A HD21 1  
ATOM   3147   H HD22 . ASN A 1 207 ? 46.333  6.734   -31.694 0.02 18.65 ?  200  ASN A HD22 1  
ATOM   3148   N N    . ASN A 1 208 ? 41.667  7.859   -34.216 0.02 17.96 ?  201  ASN A N    1  
ATOM   3149   C CA   . ASN A 1 208 ? 41.531  7.243   -35.530 0.02 18.07 ?  201  ASN A CA   1  
ATOM   3150   C C    . ASN A 1 208 ? 40.737  8.056   -36.552 0.02 18.08 ?  201  ASN A C    1  
ATOM   3151   O O    . ASN A 1 208 ? 40.794  7.726   -37.743 0.02 18.23 ?  201  ASN A O    1  
ATOM   3152   C CB   . ASN A 1 208 ? 40.897  5.848   -35.384 0.02 17.93 ?  201  ASN A CB   1  
ATOM   3153   C CG   . ASN A 1 208 ? 41.809  4.872   -34.689 0.02 18.00 ?  201  ASN A CG   1  
ATOM   3154   O OD1  . ASN A 1 208 ? 42.744  4.347   -35.283 0.02 18.22 ?  201  ASN A OD1  1  
ATOM   3155   N ND2  . ASN A 1 208 ? 41.560  4.637   -33.413 0.02 17.84 ?  201  ASN A ND2  1  
ATOM   3156   H H    . ASN A 1 208 ? 40.923  8.051   -33.837 0.02 17.81 ?  201  ASN A H    1  
ATOM   3157   H HA   . ASN A 1 208 ? 42.415  7.111   -35.900 0.02 18.26 ?  201  ASN A HA   1  
ATOM   3158   H HB2  . ASN A 1 208 ? 40.094  5.933   -34.850 0.02 17.75 ?  201  ASN A HB2  1  
ATOM   3159   H HB3  . ASN A 1 208 ? 40.676  5.493   -36.258 0.02 18.00 ?  201  ASN A HB3  1  
ATOM   3160   H HD21 . ASN A 1 208 ? 42.052  4.089   -32.972 0.02 17.88 ?  201  ASN A HD21 1  
ATOM   3161   H HD22 . ASN A 1 208 ? 40.901  5.033   -33.030 0.02 17.70 ?  201  ASN A HD22 1  
ATOM   3162   N N    . CYS A 1 209 ? 40.027  9.113   -36.151 0.02 17.97 ?  202  CYS A N    1  
ATOM   3163   C CA   . CYS A 1 209 ? 39.177  9.802   -37.112 0.02 18.00 ?  202  CYS A CA   1  
ATOM   3164   C C    . CYS A 1 209 ? 39.985  10.413  -38.251 0.02 18.30 ?  202  CYS A C    1  
ATOM   3165   O O    . CYS A 1 209 ? 39.429  10.642  -39.318 0.02 18.38 ?  202  CYS A O    1  
ATOM   3166   C CB   . CYS A 1 209 ? 38.312  10.880  -36.436 0.02 17.86 ?  202  CYS A CB   1  
ATOM   3167   S SG   . CYS A 1 209 ? 39.222  12.158  -35.592 0.02 18.01 ?  202  CYS A SG   1  
ATOM   3168   H H    . CYS A 1 209 ? 40.027  9.446   -35.360 0.02 17.91 ?  202  CYS A H    1  
ATOM   3169   H HA   . CYS A 1 209 ? 38.577  9.149   -37.498 0.02 17.92 ?  202  CYS A HA   1  
ATOM   3170   H HB2  . CYS A 1 209 ? 37.776  11.318  -37.113 0.02 17.88 ?  202  CYS A HB2  1  
ATOM   3171   H HB3  . CYS A 1 209 ? 37.727  10.455  -35.792 0.02 17.68 ?  202  CYS A HB3  1  
ATOM   3172   H HG   . CYS A 1 209 ? 40.203  11.636  -35.140 0.02 18.08 ?  202  CYS A HG   1  
ATOM   3173   N N    . ALA A 1 210 ? 41.282  10.646  -38.062 0.02 18.50 ?  203  ALA A N    1  
ATOM   3174   C CA   . ALA A 1 210 ? 42.105  11.150  -39.158 0.02 18.83 ?  203  ALA A CA   1  
ATOM   3175   C C    . ALA A 1 210 ? 42.152  10.186  -40.333 0.02 18.96 ?  203  ALA A C    1  
ATOM   3176   O O    . ALA A 1 210 ? 42.318  10.623  -41.480 0.02 19.20 ?  203  ALA A O    1  
ATOM   3177   C CB   . ALA A 1 210 ? 43.522  11.418  -38.661 0.02 19.05 ?  203  ALA A CB   1  
ATOM   3178   H H    . ALA A 1 210 ? 41.705  10.518  -37.327 0.02 18.47 ?  203  ALA A H    1  
ATOM   3179   H HA   . ALA A 1 210 ? 41.727  11.983  -39.476 0.02 18.88 ?  203  ALA A HA   1  
ATOM   3180   H HB1  . ALA A 1 210 ? 44.077  11.652  -39.420 0.02 19.28 ?  203  ALA A HB1  1  
ATOM   3181   H HB2  . ALA A 1 210 ? 43.508  12.144  -38.021 0.02 19.01 ?  203  ALA A HB2  1  
ATOM   3182   H HB3  . ALA A 1 210 ? 43.863  10.613  -38.244 0.02 19.00 ?  203  ALA A HB3  1  
ATOM   3183   N N    . ASN A 1 211 ? 42.069  8.888   -40.083 0.02 18.84 ?  204  ASN A N    1  
ATOM   3184   C CA   . ASN A 1 211 ? 42.131  7.921   -41.168 0.02 18.98 ?  204  ASN A CA   1  
ATOM   3185   C C    . ASN A 1 211 ? 40.873  7.922   -42.019 0.02 18.94 ?  204  ASN A C    1  
ATOM   3186   O O    . ASN A 1 211 ? 40.840  7.254   -43.063 0.02 19.12 ?  204  ASN A O    1  
ATOM   3187   C CB   . ASN A 1 211 ? 42.395  6.510   -40.645 0.02 18.89 ?  204  ASN A CB   1  
ATOM   3188   C CG   . ASN A 1 211 ? 43.854  6.123   -40.787 0.02 19.14 ?  204  ASN A CG   1  
ATOM   3189   O OD1  . ASN A 1 211 ? 44.665  6.409   -39.917 0.02 19.14 ?  204  ASN A OD1  1  
ATOM   3190   N ND2  . ASN A 1 211 ? 44.196  5.523   -41.915 0.02 19.38 ?  204  ASN A ND2  1  
ATOM   3191   H H    . ASN A 1 211 ? 41.980  8.544   -39.302 0.02 18.69 ?  204  ASN A H    1  
ATOM   3192   H HA   . ASN A 1 211 ? 42.874  8.156   -41.746 0.02 19.22 ?  204  ASN A HA   1  
ATOM   3193   H HB2  . ASN A 1 211 ? 42.164  6.468   -39.706 0.02 18.69 ?  204  ASN A HB2  1  
ATOM   3194   H HB3  . ASN A 1 211 ? 41.863  5.880   -41.151 0.02 18.90 ?  204  ASN A HB3  1  
ATOM   3195   H HD21 . ASN A 1 211 ? 43.813  4.788   -42.149 0.02 19.34 ?  204  ASN A HD21 1  
ATOM   3196   H HD22 . ASN A 1 211 ? 44.805  5.869   -42.415 0.02 19.59 ?  204  ASN A HD22 1  
ATOM   3197   N N    . PHE A 1 212 ? 39.864  8.698   -41.637 0.02 18.73 ?  205  PHE A N    1  
ATOM   3198   C CA   . PHE A 1 212 ? 38.630  8.831   -42.394 0.02 18.71 ?  205  PHE A CA   1  
ATOM   3199   C C    . PHE A 1 212 ? 38.376  10.270  -42.823 0.02 18.81 ?  205  PHE A C    1  
ATOM   3200   O O    . PHE A 1 212 ? 37.246  10.617  -43.161 0.02 18.76 ?  205  PHE A O    1  
ATOM   3201   C CB   . PHE A 1 212 ? 37.440  8.325   -41.577 0.02 18.39 ?  205  PHE A CB   1  
ATOM   3202   C CG   . PHE A 1 212 ? 37.589  6.917   -41.115 0.02 18.30 ?  205  PHE A CG   1  
ATOM   3203   C CD1  . PHE A 1 212 ? 38.294  6.618   -39.957 0.02 18.19 ?  205  PHE A CD1  1  
ATOM   3204   C CD2  . PHE A 1 212 ? 37.028  5.888   -41.828 0.02 18.35 ?  205  PHE A CD2  1  
ATOM   3205   C CE1  . PHE A 1 212 ? 38.434  5.323   -39.543 0.02 18.14 ?  205  PHE A CE1  1  
ATOM   3206   C CE2  . PHE A 1 212 ? 37.175  4.597   -41.420 0.02 18.30 ?  205  PHE A CE2  1  
ATOM   3207   C CZ   . PHE A 1 212 ? 37.880  4.316   -40.258 0.02 18.19 ?  205  PHE A CZ   1  
ATOM   3208   H H    . PHE A 1 212 ? 39.873  9.172   -40.924 0.02 18.62 ?  205  PHE A H    1  
ATOM   3209   H HA   . PHE A 1 212 ? 38.693  8.285   -43.192 0.02 18.85 ?  205  PHE A HA   1  
ATOM   3210   H HB2  . PHE A 1 212 ? 37.325  8.891   -40.801 0.02 18.26 ?  205  PHE A HB2  1  
ATOM   3211   H HB3  . PHE A 1 212 ? 36.651  8.364   -42.133 0.02 18.41 ?  205  PHE A HB3  1  
ATOM   3212   H HD1  . PHE A 1 212 ? 38.681  7.302   -39.463 0.02 18.18 ?  205  PHE A HD1  1  
ATOM   3213   H HD2  . PHE A 1 212 ? 36.556  6.073   -42.605 0.02 18.44 ?  205  PHE A HD2  1  
ATOM   3214   H HE1  . PHE A 1 212 ? 38.910  5.126   -38.770 0.02 18.08 ?  205  PHE A HE1  1  
ATOM   3215   H HE2  . PHE A 1 212 ? 36.790  3.909   -41.908 0.02 18.35 ?  205  PHE A HE2  1  
ATOM   3216   H HZ   . PHE A 1 212 ? 37.980  3.436   -39.972 0.02 18.17 ?  205  PHE A HZ   1  
ATOM   3217   N N    . GLY A 1 213 ? 39.409  11.106  -42.827 0.02 19.01 ?  206  GLY A N    1  
ATOM   3218   C CA   . GLY A 1 213 ? 39.282  12.509  -43.180 0.02 19.15 ?  206  GLY A CA   1  
ATOM   3219   C C    . GLY A 1 213 ? 38.828  13.450  -42.083 0.02 18.96 ?  206  GLY A C    1  
ATOM   3220   O O    . GLY A 1 213 ? 38.571  14.617  -42.366 0.02 19.09 ?  206  GLY A O    1  
ATOM   3221   H H    . GLY A 1 213 ? 40.209  10.871  -42.628 0.02 19.08 ?  206  GLY A H    1  
ATOM   3222   H HA2  . GLY A 1 213 ? 40.144  12.820  -43.497 0.02 19.37 ?  206  GLY A HA2  1  
ATOM   3223   H HA3  . GLY A 1 213 ? 38.649  12.590  -43.912 0.02 19.20 ?  206  GLY A HA3  1  
ATOM   3224   N N    . GLY A 1 214 ? 38.726  12.985  -40.843 0.02 18.69 ?  207  GLY A N    1  
ATOM   3225   C CA   . GLY A 1 214 ? 38.319  13.840  -39.740 0.02 18.52 ?  207  GLY A CA   1  
ATOM   3226   C C    . GLY A 1 214 ? 39.416  14.771  -39.233 0.02 18.69 ?  207  GLY A C    1  
ATOM   3227   O O    . GLY A 1 214 ? 40.597  14.635  -39.575 0.02 18.89 ?  207  GLY A O    1  
ATOM   3228   H H    . GLY A 1 214 ? 38.884  12.172  -40.623 0.02 18.62 ?  207  GLY A H    1  
ATOM   3229   H HA2  . GLY A 1 214 ? 37.573  14.387  -40.035 0.02 18.52 ?  207  GLY A HA2  1  
ATOM   3230   H HA3  . GLY A 1 214 ? 38.013  13.294  -39.002 0.02 18.32 ?  207  GLY A HA3  1  
ATOM   3231   N N    . ASN A 1 215 ? 39.007  15.774  -38.463 0.02 18.63 ?  208  ASN A N    1  
ATOM   3232   C CA   . ASN A 1 215 ? 39.947  16.642  -37.762 0.02 18.78 ?  208  ASN A CA   1  
ATOM   3233   C C    . ASN A 1 215 ? 39.927  16.288  -36.282 0.02 18.54 ?  208  ASN A C    1  
ATOM   3234   O O    . ASN A 1 215 ? 38.954  16.617  -35.594 0.02 18.34 ?  208  ASN A O    1  
ATOM   3235   C CB   . ASN A 1 215 ? 39.582  18.097  -37.957 0.02 18.94 ?  208  ASN A CB   1  
ATOM   3236   C CG   . ASN A 1 215 ? 40.537  19.041  -37.262 0.02 19.14 ?  208  ASN A CG   1  
ATOM   3237   O OD1  . ASN A 1 215 ? 41.586  18.642  -36.783 0.02 19.19 ?  208  ASN A OD1  1  
ATOM   3238   N ND2  . ASN A 1 215 ? 40.180  20.309  -37.230 0.02 19.27 ?  208  ASN A ND2  1  
ATOM   3239   H H    . ASN A 1 215 ? 38.182  15.979  -38.330 0.02 18.52 ?  208  ASN A H    1  
ATOM   3240   H HA   . ASN A 1 215 ? 40.841  16.510  -38.110 0.02 18.96 ?  208  ASN A HA   1  
ATOM   3241   H HB2  . ASN A 1 215 ? 39.600  18.299  -38.906 0.02 19.11 ?  208  ASN A HB2  1  
ATOM   3242   H HB3  . ASN A 1 215 ? 38.694  18.252  -37.604 0.02 18.77 ?  208  ASN A HB3  1  
ATOM   3243   H HD21 . ASN A 1 215 ? 40.505  20.835  -36.633 0.02 19.37 ?  208  ASN A HD21 1  
ATOM   3244   H HD22 . ASN A 1 215 ? 39.616  20.606  -37.806 0.02 19.28 ?  208  ASN A HD22 1  
ATOM   3245   N N    . PRO A 1 216 ? 40.945  15.613  -35.754 0.02 18.58 ?  209  PRO A N    1  
ATOM   3246   C CA   . PRO A 1 216 ? 40.899  15.223  -34.341 0.02 18.37 ?  209  PRO A CA   1  
ATOM   3247   C C    . PRO A 1 216 ? 40.925  16.397  -33.412 0.02 18.43 ?  209  PRO A C    1  
ATOM   3248   O O    . PRO A 1 216 ? 40.668  16.222  -32.218 0.02 18.26 ?  209  PRO A O    1  
ATOM   3249   C CB   . PRO A 1 216 ? 42.151  14.361  -34.174 0.02 18.48 ?  209  PRO A CB   1  
ATOM   3250   C CG   . PRO A 1 216 ? 43.050  14.860  -35.223 0.02 18.81 ?  209  PRO A CG   1  
ATOM   3251   C CD   . PRO A 1 216 ? 42.175  15.134  -36.397 0.02 18.82 ?  209  PRO A CD   1  
ATOM   3252   H HA   . PRO A 1 216 ? 40.115  14.685  -34.161 0.02 18.17 ?  209  PRO A HA   1  
ATOM   3253   H HB2  . PRO A 1 216 ? 42.531  14.506  -33.293 0.02 18.49 ?  209  PRO A HB2  1  
ATOM   3254   H HB3  . PRO A 1 216 ? 41.933  13.428  -34.313 0.02 18.36 ?  209  PRO A HB3  1  
ATOM   3255   H HG2  . PRO A 1 216 ? 43.458  15.685  -34.921 0.02 18.96 ?  209  PRO A HG2  1  
ATOM   3256   H HG3  . PRO A 1 216 ? 43.719  14.191  -35.439 0.02 18.88 ?  209  PRO A HG3  1  
ATOM   3257   H HD2  . PRO A 1 216 ? 42.566  15.821  -36.955 0.02 19.04 ?  209  PRO A HD2  1  
ATOM   3258   H HD3  . PRO A 1 216 ? 42.000  14.323  -36.892 0.02 18.76 ?  209  PRO A HD3  1  
ATOM   3259   N N    . ASP A 1 217 ? 41.212  17.582  -33.917 0.02 18.68 ?  210  ASP A N    1  
ATOM   3260   C CA   . ASP A 1 217 ? 41.145  18.803  -33.140 0.02 18.77 ?  210  ASP A CA   1  
ATOM   3261   C C    . ASP A 1 217 ? 39.836  19.565  -33.354 0.02 18.65 ?  210  ASP A C    1  
ATOM   3262   O O    . ASP A 1 217 ? 39.724  20.719  -32.931 0.02 18.77 ?  210  ASP A O    1  
ATOM   3263   C CB   . ASP A 1 217 ? 42.370  19.655  -33.468 0.02 19.17 ?  210  ASP A CB   1  
ATOM   3264   C CG   . ASP A 1 217 ? 43.649  18.910  -33.191 0.02 19.32 ?  210  ASP A CG   1  
ATOM   3265   O OD1  . ASP A 1 217 ? 43.609  18.069  -32.253 0.02 19.14 ?  210  ASP A OD1  1  
ATOM   3266   O OD2  . ASP A 1 217 ? 44.673  19.140  -33.894 0.02 19.64 -1 210  ASP A OD2  1  
ATOM   3267   H H    . ASP A 1 217 ? 41.457  17.710  -34.730 0.02 18.83 ?  210  ASP A H    1  
ATOM   3268   H HA   . ASP A 1 217 ? 41.199  18.575  -32.199 0.02 18.68 ?  210  ASP A HA   1  
ATOM   3269   H HB2  . ASP A 1 217 ? 42.359  19.884  -34.411 0.02 19.28 ?  210  ASP A HB2  1  
ATOM   3270   H HB3  . ASP A 1 217 ? 42.352  20.457  -32.924 0.02 19.24 ?  210  ASP A HB3  1  
ATOM   3271   N N    . ASN A 1 218 ? 38.831  18.926  -33.979 0.02 18.46 ?  211  ASN A N    1  
ATOM   3272   C CA   . ASN A 1 218 ? 37.494  19.532  -34.052 0.02 18.34 ?  211  ASN A CA   1  
ATOM   3273   C C    . ASN A 1 218 ? 36.435  18.425  -34.010 0.02 18.04 ?  211  ASN A C    1  
ATOM   3274   O O    . ASN A 1 218 ? 35.788  18.078  -34.977 0.02 18.03 ?  211  ASN A O    1  
ATOM   3275   C CB   . ASN A 1 218 ? 37.339  20.407  -35.298 0.02 18.59 ?  211  ASN A CB   1  
ATOM   3276   C CG   . ASN A 1 218 ? 36.390  21.581  -35.073 0.02 18.56 ?  211  ASN A CG   1  
ATOM   3277   O OD1  . ASN A 1 218 ? 35.816  21.717  -33.987 0.02 18.38 ?  211  ASN A OD1  1  
ATOM   3278   N ND2  . ASN A 1 218 ? 36.250  22.449  -36.078 0.02 18.78 ?  211  ASN A ND2  1  
ATOM   3279   H H    . ASN A 1 218 ? 38.894  18.153  -34.345 0.02 18.40 ?  211  ASN A H    1  
ATOM   3280   H HA   . ASN A 1 218 ? 37.370  20.094  -33.275 0.02 18.32 ?  211  ASN A HA   1  
ATOM   3281   H HB2  . ASN A 1 218 ? 38.203  20.766  -35.548 0.02 18.81 ?  211  ASN A HB2  1  
ATOM   3282   H HB3  . ASN A 1 218 ? 36.989  19.865  -36.020 0.02 18.58 ?  211  ASN A HB3  1  
ATOM   3283   H HD21 . ASN A 1 218 ? 36.782  22.419  -36.753 0.02 18.88 ?  211  ASN A HD21 1  
ATOM   3284   H HD22 . ASN A 1 218 ? 35.629  23.043  -36.051 0.02 18.84 ?  211  ASN A HD22 1  
ATOM   3285   N N    . ILE A 1 219 ? 36.248  17.850  -32.829 0.02 17.83 ?  212  ILE A N    1  
ATOM   3286   C CA   . ILE A 1 219 ? 35.236  16.840  -32.567 0.02 17.56 ?  212  ILE A CA   1  
ATOM   3287   C C    . ILE A 1 219 ? 34.078  17.471  -31.788 0.02 17.44 ?  212  ILE A C    1  
ATOM   3288   O O    . ILE A 1 219 ? 34.297  18.226  -30.832 0.02 17.48 ?  212  ILE A O    1  
ATOM   3289   C CB   . ILE A 1 219 ? 35.827  15.662  -31.777 0.02 17.44 ?  212  ILE A CB   1  
ATOM   3290   C CG1  . ILE A 1 219 ? 36.984  15.025  -32.524 0.02 17.58 ?  212  ILE A CG1  1  
ATOM   3291   C CG2  . ILE A 1 219 ? 34.749  14.638  -31.472 0.02 17.19 ?  212  ILE A CG2  1  
ATOM   3292   C CD1  . ILE A 1 219 ? 37.621  13.894  -31.758 0.02 17.52 ?  212  ILE A CD1  1  
ATOM   3293   H H    . ILE A 1 219 ? 36.714  18.035  -32.139 0.02 17.85 ?  212  ILE A H    1  
ATOM   3294   H HA   . ILE A 1 219 ? 34.894  16.497  -33.406 0.02 17.56 ?  212  ILE A HA   1  
ATOM   3295   H HB   . ILE A 1 219 ? 36.168  16.005  -30.937 0.02 17.45 ?  212  ILE A HB   1  
ATOM   3296   H HG12 . ILE A 1 219 ? 36.661  14.672  -33.366 0.02 17.58 ?  212  ILE A HG12 1  
ATOM   3297   H HG13 . ILE A 1 219 ? 37.663  15.699  -32.688 0.02 17.76 ?  212  ILE A HG13 1  
ATOM   3298   H HG21 . ILE A 1 219 ? 35.149  13.822  -31.142 0.02 17.14 ?  212  ILE A HG21 1  
ATOM   3299   H HG22 . ILE A 1 219 ? 34.149  14.999  -30.805 0.02 17.11 ?  212  ILE A HG22 1  
ATOM   3300   H HG23 . ILE A 1 219 ? 34.259  14.453  -32.286 0.02 17.19 ?  212  ILE A HG23 1  
ATOM   3301   H HD11 . ILE A 1 219 ? 38.540  13.789  -32.052 0.02 17.66 ?  212  ILE A HD11 1  
ATOM   3302   H HD12 . ILE A 1 219 ? 37.599  14.108  -30.813 0.02 17.49 ?  212  ILE A HD12 1  
ATOM   3303   H HD13 . ILE A 1 219 ? 37.123  13.081  -31.916 0.02 17.39 ?  212  ILE A HD13 1  
ATOM   3304   N N    . THR A 1 220 ? 32.853  17.135  -32.184 0.02 17.31 ?  213  THR A N    1  
ATOM   3305   C CA   . THR A 1 220 ? 31.637  17.532  -31.496 0.02 17.19 ?  213  THR A CA   1  
ATOM   3306   C C    . THR A 1 220 ? 30.936  16.265  -31.025 0.02 16.97 ?  213  THR A C    1  
ATOM   3307   O O    . THR A 1 220 ? 30.771  15.329  -31.796 0.02 16.93 ?  213  THR A O    1  
ATOM   3308   C CB   . THR A 1 220 ? 30.724  18.327  -32.444 0.02 17.30 ?  213  THR A CB   1  
ATOM   3309   O OG1  . THR A 1 220 ? 31.244  19.651  -32.643 0.02 17.53 ?  213  THR A OG1  1  
ATOM   3310   C CG2  . THR A 1 220 ? 29.313  18.404  -31.911 0.02 17.18 ?  213  THR A CG2  1  
ATOM   3311   H H    . THR A 1 220 ? 32.697  16.658  -32.880 0.02 17.31 ?  213  THR A H    1  
ATOM   3312   H HA   . THR A 1 220 ? 31.851  18.084  -30.728 0.02 17.22 ?  213  THR A HA   1  
ATOM   3313   H HB   . THR A 1 220 ? 30.690  17.862  -33.295 0.02 17.31 ?  213  THR A HB   1  
ATOM   3314   H HG1  . THR A 1 220 ? 32.012  19.612  -32.977 0.02 17.61 ?  213  THR A HG1  1  
ATOM   3315   H HG21 . THR A 1 220 ? 28.864  17.555  -32.041 0.02 17.09 ?  213  THR A HG21 1  
ATOM   3316   H HG22 . THR A 1 220 ? 29.325  18.616  -30.964 0.02 17.10 ?  213  THR A HG22 1  
ATOM   3317   H HG23 . THR A 1 220 ? 28.820  19.091  -32.384 0.02 17.29 ?  213  THR A HG23 1  
ATOM   3318   N N    . VAL A 1 221 ? 30.546  16.219  -29.752 0.02 16.85 ?  214  VAL A N    1  
ATOM   3319   C CA   . VAL A 1 221 ? 29.764  15.117  -29.217 0.02 16.67 ?  214  VAL A CA   1  
ATOM   3320   C C    . VAL A 1 221 ? 28.344  15.623  -28.996 0.02 16.63 ?  214  VAL A C    1  
ATOM   3321   O O    . VAL A 1 221 ? 28.156  16.721  -28.470 0.02 16.70 ?  214  VAL A O    1  
ATOM   3322   C CB   . VAL A 1 221 ? 30.371  14.578  -27.910 0.02 16.60 ?  214  VAL A CB   1  
ATOM   3323   C CG1  . VAL A 1 221 ? 29.544  13.372  -27.356 0.02 16.44 ?  214  VAL A CG1  1  
ATOM   3324   C CG2  . VAL A 1 221 ? 31.788  14.176  -28.152 0.02 16.68 ?  214  VAL A CG2  1  
ATOM   3325   H H    . VAL A 1 221 ? 30.717  16.834  -29.180 0.02 16.89 ?  214  VAL A H    1  
ATOM   3326   H HA   . VAL A 1 221 ? 29.744  14.386  -29.851 0.02 16.65 ?  214  VAL A HA   1  
ATOM   3327   H HB   . VAL A 1 221 ? 30.372  15.287  -27.256 0.02 16.63 ?  214  VAL A HB   1  
ATOM   3328   H HG11 . VAL A 1 221 ? 29.724  13.289  -26.408 0.02 16.42 ?  214  VAL A HG11 1  
ATOM   3329   H HG12 . VAL A 1 221 ? 28.600  13.524  -27.496 0.02 16.41 ?  214  VAL A HG12 1  
ATOM   3330   H HG13 . VAL A 1 221 ? 29.819  12.560  -27.806 0.02 16.42 ?  214  VAL A HG13 1  
ATOM   3331   H HG21 . VAL A 1 221 ? 32.158  13.818  -27.330 0.02 16.65 ?  214  VAL A HG21 1  
ATOM   3332   H HG22 . VAL A 1 221 ? 31.807  13.499  -28.842 0.02 16.66 ?  214  VAL A HG22 1  
ATOM   3333   H HG23 . VAL A 1 221 ? 32.294  14.955  -28.427 0.02 16.80 ?  214  VAL A HG23 1  
ATOM   3334   N N    . PHE A 1 222 ? 27.350  14.824  -29.391 0.02 16.55 ?  215  PHE A N    1  
ATOM   3335   C CA   . PHE A 1 222 ? 25.953  15.210  -29.221 0.02 16.54 ?  215  PHE A CA   1  
ATOM   3336   C C    . PHE A 1 222 ? 25.118  13.953  -29.020 0.02 16.43 ?  215  PHE A C    1  
ATOM   3337   O O    . PHE A 1 222 ? 25.528  12.852  -29.360 0.02 16.38 ?  215  PHE A O    1  
ATOM   3338   C CB   . PHE A 1 222 ? 25.432  16.088  -30.388 0.02 16.68 ?  215  PHE A CB   1  
ATOM   3339   C CG   . PHE A 1 222 ? 25.188  15.371  -31.720 0.02 16.72 ?  215  PHE A CG   1  
ATOM   3340   C CD1  . PHE A 1 222 ? 26.200  14.751  -32.430 0.02 16.74 ?  215  PHE A CD1  1  
ATOM   3341   C CD2  . PHE A 1 222 ? 23.927  15.405  -32.284 0.02 16.77 ?  215  PHE A CD2  1  
ATOM   3342   C CE1  . PHE A 1 222 ? 25.948  14.140  -33.665 0.02 16.81 ?  215  PHE A CE1  1  
ATOM   3343   C CE2  . PHE A 1 222 ? 23.683  14.825  -33.520 0.02 16.85 ?  215  PHE A CE2  1  
ATOM   3344   C CZ   . PHE A 1 222 ? 24.696  14.166  -34.196 0.02 16.86 ?  215  PHE A CZ   1  
ATOM   3345   H H    . PHE A 1 222 ? 27.458  14.052  -29.747 0.02 16.52 ?  215  PHE A H    1  
ATOM   3346   H HA   . PHE A 1 222 ? 25.874  15.743  -28.419 0.02 16.54 ?  215  PHE A HA   1  
ATOM   3347   H HB2  . PHE A 1 222 ? 24.575  16.452  -30.121 0.02 16.68 ?  215  PHE A HB2  1  
ATOM   3348   H HB3  . PHE A 1 222 ? 26.052  16.813  -30.540 0.02 16.76 ?  215  PHE A HB3  1  
ATOM   3349   H HD1  . PHE A 1 222 ? 27.057  14.718  -32.074 0.02 16.72 ?  215  PHE A HD1  1  
ATOM   3350   H HD2  . PHE A 1 222 ? 23.242  15.839  -31.837 0.02 16.77 ?  215  PHE A HD2  1  
ATOM   3351   H HE1  . PHE A 1 222 ? 26.631  13.707  -34.123 0.02 16.84 ?  215  PHE A HE1  1  
ATOM   3352   H HE2  . PHE A 1 222 ? 22.825  14.837  -33.874 0.02 16.90 ?  215  PHE A HE2  1  
ATOM   3353   H HZ   . PHE A 1 222 ? 24.528  13.762  -35.016 0.02 16.93 ?  215  PHE A HZ   1  
ATOM   3354   N N    . GLY A 1 223 ? 23.967  14.137  -28.400 0.02 16.40 ?  216  GLY A N    1  
ATOM   3355   C CA   . GLY A 1 223 ? 23.081  13.041  -28.110 0.02 16.34 ?  216  GLY A CA   1  
ATOM   3356   C C    . GLY A 1 223 ? 21.781  13.609  -27.602 0.02 16.37 ?  216  GLY A C    1  
ATOM   3357   O O    . GLY A 1 223 ? 21.702  14.776  -27.215 0.02 16.43 ?  216  GLY A O    1  
ATOM   3358   H H    . GLY A 1 223 ? 23.676  14.899  -28.136 0.02 16.44 ?  216  GLY A H    1  
ATOM   3359   H HA2  . GLY A 1 223 ? 22.903  12.510  -28.897 0.02 16.36 ?  216  GLY A HA2  1  
ATOM   3360   H HA3  . GLY A 1 223 ? 23.465  12.466  -27.433 0.02 16.27 ?  216  GLY A HA3  1  
ATOM   3361   N N    . GLU A 1 224 ? 20.768  12.769  -27.615 0.02 16.37 ?  217  GLU A N    1  
ATOM   3362   C CA   . GLU A 1 224 ? 19.432  13.170  -27.224 0.02 16.44 ?  217  GLU A CA   1  
ATOM   3363   C C    . GLU A 1 224 ? 18.950  12.310  -26.067 0.02 16.39 ?  217  GLU A C    1  
ATOM   3364   O O    . GLU A 1 224 ? 19.144  11.100  -26.070 0.02 16.34 ?  217  GLU A O    1  
ATOM   3365   C CB   . GLU A 1 224 ? 18.499  13.054  -28.422 0.02 16.54 ?  217  GLU A CB   1  
ATOM   3366   C CG   . GLU A 1 224 ? 17.037  13.377  -28.144 0.02 16.65 ?  217  GLU A CG   1  
ATOM   3367   C CD   . GLU A 1 224 ? 16.286  12.160  -27.679 0.02 16.66 ?  217  GLU A CD   1  
ATOM   3368   O OE1  . GLU A 1 224 ? 15.151  12.348  -27.199 0.02 16.74 ?  217  GLU A OE1  1  
ATOM   3369   O OE2  . GLU A 1 224 ? 16.835  11.049  -27.802 0.02 16.60 -1 217  GLU A OE2  1  
ATOM   3370   H H    . GLU A 1 224 ? 20.828  11.944  -27.841 0.02 16.35 ?  217  GLU A H    1  
ATOM   3371   H HA   . GLU A 1 224 ? 19.455  14.090  -26.933 0.02 16.47 ?  217  GLU A HA   1  
ATOM   3372   H HB2  . GLU A 1 224 ? 18.810  13.657  -29.113 0.02 16.59 ?  217  GLU A HB2  1  
ATOM   3373   H HB3  . GLU A 1 224 ? 18.541  12.143  -28.745 0.02 16.53 ?  217  GLU A HB3  1  
ATOM   3374   H HG2  . GLU A 1 224 ? 16.981  14.048  -27.448 0.02 16.65 ?  217  GLU A HG2  1  
ATOM   3375   H HG3  . GLU A 1 224 ? 16.613  13.707  -28.950 0.02 16.75 ?  217  GLU A HG3  1  
ATOM   3376   N N    . SER A 1 225 ? 18.305  12.946  -25.085 0.02 16.43 ?  218  SER A N    1  
ATOM   3377   C CA   . SER A 1 225 ? 17.768  12.278  -23.893 0.02 16.43 ?  218  SER A CA   1  
ATOM   3378   C C    . SER A 1 225 ? 18.913  11.590  -23.160 0.02 16.33 ?  218  SER A C    1  
ATOM   3379   O O    . SER A 1 225 ? 19.840  12.291  -22.735 0.02 16.30 ?  218  SER A O    1  
ATOM   3380   C CB   . SER A 1 225 ? 16.617  11.376  -24.310 0.02 16.50 ?  218  SER A CB   1  
ATOM   3381   O OG   . SER A 1 225 ? 15.968  10.914  -23.125 0.02 16.54 ?  218  SER A OG   1  
ATOM   3382   H H    . SER A 1 225 ? 18.149  13.791  -25.092 0.02 16.48 ?  218  SER A H    1  
ATOM   3383   H HA   . SER A 1 225 ? 17.410  12.942  -23.290 0.02 16.47 ?  218  SER A HA   1  
ATOM   3384   H HB2  . SER A 1 225 ? 16.000  11.882  -24.855 0.02 16.57 ?  218  SER A HB2  1  
ATOM   3385   H HB3  . SER A 1 225 ? 16.951  10.616  -24.803 0.02 16.47 ?  218  SER A HB3  1  
ATOM   3386   N N    . ALA A 1 226 ? 18.900  10.264  -22.972 0.02 16.30 ?  219  ALA A N    1  
ATOM   3387   C CA   . ALA A 1 226 ? 20.025  9.597   -22.330 0.02 16.24 ?  219  ALA A CA   1  
ATOM   3388   C C    . ALA A 1 226 ? 21.335  9.804   -23.074 0.02 16.17 ?  219  ALA A C    1  
ATOM   3389   O O    . ALA A 1 226 ? 22.397  9.676   -22.474 0.02 16.14 ?  219  ALA A O    1  
ATOM   3390   C CB   . ALA A 1 226 ? 19.765  8.100   -22.192 0.02 16.25 ?  219  ALA A CB   1  
ATOM   3391   H H    . ALA A 1 226 ? 18.259  9.738   -23.194 0.02 16.34 ?  219  ALA A H    1  
ATOM   3392   H HA   . ALA A 1 226 ? 20.129  9.962   -21.439 0.02 16.25 ?  219  ALA A HA   1  
ATOM   3393   H HB1  . ALA A 1 226 ? 20.592  7.653   -21.972 0.02 16.22 ?  219  ALA A HB1  1  
ATOM   3394   H HB2  . ALA A 1 226 ? 19.110  7.951   -21.495 0.02 16.31 ?  219  ALA A HB2  1  
ATOM   3395   H HB3  . ALA A 1 226 ? 19.434  7.765   -23.040 0.02 16.27 ?  219  ALA A HB3  1  
ATOM   3396   N N    . GLY A 1 227 ? 21.280  10.082  -24.368 0.02 16.18 ?  220  GLY A N    1  
ATOM   3397   C CA   . GLY A 1 227 ? 22.489  10.413  -25.084 0.02 16.16 ?  220  GLY A CA   1  
ATOM   3398   C C    . GLY A 1 227 ? 22.951  11.823  -24.794 0.02 16.19 ?  220  GLY A C    1  
ATOM   3399   O O    . GLY A 1 227 ? 24.136  12.136  -24.941 0.02 16.19 ?  220  GLY A O    1  
ATOM   3400   H H    . GLY A 1 227 ? 20.565  10.086  -24.839 0.02 16.22 ?  220  GLY A H    1  
ATOM   3401   H HA2  . GLY A 1 227 ? 23.189  9.795   -24.830 0.02 16.13 ?  220  GLY A HA2  1  
ATOM   3402   H HA3  . GLY A 1 227 ? 22.331  10.326  -26.034 0.02 16.18 ?  220  GLY A HA3  1  
ATOM   3403   N N    . ALA A 1 228 ? 22.026  12.696  -24.394 0.02 16.24 ?  221  ALA A N    1  
ATOM   3404   C CA   . ALA A 1 228 ? 22.401  14.027  -23.946 0.02 16.29 ?  221  ALA A CA   1  
ATOM   3405   C C    . ALA A 1 228 ? 22.978  13.974  -22.548 0.02 16.29 ?  221  ALA A C    1  
ATOM   3406   O O    . ALA A 1 228 ? 23.960  14.652  -22.258 0.02 16.32 ?  221  ALA A O    1  
ATOM   3407   C CB   . ALA A 1 228 ? 21.198  14.964  -23.962 0.02 16.38 ?  221  ALA A CB   1  
ATOM   3408   H H    . ALA A 1 228 ? 21.184  12.541  -24.364 0.02 16.26 ?  221  ALA A H    1  
ATOM   3409   H HA   . ALA A 1 228 ? 23.083  14.388  -24.528 0.02 16.31 ?  221  ALA A HA   1  
ATOM   3410   H HB1  . ALA A 1 228 ? 21.383  15.748  -23.426 0.02 16.43 ?  221  ALA A HB1  1  
ATOM   3411   H HB2  . ALA A 1 228 ? 21.020  15.231  -24.878 0.02 16.42 ?  221  ALA A HB2  1  
ATOM   3412   H HB3  . ALA A 1 228 ? 20.440  14.488  -23.593 0.02 16.38 ?  221  ALA A HB3  1  
ATOM   3413   N N    . ALA A 1 229 ? 22.395  13.163  -21.678 0.02 16.26 ?  222  ALA A N    1  
ATOM   3414   C CA   . ALA A 1 229 ? 23.026  12.969  -20.382 0.02 16.28 ?  222  ALA A CA   1  
ATOM   3415   C C    . ALA A 1 229 ? 24.404  12.371  -20.560 0.02 16.23 ?  222  ALA A C    1  
ATOM   3416   O O    . ALA A 1 229 ? 25.336  12.735  -19.849 0.02 16.28 ?  222  ALA A O    1  
ATOM   3417   C CB   . ALA A 1 229 ? 22.174  12.065  -19.494 0.02 16.28 ?  222  ALA A CB   1  
ATOM   3418   H H    . ALA A 1 229 ? 21.666  12.734  -21.804 0.02 16.26 ?  222  ALA A H    1  
ATOM   3419   H HA   . ALA A 1 229 ? 23.123  13.833  -19.958 0.02 16.33 ?  222  ALA A HA   1  
ATOM   3420   H HB1  . ALA A 1 229 ? 22.505  12.119  -18.587 0.02 16.32 ?  222  ALA A HB1  1  
ATOM   3421   H HB2  . ALA A 1 229 ? 21.257  12.366  -19.533 0.02 16.32 ?  222  ALA A HB2  1  
ATOM   3422   H HB3  . ALA A 1 229 ? 22.244  11.159  -19.819 0.02 16.24 ?  222  ALA A HB3  1  
ATOM   3423   N N    . SER A 1 230 ? 24.542  11.440  -21.505 0.02 16.17 ?  223  SER A N    1  
ATOM   3424   C CA   . SER A 1 230 ? 25.844  10.837  -21.794 0.02 16.15 ?  223  SER A CA   1  
ATOM   3425   C C    . SER A 1 230 ? 26.847  11.870  -22.281 0.02 16.20 ?  223  SER A C    1  
ATOM   3426   O O    . SER A 1 230 ? 27.992  11.894  -21.825 0.02 16.25 ?  223  SER A O    1  
ATOM   3427   C CB   . SER A 1 230 ? 25.702  9.739   -22.845 0.02 16.11 ?  223  SER A CB   1  
ATOM   3428   O OG   . SER A 1 230 ? 25.033  8.614   -22.335 0.02 16.10 ?  223  SER A OG   1  
ATOM   3429   H H    . SER A 1 230 ? 23.897  11.134  -21.976 0.02 16.16 ?  223  SER A H    1  
ATOM   3430   H HA   . SER A 1 230 ? 26.197  10.431  -20.987 0.02 16.17 ?  223  SER A HA   1  
ATOM   3431   H HB2  . SER A 1 230 ? 25.201  10.087  -23.595 0.02 16.11 ?  223  SER A HB2  1  
ATOM   3432   H HB3  . SER A 1 230 ? 26.585  9.476   -23.132 0.02 16.11 ?  223  SER A HB3  1  
ATOM   3433   H HG   . SER A 1 230 ? 24.928  8.039   -22.932 0.02 16.09 ?  223  SER A HG   1  
ATOM   3434   N N    . THR A 1 231 ? 26.450  12.683  -23.263 0.02 16.22 ?  224  THR A N    1  
ATOM   3435   C CA   . THR A 1 231 ? 27.318  13.754  -23.730 0.02 16.31 ?  224  THR A CA   1  
ATOM   3436   C C    . THR A 1 231 ? 27.745  14.626  -22.563 0.02 16.39 ?  224  THR A C    1  
ATOM   3437   O O    . THR A 1 231 ? 28.909  15.030  -22.456 0.02 16.48 ?  224  THR A O    1  
ATOM   3438   C CB   . THR A 1 231 ? 26.608  14.585  -24.794 0.02 16.35 ?  224  THR A CB   1  
ATOM   3439   O OG1  . THR A 1 231 ? 26.332  13.742  -25.921 0.02 16.30 ?  224  THR A OG1  1  
ATOM   3440   C CG2  . THR A 1 231 ? 27.463  15.746  -25.239 0.02 16.47 ?  224  THR A CG2  1  
ATOM   3441   H H    . THR A 1 231 ? 25.691  12.636  -23.656 0.02 16.21 ?  224  THR A H    1  
ATOM   3442   H HA   . THR A 1 231 ? 28.108  13.363  -24.127 0.02 16.31 ?  224  THR A HA   1  
ATOM   3443   H HB   . THR A 1 231 ? 25.776  14.932  -24.436 0.02 16.35 ?  224  THR A HB   1  
ATOM   3444   H HG1  . THR A 1 231 ? 26.124  12.972  -25.661 0.02 16.25 ?  224  THR A HG1  1  
ATOM   3445   H HG21 . THR A 1 231 ? 27.011  16.240  -25.940 0.02 16.51 ?  224  THR A HG21 1  
ATOM   3446   H HG22 . THR A 1 231 ? 27.636  16.346  -24.499 0.02 16.53 ?  224  THR A HG22 1  
ATOM   3447   H HG23 . THR A 1 231 ? 28.307  15.413  -25.580 0.02 16.49 ?  224  THR A HG23 1  
ATOM   3448   N N    . HIS A 1 232 ? 26.807  14.934  -21.672 0.02 16.40 ?  225  HIS A N    1  
ATOM   3449   C CA   . HIS A 1 232 ? 27.171  15.763  -20.537 0.02 16.51 ?  225  HIS A CA   1  
ATOM   3450   C C    . HIS A 1 232 ? 28.157  15.045  -19.615 0.02 16.52 ?  225  HIS A C    1  
ATOM   3451   O O    . HIS A 1 232 ? 29.128  15.656  -19.167 0.02 16.64 ?  225  HIS A O    1  
ATOM   3452   C CB   . HIS A 1 232 ? 25.911  16.193  -19.792 0.02 16.53 ?  225  HIS A CB   1  
ATOM   3453   C CG   . HIS A 1 232 ? 26.151  17.266  -18.778 0.02 16.68 ?  225  HIS A CG   1  
ATOM   3454   N ND1  . HIS A 1 232 ? 25.340  17.428  -17.682 0.02 16.74 ?  225  HIS A ND1  1  
ATOM   3455   C CD2  . HIS A 1 232 ? 27.100  18.227  -18.694 0.02 16.82 ?  225  HIS A CD2  1  
ATOM   3456   C CE1  . HIS A 1 232 ? 25.792  18.430  -16.950 0.02 16.90 ?  225  HIS A CE1  1  
ATOM   3457   N NE2  . HIS A 1 232 ? 26.857  18.933  -17.542 0.02 16.96 ?  225  HIS A NE2  1  
ATOM   3458   H H    . HIS A 1 232 ? 25.990  14.684  -21.701 0.02 16.36 ?  225  HIS A H    1  
ATOM   3459   H HA   . HIS A 1 232 ? 27.611  16.561  -20.864 0.02 16.59 ?  225  HIS A HA   1  
ATOM   3460   H HB2  . HIS A 1 232 ? 25.272  16.538  -20.431 0.02 16.53 ?  225  HIS A HB2  1  
ATOM   3461   H HB3  . HIS A 1 232 ? 25.533  15.429  -19.335 0.02 16.48 ?  225  HIS A HB3  1  
ATOM   3462   H HD2  . HIS A 1 232 ? 27.795  18.371  -19.290 0.02 16.84 ?  225  HIS A HD2  1  
ATOM   3463   H HE1  . HIS A 1 232 ? 25.416  18.738  -16.159 0.02 16.98 ?  225  HIS A HE1  1  
ATOM   3464   H HE2  . HIS A 1 232 ? 27.314  19.602  -17.256 0.02 17.08 ?  225  HIS A HE2  1  
ATOM   3465   N N    . TYR A 1 233 ? 27.946  13.752  -19.340 0.02 16.43 ?  226  TYR A N    1  
ATOM   3466   C CA   . TYR A 1 233 ? 28.908  13.018  -18.524 0.02 16.47 ?  226  TYR A CA   1  
ATOM   3467   C C    . TYR A 1 233 ? 30.283  13.032  -19.172 0.02 16.52 ?  226  TYR A C    1  
ATOM   3468   O O    . TYR A 1 233 ? 31.294  13.175  -18.487 0.02 16.63 ?  226  TYR A O    1  
ATOM   3469   C CB   . TYR A 1 233 ? 28.465  11.564  -18.290 0.02 16.39 ?  226  TYR A CB   1  
ATOM   3470   C CG   . TYR A 1 233 ? 27.324  11.380  -17.318 0.02 16.40 ?  226  TYR A CG   1  
ATOM   3471   C CD1  . TYR A 1 233 ? 27.405  11.880  -16.045 0.02 16.51 ?  226  TYR A CD1  1  
ATOM   3472   C CD2  . TYR A 1 233 ? 26.198  10.693  -17.679 0.02 16.32 ?  226  TYR A CD2  1  
ATOM   3473   C CE1  . TYR A 1 233 ? 26.371  11.738  -15.167 0.02 16.55 ?  226  TYR A CE1  1  
ATOM   3474   C CE2  . TYR A 1 233 ? 25.151  10.534  -16.803 0.02 16.37 ?  226  TYR A CE2  1  
ATOM   3475   C CZ   . TYR A 1 233 ? 25.260  11.052  -15.539 0.02 16.48 ?  226  TYR A CZ   1  
ATOM   3476   O OH   . TYR A 1 233 ? 24.205  10.898  -14.654 0.02 16.55 ?  226  TYR A OH   1  
ATOM   3477   H H    . TYR A 1 233 ? 27.279  13.290  -19.618 0.02 16.36 ?  226  TYR A H    1  
ATOM   3478   H HA   . TYR A 1 233 ? 28.985  13.456  -17.665 0.02 16.55 ?  226  TYR A HA   1  
ATOM   3479   H HB2  . TYR A 1 233 ? 28.189  11.180  -19.136 0.02 16.31 ?  226  TYR A HB2  1  
ATOM   3480   H HB3  . TYR A 1 233 ? 29.220  11.066  -17.945 0.02 16.42 ?  226  TYR A HB3  1  
ATOM   3481   H HD1  . TYR A 1 233 ? 28.161  12.352  -15.783 0.02 16.59 ?  226  TYR A HD1  1  
ATOM   3482   H HD2  . TYR A 1 233 ? 26.134  10.345  -18.538 0.02 16.26 ?  226  TYR A HD2  1  
ATOM   3483   H HE1  . TYR A 1 233 ? 26.440  12.088  -14.308 0.02 16.65 ?  226  TYR A HE1  1  
ATOM   3484   H HE2  . TYR A 1 233 ? 24.386  10.069  -17.054 0.02 16.34 ?  226  TYR A HE2  1  
ATOM   3485   H HH   . TYR A 1 233 ? 23.594  10.448  -15.012 0.02 16.51 ?  226  TYR A HH   1  
ATOM   3486   N N    . MET A 1 234 ? 30.340  12.873  -20.501 0.02 16.45 ?  227  MET A N    1  
ATOM   3487   C CA   . MET A 1 234 ? 31.617  12.930  -21.199 0.02 16.53 ?  227  MET A CA   1  
ATOM   3488   C C    . MET A 1 234 ? 32.247  14.314  -21.127 0.02 16.68 ?  227  MET A C    1  
ATOM   3489   O O    . MET A 1 234 ? 33.459  14.448  -21.324 0.02 16.80 ?  227  MET A O    1  
ATOM   3490   C CB   . MET A 1 234 ? 31.426  12.513  -22.664 0.02 16.45 ?  227  MET A CB   1  
ATOM   3491   C CG   . MET A 1 234 ? 30.973  11.085  -22.857 0.02 16.35 ?  227  MET A CG   1  
ATOM   3492   S SD   . MET A 1 234 ? 32.110  9.875   -22.181 0.02 16.39 ?  227  MET A SD   1  
ATOM   3493   C CE   . MET A 1 234 ? 31.205  9.382   -20.687 0.02 16.36 ?  227  MET A CE   1  
ATOM   3494   H H    . MET A 1 234 ? 29.665  12.733  -21.007 0.02 16.39 ?  227  MET A H    1  
ATOM   3495   H HA   . MET A 1 234 ? 32.221  12.298  -20.793 0.02 16.55 ?  227  MET A HA   1  
ATOM   3496   H HB2  . MET A 1 234 ? 30.767  13.090  -23.069 0.02 16.44 ?  227  MET A HB2  1  
ATOM   3497   H HB3  . MET A 1 234 ? 32.277  12.618  -23.116 0.02 16.52 ?  227  MET A HB3  1  
ATOM   3498   H HG2  . MET A 1 234 ? 30.125  10.953  -22.404 0.02 16.29 ?  227  MET A HG2  1  
ATOM   3499   H HG3  . MET A 1 234 ? 30.875  10.908  -23.806 0.02 16.33 ?  227  MET A HG3  1  
ATOM   3500   H HE1  . MET A 1 234 ? 30.390  8.926   -20.944 0.02 16.29 ?  227  MET A HE1  1  
ATOM   3501   H HE2  . MET A 1 234 ? 31.761  8.787   -20.163 0.02 16.41 ?  227  MET A HE2  1  
ATOM   3502   H HE3  . MET A 1 234 ? 30.995  10.179  -20.177 0.02 16.38 ?  227  MET A HE3  1  
ATOM   3503   N N    . MET A 1 235 ? 31.457  15.351  -20.855 0.02 16.71 ?  228  MET A N    1  
ATOM   3504   C CA   . MET A 1 235 ? 31.978  16.691  -20.648 0.02 16.89 ?  228  MET A CA   1  
ATOM   3505   C C    . MET A 1 235 ? 32.371  16.935  -19.200 0.02 17.01 ?  228  MET A C    1  
ATOM   3506   O O    . MET A 1 235 ? 33.026  17.931  -18.905 0.02 17.20 ?  228  MET A O    1  
ATOM   3507   C CB   . MET A 1 235 ? 30.929  17.728  -21.067 0.02 16.90 ?  228  MET A CB   1  
ATOM   3508   C CG   . MET A 1 235 ? 30.702  17.753  -22.535 0.02 16.87 ?  228  MET A CG   1  
ATOM   3509   S SD   . MET A 1 235 ? 29.214  18.648  -23.011 0.02 16.87 ?  228  MET A SD   1  
ATOM   3510   C CE   . MET A 1 235 ? 29.721  20.324  -22.888 0.02 17.12 ?  228  MET A CE   1  
ATOM   3511   H H    . MET A 1 235 ? 30.601  15.300  -20.788 0.02 16.64 ?  228  MET A H    1  
ATOM   3512   H HA   . MET A 1 235 ? 32.754  16.813  -21.210 0.02 16.96 ?  228  MET A HA   1  
ATOM   3513   H HB2  . MET A 1 235 ? 30.087  17.514  -20.643 0.02 16.82 ?  228  MET A HB2  1  
ATOM   3514   H HB3  . MET A 1 235 ? 31.220  18.610  -20.793 0.02 17.04 ?  228  MET A HB3  1  
ATOM   3515   H HG2  . MET A 1 235 ? 31.459  18.173  -22.969 0.02 16.97 ?  228  MET A HG2  1  
ATOM   3516   H HG3  . MET A 1 235 ? 30.606  16.839  -22.842 0.02 16.76 ?  228  MET A HG3  1  
ATOM   3517   H HE1  . MET A 1 235 ? 28.950  20.860  -22.649 0.02 17.14 ?  228  MET A HE1  1  
ATOM   3518   H HE2  . MET A 1 235 ? 30.405  20.402  -22.204 0.02 17.17 ?  228  MET A HE2  1  
ATOM   3519   H HE3  . MET A 1 235 ? 30.073  20.609  -23.746 0.02 17.20 ?  228  MET A HE3  1  
ATOM   3520   N N    . LEU A 1 236 ? 31.950  16.057  -18.296 0.02 16.93 ?  229  LEU A N    1  
ATOM   3521   C CA   . LEU A 1 236 ? 32.178  16.243  -16.867 0.02 17.06 ?  229  LEU A CA   1  
ATOM   3522   C C    . LEU A 1 236 ? 33.396  15.479  -16.384 0.02 17.14 ?  229  LEU A C    1  
ATOM   3523   O O    . LEU A 1 236 ? 34.132  15.976  -15.522 0.02 17.34 ?  229  LEU A O    1  
ATOM   3524   C CB   . LEU A 1 236 ? 30.951  15.782  -16.066 0.02 16.98 ?  229  LEU A CB   1  
ATOM   3525   C CG   . LEU A 1 236 ? 29.700  16.641  -16.218 0.02 16.96 ?  229  LEU A CG   1  
ATOM   3526   C CD1  . LEU A 1 236 ? 28.616  15.976  -15.429 0.02 16.89 ?  229  LEU A CD1  1  
ATOM   3527   C CD2  . LEU A 1 236 ? 29.852  18.083  -15.816 0.02 17.16 ?  229  LEU A CD2  1  
ATOM   3528   H H    . LEU A 1 236 ? 31.540  15.328  -18.485 0.02 16.82 ?  229  LEU A H    1  
ATOM   3529   H HA   . LEU A 1 236 ? 32.318  17.184  -16.688 0.02 17.19 ?  229  LEU A HA   1  
ATOM   3530   H HB2  . LEU A 1 236 ? 30.718  14.888  -16.353 0.02 16.86 ?  229  LEU A HB2  1  
ATOM   3531   H HB3  . LEU A 1 236 ? 31.186  15.761  -15.126 0.02 17.07 ?  229  LEU A HB3  1  
ATOM   3532   H HG   . LEU A 1 236 ? 29.430  16.641  -17.149 0.02 16.88 ?  229  LEU A HG   1  
ATOM   3533   H HD11 . LEU A 1 236 ? 27.831  16.541  -15.443 0.02 16.90 ?  229  LEU A HD11 1  
ATOM   3534   H HD12 . LEU A 1 236 ? 28.426  15.115  -15.825 0.02 16.77 ?  229  LEU A HD12 1  
ATOM   3535   H HD13 . LEU A 1 236 ? 28.921  15.854  -14.517 0.02 16.98 ?  229  LEU A HD13 1  
ATOM   3536   H HD21 . LEU A 1 236 ? 28.980  18.504  -15.828 0.02 17.15 ?  229  LEU A HD21 1  
ATOM   3537   H HD22 . LEU A 1 236 ? 30.228  18.123  -14.921 0.02 17.26 ?  229  LEU A HD22 1  
ATOM   3538   H HD23 . LEU A 1 236 ? 30.441  18.527  -16.447 0.02 17.21 ?  229  LEU A HD23 1  
ATOM   3539   N N    . THR A 1 237 ? 33.604  14.270  -16.882 0.02 17.02 ?  230  THR A N    1  
ATOM   3540   C CA   . THR A 1 237 ? 34.634  13.410  -16.313 0.02 17.11 ?  230  THR A CA   1  
ATOM   3541   C C    . THR A 1 237 ? 36.032  13.848  -16.731 0.02 17.28 ?  230  THR A C    1  
ATOM   3542   O O    . THR A 1 237 ? 36.266  14.278  -17.861 0.02 17.27 ?  230  THR A O    1  
ATOM   3543   C CB   . THR A 1 237 ? 34.396  11.952  -16.709 0.02 16.96 ?  230  THR A CB   1  
ATOM   3544   O OG1  . THR A 1 237 ? 35.377  11.106  -16.108 0.02 17.08 ?  230  THR A OG1  1  
ATOM   3545   C CG2  . THR A 1 237 ? 34.454  11.752  -18.211 0.02 16.85 ?  230  THR A CG2  1  
ATOM   3546   H H    . THR A 1 237 ? 33.176  13.927  -17.539 0.02 16.90 ?  230  THR A H    1  
ATOM   3547   H HA   . THR A 1 237 ? 34.588  13.464  -15.345 0.02 17.19 ?  230  THR A HA   1  
ATOM   3548   H HB   . THR A 1 237 ? 33.517  11.684  -16.405 0.02 16.88 ?  230  THR A HB   1  
ATOM   3549   H HG1  . THR A 1 237 ? 35.287  10.319  -16.387 0.02 17.01 ?  230  THR A HG1  1  
ATOM   3550   H HG21 . THR A 1 237 ? 34.739  12.572  -18.642 0.02 16.89 ?  230  THR A HG21 1  
ATOM   3551   H HG22 . THR A 1 237 ? 35.076  11.044  -18.427 0.02 16.88 ?  230  THR A HG22 1  
ATOM   3552   H HG23 . THR A 1 237 ? 33.575  11.514  -18.542 0.02 16.73 ?  230  THR A HG23 1  
ATOM   3553   N N    . GLU A 1 238 ? 36.976  13.734  -15.792 0.02 17.48 ?  231  GLU A N    1  
ATOM   3554   C CA   . GLU A 1 238 ? 38.362  13.996  -16.144 0.02 17.67 ?  231  GLU A CA   1  
ATOM   3555   C C    . GLU A 1 238 ? 38.899  12.973  -17.136 0.02 17.59 ?  231  GLU A C    1  
ATOM   3556   O O    . GLU A 1 238 ? 39.896  13.250  -17.804 0.02 17.73 ?  231  GLU A O    1  
ATOM   3557   C CB   . GLU A 1 238 ? 39.234  13.996  -14.892 0.02 17.92 ?  231  GLU A CB   1  
ATOM   3558   C CG   . GLU A 1 238 ? 38.812  15.018  -13.870 0.02 18.06 ?  231  GLU A CG   1  
ATOM   3559   C CD   . GLU A 1 238 ? 39.155  16.406  -14.318 0.02 18.22 ?  231  GLU A CD   1  
ATOM   3560   O OE1  . GLU A 1 238 ? 40.146  16.517  -15.072 0.02 18.33 ?  231  GLU A OE1  1  
ATOM   3561   O OE2  . GLU A 1 238 ? 38.437  17.369  -13.915 0.02 18.25 -1 231  GLU A OE2  1  
ATOM   3562   H H    . GLU A 1 238 ? 36.838  13.508  -14.978 0.02 17.52 ?  231  GLU A H    1  
ATOM   3563   H HA   . GLU A 1 238 ? 38.426  14.873  -16.549 0.02 17.73 ?  231  GLU A HA   1  
ATOM   3564   H HB2  . GLU A 1 238 ? 39.178  13.120  -14.481 0.02 17.88 ?  231  GLU A HB2  1  
ATOM   3565   H HB3  . GLU A 1 238 ? 40.151  14.181  -15.140 0.02 18.07 ?  231  GLU A HB3  1  
ATOM   3566   H HG2  . GLU A 1 238 ? 37.851  14.970  -13.741 0.02 17.92 ?  231  GLU A HG2  1  
ATOM   3567   H HG3  . GLU A 1 238 ? 39.270  14.842  -13.035 0.02 18.21 ?  231  GLU A HG3  1  
ATOM   3568   N N    . GLN A 1 239 ? 38.258  11.813  -17.260 0.02 17.40 ?  232  GLN A N    1  
ATOM   3569   C CA   . GLN A 1 239 ? 38.773  10.772  -18.143 0.02 17.36 ?  232  GLN A CA   1  
ATOM   3570   C C    . GLN A 1 239 ? 38.860  11.245  -19.585 0.02 17.32 ?  232  GLN A C    1  
ATOM   3571   O O    . GLN A 1 239 ? 39.690  10.741  -20.349 0.02 17.38 ?  232  GLN A O    1  
ATOM   3572   C CB   . GLN A 1 239 ? 37.884  9.548   -18.080 0.02 17.18 ?  232  GLN A CB   1  
ATOM   3573   C CG   . GLN A 1 239 ? 37.824  8.887   -16.723 0.02 17.24 ?  232  GLN A CG   1  
ATOM   3574   C CD   . GLN A 1 239 ? 39.078  8.037   -16.421 0.02 17.41 ?  232  GLN A CD   1  
ATOM   3575   O OE1  . GLN A 1 239 ? 39.969  7.887   -17.259 0.02 17.44 ?  232  GLN A OE1  1  
ATOM   3576   N NE2  . GLN A 1 239 ? 39.152  7.507   -15.193 0.02 17.53 ?  232  GLN A NE2  1  
ATOM   3577   H H    . GLN A 1 239 ? 37.535  11.603  -16.846 0.02 17.32 ?  232  GLN A H    1  
ATOM   3578   H HA   . GLN A 1 239 ? 39.662  10.517  -17.852 0.02 17.50 ?  232  GLN A HA   1  
ATOM   3579   H HB2  . GLN A 1 239 ? 36.985  9.810   -18.327 0.02 17.05 ?  232  GLN A HB2  1  
ATOM   3580   H HB3  . GLN A 1 239 ? 38.215  8.891   -18.711 0.02 17.17 ?  232  GLN A HB3  1  
ATOM   3581   H HG2  . GLN A 1 239 ? 37.757  9.572   -16.040 0.02 17.33 ?  232  GLN A HG2  1  
ATOM   3582   H HG3  . GLN A 1 239 ? 37.047  8.312   -16.687 0.02 17.12 ?  232  GLN A HG3  1  
ATOM   3583   H HE21 . GLN A 1 239 ? 38.811  7.923   -14.523 0.02 17.59 ?  232  GLN A HE21 1  
ATOM   3584   H HE22 . GLN A 1 239 ? 39.540  6.753   -15.074 0.02 17.57 ?  232  GLN A HE22 1  
ATOM   3585   N N    . THR A 1 240 ? 38.017  12.209  -19.971 0.02 17.24 ?  233  THR A N    1  
ATOM   3586   C CA   . THR A 1 240 ? 37.911  12.658  -21.356 0.02 17.20 ?  233  THR A CA   1  
ATOM   3587   C C    . THR A 1 240 ? 38.472  14.059  -21.592 0.02 17.39 ?  233  THR A C    1  
ATOM   3588   O O    . THR A 1 240 ? 38.270  14.609  -22.678 0.02 17.39 ?  233  THR A O    1  
ATOM   3589   C CB   . THR A 1 240 ? 36.449  12.631  -21.800 0.02 16.99 ?  233  THR A CB   1  
ATOM   3590   O OG1  . THR A 1 240 ? 35.698  13.482  -20.939 0.02 16.98 ?  233  THR A OG1  1  
ATOM   3591   C CG2  . THR A 1 240 ? 35.886  11.222  -21.772 0.02 16.83 ?  233  THR A CG2  1  
ATOM   3592   H H    . THR A 1 240 ? 37.493  12.625  -19.433 0.02 17.22 ?  233  THR A H    1  
ATOM   3593   H HA   . THR A 1 240 ? 38.388  12.040  -21.927 0.02 17.21 ?  233  THR A HA   1  
ATOM   3594   H HB   . THR A 1 240 ? 36.381  12.967  -22.707 0.02 16.99 ?  233  THR A HB   1  
ATOM   3595   H HG1  . THR A 1 240 ? 35.946  13.375  -20.147 0.02 17.01 ?  233  THR A HG1  1  
ATOM   3596   H HG21 . THR A 1 240 ? 34.956  11.226  -22.051 0.02 16.72 ?  233  THR A HG21 1  
ATOM   3597   H HG22 . THR A 1 240 ? 36.385  10.648  -22.377 0.02 16.85 ?  233  THR A HG22 1  
ATOM   3598   H HG23 . THR A 1 240 ? 35.943  10.859  -20.875 0.02 16.85 ?  233  THR A HG23 1  
ATOM   3599   N N    . ARG A 1 241 ? 39.185  14.647  -20.619 0.02 17.59 ?  234  ARG A N    1  
ATOM   3600   C CA   . ARG A 1 241 ? 39.583  16.049  -20.706 0.02 17.80 ?  234  ARG A CA   1  
ATOM   3601   C C    . ARG A 1 241 ? 40.186  16.385  -22.065 0.02 17.90 ?  234  ARG A C    1  
ATOM   3602   O O    . ARG A 1 241 ? 41.175  15.781  -22.482 0.02 17.98 ?  234  ARG A O    1  
ATOM   3603   C CB   . ARG A 1 241 ? 40.576  16.396  -19.597 0.02 18.07 ?  234  ARG A CB   1  
ATOM   3604   C CG   . ARG A 1 241 ? 41.028  17.843  -19.687 0.02 18.33 ?  234  ARG A CG   1  
ATOM   3605   C CD   . ARG A 1 241 ? 41.852  18.296  -18.481 0.02 18.62 ?  234  ARG A CD   1  
ATOM   3606   N NE   . ARG A 1 241 ? 41.021  18.443  -17.298 0.02 18.55 ?  234  ARG A NE   1  
ATOM   3607   C CZ   . ARG A 1 241 ? 40.537  19.606  -16.878 0.02 18.65 ?  234  ARG A CZ   1  
ATOM   3608   N NH1  . ARG A 1 241 ? 40.824  20.710  -17.534 0.02 18.83 ?  234  ARG A NH1  1  
ATOM   3609   N NH2  . ARG A 1 241 ? 39.788  19.662  -15.784 0.02 18.61 ?  234  ARG A NH2  1  
ATOM   3610   H H    . ARG A 1 241 ? 39.450  14.249  -19.906 0.02 17.62 ?  234  ARG A H    1  
ATOM   3611   H HA   . ARG A 1 241 ? 38.805  16.607  -20.581 0.02 17.75 ?  234  ARG A HA   1  
ATOM   3612   H HB2  . ARG A 1 241 ? 40.159  16.250  -18.734 0.02 18.02 ?  234  ARG A HB2  1  
ATOM   3613   H HB3  . ARG A 1 241 ? 41.362  15.834  -19.686 0.02 18.14 ?  234  ARG A HB3  1  
ATOM   3614   H HG2  . ARG A 1 241 ? 41.589  17.947  -20.468 0.02 18.42 ?  234  ARG A HG2  1  
ATOM   3615   H HG3  . ARG A 1 241 ? 40.251  18.417  -19.756 0.02 18.26 ?  234  ARG A HG3  1  
ATOM   3616   H HD2  . ARG A 1 241 ? 42.528  17.628  -18.288 0.02 18.68 ?  234  ARG A HD2  1  
ATOM   3617   H HD3  . ARG A 1 241 ? 42.280  19.139  -18.685 0.02 18.81 ?  234  ARG A HD3  1  
ATOM   3618   H HE   . ARG A 1 241 ? 41.017  17.791  -16.739 0.02 18.51 ?  234  ARG A HE   1  
ATOM   3619   H HH11 . ARG A 1 241 ? 41.308  20.695  -18.241 0.02 18.88 ?  234  ARG A HH11 1  
ATOM   3620   H HH12 . ARG A 1 241 ? 40.509  21.460  -17.256 0.02 18.91 ?  234  ARG A HH12 1  
ATOM   3621   H HH21 . ARG A 1 241 ? 39.603  18.944  -15.351 0.02 18.51 ?  234  ARG A HH21 1  
ATOM   3622   H HH22 . ARG A 1 241 ? 39.480  20.418  -15.512 0.02 18.69 ?  234  ARG A HH22 1  
ATOM   3623   N N    . GLY A 1 242 ? 39.575  17.359  -22.753 0.02 17.91 ?  235  GLY A N    1  
ATOM   3624   C CA   . GLY A 1 242 ? 40.038  17.863  -24.031 0.02 18.05 ?  235  GLY A CA   1  
ATOM   3625   C C    . GLY A 1 242 ? 39.999  16.870  -25.169 0.02 17.91 ?  235  GLY A C    1  
ATOM   3626   O O    . GLY A 1 242 ? 40.703  17.076  -26.167 0.02 18.07 ?  235  GLY A O    1  
ATOM   3627   H H    . GLY A 1 242 ? 38.862  17.752  -22.480 0.02 17.86 ?  235  GLY A H    1  
ATOM   3628   H HA2  . GLY A 1 242 ? 39.499  18.628  -24.282 0.02 18.06 ?  235  GLY A HA2  1  
ATOM   3629   H HA3  . GLY A 1 242 ? 40.952  18.172  -23.936 0.02 18.25 ?  235  GLY A HA3  1  
ATOM   3630   N N    . LEU A 1 243 ? 39.229  15.784  -25.036 0.02 17.65 ?  236  LEU A N    1  
ATOM   3631   C CA   . LEU A 1 243 ? 39.108  14.820  -26.124 0.02 17.54 ?  236  LEU A CA   1  
ATOM   3632   C C    . LEU A 1 243 ? 38.226  15.349  -27.248 0.02 17.47 ?  236  LEU A C    1  
ATOM   3633   O O    . LEU A 1 243 ? 38.303  14.847  -28.379 0.02 17.44 ?  236  LEU A O    1  
ATOM   3634   C CB   . LEU A 1 243 ? 38.536  13.498  -25.613 0.02 17.33 ?  236  LEU A CB   1  
ATOM   3635   C CG   . LEU A 1 243 ? 38.818  12.159  -26.293 0.02 17.27 ?  236  LEU A CG   1  
ATOM   3636   C CD1  . LEU A 1 243 ? 40.317  11.870  -26.244 0.02 17.48 ?  236  LEU A CD1  1  
ATOM   3637   C CD2  . LEU A 1 243 ? 38.049  11.070  -25.505 0.02 17.07 ?  236  LEU A CD2  1  
ATOM   3638   H H    . LEU A 1 243 ? 38.789  15.580  -24.330 0.02 17.56 ?  236  LEU A H    1  
ATOM   3639   H HA   . LEU A 1 243 ? 39.991  14.651  -26.470 0.02 17.67 ?  236  LEU A HA   1  
ATOM   3640   H HB2  . LEU A 1 243 ? 38.878  13.387  -24.711 0.02 17.37 ?  236  LEU A HB2  1  
ATOM   3641   H HB3  . LEU A 1 243 ? 37.573  13.590  -25.569 0.02 17.19 ?  236  LEU A HB3  1  
ATOM   3642   H HG   . LEU A 1 243 ? 38.516  12.172  -27.214 0.02 17.25 ?  236  LEU A HG   1  
ATOM   3643   H HD11 . LEU A 1 243 ? 40.571  11.713  -25.322 0.02 17.50 ?  236  LEU A HD11 1  
ATOM   3644   H HD12 . LEU A 1 243 ? 40.506  11.084  -26.781 0.02 17.47 ?  236  LEU A HD12 1  
ATOM   3645   H HD13 . LEU A 1 243 ? 40.796  12.635  -26.600 0.02 17.63 ?  236  LEU A HD13 1  
ATOM   3646   H HD21 . LEU A 1 243 ? 38.405  11.023  -24.602 0.02 17.11 ?  236  LEU A HD21 1  
ATOM   3647   H HD22 . LEU A 1 243 ? 37.110  11.307  -25.465 0.02 16.96 ?  236  LEU A HD22 1  
ATOM   3648   H HD23 . LEU A 1 243 ? 38.164  10.219  -25.951 0.02 17.05 ?  236  LEU A HD23 1  
ATOM   3649   N N    . PHE A 1 244 ? 37.359  16.316  -26.952 0.02 17.46 ?  237  PHE A N    1  
ATOM   3650   C CA   . PHE A 1 244 ? 36.526  16.938  -27.968 0.02 17.45 ?  237  PHE A CA   1  
ATOM   3651   C C    . PHE A 1 244 ? 36.302  18.415  -27.617 0.02 17.59 ?  237  PHE A C    1  
ATOM   3652   O O    . PHE A 1 244 ? 36.781  18.915  -26.596 0.02 17.69 ?  237  PHE A O    1  
ATOM   3653   C CB   . PHE A 1 244 ? 35.224  16.138  -28.163 0.02 17.20 ?  237  PHE A CB   1  
ATOM   3654   C CG   . PHE A 1 244 ? 34.394  15.987  -26.931 0.02 17.04 ?  237  PHE A CG   1  
ATOM   3655   C CD1  . PHE A 1 244 ? 34.595  14.941  -26.056 0.02 16.94 ?  237  PHE A CD1  1  
ATOM   3656   C CD2  . PHE A 1 244 ? 33.384  16.882  -26.672 0.02 17.03 ?  237  PHE A CD2  1  
ATOM   3657   C CE1  . PHE A 1 244 ? 33.810  14.810  -24.940 0.02 16.83 ?  237  PHE A CE1  1  
ATOM   3658   C CE2  . PHE A 1 244 ? 32.599  16.744  -25.569 0.02 16.91 ?  237  PHE A CE2  1  
ATOM   3659   C CZ   . PHE A 1 244 ? 32.809  15.713  -24.704 0.02 16.81 ?  237  PHE A CZ   1  
ATOM   3660   H H    . PHE A 1 244 ? 37.253  16.642  -26.165 0.02 17.47 ?  237  PHE A H    1  
ATOM   3661   H HA   . PHE A 1 244 ? 37.013  16.914  -28.806 0.02 17.55 ?  237  PHE A HA   1  
ATOM   3662   H HB2  . PHE A 1 244 ? 34.680  16.584  -28.828 0.02 17.21 ?  237  PHE A HB2  1  
ATOM   3663   H HB3  . PHE A 1 244 ? 35.450  15.248  -28.467 0.02 17.15 ?  237  PHE A HB3  1  
ATOM   3664   H HD1  . PHE A 1 244 ? 35.271  14.327  -26.218 0.02 16.97 ?  237  PHE A HD1  1  
ATOM   3665   H HD2  . PHE A 1 244 ? 33.229  17.583  -27.259 0.02 17.11 ?  237  PHE A HD2  1  
ATOM   3666   H HE1  . PHE A 1 244 ? 33.953  14.106  -24.350 0.02 16.78 ?  237  PHE A HE1  1  
ATOM   3667   H HE2  . PHE A 1 244 ? 31.923  17.361  -25.406 0.02 16.91 ?  237  PHE A HE2  1  
ATOM   3668   H HZ   . PHE A 1 244 ? 32.277  15.630  -23.948 0.02 16.75 ?  237  PHE A HZ   1  
ATOM   3669   N N    . HIS A 1 245 ? 35.585  19.134  -28.497 0.02 17.63 ?  238  HIS A N    1  
ATOM   3670   C CA   . HIS A 1 245 ? 35.707  20.583  -28.615 0.02 17.86 ?  238  HIS A CA   1  
ATOM   3671   C C    . HIS A 1 245 ? 34.392  21.344  -28.665 0.02 17.82 ?  238  HIS A C    1  
ATOM   3672   O O    . HIS A 1 245 ? 34.418  22.579  -28.591 0.02 18.02 ?  238  HIS A O    1  
ATOM   3673   C CB   . HIS A 1 245 ? 36.510  20.912  -29.877 0.02 18.09 ?  238  HIS A CB   1  
ATOM   3674   C CG   . HIS A 1 245 ? 37.782  20.152  -29.950 0.02 18.16 ?  238  HIS A CG   1  
ATOM   3675   N ND1  . HIS A 1 245 ? 37.879  18.916  -30.551 0.02 18.03 ?  238  HIS A ND1  1  
ATOM   3676   C CD2  . HIS A 1 245 ? 38.996  20.409  -29.417 0.02 18.36 ?  238  HIS A CD2  1  
ATOM   3677   C CE1  . HIS A 1 245 ? 39.111  18.468  -30.424 0.02 18.15 ?  238  HIS A CE1  1  
ATOM   3678   N NE2  . HIS A 1 245 ? 39.806  19.353  -29.732 0.02 18.35 ?  238  HIS A NE2  1  
ATOM   3679   H H    . HIS A 1 245 ? 35.020  18.794  -29.041 0.02 17.54 ?  238  HIS A H    1  
ATOM   3680   H HA   . HIS A 1 245 ? 36.212  20.918  -27.863 0.02 17.95 ?  238  HIS A HA   1  
ATOM   3681   H HB2  . HIS A 1 245 ? 35.983  20.671  -30.653 0.02 18.02 ?  238  HIS A HB2  1  
ATOM   3682   H HB3  . HIS A 1 245 ? 36.718  21.859  -29.893 0.02 18.27 ?  238  HIS A HB3  1  
ATOM   3683   H HD2  . HIS A 1 245 ? 39.240  21.167  -28.939 0.02 18.50 ?  238  HIS A HD2  1  
ATOM   3684   H HE1  . HIS A 1 245 ? 39.431  17.662  -30.755 0.02 18.12 ?  238  HIS A HE1  1  
ATOM   3685   H HE2  . HIS A 1 245 ? 40.637  19.282  -29.524 0.02 18.47 ?  238  HIS A HE2  1  
ATOM   3686   N N    . ARG A 1 246 ? 33.267  20.656  -28.835 0.02 17.60 ?  239  ARG A N    1  
ATOM   3687   C CA   . ARG A 1 246 ? 31.926  21.217  -28.732 0.02 17.54 ?  239  ARG A CA   1  
ATOM   3688   C C    . ARG A 1 246 ? 31.034  20.133  -28.161 0.02 17.28 ?  239  ARG A C    1  
ATOM   3689   O O    . ARG A 1 246 ? 31.270  18.947  -28.389 0.02 17.15 ?  239  ARG A O    1  
ATOM   3690   C CB   . ARG A 1 246 ? 31.331  21.648  -30.079 0.02 17.63 ?  239  ARG A CB   1  
ATOM   3691   C CG   . ARG A 1 246 ? 32.028  22.816  -30.794 0.02 17.94 ?  239  ARG A CG   1  
ATOM   3692   C CD   . ARG A 1 246 ? 33.169  22.298  -31.662 0.02 18.03 ?  239  ARG A CD   1  
ATOM   3693   N NE   . ARG A 1 246 ? 33.698  23.272  -32.616 0.02 18.35 ?  239  ARG A NE   1  
ATOM   3694   C CZ   . ARG A 1 246 ? 34.566  24.225  -32.310 0.02 18.59 ?  239  ARG A CZ   1  
ATOM   3695   N NH1  . ARG A 1 246 ? 35.017  25.023  -33.275 0.02 18.90 ?  239  ARG A NH1  1  
ATOM   3696   N NH2  . ARG A 1 246 ? 34.990  24.380  -31.060 0.02 18.54 ?  239  ARG A NH2  1  
ATOM   3697   H H    . ARG A 1 246 ? 33.260  19.814  -29.005 0.02 17.48 ?  239  ARG A H    1  
ATOM   3698   H HA   . ARG A 1 246 ? 31.928  21.980  -28.135 0.02 17.64 ?  239  ARG A HA   1  
ATOM   3699   H HB2  . ARG A 1 246 ? 31.358  20.885  -30.669 0.02 17.56 ?  239  ARG A HB2  1  
ATOM   3700   H HB3  . ARG A 1 246 ? 30.410  21.906  -29.936 0.02 17.59 ?  239  ARG A HB3  1  
ATOM   3701   H HG2  . ARG A 1 246 ? 31.392  23.274  -31.363 0.02 18.00 ?  239  ARG A HG2  1  
ATOM   3702   H HG3  . ARG A 1 246 ? 32.397  23.421  -30.131 0.02 18.03 ?  239  ARG A HG3  1  
ATOM   3703   H HD2  . ARG A 1 246 ? 33.901  22.018  -31.094 0.02 18.00 ?  239  ARG A HD2  1  
ATOM   3704   H HD3  . ARG A 1 246 ? 32.847  21.539  -32.170 0.02 17.93 ?  239  ARG A HD3  1  
ATOM   3705   H HE   . ARG A 1 246 ? 33.624  23.074  -33.449 0.02 18.40 ?  239  ARG A HE   1  
ATOM   3706   H HH11 . ARG A 1 246 ? 34.732  24.926  -34.078 0.02 18.94 ?  239  ARG A HH11 1  
ATOM   3707   H HH12 . ARG A 1 246 ? 35.564  25.659  -33.086 0.02 19.07 ?  239  ARG A HH12 1  
ATOM   3708   H HH21 . ARG A 1 246 ? 34.715  23.855  -30.438 0.02 18.36 ?  239  ARG A HH21 1  
ATOM   3709   H HH22 . ARG A 1 246 ? 35.549  25.002  -30.872 0.02 18.72 ?  239  ARG A HH22 1  
ATOM   3710   N N    . GLY A 1 247 ? 29.992  20.537  -27.458 0.02 17.23 ?  240  GLY A N    1  
ATOM   3711   C CA   . GLY A 1 247 ? 28.954  19.607  -27.045 0.02 17.02 ?  240  GLY A CA   1  
ATOM   3712   C C    . GLY A 1 247 ? 27.569  20.158  -27.304 0.02 17.03 ?  240  GLY A C    1  
ATOM   3713   O O    . GLY A 1 247 ? 27.348  21.348  -27.204 0.02 17.18 ?  240  GLY A O    1  
ATOM   3714   H H    . GLY A 1 247 ? 29.863  21.344  -27.198 0.02 17.33 ?  240  GLY A H    1  
ATOM   3715   H HA2  . GLY A 1 247 ? 29.052  18.786  -27.546 0.02 16.94 ?  240  GLY A HA2  1  
ATOM   3716   H HA3  . GLY A 1 247 ? 29.040  19.409  -26.101 0.02 16.97 ?  240  GLY A HA3  1  
ATOM   3717   N N    . ILE A 1 248 ? 26.645  19.260  -27.678 0.02 16.89 ?  241  ILE A N    1  
ATOM   3718   C CA   . ILE A 1 248 ? 25.230  19.585  -27.858 0.02 16.90 ?  241  ILE A CA   1  
ATOM   3719   C C    . ILE A 1 248 ? 24.398  18.642  -27.000 0.02 16.74 ?  241  ILE A C    1  
ATOM   3720   O O    . ILE A 1 248 ? 24.431  17.421  -27.189 0.02 16.62 ?  241  ILE A O    1  
ATOM   3721   C CB   . ILE A 1 248 ? 24.780  19.478  -29.322 0.02 16.96 ?  241  ILE A CB   1  
ATOM   3722   C CG1  . ILE A 1 248 ? 25.771  20.215  -30.218 0.02 17.13 ?  241  ILE A CG1  1  
ATOM   3723   C CG2  . ILE A 1 248 ? 23.321  20.019  -29.460 0.02 17.02 ?  241  ILE A CG2  1  
ATOM   3724   C CD1  . ILE A 1 248 ? 25.462  20.075  -31.690 0.02 17.21 ?  241  ILE A CD1  1  
ATOM   3725   H H    . ILE A 1 248 ? 26.818  18.437  -27.833 0.02 16.80 ?  241  ILE A H    1  
ATOM   3726   H HA   . ILE A 1 248 ? 25.078  20.490  -27.559 0.02 17.00 ?  241  ILE A HA   1  
ATOM   3727   H HB   . ILE A 1 248 ? 24.781  18.545  -29.567 0.02 16.86 ?  241  ILE A HB   1  
ATOM   3728   H HG12 . ILE A 1 248 ? 25.757  21.157  -29.994 0.02 17.24 ?  241  ILE A HG12 1  
ATOM   3729   H HG13 . ILE A 1 248 ? 26.657  19.850  -30.071 0.02 17.09 ?  241  ILE A HG13 1  
ATOM   3730   H HG21 . ILE A 1 248 ? 23.017  19.897  -30.372 0.02 17.07 ?  241  ILE A HG21 1  
ATOM   3731   H HG22 . ILE A 1 248 ? 22.741  19.528  -28.860 0.02 16.93 ?  241  ILE A HG22 1  
ATOM   3732   H HG23 . ILE A 1 248 ? 23.312  20.959  -29.226 0.02 17.13 ?  241  ILE A HG23 1  
ATOM   3733   H HD11 . ILE A 1 248 ? 26.088  20.608  -32.200 0.02 17.35 ?  241  ILE A HD11 1  
ATOM   3734   H HD12 . ILE A 1 248 ? 25.543  19.140  -31.930 0.02 17.12 ?  241  ILE A HD12 1  
ATOM   3735   H HD13 . ILE A 1 248 ? 24.559  20.378  -31.857 0.02 17.25 ?  241  ILE A HD13 1  
ATOM   3736   N N    . LEU A 1 249 ? 23.637  19.207  -26.075 0.02 16.77 ?  242  LEU A N    1  
ATOM   3737   C CA   . LEU A 1 249 ? 22.762  18.437  -25.205 0.02 16.67 ?  242  LEU A CA   1  
ATOM   3738   C C    . LEU A 1 249 ? 21.316  18.637  -25.652 0.02 16.72 ?  242  LEU A C    1  
ATOM   3739   O O    . LEU A 1 249 ? 20.715  19.682  -25.395 0.02 16.85 ?  242  LEU A O    1  
ATOM   3740   C CB   . LEU A 1 249 ? 22.958  18.870  -23.761 0.02 16.70 ?  242  LEU A CB   1  
ATOM   3741   C CG   . LEU A 1 249 ? 24.384  18.967  -23.223 0.02 16.72 ?  242  LEU A CG   1  
ATOM   3742   C CD1  . LEU A 1 249 ? 24.359  19.304  -21.726 0.02 16.77 ?  242  LEU A CD1  1  
ATOM   3743   C CD2  . LEU A 1 249 ? 25.161  17.689  -23.438 0.02 16.59 ?  242  LEU A CD2  1  
ATOM   3744   H H    . LEU A 1 249 ? 23.619  20.050  -25.919 0.02 16.87 ?  242  LEU A H    1  
ATOM   3745   H HA   . LEU A 1 249 ? 22.978  17.495  -25.279 0.02 16.57 ?  242  LEU A HA   1  
ATOM   3746   H HB2  . LEU A 1 249 ? 22.559  19.748  -23.667 0.02 16.80 ?  242  LEU A HB2  1  
ATOM   3747   H HB3  . LEU A 1 249 ? 22.486  18.237  -23.197 0.02 16.63 ?  242  LEU A HB3  1  
ATOM   3748   H HG   . LEU A 1 249 ? 24.848  19.678  -23.689 0.02 16.81 ?  242  LEU A HG   1  
ATOM   3749   H HD11 . LEU A 1 249 ? 25.230  19.110  -21.345 0.02 16.79 ?  242  LEU A HD11 1  
ATOM   3750   H HD12 . LEU A 1 249 ? 24.155  20.239  -21.612 0.02 16.88 ?  242  LEU A HD12 1  
ATOM   3751   H HD13 . LEU A 1 249 ? 23.683  18.761  -21.294 0.02 16.70 ?  242  LEU A HD13 1  
ATOM   3752   H HD21 . LEU A 1 249 ? 25.301  17.569  -24.390 0.02 16.58 ?  242  LEU A HD21 1  
ATOM   3753   H HD22 . LEU A 1 249 ? 26.015  17.768  -22.989 0.02 16.61 ?  242  LEU A HD22 1  
ATOM   3754   H HD23 . LEU A 1 249 ? 24.658  16.947  -23.075 0.02 16.51 ?  242  LEU A HD23 1  
ATOM   3755   N N    . MET A 1 250 ? 20.753  17.616  -26.273 0.02 16.65 ?  243  MET A N    1  
ATOM   3756   C CA   . MET A 1 250 ? 19.394  17.655  -26.802 0.02 16.73 ?  243  MET A CA   1  
ATOM   3757   C C    . MET A 1 250 ? 18.448  16.948  -25.838 0.02 16.68 ?  243  MET A C    1  
ATOM   3758   O O    . MET A 1 250 ? 18.496  15.730  -25.694 0.02 16.59 ?  243  MET A O    1  
ATOM   3759   C CB   . MET A 1 250 ? 19.364  16.995  -28.177 0.02 16.73 ?  243  MET A CB   1  
ATOM   3760   C CG   . MET A 1 250 ? 20.476  17.468  -29.096 0.02 16.78 ?  243  MET A CG   1  
ATOM   3761   S SD   . MET A 1 250 ? 20.595  16.488  -30.625 0.02 16.79 ?  243  MET A SD   1  
ATOM   3762   C CE   . MET A 1 250 ? 18.981  16.707  -31.388 0.02 16.93 ?  243  MET A CE   1  
ATOM   3763   H H    . MET A 1 250 ? 21.148  16.867  -26.421 0.02 16.58 ?  243  MET A H    1  
ATOM   3764   H HA   . MET A 1 250 ? 19.120  18.577  -26.893 0.02 16.83 ?  243  MET A HA   1  
ATOM   3765   H HB2  . MET A 1 250 ? 19.450  16.038  -28.070 0.02 16.64 ?  243  MET A HB2  1  
ATOM   3766   H HB3  . MET A 1 250 ? 18.522  17.210  -28.605 0.02 16.81 ?  243  MET A HB3  1  
ATOM   3767   H HG2  . MET A 1 250 ? 20.317  18.392  -29.337 0.02 16.90 ?  243  MET A HG2  1  
ATOM   3768   H HG3  . MET A 1 250 ? 21.325  17.391  -28.637 0.02 16.73 ?  243  MET A HG3  1  
ATOM   3769   H HE1  . MET A 1 250 ? 18.750  17.649  -31.383 0.02 17.02 ?  243  MET A HE1  1  
ATOM   3770   H HE2  . MET A 1 250 ? 19.023  16.374  -32.296 0.02 16.98 ?  243  MET A HE2  1  
ATOM   3771   H HE3  . MET A 1 250 ? 18.322  16.204  -30.886 0.02 16.88 ?  243  MET A HE3  1  
ATOM   3772   N N    . SER A 1 251 ? 17.604  17.723  -25.172 0.02 16.79 ?  244  SER A N    1  
ATOM   3773   C CA   . SER A 1 251 ? 16.617  17.224  -24.215 0.02 16.80 ?  244  SER A CA   1  
ATOM   3774   C C    . SER A 1 251 ? 17.260  16.323  -23.165 0.02 16.67 ?  244  SER A C    1  
ATOM   3775   O O    . SER A 1 251 ? 16.897  15.153  -23.018 0.02 16.62 ?  244  SER A O    1  
ATOM   3776   C CB   . SER A 1 251 ? 15.475  16.480  -24.910 0.02 16.84 ?  244  SER A CB   1  
ATOM   3777   O OG   . SER A 1 251 ? 14.775  17.313  -25.833 0.02 16.99 ?  244  SER A OG   1  
ATOM   3778   H H    . SER A 1 251 ? 17.590  18.577  -25.252 0.02 16.87 ?  244  SER A H    1  
ATOM   3779   H HA   . SER A 1 251 ? 16.231  17.982  -23.753 0.02 16.89 ?  244  SER A HA   1  
ATOM   3780   H HB2  . SER A 1 251 ? 15.857  15.727  -25.388 0.02 16.77 ?  244  SER A HB2  1  
ATOM   3781   H HB3  . SER A 1 251 ? 14.857  16.161  -24.235 0.02 16.87 ?  244  SER A HB3  1  
ATOM   3782   H HG   . SER A 1 251 ? 14.303  17.872  -25.426 0.02 17.07 ?  244  SER A HG   1  
ATOM   3783   N N    . GLY A 1 252 ? 18.208  16.891  -22.423 0.02 16.66 ?  245  GLY A N    1  
ATOM   3784   C CA   . GLY A 1 252 ? 18.736  16.210  -21.248 0.02 16.59 ?  245  GLY A CA   1  
ATOM   3785   C C    . GLY A 1 252 ? 20.145  16.611  -20.884 0.02 16.57 ?  245  GLY A C    1  
ATOM   3786   O O    . GLY A 1 252 ? 20.842  17.317  -21.603 0.02 16.59 ?  245  GLY A O    1  
ATOM   3787   H H    . GLY A 1 252 ? 18.554  17.660  -22.577 0.02 16.70 ?  245  GLY A H    1  
ATOM   3788   H HA2  . GLY A 1 252 ? 18.177  16.430  -20.489 0.02 16.66 ?  245  GLY A HA2  1  
ATOM   3789   H HA3  . GLY A 1 252 ? 18.708  15.252  -21.381 0.02 16.53 ?  245  GLY A HA3  1  
ATOM   3790   N N    . ASN A 1 253 ? 20.546  16.169  -19.698 0.02 16.55 ?  246  ASN A N    1  
ATOM   3791   C CA   . ASN A 1 253 ? 21.845  16.474  -19.113 0.02 16.57 ?  246  ASN A CA   1  
ATOM   3792   C C    . ASN A 1 253 ? 21.923  15.654  -17.841 0.02 16.57 ?  246  ASN A C    1  
ATOM   3793   O O    . ASN A 1 253 ? 20.935  15.059  -17.426 0.02 16.57 ?  246  ASN A O    1  
ATOM   3794   C CB   . ASN A 1 253 ? 22.019  17.972  -18.857 0.02 16.72 ?  246  ASN A CB   1  
ATOM   3795   C CG   . ASN A 1 253 ? 21.109  18.505  -17.790 0.02 16.84 ?  246  ASN A CG   1  
ATOM   3796   O OD1  . ASN A 1 253 ? 21.435  18.462  -16.618 0.02 16.90 ?  246  ASN A OD1  1  
ATOM   3797   N ND2  . ASN A 1 253 ? 19.969  19.032  -18.202 0.02 16.89 ?  246  ASN A ND2  1  
ATOM   3798   H H    . ASN A 1 253 ? 20.061  15.670  -19.197 0.02 16.55 ?  246  ASN A H    1  
ATOM   3799   H HA   . ASN A 1 253 ? 22.548  16.184  -19.711 0.02 16.51 ?  246  ASN A HA   1  
ATOM   3800   H HB2  . ASN A 1 253 ? 22.933  18.146  -18.584 0.02 16.75 ?  246  ASN A HB2  1  
ATOM   3801   H HB3  . ASN A 1 253 ? 21.819  18.453  -19.672 0.02 16.74 ?  246  ASN A HB3  1  
ATOM   3802   H HD21 . ASN A 1 253 ? 19.483  18.608  -18.771 0.02 16.84 ?  246  ASN A HD21 1  
ATOM   3803   H HD22 . ASN A 1 253 ? 19.713  19.796  -17.902 0.02 17.00 ?  246  ASN A HD22 1  
ATOM   3804   N N    . ALA A 1 254 ? 23.106  15.611  -17.235 0.02 16.59 ?  247  ALA A N    1  
ATOM   3805   C CA   . ALA A 1 254 ? 23.323  14.713  -16.101 0.02 16.60 ?  247  ALA A CA   1  
ATOM   3806   C C    . ALA A 1 254 ? 22.613  15.153  -14.824 0.02 16.74 ?  247  ALA A C    1  
ATOM   3807   O O    . ALA A 1 254 ? 22.458  14.341  -13.912 0.02 16.78 ?  247  ALA A O    1  
ATOM   3808   C CB   . ALA A 1 254 ? 24.822  14.555  -15.821 0.02 16.62 ?  247  ALA A CB   1  
ATOM   3809   H H    . ALA A 1 254 ? 23.778  16.062  -17.469 0.02 16.62 ?  247  ALA A H    1  
ATOM   3810   H HA   . ALA A 1 254 ? 22.983  13.838  -16.340 0.02 16.53 ?  247  ALA A HA   1  
ATOM   3811   H HB1  . ALA A 1 254 ? 24.929  13.938  -15.083 0.02 16.64 ?  247  ALA A HB1  1  
ATOM   3812   H HB2  . ALA A 1 254 ? 25.252  14.204  -16.615 0.02 16.55 ?  247  ALA A HB2  1  
ATOM   3813   H HB3  . ALA A 1 254 ? 25.199  15.419  -15.592 0.02 16.71 ?  247  ALA A HB3  1  
ATOM   3814   N N    . ILE A 1 255 ? 22.154  16.400  -14.728 0.02 16.85 ?  248  ILE A N    1  
ATOM   3815   C CA   . ILE A 1 255 ? 21.399  16.798  -13.539 0.02 17.01 ?  248  ILE A CA   1  
ATOM   3816   C C    . ILE A 1 255 ? 19.937  16.402  -13.584 0.02 17.02 ?  248  ILE A C    1  
ATOM   3817   O O    . ILE A 1 255 ? 19.259  16.492  -12.558 0.02 17.16 ?  248  ILE A O    1  
ATOM   3818   C CB   . ILE A 1 255 ? 21.592  18.310  -13.324 0.02 17.17 ?  248  ILE A CB   1  
ATOM   3819   C CG1  . ILE A 1 255 ? 22.657  18.518  -12.241 0.02 17.29 ?  248  ILE A CG1  1  
ATOM   3820   C CG2  . ILE A 1 255 ? 20.321  18.995  -12.844 0.02 17.33 ?  248  ILE A CG2  1  
ATOM   3821   C CD1  . ILE A 1 255 ? 24.078  18.554  -12.729 0.02 17.27 ?  248  ILE A CD1  1  
ATOM   3822   H H    . ILE A 1 255 ? 22.269  17.020  -15.311 0.02 16.85 ?  248  ILE A H    1  
ATOM   3823   H HA   . ILE A 1 255 ? 21.769  16.334  -12.774 0.02 17.03 ?  248  ILE A HA   1  
ATOM   3824   H HB   . ILE A 1 255 ? 21.885  18.726  -14.145 0.02 17.13 ?  248  ILE A HB   1  
ATOM   3825   H HG12 . ILE A 1 255 ? 22.479  19.365  -11.806 0.02 17.44 ?  248  ILE A HG12 1  
ATOM   3826   H HG13 . ILE A 1 255 ? 22.589  17.805  -11.588 0.02 17.27 ?  248  ILE A HG13 1  
ATOM   3827   H HG21 . ILE A 1 255 ? 20.528  19.927  -12.671 0.02 17.44 ?  248  ILE A HG21 1  
ATOM   3828   H HG22 . ILE A 1 255 ? 19.635  18.941  -13.524 0.02 17.28 ?  248  ILE A HG22 1  
ATOM   3829   H HG23 . ILE A 1 255 ? 20.023  18.587  -12.017 0.02 17.39 ?  248  ILE A HG23 1  
ATOM   3830   H HD11 . ILE A 1 255 ? 24.215  19.351  -13.261 0.02 17.31 ?  248  ILE A HD11 1  
ATOM   3831   H HD12 . ILE A 1 255 ? 24.666  18.564  -11.961 0.02 17.37 ?  248  ILE A HD12 1  
ATOM   3832   H HD13 . ILE A 1 255 ? 24.247  17.764  -13.262 0.02 17.13 ?  248  ILE A HD13 1  
ATOM   3833   N N    . CYS A 1 256 ? 19.440  15.937  -14.726 0.02 16.90 ?  249  CYS A N    1  
ATOM   3834   C CA   . CYS A 1 256 ? 18.091  15.401  -14.789 0.02 16.92 ?  249  CYS A CA   1  
ATOM   3835   C C    . CYS A 1 256 ? 17.901  14.305  -13.748 0.02 16.96 ?  249  CYS A C    1  
ATOM   3836   O O    . CYS A 1 256 ? 18.785  13.468  -13.552 0.02 16.89 ?  249  CYS A O    1  
ATOM   3837   C CB   . CYS A 1 256 ? 17.823  14.846  -16.177 0.02 16.80 ?  249  CYS A CB   1  
ATOM   3838   S SG   . CYS A 1 256 ? 17.828  16.142  -17.469 0.02 16.79 ?  249  CYS A SG   1  
ATOM   3839   H H    . CYS A 1 256 ? 19.860  15.919  -15.473 0.02 16.82 ?  249  CYS A H    1  
ATOM   3840   H HA   . CYS A 1 256 ? 17.456  16.111  -14.615 0.02 17.03 ?  249  CYS A HA   1  
ATOM   3841   H HB2  . CYS A 1 256 ? 18.528  14.214  -16.386 0.02 16.70 ?  249  CYS A HB2  1  
ATOM   3842   H HB3  . CYS A 1 256 ? 16.967  14.398  -16.184 0.02 16.83 ?  249  CYS A HB3  1  
ATOM   3843   H HG   . CYS A 1 256 ? 17.102  17.055  -17.205 0.02 16.92 ?  249  CYS A HG   1  
ATOM   3844   N N    . PRO A 1 257 ? 16.758  14.252  -13.074 0.02 17.10 ?  250  PRO A N    1  
ATOM   3845   C CA   . PRO A 1 257 ? 16.620  13.224  -12.035 0.02 17.17 ?  250  PRO A CA   1  
ATOM   3846   C C    . PRO A 1 257 ? 16.737  11.824  -12.591 0.02 17.08 ?  250  PRO A C    1  
ATOM   3847   O O    . PRO A 1 257 ? 17.396  11.004  -11.961 0.02 17.11 ?  250  PRO A O    1  
ATOM   3848   C CB   . PRO A 1 257 ? 15.247  13.503  -11.423 0.02 17.38 ?  250  PRO A CB   1  
ATOM   3849   C CG   . PRO A 1 257 ? 14.536  14.317  -12.405 0.02 17.37 ?  250  PRO A CG   1  
ATOM   3850   C CD   . PRO A 1 257 ? 15.547  15.083  -13.194 0.02 17.22 ?  250  PRO A CD   1  
ATOM   3851   H HA   . PRO A 1 257 ? 17.307  13.348  -11.360 0.02 17.19 ?  250  PRO A HA   1  
ATOM   3852   H HB2  . PRO A 1 257 ? 14.780  12.666  -11.267 0.02 17.43 ?  250  PRO A HB2  1  
ATOM   3853   H HB3  . PRO A 1 257 ? 15.360  13.987  -10.590 0.02 17.48 ?  250  PRO A HB3  1  
ATOM   3854   H HG2  . PRO A 1 257 ? 14.022  13.732  -12.984 0.02 17.35 ?  250  PRO A HG2  1  
ATOM   3855   H HG3  . PRO A 1 257 ? 13.949  14.929  -11.934 0.02 17.51 ?  250  PRO A HG3  1  
ATOM   3856   H HD2  . PRO A 1 257 ? 15.266  15.159  -14.116 0.02 17.16 ?  250  PRO A HD2  1  
ATOM   3857   H HD3  . PRO A 1 257 ? 15.705  15.953  -12.796 0.02 17.29 ?  250  PRO A HD3  1  
ATOM   3858   N N    . TRP A 1 258 ? 16.237  11.573  -13.806 0.02 16.97 ?  251  TRP A N    1  
ATOM   3859   C CA   . TRP A 1 258 ? 16.293  10.262  -14.441 0.02 16.89 ?  251  TRP A CA   1  
ATOM   3860   C C    . TRP A 1 258 ? 17.688  9.833   -14.866 0.02 16.74 ?  251  TRP A C    1  
ATOM   3861   O O    . TRP A 1 258 ? 17.853  8.667   -15.224 0.02 16.69 ?  251  TRP A O    1  
ATOM   3862   C CB   . TRP A 1 258 ? 15.391  10.217  -15.695 0.02 16.87 ?  251  TRP A CB   1  
ATOM   3863   C CG   . TRP A 1 258 ? 15.586  11.371  -16.663 0.02 16.80 ?  251  TRP A CG   1  
ATOM   3864   C CD1  . TRP A 1 258 ? 14.858  12.531  -16.710 0.02 16.90 ?  251  TRP A CD1  1  
ATOM   3865   C CD2  . TRP A 1 258 ? 16.560  11.478  -17.715 0.02 16.65 ?  251  TRP A CD2  1  
ATOM   3866   N NE1  . TRP A 1 258 ? 15.306  13.337  -17.716 0.02 16.82 ?  251  TRP A NE1  1  
ATOM   3867   C CE2  . TRP A 1 258 ? 16.347  12.717  -18.349 0.02 16.67 ?  251  TRP A CE2  1  
ATOM   3868   C CE3  . TRP A 1 258 ? 17.579  10.656  -18.178 0.02 16.53 ?  251  TRP A CE3  1  
ATOM   3869   C CZ2  . TRP A 1 258 ? 17.124  13.156  -19.412 0.02 16.58 ?  251  TRP A CZ2  1  
ATOM   3870   C CZ3  . TRP A 1 258 ? 18.345  11.098  -19.246 0.02 16.44 ?  251  TRP A CZ3  1  
ATOM   3871   C CH2  . TRP A 1 258 ? 18.100  12.331  -19.849 0.02 16.47 ?  251  TRP A CH2  1  
ATOM   3872   H H    . TRP A 1 258 ? 15.854  12.169  -14.287 0.02 16.96 ?  251  TRP A H    1  
ATOM   3873   H HA   . TRP A 1 258 ? 15.966  9.594   -13.819 0.02 16.97 ?  251  TRP A HA   1  
ATOM   3874   H HB2  . TRP A 1 258 ? 15.566  9.393   -16.172 0.02 16.82 ?  251  TRP A HB2  1  
ATOM   3875   H HB3  . TRP A 1 258 ? 14.464  10.230  -15.414 0.02 16.99 ?  251  TRP A HB3  1  
ATOM   3876   H HD1  . TRP A 1 258 ? 14.153  12.736  -16.146 0.02 17.01 ?  251  TRP A HD1  1  
ATOM   3877   H HE1  . TRP A 1 258 ? 14.989  14.108  -17.918 0.02 16.87 ?  251  TRP A HE1  1  
ATOM   3878   H HE3  . TRP A 1 258 ? 17.735  9.828   -17.787 0.02 16.53 ?  251  TRP A HE3  1  
ATOM   3879   H HZ2  . TRP A 1 258 ? 16.965  13.978  -19.813 0.02 16.62 ?  251  TRP A HZ2  1  
ATOM   3880   H HZ3  . TRP A 1 258 ? 19.027  10.558  -19.573 0.02 16.37 ?  251  TRP A HZ3  1  
ATOM   3881   H HH2  . TRP A 1 258 ? 18.632  12.602  -20.566 0.02 16.42 ?  251  TRP A HH2  1  
ATOM   3882   N N    . ALA A 1 259 ? 18.670  10.728  -14.830 0.02 16.69 ?  252  ALA A N    1  
ATOM   3883   C CA   . ALA A 1 259 ? 19.963  10.494  -15.463 0.02 16.57 ?  252  ALA A CA   1  
ATOM   3884   C C    . ALA A 1 259 ? 20.980  9.824   -14.563 0.02 16.59 ?  252  ALA A C    1  
ATOM   3885   O O    . ALA A 1 259 ? 22.067  9.494   -15.039 0.02 16.51 ?  252  ALA A O    1  
ATOM   3886   C CB   . ALA A 1 259 ? 20.547  11.811  -15.977 0.02 16.54 ?  252  ALA A CB   1  
ATOM   3887   H H    . ALA A 1 259 ? 18.610  11.489  -14.445 0.02 16.75 ?  252  ALA A H    1  
ATOM   3888   H HA   . ALA A 1 259 ? 19.828  9.909   -16.225 0.02 16.50 ?  252  ALA A HA   1  
ATOM   3889   H HB1  . ALA A 1 259 ? 21.456  11.657  -16.276 0.02 16.48 ?  252  ALA A HB1  1  
ATOM   3890   H HB2  . ALA A 1 259 ? 20.004  12.126  -16.718 0.02 16.51 ?  252  ALA A HB2  1  
ATOM   3891   H HB3  . ALA A 1 259 ? 20.545  12.466  -15.259 0.02 16.62 ?  252  ALA A HB3  1  
ATOM   3892   N N    . ASN A 1 260 ? 20.655  9.585   -13.297 0.02 16.72 ?  253  ASN A N    1  
ATOM   3893   C CA   . ASN A 1 260 ? 21.589  8.909   -12.408 0.02 16.78 ?  253  ASN A CA   1  
ATOM   3894   C C    . ASN A 1 260 ? 20.823  8.341   -11.219 0.02 16.96 ?  253  ASN A C    1  
ATOM   3895   O O    . ASN A 1 260 ? 19.793  8.890   -10.827 0.02 17.04 ?  253  ASN A O    1  
ATOM   3896   C CB   . ASN A 1 260 ? 22.699  9.883   -11.972 0.02 16.81 ?  253  ASN A CB   1  
ATOM   3897   C CG   . ASN A 1 260 ? 22.752  10.089  -10.524 0.02 16.99 ?  253  ASN A CG   1  
ATOM   3898   O OD1  . ASN A 1 260 ? 22.053  10.931  -9.999  0.02 17.10 ?  253  ASN A OD1  1  
ATOM   3899   N ND2  . ASN A 1 260 ? 23.582  9.309   -9.837  0.02 17.06 ?  253  ASN A ND2  1  
ATOM   3900   H H    . ASN A 1 260 ? 19.904  9.797   -12.937 0.02 16.80 ?  253  ASN A H    1  
ATOM   3901   H HA   . ASN A 1 260 ? 21.995  8.173   -12.885 0.02 16.72 ?  253  ASN A HA   1  
ATOM   3902   H HB2  . ASN A 1 260 ? 23.556  9.532   -12.256 0.02 16.76 ?  253  ASN A HB2  1  
ATOM   3903   H HB3  . ASN A 1 260 ? 22.540  10.749  -12.377 0.02 16.78 ?  253  ASN A HB3  1  
ATOM   3904   H HD21 . ASN A 1 260 ? 24.023  8.685   -10.237 0.02 17.01 ?  253  ASN A HD21 1  
ATOM   3905   H HD22 . ASN A 1 260 ? 23.674  9.425   -8.990  0.02 17.18 ?  253  ASN A HD22 1  
ATOM   3906   N N    . THR A 1 261 ? 21.316  7.224   -10.681 0.02 17.03 ?  254  THR A N    1  
ATOM   3907   C CA   . THR A 1 261 ? 20.629  6.467   -9.633  0.02 17.22 ?  254  THR A CA   1  
ATOM   3908   C C    . THR A 1 261 ? 21.679  5.823   -8.732  0.02 17.33 ?  254  THR A C    1  
ATOM   3909   O O    . THR A 1 261 ? 22.684  5.332   -9.221  0.02 17.24 ?  254  THR A O    1  
ATOM   3910   C CB   . THR A 1 261 ? 19.702  5.387   -10.241 0.02 17.23 ?  254  THR A CB   1  
ATOM   3911   O OG1  . THR A 1 261 ? 19.128  4.574   -9.210  0.02 17.45 ?  254  THR A OG1  1  
ATOM   3912   C CG2  . THR A 1 261 ? 20.440  4.484   -11.212 0.02 17.12 ?  254  THR A CG2  1  
ATOM   3913   H H    . THR A 1 261 ? 22.059  6.869   -10.920 0.02 16.99 ?  254  THR A H    1  
ATOM   3914   H HA   . THR A 1 261 ? 20.092  7.074   -9.102  0.02 17.31 ?  254  THR A HA   1  
ATOM   3915   H HB   . THR A 1 261 ? 18.984  5.819   -10.727 0.02 17.17 ?  254  THR A HB   1  
ATOM   3916   H HG1  . THR A 1 261 ? 19.739  4.236   -8.745  0.02 17.52 ?  254  THR A HG1  1  
ATOM   3917   H HG21 . THR A 1 261 ? 21.090  4.994   -11.718 0.02 16.99 ?  254  THR A HG21 1  
ATOM   3918   H HG22 . THR A 1 261 ? 20.895  3.777   -10.731 0.02 17.19 ?  254  THR A HG22 1  
ATOM   3919   H HG23 . THR A 1 261 ? 19.806  4.083   -11.823 0.02 17.13 ?  254  THR A HG23 1  
ATOM   3920   N N    . GLN A 1 262 ? 21.459  5.833   -7.419  0.02 17.55 ?  255  GLN A N    1  
ATOM   3921   C CA   . GLN A 1 262 ? 22.313  5.030   -6.546  0.02 17.70 ?  255  GLN A CA   1  
ATOM   3922   C C    . GLN A 1 262 ? 21.714  3.627   -6.462  0.02 17.80 ?  255  GLN A C    1  
ATOM   3923   O O    . GLN A 1 262 ? 20.890  3.323   -5.599  0.02 18.02 ?  255  GLN A O    1  
ATOM   3924   C CB   . GLN A 1 262 ? 22.474  5.711   -5.191  0.02 17.92 ?  255  GLN A CB   1  
ATOM   3925   C CG   . GLN A 1 262 ? 23.223  7.057   -5.312  0.02 17.85 ?  255  GLN A CG   1  
ATOM   3926   C CD   . GLN A 1 262 ? 24.583  6.924   -5.995  0.02 17.72 ?  255  GLN A CD   1  
ATOM   3927   O OE1  . GLN A 1 262 ? 24.793  7.415   -7.110  0.02 17.52 ?  255  GLN A OE1  1  
ATOM   3928   N NE2  . GLN A 1 262 ? 25.497  6.247   -5.340  0.02 17.88 ?  255  GLN A NE2  1  
ATOM   3929   H H    . GLN A 1 262 ? 20.852  6.286   -7.019  0.02 17.63 ?  255  GLN A H    1  
ATOM   3930   H HA   . GLN A 1 262 ? 23.190  4.951   -6.949  0.02 17.61 ?  255  GLN A HA   1  
ATOM   3931   H HB2  . GLN A 1 262 ? 21.594  5.889   -4.831  0.02 18.00 ?  255  GLN A HB2  1  
ATOM   3932   H HB3  . GLN A 1 262 ? 22.969  5.135   -4.591  0.02 18.04 ?  255  GLN A HB3  1  
ATOM   3933   H HG2  . GLN A 1 262 ? 22.686  7.678   -5.827  0.02 17.74 ?  255  GLN A HG2  1  
ATOM   3934   H HG3  . GLN A 1 262 ? 23.373  7.414   -4.421  0.02 18.01 ?  255  GLN A HG3  1  
ATOM   3935   H HE21 . GLN A 1 262 ? 25.358  6.030   -4.518  0.02 18.04 ?  255  GLN A HE21 1  
ATOM   3936   H HE22 . GLN A 1 262 ? 26.233  6.031   -5.728  0.02 17.82 ?  255  GLN A HE22 1  
ATOM   3937   N N    . CYS A 1 263 ? 22.154  2.743   -7.369  0.02 17.67 ?  256  CYS A N    1  
ATOM   3938   C CA   . CYS A 1 263 ? 21.515  1.455   -7.632  0.02 17.75 ?  256  CYS A CA   1  
ATOM   3939   C C    . CYS A 1 263 ? 22.256  0.261   -7.023  0.02 17.93 ?  256  CYS A C    1  
ATOM   3940   O O    . CYS A 1 263 ? 22.001  -0.874  -7.427  0.02 17.98 ?  256  CYS A O    1  
ATOM   3941   C CB   . CYS A 1 263 ? 21.374  1.252   -9.146  0.02 17.54 ?  256  CYS A CB   1  
ATOM   3942   S SG   . CYS A 1 263 ? 22.873  1.577   -10.165 0.02 17.32 ?  256  CYS A SG   1  
ATOM   3943   H H    . CYS A 1 263 ? 22.849  2.874   -7.859  0.02 17.55 ?  256  CYS A H    1  
ATOM   3944   H HA   . CYS A 1 263 ? 20.624  1.463   -7.258  0.02 17.86 ?  256  CYS A HA   1  
ATOM   3945   H HB2  . CYS A 1 263 ? 21.101  0.336   -9.309  0.02 17.61 ?  256  CYS A HB2  1  
ATOM   3946   H HB3  . CYS A 1 263 ? 20.684  1.850   -9.469  0.02 17.47 ?  256  CYS A HB3  1  
ATOM   3947   H HG   . CYS A 1 263 ? 23.100  2.754   -10.128 0.02 17.22 ?  256  CYS A HG   1  
ATOM   3948   N N    . GLN A 1 264 ? 23.090  0.487   -6.002  0.02 18.05 ?  257  GLN A N    1  
ATOM   3949   C CA   . GLN A 1 264 ? 23.971  -0.554  -5.486  0.02 18.23 ?  257  GLN A CA   1  
ATOM   3950   C C    . GLN A 1 264 ? 23.224  -1.708  -4.842  0.02 18.48 ?  257  GLN A C    1  
ATOM   3951   O O    . GLN A 1 264 ? 23.783  -2.804  -4.725  0.02 18.60 ?  257  GLN A O    1  
ATOM   3952   C CB   . GLN A 1 264 ? 24.940  0.029   -4.453  0.02 18.36 ?  257  GLN A CB   1  
ATOM   3953   C CG   . GLN A 1 264 ? 26.020  0.952   -5.027  0.02 18.17 ?  257  GLN A CG   1  
ATOM   3954   C CD   . GLN A 1 264 ? 25.464  2.199   -5.626  0.02 17.97 ?  257  GLN A CD   1  
ATOM   3955   O OE1  . GLN A 1 264 ? 24.522  2.772   -5.124  0.02 18.03 ?  257  GLN A OE1  1  
ATOM   3956   N NE2  . GLN A 1 264 ? 26.058  2.634   -6.732  0.02 17.74 ?  257  GLN A NE2  1  
ATOM   3957   H H    . GLN A 1 264 ? 23.153  1.236   -5.590  0.02 18.06 ?  257  GLN A H    1  
ATOM   3958   H HA   . GLN A 1 264 ? 24.490  -0.914  -6.220  0.02 18.12 ?  257  GLN A HA   1  
ATOM   3959   H HB2  . GLN A 1 264 ? 24.434  0.538   -3.800  0.02 18.45 ?  257  GLN A HB2  1  
ATOM   3960   H HB3  . GLN A 1 264 ? 25.395  -0.708  -4.019  0.02 18.52 ?  257  GLN A HB3  1  
ATOM   3961   H HG2  . GLN A 1 264 ? 26.640  1.206   -4.329  0.02 18.30 ?  257  GLN A HG2  1  
ATOM   3962   H HG3  . GLN A 1 264 ? 26.486  0.472   -5.728  0.02 18.08 ?  257  GLN A HG3  1  
ATOM   3963   H HE21 . GLN A 1 264 ? 26.814  2.307   -6.970  0.02 17.73 ?  257  GLN A HE21 1  
ATOM   3964   H HE22 . GLN A 1 264 ? 25.683  3.242   -7.205  0.02 17.63 ?  257  GLN A HE22 1  
ATOM   3965   N N    . HIS A 1 265 ? 21.998  -1.485  -4.371  0.02 18.61 ?  258  HIS A N    1  
ATOM   3966   C CA   . HIS A 1 265 ? 21.201  -2.542  -3.763  0.02 18.89 ?  258  HIS A CA   1  
ATOM   3967   C C    . HIS A 1 265 ? 20.343  -3.319  -4.755  0.02 18.84 ?  258  HIS A C    1  
ATOM   3968   O O    . HIS A 1 265 ? 19.849  -4.398  -4.424  0.02 19.08 ?  258  HIS A O    1  
ATOM   3969   C CB   . HIS A 1 265 ? 20.308  -1.914  -2.680  0.02 19.08 ?  258  HIS A CB   1  
ATOM   3970   C CG   . HIS A 1 265 ? 19.395  -2.878  -1.992  0.02 19.42 ?  258  HIS A CG   1  
ATOM   3971   N ND1  . HIS A 1 265 ? 19.853  -3.942  -1.239  0.02 19.70 ?  258  HIS A ND1  1  
ATOM   3972   C CD2  . HIS A 1 265 ? 18.045  -2.916  -1.918  0.02 19.56 ?  258  HIS A CD2  1  
ATOM   3973   C CE1  . HIS A 1 265 ? 18.819  -4.593  -0.735  0.02 19.99 ?  258  HIS A CE1  1  
ATOM   3974   N NE2  . HIS A 1 265 ? 17.712  -3.987  -1.129  0.02 19.91 ?  258  HIS A NE2  1  
ATOM   3975   H H    . HIS A 1 265 ? 21.603  -0.721  -4.387  0.02 18.55 ?  258  HIS A H    1  
ATOM   3976   H HA   . HIS A 1 265 ? 21.797  -3.168  -3.323  0.02 19.03 ?  258  HIS A HA   1  
ATOM   3977   H HB2  . HIS A 1 265 ? 20.874  -1.509  -2.014  0.02 19.14 ?  258  HIS A HB2  1  
ATOM   3978   H HB3  . HIS A 1 265 ? 19.754  -1.233  -3.095  0.02 18.95 ?  258  HIS A HB3  1  
ATOM   3979   H HD1  . HIS A 1 265 ? 20.677  -4.149  -1.113  0.02 19.70 ?  258  HIS A HD1  1  
ATOM   3980   H HD2  . HIS A 1 265 ? 17.450  -2.322  -2.317  0.02 19.45 ?  258  HIS A HD2  1  
ATOM   3981   H HE1  . HIS A 1 265 ? 18.863  -5.351  -0.201  0.02 20.23 ?  258  HIS A HE1  1  
ATOM   3982   N N    . ARG A 1 266 ? 20.175  -2.813  -5.979  0.02 18.55 ?  259  ARG A N    1  
ATOM   3983   C CA   . ARG A 1 266 ? 19.279  -3.462  -6.923  0.02 18.53 ?  259  ARG A CA   1  
ATOM   3984   C C    . ARG A 1 266 ? 19.896  -4.686  -7.614  0.02 18.54 ?  259  ARG A C    1  
ATOM   3985   O O    . ARG A 1 266 ? 19.153  -5.502  -8.150  0.02 18.64 ?  259  ARG A O    1  
ATOM   3986   C CB   . ARG A 1 266 ? 18.801  -2.419  -7.940  0.02 18.26 ?  259  ARG A CB   1  
ATOM   3987   C CG   . ARG A 1 266 ? 18.307  -1.147  -7.276  0.02 18.26 ?  259  ARG A CG   1  
ATOM   3988   C CD   . ARG A 1 266 ? 17.392  -0.322  -8.163  0.02 18.11 ?  259  ARG A CD   1  
ATOM   3989   N NE   . ARG A 1 266 ? 16.874  0.832   -7.441  0.02 18.16 ?  259  ARG A NE   1  
ATOM   3990   C CZ   . ARG A 1 266 ? 17.176  2.093   -7.684  0.02 17.98 ?  259  ARG A CZ   1  
ATOM   3991   N NH1  . ARG A 1 266 ? 17.943  2.424   -8.700  0.02 17.74 ?  259  ARG A NH1  1  
ATOM   3992   N NH2  . ARG A 1 266 ? 16.665  3.043   -6.902  0.02 18.09 ?  259  ARG A NH2  1  
ATOM   3993   H H    . ARG A 1 266 ? 20.553  -2.101  -6.270  0.02 18.39 ?  259  ARG A H    1  
ATOM   3994   H HA   . ARG A 1 266 ? 18.498  -3.772  -6.439  0.02 18.72 ?  259  ARG A HA   1  
ATOM   3995   H HB2  . ARG A 1 266 ? 19.543  -2.185  -8.518  0.02 18.09 ?  259  ARG A HB2  1  
ATOM   3996   H HB3  . ARG A 1 266 ? 18.069  -2.788  -8.455  0.02 18.29 ?  259  ARG A HB3  1  
ATOM   3997   H HG2  . ARG A 1 266 ? 17.811  -1.384  -6.477  0.02 18.47 ?  259  ARG A HG2  1  
ATOM   3998   H HG3  . ARG A 1 266 ? 19.074  -0.598  -7.041  0.02 18.18 ?  259  ARG A HG3  1  
ATOM   3999   H HD2  . ARG A 1 266 ? 17.887  -0.019  -8.932  0.02 17.91 ?  259  ARG A HD2  1  
ATOM   4000   H HD3  . ARG A 1 266 ? 16.640  -0.872  -8.430  0.02 18.20 ?  259  ARG A HD3  1  
ATOM   4001   H HE   . ARG A 1 266 ? 16.137  0.708   -7.019  0.02 18.31 ?  259  ARG A HE   1  
ATOM   4002   H HH11 . ARG A 1 266 ? 18.286  1.821   -9.205  0.02 17.68 ?  259  ARG A HH11 1  
ATOM   4003   H HH12 . ARG A 1 266 ? 18.113  3.251   -8.849  0.02 17.64 ?  259  ARG A HH12 1  
ATOM   4004   H HH21 . ARG A 1 266 ? 16.148  2.830   -6.254  0.02 18.27 ?  259  ARG A HH21 1  
ATOM   4005   H HH22 . ARG A 1 266 ? 16.825  3.869   -7.068  0.02 17.99 ?  259  ARG A HH22 1  
ATOM   4006   N N    . ALA A 1 267 ? 21.221  -4.867  -7.586  0.02 18.49 ?  260  ALA A N    1  
ATOM   4007   C CA   . ALA A 1 267 ? 21.785  -6.131  -8.054  0.02 18.58 ?  260  ALA A CA   1  
ATOM   4008   C C    . ALA A 1 267 ? 21.212  -7.303  -7.268  0.02 18.94 ?  260  ALA A C    1  
ATOM   4009   O O    . ALA A 1 267 ? 20.846  -8.334  -7.840  0.02 19.05 ?  260  ALA A O    1  
ATOM   4010   C CB   . ALA A 1 267 ? 23.312  -6.110  -7.938  0.02 18.52 ?  260  ALA A CB   1  
ATOM   4011   H H    . ALA A 1 267 ? 21.794  -4.287  -7.323  0.02 18.42 ?  260  ALA A H    1  
ATOM   4012   H HA   . ALA A 1 267 ? 21.557  -6.256  -8.987  0.02 18.46 ?  260  ALA A HA   1  
ATOM   4013   H HB1  . ALA A 1 267 ? 23.673  -6.912  -8.342  0.02 18.57 ?  260  ALA A HB1  1  
ATOM   4014   H HB2  . ALA A 1 267 ? 23.651  -5.323  -8.390  0.02 18.32 ?  260  ALA A HB2  1  
ATOM   4015   H HB3  . ALA A 1 267 ? 23.545  -6.074  -6.998  0.02 18.67 ?  260  ALA A HB3  1  
ATOM   4016   N N    . PHE A 1 268 ? 21.142  -7.157  -5.943  0.02 19.15 ?  261  PHE A N    1  
ATOM   4017   C CA   . PHE A 1 268 ? 20.571  -8.185  -5.097  0.02 19.53 ?  261  PHE A CA   1  
ATOM   4018   C C    . PHE A 1 268 ? 19.122  -8.437  -5.462  0.02 19.62 ?  261  PHE A C    1  
ATOM   4019   O O    . PHE A 1 268 ? 18.692  -9.584  -5.568  0.02 19.87 ?  261  PHE A O    1  
ATOM   4020   C CB   . PHE A 1 268 ? 20.696  -7.747  -3.640  0.02 19.73 ?  261  PHE A CB   1  
ATOM   4021   C CG   . PHE A 1 268 ? 19.850  -8.545  -2.661  0.02 20.14 ?  261  PHE A CG   1  
ATOM   4022   C CD1  . PHE A 1 268 ? 20.265  -9.778  -2.193  0.02 20.46 ?  261  PHE A CD1  1  
ATOM   4023   C CD2  . PHE A 1 268 ? 18.654  -8.031  -2.198  0.02 20.25 ?  261  PHE A CD2  1  
ATOM   4024   C CE1  . PHE A 1 268 ? 19.500  -10.481 -1.271  0.02 20.87 ?  261  PHE A CE1  1  
ATOM   4025   C CE2  . PHE A 1 268 ? 17.873  -8.736  -1.297  0.02 20.66 ?  261  PHE A CE2  1  
ATOM   4026   C CZ   . PHE A 1 268 ? 18.300  -9.956  -0.832  0.02 20.97 ?  261  PHE A CZ   1  
ATOM   4027   H H    . PHE A 1 268 ? 21.421  -6.465  -5.518  0.02 19.09 ?  261  PHE A H    1  
ATOM   4028   H HA   . PHE A 1 268 ? 21.068  -9.006  -5.210  0.02 19.63 ?  261  PHE A HA   1  
ATOM   4029   H HB2  . PHE A 1 268 ? 21.625  -7.834  -3.374  0.02 19.74 ?  261  PHE A HB2  1  
ATOM   4030   H HB3  . PHE A 1 268 ? 20.426  -6.820  -3.578  0.02 19.60 ?  261  PHE A HB3  1  
ATOM   4031   H HD1  . PHE A 1 268 ? 21.073  -10.132 -2.482  0.02 20.41 ?  261  PHE A HD1  1  
ATOM   4032   H HD2  . PHE A 1 268 ? 18.368  -7.203  -2.508  0.02 20.05 ?  261  PHE A HD2  1  
ATOM   4033   H HE1  . PHE A 1 268 ? 19.779  -11.313 -0.966  0.02 21.10 ?  261  PHE A HE1  1  
ATOM   4034   H HE2  . PHE A 1 268 ? 17.071  -8.379  -0.996  0.02 20.74 ?  261  PHE A HE2  1  
ATOM   4035   H HZ   . PHE A 1 268 ? 17.781  -10.433 -0.229  0.02 21.26 ?  261  PHE A HZ   1  
ATOM   4036   N N    . THR A 1 269 ? 18.357  -7.366  -5.656  0.02 19.46 ?  262  THR A N    1  
ATOM   4037   C CA   . THR A 1 269 ? 16.957  -7.509  -6.026  0.02 19.56 ?  262  THR A CA   1  
ATOM   4038   C C    . THR A 1 269 ? 16.815  -8.235  -7.363  0.02 19.48 ?  262  THR A C    1  
ATOM   4039   O O    . THR A 1 269 ? 15.973  -9.115  -7.519  0.02 19.72 ?  262  THR A O    1  
ATOM   4040   C CB   . THR A 1 269 ? 16.294  -6.134  -6.071  0.02 19.38 ?  262  THR A CB   1  
ATOM   4041   O OG1  . THR A 1 269 ? 16.442  -5.507  -4.779  0.02 19.50 ?  262  THR A OG1  1  
ATOM   4042   C CG2  . THR A 1 269 ? 14.827  -6.258  -6.410  0.02 19.53 ?  262  THR A CG2  1  
ATOM   4043   H H    . THR A 1 269 ? 18.620  -6.553  -5.580  0.02 19.30 ?  262  THR A H    1  
ATOM   4044   H HA   . THR A 1 269 ? 16.512  -8.038  -5.348  0.02 19.83 ?  262  THR A HA   1  
ATOM   4045   H HB   . THR A 1 269 ? 16.720  -5.589  -6.747  0.02 19.13 ?  262  THR A HB   1  
ATOM   4046   H HG1  . THR A 1 269 ? 16.113  -6.000  -4.188  0.02 19.73 ?  262  THR A HG1  1  
ATOM   4047   H HG21 . THR A 1 269 ? 14.434  -5.372  -6.461  0.02 19.42 ?  262  THR A HG21 1  
ATOM   4048   H HG22 . THR A 1 269 ? 14.709  -6.703  -7.264  0.02 19.48 ?  262  THR A HG22 1  
ATOM   4049   H HG23 . THR A 1 269 ? 14.372  -6.769  -5.723  0.02 19.80 ?  262  THR A HG23 1  
ATOM   4050   N N    . LEU A 1 270 ? 17.617  -7.858  -8.348  0.02 19.16 ?  263  LEU A N    1  
ATOM   4051   C CA   . LEU A 1 270 ? 17.582  -8.543  -9.633  0.02 19.10 ?  263  LEU A CA   1  
ATOM   4052   C C    . LEU A 1 270 ? 17.890  -10.029 -9.469  0.02 19.39 ?  263  LEU A C    1  
ATOM   4053   O O    . LEU A 1 270 ? 17.194  -10.892 -10.012 0.02 19.57 ?  263  LEU A O    1  
ATOM   4054   C CB   . LEU A 1 270 ? 18.586  -7.884  -10.570 0.02 18.75 ?  263  LEU A CB   1  
ATOM   4055   C CG   . LEU A 1 270 ? 18.800  -8.555  -11.918 0.02 18.68 ?  263  LEU A CG   1  
ATOM   4056   C CD1  . LEU A 1 270 ? 17.524  -8.571  -12.717 0.02 18.72 ?  263  LEU A CD1  1  
ATOM   4057   C CD2  . LEU A 1 270 ? 19.884  -7.810  -12.629 0.02 18.36 ?  263  LEU A CD2  1  
ATOM   4058   H H    . LEU A 1 270 ? 18.184  -7.217  -8.294  0.02 18.99 ?  263  LEU A H    1  
ATOM   4059   H HA   . LEU A 1 270 ? 16.702  -8.450  -10.021 0.02 19.12 ?  263  LEU A HA   1  
ATOM   4060   H HB2  . LEU A 1 270 ? 18.311  -6.971  -10.727 0.02 18.59 ?  263  LEU A HB2  1  
ATOM   4061   H HB3  . LEU A 1 270 ? 19.445  -7.884  -10.122 0.02 18.73 ?  263  LEU A HB3  1  
ATOM   4062   H HG   . LEU A 1 270 ? 19.093  -9.469  -11.784 0.02 18.85 ?  263  LEU A HG   1  
ATOM   4063   H HD11 . LEU A 1 270 ? 17.732  -8.414  -13.650 0.02 18.59 ?  263  LEU A HD11 1  
ATOM   4064   H HD12 . LEU A 1 270 ? 17.107  -9.440  -12.614 0.02 18.96 ?  263  LEU A HD12 1  
ATOM   4065   H HD13 . LEU A 1 270 ? 16.931  -7.881  -12.389 0.02 18.67 ?  263  LEU A HD13 1  
ATOM   4066   H HD21 . LEU A 1 270 ? 20.017  -8.202  -13.507 0.02 18.33 ?  263  LEU A HD21 1  
ATOM   4067   H HD22 . LEU A 1 270 ? 19.614  -6.884  -12.714 0.02 18.21 ?  263  LEU A HD22 1  
ATOM   4068   H HD23 . LEU A 1 270 ? 20.700  -7.871  -12.110 0.02 18.37 ?  263  LEU A HD23 1  
ATOM   4069   N N    . ALA A 1 271 ? 18.905  -10.352 -8.677  0.02 19.47 ?  264  ALA A N    1  
ATOM   4070   C CA   . ALA A 1 271 ? 19.254  -11.751 -8.469  0.02 19.78 ?  264  ALA A CA   1  
ATOM   4071   C C    . ALA A 1 271 ? 18.086  -12.516 -7.864  0.02 20.17 ?  264  ALA A C    1  
ATOM   4072   O O    . ALA A 1 271 ? 17.718  -13.589 -8.353  0.02 20.39 ?  264  ALA A O    1  
ATOM   4073   C CB   . ALA A 1 271 ? 20.484  -11.851 -7.576  0.02 19.84 ?  264  ALA A CB   1  
ATOM   4074   H H    . ALA A 1 271 ? 19.394  -9.793  -8.252  0.02 19.38 ?  264  ALA A H    1  
ATOM   4075   H HA   . ALA A 1 271 ? 19.468  -12.160 -9.321  0.02 19.72 ?  264  ALA A HA   1  
ATOM   4076   H HB1  . ALA A 1 271 ? 20.785  -12.771 -7.551  0.02 20.03 ?  264  ALA A HB1  1  
ATOM   4077   H HB2  . ALA A 1 271 ? 21.179  -11.280 -7.935  0.02 19.60 ?  264  ALA A HB2  1  
ATOM   4078   H HB3  . ALA A 1 271 ? 20.246  -11.553 -6.684  0.02 19.95 ?  264  ALA A HB3  1  
ATOM   4079   N N    . LYS A 1 272 ? 17.494  -11.969 -6.791  0.02 20.28 ?  265  LYS A N    1  
ATOM   4080   C CA   . LYS A 1 272 ? 16.322  -12.580 -6.173  0.02 20.67 ?  265  LYS A CA   1  
ATOM   4081   C C    . LYS A 1 272 ? 15.230  -12.831 -7.202  0.02 20.70 ?  265  LYS A C    1  
ATOM   4082   O O    . LYS A 1 272 ? 14.588  -13.894 -7.200  0.02 21.05 ?  265  LYS A O    1  
ATOM   4083   C CB   . LYS A 1 272 ? 15.755  -11.690 -5.059  0.02 20.73 ?  265  LYS A CB   1  
ATOM   4084   C CG   . LYS A 1 272 ? 16.644  -11.488 -3.830  0.02 20.78 ?  265  LYS A CG   1  
ATOM   4085   C CD   . LYS A 1 272 ? 16.353  -12.464 -2.737  0.02 21.26 ?  265  LYS A CD   1  
ATOM   4086   C CE   . LYS A 1 272 ? 17.195  -13.670 -2.856  0.02 21.45 ?  265  LYS A CE   1  
ATOM   4087   N NZ   . LYS A 1 272 ? 17.708  -14.053 -1.515  0.02 21.79 ?  265  LYS A NZ   1  
ATOM   4088   H H    . LYS A 1 272 ? 17.748  -11.240 -6.415  0.02 20.16 ?  265  LYS A H    1  
ATOM   4089   H HA   . LYS A 1 272 ? 16.575  -13.428 -5.777  0.02 20.92 ?  265  LYS A HA   1  
ATOM   4090   H HB2  . LYS A 1 272 ? 15.565  -10.815 -5.430  0.02 20.50 ?  265  LYS A HB2  1  
ATOM   4091   H HB3  . LYS A 1 272 ? 14.928  -12.088 -4.751  0.02 21.00 ?  265  LYS A HB3  1  
ATOM   4092   H HG2  . LYS A 1 272 ? 17.574  -11.575 -4.093  0.02 20.65 ?  265  LYS A HG2  1  
ATOM   4093   H HG3  . LYS A 1 272 ? 16.490  -10.599 -3.476  0.02 20.65 ?  265  LYS A HG3  1  
ATOM   4094   H HD2  . LYS A 1 272 ? 16.542  -12.057 -1.875  0.02 21.30 ?  265  LYS A HD2  1  
ATOM   4095   H HD3  . LYS A 1 272 ? 15.424  -12.742 -2.771  0.02 21.44 ?  265  LYS A HD3  1  
ATOM   4096   H HE2  . LYS A 1 272 ? 16.649  -14.394 -3.196  0.02 21.62 ?  265  LYS A HE2  1  
ATOM   4097   H HE3  . LYS A 1 272 ? 17.942  -13.497 -3.439  0.02 21.21 ?  265  LYS A HE3  1  
ATOM   4098   H HZ1  . LYS A 1 272 ? 18.227  -14.774 -1.581  0.02 21.86 ?  265  LYS A HZ1  1  
ATOM   4099   H HZ2  . LYS A 1 272 ? 18.183  -13.387 -1.163  0.02 21.68 ?  265  LYS A HZ2  1  
ATOM   4100   H HZ3  . LYS A 1 272 ? 17.022  -14.235 -0.977  0.02 22.06 ?  265  LYS A HZ3  1  
ATOM   4101   N N    . LEU A 1 273 ? 14.953  -11.834 -8.037  0.02 20.37 ?  266  LEU A N    1  
ATOM   4102   C CA   . LEU A 1 273 ? 13.901  -11.970 -9.037  0.02 20.40 ?  266  LEU A CA   1  
ATOM   4103   C C    . LEU A 1 273 ? 14.218  -13.070 -10.030 0.02 20.46 ?  266  LEU A C    1  
ATOM   4104   O O    . LEU A 1 273 ? 13.302  -13.621 -10.644 0.02 20.65 ?  266  LEU A O    1  
ATOM   4105   C CB   . LEU A 1 273 ? 13.708  -10.646 -9.792  0.02 20.02 ?  266  LEU A CB   1  
ATOM   4106   C CG   . LEU A 1 273 ? 12.768  -9.578  -9.234  0.02 20.01 ?  266  LEU A CG   1  
ATOM   4107   C CD1  . LEU A 1 273 ? 13.076  -8.178  -9.824  0.02 19.59 ?  266  LEU A CD1  1  
ATOM   4108   C CD2  . LEU A 1 273 ? 11.370  -10.010 -9.540  0.02 20.28 ?  266  LEU A CD2  1  
ATOM   4109   H H    . LEU A 1 273 ? 15.354  -11.076 -8.041  0.02 20.14 ?  266  LEU A H    1  
ATOM   4110   H HA   . LEU A 1 273 ? 13.069  -12.191 -8.597  0.02 20.65 ?  266  LEU A HA   1  
ATOM   4111   H HB2  . LEU A 1 273 ? 14.581  -10.228 -9.871  0.02 19.79 ?  266  LEU A HB2  1  
ATOM   4112   H HB3  . LEU A 1 273 ? 13.392  -10.867 -10.681 0.02 20.00 ?  266  LEU A HB3  1  
ATOM   4113   H HG   . LEU A 1 273 ? 12.863  -9.528  -8.270  0.02 20.14 ?  266  LEU A HG   1  
ATOM   4114   H HD11 . LEU A 1 273 ? 13.133  -8.253  -10.789 0.02 19.47 ?  266  LEU A HD11 1  
ATOM   4115   H HD12 . LEU A 1 273 ? 12.366  -7.564  -9.580  0.02 19.61 ?  266  LEU A HD12 1  
ATOM   4116   H HD13 . LEU A 1 273 ? 13.918  -7.857  -9.468  0.02 19.45 ?  266  LEU A HD13 1  
ATOM   4117   H HD21 . LEU A 1 273 ? 10.758  -9.301  -9.290  0.02 20.25 ?  266  LEU A HD21 1  
ATOM   4118   H HD22 . LEU A 1 273 ? 11.301  -10.188 -10.491 0.02 20.21 ?  266  LEU A HD22 1  
ATOM   4119   H HD23 . LEU A 1 273 ? 11.171  -10.815 -9.037  0.02 20.57 ?  266  LEU A HD23 1  
ATOM   4120   N N    . ALA A 1 274 ? 15.504  -13.370 -10.233 0.02 20.33 ?  267  ALA A N    1  
ATOM   4121   C CA   . ALA A 1 274 ? 15.957  -14.460 -11.090 0.02 20.40 ?  267  ALA A CA   1  
ATOM   4122   C C    . ALA A 1 274 ? 16.075  -15.793 -10.366 0.02 20.82 ?  267  ALA A C    1  
ATOM   4123   O O    . ALA A 1 274 ? 16.458  -16.784 -10.983 0.02 20.92 ?  267  ALA A O    1  
ATOM   4124   C CB   . ALA A 1 274 ? 17.322  -14.116 -11.708 0.02 20.04 ?  267  ALA A CB   1  
ATOM   4125   H H    . ALA A 1 274 ? 16.154  -12.931 -9.883  0.02 20.20 ?  267  ALA A H    1  
ATOM   4126   H HA   . ALA A 1 274 ? 15.320  -14.572 -11.810 0.02 20.42 ?  267  ALA A HA   1  
ATOM   4127   H HB1  . ALA A 1 274 ? 17.615  -14.861 -12.255 0.02 20.11 ?  267  ALA A HB1  1  
ATOM   4128   H HB2  . ALA A 1 274 ? 17.240  -13.315 -12.248 0.02 19.80 ?  267  ALA A HB2  1  
ATOM   4129   H HB3  . ALA A 1 274 ? 17.953  -13.963 -10.990 0.02 20.00 ?  267  ALA A HB3  1  
ATOM   4130   N N    . GLY A 1 275 ? 15.815  -15.843 -9.075  0.02 21.08 ?  268  GLY A N    1  
ATOM   4131   C CA   . GLY A 1 275 ? 15.803  -17.114 -8.363  0.02 21.54 ?  268  GLY A CA   1  
ATOM   4132   C C    . GLY A 1 275 ? 16.993  -17.366 -7.466  0.02 21.62 ?  268  GLY A C    1  
ATOM   4133   O O    . GLY A 1 275 ? 17.114  -18.469 -6.925  0.02 22.04 ?  268  GLY A O    1  
ATOM   4134   H H    . GLY A 1 275 ? 15.639  -15.157 -8.588  0.02 21.02 ?  268  GLY A H    1  
ATOM   4135   H HA2  . GLY A 1 275 ? 15.003  -17.165 -7.820  0.02 21.78 ?  268  GLY A HA2  1  
ATOM   4136   H HA3  . GLY A 1 275 ? 15.771  -17.836 -9.006  0.02 21.60 ?  268  GLY A HA3  1  
ATOM   4137   N N    . TYR A 1 276 ? 17.888  -16.400 -7.322  0.02 21.27 ?  269  TYR A N    1  
ATOM   4138   C CA   . TYR A 1 276 ? 18.941  -16.484 -6.328  0.02 21.36 ?  269  TYR A CA   1  
ATOM   4139   C C    . TYR A 1 276 ? 18.356  -16.751 -4.952  0.02 21.76 ?  269  TYR A C    1  
ATOM   4140   O O    . TYR A 1 276 ? 17.352  -16.164 -4.571  0.02 21.78 ?  269  TYR A O    1  
ATOM   4141   C CB   . TYR A 1 276 ? 19.722  -15.176 -6.322  0.02 20.94 ?  269  TYR A CB   1  
ATOM   4142   C CG   . TYR A 1 276 ? 20.715  -15.043 -5.195  0.02 21.03 ?  269  TYR A CG   1  
ATOM   4143   C CD1  . TYR A 1 276 ? 21.868  -15.815 -5.168  0.02 21.16 ?  269  TYR A CD1  1  
ATOM   4144   C CD2  . TYR A 1 276 ? 20.493  -14.144 -4.158  0.02 21.01 ?  269  TYR A CD2  1  
ATOM   4145   C CE1  . TYR A 1 276 ? 22.772  -15.687 -4.156  0.02 21.27 ?  269  TYR A CE1  1  
ATOM   4146   C CE2  . TYR A 1 276 ? 21.394  -14.015 -3.138  0.02 21.12 ?  269  TYR A CE2  1  
ATOM   4147   C CZ   . TYR A 1 276 ? 22.530  -14.785 -3.141  0.02 21.25 ?  269  TYR A CZ   1  
ATOM   4148   O OH   . TYR A 1 276 ? 23.468  -14.658 -2.132  0.02 21.39 ?  269  TYR A OH   1  
ATOM   4149   H H    . TYR A 1 276 ? 17.913  -15.687 -7.799  0.02 20.99 ?  269  TYR A H    1  
ATOM   4150   H HA   . TYR A 1 276 ? 19.546  -17.206 -6.548  0.02 21.47 ?  269  TYR A HA   1  
ATOM   4151   H HB2  . TYR A 1 276 ? 20.216  -15.108 -7.153  0.02 20.73 ?  269  TYR A HB2  1  
ATOM   4152   H HB3  . TYR A 1 276 ? 19.096  -14.440 -6.255  0.02 20.83 ?  269  TYR A HB3  1  
ATOM   4153   H HD1  . TYR A 1 276 ? 22.037  -16.422 -5.850  0.02 21.20 ?  269  TYR A HD1  1  
ATOM   4154   H HD2  . TYR A 1 276 ? 19.729  -13.622 -4.166  0.02 20.93 ?  269  TYR A HD2  1  
ATOM   4155   H HE1  . TYR A 1 276 ? 23.543  -16.205 -4.150  0.02 21.38 ?  269  TYR A HE1  1  
ATOM   4156   H HE2  . TYR A 1 276 ? 21.243  -13.405 -2.454  0.02 21.12 ?  269  TYR A HE2  1  
ATOM   4157   H HH   . TYR A 1 276 ? 23.528  -13.853 -1.910  0.02 21.24 ?  269  TYR A HH   1  
ATOM   4158   N N    . LYS A 1 277 ? 18.996  -17.627 -4.203  0.02 22.08 ?  270  LYS A N    1  
ATOM   4159   C CA   . LYS A 1 277 ? 18.696  -17.777 -2.793  0.02 22.46 ?  270  LYS A CA   1  
ATOM   4160   C C    . LYS A 1 277 ? 19.996  -17.657 -2.029  0.02 22.49 ?  270  LYS A C    1  
ATOM   4161   O O    . LYS A 1 277 ? 20.990  -18.305 -2.372  0.02 22.50 ?  270  LYS A O    1  
ATOM   4162   C CB   . LYS A 1 277 ? 18.014  -19.109 -2.517  0.02 22.98 ?  270  LYS A CB   1  
ATOM   4163   C CG   . LYS A 1 277 ? 16.698  -19.305 -3.275  0.02 23.00 ?  270  LYS A CG   1  
ATOM   4164   C CD   . LYS A 1 277 ? 15.670  -18.226 -2.963  0.02 22.90 ?  270  LYS A CD   1  
ATOM   4165   C CE   . LYS A 1 277 ? 14.235  -18.631 -3.334  0.02 23.16 ?  270  LYS A CE   1  
ATOM   4166   N NZ   . LYS A 1 277 ? 13.980  -18.617 -4.770  0.02 22.88 ?  270  LYS A NZ   1  
ATOM   4167   H H    . LYS A 1 277 ? 19.615  -18.150 -4.481  0.02 22.10 ?  270  LYS A H    1  
ATOM   4168   H HA   . LYS A 1 277 ? 18.115  -17.060 -2.504  0.02 22.38 ?  270  LYS A HA   1  
ATOM   4169   H HB2  . LYS A 1 277 ? 18.613  -19.825 -2.774  0.02 23.09 ?  270  LYS A HB2  1  
ATOM   4170   H HB3  . LYS A 1 277 ? 17.821  -19.166 -1.570  0.02 23.24 ?  270  LYS A HB3  1  
ATOM   4171   H HG2  . LYS A 1 277 ? 16.881  -19.279 -4.227  0.02 22.74 ?  270  LYS A HG2  1  
ATOM   4172   H HG3  . LYS A 1 277 ? 16.315  -20.163 -3.033  0.02 23.36 ?  270  LYS A HG3  1  
ATOM   4173   H HD2  . LYS A 1 277 ? 15.696  -18.011 -2.022  0.02 23.07 ?  270  LYS A HD2  1  
ATOM   4174   H HD3  . LYS A 1 277 ? 15.885  -17.440 -3.479  0.02 22.54 ?  270  LYS A HD3  1  
ATOM   4175   H HE2  . LYS A 1 277 ? 14.050  -19.524 -3.001  0.02 23.53 ?  270  LYS A HE2  1  
ATOM   4176   H HE3  . LYS A 1 277 ? 13.623  -17.990 -2.950  0.02 23.15 ?  270  LYS A HE3  1  
ATOM   4177   H HZ1  . LYS A 1 277 ? 13.938  -17.777 -5.060  0.02 22.56 ?  270  LYS A HZ1  1  
ATOM   4178   H HZ2  . LYS A 1 277 ? 14.637  -19.037 -5.197  0.02 22.87 ?  270  LYS A HZ2  1  
ATOM   4179   H HZ3  . LYS A 1 277 ? 13.207  -19.021 -4.947  0.02 23.07 ?  270  LYS A HZ3  1  
ATOM   4180   N N    . GLY A 1 278 ? 19.991  -16.808 -1.015  0.02 22.53 ?  271  GLY A N    1  
ATOM   4181   C CA   . GLY A 1 278 ? 21.188  -16.557 -0.247  0.02 22.53 ?  271  GLY A CA   1  
ATOM   4182   C C    . GLY A 1 278 ? 21.069  -15.204 0.425   0.02 22.31 ?  271  GLY A C    1  
ATOM   4183   O O    . GLY A 1 278 ? 20.009  -14.589 0.428   0.02 22.22 ?  271  GLY A O    1  
ATOM   4184   H H    . GLY A 1 278 ? 19.303  -16.366 -0.756  0.02 22.58 ?  271  GLY A H    1  
ATOM   4185   H HA2  . GLY A 1 278 ? 21.299  -17.247 0.425   0.02 22.88 ?  271  GLY A HA2  1  
ATOM   4186   H HA3  . GLY A 1 278 ? 21.966  -16.559 -0.824  0.02 22.34 ?  271  GLY A HA3  1  
ATOM   4187   N N    . GLU A 1 279 ? 22.198  -14.746 0.960   0.02 22.26 ?  272  GLU A N    1  
ATOM   4188   C CA   . GLU A 1 279 ? 22.261  -13.486 1.680   0.02 22.12 ?  272  GLU A CA   1  
ATOM   4189   C C    . GLU A 1 279 ? 22.433  -12.299 0.739   0.02 21.59 ?  272  GLU A C    1  
ATOM   4190   O O    . GLU A 1 279 ? 22.839  -12.426 -0.426  0.02 21.31 ?  272  GLU A O    1  
ATOM   4191   C CB   . GLU A 1 279 ? 23.425  -13.493 2.671   0.02 22.31 ?  272  GLU A CB   1  
ATOM   4192   C CG   . GLU A 1 279 ? 23.513  -14.696 3.565   0.02 22.84 ?  272  GLU A CG   1  
ATOM   4193   C CD   . GLU A 1 279 ? 22.372  -14.769 4.567   0.02 23.19 ?  272  GLU A CD   1  
ATOM   4194   O OE1  . GLU A 1 279 ? 21.906  -13.715 5.028   0.02 23.07 ?  272  GLU A OE1  1  
ATOM   4195   O OE2  . GLU A 1 279 ? 21.930  -15.886 4.869   0.02 23.60 -1 272  GLU A OE2  1  
ATOM   4196   H H    . GLU A 1 279 ? 22.948  -15.162 0.928   0.02 22.32 ?  272  GLU A H    1  
ATOM   4197   H HA   . GLU A 1 279 ? 21.437  -13.362 2.177   0.02 22.28 ?  272  GLU A HA   1  
ATOM   4198   H HB2  . GLU A 1 279 ? 24.249  -13.442 2.163   0.02 22.12 ?  272  GLU A HB2  1  
ATOM   4199   H HB3  . GLU A 1 279 ? 23.346  -12.713 3.239   0.02 22.27 ?  272  GLU A HB3  1  
ATOM   4200   H HG2  . GLU A 1 279 ? 23.483  -15.500 3.020   0.02 22.91 ?  272  GLU A HG2  1  
ATOM   4201   H HG3  . GLU A 1 279 ? 24.345  -14.661 4.060   0.02 22.93 ?  272  GLU A HG3  1  
ATOM   4202   N N    . ASP A 1 280 ? 22.152  -11.119 1.275   0.02 21.49 ?  273  ASP A N    1  
ATOM   4203   C CA   . ASP A 1 280 ? 22.474  -9.872  0.590   0.02 21.04 ?  273  ASP A CA   1  
ATOM   4204   C C    . ASP A 1 280 ? 23.955  -9.609  0.774   0.02 20.99 ?  273  ASP A C    1  
ATOM   4205   O O    . ASP A 1 280 ? 24.391  -8.909  1.697   0.02 21.13 ?  273  ASP A O    1  
ATOM   4206   C CB   . ASP A 1 280 ? 21.666  -8.705  1.115   0.02 21.01 ?  273  ASP A CB   1  
ATOM   4207   C CG   . ASP A 1 280 ? 21.729  -7.537  0.189   0.02 20.55 ?  273  ASP A CG   1  
ATOM   4208   O OD1  . ASP A 1 280 ? 22.847  -7.089  -0.148  0.02 20.30 ?  273  ASP A OD1  1  
ATOM   4209   O OD2  . ASP A 1 280 ? 20.646  -7.129  -0.257  0.02 20.47 -1 273  ASP A OD2  1  
ATOM   4210   H H    . ASP A 1 280 ? 21.765  -11.015 2.032   0.02 21.69 ?  273  ASP A H    1  
ATOM   4211   H HA   . ASP A 1 280 ? 22.297  -9.965  -0.360  0.02 20.83 ?  273  ASP A HA   1  
ATOM   4212   H HB2  . ASP A 1 280 ? 20.738  -8.973  1.204   0.02 21.16 ?  273  ASP A HB2  1  
ATOM   4213   H HB3  . ASP A 1 280 ? 22.018  -8.431  1.975   0.02 21.15 ?  273  ASP A HB3  1  
ATOM   4214   N N    . ASN A 1 281 ? 24.729  -10.203 -0.119  0.02 20.83 ?  274  ASN A N    1  
ATOM   4215   C CA   . ASN A 1 281 ? 26.171  -10.186 -0.034  0.02 20.81 ?  274  ASN A CA   1  
ATOM   4216   C C    . ASN A 1 281 ? 26.683  -10.006 -1.444  0.02 20.42 ?  274  ASN A C    1  
ATOM   4217   O O    . ASN A 1 281 ? 26.413  -10.856 -2.290  0.02 20.39 ?  274  ASN A O    1  
ATOM   4218   C CB   . ASN A 1 281 ? 26.698  -11.478 0.560   0.02 21.21 ?  274  ASN A CB   1  
ATOM   4219   C CG   . ASN A 1 281 ? 28.191  -11.494 0.628   0.02 21.26 ?  274  ASN A CG   1  
ATOM   4220   O OD1  . ASN A 1 281 ? 28.858  -12.050 -0.249  0.02 21.12 ?  274  ASN A OD1  1  
ATOM   4221   N ND2  . ASN A 1 281 ? 28.731  -10.804 1.617   0.02 21.48 ?  274  ASN A ND2  1  
ATOM   4222   H H    . ASN A 1 281 ? 24.430  -10.641 -0.792  0.02 20.75 ?  274  ASN A H    1  
ATOM   4223   H HA   . ASN A 1 281 ? 26.471  -9.438  0.501   0.02 20.81 ?  274  ASN A HA   1  
ATOM   4224   H HB2  . ASN A 1 281 ? 26.351  -11.572 1.461   0.02 21.47 ?  274  ASN A HB2  1  
ATOM   4225   H HB3  . ASN A 1 281 ? 26.412  -12.220 0.008   0.02 21.20 ?  274  ASN A HB3  1  
ATOM   4226   H HD21 . ASN A 1 281 ? 28.256  -10.222 2.037   0.02 21.38 ?  274  ASN A HD21 1  
ATOM   4227   H HD22 . ASN A 1 281 ? 29.553  -10.929 1.834   0.02 21.73 ?  274  ASN A HD22 1  
ATOM   4228   N N    . ASP A 1 282 ? 27.404  -8.907  -1.664  0.02 20.16 ?  275  ASP A N    1  
ATOM   4229   C CA   . ASP A 1 282 ? 27.797  -8.519  -3.011  0.02 19.79 ?  275  ASP A CA   1  
ATOM   4230   C C    . ASP A 1 282 ? 28.459  -9.687  -3.733  0.02 19.85 ?  275  ASP A C    1  
ATOM   4231   O O    . ASP A 1 282 ? 28.177  -9.943  -4.906  0.02 19.67 ?  275  ASP A O    1  
ATOM   4232   C CB   . ASP A 1 282 ? 28.755  -7.320  -2.965  0.02 19.62 ?  275  ASP A CB   1  
ATOM   4233   C CG   . ASP A 1 282 ? 28.089  -5.996  -2.574  0.02 19.50 ?  275  ASP A CG   1  
ATOM   4234   O OD1  . ASP A 1 282 ? 26.842  -5.863  -2.541  0.02 19.48 ?  275  ASP A OD1  1  
ATOM   4235   O OD2  . ASP A 1 282 ? 28.855  -5.049  -2.293  0.02 19.45 -1 275  ASP A OD2  1  
ATOM   4236   H H    . ASP A 1 282 ? 27.682  -8.376  -1.052  0.02 20.21 ?  275  ASP A H    1  
ATOM   4237   H HA   . ASP A 1 282 ? 27.008  -8.254  -3.510  0.02 19.64 ?  275  ASP A HA   1  
ATOM   4238   H HB2  . ASP A 1 282 ? 29.452  -7.503  -2.317  0.02 19.80 ?  275  ASP A HB2  1  
ATOM   4239   H HB3  . ASP A 1 282 ? 29.149  -7.200  -3.843  0.02 19.41 ?  275  ASP A HB3  1  
ATOM   4240   N N    . LYS A 1 283 ? 29.380  -10.383 -3.054  0.02 20.13 ?  276  LYS A N    1  
ATOM   4241   C CA   . LYS A 1 283 ? 30.127  -11.458 -3.704  0.02 20.23 ?  276  LYS A CA   1  
ATOM   4242   C C    . LYS A 1 283 ? 29.203  -12.558 -4.176  0.02 20.33 ?  276  LYS A C    1  
ATOM   4243   O O    . LYS A 1 283 ? 29.289  -12.978 -5.330  0.02 20.17 ?  276  LYS A O    1  
ATOM   4244   C CB   . LYS A 1 283 ? 31.200  -12.068 -2.802  0.02 20.59 ?  276  LYS A CB   1  
ATOM   4245   C CG   . LYS A 1 283 ? 31.772  -13.389 -3.390  0.02 20.79 ?  276  LYS A CG   1  
ATOM   4246   C CD   . LYS A 1 283 ? 32.219  -13.249 -4.832  0.02 20.49 ?  276  LYS A CD   1  
ATOM   4247   C CE   . LYS A 1 283 ? 32.892  -14.511 -5.472  0.02 20.72 ?  276  LYS A CE   1  
ATOM   4248   N NZ   . LYS A 1 283 ? 32.302  -15.900 -5.398  0.02 20.99 ?  276  LYS A NZ   1  
ATOM   4249   H H    . LYS A 1 283 ? 29.582  -10.251 -2.230  0.02 20.27 ?  276  LYS A H    1  
ATOM   4250   H HA   . LYS A 1 283 ? 30.575  -11.099 -4.481  0.02 20.01 ?  276  LYS A HA   1  
ATOM   4251   H HB2  . LYS A 1 283 ? 31.936  -11.439 -2.728  0.02 20.52 ?  276  LYS A HB2  1  
ATOM   4252   H HB3  . LYS A 1 283 ? 30.833  -12.258 -1.924  0.02 20.80 ?  276  LYS A HB3  1  
ATOM   4253   H HG2  . LYS A 1 283 ? 32.553  -13.592 -2.823  0.02 20.99 ?  276  LYS A HG2  1  
ATOM   4254   H HG3  . LYS A 1 283 ? 31.137  -14.125 -3.336  0.02 20.95 ?  276  LYS A HG3  1  
ATOM   4255   H HD2  . LYS A 1 283 ? 31.476  -12.995 -5.390  0.02 20.36 ?  276  LYS A HD2  1  
ATOM   4256   H HD3  . LYS A 1 283 ? 32.881  -12.540 -4.854  0.02 20.31 ?  276  LYS A HD3  1  
ATOM   4257   H HE2  . LYS A 1 283 ? 32.928  -14.307 -6.416  0.02 20.52 ?  276  LYS A HE2  1  
ATOM   4258   H HE3  . LYS A 1 283 ? 33.807  -14.590 -5.073  0.02 20.91 ?  276  LYS A HE3  1  
ATOM   4259   H HZ1  . LYS A 1 283 ? 31.574  -15.946 -5.906  0.02 20.84 ?  276  LYS A HZ1  1  
ATOM   4260   H HZ2  . LYS A 1 283 ? 32.893  -16.494 -5.696  0.02 21.10 ?  276  LYS A HZ2  1  
ATOM   4261   H HZ3  . LYS A 1 283 ? 32.093  -16.107 -4.559  0.02 21.20 ?  276  LYS A HZ3  1  
ATOM   4262   N N    . ASP A 1 284 ? 28.341  -13.075 -3.289  0.02 20.63 ?  277  ASP A N    1  
ATOM   4263   C CA   . ASP A 1 284 ? 27.517  -14.204 -3.695  0.02 20.80 ?  277  ASP A CA   1  
ATOM   4264   C C    . ASP A 1 284 ? 26.511  -13.774 -4.751  0.02 20.50 ?  277  ASP A C    1  
ATOM   4265   O O    . ASP A 1 284 ? 26.136  -14.571 -5.618  0.02 20.53 ?  277  ASP A O    1  
ATOM   4266   C CB   . ASP A 1 284 ? 26.785  -14.835 -2.505  0.02 21.23 ?  277  ASP A CB   1  
ATOM   4267   C CG   . ASP A 1 284 ? 27.733  -15.417 -1.432  0.02 21.60 ?  277  ASP A CG   1  
ATOM   4268   O OD1  . ASP A 1 284 ? 28.878  -15.791 -1.769  0.02 21.59 ?  277  ASP A OD1  1  
ATOM   4269   O OD2  . ASP A 1 284 ? 27.292  -15.513 -0.253  0.02 21.93 -1 277  ASP A OD2  1  
ATOM   4270   H H    . ASP A 1 284 ? 28.214  -12.794 -2.489  0.02 20.75 ?  277  ASP A H    1  
ATOM   4271   H HA   . ASP A 1 284 ? 28.094  -14.862 -4.092  0.02 20.87 ?  277  ASP A HA   1  
ATOM   4272   H HB2  . ASP A 1 284 ? 26.233  -14.157 -2.086  0.02 21.18 ?  277  ASP A HB2  1  
ATOM   4273   H HB3  . ASP A 1 284 ? 26.228  -15.559 -2.833  0.02 21.34 ?  277  ASP A HB3  1  
ATOM   4274   N N    . VAL A 1 285 ? 26.082  -12.513 -4.697  0.02 20.24 ?  278  VAL A N    1  
ATOM   4275   C CA   . VAL A 1 285 ? 25.153  -11.991 -5.695  0.02 19.95 ?  278  VAL A CA   1  
ATOM   4276   C C    . VAL A 1 285 ? 25.833  -11.872 -7.046  0.02 19.67 ?  278  VAL A C    1  
ATOM   4277   O O    . VAL A 1 285 ? 25.243  -12.211 -8.076  0.02 19.58 ?  278  VAL A O    1  
ATOM   4278   C CB   . VAL A 1 285 ? 24.582  -10.641 -5.247  0.02 19.77 ?  278  VAL A CB   1  
ATOM   4279   C CG1  . VAL A 1 285 ? 23.892  -9.915  -6.408  0.02 19.43 ?  278  VAL A CG1  1  
ATOM   4280   C CG2  . VAL A 1 285 ? 23.595  -10.873 -4.138  0.02 20.07 ?  278  VAL A CG2  1  
ATOM   4281   H H    . VAL A 1 285 ? 26.318  -11.945 -4.099  0.02 20.24 ?  278  VAL A H    1  
ATOM   4282   H HA   . VAL A 1 285 ? 24.414  -12.611 -5.785  0.02 20.10 ?  278  VAL A HA   1  
ATOM   4283   H HB   . VAL A 1 285 ? 25.303  -10.087 -4.918  0.02 19.70 ?  278  VAL A HB   1  
ATOM   4284   H HG11 . VAL A 1 285 ? 23.453  -9.122  -6.066  0.02 19.34 ?  278  VAL A HG11 1  
ATOM   4285   H HG12 . VAL A 1 285 ? 24.545  -9.652  -7.073  0.02 19.24 ?  278  VAL A HG12 1  
ATOM   4286   H HG13 . VAL A 1 285 ? 23.233  -10.509 -6.799  0.02 19.51 ?  278  VAL A HG13 1  
ATOM   4287   H HG21 . VAL A 1 285 ? 23.551  -10.076 -3.590  0.02 20.02 ?  278  VAL A HG21 1  
ATOM   4288   H HG22 . VAL A 1 285 ? 22.728  -11.062 -4.525  0.02 20.06 ?  278  VAL A HG22 1  
ATOM   4289   H HG23 . VAL A 1 285 ? 23.894  -11.629 -3.608  0.02 20.33 ?  278  VAL A HG23 1  
ATOM   4290   N N    . LEU A 1 286 ? 27.073  -11.383 -7.070  0.02 19.54 ?  279  LEU A N    1  
ATOM   4291   C CA   . LEU A 1 286 ? 27.780  -11.296 -8.344  0.02 19.30 ?  279  LEU A CA   1  
ATOM   4292   C C    . LEU A 1 286 ? 28.044  -12.688 -8.909  0.02 19.50 ?  279  LEU A C    1  
ATOM   4293   O O    . LEU A 1 286 ? 27.874  -12.917 -10.115 0.02 19.37 ?  279  LEU A O    1  
ATOM   4294   C CB   . LEU A 1 286 ? 29.073  -10.507 -8.168  0.02 19.18 ?  279  LEU A CB   1  
ATOM   4295   C CG   . LEU A 1 286 ? 29.939  -10.296 -9.402  0.02 18.97 ?  279  LEU A CG   1  
ATOM   4296   C CD1  . LEU A 1 286 ? 29.214  -9.451  -10.454 0.02 18.64 ?  279  LEU A CD1  1  
ATOM   4297   C CD2  . LEU A 1 286 ? 31.257  -9.666  -8.996  0.02 18.97 ?  279  LEU A CD2  1  
ATOM   4298   H H    . LEU A 1 286 ? 27.516  -11.102 -6.393  0.02 19.60 ?  279  LEU A H    1  
ATOM   4299   H HA   . LEU A 1 286 ? 27.223  -10.819 -8.976  0.02 19.11 ?  279  LEU A HA   1  
ATOM   4300   H HB2  . LEU A 1 286 ? 28.843  -9.623  -7.847  0.02 19.06 ?  279  LEU A HB2  1  
ATOM   4301   H HB3  . LEU A 1 286 ? 29.616  -10.962 -7.506  0.02 19.39 ?  279  LEU A HB3  1  
ATOM   4302   H HG   . LEU A 1 286 ? 30.133  -11.161 -9.791  0.02 19.08 ?  279  LEU A HG   1  
ATOM   4303   H HD11 . LEU A 1 286 ? 29.839  -9.228  -11.160 0.02 18.51 ?  279  LEU A HD11 1  
ATOM   4304   H HD12 . LEU A 1 286 ? 28.476  -9.969  -10.809 0.02 18.67 ?  279  LEU A HD12 1  
ATOM   4305   H HD13 . LEU A 1 286 ? 28.885  -8.638  -10.043 0.02 18.56 ?  279  LEU A HD13 1  
ATOM   4306   H HD21 . LEU A 1 286 ? 31.890  -9.762  -9.724  0.02 18.93 ?  279  LEU A HD21 1  
ATOM   4307   H HD22 . LEU A 1 286 ? 31.115  -8.727  -8.804  0.02 18.81 ?  279  LEU A HD22 1  
ATOM   4308   H HD23 . LEU A 1 286 ? 31.594  -10.119 -8.207  0.02 19.19 ?  279  LEU A HD23 1  
ATOM   4309   N N    . GLU A 1 287 ? 28.467  -13.632 -8.057  0.02 19.85 ?  280  GLU A N    1  
ATOM   4310   C CA   . GLU A 1 287 ? 28.671  -15.009 -8.514  0.02 20.09 ?  280  GLU A CA   1  
ATOM   4311   C C    . GLU A 1 287 ? 27.442  -15.526 -9.241  0.02 20.12 ?  280  GLU A C    1  
ATOM   4312   O O    . GLU A 1 287 ? 27.551  -16.182 -10.285 0.02 20.12 ?  280  GLU A O    1  
ATOM   4313   C CB   . GLU A 1 287 ? 29.034  -15.945 -7.343  0.02 20.52 ?  280  GLU A CB   1  
ATOM   4314   C CG   . GLU A 1 287 ? 27.883  -16.813 -6.758  0.02 20.87 ?  280  GLU A CG   1  
ATOM   4315   C CD   . GLU A 1 287 ? 28.223  -17.542 -5.415  0.02 21.34 ?  280  GLU A CD   1  
ATOM   4316   O OE1  . GLU A 1 287 ? 28.562  -16.854 -4.434  0.02 21.39 ?  280  GLU A OE1  1  
ATOM   4317   O OE2  . GLU A 1 287 ? 28.160  -18.811 -5.345  0.02 21.69 -1 280  GLU A OE2  1  
ATOM   4318   H H    . GLU A 1 287 ? 28.643  -13.500 -7.227  0.02 19.97 ?  280  GLU A H    1  
ATOM   4319   H HA   . GLU A 1 287 ? 29.411  -15.018 -9.142  0.02 19.98 ?  280  GLU A HA   1  
ATOM   4320   H HB2  . GLU A 1 287 ? 29.706  -16.566 -7.660  0.02 20.61 ?  280  GLU A HB2  1  
ATOM   4321   H HB3  . GLU A 1 287 ? 29.404  -15.416 -6.621  0.02 20.51 ?  280  GLU A HB3  1  
ATOM   4322   H HG2  . GLU A 1 287 ? 27.122  -16.242 -6.603  0.02 20.79 ?  280  GLU A HG2  1  
ATOM   4323   H HG3  . GLU A 1 287 ? 27.653  -17.495 -7.408  0.02 20.92 ?  280  GLU A HG3  1  
ATOM   4324   N N    . PHE A 1 288 ? 26.260  -15.221 -8.716  0.02 20.16 ?  281  PHE A N    1  
ATOM   4325   C CA   . PHE A 1 288 ? 25.025  -15.675 -9.335  0.02 20.21 ?  281  PHE A CA   1  
ATOM   4326   C C    . PHE A 1 288 ? 24.768  -14.937 -10.652 0.02 19.84 ?  281  PHE A C    1  
ATOM   4327   O O    . PHE A 1 288 ? 24.384  -15.549 -11.655 0.02 19.88 ?  281  PHE A O    1  
ATOM   4328   C CB   . PHE A 1 288 ? 23.879  -15.481 -8.339  0.02 20.36 ?  281  PHE A CB   1  
ATOM   4329   C CG   . PHE A 1 288 ? 22.554  -15.772 -8.908  0.02 20.46 ?  281  PHE A CG   1  
ATOM   4330   C CD1  . PHE A 1 288 ? 21.820  -14.772 -9.479  0.02 20.19 ?  281  PHE A CD1  1  
ATOM   4331   C CD2  . PHE A 1 288 ? 22.033  -17.050 -8.874  0.02 20.85 ?  281  PHE A CD2  1  
ATOM   4332   C CE1  . PHE A 1 288 ? 20.582  -15.037 -10.039 0.02 20.31 ?  281  PHE A CE1  1  
ATOM   4333   C CE2  . PHE A 1 288 ? 20.804  -17.317 -9.417  0.02 20.98 ?  281  PHE A CE2  1  
ATOM   4334   C CZ   . PHE A 1 288 ? 20.073  -16.298 -9.994  0.02 20.71 ?  281  PHE A CZ   1  
ATOM   4335   H H    . PHE A 1 288 ? 26.151  -14.756 -8.004  0.02 20.18 ?  281  PHE A H    1  
ATOM   4336   H HA   . PHE A 1 288 ? 25.090  -16.620 -9.529  0.02 20.43 ?  281  PHE A HA   1  
ATOM   4337   H HB2  . PHE A 1 288 ? 24.019  -16.063 -7.579  0.02 20.62 ?  281  PHE A HB2  1  
ATOM   4338   H HB3  . PHE A 1 288 ? 23.879  -14.558 -8.052  0.02 20.16 ?  281  PHE A HB3  1  
ATOM   4339   H HD1  . PHE A 1 288 ? 22.161  -13.908 -9.512  0.02 19.94 ?  281  PHE A HD1  1  
ATOM   4340   H HD2  . PHE A 1 288 ? 22.523  -17.738 -8.488  0.02 21.05 ?  281  PHE A HD2  1  
ATOM   4341   H HE1  . PHE A 1 288 ? 20.091  -14.344 -10.421 0.02 20.15 ?  281  PHE A HE1  1  
ATOM   4342   H HE2  . PHE A 1 288 ? 20.460  -18.180 -9.391  0.02 21.27 ?  281  PHE A HE2  1  
ATOM   4343   H HZ   . PHE A 1 288 ? 19.236  -16.475 -10.361 0.02 20.82 ?  281  PHE A HZ   1  
ATOM   4344   N N    . LEU A 1 289 ? 25.003  -13.626 -10.679 0.02 19.51 ?  282  LEU A N    1  
ATOM   4345   C CA   . LEU A 1 289 ? 24.670  -12.872 -11.875 0.02 19.20 ?  282  LEU A CA   1  
ATOM   4346   C C    . LEU A 1 289 ? 25.658  -13.147 -12.992 0.02 19.09 ?  282  LEU A C    1  
ATOM   4347   O O    . LEU A 1 289 ? 25.313  -12.981 -14.163 0.02 18.95 ?  282  LEU A O    1  
ATOM   4348   C CB   . LEU A 1 289 ? 24.623  -11.380 -11.581 0.02 18.91 ?  282  LEU A CB   1  
ATOM   4349   C CG   . LEU A 1 289 ? 23.518  -10.966 -10.609 0.02 19.00 ?  282  LEU A CG   1  
ATOM   4350   C CD1  . LEU A 1 289 ? 23.805  -9.589  -10.098 0.02 18.78 ?  282  LEU A CD1  1  
ATOM   4351   C CD2  . LEU A 1 289 ? 22.144  -11.042 -11.271 0.02 19.00 ?  282  LEU A CD2  1  
ATOM   4352   H H    . LEU A 1 289 ? 25.355  -13.166 -10.045 0.02 19.48 ?  282  LEU A H    1  
ATOM   4353   H HA   . LEU A 1 289 ? 23.790  -13.141 -12.180 0.02 19.26 ?  282  LEU A HA   1  
ATOM   4354   H HB2  . LEU A 1 289 ? 25.471  -11.101 -11.205 0.02 18.87 ?  282  LEU A HB2  1  
ATOM   4355   H HB3  . LEU A 1 289 ? 24.463  -10.905 -12.409 0.02 18.72 ?  282  LEU A HB3  1  
ATOM   4356   H HG   . LEU A 1 289 ? 23.522  -11.581 -9.858  0.02 19.23 ?  282  LEU A HG   1  
ATOM   4357   H HD11 . LEU A 1 289 ? 23.042  -9.292  -9.576  0.02 18.83 ?  282  LEU A HD11 1  
ATOM   4358   H HD12 . LEU A 1 289 ? 24.594  -9.622  -9.537  0.02 18.84 ?  282  LEU A HD12 1  
ATOM   4359   H HD13 . LEU A 1 289 ? 23.952  -8.989  -10.845 0.02 18.56 ?  282  LEU A HD13 1  
ATOM   4360   H HD21 . LEU A 1 289 ? 21.490  -10.625 -10.690 0.02 19.03 ?  282  LEU A HD21 1  
ATOM   4361   H HD22 . LEU A 1 289 ? 22.176  -10.572 -12.118 0.02 18.79 ?  282  LEU A HD22 1  
ATOM   4362   H HD23 . LEU A 1 289 ? 21.911  -11.971 -11.418 0.02 19.20 ?  282  LEU A HD23 1  
ATOM   4363   N N    . MET A 1 290 ? 26.874  -13.568 -12.646 0.02 19.18 ?  283  MET A N    1  
ATOM   4364   C CA   . MET A 1 290 ? 27.889  -13.882 -13.649 0.02 19.14 ?  283  MET A CA   1  
ATOM   4365   C C    . MET A 1 290 ? 27.564  -15.142 -14.441 0.02 19.37 ?  283  MET A C    1  
ATOM   4366   O O    . MET A 1 290 ? 28.034  -15.280 -15.577 0.02 19.30 ?  283  MET A O    1  
ATOM   4367   C CB   . MET A 1 290 ? 29.253  -14.031 -12.975 0.02 19.25 ?  283  MET A CB   1  
ATOM   4368   C CG   . MET A 1 290 ? 29.871  -12.719 -12.535 0.02 19.02 ?  283  MET A CG   1  
ATOM   4369   S SD   . MET A 1 290 ? 30.269  -11.625 -13.903 0.02 18.64 ?  283  MET A SD   1  
ATOM   4370   C CE   . MET A 1 290 ? 31.730  -12.462 -14.535 0.02 18.79 ?  283  MET A CE   1  
ATOM   4371   H H    . MET A 1 290 ? 27.138  -13.678 -11.837 0.02 19.29 ?  283  MET A H    1  
ATOM   4372   H HA   . MET A 1 290 ? 27.951  -13.135 -14.263 0.02 18.91 ?  283  MET A HA   1  
ATOM   4373   H HB2  . MET A 1 290 ? 29.155  -14.586 -12.189 0.02 19.47 ?  283  MET A HB2  1  
ATOM   4374   H HB3  . MET A 1 290 ? 29.860  -14.453 -13.600 0.02 19.28 ?  283  MET A HB3  1  
ATOM   4375   H HG2  . MET A 1 290 ? 29.243  -12.254 -11.963 0.02 18.98 ?  283  MET A HG2  1  
ATOM   4376   H HG3  . MET A 1 290 ? 30.693  -12.900 -12.054 0.02 19.14 ?  283  MET A HG3  1  
ATOM   4377   H HE1  . MET A 1 290 ? 32.084  -11.956 -15.280 0.02 18.64 ?  283  MET A HE1  1  
ATOM   4378   H HE2  . MET A 1 290 ? 32.388  -12.519 -13.826 0.02 18.88 ?  283  MET A HE2  1  
ATOM   4379   H HE3  . MET A 1 290 ? 31.482  -13.351 -14.823 0.02 18.97 ?  283  MET A HE3  1  
ATOM   4380   N N    . LYS A 1 291 ? 26.802  -16.068 -13.879 0.02 19.67 ?  284  LYS A N    1  
ATOM   4381   C CA   . LYS A 1 291 ? 26.442  -17.304 -14.557 0.02 19.94 ?  284  LYS A CA   1  
ATOM   4382   C C    . LYS A 1 291 ? 25.109  -17.219 -15.282 0.02 19.88 ?  284  LYS A C    1  
ATOM   4383   O O    . LYS A 1 291 ? 24.760  -18.157 -15.999 0.02 20.08 ?  284  LYS A O    1  
ATOM   4384   C CB   . LYS A 1 291 ? 26.379  -18.464 -13.560 0.02 20.36 ?  284  LYS A CB   1  
ATOM   4385   C CG   . LYS A 1 291 ? 27.481  -18.453 -12.530 0.02 20.47 ?  284  LYS A CG   1  
ATOM   4386   C CD   . LYS A 1 291 ? 27.314  -19.608 -11.543 0.02 20.93 ?  284  LYS A CD   1  
ATOM   4387   C CE   . LYS A 1 291 ? 27.652  -20.931 -12.241 0.02 21.21 ?  284  LYS A CE   1  
ATOM   4388   N NZ   . LYS A 1 291 ? 26.602  -21.999 -12.157 0.02 21.62 ?  284  LYS A NZ   1  
ATOM   4389   H H    . LYS A 1 291 ? 26.479  -16.006 -13.086 0.02 19.74 ?  284  LYS A H    1  
ATOM   4390   H HA   . LYS A 1 291 ? 27.121  -17.516 -15.216 0.02 19.93 ?  284  LYS A HA   1  
ATOM   4391   H HB2  . LYS A 1 291 ? 25.531  -18.433 -13.091 0.02 20.39 ?  284  LYS A HB2  1  
ATOM   4392   H HB3  . LYS A 1 291 ? 26.446  -19.290 -14.062 0.02 20.55 ?  284  LYS A HB3  1  
ATOM   4393   H HG2  . LYS A 1 291 ? 28.333  -18.558 -12.982 0.02 20.42 ?  284  LYS A HG2  1  
ATOM   4394   H HG3  . LYS A 1 291 ? 27.462  -17.622 -12.038 0.02 20.32 ?  284  LYS A HG3  1  
ATOM   4395   H HD2  . LYS A 1 291 ? 27.899  -19.483 -10.780 0.02 21.00 ?  284  LYS A HD2  1  
ATOM   4396   H HD3  . LYS A 1 291 ? 26.387  -19.645 -11.259 0.02 21.01 ?  284  LYS A HD3  1  
ATOM   4397   H HE2  . LYS A 1 291 ? 27.799  -20.739 -13.176 0.02 21.03 ?  284  LYS A HE2  1  
ATOM   4398   H HE3  . LYS A 1 291 ? 28.450  -21.310 -11.872 0.02 21.31 ?  284  LYS A HE3  1  
ATOM   4399   H HZ1  . LYS A 1 291 ? 26.987  -22.798 -12.113 0.02 21.85 ?  284  LYS A HZ1  1  
ATOM   4400   H HZ2  . LYS A 1 291 ? 26.102  -21.874 -11.431 0.02 21.71 ?  284  LYS A HZ2  1  
ATOM   4401   H HZ3  . LYS A 1 291 ? 26.079  -21.976 -12.876 0.02 21.56 ?  284  LYS A HZ3  1  
ATOM   4402   N N    . ALA A 1 292 ? 24.381  -16.109 -15.143 0.02 19.63 ?  285  ALA A N    1  
ATOM   4403   C CA   . ALA A 1 292 ? 23.045  -15.990 -15.707 0.02 19.62 ?  285  ALA A CA   1  
ATOM   4404   C C    . ALA A 1 292 ? 23.097  -15.914 -17.229 0.02 19.47 ?  285  ALA A C    1  
ATOM   4405   O O    . ALA A 1 292 ? 24.012  -15.342 -17.811 0.02 19.24 ?  285  ALA A O    1  
ATOM   4406   C CB   . ALA A 1 292 ? 22.355  -14.737 -15.176 0.02 19.39 ?  285  ALA A CB   1  
ATOM   4407   H H    . ALA A 1 292 ? 24.643  -15.402 -14.728 0.02 19.48 ?  285  ALA A H    1  
ATOM   4408   H HA   . ALA A 1 292 ? 22.515  -16.759 -15.453 0.02 19.88 ?  285  ALA A HA   1  
ATOM   4409   H HB1  . ALA A 1 292 ? 21.437  -14.728 -15.484 0.02 19.42 ?  285  ALA A HB1  1  
ATOM   4410   H HB2  . ALA A 1 292 ? 22.377  -14.755 -14.206 0.02 19.49 ?  285  ALA A HB2  1  
ATOM   4411   H HB3  . ALA A 1 292 ? 22.824  -13.954 -15.499 0.02 19.14 ?  285  ALA A HB3  1  
ATOM   4412   N N    . LYS A 1 293 ? 22.097  -16.501 -17.857 0.02 19.65 ?  286  LYS A N    1  
ATOM   4413   C CA   . LYS A 1 293 ? 21.849  -16.278 -19.268 0.02 19.53 ?  286  LYS A CA   1  
ATOM   4414   C C    . LYS A 1 293 ? 21.446  -14.817 -19.450 0.02 19.19 ?  286  LYS A C    1  
ATOM   4415   O O    . LYS A 1 293 ? 20.587  -14.317 -18.719 0.02 19.20 ?  286  LYS A O    1  
ATOM   4416   C CB   . LYS A 1 293 ? 20.765  -17.263 -19.757 0.02 19.88 ?  286  LYS A CB   1  
ATOM   4417   C CG   . LYS A 1 293 ? 21.289  -18.388 -20.671 0.02 20.12 ?  286  LYS A CG   1  
ATOM   4418   C CD   . LYS A 1 293 ? 21.519  -19.752 -19.965 0.02 20.58 ?  286  LYS A CD   1  
ATOM   4419   C CE   . LYS A 1 293 ? 20.669  -20.890 -20.601 0.02 20.93 ?  286  LYS A CE   1  
ATOM   4420   N NZ   . LYS A 1 293 ? 19.691  -21.475 -19.634 0.02 21.19 ?  286  LYS A NZ   1  
ATOM   4421   H H    . LYS A 1 293 ? 21.538  -17.035 -17.482 0.02 19.86 ?  286  LYS A H    1  
ATOM   4422   H HA   . LYS A 1 293 ? 22.665  -16.441 -19.764 0.02 19.47 ?  286  LYS A HA   1  
ATOM   4423   H HB2  . LYS A 1 293 ? 20.365  -17.687 -18.983 0.02 20.07 ?  286  LYS A HB2  1  
ATOM   4424   H HB3  . LYS A 1 293 ? 20.084  -16.768 -20.236 0.02 19.79 ?  286  LYS A HB3  1  
ATOM   4425   H HG2  . LYS A 1 293 ? 20.654  -18.515 -21.394 0.02 20.13 ?  286  LYS A HG2  1  
ATOM   4426   H HG3  . LYS A 1 293 ? 22.144  -18.118 -21.041 0.02 19.99 ?  286  LYS A HG3  1  
ATOM   4427   H HD2  . LYS A 1 293 ? 22.454  -19.992 -20.051 0.02 20.66 ?  286  LYS A HD2  1  
ATOM   4428   H HD3  . LYS A 1 293 ? 21.284  -19.681 -19.026 0.02 20.62 ?  286  LYS A HD3  1  
ATOM   4429   H HE2  . LYS A 1 293 ? 20.168  -20.558 -21.360 0.02 20.80 ?  286  LYS A HE2  1  
ATOM   4430   H HE3  . LYS A 1 293 ? 21.262  -21.600 -20.891 0.02 21.16 ?  286  LYS A HE3  1  
ATOM   4431   H HZ1  . LYS A 1 293 ? 19.105  -20.858 -19.379 0.02 21.00 ?  286  LYS A HZ1  1  
ATOM   4432   H HZ2  . LYS A 1 293 ? 19.248  -22.147 -20.017 0.02 21.35 ?  286  LYS A HZ2  1  
ATOM   4433   H HZ3  . LYS A 1 293 ? 20.119  -21.785 -18.918 0.02 21.39 ?  286  LYS A HZ3  1  
ATOM   4434   N N    . PRO A 1 294 ? 22.074  -14.081 -20.365 0.02 18.92 ?  287  PRO A N    1  
ATOM   4435   C CA   . PRO A 1 294 ? 21.992  -12.609 -20.271 0.02 18.59 ?  287  PRO A CA   1  
ATOM   4436   C C    . PRO A 1 294 ? 20.602  -12.041 -20.507 0.02 18.58 ?  287  PRO A C    1  
ATOM   4437   O O    . PRO A 1 294 ? 20.251  -10.986 -19.947 0.02 18.40 ?  287  PRO A O    1  
ATOM   4438   C CB   . PRO A 1 294 ? 22.981  -12.142 -21.343 0.02 18.38 ?  287  PRO A CB   1  
ATOM   4439   C CG   . PRO A 1 294 ? 23.211  -13.283 -22.244 0.02 18.59 ?  287  PRO A CG   1  
ATOM   4440   C CD   . PRO A 1 294 ? 22.883  -14.545 -21.508 0.02 18.92 ?  287  PRO A CD   1  
ATOM   4441   H HA   . PRO A 1 294 ? 22.311  -12.314 -19.405 0.02 18.54 ?  287  PRO A HA   1  
ATOM   4442   H HB2  . PRO A 1 294 ? 22.591  -11.403 -21.833 0.02 18.22 ?  287  PRO A HB2  1  
ATOM   4443   H HB3  . PRO A 1 294 ? 23.809  -11.877 -20.913 0.02 18.30 ?  287  PRO A HB3  1  
ATOM   4444   H HG2  . PRO A 1 294 ? 22.658  -13.197 -23.035 0.02 18.60 ?  287  PRO A HG2  1  
ATOM   4445   H HG3  . PRO A 1 294 ? 24.145  -13.290 -22.497 0.02 18.52 ?  287  PRO A HG3  1  
ATOM   4446   H HD2  . PRO A 1 294 ? 22.365  -15.136 -22.074 0.02 19.10 ?  287  PRO A HD2  1  
ATOM   4447   H HD3  . PRO A 1 294 ? 23.690  -14.977 -21.199 0.02 18.97 ?  287  PRO A HD3  1  
ATOM   4448   N N    . GLN A 1 295 ? 19.815  -12.711 -21.350 0.02 18.79 ?  288  GLN A N    1  
ATOM   4449   C CA   . GLN A 1 295 ? 18.463  -12.277 -21.665 0.02 18.83 ?  288  GLN A CA   1  
ATOM   4450   C C    . GLN A 1 295 ? 17.536  -12.468 -20.492 0.02 19.00 ?  288  GLN A C    1  
ATOM   4451   O O    . GLN A 1 295 ? 16.519  -11.762 -20.373 0.02 18.93 ?  288  GLN A O    1  
ATOM   4452   C CB   . GLN A 1 295 ? 17.932  -13.046 -22.872 0.02 19.06 ?  288  GLN A CB   1  
ATOM   4453   C CG   . GLN A 1 295 ? 17.686  -14.550 -22.715 0.02 19.47 ?  288  GLN A CG   1  
ATOM   4454   C CD   . GLN A 1 295 ? 18.966  -15.406 -22.894 0.02 19.57 ?  288  GLN A CD   1  
ATOM   4455   O OE1  . GLN A 1 295 ? 20.102  -14.899 -22.844 0.02 19.34 ?  288  GLN A OE1  1  
ATOM   4456   N NE2  . GLN A 1 295 ? 18.773  -16.702 -23.149 0.02 19.96 ?  288  GLN A NE2  1  
ATOM   4457   H H    . GLN A 1 295 ? 20.049  -13.433 -21.749 0.02 18.94 ?  288  GLN A H    1  
ATOM   4458   H HA   . GLN A 1 295 ? 18.464  -11.334 -21.888 0.02 18.61 ?  288  GLN A HA   1  
ATOM   4459   H HB2  . GLN A 1 295 ? 17.089  -12.642 -23.134 0.02 19.05 ?  288  GLN A HB2  1  
ATOM   4460   H HB3  . GLN A 1 295 ? 18.578  -12.951 -23.591 0.02 18.97 ?  288  GLN A HB3  1  
ATOM   4461   H HG2  . GLN A 1 295 ? 17.293  -14.738 -21.847 0.02 19.56 ?  288  GLN A HG2  1  
ATOM   4462   H HG3  . GLN A 1 295 ? 17.067  -14.812 -23.414 0.02 19.61 ?  288  GLN A HG3  1  
ATOM   4463   H HE21 . GLN A 1 295 ? 17.990  -16.988 -23.362 0.02 20.14 ?  288  GLN A HE21 1  
ATOM   4464   H HE22 . GLN A 1 295 ? 19.435  -17.250 -23.112 0.02 20.06 ?  288  GLN A HE22 1  
ATOM   4465   N N    . ASP A 1 296 ? 17.866  -13.410 -19.624 0.02 19.23 ?  289  ASP A N    1  
ATOM   4466   C CA   . ASP A 1 296 ? 16.999  -13.669 -18.496 0.02 19.46 ?  289  ASP A CA   1  
ATOM   4467   C C    . ASP A 1 296 ? 17.086  -12.504 -17.511 0.02 19.24 ?  289  ASP A C    1  
ATOM   4468   O O    . ASP A 1 296 ? 16.066  -12.081 -16.964 0.02 19.36 ?  289  ASP A O    1  
ATOM   4469   C CB   . ASP A 1 296 ? 17.339  -15.056 -17.915 0.02 19.82 ?  289  ASP A CB   1  
ATOM   4470   C CG   . ASP A 1 296 ? 16.598  -16.218 -18.665 0.02 20.15 ?  289  ASP A CG   1  
ATOM   4471   O OD1  . ASP A 1 296 ? 17.037  -16.676 -19.740 0.02 20.14 ?  289  ASP A OD1  1  
ATOM   4472   O OD2  . ASP A 1 296 ? 15.554  -16.682 -18.158 0.02 20.47 -1 289  ASP A OD2  1  
ATOM   4473   H H    . ASP A 1 296 ? 18.575  -13.898 -19.659 0.02 19.28 ?  289  ASP A H    1  
ATOM   4474   H HA   . ASP A 1 296 ? 16.086  -13.706 -18.819 0.02 19.55 ?  289  ASP A HA   1  
ATOM   4475   H HB2  . ASP A 1 296 ? 18.293  -15.215 -18.001 0.02 19.75 ?  289  ASP A HB2  1  
ATOM   4476   H HB3  . ASP A 1 296 ? 17.081  -15.086 -16.981 0.02 19.95 ?  289  ASP A HB3  1  
ATOM   4477   N N    . LEU A 1 297 ? 18.261  -11.861 -17.410 0.02 18.94 ?  290  LEU A N    1  
ATOM   4478   C CA   . LEU A 1 297 ? 18.399  -10.651 -16.596 0.02 18.73 ?  290  LEU A CA   1  
ATOM   4479   C C    . LEU A 1 297 ? 17.698  -9.443  -17.210 0.02 18.50 ?  290  LEU A C    1  
ATOM   4480   O O    . LEU A 1 297 ? 17.081  -8.652  -16.493 0.02 18.47 ?  290  LEU A O    1  
ATOM   4481   C CB   . LEU A 1 297 ? 19.876  -10.320 -16.378 0.02 18.54 ?  290  LEU A CB   1  
ATOM   4482   C CG   . LEU A 1 297 ? 20.659  -11.410 -15.684 0.02 18.75 ?  290  LEU A CG   1  
ATOM   4483   C CD1  . LEU A 1 297 ? 22.060  -10.972 -15.426 0.02 18.55 ?  290  LEU A CD1  1  
ATOM   4484   C CD2  . LEU A 1 297 ? 19.994  -11.774 -14.380 0.02 19.00 ?  290  LEU A CD2  1  
ATOM   4485   H H    . LEU A 1 297 ? 18.988  -12.111 -17.795 0.02 18.88 ?  290  LEU A H    1  
ATOM   4486   H HA   . LEU A 1 297 ? 17.991  -10.807 -15.730 0.02 18.87 ?  290  LEU A HA   1  
ATOM   4487   H HB2  . LEU A 1 297 ? 20.295  -10.152 -17.239 0.02 18.42 ?  290  LEU A HB2  1  
ATOM   4488   H HB3  . LEU A 1 297 ? 19.935  -9.521  -15.831 0.02 18.40 ?  290  LEU A HB3  1  
ATOM   4489   H HG   . LEU A 1 297 ? 20.683  -12.201 -16.246 0.02 18.88 ?  290  LEU A HG   1  
ATOM   4490   H HD11 . LEU A 1 297 ? 22.421  -10.583 -16.238 0.02 18.43 ?  290  LEU A HD11 1  
ATOM   4491   H HD12 . LEU A 1 297 ? 22.056  -10.312 -14.717 0.02 18.42 ?  290  LEU A HD12 1  
ATOM   4492   H HD13 . LEU A 1 297 ? 22.589  -11.740 -15.159 0.02 18.70 ?  290  LEU A HD13 1  
ATOM   4493   H HD21 . LEU A 1 297 ? 20.678  -12.002 -13.732 0.02 19.05 ?  290  LEU A HD21 1  
ATOM   4494   H HD22 . LEU A 1 297 ? 19.483  -11.009 -14.070 0.02 18.92 ?  290  LEU A HD22 1  
ATOM   4495   H HD23 . LEU A 1 297 ? 19.403  -12.531 -14.522 0.02 19.22 ?  290  LEU A HD23 1  
ATOM   4496   N N    . ILE A 1 298 ? 17.800  -9.251  -18.525 0.02 18.35 ?  291  ILE A N    1  
ATOM   4497   C CA   . ILE A 1 298 ? 17.245  -8.026  -19.094 0.02 18.14 ?  291  ILE A CA   1  
ATOM   4498   C C    . ILE A 1 298 ? 15.719  -8.096  -19.102 0.02 18.33 ?  291  ILE A C    1  
ATOM   4499   O O    . ILE A 1 298 ? 15.026  -7.083  -18.941 0.02 18.24 ?  291  ILE A O    1  
ATOM   4500   C CB   . ILE A 1 298 ? 17.834  -7.757  -20.503 0.02 17.98 ?  291  ILE A CB   1  
ATOM   4501   C CG1  . ILE A 1 298 ? 19.297  -7.249  -20.451 0.02 17.76 ?  291  ILE A CG1  1  
ATOM   4502   C CG2  . ILE A 1 298 ? 16.954  -6.777  -21.306 0.02 17.88 ?  291  ILE A CG2  1  
ATOM   4503   C CD1  . ILE A 1 298 ? 19.674  -6.208  -19.377 0.02 17.56 ?  291  ILE A CD1  1  
ATOM   4504   H H    . ILE A 1 298 ? 18.167  -9.792  -19.081 0.02 18.38 ?  291  ILE A H    1  
ATOM   4505   H HA   . ILE A 1 298 ? 17.487  -7.286  -18.520 0.02 18.00 ?  291  ILE A HA   1  
ATOM   4506   H HB   . ILE A 1 298 ? 17.836  -8.603  -20.974 0.02 18.14 ?  291  ILE A HB   1  
ATOM   4507   H HG12 . ILE A 1 298 ? 19.881  -8.011  -20.311 0.02 17.86 ?  291  ILE A HG12 1  
ATOM   4508   H HG13 . ILE A 1 298 ? 19.506  -6.843  -21.306 0.02 17.67 ?  291  ILE A HG13 1  
ATOM   4509   H HG21 . ILE A 1 298 ? 17.463  -6.445  -22.059 0.02 17.73 ?  291  ILE A HG21 1  
ATOM   4510   H HG22 . ILE A 1 298 ? 16.170  -7.249  -21.626 0.02 18.04 ?  291  ILE A HG22 1  
ATOM   4511   H HG23 . ILE A 1 298 ? 16.687  -6.041  -20.738 0.02 17.82 ?  291  ILE A HG23 1  
ATOM   4512   H HD11 . ILE A 1 298 ? 19.057  -5.460  -19.421 0.02 17.49 ?  291  ILE A HD11 1  
ATOM   4513   H HD12 . ILE A 1 298 ? 19.623  -6.630  -18.505 0.02 17.66 ?  291  ILE A HD12 1  
ATOM   4514   H HD13 . ILE A 1 298 ? 20.583  -5.906  -19.536 0.02 17.44 ?  291  ILE A HD13 1  
ATOM   4515   N N    . LYS A 1 299 ? 15.170  -9.293  -19.246 0.02 18.64 ?  292  LYS A N    1  
ATOM   4516   C CA   . LYS A 1 299 ? 13.722  -9.410  -19.306 0.02 18.84 ?  292  LYS A CA   1  
ATOM   4517   C C    . LYS A 1 299 ? 13.101  -9.255  -17.929 0.02 18.98 ?  292  LYS A C    1  
ATOM   4518   O O    . LYS A 1 299 ? 11.883  -9.069  -17.822 0.02 19.14 ?  292  LYS A O    1  
ATOM   4519   C CB   . LYS A 1 299 ? 13.364  -10.737 -19.982 0.02 19.16 ?  292  LYS A CB   1  
ATOM   4520   C CG   . LYS A 1 299 ? 12.341  -11.650 -19.293 0.02 19.55 ?  292  LYS A CG   1  
ATOM   4521   C CD   . LYS A 1 299 ? 10.895  -11.226 -19.528 0.02 19.77 ?  292  LYS A CD   1  
ATOM   4522   C CE   . LYS A 1 299 ? 9.894   -12.415 -19.484 0.02 20.24 ?  292  LYS A CE   1  
ATOM   4523   N NZ   . LYS A 1 299 ? 9.234   -12.573 -18.133 0.02 20.47 ?  292  LYS A NZ   1  
ATOM   4524   H H    . LYS A 1 299 ? 15.598  -10.035 -19.295 0.02 18.74 ?  292  LYS A H    1  
ATOM   4525   H HA   . LYS A 1 299 ? 13.371  -8.700  -19.864 0.02 18.71 ?  292  LYS A HA   1  
ATOM   4526   H HB2  . LYS A 1 299 ? 13.013  -10.529 -20.864 0.02 19.15 ?  292  LYS A HB2  1  
ATOM   4527   H HB3  . LYS A 1 299 ? 14.180  -11.249 -20.085 0.02 19.13 ?  292  LYS A HB3  1  
ATOM   4528   H HG2  . LYS A 1 299 ? 12.437  -12.544 -19.655 0.02 19.72 ?  292  LYS A HG2  1  
ATOM   4529   H HG3  . LYS A 1 299 ? 12.506  -11.677 -18.339 0.02 19.56 ?  292  LYS A HG3  1  
ATOM   4530   H HD2  . LYS A 1 299 ? 10.628  -10.607 -18.834 0.02 19.68 ?  292  LYS A HD2  1  
ATOM   4531   H HD3  . LYS A 1 299 ? 10.831  -10.806 -20.399 0.02 19.74 ?  292  LYS A HD3  1  
ATOM   4532   H HE2  . LYS A 1 299 ? 9.201   -12.273 -20.149 0.02 20.39 ?  292  LYS A HE2  1  
ATOM   4533   H HE3  . LYS A 1 299 ? 10.365  -13.241 -19.679 0.02 20.27 ?  292  LYS A HE3  1  
ATOM   4534   H HZ1  . LYS A 1 299 ? 9.792   -12.325 -17.484 0.02 20.31 ?  292  LYS A HZ1  1  
ATOM   4535   H HZ2  . LYS A 1 299 ? 8.508   -12.058 -18.106 0.02 20.54 ?  292  LYS A HZ2  1  
ATOM   4536   H HZ3  . LYS A 1 299 ? 8.986   -13.419 -18.003 0.02 20.73 ?  292  LYS A HZ3  1  
ATOM   4537   N N    . LEU A 1 300 ? 13.921  -9.308  -16.871 0.02 18.95 ?  293  LEU A N    1  
ATOM   4538   C CA   . LEU A 1 300 ? 13.461  -9.038  -15.508 0.02 19.07 ?  293  LEU A CA   1  
ATOM   4539   C C    . LEU A 1 300 ? 13.736  -7.608  -15.032 0.02 18.80 ?  293  LEU A C    1  
ATOM   4540   O O    . LEU A 1 300 ? 13.317  -7.246  -13.927 0.02 18.91 ?  293  LEU A O    1  
ATOM   4541   C CB   . LEU A 1 300 ? 14.117  -10.014 -14.524 0.02 19.25 ?  293  LEU A CB   1  
ATOM   4542   C CG   . LEU A 1 300 ? 13.645  -11.463 -14.497 0.02 19.62 ?  293  LEU A CG   1  
ATOM   4543   C CD1  . LEU A 1 300 ? 14.768  -12.304 -13.872 0.02 19.71 ?  293  LEU A CD1  1  
ATOM   4544   C CD2  . LEU A 1 300 ? 12.367  -11.571 -13.719 0.02 19.94 ?  293  LEU A CD2  1  
ATOM   4545   H H    . LEU A 1 300 ? 14.754  -9.510  -16.919 0.02 18.87 ?  293  LEU A H    1  
ATOM   4546   H HA   . LEU A 1 300 ? 12.502  -9.182  -15.472 0.02 19.27 ?  293  LEU A HA   1  
ATOM   4547   H HB2  . LEU A 1 300 ? 15.067  -10.035 -14.718 0.02 19.08 ?  293  LEU A HB2  1  
ATOM   4548   H HB3  . LEU A 1 300 ? 13.982  -9.666  -13.630 0.02 19.30 ?  293  LEU A HB3  1  
ATOM   4549   H HG   . LEU A 1 300 ? 13.484  -11.778 -15.399 0.02 19.62 ?  293  LEU A HG   1  
ATOM   4550   H HD11 . LEU A 1 300 ? 14.427  -13.187 -13.671 0.02 19.99 ?  293  LEU A HD11 1  
ATOM   4551   H HD12 . LEU A 1 300 ? 15.501  -12.371 -14.502 0.02 19.54 ?  293  LEU A HD12 1  
ATOM   4552   H HD13 . LEU A 1 300 ? 15.069  -11.866 -13.059 0.02 19.68 ?  293  LEU A HD13 1  
ATOM   4553   H HD21 . LEU A 1 300 ? 11.827  -10.789 -13.905 0.02 19.84 ?  293  LEU A HD21 1  
ATOM   4554   H HD22 . LEU A 1 300 ? 11.890  -12.370 -13.991 0.02 20.16 ?  293  LEU A HD22 1  
ATOM   4555   H HD23 . LEU A 1 300 ? 12.576  -11.614 -12.773 0.02 20.06 ?  293  LEU A HD23 1  
ATOM   4556   N N    . GLU A 1 301 ? 14.425  -6.771  -15.798 0.02 18.49 ?  294  GLU A N    1  
ATOM   4557   C CA   . GLU A 1 301 ? 14.756  -5.461  -15.250 0.02 18.26 ?  294  GLU A CA   1  
ATOM   4558   C C    . GLU A 1 301 ? 13.525  -4.561  -15.118 0.02 18.29 ?  294  GLU A C    1  
ATOM   4559   O O    . GLU A 1 301 ? 13.584  -3.519  -14.459 0.02 18.21 ?  294  GLU A O    1  
ATOM   4560   C CB   . GLU A 1 301 ? 15.836  -4.775  -16.079 0.02 17.95 ?  294  GLU A CB   1  
ATOM   4561   C CG   . GLU A 1 301 ? 17.239  -4.922  -15.503 0.02 17.88 ?  294  GLU A CG   1  
ATOM   4562   C CD   . GLU A 1 301 ? 18.210  -3.999  -16.210 0.02 17.59 ?  294  GLU A CD   1  
ATOM   4563   O OE1  . GLU A 1 301 ? 17.734  -2.996  -16.786 0.02 17.44 ?  294  GLU A OE1  1  
ATOM   4564   O OE2  . GLU A 1 301 ? 19.414  -4.280  -16.175 0.02 17.53 -1 294  GLU A OE2  1  
ATOM   4565   H H    . GLU A 1 301 ? 14.699  -6.925  -16.598 0.02 18.42 ?  294  GLU A H    1  
ATOM   4566   H HA   . GLU A 1 301 ? 15.116  -5.590  -14.359 0.02 18.31 ?  294  GLU A HA   1  
ATOM   4567   H HB2  . GLU A 1 301 ? 15.836  -5.144  -16.975 0.02 17.94 ?  294  GLU A HB2  1  
ATOM   4568   H HB3  . GLU A 1 301 ? 15.635  -3.828  -16.117 0.02 17.82 ?  294  GLU A HB3  1  
ATOM   4569   H HG2  . GLU A 1 301 ? 17.229  -4.688  -14.562 0.02 17.93 ?  294  GLU A HG2  1  
ATOM   4570   H HG3  . GLU A 1 301 ? 17.545  -5.836  -15.612 0.02 17.99 ?  294  GLU A HG3  1  
ATOM   4571   N N    . GLU A 1 302 ? 12.391  -4.951  -15.691 0.02 18.44 ?  295  GLU A N    1  
ATOM   4572   C CA   . GLU A 1 302 ? 11.199  -4.120  -15.521 0.02 18.52 ?  295  GLU A CA   1  
ATOM   4573   C C    . GLU A 1 302 ? 10.483  -4.404  -14.210 0.02 18.80 ?  295  GLU A C    1  
ATOM   4574   O O    . GLU A 1 302 ? 9.653   -3.591  -13.782 0.02 18.87 ?  295  GLU A O    1  
ATOM   4575   C CB   . GLU A 1 302 ? 10.224  -4.301  -16.692 0.02 18.64 ?  295  GLU A CB   1  
ATOM   4576   C CG   . GLU A 1 302 ? 10.478  -3.329  -17.871 0.02 18.37 ?  295  GLU A CG   1  
ATOM   4577   C CD   . GLU A 1 302 ? 11.278  -2.074  -17.473 0.02 18.06 ?  295  GLU A CD   1  
ATOM   4578   O OE1  . GLU A 1 302 ? 10.743  -1.221  -16.695 0.02 18.03 ?  295  GLU A OE1  1  
ATOM   4579   O OE2  . GLU A 1 302 ? 12.446  -1.958  -17.935 0.02 17.88 -1 295  GLU A OE2  1  
ATOM   4580   H H    . GLU A 1 302 ? 12.284  -5.667  -16.157 0.02 18.51 ?  295  GLU A H    1  
ATOM   4581   H HA   . GLU A 1 302 ? 11.477  -3.200  -15.450 0.02 18.35 ?  295  GLU A HA   1  
ATOM   4582   H HB2  . GLU A 1 302 ? 10.302  -5.208  -17.027 0.02 18.78 ?  295  GLU A HB2  1  
ATOM   4583   H HB3  . GLU A 1 302 ? 9.323   -4.152  -16.371 0.02 18.78 ?  295  GLU A HB3  1  
ATOM   4584   H HG2  . GLU A 1 302 ? 10.982  -3.792  -18.558 0.02 18.35 ?  295  GLU A HG2  1  
ATOM   4585   H HG3  . GLU A 1 302 ? 9.628   -3.041  -18.235 0.02 18.44 ?  295  GLU A HG3  1  
ATOM   4586   N N    . LYS A 1 303 ? 10.844  -5.490  -13.532 0.02 18.97 ?  296  LYS A N    1  
ATOM   4587   C CA   . LYS A 1 303 ? 10.247  -5.854  -12.253 0.02 19.28 ?  296  LYS A CA   1  
ATOM   4588   C C    . LYS A 1 303 ? 11.097  -5.459  -11.048 0.02 19.22 ?  296  LYS A C    1  
ATOM   4589   O O    . LYS A 1 303 ? 10.685  -5.717  -9.919  0.02 19.48 ?  296  LYS A O    1  
ATOM   4590   C CB   . LYS A 1 303 ? 9.965   -7.365  -12.227 0.02 19.62 ?  296  LYS A CB   1  
ATOM   4591   C CG   . LYS A 1 303 ? 8.594   -7.732  -12.886 0.02 19.88 ?  296  LYS A CG   1  
ATOM   4592   C CD   . LYS A 1 303 ? 7.331   -7.514  -11.908 0.02 20.16 ?  296  LYS A CD   1  
ATOM   4593   C CE   . LYS A 1 303 ? 6.513   -6.246  -12.092 0.02 20.17 ?  296  LYS A CE   1  
ATOM   4594   N NZ   . LYS A 1 303 ? 5.161   -6.611  -12.728 0.02 20.52 ?  296  LYS A NZ   1  
ATOM   4595   H H    . LYS A 1 303 ? 11.447  -6.041  -13.798 0.02 18.93 ?  296  LYS A H    1  
ATOM   4596   H HA   . LYS A 1 303 ? 9.393   -5.405  -12.166 0.02 19.34 ?  296  LYS A HA   1  
ATOM   4597   H HB2  . LYS A 1 303 ? 10.668  -7.828  -12.710 0.02 19.54 ?  296  LYS A HB2  1  
ATOM   4598   H HB3  . LYS A 1 303 ? 9.951   -7.673  -11.306 0.02 19.79 ?  296  LYS A HB3  1  
ATOM   4599   H HG2  . LYS A 1 303 ? 8.493   -7.179  -13.676 0.02 19.72 ?  296  LYS A HG2  1  
ATOM   4600   H HG3  . LYS A 1 303 ? 8.632   -8.670  -13.138 0.02 20.06 ?  296  LYS A HG3  1  
ATOM   4601   H HD2  . LYS A 1 303 ? 6.726   -8.263  -12.040 0.02 20.45 ?  296  LYS A HD2  1  
ATOM   4602   H HD3  . LYS A 1 303 ? 7.662   -7.518  -10.998 0.02 20.09 ?  296  LYS A HD3  1  
ATOM   4603   H HE2  . LYS A 1 303 ? 6.317   -5.761  -11.265 0.02 20.22 ?  296  LYS A HE2  1  
ATOM   4604   H HE3  . LYS A 1 303 ? 6.979   -5.650  -12.668 0.02 19.91 ?  296  LYS A HE3  1  
ATOM   4605   H HZ1  . LYS A 1 303 ? 4.702   -5.862  -12.872 0.02 20.59 ?  296  LYS A HZ1  1  
ATOM   4606   H HZ2  . LYS A 1 303 ? 5.312   -7.002  -13.513 0.02 20.45 ?  296  LYS A HZ2  1  
ATOM   4607   H HZ3  . LYS A 1 303 ? 4.679   -7.169  -12.226 0.02 20.76 ?  296  LYS A HZ3  1  
ATOM   4608   N N    . VAL A 1 304 ? 12.258  -4.832  -11.260 0.02 18.90 ?  297  VAL A N    1  
ATOM   4609   C CA   . VAL A 1 304 ? 13.195  -4.580  -10.166 0.02 18.87 ?  297  VAL A CA   1  
ATOM   4610   C C    . VAL A 1 304 ? 12.758  -3.409  -9.287  0.02 18.87 ?  297  VAL A C    1  
ATOM   4611   O O    . VAL A 1 304 ? 12.836  -3.485  -8.058  0.02 19.06 ?  297  VAL A O    1  
ATOM   4612   C CB   . VAL A 1 304 ? 14.616  -4.364  -10.724 0.02 18.58 ?  297  VAL A CB   1  
ATOM   4613   C CG1  . VAL A 1 304 ? 15.529  -3.784  -9.653  0.02 18.53 ?  297  VAL A CG1  1  
ATOM   4614   C CG2  . VAL A 1 304 ? 15.186  -5.676  -11.217 0.02 18.66 ?  297  VAL A CG2  1  
ATOM   4615   H H    . VAL A 1 304 ? 12.526  -4.547  -12.025 0.02 18.72 ?  297  VAL A H    1  
ATOM   4616   H HA   . VAL A 1 304 ? 13.225  -5.367  -9.602  0.02 19.08 ?  297  VAL A HA   1  
ATOM   4617   H HB   . VAL A 1 304 ? 14.585  -3.742  -11.466 0.02 18.39 ?  297  VAL A HB   1  
ATOM   4618   H HG11 . VAL A 1 304 ? 16.449  -3.959  -9.895  0.02 18.42 ?  297  VAL A HG11 1  
ATOM   4619   H HG12 . VAL A 1 304 ? 15.378  -2.829  -9.585  0.02 18.42 ?  297  VAL A HG12 1  
ATOM   4620   H HG13 . VAL A 1 304 ? 15.330  -4.209  -8.803  0.02 18.74 ?  297  VAL A HG13 1  
ATOM   4621   H HG21 . VAL A 1 304 ? 16.070  -5.523  -11.585 0.02 18.49 ?  297  VAL A HG21 1  
ATOM   4622   H HG22 . VAL A 1 304 ? 15.245  -6.289  -10.469 0.02 18.86 ?  297  VAL A HG22 1  
ATOM   4623   H HG23 . VAL A 1 304 ? 14.602  -6.039  -11.899 0.02 18.72 ?  297  VAL A HG23 1  
ATOM   4624   N N    . LEU A 1 305 ? 12.318  -2.299  -9.873  0.02 18.70 ?  298  LEU A N    1  
ATOM   4625   C CA   . LEU A 1 305 ? 11.938  -1.152  -9.060  0.02 18.72 ?  298  LEU A CA   1  
ATOM   4626   C C    . LEU A 1 305 ? 10.751  -1.497  -8.158  0.02 19.08 ?  298  LEU A C    1  
ATOM   4627   O O    . LEU A 1 305 ? 9.779   -2.106  -8.596  0.02 19.26 ?  298  LEU A O    1  
ATOM   4628   C CB   . LEU A 1 305 ? 11.591  0.036   -9.953  0.02 18.50 ?  298  LEU A CB   1  
ATOM   4629   C CG   . LEU A 1 305 ? 12.779  0.691   -10.676 0.02 18.16 ?  298  LEU A CG   1  
ATOM   4630   C CD1  . LEU A 1 305 ? 12.318  1.763   -11.689 0.02 18.00 ?  298  LEU A CD1  1  
ATOM   4631   C CD2  . LEU A 1 305 ? 13.771  1.316   -9.727  0.02 18.10 ?  298  LEU A CD2  1  
ATOM   4632   H H    . LEU A 1 305 ? 12.224  -2.191  -10.718 0.02 18.59 ?  298  LEU A H    1  
ATOM   4633   H HA   . LEU A 1 305 ? 12.685  -0.897  -8.496  0.02 18.67 ?  298  LEU A HA   1  
ATOM   4634   H HB2  . LEU A 1 305 ? 10.970  -0.271  -10.631 0.02 18.53 ?  298  LEU A HB2  1  
ATOM   4635   H HB3  . LEU A 1 305 ? 11.167  0.717   -9.410  0.02 18.57 ?  298  LEU A HB3  1  
ATOM   4636   H HG   . LEU A 1 305 ? 13.240  0.000   -11.174 0.02 18.10 ?  298  LEU A HG   1  
ATOM   4637   H HD11 . LEU A 1 305 ? 12.037  2.558   -11.209 0.02 18.04 ?  298  LEU A HD11 1  
ATOM   4638   H HD12 . LEU A 1 305 ? 13.064  1.980   -12.268 0.02 17.81 ?  298  LEU A HD12 1  
ATOM   4639   H HD13 . LEU A 1 305 ? 11.581  1.412   -12.213 0.02 18.07 ?  298  LEU A HD13 1  
ATOM   4640   H HD21 . LEU A 1 305 ? 14.147  2.109   -10.139 0.02 17.93 ?  298  LEU A HD21 1  
ATOM   4641   H HD22 . LEU A 1 305 ? 13.325  1.559   -8.901  0.02 18.25 ?  298  LEU A HD22 1  
ATOM   4642   H HD23 . LEU A 1 305 ? 14.474  0.674   -9.543  0.02 18.11 ?  298  LEU A HD23 1  
ATOM   4643   N N    . THR A 1 306 ? 10.837  -1.101  -6.897  0.02 19.23 ?  299  THR A N    1  
ATOM   4644   C CA   . THR A 1 306 ? 9.710   -1.214  -5.974  0.02 19.59 ?  299  THR A CA   1  
ATOM   4645   C C    . THR A 1 306 ? 8.733   -0.063  -6.162  0.02 19.58 ?  299  THR A C    1  
ATOM   4646   O O    . THR A 1 306 ? 9.113   1.044   -6.547  0.02 19.31 ?  299  THR A O    1  
ATOM   4647   C CB   . THR A 1 306 ? 10.186  -1.161  -4.541  0.02 19.79 ?  299  THR A CB   1  
ATOM   4648   O OG1  . THR A 1 306 ? 10.622  0.171   -4.275  0.02 19.63 ?  299  THR A OG1  1  
ATOM   4649   C CG2  . THR A 1 306 ? 11.333  -2.149  -4.303  0.02 19.77 ?  299  THR A CG2  1  
ATOM   4650   H H    . THR A 1 306 ? 11.544  -0.762  -6.545  0.02 19.15 ?  299  THR A H    1  
ATOM   4651   H HA   . THR A 1 306 ? 9.240   -2.049  -6.113  0.02 19.75 ?  299  THR A HA   1  
ATOM   4652   H HB   . THR A 1 306 ? 9.451   -1.392  -3.952  0.02 20.06 ?  299  THR A HB   1  
ATOM   4653   H HG1  . THR A 1 306 ? 11.151  0.177   -3.622  0.02 19.71 ?  299  THR A HG1  1  
ATOM   4654   H HG21 . THR A 1 306 ? 12.129  -1.670  -4.024  0.02 19.67 ?  299  THR A HG21 1  
ATOM   4655   H HG22 . THR A 1 306 ? 11.079  -2.772  -3.604  0.02 20.04 ?  299  THR A HG22 1  
ATOM   4656   H HG23 . THR A 1 306 ? 11.533  -2.647  -5.110  0.02 19.62 ?  299  THR A HG23 1  
ATOM   4657   N N    . LEU A 1 307 ? 7.469   -0.315  -5.798  0.02 19.92 ?  300  LEU A N    1  
ATOM   4658   C CA   . LEU A 1 307 ? 6.430   0.706   -5.934  0.02 19.98 ?  300  LEU A CA   1  
ATOM   4659   C C    . LEU A 1 307 ? 6.846   2.045   -5.337  0.02 19.86 ?  300  LEU A C    1  
ATOM   4660   O O    . LEU A 1 307 ? 6.520   3.096   -5.892  0.02 19.71 ?  300  LEU A O    1  
ATOM   4661   C CB   . LEU A 1 307 ? 5.122   0.247   -5.277  0.02 20.42 ?  300  LEU A CB   1  
ATOM   4662   C CG   . LEU A 1 307 ? 3.923   1.198   -5.393  0.02 20.59 ?  300  LEU A CG   1  
ATOM   4663   C CD1  . LEU A 1 307 ? 3.678   1.743   -6.809  0.02 20.34 ?  300  LEU A CD1  1  
ATOM   4664   C CD2  . LEU A 1 307 ? 2.663   0.472   -4.914  0.02 21.04 ?  300  LEU A CD2  1  
ATOM   4665   H H    . LEU A 1 307 ? 7.194   -1.064  -5.479  0.02 20.13 ?  300  LEU A H    1  
ATOM   4666   H HA   . LEU A 1 307 ? 6.258   0.848   -6.876  0.02 19.83 ?  300  LEU A HA   1  
ATOM   4667   H HB2  . LEU A 1 307 ? 4.861   -0.606  -5.642  0.02 20.50 ?  300  LEU A HB2  1  
ATOM   4668   H HB3  . LEU A 1 307 ? 5.297   0.140   -4.329  0.02 20.58 ?  300  LEU A HB3  1  
ATOM   4669   H HG   . LEU A 1 307 ? 4.075   1.959   -4.811  0.02 20.63 ?  300  LEU A HG   1  
ATOM   4670   H HD11 . LEU A 1 307 ? 4.478   2.191   -7.124  0.02 20.07 ?  300  LEU A HD11 1  
ATOM   4671   H HD12 . LEU A 1 307 ? 3.459   1.001   -7.393  0.02 20.33 ?  300  LEU A HD12 1  
ATOM   4672   H HD13 . LEU A 1 307 ? 2.941   2.370   -6.783  0.02 20.48 ?  300  LEU A HD13 1  
ATOM   4673   H HD21 . LEU A 1 307 ? 2.491   0.696   -3.986  0.02 21.25 ?  300  LEU A HD21 1  
ATOM   4674   H HD22 . LEU A 1 307 ? 1.916   0.752   -5.466  0.02 21.11 ?  300  LEU A HD22 1  
ATOM   4675   H HD23 . LEU A 1 307 ? 2.790   -0.484  -5.005  0.02 21.06 ?  300  LEU A HD23 1  
ATOM   4676   N N    . GLU A 1 308 ? 7.538   2.032   -4.195  0.02 19.96 ?  301  GLU A N    1  
ATOM   4677   C CA   . GLU A 1 308 ? 8.003   3.279   -3.592  0.02 19.87 ?  301  GLU A CA   1  
ATOM   4678   C C    . GLU A 1 308 ? 8.967   4.003   -4.518  0.02 19.46 ?  301  GLU A C    1  
ATOM   4679   O O    . GLU A 1 308 ? 8.852   5.218   -4.728  0.02 19.34 ?  301  GLU A O    1  
ATOM   4680   C CB   . GLU A 1 308 ? 8.676   3.010   -2.243  0.02 20.05 ?  301  GLU A CB   1  
ATOM   4681   C CG   . GLU A 1 308 ? 7.738   2.796   -1.110  0.02 20.50 ?  301  GLU A CG   1  
ATOM   4682   C CD   . GLU A 1 308 ? 7.032   1.479   -1.228  0.02 20.73 ?  301  GLU A CD   1  
ATOM   4683   O OE1  . GLU A 1 308 ? 7.069   0.887   -2.331  0.02 20.53 ?  301  GLU A OE1  1  
ATOM   4684   O OE2  . GLU A 1 308 ? 6.476   1.015   -0.205  0.02 21.12 -1 301  GLU A OE2  1  
ATOM   4685   H H    . GLU A 1 308 ? 7.758   1.324   -3.761  0.02 20.09 ?  301  GLU A H    1  
ATOM   4686   H HA   . GLU A 1 308 ? 7.243   3.866   -3.441  0.02 19.98 ?  301  GLU A HA   1  
ATOM   4687   H HB2  . GLU A 1 308 ? 9.223   2.216   -2.323  0.02 20.01 ?  301  GLU A HB2  1  
ATOM   4688   H HB3  . GLU A 1 308 ? 9.234   3.769   -2.007  0.02 19.94 ?  301  GLU A HB3  1  
ATOM   4689   H HG2  . GLU A 1 308 ? 8.231   2.799   -0.277  0.02 20.60 ?  301  GLU A HG2  1  
ATOM   4690   H HG3  . GLU A 1 308 ? 7.077   3.506   -1.114  0.02 20.56 ?  301  GLU A HG3  1  
ATOM   4691   N N    . GLU A 1 309 ? 9.955   3.279   -5.051  0.02 19.26 ?  302  GLU A N    1  
ATOM   4692   C CA   . GLU A 1 309 ? 10.881  3.900   -5.992  0.02 18.89 ?  302  GLU A CA   1  
ATOM   4693   C C    . GLU A 1 309 ? 10.137  4.506   -7.162  0.02 18.76 ?  302  GLU A C    1  
ATOM   4694   O O    . GLU A 1 309 ? 10.430  5.629   -7.582  0.02 18.57 ?  302  GLU A O    1  
ATOM   4695   C CB   . GLU A 1 309 ? 11.896  2.865   -6.489  0.02 18.75 ?  302  GLU A CB   1  
ATOM   4696   C CG   . GLU A 1 309 ? 12.674  2.244   -5.329  0.02 18.79 ?  302  GLU A CG   1  
ATOM   4697   C CD   . GLU A 1 309 ? 13.738  1.215   -5.689  0.02 18.71 ?  302  GLU A CD   1  
ATOM   4698   O OE1  . GLU A 1 309 ? 14.906  1.406   -5.268  0.02 18.59 ?  302  GLU A OE1  1  
ATOM   4699   O OE2  . GLU A 1 309 ? 13.390  0.177   -6.280  0.02 18.81 -1 302  GLU A OE2  1  
ATOM   4700   H H    . GLU A 1 309 ? 10.102  2.450   -4.890  0.02 19.34 ?  302  GLU A H    1  
ATOM   4701   H HA   . GLU A 1 309 ? 11.367  4.611   -5.547  0.02 18.85 ?  302  GLU A HA   1  
ATOM   4702   H HB2  . GLU A 1 309 ? 11.429  2.162   -6.966  0.02 18.87 ?  302  GLU A HB2  1  
ATOM   4703   H HB3  . GLU A 1 309 ? 12.527  3.310   -7.076  0.02 18.53 ?  302  GLU A HB3  1  
ATOM   4704   H HG2  . GLU A 1 309 ? 13.117  2.959   -4.848  0.02 18.67 ?  302  GLU A HG2  1  
ATOM   4705   H HG3  . GLU A 1 309 ? 12.047  1.806   -4.740  0.02 19.02 ?  302  GLU A HG3  1  
ATOM   4706   N N    . ARG A 1 310 ? 9.180   3.770   -7.712  0.02 18.89 ?  303  ARG A N    1  
ATOM   4707   C CA   . ARG A 1 310 ? 8.427   4.300   -8.844  0.02 18.81 ?  303  ARG A CA   1  
ATOM   4708   C C    . ARG A 1 310 ? 7.587   5.499   -8.396  0.02 18.93 ?  303  ARG A C    1  
ATOM   4709   O O    . ARG A 1 310 ? 7.381   6.446   -9.167  0.02 18.79 ?  303  ARG A O    1  
ATOM   4710   C CB   . ARG A 1 310 ? 7.575   3.194   -9.481  0.02 18.97 ?  303  ARG A CB   1  
ATOM   4711   C CG   . ARG A 1 310 ? 8.394   2.197   -10.350 0.02 18.83 ?  303  ARG A CG   1  
ATOM   4712   C CD   . ARG A 1 310 ? 7.506   1.308   -11.284 0.02 18.96 ?  303  ARG A CD   1  
ATOM   4713   N NE   . ARG A 1 310 ? 7.941   -0.100  -11.320 0.02 19.08 ?  303  ARG A NE   1  
ATOM   4714   C CZ   . ARG A 1 310 ? 7.326   -1.085  -11.984 0.02 19.20 ?  303  ARG A CZ   1  
ATOM   4715   N NH1  . ARG A 1 310 ? 6.253   -0.860  -12.735 0.02 19.22 ?  303  ARG A NH1  1  
ATOM   4716   N NH2  . ARG A 1 310 ? 7.805   -2.320  -11.902 0.02 19.34 ?  303  ARG A NH2  1  
ATOM   4717   H H    . ARG A 1 310 ? 8.947   2.988   -7.448  0.02 19.03 ?  303  ARG A H    1  
ATOM   4718   H HA   . ARG A 1 310 ? 9.052   4.615   -9.515  0.02 18.58 ?  303  ARG A HA   1  
ATOM   4719   H HB2  . ARG A 1 310 ? 7.128   2.692   -8.783  0.02 19.21 ?  303  ARG A HB2  1  
ATOM   4720   H HB3  . ARG A 1 310 ? 6.913   3.604   -10.058 0.02 18.97 ?  303  ARG A HB3  1  
ATOM   4721   H HG2  . ARG A 1 310 ? 8.994   2.702   -10.917 0.02 18.59 ?  303  ARG A HG2  1  
ATOM   4722   H HG3  . ARG A 1 310 ? 8.904   1.615   -9.766  0.02 18.90 ?  303  ARG A HG3  1  
ATOM   4723   H HD2  . ARG A 1 310 ? 6.589   1.334   -10.965 0.02 19.16 ?  303  ARG A HD2  1  
ATOM   4724   H HD3  . ARG A 1 310 ? 7.548   1.657   -12.187 0.02 18.79 ?  303  ARG A HD3  1  
ATOM   4725   H HE   . ARG A 1 310 ? 8.468   -0.346  -10.685 0.02 19.10 ?  303  ARG A HE   1  
ATOM   4726   H HH11 . ARG A 1 310 ? 5.920   -0.067  -12.793 0.02 19.15 ?  303  ARG A HH11 1  
ATOM   4727   H HH12 . ARG A 1 310 ? 5.881   -1.512  -13.156 0.02 19.32 ?  303  ARG A HH12 1  
ATOM   4728   H HH21 . ARG A 1 310 ? 8.509   -2.478  -11.429 0.02 19.34 ?  303  ARG A HH21 1  
ATOM   4729   H HH22 . ARG A 1 310 ? 7.430   -2.957  -12.341 0.02 19.43 ?  303  ARG A HH22 1  
ATOM   4730   N N    . THR A 1 311 ? 7.200   5.524   -7.117  0.02 19.22 ?  304  THR A N    1  
ATOM   4731   C CA   . THR A 1 311 ? 6.512   6.695   -6.557  0.02 19.37 ?  304  THR A CA   1  
ATOM   4732   C C    . THR A 1 311 ? 7.418   7.910   -6.519  0.02 19.15 ?  304  THR A C    1  
ATOM   4733   O O    . THR A 1 311 ? 6.996   9.020   -6.880  0.02 19.13 ?  304  THR A O    1  
ATOM   4734   C CB   . THR A 1 311 ? 6.016   6.406   -5.132  0.02 19.73 ?  304  THR A CB   1  
ATOM   4735   O OG1  . THR A 1 311 ? 4.861   5.568   -5.186  0.02 20.01 ?  304  THR A OG1  1  
ATOM   4736   C CG2  . THR A 1 311 ? 5.696   7.708   -4.331  0.02 19.87 ?  304  THR A CG2  1  
ATOM   4737   H H    . THR A 1 311 ? 7.336   4.887   -6.554  0.02 19.34 ?  304  THR A H    1  
ATOM   4738   H HA   . THR A 1 311 ? 5.749   6.905   -7.117  0.02 19.43 ?  304  THR A HA   1  
ATOM   4739   H HB   . THR A 1 311 ? 6.706   5.939   -4.642  0.02 19.71 ?  304  THR A HB   1  
ATOM   4740   H HG1  . THR A 1 311 ? 4.781   5.141   -4.466  0.02 20.20 ?  304  THR A HG1  1  
ATOM   4741   H HG21 . THR A 1 311 ? 5.365   7.477   -3.452  0.02 20.15 ?  304  THR A HG21 1  
ATOM   4742   H HG22 . THR A 1 311 ? 6.491   8.249   -4.212  0.02 19.78 ?  304  THR A HG22 1  
ATOM   4743   H HG23 . THR A 1 311 ? 5.020   8.231   -4.790  0.02 19.82 ?  304  THR A HG23 1  
ATOM   4744   N N    . ASN A 1 312 ? 8.628   7.733   -5.986  0.02 19.03 ?  305  ASN A N    1  
ATOM   4745   C CA   . ASN A 1 312 ? 9.651   8.760   -5.816  0.02 18.85 ?  305  ASN A CA   1  
ATOM   4746   C C    . ASN A 1 312 ? 10.237  9.215   -7.156  0.02 18.53 ?  305  ASN A C    1  
ATOM   4747   O O    . ASN A 1 312 ? 11.136  10.059  -7.164  0.02 18.38 ?  305  ASN A O    1  
ATOM   4748   C CB   . ASN A 1 312 ? 10.787  8.241   -4.912  0.02 18.84 ?  305  ASN A CB   1  
ATOM   4749   C CG   . ASN A 1 312 ? 10.691  8.736   -3.455  0.02 19.13 ?  305  ASN A CG   1  
ATOM   4750   O OD1  . ASN A 1 312 ? 11.520  9.557   -2.987  0.02 19.10 ?  305  ASN A OD1  1  
ATOM   4751   N ND2  . ASN A 1 312 ? 9.724   8.204   -2.730  0.02 19.42 ?  305  ASN A ND2  1  
ATOM   4752   H H    . ASN A 1 312 ? 8.888   6.967   -5.702  0.02 19.07 ?  305  ASN A H    1  
ATOM   4753   H HA   . ASN A 1 312 ? 9.254   9.532   -5.387  0.02 18.97 ?  305  ASN A HA   1  
ATOM   4754   H HB2  . ASN A 1 312 ? 10.754  7.273   -4.895  0.02 18.86 ?  305  ASN A HB2  1  
ATOM   4755   H HB3  . ASN A 1 312 ? 11.638  8.535   -5.267  0.02 18.65 ?  305  ASN A HB3  1  
ATOM   4756   H HD21 . ASN A 1 312 ? 9.299   7.517   -3.019  0.02 19.44 ?  305  ASN A HD21 1  
ATOM   4757   H HD22 . ASN A 1 312 ? 9.523   8.545   -1.968  0.02 19.61 ?  305  ASN A HD22 1  
ATOM   4758   N N    . LYS A 1 313 ? 9.735   8.646   -8.254  0.02 18.45 ?  306  LYS A N    1  
ATOM   4759   C CA   . LYS A 1 313 ? 10.017  9.047   -9.630  0.02 18.20 ?  306  LYS A CA   1  
ATOM   4760   C C    . LYS A 1 313 ? 11.349  8.520   -10.129 0.02 17.95 ?  306  LYS A C    1  
ATOM   4761   O O    . LYS A 1 313 ? 11.870  9.021   -11.129 0.02 17.75 ?  306  LYS A O    1  
ATOM   4762   C CB   . LYS A 1 313 ? 9.951   10.572  -9.814  0.02 18.17 ?  306  LYS A CB   1  
ATOM   4763   C CG   . LYS A 1 313 ? 8.551   11.195  -9.641  0.02 18.42 ?  306  LYS A CG   1  
ATOM   4764   C CD   . LYS A 1 313 ? 7.497   10.632  -10.607 0.02 18.49 ?  306  LYS A CD   1  
ATOM   4765   C CE   . LYS A 1 313 ? 6.088   11.051  -10.216 0.02 18.78 ?  306  LYS A CE   1  
ATOM   4766   N NZ   . LYS A 1 313 ? 5.081   10.552  -11.163 0.02 18.87 ?  306  LYS A NZ   1  
ATOM   4767   H H    . LYS A 1 313 ? 9.203   7.975   -8.229  0.02 18.57 ?  306  LYS A H    1  
ATOM   4768   H HA   . LYS A 1 313 ? 9.341   8.654   -10.199 0.02 18.24 ?  306  LYS A HA   1  
ATOM   4769   H HB2  . LYS A 1 313 ? 10.542  11.001  -9.177  0.02 18.15 ?  306  LYS A HB2  1  
ATOM   4770   H HB3  . LYS A 1 313 ? 10.244  10.783  -10.714 0.02 18.01 ?  306  LYS A HB3  1  
ATOM   4771   H HG2  . LYS A 1 313 ? 8.245   11.026  -8.739  0.02 18.59 ?  306  LYS A HG2  1  
ATOM   4772   H HG3  . LYS A 1 313 ? 8.614   12.150  -9.791  0.02 18.39 ?  306  LYS A HG3  1  
ATOM   4773   H HD2  . LYS A 1 313 ? 7.675   10.959  -11.505 0.02 18.34 ?  306  LYS A HD2  1  
ATOM   4774   H HD3  . LYS A 1 313 ? 7.523   9.665   -10.593 0.02 18.53 ?  306  LYS A HD3  1  
ATOM   4775   H HE2  . LYS A 1 313 ? 5.881   10.673  -9.347  0.02 18.95 ?  306  LYS A HE2  1  
ATOM   4776   H HE3  . LYS A 1 313 ? 6.031   12.017  -10.184 0.02 18.77 ?  306  LYS A HE3  1  
ATOM   4777   H HZ1  . LYS A 1 313 ? 4.844   9.721   -10.951 0.02 18.96 ?  306  LYS A HZ1  1  
ATOM   4778   H HZ2  . LYS A 1 313 ? 4.362   11.071  -11.146 0.02 19.02 ?  306  LYS A HZ2  1  
ATOM   4779   H HZ3  . LYS A 1 313 ? 5.418   10.553  -11.986 0.02 18.72 ?  306  LYS A HZ3  1  
ATOM   4780   N N    . VAL A 1 314 ? 11.906  7.508   -9.472  0.02 17.99 ?  307  VAL A N    1  
ATOM   4781   C CA   . VAL A 1 314 ? 13.032  6.771   -10.032 0.02 17.80 ?  307  VAL A CA   1  
ATOM   4782   C C    . VAL A 1 314 ? 12.549  6.087   -11.303 0.02 17.72 ?  307  VAL A C    1  
ATOM   4783   O O    . VAL A 1 314 ? 11.612  5.284   -11.272 0.02 17.90 ?  307  VAL A O    1  
ATOM   4784   C CB   . VAL A 1 314 ? 13.584  5.749   -9.035  0.02 17.91 ?  307  VAL A CB   1  
ATOM   4785   C CG1  . VAL A 1 314 ? 14.840  5.048   -9.619  0.02 17.72 ?  307  VAL A CG1  1  
ATOM   4786   C CG2  . VAL A 1 314 ? 13.857  6.405   -7.718  0.02 18.05 ?  307  VAL A CG2  1  
ATOM   4787   H H    . VAL A 1 314 ? 11.640  7.223   -8.709  0.02 18.14 ?  307  VAL A H    1  
ATOM   4788   H HA   . VAL A 1 314 ? 13.743  7.387   -10.265 0.02 17.66 ?  307  VAL A HA   1  
ATOM   4789   H HB   . VAL A 1 314 ? 12.906  5.069   -8.891  0.02 18.05 ?  307  VAL A HB   1  
ATOM   4790   H HG11 . VAL A 1 314 ? 15.187  4.410   -8.978  0.02 17.80 ?  307  VAL A HG11 1  
ATOM   4791   H HG12 . VAL A 1 314 ? 14.588  4.583   -10.430 0.02 17.67 ?  307  VAL A HG12 1  
ATOM   4792   H HG13 . VAL A 1 314 ? 15.511  5.718   -9.816  0.02 17.58 ?  307  VAL A HG13 1  
ATOM   4793   H HG21 . VAL A 1 314 ? 14.301  5.769   -7.136  0.02 18.08 ?  307  VAL A HG21 1  
ATOM   4794   H HG22 . VAL A 1 314 ? 14.419  7.181   -7.861  0.02 17.96 ?  307  VAL A HG22 1  
ATOM   4795   H HG23 . VAL A 1 314 ? 13.014  6.680   -7.329  0.02 18.23 ?  307  VAL A HG23 1  
ATOM   4796   N N    . MET A 1 315 ? 13.193  6.406   -12.433 0.02 17.50 ?  308  MET A N    1  
ATOM   4797   C CA   . MET A 1 315 ? 12.719  5.959   -13.737 0.02 17.44 ?  308  MET A CA   1  
ATOM   4798   C C    . MET A 1 315 ? 13.268  4.593   -14.166 0.02 17.40 ?  308  MET A C    1  
ATOM   4799   O O    . MET A 1 315 ? 12.541  3.814   -14.799 0.02 17.49 ?  308  MET A O    1  
ATOM   4800   C CB   . MET A 1 315 ? 13.044  7.027   -14.781 0.02 17.27 ?  308  MET A CB   1  
ATOM   4801   C CG   . MET A 1 315 ? 12.305  6.815   -16.069 0.02 17.27 ?  308  MET A CG   1  
ATOM   4802   S SD   . MET A 1 315 ? 12.511  8.113   -17.308 0.02 17.11 ?  308  MET A SD   1  
ATOM   4803   C CE   . MET A 1 315 ? 11.294  9.359   -16.834 0.02 17.28 ?  308  MET A CE   1  
ATOM   4804   H H    . MET A 1 315 ? 13.900  6.891   -12.463 0.02 17.39 ?  308  MET A H    1  
ATOM   4805   H HA   . MET A 1 315 ? 11.752  5.895   -13.697 0.02 17.58 ?  308  MET A HA   1  
ATOM   4806   H HB2  . MET A 1 315 ? 12.788  7.895   -14.429 0.02 17.30 ?  308  MET A HB2  1  
ATOM   4807   H HB3  . MET A 1 315 ? 13.996  7.012   -14.970 0.02 17.13 ?  308  MET A HB3  1  
ATOM   4808   H HG2  . MET A 1 315 ? 12.639  5.997   -16.464 0.02 17.24 ?  308  MET A HG2  1  
ATOM   4809   H HG3  . MET A 1 315 ? 11.359  6.725   -15.882 0.02 17.42 ?  308  MET A HG3  1  
ATOM   4810   H HE1  . MET A 1 315 ? 11.676  9.931   -16.150 0.02 17.29 ?  308  MET A HE1  1  
ATOM   4811   H HE2  . MET A 1 315 ? 11.061  9.886   -17.615 0.02 17.25 ?  308  MET A HE2  1  
ATOM   4812   H HE3  . MET A 1 315 ? 10.503  8.911   -16.495 0.02 17.42 ?  308  MET A HE3  1  
ATOM   4813   N N    . PHE A 1 316 ? 14.532  4.275   -13.856 0.02 17.30 ?  309  PHE A N    1  
ATOM   4814   C CA   . PHE A 1 316 ? 15.170  3.036   -14.287 0.02 17.27 ?  309  PHE A CA   1  
ATOM   4815   C C    . PHE A 1 316 ? 15.909  2.403   -13.117 0.02 17.35 ?  309  PHE A C    1  
ATOM   4816   O O    . PHE A 1 316 ? 16.503  3.134   -12.328 0.02 17.32 ?  309  PHE A O    1  
ATOM   4817   C CB   . PHE A 1 316 ? 16.173  3.289   -15.431 0.02 17.04 ?  309  PHE A CB   1  
ATOM   4818   C CG   . PHE A 1 316 ? 15.649  4.186   -16.514 0.02 16.96 ?  309  PHE A CG   1  
ATOM   4819   C CD1  . PHE A 1 316 ? 14.840  3.699   -17.504 0.02 17.02 ?  309  PHE A CD1  1  
ATOM   4820   C CD2  . PHE A 1 316 ? 16.009  5.517   -16.559 0.02 16.85 ?  309  PHE A CD2  1  
ATOM   4821   C CE1  . PHE A 1 316 ? 14.344  4.539   -18.498 0.02 16.97 ?  309  PHE A CE1  1  
ATOM   4822   C CE2  . PHE A 1 316 ? 15.524  6.364   -17.547 0.02 16.80 ?  309  PHE A CE2  1  
ATOM   4823   C CZ   . PHE A 1 316 ? 14.692  5.862   -18.531 0.02 16.86 ?  309  PHE A CZ   1  
ATOM   4824   H H    . PHE A 1 316 ? 15.043  4.779   -13.387 0.02 17.26 ?  309  PHE A H    1  
ATOM   4825   H HA   . PHE A 1 316 ? 14.494  2.419   -14.598 0.02 17.37 ?  309  PHE A HA   1  
ATOM   4826   H HB2  . PHE A 1 316 ? 16.960  3.713   -15.058 0.02 16.97 ?  309  PHE A HB2  1  
ATOM   4827   H HB3  . PHE A 1 316 ? 16.413  2.437   -15.829 0.02 17.05 ?  309  PHE A HB3  1  
ATOM   4828   H HD1  . PHE A 1 316 ? 14.591  2.804   -17.489 0.02 17.11 ?  309  PHE A HD1  1  
ATOM   4829   H HD2  . PHE A 1 316 ? 16.565  5.857   -15.895 0.02 16.83 ?  309  PHE A HD2  1  
ATOM   4830   H HE1  . PHE A 1 316 ? 13.789  4.188   -19.153 0.02 17.03 ?  309  PHE A HE1  1  
ATOM   4831   H HE2  . PHE A 1 316 ? 15.776  7.258   -17.554 0.02 16.74 ?  309  PHE A HE2  1  
ATOM   4832   H HZ   . PHE A 1 316 ? 14.369  6.414   -19.200 0.02 16.84 ?  309  PHE A HZ   1  
ATOM   4833   N N    . PRO A 1 317 ? 15.929  1.066   -13.003 0.02 17.47 ?  310  PRO A N    1  
ATOM   4834   C CA   . PRO A 1 317 ? 16.632  0.453   -11.864 0.02 17.59 ?  310  PRO A CA   1  
ATOM   4835   C C    . PRO A 1 317 ? 18.138  0.553   -11.961 0.02 17.43 ?  310  PRO A C    1  
ATOM   4836   O O    . PRO A 1 317 ? 18.808  0.658   -10.935 0.02 17.49 ?  310  PRO A O    1  
ATOM   4837   C CB   . PRO A 1 317 ? 16.171  -1.007  -11.907 0.02 17.79 ?  310  PRO A CB   1  
ATOM   4838   C CG   . PRO A 1 317 ? 15.757  -1.247  -13.337 0.02 17.70 ?  310  PRO A CG   1  
ATOM   4839   C CD   . PRO A 1 317 ? 15.236  0.057   -13.836 0.02 17.57 ?  310  PRO A CD   1  
ATOM   4840   H HA   . PRO A 1 317 ? 16.338  0.856   -11.034 0.02 17.68 ?  310  PRO A HA   1  
ATOM   4841   H HB2  . PRO A 1 317 ? 16.911  -1.584  -11.667 0.02 17.81 ?  310  PRO A HB2  1  
ATOM   4842   H HB3  . PRO A 1 317 ? 15.422  -1.142  -11.306 0.02 17.96 ?  310  PRO A HB3  1  
ATOM   4843   H HG2  . PRO A 1 317 ? 16.529  -1.527  -13.852 0.02 17.60 ?  310  PRO A HG2  1  
ATOM   4844   H HG3  . PRO A 1 317 ? 15.064  -1.923  -13.362 0.02 17.86 ?  310  PRO A HG3  1  
ATOM   4845   H HD2  . PRO A 1 317 ? 15.453  0.176   -14.773 0.02 17.44 ?  310  PRO A HD2  1  
ATOM   4846   H HD3  . PRO A 1 317 ? 14.276  0.101   -13.690 0.02 17.70 ?  310  PRO A HD3  1  
ATOM   4847   N N    . PHE A 1 318 ? 18.708  0.456   -13.153 0.02 17.26 ?  311  PHE A N    1  
ATOM   4848   C CA   . PHE A 1 318 ? 20.146  0.568   -13.329 0.02 17.13 ?  311  PHE A CA   1  
ATOM   4849   C C    . PHE A 1 318 ? 20.457  1.719   -14.274 0.02 16.92 ?  311  PHE A C    1  
ATOM   4850   O O    . PHE A 1 318 ? 19.776  1.896   -15.281 0.02 16.86 ?  311  PHE A O    1  
ATOM   4851   C CB   . PHE A 1 318 ? 20.716  -0.747  -13.867 0.02 17.17 ?  311  PHE A CB   1  
ATOM   4852   C CG   . PHE A 1 318 ? 20.437  -1.928  -12.981 0.02 17.41 ?  311  PHE A CG   1  
ATOM   4853   C CD1  . PHE A 1 318 ? 21.228  -2.192  -11.875 0.02 17.52 ?  311  PHE A CD1  1  
ATOM   4854   C CD2  . PHE A 1 318 ? 19.385  -2.756  -13.253 0.02 17.56 ?  311  PHE A CD2  1  
ATOM   4855   C CE1  . PHE A 1 318 ? 20.964  -3.292  -11.058 0.02 17.78 ?  311  PHE A CE1  1  
ATOM   4856   C CE2  . PHE A 1 318 ? 19.120  -3.856  -12.438 0.02 17.81 ?  311  PHE A CE2  1  
ATOM   4857   C CZ   . PHE A 1 318 ? 19.920  -4.110  -11.342 0.02 17.92 ?  311  PHE A CZ   1  
ATOM   4858   H H    . PHE A 1 318 ? 18.275  0.310   -13.877 0.02 17.24 ?  311  PHE A H    1  
ATOM   4859   H HA   . PHE A 1 318 ? 20.568  0.754   -12.479 0.02 17.18 ?  311  PHE A HA   1  
ATOM   4860   H HB2  . PHE A 1 318 ? 20.310  -0.927  -14.725 0.02 17.13 ?  311  PHE A HB2  1  
ATOM   4861   H HB3  . PHE A 1 318 ? 21.678  -0.668  -13.956 0.02 17.10 ?  311  PHE A HB3  1  
ATOM   4862   H HD1  . PHE A 1 318 ? 21.944  -1.637  -11.676 0.02 17.44 ?  311  PHE A HD1  1  
ATOM   4863   H HD2  . PHE A 1 318 ? 18.851  -2.586  -13.991 0.02 17.50 ?  311  PHE A HD2  1  
ATOM   4864   H HE1  . PHE A 1 318 ? 21.499  -3.466  -10.318 0.02 17.87 ?  311  PHE A HE1  1  
ATOM   4865   H HE2  . PHE A 1 318 ? 18.404  -4.416  -12.636 0.02 17.93 ?  311  PHE A HE2  1  
ATOM   4866   H HZ   . PHE A 1 318 ? 19.744  -4.841  -10.797 0.02 18.11 ?  311  PHE A HZ   1  
ATOM   4867   N N    . GLY A 1 319 ? 21.508  2.465   -13.949 0.02 16.84 ?  312  GLY A N    1  
ATOM   4868   C CA   . GLY A 1 319 ? 21.882  3.661   -14.662 0.02 16.69 ?  312  GLY A CA   1  
ATOM   4869   C C    . GLY A 1 319 ? 23.186  4.226   -14.153 0.02 16.67 ?  312  GLY A C    1  
ATOM   4870   O O    . GLY A 1 319 ? 23.820  3.685   -13.239 0.02 16.77 ?  312  GLY A O    1  
ATOM   4871   H H    . GLY A 1 319 ? 22.036  2.283   -13.299 0.02 16.90 ?  312  GLY A H    1  
ATOM   4872   H HA2  . GLY A 1 319 ? 21.972  3.462   -15.605 0.02 16.61 ?  312  GLY A HA2  1  
ATOM   4873   H HA3  . GLY A 1 319 ? 21.201  4.342   -14.554 0.02 16.69 ?  312  GLY A HA3  1  
ATOM   4874   N N    . PRO A 1 320 ? 23.587  5.351   -14.715 0.02 16.56 ?  313  PRO A N    1  
ATOM   4875   C CA   . PRO A 1 320 ? 24.769  6.049   -14.212 0.02 16.57 ?  313  PRO A CA   1  
ATOM   4876   C C    . PRO A 1 320 ? 24.634  6.250   -12.712 0.02 16.73 ?  313  PRO A C    1  
ATOM   4877   O O    . PRO A 1 320 ? 23.537  6.488   -12.204 0.02 16.79 ?  313  PRO A O    1  
ATOM   4878   C CB   . PRO A 1 320 ? 24.742  7.375   -14.977 0.02 16.48 ?  313  PRO A CB   1  
ATOM   4879   C CG   . PRO A 1 320 ? 24.112  6.991   -16.307 0.02 16.38 ?  313  PRO A CG   1  
ATOM   4880   C CD   . PRO A 1 320 ? 23.045  5.975   -15.934 0.02 16.45 ?  313  PRO A CD   1  
ATOM   4881   H HA   . PRO A 1 320 ? 25.572  5.554   -14.407 0.02 16.57 ?  313  PRO A HA   1  
ATOM   4882   H HB2  . PRO A 1 320 ? 24.189  8.020   -14.517 0.02 16.52 ?  313  PRO A HB2  1  
ATOM   4883   H HB3  . PRO A 1 320 ? 25.640  7.713   -15.104 0.02 16.47 ?  313  PRO A HB3  1  
ATOM   4884   H HG2  . PRO A 1 320 ? 23.724  7.770   -16.729 0.02 16.35 ?  313  PRO A HG2  1  
ATOM   4885   H HG3  . PRO A 1 320 ? 24.784  6.589   -16.875 0.02 16.34 ?  313  PRO A HG3  1  
ATOM   4886   H HD2  . PRO A 1 320 ? 22.206  6.417   -15.738 0.02 16.48 ?  313  PRO A HD2  1  
ATOM   4887   H HD3  . PRO A 1 320 ? 22.951  5.305   -16.627 0.02 16.42 ?  313  PRO A HD3  1  
ATOM   4888   N N    . THR A 1 321 ? 25.755  6.137   -12.006 0.02 16.82 ?  314  THR A N    1  
ATOM   4889   C CA   . THR A 1 321 ? 25.740  6.155   -10.553 0.02 17.00 ?  314  THR A CA   1  
ATOM   4890   C C    . THR A 1 321 ? 26.996  6.854   -10.065 0.02 17.08 ?  314  THR A C    1  
ATOM   4891   O O    . THR A 1 321 ? 27.965  6.997   -10.792 0.02 17.00 ?  314  THR A O    1  
ATOM   4892   C CB   . THR A 1 321 ? 25.668  4.734   -9.989  0.02 17.12 ?  314  THR A CB   1  
ATOM   4893   O OG1  . THR A 1 321 ? 25.259  4.780   -8.620  0.02 17.32 ?  314  THR A OG1  1  
ATOM   4894   C CG2  . THR A 1 321 ? 27.036  4.058   -10.059 0.02 17.15 ?  314  THR A CG2  1  
ATOM   4895   H H    . THR A 1 321 ? 26.539  6.059   -12.338 0.02 16.79 ?  314  THR A H    1  
ATOM   4896   H HA   . THR A 1 321 ? 24.967  6.652   -10.247 0.02 17.03 ?  314  THR A HA   1  
ATOM   4897   H HB   . THR A 1 321 ? 25.033  4.209   -10.499 0.02 17.07 ?  314  THR A HB   1  
ATOM   4898   H HG1  . THR A 1 321 ? 24.536  5.199   -8.559  0.02 17.32 ?  314  THR A HG1  1  
ATOM   4899   H HG21 . THR A 1 321 ? 26.930  3.099   -10.140 0.02 17.18 ?  314  THR A HG21 1  
ATOM   4900   H HG22 . THR A 1 321 ? 27.531  4.383   -10.825 0.02 17.05 ?  314  THR A HG22 1  
ATOM   4901   H HG23 . THR A 1 321 ? 27.544  4.252   -9.255  0.02 17.28 ?  314  THR A HG23 1  
ATOM   4902   N N    . VAL A 1 322 ? 26.989  7.290   -8.814  0.02 17.26 ?  315  VAL A N    1  
ATOM   4903   C CA   . VAL A 1 322 ? 28.230  7.750   -8.211  0.02 17.39 ?  315  VAL A CA   1  
ATOM   4904   C C    . VAL A 1 322 ? 28.961  6.514   -7.703  0.02 17.51 ?  315  VAL A C    1  
ATOM   4905   O O    . VAL A 1 322 ? 28.427  5.774   -6.875  0.02 17.64 ?  315  VAL A O    1  
ATOM   4906   C CB   . VAL A 1 322 ? 27.947  8.766   -7.090  0.02 17.57 ?  315  VAL A CB   1  
ATOM   4907   C CG1  . VAL A 1 322 ? 29.226  9.340   -6.566  0.02 17.73 ?  315  VAL A CG1  1  
ATOM   4908   C CG2  . VAL A 1 322 ? 27.082  9.875   -7.645  0.02 17.46 ?  315  VAL A CG2  1  
ATOM   4909   H H    . VAL A 1 322 ? 26.302  7.324   -8.303  0.02 17.32 ?  315  VAL A H    1  
ATOM   4910   H HA   . VAL A 1 322 ? 28.778  8.178   -8.883  0.02 17.31 ?  315  VAL A HA   1  
ATOM   4911   H HB   . VAL A 1 322 ? 27.470  8.328   -6.371  0.02 17.67 ?  315  VAL A HB   1  
ATOM   4912   H HG11 . VAL A 1 322 ? 29.027  10.159  -6.088  0.02 17.83 ?  315  VAL A HG11 1  
ATOM   4913   H HG12 . VAL A 1 322 ? 29.647  8.696   -5.976  0.02 17.85 ?  315  VAL A HG12 1  
ATOM   4914   H HG13 . VAL A 1 322 ? 29.809  9.538   -7.316  0.02 17.64 ?  315  VAL A HG13 1  
ATOM   4915   H HG21 . VAL A 1 322 ? 26.988  10.564  -6.971  0.02 17.59 ?  315  VAL A HG21 1  
ATOM   4916   H HG22 . VAL A 1 322 ? 27.517  10.239  -8.428  0.02 17.35 ?  315  VAL A HG22 1  
ATOM   4917   H HG23 . VAL A 1 322 ? 26.210  9.527   -7.881  0.02 17.40 ?  315  VAL A HG23 1  
ATOM   4918   N N    . GLU A 1 323 ? 30.198  6.315   -8.165  0.02 17.51 ?  316  GLU A N    1  
ATOM   4919   C CA   . GLU A 1 323 ? 30.904  5.067   -7.950  0.02 17.60 ?  316  GLU A CA   1  
ATOM   4920   C C    . GLU A 1 323 ? 31.348  4.950   -6.493  0.02 17.89 ?  316  GLU A C    1  
ATOM   4921   O O    . GLU A 1 323 ? 31.852  5.913   -5.938  0.02 18.01 ?  316  GLU A O    1  
ATOM   4922   C CB   . GLU A 1 323 ? 32.098  4.981   -8.903  0.02 17.54 ?  316  GLU A CB   1  
ATOM   4923   C CG   . GLU A 1 323 ? 31.610  5.117   -10.351 0.02 17.28 ?  316  GLU A CG   1  
ATOM   4924   C CD   . GLU A 1 323 ? 32.657  4.886   -11.431 0.02 17.22 ?  316  GLU A CD   1  
ATOM   4925   O OE1  . GLU A 1 323 ? 32.551  5.577   -12.462 0.02 17.07 ?  316  GLU A OE1  1  
ATOM   4926   O OE2  . GLU A 1 323 ? 33.554  4.021   -11.276 0.02 17.33 -1 316  GLU A OE2  1  
ATOM   4927   H H    . GLU A 1 323 ? 30.644  6.894   -8.608  0.02 17.46 ?  316  GLU A H    1  
ATOM   4928   H HA   . GLU A 1 323 ? 30.301  4.341   -8.156  0.02 17.55 ?  316  GLU A HA   1  
ATOM   4929   H HB2  . GLU A 1 323 ? 32.712  5.707   -8.715  0.02 17.60 ?  316  GLU A HB2  1  
ATOM   4930   H HB3  . GLU A 1 323 ? 32.542  4.128   -8.797  0.02 17.61 ?  316  GLU A HB3  1  
ATOM   4931   H HG2  . GLU A 1 323 ? 30.897  4.475   -10.496 0.02 17.24 ?  316  GLU A HG2  1  
ATOM   4932   H HG3  . GLU A 1 323 ? 31.263  6.012   -10.472 0.02 17.22 ?  316  GLU A HG3  1  
ATOM   4933   N N    . PRO A 1 324 ? 31.159  3.786   -5.864  0.02 18.02 ?  317  PRO A N    1  
ATOM   4934   C CA   . PRO A 1 324 ? 31.321  3.709   -4.393  0.02 18.32 ?  317  PRO A CA   1  
ATOM   4935   C C    . PRO A 1 324 ? 32.750  3.807   -3.909  0.02 18.52 ?  317  PRO A C    1  
ATOM   4936   O O    . PRO A 1 324 ? 32.961  4.012   -2.704  0.02 18.78 ?  317  PRO A O    1  
ATOM   4937   C CB   . PRO A 1 324 ? 30.709  2.345   -4.039  0.02 18.42 ?  317  PRO A CB   1  
ATOM   4938   C CG   . PRO A 1 324 ? 30.627  1.563   -5.323  0.02 18.19 ?  317  PRO A CG   1  
ATOM   4939   C CD   . PRO A 1 324 ? 30.567  2.554   -6.425  0.02 17.93 ?  317  PRO A CD   1  
ATOM   4940   H HA   . PRO A 1 324 ? 30.802  4.414   -3.974  0.02 18.36 ?  317  PRO A HA   1  
ATOM   4941   H HB2  . PRO A 1 324 ? 31.278  1.888   -3.402  0.02 18.60 ?  317  PRO A HB2  1  
ATOM   4942   H HB3  . PRO A 1 324 ? 29.824  2.475   -3.669  0.02 18.46 ?  317  PRO A HB3  1  
ATOM   4943   H HG2  . PRO A 1 324 ? 31.416  1.007   -5.416  0.02 18.25 ?  317  PRO A HG2  1  
ATOM   4944   H HG3  . PRO A 1 324 ? 29.831  1.013   -5.308  0.02 18.20 ?  317  PRO A HG3  1  
ATOM   4945   H HD2  . PRO A 1 324 ? 31.086  2.241   -7.183  0.02 17.84 ?  317  PRO A HD2  1  
ATOM   4946   H HD3  . PRO A 1 324 ? 29.643  2.711   -6.673  0.02 17.84 ?  317  PRO A HD3  1  
ATOM   4947   N N    . TYR A 1 325 ? 33.728  3.650   -4.785  0.02 18.44 ?  318  TYR A N    1  
ATOM   4948   C CA   . TYR A 1 325 ? 35.138  3.713   -4.423  0.02 18.64 ?  318  TYR A CA   1  
ATOM   4949   C C    . TYR A 1 325 ? 35.927  4.115   -5.656  0.02 18.46 ?  318  TYR A C    1  
ATOM   4950   O O    . TYR A 1 325 ? 35.401  4.123   -6.773  0.02 18.20 ?  318  TYR A O    1  
ATOM   4951   C CB   . TYR A 1 325 ? 35.657  2.371   -3.885  0.02 18.86 ?  318  TYR A CB   1  
ATOM   4952   C CG   . TYR A 1 325 ? 35.404  1.228   -4.842  0.02 18.70 ?  318  TYR A CG   1  
ATOM   4953   C CD1  . TYR A 1 325 ? 34.242  0.475   -4.753  0.02 18.67 ?  318  TYR A CD1  1  
ATOM   4954   C CD2  . TYR A 1 325 ? 36.288  0.937   -5.861  0.02 18.61 ?  318  TYR A CD2  1  
ATOM   4955   C CE1  . TYR A 1 325 ? 33.987  -0.553  -5.627  0.02 18.55 ?  318  TYR A CE1  1  
ATOM   4956   C CE2  . TYR A 1 325 ? 36.049  -0.082  -6.741  0.02 18.49 ?  318  TYR A CE2  1  
ATOM   4957   C CZ   . TYR A 1 325 ? 34.891  -0.832  -6.634  0.02 18.46 ?  318  TYR A CZ   1  
ATOM   4958   O OH   . TYR A 1 325 ? 34.652  -1.860  -7.517  0.02 18.37 ?  318  TYR A OH   1  
ATOM   4959   H H    . TYR A 1 325 ? 33.591  3.516   -5.624  0.02 18.27 ?  318  TYR A H    1  
ATOM   4960   H HA   . TYR A 1 325 ? 35.274  4.391   -3.743  0.02 18.77 ?  318  TYR A HA   1  
ATOM   4961   H HB2  . TYR A 1 325 ? 36.613  2.435   -3.735  0.02 18.99 ?  318  TYR A HB2  1  
ATOM   4962   H HB3  . TYR A 1 325 ? 35.202  2.175   -3.053  0.02 19.01 ?  318  TYR A HB3  1  
ATOM   4963   H HD1  . TYR A 1 325 ? 33.631  0.663   -4.079  0.02 18.74 ?  318  TYR A HD1  1  
ATOM   4964   H HD2  . TYR A 1 325 ? 37.068  1.434   -5.943  0.02 18.65 ?  318  TYR A HD2  1  
ATOM   4965   H HE1  . TYR A 1 325 ? 33.207  -1.050  -5.547  0.02 18.56 ?  318  TYR A HE1  1  
ATOM   4966   H HE2  . TYR A 1 325 ? 36.661  -0.267  -7.413  0.02 18.44 ?  318  TYR A HE2  1  
ATOM   4967   H HH   . TYR A 1 325 ? 34.014  -2.332  -7.252  0.02 18.42 ?  318  TYR A HH   1  
ATOM   4968   N N    . GLN A 1 326 ? 37.211  4.413   -5.453  0.02 18.64 ?  319  GLN A N    1  
ATOM   4969   C CA   . GLN A 1 326 ? 38.030  4.837   -6.588  0.02 18.52 ?  319  GLN A CA   1  
ATOM   4970   C C    . GLN A 1 326 ? 38.690  3.673   -7.338  0.02 18.54 ?  319  GLN A C    1  
ATOM   4971   O O    . GLN A 1 326 ? 39.165  2.688   -6.756  0.02 18.77 ?  319  GLN A O    1  
ATOM   4972   C CB   . GLN A 1 326 ? 39.126  5.830   -6.182  0.02 18.73 ?  319  GLN A CB   1  
ATOM   4973   C CG   . GLN A 1 326 ? 39.097  7.196   -6.763  0.02 18.57 ?  319  GLN A CG   1  
ATOM   4974   C CD   . GLN A 1 326 ? 38.390  7.309   -8.120  0.02 18.25 ?  319  GLN A CD   1  
ATOM   4975   O OE1  . GLN A 1 326 ? 37.312  7.926   -8.416  0.02 18.07 ?  319  GLN A OE1  1  
ATOM   4976   N NE2  . GLN A 1 326 ? 39.040  6.586   -9.013  0.02 18.22 ?  319  GLN A NE2  1  
ATOM   4977   H H    . GLN A 1 326 ? 37.608  4.391   -4.692  0.02 18.83 ?  319  GLN A H    1  
ATOM   4978   H HA   . GLN A 1 326 ? 37.426  5.256   -7.209  0.02 18.32 ?  319  GLN A HA   1  
ATOM   4979   H HB2  . GLN A 1 326 ? 39.123  5.886   -5.208  0.02 18.90 ?  319  GLN A HB2  1  
ATOM   4980   H HB3  . GLN A 1 326 ? 39.961  5.454   -6.489  0.02 18.83 ?  319  GLN A HB3  1  
ATOM   4981   H HG2  . GLN A 1 326 ? 38.526  7.588   -6.069  0.02 18.56 ?  319  GLN A HG2  1  
ATOM   4982   H HG3  . GLN A 1 326 ? 39.997  7.752   -6.786  0.02 18.71 ?  319  GLN A HG3  1  
ATOM   4983   H HE21 . GLN A 1 326 ? 38.979  6.824   -9.831  0.02 18.06 ?  319  GLN A HE21 1  
ATOM   4984   H HE22 . GLN A 1 326 ? 39.551  5.929   -8.788  0.02 18.37 ?  319  GLN A HE22 1  
ATOM   4985   N N    . THR A 1 327 ? 38.643  3.784   -8.668  0.02 18.30 ?  320  THR A N    1  
ATOM   4986   C CA   . THR A 1 327 ? 39.438  3.002   -9.610  0.02 18.30 ?  320  THR A CA   1  
ATOM   4987   C C    . THR A 1 327 ? 40.126  3.947   -10.601 0.02 18.23 ?  320  THR A C    1  
ATOM   4988   O O    . THR A 1 327 ? 39.716  5.096   -10.783 0.02 18.16 ?  320  THR A O    1  
ATOM   4989   C CB   . THR A 1 327 ? 38.545  2.040   -10.373 0.02 18.10 ?  320  THR A CB   1  
ATOM   4990   O OG1  . THR A 1 327 ? 37.692  2.827   -11.194 0.02 17.84 ?  320  THR A OG1  1  
ATOM   4991   C CG2  . THR A 1 327 ? 37.674  1.248   -9.426  0.02 18.13 ?  320  THR A CG2  1  
ATOM   4992   H H    . THR A 1 327 ? 38.103  4.321   -9.063  0.02 18.13 ?  320  THR A H    1  
ATOM   4993   H HA   . THR A 1 327 ? 40.117  2.498   -9.137  0.02 18.50 ?  320  THR A HA   1  
ATOM   4994   H HB   . THR A 1 327 ? 39.076  1.433   -10.914 0.02 18.16 ?  320  THR A HB   1  
ATOM   4995   H HG1  . THR A 1 327 ? 37.478  3.529   -10.788 0.02 17.82 ?  320  THR A HG1  1  
ATOM   4996   H HG21 . THR A 1 327 ? 37.165  1.853   -8.864  0.02 18.12 ?  320  THR A HG21 1  
ATOM   4997   H HG22 . THR A 1 327 ? 37.053  0.692   -9.920  0.02 18.00 ?  320  THR A HG22 1  
ATOM   4998   H HG23 . THR A 1 327 ? 38.225  0.691   -8.855  0.02 18.32 ?  320  THR A HG23 1  
ATOM   4999   N N    . ALA A 1 328 ? 41.180  3.452   -11.260 0.02 18.26 ?  321  ALA A N    1  
ATOM   5000   C CA   . ALA A 1 328 ? 41.793  4.218   -12.339 0.02 18.24 ?  321  ALA A CA   1  
ATOM   5001   C C    . ALA A 1 328 ? 40.822  4.505   -13.485 0.02 17.95 ?  321  ALA A C    1  
ATOM   5002   O O    . ALA A 1 328 ? 40.997  5.496   -14.201 0.02 17.91 ?  321  ALA A O    1  
ATOM   5003   C CB   . ALA A 1 328 ? 43.042  3.496   -12.846 0.02 18.41 ?  321  ALA A CB   1  
ATOM   5004   H H    . ALA A 1 328 ? 41.559  2.699   -11.094 0.02 18.30 ?  321  ALA A H    1  
ATOM   5005   H HA   . ALA A 1 328 ? 42.070  5.078   -11.985 0.02 18.35 ?  321  ALA A HA   1  
ATOM   5006   H HB1  . ALA A 1 328 ? 43.343  3.923   -13.662 0.02 18.41 ?  321  ALA A HB1  1  
ATOM   5007   H HB2  . ALA A 1 328 ? 43.733  3.553   -12.167 0.02 18.62 ?  321  ALA A HB2  1  
ATOM   5008   H HB3  . ALA A 1 328 ? 42.821  2.568   -13.021 0.02 18.32 ?  321  ALA A HB3  1  
ATOM   5009   N N    . ASP A 1 329 ? 39.783  3.683   -13.675 0.02 17.77 ?  322  ASP A N    1  
ATOM   5010   C CA   . ASP A 1 329 ? 38.828  3.942   -14.768 0.02 17.51 ?  322  ASP A CA   1  
ATOM   5011   C C    . ASP A 1 329 ? 37.634  4.803   -14.351 0.02 17.38 ?  322  ASP A C    1  
ATOM   5012   O O    . ASP A 1 329 ? 36.839  5.180   -15.206 0.02 17.19 ?  322  ASP A O    1  
ATOM   5013   C CB   . ASP A 1 329 ? 38.260  2.659   -15.397 0.02 17.41 ?  322  ASP A CB   1  
ATOM   5014   C CG   . ASP A 1 329 ? 39.113  1.432   -15.195 0.02 17.59 ?  322  ASP A CG   1  
ATOM   5015   O OD1  . ASP A 1 329 ? 38.752  0.561   -14.370 0.02 17.63 ?  322  ASP A OD1  1  
ATOM   5016   O OD2  . ASP A 1 329 ? 40.148  1.320   -15.893 0.02 17.73 -1 322  ASP A OD2  1  
ATOM   5017   H H    . ASP A 1 329 ? 39.621  2.987   -13.198 0.02 17.80 ?  322  ASP A H    1  
ATOM   5018   H HA   . ASP A 1 329 ? 39.282  4.431   -15.468 0.02 17.51 ?  322  ASP A HA   1  
ATOM   5019   H HB2  . ASP A 1 329 ? 37.377  2.505   -15.055 0.02 17.32 ?  322  ASP A HB2  1  
ATOM   5020   H HB3  . ASP A 1 329 ? 38.200  2.801   -16.352 0.02 17.33 ?  322  ASP A HB3  1  
ATOM   5021   N N    . CYS A 1 330 ? 37.468  5.070   -13.067 0.02 17.49 ?  323  CYS A N    1  
ATOM   5022   C CA   . CYS A 1 330 ? 36.337  5.833   -12.532 0.02 17.41 ?  323  CYS A CA   1  
ATOM   5023   C C    . CYS A 1 330 ? 35.903  6.956   -13.462 0.02 17.26 ?  323  CYS A C    1  
ATOM   5024   O O    . CYS A 1 330 ? 36.714  7.805   -13.812 0.02 17.33 ?  323  CYS A O    1  
ATOM   5025   C CB   . CYS A 1 330 ? 36.763  6.437   -11.189 0.02 17.62 ?  323  CYS A CB   1  
ATOM   5026   S SG   . CYS A 1 330 ? 35.436  7.264   -10.320 0.02 17.58 ?  323  CYS A SG   1  
ATOM   5027   H H    . CYS A 1 330 ? 38.012  4.805   -12.457 0.02 17.64 ?  323  CYS A H    1  
ATOM   5028   H HA   . CYS A 1 330 ? 35.583  5.242   -12.386 0.02 17.33 ?  323  CYS A HA   1  
ATOM   5029   H HB2  . CYS A 1 330 ? 37.112  5.740   -10.616 0.02 17.72 ?  323  CYS A HB2  1  
ATOM   5030   H HB3  . CYS A 1 330 ? 37.453  7.096   -11.351 0.02 17.72 ?  323  CYS A HB3  1  
ATOM   5031   H HG   . CYS A 1 330 ? 34.577  6.451   -10.127 0.02 17.49 ?  323  CYS A HG   1  
ATOM   5032   N N    . VAL A 1 331 ? 34.609  7.030   -13.773 0.02 17.09 ?  324  VAL A N    1  
ATOM   5033   C CA   . VAL A 1 331 ? 34.087  8.138   -14.574 0.02 16.96 ?  324  VAL A CA   1  
ATOM   5034   C C    . VAL A 1 331 ? 33.357  9.157   -13.714 0.02 17.01 ?  324  VAL A C    1  
ATOM   5035   O O    . VAL A 1 331 ? 33.489  10.357  -13.948 0.02 17.04 ?  324  VAL A O    1  
ATOM   5036   C CB   . VAL A 1 331 ? 33.171  7.656   -15.719 0.02 16.77 ?  324  VAL A CB   1  
ATOM   5037   C CG1  . VAL A 1 331 ? 32.466  8.872   -16.433 0.02 16.67 ?  324  VAL A CG1  1  
ATOM   5038   C CG2  . VAL A 1 331 ? 33.945  6.903   -16.747 0.02 16.75 ?  324  VAL A CG2  1  
ATOM   5039   H H    . VAL A 1 331 ? 34.018  6.458   -13.534 0.02 17.05 ?  324  VAL A H    1  
ATOM   5040   H HA   . VAL A 1 331 ? 34.840  8.586   -14.990 0.02 17.01 ?  324  VAL A HA   1  
ATOM   5041   H HB   . VAL A 1 331 ? 32.483  7.070   -15.365 0.02 16.74 ?  324  VAL A HB   1  
ATOM   5042   H HG11 . VAL A 1 331 ? 31.868  9.320   -15.813 0.02 16.67 ?  324  VAL A HG11 1  
ATOM   5043   H HG12 . VAL A 1 331 ? 33.141  9.493   -16.751 0.02 16.72 ?  324  VAL A HG12 1  
ATOM   5044   H HG13 . VAL A 1 331 ? 31.957  8.530   -17.182 0.02 16.57 ?  324  VAL A HG13 1  
ATOM   5045   H HG21 . VAL A 1 331 ? 33.338  6.592   -17.437 0.02 16.64 ?  324  VAL A HG21 1  
ATOM   5046   H HG22 . VAL A 1 331 ? 34.605  7.502   -17.132 0.02 16.78 ?  324  VAL A HG22 1  
ATOM   5047   H HG23 . VAL A 1 331 ? 34.382  6.152   -16.317 0.02 16.83 ?  324  VAL A HG23 1  
ATOM   5048   N N    . LEU A 1 332 ? 32.533  8.709   -12.752 0.02 17.04 ?  325  LEU A N    1  
ATOM   5049   C CA   . LEU A 1 332 ? 31.750  9.608   -11.900 0.02 17.10 ?  325  LEU A CA   1  
ATOM   5050   C C    . LEU A 1 332 ? 32.130  9.443   -10.431 0.02 17.32 ?  325  LEU A C    1  
ATOM   5051   O O    . LEU A 1 332 ? 31.496  8.680   -9.686  0.02 17.36 ?  325  LEU A O    1  
ATOM   5052   C CB   . LEU A 1 332 ? 30.259  9.365   -12.087 0.02 16.96 ?  325  LEU A CB   1  
ATOM   5053   C CG   . LEU A 1 332 ? 29.761  9.554   -13.518 0.02 16.77 ?  325  LEU A CG   1  
ATOM   5054   C CD1  . LEU A 1 332 ? 28.277  9.419   -13.543 0.02 16.70 ?  325  LEU A CD1  1  
ATOM   5055   C CD2  . LEU A 1 332 ? 30.085  10.931  -14.063 0.02 16.76 ?  325  LEU A CD2  1  
ATOM   5056   H H    . LEU A 1 332 ? 32.407  7.881   -12.576 0.02 17.04 ?  325  LEU A H    1  
ATOM   5057   H HA   . LEU A 1 332 ? 31.932  10.525  -12.147 0.02 17.11 ?  325  LEU A HA   1  
ATOM   5058   H HB2  . LEU A 1 332 ? 30.046  8.461   -11.808 0.02 16.98 ?  325  LEU A HB2  1  
ATOM   5059   H HB3  . LEU A 1 332 ? 29.775  9.994   -11.532 0.02 17.02 ?  325  LEU A HB3  1  
ATOM   5060   H HG   . LEU A 1 332 ? 30.149  8.877   -14.092 0.02 16.73 ?  325  LEU A HG   1  
ATOM   5061   H HD11 . LEU A 1 332 ? 27.962  9.675   -14.422 0.02 16.60 ?  325  LEU A HD11 1  
ATOM   5062   H HD12 . LEU A 1 332 ? 28.031  8.501   -13.350 0.02 16.70 ?  325  LEU A HD12 1  
ATOM   5063   H HD13 . LEU A 1 332 ? 27.905  10.017  -12.875 0.02 16.77 ?  325  LEU A HD13 1  
ATOM   5064   H HD21 . LEU A 1 332 ? 29.805  10.961  -14.989 0.02 16.66 ?  325  LEU A HD21 1  
ATOM   5065   H HD22 . LEU A 1 332 ? 29.599  11.590  -13.547 0.02 16.82 ?  325  LEU A HD22 1  
ATOM   5066   H HD23 . LEU A 1 332 ? 31.038  11.097  -14.006 0.02 16.84 ?  325  LEU A HD23 1  
ATOM   5067   N N    . PRO A 1 333 ? 33.134  10.167  -9.961  0.02 17.50 ?  326  PRO A N    1  
ATOM   5068   C CA   . PRO A 1 333 ? 33.563  10.013  -8.561  0.02 17.75 ?  326  PRO A CA   1  
ATOM   5069   C C    . PRO A 1 333 ? 32.656  10.714  -7.587  0.02 17.85 ?  326  PRO A C    1  
ATOM   5070   O O    . PRO A 1 333 ? 32.760  10.483  -6.371  0.02 18.06 ?  326  PRO A O    1  
ATOM   5071   C CB   . PRO A 1 333 ? 34.958  10.650  -8.558  0.02 17.92 ?  326  PRO A CB   1  
ATOM   5072   C CG   . PRO A 1 333 ? 34.914  11.637  -9.689  0.02 17.80 ?  326  PRO A CG   1  
ATOM   5073   C CD   . PRO A 1 333 ? 34.046  11.009  -10.739 0.02 17.52 ?  326  PRO A CD   1  
ATOM   5074   H HA   . PRO A 1 333 ? 33.628  9.076   -8.329  0.02 17.76 ?  326  PRO A HA   1  
ATOM   5075   H HB2  . PRO A 1 333 ? 35.110  11.107  -7.716  0.02 18.10 ?  326  PRO A HB2  1  
ATOM   5076   H HB3  . PRO A 1 333 ? 35.632  9.970   -8.710  0.02 17.94 ?  326  PRO A HB3  1  
ATOM   5077   H HG2  . PRO A 1 333 ? 34.532  12.472  -9.379  0.02 17.85 ?  326  PRO A HG2  1  
ATOM   5078   H HG3  . PRO A 1 333 ? 35.808  11.781  -10.038 0.02 17.86 ?  326  PRO A HG3  1  
ATOM   5079   H HD2  . PRO A 1 333 ? 33.557  11.689  -11.228 0.02 17.43 ?  326  PRO A HD2  1  
ATOM   5080   H HD3  . PRO A 1 333 ? 34.568  10.453  -11.338 0.02 17.46 ?  326  PRO A HD3  1  
ATOM   5081   N N    . LYS A 1 334 ? 31.755  11.548  -8.087  0.02 17.74 ?  327  LYS A N    1  
ATOM   5082   C CA   . LYS A 1 334 ? 30.935  12.422  -7.271  0.02 17.85 ?  327  LYS A CA   1  
ATOM   5083   C C    . LYS A 1 334 ? 29.651  12.738  -8.020  0.02 17.65 ?  327  LYS A C    1  
ATOM   5084   O O    . LYS A 1 334 ? 29.531  12.482  -9.218  0.02 17.44 ?  327  LYS A O    1  
ATOM   5085   C CB   . LYS A 1 334 ? 31.678  13.713  -6.922  0.02 18.07 ?  327  LYS A CB   1  
ATOM   5086   C CG   . LYS A 1 334 ? 32.438  13.601  -5.626  0.02 18.35 ?  327  LYS A CG   1  
ATOM   5087   C CD   . LYS A 1 334 ? 33.550  14.641  -5.523  0.02 18.63 ?  327  LYS A CD   1  
ATOM   5088   C CE   . LYS A 1 334 ? 33.829  15.034  -4.049  0.02 18.95 ?  327  LYS A CE   1  
ATOM   5089   N NZ   . LYS A 1 334 ? 33.951  13.880  -3.052  0.02 19.07 ?  327  LYS A NZ   1  
ATOM   5090   H H    . LYS A 1 334 ? 31.590  11.619  -8.925  0.02 17.62 ?  327  LYS A H    1  
ATOM   5091   H HA   . LYS A 1 334 ? 30.711  11.965  -6.448  0.02 17.95 ?  327  LYS A HA   1  
ATOM   5092   H HB2  . LYS A 1 334 ? 32.314  13.914  -7.624  0.02 18.02 ?  327  LYS A HB2  1  
ATOM   5093   H HB3  . LYS A 1 334 ? 31.039  14.436  -6.838  0.02 18.11 ?  327  LYS A HB3  1  
ATOM   5094   H HG2  . LYS A 1 334 ? 31.825  13.730  -4.888  0.02 18.42 ?  327  LYS A HG2  1  
ATOM   5095   H HG3  . LYS A 1 334 ? 32.841  12.722  -5.578  0.02 18.32 ?  327  LYS A HG3  1  
ATOM   5096   H HD2  . LYS A 1 334 ? 34.365  14.274  -5.900  0.02 18.66 ?  327  LYS A HD2  1  
ATOM   5097   H HD3  . LYS A 1 334 ? 33.285  15.439  -6.005  0.02 18.60 ?  327  LYS A HD3  1  
ATOM   5098   H HE2  . LYS A 1 334 ? 34.658  15.536  -4.022  0.02 19.13 ?  327  LYS A HE2  1  
ATOM   5099   H HE3  . LYS A 1 334 ? 33.103  15.600  -3.743  0.02 18.92 ?  327  LYS A HE3  1  
ATOM   5100   H HZ1  . LYS A 1 334 ? 33.171  13.458  -2.975  0.02 19.01 ?  327  LYS A HZ1  1  
ATOM   5101   H HZ2  . LYS A 1 334 ? 34.567  13.298  -3.328  0.02 18.99 ?  327  LYS A HZ2  1  
ATOM   5102   H HZ3  . LYS A 1 334 ? 34.186  14.191  -2.252  0.02 19.31 ?  327  LYS A HZ3  1  
ATOM   5103   N N    . HIS A 1 335 ? 28.687  13.308  -7.306  0.02 17.73 ?  328  HIS A N    1  
ATOM   5104   C CA   . HIS A 1 335 ? 27.405  13.620  -7.921  0.02 17.58 ?  328  HIS A CA   1  
ATOM   5105   C C    . HIS A 1 335 ? 27.605  14.685  -9.005  0.02 17.50 ?  328  HIS A C    1  
ATOM   5106   O O    . HIS A 1 335 ? 28.498  15.523  -8.909  0.02 17.64 ?  328  HIS A O    1  
ATOM   5107   C CB   . HIS A 1 335 ? 26.394  14.079  -6.873  0.02 17.73 ?  328  HIS A CB   1  
ATOM   5108   C CG   . HIS A 1 335 ? 25.902  12.970  -6.009  0.02 17.81 ?  328  HIS A CG   1  
ATOM   5109   N ND1  . HIS A 1 335 ? 24.728  12.299  -6.273  0.02 17.70 ?  328  HIS A ND1  1  
ATOM   5110   C CD2  . HIS A 1 335 ? 26.446  12.371  -4.921  0.02 18.02 ?  328  HIS A CD2  1  
ATOM   5111   C CE1  . HIS A 1 335 ? 24.556  11.352  -5.366  0.02 17.84 ?  328  HIS A CE1  1  
ATOM   5112   N NE2  . HIS A 1 335 ? 25.582  11.378  -4.533  0.02 18.03 ?  328  HIS A NE2  1  
ATOM   5113   H H    . HIS A 1 335 ? 28.753  13.532  -6.481  0.02 17.89 ?  328  HIS A H    1  
ATOM   5114   H HA   . HIS A 1 335 ? 27.066  12.808  -8.319  0.02 17.45 ?  328  HIS A HA   1  
ATOM   5115   H HB2  . HIS A 1 335 ? 26.802  14.749  -6.302  0.02 17.89 ?  328  HIS A HB2  1  
ATOM   5116   H HB3  . HIS A 1 335 ? 25.621  14.454  -7.321  0.02 17.65 ?  328  HIS A HB3  1  
ATOM   5117   H HD1  . HIS A 1 335 ? 24.187  12.478  -6.917  0.02 17.58 ?  328  HIS A HD1  1  
ATOM   5118   H HD2  . HIS A 1 335 ? 27.243  12.600  -4.500  0.02 18.15 ?  328  HIS A HD2  1  
ATOM   5119   H HE1  . HIS A 1 335 ? 23.833  10.768  -5.319  0.02 17.82 ?  328  HIS A HE1  1  
ATOM   5120   N N    . PRO A 1 336 ? 26.794  14.657  -10.058 0.02 17.32 ?  329  PRO A N    1  
ATOM   5121   C CA   . PRO A 1 336 ? 27.008  15.579  -11.190 0.02 17.25 ?  329  PRO A CA   1  
ATOM   5122   C C    . PRO A 1 336 ? 27.109  17.051  -10.855 0.02 17.43 ?  329  PRO A C    1  
ATOM   5123   O O    . PRO A 1 336 ? 27.939  17.740  -11.448 0.02 17.47 ?  329  PRO A O    1  
ATOM   5124   C CB   . PRO A 1 336 ? 25.786  15.293  -12.061 0.02 17.06 ?  329  PRO A CB   1  
ATOM   5125   C CG   . PRO A 1 336 ? 25.613  13.831  -11.901 0.02 16.98 ?  329  PRO A CG   1  
ATOM   5126   C CD   . PRO A 1 336 ? 25.905  13.554  -10.436 0.02 17.16 ?  329  PRO A CD   1  
ATOM   5127   H HA   . PRO A 1 336 ? 27.809  15.317  -11.671 0.02 17.23 ?  329  PRO A HA   1  
ATOM   5128   H HB2  . PRO A 1 336 ? 25.014  15.769  -11.718 0.02 17.11 ?  329  PRO A HB2  1  
ATOM   5129   H HB3  . PRO A 1 336 ? 25.967  15.533  -12.983 0.02 16.99 ?  329  PRO A HB3  1  
ATOM   5130   H HG2  . PRO A 1 336 ? 24.704  13.577  -12.124 0.02 16.92 ?  329  PRO A HG2  1  
ATOM   5131   H HG3  . PRO A 1 336 ? 26.247  13.371  -12.470 0.02 16.91 ?  329  PRO A HG3  1  
ATOM   5132   H HD2  . PRO A 1 336 ? 25.091  13.587  -9.916  0.02 17.20 ?  329  PRO A HD2  1  
ATOM   5133   H HD3  . PRO A 1 336 ? 26.363  12.705  -10.342 0.02 17.14 ?  329  PRO A HD3  1  
ATOM   5134   N N    . ARG A 1 337 ? 26.247  17.581  -9.986  0.02 17.56 ?  330  ARG A N    1  
ATOM   5135   C CA   . ARG A 1 337 ? 26.394  18.979  -9.614  0.02 17.77 ?  330  ARG A CA   1  
ATOM   5136   C C    . ARG A 1 337 ? 27.771  19.227  -9.022  0.02 17.96 ?  330  ARG A C    1  
ATOM   5137   O O    . ARG A 1 337 ? 28.330  20.314  -9.162  0.02 18.12 ?  330  ARG A O    1  
ATOM   5138   C CB   . ARG A 1 337 ? 25.303  19.385  -8.621  0.02 17.92 ?  330  ARG A CB   1  
ATOM   5139   C CG   . ARG A 1 337 ? 23.912  19.405  -9.196  0.02 17.82 ?  330  ARG A CG   1  
ATOM   5140   C CD   . ARG A 1 337 ? 22.831  19.877  -8.184  0.02 18.02 ?  330  ARG A CD   1  
ATOM   5141   N NE   . ARG A 1 337 ? 23.126  21.198  -7.639  0.02 18.28 ?  330  ARG A NE   1  
ATOM   5142   C CZ   . ARG A 1 337 ? 23.607  21.407  -6.422  0.02 18.52 ?  330  ARG A CZ   1  
ATOM   5143   N NH1  . ARG A 1 337 ? 23.797  20.400  -5.590  0.02 18.54 ?  330  ARG A NH1  1  
ATOM   5144   N NH2  . ARG A 1 337 ? 23.883  22.635  -6.031  0.02 18.76 ?  330  ARG A NH2  1  
ATOM   5145   H H    . ARG A 1 337 ? 25.593  17.167  -9.612  0.02 17.54 ?  330  ARG A H    1  
ATOM   5146   H HA   . ARG A 1 337 ? 26.299  19.527  -10.406 0.02 17.72 ?  330  ARG A HA   1  
ATOM   5147   H HB2  . ARG A 1 337 ? 25.312  18.754  -7.884  0.02 17.96 ?  330  ARG A HB2  1  
ATOM   5148   H HB3  . ARG A 1 337 ? 25.499  20.276  -8.290  0.02 18.10 ?  330  ARG A HB3  1  
ATOM   5149   H HG2  . ARG A 1 337 ? 23.893  20.011  -9.952  0.02 17.79 ?  330  ARG A HG2  1  
ATOM   5150   H HG3  . ARG A 1 337 ? 23.678  18.509  -9.485  0.02 17.67 ?  330  ARG A HG3  1  
ATOM   5151   H HD2  . ARG A 1 337 ? 21.975  19.927  -8.635  0.02 17.96 ?  330  ARG A HD2  1  
ATOM   5152   H HD3  . ARG A 1 337 ? 22.777  19.236  -7.460  0.02 18.07 ?  330  ARG A HD3  1  
ATOM   5153   H HE   . ARG A 1 337 ? 22.761  21.869  -8.031  0.02 18.30 ?  330  ARG A HE   1  
ATOM   5154   H HH11 . ARG A 1 337 ? 23.635  19.593  -5.823  0.02 18.40 ?  330  ARG A HH11 1  
ATOM   5155   H HH12 . ARG A 1 337 ? 24.101  20.560  -4.802  0.02 18.71 ?  330  ARG A HH12 1  
ATOM   5156   H HH21 . ARG A 1 337 ? 23.751  23.294  -6.566  0.02 18.77 ?  330  ARG A HH21 1  
ATOM   5157   H HH22 . ARG A 1 337 ? 24.176  22.779  -5.236  0.02 18.94 ?  330  ARG A HH22 1  
ATOM   5158   N N    . GLU A 1 338 ? 28.319  18.228  -8.338  0.02 17.98 ?  331  GLU A N    1  
ATOM   5159   C CA   . GLU A 1 338 ? 29.668  18.337  -7.814  0.02 18.17 ?  331  GLU A CA   1  
ATOM   5160   C C    . GLU A 1 338 ? 30.702  18.274  -8.925  0.02 18.06 ?  331  GLU A C    1  
ATOM   5161   O O    . GLU A 1 338 ? 31.751  18.923  -8.846  0.02 18.24 ?  331  GLU A O    1  
ATOM   5162   C CB   . GLU A 1 338 ? 29.902  17.216  -6.809  0.02 18.24 ?  331  GLU A CB   1  
ATOM   5163   C CG   . GLU A 1 338 ? 29.033  17.350  -5.660  0.02 18.40 ?  331  GLU A CG   1  
ATOM   5164   C CD   . GLU A 1 338 ? 29.705  18.225  -4.674  0.02 18.73 ?  331  GLU A CD   1  
ATOM   5165   O OE1  . GLU A 1 338 ? 30.845  17.880  -4.285  0.02 18.86 ?  331  GLU A OE1  1  
ATOM   5166   O OE2  . GLU A 1 338 ? 29.136  19.283  -4.377  0.02 18.87 -1 331  GLU A OE2  1  
ATOM   5167   H H    . GLU A 1 338 ? 27.928  17.483  -8.163  0.02 17.91 ?  331  GLU A H    1  
ATOM   5168   H HA   . GLU A 1 338 ? 29.766  19.184  -7.355  0.02 18.35 ?  331  GLU A HA   1  
ATOM   5169   H HB2  . GLU A 1 338 ? 29.732  16.358  -7.223  0.02 18.08 ?  331  GLU A HB2  1  
ATOM   5170   H HB3  . GLU A 1 338 ? 30.818  17.260  -6.501  0.02 18.38 ?  331  GLU A HB3  1  
ATOM   5171   H HG2  . GLU A 1 338 ? 28.199  17.771  -5.920  0.02 18.35 ?  331  GLU A HG2  1  
ATOM   5172   H HG3  . GLU A 1 338 ? 28.870  16.480  -5.260  0.02 18.36 ?  331  GLU A HG3  1  
ATOM   5173   N N    . MET A 1 339 ? 30.439  17.472  -9.948  0.02 17.79 ?  332  MET A N    1  
ATOM   5174   C CA   . MET A 1 339 ? 31.364  17.375  -11.063 0.02 17.70 ?  332  MET A CA   1  
ATOM   5175   C C    . MET A 1 339 ? 31.365  18.647  -11.892 0.02 17.75 ?  332  MET A C    1  
ATOM   5176   O O    . MET A 1 339 ? 32.411  19.038  -12.414 0.02 17.83 ?  332  MET A O    1  
ATOM   5177   C CB   . MET A 1 339 ? 31.020  16.144  -11.904 0.02 17.44 ?  332  MET A CB   1  
ATOM   5178   C CG   . MET A 1 339 ? 31.262  14.822  -11.104 0.02 17.44 ?  332  MET A CG   1  
ATOM   5179   S SD   . MET A 1 339 ? 31.133  13.254  -11.972 0.02 17.20 ?  332  MET A SD   1  
ATOM   5180   C CE   . MET A 1 339 ? 32.404  13.408  -13.266 0.02 17.15 ?  332  MET A CE   1  
ATOM   5181   H H    . MET A 1 339 ? 29.740  16.980  -10.023 0.02 17.68 ?  332  MET A H    1  
ATOM   5182   H HA   . MET A 1 339 ? 32.258  17.247  -10.708 0.02 17.82 ?  332  MET A HA   1  
ATOM   5183   H HB2  . MET A 1 339 ? 30.086  16.179  -12.152 0.02 17.34 ?  332  MET A HB2  1  
ATOM   5184   H HB3  . MET A 1 339 ? 31.579  16.140  -12.694 0.02 17.39 ?  332  MET A HB3  1  
ATOM   5185   H HG2  . MET A 1 339 ? 32.151  14.853  -10.718 0.02 17.57 ?  332  MET A HG2  1  
ATOM   5186   H HG3  . MET A 1 339 ? 30.606  14.788  -10.390 0.02 17.49 ?  332  MET A HG3  1  
ATOM   5187   H HE1  . MET A 1 339 ? 33.157  13.909  -12.912 0.02 17.30 ?  332  MET A HE1  1  
ATOM   5188   H HE2  . MET A 1 339 ? 32.693  12.523  -13.527 0.02 17.08 ?  332  MET A HE2  1  
ATOM   5189   H HE3  . MET A 1 339 ? 32.023  13.871  -14.026 0.02 17.08 ?  332  MET A HE3  1  
ATOM   5190   N N    . VAL A 1 340 ? 30.236  19.348  -11.955 0.02 17.73 ?  333  VAL A N    1  
ATOM   5191   C CA   . VAL A 1 340 ? 30.174  20.576  -12.743 0.02 17.81 ?  333  VAL A CA   1  
ATOM   5192   C C    . VAL A 1 340 ? 31.168  21.604  -12.217 0.02 18.11 ?  333  VAL A C    1  
ATOM   5193   O O    . VAL A 1 340 ? 31.706  22.408  -12.977 0.02 18.20 ?  333  VAL A O    1  
ATOM   5194   C CB   . VAL A 1 340 ? 28.736  21.139  -12.760 0.02 17.77 ?  333  VAL A CB   1  
ATOM   5195   C CG1  . VAL A 1 340 ? 28.691  22.437  -13.500 0.02 17.88 ?  333  VAL A CG1  1  
ATOM   5196   C CG2  . VAL A 1 340 ? 27.762  20.135  -13.353 0.02 17.51 ?  333  VAL A CG2  1  
ATOM   5197   H H    . VAL A 1 340 ? 29.506  19.136  -11.559 0.02 17.70 ?  333  VAL A H    1  
ATOM   5198   H HA   . VAL A 1 340 ? 30.421  20.366  -13.657 0.02 17.70 ?  333  VAL A HA   1  
ATOM   5199   H HB   . VAL A 1 340 ? 28.454  21.315  -11.847 0.02 17.89 ?  333  VAL A HB   1  
ATOM   5200   H HG11 . VAL A 1 340 ? 27.777  22.755  -13.502 0.02 17.85 ?  333  VAL A HG11 1  
ATOM   5201   H HG12 . VAL A 1 340 ? 29.265  23.088  -13.070 0.02 18.08 ?  333  VAL A HG12 1  
ATOM   5202   H HG13 . VAL A 1 340 ? 28.989  22.287  -14.411 0.02 17.80 ?  333  VAL A HG13 1  
ATOM   5203   H HG21 . VAL A 1 340 ? 27.167  20.591  -13.964 0.02 17.47 ?  333  VAL A HG21 1  
ATOM   5204   H HG22 . VAL A 1 340 ? 28.260  19.451  -13.823 0.02 17.40 ?  333  VAL A HG22 1  
ATOM   5205   H HG23 . VAL A 1 340 ? 27.253  19.731  -12.637 0.02 17.51 ?  333  VAL A HG23 1  
ATOM   5206   N N    . LYS A 1 341 ? 31.420  21.600  -10.911 0.02 18.30 ?  334  LYS A N    1  
ATOM   5207   C CA   . LYS A 1 341 ? 32.443  22.463  -10.337 0.02 18.62 ?  334  LYS A CA   1  
ATOM   5208   C C    . LYS A 1 341 ? 33.759  22.431  -11.076 0.02 18.65 ?  334  LYS A C    1  
ATOM   5209   O O    . LYS A 1 341 ? 34.340  23.488  -11.330 0.02 18.83 ?  334  LYS A O    1  
ATOM   5210   C CB   . LYS A 1 341 ? 32.741  22.046  -8.909  0.02 18.80 ?  334  LYS A CB   1  
ATOM   5211   C CG   . LYS A 1 341 ? 32.179  22.946  -7.892  0.02 19.08 ?  334  LYS A CG   1  
ATOM   5212   C CD   . LYS A 1 341 ? 30.648  22.893  -7.859  0.02 18.96 ?  334  LYS A CD   1  
ATOM   5213   C CE   . LYS A 1 341 ? 30.069  23.962  -6.875  0.02 19.30 ?  334  LYS A CE   1  
ATOM   5214   N NZ   . LYS A 1 341 ? 28.965  24.837  -7.471  0.02 19.26 ?  334  LYS A NZ   1  
ATOM   5215   H H    . LYS A 1 341 ? 31.009  21.108  -10.342 0.02 18.27 ?  334  LYS A H    1  
ATOM   5216   H HA   . LYS A 1 341 ? 32.123  23.374  -10.327 0.02 18.74 ?  334  LYS A HA   1  
ATOM   5217   H HB2  . LYS A 1 341 ? 32.360  21.171  -8.754  0.02 18.65 ?  334  LYS A HB2  1  
ATOM   5218   H HB3  . LYS A 1 341 ? 33.704  22.016  -8.787  0.02 18.90 ?  334  LYS A HB3  1  
ATOM   5219   H HG2  . LYS A 1 341 ? 32.511  22.691  -7.016  0.02 19.23 ?  334  LYS A HG2  1  
ATOM   5220   H HG3  . LYS A 1 341 ? 32.458  23.850  -8.100  0.02 19.23 ?  334  LYS A HG3  1  
ATOM   5221   H HD2  . LYS A 1 341 ? 30.297  23.074  -8.742  0.02 18.81 ?  334  LYS A HD2  1  
ATOM   5222   H HD3  . LYS A 1 341 ? 30.363  22.015  -7.557  0.02 18.86 ?  334  LYS A HD3  1  
ATOM   5223   H HE2  . LYS A 1 341 ? 29.708  23.509  -6.095  0.02 19.39 ?  334  LYS A HE2  1  
ATOM   5224   H HE3  . LYS A 1 341 ? 30.792  24.554  -6.606  0.02 19.49 ?  334  LYS A HE3  1  
ATOM   5225   H HZ1  . LYS A 1 341 ? 28.170  24.578  -7.166  0.02 19.32 ?  334  LYS A HZ1  1  
ATOM   5226   H HZ2  . LYS A 1 341 ? 29.095  25.685  -7.246  0.02 19.43 ?  334  LYS A HZ2  1  
ATOM   5227   H HZ3  . LYS A 1 341 ? 28.963  24.767  -8.356  0.02 19.05 ?  334  LYS A HZ3  1  
ATOM   5228   N N    . THR A 1 342 ? 34.300  21.253  -11.323 0.02 18.51 ?  335  THR A N    1  
ATOM   5229   C CA   . THR A 1 342 ? 35.661  21.158  -11.838 0.02 18.61 ?  335  THR A CA   1  
ATOM   5230   C C    . THR A 1 342 ? 35.692  20.686  -13.286 0.02 18.37 ?  335  THR A C    1  
ATOM   5231   O O    . THR A 1 342 ? 36.739  20.264  -13.765 0.02 18.42 ?  335  THR A O    1  
ATOM   5232   C CB   . THR A 1 342 ? 36.474  20.209  -10.955 0.02 18.67 ?  335  THR A CB   1  
ATOM   5233   O OG1  . THR A 1 342 ? 35.652  19.076  -10.637 0.02 18.41 ?  335  THR A OG1  1  
ATOM   5234   C CG2  . THR A 1 342 ? 36.901  20.906  -9.648  0.02 19.00 ?  335  THR A CG2  1  
ATOM   5235   H H    . THR A 1 342 ? 33.915  20.499  -11.191 0.02 18.38 ?  335  THR A H    1  
ATOM   5236   H HA   . THR A 1 342 ? 36.078  22.031  -11.796 0.02 18.82 ?  335  THR A HA   1  
ATOM   5237   H HB   . THR A 1 342 ? 37.268  19.919  -11.425 0.02 18.70 ?  335  THR A HB   1  
ATOM   5238   H HG1  . THR A 1 342 ? 35.416  18.685  -11.339 0.02 18.24 ?  335  THR A HG1  1  
ATOM   5239   H HG21 . THR A 1 342 ? 37.736  21.384  -9.773  0.02 19.21 ?  335  THR A HG21 1  
ATOM   5240   H HG22 . THR A 1 342 ? 36.216  21.537  -9.377  0.02 19.04 ?  335  THR A HG22 1  
ATOM   5241   H HG23 . THR A 1 342 ? 37.019  20.246  -8.946  0.02 18.99 ?  335  THR A HG23 1  
ATOM   5242   N N    . ALA A 1 343 ? 34.567  20.768  -13.998 0.02 18.15 ?  336  ALA A N    1  
ATOM   5243   C CA   . ALA A 1 343 ? 34.415  20.106  -15.283 0.02 17.91 ?  336  ALA A CA   1  
ATOM   5244   C C    . ALA A 1 343 ? 35.165  20.806  -16.412 0.02 18.02 ?  336  ALA A C    1  
ATOM   5245   O O    . ALA A 1 343 ? 35.001  22.005  -16.652 0.02 18.17 ?  336  ALA A O    1  
ATOM   5246   C CB   . ALA A 1 343 ? 32.940  20.014  -15.631 0.02 17.70 ?  336  ALA A CB   1  
ATOM   5247   H H    . ALA A 1 343 ? 33.872  21.205  -13.746 0.02 18.15 ?  336  ALA A H    1  
ATOM   5248   H HA   . ALA A 1 343 ? 34.767  19.206  -15.222 0.02 17.83 ?  336  ALA A HA   1  
ATOM   5249   H HB1  . ALA A 1 343 ? 32.841  19.686  -16.540 0.02 17.57 ?  336  ALA A HB1  1  
ATOM   5250   H HB2  . ALA A 1 343 ? 32.514  19.405  -15.006 0.02 17.62 ?  336  ALA A HB2  1  
ATOM   5251   H HB3  . ALA A 1 343 ? 32.551  20.899  -15.558 0.02 17.79 ?  336  ALA A HB3  1  
ATOM   5252   N N    . TRP A 1 344 ? 35.953  20.024  -17.137 0.02 17.95 ?  337  TRP A N    1  
ATOM   5253   C CA   . TRP A 1 344 ? 36.682  20.578  -18.266 0.02 18.06 ?  337  TRP A CA   1  
ATOM   5254   C C    . TRP A 1 344 ? 35.722  21.035  -19.354 0.02 17.94 ?  337  TRP A C    1  
ATOM   5255   O O    . TRP A 1 344 ? 35.990  22.026  -20.044 0.02 18.11 ?  337  TRP A O    1  
ATOM   5256   C CB   . TRP A 1 344 ? 37.667  19.543  -18.808 0.02 18.03 ?  337  TRP A CB   1  
ATOM   5257   C CG   . TRP A 1 344 ? 37.060  18.447  -19.546 0.02 17.74 ?  337  TRP A CG   1  
ATOM   5258   C CD1  . TRP A 1 344 ? 36.692  17.261  -19.045 0.02 17.57 ?  337  TRP A CD1  1  
ATOM   5259   C CD2  . TRP A 1 344 ? 36.750  18.420  -20.936 0.02 17.64 ?  337  TRP A CD2  1  
ATOM   5260   N NE1  . TRP A 1 344 ? 36.167  16.471  -20.028 0.02 17.36 ?  337  TRP A NE1  1  
ATOM   5261   C CE2  . TRP A 1 344 ? 36.187  17.168  -21.203 0.02 17.40 ?  337  TRP A CE2  1  
ATOM   5262   C CE3  . TRP A 1 344 ? 36.894  19.329  -21.976 0.02 17.76 ?  337  TRP A CE3  1  
ATOM   5263   C CZ2  . TRP A 1 344 ? 35.763  16.790  -22.467 0.02 17.27 ?  337  TRP A CZ2  1  
ATOM   5264   C CZ3  . TRP A 1 344 ? 36.469  18.951  -23.244 0.02 17.62 ?  337  TRP A CZ3  1  
ATOM   5265   C CH2  . TRP A 1 344 ? 35.913  17.695  -23.477 0.02 17.38 ?  337  TRP A CH2  1  
ATOM   5266   H H    . TRP A 1 344 ? 36.076  19.185  -17.002 0.02 17.85 ?  337  TRP A H    1  
ATOM   5267   H HA   . TRP A 1 344 ? 37.189  21.350  -17.971 0.02 18.28 ?  337  TRP A HA   1  
ATOM   5268   H HB2  . TRP A 1 344 ? 38.295  19.985  -19.399 0.02 18.16 ?  337  TRP A HB2  1  
ATOM   5269   H HB3  . TRP A 1 344 ? 38.134  19.147  -18.058 0.02 18.09 ?  337  TRP A HB3  1  
ATOM   5270   H HD1  . TRP A 1 344 ? 36.786  17.012  -18.155 0.02 17.60 ?  337  TRP A HD1  1  
ATOM   5271   H HE1  . TRP A 1 344 ? 35.870  15.672  -19.923 0.02 17.24 ?  337  TRP A HE1  1  
ATOM   5272   H HE3  . TRP A 1 344 ? 37.263  20.167  -21.826 0.02 17.94 ?  337  TRP A HE3  1  
ATOM   5273   H HZ2  . TRP A 1 344 ? 35.398  15.951  -22.616 0.02 17.13 ?  337  TRP A HZ2  1  
ATOM   5274   H HZ3  . TRP A 1 344 ? 36.553  19.548  -23.953 0.02 17.72 ?  337  TRP A HZ3  1  
ATOM   5275   H HH2  . TRP A 1 344 ? 35.634  17.468  -24.332 0.02 17.32 ?  337  TRP A HH2  1  
ATOM   5276   N N    . GLY A 1 345 ? 34.611  20.327  -19.512 0.02 17.68 ?  338  GLY A N    1  
ATOM   5277   C CA   . GLY A 1 345 ? 33.637  20.612  -20.550 0.02 17.56 ?  338  GLY A CA   1  
ATOM   5278   C C    . GLY A 1 345 ? 32.852  21.877  -20.327 0.02 17.68 ?  338  GLY A C    1  
ATOM   5279   O O    . GLY A 1 345 ? 32.212  22.370  -21.261 0.02 17.67 ?  338  GLY A O    1  
ATOM   5280   H H    . GLY A 1 345 ? 34.399  19.655  -19.020 0.02 17.58 ?  338  GLY A H    1  
ATOM   5281   H HA2  . GLY A 1 345 ? 34.084  20.685  -21.405 0.02 17.60 ?  338  GLY A HA2  1  
ATOM   5282   H HA3  . GLY A 1 345 ? 33.018  19.872  -20.598 0.02 17.39 ?  338  GLY A HA3  1  
ATOM   5283   N N    . ASN A 1 346 ? 32.899  22.441  -19.125 0.02 17.83 ?  339  ASN A N    1  
ATOM   5284   C CA   . ASN A 1 346 ? 32.250  23.722  -18.920 0.02 17.99 ?  339  ASN A CA   1  
ATOM   5285   C C    . ASN A 1 346 ? 32.858  24.791  -19.800 0.02 18.22 ?  339  ASN A C    1  
ATOM   5286   O O    . ASN A 1 346 ? 32.256  25.846  -19.986 0.02 18.35 ?  339  ASN A O    1  
ATOM   5287   C CB   . ASN A 1 346 ? 32.375  24.150  -17.461 0.02 18.17 ?  339  ASN A CB   1  
ATOM   5288   C CG   . ASN A 1 346 ? 31.506  23.352  -16.545 0.02 18.01 ?  339  ASN A CG   1  
ATOM   5289   O OD1  . ASN A 1 346 ? 30.735  22.527  -16.968 0.02 17.77 ?  339  ASN A OD1  1  
ATOM   5290   N ND2  . ASN A 1 346 ? 31.679  23.566  -15.257 0.02 18.17 ?  339  ASN A ND2  1  
ATOM   5291   H H    . ASN A 1 346 ? 33.287  22.110  -18.434 0.02 17.85 ?  339  ASN A H    1  
ATOM   5292   H HA   . ASN A 1 346 ? 31.306  23.651  -19.134 0.02 17.88 ?  339  ASN A HA   1  
ATOM   5293   H HB2  . ASN A 1 346 ? 33.294  24.026  -17.181 0.02 18.27 ?  339  ASN A HB2  1  
ATOM   5294   H HB3  . ASN A 1 346 ? 32.126  25.083  -17.378 0.02 18.33 ?  339  ASN A HB3  1  
ATOM   5295   H HD21 . ASN A 1 346 ? 32.240  24.164  -14.999 0.02 18.36 ?  339  ASN A HD21 1  
ATOM   5296   H HD22 . ASN A 1 346 ? 31.230  23.114  -14.682 0.02 18.10 ?  339  ASN A HD22 1  
ATOM   5297   N N    . SER A 1 347 ? 34.039  24.523  -20.357 0.02 18.28 ?  340  SER A N    1  
ATOM   5298   C CA   . SER A 1 347 ? 34.860  25.527  -20.997 0.02 18.56 ?  340  SER A CA   1  
ATOM   5299   C C    . SER A 1 347 ? 35.024  25.251  -22.487 0.02 18.49 ?  340  SER A C    1  
ATOM   5300   O O    . SER A 1 347 ? 36.024  25.640  -23.083 0.02 18.69 ?  340  SER A O    1  
ATOM   5301   C CB   . SER A 1 347 ? 36.214  25.590  -20.295 0.02 18.79 ?  340  SER A CB   1  
ATOM   5302   O OG   . SER A 1 347 ? 36.791  26.857  -20.463 0.02 19.11 ?  340  SER A OG   1  
ATOM   5303   H H    . SER A 1 347 ? 34.397  23.747  -20.374 0.02 18.17 ?  340  SER A H    1  
ATOM   5304   H HA   . SER A 1 347 ? 34.438  26.390  -20.898 0.02 18.69 ?  340  SER A HA   1  
ATOM   5305   H HB2  . SER A 1 347 ? 36.087  25.434  -19.346 0.02 18.86 ?  340  SER A HB2  1  
ATOM   5306   H HB3  . SER A 1 347 ? 36.805  24.918  -20.666 0.02 18.67 ?  340  SER A HB3  1  
ATOM   5307   H HG   . SER A 1 347 ? 36.983  26.986  -21.270 0.02 19.07 ?  340  SER A HG   1  
ATOM   5308   N N    . ILE A 1 348 ? 34.065  24.560  -23.097 0.02 18.23 ?  341  ILE A N    1  
ATOM   5309   C CA   . ILE A 1 348 ? 34.007  24.466  -24.558 0.02 18.21 ?  341  ILE A CA   1  
ATOM   5310   C C    . ILE A 1 348 ? 32.646  24.936  -25.044 0.02 18.15 ?  341  ILE A C    1  
ATOM   5311   O O    . ILE A 1 348 ? 31.686  24.892  -24.278 0.02 18.03 ?  341  ILE A O    1  
ATOM   5312   C CB   . ILE A 1 348 ? 34.278  23.043  -25.056 0.02 17.99 ?  341  ILE A CB   1  
ATOM   5313   C CG1  . ILE A 1 348 ? 33.127  22.105  -24.664 0.02 17.69 ?  341  ILE A CG1  1  
ATOM   5314   C CG2  . ILE A 1 348 ? 35.687  22.626  -24.613 0.02 18.12 ?  341  ILE A CG2  1  
ATOM   5315   C CD1  . ILE A 1 348 ? 33.326  20.657  -25.052 0.02 17.49 ?  341  ILE A CD1  1  
ATOM   5316   H H    . ILE A 1 348 ? 33.440  24.137  -22.691 0.02 18.08 ?  341  ILE A H    1  
ATOM   5317   H HA   . ILE A 1 348 ? 34.675  25.052  -24.940 0.02 18.41 ?  341  ILE A HA   1  
ATOM   5318   H HB   . ILE A 1 348 ? 34.286  23.077  -26.027 0.02 17.99 ?  341  ILE A HB   1  
ATOM   5319   H HG12 . ILE A 1 348 ? 32.995  22.142  -23.705 0.02 17.69 ?  341  ILE A HG12 1  
ATOM   5320   H HG13 . ILE A 1 348 ? 32.321  22.402  -25.110 0.02 17.64 ?  341  ILE A HG13 1  
ATOM   5321   H HG21 . ILE A 1 348 ? 36.325  23.191  -25.072 0.02 18.32 ?  341  ILE A HG21 1  
ATOM   5322   H HG22 . ILE A 1 348 ? 35.774  22.744  -23.656 0.02 18.15 ?  341  ILE A HG22 1  
ATOM   5323   H HG23 . ILE A 1 348 ? 35.843  21.700  -24.854 0.02 18.00 ?  341  ILE A HG23 1  
ATOM   5324   H HD11 . ILE A 1 348 ? 34.178  20.342  -24.714 0.02 17.55 ?  341  ILE A HD11 1  
ATOM   5325   H HD12 . ILE A 1 348 ? 32.609  20.129  -24.674 0.02 17.33 ?  341  ILE A HD12 1  
ATOM   5326   H HD13 . ILE A 1 348 ? 33.310  20.591  -26.021 0.02 17.49 ?  341  ILE A HD13 1  
ATOM   5327   N N    . PRO A 1 349 ? 32.528  25.408  -26.287 0.02 18.25 ?  342  PRO A N    1  
ATOM   5328   C CA   . PRO A 1 349 ? 31.220  25.836  -26.801 0.02 18.23 ?  342  PRO A CA   1  
ATOM   5329   C C    . PRO A 1 349 ? 30.157  24.751  -26.658 0.02 17.92 ?  342  PRO A C    1  
ATOM   5330   O O    . PRO A 1 349 ? 30.384  23.578  -26.961 0.02 17.73 ?  342  PRO A O    1  
ATOM   5331   C CB   . PRO A 1 349 ? 31.514  26.146  -28.276 0.02 18.38 ?  342  PRO A CB   1  
ATOM   5332   C CG   . PRO A 1 349 ? 32.980  26.420  -28.321 0.02 18.59 ?  342  PRO A CG   1  
ATOM   5333   C CD   . PRO A 1 349 ? 33.604  25.570  -27.283 0.02 18.43 ?  342  PRO A CD   1  
ATOM   5334   H HA   . PRO A 1 349 ? 30.933  26.647  -26.355 0.02 18.35 ?  342  PRO A HA   1  
ATOM   5335   H HB2  . PRO A 1 349 ? 31.293  25.375  -28.818 0.02 18.23 ?  342  PRO A HB2  1  
ATOM   5336   H HB3  . PRO A 1 349 ? 31.015  26.925  -28.556 0.02 18.51 ?  342  PRO A HB3  1  
ATOM   5337   H HG2  . PRO A 1 349 ? 33.319  26.196  -29.202 0.02 18.62 ?  342  PRO A HG2  1  
ATOM   5338   H HG3  . PRO A 1 349 ? 33.136  27.356  -28.123 0.02 18.80 ?  342  PRO A HG3  1  
ATOM   5339   H HD2  . PRO A 1 349 ? 33.856  24.712  -27.654 0.02 18.29 ?  342  PRO A HD2  1  
ATOM   5340   H HD3  . PRO A 1 349 ? 34.366  26.020  -26.889 0.02 18.59 ?  342  PRO A HD3  1  
ATOM   5341   N N    . THR A 1 350 ? 28.970  25.156  -26.215 0.02 17.89 ?  343  THR A N    1  
ATOM   5342   C CA   . THR A 1 350 ? 27.910  24.234  -25.858 0.02 17.65 ?  343  THR A CA   1  
ATOM   5343   C C    . THR A 1 350 ? 26.592  24.744  -26.411 0.02 17.69 ?  343  THR A C    1  
ATOM   5344   O O    . THR A 1 350 ? 26.329  25.942  -26.392 0.02 17.90 ?  343  THR A O    1  
ATOM   5345   C CB   . THR A 1 350 ? 27.790  24.096  -24.337 0.02 17.60 ?  343  THR A CB   1  
ATOM   5346   O OG1  . THR A 1 350 ? 29.055  23.725  -23.791 0.02 17.63 ?  343  THR A OG1  1  
ATOM   5347   C CG2  . THR A 1 350 ? 26.758  23.073  -23.970 0.02 17.36 ?  343  THR A CG2  1  
ATOM   5348   H H    . THR A 1 350 ? 28.755  25.978  -26.109 0.02 18.04 ?  343  THR A H    1  
ATOM   5349   H HA   . THR A 1 350 ? 28.094  23.364  -26.235 0.02 17.51 ?  343  THR A HA   1  
ATOM   5350   H HB   . THR A 1 350 ? 27.522  24.953  -23.972 0.02 17.73 ?  343  THR A HB   1  
ATOM   5351   H HG1  . THR A 1 350 ? 29.616  24.334  -23.931 0.02 17.78 ?  343  THR A HG1  1  
ATOM   5352   H HG21 . THR A 1 350 ? 26.582  22.500  -24.729 0.02 17.27 ?  343  THR A HG21 1  
ATOM   5353   H HG22 . THR A 1 350 ? 27.069  22.536  -23.229 0.02 17.29 ?  343  THR A HG22 1  
ATOM   5354   H HG23 . THR A 1 350 ? 25.931  23.509  -23.714 0.02 17.39 ?  343  THR A HG23 1  
ATOM   5355   N N    . MET A 1 351 ? 25.760  23.832  -26.864 0.02 17.51 ?  344  MET A N    1  
ATOM   5356   C CA   . MET A 1 351 ? 24.415  24.169  -27.299 0.02 17.55 ?  344  MET A CA   1  
ATOM   5357   C C    . MET A 1 351 ? 23.483  23.200  -26.590 0.02 17.35 ?  344  MET A C    1  
ATOM   5358   O O    . MET A 1 351 ? 23.771  22.010  -26.517 0.02 17.16 ?  344  MET A O    1  
ATOM   5359   C CB   . MET A 1 351 ? 24.271  24.070  -28.836 0.02 17.61 ?  344  MET A CB   1  
ATOM   5360   C CG   . MET A 1 351 ? 22.828  24.203  -29.330 0.02 17.66 ?  344  MET A CG   1  
ATOM   5361   S SD   . MET A 1 351 ? 22.751  24.749  -31.049 0.02 17.89 ?  344  MET A SD   1  
ATOM   5362   C CE   . MET A 1 351 ? 23.873  23.605  -31.801 0.02 17.75 ?  344  MET A CE   1  
ATOM   5363   H H    . MET A 1 351 ? 25.945  22.998  -26.932 0.02 17.38 ?  344  MET A H    1  
ATOM   5364   H HA   . MET A 1 351 ? 24.198  25.076  -27.043 0.02 17.69 ?  344  MET A HA   1  
ATOM   5365   H HB2  . MET A 1 351 ? 24.785  24.776  -29.252 0.02 17.76 ?  344  MET A HB2  1  
ATOM   5366   H HB3  . MET A 1 351 ? 24.605  23.207  -29.124 0.02 17.49 ?  344  MET A HB3  1  
ATOM   5367   H HG2  . MET A 1 351 ? 22.390  23.341  -29.264 0.02 17.52 ?  344  MET A HG2  1  
ATOM   5368   H HG3  . MET A 1 351 ? 22.365  24.860  -28.789 0.02 17.74 ?  344  MET A HG3  1  
ATOM   5369   H HE1  . MET A 1 351 ? 23.862  23.749  -32.761 0.02 17.87 ?  344  MET A HE1  1  
ATOM   5370   H HE2  . MET A 1 351 ? 24.764  23.763  -31.454 0.02 17.75 ?  344  MET A HE2  1  
ATOM   5371   H HE3  . MET A 1 351 ? 23.594  22.696  -31.607 0.02 17.59 ?  344  MET A HE3  1  
ATOM   5372   N N    . MET A 1 352 ? 22.378  23.715  -26.062 0.02 17.41 ?  345  MET A N    1  
ATOM   5373   C CA   . MET A 1 352 ? 21.387  22.893  -25.391 0.02 17.27 ?  345  MET A CA   1  
ATOM   5374   C C    . MET A 1 352 ? 20.005  23.316  -25.836 0.02 17.37 ?  345  MET A C    1  
ATOM   5375   O O    . MET A 1 352 ? 19.788  24.459  -26.218 0.02 17.57 ?  345  MET A O    1  
ATOM   5376   C CB   . MET A 1 352 ? 21.485  23.006  -23.867 0.02 17.26 ?  345  MET A CB   1  
ATOM   5377   C CG   . MET A 1 352 ? 22.870  22.777  -23.352 0.02 17.21 ?  345  MET A CG   1  
ATOM   5378   S SD   . MET A 1 352 ? 22.845  22.616  -21.544 0.02 17.23 ?  345  MET A SD   1  
ATOM   5379   C CE   . MET A 1 352 ? 24.541  22.982  -21.128 0.02 17.32 ?  345  MET A CE   1  
ATOM   5380   H H    . MET A 1 352 ? 22.184  24.551  -26.072 0.02 17.55 ?  345  MET A H    1  
ATOM   5381   H HA   . MET A 1 352 ? 21.526  21.966  -25.637 0.02 17.13 ?  345  MET A HA   1  
ATOM   5382   H HB2  . MET A 1 352 ? 21.222  23.898  -23.596 0.02 17.41 ?  345  MET A HB2  1  
ATOM   5383   H HB3  . MET A 1 352 ? 20.896  22.350  -23.468 0.02 17.18 ?  345  MET A HB3  1  
ATOM   5384   H HG2  . MET A 1 352 ? 23.225  21.966  -23.742 0.02 17.08 ?  345  MET A HG2  1  
ATOM   5385   H HG3  . MET A 1 352 ? 23.427  23.535  -23.587 0.02 17.31 ?  345  MET A HG3  1  
ATOM   5386   H HE1  . MET A 1 352 ? 24.876  23.669  -21.727 0.02 17.43 ?  345  MET A HE1  1  
ATOM   5387   H HE2  . MET A 1 352 ? 24.572  23.304  -20.212 0.02 17.39 ?  345  MET A HE2  1  
ATOM   5388   H HE3  . MET A 1 352 ? 25.071  22.176  -21.218 0.02 17.20 ?  345  MET A HE3  1  
ATOM   5389   N N    . GLY A 1 353 ? 19.066  22.381  -25.752 0.02 17.26 ?  346  GLY A N    1  
ATOM   5390   C CA   . GLY A 1 353 ? 17.689  22.716  -26.058 0.02 17.39 ?  346  GLY A CA   1  
ATOM   5391   C C    . GLY A 1 353 ? 16.742  21.596  -25.707 0.02 17.28 ?  346  GLY A C    1  
ATOM   5392   O O    . GLY A 1 353 ? 17.140  20.487  -25.347 0.02 17.11 ?  346  GLY A O    1  
ATOM   5393   H H    . GLY A 1 353 ? 19.202  21.564  -25.536 0.02 17.14 ?  346  GLY A H    1  
ATOM   5394   H HA2  . GLY A 1 353 ? 17.434  23.501  -25.551 0.02 17.50 ?  346  GLY A HA2  1  
ATOM   5395   H HA3  . GLY A 1 353 ? 17.595  22.917  -27.002 0.02 17.45 ?  346  GLY A HA3  1  
ATOM   5396   N N    . ASN A 1 354 ? 15.462  21.922  -25.822 0.02 17.42 ?  347  ASN A N    1  
ATOM   5397   C CA   . ASN A 1 354 ? 14.351  21.020  -25.572 0.02 17.40 ?  347  ASN A CA   1  
ATOM   5398   C C    . ASN A 1 354 ? 13.303  21.253  -26.649 0.02 17.56 ?  347  ASN A C    1  
ATOM   5399   O O    . ASN A 1 354 ? 13.374  22.222  -27.412 0.02 17.71 ?  347  ASN A O    1  
ATOM   5400   C CB   . ASN A 1 354 ? 13.747  21.256  -24.184 0.02 17.45 ?  347  ASN A CB   1  
ATOM   5401   C CG   . ASN A 1 354 ? 14.745  21.031  -23.082 0.02 17.31 ?  347  ASN A CG   1  
ATOM   5402   O OD1  . ASN A 1 354 ? 15.105  19.895  -22.786 0.02 17.16 ?  347  ASN A OD1  1  
ATOM   5403   N ND2  . ASN A 1 354 ? 15.176  22.100  -22.459 0.02 17.40 ?  347  ASN A ND2  1  
ATOM   5404   H H    . ASN A 1 354 ? 15.204  22.704  -26.054 0.02 17.55 ?  347  ASN A H    1  
ATOM   5405   H HA   . ASN A 1 354 ? 14.647  20.102  -25.623 0.02 17.27 ?  347  ASN A HA   1  
ATOM   5406   H HB2  . ASN A 1 354 ? 13.446  22.173  -24.121 0.02 17.59 ?  347  ASN A HB2  1  
ATOM   5407   H HB3  . ASN A 1 354 ? 13.000  20.650  -24.056 0.02 17.46 ?  347  ASN A HB3  1  
ATOM   5408   H HD21 . ASN A 1 354 ? 16.015  22.178  -22.275 0.02 17.34 ?  347  ASN A HD21 1  
ATOM   5409   H HD22 . ASN A 1 354 ? 14.627  22.726  -22.244 0.02 17.54 ?  347  ASN A HD22 1  
ATOM   5410   N N    . THR A 1 355 ? 12.321  20.360  -26.706 0.02 17.58 ?  348  THR A N    1  
ATOM   5411   C CA   . THR A 1 355 ? 11.154  20.617  -27.539 0.02 17.79 ?  348  THR A CA   1  
ATOM   5412   C C    . THR A 1 355 ? 10.143  21.508  -26.807 0.02 17.99 ?  348  THR A C    1  
ATOM   5413   O O    . THR A 1 355 ? 10.256  21.797  -25.609 0.02 17.96 ?  348  THR A O    1  
ATOM   5414   C CB   . THR A 1 355 ? 10.455  19.321  -27.954 0.02 17.77 ?  348  THR A CB   1  
ATOM   5415   O OG1  . THR A 1 355 ? 9.762   18.772  -26.830 0.02 17.76 ?  348  THR A OG1  1  
ATOM   5416   C CG2  . THR A 1 355 ? 11.412  18.270  -28.504 0.02 17.58 ?  348  THR A CG2  1  
ATOM   5417   H H    . THR A 1 355 ? 12.312  19.612  -26.293 0.02 17.49 ?  348  THR A H    1  
ATOM   5418   H HA   . THR A 1 355 ? 11.434  21.082  -28.342 0.02 17.85 ?  348  THR A HA   1  
ATOM   5419   H HB   . THR A 1 355 ? 9.802   19.520  -28.644 0.02 17.92 ?  348  THR A HB   1  
ATOM   5420   H HG1  . THR A 1 355 ? 9.546   17.976  -26.986 0.02 17.73 ?  348  THR A HG1  1  
ATOM   5421   H HG21 . THR A 1 355 ? 11.692  18.522  -29.397 0.02 17.62 ?  348  THR A HG21 1  
ATOM   5422   H HG22 . THR A 1 355 ? 12.197  18.183  -27.940 0.02 17.44 ?  348  THR A HG22 1  
ATOM   5423   H HG23 . THR A 1 355 ? 10.962  17.414  -28.552 0.02 17.57 ?  348  THR A HG23 1  
ATOM   5424   N N    . SER A 1 356 ? 9.110   21.918  -27.541 0.02 18.22 ?  349  SER A N    1  
ATOM   5425   C CA   . SER A 1 356 ? 8.129   22.834  -26.984 0.02 18.45 ?  349  SER A CA   1  
ATOM   5426   C C    . SER A 1 356 ? 7.024   22.143  -26.199 0.02 18.52 ?  349  SER A C    1  
ATOM   5427   O O    . SER A 1 356 ? 6.212   22.849  -25.604 0.02 18.73 ?  349  SER A O    1  
ATOM   5428   C CB   . SER A 1 356 ? 7.494   23.700  -28.079 0.02 18.72 ?  349  SER A CB   1  
ATOM   5429   O OG   . SER A 1 356 ? 6.924   22.932  -29.136 0.02 18.79 ?  349  SER A OG   1  
ATOM   5430   H H    . SER A 1 356 ? 8.956   21.676  -28.349 0.02 18.26 ?  349  SER A H    1  
ATOM   5431   H HA   . SER A 1 356 ? 8.586   23.433  -26.372 0.02 18.43 ?  349  SER A HA   1  
ATOM   5432   H HB2  . SER A 1 356 ? 6.790   24.235  -27.680 0.02 18.89 ?  349  SER A HB2  1  
ATOM   5433   H HB3  . SER A 1 356 ? 8.176   24.286  -28.439 0.02 18.72 ?  349  SER A HB3  1  
ATOM   5434   H HG   . SER A 1 356 ? 6.476   22.295  -28.823 0.02 18.77 ?  349  SER A HG   1  
ATOM   5435   N N    . TYR A 1 357 ? 6.945   20.809  -26.190 0.02 18.38 ?  350  TYR A N    1  
ATOM   5436   C CA   . TYR A 1 357 ? 5.998   20.106  -25.317 0.02 18.45 ?  350  TYR A CA   1  
ATOM   5437   C C    . TYR A 1 357 ? 6.584   18.723  -24.987 0.02 18.21 ?  350  TYR A C    1  
ATOM   5438   O O    . TYR A 1 357 ? 6.081   17.660  -25.320 0.02 18.24 ?  350  TYR A O    1  
ATOM   5439   C CB   . TYR A 1 357 ? 4.613   20.018  -25.965 0.02 18.73 ?  350  TYR A CB   1  
ATOM   5440   C CG   . TYR A 1 357 ? 3.475   19.696  -25.016 0.02 18.90 ?  350  TYR A CG   1  
ATOM   5441   C CD1  . TYR A 1 357 ? 3.706   19.431  -23.678 0.02 18.80 ?  350  TYR A CD1  1  
ATOM   5442   C CD2  . TYR A 1 357 ? 2.168   19.666  -25.466 0.02 19.20 ?  350  TYR A CD2  1  
ATOM   5443   C CE1  . TYR A 1 357 ? 2.668   19.130  -22.812 0.02 18.99 ?  350  TYR A CE1  1  
ATOM   5444   C CE2  . TYR A 1 357 ? 1.119   19.372  -24.624 0.02 19.40 ?  350  TYR A CE2  1  
ATOM   5445   C CZ   . TYR A 1 357 ? 1.363   19.096  -23.291 0.02 19.29 ?  350  TYR A CZ   1  
ATOM   5446   O OH   . TYR A 1 357 ? 0.274   18.813  -22.481 0.02 19.53 ?  350  TYR A OH   1  
ATOM   5447   H H    . TYR A 1 357 ? 7.424   20.286  -26.674 0.02 18.26 ?  350  TYR A H    1  
ATOM   5448   H HA   . TYR A 1 357 ? 5.920   20.605  -24.490 0.02 18.49 ?  350  TYR A HA   1  
ATOM   5449   H HB2  . TYR A 1 357 ? 4.415   20.869  -26.381 0.02 18.86 ?  350  TYR A HB2  1  
ATOM   5450   H HB3  . TYR A 1 357 ? 4.633   19.324  -26.640 0.02 18.69 ?  350  TYR A HB3  1  
ATOM   5451   H HD1  . TYR A 1 357 ? 4.579   19.445  -23.359 0.02 18.61 ?  350  TYR A HD1  1  
ATOM   5452   H HD2  . TYR A 1 357 ? 1.999   19.844  -26.362 0.02 19.29 ?  350  TYR A HD2  1  
ATOM   5453   H HE1  . TYR A 1 357 ? 2.847   18.954  -21.918 0.02 18.93 ?  350  TYR A HE1  1  
ATOM   5454   H HE2  . TYR A 1 357 ? 0.249   19.355  -24.953 0.02 19.62 ?  350  TYR A HE2  1  
ATOM   5455   H HH   . TYR A 1 357 ? -0.438  18.943  -22.908 0.02 19.72 ?  350  TYR A HH   1  
ATOM   5456   N N    . GLU A 1 358 ? 7.694   18.732  -24.246 0.02 18.00 ?  351  GLU A N    1  
ATOM   5457   C CA   . GLU A 1 358 ? 8.423   17.498  -23.964 0.02 17.79 ?  351  GLU A CA   1  
ATOM   5458   C C    . GLU A 1 358 ? 7.513   16.429  -23.386 0.02 17.87 ?  351  GLU A C    1  
ATOM   5459   O O    . GLU A 1 358 ? 7.532   15.281  -23.826 0.02 17.81 ?  351  GLU A O    1  
ATOM   5460   C CB   . GLU A 1 358 ? 9.584   17.766  -22.994 0.02 17.62 ?  351  GLU A CB   1  
ATOM   5461   C CG   . GLU A 1 358 ? 10.775  18.596  -23.530 0.02 17.52 ?  351  GLU A CG   1  
ATOM   5462   C CD   . GLU A 1 358 ? 11.774  17.742  -24.257 0.02 17.33 ?  351  GLU A CD   1  
ATOM   5463   O OE1  . GLU A 1 358 ? 12.734  18.321  -24.786 0.02 17.27 ?  351  GLU A OE1  1  
ATOM   5464   O OE2  . GLU A 1 358 ? 11.587  16.503  -24.278 0.02 17.26 -1 351  GLU A OE2  1  
ATOM   5465   H H    . GLU A 1 358 ? 8.042   19.436  -23.904 0.02 18.00 ?  351  GLU A H    1  
ATOM   5466   H HA   . GLU A 1 358 ? 8.797   17.156  -24.790 0.02 17.72 ?  351  GLU A HA   1  
ATOM   5467   H HB2  . GLU A 1 358 ? 9.219   18.234  -22.226 0.02 17.71 ?  351  GLU A HB2  1  
ATOM   5468   H HB3  . GLU A 1 358 ? 9.942   16.913  -22.714 0.02 17.50 ?  351  GLU A HB3  1  
ATOM   5469   H HG2  . GLU A 1 358 ? 10.448  19.257  -24.156 0.02 17.63 ?  351  GLU A HG2  1  
ATOM   5470   H HG3  . GLU A 1 358 ? 11.223  19.036  -22.794 0.02 17.50 ?  351  GLU A HG3  1  
ATOM   5471   N N    . GLY A 1 359 ? 6.739   16.780  -22.353 0.02 18.02 ?  352  GLY A N    1  
ATOM   5472   C CA   . GLY A 1 359 ? 5.974   15.790  -21.616 0.02 18.12 ?  352  GLY A CA   1  
ATOM   5473   C C    . GLY A 1 359 ? 4.807   15.203  -22.371 0.02 18.32 ?  352  GLY A C    1  
ATOM   5474   O O    . GLY A 1 359 ? 4.196   14.252  -21.889 0.02 18.41 ?  352  GLY A O    1  
ATOM   5475   H H    . GLY A 1 359 ? 6.644   17.583  -22.076 0.02 18.09 ?  352  GLY A H    1  
ATOM   5476   H HA2  . GLY A 1 359 ? 6.554   15.061  -21.357 0.02 17.98 ?  352  GLY A HA2  1  
ATOM   5477   H HA3  . GLY A 1 359 ? 5.632   16.207  -20.810 0.02 18.21 ?  352  GLY A HA3  1  
ATOM   5478   N N    . LEU A 1 360 ? 4.524   15.707  -23.568 0.02 18.40 ?  353  LEU A N    1  
ATOM   5479   C CA   . LEU A 1 360 ? 3.485   15.115  -24.403 0.02 18.61 ?  353  LEU A CA   1  
ATOM   5480   C C    . LEU A 1 360 ? 3.791   13.663  -24.735 0.02 18.51 ?  353  LEU A C    1  
ATOM   5481   O O    . LEU A 1 360 ? 2.894   12.903  -25.087 0.02 18.71 ?  353  LEU A O    1  
ATOM   5482   C CB   . LEU A 1 360 ? 3.346   15.961  -25.670 0.02 18.71 ?  353  LEU A CB   1  
ATOM   5483   C CG   . LEU A 1 360 ? 2.228   15.696  -26.662 0.02 19.00 ?  353  LEU A CG   1  
ATOM   5484   C CD1  . LEU A 1 360 ? 0.883   15.833  -26.003 0.02 19.30 ?  353  LEU A CD1  1  
ATOM   5485   C CD2  . LEU A 1 360 ? 2.417   16.718  -27.793 0.02 19.06 ?  353  LEU A CD2  1  
ATOM   5486   H H    . LEU A 1 360 ? 4.913   16.392  -23.910 0.02 18.36 ?  353  LEU A H    1  
ATOM   5487   H HA   . LEU A 1 360 ? 2.646   15.141  -23.917 0.02 18.79 ?  353  LEU A HA   1  
ATOM   5488   H HB2  . LEU A 1 360 ? 3.238   16.882  -25.387 0.02 18.76 ?  353  LEU A HB2  1  
ATOM   5489   H HB3  . LEU A 1 360 ? 4.180   15.887  -26.161 0.02 18.55 ?  353  LEU A HB3  1  
ATOM   5490   H HG   . LEU A 1 360 ? 2.321   14.803  -27.030 0.02 18.98 ?  353  LEU A HG   1  
ATOM   5491   H HD11 . LEU A 1 360 ? 0.363   15.033  -26.174 0.02 19.41 ?  353  LEU A HD11 1  
ATOM   5492   H HD12 . LEU A 1 360 ? 1.001   15.949  -25.049 0.02 19.23 ?  353  LEU A HD12 1  
ATOM   5493   H HD13 . LEU A 1 360 ? 0.435   16.608  -26.374 0.02 19.45 ?  353  LEU A HD13 1  
ATOM   5494   H HD21 . LEU A 1 360 ? 1.722   16.588  -28.456 0.02 19.27 ?  353  LEU A HD21 1  
ATOM   5495   H HD22 . LEU A 1 360 ? 2.361   17.613  -27.426 0.02 19.09 ?  353  LEU A HD22 1  
ATOM   5496   H HD23 . LEU A 1 360 ? 3.291   16.583  -28.189 0.02 18.89 ?  353  LEU A HD23 1  
ATOM   5497   N N    . PHE A 1 361 ? 5.051   13.268  -24.592 0.02 18.23 ?  354  PHE A N    1  
ATOM   5498   C CA   . PHE A 1 361 ? 5.463   11.893  -24.790 0.02 18.13 ?  354  PHE A CA   1  
ATOM   5499   C C    . PHE A 1 361 ? 4.651   10.928  -23.939 0.02 18.27 ?  354  PHE A C    1  
ATOM   5500   O O    . PHE A 1 361 ? 4.440   9.783   -24.337 0.02 18.32 ?  354  PHE A O    1  
ATOM   5501   C CB   . PHE A 1 361 ? 6.947   11.816  -24.469 0.02 17.83 ?  354  PHE A CB   1  
ATOM   5502   C CG   . PHE A 1 361 ? 7.513   10.448  -24.504 0.02 17.71 ?  354  PHE A CG   1  
ATOM   5503   C CD1  . PHE A 1 361 ? 7.307   9.581   -23.434 0.02 17.74 ?  354  PHE A CD1  1  
ATOM   5504   C CD2  . PHE A 1 361 ? 8.265   10.026  -25.591 0.02 17.60 ?  354  PHE A CD2  1  
ATOM   5505   C CE1  . PHE A 1 361 ? 7.806   8.309   -23.453 0.02 17.66 ?  354  PHE A CE1  1  
ATOM   5506   C CE2  . PHE A 1 361 ? 8.794   8.754   -25.620 0.02 17.52 ?  354  PHE A CE2  1  
ATOM   5507   C CZ   . PHE A 1 361 ? 8.564   7.885   -24.544 0.02 17.55 ?  354  PHE A CZ   1  
ATOM   5508   H H    . PHE A 1 361 ? 5.690   13.795  -24.375 0.02 18.11 ?  354  PHE A H    1  
ATOM   5509   H HA   . PHE A 1 361 ? 5.337   11.652  -25.720 0.02 18.18 ?  354  PHE A HA   1  
ATOM   5510   H HB2  . PHE A 1 361 ? 7.432   12.365  -25.104 0.02 17.76 ?  354  PHE A HB2  1  
ATOM   5511   H HB3  . PHE A 1 361 ? 7.078   12.158  -23.571 0.02 17.80 ?  354  PHE A HB3  1  
ATOM   5512   H HD1  . PHE A 1 361 ? 6.795   9.863   -22.710 0.02 17.83 ?  354  PHE A HD1  1  
ATOM   5513   H HD2  . PHE A 1 361 ? 8.413   10.605  -26.304 0.02 17.60 ?  354  PHE A HD2  1  
ATOM   5514   H HE1  . PHE A 1 361 ? 7.656   7.740   -22.734 0.02 17.70 ?  354  PHE A HE1  1  
ATOM   5515   H HE2  . PHE A 1 361 ? 9.292   8.474   -26.355 0.02 17.46 ?  354  PHE A HE2  1  
ATOM   5516   H HZ   . PHE A 1 361 ? 8.914   7.025   -24.561 0.02 17.51 ?  354  PHE A HZ   1  
ATOM   5517   N N    . PHE A 1 362 ? 4.187   11.367  -22.773 0.02 18.37 ?  355  PHE A N    1  
ATOM   5518   C CA   . PHE A 1 362 ? 3.525   10.493  -21.816 0.02 18.53 ?  355  PHE A CA   1  
ATOM   5519   C C    . PHE A 1 362 ? 2.018   10.382  -22.038 0.02 18.88 ?  355  PHE A C    1  
ATOM   5520   O O    . PHE A 1 362 ? 1.304   9.951   -21.127 0.02 19.08 ?  355  PHE A O    1  
ATOM   5521   C CB   . PHE A 1 362 ? 3.812   10.974  -20.385 0.02 18.49 ?  355  PHE A CB   1  
ATOM   5522   C CG   . PHE A 1 362 ? 5.203   10.674  -19.921 0.02 18.21 ?  355  PHE A CG   1  
ATOM   5523   C CD1  . PHE A 1 362 ? 5.606   9.361   -19.767 0.02 18.18 ?  355  PHE A CD1  1  
ATOM   5524   C CD2  . PHE A 1 362 ? 6.114   11.701  -19.662 0.02 18.02 ?  355  PHE A CD2  1  
ATOM   5525   C CE1  . PHE A 1 362 ? 6.878   9.061   -19.342 0.02 17.96 ?  355  PHE A CE1  1  
ATOM   5526   C CE2  . PHE A 1 362 ? 7.395   11.418  -19.235 0.02 17.81 ?  355  PHE A CE2  1  
ATOM   5527   C CZ   . PHE A 1 362 ? 7.783   10.094  -19.079 0.02 17.77 ?  355  PHE A CZ   1  
ATOM   5528   H H    . PHE A 1 362 ? 4.247   12.182  -22.511 0.02 18.37 ?  355  PHE A H    1  
ATOM   5529   H HA   . PHE A 1 362 ? 3.897   9.604   -21.906 0.02 18.46 ?  355  PHE A HA   1  
ATOM   5530   H HB2  . PHE A 1 362 ? 3.698   11.936  -20.354 0.02 18.50 ?  355  PHE A HB2  1  
ATOM   5531   H HB3  . PHE A 1 362 ? 3.193   10.550  -19.775 0.02 18.66 ?  355  PHE A HB3  1  
ATOM   5532   H HD1  . PHE A 1 362 ? 5.004   8.674   -19.940 0.02 18.33 ?  355  PHE A HD1  1  
ATOM   5533   H HD2  . PHE A 1 362 ? 5.855   12.587  -19.767 0.02 18.06 ?  355  PHE A HD2  1  
ATOM   5534   H HE1  . PHE A 1 362 ? 7.134   8.175   -19.236 0.02 17.96 ?  355  PHE A HE1  1  
ATOM   5535   H HE2  . PHE A 1 362 ? 7.992   12.107  -19.063 0.02 17.70 ?  355  PHE A HE2  1  
ATOM   5536   H HZ   . PHE A 1 362 ? 8.643   9.890   -18.793 0.02 17.64 ?  355  PHE A HZ   1  
ATOM   5537   N N    . THR A 1 363 ? 1.520   10.706  -23.232 0.02 19.00 ?  356  THR A N    1  
ATOM   5538   C CA   . THR A 1 363 ? 0.083   10.656  -23.478 0.02 19.38 ?  356  THR A CA   1  
ATOM   5539   C C    . THR A 1 363 ? -0.471  9.260   -23.202 0.02 19.55 ?  356  THR A C    1  
ATOM   5540   O O    . THR A 1 363 ? -1.183  9.039   -22.209 0.02 19.81 ?  356  THR A O    1  
ATOM   5541   C CB   . THR A 1 363 ? -0.217  11.108  -24.919 0.02 19.49 ?  356  THR A CB   1  
ATOM   5542   O OG1  . THR A 1 363 ? 0.171   12.480  -25.072 0.02 19.38 ?  356  THR A OG1  1  
ATOM   5543   C CG2  . THR A 1 363 ? -1.708  11.000  -25.249 0.02 19.91 ?  356  THR A CG2  1  
ATOM   5544   H H    . THR A 1 363 ? 1.987   10.948  -23.911 0.02 18.90 ?  356  THR A H    1  
ATOM   5545   H HA   . THR A 1 363 ? -0.356  11.277  -22.878 0.02 19.48 ?  356  THR A HA   1  
ATOM   5546   H HB   . THR A 1 363 ? 0.274   10.553  -25.542 0.02 19.39 ?  356  THR A HB   1  
ATOM   5547   H HG1  . THR A 1 363 ? 1.010   12.537  -25.084 0.02 19.17 ?  356  THR A HG1  1  
ATOM   5548   H HG21 . THR A 1 363 ? -2.003  11.830  -25.653 0.02 19.99 ?  356  THR A HG21 1  
ATOM   5549   H HG22 . THR A 1 363 ? -1.868  10.276  -25.875 0.02 20.00 ?  356  THR A HG22 1  
ATOM   5550   H HG23 . THR A 1 363 ? -2.224  10.842  -24.443 0.02 20.02 ?  356  THR A HG23 1  
ATOM   5551   N N    . SER A 1 364 ? -0.158  8.301   -24.071 0.02 19.46 ?  357  SER A N    1  
ATOM   5552   C CA   . SER A 1 364 ? -0.613  6.926   -23.871 0.02 19.66 ?  357  SER A CA   1  
ATOM   5553   C C    . SER A 1 364 ? -0.548  6.507   -22.414 0.02 19.69 ?  357  SER A C    1  
ATOM   5554   O O    . SER A 1 364 ? -1.481  5.883   -21.897 0.02 20.02 ?  357  SER A O    1  
ATOM   5555   C CB   . SER A 1 364 ? 0.238   5.951   -24.693 0.02 19.49 ?  357  SER A CB   1  
ATOM   5556   O OG   . SER A 1 364 ? 1.553   5.813   -24.162 0.02 19.14 ?  357  SER A OG   1  
ATOM   5557   H H    . SER A 1 364 ? 0.311   8.419   -24.783 0.02 19.29 ?  357  SER A H    1  
ATOM   5558   H HA   . SER A 1 364 ? -1.524  6.880   -24.176 0.02 19.92 ?  357  SER A HA   1  
ATOM   5559   H HB2  . SER A 1 364 ? -0.188  5.080   -24.681 0.02 19.66 ?  357  SER A HB2  1  
ATOM   5560   H HB3  . SER A 1 364 ? 0.297   6.277   -25.603 0.02 19.48 ?  357  SER A HB3  1  
ATOM   5561   H HG   . SER A 1 364 ? 2.115   5.795   -24.787 0.02 19.04 ?  357  SER A HG   1  
ATOM   5562   N N    . ILE A 1 365 ? 0.541   6.846   -21.737 0.02 19.39 ?  358  ILE A N    1  
ATOM   5563   C CA   . ILE A 1 365 ? 0.832   6.221   -20.456 0.02 19.38 ?  358  ILE A CA   1  
ATOM   5564   C C    . ILE A 1 365 ? -0.137  6.685   -19.378 0.02 19.66 ?  358  ILE A C    1  
ATOM   5565   O O    . ILE A 1 365 ? -0.425  5.949   -18.426 0.02 19.84 ?  358  ILE A O    1  
ATOM   5566   C CB   . ILE A 1 365 ? 2.296   6.491   -20.070 0.02 19.00 ?  358  ILE A CB   1  
ATOM   5567   C CG1  . ILE A 1 365 ? 3.177   5.311   -20.498 0.02 18.82 ?  358  ILE A CG1  1  
ATOM   5568   C CG2  . ILE A 1 365 ? 2.406   6.795   -18.602 0.02 19.02 ?  358  ILE A CG2  1  
ATOM   5569   C CD1  . ILE A 1 365 ? 3.367   5.223   -21.999 0.02 18.82 ?  358  ILE A CD1  1  
ATOM   5570   H H    . ILE A 1 365 ? 1.116   7.428   -21.995 0.02 19.21 ?  358  ILE A H    1  
ATOM   5571   H HA   . ILE A 1 365 ? 0.716   5.263   -20.555 0.02 19.46 ?  358  ILE A HA   1  
ATOM   5572   H HB   . ILE A 1 365 ? 2.593   7.276   -20.558 0.02 18.89 ?  358  ILE A HB   1  
ATOM   5573   H HG12 . ILE A 1 365 ? 4.057   5.414   -20.103 0.02 18.59 ?  358  ILE A HG12 1  
ATOM   5574   H HG13 . ILE A 1 365 ? 2.767   4.486   -20.196 0.02 18.93 ?  358  ILE A HG13 1  
ATOM   5575   H HG21 . ILE A 1 365 ? 3.349   6.834   -18.372 0.02 18.80 ?  358  ILE A HG21 1  
ATOM   5576   H HG22 . ILE A 1 365 ? 1.991   7.652   -18.414 0.02 19.09 ?  358  ILE A HG22 1  
ATOM   5577   H HG23 . ILE A 1 365 ? 1.983   6.086   -18.093 0.02 19.19 ?  358  ILE A HG23 1  
ATOM   5578   H HD11 . ILE A 1 365 ? 2.645   4.695   -22.370 0.02 19.05 ?  358  ILE A HD11 1  
ATOM   5579   H HD12 . ILE A 1 365 ? 3.361   6.117   -22.373 0.02 18.79 ?  358  ILE A HD12 1  
ATOM   5580   H HD13 . ILE A 1 365 ? 4.216   4.792   -22.184 0.02 18.66 ?  358  ILE A HD13 1  
ATOM   5581   N N    . LEU A 1 366 ? -0.629  7.912   -19.475 0.02 19.71 ?  359  LEU A N    1  
ATOM   5582   C CA   . LEU A 1 366 ? -1.720  8.288   -18.588 0.02 20.04 ?  359  LEU A CA   1  
ATOM   5583   C C    . LEU A 1 366 ? -2.984  7.490   -18.889 0.02 20.43 ?  359  LEU A C    1  
ATOM   5584   O O    . LEU A 1 366 ? -3.978  7.586   -18.149 0.02 20.76 ?  359  LEU A O    1  
ATOM   5585   C CB   . LEU A 1 366 ? -1.965  9.778   -18.714 0.02 20.04 ?  359  LEU A CB   1  
ATOM   5586   C CG   . LEU A 1 366 ? -0.787  10.586  -18.200 0.02 19.71 ?  359  LEU A CG   1  
ATOM   5587   C CD1  . LEU A 1 366 ? -0.719  11.951  -18.872 0.02 19.64 ?  359  LEU A CD1  1  
ATOM   5588   C CD2  . LEU A 1 366 ? -0.910  10.722  -16.711 0.02 19.82 ?  359  LEU A CD2  1  
ATOM   5589   H H    . LEU A 1 366 ? -0.363  8.523   -20.018 0.02 19.58 ?  359  LEU A H    1  
ATOM   5590   H HA   . LEU A 1 366 ? -1.463  8.095   -17.673 0.02 20.02 ?  359  LEU A HA   1  
ATOM   5591   H HB2  . LEU A 1 366 ? -2.103  9.996   -19.648 0.02 20.03 ?  359  LEU A HB2  1  
ATOM   5592   H HB3  . LEU A 1 366 ? -2.745  10.016  -18.189 0.02 20.28 ?  359  LEU A HB3  1  
ATOM   5593   H HG   . LEU A 1 366 ? 0.039   10.115  -18.390 0.02 19.50 ?  359  LEU A HG   1  
ATOM   5594   H HD11 . LEU A 1 366 ? -0.325  11.849  -19.753 0.02 19.51 ?  359  LEU A HD11 1  
ATOM   5595   H HD12 . LEU A 1 366 ? -1.620  12.301  -18.956 0.02 19.87 ?  359  LEU A HD12 1  
ATOM   5596   H HD13 . LEU A 1 366 ? -0.179  12.549  -18.332 0.02 19.50 ?  359  LEU A HD13 1  
ATOM   5597   H HD21 . LEU A 1 366 ? -0.048  10.959  -16.335 0.02 19.62 ?  359  LEU A HD21 1  
ATOM   5598   H HD22 . LEU A 1 366 ? -1.557  11.414  -16.514 0.02 20.01 ?  359  LEU A HD22 1  
ATOM   5599   H HD23 . LEU A 1 366 ? -1.207  9.875   -16.346 0.02 19.94 ?  359  LEU A HD23 1  
ATOM   5600   N N    . LYS A 1 367 ? -2.982  6.720   -19.981 0.02 20.44 ?  360  LYS A N    1  
ATOM   5601   C CA   . LYS A 1 367 ? -4.106  5.826   -20.258 0.02 20.85 ?  360  LYS A CA   1  
ATOM   5602   C C    . LYS A 1 367 ? -3.887  4.455   -19.630 0.02 20.93 ?  360  LYS A C    1  
ATOM   5603   O O    . LYS A 1 367 ? -4.858  3.754   -19.316 0.02 21.33 ?  360  LYS A O    1  
ATOM   5604   C CB   . LYS A 1 367 ? -4.316  5.688   -21.763 0.02 20.89 ?  360  LYS A CB   1  
ATOM   5605   C CG   . LYS A 1 367 ? -3.683  4.434   -22.368 0.02 20.84 ?  360  LYS A CG   1  
ATOM   5606   C CD   . LYS A 1 367 ? -3.341  4.650   -23.821 0.02 20.68 ?  360  LYS A CD   1  
ATOM   5607   C CE   . LYS A 1 367 ? -2.729  3.437   -24.450 0.02 20.54 ?  360  LYS A CE   1  
ATOM   5608   N NZ   . LYS A 1 367 ? -2.757  3.545   -25.946 0.02 20.71 ?  360  LYS A NZ   1  
ATOM   5609   H H    . LYS A 1 367 ? -2.357  6.707   -20.572 0.02 20.24 ?  360  LYS A H    1  
ATOM   5610   H HA   . LYS A 1 367 ? -4.913  6.202   -19.879 0.02 21.09 ?  360  LYS A HA   1  
ATOM   5611   H HB2  . LYS A 1 367 ? -5.267  5.661   -21.943 0.02 21.19 ?  360  LYS A HB2  1  
ATOM   5612   H HB3  . LYS A 1 367 ? -3.923  6.459   -22.201 0.02 20.69 ?  360  LYS A HB3  1  
ATOM   5613   H HG2  . LYS A 1 367 ? -2.873  4.181   -21.906 0.02 20.64 ?  360  LYS A HG2  1  
ATOM   5614   H HG3  . LYS A 1 367 ? -4.324  3.707   -22.323 0.02 21.13 ?  360  LYS A HG3  1  
ATOM   5615   H HD2  . LYS A 1 367 ? -4.149  4.866   -24.313 0.02 20.92 ?  360  LYS A HD2  1  
ATOM   5616   H HD3  . LYS A 1 367 ? -2.709  5.366   -23.890 0.02 20.45 ?  360  LYS A HD3  1  
ATOM   5617   H HE2  . LYS A 1 367 ? -1.808  3.354   -24.158 0.02 20.24 ?  360  LYS A HE2  1  
ATOM   5618   H HE3  . LYS A 1 367 ? -3.240  2.654   -24.194 0.02 20.66 ?  360  LYS A HE3  1  
ATOM   5619   H HZ1  . LYS A 1 367 ? -1.994  3.247   -26.291 0.02 20.53 ?  360  LYS A HZ1  1  
ATOM   5620   H HZ2  . LYS A 1 367 ? -3.432  3.061   -26.270 0.02 20.96 ?  360  LYS A HZ2  1  
ATOM   5621   H HZ3  . LYS A 1 367 ? -2.867  4.396   -26.186 0.02 20.78 ?  360  LYS A HZ3  1  
ATOM   5622   N N    . GLN A 1 368 ? -2.621  4.049   -19.458 0.02 20.60 ?  361  GLN A N    1  
ATOM   5623   C CA   . GLN A 1 368 ? -2.297  2.836   -18.699 0.02 20.68 ?  361  GLN A CA   1  
ATOM   5624   C C    . GLN A 1 368 ? -2.473  3.058   -17.203 0.02 20.77 ?  361  GLN A C    1  
ATOM   5625   O O    . GLN A 1 368 ? -2.771  2.105   -16.483 0.02 21.04 ?  361  GLN A O    1  
ATOM   5626   C CB   . GLN A 1 368 ? -0.856  2.366   -18.953 0.02 20.33 ?  361  GLN A CB   1  
ATOM   5627   C CG   . GLN A 1 368 ? 0.024   2.255   -17.661 0.02 20.06 ?  361  GLN A CG   1  
ATOM   5628   C CD   . GLN A 1 368 ? 1.296   1.428   -17.847 0.02 19.77 ?  361  GLN A CD   1  
ATOM   5629   O OE1  . GLN A 1 368 ? 1.365   0.281   -17.397 0.02 19.90 ?  361  GLN A OE1  1  
ATOM   5630   N NE2  . GLN A 1 368 ? 2.297   2.005   -18.502 0.02 19.42 ?  361  GLN A NE2  1  
ATOM   5631   H H    . GLN A 1 368 ? -1.937  4.471   -19.764 0.02 20.34 ?  361  GLN A H    1  
ATOM   5632   H HA   . GLN A 1 368 ? -2.902  2.122   -18.973 0.02 20.95 ?  361  GLN A HA   1  
ATOM   5633   H HB2  . GLN A 1 368 ? -0.855  1.499   -19.365 0.02 20.47 ?  361  GLN A HB2  1  
ATOM   5634   H HB3  . GLN A 1 368 ? -0.425  3.002   -19.542 0.02 20.16 ?  361  GLN A HB3  1  
ATOM   5635   H HG2  . GLN A 1 368 ? 0.279   3.142   -17.365 0.02 19.92 ?  361  GLN A HG2  1  
ATOM   5636   H HG3  . GLN A 1 368 ? -0.462  1.791   -16.962 0.02 20.25 ?  361  GLN A HG3  1  
ATOM   5637   H HE21 . GLN A 1 368 ? 3.061   2.119   -18.119 0.02 19.24 ?  361  GLN A HE21 1  
ATOM   5638   H HE22 . GLN A 1 368 ? 2.175   2.280   -19.309 0.02 19.37 ?  361  GLN A HE22 1  
ATOM   5639   N N    . MET A 1 369 ? -2.194  4.282   -16.703 0.02 20.59 ?  362  MET A N    1  
ATOM   5640   C CA   . MET A 1 369 ? -2.427  4.665   -15.303 0.02 20.75 ?  362  MET A CA   1  
ATOM   5641   C C    . MET A 1 369 ? -2.959  6.102   -15.267 0.02 20.78 ?  362  MET A C    1  
ATOM   5642   O O    . MET A 1 369 ? -2.235  7.075   -15.008 0.02 20.50 ?  362  MET A O    1  
ATOM   5643   C CB   . MET A 1 369 ? -1.184  4.504   -14.404 0.02 20.51 ?  362  MET A CB   1  
ATOM   5644   C CG   . MET A 1 369 ? -1.411  3.628   -13.190 0.02 20.84 ?  362  MET A CG   1  
ATOM   5645   S SD   . MET A 1 369 ? -1.055  4.129   -11.323 0.02 20.76 ?  362  MET A SD   1  
ATOM   5646   C CE   . MET A 1 369 ? 0.705   4.444   -11.335 0.02 20.23 ?  362  MET A CE   1  
ATOM   5647   H H    . MET A 1 369 ? -1.870  4.921   -17.174 0.02 20.38 ?  362  MET A H    1  
ATOM   5648   H HA   . MET A 1 369 ? -3.167  4.089   -15.036 0.02 21.05 ?  362  MET A HA   1  
ATOM   5649   H HB2  . MET A 1 369 ? -0.455  4.137   -14.925 0.02 20.35 ?  362  MET A HB2  1  
ATOM   5650   H HB3  . MET A 1 369 ? -0.936  5.377   -14.072 0.02 20.34 ?  362  MET A HB3  1  
ATOM   5651   H HG2  . MET A 1 369 ? -2.340  3.417   -13.164 0.02 21.12 ?  362  MET A HG2  1  
ATOM   5652   H HG3  . MET A 1 369 ? -0.987  2.764   -13.295 0.02 20.86 ?  362  MET A HG3  1  
ATOM   5653   H HE1  . MET A 1 369 ? 0.928   5.079   -10.635 0.02 20.12 ?  362  MET A HE1  1  
ATOM   5654   H HE2  . MET A 1 369 ? 1.174   3.607   -11.191 0.02 20.25 ?  362  MET A HE2  1  
ATOM   5655   H HE3  . MET A 1 369 ? 0.935   4.809   -12.203 0.02 20.08 ?  362  MET A HE3  1  
ATOM   5656   N N    . PRO A 1 370 ? -4.263  6.265   -15.495 0.02 21.16 ?  363  PRO A N    1  
ATOM   5657   C CA   . PRO A 1 370 ? -4.833  7.609   -15.433 0.02 21.24 ?  363  PRO A CA   1  
ATOM   5658   C C    . PRO A 1 370 ? -5.020  8.147   -14.030 0.02 21.34 ?  363  PRO A C    1  
ATOM   5659   O O    . PRO A 1 370 ? -5.339  9.332   -13.903 0.02 21.32 ?  363  PRO A O    1  
ATOM   5660   C CB   . PRO A 1 370 ? -6.172  7.452   -16.151 0.02 21.67 ?  363  PRO A CB   1  
ATOM   5661   C CG   . PRO A 1 370 ? -6.540  6.074   -15.964 0.02 21.91 ?  363  PRO A CG   1  
ATOM   5662   C CD   . PRO A 1 370 ? -5.242  5.308   -16.048 0.02 21.54 ?  363  PRO A CD   1  
ATOM   5663   H HA   . PRO A 1 370 ? -4.272  8.226   -15.925 0.02 21.00 ?  363  PRO A HA   1  
ATOM   5664   H HB2  . PRO A 1 370 ? -6.824  8.039   -15.742 0.02 21.87 ?  363  PRO A HB2  1  
ATOM   5665   H HB3  . PRO A 1 370 ? -6.068  7.653   -17.092 0.02 21.59 ?  363  PRO A HB3  1  
ATOM   5666   H HG2  . PRO A 1 370 ? -6.943  5.973   -15.088 0.02 22.11 ?  363  PRO A HG2  1  
ATOM   5667   H HG3  . PRO A 1 370 ? -7.162  5.805   -16.658 0.02 22.11 ?  363  PRO A HG3  1  
ATOM   5668   H HD2  . PRO A 1 370 ? -5.275  4.501   -15.512 0.02 21.65 ?  363  PRO A HD2  1  
ATOM   5669   H HD3  . PRO A 1 370 ? -5.037  5.109   -16.976 0.02 21.45 ?  363  PRO A HD3  1  
ATOM   5670   N N    . LEU A 1 371 ? -4.834  7.350   -12.978 0.02 21.48 ?  364  LEU A N    1  
ATOM   5671   C CA   . LEU A 1 371 ? -4.791  7.965   -11.658 0.02 21.56 ?  364  LEU A CA   1  
ATOM   5672   C C    . LEU A 1 371 ? -3.427  8.597   -11.381 0.02 21.14 ?  364  LEU A C    1  
ATOM   5673   O O    . LEU A 1 371 ? -3.191  9.096   -10.280 0.02 21.18 ?  364  LEU A O    1  
ATOM   5674   C CB   . LEU A 1 371 ? -5.204  6.939   -10.583 0.02 21.88 ?  364  LEU A CB   1  
ATOM   5675   C CG   . LEU A 1 371 ? -6.667  6.451   -10.653 0.02 22.38 ?  364  LEU A CG   1  
ATOM   5676   C CD1  . LEU A 1 371 ? -7.114  5.723   -9.362  0.02 22.74 ?  364  LEU A CD1  1  
ATOM   5677   C CD2  . LEU A 1 371 ? -7.688  7.570   -10.959 0.02 22.64 ?  364  LEU A CD2  1  
ATOM   5678   H H    . LEU A 1 371 ? -4.737  6.499   -12.999 0.02 21.54 ?  364  LEU A H    1  
ATOM   5679   H HA   . LEU A 1 371 ? -5.430  8.691   -11.637 0.02 21.73 ?  364  LEU A HA   1  
ATOM   5680   H HB2  . LEU A 1 371 ? -4.634  6.159   -10.670 0.02 21.72 ?  364  LEU A HB2  1  
ATOM   5681   H HB3  . LEU A 1 371 ? -5.075  7.341   -9.710  0.02 21.95 ?  364  LEU A HB3  1  
ATOM   5682   H HG   . LEU A 1 371 ? -6.730  5.810   -11.376 0.02 22.34 ?  364  LEU A HG   1  
ATOM   5683   H HD11 . LEU A 1 371 ? -7.911  5.205   -9.551  0.02 23.05 ?  364  LEU A HD11 1  
ATOM   5684   H HD12 . LEU A 1 371 ? -6.398  5.137   -9.072  0.02 22.58 ?  364  LEU A HD12 1  
ATOM   5685   H HD13 . LEU A 1 371 ? -7.304  6.380   -8.674  0.02 22.81 ?  364  LEU A HD13 1  
ATOM   5686   H HD21 . LEU A 1 371 ? -8.564  7.167   -11.063 0.02 22.99 ?  364  LEU A HD21 1  
ATOM   5687   H HD22 . LEU A 1 371 ? -7.706  8.193   -10.215 0.02 22.65 ?  364  LEU A HD22 1  
ATOM   5688   H HD23 . LEU A 1 371 ? -7.445  8.028   -11.777 0.02 22.48 ?  364  LEU A HD23 1  
ATOM   5689   N N    . LEU A 1 372 ? -2.536  8.607   -12.376 0.02 20.76 ?  365  LEU A N    1  
ATOM   5690   C CA   . LEU A 1 372 ? -1.391  9.513   -12.347 0.02 20.38 ?  365  LEU A CA   1  
ATOM   5691   C C    . LEU A 1 372 ? -1.832  10.969  -12.178 0.02 20.43 ?  365  LEU A C    1  
ATOM   5692   O O    . LEU A 1 372 ? -1.213  11.733  -11.425 0.02 20.31 ?  365  LEU A O    1  
ATOM   5693   C CB   . LEU A 1 372 ? -0.574  9.364   -13.642 0.02 20.06 ?  365  LEU A CB   1  
ATOM   5694   C CG   . LEU A 1 372 ? 0.922   9.048   -13.685 0.02 19.65 ?  365  LEU A CG   1  
ATOM   5695   C CD1  . LEU A 1 372 ? 1.528   8.550   -12.375 0.02 19.59 ?  365  LEU A CD1  1  
ATOM   5696   C CD2  . LEU A 1 372 ? 1.169   8.041   -14.798 0.02 19.51 ?  365  LEU A CD2  1  
ATOM   5697   H H    . LEU A 1 372 ? -2.572  8.096   -13.066 0.02 20.74 ?  365  LEU A H    1  
ATOM   5698   H HA   . LEU A 1 372 ? -0.838  9.282   -11.591 0.02 20.32 ?  365  LEU A HA   1  
ATOM   5699   H HB2  . LEU A 1 372 ? -0.989  8.670   -14.162 0.02 20.15 ?  365  LEU A HB2  1  
ATOM   5700   H HB3  . LEU A 1 372 ? -0.678  10.196  -14.126 0.02 20.07 ?  365  LEU A HB3  1  
ATOM   5701   H HG   . LEU A 1 372 ? 1.401   9.847   -13.925 0.02 19.53 ?  365  LEU A HG   1  
ATOM   5702   H HD11 . LEU A 1 372 ? 1.243   9.118   -11.645 0.02 19.74 ?  365  LEU A HD11 1  
ATOM   5703   H HD12 . LEU A 1 372 ? 1.246   7.635   -12.214 0.02 19.67 ?  365  LEU A HD12 1  
ATOM   5704   H HD13 . LEU A 1 372 ? 2.495   8.590   -12.456 0.02 19.34 ?  365  LEU A HD13 1  
ATOM   5705   H HD21 . LEU A 1 372 ? 0.830   7.176   -14.521 0.02 19.69 ?  365  LEU A HD21 1  
ATOM   5706   H HD22 . LEU A 1 372 ? 0.700   8.340   -15.592 0.02 19.49 ?  365  LEU A HD22 1  
ATOM   5707   H HD23 . LEU A 1 372 ? 2.120   7.987   -14.972 0.02 19.29 ?  365  LEU A HD23 1  
ATOM   5708   N N    . VAL A 1 373 ? -2.877  11.393  -12.885 0.02 20.64 ?  366  VAL A N    1  
ATOM   5709   C CA   . VAL A 1 373 ? -3.240  12.805  -12.808 0.02 20.74 ?  366  VAL A CA   1  
ATOM   5710   C C    . VAL A 1 373 ? -3.405  13.235  -11.365 0.02 20.94 ?  366  VAL A C    1  
ATOM   5711   O O    . VAL A 1 373 ? -2.908  14.295  -10.993 0.02 20.86 ?  366  VAL A O    1  
ATOM   5712   C CB   . VAL A 1 373 ? -4.521  13.146  -13.602 0.02 21.05 ?  366  VAL A CB   1  
ATOM   5713   C CG1  . VAL A 1 373 ? -4.930  14.593  -13.312 0.02 21.20 ?  366  VAL A CG1  1  
ATOM   5714   C CG2  . VAL A 1 373 ? -4.297  12.976  -15.115 0.02 20.87 ?  366  VAL A CG2  1  
ATOM   5715   H H    . VAL A 1 373 ? -3.375  10.906  -13.390 0.02 20.74 ?  366  VAL A H    1  
ATOM   5716   H HA   . VAL A 1 373 ? -2.515  13.327  -13.184 0.02 20.50 ?  366  VAL A HA   1  
ATOM   5717   H HB   . VAL A 1 373 ? -5.240  12.557  -13.326 0.02 21.30 ?  366  VAL A HB   1  
ATOM   5718   H HG11 . VAL A 1 373 ? -5.567  14.880  -13.986 0.02 21.38 ?  366  VAL A HG11 1  
ATOM   5719   H HG12 . VAL A 1 373 ? -5.333  14.648  -12.431 0.02 21.38 ?  366  VAL A HG12 1  
ATOM   5720   H HG13 . VAL A 1 373 ? -4.144  15.158  -13.350 0.02 20.97 ?  366  VAL A HG13 1  
ATOM   5721   H HG21 . VAL A 1 373 ? -3.565  12.358  -15.259 0.02 20.63 ?  366  VAL A HG21 1  
ATOM   5722   H HG22 . VAL A 1 373 ? -5.110  12.628  -15.513 0.02 21.09 ?  366  VAL A HG22 1  
ATOM   5723   H HG23 . VAL A 1 373 ? -4.091  13.839  -15.501 0.02 20.81 ?  366  VAL A HG23 1  
ATOM   5724   N N    . LYS A 1 374 ? -4.082  12.423  -10.537 0.02 21.21 ?  367  LYS A N    1  
ATOM   5725   C CA   . LYS A 1 374 ? -4.320  12.725  -9.125  0.02 21.46 ?  367  LYS A CA   1  
ATOM   5726   C C    . LYS A 1 374 ? -3.040  12.997  -8.341  0.02 21.20 ?  367  LYS A C    1  
ATOM   5727   O O    . LYS A 1 374 ? -3.104  13.593  -7.260  0.02 21.38 ?  367  LYS A O    1  
ATOM   5728   C CB   . LYS A 1 374 ? -5.112  11.575  -8.478  0.02 21.79 ?  367  LYS A CB   1  
ATOM   5729   C CG   . LYS A 1 374 ? -4.787  11.316  -6.992  0.02 21.99 ?  367  LYS A CG   1  
ATOM   5730   C CD   . LYS A 1 374 ? -5.898  10.600  -6.235  0.02 22.43 ?  367  LYS A CD   1  
ATOM   5731   C CE   . LYS A 1 374 ? -6.142  11.165  -4.805  0.02 22.73 ?  367  LYS A CE   1  
ATOM   5732   N NZ   . LYS A 1 374 ? -5.053  10.902  -3.786  0.02 22.47 ?  367  LYS A NZ   1  
ATOM   5733   H H    . LYS A 1 374 ? -4.424  11.675  -10.786 0.02 21.28 ?  367  LYS A H    1  
ATOM   5734   H HA   . LYS A 1 374 ? -4.867  13.524  -9.074  0.02 21.64 ?  367  LYS A HA   1  
ATOM   5735   H HB2  . LYS A 1 374 ? -6.059  11.776  -8.547  0.02 22.04 ?  367  LYS A HB2  1  
ATOM   5736   H HB3  . LYS A 1 374 ? -4.918  10.764  -8.970  0.02 21.64 ?  367  LYS A HB3  1  
ATOM   5737   H HG2  . LYS A 1 374 ? -3.992  10.762  -6.940  0.02 21.78 ?  367  LYS A HG2  1  
ATOM   5738   H HG3  . LYS A 1 374 ? -4.645  12.156  -6.536  0.02 22.07 ?  367  LYS A HG3  1  
ATOM   5739   H HD2  . LYS A 1 374 ? -6.727  10.691  -6.732  0.02 22.64 ?  367  LYS A HD2  1  
ATOM   5740   H HD3  . LYS A 1 374 ? -5.663  9.663   -6.150  0.02 22.35 ?  367  LYS A HD3  1  
ATOM   5741   H HE2  . LYS A 1 374 ? -6.250  12.125  -4.868  0.02 22.83 ?  367  LYS A HE2  1  
ATOM   5742   H HE3  . LYS A 1 374 ? -6.960  10.775  -4.459  0.02 23.02 ?  367  LYS A HE3  1  
ATOM   5743   H HZ1  . LYS A 1 374 ? -4.865  10.033  -3.755  0.02 22.42 ?  367  LYS A HZ1  1  
ATOM   5744   H HZ2  . LYS A 1 374 ? -4.316  11.351  -4.004  0.02 22.19 ?  367  LYS A HZ2  1  
ATOM   5745   H HZ3  . LYS A 1 374 ? -5.323  11.168  -2.981  0.02 22.65 ?  367  LYS A HZ3  1  
ATOM   5746   N N    . GLU A 1 375 ? -1.884  12.610  -8.861  0.02 20.80 ?  368  GLU A N    1  
ATOM   5747   C CA   . GLU A 1 375 ? -0.623  13.016  -8.259  0.02 20.55 ?  368  GLU A CA   1  
ATOM   5748   C C    . GLU A 1 375 ? -0.504  14.529  -8.157  0.02 20.54 ?  368  GLU A C    1  
ATOM   5749   O O    . GLU A 1 375 ? 0.294   15.037  -7.347  0.02 20.46 ?  368  GLU A O    1  
ATOM   5750   C CB   . GLU A 1 375 ? 0.532   12.466  -9.092  0.02 20.14 ?  368  GLU A CB   1  
ATOM   5751   C CG   . GLU A 1 375 ? 1.756   12.210  -8.314  0.02 19.95 ?  368  GLU A CG   1  
ATOM   5752   C CD   . GLU A 1 375 ? 2.025   10.733  -8.156  0.02 19.92 ?  368  GLU A CD   1  
ATOM   5753   O OE1  . GLU A 1 375 ? 1.400   10.103  -7.242  0.02 20.22 ?  368  GLU A OE1  1  
ATOM   5754   O OE2  . GLU A 1 375 ? 2.891   10.235  -8.892  0.02 19.62 -1 368  GLU A OE2  1  
ATOM   5755   H H    . GLU A 1 375 ? -1.803  12.118  -9.559  0.02 20.68 ?  368  GLU A H    1  
ATOM   5756   H HA   . GLU A 1 375 ? -0.565  12.645  -7.366  0.02 20.66 ?  368  GLU A HA   1  
ATOM   5757   H HB2  . GLU A 1 375 ? 0.265   11.626  -9.493  0.02 20.16 ?  368  GLU A HB2  1  
ATOM   5758   H HB3  . GLU A 1 375 ? 0.749   13.104  -9.788  0.02 20.00 ?  368  GLU A HB3  1  
ATOM   5759   H HG2  . GLU A 1 375 ? 2.514   12.627  -8.750  0.02 19.72 ?  368  GLU A HG2  1  
ATOM   5760   H HG3  . GLU A 1 375 ? 1.626   12.573  -7.432  0.02 20.12 ?  368  GLU A HG3  1  
ATOM   5761   N N    . LEU A 1 376 ? -1.250  15.262  -8.980  0.02 20.64 ?  369  LEU A N    1  
ATOM   5762   C CA   . LEU A 1 376 ? -1.193  16.712  -8.945  0.02 20.66 ?  369  LEU A CA   1  
ATOM   5763   C C    . LEU A 1 376 ? -1.997  17.303  -7.813  0.02 21.05 ?  369  LEU A C    1  
ATOM   5764   O O    . LEU A 1 376 ? -1.927  18.510  -7.616  0.02 21.12 ?  369  LEU A O    1  
ATOM   5765   C CB   . LEU A 1 376 ? -1.728  17.334  -10.234 0.02 20.67 ?  369  LEU A CB   1  
ATOM   5766   C CG   . LEU A 1 376 ? -0.739  17.766  -11.298 0.02 20.30 ?  369  LEU A CG   1  
ATOM   5767   C CD1  . LEU A 1 376 ? 0.411   16.835  -11.321 0.02 19.97 ?  369  LEU A CD1  1  
ATOM   5768   C CD2  . LEU A 1 376 ? -1.410  17.767  -12.660 0.02 20.32 ?  369  LEU A CD2  1  
ATOM   5769   H H    . LEU A 1 376 ? -1.796  14.943  -9.559  0.02 20.70 ?  369  LEU A H    1  
ATOM   5770   H HA   . LEU A 1 376 ? -0.273  16.987  -8.818  0.02 20.46 ?  369  LEU A HA   1  
ATOM   5771   H HB2  . LEU A 1 376 ? -2.329  16.694  -10.643 0.02 20.78 ?  369  LEU A HB2  1  
ATOM   5772   H HB3  . LEU A 1 376 ? -2.231  18.122  -9.986  0.02 20.85 ?  369  LEU A HB3  1  
ATOM   5773   H HG   . LEU A 1 376 ? -0.422  18.660  -11.106 0.02 20.29 ?  369  LEU A HG   1  
ATOM   5774   H HD11 . LEU A 1 376 ? 0.900   16.951  -12.148 0.02 19.77 ?  369  LEU A HD11 1  
ATOM   5775   H HD12 . LEU A 1 376 ? 0.990   17.021  -10.566 0.02 19.93 ?  369  LEU A HD12 1  
ATOM   5776   H HD13 . LEU A 1 376 ? 0.078   15.928  -11.267 0.02 20.02 ?  369  LEU A HD13 1  
ATOM   5777   H HD21 . LEU A 1 376 ? -2.008  18.527  -12.725 0.02 20.52 ?  369  LEU A HD21 1  
ATOM   5778   H HD22 . LEU A 1 376 ? -0.723  17.826  -13.342 0.02 20.09 ?  369  LEU A HD22 1  
ATOM   5779   H HD23 . LEU A 1 376 ? -1.908  16.942  -12.766 0.02 20.40 ?  369  LEU A HD23 1  
ATOM   5780   N N    . GLU A 1 377 ? -2.794  16.503  -7.115  0.02 21.34 ?  370  GLU A N    1  
ATOM   5781   C CA   . GLU A 1 377 ? -3.618  17.073  -6.057  0.02 21.75 ?  370  GLU A CA   1  
ATOM   5782   C C    . GLU A 1 377 ? -2.740  17.685  -4.974  0.02 21.71 ?  370  GLU A C    1  
ATOM   5783   O O    . GLU A 1 377 ? -3.098  18.728  -4.413  0.02 21.93 ?  370  GLU A O    1  
ATOM   5784   C CB   . GLU A 1 377 ? -4.585  16.023  -5.498  0.02 22.09 ?  370  GLU A CB   1  
ATOM   5785   C CG   . GLU A 1 377 ? -5.605  15.507  -6.554  0.02 22.20 ?  370  GLU A CG   1  
ATOM   5786   C CD   . GLU A 1 377 ? -6.819  14.798  -5.980  0.02 22.65 ?  370  GLU A CD   1  
ATOM   5787   O OE1  . GLU A 1 377 ? -7.712  14.456  -6.793  0.02 22.80 ?  370  GLU A OE1  1  
ATOM   5788   O OE2  . GLU A 1 377 ? -6.892  14.576  -4.749  0.02 22.88 -1 370  GLU A OE2  1  
ATOM   5789   H H    . GLU A 1 377 ? -2.877  15.657  -7.225  0.02 21.32 ?  370  GLU A H    1  
ATOM   5790   H HA   . GLU A 1 377 ? -4.148  17.788  -6.440  0.02 21.87 ?  370  GLU A HA   1  
ATOM   5791   H HB2  . GLU A 1 377 ? -4.074  15.263  -5.178  0.02 21.98 ?  370  GLU A HB2  1  
ATOM   5792   H HB3  . GLU A 1 377 ? -5.082  16.417  -4.767  0.02 22.37 ?  370  GLU A HB3  1  
ATOM   5793   H HG2  . GLU A 1 377 ? -5.909  16.235  -7.105  0.02 22.23 ?  370  GLU A HG2  1  
ATOM   5794   H HG3  . GLU A 1 377 ? -5.150  14.862  -7.115  0.02 21.96 ?  370  GLU A HG3  1  
ATOM   5795   N N    . THR A 1 378 ? -1.561  17.085  -4.705  0.02 21.44 ?  371  THR A N    1  
ATOM   5796   C CA   . THR A 1 378 ? -0.548  17.702  -3.838  0.02 21.37 ?  371  THR A CA   1  
ATOM   5797   C C    . THR A 1 378 ? 0.828   17.864  -4.479  0.02 20.93 ?  371  THR A C    1  
ATOM   5798   O O    . THR A 1 378 ? 1.632   18.644  -3.964  0.02 20.89 ?  371  THR A O    1  
ATOM   5799   C CB   . THR A 1 378 ? -0.366  16.916  -2.524  0.02 21.54 ?  371  THR A CB   1  
ATOM   5800   O OG1  . THR A 1 378 ? 0.218   15.631  -2.770  0.02 21.29 ?  371  THR A OG1  1  
ATOM   5801   C CG2  . THR A 1 378 ? -1.675  16.761  -1.808  0.02 22.00 ?  371  THR A CG2  1  
ATOM   5802   H H    . THR A 1 378 ? -1.327  16.321  -5.020  0.02 21.31 ?  371  THR A H    1  
ATOM   5803   H HA   . THR A 1 378 ? -0.853  18.591  -3.595  0.02 21.54 ?  371  THR A HA   1  
ATOM   5804   H HB   . THR A 1 378 ? 0.224   17.424  -1.945  0.02 21.54 ?  371  THR A HB   1  
ATOM   5805   H HG1  . THR A 1 378 ? 0.907   15.708  -3.241  0.02 21.04 ?  371  THR A HG1  1  
ATOM   5806   H HG21 . THR A 1 378 ? -1.577  16.144  -1.066  0.02 22.11 ?  371  THR A HG21 1  
ATOM   5807   H HG22 . THR A 1 378 ? -1.963  17.623  -1.467  0.02 22.19 ?  371  THR A HG22 1  
ATOM   5808   H HG23 . THR A 1 378 ? -2.348  16.417  -2.415  0.02 22.04 ?  371  THR A HG23 1  
ATOM   5809   N N    . CYS A 1 379 ? 1.137   17.126  -5.546  0.02 20.63 ?  372  CYS A N    1  
ATOM   5810   C CA   . CYS A 1 379 ? 2.423   17.189  -6.256  0.02 20.23 ?  372  CYS A CA   1  
ATOM   5811   C C    . CYS A 1 379 ? 3.625   16.770  -5.409  0.02 20.10 ?  372  CYS A C    1  
ATOM   5812   O O    . CYS A 1 379 ? 4.767   17.003  -5.812  0.02 19.82 ?  372  CYS A O    1  
ATOM   5813   C CB   . CYS A 1 379 ? 2.669   18.589  -6.832  0.02 20.17 ?  372  CYS A CB   1  
ATOM   5814   S SG   . CYS A 1 379 ? 1.556   19.013  -8.233  0.02 20.23 ?  372  CYS A SG   1  
ATOM   5815   H H    . CYS A 1 379 ? 0.597   16.556  -5.889  0.02 20.68 ?  372  CYS A H    1  
ATOM   5816   H HA   . CYS A 1 379 ? 2.380   16.573  -7.003  0.02 20.09 ?  372  CYS A HA   1  
ATOM   5817   H HB2  . CYS A 1 379 ? 2.527   19.249  -6.142  0.02 20.36 ?  372  CYS A HB2  1  
ATOM   5818   H HB3  . CYS A 1 379 ? 3.578   18.643  -7.157  0.02 19.94 ?  372  CYS A HB3  1  
ATOM   5819   H HG   . CYS A 1 379 ? 1.840   20.124  -8.573  0.02 20.20 ?  372  CYS A HG   1  
ATOM   5820   N N    . VAL A 1 380 ? 3.418   16.136  -4.254  0.02 20.32 ?  373  VAL A N    1  
ATOM   5821   C CA   . VAL A 1 380 ? 4.544   15.750  -3.400  0.02 20.24 ?  373  VAL A CA   1  
ATOM   5822   C C    . VAL A 1 380 ? 5.551   14.862  -4.120  0.02 19.87 ?  373  VAL A C    1  
ATOM   5823   O O    . VAL A 1 380 ? 6.747   14.888  -3.801  0.02 19.72 ?  373  VAL A O    1  
ATOM   5824   C CB   . VAL A 1 380 ? 4.015   15.070  -2.120  0.02 20.57 ?  373  VAL A CB   1  
ATOM   5825   C CG1  . VAL A 1 380 ? 3.201   16.055  -1.312  0.02 20.94 ?  373  VAL A CG1  1  
ATOM   5826   C CG2  . VAL A 1 380 ? 3.158   13.829  -2.433  0.02 20.66 ?  373  VAL A CG2  1  
ATOM   5827   H H    . VAL A 1 380 ? 2.649   15.929  -3.942  0.02 20.53 ?  373  VAL A H    1  
ATOM   5828   H HA   . VAL A 1 380 ? 5.018   16.551  -3.132  0.02 20.23 ?  373  VAL A HA   1  
ATOM   5829   H HB   . VAL A 1 380 ? 4.766   14.787  -1.578  0.02 20.53 ?  373  VAL A HB   1  
ATOM   5830   H HG11 . VAL A 1 380 ? 2.874   15.610  -0.516  0.02 21.17 ?  373  VAL A HG11 1  
ATOM   5831   H HG12 . VAL A 1 380 ? 3.765   16.806  -1.065  0.02 20.91 ?  373  VAL A HG12 1  
ATOM   5832   H HG13 . VAL A 1 380 ? 2.452   16.358  -1.848  0.02 21.00 ?  373  VAL A HG13 1  
ATOM   5833   H HG21 . VAL A 1 380 ? 3.030   13.318  -1.620  0.02 20.83 ?  373  VAL A HG21 1  
ATOM   5834   H HG22 . VAL A 1 380 ? 2.297   14.115  -2.772  0.02 20.79 ?  373  VAL A HG22 1  
ATOM   5835   H HG23 . VAL A 1 380 ? 3.614   13.282  -3.090  0.02 20.42 ?  373  VAL A HG23 1  
ATOM   5836   N N    . ASN A 1 381 ? 5.099   14.050  -5.073  0.02 19.77 ?  374  ASN A N    1  
ATOM   5837   C CA   . ASN A 1 381 ? 5.995   13.078  -5.677  0.02 19.47 ?  374  ASN A CA   1  
ATOM   5838   C C    . ASN A 1 381 ? 6.965   13.722  -6.665  0.02 19.14 ?  374  ASN A C    1  
ATOM   5839   O O    . ASN A 1 381 ? 7.974   13.107  -7.021  0.02 18.90 ?  374  ASN A O    1  
ATOM   5840   C CB   . ASN A 1 381 ? 5.178   11.996  -6.367  0.02 19.51 ?  374  ASN A CB   1  
ATOM   5841   C CG   . ASN A 1 381 ? 4.389   11.150  -5.388  0.02 19.84 ?  374  ASN A CG   1  
ATOM   5842   O OD1  . ASN A 1 381 ? 4.611   11.202  -4.175  0.02 20.01 ?  374  ASN A OD1  1  
ATOM   5843   N ND2  . ASN A 1 381 ? 3.493   10.325  -5.913  0.02 19.96 ?  374  ASN A ND2  1  
ATOM   5844   H H    . ASN A 1 381 ? 4.296   14.040  -5.374  0.02 19.88 ?  374  ASN A H    1  
ATOM   5845   H HA   . ASN A 1 381 ? 6.516   12.654  -4.985  0.02 19.49 ?  374  ASN A HA   1  
ATOM   5846   H HB2  . ASN A 1 381 ? 4.554   12.405  -6.986  0.02 19.53 ?  374  ASN A HB2  1  
ATOM   5847   H HB3  . ASN A 1 381 ? 5.784   11.413  -6.848  0.02 19.31 ?  374  ASN A HB3  1  
ATOM   5848   H HD21 . ASN A 1 381 ? 2.679   10.342  -5.638  0.02 20.17 ?  374  ASN A HD21 1  
ATOM   5849   H HD22 . ASN A 1 381 ? 3.723   9.780   -6.533  0.02 19.84 ?  374  ASN A HD22 1  
ATOM   5850   N N    . PHE A 1 382 ? 6.701   14.950  -7.081  0.02 19.16 ?  375  PHE A N    1  
ATOM   5851   C CA   . PHE A 1 382 ? 7.570   15.650  -8.011  0.02 18.90 ?  375  PHE A CA   1  
ATOM   5852   C C    . PHE A 1 382 ? 8.511   16.622  -7.327  0.02 18.91 ?  375  PHE A C    1  
ATOM   5853   O O    . PHE A 1 382 ? 9.327   17.265  -7.990  0.02 18.72 ?  375  PHE A O    1  
ATOM   5854   C CB   . PHE A 1 382 ? 6.715   16.361  -9.050  0.02 18.93 ?  375  PHE A CB   1  
ATOM   5855   C CG   . PHE A 1 382 ? 6.107   15.431  -10.060 0.02 18.86 ?  375  PHE A CG   1  
ATOM   5856   C CD1  . PHE A 1 382 ? 6.891   14.862  -11.046 0.02 18.58 ?  375  PHE A CD1  1  
ATOM   5857   C CD2  . PHE A 1 382 ? 4.761   15.149  -10.041 0.02 19.11 ?  375  PHE A CD2  1  
ATOM   5858   C CE1  . PHE A 1 382 ? 6.332   14.032  -11.995 0.02 18.55 ?  375  PHE A CE1  1  
ATOM   5859   C CE2  . PHE A 1 382 ? 4.206   14.310  -10.972 0.02 19.08 ?  375  PHE A CE2  1  
ATOM   5860   C CZ   . PHE A 1 382 ? 4.980   13.762  -11.953 0.02 18.80 ?  375  PHE A CZ   1  
ATOM   5861   H H    . PHE A 1 382 ? 6.014   15.406  -6.842  0.02 19.34 ?  375  PHE A H    1  
ATOM   5862   H HA   . PHE A 1 382 ? 8.113   15.003  -8.485  0.02 18.71 ?  375  PHE A HA   1  
ATOM   5863   H HB2  . PHE A 1 382 ? 5.990   16.816  -8.598  0.02 19.14 ?  375  PHE A HB2  1  
ATOM   5864   H HB3  . PHE A 1 382 ? 7.264   17.006  -9.520  0.02 18.80 ?  375  PHE A HB3  1  
ATOM   5865   H HD1  . PHE A 1 382 ? 7.799   15.053  -11.077 0.02 18.43 ?  375  PHE A HD1  1  
ATOM   5866   H HD2  . PHE A 1 382 ? 4.220   15.526  -9.382  0.02 19.32 ?  375  PHE A HD2  1  
ATOM   5867   H HE1  . PHE A 1 382 ? 6.862   13.648  -12.653 0.02 18.37 ?  375  PHE A HE1  1  
ATOM   5868   H HE2  . PHE A 1 382 ? 3.296   14.128  -10.947 0.02 19.27 ?  375  PHE A HE2  1  
ATOM   5869   H HZ   . PHE A 1 382 ? 4.599   13.191  -12.580 0.02 18.80 ?  375  PHE A HZ   1  
ATOM   5870   N N    . VAL A 1 383 ? 8.448   16.721  -6.003  0.02 19.14 ?  376  VAL A N    1  
ATOM   5871   C CA   . VAL A 1 383 ? 9.434   17.536  -5.300  0.02 19.17 ?  376  VAL A CA   1  
ATOM   5872   C C    . VAL A 1 383 ? 10.820  16.935  -5.500  0.02 18.91 ?  376  VAL A C    1  
ATOM   5873   O O    . VAL A 1 383 ? 10.999  15.718  -5.326  0.02 18.85 ?  376  VAL A O    1  
ATOM   5874   C CB   . VAL A 1 383 ? 9.076   17.621  -3.812  0.02 19.50 ?  376  VAL A CB   1  
ATOM   5875   C CG1  . VAL A 1 383 ? 10.186  18.315  -3.036  0.02 19.56 ?  376  VAL A CG1  1  
ATOM   5876   C CG2  . VAL A 1 383 ? 7.731   18.330  -3.634  0.02 19.79 ?  376  VAL A CG2  1  
ATOM   5877   H H    . VAL A 1 383 ? 7.863   16.343  -5.505  0.02 19.30 ?  376  VAL A H    1  
ATOM   5878   H HA   . VAL A 1 383 ? 9.416   18.431  -5.666  0.02 19.17 ?  376  VAL A HA   1  
ATOM   5879   H HB   . VAL A 1 383 ? 8.982   16.719  -3.475  0.02 19.53 ?  376  VAL A HB   1  
ATOM   5880   H HG11 . VAL A 1 383 ? 9.868   18.501  -2.139  0.02 19.80 ?  376  VAL A HG11 1  
ATOM   5881   H HG12 . VAL A 1 383 ? 10.953  17.726  -2.994  0.02 19.43 ?  376  VAL A HG12 1  
ATOM   5882   H HG13 . VAL A 1 383 ? 10.428  19.141  -3.477  0.02 19.51 ?  376  VAL A HG13 1  
ATOM   5883   H HG21 . VAL A 1 383 ? 7.490   18.331  -2.695  0.02 20.02 ?  376  VAL A HG21 1  
ATOM   5884   H HG22 . VAL A 1 383 ? 7.817   19.240  -3.954  0.02 19.79 ?  376  VAL A HG22 1  
ATOM   5885   H HG23 . VAL A 1 383 ? 7.051   17.862  -4.143  0.02 19.77 ?  376  VAL A HG23 1  
ATOM   5886   N N    . PRO A 1 384 ? 11.839  17.733  -5.842  0.02 18.78 ?  377  PRO A N    1  
ATOM   5887   C CA   . PRO A 1 384 ? 13.195  17.186  -5.972  0.02 18.58 ?  377  PRO A CA   1  
ATOM   5888   C C    . PRO A 1 384 ? 13.603  16.305  -4.800  0.02 18.69 ?  377  PRO A C    1  
ATOM   5889   O O    . PRO A 1 384 ? 13.475  16.693  -3.632  0.02 18.95 ?  377  PRO A O    1  
ATOM   5890   C CB   . PRO A 1 384 ? 14.064  18.444  -6.057  0.02 18.59 ?  377  PRO A CB   1  
ATOM   5891   C CG   . PRO A 1 384 ? 13.173  19.462  -6.702  0.02 18.65 ?  377  PRO A CG   1  
ATOM   5892   C CD   . PRO A 1 384 ? 11.802  19.179  -6.126  0.02 18.85 ?  377  PRO A CD   1  
ATOM   5893   H HA   . PRO A 1 384 ? 13.277  16.679  -6.790  0.02 18.39 ?  377  PRO A HA   1  
ATOM   5894   H HB2  . PRO A 1 384 ? 14.314  18.721  -5.162  0.02 18.75 ?  377  PRO A HB2  1  
ATOM   5895   H HB3  . PRO A 1 384 ? 14.850  18.265  -6.594  0.02 18.42 ?  377  PRO A HB3  1  
ATOM   5896   H HG2  . PRO A 1 384 ? 13.469  20.353  -6.458  0.02 18.76 ?  377  PRO A HG2  1  
ATOM   5897   H HG3  . PRO A 1 384 ? 13.182  19.350  -7.665  0.02 18.48 ?  377  PRO A HG3  1  
ATOM   5898   H HD2  . PRO A 1 384 ? 11.674  19.676  -5.305  0.02 19.06 ?  377  PRO A HD2  1  
ATOM   5899   H HD3  . PRO A 1 384 ? 11.108  19.378  -6.770  0.02 18.82 ?  377  PRO A HD3  1  
ATOM   5900   N N    . SER A 1 385 ? 14.067  15.097  -5.112  0.02 18.52 ?  378  SER A N    1  
ATOM   5901   C CA   . SER A 1 385 ? 14.368  14.119  -4.071  0.02 18.64 ?  378  SER A CA   1  
ATOM   5902   C C    . SER A 1 385 ? 15.272  14.682  -2.981  0.02 18.81 ?  378  SER A C    1  
ATOM   5903   O O    . SER A 1 385 ? 15.091  14.343  -1.804  0.02 19.06 ?  378  SER A O    1  
ATOM   5904   C CB   . SER A 1 385 ? 15.013  12.888  -4.687  0.02 18.41 ?  378  SER A CB   1  
ATOM   5905   O OG   . SER A 1 385 ? 14.162  12.291  -5.611  0.02 18.27 ?  378  SER A OG   1  
ATOM   5906   H H    . SER A 1 385 ? 14.200  14.810  -5.909  0.02 18.35 ?  378  SER A H    1  
ATOM   5907   H HA   . SER A 1 385 ? 13.540  13.841  -3.650  0.02 18.78 ?  378  SER A HA   1  
ATOM   5908   H HB2  . SER A 1 385 ? 15.839  13.138  -5.138  0.02 18.28 ?  378  SER A HB2  1  
ATOM   5909   H HB3  . SER A 1 385 ? 15.198  12.250  -3.981  0.02 18.52 ?  378  SER A HB3  1  
ATOM   5910   H HG   . SER A 1 385 ? 13.863  12.868  -6.144  0.02 18.27 ?  378  SER A HG   1  
ATOM   5911   N N    . GLU A 1 386 ? 16.275  15.486  -3.331  0.02 18.71 ?  379  GLU A N    1  
ATOM   5912   C CA   . GLU A 1 386 ? 17.197  15.888  -2.275  0.02 18.90 ?  379  GLU A CA   1  
ATOM   5913   C C    . GLU A 1 386 ? 16.480  16.688  -1.221  0.02 19.22 ?  379  GLU A C    1  
ATOM   5914   O O    . GLU A 1 386 ? 17.004  16.852  -0.113  0.02 19.45 ?  379  GLU A O    1  
ATOM   5915   C CB   . GLU A 1 386 ? 18.413  16.753  -2.727  0.02 18.78 ?  379  GLU A CB   1  
ATOM   5916   C CG   . GLU A 1 386 ? 18.896  16.985  -4.197  0.02 18.47 ?  379  GLU A CG   1  
ATOM   5917   C CD   . GLU A 1 386 ? 17.851  17.478  -5.207  0.02 18.37 ?  379  GLU A CD   1  
ATOM   5918   O OE1  . GLU A 1 386 ? 16.946  16.713  -5.498  0.02 18.31 ?  379  GLU A OE1  1  
ATOM   5919   O OE2  . GLU A 1 386 ? 17.979  18.592  -5.766  0.02 18.38 -1 379  GLU A OE2  1  
ATOM   5920   H H    . GLU A 1 386 ? 16.435  15.787  -4.116  0.02 18.56 ?  379  GLU A H    1  
ATOM   5921   H HA   . GLU A 1 386 ? 17.540  15.084  -1.852  0.02 18.93 ?  379  GLU A HA   1  
ATOM   5922   H HB2  . GLU A 1 386 ? 18.278  17.633  -2.349  0.02 18.92 ?  379  GLU A HB2  1  
ATOM   5923   H HB3  . GLU A 1 386 ? 19.182  16.359  -2.291  0.02 18.81 ?  379  GLU A HB3  1  
ATOM   5924   H HG2  . GLU A 1 386 ? 19.594  17.659  -4.174  0.02 18.47 ?  379  GLU A HG2  1  
ATOM   5925   H HG3  . GLU A 1 386 ? 19.275  16.158  -4.541  0.02 18.33 ?  379  GLU A HG3  1  
ATOM   5926   N N    . LEU A 1 387 ? 15.302  17.214  -1.534  0.02 19.27 ?  380  LEU A N    1  
ATOM   5927   C CA   . LEU A 1 387 ? 14.609  18.069  -0.594  0.02 19.61 ?  380  LEU A CA   1  
ATOM   5928   C C    . LEU A 1 387 ? 13.528  17.335  0.206   0.02 19.83 ?  380  LEU A C    1  
ATOM   5929   O O    . LEU A 1 387 ? 12.802  18.002  0.946   0.02 20.13 ?  380  LEU A O    1  
ATOM   5930   C CB   . LEU A 1 387 ? 14.017  19.289  -1.339  0.02 19.60 ?  380  LEU A CB   1  
ATOM   5931   C CG   . LEU A 1 387 ? 14.958  20.276  -2.088  0.02 19.47 ?  380  LEU A CG   1  
ATOM   5932   C CD1  . LEU A 1 387 ? 14.197  21.469  -2.746  0.02 19.53 ?  380  LEU A CD1  1  
ATOM   5933   C CD2  . LEU A 1 387 ? 16.102  20.823  -1.182  0.02 19.67 ?  380  LEU A CD2  1  
ATOM   5934   H H    . LEU A 1 387 ? 14.890  17.101  -2.278  0.02 19.13 ?  380  LEU A H    1  
ATOM   5935   H HA   . LEU A 1 387 ? 15.252  18.418  0.037   0.02 19.74 ?  380  LEU A HA   1  
ATOM   5936   H HB2  . LEU A 1 387 ? 13.387  18.953  -1.992  0.02 19.47 ?  380  LEU A HB2  1  
ATOM   5937   H HB3  . LEU A 1 387 ? 13.528  19.815  -0.687  0.02 19.84 ?  380  LEU A HB3  1  
ATOM   5938   H HG   . LEU A 1 387 ? 15.385  19.790  -2.806  0.02 19.24 ?  380  LEU A HG   1  
ATOM   5939   H HD11 . LEU A 1 387 ? 14.750  22.265  -2.709  0.02 19.49 ?  380  LEU A HD11 1  
ATOM   5940   H HD12 . LEU A 1 387 ? 13.997  21.248  -3.669  0.02 19.39 ?  380  LEU A HD12 1  
ATOM   5941   H HD13 . LEU A 1 387 ? 13.379  21.619  -2.256  0.02 19.77 ?  380  LEU A HD13 1  
ATOM   5942   H HD21 . LEU A 1 387 ? 16.624  20.079  -0.847  0.02 19.67 ?  380  LEU A HD21 1  
ATOM   5943   H HD22 . LEU A 1 387 ? 16.662  21.413  -1.707  0.02 19.57 ?  380  LEU A HD22 1  
ATOM   5944   H HD23 . LEU A 1 387 ? 15.709  21.311  -0.444  0.02 19.91 ?  380  LEU A HD23 1  
ATOM   5945   N N    . ALA A 1 388 ? 13.433  15.984  0.135   0.02 19.71 ?  381  ALA A N    1  
ATOM   5946   C CA   . ALA A 1 388 ? 12.369  15.239  0.828   0.02 19.95 ?  381  ALA A CA   1  
ATOM   5947   C C    . ALA A 1 388 ? 12.729  13.783  1.225   0.02 19.96 ?  381  ALA A C    1  
ATOM   5948   O O    . ALA A 1 388 ? 13.833  13.286  0.993   0.02 19.74 ?  381  ALA A O    1  
ATOM   5949   C CB   . ALA A 1 388 ? 11.123  15.254  -0.059  0.02 19.87 ?  381  ALA A CB   1  
ATOM   5950   H H    . ALA A 1 388 ? 13.969  15.486  -0.316  0.02 19.52 ?  381  ALA A H    1  
ATOM   5951   H HA   . ALA A 1 388 ? 12.149  15.712  1.648   0.02 20.20 ?  381  ALA A HA   1  
ATOM   5952   H HB1  . ALA A 1 388 ? 10.586  14.469  0.120   0.02 20.03 ?  381  ALA A HB1  1  
ATOM   5953   H HB2  . ALA A 1 388 ? 10.611  16.055  0.138   0.02 19.91 ?  381  ALA A HB2  1  
ATOM   5954   H HB3  . ALA A 1 388 ? 11.394  15.255  -0.990  0.02 19.62 ?  381  ALA A HB3  1  
ATOM   5955   N N    . ASP A 1 389 ? 11.754  13.082  1.845   0.02 20.24 ?  382  ASP A N    1  
ATOM   5956   C CA   . ASP A 1 389 ? 11.868  11.669  2.213   0.02 20.29 ?  382  ASP A CA   1  
ATOM   5957   C C    . ASP A 1 389 ? 11.055  10.767  1.290   0.02 20.14 ?  382  ASP A C    1  
ATOM   5958   O O    . ASP A 1 389 ? 10.091  11.197  0.640   0.02 20.10 ?  382  ASP A O    1  
ATOM   5959   C CB   . ASP A 1 389 ? 11.394  11.388  3.650   0.02 20.73 ?  382  ASP A CB   1  
ATOM   5960   C CG   . ASP A 1 389 ? 11.264  9.882   3.942   0.02 20.80 ?  382  ASP A CG   1  
ATOM   5961   O OD1  . ASP A 1 389 ? 12.155  9.137   3.477   0.02 20.57 ?  382  ASP A OD1  1  
ATOM   5962   O OD2  . ASP A 1 389 ? 10.268  9.445   4.586   0.02 21.08 -1 382  ASP A OD2  1  
ATOM   5963   H H    . ASP A 1 389 ? 10.996  13.423  2.066   0.02 20.44 ?  382  ASP A H    1  
ATOM   5964   H HA   . ASP A 1 389 ? 12.797  11.397  2.150   0.02 20.17 ?  382  ASP A HA   1  
ATOM   5965   H HB2  . ASP A 1 389 ? 12.037  11.754  4.275   0.02 20.85 ?  382  ASP A HB2  1  
ATOM   5966   H HB3  . ASP A 1 389 ? 10.525  11.795  3.782   0.02 20.87 ?  382  ASP A HB3  1  
ATOM   5967   N N    . ALA A 1 390 ? 11.456  9.492   1.275   0.02 20.10 ?  383  ALA A N    1  
ATOM   5968   C CA   . ALA A 1 390 ? 10.815  8.474   0.449   0.02 19.96 ?  383  ALA A CA   1  
ATOM   5969   C C    . ALA A 1 390 ? 9.290   8.514   0.524   0.02 20.24 ?  383  ALA A C    1  
ATOM   5970   O O    . ALA A 1 390 ? 8.632   8.493   -0.517  0.02 20.12 ?  383  ALA A O    1  
ATOM   5971   C CB   . ALA A 1 390 ? 11.335  7.091   0.849   0.02 19.93 ?  383  ALA A CB   1  
ATOM   5972   H H    . ALA A 1 390 ? 12.113  9.189   1.742   0.02 20.16 ?  383  ALA A H    1  
ATOM   5973   H HA   . ALA A 1 390 ? 11.063  8.619   -0.477  0.02 19.73 ?  383  ALA A HA   1  
ATOM   5974   H HB1  . ALA A 1 390 ? 11.278  6.999   1.813   0.02 20.18 ?  383  ALA A HB1  1  
ATOM   5975   H HB2  . ALA A 1 390 ? 10.811  6.407   0.409   0.02 19.83 ?  383  ALA A HB2  1  
ATOM   5976   H HB3  . ALA A 1 390 ? 12.260  7.012   0.567   0.02 19.77 ?  383  ALA A HB3  1  
ATOM   5977   N N    . GLU A 1 391 ? 8.705   8.526   1.726   0.02 20.62 ?  384  GLU A N    1  
ATOM   5978   C CA   . GLU A 1 391 ? 7.281   8.220   1.819   0.02 20.92 ?  384  GLU A CA   1  
ATOM   5979   C C    . GLU A 1 391 ? 6.432   9.438   1.460   0.02 20.95 ?  384  GLU A C    1  
ATOM   5980   O O    . GLU A 1 391 ? 5.237   9.303   1.167   0.02 21.16 ?  384  GLU A O    1  
ATOM   5981   C CB   . GLU A 1 391 ? 6.970   7.668   3.223   0.02 21.36 ?  384  GLU A CB   1  
ATOM   5982   C CG   . GLU A 1 391 ? 8.099   6.746   3.833   0.02 21.36 ?  384  GLU A CG   1  
ATOM   5983   C CD   . GLU A 1 391 ? 8.819   5.818   2.824   0.02 21.05 ?  384  GLU A CD   1  
ATOM   5984   O OE1  . GLU A 1 391 ? 9.043   6.206   1.669   0.02 20.74 ?  384  GLU A OE1  1  
ATOM   5985   O OE2  . GLU A 1 391 ? 9.186   4.688   3.193   0.02 21.15 -1 384  GLU A OE2  1  
ATOM   5986   H H    . GLU A 1 391 ? 9.089   8.723   2.469   0.02 20.73 ?  384  GLU A H    1  
ATOM   5987   H HA   . GLU A 1 391 ? 7.066   7.525   1.183   0.02 20.86 ?  384  GLU A HA   1  
ATOM   5988   H HB2  . GLU A 1 391 ? 6.847   8.415   3.829   0.02 21.50 ?  384  GLU A HB2  1  
ATOM   5989   H HB3  . GLU A 1 391 ? 6.153   7.146   3.186   0.02 21.55 ?  384  GLU A HB3  1  
ATOM   5990   H HG2  . GLU A 1 391 ? 8.770   7.311   4.246   0.02 21.31 ?  384  GLU A HG2  1  
ATOM   5991   H HG3  . GLU A 1 391 ? 7.695   6.174   4.505   0.02 21.66 ?  384  GLU A HG3  1  
ATOM   5992   N N    . ARG A 1 392 ? 7.037   10.617  1.429   0.02 20.78 ?  385  ARG A N    1  
ATOM   5993   C CA   . ARG A 1 392 ? 6.423   11.785  0.803   0.02 20.75 ?  385  ARG A CA   1  
ATOM   5994   C C    . ARG A 1 392 ? 5.284   12.330  1.667   0.02 21.18 ?  385  ARG A C    1  
ATOM   5995   O O    . ARG A 1 392 ? 4.308   12.897  1.167   0.02 21.28 ?  385  ARG A O    1  
ATOM   5996   C CB   . ARG A 1 392 ? 5.967   11.434  -0.622  0.02 20.51 ?  385  ARG A CB   1  
ATOM   5997   C CG   . ARG A 1 392 ? 7.121   10.884  -1.533  0.02 20.08 ?  385  ARG A CG   1  
ATOM   5998   C CD   . ARG A 1 392 ? 7.737   11.999  -2.291  0.02 19.81 ?  385  ARG A CD   1  
ATOM   5999   N NE   . ARG A 1 392 ? 9.083   11.725  -2.787  0.02 19.50 ?  385  ARG A NE   1  
ATOM   6000   C CZ   . ARG A 1 392 ? 9.783   12.573  -3.529  0.02 19.25 ?  385  ARG A CZ   1  
ATOM   6001   N NH1  . ARG A 1 392 ? 9.280   13.739  -3.901  0.02 19.25 ?  385  ARG A NH1  1  
ATOM   6002   N NH2  . ARG A 1 392 ? 10.996  12.231  -3.920  0.02 19.01 ?  385  ARG A NH2  1  
ATOM   6003   H H    . ARG A 1 392 ? 7.811   10.771  1.772   0.02 20.69 ?  385  ARG A H    1  
ATOM   6004   H HA   . ARG A 1 392 ? 7.090   12.483  0.731   0.02 20.62 ?  385  ARG A HA   1  
ATOM   6005   H HB2  . ARG A 1 392 ? 5.262   10.771  -0.597  0.02 20.64 ?  385  ARG A HB2  1  
ATOM   6006   H HB3  . ARG A 1 392 ? 5.633   12.243  -1.041  0.02 20.51 ?  385  ARG A HB3  1  
ATOM   6007   H HG2  . ARG A 1 392 ? 7.810   10.489  -0.984  0.02 20.07 ?  385  ARG A HG2  1  
ATOM   6008   H HG3  . ARG A 1 392 ? 6.770   10.235  -2.165  0.02 20.00 ?  385  ARG A HG3  1  
ATOM   6009   H HD2  . ARG A 1 392 ? 7.175   12.188  -3.056  0.02 19.75 ?  385  ARG A HD2  1  
ATOM   6010   H HD3  . ARG A 1 392 ? 7.788   12.776  -1.714  0.02 19.94 ?  385  ARG A HD3  1  
ATOM   6011   H HE   . ARG A 1 392 ? 9.349   10.910  -2.769  0.02 19.46 ?  385  ARG A HE   1  
ATOM   6012   H HH11 . ARG A 1 392 ? 8.492   13.969  -3.653  0.02 19.42 ?  385  ARG A HH11 1  
ATOM   6013   H HH12 . ARG A 1 392 ? 9.745   14.271  -4.386  0.02 19.11 ?  385  ARG A HH12 1  
ATOM   6014   H HH21 . ARG A 1 392 ? 11.326  11.471  -3.689  0.02 19.02 ?  385  ARG A HH21 1  
ATOM   6015   H HH22 . ARG A 1 392 ? 11.454  12.768  -4.409  0.02 18.86 ?  385  ARG A HH22 1  
ATOM   6016   N N    . THR A 1 393 ? 5.458   12.179  2.993   0.02 21.46 ?  386  THR A N    1  
ATOM   6017   C CA   . THR A 1 393 ? 4.510   12.578  4.032   0.02 21.93 ?  386  THR A CA   1  
ATOM   6018   C C    . THR A 1 393 ? 4.781   13.953  4.623   0.02 22.05 ?  386  THR A C    1  
ATOM   6019   O O    . THR A 1 393 ? 3.854   14.568  5.176   0.02 22.40 ?  386  THR A O    1  
ATOM   6020   C CB   . THR A 1 393 ? 4.541   11.604  5.232   0.02 22.24 ?  386  THR A CB   1  
ATOM   6021   O OG1  . THR A 1 393 ? 5.226   12.242  6.319   0.02 22.37 ?  386  THR A OG1  1  
ATOM   6022   C CG2  . THR A 1 393 ? 5.289   10.326  4.945   0.02 22.04 ?  386  THR A CG2  1  
ATOM   6023   H H    . THR A 1 393 ? 6.182   11.849  3.315   0.02 21.40 ?  386  THR A H    1  
ATOM   6024   H HA   . THR A 1 393 ? 3.614   12.578  3.660   0.02 22.03 ?  386  THR A HA   1  
ATOM   6025   H HB   . THR A 1 393 ? 3.637   11.380  5.500   0.02 22.53 ?  386  THR A HB   1  
ATOM   6026   H HG1  . THR A 1 393 ? 5.557   11.667  6.834   0.02 22.48 ?  386  THR A HG1  1  
ATOM   6027   H HG21 . THR A 1 393 ? 6.214   10.520  4.729   0.02 21.89 ?  386  THR A HG21 1  
ATOM   6028   H HG22 . THR A 1 393 ? 5.274   9.753   5.726   0.02 22.28 ?  386  THR A HG22 1  
ATOM   6029   H HG23 . THR A 1 393 ? 4.879   9.860   4.198   0.02 21.82 ?  386  THR A HG23 1  
ATOM   6030   N N    . ALA A 1 394 ? 6.026   14.417  4.594   0.02 21.82 ?  387  ALA A N    1  
ATOM   6031   C CA   . ALA A 1 394 ? 6.466   15.440  5.523   0.02 22.04 ?  387  ALA A CA   1  
ATOM   6032   C C    . ALA A 1 394 ? 5.773   16.769  5.222   0.02 22.15 ?  387  ALA A C    1  
ATOM   6033   O O    . ALA A 1 394 ? 5.417   17.050  4.070   0.02 21.91 ?  387  ALA A O    1  
ATOM   6034   C CB   . ALA A 1 394 ? 7.981   15.599  5.451   0.02 21.76 ?  387  ALA A CB   1  
ATOM   6035   H H    . ALA A 1 394 ? 6.635   14.155  4.045   0.02 21.55 ?  387  ALA A H    1  
ATOM   6036   H HA   . ALA A 1 394 ? 6.235   15.166  6.423   0.02 22.32 ?  387  ALA A HA   1  
ATOM   6037   H HB1  . ALA A 1 394 ? 8.391   14.721  5.475   0.02 21.68 ?  387  ALA A HB1  1  
ATOM   6038   H HB2  . ALA A 1 394 ? 8.208   16.045  4.618   0.02 21.51 ?  387  ALA A HB2  1  
ATOM   6039   H HB3  . ALA A 1 394 ? 8.279   16.133  6.202   0.02 21.96 ?  387  ALA A HB3  1  
ATOM   6040   N N    . PRO A 1 395 ? 5.570   17.612  6.236   0.02 22.52 ?  388  PRO A N    1  
ATOM   6041   C CA   . PRO A 1 395 ? 4.909   18.898  5.976   0.02 22.66 ?  388  PRO A CA   1  
ATOM   6042   C C    . PRO A 1 395 ? 5.738   19.820  5.091   0.02 22.31 ?  388  PRO A C    1  
ATOM   6043   O O    . PRO A 1 395 ? 5.165   20.608  4.329   0.02 22.25 ?  388  PRO A O    1  
ATOM   6044   C CB   . PRO A 1 395 ? 4.663   19.450  7.396   0.02 23.13 ?  388  PRO A CB   1  
ATOM   6045   C CG   . PRO A 1 395 ? 5.598   18.729  8.279   0.02 23.18 ?  388  PRO A CG   1  
ATOM   6046   C CD   . PRO A 1 395 ? 5.718   17.357  7.681   0.02 22.89 ?  388  PRO A CD   1  
ATOM   6047   H HA   . PRO A 1 395 ? 4.053   18.744  5.549   0.02 22.74 ?  388  PRO A HA   1  
ATOM   6048   H HB2  . PRO A 1 395 ? 4.827   20.405  7.424   0.02 23.12 ?  388  PRO A HB2  1  
ATOM   6049   H HB3  . PRO A 1 395 ? 3.749   19.251  7.652   0.02 23.40 ?  388  PRO A HB3  1  
ATOM   6050   H HG2  . PRO A 1 395 ? 6.460   19.176  8.274   0.02 23.07 ?  388  PRO A HG2  1  
ATOM   6051   H HG3  . PRO A 1 395 ? 5.241   18.683  9.180   0.02 23.53 ?  388  PRO A HG3  1  
ATOM   6052   H HD2  . PRO A 1 395 ? 6.588   16.980  7.872   0.02 22.76 ?  388  PRO A HD2  1  
ATOM   6053   H HD3  . PRO A 1 395 ? 5.005   16.779  7.992   0.02 23.10 ?  388  PRO A HD3  1  
ATOM   6054   N N    . GLU A 1 396 ? 7.069   19.701  5.108   0.02 22.09 ?  389  GLU A N    1  
ATOM   6055   C CA   . GLU A 1 396 ? 7.878   20.544  4.228   0.02 21.80 ?  389  GLU A CA   1  
ATOM   6056   C C    . GLU A 1 396 ? 7.807   20.080  2.785   0.02 21.39 ?  389  GLU A C    1  
ATOM   6057   O O    . GLU A 1 396 ? 8.057   20.872  1.870   0.02 21.20 ?  389  GLU A O    1  
ATOM   6058   C CB   . GLU A 1 396 ? 9.329   20.564  4.660   0.02 21.74 ?  389  GLU A CB   1  
ATOM   6059   C CG   . GLU A 1 396 ? 10.060  21.756  4.063   0.02 21.65 ?  389  GLU A CG   1  
ATOM   6060   C CD   . GLU A 1 396 ? 10.052  22.982  4.982   0.02 22.06 ?  389  GLU A CD   1  
ATOM   6061   O OE1  . GLU A 1 396 ? 11.151  23.559  5.123   0.02 22.04 ?  389  GLU A OE1  1  
ATOM   6062   O OE2  . GLU A 1 396 ? 8.996   23.370  5.557   0.02 22.45 -1 389  GLU A OE2  1  
ATOM   6063   H H    . GLU A 1 396 ? 7.514   19.160  5.607   0.02 22.12 ?  389  GLU A H    1  
ATOM   6064   H HA   . GLU A 1 396 ? 7.566   21.459  4.270   0.02 21.96 ?  389  GLU A HA   1  
ATOM   6065   H HB2  . GLU A 1 396 ? 9.365   20.628  5.627   0.02 22.01 ?  389  GLU A HB2  1  
ATOM   6066   H HB3  . GLU A 1 396 ? 9.769   19.755  4.359   0.02 21.51 ?  389  GLU A HB3  1  
ATOM   6067   H HG2  . GLU A 1 396 ? 10.986  21.515  3.902   0.02 21.42 ?  389  GLU A HG2  1  
ATOM   6068   H HG3  . GLU A 1 396 ? 9.627   22.014  3.243   0.02 21.61 ?  389  GLU A HG3  1  
ATOM   6069   N N    . THR A 1 397 ? 7.513   18.803  2.569   0.02 21.25 ?  390  THR A N    1  
ATOM   6070   C CA   . THR A 1 397 ? 7.308   18.314  1.207   0.02 20.91 ?  390  THR A CA   1  
ATOM   6071   C C    . THR A 1 397 ? 5.987   18.822  0.655   0.02 21.03 ?  390  THR A C    1  
ATOM   6072   O O    . THR A 1 397 ? 5.873   19.134  -0.541  0.02 20.79 ?  390  THR A O    1  
ATOM   6073   C CB   . THR A 1 397 ? 7.351   16.782  1.210   0.02 20.80 ?  390  THR A CB   1  
ATOM   6074   O OG1  . THR A 1 397 ? 8.563   16.353  1.830   0.02 20.71 ?  390  THR A OG1  1  
ATOM   6075   C CG2  . THR A 1 397 ? 7.233   16.173  -0.208  0.02 20.47 ?  390  THR A CG2  1  
ATOM   6076   H H    . THR A 1 397 ? 7.422   18.207  3.180   0.02 21.37 ?  390  THR A H    1  
ATOM   6077   H HA   . THR A 1 397 ? 8.018   18.650  0.640   0.02 20.69 ?  390  THR A HA   1  
ATOM   6078   H HB   . THR A 1 397 ? 6.599   16.458  1.731   0.02 21.04 ?  390  THR A HB   1  
ATOM   6079   H HG1  . THR A 1 397 ? 9.219   16.756  1.497   0.02 20.54 ?  390  THR A HG1  1  
ATOM   6080   H HG21 . THR A 1 397 ? 7.079   15.219  -0.142  0.02 20.46 ?  390  THR A HG21 1  
ATOM   6081   H HG22 . THR A 1 397 ? 6.490   16.574  -0.686  0.02 20.52 ?  390  THR A HG22 1  
ATOM   6082   H HG23 . THR A 1 397 ? 8.049   16.323  -0.707  0.02 20.22 ?  390  THR A HG23 1  
ATOM   6083   N N    . LEU A 1 398 ? 4.981   18.913  1.514   0.02 21.42 ?  391  LEU A N    1  
ATOM   6084   C CA   . LEU A 1 398 ? 3.690   19.433  1.093   0.02 21.59 ?  391  LEU A CA   1  
ATOM   6085   C C    . LEU A 1 398 ? 3.774   20.890  0.655   0.02 21.60 ?  391  LEU A C    1  
ATOM   6086   O O    . LEU A 1 398 ? 3.166   21.263  -0.346  0.02 21.52 ?  391  LEU A O    1  
ATOM   6087   C CB   . LEU A 1 398 ? 2.682   19.275  2.224   0.02 22.06 ?  391  LEU A CB   1  
ATOM   6088   C CG   . LEU A 1 398 ? 1.717   18.100  2.103   0.02 22.15 ?  391  LEU A CG   1  
ATOM   6089   C CD1  . LEU A 1 398 ? 0.652   18.287  3.169   0.02 22.66 ?  391  LEU A CD1  1  
ATOM   6090   C CD2  . LEU A 1 398 ? 1.093   17.952  0.709   0.02 21.95 ?  391  LEU A CD2  1  
ATOM   6091   H H    . LEU A 1 398 ? 5.017   18.670  2.336   0.02 21.60 ?  391  LEU A H    1  
ATOM   6092   H HA   . LEU A 1 398 ? 3.394   18.929  0.327   0.02 21.43 ?  391  LEU A HA   1  
ATOM   6093   H HB2  . LEU A 1 398 ? 3.167   19.173  3.055   0.02 22.17 ?  391  LEU A HB2  1  
ATOM   6094   H HB3  . LEU A 1 398 ? 2.147   20.084  2.263   0.02 22.24 ?  391  LEU A HB3  1  
ATOM   6095   H HG   . LEU A 1 398 ? 2.198   17.281  2.304   0.02 22.04 ?  391  LEU A HG   1  
ATOM   6096   H HD11 . LEU A 1 398 ? 0.288   19.182  3.096   0.02 22.79 ?  391  LEU A HD11 1  
ATOM   6097   H HD12 . LEU A 1 398 ? -0.048  17.630  3.035   0.02 22.76 ?  391  LEU A HD12 1  
ATOM   6098   H HD13 . LEU A 1 398 ? 1.064   18.167  4.039   0.02 22.79 ?  391  LEU A HD13 1  
ATOM   6099   H HD21 . LEU A 1 398 ? 0.760   18.814  0.414   0.02 22.00 ?  391  LEU A HD21 1  
ATOM   6100   H HD22 . LEU A 1 398 ? 1.764   17.630  0.096   0.02 21.64 ?  391  LEU A HD22 1  
ATOM   6101   H HD23 . LEU A 1 398 ? 0.364   17.315  0.758   0.02 22.10 ?  391  LEU A HD23 1  
ATOM   6102   N N    . GLU A 1 399 ? 4.487   21.741  1.403   0.02 21.71 ?  392  GLU A N    1  
ATOM   6103   C CA   . GLU A 1 399 ? 4.551   23.153  1.015   0.02 21.76 ?  392  GLU A CA   1  
ATOM   6104   C C    . GLU A 1 399 ? 5.261   23.314  -0.319  0.02 21.35 ?  392  GLU A C    1  
ATOM   6105   O O    . GLU A 1 399 ? 4.830   24.118  -1.144  0.02 21.34 ?  392  GLU A O    1  
ATOM   6106   C CB   . GLU A 1 399 ? 5.212   24.016  2.105   0.02 22.02 ?  392  GLU A CB   1  
ATOM   6107   C CG   . GLU A 1 399 ? 5.030   25.555  1.938   0.02 22.23 ?  392  GLU A CG   1  
ATOM   6108   C CD   . GLU A 1 399 ? 5.924   26.189  0.861   0.02 21.94 ?  392  GLU A CD   1  
ATOM   6109   O OE1  . GLU A 1 399 ? 5.714   27.389  0.565   0.02 22.13 ?  392  GLU A OE1  1  
ATOM   6110   O OE2  . GLU A 1 399 ? 6.794   25.514  0.242   0.02 21.54 -1 392  GLU A OE2  1  
ATOM   6111   H H    . GLU A 1 399 ? 4.910   21.525  2.116   0.02 21.79 ?  392  GLU A H    1  
ATOM   6112   H HA   . GLU A 1 399 ? 3.643   23.480  0.910   0.02 21.95 ?  392  GLU A HA   1  
ATOM   6113   H HB2  . GLU A 1 399 ? 4.804   23.743  2.955   0.02 22.26 ?  392  GLU A HB2  1  
ATOM   6114   H HB3  . GLU A 1 399 ? 6.165   23.838  2.158   0.02 21.83 ?  392  GLU A HB3  1  
ATOM   6115   H HG2  . GLU A 1 399 ? 4.106   25.729  1.698   0.02 22.32 ?  392  GLU A HG2  1  
ATOM   6116   H HG3  . GLU A 1 399 ? 5.236   25.997  2.779   0.02 22.49 ?  392  GLU A HG3  1  
ATOM   6117   N N    . MET A 1 400 ? 6.320   22.535  -0.571  0.02 21.03 ?  393  MET A N    1  
ATOM   6118   C CA   . MET A 1 400 ? 6.983   22.650  -1.861  0.02 20.65 ?  393  MET A CA   1  
ATOM   6119   C C    . MET A 1 400 ? 6.125   22.020  -2.948  0.02 20.51 ?  393  MET A C    1  
ATOM   6120   O O    . MET A 1 400 ? 6.060   22.541  -4.066  0.02 20.37 ?  393  MET A O    1  
ATOM   6121   C CB   . MET A 1 400 ? 8.382   22.036  -1.812  0.02 20.38 ?  393  MET A CB   1  
ATOM   6122   C CG   . MET A 1 400 ? 9.415   22.903  -1.070  0.02 20.51 ?  393  MET A CG   1  
ATOM   6123   S SD   . MET A 1 400 ? 10.931  22.089  -1.370  0.02 20.17 ?  393  MET A SD   1  
ATOM   6124   C CE   . MET A 1 400 ? 11.999  22.587  -0.029  0.02 20.44 ?  393  MET A CE   1  
ATOM   6125   H H    . MET A 1 400 ? 6.649   21.944  -0.043  0.02 21.03 ?  393  MET A H    1  
ATOM   6126   H HA   . MET A 1 400 ? 7.101   23.591  -2.069  0.02 20.69 ?  393  MET A HA   1  
ATOM   6127   H HB2  . MET A 1 400 ? 8.342   21.171  -1.376  0.02 20.38 ?  393  MET A HB2  1  
ATOM   6128   H HB3  . MET A 1 400 ? 8.707   21.919  -2.718  0.02 20.13 ?  393  MET A HB3  1  
ATOM   6129   H HG2  . MET A 1 400 ? 9.449   23.804  -1.424  0.02 20.55 ?  393  MET A HG2  1  
ATOM   6130   H HG3  . MET A 1 400 ? 9.236   22.896  -0.119  0.02 20.75 ?  393  MET A HG3  1  
ATOM   6131   H HE1  . MET A 1 400 ? 11.508  22.514  0.804   0.02 20.67 ?  393  MET A HE1  1  
ATOM   6132   H HE2  . MET A 1 400 ? 12.772  22.000  -0.009  0.02 20.30 ?  393  MET A HE2  1  
ATOM   6133   H HE3  . MET A 1 400 ? 12.284  23.502  -0.168  0.02 20.53 ?  393  MET A HE3  1  
ATOM   6134   N N    . GLY A 1 401 ? 5.393   20.956  -2.615  0.02 20.59 ?  394  GLY A N    1  
ATOM   6135   C CA   . GLY A 1 401 ? 4.478   20.381  -3.590  0.02 20.51 ?  394  GLY A CA   1  
ATOM   6136   C C    . GLY A 1 401 ? 3.414   21.375  -3.988  0.02 20.73 ?  394  GLY A C    1  
ATOM   6137   O O    . GLY A 1 401 ? 2.977   21.405  -5.139  0.02 20.62 ?  394  GLY A O    1  
ATOM   6138   H H    . GLY A 1 401 ? 5.400   20.564  -1.853  0.02 20.71 ?  394  GLY A H    1  
ATOM   6139   H HA2  . GLY A 1 401 ? 4.978   20.125  -4.377  0.02 20.25 ?  394  GLY A HA2  1  
ATOM   6140   H HA3  . GLY A 1 401 ? 4.041   19.592  -3.234  0.02 20.59 ?  394  GLY A HA3  1  
ATOM   6141   N N    . ALA A 1 402 ? 3.017   22.235  -3.046  0.02 21.08 ?  395  ALA A N    1  
ATOM   6142   C CA   . ALA A 1 402 ? 2.025   23.258  -3.340  0.02 21.34 ?  395  ALA A CA   1  
ATOM   6143   C C    . ALA A 1 402 ? 2.568   24.298  -4.317  0.02 21.18 ?  395  ALA A C    1  
ATOM   6144   O O    . ALA A 1 402 ? 1.808   24.866  -5.106  0.02 21.28 ?  395  ALA A O    1  
ATOM   6145   C CB   . ALA A 1 402 ? 1.549   23.932  -2.047  0.02 21.78 ?  395  ALA A CB   1  
ATOM   6146   H H    . ALA A 1 402 ? 3.297   22.231  -2.236  0.02 21.18 ?  395  ALA A H    1  
ATOM   6147   H HA   . ALA A 1 402 ? 1.257   22.834  -3.750  0.02 21.39 ?  395  ALA A HA   1  
ATOM   6148   H HB1  . ALA A 1 402 ? 0.820   24.531  -2.256  0.02 21.97 ?  395  ALA A HB1  1  
ATOM   6149   H HB2  . ALA A 1 402 ? 1.249   23.245  -1.433  0.02 21.88 ?  395  ALA A HB2  1  
ATOM   6150   H HB3  . ALA A 1 402 ? 2.282   24.426  -1.653  0.02 21.76 ?  395  ALA A HB3  1  
ATOM   6151   N N    . LYS A 1 403 ? 3.871   24.587  -4.276  0.02 20.98 ?  396  LYS A N    1  
ATOM   6152   C CA   . LYS A 1 403 ? 4.389   25.557  -5.234  0.02 20.83 ?  396  LYS A CA   1  
ATOM   6153   C C    . LYS A 1 403 ? 4.507   24.938  -6.617  0.02 20.49 ?  396  LYS A C    1  
ATOM   6154   O O    . LYS A 1 403 ? 4.325   25.627  -7.625  0.02 20.48 ?  396  LYS A O    1  
ATOM   6155   C CB   . LYS A 1 403 ? 5.728   26.143  -4.784  0.02 20.76 ?  396  LYS A CB   1  
ATOM   6156   C CG   . LYS A 1 403 ? 5.866   27.686  -5.104  0.02 21.03 ?  396  LYS A CG   1  
ATOM   6157   C CD   . LYS A 1 403 ? 4.584   28.340  -4.633  0.02 21.40 ?  396  LYS A CD   1  
ATOM   6158   C CE   . LYS A 1 403 ? 4.603   29.717  -3.968  0.02 21.78 ?  396  LYS A CE   1  
ATOM   6159   N NZ   . LYS A 1 403 ? 3.327   29.784  -3.147  0.02 22.20 ?  396  LYS A NZ   1  
ATOM   6160   H H    . LYS A 1 403 ? 4.443   24.250  -3.737  0.02 20.93 ?  396  LYS A H    1  
ATOM   6161   H HA   . LYS A 1 403 ? 3.726   26.242  -5.325  0.02 21.04 ?  396  LYS A HA   1  
ATOM   6162   H HB2  . LYS A 1 403 ? 5.771   26.038  -3.824  0.02 20.84 ?  396  LYS A HB2  1  
ATOM   6163   H HB3  . LYS A 1 403 ? 6.455   25.667  -5.208  0.02 20.50 ?  396  LYS A HB3  1  
ATOM   6164   H HG2  . LYS A 1 403 ? 6.620   28.078  -4.638  0.02 21.14 ?  396  LYS A HG2  1  
ATOM   6165   H HG3  . LYS A 1 403 ? 5.956   27.822  -6.036  0.02 20.89 ?  396  LYS A HG3  1  
ATOM   6166   H HD2  . LYS A 1 403 ? 3.962   28.367  -5.372  0.02 21.32 ?  396  LYS A HD2  1  
ATOM   6167   H HD3  . LYS A 1 403 ? 4.269   27.721  -3.986  0.02 21.51 ?  396  LYS A HD3  1  
ATOM   6168   H HE2  . LYS A 1 403 ? 5.372   29.823  -3.383  0.02 21.77 ?  396  LYS A HE2  1  
ATOM   6169   H HE3  . LYS A 1 403 ? 4.564   30.416  -4.637  0.02 21.78 ?  396  LYS A HE3  1  
ATOM   6170   H HZ1  . LYS A 1 403 ? 2.933   30.576  -3.249  0.02 22.42 ?  396  LYS A HZ1  1  
ATOM   6171   H HZ2  . LYS A 1 403 ? 2.765   29.157  -3.429  0.02 22.21 ?  396  LYS A HZ2  1  
ATOM   6172   H HZ3  . LYS A 1 403 ? 3.499   29.653  -2.284  0.02 22.26 ?  396  LYS A HZ3  1  
ATOM   6173   N N    . ILE A 1 404 ? 4.831   23.648  -6.698  0.02 20.25 ?  397  ILE A N    1  
ATOM   6174   C CA   . ILE A 1 404 ? 4.780   22.985  -7.998  0.02 19.98 ?  397  ILE A CA   1  
ATOM   6175   C C    . ILE A 1 404 ? 3.362   23.038  -8.547  0.02 20.18 ?  397  ILE A C    1  
ATOM   6176   O O    . ILE A 1 404 ? 3.144   23.350  -9.728  0.02 20.10 ?  397  ILE A O    1  
ATOM   6177   C CB   . ILE A 1 404 ? 5.280   21.532  -7.887  0.02 19.75 ?  397  ILE A CB   1  
ATOM   6178   C CG1  . ILE A 1 404 ? 6.774   21.494  -7.539  0.02 19.54 ?  397  ILE A CG1  1  
ATOM   6179   C CG2  . ILE A 1 404 ? 4.997   20.806  -9.180  0.02 19.55 ?  397  ILE A CG2  1  
ATOM   6180   C CD1  . ILE A 1 404 ? 7.319   20.112  -7.201  0.02 19.38 ?  397  ILE A CD1  1  
ATOM   6181   H H    . ILE A 1 404 ? 5.087   23.148  -6.049  0.02 20.25 ?  397  ILE A H    1  
ATOM   6182   H HA   . ILE A 1 404 ? 5.356   23.464  -8.609  0.02 19.84 ?  397  ILE A HA   1  
ATOM   6183   H HB   . ILE A 1 404 ? 4.792   21.095  -7.174  0.02 19.91 ?  397  ILE A HB   1  
ATOM   6184   H HG12 . ILE A 1 404 ? 7.277   21.825  -8.299  0.02 19.38 ?  397  ILE A HG12 1  
ATOM   6185   H HG13 . ILE A 1 404 ? 6.932   22.062  -6.769  0.02 19.70 ?  397  ILE A HG13 1  
ATOM   6186   H HG21 . ILE A 1 404 ? 5.446   19.948  -9.159  0.02 19.40 ?  397  ILE A HG21 1  
ATOM   6187   H HG22 . ILE A 1 404 ? 4.043   20.661  -9.276  0.02 19.71 ?  397  ILE A HG22 1  
ATOM   6188   H HG23 . ILE A 1 404 ? 5.331   21.339  -9.917  0.02 19.44 ?  397  ILE A HG23 1  
ATOM   6189   H HD11 . ILE A 1 404 ? 8.275   20.187  -7.058  0.02 19.27 ?  397  ILE A HD11 1  
ATOM   6190   H HD12 . ILE A 1 404 ? 6.889   19.785  -6.395  0.02 19.56 ?  397  ILE A HD12 1  
ATOM   6191   H HD13 . ILE A 1 404 ? 7.145   19.506  -7.937  0.02 19.24 ?  397  ILE A HD13 1  
ATOM   6192   N N    . LYS A 1 405 ? 2.378   22.748  -7.695  0.02 20.47 ?  398  LYS A N    1  
ATOM   6193   C CA   . LYS A 1 405 ? 0.982   22.711  -8.137  0.02 20.70 ?  398  LYS A CA   1  
ATOM   6194   C C    . LYS A 1 405 ? 0.546   24.066  -8.675  0.02 20.88 ?  398  LYS A C    1  
ATOM   6195   O O    . LYS A 1 405 ? -0.182  24.150  -9.677  0.02 20.92 ?  398  LYS A O    1  
ATOM   6196   C CB   . LYS A 1 405 ? 0.075   22.285  -6.975  0.02 21.03 ?  398  LYS A CB   1  
ATOM   6197   C CG   . LYS A 1 405 ? -1.382  22.061  -7.388  0.02 21.30 ?  398  LYS A CG   1  
ATOM   6198   C CD   . LYS A 1 405 ? -2.276  21.640  -6.195  0.02 21.67 ?  398  LYS A CD   1  
ATOM   6199   C CE   . LYS A 1 405 ? -3.700  21.334  -6.670  0.02 21.95 ?  398  LYS A CE   1  
ATOM   6200   N NZ   . LYS A 1 405 ? -4.598  20.927  -5.554  0.02 22.34 ?  398  LYS A NZ   1  
ATOM   6201   H H    . LYS A 1 405 ? 2.492   22.580  -6.861  0.02 20.56 ?  398  LYS A H    1  
ATOM   6202   H HA   . LYS A 1 405 ? 0.882   22.062  -8.845  0.02 20.55 ?  398  LYS A HA   1  
ATOM   6203   H HB2  . LYS A 1 405 ? 0.410   21.463  -6.590  0.02 20.93 ?  398  LYS A HB2  1  
ATOM   6204   H HB3  . LYS A 1 405 ? 0.086   22.988  -6.310  0.02 21.21 ?  398  LYS A HB3  1  
ATOM   6205   H HG2  . LYS A 1 405 ? -1.733  22.882  -7.760  0.02 21.42 ?  398  LYS A HG2  1  
ATOM   6206   H HG3  . LYS A 1 405 ? -1.423  21.353  -8.048  0.02 21.15 ?  398  LYS A HG3  1  
ATOM   6207   H HD2  . LYS A 1 405 ? -1.914  20.843  -5.782  0.02 21.56 ?  398  LYS A HD2  1  
ATOM   6208   H HD3  . LYS A 1 405 ? -2.315  22.366  -5.556  0.02 21.85 ?  398  LYS A HD3  1  
ATOM   6209   H HE2  . LYS A 1 405 ? -4.078  22.127  -7.080  0.02 22.06 ?  398  LYS A HE2  1  
ATOM   6210   H HE3  . LYS A 1 405 ? -3.680  20.607  -7.311  0.02 21.79 ?  398  LYS A HE3  1  
ATOM   6211   H HZ1  . LYS A 1 405 ? -4.409  21.406  -4.830  0.02 22.45 ?  398  LYS A HZ1  1  
ATOM   6212   H HZ2  . LYS A 1 405 ? -5.446  21.066  -5.780  0.02 22.56 ?  398  LYS A HZ2  1  
ATOM   6213   H HZ3  . LYS A 1 405 ? -4.481  20.065  -5.365  0.02 22.28 ?  398  LYS A HZ3  1  
ATOM   6214   N N    . LYS A 1 406 ? 0.964   25.139  -8.004  0.02 21.02 ?  399  LYS A N    1  
ATOM   6215   C CA   . LYS A 1 406 ? 0.676   26.483  -8.476  0.02 21.21 ?  399  LYS A CA   1  
ATOM   6216   C C    . LYS A 1 406 ? 1.227   26.712  -9.864  0.02 20.94 ?  399  LYS A C    1  
ATOM   6217   O O    . LYS A 1 406 ? 0.645   27.482  -10.632 0.02 21.09 ?  399  LYS A O    1  
ATOM   6218   C CB   . LYS A 1 406 ? 1.275   27.529  -7.537  0.02 21.40 ?  399  LYS A CB   1  
ATOM   6219   C CG   . LYS A 1 406 ? 0.415   27.888  -6.371  0.02 21.83 ?  399  LYS A CG   1  
ATOM   6220   C CD   . LYS A 1 406 ? 1.127   28.878  -5.465  0.02 22.02 ?  399  LYS A CD   1  
ATOM   6221   C CE   . LYS A 1 406 ? 0.361   29.119  -4.190  0.02 22.47 ?  399  LYS A CE   1  
ATOM   6222   N NZ   . LYS A 1 406 ? 0.249   27.860  -3.365  0.02 22.47 ?  399  LYS A NZ   1  
ATOM   6223   H H    . LYS A 1 406 ? 1.414   25.112  -7.274  0.02 21.03 ?  399  LYS A H    1  
ATOM   6224   H HA   . LYS A 1 406 ? -0.285  26.612  -8.502  0.02 21.43 ?  399  LYS A HA   1  
ATOM   6225   H HB2  . LYS A 1 406 ? 2.115   27.191  -7.190  0.02 21.23 ?  399  LYS A HB2  1  
ATOM   6226   H HB3  . LYS A 1 406 ? 1.428   28.342  -8.041  0.02 21.43 ?  399  LYS A HB3  1  
ATOM   6227   H HG2  . LYS A 1 406 ? -0.406  28.294  -6.693  0.02 22.02 ?  399  LYS A HG2  1  
ATOM   6228   H HG3  . LYS A 1 406 ? 0.219   27.088  -5.861  0.02 21.82 ?  399  LYS A HG3  1  
ATOM   6229   H HD2  . LYS A 1 406 ? 1.981   28.506  -5.221  0.02 21.84 ?  399  LYS A HD2  1  
ATOM   6230   H HD3  . LYS A 1 406 ? 1.239   29.725  -5.923  0.02 22.06 ?  399  LYS A HD3  1  
ATOM   6231   H HE2  . LYS A 1 406 ? 0.826   29.788  -3.663  0.02 22.60 ?  399  LYS A HE2  1  
ATOM   6232   H HE3  . LYS A 1 406 ? -0.534  29.424  -4.407  0.02 22.66 ?  399  LYS A HE3  1  
ATOM   6233   H HZ1  . LYS A 1 406 ? -0.602  27.614  -3.290  0.02 22.71 ?  399  LYS A HZ1  1  
ATOM   6234   H HZ2  . LYS A 1 406 ? 0.705   27.202  -3.751  0.02 22.23 ?  399  LYS A HZ2  1  
ATOM   6235   H HZ3  . LYS A 1 406 ? 0.581   28.001  -2.553  0.02 22.49 ?  399  LYS A HZ3  1  
ATOM   6236   N N    . ALA A 1 407 ? 2.364   26.077  -10.183 0.02 20.57 ?  400  ALA A N    1  
ATOM   6237   C CA   . ALA A 1 407 ? 3.052   26.349  -11.433 0.02 20.33 ?  400  ALA A CA   1  
ATOM   6238   C C    . ALA A 1 407 ? 2.369   25.666  -12.611 0.02 20.25 ?  400  ALA A C    1  
ATOM   6239   O O    . ALA A 1 407 ? 2.470   26.151  -13.742 0.02 20.20 ?  400  ALA A O    1  
ATOM   6240   C CB   . ALA A 1 407 ? 4.512   25.901  -11.345 0.02 19.99 ?  400  ALA A CB   1  
ATOM   6241   H H    . ALA A 1 407 ? 2.754   25.496  -9.688  0.02 20.47 ?  400  ALA A H    1  
ATOM   6242   H HA   . ALA A 1 407 ? 3.049   27.301  -11.595 0.02 20.46 ?  400  ALA A HA   1  
ATOM   6243   H HB1  . ALA A 1 407 ? 4.930   26.036  -12.209 0.02 19.85 ?  400  ALA A HB1  1  
ATOM   6244   H HB2  . ALA A 1 407 ? 4.971   26.422  -10.671 0.02 20.06 ?  400  ALA A HB2  1  
ATOM   6245   H HB3  . ALA A 1 407 ? 4.534   24.961  -11.112 0.02 19.88 ?  400  ALA A HB3  1  
ATOM   6246   N N    . HIS A 1 408 ? 1.634   24.585  -12.370 0.02 20.27 ?  401  HIS A N    1  
ATOM   6247   C CA   . HIS A 1 408 ? 1.132   23.776  -13.474 0.02 20.18 ?  401  HIS A CA   1  
ATOM   6248   C C    . HIS A 1 408 ? -0.369  23.530  -13.485 0.02 20.50 ?  401  HIS A C    1  
ATOM   6249   O O    . HIS A 1 408 ? -0.946  23.489  -14.574 0.02 20.55 ?  401  HIS A O    1  
ATOM   6250   C CB   . HIS A 1 408 ? 1.863   22.438  -13.511 0.02 19.86 ?  401  HIS A CB   1  
ATOM   6251   C CG   . HIS A 1 408 ? 3.336   22.593  -13.691 0.02 19.56 ?  401  HIS A CG   1  
ATOM   6252   N ND1  . HIS A 1 408 ? 3.899   23.025  -14.876 0.02 19.40 ?  401  HIS A ND1  1  
ATOM   6253   C CD2  . HIS A 1 408 ? 4.361   22.421  -12.827 0.02 19.42 ?  401  HIS A CD2  1  
ATOM   6254   C CE1  . HIS A 1 408 ? 5.209   23.097  -14.734 0.02 19.17 ?  401  HIS A CE1  1  
ATOM   6255   N NE2  . HIS A 1 408 ? 5.517   22.734  -13.502 0.02 19.18 ?  401  HIS A NE2  1  
ATOM   6256   H H    . HIS A 1 408 ? 1.414   24.301  -11.590 0.02 20.36 ?  401  HIS A H    1  
ATOM   6257   H HA   . HIS A 1 408 ? 1.347   24.233  -14.302 0.02 20.12 ?  401  HIS A HA   1  
ATOM   6258   H HB2  . HIS A 1 408 ? 1.714   21.970  -12.675 0.02 19.92 ?  401  HIS A HB2  1  
ATOM   6259   H HB3  . HIS A 1 408 ? 1.527   21.912  -14.251 0.02 19.82 ?  401  HIS A HB3  1  
ATOM   6260   H HD1  . HIS A 1 408 ? 3.466   23.219  -15.589 0.02 19.45 ?  401  HIS A HD1  1  
ATOM   6261   H HD2  . HIS A 1 408 ? 4.297   22.135  -11.948 0.02 19.49 ?  401  HIS A HD2  1  
ATOM   6262   H HE1  . HIS A 1 408 ? 5.815   23.354  -15.391 0.02 19.05 ?  401  HIS A HE1  1  
ATOM   6263   N N    . VAL A 1 409 ? -1.021  23.332  -12.347 0.02 20.73 ?  402  VAL A N    1  
ATOM   6264   C CA   . VAL A 1 409 ? -2.466  23.162  -12.345 0.02 21.08 ?  402  VAL A CA   1  
ATOM   6265   C C    . VAL A 1 409 ? -3.081  24.520  -12.646 0.02 21.37 ?  402  VAL A C    1  
ATOM   6266   O O    . VAL A 1 409 ? -2.682  25.532  -12.065 0.02 21.49 ?  402  VAL A O    1  
ATOM   6267   C CB   . VAL A 1 409 ? -2.954  22.586  -11.011 0.02 21.28 ?  402  VAL A CB   1  
ATOM   6268   C CG1  . VAL A 1 409 ? -4.476  22.508  -10.986 0.02 21.70 ?  402  VAL A CG1  1  
ATOM   6269   C CG2  . VAL A 1 409 ? -2.358  21.216  -10.820 0.02 21.02 ?  402  VAL A CG2  1  
ATOM   6270   H H    . VAL A 1 409 ? -0.653  23.287  -11.574 0.02 20.72 ?  402  VAL A H    1  
ATOM   6271   H HA   . VAL A 1 409 ? -2.723  22.545  -13.043 0.02 21.01 ?  402  VAL A HA   1  
ATOM   6272   H HB   . VAL A 1 409 ? -2.653  23.154  -10.286 0.02 21.34 ?  402  VAL A HB   1  
ATOM   6273   H HG11 . VAL A 1 409 ? -4.761  22.238  -10.099 0.02 21.83 ?  402  VAL A HG11 1  
ATOM   6274   H HG12 . VAL A 1 409 ? -4.846  23.376  -11.203 0.02 21.88 ?  402  VAL A HG12 1  
ATOM   6275   H HG13 . VAL A 1 409 ? -4.771  21.855  -11.639 0.02 21.66 ?  402  VAL A HG13 1  
ATOM   6276   H HG21 . VAL A 1 409 ? -2.653  20.855  -9.969  0.02 21.16 ?  402  VAL A HG21 1  
ATOM   6277   H HG22 . VAL A 1 409 ? -2.641  20.635  -11.543 0.02 20.97 ?  402  VAL A HG22 1  
ATOM   6278   H HG23 . VAL A 1 409 ? -1.392  21.300  -10.828 0.02 20.77 ?  402  VAL A HG23 1  
ATOM   6279   N N    . THR A 1 410 ? -4.022  24.550  -13.590 0.02 21.51 ?  403  THR A N    1  
ATOM   6280   C CA   . THR A 1 410 ? -4.512  25.804  -14.142 0.02 21.76 ?  403  THR A CA   1  
ATOM   6281   C C    . THR A 1 410 ? -5.987  26.036  -13.861 0.02 22.23 ?  403  THR A C    1  
ATOM   6282   O O    . THR A 1 410 ? -6.546  27.025  -14.351 0.02 22.50 ?  403  THR A O    1  
ATOM   6283   C CB   . THR A 1 410 ? -4.248  25.833  -15.651 0.02 21.60 ?  403  THR A CB   1  
ATOM   6284   O OG1  . THR A 1 410 ? -4.914  24.735  -16.294 0.02 21.59 ?  403  THR A OG1  1  
ATOM   6285   C CG2  . THR A 1 410 ? -2.767  25.695  -15.875 0.02 21.18 ?  403  THR A CG2  1  
ATOM   6286   H H    . THR A 1 410 ? -4.395  23.852  -13.926 0.02 21.48 ?  403  THR A H    1  
ATOM   6287   H HA   . THR A 1 410 ? -4.017  26.539  -13.748 0.02 21.74 ?  403  THR A HA   1  
ATOM   6288   H HB   . THR A 1 410 ? -4.553  26.674  -16.024 0.02 21.79 ?  403  THR A HB   1  
ATOM   6289   H HG1  . THR A 1 410 ? -4.666  24.003  -15.965 0.02 21.43 ?  403  THR A HG1  1  
ATOM   6290   H HG21 . THR A 1 410 ? -2.584  24.899  -16.398 0.02 21.00 ?  403  THR A HG21 1  
ATOM   6291   H HG22 . THR A 1 410 ? -2.430  26.469  -16.354 0.02 21.21 ?  403  THR A HG22 1  
ATOM   6292   H HG23 . THR A 1 410 ? -2.307  25.626  -15.025 0.02 21.08 ?  403  THR A HG23 1  
ATOM   6293   N N    . GLY A 1 411 ? -6.616  25.128  -13.114 0.02 22.37 ?  404  GLY A N    1  
ATOM   6294   C CA   . GLY A 1 411 ? -7.979  25.257  -12.633 0.02 22.85 ?  404  GLY A CA   1  
ATOM   6295   C C    . GLY A 1 411 ? -8.228  24.373  -11.422 0.02 22.96 ?  404  GLY A C    1  
ATOM   6296   O O    . GLY A 1 411 ? -7.289  23.956  -10.746 0.02 22.70 ?  404  GLY A O    1  
ATOM   6297   H H    . GLY A 1 411 ? -6.254  24.390  -12.869 0.02 22.20 ?  404  GLY A H    1  
ATOM   6298   H HA2  . GLY A 1 411 ? -8.153  26.179  -12.385 0.02 23.04 ?  404  GLY A HA2  1  
ATOM   6299   H HA3  . GLY A 1 411 ? -8.598  25.008  -13.336 0.02 22.95 ?  404  GLY A HA3  1  
ATOM   6300   N N    . GLU A 1 412 ? -9.497  24.074  -11.130 0.02 23.37 ?  405  GLU A N    1  
ATOM   6301   C CA   . GLU A 1 412 ? -9.843  23.418  -9.868  0.02 23.59 ?  405  GLU A CA   1  
ATOM   6302   C C    . GLU A 1 412 ? -9.521  21.924  -9.853  0.02 23.36 ?  405  GLU A C    1  
ATOM   6303   O O    . GLU A 1 412 ? -9.250  21.373  -8.782  0.02 23.41 ?  405  GLU A O    1  
ATOM   6304   C CB   . GLU A 1 412 ? -11.333 23.637  -9.555  0.02 24.16 ?  405  GLU A CB   1  
ATOM   6305   C CG   . GLU A 1 412 ? -11.615 24.741  -8.523  0.02 24.51 ?  405  GLU A CG   1  
ATOM   6306   C CD   . GLU A 1 412 ? -12.842 24.462  -7.678  0.02 25.02 ?  405  GLU A CD   1  
ATOM   6307   O OE1  . GLU A 1 412 ? -12.957 23.357  -7.123  0.02 25.00 ?  405  GLU A OE1  1  
ATOM   6308   O OE2  . GLU A 1 412 ? -13.704 25.354  -7.580  0.02 25.47 -1 405  GLU A OE2  1  
ATOM   6309   H H    . GLU A 1 412 ? -10.166 24.245  -11.642 0.02 23.56 ?  405  GLU A H    1  
ATOM   6310   H HA   . GLU A 1 412 ? -9.324  23.825  -9.158  0.02 23.55 ?  405  GLU A HA   1  
ATOM   6311   H HB2  . GLU A 1 412 ? -11.786 23.889  -10.375 0.02 24.25 ?  405  GLU A HB2  1  
ATOM   6312   H HB3  . GLU A 1 412 ? -11.706 22.809  -9.216  0.02 24.24 ?  405  GLU A HB3  1  
ATOM   6313   H HG2  . GLU A 1 412 ? -10.861 24.818  -7.920  0.02 24.32 ?  405  GLU A HG2  1  
ATOM   6314   H HG3  . GLU A 1 412 ? -11.750 25.581  -8.987  0.02 24.62 ?  405  GLU A HG3  1  
ATOM   6315   N N    . THR A 1 413 ? -9.535  21.247  -11.002 0.02 23.13 ?  406  THR A N    1  
ATOM   6316   C CA   . THR A 1 413 ? -9.241  19.818  -11.050 0.02 22.94 ?  406  THR A CA   1  
ATOM   6317   C C    . THR A 1 413 ? -7.980  19.601  -11.881 0.02 22.42 ?  406  THR A C    1  
ATOM   6318   O O    . THR A 1 413 ? -7.885  20.149  -12.989 0.02 22.31 ?  406  THR A O    1  
ATOM   6319   C CB   . THR A 1 413 ? -10.422 19.032  -11.645 0.02 23.24 ?  406  THR A CB   1  
ATOM   6320   O OG1  . THR A 1 413 ? -11.593 19.243  -10.846 0.02 23.76 ?  406  THR A OG1  1  
ATOM   6321   C CG2  . THR A 1 413 ? -10.135 17.548  -11.666 0.02 23.09 ?  406  THR A CG2  1  
ATOM   6322   H H    . THR A 1 413 ? -9.712  21.595  -11.766 0.02 23.10 ?  406  THR A H    1  
ATOM   6323   H HA   . THR A 1 413 ? -9.092  19.489  -10.153 0.02 22.98 ?  406  THR A HA   1  
ATOM   6324   H HB   . THR A 1 413 ? -10.583 19.329  -12.553 0.02 23.21 ?  406  THR A HB   1  
ATOM   6325   H HG1  . THR A 1 413 ? -11.443 19.007  -10.055 0.02 23.80 ?  406  THR A HG1  1  
ATOM   6326   H HG21 . THR A 1 413 ? -10.912 17.060  -11.355 0.02 23.39 ?  406  THR A HG21 1  
ATOM   6327   H HG22 . THR A 1 413 ? -9.922  17.262  -12.566 0.02 22.93 ?  406  THR A HG22 1  
ATOM   6328   H HG23 . THR A 1 413 ? -9.390  17.346  -11.080 0.02 22.89 ?  406  THR A HG23 1  
ATOM   6329   N N    . PRO A 1 414 ? -6.986  18.843  -11.408 0.02 22.11 ?  407  PRO A N    1  
ATOM   6330   C CA   . PRO A 1 414 ? -5.817  18.571  -12.250 0.02 21.65 ?  407  PRO A CA   1  
ATOM   6331   C C    . PRO A 1 414 ? -6.182  17.785  -13.497 0.02 21.61 ?  407  PRO A C    1  
ATOM   6332   O O    . PRO A 1 414 ? -7.076  16.936  -13.480 0.02 21.86 ?  407  PRO A O    1  
ATOM   6333   C CB   . PRO A 1 414 ? -4.904  17.747  -11.342 0.02 21.44 ?  407  PRO A CB   1  
ATOM   6334   C CG   . PRO A 1 414 ? -5.348  18.048  -9.961  0.02 21.74 ?  407  PRO A CG   1  
ATOM   6335   C CD   . PRO A 1 414 ? -6.811  18.317  -10.045 0.02 22.19 ?  407  PRO A CD   1  
ATOM   6336   H HA   . PRO A 1 414 ? -5.383  19.401  -12.499 0.02 21.54 ?  407  PRO A HA   1  
ATOM   6337   H HB2  . PRO A 1 414 ? -5.013  16.805  -11.539 0.02 21.42 ?  407  PRO A HB2  1  
ATOM   6338   H HB3  . PRO A 1 414 ? -3.988  18.028  -11.482 0.02 21.17 ?  407  PRO A HB3  1  
ATOM   6339   H HG2  . PRO A 1 414 ? -5.173  17.285  -9.388  0.02 21.73 ?  407  PRO A HG2  1  
ATOM   6340   H HG3  . PRO A 1 414 ? -4.883  18.835  -9.639  0.02 21.68 ?  407  PRO A HG3  1  
ATOM   6341   H HD2  . PRO A 1 414 ? -7.309  17.496  -9.929  0.02 22.33 ?  407  PRO A HD2  1  
ATOM   6342   H HD3  . PRO A 1 414 ? -7.067  18.991  -9.398  0.02 22.39 ?  407  PRO A HD3  1  
ATOM   6343   N N    . THR A 1 415 ? -5.467  18.066  -14.580 0.02 21.33 ?  408  THR A N    1  
ATOM   6344   C CA   . THR A 1 415 ? -5.742  17.440  -15.861 0.02 21.30 ?  408  THR A CA   1  
ATOM   6345   C C    . THR A 1 415 ? -4.512  16.706  -16.371 0.02 20.87 ?  408  THR A C    1  
ATOM   6346   O O    . THR A 1 415 ? -3.381  16.956  -15.946 0.02 20.58 ?  408  THR A O    1  
ATOM   6347   C CB   . THR A 1 415 ? -6.171  18.468  -16.914 0.02 21.42 ?  408  THR A CB   1  
ATOM   6348   O OG1  . THR A 1 415 ? -5.075  19.331  -17.217 0.02 21.12 ?  408  THR A OG1  1  
ATOM   6349   C CG2  . THR A 1 415 ? -7.354  19.303  -16.410 0.02 21.86 ?  408  THR A CG2  1  
ATOM   6350   H H    . THR A 1 415 ? -4.821  18.630  -14.600 0.02 21.16 ?  408  THR A H    1  
ATOM   6351   H HA   . THR A 1 415 ? -6.459  16.796  -15.757 0.02 21.51 ?  408  THR A HA   1  
ATOM   6352   H HB   . THR A 1 415 ? -6.443  18.005  -17.722 0.02 21.45 ?  408  THR A HB   1  
ATOM   6353   H HG1  . THR A 1 415 ? -5.279  19.852  -17.842 0.02 21.19 ?  408  THR A HG1  1  
ATOM   6354   H HG21 . THR A 1 415 ? -7.186  19.633  -15.515 0.02 21.87 ?  408  THR A HG21 1  
ATOM   6355   H HG22 . THR A 1 415 ? -7.501  20.059  -16.998 0.02 21.93 ?  408  THR A HG22 1  
ATOM   6356   H HG23 . THR A 1 415 ? -8.153  18.757  -16.393 0.02 22.10 ?  408  THR A HG23 1  
ATOM   6357   N N    . ALA A 1 416 ? -4.746  15.839  -17.350 0.02 20.86 ?  409  ALA A N    1  
ATOM   6358   C CA   . ALA A 1 416 ? -3.630  15.191  -18.029 0.02 20.49 ?  409  ALA A CA   1  
ATOM   6359   C C    . ALA A 1 416 ? -2.726  16.224  -18.686 0.02 20.24 ?  409  ALA A C    1  
ATOM   6360   O O    . ALA A 1 416 ? -1.501  16.096  -18.660 0.02 19.90 ?  409  ALA A O    1  
ATOM   6361   C CB   . ALA A 1 416 ? -4.153  14.192  -19.065 0.02 20.60 ?  409  ALA A CB   1  
ATOM   6362   H H    . ALA A 1 416 ? -5.521  15.616  -17.638 0.02 21.08 ?  409  ALA A H    1  
ATOM   6363   H HA   . ALA A 1 416 ? -3.105  14.702  -17.380 0.02 20.36 ?  409  ALA A HA   1  
ATOM   6364   H HB1  . ALA A 1 416 ? -3.404  13.868  -19.587 0.02 20.36 ?  409  ALA A HB1  1  
ATOM   6365   H HB2  . ALA A 1 416 ? -4.580  13.450  -18.608 0.02 20.73 ?  409  ALA A HB2  1  
ATOM   6366   H HB3  . ALA A 1 416 ? -4.786  14.642  -19.646 0.02 20.78 ?  409  ALA A HB3  1  
ATOM   6367   N N    . ASP A 1 417 ? -3.304  17.239  -19.317 0.02 20.42 ?  410  ASP A N    1  
ATOM   6368   C CA   . ASP A 1 417 ? -2.466  18.278  -19.900 0.02 20.22 ?  410  ASP A CA   1  
ATOM   6369   C C    . ASP A 1 417 ? -1.541  18.881  -18.855 0.02 20.04 ?  410  ASP A C    1  
ATOM   6370   O O    . ASP A 1 417 ? -0.354  19.107  -19.113 0.02 19.75 ?  410  ASP A O    1  
ATOM   6371   C CB   . ASP A 1 417 ? -3.324  19.377  -20.512 0.02 20.52 ?  410  ASP A CB   1  
ATOM   6372   C CG   . ASP A 1 417 ? -3.448  19.248  -22.004 0.02 20.54 ?  410  ASP A CG   1  
ATOM   6373   O OD1  . ASP A 1 417 ? -2.409  18.992  -22.655 0.02 20.24 ?  410  ASP A OD1  1  
ATOM   6374   O OD2  . ASP A 1 417 ? -4.592  19.408  -22.498 0.02 20.89 -1 410  ASP A OD2  1  
ATOM   6375   H H    . ASP A 1 417 ? -4.150  17.350  -19.417 0.02 20.67 ?  410  ASP A H    1  
ATOM   6376   H HA   . ASP A 1 417 ? -1.925  17.892  -20.604 0.02 20.04 ?  410  ASP A HA   1  
ATOM   6377   H HB2  . ASP A 1 417 ? -4.216  19.329  -20.139 0.02 20.78 ?  410  ASP A HB2  1  
ATOM   6378   H HB3  . ASP A 1 417 ? -2.928  20.239  -20.314 0.02 20.47 ?  410  ASP A HB3  1  
ATOM   6379   N N    . ASN A 1 418 ? -2.087  19.178  -17.678 0.02 20.25 ?  411  ASN A N    1  
ATOM   6380   C CA   . ASN A 1 418 ? -1.274  19.753  -16.614 0.02 20.13 ?  411  ASN A CA   1  
ATOM   6381   C C    . ASN A 1 418 ? -0.167  18.801  -16.214 0.02 19.81 ?  411  ASN A C    1  
ATOM   6382   O O    . ASN A 1 418 ? 0.941   19.231  -15.902 0.02 19.59 ?  411  ASN A O    1  
ATOM   6383   C CB   . ASN A 1 418 ? -2.117  20.046  -15.369 0.02 20.45 ?  411  ASN A CB   1  
ATOM   6384   C CG   . ASN A 1 418 ? -3.173  21.119  -15.572 0.02 20.80 ?  411  ASN A CG   1  
ATOM   6385   O OD1  . ASN A 1 418 ? -3.192  21.864  -16.552 0.02 20.82 ?  411  ASN A OD1  1  
ATOM   6386   N ND2  . ASN A 1 418 ? -4.061  21.202  -14.607 0.02 21.13 ?  411  ASN A ND2  1  
ATOM   6387   H H    . ASN A 1 418 ? -2.912  19.052  -17.477 0.02 20.47 ?  411  ASN A H    1  
ATOM   6388   H HA   . ASN A 1 418 ? -0.878  20.581  -16.923 0.02 20.08 ?  411  ASN A HA   1  
ATOM   6389   H HB2  . ASN A 1 418 ? -2.567  19.231  -15.110 0.02 20.53 ?  411  ASN A HB2  1  
ATOM   6390   H HB3  . ASN A 1 418 ? -1.532  20.339  -14.658 0.02 20.37 ?  411  ASN A HB3  1  
ATOM   6391   H HD21 . ASN A 1 418 ? -4.434  21.955  -14.430 0.02 21.31 ?  411  ASN A HD21 1  
ATOM   6392   H HD22 . ASN A 1 418 ? -4.265  20.500  -14.159 0.02 21.16 ?  411  ASN A HD22 1  
ATOM   6393   N N    . PHE A 1 419 ? -0.479  17.510  -16.154 0.02 19.81 ?  412  PHE A N    1  
ATOM   6394   C CA   . PHE A 1 419 ? 0.517   16.515  -15.783 0.02 19.54 ?  412  PHE A CA   1  
ATOM   6395   C C    . PHE A 1 419 ? 1.667   16.534  -16.778 0.02 19.21 ?  412  PHE A C    1  
ATOM   6396   O O    . PHE A 1 419 ? 2.845   16.467  -16.405 0.02 18.96 ?  412  PHE A O    1  
ATOM   6397   C CB   . PHE A 1 419 ? -0.135  15.128  -15.737 0.02 19.66 ?  412  PHE A CB   1  
ATOM   6398   C CG   . PHE A 1 419 ? 0.755   14.055  -15.238 0.02 19.45 ?  412  PHE A CG   1  
ATOM   6399   C CD1  . PHE A 1 419 ? 1.729   13.506  -16.053 0.02 19.15 ?  412  PHE A CD1  1  
ATOM   6400   C CD2  . PHE A 1 419 ? 0.637   13.595  -13.941 0.02 19.57 ?  412  PHE A CD2  1  
ATOM   6401   C CE1  . PHE A 1 419 ? 2.554   12.515  -15.591 0.02 18.98 ?  412  PHE A CE1  1  
ATOM   6402   C CE2  . PHE A 1 419 ? 1.455   12.597  -13.491 0.02 19.40 ?  412  PHE A CE2  1  
ATOM   6403   C CZ   . PHE A 1 419 ? 2.440   12.082  -14.321 0.02 19.10 ?  412  PHE A CZ   1  
ATOM   6404   H H    . PHE A 1 419 ? -1.253  17.187  -16.333 0.02 19.98 ?  412  PHE A H    1  
ATOM   6405   H HA   . PHE A 1 419 ? 0.868   16.723  -14.906 0.02 19.53 ?  412  PHE A HA   1  
ATOM   6406   H HB2  . PHE A 1 419 ? -0.908  15.164  -15.152 0.02 19.90 ?  412  PHE A HB2  1  
ATOM   6407   H HB3  . PHE A 1 419 ? -0.413  14.884  -16.632 0.02 19.68 ?  412  PHE A HB3  1  
ATOM   6408   H HD1  . PHE A 1 419 ? 1.823   13.811  -16.926 0.02 19.08 ?  412  PHE A HD1  1  
ATOM   6409   H HD2  . PHE A 1 419 ? -0.012  13.951  -13.381 0.02 19.78 ?  412  PHE A HD2  1  
ATOM   6410   H HE1  . PHE A 1 419 ? 3.209   12.157  -16.147 0.02 18.79 ?  412  PHE A HE1  1  
ATOM   6411   H HE2  . PHE A 1 419 ? 1.379   12.295  -12.616 0.02 19.50 ?  412  PHE A HE2  1  
ATOM   6412   H HZ   . PHE A 1 419 ? 2.997   11.402  -14.015 0.02 19.00 ?  412  PHE A HZ   1  
ATOM   6413   N N    . MET A 1 420 ? 1.346   16.621  -18.057 0.02 19.23 ?  413  MET A N    1  
ATOM   6414   C CA   . MET A 1 420 ? 2.407   16.563  -19.056 0.02 18.94 ?  413  MET A CA   1  
ATOM   6415   C C    . MET A 1 420 ? 3.251   17.829  -19.045 0.02 18.82 ?  413  MET A C    1  
ATOM   6416   O O    . MET A 1 420 ? 4.468   17.773  -19.256 0.02 18.56 ?  413  MET A O    1  
ATOM   6417   C CB   . MET A 1 420 ? 1.808   16.290  -20.437 0.02 19.03 ?  413  MET A CB   1  
ATOM   6418   C CG   . MET A 1 420 ? 1.204   14.918  -20.531 0.02 19.12 ?  413  MET A CG   1  
ATOM   6419   S SD   . MET A 1 420 ? 0.556   14.462  -22.167 0.02 19.25 ?  413  MET A SD   1  
ATOM   6420   C CE   . MET A 1 420 ? -0.795  15.592  -22.288 0.02 19.63 ?  413  MET A CE   1  
ATOM   6421   H H    . MET A 1 420 ? 0.547   16.707  -18.363 0.02 19.41 ?  413  MET A H    1  
ATOM   6422   H HA   . MET A 1 420 ? 2.986   15.815  -18.843 0.02 18.79 ?  413  MET A HA   1  
ATOM   6423   H HB2  . MET A 1 420 ? 1.120   16.946  -20.626 0.02 19.21 ?  413  MET A HB2  1  
ATOM   6424   H HB3  . MET A 1 420 ? 2.508   16.350  -21.105 0.02 18.86 ?  413  MET A HB3  1  
ATOM   6425   H HG2  . MET A 1 420 ? 1.883   14.271  -20.293 0.02 18.95 ?  413  MET A HG2  1  
ATOM   6426   H HG3  . MET A 1 420 ? 0.468   14.865  -19.905 0.02 19.32 ?  413  MET A HG3  1  
ATOM   6427   H HE1  . MET A 1 420 ? -1.535  15.159  -22.741 0.02 19.82 ?  413  MET A HE1  1  
ATOM   6428   H HE2  . MET A 1 420 ? -1.058  15.850  -21.388 0.02 19.71 ?  413  MET A HE2  1  
ATOM   6429   H HE3  . MET A 1 420 ? -0.512  16.376  -22.784 0.02 19.59 ?  413  MET A HE3  1  
ATOM   6430   N N    . ASP A 1 421 ? 2.622   18.982  -18.848 0.02 19.05 ?  414  ASP A N    1  
ATOM   6431   C CA   . ASP A 1 421 ? 3.365   20.219  -18.684 0.02 18.99 ?  414  ASP A CA   1  
ATOM   6432   C C    . ASP A 1 421 ? 4.350   20.098  -17.527 0.02 18.83 ?  414  ASP A C    1  
ATOM   6433   O O    . ASP A 1 421 ? 5.525   20.450  -17.649 0.02 18.64 ?  414  ASP A O    1  
ATOM   6434   C CB   . ASP A 1 421 ? 2.366   21.369  -18.472 0.02 19.32 ?  414  ASP A CB   1  
ATOM   6435   C CG   . ASP A 1 421 ? 3.019   22.756  -18.448 0.02 19.32 ?  414  ASP A CG   1  
ATOM   6436   O OD1  . ASP A 1 421 ? 3.711   23.147  -19.413 0.02 19.17 ?  414  ASP A OD1  1  
ATOM   6437   O OD2  . ASP A 1 421 ? 2.777   23.500  -17.476 0.02 19.52 -1 414  ASP A OD2  1  
ATOM   6438   H H    . ASP A 1 421 ? 1.771   19.074  -18.825 0.02 19.24 ?  414  ASP A H    1  
ATOM   6439   H HA   . ASP A 1 421 ? 3.870   20.404  -19.490 0.02 18.88 ?  414  ASP A HA   1  
ATOM   6440   H HB2  . ASP A 1 421 ? 1.718   21.356  -19.193 0.02 19.43 ?  414  ASP A HB2  1  
ATOM   6441   H HB3  . ASP A 1 421 ? 1.911   21.231  -17.628 0.02 19.44 ?  414  ASP A HB3  1  
ATOM   6442   N N    . LEU A 1 422 ? 3.882   19.570  -16.400 0.02 18.94 ?  415  LEU A N    1  
ATOM   6443   C CA   . LEU A 1 422 ? 4.757   19.403  -15.246 0.02 18.83 ?  415  LEU A CA   1  
ATOM   6444   C C    . LEU A 1 422 ? 5.938   18.505  -15.593 0.02 18.52 ?  415  LEU A C    1  
ATOM   6445   O O    . LEU A 1 422 ? 7.083   18.814  -15.259 0.02 18.37 ?  415  LEU A O    1  
ATOM   6446   C CB   . LEU A 1 422 ? 3.948   18.833  -14.076 0.02 19.04 ?  415  LEU A CB   1  
ATOM   6447   C CG   . LEU A 1 422 ? 4.567   18.819  -12.669 0.02 19.06 ?  415  LEU A CG   1  
ATOM   6448   C CD1  . LEU A 1 422 ? 3.451   18.704  -11.664 0.02 19.38 ?  415  LEU A CD1  1  
ATOM   6449   C CD2  . LEU A 1 422 ? 5.550   17.664  -12.487 0.02 18.81 ?  415  LEU A CD2  1  
ATOM   6450   H H    . LEU A 1 422 ? 3.078   19.302  -16.283 0.02 19.10 ?  415  LEU A H    1  
ATOM   6451   H HA   . LEU A 1 422 ? 5.099   20.268  -14.986 0.02 18.86 ?  415  LEU A HA   1  
ATOM   6452   H HB2  . LEU A 1 422 ? 3.125   19.337  -14.012 0.02 19.25 ?  415  LEU A HB2  1  
ATOM   6453   H HB3  . LEU A 1 422 ? 3.730   17.916  -14.290 0.02 19.00 ?  415  LEU A HB3  1  
ATOM   6454   H HG   . LEU A 1 422 ? 5.035   19.653  -12.521 0.02 19.05 ?  415  LEU A HG   1  
ATOM   6455   H HD11 . LEU A 1 422 ? 3.818   18.389  -10.822 0.02 19.38 ?  415  LEU A HD11 1  
ATOM   6456   H HD12 . LEU A 1 422 ? 3.049   19.578  -11.549 0.02 19.54 ?  415  LEU A HD12 1  
ATOM   6457   H HD13 . LEU A 1 422 ? 2.794   18.070  -11.989 0.02 19.44 ?  415  LEU A HD13 1  
ATOM   6458   H HD21 . LEU A 1 422 ? 5.853   17.656  -11.566 0.02 18.85 ?  415  LEU A HD21 1  
ATOM   6459   H HD22 . LEU A 1 422 ? 5.101   16.830  -12.692 0.02 18.83 ?  415  LEU A HD22 1  
ATOM   6460   H HD23 . LEU A 1 422 ? 6.308   17.790  -13.077 0.02 18.62 ?  415  LEU A HD23 1  
ATOM   6461   N N    . CYS A 1 423 ? 5.670   17.373  -16.251 0.02 18.45 ?  416  CYS A N    1  
ATOM   6462   C CA   . CYS A 1 423 ? 6.750   16.488  -16.669 0.02 18.17 ?  416  CYS A CA   1  
ATOM   6463   C C    . CYS A 1 423 ? 7.790   17.225  -17.511 0.02 17.99 ?  416  CYS A C    1  
ATOM   6464   O O    . CYS A 1 423 ? 8.985   16.953  -17.389 0.02 17.79 ?  416  CYS A O    1  
ATOM   6465   C CB   . CYS A 1 423 ? 6.200   15.282  -17.434 0.02 18.17 ?  416  CYS A CB   1  
ATOM   6466   S SG   . CYS A 1 423 ? 5.301   14.128  -16.393 0.02 18.36 ?  416  CYS A SG   1  
ATOM   6467   H H    . CYS A 1 423 ? 4.884   17.099  -16.456 0.02 18.57 ?  416  CYS A H    1  
ATOM   6468   H HA   . CYS A 1 423 ? 7.194   16.146  -15.877 0.02 18.13 ?  416  CYS A HA   1  
ATOM   6469   H HB2  . CYS A 1 423 ? 5.599   15.590  -18.129 0.02 18.27 ?  416  CYS A HB2  1  
ATOM   6470   H HB3  . CYS A 1 423 ? 6.943   14.804  -17.829 0.02 18.00 ?  416  CYS A HB3  1  
ATOM   6471   H HG   . CYS A 1 423 ? 4.398   14.729  -15.886 0.02 18.59 ?  416  CYS A HG   1  
ATOM   6472   N N    . SER A 1 424 ? 7.357   18.107  -18.421 0.02 18.08 ?  417  SER A N    1  
ATOM   6473   C CA   . SER A 1 424 ? 8.335   18.847  -19.220 0.02 17.95 ?  417  SER A CA   1  
ATOM   6474   C C    . SER A 1 424 ? 9.340   19.544  -18.317 0.02 17.90 ?  417  SER A C    1  
ATOM   6475   O O    . SER A 1 424 ? 10.525  19.660  -18.645 0.02 17.73 ?  417  SER A O    1  
ATOM   6476   C CB   . SER A 1 424 ? 7.651   19.893  -20.101 0.02 18.13 ?  417  SER A CB   1  
ATOM   6477   O OG   . SER A 1 424 ? 6.673   19.308  -20.950 0.02 18.23 ?  417  SER A OG   1  
ATOM   6478   H H    . SER A 1 424 ? 6.538   18.287  -18.591 0.02 18.23 ?  417  SER A H    1  
ATOM   6479   H HA   . SER A 1 424 ? 8.810   18.232  -19.793 0.02 17.81 ?  417  SER A HA   1  
ATOM   6480   H HB2  . SER A 1 424 ? 7.225   20.551  -19.531 0.02 18.28 ?  417  SER A HB2  1  
ATOM   6481   H HB3  . SER A 1 424 ? 8.320   20.331  -20.649 0.02 18.05 ?  417  SER A HB3  1  
ATOM   6482   H HG   . SER A 1 424 ? 6.329   18.640  -20.578 0.02 18.23 ?  417  SER A HG   1  
ATOM   6483   N N    . HIS A 1 425 ? 8.870   20.057  -17.192 0.02 18.07 ?  418  HIS A N    1  
ATOM   6484   C CA   . HIS A 1 425 ? 9.749   20.825  -16.319 0.02 18.08 ?  418  HIS A CA   1  
ATOM   6485   C C    . HIS A 1 425 ? 10.524  19.913  -15.383 0.02 17.94 ?  418  HIS A C    1  
ATOM   6486   O O    . HIS A 1 425 ? 11.744  20.043  -15.236 0.02 17.82 ?  418  HIS A O    1  
ATOM   6487   C CB   . HIS A 1 425 ? 8.919   21.861  -15.547 0.02 18.36 ?  418  HIS A CB   1  
ATOM   6488   C CG   . HIS A 1 425 ? 8.492   22.998  -16.409 0.02 18.50 ?  418  HIS A CG   1  
ATOM   6489   N ND1  . HIS A 1 425 ? 9.167   24.200  -16.449 0.02 18.57 ?  418  HIS A ND1  1  
ATOM   6490   C CD2  . HIS A 1 425 ? 7.534   23.070  -17.365 0.02 18.60 ?  418  HIS A CD2  1  
ATOM   6491   C CE1  . HIS A 1 425 ? 8.612   24.974  -17.366 0.02 18.70 ?  418  HIS A CE1  1  
ATOM   6492   N NE2  . HIS A 1 425 ? 7.609   24.318  -17.919 0.02 18.73 ?  418  HIS A NE2  1  
ATOM   6493   H H    . HIS A 1 425 ? 8.062   19.974  -16.918 0.02 18.20 ?  418  HIS A H    1  
ATOM   6494   H HA   . HIS A 1 425 ? 10.387  21.300  -16.869 0.02 18.01 ?  418  HIS A HA   1  
ATOM   6495   H HB2  . HIS A 1 425 ? 8.124   21.424  -15.210 0.02 18.45 ?  418  HIS A HB2  1  
ATOM   6496   H HB3  . HIS A 1 425 ? 9.441   22.219  -14.816 0.02 18.38 ?  418  HIS A HB3  1  
ATOM   6497   H HD2  . HIS A 1 425 ? 6.919   22.410  -17.581 0.02 18.61 ?  418  HIS A HD2  1  
ATOM   6498   H HE1  . HIS A 1 425 ? 8.865   25.846  -17.564 0.02 18.79 ?  418  HIS A HE1  1  
ATOM   6499   H HE2  . HIS A 1 425 ? 7.093   24.618  -18.534 0.02 18.83 ?  418  HIS A HE2  1  
ATOM   6500   N N    . PHE A 1 426 ? 9.832   18.945  -14.797 0.02 17.99 ?  419  PHE A N    1  
ATOM   6501   C CA   . PHE A 1 426 ? 10.467  18.015  -13.870 0.02 17.91 ?  419  PHE A CA   1  
ATOM   6502   C C    . PHE A 1 426 ? 11.631  17.296  -14.535 0.02 17.65 ?  419  PHE A C    1  
ATOM   6503   O O    . PHE A 1 426 ? 12.718  17.166  -13.968 0.02 17.56 ?  419  PHE A O    1  
ATOM   6504   C CB   . PHE A 1 426 ? 9.422   17.012  -13.382 0.02 18.03 ?  419  PHE A CB   1  
ATOM   6505   C CG   . PHE A 1 426 ? 9.936   16.027  -12.380 0.02 18.00 ?  419  PHE A CG   1  
ATOM   6506   C CD1  . PHE A 1 426 ? 10.464  16.454  -11.180 0.02 18.11 ?  419  PHE A CD1  1  
ATOM   6507   C CD2  . PHE A 1 426 ? 9.846   14.681  -12.623 0.02 17.89 ?  419  PHE A CD2  1  
ATOM   6508   C CE1  . PHE A 1 426 ? 10.924  15.533  -10.256 0.02 18.10 ?  419  PHE A CE1  1  
ATOM   6509   C CE2  . PHE A 1 426 ? 10.290  13.755  -11.688 0.02 17.89 ?  419  PHE A CE2  1  
ATOM   6510   C CZ   . PHE A 1 426 ? 10.828  14.188  -10.514 0.02 18.00 ?  419  PHE A CZ   1  
ATOM   6511   H H    . PHE A 1 426 ? 8.998   18.803  -14.925 0.02 18.08 ?  419  PHE A H    1  
ATOM   6512   H HA   . PHE A 1 426 ? 10.805  18.504  -13.106 0.02 17.98 ?  419  PHE A HA   1  
ATOM   6513   H HB2  . PHE A 1 426 ? 8.696   17.500  -12.967 0.02 18.21 ?  419  PHE A HB2  1  
ATOM   6514   H HB3  . PHE A 1 426 ? 9.085   16.511  -14.136 0.02 17.99 ?  419  PHE A HB3  1  
ATOM   6515   H HD1  . PHE A 1 426 ? 10.528  17.362  -11.002 0.02 18.20 ?  419  PHE A HD1  1  
ATOM   6516   H HD2  . PHE A 1 426 ? 9.476   14.380  -13.420 0.02 17.84 ?  419  PHE A HD2  1  
ATOM   6517   H HE1  . PHE A 1 426 ? 11.285  15.823  -9.451  0.02 18.20 ?  419  PHE A HE1  1  
ATOM   6518   H HE2  . PHE A 1 426 ? 10.233  12.844  -11.868 0.02 17.83 ?  419  PHE A HE2  1  
ATOM   6519   H HZ   . PHE A 1 426 ? 11.135  13.571  -9.893  0.02 18.01 ?  419  PHE A HZ   1  
ATOM   6520   N N    . TYR A 1 427 ? 11.438  16.866  -15.767 0.02 17.55 ?  420  TYR A N    1  
ATOM   6521   C CA   . TYR A 1 427 ? 12.425  15.999  -16.386 0.02 17.33 ?  420  TYR A CA   1  
ATOM   6522   C C    . TYR A 1 427 ? 13.403  16.718  -17.301 0.02 17.21 ?  420  TYR A C    1  
ATOM   6523   O O    . TYR A 1 427 ? 14.449  16.137  -17.605 0.02 17.05 ?  420  TYR A O    1  
ATOM   6524   C CB   . TYR A 1 427 ? 11.718  14.899  -17.177 0.02 17.31 ?  420  TYR A CB   1  
ATOM   6525   C CG   . TYR A 1 427 ? 11.040  13.869  -16.296 0.02 17.42 ?  420  TYR A CG   1  
ATOM   6526   C CD1  . TYR A 1 427 ? 11.770  13.133  -15.378 0.02 17.36 ?  420  TYR A CD1  1  
ATOM   6527   C CD2  . TYR A 1 427 ? 9.677   13.634  -16.381 0.02 17.62 ?  420  TYR A CD2  1  
ATOM   6528   C CE1  . TYR A 1 427 ? 11.170  12.193  -14.574 0.02 17.49 ?  420  TYR A CE1  1  
ATOM   6529   C CE2  . TYR A 1 427 ? 9.057   12.692  -15.554 0.02 17.75 ?  420  TYR A CE2  1  
ATOM   6530   C CZ   . TYR A 1 427 ? 9.831   11.961  -14.671 0.02 17.69 ?  420  TYR A CZ   1  
ATOM   6531   O OH   . TYR A 1 427 ? 9.307   10.998  -13.835 0.02 17.84 ?  420  TYR A OH   1  
ATOM   6532   H H    . TYR A 1 427 ? 10.766  17.061  -16.258 0.02 17.61 ?  420  TYR A H    1  
ATOM   6533   H HA   . TYR A 1 427 ? 12.946  15.571  -15.692 0.02 17.29 ?  420  TYR A HA   1  
ATOM   6534   H HB2  . TYR A 1 427 ? 11.039  15.313  -17.732 0.02 17.38 ?  420  TYR A HB2  1  
ATOM   6535   H HB3  . TYR A 1 427 ? 12.363  14.436  -17.733 0.02 17.17 ?  420  TYR A HB3  1  
ATOM   6536   H HD1  . TYR A 1 427 ? 12.684  13.271  -15.305 0.02 17.24 ?  420  TYR A HD1  1  
ATOM   6537   H HD2  . TYR A 1 427 ? 9.171   14.122  -16.987 0.02 17.68 ?  420  TYR A HD2  1  
ATOM   6538   H HE1  . TYR A 1 427 ? 11.681  11.705  -13.970 0.02 17.46 ?  420  TYR A HE1  1  
ATOM   6539   H HE2  . TYR A 1 427 ? 8.145   12.528  -15.624 0.02 17.91 ?  420  TYR A HE2  1  
ATOM   6540   H HH   . TYR A 1 427 ? 8.643   10.631  -14.198 0.02 17.93 ?  420  TYR A HH   1  
ATOM   6541   N N    . PHE A 1 428 ? 13.133  17.963  -17.700 0.02 17.31 ?  421  PHE A N    1  
ATOM   6542   C CA   . PHE A 1 428 ? 13.944  18.615  -18.730 0.02 17.24 ?  421  PHE A CA   1  
ATOM   6543   C C    . PHE A 1 428 ? 14.240  20.085  -18.419 0.02 17.37 ?  421  PHE A C    1  
ATOM   6544   O O    . PHE A 1 428 ? 15.403  20.442  -18.260 0.02 17.31 ?  421  PHE A O    1  
ATOM   6545   C CB   . PHE A 1 428 ? 13.281  18.454  -20.119 0.02 17.24 ?  421  PHE A CB   1  
ATOM   6546   C CG   . PHE A 1 428 ? 13.086  17.009  -20.521 0.02 17.13 ?  421  PHE A CG   1  
ATOM   6547   C CD1  . PHE A 1 428 ? 14.155  16.196  -20.863 0.02 16.96 ?  421  PHE A CD1  1  
ATOM   6548   C CD2  . PHE A 1 428 ? 11.822  16.446  -20.529 0.02 17.24 ?  421  PHE A CD2  1  
ATOM   6549   C CE1  . PHE A 1 428 ? 13.944  14.856  -21.190 0.02 16.89 ?  421  PHE A CE1  1  
ATOM   6550   C CE2  . PHE A 1 428 ? 11.624  15.136  -20.864 0.02 17.19 ?  421  PHE A CE2  1  
ATOM   6551   C CZ   . PHE A 1 428 ? 12.672  14.330  -21.197 0.02 17.01 ?  421  PHE A CZ   1  
ATOM   6552   H H    . PHE A 1 428 ? 12.504  18.451  -17.386 0.02 17.44 ?  421  PHE A H    1  
ATOM   6553   H HA   . PHE A 1 428 ? 14.798  18.160  -18.782 0.02 17.11 ?  421  PHE A HA   1  
ATOM   6554   H HB2  . PHE A 1 428 ? 12.413  18.880  -20.116 0.02 17.37 ?  421  PHE A HB2  1  
ATOM   6555   H HB3  . PHE A 1 428 ? 13.846  18.882  -20.779 0.02 17.21 ?  421  PHE A HB3  1  
ATOM   6556   H HD1  . PHE A 1 428 ? 15.021  16.536  -20.852 0.02 16.90 ?  421  PHE A HD1  1  
ATOM   6557   H HD2  . PHE A 1 428 ? 11.091  16.974  -20.301 0.02 17.38 ?  421  PHE A HD2  1  
ATOM   6558   H HE1  . PHE A 1 428 ? 14.663  14.318  -21.423 0.02 16.79 ?  421  PHE A HE1  1  
ATOM   6559   H HE2  . PHE A 1 428 ? 10.763  14.789  -20.867 0.02 17.29 ?  421  PHE A HE2  1  
ATOM   6560   H HZ   . PHE A 1 428 ? 12.523  13.444  -21.426 0.02 16.99 ?  421  PHE A HZ   1  
ATOM   6561   N N    . TRP A 1 429 ? 13.234  20.958  -18.322 0.02 17.57 ?  422  TRP A N    1  
ATOM   6562   C CA   . TRP A 1 429 ? 13.542  22.385  -18.255 0.02 17.71 ?  422  TRP A CA   1  
ATOM   6563   C C    . TRP A 1 429 ? 14.185  22.774  -16.927 0.02 17.78 ?  422  TRP A C    1  
ATOM   6564   O O    . TRP A 1 429 ? 15.106  23.589  -16.895 0.02 17.82 ?  422  TRP A O    1  
ATOM   6565   C CB   . TRP A 1 429 ? 12.284  23.214  -18.481 0.02 17.94 ?  422  TRP A CB   1  
ATOM   6566   C CG   . TRP A 1 429 ? 11.829  23.213  -19.890 0.02 17.94 ?  422  TRP A CG   1  
ATOM   6567   C CD1  . TRP A 1 429 ? 10.809  22.486  -20.395 0.02 17.95 ?  422  TRP A CD1  1  
ATOM   6568   C CD2  . TRP A 1 429 ? 12.355  23.997  -20.983 0.02 17.97 ?  422  TRP A CD2  1  
ATOM   6569   N NE1  . TRP A 1 429 ? 10.661  22.747  -21.749 0.02 17.98 ?  422  TRP A NE1  1  
ATOM   6570   C CE2  . TRP A 1 429 ? 11.602  23.669  -22.124 0.02 17.99 ?  422  TRP A CE2  1  
ATOM   6571   C CE3  . TRP A 1 429 ? 13.384  24.927  -21.102 0.02 18.00 ?  422  TRP A CE3  1  
ATOM   6572   C CZ2  . TRP A 1 429 ? 11.840  24.259  -23.361 0.02 18.05 ?  422  TRP A CZ2  1  
ATOM   6573   C CZ3  . TRP A 1 429 ? 13.633  25.493  -22.338 0.02 18.06 ?  422  TRP A CZ3  1  
ATOM   6574   C CH2  . TRP A 1 429 ? 12.861  25.160  -23.443 0.02 18.08 ?  422  TRP A CH2  1  
ATOM   6575   H H    . TRP A 1 429 ? 12.402  20.762  -18.316 0.02 17.63 ?  422  TRP A H    1  
ATOM   6576   H HA   . TRP A 1 429 ? 14.169  22.605  -18.959 0.02 17.65 ?  422  TRP A HA   1  
ATOM   6577   H HB2  . TRP A 1 429 ? 11.571  22.865  -17.928 0.02 18.00 ?  422  TRP A HB2  1  
ATOM   6578   H HB3  . TRP A 1 429 ? 12.471  24.133  -18.236 0.02 18.06 ?  422  TRP A HB3  1  
ATOM   6579   H HD1  . TRP A 1 429 ? 10.286  21.893  -19.910 0.02 17.96 ?  422  TRP A HD1  1  
ATOM   6580   H HE1  . TRP A 1 429 ? 10.071  22.390  -22.257 0.02 18.01 ?  422  TRP A HE1  1  
ATOM   6581   H HE3  . TRP A 1 429 ? 13.901  25.156  -20.366 0.02 18.01 ?  422  TRP A HE3  1  
ATOM   6582   H HZ2  . TRP A 1 429 ? 11.338  24.033  -24.106 0.02 18.08 ?  422  TRP A HZ2  1  
ATOM   6583   H HZ3  . TRP A 1 429 ? 14.314  26.117  -22.431 0.02 18.10 ?  422  TRP A HZ3  1  
ATOM   6584   H HH2  . TRP A 1 429 ? 13.048  25.558  -24.263 0.02 18.14 ?  422  TRP A HH2  1  
ATOM   6585   N N    . PHE A 1 430 ? 13.709  22.228  -15.826 0.02 17.82 ?  423  PHE A N    1  
ATOM   6586   C CA   . PHE A 1 430 ? 14.293  22.646  -14.554 0.02 17.92 ?  423  PHE A CA   1  
ATOM   6587   C C    . PHE A 1 430 ? 15.716  22.133  -14.443 0.02 17.76 ?  423  PHE A C    1  
ATOM   6588   O O    . PHE A 1 430 ? 16.604  22.932  -14.109 0.02 17.84 ?  423  PHE A O    1  
ATOM   6589   C CB   . PHE A 1 430 ? 13.416  22.210  -13.371 0.02 18.05 ?  423  PHE A CB   1  
ATOM   6590   C CG   . PHE A 1 430 ? 13.898  22.756  -12.044 0.02 18.22 ?  423  PHE A CG   1  
ATOM   6591   C CD1  . PHE A 1 430 ? 14.144  24.110  -11.905 0.02 18.41 ?  423  PHE A CD1  1  
ATOM   6592   C CD2  . PHE A 1 430 ? 14.138  21.914  -10.981 0.02 18.21 ?  423  PHE A CD2  1  
ATOM   6593   C CE1  . PHE A 1 430 ? 14.606  24.645  -10.716 0.02 18.59 ?  423  PHE A CE1  1  
ATOM   6594   C CE2  . PHE A 1 430 ? 14.599  22.445  -9.756  0.02 18.40 ?  423  PHE A CE2  1  
ATOM   6595   C CZ   . PHE A 1 430 ? 14.843  23.805  -9.645  0.02 18.59 ?  423  PHE A CZ   1  
ATOM   6596   H H    . PHE A 1 430 ? 13.081  21.646  -15.784 0.02 17.81 ?  423  PHE A H    1  
ATOM   6597   H HA   . PHE A 1 430 ? 14.334  23.613  -14.549 0.02 18.06 ?  423  PHE A HA   1  
ATOM   6598   H HB2  . PHE A 1 430 ? 12.522  22.545  -13.515 0.02 18.17 ?  423  PHE A HB2  1  
ATOM   6599   H HB3  . PHE A 1 430 ? 13.393  21.245  -13.312 0.02 17.95 ?  423  PHE A HB3  1  
ATOM   6600   H HD1  . PHE A 1 430 ? 13.993  24.672  -12.629 0.02 18.43 ?  423  PHE A HD1  1  
ATOM   6601   H HD2  . PHE A 1 430 ? 13.980  21.005  -11.063 0.02 18.11 ?  423  PHE A HD2  1  
ATOM   6602   H HE1  . PHE A 1 430 ? 14.764  25.556  -10.637 0.02 18.74 ?  423  PHE A HE1  1  
ATOM   6603   H HE2  . PHE A 1 430 ? 14.758  21.883  -9.035  0.02 18.42 ?  423  PHE A HE2  1  
ATOM   6604   H HZ   . PHE A 1 430 ? 15.146  24.156  -8.838  0.02 18.73 ?  423  PHE A HZ   1  
ATOM   6605   N N    . PRO A 1 431 ? 16.008  20.849  -14.705 0.02 17.55 ?  424  PRO A N    1  
ATOM   6606   C CA   . PRO A 1 431 ? 17.415  20.409  -14.760 0.02 17.41 ?  424  PRO A CA   1  
ATOM   6607   C C    . PRO A 1 431 ? 18.292  21.275  -15.633 0.02 17.40 ?  424  PRO A C    1  
ATOM   6608   O O    . PRO A 1 431 ? 19.453  21.497  -15.292 0.02 17.41 ?  424  PRO A O    1  
ATOM   6609   C CB   . PRO A 1 431 ? 17.340  18.993  -15.330 0.02 17.22 ?  424  PRO A CB   1  
ATOM   6610   C CG   . PRO A 1 431 ? 15.949  18.525  -15.123 0.02 17.28 ?  424  PRO A CG   1  
ATOM   6611   C CD   . PRO A 1 431 ? 15.067  19.729  -14.857 0.02 17.49 ?  424  PRO A CD   1  
ATOM   6612   H HA   . PRO A 1 431 ? 17.786  20.378  -13.866 0.02 17.48 ?  424  PRO A HA   1  
ATOM   6613   H HB2  . PRO A 1 431 ? 17.535  19.030  -16.282 0.02 17.13 ?  424  PRO A HB2  1  
ATOM   6614   H HB3  . PRO A 1 431 ? 17.979  18.423  -14.874 0.02 17.17 ?  424  PRO A HB3  1  
ATOM   6615   H HG2  . PRO A 1 431 ? 15.655  18.063  -15.921 0.02 17.19 ?  424  PRO A HG2  1  
ATOM   6616   H HG3  . PRO A 1 431 ? 15.925  17.917  -14.368 0.02 17.29 ?  424  PRO A HG3  1  
ATOM   6617   H HD2  . PRO A 1 431 ? 14.479  19.882  -15.612 0.02 17.49 ?  424  PRO A HD2  1  
ATOM   6618   H HD3  . PRO A 1 431 ? 14.562  19.596  -14.044 0.02 17.59 ?  424  PRO A HD3  1  
ATOM   6619   N N    . MET A 1 432 ? 17.791  21.742  -16.769 0.02 17.41 ?  425  MET A N    1  
ATOM   6620   C CA   . MET A 1 432 ? 18.613  22.584  -17.629 0.02 17.43 ?  425  MET A CA   1  
ATOM   6621   C C    . MET A 1 432 ? 18.918  23.927  -16.961 0.02 17.66 ?  425  MET A C    1  
ATOM   6622   O O    . MET A 1 432 ? 20.043  24.415  -17.034 0.02 17.70 ?  425  MET A O    1  
ATOM   6623   C CB   . MET A 1 432 ? 17.917  22.782  -18.987 0.02 17.40 ?  425  MET A CB   1  
ATOM   6624   C CG   . MET A 1 432 ? 18.790  23.436  -20.039 0.02 17.43 ?  425  MET A CG   1  
ATOM   6625   S SD   . MET A 1 432 ? 17.888  24.147  -21.428 0.02 17.48 ?  425  MET A SD   1  
ATOM   6626   C CE   . MET A 1 432 ? 16.850  25.321  -20.636 0.02 17.74 ?  425  MET A CE   1  
ATOM   6627   H H    . MET A 1 432 ? 16.998  21.591  -17.058 0.02 17.42 ?  425  MET A H    1  
ATOM   6628   H HA   . MET A 1 432 ? 19.448  22.125  -17.790 0.02 17.33 ?  425  MET A HA   1  
ATOM   6629   H HB2  . MET A 1 432 ? 17.664  21.914  -19.330 0.02 17.27 ?  425  MET A HB2  1  
ATOM   6630   H HB3  . MET A 1 432 ? 17.128  23.325  -18.855 0.02 17.52 ?  425  MET A HB3  1  
ATOM   6631   H HG2  . MET A 1 432 ? 19.308  24.140  -19.626 0.02 17.56 ?  425  MET A HG2  1  
ATOM   6632   H HG3  . MET A 1 432 ? 19.386  22.757  -20.396 0.02 17.31 ?  425  MET A HG3  1  
ATOM   6633   H HE1  . MET A 1 432 ? 15.941  25.151  -20.912 0.02 17.74 ?  425  MET A HE1  1  
ATOM   6634   H HE2  . MET A 1 432 ? 16.932  25.231  -19.674 0.02 17.78 ?  425  MET A HE2  1  
ATOM   6635   H HE3  . MET A 1 432 ? 17.119  26.212  -20.905 0.02 17.86 ?  425  MET A HE3  1  
ATOM   6636   N N    . HIS A 1 433 ? 17.928  24.527  -16.295 0.02 17.83 ?  426  HIS A N    1  
ATOM   6637   C CA   . HIS A 1 433 ? 18.152  25.791  -15.604 0.02 18.09 ?  426  HIS A CA   1  
ATOM   6638   C C    . HIS A 1 433 ? 19.197  25.642  -14.501 0.02 18.12 ?  426  HIS A C    1  
ATOM   6639   O O    . HIS A 1 433 ? 20.113  26.464  -14.368 0.02 18.26 ?  426  HIS A O    1  
ATOM   6640   C CB   . HIS A 1 433 ? 16.821  26.285  -15.044 0.02 18.28 ?  426  HIS A CB   1  
ATOM   6641   C CG   . HIS A 1 433 ? 16.916  27.517  -14.202 0.02 18.57 ?  426  HIS A CG   1  
ATOM   6642   N ND1  . HIS A 1 433 ? 17.508  28.683  -14.626 0.02 18.74 ?  426  HIS A ND1  1  
ATOM   6643   C CD2  . HIS A 1 433 ? 16.425  27.774  -12.964 0.02 18.76 ?  426  HIS A CD2  1  
ATOM   6644   C CE1  . HIS A 1 433 ? 17.393  29.600  -13.682 0.02 19.02 ?  426  HIS A CE1  1  
ATOM   6645   N NE2  . HIS A 1 433 ? 16.737  29.071  -12.665 0.02 19.04 ?  426  HIS A NE2  1  
ATOM   6646   H H    . HIS A 1 433 ? 17.129  24.222  -16.235 0.02 17.83 ?  426  HIS A H    1  
ATOM   6647   H HA   . HIS A 1 433 ? 18.479  26.453  -16.231 0.02 18.15 ?  426  HIS A HA   1  
ATOM   6648   H HB2  . HIS A 1 433 ? 16.246  26.487  -15.796 0.02 18.28 ?  426  HIS A HB2  1  
ATOM   6649   H HB3  . HIS A 1 433 ? 16.422  25.588  -14.503 0.02 18.22 ?  426  HIS A HB3  1  
ATOM   6650   H HD2  . HIS A 1 433 ? 15.958  27.181  -12.424 0.02 18.74 ?  426  HIS A HD2  1  
ATOM   6651   H HE1  . HIS A 1 433 ? 17.722  30.467  -13.721 0.02 19.20 ?  426  HIS A HE1  1  
ATOM   6652   H HE2  . HIS A 1 433 ? 16.545  29.472  -11.932 0.02 19.21 ?  426  HIS A HE2  1  
ATOM   6653   N N    . ARG A 1 434 ? 19.068  24.594  -13.698 0.02 18.02 ?  427  ARG A N    1  
ATOM   6654   C CA   . ARG A 1 434 ? 20.048  24.347  -12.649 0.02 18.06 ?  427  ARG A CA   1  
ATOM   6655   C C    . ARG A 1 434 ? 21.443  24.212  -13.230 0.02 17.96 ?  427  ARG A C    1  
ATOM   6656   O O    . ARG A 1 434 ? 22.418  24.764  -12.696 0.02 18.11 ?  427  ARG A O    1  
ATOM   6657   C CB   . ARG A 1 434 ? 19.685  23.082  -11.882 0.02 17.96 ?  427  ARG A CB   1  
ATOM   6658   C CG   . ARG A 1 434 ? 18.406  23.149  -11.119 0.02 18.10 ?  427  ARG A CG   1  
ATOM   6659   C CD   . ARG A 1 434 ? 18.073  21.814  -10.538 0.02 18.00 ?  427  ARG A CD   1  
ATOM   6660   N NE   . ARG A 1 434 ? 18.811  21.575  -9.307  0.02 18.09 ?  427  ARG A NE   1  
ATOM   6661   C CZ   . ARG A 1 434 ? 18.493  20.633  -8.434  0.02 18.12 ?  427  ARG A CZ   1  
ATOM   6662   N NH1  . ARG A 1 434 ? 17.461  19.853  -8.643  0.02 18.06 ?  427  ARG A NH1  1  
ATOM   6663   N NH2  . ARG A 1 434 ? 19.209  20.477  -7.321  0.02 18.24 ?  427  ARG A NH2  1  
ATOM   6664   H H    . ARG A 1 434 ? 18.427  24.025  -13.736 0.02 17.95 ?  427  ARG A H    1  
ATOM   6665   H HA   . ARG A 1 434 ? 20.046  25.098  -12.035 0.02 18.26 ?  427  ARG A HA   1  
ATOM   6666   H HB2  . ARG A 1 434 ? 19.613  22.344  -12.506 0.02 17.78 ?  427  ARG A HB2  1  
ATOM   6667   H HB3  . ARG A 1 434 ? 20.395  22.900  -11.246 0.02 18.00 ?  427  ARG A HB3  1  
ATOM   6668   H HG2  . ARG A 1 434 ? 18.497  23.782  -10.392 0.02 18.28 ?  427  ARG A HG2  1  
ATOM   6669   H HG3  . ARG A 1 434 ? 17.687  23.412  -11.716 0.02 18.09 ?  427  ARG A HG3  1  
ATOM   6670   H HD2  . ARG A 1 434 ? 17.127  21.783  -10.334 0.02 18.07 ?  427  ARG A HD2  1  
ATOM   6671   H HD3  . ARG A 1 434 ? 18.306  21.119  -11.171 0.02 17.82 ?  427  ARG A HD3  1  
ATOM   6672   H HE   . ARG A 1 434 ? 19.269  22.234  -9.007  0.02 18.20 ?  427  ARG A HE   1  
ATOM   6673   H HH11 . ARG A 1 434 ? 16.985  19.945  -9.353  0.02 18.00 ?  427  ARG A HH11 1  
ATOM   6674   H HH12 . ARG A 1 434 ? 17.257  19.247  -8.068  0.02 18.10 ?  427  ARG A HH12 1  
ATOM   6675   H HH21 . ARG A 1 434 ? 19.888  20.982  -7.176  0.02 18.30 ?  427  ARG A HH21 1  
ATOM   6676   H HH22 . ARG A 1 434 ? 18.999  19.865  -6.758  0.02 18.28 ?  427  ARG A HH22 1  
ATOM   6677   N N    . LEU A 1 435 ? 21.563  23.461  -14.317 0.02 17.74 ?  428  LEU A N    1  
ATOM   6678   C CA   . LEU A 1 435 ? 22.864  23.284  -14.954 0.02 17.65 ?  428  LEU A CA   1  
ATOM   6679   C C    . LEU A 1 435 ? 23.408  24.617  -15.452 0.02 17.84 ?  428  LEU A C    1  
ATOM   6680   O O    . LEU A 1 435 ? 24.578  24.948  -15.225 0.02 17.94 ?  428  LEU A O    1  
ATOM   6681   C CB   . LEU A 1 435 ? 22.758  22.291  -16.120 0.02 17.41 ?  428  LEU A CB   1  
ATOM   6682   C CG   . LEU A 1 435 ? 24.019  22.237  -16.968 0.02 17.35 ?  428  LEU A CG   1  
ATOM   6683   C CD1  . LEU A 1 435 ? 25.211  21.784  -16.111 0.02 17.38 ?  428  LEU A CD1  1  
ATOM   6684   C CD2  . LEU A 1 435 ? 23.852  21.338  -18.173 0.02 17.14 ?  428  LEU A CD2  1  
ATOM   6685   H H    . LEU A 1 435 ? 20.916  23.053  -14.701 0.02 17.65 ?  428  LEU A H    1  
ATOM   6686   H HA   . LEU A 1 435 ? 23.487  22.922  -14.310 0.02 17.66 ?  428  LEU A HA   1  
ATOM   6687   H HB2  . LEU A 1 435 ? 22.597  21.398  -15.780 0.02 17.31 ?  428  LEU A HB2  1  
ATOM   6688   H HB3  . LEU A 1 435 ? 22.024  22.561  -16.689 0.02 17.41 ?  428  LEU A HB3  1  
ATOM   6689   H HG   . LEU A 1 435 ? 24.222  23.118  -17.309 0.02 17.47 ?  428  LEU A HG   1  
ATOM   6690   H HD11 . LEU A 1 435 ? 24.877  21.443  -15.268 0.02 17.40 ?  428  LEU A HD11 1  
ATOM   6691   H HD12 . LEU A 1 435 ? 25.690  21.090  -16.582 0.02 17.26 ?  428  LEU A HD12 1  
ATOM   6692   H HD13 . LEU A 1 435 ? 25.798  22.541  -15.956 0.02 17.53 ?  428  LEU A HD13 1  
ATOM   6693   H HD21 . LEU A 1 435 ? 24.712  21.229  -18.611 0.02 17.11 ?  428  LEU A HD21 1  
ATOM   6694   H HD22 . LEU A 1 435 ? 23.517  20.474  -17.880 0.02 17.05 ?  428  LEU A HD22 1  
ATOM   6695   H HD23 . LEU A 1 435 ? 23.217  21.747  -18.783 0.02 17.16 ?  428  LEU A HD23 1  
ATOM   6696   N N    . LEU A 1 436 ? 22.579  25.376  -16.178 0.02 17.91 ?  429  LEU A N    1  
ATOM   6697   C CA   . LEU A 1 436 ? 23.018  26.676  -16.685 0.02 18.11 ?  429  LEU A CA   1  
ATOM   6698   C C    . LEU A 1 436 ? 23.603  27.526  -15.566 0.02 18.38 ?  429  LEU A C    1  
ATOM   6699   O O    . LEU A 1 436 ? 24.710  28.046  -15.686 0.02 18.52 ?  429  LEU A O    1  
ATOM   6700   C CB   . LEU A 1 436 ? 21.863  27.404  -17.376 0.02 18.19 ?  429  LEU A CB   1  
ATOM   6701   C CG   . LEU A 1 436 ? 21.400  26.859  -18.729 0.02 18.00 ?  429  LEU A CG   1  
ATOM   6702   C CD1  . LEU A 1 436 ? 20.205  27.703  -19.265 0.02 18.10 ?  429  LEU A CD1  1  
ATOM   6703   C CD2  . LEU A 1 436 ? 22.531  26.784  -19.757 0.02 17.98 ?  429  LEU A CD2  1  
ATOM   6704   H H    . LEU A 1 436 ? 21.772  25.169  -16.375 0.02 17.86 ?  429  LEU A H    1  
ATOM   6705   H HA   . LEU A 1 436 ? 23.725  26.533  -17.324 0.02 18.05 ?  429  LEU A HA   1  
ATOM   6706   H HB2  . LEU A 1 436 ? 21.094  27.384  -16.787 0.02 18.23 ?  429  LEU A HB2  1  
ATOM   6707   H HB3  . LEU A 1 436 ? 22.129  28.324  -17.514 0.02 18.37 ?  429  LEU A HB3  1  
ATOM   6708   H HG   . LEU A 1 436 ? 21.081  25.953  -18.601 0.02 17.83 ?  429  LEU A HG   1  
ATOM   6709   H HD11 . LEU A 1 436 ? 19.812  27.260  -20.033 0.02 17.99 ?  429  LEU A HD11 1  
ATOM   6710   H HD12 . LEU A 1 436 ? 19.545  27.774  -18.561 0.02 18.12 ?  429  LEU A HD12 1  
ATOM   6711   H HD13 . LEU A 1 436 ? 20.525  28.584  -19.514 0.02 18.28 ?  429  LEU A HD13 1  
ATOM   6712   H HD21 . LEU A 1 436 ? 22.372  26.016  -20.326 0.02 17.83 ?  429  LEU A HD21 1  
ATOM   6713   H HD22 . LEU A 1 436 ? 22.523  27.595  -20.288 0.02 18.14 ?  429  LEU A HD22 1  
ATOM   6714   H HD23 . LEU A 1 436 ? 23.386  26.686  -19.319 0.02 17.99 ?  429  LEU A HD23 1  
ATOM   6715   N N    . GLN A 1 437 ? 22.898  27.632  -14.444 0.02 18.48 ?  430  GLN A N    1  
ATOM   6716   C CA   . GLN A 1 437 ? 23.323  28.569  -13.412 0.02 18.78 ?  430  GLN A CA   1  
ATOM   6717   C C    . GLN A 1 437 ? 24.574  28.076  -12.689 0.02 18.79 ?  430  GLN A C    1  
ATOM   6718   O O    . GLN A 1 437 ? 25.485  28.859  -12.403 0.02 19.03 ?  430  GLN A O    1  
ATOM   6719   C CB   . GLN A 1 437 ? 22.156  28.797  -12.459 0.02 18.91 ?  430  GLN A CB   1  
ATOM   6720   C CG   . GLN A 1 437 ? 20.999  29.577  -13.111 0.02 19.01 ?  430  GLN A CG   1  
ATOM   6721   C CD   . GLN A 1 437 ? 21.477  30.860  -13.757 0.02 19.24 ?  430  GLN A CD   1  
ATOM   6722   O OE1  . GLN A 1 437 ? 22.206  31.641  -13.132 0.02 19.50 ?  430  GLN A OE1  1  
ATOM   6723   N NE2  . GLN A 1 437 ? 21.133  31.054  -15.033 0.02 19.18 ?  430  GLN A NE2  1  
ATOM   6724   H H    . GLN A 1 437 ? 22.191  27.186  -14.260 0.02 18.40 ?  430  GLN A H    1  
ATOM   6725   H HA   . GLN A 1 437 ? 23.552  29.414  -13.826 0.02 18.93 ?  430  GLN A HA   1  
ATOM   6726   H HB2  . GLN A 1 437 ? 21.815  27.936  -12.179 0.02 18.76 ?  430  GLN A HB2  1  
ATOM   6727   H HB3  . GLN A 1 437 ? 22.462  29.299  -11.690 0.02 19.11 ?  430  GLN A HB3  1  
ATOM   6728   H HG2  . GLN A 1 437 ? 20.586  29.030  -13.796 0.02 18.82 ?  430  GLN A HG2  1  
ATOM   6729   H HG3  . GLN A 1 437 ? 20.347  29.804  -12.432 0.02 19.13 ?  430  GLN A HG3  1  
ATOM   6730   H HE21 . GLN A 1 437 ? 21.532  31.655  -15.498 0.02 19.32 ?  430  GLN A HE21 1  
ATOM   6731   H HE22 . GLN A 1 437 ? 20.518  30.575  -15.392 0.02 19.02 ?  430  GLN A HE22 1  
ATOM   6732   N N    . LEU A 1 438 ? 24.671  26.772  -12.469 0.02 18.55 ?  431  LEU A N    1  
ATOM   6733   C CA   . LEU A 1 438 ? 25.863  26.195  -11.852 0.02 18.57 ?  431  LEU A CA   1  
ATOM   6734   C C    . LEU A 1 438 ? 27.080  26.324  -12.761 0.02 18.54 ?  431  LEU A C    1  
ATOM   6735   O O    . LEU A 1 438 ? 28.183  26.656  -12.307 0.02 18.73 ?  431  LEU A O    1  
ATOM   6736   C CB   . LEU A 1 438 ? 25.568  24.735  -11.512 0.02 18.34 ?  431  LEU A CB   1  
ATOM   6737   C CG   . LEU A 1 438 ? 26.557  23.928  -10.702 0.02 18.36 ?  431  LEU A CG   1  
ATOM   6738   C CD1  . LEU A 1 438 ? 26.636  24.443  -9.266  0.02 18.68 ?  431  LEU A CD1  1  
ATOM   6739   C CD2  . LEU A 1 438 ? 26.105  22.477  -10.770 0.02 18.13 ?  431  LEU A CD2  1  
ATOM   6740   H H    . LEU A 1 438 ? 24.064  26.198  -12.671 0.02 18.40 ?  431  LEU A H    1  
ATOM   6741   H HA   . LEU A 1 438 ? 26.055  26.661  -11.023 0.02 18.77 ?  431  LEU A HA   1  
ATOM   6742   H HB2  . LEU A 1 438 ? 24.748  24.724  -10.996 0.02 18.38 ?  431  LEU A HB2  1  
ATOM   6743   H HB3  . LEU A 1 438 ? 25.422  24.262  -12.345 0.02 18.14 ?  431  LEU A HB3  1  
ATOM   6744   H HG   . LEU A 1 438 ? 27.437  24.001  -11.104 0.02 18.36 ?  431  LEU A HG   1  
ATOM   6745   H HD11 . LEU A 1 438 ? 27.082  23.784  -8.715  0.02 18.70 ?  431  LEU A HD11 1  
ATOM   6746   H HD12 . LEU A 1 438 ? 27.136  25.275  -9.262  0.02 18.85 ?  431  LEU A HD12 1  
ATOM   6747   H HD13 . LEU A 1 438 ? 25.738  24.597  -8.931  0.02 18.70 ?  431  LEU A HD13 1  
ATOM   6748   H HD21 . LEU A 1 438 ? 26.573  21.963  -10.093 0.02 18.17 ?  431  LEU A HD21 1  
ATOM   6749   H HD22 . LEU A 1 438 ? 25.147  22.443  -10.610 0.02 18.15 ?  431  LEU A HD22 1  
ATOM   6750   H HD23 . LEU A 1 438 ? 26.303  22.128  -11.653 0.02 17.95 ?  431  LEU A HD23 1  
ATOM   6751   N N    . ARG A 1 439 ? 26.890  26.108  -14.062 0.02 18.35 ?  432  ARG A N    1  
ATOM   6752   C CA   . ARG A 1 439 ? 27.995  26.199  -15.005 0.02 18.35 ?  432  ARG A CA   1  
ATOM   6753   C C    . ARG A 1 439 ? 28.540  27.621  -15.105 0.02 18.68 ?  432  ARG A C    1  
ATOM   6754   O O    . ARG A 1 439 ? 29.745  27.806  -15.264 0.02 18.81 ?  432  ARG A O    1  
ATOM   6755   C CB   . ARG A 1 439 ? 27.530  25.690  -16.374 0.02 18.12 ?  432  ARG A CB   1  
ATOM   6756   C CG   . ARG A 1 439 ? 28.574  25.778  -17.477 0.02 18.13 ?  432  ARG A CG   1  
ATOM   6757   C CD   . ARG A 1 439 ? 27.921  25.727  -18.839 0.02 18.02 ?  432  ARG A CD   1  
ATOM   6758   N NE   . ARG A 1 439 ? 28.880  26.158  -19.853 0.02 18.14 ?  432  ARG A NE   1  
ATOM   6759   C CZ   . ARG A 1 439 ? 29.065  27.419  -20.239 0.02 18.40 ?  432  ARG A CZ   1  
ATOM   6760   N NH1  . ARG A 1 439 ? 28.334  28.418  -19.756 0.02 18.57 ?  432  ARG A NH1  1  
ATOM   6761   N NH2  . ARG A 1 439 ? 29.986  27.678  -21.146 0.02 18.52 ?  432  ARG A NH2  1  
ATOM   6762   H H    . ARG A 1 439 ? 26.136  25.899  -14.413 0.02 18.23 ?  432  ARG A H    1  
ATOM   6763   H HA   . ARG A 1 439 ? 28.715  25.627  -14.706 0.02 18.31 ?  432  ARG A HA   1  
ATOM   6764   H HB2  . ARG A 1 439 ? 27.272  24.759  -16.292 0.02 17.93 ?  432  ARG A HB2  1  
ATOM   6765   H HB3  . ARG A 1 439 ? 26.766  26.221  -16.645 0.02 18.16 ?  432  ARG A HB3  1  
ATOM   6766   H HG2  . ARG A 1 439 ? 29.053  26.617  -17.414 0.02 18.33 ?  432  ARG A HG2  1  
ATOM   6767   H HG3  . ARG A 1 439 ? 29.191  25.037  -17.402 0.02 18.02 ?  432  ARG A HG3  1  
ATOM   6768   H HD2  . ARG A 1 439 ? 27.649  24.816  -19.026 0.02 17.82 ?  432  ARG A HD2  1  
ATOM   6769   H HD3  . ARG A 1 439 ? 27.162  26.326  -18.857 0.02 18.11 ?  432  ARG A HD3  1  
ATOM   6770   H HE   . ARG A 1 439 ? 29.251  25.545  -20.326 0.02 18.03 ?  432  ARG A HE   1  
ATOM   6771   H HH11 . ARG A 1 439 ? 27.733  28.267  -19.160 0.02 18.52 ?  432  ARG A HH11 1  
ATOM   6772   H HH12 . ARG A 1 439 ? 28.471  29.220  -20.032 0.02 18.76 ?  432  ARG A HH12 1  
ATOM   6773   H HH21 . ARG A 1 439 ? 30.458  27.039  -21.473 0.02 18.42 ?  432  ARG A HH21 1  
ATOM   6774   H HH22 . ARG A 1 439 ? 30.106  28.486  -21.418 0.02 18.70 ?  432  ARG A HH22 1  
ATOM   6775   N N    . PHE A 1 440 ? 27.692  28.647  -14.990 0.02 18.85 ?  433  PHE A N    1  
ATOM   6776   C CA   . PHE A 1 440 ? 28.186  30.019  -15.151 0.02 19.19 ?  433  PHE A CA   1  
ATOM   6777   C C    . PHE A 1 440 ? 29.216  30.387  -14.087 0.02 19.46 ?  433  PHE A C    1  
ATOM   6778   O O    . PHE A 1 440 ? 29.855  31.442  -14.168 0.02 19.75 ?  433  PHE A O    1  
ATOM   6779   C CB   . PHE A 1 440 ? 27.028  31.028  -15.109 0.02 19.35 ?  433  PHE A CB   1  
ATOM   6780   C CG   . PHE A 1 440 ? 26.206  31.084  -16.367 0.02 19.25 ?  433  PHE A CG   1  
ATOM   6781   C CD1  . PHE A 1 440 ? 26.806  31.103  -17.600 0.02 19.26 ?  433  PHE A CD1  1  
ATOM   6782   C CD2  . PHE A 1 440 ? 24.820  31.134  -16.305 0.02 19.18 ?  433  PHE A CD2  1  
ATOM   6783   C CE1  . PHE A 1 440 ? 26.036  31.168  -18.763 0.02 19.20 ?  433  PHE A CE1  1  
ATOM   6784   C CE2  . PHE A 1 440 ? 24.063  31.199  -17.446 0.02 19.12 ?  433  PHE A CE2  1  
ATOM   6785   C CZ   . PHE A 1 440 ? 24.668  31.207  -18.682 0.02 19.13 ?  433  PHE A CZ   1  
ATOM   6786   H H    . PHE A 1 440 ? 26.854  28.581  -14.819 0.02 18.79 ?  433  PHE A H    1  
ATOM   6787   H HA   . PHE A 1 440 ? 28.632  30.084  -16.008 0.02 19.17 ?  433  PHE A HA   1  
ATOM   6788   H HB2  . PHE A 1 440 ? 26.440  30.808  -14.371 0.02 19.30 ?  433  PHE A HB2  1  
ATOM   6789   H HB3  . PHE A 1 440 ? 27.401  31.913  -14.978 0.02 19.62 ?  433  PHE A HB3  1  
ATOM   6790   H HD1  . PHE A 1 440 ? 27.733  31.073  -17.659 0.02 19.33 ?  433  PHE A HD1  1  
ATOM   6791   H HD2  . PHE A 1 440 ? 24.398  31.125  -15.476 0.02 19.19 ?  433  PHE A HD2  1  
ATOM   6792   H HE1  . PHE A 1 440 ? 26.450  31.174  -19.597 0.02 19.22 ?  433  PHE A HE1  1  
ATOM   6793   H HE2  . PHE A 1 440 ? 23.135  31.224  -17.387 0.02 19.09 ?  433  PHE A HE2  1  
ATOM   6794   H HZ   . PHE A 1 440 ? 24.151  31.249  -19.453 0.02 19.11 ?  433  PHE A HZ   1  
ATOM   6795   N N    . ASN A 1 441 ? 29.399  29.543  -13.098 0.02 19.39 ?  434  ASN A N    1  
ATOM   6796   C CA   . ASN A 1 441 ? 30.349  29.835  -12.036 0.02 19.68 ?  434  ASN A CA   1  
ATOM   6797   C C    . ASN A 1 441 ? 31.568  28.921  -12.053 0.02 19.58 ?  434  ASN A C    1  
ATOM   6798   O O    . ASN A 1 441 ? 32.427  29.056  -11.168 0.02 19.83 ?  434  ASN A O    1  
ATOM   6799   C CB   . ASN A 1 441 ? 29.587  29.795  -10.722 0.02 19.80 ?  434  ASN A CB   1  
ATOM   6800   C CG   . ASN A 1 441 ? 28.387  30.741  -10.756 0.02 19.98 ?  434  ASN A CG   1  
ATOM   6801   O OD1  . ASN A 1 441 ? 28.085  31.301  -11.812 0.02 19.91 ?  434  ASN A OD1  1  
ATOM   6802   N ND2  . ASN A 1 441 ? 27.710  30.925  -9.631  0.02 20.24 ?  434  ASN A ND2  1  
ATOM   6803   H H    . ASN A 1 441 ? 28.983  28.798  -13.004 0.02 19.21 ?  434  ASN A H    1  
ATOM   6804   H HA   . ASN A 1 441 ? 30.670  30.745  -12.141 0.02 19.91 ?  434  ASN A HA   1  
ATOM   6805   H HB2  . ASN A 1 441 ? 29.267  28.895  -10.559 0.02 19.59 ?  434  ASN A HB2  1  
ATOM   6806   H HB3  . ASN A 1 441 ? 30.178  30.078  -10.005 0.02 20.01 ?  434  ASN A HB3  1  
ATOM   6807   H HD21 . ASN A 1 441 ? 27.858  31.624  -9.150  0.02 20.48 ?  434  ASN A HD21 1  
ATOM   6808   H HD22 . ASN A 1 441 ? 27.122  30.349  -9.383  0.02 20.19 ?  434  ASN A HD22 1  
ATOM   6809   N N    . HIS A 1 442 ? 31.696  28.046  -13.051 0.02 19.27 ?  435  HIS A N    1  
ATOM   6810   C CA   . HIS A 1 442 ? 32.888  27.216  -13.207 0.02 19.21 ?  435  HIS A CA   1  
ATOM   6811   C C    . HIS A 1 442 ? 33.311  27.084  -14.674 0.02 19.07 ?  435  HIS A C    1  
ATOM   6812   O O    . HIS A 1 442 ? 33.724  26.015  -15.135 0.02 18.83 ?  435  HIS A O    1  
ATOM   6813   C CB   . HIS A 1 442 ? 32.634  25.851  -12.571 0.02 18.97 ?  435  HIS A CB   1  
ATOM   6814   C CG   . HIS A 1 442 ? 32.315  25.939  -11.119 0.02 19.12 ?  435  HIS A CG   1  
ATOM   6815   N ND1  . HIS A 1 442 ? 31.073  25.653  -10.604 0.02 18.98 ?  435  HIS A ND1  1  
ATOM   6816   C CD2  . HIS A 1 442 ? 33.074  26.343  -10.077 0.02 19.44 ?  435  HIS A CD2  1  
ATOM   6817   C CE1  . HIS A 1 442 ? 31.088  25.851  -9.298  0.02 19.20 ?  435  HIS A CE1  1  
ATOM   6818   N NE2  . HIS A 1 442 ? 32.292  26.258  -8.953  0.02 19.48 ?  435  HIS A NE2  1  
ATOM   6819   H H    . HIS A 1 442 ? 31.097  27.906  -13.650 0.02 19.10 ?  435  HIS A H    1  
ATOM   6820   H HA   . HIS A 1 442 ? 33.619  27.632  -12.728 0.02 19.45 ?  435  HIS A HA   1  
ATOM   6821   H HB2  . HIS A 1 442 ? 31.874  25.442  -13.011 0.02 18.75 ?  435  HIS A HB2  1  
ATOM   6822   H HB3  . HIS A 1 442 ? 33.423  25.299  -12.678 0.02 18.96 ?  435  HIS A HB3  1  
ATOM   6823   H HD1  . HIS A 1 442 ? 30.396  25.382  -11.057 0.02 18.79 ?  435  HIS A HD1  1  
ATOM   6824   H HD2  . HIS A 1 442 ? 33.963  26.602  -10.115 0.02 19.62 ?  435  HIS A HD2  1  
ATOM   6825   H HE1  . HIS A 1 442 ? 30.381  25.720  -8.717  0.02 19.17 ?  435  HIS A HE1  1  
ATOM   6826   N N    . THR A 1 443 ? 33.323  28.203  -15.398 0.02 19.27 ?  436  THR A N    1  
ATOM   6827   C CA   . THR A 1 443 ? 33.594  28.211  -16.834 0.02 19.18 ?  436  THR A CA   1  
ATOM   6828   C C    . THR A 1 443 ? 34.607  29.288  -17.194 0.02 19.55 ?  436  THR A C    1  
ATOM   6829   O O    . THR A 1 443 ? 34.627  30.368  -16.604 0.02 19.87 ?  436  THR A O    1  
ATOM   6830   C CB   . THR A 1 443 ? 32.332  28.463  -17.658 0.02 19.03 ?  436  THR A CB   1  
ATOM   6831   O OG1  . THR A 1 443 ? 32.695  28.597  -19.039 0.02 19.02 ?  436  THR A OG1  1  
ATOM   6832   C CG2  . THR A 1 443 ? 31.628  29.710  -17.199 0.02 19.27 ?  436  THR A CG2  1  
ATOM   6833   H H    . THR A 1 443 ? 33.181  28.985  -15.069 0.02 19.48 ?  436  THR A H    1  
ATOM   6834   H HA   . THR A 1 443 ? 33.959  27.354  -17.102 0.02 19.02 ?  436  THR A HA   1  
ATOM   6835   H HB   . THR A 1 443 ? 31.724  27.714  -17.553 0.02 18.80 ?  436  THR A HB   1  
ATOM   6836   H HG1  . THR A 1 443 ? 33.278  28.028  -19.238 0.02 18.96 ?  436  THR A HG1  1  
ATOM   6837   H HG21 . THR A 1 443 ? 30.854  29.880  -17.756 0.02 19.21 ?  436  THR A HG21 1  
ATOM   6838   H HG22 . THR A 1 443 ? 31.332  29.598  -16.282 0.02 19.26 ?  436  THR A HG22 1  
ATOM   6839   H HG23 . THR A 1 443 ? 32.228  30.468  -17.250 0.02 19.53 ?  436  THR A HG23 1  
ATOM   6840   N N    . SER A 1 444 ? 35.452  28.971  -18.181 0.02 19.52 ?  437  SER A N    1  
ATOM   6841   C CA   . SER A 1 444 ? 36.310  29.995  -18.773 0.02 19.88 ?  437  SER A CA   1  
ATOM   6842   C C    . SER A 1 444 ? 35.519  31.150  -19.336 0.02 20.05 ?  437  SER A C    1  
ATOM   6843   O O    . SER A 1 444 ? 36.074  32.234  -19.493 0.02 20.41 ?  437  SER A O    1  
ATOM   6844   C CB   . SER A 1 444 ? 37.140  29.457  -19.927 0.02 19.81 ?  437  SER A CB   1  
ATOM   6845   O OG   . SER A 1 444 ? 36.287  28.994  -20.965 0.02 19.55 ?  437  SER A OG   1  
ATOM   6846   H H    . SER A 1 444 ? 35.544  28.187  -18.518 0.02 19.32 ?  437  SER A H    1  
ATOM   6847   H HA   . SER A 1 444 ? 36.906  30.345  -18.094 0.02 20.10 ?  437  SER A HA   1  
ATOM   6848   H HB2  . SER A 1 444 ? 37.668  30.191  -20.278 0.02 20.08 ?  437  SER A HB2  1  
ATOM   6849   H HB3  . SER A 1 444 ? 37.728  28.752  -19.613 0.02 19.72 ?  437  SER A HB3  1  
ATOM   6850   H HG   . SER A 1 444 ? 35.522  28.828  -20.659 0.02 19.47 ?  437  SER A HG   1  
ATOM   6851   N N    . GLY A 1 445 ? 34.256  30.930  -19.686 0.02 19.82 ?  438  GLY A N    1  
ATOM   6852   C CA   . GLY A 1 445 ? 33.443  31.968  -20.275 0.02 19.97 ?  438  GLY A CA   1  
ATOM   6853   C C    . GLY A 1 445 ? 33.018  31.674  -21.688 0.02 19.76 ?  438  GLY A C    1  
ATOM   6854   O O    . GLY A 1 445 ? 32.463  32.568  -22.353 0.02 19.87 ?  438  GLY A O    1  
ATOM   6855   H H    . GLY A 1 445 ? 33.854  30.176  -19.595 0.02 19.59 ?  438  GLY A H    1  
ATOM   6856   H HA2  . GLY A 1 445 ? 32.651  32.107  -19.733 0.02 19.98 ?  438  GLY A HA2  1  
ATOM   6857   H HA3  . GLY A 1 445 ? 33.949  32.795  -20.287 0.02 20.26 ?  438  GLY A HA3  1  
ATOM   6858   N N    . THR A 1 446 ? 33.278  30.471  -22.181 0.02 19.48 ?  439  THR A N    1  
ATOM   6859   C CA   . THR A 1 446 ? 32.886  30.159  -23.531 0.02 19.33 ?  439  THR A CA   1  
ATOM   6860   C C    . THR A 1 446 ? 31.362  30.149  -23.601 0.02 19.16 ?  439  THR A C    1  
ATOM   6861   O O    . THR A 1 446 ? 30.692  30.033  -22.570 0.02 19.07 ?  439  THR A O    1  
ATOM   6862   C CB   . THR A 1 446 ? 33.478  28.818  -23.995 0.02 19.07 ?  439  THR A CB   1  
ATOM   6863   O OG1  . THR A 1 446 ? 33.107  27.758  -23.099 0.02 18.77 ?  439  THR A OG1  1  
ATOM   6864   C CG2  . THR A 1 446 ? 35.010  28.930  -24.054 0.02 19.29 ?  439  THR A CG2  1  
ATOM   6865   H H    . THR A 1 446 ? 33.676  29.834  -21.764 0.02 19.40 ?  439  THR A H    1  
ATOM   6866   H HA   . THR A 1 446 ? 33.216  30.856  -24.119 0.02 19.54 ?  439  THR A HA   1  
ATOM   6867   H HB   . THR A 1 446 ? 33.165  28.603  -24.884 0.02 18.99 ?  439  THR A HB   1  
ATOM   6868   H HG1  . THR A 1 446 ? 32.275  27.757  -22.986 0.02 18.73 ?  439  THR A HG1  1  
ATOM   6869   H HG21 . THR A 1 446 ? 35.380  28.797  -23.169 0.02 19.26 ?  439  THR A HG21 1  
ATOM   6870   H HG22 . THR A 1 446 ? 35.373  28.256  -24.649 0.02 19.20 ?  439  THR A HG22 1  
ATOM   6871   H HG23 . THR A 1 446 ? 35.263  29.810  -24.378 0.02 19.55 ?  439  THR A HG23 1  
ATOM   6872   N N    . PRO A 1 447 ? 30.793  30.292  -24.788 0.02 19.14 ?  440  PRO A N    1  
ATOM   6873   C CA   . PRO A 1 447 ? 29.351  30.493  -24.908 0.02 19.05 ?  440  PRO A CA   1  
ATOM   6874   C C    . PRO A 1 447 ? 28.552  29.211  -24.827 0.02 18.68 ?  440  PRO A C    1  
ATOM   6875   O O    . PRO A 1 447 ? 28.983  28.150  -25.281 0.02 18.47 ?  440  PRO A O    1  
ATOM   6876   C CB   . PRO A 1 447 ? 29.208  31.100  -26.304 0.02 19.21 ?  440  PRO A CB   1  
ATOM   6877   C CG   . PRO A 1 447 ? 30.326  30.515  -27.047 0.02 19.20 ?  440  PRO A CG   1  
ATOM   6878   C CD   . PRO A 1 447 ? 31.469  30.379  -26.085 0.02 19.25 ?  440  PRO A CD   1  
ATOM   6879   H HA   . PRO A 1 447 ? 29.038  31.119  -24.243 0.02 19.18 ?  440  PRO A HA   1  
ATOM   6880   H HB2  . PRO A 1 447 ? 28.359  30.838  -26.693 0.02 19.09 ?  440  PRO A HB2  1  
ATOM   6881   H HB3  . PRO A 1 447 ? 29.293  32.066  -26.260 0.02 19.47 ?  440  PRO A HB3  1  
ATOM   6882   H HG2  . PRO A 1 447 ? 30.063  29.644  -27.379 0.02 18.97 ?  440  PRO A HG2  1  
ATOM   6883   H HG3  . PRO A 1 447 ? 30.569  31.098  -27.785 0.02 19.40 ?  440  PRO A HG3  1  
ATOM   6884   H HD2  . PRO A 1 447 ? 31.962  29.567  -26.273 0.02 19.11 ?  440  PRO A HD2  1  
ATOM   6885   H HD3  . PRO A 1 447 ? 32.044  31.158  -26.121 0.02 19.52 ?  440  PRO A HD3  1  
ATOM   6886   N N    . VAL A 1 448 ? 27.333  29.355  -24.321 0.02 18.63 ?  441  VAL A N    1  
ATOM   6887   C CA   . VAL A 1 448 ? 26.290  28.346  -24.475 0.02 18.35 ?  441  VAL A CA   1  
ATOM   6888   C C    . VAL A 1 448 ? 25.097  28.975  -25.183 0.02 18.46 ?  441  VAL A C    1  
ATOM   6889   O O    . VAL A 1 448 ? 24.635  30.056  -24.803 0.02 18.69 ?  441  VAL A O    1  
ATOM   6890   C CB   . VAL A 1 448 ? 25.834  27.729  -23.141 0.02 18.19 ?  441  VAL A CB   1  
ATOM   6891   C CG1  . VAL A 1 448 ? 25.593  28.802  -22.064 0.02 18.41 ?  441  VAL A CG1  1  
ATOM   6892   C CG2  . VAL A 1 448 ? 24.581  26.887  -23.390 0.02 17.97 ?  441  VAL A CG2  1  
ATOM   6893   H H    . VAL A 1 448 ? 27.080  30.051  -23.885 0.02 18.78 ?  441  VAL A H    1  
ATOM   6894   H HA   . VAL A 1 448 ? 26.633  27.634  -25.027 0.02 18.22 ?  441  VAL A HA   1  
ATOM   6895   H HB   . VAL A 1 448 ? 26.523  27.127  -22.817 0.02 18.09 ?  441  VAL A HB   1  
ATOM   6896   H HG11 . VAL A 1 448 ? 25.361  28.366  -21.229 0.02 18.32 ?  441  VAL A HG11 1  
ATOM   6897   H HG12 . VAL A 1 448 ? 26.405  29.323  -21.946 0.02 18.57 ?  441  VAL A HG12 1  
ATOM   6898   H HG13 . VAL A 1 448 ? 24.869  29.381  -22.347 0.02 18.51 ?  441  VAL A HG13 1  
ATOM   6899   H HG21 . VAL A 1 448 ? 24.516  26.197  -22.710 0.02 17.82 ?  441  VAL A HG21 1  
ATOM   6900   H HG22 . VAL A 1 448 ? 23.800  27.464  -23.357 0.02 18.06 ?  441  VAL A HG22 1  
ATOM   6901   H HG23 . VAL A 1 448 ? 24.652  26.475  -24.265 0.02 17.90 ?  441  VAL A HG23 1  
ATOM   6902   N N    . TYR A 1 449 ? 24.590  28.280  -26.177 0.02 18.31 ?  442  TYR A N    1  
ATOM   6903   C CA   . TYR A 1 449 ? 23.450  28.721  -26.961 0.02 18.41 ?  442  TYR A CA   1  
ATOM   6904   C C    . TYR A 1 449 ? 22.245  27.830  -26.701 0.02 18.19 ?  442  TYR A C    1  
ATOM   6905   O O    . TYR A 1 449 ? 22.392  26.623  -26.527 0.02 17.95 ?  442  TYR A O    1  
ATOM   6906   C CB   . TYR A 1 449 ? 23.794  28.658  -28.440 0.02 18.48 ?  442  TYR A CB   1  
ATOM   6907   C CG   . TYR A 1 449 ? 24.986  29.500  -28.840 0.02 18.72 ?  442  TYR A CG   1  
ATOM   6908   C CD1  . TYR A 1 449 ? 24.808  30.805  -29.307 0.02 19.06 ?  442  TYR A CD1  1  
ATOM   6909   C CD2  . TYR A 1 449 ? 26.271  28.989  -28.797 0.02 18.64 ?  442  TYR A CD2  1  
ATOM   6910   C CE1  . TYR A 1 449 ? 25.890  31.570  -29.688 0.02 19.31 ?  442  TYR A CE1  1  
ATOM   6911   C CE2  . TYR A 1 449 ? 27.357  29.740  -29.189 0.02 18.89 ?  442  TYR A CE2  1  
ATOM   6912   C CZ   . TYR A 1 449 ? 27.171  31.030  -29.618 0.02 19.23 ?  442  TYR A CZ   1  
ATOM   6913   O OH   . TYR A 1 449 ? 28.259  31.791  -30.008 0.02 19.51 ?  442  TYR A OH   1  
ATOM   6914   H H    . TYR A 1 449 ? 24.902  27.524  -26.433 0.02 18.16 ?  442  TYR A H    1  
ATOM   6915   H HA   . TYR A 1 449 ? 23.216  29.633  -26.726 0.02 18.60 ?  442  TYR A HA   1  
ATOM   6916   H HB2  . TYR A 1 449 ? 24.011  27.737  -28.649 0.02 18.31 ?  442  TYR A HB2  1  
ATOM   6917   H HB3  . TYR A 1 449 ? 23.024  28.944  -28.955 0.02 18.58 ?  442  TYR A HB3  1  
ATOM   6918   H HD1  . TYR A 1 449 ? 23.953  31.165  -29.346 0.02 19.13 ?  442  TYR A HD1  1  
ATOM   6919   H HD2  . TYR A 1 449 ? 26.408  28.119  -28.500 0.02 18.44 ?  442  TYR A HD2  1  
ATOM   6920   H HE1  . TYR A 1 449 ? 25.765  32.443  -29.989 0.02 19.55 ?  442  TYR A HE1  1  
ATOM   6921   H HE2  . TYR A 1 449 ? 28.213  29.381  -29.140 0.02 18.85 ?  442  TYR A HE2  1  
ATOM   6922   H HH   . TYR A 1 449 ? 28.945  31.308  -30.064 0.02 19.44 ?  442  TYR A HH   1  
ATOM   6923   N N    . LEU A 1 450 ? 21.046  28.425  -26.715 0.02 18.32 ?  443  LEU A N    1  
ATOM   6924   C CA   . LEU A 1 450 ? 19.810  27.701  -26.449 0.02 18.17 ?  443  LEU A CA   1  
ATOM   6925   C C    . LEU A 1 450 ? 18.922  27.634  -27.686 0.02 18.24 ?  443  LEU A C    1  
ATOM   6926   O O    . LEU A 1 450 ? 18.730  28.646  -28.364 0.02 18.49 ?  443  LEU A O    1  
ATOM   6927   C CB   . LEU A 1 450 ? 18.982  28.363  -25.347 0.02 18.29 ?  443  LEU A CB   1  
ATOM   6928   C CG   . LEU A 1 450 ? 19.591  28.694  -23.997 0.02 18.32 ?  443  LEU A CG   1  
ATOM   6929   C CD1  . LEU A 1 450 ? 18.488  29.129  -22.994 0.02 18.44 ?  443  LEU A CD1  1  
ATOM   6930   C CD2  . LEU A 1 450 ? 20.335  27.548  -23.451 0.02 18.07 ?  443  LEU A CD2  1  
ATOM   6931   H H    . LEU A 1 450 ? 20.926  29.258  -26.881 0.02 18.50 ?  443  LEU A H    1  
ATOM   6932   H HA   . LEU A 1 450 ? 20.025  26.798  -26.175 0.02 17.98 ?  443  LEU A HA   1  
ATOM   6933   H HB2  . LEU A 1 450 ? 18.652  29.201  -25.705 0.02 18.48 ?  443  LEU A HB2  1  
ATOM   6934   H HB3  . LEU A 1 450 ? 18.226  27.782  -25.168 0.02 18.19 ?  443  LEU A HB3  1  
ATOM   6935   H HG   . LEU A 1 450 ? 20.215  29.426  -24.109 0.02 18.46 ?  443  LEU A HG   1  
ATOM   6936   H HD11 . LEU A 1 450 ? 18.915  29.451  -22.185 0.02 18.44 ?  443  LEU A HD11 1  
ATOM   6937   H HD12 . LEU A 1 450 ? 17.962  29.837  -23.395 0.02 18.64 ?  443  LEU A HD12 1  
ATOM   6938   H HD13 . LEU A 1 450 ? 17.921  28.371  -22.786 0.02 18.33 ?  443  LEU A HD13 1  
ATOM   6939   H HD21 . LEU A 1 450 ? 20.481  27.699  -22.503 0.02 18.12 ?  443  LEU A HD21 1  
ATOM   6940   H HD22 . LEU A 1 450 ? 19.814  26.742  -23.587 0.02 17.94 ?  443  LEU A HD22 1  
ATOM   6941   H HD23 . LEU A 1 450 ? 21.186  27.479  -23.913 0.02 17.99 ?  443  LEU A HD23 1  
ATOM   6942   N N    . TYR A 1 451 ? 18.374  26.439  -27.962 0.02 18.04 ?  444  TYR A N    1  
ATOM   6943   C CA   . TYR A 1 451 ? 17.302  26.292  -28.941 0.02 18.12 ?  444  TYR A CA   1  
ATOM   6944   C C    . TYR A 1 451 ? 16.061  25.681  -28.293 0.02 18.05 ?  444  TYR A C    1  
ATOM   6945   O O    . TYR A 1 451 ? 16.124  25.028  -27.246 0.02 17.88 ?  444  TYR A O    1  
ATOM   6946   C CB   . TYR A 1 451 ? 17.738  25.433  -30.148 0.02 18.03 ?  444  TYR A CB   1  
ATOM   6947   C CG   . TYR A 1 451 ? 17.870  23.982  -29.810 0.02 17.76 ?  444  TYR A CG   1  
ATOM   6948   C CD1  . TYR A 1 451 ? 16.776  23.122  -29.849 0.02 17.69 ?  444  TYR A CD1  1  
ATOM   6949   C CD2  . TYR A 1 451 ? 19.091  23.468  -29.427 0.02 17.59 ?  444  TYR A CD2  1  
ATOM   6950   C CE1  . TYR A 1 451 ? 16.896  21.809  -29.492 0.02 17.48 ?  444  TYR A CE1  1  
ATOM   6951   C CE2  . TYR A 1 451 ? 19.226  22.151  -29.082 0.02 17.37 ?  444  TYR A CE2  1  
ATOM   6952   C CZ   . TYR A 1 451 ? 18.147  21.323  -29.116 0.02 17.31 ?  444  TYR A CZ   1  
ATOM   6953   O OH   . TYR A 1 451 ? 18.323  20.021  -28.742 0.02 17.12 ?  444  TYR A OH   1  
ATOM   6954   H H    . TYR A 1 451 ? 18.609  25.701  -27.595 0.02 17.88 ?  444  TYR A H    1  
ATOM   6955   H HA   . TYR A 1 451 ? 17.053  27.166  -29.269 0.02 18.32 ?  444  TYR A HA   1  
ATOM   6956   H HB2  . TYR A 1 451 ? 17.082  25.518  -30.855 0.02 18.14 ?  444  TYR A HB2  1  
ATOM   6957   H HB3  . TYR A 1 451 ? 18.599  25.748  -30.456 0.02 18.07 ?  444  TYR A HB3  1  
ATOM   6958   H HD1  . TYR A 1 451 ? 15.944  23.456  -30.092 0.02 17.82 ?  444  TYR A HD1  1  
ATOM   6959   H HD2  . TYR A 1 451 ? 19.828  24.032  -29.393 0.02 17.66 ?  444  TYR A HD2  1  
ATOM   6960   H HE1  . TYR A 1 451 ? 16.161  21.244  -29.519 0.02 17.46 ?  444  TYR A HE1  1  
ATOM   6961   H HE2  . TYR A 1 451 ? 20.053  21.819  -28.820 0.02 17.28 ?  444  TYR A HE2  1  
ATOM   6962   H HH   . TYR A 1 451 ? 17.582  19.669  -28.574 0.02 17.12 ?  444  TYR A HH   1  
ATOM   6963   N N    . ARG A 1 452 ? 14.929  25.908  -28.944 0.02 18.21 ?  445  ARG A N    1  
ATOM   6964   C CA   . ARG A 1 452 ? 13.653  25.315  -28.559 0.02 18.20 ?  445  ARG A CA   1  
ATOM   6965   C C    . ARG A 1 452 ? 13.040  24.746  -29.823 0.02 18.26 ?  445  ARG A C    1  
ATOM   6966   O O    . ARG A 1 452 ? 12.741  25.496  -30.751 0.02 18.48 ?  445  ARG A O    1  
ATOM   6967   C CB   . ARG A 1 452 ? 12.743  26.352  -27.934 0.02 18.43 ?  445  ARG A CB   1  
ATOM   6968   C CG   . ARG A 1 452 ? 11.392  25.872  -27.421 0.02 18.47 ?  445  ARG A CG   1  
ATOM   6969   C CD   . ARG A 1 452 ? 10.772  27.079  -26.726 0.02 18.72 ?  445  ARG A CD   1  
ATOM   6970   N NE   . ARG A 1 452 ? 9.540   26.825  -26.007 0.02 18.80 ?  445  ARG A NE   1  
ATOM   6971   C CZ   . ARG A 1 452 ? 8.325   26.897  -26.541 0.02 19.01 ?  445  ARG A CZ   1  
ATOM   6972   N NH1  . ARG A 1 452 ? 8.163   27.179  -27.826 0.02 19.14 ?  445  ARG A NH1  1  
ATOM   6973   N NH2  . ARG A 1 452 ? 7.259   26.686  -25.794 0.02 19.11 ?  445  ARG A NH2  1  
ATOM   6974   H H    . ARG A 1 452 ? 14.867  26.423  -29.626 0.02 18.35 ?  445  ARG A H    1  
ATOM   6975   H HA   . ARG A 1 452 ? 13.798  24.600  -27.922 0.02 18.03 ?  445  ARG A HA   1  
ATOM   6976   H HB2  . ARG A 1 452 ? 13.219  26.740  -27.186 0.02 18.41 ?  445  ARG A HB2  1  
ATOM   6977   H HB3  . ARG A 1 452 ? 12.567  27.039  -28.595 0.02 18.60 ?  445  ARG A HB3  1  
ATOM   6978   H HG2  . ARG A 1 452 ? 10.827  25.600  -28.161 0.02 18.53 ?  445  ARG A HG2  1  
ATOM   6979   H HG3  . ARG A 1 452 ? 11.507  25.151  -26.785 0.02 18.31 ?  445  ARG A HG3  1  
ATOM   6980   H HD2  . ARG A 1 452 ? 11.415  27.428  -26.090 0.02 18.68 ?  445  ARG A HD2  1  
ATOM   6981   H HD3  . ARG A 1 452 ? 10.587  27.756  -27.393 0.02 18.89 ?  445  ARG A HD3  1  
ATOM   6982   H HE   . ARG A 1 452 ? 9.611   26.426  -25.248 0.02 18.70 ?  445  ARG A HE   1  
ATOM   6983   H HH11 . ARG A 1 452 ? 8.844   27.329  -28.321 0.02 19.10 ?  445  ARG A HH11 1  
ATOM   6984   H HH12 . ARG A 1 452 ? 7.374   27.215  -28.159 0.02 19.29 ?  445  ARG A HH12 1  
ATOM   6985   H HH21 . ARG A 1 452 ? 7.353   26.493  -24.962 0.02 19.04 ?  445  ARG A HH21 1  
ATOM   6986   H HH22 . ARG A 1 452 ? 6.473   26.716  -26.141 0.02 19.25 ?  445  ARG A HH22 1  
ATOM   6987   N N    . PHE A 1 453 ? 12.895  23.437  -29.886 0.02 18.08 ?  446  PHE A N    1  
ATOM   6988   C CA   . PHE A 1 453 ? 12.407  22.821  -31.111 0.02 18.15 ?  446  PHE A CA   1  
ATOM   6989   C C    . PHE A 1 453 ? 10.886  22.729  -31.086 0.02 18.32 ?  446  PHE A C    1  
ATOM   6990   O O    . PHE A 1 453 ? 10.306  22.059  -30.229 0.02 18.24 ?  446  PHE A O    1  
ATOM   6991   C CB   . PHE A 1 453 ? 13.024  21.457  -31.331 0.02 17.92 ?  446  PHE A CB   1  
ATOM   6992   C CG   . PHE A 1 453 ? 12.674  20.871  -32.662 0.02 18.02 ?  446  PHE A CG   1  
ATOM   6993   C CD1  . PHE A 1 453 ? 13.345  21.261  -33.799 0.02 18.13 ?  446  PHE A CD1  1  
ATOM   6994   C CD2  . PHE A 1 453 ? 11.635  19.972  -32.770 0.02 18.05 ?  446  PHE A CD2  1  
ATOM   6995   C CE1  . PHE A 1 453 ? 13.006  20.725  -35.012 0.02 18.25 ?  446  PHE A CE1  1  
ATOM   6996   C CE2  . PHE A 1 453 ? 11.290  19.438  -33.984 0.02 18.17 ?  446  PHE A CE2  1  
ATOM   6997   C CZ   . PHE A 1 453 ? 11.978  19.811  -35.099 0.02 18.27 ?  446  PHE A CZ   1  
ATOM   6998   H H    . PHE A 1 453 ? 13.077  22.887  -29.254 0.02 17.94 ?  446  PHE A H    1  
ATOM   6999   H HA   . PHE A 1 453 ? 12.656  23.379  -31.860 0.02 18.27 ?  446  PHE A HA   1  
ATOM   7000   H HB2  . PHE A 1 453 ? 13.986  21.526  -31.269 0.02 17.83 ?  446  PHE A HB2  1  
ATOM   7001   H HB3  . PHE A 1 453 ? 12.688  20.853  -30.653 0.02 17.84 ?  446  PHE A HB3  1  
ATOM   7002   H HD1  . PHE A 1 453 ? 14.041  21.873  -33.740 0.02 18.13 ?  446  PHE A HD1  1  
ATOM   7003   H HD2  . PHE A 1 453 ? 11.174  19.712  -32.006 0.02 18.00 ?  446  PHE A HD2  1  
ATOM   7004   H HE1  . PHE A 1 453 ? 13.469  20.984  -35.773 0.02 18.33 ?  446  PHE A HE1  1  
ATOM   7005   H HE2  . PHE A 1 453 ? 10.600  18.821  -34.041 0.02 18.21 ?  446  PHE A HE2  1  
ATOM   7006   H HZ   . PHE A 1 453 ? 11.745  19.452  -35.924 0.02 18.37 ?  446  PHE A HZ   1  
ATOM   7007   N N    . ASP A 1 454 ? 10.262  23.355  -32.069 0.02 18.58 ?  447  ASP A N    1  
ATOM   7008   C CA   . ASP A 1 454 ? 8.845   23.669  -32.043 0.02 18.82 ?  447  ASP A CA   1  
ATOM   7009   C C    . ASP A 1 454 ? 8.238   23.454  -33.429 0.02 19.03 ?  447  ASP A C    1  
ATOM   7010   O O    . ASP A 1 454 ? 7.346   24.189  -33.838 0.02 19.33 ?  447  ASP A O    1  
ATOM   7011   C CB   . ASP A 1 454 ? 8.659   25.116  -31.553 0.02 19.02 ?  447  ASP A CB   1  
ATOM   7012   C CG   . ASP A 1 454 ? 7.204   25.528  -31.386 0.02 19.29 ?  447  ASP A CG   1  
ATOM   7013   O OD1  . ASP A 1 454 ? 6.357   24.695  -30.999 0.02 19.27 ?  447  ASP A OD1  1  
ATOM   7014   O OD2  . ASP A 1 454 ? 6.915   26.722  -31.636 0.02 19.55 -1 447  ASP A OD2  1  
ATOM   7015   H H    . ASP A 1 454 ? 10.655  23.619  -32.783 0.02 18.64 ?  447  ASP A H    1  
ATOM   7016   H HA   . ASP A 1 454 ? 8.395   23.075  -31.426 0.02 18.75 ?  447  ASP A HA   1  
ATOM   7017   H HB2  . ASP A 1 454 ? 9.086   25.197  -30.685 0.02 18.89 ?  447  ASP A HB2  1  
ATOM   7018   H HB3  . ASP A 1 454 ? 9.076   25.726  -32.180 0.02 19.12 ?  447  ASP A HB3  1  
ATOM   7019   N N    . PHE A 1 455 ? 8.727   22.460  -34.161 0.02 18.91 ?  448  PHE A N    1  
ATOM   7020   C CA   . PHE A 1 455 ? 8.249   22.165  -35.510 0.02 19.12 ?  448  PHE A CA   1  
ATOM   7021   C C    . PHE A 1 455 ? 7.442   20.880  -35.466 0.02 19.09 ?  448  PHE A C    1  
ATOM   7022   O O    . PHE A 1 455 ? 7.967   19.830  -35.092 0.02 18.84 ?  448  PHE A O    1  
ATOM   7023   C CB   . PHE A 1 455 ? 9.403   22.024  -36.497 0.02 19.05 ?  448  PHE A CB   1  
ATOM   7024   C CG   . PHE A 1 455 ? 8.955   21.652  -37.892 0.02 19.29 ?  448  PHE A CG   1  
ATOM   7025   C CD1  . PHE A 1 455 ? 8.527   22.632  -38.778 0.02 19.61 ?  448  PHE A CD1  1  
ATOM   7026   C CD2  . PHE A 1 455 ? 8.944   20.334  -38.307 0.02 19.21 ?  448  PHE A CD2  1  
ATOM   7027   C CE1  . PHE A 1 455 ? 8.105   22.286  -40.071 0.02 19.86 ?  448  PHE A CE1  1  
ATOM   7028   C CE2  . PHE A 1 455 ? 8.536   19.996  -39.596 0.02 19.46 ?  448  PHE A CE2  1  
ATOM   7029   C CZ   . PHE A 1 455 ? 8.102   20.970  -40.463 0.02 19.78 ?  448  PHE A CZ   1  
ATOM   7030   H H    . PHE A 1 455 ? 9.355   21.935  -33.901 0.02 18.72 ?  448  PHE A H    1  
ATOM   7031   H HA   . PHE A 1 455 ? 7.677   22.885  -35.814 0.02 19.34 ?  448  PHE A HA   1  
ATOM   7032   H HB2  . PHE A 1 455 ? 9.869   22.873  -36.557 0.02 19.10 ?  448  PHE A HB2  1  
ATOM   7033   H HB3  . PHE A 1 455 ? 10.006  21.336  -36.182 0.02 18.84 ?  448  PHE A HB3  1  
ATOM   7034   H HD1  . PHE A 1 455 ? 8.523   23.523  -38.517 0.02 19.69 ?  448  PHE A HD1  1  
ATOM   7035   H HD2  . PHE A 1 455 ? 9.228   19.666  -37.728 0.02 19.01 ?  448  PHE A HD2  1  
ATOM   7036   H HE1  . PHE A 1 455 ? 7.822   22.947  -40.660 0.02 20.10 ?  448  PHE A HE1  1  
ATOM   7037   H HE2  . PHE A 1 455 ? 8.531   19.107  -39.864 0.02 19.42 ?  448  PHE A HE2  1  
ATOM   7038   H HZ   . PHE A 1 455 ? 7.830   20.740  -41.320 0.02 19.97 ?  448  PHE A HZ   1  
ATOM   7039   N N    . ASP A 1 456 ? 6.171   20.977  -35.841 0.02 19.38 ?  449  ASP A N    1  
ATOM   7040   C CA   . ASP A 1 456 ? 5.209   19.899  -35.729 0.02 19.43 ?  449  ASP A CA   1  
ATOM   7041   C C    . ASP A 1 456 ? 4.846   19.408  -37.126 0.02 19.67 ?  449  ASP A C    1  
ATOM   7042   O O    . ASP A 1 456 ? 4.285   20.162  -37.914 0.02 19.98 ?  449  ASP A O    1  
ATOM   7043   C CB   . ASP A 1 456 ? 3.959   20.404  -35.008 0.02 19.62 ?  449  ASP A CB   1  
ATOM   7044   C CG   . ASP A 1 456 ? 3.050   19.287  -34.545 0.02 19.65 ?  449  ASP A CG   1  
ATOM   7045   O OD1  . ASP A 1 456 ? 3.303   18.120  -34.870 0.02 19.48 ?  449  ASP A OD1  1  
ATOM   7046   O OD2  . ASP A 1 456 ? 2.029   19.589  -33.897 0.02 19.87 -1 449  ASP A OD2  1  
ATOM   7047   H H    . ASP A 1 456 ? 5.834   21.695  -36.170 0.02 19.56 ?  449  ASP A H    1  
ATOM   7048   H HA   . ASP A 1 456 ? 5.583   19.164  -35.225 0.02 19.22 ?  449  ASP A HA   1  
ATOM   7049   H HB2  . ASP A 1 456 ? 4.232   20.904  -34.224 0.02 19.51 ?  449  ASP A HB2  1  
ATOM   7050   H HB3  . ASP A 1 456 ? 3.464   20.981  -35.607 0.02 19.87 ?  449  ASP A HB3  1  
ATOM   7051   N N    . SER A 1 457 ? 5.155   18.152  -37.425 0.02 19.56 ?  450  SER A N    1  
ATOM   7052   C CA   . SER A 1 457 ? 4.754   17.552  -38.688 0.02 19.80 ?  450  SER A CA   1  
ATOM   7053   C C    . SER A 1 457 ? 4.612   16.063  -38.476 0.02 19.71 ?  450  SER A C    1  
ATOM   7054   O O    . SER A 1 457 ? 5.488   15.411  -37.888 0.02 19.40 ?  450  SER A O    1  
ATOM   7055   C CB   . SER A 1 457 ? 5.753   17.799  -39.816 0.02 19.81 ?  450  SER A CB   1  
ATOM   7056   O OG   . SER A 1 457 ? 5.451   16.993  -40.948 0.02 20.05 ?  450  SER A OG   1  
ATOM   7057   H H    . SER A 1 457 ? 5.586   17.617  -36.912 0.02 19.35 ?  450  SER A H    1  
ATOM   7058   H HA   . SER A 1 457 ? 3.894   17.912  -38.954 0.02 20.05 ?  450  SER A HA   1  
ATOM   7059   H HB2  . SER A 1 457 ? 5.714   18.733  -40.070 0.02 19.91 ?  450  SER A HB2  1  
ATOM   7060   H HB3  . SER A 1 457 ? 6.640   17.572  -39.496 0.02 19.56 ?  450  SER A HB3  1  
ATOM   7061   H HG   . SER A 1 457 ? 5.513   16.178  -40.755 0.02 19.98 ?  450  SER A HG   1  
ATOM   7062   N N    . GLU A 1 458 ? 3.503   15.534  -38.961 0.02 20.01 ?  451  GLU A N    1  
ATOM   7063   C CA   . GLU A 1 458 ? 3.288   14.099  -38.939 0.02 20.01 ?  451  GLU A CA   1  
ATOM   7064   C C    . GLU A 1 458 ? 2.989   13.579  -40.342 0.02 20.33 ?  451  GLU A C    1  
ATOM   7065   O O    . GLU A 1 458 ? 2.103   12.737  -40.532 0.02 20.55 ?  451  GLU A O    1  
ATOM   7066   C CB   . GLU A 1 458 ? 2.206   13.760  -37.906 0.02 20.07 ?  451  GLU A CB   1  
ATOM   7067   C CG   . GLU A 1 458 ? 1.495   15.009  -37.233 0.02 20.18 ?  451  GLU A CG   1  
ATOM   7068   C CD   . GLU A 1 458 ? 2.472   15.959  -36.475 0.02 19.89 ?  451  GLU A CD   1  
ATOM   7069   O OE1  . GLU A 1 458 ? 3.148   15.497  -35.509 0.02 19.55 ?  451  GLU A OE1  1  
ATOM   7070   O OE2  . GLU A 1 458 ? 2.629   17.129  -36.881 0.02 20.02 -1 451  GLU A OE2  1  
ATOM   7071   H H    . GLU A 1 458 ? 2.864   15.991  -39.310 0.02 20.24 ?  451  GLU A H    1  
ATOM   7072   H HA   . GLU A 1 458 ? 4.111   13.672  -38.661 0.02 19.77 ?  451  GLU A HA   1  
ATOM   7073   H HB2  . GLU A 1 458 ? 1.526   13.212  -38.331 0.02 20.29 ?  451  GLU A HB2  1  
ATOM   7074   H HB3  . GLU A 1 458 ? 2.630   13.251  -37.197 0.02 19.84 ?  451  GLU A HB3  1  
ATOM   7075   H HG2  . GLU A 1 458 ? 1.042   15.543  -37.911 0.02 20.43 ?  451  GLU A HG2  1  
ATOM   7076   H HG3  . GLU A 1 458 ? 0.841   14.693  -36.585 0.02 20.23 ?  451  GLU A HG3  1  
ATOM   7077   N N    . ASP A 1 459 ? 3.701   14.103  -41.328 0.02 20.39 ?  452  ASP A N    1  
ATOM   7078   C CA   . ASP A 1 459 ? 3.915   13.415  -42.591 0.02 20.57 ?  452  ASP A CA   1  
ATOM   7079   C C    . ASP A 1 459 ? 5.271   12.730  -42.606 0.02 20.24 ?  452  ASP A C    1  
ATOM   7080   O O    . ASP A 1 459 ? 5.583   11.996  -43.547 0.02 20.35 ?  452  ASP A O    1  
ATOM   7081   C CB   . ASP A 1 459 ? 3.811   14.407  -43.754 0.02 20.87 ?  452  ASP A CB   1  
ATOM   7082   C CG   . ASP A 1 459 ? 2.365   14.715  -44.158 0.02 21.28 ?  452  ASP A CG   1  
ATOM   7083   O OD1  . ASP A 1 459 ? 2.210   15.448  -45.165 0.02 21.59 ?  452  ASP A OD1  1  
ATOM   7084   O OD2  . ASP A 1 459 ? 1.401   14.207  -43.537 0.02 21.35 -1 452  ASP A OD2  1  
ATOM   7085   H H    . ASP A 1 459 ? 4.082   14.870  -41.286 0.02 20.35 ?  452  ASP A H    1  
ATOM   7086   H HA   . ASP A 1 459 ? 3.228   12.740  -42.708 0.02 20.74 ?  452  ASP A HA   1  
ATOM   7087   H HB2  . ASP A 1 459 ? 4.233   15.241  -43.499 0.02 20.73 ?  452  ASP A HB2  1  
ATOM   7088   H HB3  . ASP A 1 459 ? 4.259   14.033  -44.529 0.02 20.96 ?  452  ASP A HB3  1  
ATOM   7089   N N    . LEU A 1 460 ? 6.081   12.961  -41.578 0.02 19.88 ?  453  LEU A N    1  
ATOM   7090   C CA   . LEU A 1 460 ? 7.409   12.397  -41.468 0.02 19.57 ?  453  LEU A CA   1  
ATOM   7091   C C    . LEU A 1 460 ? 7.656   12.194  -39.981 0.02 19.25 ?  453  LEU A C    1  
ATOM   7092   O O    . LEU A 1 460 ? 7.507   13.143  -39.209 0.02 19.16 ?  453  LEU A O    1  
ATOM   7093   C CB   . LEU A 1 460 ? 8.421   13.344  -42.104 0.02 19.51 ?  453  LEU A CB   1  
ATOM   7094   C CG   . LEU A 1 460 ? 9.814   12.767  -42.231 0.02 19.30 ?  453  LEU A CG   1  
ATOM   7095   C CD1  . LEU A 1 460 ? 9.881   11.761  -43.378 0.02 19.50 ?  453  LEU A CD1  1  
ATOM   7096   C CD2  . LEU A 1 460 ? 10.856  13.869  -42.383 0.02 19.22 ?  453  LEU A CD2  1  
ATOM   7097   H H    . LEU A 1 460 ? 5.877   13.465  -40.914 0.02 19.81 ?  453  LEU A H    1  
ATOM   7098   H HA   . LEU A 1 460 ? 7.452   11.533  -41.902 0.02 19.64 ?  453  LEU A HA   1  
ATOM   7099   H HB2  . LEU A 1 460 ? 8.112   13.568  -42.995 0.02 19.75 ?  453  LEU A HB2  1  
ATOM   7100   H HB3  . LEU A 1 460 ? 8.471   14.144  -41.562 0.02 19.40 ?  453  LEU A HB3  1  
ATOM   7101   H HG   . LEU A 1 460 ? 10.013  12.286  -41.415 0.02 19.08 ?  453  LEU A HG   1  
ATOM   7102   H HD11 . LEU A 1 460 ? 9.159   11.123  -43.284 0.02 19.61 ?  453  LEU A HD11 1  
ATOM   7103   H HD12 . LEU A 1 460 ? 9.800   12.229  -44.223 0.02 19.70 ?  453  LEU A HD12 1  
ATOM   7104   H HD13 . LEU A 1 460 ? 10.734  11.303  -43.335 0.02 19.35 ?  453  LEU A HD13 1  
ATOM   7105   H HD21 . LEU A 1 460 ? 11.732  13.460  -42.475 0.02 19.09 ?  453  LEU A HD21 1  
ATOM   7106   H HD22 . LEU A 1 460 ? 10.647  14.389  -43.175 0.02 19.45 ?  453  LEU A HD22 1  
ATOM   7107   H HD23 . LEU A 1 460 ? 10.834  14.435  -41.595 0.02 19.11 ?  453  LEU A HD23 1  
ATOM   7108   N N    . ILE A 1 461 ? 7.931   10.953  -39.579 0.02 19.11 ?  454  ILE A N    1  
ATOM   7109   C CA   . ILE A 1 461 ? 7.972   10.577  -38.165 0.02 18.87 ?  454  ILE A CA   1  
ATOM   7110   C C    . ILE A 1 461 ? 9.172   9.671   -37.908 0.02 18.61 ?  454  ILE A C    1  
ATOM   7111   O O    . ILE A 1 461 ? 9.947   9.342   -38.813 0.02 18.63 ?  454  ILE A O    1  
ATOM   7112   C CB   . ILE A 1 461 ? 6.669   9.886   -37.703 0.02 19.05 ?  454  ILE A CB   1  
ATOM   7113   C CG1  . ILE A 1 461 ? 6.445   8.554   -38.417 0.02 19.23 ?  454  ILE A CG1  1  
ATOM   7114   C CG2  . ILE A 1 461 ? 5.445   10.795  -37.910 0.02 19.33 ?  454  ILE A CG2  1  
ATOM   7115   C CD1  . ILE A 1 461 ? 5.785   7.550   -37.525 0.02 19.26 ?  454  ILE A CD1  1  
ATOM   7116   H H    . ILE A 1 461 ? 8.103   10.301  -40.108 0.02 19.18 ?  454  ILE A H    1  
ATOM   7117   H HA   . ILE A 1 461 ? 8.082   11.382  -37.636 0.02 18.76 ?  454  ILE A HA   1  
ATOM   7118   H HB   . ILE A 1 461 ? 6.752   9.709   -36.754 0.02 18.89 ?  454  ILE A HB   1  
ATOM   7119   H HG12 . ILE A 1 461 ? 5.868   8.704   -39.181 0.02 19.47 ?  454  ILE A HG12 1  
ATOM   7120   H HG13 . ILE A 1 461 ? 7.286   8.180   -38.713 0.02 19.11 ?  454  ILE A HG13 1  
ATOM   7121   H HG21 . ILE A 1 461 ? 4.643   10.262  -37.805 0.02 19.51 ?  454  ILE A HG21 1  
ATOM   7122   H HG22 . ILE A 1 461 ? 5.455   11.499  -37.246 0.02 19.23 ?  454  ILE A HG22 1  
ATOM   7123   H HG23 . ILE A 1 461 ? 5.470   11.175  -38.800 0.02 19.45 ?  454  ILE A HG23 1  
ATOM   7124   H HD11 . ILE A 1 461 ? 5.763   6.695   -37.978 0.02 19.29 ?  454  ILE A HD11 1  
ATOM   7125   H HD12 . ILE A 1 461 ? 6.282   7.476   -36.698 0.02 19.05 ?  454  ILE A HD12 1  
ATOM   7126   H HD13 . ILE A 1 461 ? 4.881   7.849   -37.341 0.02 19.47 ?  454  ILE A HD13 1  
ATOM   7127   N N    . ASN A 1 462 ? 9.340   9.279   -36.653 0.02 18.40 ?  455  ASN A N    1  
ATOM   7128   C CA   . ASN A 1 462 ? 10.369  8.319   -36.299 0.02 18.19 ?  455  ASN A CA   1  
ATOM   7129   C C    . ASN A 1 462 ? 9.808   7.297   -35.328 0.02 18.19 ?  455  ASN A C    1  
ATOM   7130   O O    . ASN A 1 462 ? 8.704   7.461   -34.797 0.02 18.31 ?  455  ASN A O    1  
ATOM   7131   C CB   . ASN A 1 462 ? 11.627  9.010   -35.731 0.02 17.90 ?  455  ASN A CB   1  
ATOM   7132   C CG   . ASN A 1 462 ? 11.500  9.471   -34.283 0.02 17.74 ?  455  ASN A CG   1  
ATOM   7133   O OD1  . ASN A 1 462 ? 11.325  8.669   -33.372 0.02 17.68 ?  455  ASN A OD1  1  
ATOM   7134   N ND2  . ASN A 1 462 ? 11.707  10.756  -34.067 0.02 17.68 ?  455  ASN A ND2  1  
ATOM   7135   H H    . ASN A 1 462 ? 8.868   9.552   -35.991 0.02 18.38 ?  455  ASN A H    1  
ATOM   7136   H HA   . ASN A 1 462 ? 10.633  7.861   -37.108 0.02 18.27 ?  455  ASN A HA   1  
ATOM   7137   H HB2  . ASN A 1 462 ? 12.375  8.399   -35.789 0.02 17.80 ?  455  ASN A HB2  1  
ATOM   7138   H HB3  . ASN A 1 462 ? 11.804  9.800   -36.263 0.02 17.93 ?  455  ASN A HB3  1  
ATOM   7139   H HD21 . ASN A 1 462 ? 11.560  11.092  -33.291 0.02 17.61 ?  455  ASN A HD21 1  
ATOM   7140   H HD22 . ASN A 1 462 ? 11.984  11.261  -34.703 0.02 17.74 ?  455  ASN A HD22 1  
ATOM   7141   N N    . PRO A 1 463 ? 10.520  6.199   -35.133 0.02 18.09 ?  456  PRO A N    1  
ATOM   7142   C CA   . PRO A 1 463 ? 9.956   5.056   -34.417 0.02 18.16 ?  456  PRO A CA   1  
ATOM   7143   C C    . PRO A 1 463 ? 9.632   5.300   -32.957 0.02 18.04 ?  456  PRO A C    1  
ATOM   7144   O O    . PRO A 1 463 ? 8.865   4.505   -32.405 0.02 18.17 ?  456  PRO A O    1  
ATOM   7145   C CB   . PRO A 1 463 ? 11.055  4.012   -34.555 0.02 18.06 ?  456  PRO A CB   1  
ATOM   7146   C CG   . PRO A 1 463 ? 11.687  4.368   -35.868 0.02 18.10 ?  456  PRO A CG   1  
ATOM   7147   C CD   . PRO A 1 463 ? 11.739  5.824   -35.869 0.02 18.00 ?  456  PRO A CD   1  
ATOM   7148   H HA   . PRO A 1 463 ? 9.159   4.744   -34.867 0.02 18.37 ?  456  PRO A HA   1  
ATOM   7149   H HB2  . PRO A 1 463 ? 11.688  4.102   -33.830 0.02 17.86 ?  456  PRO A HB2  1  
ATOM   7150   H HB3  . PRO A 1 463 ? 10.665  3.126   -34.576 0.02 18.19 ?  456  PRO A HB3  1  
ATOM   7151   H HG2  . PRO A 1 463 ? 12.579  3.990   -35.920 0.02 18.00 ?  456  PRO A HG2  1  
ATOM   7152   H HG3  . PRO A 1 463 ? 11.124  4.043   -36.585 0.02 18.31 ?  456  PRO A HG3  1  
ATOM   7153   H HD2  . PRO A 1 463 ? 12.523  6.135   -35.394 0.02 17.81 ?  456  PRO A HD2  1  
ATOM   7154   H HD3  . PRO A 1 463 ? 11.719  6.142   -36.780 0.02 18.11 ?  456  PRO A HD3  1  
ATOM   7155   N N    . TYR A 1 464 ? 10.227  6.308   -32.308 0.02 17.82 ?  457  TYR A N    1  
ATOM   7156   C CA   . TYR A 1 464 ? 9.806   6.639   -30.949 0.02 17.76 ?  457  TYR A CA   1  
ATOM   7157   C C    . TYR A 1 464 ? 8.317   6.955   -30.919 0.02 18.01 ?  457  TYR A C    1  
ATOM   7158   O O    . TYR A 1 464 ? 7.631   6.644   -29.936 0.02 18.08 ?  457  TYR A O    1  
ATOM   7159   C CB   . TYR A 1 464 ? 10.611  7.814   -30.382 0.02 17.54 ?  457  TYR A CB   1  
ATOM   7160   C CG   . TYR A 1 464 ? 12.019  7.524   -29.834 0.02 17.30 ?  457  TYR A CG   1  
ATOM   7161   C CD1  . TYR A 1 464 ? 13.159  8.035   -30.458 0.02 17.17 ?  457  TYR A CD1  1  
ATOM   7162   C CD2  . TYR A 1 464 ? 12.197  6.819   -28.666 0.02 17.22 ?  457  TYR A CD2  1  
ATOM   7163   C CE1  . TYR A 1 464 ? 14.428  7.805   -29.946 0.02 16.98 ?  457  TYR A CE1  1  
ATOM   7164   C CE2  . TYR A 1 464 ? 13.467  6.598   -28.148 0.02 17.03 ?  457  TYR A CE2  1  
ATOM   7165   C CZ   . TYR A 1 464 ? 14.578  7.083   -28.802 0.02 16.91 ?  457  TYR A CZ   1  
ATOM   7166   O OH   . TYR A 1 464 ? 15.855  6.863   -28.296 0.02 16.74 ?  457  TYR A OH   1  
ATOM   7167   H H    . TYR A 1 464 ? 10.848  6.805   -32.626 0.02 17.72 ?  457  TYR A H    1  
ATOM   7168   H HA   . TYR A 1 464 ? 9.985   5.894   -30.378 0.02 17.72 ?  457  TYR A HA   1  
ATOM   7169   H HB2  . TYR A 1 464 ? 10.708  8.476   -31.081 0.02 17.56 ?  457  TYR A HB2  1  
ATOM   7170   H HB3  . TYR A 1 464 ? 10.097  8.198   -29.655 0.02 17.56 ?  457  TYR A HB3  1  
ATOM   7171   H HD1  . TYR A 1 464 ? 13.069  8.520   -31.245 0.02 17.24 ?  457  TYR A HD1  1  
ATOM   7172   H HD2  . TYR A 1 464 ? 11.455  6.496   -28.219 0.02 17.31 ?  457  TYR A HD2  1  
ATOM   7173   H HE1  . TYR A 1 464 ? 15.179  8.131   -30.384 0.02 16.92 ?  457  TYR A HE1  1  
ATOM   7174   H HE2  . TYR A 1 464 ? 13.569  6.110   -27.365 0.02 16.99 ?  457  TYR A HE2  1  
ATOM   7175   H HH   . TYR A 1 464 ? 16.426  7.002   -28.895 0.02 16.70 ?  457  TYR A HH   1  
ATOM   7176   N N    . ARG A 1 465 ? 7.780   7.508   -32.009 0.02 18.19 ?  458  ARG A N    1  
ATOM   7177   C CA   . ARG A 1 465 ? 6.354   7.802   -32.046 0.02 18.47 ?  458  ARG A CA   1  
ATOM   7178   C C    . ARG A 1 465 ? 5.530   6.517   -32.067 0.02 18.70 ?  458  ARG A C    1  
ATOM   7179   O O    . ARG A 1 465 ? 4.394   6.518   -31.581 0.02 18.89 ?  458  ARG A O    1  
ATOM   7180   C CB   . ARG A 1 465 ? 6.031   8.711   -33.238 0.02 18.65 ?  458  ARG A CB   1  
ATOM   7181   C CG   . ARG A 1 465 ? 4.530   9.006   -33.459 0.02 18.98 ?  458  ARG A CG   1  
ATOM   7182   C CD   . ARG A 1 465 ? 4.321   10.111  -34.484 0.02 19.12 ?  458  ARG A CD   1  
ATOM   7183   N NE   . ARG A 1 465 ? 5.060   11.325  -34.120 0.02 18.89 ?  458  ARG A NE   1  
ATOM   7184   C CZ   . ARG A 1 465 ? 4.712   12.578  -34.422 0.02 18.99 ?  458  ARG A CZ   1  
ATOM   7185   N NH1  . ARG A 1 465 ? 3.609   12.866  -35.110 0.02 19.32 ?  458  ARG A NH1  1  
ATOM   7186   N NH2  . ARG A 1 465 ? 5.481   13.570  -34.014 0.02 18.79 ?  458  ARG A NH2  1  
ATOM   7187   H H    . ARG A 1 465 ? 8.209   7.723   -32.722 0.02 18.17 ?  458  ARG A H    1  
ATOM   7188   H HA   . ARG A 1 465 ? 6.115   8.287   -31.244 0.02 18.44 ?  458  ARG A HA   1  
ATOM   7189   H HB2  . ARG A 1 465 ? 6.478   9.553   -33.085 0.02 18.52 ?  458  ARG A HB2  1  
ATOM   7190   H HB3  . ARG A 1 465 ? 6.380   8.306   -34.046 0.02 18.69 ?  458  ARG A HB3  1  
ATOM   7191   H HG2  . ARG A 1 465 ? 4.096   8.205   -33.793 0.02 19.16 ?  458  ARG A HG2  1  
ATOM   7192   H HG3  . ARG A 1 465 ? 4.125   9.280   -32.623 0.02 18.96 ?  458  ARG A HG3  1  
ATOM   7193   H HD2  . ARG A 1 465 ? 4.635   9.808   -35.349 0.02 19.16 ?  458  ARG A HD2  1  
ATOM   7194   H HD3  . ARG A 1 465 ? 3.378   10.326  -34.534 0.02 19.33 ?  458  ARG A HD3  1  
ATOM   7195   H HE   . ARG A 1 465 ? 5.756   11.228  -33.634 0.02 18.68 ?  458  ARG A HE   1  
ATOM   7196   H HH11 . ARG A 1 465 ? 3.091   12.236  -35.381 0.02 19.48 ?  458  ARG A HH11 1  
ATOM   7197   H HH12 . ARG A 1 465 ? 3.414   13.685  -35.284 0.02 19.40 ?  458  ARG A HH12 1  
ATOM   7198   H HH21 . ARG A 1 465 ? 6.196   13.402  -33.568 0.02 18.59 ?  458  ARG A HH21 1  
ATOM   7199   H HH22 . ARG A 1 465 ? 5.270   14.382  -34.201 0.02 18.87 ?  458  ARG A HH22 1  
ATOM   7200   N N    . ILE A 1 466 ? 6.107   5.416   -32.556 0.02 18.70 ?  459  ILE A N    1  
ATOM   7201   C CA   . ILE A 1 466 ? 5.424   4.129   -32.591 0.02 18.94 ?  459  ILE A CA   1  
ATOM   7202   C C    . ILE A 1 466 ? 5.484   3.441   -31.231 0.02 18.84 ?  459  ILE A C    1  
ATOM   7203   O O    . ILE A 1 466 ? 4.469   2.934   -30.734 0.02 19.04 ?  459  ILE A O    1  
ATOM   7204   C CB   . ILE A 1 466 ? 6.033   3.271   -33.721 0.02 19.02 ?  459  ILE A CB   1  
ATOM   7205   C CG1  . ILE A 1 466 ? 5.736   3.913   -35.076 0.02 19.16 ?  459  ILE A CG1  1  
ATOM   7206   C CG2  . ILE A 1 466 ? 5.574   1.811   -33.681 0.02 19.31 ?  459  ILE A CG2  1  
ATOM   7207   C CD1  . ILE A 1 466 ? 4.292   4.299   -35.265 0.02 19.56 ?  459  ILE A CD1  1  
ATOM   7208   H H    . ILE A 1 466 ? 6.904   5.388   -32.874 0.02 18.58 ?  459  ILE A H    1  
ATOM   7209   H HA   . ILE A 1 466 ? 4.481   4.266   -32.739 0.02 19.16 ?  459  ILE A HA   1  
ATOM   7210   H HB   . ILE A 1 466 ? 6.997   3.280   -33.604 0.02 18.82 ?  459  ILE A HB   1  
ATOM   7211   H HG12 . ILE A 1 466 ? 6.273   4.716   -35.157 0.02 19.02 ?  459  ILE A HG12 1  
ATOM   7212   H HG13 . ILE A 1 466 ? 5.968   3.289   -35.782 0.02 19.15 ?  459  ILE A HG13 1  
ATOM   7213   H HG21 . ILE A 1 466 ? 4.641   1.772   -33.419 0.02 19.47 ?  459  ILE A HG21 1  
ATOM   7214   H HG22 . ILE A 1 466 ? 5.686   1.432   -34.568 0.02 19.46 ?  459  ILE A HG22 1  
ATOM   7215   H HG23 . ILE A 1 466 ? 6.117   1.320   -33.045 0.02 19.20 ?  459  ILE A HG23 1  
ATOM   7216   H HD11 . ILE A 1 466 ? 4.226   4.838   -36.068 0.02 19.65 ?  459  ILE A HD11 1  
ATOM   7217   H HD12 . ILE A 1 466 ? 3.765   3.489   -35.365 0.02 19.72 ?  459  ILE A HD12 1  
ATOM   7218   H HD13 . ILE A 1 466 ? 3.964   4.820   -34.523 0.02 19.56 ?  459  ILE A HD13 1  
ATOM   7219   N N    . MET A 1 467 ? 6.664   3.424   -30.595 0.02 18.54 ?  460  MET A N    1  
ATOM   7220   C CA   . MET A 1 467 ? 6.757   2.805   -29.270 0.02 18.46 ?  460  MET A CA   1  
ATOM   7221   C C    . MET A 1 467 ? 5.773   3.428   -28.297 0.02 18.54 ?  460  MET A C    1  
ATOM   7222   O O    . MET A 1 467 ? 5.250   2.731   -27.425 0.02 18.66 ?  460  MET A O    1  
ATOM   7223   C CB   . MET A 1 467 ? 8.186   2.864   -28.678 0.02 18.14 ?  460  MET A CB   1  
ATOM   7224   C CG   . MET A 1 467 ? 9.042   4.150   -28.843 0.02 17.90 ?  460  MET A CG   1  
ATOM   7225   S SD   . MET A 1 467 ? 10.627  4.305   -27.829 0.02 17.57 ?  460  MET A SD   1  
ATOM   7226   C CE   . MET A 1 467 ? 10.091  3.362   -26.468 0.02 17.61 ?  460  MET A CE   1  
ATOM   7227   H H    . MET A 1 467 ? 7.396   3.752   -30.899 0.02 18.40 ?  460  MET A H    1  
ATOM   7228   H HA   . MET A 1 467 ? 6.525   1.868   -29.357 0.02 18.62 ?  460  MET A HA   1  
ATOM   7229   H HB2  . MET A 1 467 ? 8.075   2.714   -27.728 0.02 18.08 ?  460  MET A HB2  1  
ATOM   7230   H HB3  . MET A 1 467 ? 8.700   2.133   -29.058 0.02 18.16 ?  460  MET A HB3  1  
ATOM   7231   H HG2  . MET A 1 467 ? 9.301   4.158   -29.777 0.02 17.87 ?  460  MET A HG2  1  
ATOM   7232   H HG3  . MET A 1 467 ? 8.482   4.917   -28.643 0.02 17.98 ?  460  MET A HG3  1  
ATOM   7233   H HE1  . MET A 1 467 ? 9.269   3.742   -26.129 0.02 17.71 ?  460  MET A HE1  1  
ATOM   7234   H HE2  . MET A 1 467 ? 9.946   2.451   -26.763 0.02 17.70 ?  460  MET A HE2  1  
ATOM   7235   H HE3  . MET A 1 467 ? 10.777  3.373   -25.783 0.02 17.45 ?  460  MET A HE3  1  
ATOM   7236   N N    . ARG A 1 468 ? 5.498   4.728   -28.441 0.02 18.52 ?  461  ARG A N    1  
ATOM   7237   C CA   . ARG A 1 468 ? 4.681   5.482   -27.491 0.02 18.58 ?  461  ARG A CA   1  
ATOM   7238   C C    . ARG A 1 468 ? 3.210   5.588   -27.885 0.02 18.94 ?  461  ARG A C    1  
ATOM   7239   O O    . ARG A 1 468 ? 2.424   6.178   -27.136 0.02 19.05 ?  461  ARG A O    1  
ATOM   7240   C CB   . ARG A 1 468 ? 5.259   6.903   -27.280 0.02 18.37 ?  461  ARG A CB   1  
ATOM   7241   C CG   . ARG A 1 468 ? 5.123   7.968   -28.424 0.02 18.45 ?  461  ARG A CG   1  
ATOM   7242   C CD   . ARG A 1 468 ? 5.833   9.340   -28.053 0.02 18.23 ?  461  ARG A CD   1  
ATOM   7243   N NE   . ARG A 1 468 ? 5.902   10.356  -29.110 0.02 18.27 ?  461  ARG A NE   1  
ATOM   7244   C CZ   . ARG A 1 468 ? 6.890   10.475  -29.984 0.02 18.16 ?  461  ARG A CZ   1  
ATOM   7245   N NH1  . ARG A 1 468 ? 7.908   9.635   -29.936 0.02 18.00 ?  461  ARG A NH1  1  
ATOM   7246   N NH2  . ARG A 1 468 ? 6.847   11.433  -30.916 0.02 18.25 ?  461  ARG A NH2  1  
ATOM   7247   H H    . ARG A 1 468 ? 5.778   5.205   -29.096 0.02 18.49 ?  461  ARG A H    1  
ATOM   7248   H HA   . ARG A 1 468 ? 4.716   5.027   -26.635 0.02 18.53 ?  461  ARG A HA   1  
ATOM   7249   H HB2  . ARG A 1 468 ? 4.812   7.277   -26.507 0.02 18.38 ?  461  ARG A HB2  1  
ATOM   7250   H HB3  . ARG A 1 468 ? 6.205   6.817   -27.087 0.02 18.16 ?  461  ARG A HB3  1  
ATOM   7251   H HG2  . ARG A 1 468 ? 5.534   7.621   -29.229 0.02 18.46 ?  461  ARG A HG2  1  
ATOM   7252   H HG3  . ARG A 1 468 ? 4.184   8.145   -28.585 0.02 18.66 ?  461  ARG A HG3  1  
ATOM   7253   H HD2  . ARG A 1 468 ? 5.337   9.736   -27.326 0.02 18.27 ?  461  ARG A HD2  1  
ATOM   7254   H HD3  . ARG A 1 468 ? 6.738   9.151   -27.758 0.02 18.04 ?  461  ARG A HD3  1  
ATOM   7255   H HE   . ARG A 1 468 ? 5.490   11.089  -28.935 0.02 18.40 ?  461  ARG A HE   1  
ATOM   7256   H HH11 . ARG A 1 468 ? 7.932   9.019   -29.343 0.02 17.95 ?  461  ARG A HH11 1  
ATOM   7257   H HH12 . ARG A 1 468 ? 8.551   9.708   -30.504 0.02 17.94 ?  461  ARG A HH12 1  
ATOM   7258   H HH21 . ARG A 1 468 ? 6.189   11.975  -30.946 0.02 18.38 ?  461  ARG A HH21 1  
ATOM   7259   H HH22 . ARG A 1 468 ? 7.493   11.511  -31.485 0.02 18.20 ?  461  ARG A HH22 1  
ATOM   7260   N N    . SER A 1 469 ? 2.786   5.024   -29.014 0.02 19.16 ?  462  SER A N    1  
ATOM   7261   C CA   . SER A 1 469 ? 1.404   5.197   -29.458 0.02 19.54 ?  462  SER A CA   1  
ATOM   7262   C C    . SER A 1 469 ? 1.073   6.676   -29.667 0.02 19.56 ?  462  SER A C    1  
ATOM   7263   O O    . SER A 1 469 ? 0.028   7.161   -29.231 0.02 19.78 ?  462  SER A O    1  
ATOM   7264   C CB   . SER A 1 469 ? 0.427   4.568   -28.454 0.02 19.78 ?  462  SER A CB   1  
ATOM   7265   O OG   . SER A 1 469 ? -0.014  3.298   -28.880 0.02 20.02 ?  462  SER A OG   1  
ATOM   7266   H H    . SER A 1 469 ? 3.274   4.545   -29.534 0.02 19.12 ?  462  SER A H    1  
ATOM   7267   H HA   . SER A 1 469 ? 1.288   4.744   -30.307 0.02 19.68 ?  462  SER A HA   1  
ATOM   7268   H HB2  . SER A 1 469 ? 0.868   4.464   -27.596 0.02 19.62 ?  462  SER A HB2  1  
ATOM   7269   H HB3  . SER A 1 469 ? -0.350  5.137   -28.351 0.02 19.96 ?  462  SER A HB3  1  
ATOM   7270   H HG   . SER A 1 469 ? -0.247  2.841   -28.217 0.02 20.19 ?  462  SER A HG   1  
ATOM   7271   N N    . GLY A 1 470 ? 1.969   7.405   -30.343 0.02 19.36 ?  463  GLY A N    1  
ATOM   7272   C CA   . GLY A 1 470 ? 1.878   8.851   -30.430 0.02 19.36 ?  463  GLY A CA   1  
ATOM   7273   C C    . GLY A 1 470 ? 1.417   9.393   -31.764 0.02 19.58 ?  463  GLY A C    1  
ATOM   7274   O O    . GLY A 1 470 ? 1.552   10.592  -32.028 0.02 19.58 ?  463  GLY A O    1  
ATOM   7275   H H    . GLY A 1 470 ? 2.640   7.075   -30.767 0.02 19.23 ?  463  GLY A H    1  
ATOM   7276   H HA2  . GLY A 1 470 ? 1.270   9.175   -29.748 0.02 19.46 ?  463  GLY A HA2  1  
ATOM   7277   H HA3  . GLY A 1 470 ? 2.753   9.229   -30.256 0.02 19.12 ?  463  GLY A HA3  1  
ATOM   7278   N N    . ARG A 1 471 ? 0.918   8.509   -32.624 0.02 19.80 ?  464  ARG A N    1  
ATOM   7279   C CA   . ARG A 1 471 ? 0.360   8.933   -33.893 0.02 20.08 ?  464  ARG A CA   1  
ATOM   7280   C C    . ARG A 1 471 ? -0.845  9.825   -33.640 0.02 20.37 ?  464  ARG A C    1  
ATOM   7281   O O    . ARG A 1 471 ? -1.523  9.709   -32.617 0.02 20.48 ?  464  ARG A O    1  
ATOM   7282   C CB   . ARG A 1 471 ? -0.049  7.718   -34.734 0.02 20.32 ?  464  ARG A CB   1  
ATOM   7283   C CG   . ARG A 1 471 ? 0.702   7.519   -36.066 0.02 20.13 ?  464  ARG A CG   1  
ATOM   7284   C CD   . ARG A 1 471 ? 0.968   6.015   -36.318 0.02 20.27 ?  464  ARG A CD   1  
ATOM   7285   N NE   . ARG A 1 471 ? 0.743   5.578   -37.694 0.02 20.61 ?  464  ARG A NE   1  
ATOM   7286   C CZ   . ARG A 1 471 ? 1.451   4.632   -38.322 0.02 20.66 ?  464  ARG A CZ   1  
ATOM   7287   N NH1  . ARG A 1 471 ? 2.429   3.988   -37.711 0.02 20.39 ?  464  ARG A NH1  1  
ATOM   7288   N NH2  . ARG A 1 471 ? 1.170   4.325   -39.584 0.02 21.01 ?  464  ARG A NH2  1  
ATOM   7289   H H    . ARG A 1 471 ? 0.897   7.662   -32.495 0.02 19.82 ?  464  ARG A H    1  
ATOM   7290   H HA   . ARG A 1 471 ? 1.020   9.445   -34.389 0.02 19.95 ?  464  ARG A HA   1  
ATOM   7291   H HB2  . ARG A 1 471 ? 0.075   6.923   -34.196 0.02 20.36 ?  464  ARG A HB2  1  
ATOM   7292   H HB3  . ARG A 1 471 ? -0.990  7.814   -34.952 0.02 20.59 ?  464  ARG A HB3  1  
ATOM   7293   H HG2  . ARG A 1 471 ? 0.170   7.866   -36.796 0.02 20.24 ?  464  ARG A HG2  1  
ATOM   7294   H HG3  . ARG A 1 471 ? 1.558   7.974   -36.028 0.02 19.85 ?  464  ARG A HG3  1  
ATOM   7295   H HD2  . ARG A 1 471 ? 1.895   5.832   -36.101 0.02 20.04 ?  464  ARG A HD2  1  
ATOM   7296   H HD3  . ARG A 1 471 ? 0.383   5.494   -35.748 0.02 20.37 ?  464  ARG A HD3  1  
ATOM   7297   H HE   . ARG A 1 471 ? -0.036  5.743   -38.019 0.02 20.84 ?  464  ARG A HE   1  
ATOM   7298   H HH11 . ARG A 1 471 ? 2.612   4.169   -36.900 0.02 20.18 ?  464  ARG A HH11 1  
ATOM   7299   H HH12 . ARG A 1 471 ? 2.866   3.374   -38.124 0.02 20.44 ?  464  ARG A HH12 1  
ATOM   7300   H HH21 . ARG A 1 471 ? 0.538   4.736   -39.998 0.02 21.20 ?  464  ARG A HH21 1  
ATOM   7301   H HH22 . ARG A 1 471 ? 1.619   3.712   -39.989 0.02 21.06 ?  464  ARG A HH22 1  
ATOM   7302   N N    . GLY A 1 472 ? -1.086  10.735  -34.569 0.02 20.51 ?  465  GLY A N    1  
ATOM   7303   C CA   . GLY A 1 472 ? -2.282  11.552  -34.558 0.02 20.84 ?  465  GLY A CA   1  
ATOM   7304   C C    . GLY A 1 472 ? -2.394  12.494  -33.386 0.02 20.71 ?  465  GLY A C    1  
ATOM   7305   O O    . GLY A 1 472 ? -3.511  12.827  -32.997 0.02 20.99 ?  465  GLY A O    1  
ATOM   7306   H H    . GLY A 1 472 ? -0.556  10.899  -35.226 0.02 20.43 ?  465  GLY A H    1  
ATOM   7307   H HA2  . GLY A 1 472 ? -2.313  12.083  -35.370 0.02 20.96 ?  465  GLY A HA2  1  
ATOM   7308   H HA3  . GLY A 1 472 ? -3.057  10.970  -34.551 0.02 21.07 ?  465  GLY A HA3  1  
ATOM   7309   N N    . VAL A 1 473 ? -1.278  12.960  -32.837 0.02 20.32 ?  466  VAL A N    1  
ATOM   7310   C CA   . VAL A 1 473 ? -1.289  13.744  -31.606 0.02 20.20 ?  466  VAL A CA   1  
ATOM   7311   C C    . VAL A 1 473 ? -0.462  14.998  -31.831 0.02 20.04 ?  466  VAL A C    1  
ATOM   7312   O O    . VAL A 1 473 ? 0.752   14.931  -32.041 0.02 19.82 ?  466  VAL A O    1  
ATOM   7313   C CB   . VAL A 1 473 ? -0.781  12.947  -30.402 0.02 19.92 ?  466  VAL A CB   1  
ATOM   7314   C CG1  . VAL A 1 473 ? -0.385  13.893  -29.253 0.02 19.74 ?  466  VAL A CG1  1  
ATOM   7315   C CG2  . VAL A 1 473 ? -1.877  11.940  -29.955 0.02 20.16 ?  466  VAL A CG2  1  
ATOM   7316   H H    . VAL A 1 473 ? -0.497  12.841  -33.172 0.02 20.13 ?  466  VAL A H    1  
ATOM   7317   H HA   . VAL A 1 473 ? -2.197  14.019  -31.406 0.02 20.43 ?  466  VAL A HA   1  
ATOM   7318   H HB   . VAL A 1 473 ? 0.006   12.440  -30.657 0.02 19.73 ?  466  VAL A HB   1  
ATOM   7319   H HG11 . VAL A 1 473 ? -0.634  13.480  -28.412 0.02 19.66 ?  466  VAL A HG11 1  
ATOM   7320   H HG12 . VAL A 1 473 ? 0.576   14.032  -29.277 0.02 19.53 ?  466  VAL A HG12 1  
ATOM   7321   H HG13 . VAL A 1 473 ? -0.844  14.742  -29.336 0.02 19.92 ?  466  VAL A HG13 1  
ATOM   7322   H HG21 . VAL A 1 473 ? -1.605  11.518  -29.126 0.02 20.00 ?  466  VAL A HG21 1  
ATOM   7323   H HG22 . VAL A 1 473 ? -2.708  12.420  -29.823 0.02 20.38 ?  466  VAL A HG22 1  
ATOM   7324   H HG23 . VAL A 1 473 ? -1.989  11.269  -30.645 0.02 20.27 ?  466  VAL A HG23 1  
ATOM   7325   N N    . LYS A 1 474 ? -1.135  16.132  -31.710 0.02 20.19 ?  467  LYS A N    1  
ATOM   7326   C CA   . LYS A 1 474 ? -0.622  17.431  -32.083 0.02 20.17 ?  467  LYS A CA   1  
ATOM   7327   C C    . LYS A 1 474 ? 0.313   17.964  -31.005 0.02 19.87 ?  467  LYS A C    1  
ATOM   7328   O O    . LYS A 1 474 ? 0.049   17.833  -29.805 0.02 19.84 ?  467  LYS A O    1  
ATOM   7329   C CB   . LYS A 1 474 ? -1.797  18.394  -32.302 0.02 20.58 ?  467  LYS A CB   1  
ATOM   7330   C CG   . LYS A 1 474 ? -3.044  17.760  -32.970 0.02 20.94 ?  467  LYS A CG   1  
ATOM   7331   C CD   . LYS A 1 474 ? -2.990  17.851  -34.476 0.02 21.17 ?  467  LYS A CD   1  
ATOM   7332   C CE   . LYS A 1 474 ? -3.806  19.067  -34.997 0.02 21.52 ?  467  LYS A CE   1  
ATOM   7333   N NZ   . LYS A 1 474 ? -3.152  20.389  -34.616 0.02 21.33 ?  467  LYS A NZ   1  
ATOM   7334   H H    . LYS A 1 474 ? -1.924  16.172  -31.373 0.02 20.32 ?  467  LYS A H    1  
ATOM   7335   H HA   . LYS A 1 474 ? -0.121  17.358  -32.910 0.02 20.12 ?  467  LYS A HA   1  
ATOM   7336   H HB2  . LYS A 1 474 ? -2.078  18.741  -31.441 0.02 20.61 ?  467  LYS A HB2  1  
ATOM   7337   H HB3  . LYS A 1 474 ? -1.500  19.128  -32.863 0.02 20.61 ?  467  LYS A HB3  1  
ATOM   7338   H HG2  . LYS A 1 474 ? -3.138  16.826  -32.737 0.02 20.85 ?  467  LYS A HG2  1  
ATOM   7339   H HG3  . LYS A 1 474 ? -3.833  18.242  -32.676 0.02 21.15 ?  467  LYS A HG3  1  
ATOM   7340   H HD2  . LYS A 1 474 ? -2.066  17.965  -34.750 0.02 20.97 ?  467  LYS A HD2  1  
ATOM   7341   H HD3  . LYS A 1 474 ? -3.359  17.042  -34.865 0.02 21.32 ?  467  LYS A HD3  1  
ATOM   7342   H HE2  . LYS A 1 474 ? -3.861  19.026  -35.963 0.02 21.74 ?  467  LYS A HE2  1  
ATOM   7343   H HE3  . LYS A 1 474 ? -4.696  19.047  -34.615 0.02 21.66 ?  467  LYS A HE3  1  
ATOM   7344   H HZ1  . LYS A 1 474 ? -3.696  21.066  -34.811 0.02 21.54 ?  467  LYS A HZ1  1  
ATOM   7345   H HZ2  . LYS A 1 474 ? -2.974  20.402  -33.744 0.02 21.15 ?  467  LYS A HZ2  1  
ATOM   7346   H HZ3  . LYS A 1 474 ? -2.390  20.494  -35.067 0.02 21.19 ?  467  LYS A HZ3  1  
ATOM   7347   N N    . GLY A 1 475 ? 1.403   18.577  -31.447 0.02 19.68 ?  468  GLY A N    1  
ATOM   7348   C CA   . GLY A 1 475 ? 2.407   19.124  -30.555 0.02 19.40 ?  468  GLY A CA   1  
ATOM   7349   C C    . GLY A 1 475 ? 3.725   18.392  -30.671 0.02 19.07 ?  468  GLY A C    1  
ATOM   7350   O O    . GLY A 1 475 ? 3.817   17.325  -31.294 0.02 19.03 ?  468  GLY A O    1  
ATOM   7351   H H    . GLY A 1 475 ? 1.579   18.693  -32.278 0.02 19.72 ?  468  GLY A H    1  
ATOM   7352   H HA2  . GLY A 1 475 ? 2.562   20.054  -30.784 0.02 19.46 ?  468  GLY A HA2  1  
ATOM   7353   H HA3  . GLY A 1 475 ? 2.098   19.084  -29.638 0.02 19.39 ?  468  GLY A HA3  1  
ATOM   7354   N N    . VAL A 1 476 ? 4.766   18.960  -30.075 0.02 18.85 ?  469  VAL A N    1  
ATOM   7355   C CA   . VAL A 1 476 ? 6.109   18.453  -30.288 0.02 18.56 ?  469  VAL A CA   1  
ATOM   7356   C C    . VAL A 1 476 ? 6.649   17.804  -29.021 0.02 18.32 ?  469  VAL A C    1  
ATOM   7357   O O    . VAL A 1 476 ? 7.219   18.463  -28.139 0.02 18.22 ?  469  VAL A O    1  
ATOM   7358   C CB   . VAL A 1 476 ? 7.040   19.559  -30.792 0.02 18.54 ?  469  VAL A CB   1  
ATOM   7359   C CG1  . VAL A 1 476 ? 8.353   18.950  -31.214 0.02 18.30 ?  469  VAL A CG1  1  
ATOM   7360   C CG2  . VAL A 1 476 ? 6.410   20.262  -31.985 0.02 18.83 ?  469  VAL A CG2  1  
ATOM   7361   H H    . VAL A 1 476 ? 4.722   19.645  -29.557 0.02 18.88 ?  469  VAL A H    1  
ATOM   7362   H HA   . VAL A 1 476 ? 6.077   17.765  -30.967 0.02 18.57 ?  469  VAL A HA   1  
ATOM   7363   H HB   . VAL A 1 476 ? 7.206   20.204  -30.088 0.02 18.52 ?  469  VAL A HB   1  
ATOM   7364   H HG11 . VAL A 1 476 ? 8.909   19.648  -31.592 0.02 18.29 ?  469  VAL A HG11 1  
ATOM   7365   H HG12 . VAL A 1 476 ? 8.783   18.557  -30.437 0.02 18.13 ?  469  VAL A HG12 1  
ATOM   7366   H HG13 . VAL A 1 476 ? 8.172   18.261  -31.871 0.02 18.35 ?  469  VAL A HG13 1  
ATOM   7367   H HG21 . VAL A 1 476 ? 6.908   21.072  -32.166 0.02 18.84 ?  469  VAL A HG21 1  
ATOM   7368   H HG22 . VAL A 1 476 ? 6.449   19.667  -32.751 0.02 18.85 ?  469  VAL A HG22 1  
ATOM   7369   H HG23 . VAL A 1 476 ? 5.486   20.489  -31.793 0.02 19.00 ?  469  VAL A HG23 1  
ATOM   7370   N N    . SER A 1 477 ? 6.523   16.484  -28.995 0.02 18.26 ?  470  SER A N    1  
ATOM   7371   C CA   . SER A 1 477 ? 6.943   15.614  -27.916 0.02 18.07 ?  470  SER A CA   1  
ATOM   7372   C C    . SER A 1 477 ? 8.453   15.507  -27.854 0.02 17.80 ?  470  SER A C    1  
ATOM   7373   O O    . SER A 1 477 ? 9.172   15.713  -28.839 0.02 17.75 ?  470  SER A O    1  
ATOM   7374   C CB   . SER A 1 477 ? 6.382   14.217  -28.129 0.02 18.13 ?  470  SER A CB   1  
ATOM   7375   O OG   . SER A 1 477 ? 6.547   13.879  -29.502 0.02 18.16 ?  470  SER A OG   1  
ATOM   7376   H H    . SER A 1 477 ? 6.166   16.045  -29.641 0.02 18.35 ?  470  SER A H    1  
ATOM   7377   H HA   . SER A 1 477 ? 6.612   15.956  -27.072 0.02 18.10 ?  470  SER A HA   1  
ATOM   7378   H HB2  . SER A 1 477 ? 6.847   13.580  -27.568 0.02 18.00 ?  470  SER A HB2  1  
ATOM   7379   H HB3  . SER A 1 477 ? 5.429   14.211  -27.924 0.02 18.31 ?  470  SER A HB3  1  
ATOM   7380   H HG   . SER A 1 477 ? 6.914   13.129  -29.552 0.02 18.05 ?  470  SER A HG   1  
ATOM   7381   N N    . HIS A 1 478 ? 8.931   15.137  -26.671 0.02 17.64 ?  471  HIS A N    1  
ATOM   7382   C CA   . HIS A 1 478 ? 10.227  14.489  -26.533 0.02 17.41 ?  471  HIS A CA   1  
ATOM   7383   C C    . HIS A 1 478 ? 10.435  13.493  -27.673 0.02 17.39 ?  471  HIS A C    1  
ATOM   7384   O O    . HIS A 1 478 ? 9.582   12.639  -27.928 0.02 17.52 ?  471  HIS A O    1  
ATOM   7385   C CB   . HIS A 1 478 ? 10.277  13.759  -25.186 0.02 17.33 ?  471  HIS A CB   1  
ATOM   7386   C CG   . HIS A 1 478 ? 11.624  13.198  -24.823 0.02 17.11 ?  471  HIS A CG   1  
ATOM   7387   N ND1  . HIS A 1 478 ? 12.731  13.992  -24.640 0.02 16.99 ?  471  HIS A ND1  1  
ATOM   7388   C CD2  . HIS A 1 478 ? 12.027  11.929  -24.581 0.02 17.02 ?  471  HIS A CD2  1  
ATOM   7389   C CE1  . HIS A 1 478 ? 13.766  13.235  -24.318 0.02 16.84 ?  471  HIS A CE1  1  
ATOM   7390   N NE2  . HIS A 1 478 ? 13.363  11.979  -24.259 0.02 16.85 ?  471  HIS A NE2  1  
ATOM   7391   H H    . HIS A 1 478 ? 8.518   15.255  -25.927 0.02 17.69 ?  471  HIS A H    1  
ATOM   7392   H HA   . HIS A 1 478 ? 10.931  15.152  -26.562 0.02 17.34 ?  471  HIS A HA   1  
ATOM   7393   H HB2  . HIS A 1 478 ? 10.014  14.382  -24.491 0.02 17.38 ?  471  HIS A HB2  1  
ATOM   7394   H HB3  . HIS A 1 478 ? 9.656   13.015  -25.215 0.02 17.40 ?  471  HIS A HB3  1  
ATOM   7395   H HD1  . HIS A 1 478 ? 12.750  14.846  -24.731 0.02 17.03 ?  471  HIS A HD1  1  
ATOM   7396   H HD2  . HIS A 1 478 ? 11.501  11.162  -24.615 0.02 17.08 ?  471  HIS A HD2  1  
ATOM   7397   H HE1  . HIS A 1 478 ? 14.626  13.538  -24.145 0.02 16.76 ?  471  HIS A HE1  1  
ATOM   7398   H HE2  . HIS A 1 478 ? 13.855  11.301  -24.073 0.02 16.77 ?  471  HIS A HE2  1  
ATOM   7399   N N    . THR A 1 479 ? 11.579  13.620  -28.347 0.02 17.26 ?  472  THR A N    1  
ATOM   7400   C CA   . THR A 1 479 ? 12.133  12.781  -29.419 0.02 17.23 ?  472  THR A CA   1  
ATOM   7401   C C    . THR A 1 479 ? 11.666  13.188  -30.799 0.02 17.41 ?  472  THR A C    1  
ATOM   7402   O O    . THR A 1 479 ? 12.119  12.589  -31.762 0.02 17.42 ?  472  THR A O    1  
ATOM   7403   C CB   . THR A 1 479 ? 11.852  11.268  -29.280 0.02 17.23 ?  472  THR A CB   1  
ATOM   7404   O OG1  . THR A 1 479 ? 10.480  10.966  -29.562 0.02 17.45 ?  472  THR A OG1  1  
ATOM   7405   C CG2  . THR A 1 479 ? 12.252  10.762  -27.910 0.02 17.10 ?  472  THR A CG2  1  
ATOM   7406   H H    . THR A 1 479 ? 12.105  14.279  -28.186 0.02 17.21 ?  472  THR A H    1  
ATOM   7407   H HA   . THR A 1 479 ? 13.095  12.887  -29.416 0.02 17.11 ?  472  THR A HA   1  
ATOM   7408   H HB   . THR A 1 479 ? 12.403  10.797  -29.923 0.02 17.20 ?  472  THR A HB   1  
ATOM   7409   H HG1  . THR A 1 479 ? 10.326  11.049  -30.383 0.02 17.54 ?  472  THR A HG1  1  
ATOM   7410   H HG21 . THR A 1 479 ? 12.259  9.795   -27.901 0.02 17.10 ?  472  THR A HG21 1  
ATOM   7411   H HG22 . THR A 1 479 ? 13.138  11.089  -27.697 0.02 16.97 ?  472  THR A HG22 1  
ATOM   7412   H HG23 . THR A 1 479 ? 11.631  11.082  -27.240 0.02 17.15 ?  472  THR A HG23 1  
ATOM   7413   N N    . ASP A 1 480 ? 10.743  14.131  -30.935 0.02 17.59 ?  473  ASP A N    1  
ATOM   7414   C CA   . ASP A 1 480 ? 10.234  14.433  -32.267 0.02 17.80 ?  473  ASP A CA   1  
ATOM   7415   C C    . ASP A 1 480 ? 11.277  15.082  -33.152 0.02 17.76 ?  473  ASP A C    1  
ATOM   7416   O O    . ASP A 1 480 ? 11.120  15.078  -34.379 0.02 17.92 ?  473  ASP A O    1  
ATOM   7417   C CB   . ASP A 1 480 ? 9.017   15.347  -32.199 0.02 18.02 ?  473  ASP A CB   1  
ATOM   7418   C CG   . ASP A 1 480 ? 7.778   14.619  -31.784 0.02 18.18 ?  473  ASP A CG   1  
ATOM   7419   O OD1  . ASP A 1 480 ? 7.869   13.395  -31.627 0.02 18.14 ?  473  ASP A OD1  1  
ATOM   7420   O OD2  . ASP A 1 480 ? 6.720   15.255  -31.583 0.02 18.38 -1 473  ASP A OD2  1  
ATOM   7421   H H    . ASP A 1 480 ? 10.394  14.584  -30.300 0.02 17.60 ?  473  ASP A H    1  
ATOM   7422   H HA   . ASP A 1 480 ? 9.968   13.600  -32.684 0.02 17.86 ?  473  ASP A HA   1  
ATOM   7423   H HB2  . ASP A 1 480 ? 9.182   16.053  -31.554 0.02 17.96 ?  473  ASP A HB2  1  
ATOM   7424   H HB3  . ASP A 1 480 ? 8.860   15.731  -33.078 0.02 18.15 ?  473  ASP A HB3  1  
ATOM   7425   N N    . GLU A 1 481 ? 12.324  15.653  -32.578 0.02 17.59 ?  474  GLU A N    1  
ATOM   7426   C CA   . GLU A 1 481 ? 13.322  16.323  -33.380 0.02 17.60 ?  474  GLU A CA   1  
ATOM   7427   C C    . GLU A 1 481 ? 14.184  15.339  -34.150 0.02 17.52 ?  474  GLU A C    1  
ATOM   7428   O O    . GLU A 1 481 ? 14.771  15.733  -35.159 0.02 17.60 ?  474  GLU A O    1  
ATOM   7429   C CB   . GLU A 1 481 ? 14.211  17.190  -32.500 0.02 17.49 ?  474  GLU A CB   1  
ATOM   7430   C CG   . GLU A 1 481 ? 15.244  16.408  -31.734 0.02 17.25 ?  474  GLU A CG   1  
ATOM   7431   C CD   . GLU A 1 481 ? 14.958  16.338  -30.286 0.02 17.14 ?  474  GLU A CD   1  
ATOM   7432   O OE1  . GLU A 1 481 ? 15.923  16.084  -29.555 0.02 17.00 ?  474  GLU A OE1  1  
ATOM   7433   O OE2  . GLU A 1 481 ? 13.794  16.530  -29.904 0.02 17.21 -1 474  GLU A OE2  1  
ATOM   7434   H H    . GLU A 1 481 ? 12.478  15.662  -31.733 0.02 17.49 ?  474  GLU A H    1  
ATOM   7435   H HA   . GLU A 1 481 ? 12.878  16.904  -34.017 0.02 17.77 ?  474  GLU A HA   1  
ATOM   7436   H HB2  . GLU A 1 481 ? 14.675  17.834  -33.058 0.02 17.57 ?  474  GLU A HB2  1  
ATOM   7437   H HB3  . GLU A 1 481 ? 13.654  17.653  -31.855 0.02 17.52 ?  474  GLU A HB3  1  
ATOM   7438   H HG2  . GLU A 1 481 ? 15.300  15.492  -32.030 0.02 17.20 ?  474  GLU A HG2  1  
ATOM   7439   H HG3  . GLU A 1 481 ? 16.108  16.835  -31.839 0.02 17.23 ?  474  GLU A HG3  1  
ATOM   7440   N N    . LEU A 1 482 ? 14.278  14.088  -33.689 0.02 17.38 ?  475  LEU A N    1  
ATOM   7441   C CA   . LEU A 1 482 ? 15.255  13.147  -34.228 0.02 17.30 ?  475  LEU A CA   1  
ATOM   7442   C C    . LEU A 1 482 ? 14.971  12.882  -35.691 0.02 17.50 ?  475  LEU A C    1  
ATOM   7443   O O    . LEU A 1 482 ? 15.887  12.615  -36.476 0.02 17.51 ?  475  LEU A O    1  
ATOM   7444   C CB   . LEU A 1 482 ? 15.233  11.822  -33.437 0.02 17.18 ?  475  LEU A CB   1  
ATOM   7445   C CG   . LEU A 1 482 ? 15.605  11.731  -31.945 0.02 16.98 ?  475  LEU A CG   1  
ATOM   7446   C CD1  . LEU A 1 482 ? 15.571  10.298  -31.467 0.02 16.93 ?  475  LEU A CD1  1  
ATOM   7447   C CD2  . LEU A 1 482 ? 16.971  12.295  -31.709 0.02 16.85 ?  475  LEU A CD2  1  
ATOM   7448   H H    . LEU A 1 482 ? 13.782  13.756  -33.072 0.02 17.36 ?  475  LEU A H    1  
ATOM   7449   H HA   . LEU A 1 482 ? 16.138  13.541  -34.165 0.02 17.23 ?  475  LEU A HA   1  
ATOM   7450   H HB2  . LEU A 1 482 ? 14.342  11.455  -33.515 0.02 17.27 ?  475  LEU A HB2  1  
ATOM   7451   H HB3  . LEU A 1 482 ? 15.847  11.231  -33.889 0.02 17.16 ?  475  LEU A HB3  1  
ATOM   7452   H HG   . LEU A 1 482 ? 14.970  12.238  -31.414 0.02 17.00 ?  475  LEU A HG   1  
ATOM   7453   H HD11 . LEU A 1 482 ? 14.649  10.015  -31.409 0.02 17.01 ?  475  LEU A HD11 1  
ATOM   7454   H HD12 . LEU A 1 482 ? 16.059  9.744   -32.097 0.02 16.95 ?  475  LEU A HD12 1  
ATOM   7455   H HD13 . LEU A 1 482 ? 15.989  10.248  -30.593 0.02 16.81 ?  475  LEU A HD13 1  
ATOM   7456   H HD21 . LEU A 1 482 ? 17.074  12.438  -30.755 0.02 16.74 ?  475  LEU A HD21 1  
ATOM   7457   H HD22 . LEU A 1 482 ? 17.638  11.667  -32.025 0.02 16.86 ?  475  LEU A HD22 1  
ATOM   7458   H HD23 . LEU A 1 482 ? 17.060  13.137  -32.182 0.02 16.89 ?  475  LEU A HD23 1  
ATOM   7459   N N    . THR A 1 483 ? 13.704  12.965  -36.058 0.02 17.70 ?  476  THR A N    1  
ATOM   7460   C CA   . THR A 1 483 ? 13.265  12.776  -37.427 0.02 17.94 ?  476  THR A CA   1  
ATOM   7461   C C    . THR A 1 483 ? 13.973  13.681  -38.408 0.02 18.04 ?  476  THR A C    1  
ATOM   7462   O O    . THR A 1 483 ? 14.041  13.348  -39.603 0.02 18.22 ?  476  THR A O    1  
ATOM   7463   C CB   . THR A 1 483 ? 11.779  13.065  -37.482 0.02 18.16 ?  476  THR A CB   1  
ATOM   7464   O OG1  . THR A 1 483 ? 11.106  12.258  -36.515 0.02 18.10 ?  476  THR A OG1  1  
ATOM   7465   C CG2  . THR A 1 483 ? 11.213  12.776  -38.846 0.02 18.45 ?  476  THR A CG2  1  
ATOM   7466   H H    . THR A 1 483 ? 13.061  13.142  -35.520 0.02 17.72 ?  476  THR A H    1  
ATOM   7467   H HA   . THR A 1 483 ? 13.415  11.856  -37.688 0.02 17.94 ?  476  THR A HA   1  
ATOM   7468   H HB   . THR A 1 483 ? 11.639  14.001  -37.277 0.02 18.18 ?  476  THR A HB   1  
ATOM   7469   H HG1  . THR A 1 483 ? 10.279  12.301  -36.641 0.02 18.25 ?  476  THR A HG1  1  
ATOM   7470   H HG21 . THR A 1 483 ? 11.580  13.398  -39.494 0.02 18.52 ?  476  THR A HG21 1  
ATOM   7471   H HG22 . THR A 1 483 ? 11.441  11.870  -39.111 0.02 18.44 ?  476  THR A HG22 1  
ATOM   7472   H HG23 . THR A 1 483 ? 10.249  12.872  -38.833 0.02 18.60 ?  476  THR A HG23 1  
ATOM   7473   N N    . TYR A 1 484 ? 14.427  14.844  -37.973 0.02 17.98 ?  477  TYR A N    1  
ATOM   7474   C CA   . TYR A 1 484 ? 14.994  15.814  -38.892 0.02 18.12 ?  477  TYR A CA   1  
ATOM   7475   C C    . TYR A 1 484 ? 16.512  15.765  -38.888 0.02 17.97 ?  477  TYR A C    1  
ATOM   7476   O O    . TYR A 1 484 ? 17.146  16.509  -39.628 0.02 18.10 ?  477  TYR A O    1  
ATOM   7477   C CB   . TYR A 1 484 ? 14.448  17.204  -38.552 0.02 18.23 ?  477  TYR A CB   1  
ATOM   7478   C CG   . TYR A 1 484 ? 12.942  17.141  -38.563 0.02 18.40 ?  477  TYR A CG   1  
ATOM   7479   C CD1  . TYR A 1 484 ? 12.242  17.216  -39.752 0.02 18.67 ?  477  TYR A CD1  1  
ATOM   7480   C CD2  . TYR A 1 484 ? 12.228  16.867  -37.412 0.02 18.30 ?  477  TYR A CD2  1  
ATOM   7481   C CE1  . TYR A 1 484 ? 10.876  17.084  -39.772 0.02 18.86 ?  477  TYR A CE1  1  
ATOM   7482   C CE2  . TYR A 1 484 ? 10.874  16.746  -37.434 0.02 18.48 ?  477  TYR A CE2  1  
ATOM   7483   C CZ   . TYR A 1 484 ? 10.202  16.845  -38.602 0.02 18.76 ?  477  TYR A CZ   1  
ATOM   7484   O OH   . TYR A 1 484 ? 8.837   16.696  -38.562 0.02 18.97 ?  477  TYR A OH   1  
ATOM   7485   H H    . TYR A 1 484 ? 14.419  15.099  -37.155 0.02 17.87 ?  477  TYR A H    1  
ATOM   7486   H HA   . TYR A 1 484 ? 14.705  15.605  -39.791 0.02 18.29 ?  477  TYR A HA   1  
ATOM   7487   H HB2  . TYR A 1 484 ? 14.749  17.469  -37.668 0.02 18.08 ?  477  TYR A HB2  1  
ATOM   7488   H HB3  . TYR A 1 484 ? 14.736  17.844  -39.221 0.02 18.36 ?  477  TYR A HB3  1  
ATOM   7489   H HD1  . TYR A 1 484 ? 12.703  17.375  -40.543 0.02 18.76 ?  477  TYR A HD1  1  
ATOM   7490   H HD2  . TYR A 1 484 ? 12.679  16.791  -36.602 0.02 18.13 ?  477  TYR A HD2  1  
ATOM   7491   H HE1  . TYR A 1 484 ? 10.417  17.158  -40.576 0.02 19.07 ?  477  TYR A HE1  1  
ATOM   7492   H HE2  . TYR A 1 484 ? 10.410  16.578  -36.646 0.02 18.43 ?  477  TYR A HE2  1  
ATOM   7493   H HH   . TYR A 1 484 ? 8.611   16.309  -37.851 0.02 18.88 ?  477  TYR A HH   1  
ATOM   7494   N N    . PHE A 1 485 ? 17.097  14.853  -38.132 0.02 17.74 ?  478  PHE A N    1  
ATOM   7495   C CA   . PHE A 1 485 ? 18.531  14.636  -38.104 0.02 17.62 ?  478  PHE A CA   1  
ATOM   7496   C C    . PHE A 1 485 ? 18.936  13.315  -38.723 0.02 17.62 ?  478  PHE A C    1  
ATOM   7497   O O    . PHE A 1 485 ? 19.985  13.228  -39.345 0.02 17.65 ?  478  PHE A O    1  
ATOM   7498   C CB   . PHE A 1 485 ? 19.035  14.662  -36.665 0.02 17.38 ?  478  PHE A CB   1  
ATOM   7499   C CG   . PHE A 1 485 ? 19.057  16.024  -36.054 0.02 17.39 ?  478  PHE A CG   1  
ATOM   7500   C CD1  . PHE A 1 485 ? 20.086  16.905  -36.318 0.02 17.43 ?  478  PHE A CD1  1  
ATOM   7501   C CD2  . PHE A 1 485 ? 18.066  16.415  -35.192 0.02 17.39 ?  478  PHE A CD2  1  
ATOM   7502   C CE1  . PHE A 1 485 ? 20.108  18.125  -35.751 0.02 17.47 ?  478  PHE A CE1  1  
ATOM   7503   C CE2  . PHE A 1 485 ? 18.109  17.652  -34.617 0.02 17.43 ?  478  PHE A CE2  1  
ATOM   7504   C CZ   . PHE A 1 485 ? 19.128  18.492  -34.886 0.02 17.46 ?  478  PHE A CZ   1  
ATOM   7505   H H    . PHE A 1 485 ? 16.668  14.317  -37.618 0.02 17.67 ?  478  PHE A H    1  
ATOM   7506   H HA   . PHE A 1 485 ? 18.981  15.350  -38.580 0.02 17.71 ?  478  PHE A HA   1  
ATOM   7507   H HB2  . PHE A 1 485 ? 18.455  14.102  -36.131 0.02 17.31 ?  478  PHE A HB2  1  
ATOM   7508   H HB3  . PHE A 1 485 ? 19.938  14.306  -36.647 0.02 17.30 ?  478  PHE A HB3  1  
ATOM   7509   H HD1  . PHE A 1 485 ? 20.767  16.658  -36.897 0.02 17.44 ?  478  PHE A HD1  1  
ATOM   7510   H HD2  . PHE A 1 485 ? 17.367  15.836  -34.992 0.02 17.39 ?  478  PHE A HD2  1  
ATOM   7511   H HE1  . PHE A 1 485 ? 20.805  18.710  -35.932 0.02 17.52 ?  478  PHE A HE1  1  
ATOM   7512   H HE2  . PHE A 1 485 ? 17.433  17.913  -34.036 0.02 17.44 ?  478  PHE A HE2  1  
ATOM   7513   H HZ   . PHE A 1 485 ? 19.144  19.339  -34.503 0.02 17.51 ?  478  PHE A HZ   1  
ATOM   7514   N N    . PHE A 1 486 ? 18.131  12.281  -38.551 0.02 17.61 ?  479  PHE A N    1  
ATOM   7515   C CA   . PHE A 1 486 ? 18.486  10.930  -38.935 0.02 17.60 ?  479  PHE A CA   1  
ATOM   7516   C C    . PHE A 1 486 ? 17.430  10.323  -39.842 0.02 17.83 ?  479  PHE A C    1  
ATOM   7517   O O    . PHE A 1 486 ? 16.227  10.449  -39.605 0.02 17.90 ?  479  PHE A O    1  
ATOM   7518   C CB   . PHE A 1 486 ? 18.661  10.041  -37.723 0.02 17.39 ?  479  PHE A CB   1  
ATOM   7519   C CG   . PHE A 1 486 ? 19.786  10.461  -36.845 0.02 17.19 ?  479  PHE A CG   1  
ATOM   7520   C CD1  . PHE A 1 486 ? 21.110  10.239  -37.199 0.02 17.16 ?  479  PHE A CD1  1  
ATOM   7521   C CD2  . PHE A 1 486 ? 19.529  11.104  -35.657 0.02 17.06 ?  479  PHE A CD2  1  
ATOM   7522   C CE1  . PHE A 1 486 ? 22.133  10.652  -36.382 0.02 17.02 ?  479  PHE A CE1  1  
ATOM   7523   C CE2  . PHE A 1 486 ? 20.550  11.501  -34.829 0.02 16.91 ?  479  PHE A CE2  1  
ATOM   7524   C CZ   . PHE A 1 486 ? 21.845  11.288  -35.194 0.02 16.89 ?  479  PHE A CZ   1  
ATOM   7525   H H    . PHE A 1 486 ? 17.346  12.341  -38.204 0.02 17.62 ?  479  PHE A H    1  
ATOM   7526   H HA   . PHE A 1 486 ? 19.329  10.932  -39.411 0.02 17.62 ?  479  PHE A HA   1  
ATOM   7527   H HB2  . PHE A 1 486 ? 17.842  10.049  -37.209 0.02 17.38 ?  479  PHE A HB2  1  
ATOM   7528   H HB3  . PHE A 1 486 ? 18.846  9.139   -38.024 0.02 17.41 ?  479  PHE A HB3  1  
ATOM   7529   H HD1  . PHE A 1 486 ? 21.310  9.815   -38.003 0.02 17.27 ?  479  PHE A HD1  1  
ATOM   7530   H HD2  . PHE A 1 486 ? 18.644  11.255  -35.408 0.02 17.09 ?  479  PHE A HD2  1  
ATOM   7531   H HE1  . PHE A 1 486 ? 23.017  10.497  -36.618 0.02 17.02 ?  479  PHE A HE1  1  
ATOM   7532   H HE2  . PHE A 1 486 ? 20.356  11.934  -34.031 0.02 16.84 ?  479  PHE A HE2  1  
ATOM   7533   H HZ   . PHE A 1 486 ? 22.535  11.560  -34.635 0.02 16.81 ?  479  PHE A HZ   1  
ATOM   7534   N N    . TRP A 1 487 ? 17.908  9.635   -40.869 0.02 17.97 ?  480  TRP A N    1  
ATOM   7535   C CA   . TRP A 1 487 ? 17.047  8.748   -41.627 0.02 18.18 ?  480  TRP A CA   1  
ATOM   7536   C C    . TRP A 1 487 ? 16.675  7.552   -40.755 0.02 18.07 ?  480  TRP A C    1  
ATOM   7537   O O    . TRP A 1 487 ? 17.457  7.095   -39.926 0.02 17.86 ?  480  TRP A O    1  
ATOM   7538   C CB   . TRP A 1 487 ? 17.755  8.300   -42.919 0.02 18.37 ?  480  TRP A CB   1  
ATOM   7539   C CG   . TRP A 1 487 ? 17.035  7.196   -43.672 0.02 18.59 ?  480  TRP A CG   1  
ATOM   7540   C CD1  . TRP A 1 487 ? 17.210  5.832   -43.547 0.02 18.56 ?  480  TRP A CD1  1  
ATOM   7541   C CD2  . TRP A 1 487 ? 16.028  7.373   -44.661 0.02 18.91 ?  480  TRP A CD2  1  
ATOM   7542   N NE1  . TRP A 1 487 ? 16.362  5.162   -44.406 0.02 18.85 ?  480  TRP A NE1  1  
ATOM   7543   C CE2  . TRP A 1 487 ? 15.638  6.091   -45.103 0.02 19.07 ?  480  TRP A CE2  1  
ATOM   7544   C CE3  . TRP A 1 487 ? 15.421  8.493   -45.227 0.02 19.11 ?  480  TRP A CE3  1  
ATOM   7545   C CZ2  . TRP A 1 487 ? 14.658  5.909   -46.058 0.02 19.42 ?  480  TRP A CZ2  1  
ATOM   7546   C CZ3  . TRP A 1 487 ? 14.465  8.305   -46.184 0.02 19.45 ?  480  TRP A CZ3  1  
ATOM   7547   C CH2  . TRP A 1 487 ? 14.086  7.030   -46.586 0.02 19.60 ?  480  TRP A CH2  1  
ATOM   7548   H H    . TRP A 1 487 ? 18.724  9.661   -41.132 0.02 17.95 ?  480  TRP A H    1  
ATOM   7549   H HA   . TRP A 1 487 ? 16.236  9.222   -41.860 0.02 18.31 ?  480  TRP A HA   1  
ATOM   7550   H HB2  . TRP A 1 487 ? 17.807  9.068   -43.508 0.02 18.50 ?  480  TRP A HB2  1  
ATOM   7551   H HB3  . TRP A 1 487 ? 18.649  7.992   -42.704 0.02 18.26 ?  480  TRP A HB3  1  
ATOM   7552   H HD1  . TRP A 1 487 ? 17.808  5.420   -42.966 0.02 18.39 ?  480  TRP A HD1  1  
ATOM   7553   H HE1  . TRP A 1 487 ? 16.300  4.309   -44.493 0.02 18.90 ?  480  TRP A HE1  1  
ATOM   7554   H HE3  . TRP A 1 487 ? 15.660  9.350   -44.963 0.02 19.04 ?  480  TRP A HE3  1  
ATOM   7555   H HZ2  . TRP A 1 487 ? 14.412  5.058   -46.336 0.02 19.54 ?  480  TRP A HZ2  1  
ATOM   7556   H HZ3  . TRP A 1 487 ? 14.051  9.043   -46.566 0.02 19.60 ?  480  TRP A HZ3  1  
ATOM   7557   H HH2  . TRP A 1 487 ? 13.432  6.939   -47.244 0.02 19.86 ?  480  TRP A HH2  1  
ATOM   7558   N N    . ASN A 1 488 ? 15.447  7.070   -40.928 0.02 18.25 ?  481  ASN A N    1  
ATOM   7559   C CA   . ASN A 1 488 ? 14.996  5.861   -40.259 0.02 18.22 ?  481  ASN A CA   1  
ATOM   7560   C C    . ASN A 1 488 ? 14.054  5.151   -41.205 0.02 18.54 ?  481  ASN A C    1  
ATOM   7561   O O    . ASN A 1 488 ? 13.601  5.731   -42.198 0.02 18.77 ?  481  ASN A O    1  
ATOM   7562   C CB   . ASN A 1 488 ? 14.297  6.167   -38.927 0.02 18.07 ?  481  ASN A CB   1  
ATOM   7563   C CG   . ASN A 1 488 ? 12.939  6.800   -39.120 0.02 18.26 ?  481  ASN A CG   1  
ATOM   7564   O OD1  . ASN A 1 488 ? 11.970  6.125   -39.451 0.02 18.49 ?  481  ASN A OD1  1  
ATOM   7565   N ND2  . ASN A 1 488 ? 12.861  8.101   -38.910 0.02 18.20 ?  481  ASN A ND2  1  
ATOM   7566   H H    . ASN A 1 488 ? 14.855  7.425   -41.438 0.02 18.41 ?  481  ASN A H    1  
ATOM   7567   H HA   . ASN A 1 488 ? 15.748  5.277   -40.079 0.02 18.12 ?  481  ASN A HA   1  
ATOM   7568   H HB2  . ASN A 1 488 ? 14.171  5.335   -38.446 0.02 18.04 ?  481  ASN A HB2  1  
ATOM   7569   H HB3  . ASN A 1 488 ? 14.843  6.779   -38.412 0.02 17.90 ?  481  ASN A HB3  1  
ATOM   7570   H HD21 . ASN A 1 488 ? 12.140  8.528   -39.097 0.02 18.32 ?  481  ASN A HD21 1  
ATOM   7571   H HD22 . ASN A 1 488 ? 13.542  8.522   -38.603 0.02 18.04 ?  481  ASN A HD22 1  
ATOM   7572   N N    . GLN A 1 489 ? 13.754  3.882   -40.887 0.02 18.59 ?  482  GLN A N    1  
ATOM   7573   C CA   . GLN A 1 489 ? 13.052  3.041   -41.840 0.02 18.93 ?  482  GLN A CA   1  
ATOM   7574   C C    . GLN A 1 489 ? 11.595  3.433   -42.035 0.02 19.17 ?  482  GLN A C    1  
ATOM   7575   O O    . GLN A 1 489 ? 10.953  2.899   -42.946 0.02 19.49 ?  482  GLN A O    1  
ATOM   7576   C CB   . GLN A 1 489 ? 13.138  1.572   -41.414 0.02 18.95 ?  482  GLN A CB   1  
ATOM   7577   C CG   . GLN A 1 489 ? 12.444  1.234   -40.102 0.02 18.81 ?  482  GLN A CG   1  
ATOM   7578   C CD   . GLN A 1 489 ? 12.281  -0.276  -39.956 0.02 18.98 ?  482  GLN A CD   1  
ATOM   7579   O OE1  . GLN A 1 489 ? 13.058  -1.034  -40.514 0.02 18.99 ?  482  GLN A OE1  1  
ATOM   7580   N NE2  . GLN A 1 489 ? 11.247  -0.709  -39.250 0.02 19.13 ?  482  GLN A NE2  1  
ATOM   7581   H H    . GLN A 1 489 ? 13.947  3.494   -40.148 0.02 18.46 ?  482  GLN A H    1  
ATOM   7582   H HA   . GLN A 1 489 ? 13.492  3.122   -42.697 0.02 19.03 ?  482  GLN A HA   1  
ATOM   7583   H HB2  . GLN A 1 489 ? 12.728  1.032   -42.105 0.02 19.19 ?  482  GLN A HB2  1  
ATOM   7584   H HB3  . GLN A 1 489 ? 14.070  1.325   -41.326 0.02 18.83 ?  482  GLN A HB3  1  
ATOM   7585   H HG2  . GLN A 1 489 ? 12.978  1.556   -39.360 0.02 18.58 ?  482  GLN A HG2  1  
ATOM   7586   H HG3  . GLN A 1 489 ? 11.565  1.639   -40.081 0.02 18.88 ?  482  GLN A HG3  1  
ATOM   7587   H HE21 . GLN A 1 489 ? 11.145  -1.551  -39.116 0.02 19.17 ?  482  GLN A HE21 1  
ATOM   7588   H HE22 . GLN A 1 489 ? 10.678  -0.148  -38.932 0.02 19.21 ?  482  GLN A HE22 1  
ATOM   7589   N N    . LEU A 1 490 ? 11.055  4.330   -41.225 0.02 19.04 ?  483  LEU A N    1  
ATOM   7590   C CA   . LEU A 1 490 ? 9.728   4.878   -41.480 0.02 19.29 ?  483  LEU A CA   1  
ATOM   7591   C C    . LEU A 1 490 ? 9.760   6.131   -42.347 0.02 19.39 ?  483  LEU A C    1  
ATOM   7592   O O    . LEU A 1 490 ? 8.704   6.662   -42.706 0.02 19.64 ?  483  LEU A O    1  
ATOM   7593   C CB   . LEU A 1 490 ? 9.024   5.181   -40.156 0.02 19.16 ?  483  LEU A CB   1  
ATOM   7594   C CG   . LEU A 1 490 ? 8.997   4.025   -39.164 0.02 19.06 ?  483  LEU A CG   1  
ATOM   7595   C CD1  . LEU A 1 490 ? 8.318   4.512   -37.871 0.02 18.96 ?  483  LEU A CD1  1  
ATOM   7596   C CD2  . LEU A 1 490 ? 8.314   2.771   -39.659 0.02 19.38 ?  483  LEU A CD2  1  
ATOM   7597   H H    . LEU A 1 490 ? 11.436  4.638   -40.521 0.02 18.83 ?  483  LEU A H    1  
ATOM   7598   H HA   . LEU A 1 490 ? 9.204   4.213   -41.952 0.02 19.52 ?  483  LEU A HA   1  
ATOM   7599   H HB2  . LEU A 1 490 ? 9.479   5.926   -39.734 0.02 18.97 ?  483  LEU A HB2  1  
ATOM   7600   H HB3  . LEU A 1 490 ? 8.104   5.428   -40.340 0.02 19.36 ?  483  LEU A HB3  1  
ATOM   7601   H HG   . LEU A 1 490 ? 9.911   3.788   -38.946 0.02 18.87 ?  483  LEU A HG   1  
ATOM   7602   H HD11 . LEU A 1 490 ? 7.871   5.353   -38.049 0.02 19.02 ?  483  LEU A HD11 1  
ATOM   7603   H HD12 . LEU A 1 490 ? 7.676   3.842   -37.590 0.02 19.09 ?  483  LEU A HD12 1  
ATOM   7604   H HD13 . LEU A 1 490 ? 8.995   4.640   -37.188 0.02 18.72 ?  483  LEU A HD13 1  
ATOM   7605   H HD21 . LEU A 1 490 ? 8.462   2.061   -39.019 0.02 19.30 ?  483  LEU A HD21 1  
ATOM   7606   H HD22 . LEU A 1 490 ? 7.363   2.943   -39.746 0.02 19.58 ?  483  LEU A HD22 1  
ATOM   7607   H HD23 . LEU A 1 490 ? 8.687   2.523   -40.519 0.02 19.47 ?  483  LEU A HD23 1  
ATOM   7608   N N    . ALA A 1 491 ? 10.936  6.599   -42.717 0.02 19.23 ?  484  ALA A N    1  
ATOM   7609   C CA   . ALA A 1 491 ? 11.049  7.842   -43.449 0.02 19.33 ?  484  ALA A CA   1  
ATOM   7610   C C    . ALA A 1 491 ? 10.688  7.638   -44.920 0.02 19.72 ?  484  ALA A C    1  
ATOM   7611   O O    . ALA A 1 491 ? 10.561  6.513   -45.407 0.02 19.90 ?  484  ALA A O    1  
ATOM   7612   C CB   . ALA A 1 491 ? 12.465  8.395   -43.305 0.02 19.08 ?  484  ALA A CB   1  
ATOM   7613   H H    . ALA A 1 491 ? 11.687  6.214   -42.562 0.02 19.08 ?  484  ALA A H    1  
ATOM   7614   H HA   . ALA A 1 491 ? 10.429  8.487   -43.079 0.02 19.34 ?  484  ALA A HA   1  
ATOM   7615   H HB1  . ALA A 1 491 ? 12.485  9.301   -43.650 0.02 19.15 ?  484  ALA A HB1  1  
ATOM   7616   H HB2  . ALA A 1 491 ? 12.697  8.393   -42.365 0.02 18.85 ?  484  ALA A HB2  1  
ATOM   7617   H HB3  . ALA A 1 491 ? 13.087  7.835   -43.793 0.02 19.10 ?  484  ALA A HB3  1  
ATOM   7618   N N    . LYS A 1 492 ? 10.557  8.768   -45.618 0.02 19.88 ?  485  LYS A N    1  
ATOM   7619   C CA   . LYS A 1 492 ? 10.209  8.844   -47.028 0.02 20.28 ?  485  LYS A CA   1  
ATOM   7620   C C    . LYS A 1 492 ? 10.983  10.007  -47.638 0.02 20.29 ?  485  LYS A C    1  
ATOM   7621   O O    . LYS A 1 492 ? 11.297  10.984  -46.972 0.02 20.09 ?  485  LYS A O    1  
ATOM   7622   C CB   . LYS A 1 492 ? 8.679   9.009   -47.226 0.02 20.60 ?  485  LYS A CB   1  
ATOM   7623   C CG   . LYS A 1 492 ? 7.942   9.834   -46.125 0.02 20.44 ?  485  LYS A CG   1  
ATOM   7624   C CD   . LYS A 1 492 ? 6.447   9.526   -45.980 0.02 20.73 ?  485  LYS A CD   1  
ATOM   7625   C CE   . LYS A 1 492 ? 5.616   10.141  -47.097 0.02 21.16 ?  485  LYS A CE   1  
ATOM   7626   N NZ   . LYS A 1 492 ? 5.523   9.294   -48.320 0.02 21.54 ?  485  LYS A NZ   1  
ATOM   7627   H H    . LYS A 1 492 ? 10.674  9.545   -45.272 0.02 19.77 ?  485  LYS A H    1  
ATOM   7628   H HA   . LYS A 1 492 ? 10.494  8.026   -47.468 0.02 20.37 ?  485  LYS A HA   1  
ATOM   7629   H HB2  . LYS A 1 492 ? 8.528   9.466   -48.066 0.02 20.83 ?  485  LYS A HB2  1  
ATOM   7630   H HB3  . LYS A 1 492 ? 8.274   8.128   -47.256 0.02 20.72 ?  485  LYS A HB3  1  
ATOM   7631   H HG2  . LYS A 1 492 ? 8.348   9.664   -45.259 0.02 20.17 ?  485  LYS A HG2  1  
ATOM   7632   H HG3  . LYS A 1 492 ? 8.023   10.776  -46.344 0.02 20.45 ?  485  LYS A HG3  1  
ATOM   7633   H HD2  . LYS A 1 492 ? 6.318   8.565   -46.007 0.02 20.79 ?  485  LYS A HD2  1  
ATOM   7634   H HD3  . LYS A 1 492 ? 6.126   9.881   -45.137 0.02 20.59 ?  485  LYS A HD3  1  
ATOM   7635   H HE2  . LYS A 1 492 ? 4.715   10.286  -46.769 0.02 21.28 ?  485  LYS A HE2  1  
ATOM   7636   H HE3  . LYS A 1 492 ? 6.013   10.988  -47.350 0.02 21.12 ?  485  LYS A HE3  1  
ATOM   7637   H HZ1  . LYS A 1 492 ? 4.669   9.107   -48.494 0.02 21.81 ?  485  LYS A HZ1  1  
ATOM   7638   H HZ2  . LYS A 1 492 ? 5.868   9.730   -49.015 0.02 21.56 ?  485  LYS A HZ2  1  
ATOM   7639   H HZ3  . LYS A 1 492 ? 5.970   8.533   -48.199 0.02 21.50 ?  485  LYS A HZ3  1  
ATOM   7640   N N    . ARG A 1 493 ? 11.333  9.861   -48.909 0.02 20.54 ?  486  ARG A N    1  
ATOM   7641   C CA   . ARG A 1 493 ? 11.811  10.983  -49.694 0.02 20.69 ?  486  ARG A CA   1  
ATOM   7642   C C    . ARG A 1 493 ? 10.796  12.111  -49.661 0.02 20.88 ?  486  ARG A C    1  
ATOM   7643   O O    . ARG A 1 493 ? 9.670   11.954  -50.149 0.02 21.19 ?  486  ARG A O    1  
ATOM   7644   C CB   . ARG A 1 493 ? 12.048  10.547  -51.144 0.02 21.05 ?  486  ARG A CB   1  
ATOM   7645   C CG   . ARG A 1 493 ? 12.606  9.158   -51.279 0.02 20.99 ?  486  ARG A CG   1  
ATOM   7646   C CD   . ARG A 1 493 ? 11.581  7.984   -51.311 0.02 21.15 ?  486  ARG A CD   1  
ATOM   7647   N NE   . ARG A 1 493 ? 10.219  8.408   -50.989 0.02 21.30 ?  486  ARG A NE   1  
ATOM   7648   C CZ   . ARG A 1 493 ? 9.279   8.723   -51.876 0.02 21.74 ?  486  ARG A CZ   1  
ATOM   7649   N NH1  . ARG A 1 493 ? 9.520   8.653   -53.191 0.02 22.08 ?  486  ARG A NH1  1  
ATOM   7650   N NH2  . ARG A 1 493 ? 8.088   9.127   -51.433 0.02 21.86 ?  486  ARG A NH2  1  
ATOM   7651   H H    . ARG A 1 493 ? 11.332  9.111   -49.300 0.02 20.63 ?  486  ARG A H    1  
ATOM   7652   H HA   . ARG A 1 493 ? 12.647  11.309  -49.334 0.02 20.47 ?  486  ARG A HA   1  
ATOM   7653   H HB2  . ARG A 1 493 ? 11.210  10.592  -51.627 0.02 21.33 ?  486  ARG A HB2  1  
ATOM   7654   H HB3  . ARG A 1 493 ? 12.683  11.159  -51.548 0.02 21.06 ?  486  ARG A HB3  1  
ATOM   7655   H HG2  . ARG A 1 493 ? 13.135  9.114   -52.095 0.02 21.16 ?  486  ARG A HG2  1  
ATOM   7656   H HG3  . ARG A 1 493 ? 13.152  8.997   -50.503 0.02 20.69 ?  486  ARG A HG3  1  
ATOM   7657   H HD2  . ARG A 1 493 ? 11.590  7.583   -52.195 0.02 21.40 ?  486  ARG A HD2  1  
ATOM   7658   H HD3  . ARG A 1 493 ? 11.838  7.323   -50.645 0.02 20.91 ?  486  ARG A HD3  1  
ATOM   7659   H HE   . ARG A 1 493 ? 9.936   8.187   -50.204 0.02 21.14 ?  486  ARG A HE   1  
ATOM   7660   H HH11 . ARG A 1 493 ? 10.290  8.402   -53.482 0.02 22.02 ?  486  ARG A HH11 1  
ATOM   7661   H HH12 . ARG A 1 493 ? 8.900   8.857   -53.752 0.02 22.37 ?  486  ARG A HH12 1  
ATOM   7662   H HH21 . ARG A 1 493 ? 7.936   9.168   -50.589 0.02 21.65 ?  486  ARG A HH21 1  
ATOM   7663   H HH22 . ARG A 1 493 ? 7.464   9.326   -51.990 0.02 22.15 ?  486  ARG A HH22 1  
ATOM   7664   N N    . MET A 1 494 ? 11.184  13.197  -49.172 0.02 20.72 ?  487  MET A N    1  
ATOM   7665   C CA   . MET A 1 494 ? 10.294  14.342  -49.150 0.02 20.90 ?  487  MET A CA   1  
ATOM   7666   C C    . MET A 1 494 ? 10.661  15.301  -50.270 0.02 21.21 ?  487  MET A C    1  
ATOM   7667   O O    . MET A 1 494 ? 11.795  15.267  -50.751 0.02 21.18 ?  487  MET A O    1  
ATOM   7668   C CB   . MET A 1 494 ? 10.377  15.046  -47.794 0.02 20.57 ?  487  MET A CB   1  
ATOM   7669   C CG   . MET A 1 494 ? 9.863   14.175  -46.658 0.02 20.30 ?  487  MET A CG   1  
ATOM   7670   S SD   . MET A 1 494 ? 8.119   13.769  -46.913 0.02 20.61 ?  487  MET A SD   1  
ATOM   7671   C CE   . MET A 1 494 ? 7.325   15.249  -46.269 0.02 20.70 ?  487  MET A CE   1  
ATOM   7672   H H    . MET A 1 494 ? 11.961  13.341  -48.839 0.02 20.53 ?  487  MET A H    1  
ATOM   7673   H HA   . MET A 1 494 ? 9.384   14.040  -49.274 0.02 21.07 ?  487  MET A HA   1  
ATOM   7674   H HB2  . MET A 1 494 ? 11.301  15.271  -47.614 0.02 20.40 ?  487  MET A HB2  1  
ATOM   7675   H HB3  . MET A 1 494 ? 9.837   15.850  -47.824 0.02 20.71 ?  487  MET A HB3  1  
ATOM   7676   H HG2  . MET A 1 494 ? 10.361  13.344  -46.645 0.02 20.18 ?  487  MET A HG2  1  
ATOM   7677   H HG3  . MET A 1 494 ? 9.957   14.643  -45.816 0.02 20.10 ?  487  MET A HG3  1  
ATOM   7678   H HE1  . MET A 1 494 ? 7.625   16.018  -46.777 0.02 20.87 ?  487  MET A HE1  1  
ATOM   7679   H HE2  . MET A 1 494 ? 6.365   15.145  -46.349 0.02 20.86 ?  487  MET A HE2  1  
ATOM   7680   H HE3  . MET A 1 494 ? 7.566   15.354  -45.336 0.02 20.44 ?  487  MET A HE3  1  
ATOM   7681   N N    . PRO A 1 495 ? 9.708   16.120  -50.733 0.02 21.53 ?  488  PRO A N    1  
ATOM   7682   C CA   . PRO A 1 495 ? 10.020  17.103  -51.773 0.02 21.85 ?  488  PRO A CA   1  
ATOM   7683   C C    . PRO A 1 495 ? 10.895  18.187  -51.197 0.02 21.62 ?  488  PRO A C    1  
ATOM   7684   O O    . PRO A 1 495 ? 10.927  18.396  -49.990 0.02 21.29 ?  488  PRO A O    1  
ATOM   7685   C CB   . PRO A 1 495 ? 8.648   17.655  -52.179 0.02 22.23 ?  488  PRO A CB   1  
ATOM   7686   C CG   . PRO A 1 495 ? 7.673   16.751  -51.581 0.02 22.16 ?  488  PRO A CG   1  
ATOM   7687   C CD   . PRO A 1 495 ? 8.295   16.214  -50.349 0.02 21.66 ?  488  PRO A CD   1  
ATOM   7688   H HA   . PRO A 1 495 ? 10.451  16.691  -52.537 0.02 21.99 ?  488  PRO A HA   1  
ATOM   7689   H HB2  . PRO A 1 495 ? 8.545   18.551  -51.823 0.02 22.21 ?  488  PRO A HB2  1  
ATOM   7690   H HB3  . PRO A 1 495 ? 8.568   17.653  -53.146 0.02 22.55 ?  488  PRO A HB3  1  
ATOM   7691   H HG2  . PRO A 1 495 ? 6.868   17.245  -51.362 0.02 22.27 ?  488  PRO A HG2  1  
ATOM   7692   H HG3  . PRO A 1 495 ? 7.474   16.032  -52.203 0.02 22.35 ?  488  PRO A HG3  1  
ATOM   7693   H HD2  . PRO A 1 495 ? 8.182   16.838  -49.618 0.02 21.50 ?  488  PRO A HD2  1  
ATOM   7694   H HD3  . PRO A 1 495 ? 7.927   15.341  -50.147 0.02 21.63 ?  488  PRO A HD3  1  
ATOM   7695   N N    . LYS A 1 496 ? 11.591  18.896  -52.073 0.02 21.82 ?  489  LYS A N    1  
ATOM   7696   C CA   . LYS A 1 496 ? 12.469  19.956  -51.612 0.02 21.67 ?  489  LYS A CA   1  
ATOM   7697   C C    . LYS A 1 496 ? 11.687  21.152  -51.076 0.02 21.77 ?  489  LYS A C    1  
ATOM   7698   O O    . LYS A 1 496 ? 12.111  21.763  -50.085 0.02 21.52 ?  489  LYS A O    1  
ATOM   7699   C CB   . LYS A 1 496 ? 13.402  20.374  -52.750 0.02 21.92 ?  489  LYS A CB   1  
ATOM   7700   C CG   . LYS A 1 496 ? 14.658  21.059  -52.279 0.02 21.75 ?  489  LYS A CG   1  
ATOM   7701   C CD   . LYS A 1 496 ? 15.901  20.270  -52.627 0.02 21.69 ?  489  LYS A CD   1  
ATOM   7702   C CE   . LYS A 1 496 ? 16.073  20.181  -54.115 0.02 22.13 ?  489  LYS A CE   1  
ATOM   7703   N NZ   . LYS A 1 496 ? 17.478  20.306  -54.522 0.02 22.24 ?  489  LYS A NZ   1  
ATOM   7704   H H    . LYS A 1 496 ? 11.572  18.783  -52.925 0.02 22.06 ?  489  LYS A H    1  
ATOM   7705   H HA   . LYS A 1 496 ? 13.018  19.613  -50.892 0.02 21.35 ?  489  LYS A HA   1  
ATOM   7706   H HB2  . LYS A 1 496 ? 13.658  19.583  -53.248 0.02 21.90 ?  489  LYS A HB2  1  
ATOM   7707   H HB3  . LYS A 1 496 ? 12.932  20.994  -53.328 0.02 22.25 ?  489  LYS A HB3  1  
ATOM   7708   H HG2  . LYS A 1 496 ? 14.706  21.911  -52.734 0.02 21.99 ?  489  LYS A HG2  1  
ATOM   7709   H HG3  . LYS A 1 496 ? 14.629  21.188  -51.319 0.02 21.47 ?  489  LYS A HG3  1  
ATOM   7710   H HD2  . LYS A 1 496 ? 16.679  20.714  -52.254 0.02 21.64 ?  489  LYS A HD2  1  
ATOM   7711   H HD3  . LYS A 1 496 ? 15.823  19.370  -52.275 0.02 21.45 ?  489  LYS A HD3  1  
ATOM   7712   H HE2  . LYS A 1 496 ? 15.759  19.313  -54.411 0.02 22.10 ?  489  LYS A HE2  1  
ATOM   7713   H HE3  . LYS A 1 496 ? 15.563  20.889  -54.541 0.02 22.40 ?  489  LYS A HE3  1  
ATOM   7714   H HZ1  . LYS A 1 496 ? 17.831  19.498  -54.641 0.02 22.25 ?  489  LYS A HZ1  1  
ATOM   7715   H HZ2  . LYS A 1 496 ? 17.529  20.758  -55.290 0.02 22.54 ?  489  LYS A HZ2  1  
ATOM   7716   H HZ3  . LYS A 1 496 ? 17.942  20.742  -53.900 0.02 22.04 ?  489  LYS A HZ3  1  
ATOM   7717   N N    . GLU A 1 497 ? 10.520  21.442  -51.658 0.02 22.15 ?  490  GLU A N    1  
ATOM   7718   C CA   . GLU A 1 497 ? 9.669   22.551  -51.260 0.02 22.30 ?  490  GLU A CA   1  
ATOM   7719   C C    . GLU A 1 497 ? 9.077   22.362  -49.871 0.02 21.96 ?  490  GLU A C    1  
ATOM   7720   O O    . GLU A 1 497 ? 8.662   23.346  -49.254 0.02 21.97 ?  490  GLU A O    1  
ATOM   7721   C CB   . GLU A 1 497 ? 8.536   22.732  -52.301 0.02 22.81 ?  490  GLU A CB   1  
ATOM   7722   C CG   . GLU A 1 497 ? 8.365   24.178  -52.869 0.02 23.22 ?  490  GLU A CG   1  
ATOM   7723   C CD   . GLU A 1 497 ? 7.482   25.090  -52.000 0.02 23.30 ?  490  GLU A CD   1  
ATOM   7724   O OE1  . GLU A 1 497 ? 6.676   25.890  -52.545 0.02 23.76 ?  490  GLU A OE1  1  
ATOM   7725   O OE2  . GLU A 1 497 ? 7.594   24.999  -50.764 0.02 22.92 -1 490  GLU A OE2  1  
ATOM   7726   H H    . GLU A 1 497 ? 10.191  20.982  -52.303 0.02 22.34 ?  490  GLU A H    1  
ATOM   7727   H HA   . GLU A 1 497 ? 10.195  23.367  -51.251 0.02 22.33 ?  490  GLU A HA   1  
ATOM   7728   H HB2  . GLU A 1 497 ? 8.716   22.146  -53.050 0.02 22.92 ?  490  GLU A HB2  1  
ATOM   7729   H HB3  . GLU A 1 497 ? 7.693   22.478  -51.893 0.02 22.81 ?  490  GLU A HB3  1  
ATOM   7730   H HG2  . GLU A 1 497 ? 9.241   24.590  -52.936 0.02 23.15 ?  490  GLU A HG2  1  
ATOM   7731   H HG3  . GLU A 1 497 ? 7.961   24.122  -53.751 0.02 23.55 ?  490  GLU A HG3  1  
ATOM   7732   N N    . SER A 1 498 ? 9.108   21.142  -49.348 0.02 21.68 ?  491  SER A N    1  
ATOM   7733   C CA   . SER A 1 498 ? 8.266   20.778  -48.221 0.02 21.48 ?  491  SER A CA   1  
ATOM   7734   C C    . SER A 1 498 ? 8.833   21.327  -46.920 0.02 21.11 ?  491  SER A C    1  
ATOM   7735   O O    . SER A 1 498 ? 10.044  21.511  -46.765 0.02 20.90 ?  491  SER A O    1  
ATOM   7736   C CB   . SER A 1 498 ? 8.129   19.259  -48.123 0.02 21.31 ?  491  SER A CB   1  
ATOM   7737   O OG   . SER A 1 498 ? 9.335   18.633  -47.714 0.02 20.95 ?  491  SER A OG   1  
ATOM   7738   H H    . SER A 1 498 ? 9.618   20.505  -49.623 0.02 21.61 ?  491  SER A H    1  
ATOM   7739   H HA   . SER A 1 498 ? 7.385   21.157  -48.346 0.02 21.71 ?  491  SER A HA   1  
ATOM   7740   H HB2  . SER A 1 498 ? 7.442   19.048  -47.473 0.02 21.24 ?  491  SER A HB2  1  
ATOM   7741   H HB3  . SER A 1 498 ? 7.877   18.915  -48.993 0.02 21.56 ?  491  SER A HB3  1  
ATOM   7742   H HG   . SER A 1 498 ? 9.254   17.800  -47.757 0.02 20.93 ?  491  SER A HG   1  
ATOM   7743   N N    . ARG A 1 499 ? 7.928   21.583  -45.977 0.02 21.07 ?  492  ARG A N    1  
ATOM   7744   C CA   . ARG A 1 499 ? 8.351   22.100  -44.683 0.02 20.75 ?  492  ARG A CA   1  
ATOM   7745   C C    . ARG A 1 499 ? 9.240   21.099  -43.964 0.02 20.33 ?  492  ARG A C    1  
ATOM   7746   O O    . ARG A 1 499 ? 10.176  21.499  -43.266 0.02 20.08 ?  492  ARG A O    1  
ATOM   7747   C CB   . ARG A 1 499 ? 7.128   22.496  -43.846 0.02 20.82 ?  492  ARG A CB   1  
ATOM   7748   C CG   . ARG A 1 499 ? 6.083   21.463  -43.671 0.02 20.86 ?  492  ARG A CG   1  
ATOM   7749   C CD   . ARG A 1 499 ? 4.763   22.102  -43.227 0.02 21.09 ?  492  ARG A CD   1  
ATOM   7750   N NE   . ARG A 1 499 ? 4.838   22.674  -41.885 0.02 20.85 ?  492  ARG A NE   1  
ATOM   7751   C CZ   . ARG A 1 499 ? 4.669   21.965  -40.777 0.02 20.58 ?  492  ARG A CZ   1  
ATOM   7752   N NH1  . ARG A 1 499 ? 4.431   20.656  -40.855 0.02 20.52 ?  492  ARG A NH1  1  
ATOM   7753   N NH2  . ARG A 1 499 ? 4.753   22.568  -39.594 0.02 20.41 ?  492  ARG A NH2  1  
ATOM   7754   H H    . ARG A 1 499 ? 7.082   21.469  -46.063 0.02 21.23 ?  492  ARG A H    1  
ATOM   7755   H HA   . ARG A 1 499 ? 8.880   22.902  -44.817 0.02 20.80 ?  492  ARG A HA   1  
ATOM   7756   H HB2  . ARG A 1 499 ? 7.436   22.744  -42.961 0.02 20.61 ?  492  ARG A HB2  1  
ATOM   7757   H HB3  . ARG A 1 499 ? 6.705   23.260  -44.266 0.02 21.09 ?  492  ARG A HB3  1  
ATOM   7758   H HG2  . ARG A 1 499 ? 5.922   21.004  -44.510 0.02 21.03 ?  492  ARG A HG2  1  
ATOM   7759   H HG3  . ARG A 1 499 ? 6.367   20.831  -42.996 0.02 20.59 ?  492  ARG A HG3  1  
ATOM   7760   H HD2  . ARG A 1 499 ? 4.531   22.813  -43.841 0.02 21.35 ?  492  ARG A HD2  1  
ATOM   7761   H HD3  . ARG A 1 499 ? 4.070   21.426  -43.227 0.02 21.17 ?  492  ARG A HD3  1  
ATOM   7762   H HE   . ARG A 1 499 ? 4.999   23.515  -41.805 0.02 20.92 ?  492  ARG A HE   1  
ATOM   7763   H HH11 . ARG A 1 499 ? 4.380   20.266  -41.617 0.02 20.65 ?  492  ARG A HH11 1  
ATOM   7764   H HH12 . ARG A 1 499 ? 4.326   20.196  -40.139 0.02 20.36 ?  492  ARG A HH12 1  
ATOM   7765   H HH21 . ARG A 1 499 ? 4.907   23.412  -39.556 0.02 20.47 ?  492  ARG A HH21 1  
ATOM   7766   H HH22 . ARG A 1 499 ? 4.649   22.118  -38.869 0.02 20.25 ?  492  ARG A HH22 1  
ATOM   7767   N N    . GLU A 1 500 ? 9.005   19.804  -44.153 0.02 20.28 ?  493  GLU A N    1  
ATOM   7768   C CA   . GLU A 1 500 ? 9.874   18.812  -43.526 0.02 19.91 ?  493  GLU A CA   1  
ATOM   7769   C C    . GLU A 1 500 ? 11.271  18.830  -44.130 0.02 19.82 ?  493  GLU A C    1  
ATOM   7770   O O    . GLU A 1 500 ? 12.275  18.739  -43.414 0.02 19.52 ?  493  GLU A O    1  
ATOM   7771   C CB   . GLU A 1 500 ? 9.272   17.423  -43.648 0.02 19.92 ?  493  GLU A CB   1  
ATOM   7772   C CG   . GLU A 1 500 ? 7.985   17.245  -42.879 0.02 19.97 ?  493  GLU A CG   1  
ATOM   7773   C CD   . GLU A 1 500 ? 6.749   17.649  -43.656 0.02 20.39 ?  493  GLU A CD   1  
ATOM   7774   O OE1  . GLU A 1 500 ? 6.850   18.260  -44.763 0.02 20.67 ?  493  GLU A OE1  1  
ATOM   7775   O OE2  . GLU A 1 500 ? 5.657   17.322  -43.148 0.02 20.47 -1 493  GLU A OE2  1  
ATOM   7776   H H    . GLU A 1 500 ? 8.364   19.483  -44.621 0.02 20.46 ?  493  GLU A H    1  
ATOM   7777   H HA   . GLU A 1 500 ? 9.954   19.015  -42.580 0.02 19.72 ?  493  GLU A HA   1  
ATOM   7778   H HB2  . GLU A 1 500 ? 9.082   17.244  -44.581 0.02 20.15 ?  493  GLU A HB2  1  
ATOM   7779   H HB3  . GLU A 1 500 ? 9.911   16.778  -43.307 0.02 19.70 ?  493  GLU A HB3  1  
ATOM   7780   H HG2  . GLU A 1 500 ? 7.892   16.313  -42.636 0.02 19.91 ?  493  GLU A HG2  1  
ATOM   7781   H HG3  . GLU A 1 500 ? 8.023   17.783  -42.075 0.02 19.82 ?  493  GLU A HG3  1  
ATOM   7782   N N    . TYR A 1 501 ? 11.363  18.859  -45.454 0.02 20.10 ?  494  TYR A N    1  
ATOM   7783   C CA   . TYR A 1 501 ? 12.684  18.910  -46.067 0.02 20.07 ?  494  TYR A CA   1  
ATOM   7784   C C    . TYR A 1 501 ? 13.461  20.124  -45.586 0.02 20.01 ?  494  TYR A C    1  
ATOM   7785   O O    . TYR A 1 501 ? 14.655  20.023  -45.265 0.02 19.80 ?  494  TYR A O    1  
ATOM   7786   C CB   . TYR A 1 501 ? 12.578  18.933  -47.594 0.02 20.45 ?  494  TYR A CB   1  
ATOM   7787   C CG   . TYR A 1 501 ? 13.918  18.833  -48.282 0.02 20.48 ?  494  TYR A CG   1  
ATOM   7788   C CD1  . TYR A 1 501 ? 14.693  19.957  -48.463 0.02 20.60 ?  494  TYR A CD1  1  
ATOM   7789   C CD2  . TYR A 1 501 ? 14.414  17.610  -48.735 0.02 20.44 ?  494  TYR A CD2  1  
ATOM   7790   C CE1  . TYR A 1 501 ? 15.937  19.893  -49.073 0.02 20.66 ?  494  TYR A CE1  1  
ATOM   7791   C CE2  . TYR A 1 501 ? 15.674  17.531  -49.372 0.02 20.51 ?  494  TYR A CE2  1  
ATOM   7792   C CZ   . TYR A 1 501 ? 16.424  18.687  -49.540 0.02 20.62 ?  494  TYR A CZ   1  
ATOM   7793   O OH   . TYR A 1 501 ? 17.673  18.652  -50.156 0.02 20.71 ?  494  TYR A OH   1  
ATOM   7794   H H    . TYR A 1 501 ? 10.698  18.851  -45.997 0.02 20.33 ?  494  TYR A H    1  
ATOM   7795   H HA   . TYR A 1 501 ? 13.172  18.111  -45.813 0.02 19.86 ?  494  TYR A HA   1  
ATOM   7796   H HB2  . TYR A 1 501 ? 12.032  18.188  -47.887 0.02 20.51 ?  494  TYR A HB2  1  
ATOM   7797   H HB3  . TYR A 1 501 ? 12.170  19.772  -47.857 0.02 20.67 ?  494  TYR A HB3  1  
ATOM   7798   H HD1  . TYR A 1 501 ? 14.377  20.776  -48.156 0.02 20.64 ?  494  TYR A HD1  1  
ATOM   7799   H HD2  . TYR A 1 501 ? 13.908  16.838  -48.625 0.02 20.39 ?  494  TYR A HD2  1  
ATOM   7800   H HE1  . TYR A 1 501 ? 16.438  20.666  -49.187 0.02 20.76 ?  494  TYR A HE1  1  
ATOM   7801   H HE2  . TYR A 1 501 ? 15.994  16.712  -49.675 0.02 20.49 ?  494  TYR A HE2  1  
ATOM   7802   H HH   . TYR A 1 501 ? 17.998  19.424  -50.203 0.02 20.72 ?  494  TYR A HH   1  
ATOM   7803   N N    . LYS A 1 502 ? 12.808  21.284  -45.556 0.02 20.21 ?  495  LYS A N    1  
ATOM   7804   C CA   . LYS A 1 502 ? 13.489  22.502  -45.149 0.02 20.20 ?  495  LYS A CA   1  
ATOM   7805   C C    . LYS A 1 502 ? 13.920  22.403  -43.687 0.02 19.82 ?  495  LYS A C    1  
ATOM   7806   O O    . LYS A 1 502 ? 14.940  22.980  -43.300 0.02 19.72 ?  495  LYS A O    1  
ATOM   7807   C CB   . LYS A 1 502 ? 12.596  23.722  -45.390 0.02 20.53 ?  495  LYS A CB   1  
ATOM   7808   C CG   . LYS A 1 502 ? 12.131  23.927  -46.866 0.02 20.99 ?  495  LYS A CG   1  
ATOM   7809   C CD   . LYS A 1 502 ? 13.196  24.567  -47.784 0.02 21.16 ?  495  LYS A CD   1  
ATOM   7810   C CE   . LYS A 1 502 ? 12.655  24.741  -49.216 0.02 21.67 ?  495  LYS A CE   1  
ATOM   7811   N NZ   . LYS A 1 502 ? 13.541  25.593  -50.091 0.02 21.93 ?  495  LYS A NZ   1  
ATOM   7812   H H    . LYS A 1 502 ? 11.982  21.387  -45.761 0.02 20.37 ?  495  LYS A H    1  
ATOM   7813   H HA   . LYS A 1 502 ? 14.288  22.617  -45.688 0.02 20.26 ?  495  LYS A HA   1  
ATOM   7814   H HB2  . LYS A 1 502 ? 11.802  23.637  -44.839 0.02 20.50 ?  495  LYS A HB2  1  
ATOM   7815   H HB3  . LYS A 1 502 ? 13.087  24.518  -45.133 0.02 20.53 ?  495  LYS A HB3  1  
ATOM   7816   H HG2  . LYS A 1 502 ? 11.899  23.065  -47.244 0.02 21.03 ?  495  LYS A HG2  1  
ATOM   7817   H HG3  . LYS A 1 502 ? 11.354  24.507  -46.872 0.02 21.18 ?  495  LYS A HG3  1  
ATOM   7818   H HD2  . LYS A 1 502 ? 13.431  25.445  -47.449 0.02 21.13 ?  495  LYS A HD2  1  
ATOM   7819   H HD3  . LYS A 1 502 ? 13.979  23.997  -47.804 0.02 21.01 ?  495  LYS A HD3  1  
ATOM   7820   H HE2  . LYS A 1 502 ? 12.590  23.871  -49.627 0.02 21.71 ?  495  LYS A HE2  1  
ATOM   7821   H HE3  . LYS A 1 502 ? 11.778  25.156  -49.180 0.02 21.82 ?  495  LYS A HE3  1  
ATOM   7822   H HZ1  . LYS A 1 502 ? 13.111  26.329  -50.341 0.02 22.23 ?  495  LYS A HZ1  1  
ATOM   7823   H HZ2  . LYS A 1 502 ? 14.277  25.819  -49.646 0.02 21.82 ?  495  LYS A HZ2  1  
ATOM   7824   H HZ3  . LYS A 1 502 ? 13.778  25.137  -50.816 0.02 21.92 ?  495  LYS A HZ3  1  
ATOM   7825   N N    . THR A 1 503 ? 13.189  21.638  -42.873 0.02 19.62 ?  496  THR A N    1  
ATOM   7826   C CA   . THR A 1 503 ? 13.606  21.520  -41.470 0.02 19.28 ?  496  THR A CA   1  
ATOM   7827   C C    . THR A 1 503 ? 14.807  20.582  -41.334 0.02 19.02 ?  496  THR A C    1  
ATOM   7828   O O    . THR A 1 503 ? 15.719  20.856  -40.546 0.02 18.81 ?  496  THR A O    1  
ATOM   7829   C CB   . THR A 1 503 ? 12.422  21.094  -40.592 0.02 19.19 ?  496  THR A CB   1  
ATOM   7830   O OG1  . THR A 1 503 ? 11.440  22.123  -40.635 0.02 19.45 ?  496  THR A OG1  1  
ATOM   7831   C CG2  . THR A 1 503 ? 12.827  20.901  -39.131 0.02 18.86 ?  496  THR A CG2  1  
ATOM   7832   H H    . THR A 1 503 ? 12.488  21.196  -43.090 0.02 19.69 ?  496  THR A H    1  
ATOM   7833   H HA   . THR A 1 503 ? 13.884  22.396  -41.166 0.02 19.31 ?  496  THR A HA   1  
ATOM   7834   H HB   . THR A 1 503 ? 12.036  20.266  -40.915 0.02 19.21 ?  496  THR A HB   1  
ATOM   7835   H HG1  . THR A 1 503 ? 11.004  22.078  -41.349 0.02 19.64 ?  496  THR A HG1  1  
ATOM   7836   H HG21 . THR A 1 503 ? 12.151  20.378  -38.674 0.02 18.81 ?  496  THR A HG21 1  
ATOM   7837   H HG22 . THR A 1 503 ? 13.675  20.440  -39.069 0.02 18.70 ?  496  THR A HG22 1  
ATOM   7838   H HG23 . THR A 1 503 ? 12.895  21.764  -38.695 0.02 18.88 ?  496  THR A HG23 1  
ATOM   7839   N N    . ILE A 1 504 ? 14.843  19.487  -42.109 0.02 19.05 ?  497  ILE A N    1  
ATOM   7840   C CA   . ILE A 1 504 ? 16.047  18.653  -42.182 0.02 18.86 ?  497  ILE A CA   1  
ATOM   7841   C C    . ILE A 1 504 ? 17.265  19.505  -42.501 0.02 18.91 ?  497  ILE A C    1  
ATOM   7842   O O    . ILE A 1 504 ? 18.313  19.396  -41.857 0.02 18.70 ?  497  ILE A O    1  
ATOM   7843   C CB   . ILE A 1 504 ? 15.900  17.550  -43.245 0.02 18.98 ?  497  ILE A CB   1  
ATOM   7844   C CG1  . ILE A 1 504 ? 14.862  16.504  -42.867 0.02 18.91 ?  497  ILE A CG1  1  
ATOM   7845   C CG2  . ILE A 1 504 ? 17.273  16.876  -43.476 0.02 18.83 ?  497  ILE A CG2  1  
ATOM   7846   C CD1  . ILE A 1 504 ? 14.483  15.553  -44.057 0.02 19.12 ?  497  ILE A CD1  1  
ATOM   7847   H H    . ILE A 1 504 ? 14.194  19.207  -42.589 0.02 19.20 ?  497  ILE A H    1  
ATOM   7848   H HA   . ILE A 1 504 ? 16.192  18.228  -41.324 0.02 18.64 ?  497  ILE A HA   1  
ATOM   7849   H HB   . ILE A 1 504 ? 15.618  17.967  -44.073 0.02 19.22 ?  497  ILE A HB   1  
ATOM   7850   H HG12 . ILE A 1 504 ? 15.212  15.962  -42.144 0.02 18.69 ?  497  ILE A HG12 1  
ATOM   7851   H HG13 . ILE A 1 504 ? 14.052  16.956  -42.585 0.02 18.99 ?  497  ILE A HG13 1  
ATOM   7852   H HG21 . ILE A 1 504 ? 17.149  16.013  -43.892 0.02 18.88 ?  497  ILE A HG21 1  
ATOM   7853   H HG22 . ILE A 1 504 ? 17.813  17.444  -44.045 0.02 18.94 ?  497  ILE A HG22 1  
ATOM   7854   H HG23 . ILE A 1 504 ? 17.713  16.753  -42.621 0.02 18.61 ?  497  ILE A HG23 1  
ATOM   7855   H HD11 . ILE A 1 504 ? 14.030  14.772  -43.705 0.02 19.04 ?  497  ILE A HD11 1  
ATOM   7856   H HD12 . ILE A 1 504 ? 13.898  16.033  -44.662 0.02 19.35 ?  497  ILE A HD12 1  
ATOM   7857   H HD13 . ILE A 1 504 ? 15.284  15.278  -44.527 0.02 19.12 ?  497  ILE A HD13 1  
ATOM   7858   N N    . GLU A 1 505 ? 17.170  20.302  -43.566 0.02 19.23 ?  498  GLU A N    1  
ATOM   7859   C CA   . GLU A 1 505 ? 18.290  21.143  -43.978 0.02 19.34 ?  498  GLU A CA   1  
ATOM   7860   C C    . GLU A 1 505 ? 18.650  22.156  -42.893 0.02 19.24 ?  498  GLU A C    1  
ATOM   7861   O O    . GLU A 1 505 ? 19.831  22.409  -42.632 0.02 19.17 ?  498  GLU A O    1  
ATOM   7862   C CB   . GLU A 1 505 ? 17.944  21.827  -45.304 0.02 19.74 ?  498  GLU A CB   1  
ATOM   7863   C CG   . GLU A 1 505 ? 17.590  20.817  -46.405 0.02 19.86 ?  498  GLU A CG   1  
ATOM   7864   C CD   . GLU A 1 505 ? 18.793  20.355  -47.207 0.02 20.01 ?  498  GLU A CD   1  
ATOM   7865   O OE1  . GLU A 1 505 ? 18.652  19.940  -48.378 0.02 20.30 ?  498  GLU A OE1  1  
ATOM   7866   O OE2  . GLU A 1 505 ? 19.892  20.420  -46.670 0.02 19.85 -1 498  GLU A OE2  1  
ATOM   7867   H H    . GLU A 1 505 ? 16.471  20.370  -44.058 0.02 19.40 ?  498  GLU A H    1  
ATOM   7868   H HA   . GLU A 1 505 ? 19.069  20.587  -44.131 0.02 19.24 ?  498  GLU A HA   1  
ATOM   7869   H HB2  . GLU A 1 505 ? 17.179  22.408  -45.174 0.02 19.87 ?  498  GLU A HB2  1  
ATOM   7870   H HB3  . GLU A 1 505 ? 18.705  22.346  -45.599 0.02 19.83 ?  498  GLU A HB3  1  
ATOM   7871   H HG2  . GLU A 1 505 ? 17.199  20.031  -45.994 0.02 19.66 ?  498  GLU A HG2  1  
ATOM   7872   H HG3  . GLU A 1 505 ? 16.954  21.211  -47.011 0.02 20.07 ?  498  GLU A HG3  1  
ATOM   7873   N N    . ARG A 1 506 ? 17.635  22.738  -42.245 0.02 19.24 ?  499  ARG A N    1  
ATOM   7874   C CA   . ARG A 1 506 ? 17.876  23.684  -41.162 0.02 19.16 ?  499  ARG A CA   1  
ATOM   7875   C C    . ARG A 1 506 ? 18.601  23.027  -39.997 0.02 18.80 ?  499  ARG A C    1  
ATOM   7876   O O    . ARG A 1 506 ? 19.591  23.562  -39.475 0.02 18.74 ?  499  ARG A O    1  
ATOM   7877   C CB   . ARG A 1 506 ? 16.544  24.265  -40.686 0.02 19.26 ?  499  ARG A CB   1  
ATOM   7878   C CG   . ARG A 1 506 ? 15.931  25.315  -41.622 0.02 19.65 ?  499  ARG A CG   1  
ATOM   7879   C CD   . ARG A 1 506 ? 14.604  25.828  -41.123 0.02 19.76 ?  499  ARG A CD   1  
ATOM   7880   N NE   . ARG A 1 506 ? 14.138  26.941  -41.922 0.02 20.17 ?  499  ARG A NE   1  
ATOM   7881   C CZ   . ARG A 1 506 ? 12.938  27.488  -41.794 0.02 20.37 ?  499  ARG A CZ   1  
ATOM   7882   N NH1  . ARG A 1 506 ? 12.078  27.011  -40.897 0.02 20.21 ?  499  ARG A NH1  1  
ATOM   7883   N NH2  . ARG A 1 506 ? 12.609  28.507  -42.571 0.02 20.77 ?  499  ARG A NH2  1  
ATOM   7884   H H    . ARG A 1 506 ? 16.807  22.601  -42.414 0.02 19.31 ?  499  ARG A H    1  
ATOM   7885   H HA   . ARG A 1 506 ? 18.422  24.412  -41.493 0.02 19.30 ?  499  ARG A HA   1  
ATOM   7886   H HB2  . ARG A 1 506 ? 15.911  23.538  -40.606 0.02 19.19 ?  499  ARG A HB2  1  
ATOM   7887   H HB3  . ARG A 1 506 ? 16.682  24.679  -39.820 0.02 19.15 ?  499  ARG A HB3  1  
ATOM   7888   H HG2  . ARG A 1 506 ? 16.531  26.072  -41.689 0.02 19.74 ?  499  ARG A HG2  1  
ATOM   7889   H HG3  . ARG A 1 506 ? 15.797  24.925  -42.499 0.02 19.78 ?  499  ARG A HG3  1  
ATOM   7890   H HD2  . ARG A 1 506 ? 13.942  25.122  -41.182 0.02 19.69 ?  499  ARG A HD2  1  
ATOM   7891   H HD3  . ARG A 1 506 ? 14.692  26.128  -40.205 0.02 19.67 ?  499  ARG A HD3  1  
ATOM   7892   H HE   . ARG A 1 506 ? 14.587  27.132  -42.630 0.02 20.29 ?  499  ARG A HE   1  
ATOM   7893   H HH11 . ARG A 1 506 ? 12.297  26.351  -40.392 0.02 19.97 ?  499  ARG A HH11 1  
ATOM   7894   H HH12 . ARG A 1 506 ? 11.302  27.369  -40.817 0.02 20.36 ?  499  ARG A HH12 1  
ATOM   7895   H HH21 . ARG A 1 506 ? 13.173  28.803  -43.149 0.02 20.88 ?  499  ARG A HH21 1  
ATOM   7896   H HH22 . ARG A 1 506 ? 11.831  28.869  -42.501 0.02 20.92 ?  499  ARG A HH22 1  
ATOM   7897   N N    . MET A 1 507 ? 18.105  21.875  -39.549 0.02 18.59 ?  500  MET A N    1  
ATOM   7898   C CA   . MET A 1 507 ? 18.637  21.280  -38.334 0.02 18.28 ?  500  MET A CA   1  
ATOM   7899   C C    . MET A 1 507 ? 20.044  20.755  -38.566 0.02 18.19 ?  500  MET A C    1  
ATOM   7900   O O    . MET A 1 507 ? 20.947  21.013  -37.768 0.02 18.06 ?  500  MET A O    1  
ATOM   7901   C CB   . MET A 1 507 ? 17.731  20.155  -37.844 0.02 18.12 ?  500  MET A CB   1  
ATOM   7902   C CG   . MET A 1 507 ? 16.311  20.613  -37.427 0.02 18.21 ?  500  MET A CG   1  
ATOM   7903   S SD   . MET A 1 507 ? 16.233  21.988  -36.252 0.02 18.23 ?  500  MET A SD   1  
ATOM   7904   C CE   . MET A 1 507 ? 16.758  21.265  -34.708 0.02 17.90 ?  500  MET A CE   1  
ATOM   7905   H H    . MET A 1 507 ? 17.479  21.422  -39.919 0.02 18.64 ?  500  MET A H    1  
ATOM   7906   H HA   . MET A 1 507 ? 18.657  21.971  -37.654 0.02 18.27 ?  500  MET A HA   1  
ATOM   7907   H HB2  . MET A 1 507 ? 17.637  19.496  -38.547 0.02 18.17 ?  500  MET A HB2  1  
ATOM   7908   H HB3  . MET A 1 507 ? 18.148  19.745  -37.074 0.02 17.94 ?  500  MET A HB3  1  
ATOM   7909   H HG2  . MET A 1 507 ? 15.835  20.894  -38.220 0.02 18.41 ?  500  MET A HG2  1  
ATOM   7910   H HG3  . MET A 1 507 ? 15.850  19.864  -37.023 0.02 18.11 ?  500  MET A HG3  1  
ATOM   7911   H HE1  . MET A 1 507 ? 16.706  21.940  -34.015 0.02 17.91 ?  500  MET A HE1  1  
ATOM   7912   H HE2  . MET A 1 507 ? 16.173  20.523  -34.490 0.02 17.83 ?  500  MET A HE2  1  
ATOM   7913   H HE3  . MET A 1 507 ? 17.673  20.954  -34.798 0.02 17.80 ?  500  MET A HE3  1  
ATOM   7914   N N    . THR A 1 508 ? 20.252  19.995  -39.649 0.02 18.27 ?  501  THR A N    1  
ATOM   7915   C CA   . THR A 1 508 ? 21.608  19.515  -39.924 0.02 18.21 ?  501  THR A CA   1  
ATOM   7916   C C    . THR A 1 508 ? 22.534  20.675  -40.249 0.02 18.40 ?  501  THR A C    1  
ATOM   7917   O O    . THR A 1 508 ? 23.710  20.653  -39.875 0.02 18.32 ?  501  THR A O    1  
ATOM   7918   C CB   . THR A 1 508 ? 21.623  18.474  -41.063 0.02 18.29 ?  501  THR A CB   1  
ATOM   7919   O OG1  . THR A 1 508 ? 21.011  19.006  -42.247 0.02 18.59 ?  501  THR A OG1  1  
ATOM   7920   C CG2  . THR A 1 508 ? 20.927  17.147  -40.644 0.02 18.10 ?  501  THR A CG2  1  
ATOM   7921   H H    . THR A 1 508 ? 19.648  19.744  -40.203 0.02 18.36 ?  501  THR A H    1  
ATOM   7922   H HA   . THR A 1 508 ? 21.960  19.088  -39.130 0.02 18.02 ?  501  THR A HA   1  
ATOM   7923   H HB   . THR A 1 508 ? 22.547  18.260  -41.261 0.02 18.29 ?  501  THR A HB   1  
ATOM   7924   H HG1  . THR A 1 508 ? 21.371  19.738  -42.449 0.02 18.71 ?  501  THR A HG1  1  
ATOM   7925   H HG21 . THR A 1 508 ? 19.964  17.225  -40.724 0.02 18.15 ?  501  THR A HG21 1  
ATOM   7926   H HG22 . THR A 1 508 ? 21.234  16.416  -41.201 0.02 18.14 ?  501  THR A HG22 1  
ATOM   7927   H HG23 . THR A 1 508 ? 21.146  16.942  -39.722 0.02 17.91 ?  501  THR A HG23 1  
ATOM   7928   N N    . GLY A 1 509 ? 22.014  21.719  -40.893 0.02 18.66 ?  502  GLY A N    1  
ATOM   7929   C CA   . GLY A 1 509 ? 22.831  22.888  -41.149 0.02 18.87 ?  502  GLY A CA   1  
ATOM   7930   C C    . GLY A 1 509 ? 23.313  23.547  -39.869 0.02 18.75 ?  502  GLY A C    1  
ATOM   7931   O O    . GLY A 1 509 ? 24.478  23.931  -39.757 0.02 18.79 ?  502  GLY A O    1  
ATOM   7932   H H    . GLY A 1 509 ? 21.208  21.769  -41.187 0.02 18.74 ?  502  GLY A H    1  
ATOM   7933   H HA2  . GLY A 1 509 ? 23.606  22.624  -41.666 0.02 18.93 ?  502  GLY A HA2  1  
ATOM   7934   H HA3  . GLY A 1 509 ? 22.330  23.540  -41.663 0.02 19.08 ?  502  GLY A HA3  1  
ATOM   7935   N N    . ILE A 1 510 ? 22.402  23.737  -38.909 0.02 18.63 ?  503  ILE A N    1  
ATOM   7936   C CA   . ILE A 1 510 ? 22.763  24.394  -37.657 0.02 18.54 ?  503  ILE A CA   1  
ATOM   7937   C C    . ILE A 1 510 ? 23.743  23.537  -36.870 0.02 18.28 ?  503  ILE A C    1  
ATOM   7938   O O    . ILE A 1 510 ? 24.746  24.034  -36.356 0.02 18.31 ?  503  ILE A O    1  
ATOM   7939   C CB   . ILE A 1 510 ? 21.498  24.695  -36.831 0.02 18.49 ?  503  ILE A CB   1  
ATOM   7940   C CG1  . ILE A 1 510 ? 20.704  25.844  -37.484 0.02 18.80 ?  503  ILE A CG1  1  
ATOM   7941   C CG2  . ILE A 1 510 ? 21.881  25.020  -35.377 0.02 18.34 ?  503  ILE A CG2  1  
ATOM   7942   C CD1  . ILE A 1 510 ? 19.238  26.030  -36.981 0.02 18.80 ?  503  ILE A CD1  1  
ATOM   7943   H H    . ILE A 1 510 ? 21.581  23.496  -38.957 0.02 18.61 ?  503  ILE A H    1  
ATOM   7944   H HA   . ILE A 1 510 ? 23.199  25.234  -37.859 0.02 18.72 ?  503  ILE A HA   1  
ATOM   7945   H HB   . ILE A 1 510 ? 20.943  23.902  -36.838 0.02 18.37 ?  503  ILE A HB   1  
ATOM   7946   H HG12 . ILE A 1 510 ? 21.175  26.675  -37.324 0.02 18.93 ?  503  ILE A HG12 1  
ATOM   7947   H HG13 . ILE A 1 510 ? 20.659  25.680  -38.439 0.02 18.92 ?  503  ILE A HG13 1  
ATOM   7948   H HG21 . ILE A 1 510 ? 21.085  25.320  -34.912 0.02 18.35 ?  503  ILE A HG21 1  
ATOM   7949   H HG22 . ILE A 1 510 ? 22.229  24.228  -34.942 0.02 18.15 ?  503  ILE A HG22 1  
ATOM   7950   H HG23 . ILE A 1 510 ? 22.546  25.724  -35.377 0.02 18.46 ?  503  ILE A HG23 1  
ATOM   7951   H HD11 . ILE A 1 510 ? 18.762  26.609  -37.596 0.02 19.02 ?  503  ILE A HD11 1  
ATOM   7952   H HD12 . ILE A 1 510 ? 18.812  25.158  -36.946 0.02 18.66 ?  503  ILE A HD12 1  
ATOM   7953   H HD13 . ILE A 1 510 ? 19.249  26.431  -36.100 0.02 18.74 ?  503  ILE A HD13 1  
ATOM   7954   N N    . TRP A 1 511 ? 23.463  22.241  -36.757 0.02 18.06 ?  504  TRP A N    1  
ATOM   7955   C CA   . TRP A 1 511 ? 24.342  21.344  -36.010 0.02 17.83 ?  504  TRP A CA   1  
ATOM   7956   C C    . TRP A 1 511 ? 25.723  21.262  -36.639 0.02 17.93 ?  504  TRP A C    1  
ATOM   7957   O O    . TRP A 1 511 ? 26.733  21.260  -35.936 0.02 17.86 ?  504  TRP A O    1  
ATOM   7958   C CB   . TRP A 1 511 ? 23.726  19.944  -35.928 0.02 17.63 ?  504  TRP A CB   1  
ATOM   7959   C CG   . TRP A 1 511 ? 22.972  19.666  -34.660 0.02 17.45 ?  504  TRP A CG   1  
ATOM   7960   C CD1  . TRP A 1 511 ? 23.156  18.612  -33.840 0.02 17.23 ?  504  TRP A CD1  1  
ATOM   7961   C CD2  . TRP A 1 511 ? 21.928  20.454  -34.087 0.02 17.50 ?  504  TRP A CD2  1  
ATOM   7962   N NE1  . TRP A 1 511 ? 22.296  18.679  -32.766 0.02 17.14 ?  504  TRP A NE1  1  
ATOM   7963   C CE2  . TRP A 1 511 ? 21.525  19.804  -32.896 0.02 17.30 ?  504  TRP A CE2  1  
ATOM   7964   C CE3  . TRP A 1 511 ? 21.291  21.638  -34.457 0.02 17.71 ?  504  TRP A CE3  1  
ATOM   7965   C CZ2  . TRP A 1 511 ? 20.516  20.296  -32.087 0.02 17.31 ?  504  TRP A CZ2  1  
ATOM   7966   C CZ3  . TRP A 1 511 ? 20.289  22.129  -33.653 0.02 17.72 ?  504  TRP A CZ3  1  
ATOM   7967   C CH2  . TRP A 1 511 ? 19.929  21.469  -32.465 0.02 17.52 ?  504  TRP A CH2  1  
ATOM   7968   H H    . TRP A 1 511 ? 22.777  21.864  -37.105 0.02 18.06 ?  504  TRP A H    1  
ATOM   7969   H HA   . TRP A 1 511 ? 24.441  21.682  -35.107 0.02 17.77 ?  504  TRP A HA   1  
ATOM   7970   H HB2  . TRP A 1 511 ? 23.106  19.829  -36.663 0.02 17.72 ?  504  TRP A HB2  1  
ATOM   7971   H HB3  . TRP A 1 511 ? 24.433  19.286  -35.995 0.02 17.56 ?  504  TRP A HB3  1  
ATOM   7972   H HD1  . TRP A 1 511 ? 23.784  17.942  -33.978 0.02 17.17 ?  504  TRP A HD1  1  
ATOM   7973   H HE1  . TRP A 1 511 ? 22.249  18.109  -32.130 0.02 17.02 ?  504  TRP A HE1  1  
ATOM   7974   H HE3  . TRP A 1 511 ? 21.538  22.083  -35.235 0.02 17.86 ?  504  TRP A HE3  1  
ATOM   7975   H HZ2  . TRP A 1 511 ? 20.270  19.855  -31.307 0.02 17.20 ?  504  TRP A HZ2  1  
ATOM   7976   H HZ3  . TRP A 1 511 ? 19.864  22.920  -33.883 0.02 17.87 ?  504  TRP A HZ3  1  
ATOM   7977   H HH2  . TRP A 1 511 ? 19.242  21.820  -31.945 0.02 17.54 ?  504  TRP A HH2  1  
ATOM   7978   N N    . THR A 1 512 ? 25.777  21.188  -37.972 0.02 18.11 ?  505  THR A N    1  
ATOM   7979   C CA   . THR A 1 512 ? 27.038  21.110  -38.688 0.02 18.22 ?  505  THR A CA   1  
ATOM   7980   C C    . THR A 1 512 ? 27.832  22.423  -38.548 0.02 18.45 ?  505  THR A C    1  
ATOM   7981   O O    . THR A 1 512 ? 29.054  22.408  -38.341 0.02 18.48 ?  505  THR A O    1  
ATOM   7982   C CB   . THR A 1 512 ? 26.704  20.736  -40.153 0.02 18.35 ?  505  THR A CB   1  
ATOM   7983   O OG1  . THR A 1 512 ? 26.523  19.296  -40.286 0.02 18.24 ?  505  THR A OG1  1  
ATOM   7984   C CG2  . THR A 1 512 ? 27.731  21.340  -41.124 0.02 18.69 ?  505  THR A CG2  1  
ATOM   7985   H H    . THR A 1 512 ? 25.086  21.184  -38.479 0.02 18.19 ?  505  THR A H    1  
ATOM   7986   H HA   . THR A 1 512 ? 27.569  20.393  -38.309 0.02 18.07 ?  505  THR A HA   1  
ATOM   7987   H HB   . THR A 1 512 ? 25.863  21.155  -40.377 0.02 18.32 ?  505  THR A HB   1  
ATOM   7988   H HG1  . THR A 1 512 ? 26.281  19.100  -41.060 0.02 18.36 ?  505  THR A HG1  1  
ATOM   7989   H HG21 . THR A 1 512 ? 27.574  21.014  -42.023 0.02 18.78 ?  505  THR A HG21 1  
ATOM   7990   H HG22 . THR A 1 512 ? 27.634  22.307  -41.127 0.02 18.78 ?  505  THR A HG22 1  
ATOM   7991   H HG23 . THR A 1 512 ? 28.637  21.118  -40.857 0.02 18.75 ?  505  THR A HG23 1  
ATOM   7992   N N    . GLN A 1 513 ? 27.144  23.568  -38.624 0.02 18.62 ?  506  GLN A N    1  
ATOM   7993   C CA   . GLN A 1 513 ? 27.762  24.872  -38.417 0.02 18.85 ?  506  GLN A CA   1  
ATOM   7994   C C    . GLN A 1 513 ? 28.338  25.009  -37.017 0.02 18.70 ?  506  GLN A C    1  
ATOM   7995   O O    . GLN A 1 513 ? 29.476  25.454  -36.844 0.02 18.83 ?  506  GLN A O    1  
ATOM   7996   C CB   . GLN A 1 513 ? 26.714  25.948  -38.658 0.02 19.05 ?  506  GLN A CB   1  
ATOM   7997   C CG   . GLN A 1 513 ? 27.016  27.299  -38.013 0.02 19.27 ?  506  GLN A CG   1  
ATOM   7998   C CD   . GLN A 1 513 ? 28.290  27.954  -38.514 0.02 19.57 ?  506  GLN A CD   1  
ATOM   7999   O OE1  . GLN A 1 513 ? 29.030  28.605  -37.755 0.02 19.75 ?  506  GLN A OE1  1  
ATOM   8000   N NE2  . GLN A 1 513 ? 28.547  27.802  -39.798 0.02 19.68 ?  506  GLN A NE2  1  
ATOM   8001   H H    . GLN A 1 513 ? 26.306  23.614  -38.803 0.02 18.63 ?  506  GLN A H    1  
ATOM   8002   H HA   . GLN A 1 513 ? 28.483  24.997  -39.051 0.02 19.01 ?  506  GLN A HA   1  
ATOM   8003   H HB2  . GLN A 1 513 ? 26.624  26.036  -39.611 0.02 19.21 ?  506  GLN A HB2  1  
ATOM   8004   H HB3  . GLN A 1 513 ? 25.874  25.635  -38.289 0.02 18.90 ?  506  GLN A HB3  1  
ATOM   8005   H HG2  . GLN A 1 513 ? 26.284  27.903  -38.194 0.02 19.38 ?  506  GLN A HG2  1  
ATOM   8006   H HG3  . GLN A 1 513 ? 27.106  27.174  -37.059 0.02 19.13 ?  506  GLN A HG3  1  
ATOM   8007   H HE21 . GLN A 1 513 ? 28.249  27.118  -40.222 0.02 19.69 ?  506  GLN A HE21 1  
ATOM   8008   H HE22 . GLN A 1 513 ? 29.019  28.392  -40.210 0.02 19.75 ?  506  GLN A HE22 1  
ATOM   8009   N N    . PHE A 1 514 ? 27.546  24.663  -36.008 0.02 18.47 ?  507  PHE A N    1  
ATOM   8010   C CA   . PHE A 1 514 ? 28.044  24.700  -34.637 0.02 18.33 ?  507  PHE A CA   1  
ATOM   8011   C C    . PHE A 1 514 ? 29.278  23.820  -34.478 0.02 18.23 ?  507  PHE A C    1  
ATOM   8012   O O    . PHE A 1 514 ? 30.239  24.192  -33.787 0.02 18.29 ?  507  PHE A O    1  
ATOM   8013   C CB   . PHE A 1 514 ? 26.930  24.257  -33.681 0.02 18.09 ?  507  PHE A CB   1  
ATOM   8014   C CG   . PHE A 1 514 ? 27.328  24.291  -32.240 0.02 17.98 ?  507  PHE A CG   1  
ATOM   8015   C CD1  . PHE A 1 514 ? 27.573  25.477  -31.610 0.02 18.15 ?  507  PHE A CD1  1  
ATOM   8016   C CD2  . PHE A 1 514 ? 27.493  23.120  -31.534 0.02 17.72 ?  507  PHE A CD2  1  
ATOM   8017   C CE1  . PHE A 1 514 ? 27.978  25.485  -30.288 0.02 18.07 ?  507  PHE A CE1  1  
ATOM   8018   C CE2  . PHE A 1 514 ? 27.891  23.141  -30.220 0.02 17.65 ?  507  PHE A CE2  1  
ATOM   8019   C CZ   . PHE A 1 514 ? 28.122  24.318  -29.612 0.02 17.82 ?  507  PHE A CZ   1  
ATOM   8020   H H    . PHE A 1 514 ? 26.735  24.403  -36.089 0.02 18.40 ?  507  PHE A H    1  
ATOM   8021   H HA   . PHE A 1 514 ? 28.293  25.609  -34.415 0.02 18.49 ?  507  PHE A HA   1  
ATOM   8022   H HB2  . PHE A 1 514 ? 26.166  24.842  -33.788 0.02 18.18 ?  507  PHE A HB2  1  
ATOM   8023   H HB3  . PHE A 1 514 ? 26.684  23.347  -33.897 0.02 17.95 ?  507  PHE A HB3  1  
ATOM   8024   H HD1  . PHE A 1 514 ? 27.483  26.273  -32.064 0.02 18.34 ?  507  PHE A HD1  1  
ATOM   8025   H HD2  . PHE A 1 514 ? 27.338  22.304  -31.948 0.02 17.62 ?  507  PHE A HD2  1  
ATOM   8026   H HE1  . PHE A 1 514 ? 28.136  26.295  -29.857 0.02 18.21 ?  507  PHE A HE1  1  
ATOM   8027   H HE2  . PHE A 1 514 ? 27.990  22.344  -29.750 0.02 17.49 ?  507  PHE A HE2  1  
ATOM   8028   H HZ   . PHE A 1 514 ? 28.386  24.329  -28.719 0.02 17.79 ?  507  PHE A HZ   1  
ATOM   8029   N N    . ALA A 1 515 ? 29.266  22.644  -35.091 0.02 18.09 ?  508  ALA A N    1  
ATOM   8030   C CA   . ALA A 1 515 ? 30.419  21.757  -34.982 0.02 18.01 ?  508  ALA A CA   1  
ATOM   8031   C C    . ALA A 1 515 ? 31.648  22.402  -35.599 0.02 18.29 ?  508  ALA A C    1  
ATOM   8032   O O    . ALA A 1 515 ? 32.781  22.164  -35.156 0.02 18.30 ?  508  ALA A O    1  
ATOM   8033   C CB   . ALA A 1 515 ? 30.121  20.418  -35.656 0.02 17.88 ?  508  ALA A CB   1  
ATOM   8034   H H    . ALA A 1 515 ? 28.621  22.339  -35.568 0.02 18.06 ?  508  ALA A H    1  
ATOM   8035   H HA   . ALA A 1 515 ? 30.598  21.590  -34.044 0.02 17.89 ?  508  ALA A HA   1  
ATOM   8036   H HB1  . ALA A 1 515 ? 30.849  19.805  -35.476 0.02 17.82 ?  508  ALA A HB1  1  
ATOM   8037   H HB2  . ALA A 1 515 ? 29.292  20.057  -35.307 0.02 17.73 ?  508  ALA A HB2  1  
ATOM   8038   H HB3  . ALA A 1 515 ? 30.046  20.564  -36.610 0.02 18.01 ?  508  ALA A HB3  1  
ATOM   8039   N N    . THR A 1 516 ? 31.445  23.230  -36.624 0.02 18.55 ?  509  THR A N    1  
ATOM   8040   C CA   . THR A 1 516 ? 32.578  23.810  -37.333 0.02 18.85 ?  509  THR A CA   1  
ATOM   8041   C C    . THR A 1 516 ? 33.230  24.946  -36.551 0.02 19.03 ?  509  THR A C    1  
ATOM   8042   O O    . THR A 1 516 ? 34.461  24.972  -36.419 0.02 19.14 ?  509  THR A O    1  
ATOM   8043   C CB   . THR A 1 516 ? 32.144  24.272  -38.719 0.02 19.10 ?  509  THR A CB   1  
ATOM   8044   O OG1  . THR A 1 516 ? 31.653  23.145  -39.453 0.02 18.95 ?  509  THR A OG1  1  
ATOM   8045   C CG2  . THR A 1 516 ? 33.322  24.796  -39.508 0.02 19.44 ?  509  THR A CG2  1  
ATOM   8046   H H    . THR A 1 516 ? 30.677  23.470  -36.920 0.02 18.57 ?  509  THR A H    1  
ATOM   8047   H HA   . THR A 1 516 ? 33.252  23.122  -37.450 0.02 18.82 ?  509  THR A HA   1  
ATOM   8048   H HB   . THR A 1 516 ? 31.471  24.966  -38.654 0.02 19.17 ?  509  THR A HB   1  
ATOM   8049   H HG1  . THR A 1 516 ? 31.059  22.746  -39.014 0.02 18.84 ?  509  THR A HG1  1  
ATOM   8050   H HG21 . THR A 1 516 ? 33.047  24.987  -40.419 0.02 19.62 ?  509  THR A HG21 1  
ATOM   8051   H HG22 . THR A 1 516 ? 33.665  25.609  -39.107 0.02 19.55 ?  509  THR A HG22 1  
ATOM   8052   H HG23 . THR A 1 516 ? 34.025  24.129  -39.523 0.02 19.38 ?  509  THR A HG23 1  
ATOM   8053   N N    . THR A 1 517 ? 32.453  25.909  -36.022 0.02 19.09 ?  510  THR A N    1  
ATOM   8054   C CA   . THR A 1 517 ? 33.120  26.963  -35.254 0.02 19.30 ?  510  THR A CA   1  
ATOM   8055   C C    . THR A 1 517 ? 32.606  27.210  -33.857 0.02 19.15 ?  510  THR A C    1  
ATOM   8056   O O    . THR A 1 517 ? 33.017  28.200  -33.260 0.02 19.36 ?  510  THR A O    1  
ATOM   8057   C CB   . THR A 1 517 ? 33.088  28.336  -35.943 0.02 19.69 ?  510  THR A CB   1  
ATOM   8058   O OG1  . THR A 1 517 ? 31.880  28.509  -36.677 0.02 19.72 ?  510  THR A OG1  1  
ATOM   8059   C CG2  . THR A 1 517 ? 34.346  28.559  -36.794 0.02 20.02 ?  510  THR A CG2  1  
ATOM   8060   H H    . THR A 1 517 ? 31.599  25.970  -36.089 0.02 19.02 ?  510  THR A H    1  
ATOM   8061   H HA   . THR A 1 517 ? 34.055  26.725  -35.158 0.02 19.35 ?  510  THR A HA   1  
ATOM   8062   H HB   . THR A 1 517 ? 33.103  29.028  -35.267 0.02 19.76 ?  510  THR A HB   1  
ATOM   8063   H HG1  . THR A 1 517 ? 32.015  28.990  -37.358 0.02 19.82 ?  510  THR A HG1  1  
ATOM   8064   H HG21 . THR A 1 517 ? 34.194  29.270  -37.435 0.02 20.27 ?  510  THR A HG21 1  
ATOM   8065   H HG22 . THR A 1 517 ? 35.088  28.812  -36.218 0.02 20.07 ?  510  THR A HG22 1  
ATOM   8066   H HG23 . THR A 1 517 ? 34.581  27.746  -37.266 0.02 19.95 ?  510  THR A HG23 1  
ATOM   8067   N N    . GLY A 1 518 ? 31.734  26.371  -33.314 0.02 18.84 ?  511  GLY A N    1  
ATOM   8068   C CA   . GLY A 1 518 ? 31.239  26.674  -31.992 0.02 18.72 ?  511  GLY A CA   1  
ATOM   8069   C C    . GLY A 1 518 ? 30.247  27.820  -31.935 0.02 18.85 ?  511  GLY A C    1  
ATOM   8070   O O    . GLY A 1 518 ? 29.912  28.265  -30.835 0.02 18.81 ?  511  GLY A O    1  
ATOM   8071   H H    . GLY A 1 518 ? 31.436  25.650  -33.672 0.02 18.70 ?  511  GLY A H    1  
ATOM   8072   H HA2  . GLY A 1 518 ? 30.806  25.887  -31.625 0.02 18.49 ?  511  GLY A HA2  1  
ATOM   8073   H HA3  . GLY A 1 518 ? 31.993  26.895  -31.421 0.02 18.81 ?  511  GLY A HA3  1  
ATOM   8074   N N    . ASN A 1 519 ? 29.779  28.319  -33.083 0.02 19.02 ?  512  ASN A N    1  
ATOM   8075   C CA   . ASN A 1 519 ? 28.637  29.242  -33.155 0.02 19.16 ?  512  ASN A CA   1  
ATOM   8076   C C    . ASN A 1 519 ? 27.762  28.914  -34.358 0.02 19.17 ?  512  ASN A C    1  
ATOM   8077   O O    . ASN A 1 519 ? 28.291  28.553  -35.422 0.02 19.21 ?  512  ASN A O    1  
ATOM   8078   C CB   . ASN A 1 519 ? 29.005  30.712  -33.322 0.02 19.55 ?  512  ASN A CB   1  
ATOM   8079   C CG   . ASN A 1 519 ? 27.921  31.434  -34.118 0.02 19.78 ?  512  ASN A CG   1  
ATOM   8080   O OD1  . ASN A 1 519 ? 28.014  31.599  -35.332 0.02 19.96 ?  512  ASN A OD1  1  
ATOM   8081   N ND2  . ASN A 1 519 ? 26.807  31.664  -33.469 0.02 19.74 ?  512  ASN A ND2  1  
ATOM   8082   H H    . ASN A 1 519 ? 30.105  28.127  -33.853 0.02 19.08 ?  512  ASN A H    1  
ATOM   8083   H HA   . ASN A 1 519 ? 28.106  29.148  -32.348 0.02 19.02 ?  512  ASN A HA   1  
ATOM   8084   H HB2  . ASN A 1 519 ? 29.086  31.129  -32.448 0.02 19.56 ?  512  ASN A HB2  1  
ATOM   8085   H HB3  . ASN A 1 519 ? 29.841  30.784  -33.809 0.02 19.67 ?  512  ASN A HB3  1  
ATOM   8086   H HD21 . ASN A 1 519 ? 26.229  32.216  -33.784 0.02 19.94 ?  512  ASN A HD21 1  
ATOM   8087   H HD22 . ASN A 1 519 ? 26.656  31.257  -32.727 0.02 19.54 ?  512  ASN A HD22 1  
ATOM   8088   N N    . PRO A 1 520 ? 26.442  29.095  -34.290 0.02 19.16 ?  513  PRO A N    1  
ATOM   8089   C CA   . PRO A 1 520 ? 25.661  29.187  -35.540 0.02 19.32 ?  513  PRO A CA   1  
ATOM   8090   C C    . PRO A 1 520 ? 25.367  30.586  -36.089 0.02 19.71 ?  513  PRO A C    1  
ATOM   8091   O O    . PRO A 1 520 ? 24.978  31.462  -35.336 0.02 19.81 ?  513  PRO A O    1  
ATOM   8092   C CB   . PRO A 1 520 ? 24.379  28.469  -35.178 0.02 19.09 ?  513  PRO A CB   1  
ATOM   8093   C CG   . PRO A 1 520 ? 24.825  27.457  -34.234 0.02 18.76 ?  513  PRO A CG   1  
ATOM   8094   C CD   . PRO A 1 520 ? 25.858  28.116  -33.378 0.02 18.82 ?  513  PRO A CD   1  
ATOM   8095   H HA   . PRO A 1 520 ? 26.103  28.694  -36.228 0.02 19.32 ?  513  PRO A HA   1  
ATOM   8096   H HB2  . PRO A 1 520 ? 23.758  29.095  -34.771 0.02 19.17 ?  513  PRO A HB2  1  
ATOM   8097   H HB3  . PRO A 1 520 ? 24.005  28.069  -35.980 0.02 19.11 ?  513  PRO A HB3  1  
ATOM   8098   H HG2  . PRO A 1 520 ? 24.075  27.154  -33.694 0.02 18.63 ?  513  PRO A HG2  1  
ATOM   8099   H HG3  . PRO A 1 520 ? 25.217  26.717  -34.729 0.02 18.68 ?  513  PRO A HG3  1  
ATOM   8100   H HD2  . PRO A 1 520 ? 25.450  28.545  -32.606 0.02 18.83 ?  513  PRO A HD2  1  
ATOM   8101   H HD3  . PRO A 1 520 ? 26.519  27.468  -33.121 0.02 18.67 ?  513  PRO A HD3  1  
ATOM   8102   N N    . TYR A 1 521 ? 25.629  30.802  -37.384 0.02 19.96 ?  514  TYR A N    1  
ATOM   8103   C CA   . TYR A 1 521 ? 24.970  31.812  -38.205 0.02 20.33 ?  514  TYR A CA   1  
ATOM   8104   C C    . TYR A 1 521 ? 25.067  31.337  -39.647 0.02 20.44 ?  514  TYR A C    1  
ATOM   8105   O O    . TYR A 1 521 ? 24.745  32.082  -40.562 0.02 20.81 ?  514  TYR A O    1  
ATOM   8106   C CB   . TYR A 1 521 ? 25.709  33.151  -38.077 0.02 20.65 ?  514  TYR A CB   1  
ATOM   8107   C CG   . TYR A 1 521 ? 24.896  34.432  -38.302 0.02 21.01 ?  514  TYR A CG   1  
ATOM   8108   C CD1  . TYR A 1 521 ? 24.753  35.354  -37.276 0.02 21.15 ?  514  TYR A CD1  1  
ATOM   8109   C CD2  . TYR A 1 521 ? 24.283  34.716  -39.522 0.02 21.26 ?  514  TYR A CD2  1  
ATOM   8110   C CE1  . TYR A 1 521 ? 24.018  36.510  -37.439 0.02 21.51 ?  514  TYR A CE1  1  
ATOM   8111   C CE2  . TYR A 1 521 ? 23.545  35.887  -39.703 0.02 21.61 ?  514  TYR A CE2  1  
ATOM   8112   C CZ   . TYR A 1 521 ? 23.408  36.783  -38.660 0.02 21.74 ?  514  TYR A CZ   1  
ATOM   8113   O OH   . TYR A 1 521 ? 22.661  37.964  -38.765 0.02 22.13 ?  514  TYR A OH   1  
ATOM   8114   H H    . TYR A 1 521 ? 26.182  30.310  -37.783 0.02 19.94 ?  514  TYR A H    1  
ATOM   8115   H HA   . TYR A 1 521 ? 24.084  31.881  -37.970 0.02 20.30 ?  514  TYR A HA   1  
ATOM   8116   H HB2  . TYR A 1 521 ? 26.018  33.260  -37.165 0.02 20.53 ?  514  TYR A HB2  1  
ATOM   8117   H HB3  . TYR A 1 521 ? 26.483  33.098  -38.648 0.02 20.78 ?  514  TYR A HB3  1  
ATOM   8118   H HD1  . TYR A 1 521 ? 25.151  35.176  -36.454 0.02 21.00 ?  514  TYR A HD1  1  
ATOM   8119   H HD2  . TYR A 1 521 ? 24.368  34.120  -40.227 0.02 21.20 ?  514  TYR A HD2  1  
ATOM   8120   H HE1  . TYR A 1 521 ? 23.933  37.105  -36.730 0.02 21.61 ?  514  TYR A HE1  1  
ATOM   8121   H HE2  . TYR A 1 521 ? 23.137  36.060  -40.518 0.02 21.79 ?  514  TYR A HE2  1  
ATOM   8122   H HH   . TYR A 1 521 ? 22.546  38.292  -38.000 0.02 22.30 ?  514  TYR A HH   1  
ATOM   8123   N N    . SER A 1 522 ? 25.611  30.116  -39.823 0.02 20.14 ?  515  SER A N    1  
ATOM   8124   C CA   . SER A 1 522 ? 26.065  29.569  -41.111 0.02 20.23 ?  515  SER A CA   1  
ATOM   8125   C C    . SER A 1 522 ? 25.202  30.091  -42.240 0.02 20.54 ?  515  SER A C    1  
ATOM   8126   O O    . SER A 1 522 ? 24.463  29.316  -42.854 0.02 20.50 ?  515  SER A O    1  
ATOM   8127   C CB   . SER A 1 522 ? 25.983  28.021  -41.147 0.02 19.87 ?  515  SER A CB   1  
ATOM   8128   O OG   . SER A 1 522 ? 26.958  27.404  -42.036 0.02 19.97 ?  515  SER A OG   1  
ATOM   8129   H H    . SER A 1 522 ? 25.630  29.529  -39.203 0.02 19.90 ?  515  SER A H    1  
ATOM   8130   H HA   . SER A 1 522 ? 26.983  29.808  -41.326 0.02 20.34 ?  515  SER A HA   1  
ATOM   8131   H HB2  . SER A 1 522 ? 26.123  27.743  -40.255 0.02 19.67 ?  515  SER A HB2  1  
ATOM   8132   H HB3  . SER A 1 522 ? 25.097  27.729  -41.414 0.02 19.81 ?  515  SER A HB3  1  
ATOM   8133   H HG   . SER A 1 522 ? 27.022  26.577  -41.897 0.02 19.80 ?  515  SER A HG   1  
ATOM   8134   N N    . ASN A 1 523 ? 25.354  31.377  -42.573 0.02 20.89 ?  516  ASN A N    1  
ATOM   8135   C CA   . ASN A 1 523 ? 24.294  32.010  -43.354 0.02 21.20 ?  516  ASN A CA   1  
ATOM   8136   C C    . ASN A 1 523 ? 23.867  31.128  -44.530 0.02 21.22 ?  516  ASN A C    1  
ATOM   8137   O O    . ASN A 1 523 ? 22.767  31.314  -45.046 0.02 21.39 ?  516  ASN A O    1  
ATOM   8138   C CB   . ASN A 1 523 ? 24.705  33.430  -43.812 0.02 21.68 ?  516  ASN A CB   1  
ATOM   8139   C CG   . ASN A 1 523 ? 23.488  34.366  -44.008 0.02 21.96 ?  516  ASN A CG   1  
ATOM   8140   O OD1  . ASN A 1 523 ? 23.536  35.560  -43.671 0.02 22.24 ?  516  ASN A OD1  1  
ATOM   8141   N ND2  . ASN A 1 523 ? 22.404  33.826  -44.558 0.02 21.90 ?  516  ASN A ND2  1  
ATOM   8142   H H    . ASN A 1 523 ? 26.032  31.872  -42.384 0.02 20.98 ?  516  ASN A H    1  
ATOM   8143   H HA   . ASN A 1 523 ? 23.522  32.118  -42.778 0.02 21.13 ?  516  ASN A HA   1  
ATOM   8144   H HB2  . ASN A 1 523 ? 25.256  33.826  -43.119 0.02 21.67 ?  516  ASN A HB2  1  
ATOM   8145   H HB3  . ASN A 1 523 ? 25.207  33.381  -44.642 0.02 21.85 ?  516  ASN A HB3  1  
ATOM   8146   H HD21 . ASN A 1 523 ? 22.345  32.978  -44.666 0.02 21.82 ?  516  ASN A HD21 1  
ATOM   8147   H HD22 . ASN A 1 523 ? 21.755  34.334  -44.806 0.02 21.95 ?  516  ASN A HD22 1  
ATOM   8148   N N    . GLU A 1 524 ? 24.686  30.137  -44.923 0.02 21.09 ?  517  GLU A N    1  
ATOM   8149   C CA   . GLU A 1 524 ? 24.344  29.089  -45.892 0.02 21.09 ?  517  GLU A CA   1  
ATOM   8150   C C    . GLU A 1 524 ? 23.118  28.273  -45.489 0.02 20.81 ?  517  GLU A C    1  
ATOM   8151   O O    . GLU A 1 524 ? 23.257  27.268  -44.789 0.02 20.45 ?  517  GLU A O    1  
ATOM   8152   C CB   . GLU A 1 524 ? 25.531  28.126  -46.073 0.02 20.96 ?  517  GLU A CB   1  
ATOM   8153   C CG   . GLU A 1 524 ? 26.858  28.836  -46.345 0.02 21.15 ?  517  GLU A CG   1  
ATOM   8154   C CD   . GLU A 1 524 ? 28.077  27.943  -46.230 0.02 21.01 ?  517  GLU A CD   1  
ATOM   8155   O OE1  . GLU A 1 524 ? 27.945  26.690  -46.196 0.02 20.83 ?  517  GLU A OE1  1  
ATOM   8156   O OE2  . GLU A 1 524 ? 29.171  28.549  -46.166 0.02 21.09 -1 517  GLU A OE2  1  
ATOM   8157   H H    . GLU A 1 524 ? 25.484  30.053  -44.623 0.02 21.02 ?  517  GLU A H    1  
ATOM   8158   H HA   . GLU A 1 524 ? 24.157  29.498  -46.749 0.02 21.39 ?  517  GLU A HA   1  
ATOM   8159   H HB2  . GLU A 1 524 ? 25.633  27.604  -45.262 0.02 20.65 ?  517  GLU A HB2  1  
ATOM   8160   H HB3  . GLU A 1 524 ? 25.350  27.539  -46.823 0.02 21.07 ?  517  GLU A HB3  1  
ATOM   8161   H HG2  . GLU A 1 524 ? 26.839  29.203  -47.243 0.02 21.48 ?  517  GLU A HG2  1  
ATOM   8162   H HG3  . GLU A 1 524 ? 26.986  29.550  -45.703 0.02 21.07 ?  517  GLU A HG3  1  
ATOM   8163   N N    . ILE A 1 525 ? 21.943  28.625  -45.977 0.02 21.01 ?  518  ILE A N    1  
ATOM   8164   C CA   . ILE A 1 525 ? 20.707  28.201  -45.355 0.02 20.80 ?  518  ILE A CA   1  
ATOM   8165   C C    . ILE A 1 525 ? 19.560  28.449  -46.342 0.02 21.11 ?  518  ILE A C    1  
ATOM   8166   O O    . ILE A 1 525 ? 19.733  29.195  -47.319 0.02 21.49 ?  518  ILE A O    1  
ATOM   8167   C CB   . ILE A 1 525 ? 20.545  28.981  -44.032 0.02 20.68 ?  518  ILE A CB   1  
ATOM   8168   C CG1  . ILE A 1 525 ? 21.355  28.300  -42.947 0.02 20.33 ?  518  ILE A CG1  1  
ATOM   8169   C CG2  . ILE A 1 525 ? 19.147  29.264  -43.739 0.02 20.64 ?  518  ILE A CG2  1  
ATOM   8170   C CD1  . ILE A 1 525 ? 20.751  28.391  -41.605 0.02 19.97 ?  518  ILE A CD1  1  
ATOM   8171   H H    . ILE A 1 525 ? 21.837  29.113  -46.677 0.02 21.29 ?  518  ILE A H    1  
ATOM   8172   H HA   . ILE A 1 525 ? 20.751  27.250  -45.165 0.02 20.55 ?  518  ILE A HA   1  
ATOM   8173   H HB   . ILE A 1 525 ? 20.967  29.843  -44.164 0.02 20.92 ?  518  ILE A HB   1  
ATOM   8174   H HG12 . ILE A 1 525 ? 21.467  27.363  -43.163 0.02 20.24 ?  518  ILE A HG12 1  
ATOM   8175   H HG13 . ILE A 1 525 ? 22.219  28.731  -42.903 0.02 20.44 ?  518  ILE A HG13 1  
ATOM   8176   H HG21 . ILE A 1 525 ? 18.872  29.893  -44.408 0.02 20.92 ?  518  ILE A HG21 1  
ATOM   8177   H HG22 . ILE A 1 525 ? 18.640  28.443  -43.793 0.02 20.47 ?  518  ILE A HG22 1  
ATOM   8178   H HG23 . ILE A 1 525 ? 19.035  29.686  -42.880 0.02 20.53 ?  518  ILE A HG23 1  
ATOM   8179   H HD11 . ILE A 1 525 ? 20.049  27.724  -41.525 0.02 19.94 ?  518  ILE A HD11 1  
ATOM   8180   H HD12 . ILE A 1 525 ? 21.444  28.222  -40.951 0.02 19.75 ?  518  ILE A HD12 1  
ATOM   8181   H HD13 . ILE A 1 525 ? 20.400  29.280  -41.455 0.02 20.01 ?  518  ILE A HD13 1  
ATOM   8182   N N    . GLU A 1 526 ? 18.403  27.798  -46.131 0.02 20.98 ?  519  GLU A N    1  
ATOM   8183   C CA   . GLU A 1 526 ? 17.139  28.490  -46.404 0.02 21.27 ?  519  GLU A CA   1  
ATOM   8184   C C    . GLU A 1 526 ? 16.489  28.894  -45.083 0.02 21.09 ?  519  GLU A C    1  
ATOM   8185   O O    . GLU A 1 526 ? 15.805  28.086  -44.444 0.02 20.82 ?  519  GLU A O    1  
ATOM   8186   C CB   . GLU A 1 526 ? 16.170  27.658  -47.258 0.02 21.37 ?  519  GLU A CB   1  
ATOM   8187   C CG   . GLU A 1 526 ? 15.806  28.402  -48.585 0.02 21.87 ?  519  GLU A CG   1  
ATOM   8188   C CD   . GLU A 1 526 ? 14.382  28.190  -49.055 0.02 22.04 ?  519  GLU A CD   1  
ATOM   8189   O OE1  . GLU A 1 526 ? 13.466  28.093  -48.207 0.02 21.87 ?  519  GLU A OE1  1  
ATOM   8190   O OE2  . GLU A 1 526 ? 14.172  28.128  -50.279 0.02 22.39 -1 519  GLU A OE2  1  
ATOM   8191   H H    . GLU A 1 526 ? 18.329  26.987  -45.849 0.02 20.73 ?  519  GLU A H    1  
ATOM   8192   H HA   . GLU A 1 526 ? 17.333  29.300  -46.896 0.02 21.55 ?  519  GLU A HA   1  
ATOM   8193   H HB2  . GLU A 1 526 ? 16.568  26.802  -47.477 0.02 21.25 ?  519  GLU A HB2  1  
ATOM   8194   H HB3  . GLU A 1 526 ? 15.347  27.527  -46.761 0.02 21.25 ?  519  GLU A HB3  1  
ATOM   8195   H HG2  . GLU A 1 526 ? 15.922  29.354  -48.456 0.02 22.03 ?  519  GLU A HG2  1  
ATOM   8196   H HG3  . GLU A 1 526 ? 16.394  28.095  -49.293 0.02 21.97 ?  519  GLU A HG3  1  
ATOM   8197   N N    . GLY A 1 527 ? 16.709  30.168  -44.701 0.02 21.28 ?  520  GLY A N    1  
ATOM   8198   C CA   . GLY A 1 527 ? 16.312  30.777  -43.445 0.02 21.12 ?  520  GLY A CA   1  
ATOM   8199   C C    . GLY A 1 527 ? 16.994  32.105  -43.130 0.02 21.29 ?  520  GLY A C    1  
ATOM   8200   O O    . GLY A 1 527 ? 17.582  32.229  -42.028 0.02 21.05 ?  520  GLY A O    1  
ATOM   8201   H H    . GLY A 1 527 ? 17.117  30.726  -45.207 0.02 21.54 ?  520  GLY A H    1  
ATOM   8202   H HA2  . GLY A 1 527 ? 15.354  30.932  -43.428 0.02 21.22 ?  520  GLY A HA2  1  
ATOM   8203   H HA3  . GLY A 1 527 ? 16.556  30.171  -42.725 0.02 20.81 ?  520  GLY A HA3  1  
ATOM   8204   N N    . MET A 1 528 ? 16.815  33.114  -43.969 0.02 21.73 ?  521  MET A N    1  
ATOM   8205   C CA   . MET A 1 528 ? 17.849  34.116  -44.335 0.02 22.00 ?  521  MET A CA   1  
ATOM   8206   C C    . MET A 1 528 ? 18.778  34.602  -43.197 0.02 21.85 ?  521  MET A C    1  
ATOM   8207   O O    . MET A 1 528 ? 19.943  34.177  -43.207 0.02 21.72 ?  521  MET A O    1  
ATOM   8208   C CB   . MET A 1 528 ? 17.153  35.311  -45.006 0.02 22.53 ?  521  MET A CB   1  
ATOM   8209   C CG   . MET A 1 528 ? 16.151  36.117  -44.148 0.02 22.64 ?  521  MET A CG   1  
ATOM   8210   S SD   . MET A 1 528 ? 17.118  37.196  -43.037 0.02 22.66 ?  521  MET A SD   1  
ATOM   8211   C CE   . MET A 1 528 ? 17.697  38.401  -44.219 0.02 23.11 ?  521  MET A CE   1  
ATOM   8212   H H    . MET A 1 528 ? 16.023  33.261  -44.290 0.02 21.91 ?  521  MET A H    1  
ATOM   8213   H HA   . MET A 1 528 ? 18.447  33.786  -44.989 0.02 22.00 ?  521  MET A HA   1  
ATOM   8214   H HB2  . MET A 1 528 ? 17.861  35.900  -45.330 0.02 22.73 ?  521  MET A HB2  1  
ATOM   8215   H HB3  . MET A 1 528 ? 16.631  34.972  -45.750 0.02 22.63 ?  521  MET A HB3  1  
ATOM   8216   H HG2  . MET A 1 528 ? 15.599  36.658  -44.734 0.02 22.97 ?  521  MET A HG2  1  
ATOM   8217   H HG3  . MET A 1 528 ? 15.592  35.520  -43.624 0.02 22.41 ?  521  MET A HG3  1  
ATOM   8218   H HE1  . MET A 1 528 ? 17.760  39.265  -43.787 0.02 23.10 ?  521  MET A HE1  1  
ATOM   8219   H HE2  . MET A 1 528 ? 18.567  38.124  -44.551 0.02 23.05 ?  521  MET A HE2  1  
ATOM   8220   H HE3  . MET A 1 528 ? 17.065  38.451  -44.954 0.02 23.45 ?  521  MET A HE3  1  
ATOM   8221   N N    . GLU A 1 529 ? 18.301  35.470  -42.274 0.02 21.89 ?  522  GLU A N    1  
ATOM   8222   C CA   . GLU A 1 529 ? 19.113  36.126  -41.226 0.02 21.83 ?  522  GLU A CA   1  
ATOM   8223   C C    . GLU A 1 529 ? 18.521  37.456  -40.748 0.02 22.17 ?  522  GLU A C    1  
ATOM   8224   O O    . GLU A 1 529 ? 19.138  38.516  -40.898 0.02 22.51 ?  522  GLU A O    1  
ATOM   8225   C CB   . GLU A 1 529 ? 20.575  36.324  -41.649 0.02 21.89 ?  522  GLU A CB   1  
ATOM   8226   C CG   . GLU A 1 529 ? 20.844  37.256  -42.756 0.02 22.37 ?  522  GLU A CG   1  
ATOM   8227   C CD   . GLU A 1 529 ? 22.089  38.077  -42.456 0.02 22.61 ?  522  GLU A CD   1  
ATOM   8228   O OE1  . GLU A 1 529 ? 21.925  39.284  -42.290 0.02 22.90 ?  522  GLU A OE1  1  
ATOM   8229   O OE2  . GLU A 1 529 ? 23.222  37.534  -42.349 0.02 22.51 -1 522  GLU A OE2  1  
ATOM   8230   H H    . GLU A 1 529 ? 17.468  35.647  -42.209 0.02 21.97 ?  522  GLU A H    1  
ATOM   8231   H HA   . GLU A 1 529 ? 19.147  35.582  -40.419 0.02 21.52 ?  522  GLU A HA   1  
ATOM   8232   H HB2  . GLU A 1 529 ? 21.040  36.710  -40.891 0.02 21.83 ?  522  GLU A HB2  1  
ATOM   8233   H HB3  . GLU A 1 529 ? 20.979  35.468  -41.848 0.02 21.66 ?  522  GLU A HB3  1  
ATOM   8234   H HG2  . GLU A 1 529 ? 20.994  36.760  -43.575 0.02 22.36 ?  522  GLU A HG2  1  
ATOM   8235   H HG3  . GLU A 1 529 ? 20.098  37.863  -42.867 0.02 22.59 ?  522  GLU A HG3  1  
ATOM   8236   N N    . ASN A 1 530 ? 17.311  37.421  -40.190 0.02 22.13 ?  523  ASN A N    1  
ATOM   8237   C CA   . ASN A 1 530 ? 16.956  38.369  -39.147 0.02 22.25 ?  523  ASN A CA   1  
ATOM   8238   C C    . ASN A 1 530 ? 17.221  37.776  -37.758 0.02 21.86 ?  523  ASN A C    1  
ATOM   8239   O O    . ASN A 1 530 ? 16.720  38.295  -36.754 0.02 21.91 ?  523  ASN A O    1  
ATOM   8240   C CB   . ASN A 1 530 ? 15.494  38.783  -39.308 0.02 22.40 ?  523  ASN A CB   1  
ATOM   8241   C CG   . ASN A 1 530 ? 14.622  38.216  -38.266 0.02 22.05 ?  523  ASN A CG   1  
ATOM   8242   O OD1  . ASN A 1 530 ? 14.116  38.951  -37.421 0.02 22.10 ?  523  ASN A OD1  1  
ATOM   8243   N ND2  . ASN A 1 530 ? 14.453  36.895  -38.277 0.02 21.72 ?  523  ASN A ND2  1  
ATOM   8244   H H    . ASN A 1 530 ? 16.691  36.855  -40.371 0.02 22.05 ?  523  ASN A H    1  
ATOM   8245   H HA   . ASN A 1 530 ? 17.509  39.156  -39.242 0.02 22.53 ?  523  ASN A HA   1  
ATOM   8246   H HB2  . ASN A 1 530 ? 15.406  39.740  -39.218 0.02 22.71 ?  523  ASN A HB2  1  
ATOM   8247   H HB3  . ASN A 1 530 ? 15.176  38.482  -40.172 0.02 22.44 ?  523  ASN A HB3  1  
ATOM   8248   H HD21 . ASN A 1 530 ? 14.860  36.416  -38.865 0.02 21.76 ?  523  ASN A HD21 1  
ATOM   8249   H HD22 . ASN A 1 530 ? 13.943  36.518  -37.692 0.02 21.48 ?  523  ASN A HD22 1  
ATOM   8250   N N    . VAL A 1 531 ? 17.988  36.676  -37.681 0.02 21.49 ?  524  VAL A N    1  
ATOM   8251   C CA   . VAL A 1 531 ? 18.229  35.979  -36.417 0.02 21.10 ?  524  VAL A CA   1  
ATOM   8252   C C    . VAL A 1 531 ? 19.470  36.552  -35.734 0.02 21.14 ?  524  VAL A C    1  
ATOM   8253   O O    . VAL A 1 531 ? 20.572  36.544  -36.301 0.02 21.15 ?  524  VAL A O    1  
ATOM   8254   C CB   . VAL A 1 531 ? 18.361  34.457  -36.620 0.02 20.70 ?  524  VAL A CB   1  
ATOM   8255   C CG1  . VAL A 1 531 ? 19.045  33.790  -35.398 0.02 20.33 ?  524  VAL A CG1  1  
ATOM   8256   C CG2  . VAL A 1 531 ? 16.982  33.851  -36.822 0.02 20.66 ?  524  VAL A CG2  1  
ATOM   8257   H H    . VAL A 1 531 ? 18.383  36.315  -38.354 0.02 21.48 ?  524  VAL A H    1  
ATOM   8258   H HA   . VAL A 1 531 ? 17.471  36.132  -35.831 0.02 21.10 ?  524  VAL A HA   1  
ATOM   8259   H HB   . VAL A 1 531 ? 18.897  34.275  -37.407 0.02 20.72 ?  524  VAL A HB   1  
ATOM   8260   H HG11 . VAL A 1 531 ? 18.953  32.828  -35.473 0.02 20.10 ?  524  VAL A HG11 1  
ATOM   8261   H HG12 . VAL A 1 531 ? 19.987  34.022  -35.382 0.02 20.35 ?  524  VAL A HG12 1  
ATOM   8262   H HG13 . VAL A 1 531 ? 18.612  34.098  -34.588 0.02 20.33 ?  524  VAL A HG13 1  
ATOM   8263   H HG21 . VAL A 1 531 ? 17.079  32.932  -37.113 0.02 20.46 ?  524  VAL A HG21 1  
ATOM   8264   H HG22 . VAL A 1 531 ? 16.497  33.886  -35.985 0.02 20.59 ?  524  VAL A HG22 1  
ATOM   8265   H HG23 . VAL A 1 531 ? 16.509  34.367  -37.496 0.02 20.93 ?  524  VAL A HG23 1  
ATOM   8266   N N    . SER A 1 532 ? 19.278  37.059  -34.519 0.02 21.18 ?  525  SER A N    1  
ATOM   8267   C CA   . SER A 1 532 ? 20.351  37.603  -33.674 0.02 21.22 ?  525  SER A CA   1  
ATOM   8268   C C    . SER A 1 532 ? 20.583  36.643  -32.505 0.02 20.81 ?  525  SER A C    1  
ATOM   8269   O O    . SER A 1 532 ? 20.021  36.830  -31.420 0.02 20.78 ?  525  SER A O    1  
ATOM   8270   C CB   . SER A 1 532 ? 19.982  38.993  -33.155 0.02 21.62 ?  525  SER A CB   1  
ATOM   8271   O OG   . SER A 1 532 ? 20.027  39.976  -34.181 0.02 22.05 ?  525  SER A OG   1  
ATOM   8272   H H    . SER A 1 532 ? 18.506  37.099  -34.148 0.02 21.20 ?  525  SER A H    1  
ATOM   8273   H HA   . SER A 1 532 ? 21.167  37.675  -34.196 0.02 21.29 ?  525  SER A HA   1  
ATOM   8274   H HB2  . SER A 1 532 ? 19.083  38.962  -32.799 0.02 21.58 ?  525  SER A HB2  1  
ATOM   8275   H HB3  . SER A 1 532 ? 20.604  39.237  -32.452 0.02 21.64 ?  525  SER A HB3  1  
ATOM   8276   H HG   . SER A 1 532 ? 19.831  40.728  -33.862 0.02 22.27 ?  525  SER A HG   1  
ATOM   8277   N N    . TRP A 1 533 ? 21.418  35.621  -32.718 0.02 20.51 ?  526  TRP A N    1  
ATOM   8278   C CA   . TRP A 1 533 ? 21.495  34.484  -31.790 0.02 20.11 ?  526  TRP A CA   1  
ATOM   8279   C C    . TRP A 1 533 ? 22.689  34.605  -30.838 0.02 20.11 ?  526  TRP A C    1  
ATOM   8280   O O    . TRP A 1 533 ? 23.693  33.913  -30.980 0.02 20.03 ?  526  TRP A O    1  
ATOM   8281   C CB   . TRP A 1 533 ? 21.549  33.176  -32.572 0.02 19.81 ?  526  TRP A CB   1  
ATOM   8282   C CG   . TRP A 1 533 ? 21.235  31.980  -31.732 0.02 19.44 ?  526  TRP A CG   1  
ATOM   8283   C CD1  . TRP A 1 533 ? 21.016  31.968  -30.388 0.02 19.33 ?  526  TRP A CD1  1  
ATOM   8284   C CD2  . TRP A 1 533 ? 21.109  30.622  -32.173 0.02 19.15 ?  526  TRP A CD2  1  
ATOM   8285   N NE1  . TRP A 1 533 ? 20.756  30.687  -29.970 0.02 18.99 ?  526  TRP A NE1  1  
ATOM   8286   C CE2  . TRP A 1 533 ? 20.806  29.846  -31.045 0.02 18.88 ?  526  TRP A CE2  1  
ATOM   8287   C CE3  . TRP A 1 533 ? 21.214  29.984  -33.418 0.02 19.13 ?  526  TRP A CE3  1  
ATOM   8288   C CZ2  . TRP A 1 533 ? 20.604  28.481  -31.110 0.02 18.60 ?  526  TRP A CZ2  1  
ATOM   8289   C CZ3  . TRP A 1 533 ? 21.012  28.628  -33.485 0.02 18.85 ?  526  TRP A CZ3  1  
ATOM   8290   C CH2  . TRP A 1 533 ? 20.725  27.878  -32.322 0.02 18.58 ?  526  TRP A CH2  1  
ATOM   8291   H H    . TRP A 1 533 ? 21.952  35.561  -33.388 0.02 20.54 ?  526  TRP A H    1  
ATOM   8292   H HA   . TRP A 1 533 ? 20.688  34.480  -31.257 0.02 20.07 ?  526  TRP A HA   1  
ATOM   8293   H HB2  . TRP A 1 533 ? 20.902  33.213  -33.293 0.02 19.90 ?  526  TRP A HB2  1  
ATOM   8294   H HB3  . TRP A 1 533 ? 22.438  33.055  -32.938 0.02 19.81 ?  526  TRP A HB3  1  
ATOM   8295   H HD1  . TRP A 1 533 ? 21.039  32.715  -29.837 0.02 19.47 ?  526  TRP A HD1  1  
ATOM   8296   H HE1  . TRP A 1 533 ? 20.590  30.448  -29.163 0.02 18.88 ?  526  TRP A HE1  1  
ATOM   8297   H HE3  . TRP A 1 533 ? 21.408  30.471  -34.185 0.02 19.33 ?  526  TRP A HE3  1  
ATOM   8298   H HZ2  . TRP A 1 533 ? 20.409  27.991  -30.344 0.02 18.44 ?  526  TRP A HZ2  1  
ATOM   8299   H HZ3  . TRP A 1 533 ? 21.084  28.191  -34.302 0.02 18.85 ?  526  TRP A HZ3  1  
ATOM   8300   H HH2  . TRP A 1 533 ? 20.589  26.963  -32.386 0.02 18.41 ?  526  TRP A HH2  1  
ATOM   8301   N N    . ASP A 1 534 ? 22.560  35.513  -29.805 0.02 20.23 ?  527  ASP A N    1  
ATOM   8302   C CA   . ASP A 1 534 ? 23.434  35.784  -28.666 0.02 20.28 ?  527  ASP A CA   1  
ATOM   8303   C C    . ASP A 1 534 ? 23.552  34.525  -27.818 0.02 19.89 ?  527  ASP A C    1  
ATOM   8304   O O    . ASP A 1 534 ? 22.570  33.803  -27.664 0.02 19.65 ?  527  ASP A O    1  
ATOM   8305   C CB   . ASP A 1 534 ? 22.834  36.913  -27.806 0.02 20.57 ?  527  ASP A CB   1  
ATOM   8306   C CG   . ASP A 1 534 ? 23.861  37.957  -27.310 0.02 20.94 ?  527  ASP A CG   1  
ATOM   8307   O OD1  . ASP A 1 534 ? 24.762  38.419  -28.074 0.02 21.16 ?  527  ASP A OD1  1  
ATOM   8308   O OD2  . ASP A 1 534 ? 23.715  38.378  -26.128 0.02 21.06 -1 527  ASP A OD2  1  
ATOM   8309   H H    . ASP A 1 534 ? 21.875  36.034  -29.778 0.02 20.30 ?  527  ASP A H    1  
ATOM   8310   H HA   . ASP A 1 534 ? 24.310  36.055  -28.976 0.02 20.41 ?  527  ASP A HA   1  
ATOM   8311   H HB2  . ASP A 1 534 ? 22.165  37.383  -28.327 0.02 20.71 ?  527  ASP A HB2  1  
ATOM   8312   H HB3  . ASP A 1 534 ? 22.415  36.523  -27.023 0.02 20.42 ?  527  ASP A HB3  1  
ATOM   8313   N N    . PRO A 1 535 ? 24.721  34.207  -27.258 0.02 19.83 ?  528  PRO A N    1  
ATOM   8314   C CA   . PRO A 1 535 ? 24.753  33.263  -26.138 0.02 19.53 ?  528  PRO A CA   1  
ATOM   8315   C C    . PRO A 1 535 ? 24.062  33.830  -24.909 0.02 19.63 ?  528  PRO A C    1  
ATOM   8316   O O    . PRO A 1 535 ? 23.595  34.972  -24.893 0.02 19.95 ?  528  PRO A O    1  
ATOM   8317   C CB   . PRO A 1 535 ? 26.244  33.052  -25.873 0.02 19.54 ?  528  PRO A CB   1  
ATOM   8318   C CG   . PRO A 1 535 ? 26.931  34.150  -26.589 0.02 19.92 ?  528  PRO A CG   1  
ATOM   8319   C CD   . PRO A 1 535 ? 26.076  34.545  -27.719 0.02 20.02 ?  528  PRO A CD   1  
ATOM   8320   H HA   . PRO A 1 535 ? 24.339  32.422  -26.380 0.02 19.30 ?  528  PRO A HA   1  
ATOM   8321   H HB2  . PRO A 1 535 ? 26.409  33.107  -24.919 0.02 19.54 ?  528  PRO A HB2  1  
ATOM   8322   H HB3  . PRO A 1 535 ? 26.519  32.188  -26.219 0.02 19.34 ?  528  PRO A HB3  1  
ATOM   8323   H HG2  . PRO A 1 535 ? 27.048  34.902  -25.983 0.02 20.12 ?  528  PRO A HG2  1  
ATOM   8324   H HG3  . PRO A 1 535 ? 27.794  33.838  -26.909 0.02 19.91 ?  528  PRO A HG3  1  
ATOM   8325   H HD2  . PRO A 1 535 ? 26.158  35.499  -27.872 0.02 20.31 ?  528  PRO A HD2  1  
ATOM   8326   H HD3  . PRO A 1 535 ? 26.306  34.030  -28.506 0.02 19.93 ?  528  PRO A HD3  1  
ATOM   8327   N N    . ILE A 1 536 ? 24.011  32.992  -23.871 0.02 19.38 ?  529  ILE A N    1  
ATOM   8328   C CA   . ILE A 1 536 ? 23.403  33.347  -22.595 0.02 19.45 ?  529  ILE A CA   1  
ATOM   8329   C C    . ILE A 1 536 ? 24.444  33.967  -21.679 0.02 19.67 ?  529  ILE A C    1  
ATOM   8330   O O    . ILE A 1 536 ? 25.537  33.410  -21.492 0.02 19.57 ?  529  ILE A O    1  
ATOM   8331   C CB   . ILE A 1 536 ? 22.807  32.097  -21.927 0.02 19.12 ?  529  ILE A CB   1  
ATOM   8332   C CG1  . ILE A 1 536 ? 21.932  31.331  -22.918 0.02 18.93 ?  529  ILE A CG1  1  
ATOM   8333   C CG2  . ILE A 1 536 ? 21.992  32.467  -20.688 0.02 19.23 ?  529  ILE A CG2  1  
ATOM   8334   C CD1  . ILE A 1 536 ? 20.693  32.091  -23.343 0.02 19.09 ?  529  ILE A CD1  1  
ATOM   8335   H H    . ILE A 1 536 ? 24.325  32.192  -23.886 0.02 19.17 ?  529  ILE A H    1  
ATOM   8336   H HA   . ILE A 1 536 ? 22.695  33.991  -22.742 0.02 19.61 ?  529  ILE A HA   1  
ATOM   8337   H HB   . ILE A 1 536 ? 23.541  31.523  -21.654 0.02 18.99 ?  529  ILE A HB   1  
ATOM   8338   H HG12 . ILE A 1 536 ? 22.445  31.127  -23.712 0.02 18.93 ?  529  ILE A HG12 1  
ATOM   8339   H HG13 . ILE A 1 536 ? 21.643  30.507  -22.494 0.02 18.71 ?  529  ILE A HG13 1  
ATOM   8340   H HG21 . ILE A 1 536 ? 21.552  31.672  -20.352 0.02 19.04 ?  529  ILE A HG21 1  
ATOM   8341   H HG22 . ILE A 1 536 ? 22.585  32.821  -20.009 0.02 19.35 ?  529  ILE A HG22 1  
ATOM   8342   H HG23 . ILE A 1 536 ? 21.332  33.134  -20.926 0.02 19.39 ?  529  ILE A HG23 1  
ATOM   8343   H HD11 . ILE A 1 536 ? 20.154  32.295  -22.563 0.02 19.12 ?  529  ILE A HD11 1  
ATOM   8344   H HD12 . ILE A 1 536 ? 20.963  32.909  -23.786 0.02 19.31 ?  529  ILE A HD12 1  
ATOM   8345   H HD13 . ILE A 1 536 ? 20.176  31.545  -23.952 0.02 18.96 ?  529  ILE A HD13 1  
ATOM   8346   N N    . GLU A 1 537 ? 24.084  35.079  -21.050 0.02 19.97 ?  530  GLU A N    1  
ATOM   8347   C CA   . GLU A 1 537 ? 24.957  35.747  -20.098 0.02 20.24 ?  530  GLU A CA   1  
ATOM   8348   C C    . GLU A 1 537 ? 24.562  35.437  -18.657 0.02 20.18 ?  530  GLU A C    1  
ATOM   8349   O O    . GLU A 1 537 ? 23.473  34.932  -18.362 0.02 20.01 ?  530  GLU A O    1  
ATOM   8350   C CB   . GLU A 1 537 ? 24.965  37.256  -20.341 0.02 20.69 ?  530  GLU A CB   1  
ATOM   8351   C CG   . GLU A 1 537 ? 25.692  37.694  -21.646 0.02 20.86 ?  530  GLU A CG   1  
ATOM   8352   C CD   . GLU A 1 537 ? 27.008  36.943  -21.941 0.02 20.83 ?  530  GLU A CD   1  
ATOM   8353   O OE1  . GLU A 1 537 ? 28.133  37.372  -21.512 0.02 21.08 ?  530  GLU A OE1  1  
ATOM   8354   O OE2  . GLU A 1 537 ? 26.931  35.924  -22.627 0.02 20.57 -1 530  GLU A OE2  1  
ATOM   8355   H H    . GLU A 1 537 ? 23.328  35.474  -21.161 0.02 20.05 ?  530  GLU A H    1  
ATOM   8356   H HA   . GLU A 1 537 ? 25.863  35.424  -20.215 0.02 20.20 ?  530  GLU A HA   1  
ATOM   8357   H HB2  . GLU A 1 537 ? 24.046  37.558  -20.396 0.02 20.72 ?  530  GLU A HB2  1  
ATOM   8358   H HB3  . GLU A 1 537 ? 25.408  37.693  -19.596 0.02 20.87 ?  530  GLU A HB3  1  
ATOM   8359   H HG2  . GLU A 1 537 ? 25.091  37.531  -22.391 0.02 20.70 ?  530  GLU A HG2  1  
ATOM   8360   H HG3  . GLU A 1 537 ? 25.894  38.642  -21.585 0.02 21.17 ?  530  GLU A HG3  1  
ATOM   8361   N N    . LYS A 1 538 ? 25.490  35.746  -17.748 0.02 20.38 ?  531  LYS A N    1  
ATOM   8362   C CA   . LYS A 1 538 ? 25.283  35.436  -16.340 0.02 20.38 ?  531  LYS A CA   1  
ATOM   8363   C C    . LYS A 1 538 ? 24.180  36.298  -15.742 0.02 20.61 ?  531  LYS A C    1  
ATOM   8364   O O    . LYS A 1 538 ? 23.236  35.778  -15.129 0.02 20.47 ?  531  LYS A O    1  
ATOM   8365   C CB   . LYS A 1 538 ? 26.582  35.620  -15.549 0.02 20.61 ?  531  LYS A CB   1  
ATOM   8366   C CG   . LYS A 1 538 ? 27.910  35.484  -16.339 0.02 20.59 ?  531  LYS A CG   1  
ATOM   8367   C CD   . LYS A 1 538 ? 28.487  36.845  -16.850 0.02 21.01 ?  531  LYS A CD   1  
ATOM   8368   C CE   . LYS A 1 538 ? 30.027  36.988  -16.671 0.02 21.24 ?  531  LYS A CE   1  
ATOM   8369   N NZ   . LYS A 1 538 ? 30.766  35.823  -16.066 0.02 20.98 ?  531  LYS A NZ   1  
ATOM   8370   H H    . LYS A 1 538 ? 26.228  36.142  -17.929 0.02 20.52 ?  531  LYS A H    1  
ATOM   8371   H HA   . LYS A 1 538 ? 25.010  34.507  -16.266 0.02 20.11 ?  531  LYS A HA   1  
ATOM   8372   H HB2  . LYS A 1 538 ? 26.568  36.501  -15.147 0.02 20.91 ?  531  LYS A HB2  1  
ATOM   8373   H HB3  . LYS A 1 538 ? 26.596  34.954  -14.843 0.02 20.49 ?  531  LYS A HB3  1  
ATOM   8374   H HG2  . LYS A 1 538 ? 28.576  35.087  -15.753 0.02 20.57 ?  531  LYS A HG2  1  
ATOM   8375   H HG3  . LYS A 1 538 ? 27.764  34.911  -17.110 0.02 20.35 ?  531  LYS A HG3  1  
ATOM   8376   H HD2  . LYS A 1 538 ? 28.293  36.925  -17.797 0.02 20.94 ?  531  LYS A HD2  1  
ATOM   8377   H HD3  . LYS A 1 538 ? 28.064  37.576  -16.369 0.02 21.24 ?  531  LYS A HD3  1  
ATOM   8378   H HE2  . LYS A 1 538 ? 30.424  37.164  -17.540 0.02 21.31 ?  531  LYS A HE2  1  
ATOM   8379   H HE3  . LYS A 1 538 ? 30.185  37.751  -16.092 0.02 21.53 ?  531  LYS A HE3  1  
ATOM   8380   H HZ1  . LYS A 1 538 ? 30.568  35.747  -15.200 0.02 21.00 ?  531  LYS A HZ1  1  
ATOM   8381   H HZ2  . LYS A 1 538 ? 30.545  35.071  -16.487 0.02 20.70 ?  531  LYS A HZ2  1  
ATOM   8382   H HZ3  . LYS A 1 538 ? 31.644  35.952  -16.144 0.02 21.12 ?  531  LYS A HZ3  1  
ATOM   8383   N N    . SER A 1 539 ? 24.297  37.622  -15.878 0.02 21.00 ?  532  SER A N    1  
ATOM   8384   C CA   . SER A 1 539 ? 23.259  38.509  -15.386 0.02 21.28 ?  532  SER A CA   1  
ATOM   8385   C C    . SER A 1 539 ? 22.108  38.591  -16.370 0.02 21.17 ?  532  SER A C    1  
ATOM   8386   O O    . SER A 1 539 ? 21.610  39.687  -16.634 0.02 21.47 ?  532  SER A O    1  
ATOM   8387   C CB   . SER A 1 539 ? 23.808  39.926  -15.108 0.02 21.79 ?  532  SER A CB   1  
ATOM   8388   O OG   . SER A 1 539 ? 22.787  40.794  -14.618 0.02 22.08 ?  532  SER A OG   1  
ATOM   8389   H H    . SER A 1 539 ? 24.947  38.020  -16.271 0.02 21.13 ?  532  SER A H    1  
ATOM   8390   H HA   . SER A 1 539 ? 22.918  38.161  -14.548 0.02 21.24 ?  532  SER A HA   1  
ATOM   8391   H HB2  . SER A 1 539 ? 24.517  39.869  -14.447 0.02 21.86 ?  532  SER A HB2  1  
ATOM   8392   H HB3  . SER A 1 539 ? 24.152  40.297  -15.937 0.02 21.86 ?  532  SER A HB3  1  
ATOM   8393   H HG   . SER A 1 539 ? 23.092  41.570  -14.510 0.02 22.37 ?  532  SER A HG   1  
ATOM   8394   N N    . ASP A 1 540 ? 21.697  37.473  -16.952 0.02 20.77 ?  533  ASP A N    1  
ATOM   8395   C CA   . ASP A 1 540 ? 20.425  37.462  -17.663 0.02 20.68 ?  533  ASP A CA   1  
ATOM   8396   C C    . ASP A 1 540 ? 19.344  36.824  -16.795 0.02 20.55 ?  533  ASP A C    1  
ATOM   8397   O O    . ASP A 1 540 ? 19.478  35.687  -16.358 0.02 20.27 ?  533  ASP A O    1  
ATOM   8398   C CB   . ASP A 1 540 ? 20.577  36.734  -18.996 0.02 20.38 ?  533  ASP A CB   1  
ATOM   8399   C CG   . ASP A 1 540 ? 20.973  37.667  -20.102 0.02 20.61 ?  533  ASP A CG   1  
ATOM   8400   O OD1  . ASP A 1 540 ? 20.889  38.909  -19.876 0.02 20.99 ?  533  ASP A OD1  1  
ATOM   8401   O OD2  . ASP A 1 540 ? 21.349  37.188  -21.198 0.02 20.43 -1 533  ASP A OD2  1  
ATOM   8402   H H    . ASP A 1 540 ? 22.125  36.732  -16.965 0.02 20.57 ?  533  ASP A H    1  
ATOM   8403   H HA   . ASP A 1 540 ? 20.137  38.370  -17.840 0.02 20.94 ?  533  ASP A HA   1  
ATOM   8404   H HB2  . ASP A 1 540 ? 21.276  36.068  -18.901 0.02 20.20 ?  533  ASP A HB2  1  
ATOM   8405   H HB3  . ASP A 1 540 ? 19.736  36.308  -19.229 0.02 20.25 ?  533  ASP A HB3  1  
ATOM   8406   N N    . GLU A 1 541 ? 18.274  37.578  -16.522 0.02 20.79 ?  534  GLU A N    1  
ATOM   8407   C CA   . GLU A 1 541 ? 17.182  37.046  -15.707 0.02 20.70 ?  534  GLU A CA   1  
ATOM   8408   C C    . GLU A 1 541 ? 16.181  36.251  -16.532 0.02 20.47 ?  534  GLU A C    1  
ATOM   8409   O O    . GLU A 1 541 ? 15.229  35.701  -15.968 0.02 20.36 ?  534  GLU A O    1  
ATOM   8410   C CB   . GLU A 1 541 ? 16.427  38.169  -14.978 0.02 21.11 ?  534  GLU A CB   1  
ATOM   8411   C CG   . GLU A 1 541 ? 17.153  38.969  -13.842 0.02 21.42 ?  534  GLU A CG   1  
ATOM   8412   C CD   . GLU A 1 541 ? 16.571  40.386  -13.678 0.02 21.91 ?  534  GLU A CD   1  
ATOM   8413   O OE1  . GLU A 1 541 ? 16.175  40.962  -14.689 0.02 21.99 ?  534  GLU A OE1  1  
ATOM   8414   O OE2  . GLU A 1 541 ? 16.489  40.940  -12.563 0.02 22.22 -1 534  GLU A OE2  1  
ATOM   8415   H H    . GLU A 1 541 ? 18.166  38.382  -16.806 0.02 21.02 ?  534  GLU A H    1  
ATOM   8416   H HA   . GLU A 1 541 ? 17.553  36.448  -15.044 0.02 20.56 ?  534  GLU A HA   1  
ATOM   8417   H HB2  . GLU A 1 541 ? 16.146  38.795  -15.668 0.02 21.27 ?  534  GLU A HB2  1  
ATOM   8418   H HB3  . GLU A 1 541 ? 15.650  37.774  -14.569 0.02 21.04 ?  534  GLU A HB3  1  
ATOM   8419   H HG2  . GLU A 1 541 ? 16.992  38.504  -13.015 0.02 21.39 ?  534  GLU A HG2  1  
ATOM   8420   H HG3  . GLU A 1 541 ? 18.108  39.031  -14.051 0.02 21.39 ?  534  GLU A HG3  1  
ATOM   8421   N N    . VAL A 1 542 ? 16.303  36.278  -17.862 0.02 20.44 ?  535  VAL A N    1  
ATOM   8422   C CA   . VAL A 1 542 ? 15.411  35.556  -18.759 0.02 20.24 ?  535  VAL A CA   1  
ATOM   8423   C C    . VAL A 1 542 ? 16.253  35.026  -19.909 0.02 20.01 ?  535  VAL A C    1  
ATOM   8424   O O    . VAL A 1 542 ? 16.954  35.803  -20.556 0.02 20.18 ?  535  VAL A O    1  
ATOM   8425   C CB   . VAL A 1 542 ? 14.290  36.458  -19.304 0.02 20.53 ?  535  VAL A CB   1  
ATOM   8426   C CG1  . VAL A 1 542 ? 13.480  35.727  -20.343 0.02 20.36 ?  535  VAL A CG1  1  
ATOM   8427   C CG2  . VAL A 1 542 ? 13.393  36.942  -18.213 0.02 20.78 ?  535  VAL A CG2  1  
ATOM   8428   H H    . VAL A 1 542 ? 16.911  36.718  -18.275 0.02 20.56 ?  535  VAL A H    1  
ATOM   8429   H HA   . VAL A 1 542 ? 15.014  34.805  -18.298 0.02 20.08 ?  535  VAL A HA   1  
ATOM   8430   H HB   . VAL A 1 542 ? 14.689  37.237  -19.718 0.02 20.72 ?  535  VAL A HB   1  
ATOM   8431   H HG11 . VAL A 1 542 ? 12.690  36.254  -20.538 0.02 20.56 ?  535  VAL A HG11 1  
ATOM   8432   H HG12 . VAL A 1 542 ? 14.011  35.623  -21.148 0.02 20.26 ?  535  VAL A HG12 1  
ATOM   8433   H HG13 . VAL A 1 542 ? 13.228  34.857  -19.997 0.02 20.16 ?  535  VAL A HG13 1  
ATOM   8434   H HG21 . VAL A 1 542 ? 13.099  37.838  -18.439 0.02 21.05 ?  535  VAL A HG21 1  
ATOM   8435   H HG22 . VAL A 1 542 ? 12.628  36.351  -18.153 0.02 20.68 ?  535  VAL A HG22 1  
ATOM   8436   H HG23 . VAL A 1 542 ? 13.873  36.959  -17.374 0.02 20.79 ?  535  VAL A HG23 1  
ATOM   8437   N N    . TYR A 1 543 ? 16.146  33.730  -20.192 0.02 19.67 ?  536  TYR A N    1  
ATOM   8438   C CA   . TYR A 1 543 ? 16.913  33.143  -21.286 0.02 19.46 ?  536  TYR A CA   1  
ATOM   8439   C C    . TYR A 1 543 ? 16.242  33.392  -22.626 0.02 19.55 ?  536  TYR A C    1  
ATOM   8440   O O    . TYR A 1 543 ? 15.020  33.287  -22.762 0.02 19.59 ?  536  TYR A O    1  
ATOM   8441   C CB   . TYR A 1 543 ? 17.072  31.638  -21.139 0.02 19.09 ?  536  TYR A CB   1  
ATOM   8442   C CG   . TYR A 1 543 ? 17.621  31.111  -19.847 0.02 18.97 ?  536  TYR A CG   1  
ATOM   8443   C CD1  . TYR A 1 543 ? 18.808  31.575  -19.323 0.02 19.07 ?  536  TYR A CD1  1  
ATOM   8444   C CD2  . TYR A 1 543 ? 16.987  30.071  -19.214 0.02 18.78 ?  536  TYR A CD2  1  
ATOM   8445   C CE1  . TYR A 1 543 ? 19.315  31.044  -18.160 0.02 18.98 ?  536  TYR A CE1  1  
ATOM   8446   C CE2  . TYR A 1 543 ? 17.477  29.541  -18.046 0.02 18.69 ?  536  TYR A CE2  1  
ATOM   8447   C CZ   . TYR A 1 543 ? 18.639  30.028  -17.525 0.02 18.79 ?  536  TYR A CZ   1  
ATOM   8448   O OH   . TYR A 1 543 ? 19.130  29.480  -16.363 0.02 18.73 ?  536  TYR A OH   1  
ATOM   8449   H H    . TYR A 1 543 ? 15.641  33.179  -19.772 0.02 19.56 ?  536  TYR A H    1  
ATOM   8450   H HA   . TYR A 1 543 ? 17.794  33.546  -21.311 0.02 19.52 ?  536  TYR A HA   1  
ATOM   8451   H HB2  . TYR A 1 543 ? 16.203  31.232  -21.263 0.02 19.04 ?  536  TYR A HB2  1  
ATOM   8452   H HB3  . TYR A 1 543 ? 17.671  31.337  -21.837 0.02 18.98 ?  536  TYR A HB3  1  
ATOM   8453   H HD1  . TYR A 1 543 ? 19.260  32.264  -19.749 0.02 19.21 ?  536  TYR A HD1  1  
ATOM   8454   H HD2  . TYR A 1 543 ? 16.193  29.740  -19.562 0.02 18.73 ?  536  TYR A HD2  1  
ATOM   8455   H HE1  . TYR A 1 543 ? 20.106  31.374  -17.800 0.02 19.07 ?  536  TYR A HE1  1  
ATOM   8456   H HE2  . TYR A 1 543 ? 17.025  28.849  -17.621 0.02 18.59 ?  536  TYR A HE2  1  
ATOM   8457   H HH   . TYR A 1 543 ? 19.070  28.646  -16.391 0.02 18.56 ?  536  TYR A HH   1  
ATOM   8458   N N    . LYS A 1 544 ? 17.062  33.668  -23.616 0.02 19.59 ?  537  LYS A N    1  
ATOM   8459   C CA   . LYS A 1 544 ? 16.637  33.761  -25.001 0.02 19.66 ?  537  LYS A CA   1  
ATOM   8460   C C    . LYS A 1 544 ? 17.012  32.486  -25.741 0.02 19.33 ?  537  LYS A C    1  
ATOM   8461   O O    . LYS A 1 544 ? 18.048  31.872  -25.463 0.02 19.14 ?  537  LYS A O    1  
ATOM   8462   C CB   . LYS A 1 544 ? 17.314  34.955  -25.668 0.02 19.97 ?  537  LYS A CB   1  
ATOM   8463   C CG   . LYS A 1 544 ? 16.498  35.658  -26.732 0.02 20.23 ?  537  LYS A CG   1  
ATOM   8464   C CD   . LYS A 1 544 ? 16.890  37.136  -26.806 0.02 20.61 ?  537  LYS A CD   1  
ATOM   8465   C CE   . LYS A 1 544 ? 16.283  37.833  -28.030 0.02 20.94 ?  537  LYS A CE   1  
ATOM   8466   N NZ   . LYS A 1 544 ? 16.609  39.281  -28.104 0.02 21.38 ?  537  LYS A NZ   1  
ATOM   8467   H H    . LYS A 1 544 ? 17.901  33.815  -23.507 0.02 19.60 ?  537  LYS A H    1  
ATOM   8468   H HA   . LYS A 1 544 ? 15.676  33.877  -25.042 0.02 19.73 ?  537  LYS A HA   1  
ATOM   8469   H HB2  . LYS A 1 544 ? 17.525  35.605  -24.980 0.02 20.13 ?  537  LYS A HB2  1  
ATOM   8470   H HB3  . LYS A 1 544 ? 18.130  34.644  -26.083 0.02 19.87 ?  537  LYS A HB3  1  
ATOM   8471   H HG2  . LYS A 1 544 ? 16.667  35.236  -27.590 0.02 20.11 ?  537  LYS A HG2  1  
ATOM   8472   H HG3  . LYS A 1 544 ? 15.560  35.592  -26.501 0.02 20.31 ?  537  LYS A HG3  1  
ATOM   8473   H HD2  . LYS A 1 544 ? 16.524  37.602  -26.034 0.02 20.74 ?  537  LYS A HD2  1  
ATOM   8474   H HD3  . LYS A 1 544 ? 17.878  37.181  -26.837 0.02 20.56 ?  537  LYS A HD3  1  
ATOM   8475   H HE2  . LYS A 1 544 ? 16.601  37.394  -28.838 0.02 20.88 ?  537  LYS A HE2  1  
ATOM   8476   H HE3  . LYS A 1 544 ? 15.319  37.756  -27.949 0.02 20.95 ?  537  LYS A HE3  1  
ATOM   8477   H HZ1  . LYS A 1 544 ? 17.407  39.418  -28.474 0.02 21.44 ?  537  LYS A HZ1  1  
ATOM   8478   H HZ2  . LYS A 1 544 ? 15.985  39.682  -28.591 0.02 21.57 ?  537  LYS A HZ2  1  
ATOM   8479   H HZ3  . LYS A 1 544 ? 16.599  39.626  -27.286 0.02 21.42 ?  537  LYS A HZ3  1  
ATOM   8480   N N    . CYS A 1 545 ? 16.164  32.082  -26.678 0.02 19.31 ?  538  CYS A N    1  
ATOM   8481   C CA   . CYS A 1 545 ? 16.379  30.842  -27.410 0.02 19.03 ?  538  CYS A CA   1  
ATOM   8482   C C    . CYS A 1 545 ? 15.949  31.047  -28.852 0.02 19.18 ?  538  CYS A C    1  
ATOM   8483   O O    . CYS A 1 545 ? 15.079  31.869  -29.142 0.02 19.44 ?  538  CYS A O    1  
ATOM   8484   C CB   . CYS A 1 545 ? 15.604  29.661  -26.821 0.02 18.79 ?  538  CYS A CB   1  
ATOM   8485   S SG   . CYS A 1 545 ? 13.804  29.840  -26.950 0.02 18.96 ?  538  CYS A SG   1  
ATOM   8486   H H    . CYS A 1 545 ? 15.460  32.515  -26.912 0.02 19.46 ?  538  CYS A H    1  
ATOM   8487   H HA   . CYS A 1 545 ? 17.320  30.613  -27.400 0.02 18.94 ?  538  CYS A HA   1  
ATOM   8488   H HB2  . CYS A 1 545 ? 15.853  28.854  -27.295 0.02 18.62 ?  538  CYS A HB2  1  
ATOM   8489   H HB3  . CYS A 1 545 ? 15.830  29.573  -25.883 0.02 18.72 ?  538  CYS A HB3  1  
ATOM   8490   H HG   . CYS A 1 545 ? 13.291  28.815  -26.603 0.02 18.77 ?  538  CYS A HG   1  
ATOM   8491   N N    . LEU A 1 546 ? 16.568  30.285  -29.747 0.02 19.03 ?  539  LEU A N    1  
ATOM   8492   C CA   . LEU A 1 546 ? 16.068  30.166  -31.117 0.02 19.14 ?  539  LEU A CA   1  
ATOM   8493   C C    . LEU A 1 546 ? 14.908  29.180  -31.130 0.02 19.00 ?  539  LEU A C    1  
ATOM   8494   O O    . LEU A 1 546 ? 15.101  27.972  -30.961 0.02 18.73 ?  539  LEU A O    1  
ATOM   8495   C CB   . LEU A 1 546 ? 17.166  29.696  -32.064 0.02 19.07 ?  539  LEU A CB   1  
ATOM   8496   C CG   . LEU A 1 546 ? 16.712  29.623  -33.523 0.02 19.22 ?  539  LEU A CG   1  
ATOM   8497   C CD1  . LEU A 1 546 ? 16.727  30.985  -34.155 0.02 19.59 ?  539  LEU A CD1  1  
ATOM   8498   C CD2  . LEU A 1 546 ? 17.592  28.674  -34.313 0.02 19.03 ?  539  LEU A CD2  1  
ATOM   8499   H H    . LEU A 1 546 ? 17.272  29.823  -29.592 0.02 18.88 ?  539  LEU A H    1  
ATOM   8500   H HA   . LEU A 1 546 ? 15.751  31.032  -31.416 0.02 19.38 ?  539  LEU A HA   1  
ATOM   8501   H HB2  . LEU A 1 546 ? 17.908  30.318  -32.017 0.02 19.17 ?  539  LEU A HB2  1  
ATOM   8502   H HB3  . LEU A 1 546 ? 17.459  28.814  -31.794 0.02 18.84 ?  539  LEU A HB3  1  
ATOM   8503   H HG   . LEU A 1 546 ? 15.808  29.285  -33.564 0.02 19.23 ?  539  LEU A HG   1  
ATOM   8504   H HD11 . LEU A 1 546 ? 16.380  30.907  -35.056 0.02 19.68 ?  539  LEU A HD11 1  
ATOM   8505   H HD12 . LEU A 1 546 ? 16.173  31.586  -33.634 0.02 19.73 ?  539  LEU A HD12 1  
ATOM   8506   H HD13 . LEU A 1 546 ? 17.641  31.308  -34.183 0.02 19.60 ?  539  LEU A HD13 1  
ATOM   8507   H HD21 . LEU A 1 546 ? 17.289  28.663  -35.234 0.02 19.17 ?  539  LEU A HD21 1  
ATOM   8508   H HD22 . LEU A 1 546 ? 18.505  28.986  -34.269 0.02 18.99 ?  539  LEU A HD22 1  
ATOM   8509   H HD23 . LEU A 1 546 ? 17.521  27.785  -33.930 0.02 18.84 ?  539  LEU A HD23 1  
ATOM   8510   N N    . ASN A 1 547 ? 13.703  29.689  -31.344 0.02 19.23 ?  540  ASN A N    1  
ATOM   8511   C CA   . ASN A 1 547 ? 12.548  28.826  -31.508 0.02 19.17 ?  540  ASN A CA   1  
ATOM   8512   C C    . ASN A 1 547 ? 12.485  28.380  -32.955 0.02 19.23 ?  540  ASN A C    1  
ATOM   8513   O O    . ASN A 1 547 ? 12.445  29.215  -33.862 0.02 19.50 ?  540  ASN A O    1  
ATOM   8514   C CB   . ASN A 1 547 ? 11.279  29.561  -31.124 0.02 19.42 ?  540  ASN A CB   1  
ATOM   8515   C CG   . ASN A 1 547 ? 10.141  28.618  -30.805 0.02 19.34 ?  540  ASN A CG   1  
ATOM   8516   O OD1  . ASN A 1 547 ? 10.113  27.981  -29.759 0.02 19.14 ?  540  ASN A OD1  1  
ATOM   8517   N ND2  . ASN A 1 547 ? 9.198   28.525  -31.715 0.02 19.53 ?  540  ASN A ND2  1  
ATOM   8518   H H    . ASN A 1 547 ? 13.529  30.529  -31.405 0.02 19.43 ?  540  ASN A H    1  
ATOM   8519   H HA   . ASN A 1 547 ? 12.639  28.041  -30.947 0.02 18.96 ?  540  ASN A HA   1  
ATOM   8520   H HB2  . ASN A 1 547 ? 11.454  30.107  -30.342 0.02 19.44 ?  540  ASN A HB2  1  
ATOM   8521   H HB3  . ASN A 1 547 ? 11.005  30.120  -31.865 0.02 19.64 ?  540  ASN A HB3  1  
ATOM   8522   H HD21 . ASN A 1 547 ? 8.688   27.834  -31.730 0.02 19.47 ?  540  ASN A HD21 1  
ATOM   8523   H HD22 . ASN A 1 547 ? 9.091   29.152  -32.290 0.02 19.73 ?  540  ASN A HD22 1  
ATOM   8524   N N    . ILE A 1 548 ? 12.503  27.077  -33.158 0.02 19.00 ?  541  ILE A N    1  
ATOM   8525   C CA   . ILE A 1 548 ? 12.588  26.474  -34.477 0.02 19.04 ?  541  ILE A CA   1  
ATOM   8526   C C    . ILE A 1 548 ? 11.191  25.958  -34.804 0.02 19.15 ?  541  ILE A C    1  
ATOM   8527   O O    . ILE A 1 548 ? 10.782  24.899  -34.342 0.02 18.98 ?  541  ILE A O    1  
ATOM   8528   C CB   . ILE A 1 548 ? 13.649  25.367  -34.508 0.02 18.74 ?  541  ILE A CB   1  
ATOM   8529   C CG1  . ILE A 1 548 ? 15.018  25.921  -34.141 0.02 18.67 ?  541  ILE A CG1  1  
ATOM   8530   C CG2  . ILE A 1 548 ? 13.707  24.704  -35.895 0.02 18.81 ?  541  ILE A CG2  1  
ATOM   8531   C CD1  . ILE A 1 548 ? 16.084  24.842  -33.840 0.02 18.38 ?  541  ILE A CD1  1  
ATOM   8532   H H    . ILE A 1 548 ? 12.452  26.498  -32.528 0.02 18.84 ?  541  ILE A H    1  
ATOM   8533   H HA   . ILE A 1 548 ? 12.827  27.150  -35.127 0.02 19.22 ?  541  ILE A HA   1  
ATOM   8534   H HB   . ILE A 1 548 ? 13.409  24.692  -33.859 0.02 18.58 ?  541  ILE A HB   1  
ATOM   8535   H HG12 . ILE A 1 548 ? 15.343  26.458  -34.877 0.02 18.84 ?  541  ILE A HG12 1  
ATOM   8536   H HG13 . ILE A 1 548 ? 14.935  26.476  -33.352 0.02 18.69 ?  541  ILE A HG13 1  
ATOM   8537   H HG21 . ILE A 1 548 ? 12.816  24.646  -36.272 0.02 18.94 ?  541  ILE A HG21 1  
ATOM   8538   H HG22 . ILE A 1 548 ? 14.276  25.239  -36.469 0.02 18.93 ?  541  ILE A HG22 1  
ATOM   8539   H HG23 . ILE A 1 548 ? 14.083  23.816  -35.799 0.02 18.62 ?  541  ILE A HG23 1  
ATOM   8540   H HD11 . ILE A 1 548 ? 16.891  25.264  -33.506 0.02 18.36 ?  541  ILE A HD11 1  
ATOM   8541   H HD12 . ILE A 1 548 ? 15.732  24.230  -33.175 0.02 18.23 ?  541  ILE A HD12 1  
ATOM   8542   H HD13 . ILE A 1 548 ? 16.283  24.363  -34.661 0.02 18.39 ?  541  ILE A HD13 1  
ATOM   8543   N N    . SER A 1 549 ? 10.458  26.695  -35.637 0.02 19.48 ?  542  SER A N    1  
ATOM   8544   C CA   . SER A 1 549 ? 9.167   26.237  -36.111 0.02 19.65 ?  542  SER A CA   1  
ATOM   8545   C C    . SER A 1 549 ? 9.227   26.297  -37.622 0.02 19.86 ?  542  SER A C    1  
ATOM   8546   O O    . SER A 1 549 ? 10.277  26.009  -38.189 0.02 19.75 ?  542  SER A O    1  
ATOM   8547   C CB   . SER A 1 549 ? 8.040   27.098  -35.558 0.02 19.90 ?  542  SER A CB   1  
ATOM   8548   O OG   . SER A 1 549 ? 6.811   26.697  -36.094 0.02 20.11 ?  542  SER A OG   1  
ATOM   8549   H H    . SER A 1 549 ? 10.689  27.463  -35.948 0.02 19.63 ?  542  SER A H    1  
ATOM   8550   H HA   . SER A 1 549 ? 9.009   25.320  -35.841 0.02 19.49 ?  542  SER A HA   1  
ATOM   8551   H HB2  . SER A 1 549 ? 8.007   27.001  -34.595 0.02 19.76 ?  542  SER A HB2  1  
ATOM   8552   H HB3  . SER A 1 549 ? 8.189   28.028  -35.800 0.02 20.06 ?  542  SER A HB3  1  
ATOM   8553   H HG   . SER A 1 549 ? 6.207   27.216  -35.825 0.02 20.24 ?  542  SER A HG   1  
ATOM   8554   N N    . ASP A 1 550 ? 8.117   26.665  -38.263 0.02 20.20 ?  543  ASP A N    1  
ATOM   8555   C CA   . ASP A 1 550 ? 8.191   27.090  -39.658 0.02 20.49 ?  543  ASP A CA   1  
ATOM   8556   C C    . ASP A 1 550 ? 9.035   28.341  -39.805 0.02 20.63 ?  543  ASP A C    1  
ATOM   8557   O O    . ASP A 1 550 ? 9.679   28.548  -40.847 0.02 20.79 ?  543  ASP A O    1  
ATOM   8558   C CB   . ASP A 1 550 ? 6.793   27.356  -40.185 0.02 20.86 ?  543  ASP A CB   1  
ATOM   8559   C CG   . ASP A 1 550 ? 5.918   26.165  -40.044 0.02 20.78 ?  543  ASP A CG   1  
ATOM   8560   O OD1  . ASP A 1 550 ? 6.347   25.085  -40.496 0.02 20.56 ?  543  ASP A OD1  1  
ATOM   8561   O OD2  . ASP A 1 550 ? 4.848   26.300  -39.427 0.02 20.96 -1 543  ASP A OD2  1  
ATOM   8562   H H    . ASP A 1 550 ? 7.328   26.683  -37.922 0.02 20.28 ?  543  ASP A H    1  
ATOM   8563   H HA   . ASP A 1 550 ? 8.587   26.384  -40.192 0.02 20.40 ?  543  ASP A HA   1  
ATOM   8564   H HB2  . ASP A 1 550 ? 6.396   28.071  -39.667 0.02 20.98 ?  543  ASP A HB2  1  
ATOM   8565   H HB3  . ASP A 1 550 ? 6.833   27.597  -41.123 0.02 21.06 ?  543  ASP A HB3  1  
ATOM   8566   N N    . GLU A 1 551 ? 8.993   29.206  -38.802 0.02 20.61 ?  544  GLU A N    1  
ATOM   8567   C CA   . GLU A 1 551 ? 9.911   30.324  -38.625 0.02 20.67 ?  544  GLU A CA   1  
ATOM   8568   C C    . GLU A 1 551 ? 11.080  29.913  -37.748 0.02 20.30 ?  544  GLU A C    1  
ATOM   8569   O O    . GLU A 1 551 ? 10.953  29.044  -36.881 0.02 20.00 ?  544  GLU A O    1  
ATOM   8570   C CB   . GLU A 1 551 ? 9.220   31.519  -37.953 0.02 20.88 ?  544  GLU A CB   1  
ATOM   8571   C CG   . GLU A 1 551 ? 7.863   31.732  -38.436 0.02 21.25 ?  544  GLU A CG   1  
ATOM   8572   C CD   . GLU A 1 551 ? 7.871   31.751  -39.936 0.02 21.48 ?  544  GLU A CD   1  
ATOM   8573   O OE1  . GLU A 1 551 ? 8.898   32.169  -40.489 0.02 21.55 ?  544  GLU A OE1  1  
ATOM   8574   O OE2  . GLU A 1 551 ? 6.891   31.316  -40.563 0.02 21.58 -1 544  GLU A OE2  1  
ATOM   8575   H H    . GLU A 1 551 ? 8.407   29.151  -38.174 0.02 20.57 ?  544  GLU A H    1  
ATOM   8576   H HA   . GLU A 1 551 ? 10.261  30.596  -39.484 0.02 20.84 ?  544  GLU A HA   1  
ATOM   8577   H HB2  . GLU A 1 551 ? 9.177   31.373  -36.995 0.02 20.70 ?  544  GLU A HB2  1  
ATOM   8578   H HB3  . GLU A 1 551 ? 9.726   32.324  -38.141 0.02 20.97 ?  544  GLU A HB3  1  
ATOM   8579   H HG2  . GLU A 1 551 ? 7.302   31.006  -38.126 0.02 21.18 ?  544  GLU A HG2  1  
ATOM   8580   H HG3  . GLU A 1 551 ? 7.533   32.584  -38.112 0.02 21.44 ?  544  GLU A HG3  1  
ATOM   8581   N N    . LEU A 1 552 ? 12.210  30.568  -37.960 0.02 20.36 ?  545  LEU A N    1  
ATOM   8582   C CA   . LEU A 1 552 ? 13.265  30.634  -36.965 0.02 20.13 ?  545  LEU A CA   1  
ATOM   8583   C C    . LEU A 1 552 ? 13.139  31.998  -36.285 0.02 20.39 ?  545  LEU A C    1  
ATOM   8584   O O    . LEU A 1 552 ? 13.241  33.024  -36.964 0.02 20.72 ?  545  LEU A O    1  
ATOM   8585   C CB   . LEU A 1 552 ? 14.636  30.454  -37.638 0.02 20.06 ?  545  LEU A CB   1  
ATOM   8586   C CG   . LEU A 1 552 ? 14.736  29.243  -38.574 0.02 19.95 ?  545  LEU A CG   1  
ATOM   8587   C CD1  . LEU A 1 552 ? 16.130  29.194  -39.220 0.02 19.95 ?  545  LEU A CD1  1  
ATOM   8588   C CD2  . LEU A 1 552 ? 14.408  27.947  -37.850 0.02 19.61 ?  545  LEU A CD2  1  
ATOM   8589   H H    . LEU A 1 552 ? 12.408  30.979  -38.689 0.02 20.55 ?  545  LEU A H    1  
ATOM   8590   H HA   . LEU A 1 552 ? 13.147  29.941  -36.292 0.02 19.90 ?  545  LEU A HA   1  
ATOM   8591   H HB2  . LEU A 1 552 ? 14.836  31.247  -38.163 0.02 20.29 ?  545  LEU A HB2  1  
ATOM   8592   H HB3  . LEU A 1 552 ? 15.299  30.345  -36.941 0.02 19.87 ?  545  LEU A HB3  1  
ATOM   8593   H HG   . LEU A 1 552 ? 14.093  29.345  -39.293 0.02 20.15 ?  545  LEU A HG   1  
ATOM   8594   H HD11 . LEU A 1 552 ? 16.669  28.535  -38.758 0.02 19.70 ?  545  LEU A HD11 1  
ATOM   8595   H HD12 . LEU A 1 552 ? 16.034  28.953  -40.154 0.02 20.07 ?  545  LEU A HD12 1  
ATOM   8596   H HD13 . LEU A 1 552 ? 16.543  30.068  -39.149 0.02 20.10 ?  545  LEU A HD13 1  
ATOM   8597   H HD21 . LEU A 1 552 ? 14.910  27.217  -38.240 0.02 19.50 ?  545  LEU A HD21 1  
ATOM   8598   H HD22 . LEU A 1 552 ? 14.648  28.051  -36.916 0.02 19.45 ?  545  LEU A HD22 1  
ATOM   8599   H HD23 . LEU A 1 552 ? 13.457  27.776  -37.924 0.02 19.67 ?  545  LEU A HD23 1  
ATOM   8600   N N    . LYS A 1 553 ? 12.889  32.045  -34.967 0.02 20.26 ?  546  LYS A N    1  
ATOM   8601   C CA   . LYS A 1 553 ? 12.962  33.339  -34.319 0.02 20.49 ?  546  LYS A CA   1  
ATOM   8602   C C    . LYS A 1 553 ? 13.286  33.250  -32.848 0.02 20.25 ?  546  LYS A C    1  
ATOM   8603   O O    . LYS A 1 553 ? 12.840  32.337  -32.143 0.02 20.02 ?  546  LYS A O    1  
ATOM   8604   C CB   . LYS A 1 553 ? 11.656  34.105  -34.572 0.02 20.84 ?  546  LYS A CB   1  
ATOM   8605   C CG   . LYS A 1 553 ? 10.701  34.335  -33.416 0.02 20.74 ?  546  LYS A CG   1  
ATOM   8606   C CD   . LYS A 1 553 ? 9.366   35.077  -34.000 0.02 21.13 ?  546  LYS A CD   1  
ATOM   8607   C CE   . LYS A 1 553 ? 8.078   34.889  -33.417 0.02 21.07 ?  546  LYS A CE   1  
ATOM   8608   N NZ   . LYS A 1 553 ? 8.114   34.584  -31.915 0.02 21.01 ?  546  LYS A NZ   1  
ATOM   8609   H H    . LYS A 1 553 ? 12.630  31.395  -34.473 0.02 20.07 ?  546  LYS A H    1  
ATOM   8610   H HA   . LYS A 1 553 ? 13.696  33.804  -34.728 0.02 20.61 ?  546  LYS A HA   1  
ATOM   8611   H HB2  . LYS A 1 553 ? 11.752  34.989  -34.997 0.02 21.02 ?  546  LYS A HB2  1  
ATOM   8612   H HB3  . LYS A 1 553 ? 11.153  33.620  -35.254 0.02 20.99 ?  546  LYS A HB3  1  
ATOM   8613   H HG2  . LYS A 1 553 ? 10.465  33.473  -33.012 0.02 20.53 ?  546  LYS A HG2  1  
ATOM   8614   H HG3  . LYS A 1 553 ? 11.162  34.885  -32.776 0.02 20.66 ?  546  LYS A HG3  1  
ATOM   8615   H HD2  . LYS A 1 553 ? 9.595   36.004  -33.829 0.02 21.30 ?  546  LYS A HD2  1  
ATOM   8616   H HD3  . LYS A 1 553 ? 9.344   34.964  -34.982 0.02 21.28 ?  546  LYS A HD3  1  
ATOM   8617   H HE2  . LYS A 1 553 ? 7.180   35.489  -33.618 0.02 21.32 ?  546  LYS A HE2  1  
ATOM   8618   H HE3  . LYS A 1 553 ? 7.837   34.120  -33.822 0.02 20.84 ?  546  LYS A HE3  1  
ATOM   8619   H HZ1  . LYS A 1 553 ? 8.960   34.424  -31.679 0.02 20.88 ?  546  LYS A HZ1  1  
ATOM   8620   H HZ2  . LYS A 1 553 ? 7.785   35.223  -31.379 0.02 21.26 ?  546  LYS A HZ2  1  
ATOM   8621   H HZ3  . LYS A 1 553 ? 7.643   33.849  -31.810 0.02 20.88 ?  546  LYS A HZ3  1  
ATOM   8622   N N    . MET A 1 554 ? 14.260  34.083  -32.504 0.02 20.36 ?  547  MET A N    1  
ATOM   8623   C CA   . MET A 1 554 ? 14.664  34.271  -31.132 0.02 20.23 ?  547  MET A CA   1  
ATOM   8624   C C    . MET A 1 554 ? 13.480  34.749  -30.320 0.02 20.38 ?  547  MET A C    1  
ATOM   8625   O O    . MET A 1 554 ? 12.813  35.717  -30.686 0.02 20.72 ?  547  MET A O    1  
ATOM   8626   C CB   . MET A 1 554 ? 15.790  35.293  -31.054 0.02 20.42 ?  547  MET A CB   1  
ATOM   8627   C CG   . MET A 1 554 ? 17.035  34.925  -31.821 0.02 20.32 ?  547  MET A CG   1  
ATOM   8628   S SD   . MET A 1 554 ? 17.755  33.388  -31.356 0.02 19.84 ?  547  MET A SD   1  
ATOM   8629   C CE   . MET A 1 554 ? 18.087  33.637  -29.598 0.02 19.76 ?  547  MET A CE   1  
ATOM   8630   H H    . MET A 1 554 ? 14.753  34.512  -33.063 0.02 20.52 ?  547  MET A H    1  
ATOM   8631   H HA   . MET A 1 554 ? 14.993  33.430  -30.788 0.02 19.96 ?  547  MET A HA   1  
ATOM   8632   H HB2  . MET A 1 554 ? 15.476  36.141  -31.402 0.02 20.70 ?  547  MET A HB2  1  
ATOM   8633   H HB3  . MET A 1 554 ? 16.038  35.395  -30.124 0.02 20.35 ?  547  MET A HB3  1  
ATOM   8634   H HG2  . MET A 1 554 ? 16.805  34.863  -32.762 0.02 20.41 ?  547  MET A HG2  1  
ATOM   8635   H HG3  . MET A 1 554 ? 17.704  35.615  -31.690 0.02 20.47 ?  547  MET A HG3  1  
ATOM   8636   H HE1  . MET A 1 554 ? 18.799  33.045  -29.315 0.02 19.56 ?  547  MET A HE1  1  
ATOM   8637   H HE2  . MET A 1 554 ? 18.349  34.559  -29.459 0.02 19.98 ?  547  MET A HE2  1  
ATOM   8638   H HE3  . MET A 1 554 ? 17.281  33.444  -29.097 0.02 19.72 ?  547  MET A HE3  1  
ATOM   8639   N N    . ILE A 1 555 ? 13.226  34.075  -29.202 0.02 20.14 ?  548  ILE A N    1  
ATOM   8640   C CA   . ILE A 1 555 ? 12.172  34.472  -28.282 0.02 20.27 ?  548  ILE A CA   1  
ATOM   8641   C C    . ILE A 1 555 ? 12.674  34.262  -26.863 0.02 20.10 ?  548  ILE A C    1  
ATOM   8642   O O    . ILE A 1 555 ? 13.644  33.547  -26.625 0.02 19.82 ?  548  ILE A O    1  
ATOM   8643   C CB   . ILE A 1 555 ? 10.869  33.677  -28.510 0.02 20.21 ?  548  ILE A CB   1  
ATOM   8644   C CG1  . ILE A 1 555 ? 11.009  32.228  -28.012 0.02 19.82 ?  548  ILE A CG1  1  
ATOM   8645   C CG2  . ILE A 1 555 ? 10.517  33.687  -29.998 0.02 20.35 ?  548  ILE A CG2  1  
ATOM   8646   C CD1  . ILE A 1 555 ? 9.828   31.347  -28.268 0.02 19.77 ?  548  ILE A CD1  1  
ATOM   8647   H H    . ILE A 1 555 ? 13.658  33.371  -28.959 0.02 19.91 ?  548  ILE A H    1  
ATOM   8648   H HA   . ILE A 1 555 ? 11.987  35.415  -28.398 0.02 20.55 ?  548  ILE A HA   1  
ATOM   8649   H HB   . ILE A 1 555 ? 10.154  34.107  -28.017 0.02 20.38 ?  548  ILE A HB   1  
ATOM   8650   H HG12 . ILE A 1 555 ? 11.778  31.818  -28.438 0.02 19.66 ?  548  ILE A HG12 1  
ATOM   8651   H HG13 . ILE A 1 555 ? 11.131  32.233  -27.049 0.02 19.77 ?  548  ILE A HG13 1  
ATOM   8652   H HG21 . ILE A 1 555 ? 9.632   33.309  -30.117 0.02 20.38 ?  548  ILE A HG21 1  
ATOM   8653   H HG22 . ILE A 1 555 ? 10.530  34.602  -30.318 0.02 20.60 ?  548  ILE A HG22 1  
ATOM   8654   H HG23 . ILE A 1 555 ? 11.171  33.160  -30.479 0.02 20.18 ?  548  ILE A HG23 1  
ATOM   8655   H HD11 . ILE A 1 555 ? 9.962   30.503  -27.813 0.02 19.54 ?  548  ILE A HD11 1  
ATOM   8656   H HD12 . ILE A 1 555 ? 9.028   31.776  -27.926 0.02 19.94 ?  548  ILE A HD12 1  
ATOM   8657   H HD13 . ILE A 1 555 ? 9.739   31.196  -29.222 0.02 19.82 ?  548  ILE A HD13 1  
ATOM   8658   N N    . ASP A 1 556 ? 12.001  34.901  -25.920 0.02 20.29 ?  549  ASP A N    1  
ATOM   8659   C CA   . ASP A 1 556 ? 12.202  34.563  -24.521 0.02 20.14 ?  549  ASP A CA   1  
ATOM   8660   C C    . ASP A 1 556 ? 11.615  33.186  -24.288 0.02 19.85 ?  549  ASP A C    1  
ATOM   8661   O O    . ASP A 1 556 ? 10.534  32.869  -24.780 0.02 19.89 ?  549  ASP A O    1  
ATOM   8662   C CB   . ASP A 1 556 ? 11.532  35.601  -23.614 0.02 20.47 ?  549  ASP A CB   1  
ATOM   8663   C CG   . ASP A 1 556 ? 11.596  36.997  -24.199 0.02 20.85 ?  549  ASP A CG   1  
ATOM   8664   O OD1  . ASP A 1 556 ? 11.627  37.073  -25.447 0.02 20.94 ?  549  ASP A OD1  1  
ATOM   8665   O OD2  . ASP A 1 556 ? 11.612  38.006  -23.439 0.02 21.10 -1 549  ASP A OD2  1  
ATOM   8666   H H    . ASP A 1 556 ? 11.418  35.513  -26.065 0.02 20.51 ?  549  ASP A H    1  
ATOM   8667   H HA   . ASP A 1 556 ? 13.149  34.535  -24.320 0.02 20.05 ?  549  ASP A HA   1  
ATOM   8668   H HB2  . ASP A 1 556 ? 10.602  35.357  -23.487 0.02 20.52 ?  549  ASP A HB2  1  
ATOM   8669   H HB3  . ASP A 1 556 ? 11.992  35.613  -22.761 0.02 20.41 ?  549  ASP A HB3  1  
ATOM   8670   N N    . VAL A 1 557 ? 12.355  32.346  -23.580 0.02 19.56 ?  550  VAL A N    1  
ATOM   8671   C CA   . VAL A 1 557 ? 11.880  30.998  -23.323 0.02 19.30 ?  550  VAL A CA   1  
ATOM   8672   C C    . VAL A 1 557 ? 10.507  31.103  -22.666 0.02 19.46 ?  550  VAL A C    1  
ATOM   8673   O O    . VAL A 1 557 ? 10.387  31.615  -21.547 0.02 19.60 ?  550  VAL A O    1  
ATOM   8674   C CB   . VAL A 1 557 ? 12.875  30.217  -22.455 0.02 19.04 ?  550  VAL A CB   1  
ATOM   8675   C CG1  . VAL A 1 557 ? 12.311  28.844  -22.079 0.02 18.84 ?  550  VAL A CG1  1  
ATOM   8676   C CG2  . VAL A 1 557 ? 14.221  30.064  -23.164 0.02 18.86 ?  550  VAL A CG2  1  
ATOM   8677   H H    . VAL A 1 557 ? 13.123  32.532  -23.247 0.02 19.54 ?  550  VAL A H    1  
ATOM   8678   H HA   . VAL A 1 557 ? 11.799  30.530  -24.162 0.02 19.21 ?  550  VAL A HA   1  
ATOM   8679   H HB   . VAL A 1 557 ? 13.025  30.710  -21.635 0.02 19.15 ?  550  VAL A HB   1  
ATOM   8680   H HG11 . VAL A 1 557 ? 13.040  28.212  -21.995 0.02 18.65 ?  550  VAL A HG11 1  
ATOM   8681   H HG12 . VAL A 1 557 ? 11.845  28.927  -21.233 0.02 18.94 ?  550  VAL A HG12 1  
ATOM   8682   H HG13 . VAL A 1 557 ? 11.698  28.553  -22.771 0.02 18.81 ?  550  VAL A HG13 1  
ATOM   8683   H HG21 . VAL A 1 557 ? 14.929  30.069  -22.504 0.02 18.81 ?  550  VAL A HG21 1  
ATOM   8684   H HG22 . VAL A 1 557 ? 14.229  29.220  -23.638 0.02 18.69 ?  550  VAL A HG22 1  
ATOM   8685   H HG23 . VAL A 1 557 ? 14.343  30.798  -23.787 0.02 19.00 ?  550  VAL A HG23 1  
ATOM   8686   N N    . PRO A 1 558 ? 9.442   30.667  -23.322 0.02 19.50 ?  551  PRO A N    1  
ATOM   8687   C CA   . PRO A 1 558 ? 8.118   30.777  -22.692 0.02 19.69 ?  551  PRO A CA   1  
ATOM   8688   C C    . PRO A 1 558 ? 8.029   30.036  -21.369 0.02 19.55 ?  551  PRO A C    1  
ATOM   8689   O O    . PRO A 1 558 ? 7.137   30.317  -20.562 0.02 19.76 ?  551  PRO A O    1  
ATOM   8690   C CB   . PRO A 1 558 ? 7.181   30.190  -23.752 0.02 19.69 ?  551  PRO A CB   1  
ATOM   8691   C CG   . PRO A 1 558 ? 7.997   30.202  -25.042 0.02 19.61 ?  551  PRO A CG   1  
ATOM   8692   C CD   . PRO A 1 558 ? 9.395   30.027  -24.649 0.02 19.40 ?  551  PRO A CD   1  
ATOM   8693   H HA   . PRO A 1 558 ? 7.890   31.709  -22.550 0.02 19.92 ?  551  PRO A HA   1  
ATOM   8694   H HB2  . PRO A 1 558 ? 6.949   29.280  -23.511 0.02 19.53 ?  551  PRO A HB2  1  
ATOM   8695   H HB3  . PRO A 1 558 ? 6.390   30.744  -23.830 0.02 19.92 ?  551  PRO A HB3  1  
ATOM   8696   H HG2  . PRO A 1 558 ? 7.710   29.479  -25.620 0.02 19.51 ?  551  PRO A HG2  1  
ATOM   8697   H HG3  . PRO A 1 558 ? 7.876   31.058  -25.479 0.02 19.82 ?  551  PRO A HG3  1  
ATOM   8698   H HD2  . PRO A 1 558 ? 9.621   29.087  -24.580 0.02 19.17 ?  551  PRO A HD2  1  
ATOM   8699   H HD3  . PRO A 1 558 ? 9.971   30.488  -25.272 0.02 19.46 ?  551  PRO A HD3  1  
ATOM   8700   N N    . GLU A 1 559 ? 8.939   29.112  -21.118 0.02 19.24 ?  552  GLU A N    1  
ATOM   8701   C CA   . GLU A 1 559 ? 8.919   28.302  -19.905 0.02 19.12 ?  552  GLU A CA   1  
ATOM   8702   C C    . GLU A 1 559 ? 9.534   29.024  -18.711 0.02 19.21 ?  552  GLU A C    1  
ATOM   8703   O O    . GLU A 1 559 ? 9.534   28.462  -17.608 0.02 19.15 ?  552  GLU A O    1  
ATOM   8704   C CB   . GLU A 1 559 ? 9.667   26.990  -20.179 0.02 18.78 ?  552  GLU A CB   1  
ATOM   8705   C CG   . GLU A 1 559 ? 8.937   25.945  -21.036 0.02 18.68 ?  552  GLU A CG   1  
ATOM   8706   C CD   . GLU A 1 559 ? 8.752   26.331  -22.497 0.02 18.73 ?  552  GLU A CD   1  
ATOM   8707   O OE1  . GLU A 1 559 ? 9.590   27.057  -23.038 0.02 18.79 ?  552  GLU A OE1  1  
ATOM   8708   O OE2  . GLU A 1 559 ? 7.720   25.922  -23.075 0.02 18.75 -1 552  GLU A OE2  1  
ATOM   8709   H H    . GLU A 1 559 ? 9.598   28.931  -21.636 0.02 19.11 ?  552  GLU A H    1  
ATOM   8710   H HA   . GLU A 1 559 ? 8.004   28.083  -19.678 0.02 19.21 ?  552  GLU A HA   1  
ATOM   8711   H HB2  . GLU A 1 559 ? 10.486  27.212  -20.649 0.02 18.71 ?  552  GLU A HB2  1  
ATOM   8712   H HB3  . GLU A 1 559 ? 9.891   26.572  -19.334 0.02 18.70 ?  552  GLU A HB3  1  
ATOM   8713   H HG2  . GLU A 1 559 ? 9.451   25.124  -21.023 0.02 18.48 ?  552  GLU A HG2  1  
ATOM   8714   H HG3  . GLU A 1 559 ? 8.058   25.780  -20.662 0.02 18.80 ?  552  GLU A HG3  1  
ATOM   8715   N N    . MET A 1 560 ? 10.051  30.241  -18.908 0.02 19.39 ?  553  MET A N    1  
ATOM   8716   C CA   . MET A 1 560 ? 10.864  30.912  -17.889 0.02 19.48 ?  553  MET A CA   1  
ATOM   8717   C C    . MET A 1 560 ? 10.112  31.098  -16.585 0.02 19.67 ?  553  MET A C    1  
ATOM   8718   O O    . MET A 1 560 ? 10.691  30.942  -15.508 0.02 19.65 ?  553  MET A O    1  
ATOM   8719   C CB   . MET A 1 560 ? 11.344  32.272  -18.406 0.02 19.71 ?  553  MET A CB   1  
ATOM   8720   C CG   . MET A 1 560 ? 12.540  32.833  -17.667 0.02 19.77 ?  553  MET A CG   1  
ATOM   8721   S SD   . MET A 1 560 ? 14.035  31.849  -18.037 0.02 19.40 ?  553  MET A SD   1  
ATOM   8722   C CE   . MET A 1 560 ? 15.191  32.480  -16.792 0.02 19.51 ?  553  MET A CE   1  
ATOM   8723   H H    . MET A 1 560 ? 9.951   30.697  -19.626 0.02 19.47 ?  553  MET A H    1  
ATOM   8724   H HA   . MET A 1 560 ? 11.649  30.371  -17.711 0.02 19.29 ?  553  MET A HA   1  
ATOM   8725   H HB2  . MET A 1 560 ? 11.599  32.176  -19.336 0.02 19.63 ?  553  MET A HB2  1  
ATOM   8726   H HB3  . MET A 1 560 ? 10.619  32.909  -18.332 0.02 19.94 ?  553  MET A HB3  1  
ATOM   8727   H HG2  . MET A 1 560 ? 12.697  33.748  -17.948 0.02 19.96 ?  553  MET A HG2  1  
ATOM   8728   H HG3  . MET A 1 560 ? 12.371  32.797  -16.713 0.02 19.82 ?  553  MET A HG3  1  
ATOM   8729   H HE1  . MET A 1 560 ? 14.686  32.824  -16.040 0.02 19.62 ?  553  MET A HE1  1  
ATOM   8730   H HE2  . MET A 1 560 ? 15.768  31.757  -16.503 0.02 19.32 ?  553  MET A HE2  1  
ATOM   8731   H HE3  . MET A 1 560 ? 15.727  33.187  -17.180 0.02 19.68 ?  553  MET A HE3  1  
ATOM   8732   N N    . GLY A 1 561 ? 8.836   31.467  -16.655 0.02 19.90 ?  554  GLY A N    1  
ATOM   8733   C CA   . GLY A 1 561 ? 8.104   31.749  -15.436 0.02 20.14 ?  554  GLY A CA   1  
ATOM   8734   C C    . GLY A 1 561 ? 7.982   30.528  -14.548 0.02 19.96 ?  554  GLY A C    1  
ATOM   8735   O O    . GLY A 1 561 ? 8.119   30.616  -13.323 0.02 20.07 ?  554  GLY A O    1  
ATOM   8736   H H    . GLY A 1 561 ? 8.385   31.557  -17.379 0.02 19.94 ?  554  GLY A H    1  
ATOM   8737   H HA2  . GLY A 1 561 ? 8.561   32.449  -14.948 0.02 20.27 ?  554  GLY A HA2  1  
ATOM   8738   H HA3  . GLY A 1 561 ? 7.212   32.062  -15.655 0.02 20.31 ?  554  GLY A HA3  1  
ATOM   8739   N N    . LYS A 1 562 ? 7.705   29.381  -15.145 0.02 19.72 ?  555  LYS A N    1  
ATOM   8740   C CA   . LYS A 1 562 ? 7.618   28.154  -14.369 0.02 19.56 ?  555  LYS A CA   1  
ATOM   8741   C C    . LYS A 1 562 ? 8.994   27.711  -13.874 0.02 19.34 ?  555  LYS A C    1  
ATOM   8742   O O    . LYS A 1 562 ? 9.120   27.189  -12.760 0.02 19.35 ?  555  LYS A O    1  
ATOM   8743   C CB   . LYS A 1 562 ? 6.933   27.076  -15.210 0.02 19.41 ?  555  LYS A CB   1  
ATOM   8744   C CG   . LYS A 1 562 ? 5.449   27.356  -15.435 0.02 19.68 ?  555  LYS A CG   1  
ATOM   8745   C CD   . LYS A 1 562 ? 4.938   26.627  -16.675 0.02 19.57 ?  555  LYS A CD   1  
ATOM   8746   C CE   . LYS A 1 562 ? 3.483   26.909  -16.966 0.02 19.88 ?  555  LYS A CE   1  
ATOM   8747   N NZ   . LYS A 1 562 ? 3.054   26.138  -18.190 0.02 19.80 ?  555  LYS A NZ   1  
ATOM   8748   H H    . LYS A 1 562 ? 7.564   29.286  -15.985 0.02 19.67 ?  555  LYS A H    1  
ATOM   8749   H HA   . LYS A 1 562 ? 7.074   28.318  -13.590 0.02 19.74 ?  555  LYS A HA   1  
ATOM   8750   H HB2  . LYS A 1 562 ? 7.360   27.033  -16.077 0.02 19.28 ?  555  LYS A HB2  1  
ATOM   8751   H HB3  . LYS A 1 562 ? 7.012   26.224  -14.760 0.02 19.29 ?  555  LYS A HB3  1  
ATOM   8752   H HG2  . LYS A 1 562 ? 4.937   27.056  -14.671 0.02 19.78 ?  555  LYS A HG2  1  
ATOM   8753   H HG3  . LYS A 1 562 ? 5.323   28.307  -15.571 0.02 19.86 ?  555  LYS A HG3  1  
ATOM   8754   H HD2  . LYS A 1 562 ? 5.454   26.923  -17.441 0.02 19.50 ?  555  LYS A HD2  1  
ATOM   8755   H HD3  . LYS A 1 562 ? 5.042   25.671  -16.559 0.02 19.41 ?  555  LYS A HD3  1  
ATOM   8756   H HE2  . LYS A 1 562 ? 2.942   26.634  -16.210 0.02 19.99 ?  555  LYS A HE2  1  
ATOM   8757   H HE3  . LYS A 1 562 ? 3.370   27.852  -17.150 0.02 20.04 ?  555  LYS A HE3  1  
ATOM   8758   H HZ1  . LYS A 1 562 ? 3.166   25.267  -18.049 0.02 19.64 ?  555  LYS A HZ1  1  
ATOM   8759   H HZ2  . LYS A 1 562 ? 2.196   26.291  -18.367 0.02 19.99 ?  555  LYS A HZ2  1  
ATOM   8760   H HZ3  . LYS A 1 562 ? 3.544   26.383  -18.890 0.02 19.72 ?  555  LYS A HZ3  1  
ATOM   8761   N N    . ILE A 1 563 ? 10.045  27.983  -14.645 0.02 19.18 ?  556  ILE A N    1  
ATOM   8762   C CA   . ILE A 1 563 ? 11.394  27.657  -14.201 0.02 19.02 ?  556  ILE A CA   1  
ATOM   8763   C C    . ILE A 1 563 ? 11.713  28.403  -12.921 0.02 19.25 ?  556  ILE A C    1  
ATOM   8764   O O    . ILE A 1 563 ? 12.381  27.880  -12.021 0.02 19.18 ?  556  ILE A O    1  
ATOM   8765   C CB   . ILE A 1 563 ? 12.400  27.987  -15.314 0.02 18.89 ?  556  ILE A CB   1  
ATOM   8766   C CG1  . ILE A 1 563 ? 12.160  27.048  -16.493 0.02 18.66 ?  556  ILE A CG1  1  
ATOM   8767   C CG2  . ILE A 1 563 ? 13.795  27.870  -14.780 0.02 18.79 ?  556  ILE A CG2  1  
ATOM   8768   C CD1  . ILE A 1 563 ? 12.902  27.427  -17.743 0.02 18.59 ?  556  ILE A CD1  1  
ATOM   8769   H H    . ILE A 1 563 ? 10.008  28.360  -15.414 0.02 19.19 ?  556  ILE A H    1  
ATOM   8770   H HA   . ILE A 1 563 ? 11.452  26.709  -14.018 0.02 18.86 ?  556  ILE A HA   1  
ATOM   8771   H HB   . ILE A 1 563 ? 12.254  28.899  -15.608 0.02 19.06 ?  556  ILE A HB   1  
ATOM   8772   H HG12 . ILE A 1 563 ? 12.435  26.156  -16.233 0.02 18.49 ?  556  ILE A HG12 1  
ATOM   8773   H HG13 . ILE A 1 563 ? 11.215  27.051  -16.703 0.02 18.74 ?  556  ILE A HG13 1  
ATOM   8774   H HG21 . ILE A 1 563 ? 14.379  27.544  -15.479 0.02 18.62 ?  556  ILE A HG21 1  
ATOM   8775   H HG22 . ILE A 1 563 ? 14.089  28.745  -14.492 0.02 18.96 ?  556  ILE A HG22 1  
ATOM   8776   H HG23 . ILE A 1 563 ? 13.805  27.253  -14.035 0.02 18.74 ?  556  ILE A HG23 1  
ATOM   8777   H HD11 . ILE A 1 563 ? 13.087  26.625  -18.254 0.02 18.40 ?  556  ILE A HD11 1  
ATOM   8778   H HD12 . ILE A 1 563 ? 12.355  28.031  -18.267 0.02 18.72 ?  556  ILE A HD12 1  
ATOM   8779   H HD13 . ILE A 1 563 ? 13.734  27.858  -17.502 0.02 18.63 ?  556  ILE A HD13 1  
ATOM   8780   N N    . LYS A 1 564 ? 11.255  29.646  -12.837 0.02 19.55 ?  557  LYS A N    1  
ATOM   8781   C CA   . LYS A 1 564 ? 11.475  30.474  -11.656 0.02 19.82 ?  557  LYS A CA   1  
ATOM   8782   C C    . LYS A 1 564 ? 10.670  29.975  -10.466 0.02 19.94 ?  557  LYS A C    1  
ATOM   8783   O O    . LYS A 1 564 ? 11.131  30.049  -9.324  0.02 20.05 ?  557  LYS A O    1  
ATOM   8784   C CB   . LYS A 1 564 ? 11.075  31.924  -11.953 0.02 20.15 ?  557  LYS A CB   1  
ATOM   8785   C CG   . LYS A 1 564 ? 11.955  32.662  -12.945 0.02 20.16 ?  557  LYS A CG   1  
ATOM   8786   C CD   . LYS A 1 564 ? 13.398  32.551  -12.630 0.02 20.02 ?  557  LYS A CD   1  
ATOM   8787   C CE   . LYS A 1 564 ? 13.686  32.777  -11.149 0.02 20.19 ?  557  LYS A CE   1  
ATOM   8788   N NZ   . LYS A 1 564 ? 15.043  33.340  -10.936 0.02 20.28 ?  557  LYS A NZ   1  
ATOM   8789   H H    . LYS A 1 564 ? 10.811  30.037  -13.457 0.02 19.62 ?  557  LYS A H    1  
ATOM   8790   H HA   . LYS A 1 564 ? 12.409  30.433  -11.422 0.02 19.75 ?  557  LYS A HA   1  
ATOM   8791   H HB2  . LYS A 1 564 ? 10.185  31.912  -12.335 0.02 20.20 ?  557  LYS A HB2  1  
ATOM   8792   H HB3  . LYS A 1 564 ? 11.052  32.429  -11.126 0.02 20.36 ?  557  LYS A HB3  1  
ATOM   8793   H HG2  . LYS A 1 564 ? 11.821  32.288  -13.828 0.02 20.03 ?  557  LYS A HG2  1  
ATOM   8794   H HG3  . LYS A 1 564 ? 11.717  33.601  -12.937 0.02 20.42 ?  557  LYS A HG3  1  
ATOM   8795   H HD2  . LYS A 1 564 ? 13.712  31.665  -12.871 0.02 19.77 ?  557  LYS A HD2  1  
ATOM   8796   H HD3  . LYS A 1 564 ? 13.875  33.223  -13.140 0.02 20.10 ?  557  LYS A HD3  1  
ATOM   8797   H HE2  . LYS A 1 564 ? 13.037  33.397  -10.782 0.02 20.43 ?  557  LYS A HE2  1  
ATOM   8798   H HE3  . LYS A 1 564 ? 13.645  31.936  -10.672 0.02 20.04 ?  557  LYS A HE3  1  
ATOM   8799   H HZ1  . LYS A 1 564 ? 15.657  32.710  -11.071 0.02 20.08 ?  557  LYS A HZ1  1  
ATOM   8800   H HZ2  . LYS A 1 564 ? 15.191  34.011  -11.499 0.02 20.43 ?  557  LYS A HZ2  1  
ATOM   8801   H HZ3  . LYS A 1 564 ? 15.114  33.638  -10.102 0.02 20.42 ?  557  LYS A HZ3  1  
ATOM   8802   N N    . GLN A 1 565 ? 9.441   29.523  -10.710 0.02 19.96 ?  558  GLN A N    1  
ATOM   8803   C CA   . GLN A 1 565 ? 8.645   28.944  -9.638  0.02 20.08 ?  558  GLN A CA   1  
ATOM   8804   C C    . GLN A 1 565 ? 9.315   27.689  -9.068  0.02 19.84 ?  558  GLN A C    1  
ATOM   8805   O O    . GLN A 1 565 ? 9.339   27.497  -7.847  0.02 19.98 ?  558  GLN A O    1  
ATOM   8806   C CB   . GLN A 1 565 ? 7.229   28.665  -10.163 0.02 20.17 ?  558  GLN A CB   1  
ATOM   8807   C CG   . GLN A 1 565 ? 6.370   29.955  -10.386 0.02 20.50 ?  558  GLN A CG   1  
ATOM   8808   C CD   . GLN A 1 565 ? 5.022   29.728  -11.095 0.02 20.60 ?  558  GLN A CD   1  
ATOM   8809   O OE1  . GLN A 1 565 ? 3.965   29.861  -10.481 0.02 20.89 ?  558  GLN A OE1  1  
ATOM   8810   N NE2  . GLN A 1 565 ? 5.051   29.456  -12.402 0.02 20.38 ?  558  GLN A NE2  1  
ATOM   8811   H H    . GLN A 1 565 ? 9.050   29.549  -11.473 0.02 19.92 ?  558  GLN A H    1  
ATOM   8812   H HA   . GLN A 1 565 ? 8.579   29.593  -8.923  0.02 20.31 ?  558  GLN A HA   1  
ATOM   8813   H HB2  . GLN A 1 565 ? 7.303   28.215  -11.016 0.02 19.97 ?  558  GLN A HB2  1  
ATOM   8814   H HB3  . GLN A 1 565 ? 6.756   28.099  -9.535  0.02 20.23 ?  558  GLN A HB3  1  
ATOM   8815   H HG2  . GLN A 1 565 ? 6.179   30.351  -9.521  0.02 20.72 ?  558  GLN A HG2  1  
ATOM   8816   H HG3  . GLN A 1 565 ? 6.882   30.581  -10.923 0.02 20.47 ?  558  GLN A HG3  1  
ATOM   8817   H HE21 . GLN A 1 565 ? 5.483   28.776  -12.692 0.02 20.16 ?  558  GLN A HE21 1  
ATOM   8818   H HE22 . GLN A 1 565 ? 4.606   29.947  -12.951 0.02 20.49 ?  558  GLN A HE22 1  
ATOM   8819   N N    . TRP A 1 566 ? 9.893   26.840  -9.921  0.02 19.51 ?  559  TRP A N    1  
ATOM   8820   C CA   . TRP A 1 566 ? 10.607  25.662  -9.420  0.02 19.30 ?  559  TRP A CA   1  
ATOM   8821   C C    . TRP A 1 566 ? 11.845  26.066  -8.624  0.02 19.34 ?  559  TRP A C    1  
ATOM   8822   O O    . TRP A 1 566 ? 12.145  25.480  -7.573  0.02 19.37 ?  559  TRP A O    1  
ATOM   8823   C CB   . TRP A 1 566 ? 11.013  24.723  -10.574 0.02 18.96 ?  559  TRP A CB   1  
ATOM   8824   C CG   . TRP A 1 566 ? 9.899   23.830  -11.073 0.02 18.90 ?  559  TRP A CG   1  
ATOM   8825   C CD1  . TRP A 1 566 ? 8.830   24.217  -11.838 0.02 19.01 ?  559  TRP A CD1  1  
ATOM   8826   C CD2  . TRP A 1 566 ? 9.748   22.411  -10.874 0.02 18.76 ?  559  TRP A CD2  1  
ATOM   8827   N NE1  . TRP A 1 566 ? 8.014   23.145  -12.082 0.02 18.96 ?  559  TRP A NE1  1  
ATOM   8828   C CE2  . TRP A 1 566 ? 8.560   22.023  -11.520 0.02 18.80 ?  559  TRP A CE2  1  
ATOM   8829   C CE3  . TRP A 1 566 ? 10.495  21.435  -10.207 0.02 18.63 ?  559  TRP A CE3  1  
ATOM   8830   C CZ2  . TRP A 1 566 ? 8.109   20.714  -11.518 0.02 18.72 ?  559  TRP A CZ2  1  
ATOM   8831   C CZ3  . TRP A 1 566 ? 10.044  20.151  -10.196 0.02 18.55 ?  559  TRP A CZ3  1  
ATOM   8832   C CH2  . TRP A 1 566 ? 8.868   19.790  -10.850 0.02 18.60 ?  559  TRP A CH2  1  
ATOM   8833   H H    . TRP A 1 566 ? 9.886   26.921  -10.776 0.02 19.42 ?  559  TRP A H    1  
ATOM   8834   H HA   . TRP A 1 566 ? 10.021  25.164  -8.832  0.02 19.37 ?  559  TRP A HA   1  
ATOM   8835   H HB2  . TRP A 1 566 ? 11.313  25.258  -11.321 0.02 18.92 ?  559  TRP A HB2  1  
ATOM   8836   H HB3  . TRP A 1 566 ? 11.733  24.153  -10.270 0.02 18.83 ?  559  TRP A HB3  1  
ATOM   8837   H HD1  . TRP A 1 566 ? 8.663   25.087  -12.113 0.02 19.13 ?  559  TRP A HD1  1  
ATOM   8838   H HE1  . TRP A 1 566 ? 7.301   23.172  -12.538 0.02 19.02 ?  559  TRP A HE1  1  
ATOM   8839   H HE3  . TRP A 1 566 ? 11.280  21.664  -9.767  0.02 18.62 ?  559  TRP A HE3  1  
ATOM   8840   H HZ2  . TRP A 1 566 ? 7.322   20.471  -11.949 0.02 18.78 ?  559  TRP A HZ2  1  
ATOM   8841   H HZ3  . TRP A 1 566 ? 10.537  19.495  -9.760  0.02 18.48 ?  559  TRP A HZ3  1  
ATOM   8842   H HH2  . TRP A 1 566 ? 8.592   18.903  -10.831 0.02 18.56 ?  559  TRP A HH2  1  
ATOM   8843   N N    . GLU A 1 567 ? 12.584  27.064  -9.110  0.02 19.37 ?  560  GLU A N    1  
ATOM   8844   C CA   . GLU A 1 567 ? 13.776  27.501  -8.395  0.02 19.45 ?  560  GLU A CA   1  
ATOM   8845   C C    . GLU A 1 567 ? 13.420  27.979  -6.992  0.02 19.79 ?  560  GLU A C    1  
ATOM   8846   O O    . GLU A 1 567 ? 14.210  27.814  -6.056  0.02 19.85 ?  560  GLU A O    1  
ATOM   8847   C CB   . GLU A 1 567 ? 14.488  28.603  -9.173  0.02 19.50 ?  560  GLU A CB   1  
ATOM   8848   C CG   . GLU A 1 567 ? 15.828  29.025  -8.570  0.02 19.61 ?  560  GLU A CG   1  
ATOM   8849   C CD   . GLU A 1 567 ? 16.473  30.180  -9.332  0.02 19.69 ?  560  GLU A CD   1  
ATOM   8850   O OE1  . GLU A 1 567 ? 15.993  30.507  -10.443 0.02 19.67 ?  560  GLU A OE1  1  
ATOM   8851   O OE2  . GLU A 1 567 ? 17.455  30.754  -8.838  0.02 19.81 -1 560  GLU A OE2  1  
ATOM   8852   H H    . GLU A 1 567 ? 12.412  27.500  -9.829  0.02 19.38 ?  560  GLU A H    1  
ATOM   8853   H HA   . GLU A 1 567 ? 14.384  26.752  -8.312  0.02 19.29 ?  560  GLU A HA   1  
ATOM   8854   H HB2  . GLU A 1 567 ? 14.646  28.298  -10.078 0.02 19.30 ?  560  GLU A HB2  1  
ATOM   8855   H HB3  . GLU A 1 567 ? 13.919  29.387  -9.190  0.02 19.68 ?  560  GLU A HB3  1  
ATOM   8856   H HG2  . GLU A 1 567 ? 15.687  29.304  -7.653  0.02 19.83 ?  560  GLU A HG2  1  
ATOM   8857   H HG3  . GLU A 1 567 ? 16.436  28.277  -8.590  0.02 19.45 ?  560  GLU A HG3  1  
ATOM   8858   N N    . SER A 1 568 ? 12.236  28.546  -6.814  0.02 20.03 ?  561  SER A N    1  
ATOM   8859   C CA   . SER A 1 568 ? 11.912  29.099  -5.508  0.02 20.39 ?  561  SER A CA   1  
ATOM   8860   C C    . SER A 1 568 ? 11.885  28.026  -4.429  0.02 20.37 ?  561  SER A C    1  
ATOM   8861   O O    . SER A 1 568 ? 11.980  28.370  -3.247  0.02 20.62 ?  561  SER A O    1  
ATOM   8862   C CB   . SER A 1 568 ? 10.584  29.839  -5.554  0.02 20.65 ?  561  SER A CB   1  
ATOM   8863   O OG   . SER A 1 568 ? 9.494   28.958  -5.735  0.02 20.55 ?  561  SER A OG   1  
ATOM   8864   H H    . SER A 1 568 ? 11.619  28.624  -7.408  0.02 20.02 ?  561  SER A H    1  
ATOM   8865   H HA   . SER A 1 568 ? 12.595  29.744  -5.273  0.02 20.51 ?  561  SER A HA   1  
ATOM   8866   H HB2  . SER A 1 568 ? 10.462  30.306  -4.711  0.02 20.91 ?  561  SER A HB2  1  
ATOM   8867   H HB3  . SER A 1 568 ? 10.599  30.477  -6.286  0.02 20.67 ?  561  SER A HB3  1  
ATOM   8868   H HG   . SER A 1 568 ? 9.519   28.623  -6.505  0.02 20.36 ?  561  SER A HG   1  
ATOM   8869   N N    . MET A 1 569 ? 11.795  26.737  -4.790  0.02 20.10 ?  562  MET A N    1  
ATOM   8870   C CA   . MET A 1 569 ? 11.811  25.680  -3.778  0.02 20.10 ?  562  MET A CA   1  
ATOM   8871   C C    . MET A 1 569 ? 13.129  25.645  -3.030  0.02 20.13 ?  562  MET A C    1  
ATOM   8872   O O    . MET A 1 569 ? 13.165  25.145  -1.900  0.02 20.31 ?  562  MET A O    1  
ATOM   8873   C CB   . MET A 1 569 ? 11.541  24.295  -4.404  0.02 19.78 ?  562  MET A CB   1  
ATOM   8874   C CG   . MET A 1 569 ? 10.055  23.907  -4.577  0.02 19.83 ?  562  MET A CG   1  
ATOM   8875   S SD   . MET A 1 569 ? 9.716   22.287  -5.358  0.02 19.53 ?  562  MET A SD   1  
ATOM   8876   C CE   . MET A 1 569 ? 10.262  22.574  -7.020  0.02 19.22 ?  562  MET A CE   1  
ATOM   8877   H H    . MET A 1 569 ? 11.732  26.452  -5.596  0.02 19.93 ?  562  MET A H    1  
ATOM   8878   H HA   . MET A 1 569 ? 11.108  25.851  -3.133  0.02 20.32 ?  562  MET A HA   1  
ATOM   8879   H HB2  . MET A 1 569 ? 11.940  24.286  -5.288  0.02 19.58 ?  562  MET A HB2  1  
ATOM   8880   H HB3  . MET A 1 569 ? 11.962  23.623  -3.849  0.02 19.76 ?  562  MET A HB3  1  
ATOM   8881   H HG2  . MET A 1 569 ? 9.652   23.882  -3.695  0.02 20.06 ?  562  MET A HG2  1  
ATOM   8882   H HG3  . MET A 1 569 ? 9.624   24.590  -5.114  0.02 19.83 ?  562  MET A HG3  1  
ATOM   8883   H HE1  . MET A 1 569 ? 9.486   22.728  -7.579  0.02 19.26 ?  562  MET A HE1  1  
ATOM   8884   H HE2  . MET A 1 569 ? 10.841  23.349  -7.031  0.02 19.23 ?  562  MET A HE2  1  
ATOM   8885   H HE3  . MET A 1 569 ? 10.743  21.789  -7.325  0.02 19.02 ?  562  MET A HE3  1  
ATOM   8886   N N    . PHE A 1 570 ? 14.188  26.218  -3.586  0.02 20.00 ?  563  PHE A N    1  
ATOM   8887   C CA   . PHE A 1 570 ? 15.501  26.160  -2.963  0.02 20.05 ?  563  PHE A CA   1  
ATOM   8888   C C    . PHE A 1 570 ? 15.800  27.405  -2.133  0.02 20.42 ?  563  PHE A C    1  
ATOM   8889   O O    . PHE A 1 570 ? 16.921  27.559  -1.640  0.02 20.48 ?  563  PHE A O    1  
ATOM   8890   C CB   . PHE A 1 570 ? 16.565  25.926  -4.035  0.02 19.74 ?  563  PHE A CB   1  
ATOM   8891   C CG   . PHE A 1 570 ? 16.494  24.547  -4.642  0.02 19.40 ?  563  PHE A CG   1  
ATOM   8892   C CD1  . PHE A 1 570 ? 15.569  24.258  -5.641  0.02 19.23 ?  563  PHE A CD1  1  
ATOM   8893   C CD2  . PHE A 1 570 ? 17.315  23.532  -4.190  0.02 19.29 ?  563  PHE A CD2  1  
ATOM   8894   C CE1  . PHE A 1 570 ? 15.497  22.982  -6.181  0.02 18.96 ?  563  PHE A CE1  1  
ATOM   8895   C CE2  . PHE A 1 570 ? 17.248  22.265  -4.722  0.02 19.02 ?  563  PHE A CE2  1  
ATOM   8896   C CZ   . PHE A 1 570 ? 16.337  21.988  -5.729  0.02 18.85 ?  563  PHE A CZ   1  
ATOM   8897   H H    . PHE A 1 570 ? 14.173  26.665  -4.319  0.02 19.90 ?  563  PHE A H    1  
ATOM   8898   H HA   . PHE A 1 570 ? 15.527  25.396  -2.366  0.02 20.06 ?  563  PHE A HA   1  
ATOM   8899   H HB2  . PHE A 1 570 ? 16.452  26.575  -4.744  0.02 19.72 ?  563  PHE A HB2  1  
ATOM   8900   H HB3  . PHE A 1 570 ? 17.442  26.028  -3.637  0.02 19.80 ?  563  PHE A HB3  1  
ATOM   8901   H HD1  . PHE A 1 570 ? 15.005  24.929  -5.952  0.02 19.32 ?  563  PHE A HD1  1  
ATOM   8902   H HD2  . PHE A 1 570 ? 17.932  23.708  -3.521  0.02 19.42 ?  563  PHE A HD2  1  
ATOM   8903   H HE1  . PHE A 1 570 ? 14.883  22.798  -6.854  0.02 18.87 ?  563  PHE A HE1  1  
ATOM   8904   H HE2  . PHE A 1 570 ? 17.817  21.602  -4.409  0.02 18.96 ?  563  PHE A HE2  1  
ATOM   8905   H HZ   . PHE A 1 570 ? 16.288  21.134  -6.088  0.02 18.68 ?  563  PHE A HZ   1  
ATOM   8906   N N    . GLU A 1 571 ? 14.795  28.250  -1.897  0.02 20.70 ?  564  GLU A N    1  
ATOM   8907   C CA   . GLU A 1 571 ? 15.064  29.558  -1.297  0.02 21.08 ?  564  GLU A CA   1  
ATOM   8908   C C    . GLU A 1 571 ? 15.815  29.454  0.020   0.02 21.32 ?  564  GLU A C    1  
ATOM   8909   O O    . GLU A 1 571 ? 16.643  30.317  0.325   0.02 21.57 ?  564  GLU A O    1  
ATOM   8910   C CB   . GLU A 1 571 ? 13.780  30.374  -1.098  0.02 21.38 ?  564  GLU A CB   1  
ATOM   8911   C CG   . GLU A 1 571 ? 12.407  29.730  -0.715  0.02 21.39 ?  564  GLU A CG   1  
ATOM   8912   C CD   . GLU A 1 571 ? 12.391  28.378  0.040   0.02 21.29 ?  564  GLU A CD   1  
ATOM   8913   O OE1  . GLU A 1 571 ? 13.347  27.555  -0.026  0.02 21.03 ?  564  GLU A OE1  1  
ATOM   8914   O OE2  . GLU A 1 571 ? 11.334  28.147  0.686   0.02 21.52 -1 564  GLU A OE2  1  
ATOM   8915   H H    . GLU A 1 571 ? 13.968  28.093  -2.070  0.02 20.70 ?  564  GLU A H    1  
ATOM   8916   H HA   . GLU A 1 571 ? 15.631  30.061  -1.903  0.02 21.03 ?  564  GLU A HA   1  
ATOM   8917   H HB2  . GLU A 1 571 ? 13.966  31.041  -0.418  0.02 21.67 ?  564  GLU A HB2  1  
ATOM   8918   H HB3  . GLU A 1 571 ? 13.620  30.836  -1.937  0.02 21.34 ?  564  GLU A HB3  1  
ATOM   8919   H HG2  . GLU A 1 571 ? 11.971  30.362  -0.121  0.02 21.68 ?  564  GLU A HG2  1  
ATOM   8920   H HG3  . GLU A 1 571 ? 11.863  29.645  -1.508  0.02 21.22 ?  564  GLU A HG3  1  
ATOM   8921   N N    . LYS A 1 572 ? 15.562  28.409  0.796   0.02 21.27 ?  565  LYS A N    1  
ATOM   8922   C CA   . LYS A 1 572 ? 16.278  28.199  2.051   0.02 21.52 ?  565  LYS A CA   1  
ATOM   8923   C C    . LYS A 1 572 ? 17.366  27.152  1.939   0.02 21.26 ?  565  LYS A C    1  
ATOM   8924   O O    . LYS A 1 572 ? 17.955  26.791  2.965   0.02 21.45 ?  565  LYS A O    1  
ATOM   8925   C CB   . LYS A 1 572 ? 15.290  27.809  3.138   0.02 21.78 ?  565  LYS A CB   1  
ATOM   8926   C CG   . LYS A 1 572 ? 14.204  28.833  3.240   0.02 22.04 ?  565  LYS A CG   1  
ATOM   8927   C CD   . LYS A 1 572 ? 13.318  28.716  4.466   0.02 22.42 ?  565  LYS A CD   1  
ATOM   8928   C CE   . LYS A 1 572 ? 13.952  29.323  5.734   0.02 22.86 ?  565  LYS A CE   1  
ATOM   8929   N NZ   . LYS A 1 572 ? 12.897  29.431  6.767   0.02 23.30 ?  565  LYS A NZ   1  
ATOM   8930   H H    . LYS A 1 572 ? 14.977  27.806  0.622   0.02 21.12 ?  565  LYS A H    1  
ATOM   8931   H HA   . LYS A 1 572 ? 16.700  29.029  2.320   0.02 21.73 ?  565  LYS A HA   1  
ATOM   8932   H HB2  . LYS A 1 572 ? 14.890  26.950  2.925   0.02 21.60 ?  565  LYS A HB2  1  
ATOM   8933   H HB3  . LYS A 1 572 ? 15.749  27.765  3.993   0.02 22.00 ?  565  LYS A HB3  1  
ATOM   8934   H HG2  . LYS A 1 572 ? 14.612  29.712  3.245   0.02 22.19 ?  565  LYS A HG2  1  
ATOM   8935   H HG3  . LYS A 1 572 ? 13.631  28.745  2.463   0.02 21.85 ?  565  LYS A HG3  1  
ATOM   8936   H HD2  . LYS A 1 572 ? 12.488  29.186  4.294   0.02 22.51 ?  565  LYS A HD2  1  
ATOM   8937   H HD3  . LYS A 1 572 ? 13.134  27.779  4.634   0.02 22.32 ?  565  LYS A HD3  1  
ATOM   8938   H HE2  . LYS A 1 572 ? 14.656  28.740  6.065   0.02 22.82 ?  565  LYS A HE2  1  
ATOM   8939   H HE3  . LYS A 1 572 ? 14.302  30.210  5.549   0.02 22.94 ?  565  LYS A HE3  1  
ATOM   8940   H HZ1  . LYS A 1 572 ? 12.482  30.213  6.687   0.02 23.52 ?  565  LYS A HZ1  1  
ATOM   8941   H HZ2  . LYS A 1 572 ? 12.301  28.778  6.667   0.02 23.22 ?  565  LYS A HZ2  1  
ATOM   8942   H HZ3  . LYS A 1 572 ? 13.259  29.373  7.576   0.02 23.44 ?  565  LYS A HZ3  1  
ATOM   8943   N N    . HIS A 1 573 ? 17.656  26.697  0.715   0.02 20.86 ?  566  HIS A N    1  
ATOM   8944   C CA   . HIS A 1 573 ? 18.641  25.655  0.459   0.02 20.58 ?  566  HIS A CA   1  
ATOM   8945   C C    . HIS A 1 573 ? 19.413  26.013  -0.811  0.02 20.33 ?  566  HIS A C    1  
ATOM   8946   O O    . HIS A 1 573 ? 19.491  25.238  -1.766  0.02 19.98 ?  566  HIS A O    1  
ATOM   8947   C CB   . HIS A 1 573 ? 17.967  24.279  0.344   0.02 20.36 ?  566  HIS A CB   1  
ATOM   8948   C CG   . HIS A 1 573 ? 16.935  24.001  1.398   0.02 20.62 ?  566  HIS A CG   1  
ATOM   8949   N ND1  . HIS A 1 573 ? 17.265  23.618  2.679   0.02 20.83 ?  566  HIS A ND1  1  
ATOM   8950   C CD2  . HIS A 1 573 ? 15.578  24.039  1.357   0.02 20.74 ?  566  HIS A CD2  1  
ATOM   8951   C CE1  . HIS A 1 573 ? 16.160  23.454  3.388   0.02 21.07 ?  566  HIS A CE1  1  
ATOM   8952   N NE2  . HIS A 1 573 ? 15.123  23.692  2.607   0.02 21.02 ?  566  HIS A NE2  1  
ATOM   8953   H H    . HIS A 1 573 ? 17.286  26.994  0.002   0.02 20.75 ?  566  HIS A H    1  
ATOM   8954   H HA   . HIS A 1 573 ? 19.275  25.622  1.191   0.02 20.74 ?  566  HIS A HA   1  
ATOM   8955   H HB2  . HIS A 1 573 ? 17.530  24.214  -0.522  0.02 20.17 ?  566  HIS A HB2  1  
ATOM   8956   H HB3  . HIS A 1 573 ? 18.651  23.595  0.421   0.02 20.24 ?  566  HIS A HB3  1  
ATOM   8957   H HD1  . HIS A 1 573 ? 18.066  23.522  2.981   0.02 20.83 ?  566  HIS A HD1  1  
ATOM   8958   H HD2  . HIS A 1 573 ? 15.054  24.260  0.622   0.02 20.67 ?  566  HIS A HD2  1  
ATOM   8959   H HE1  . HIS A 1 573 ? 16.120  23.192  4.281   0.02 21.26 ?  566  HIS A HE1  1  
ATOM   8960   N N    . ARG A 1 574 ? 19.978  27.217  -0.847  0.02 20.53 ?  567  ARG A N    1  
ATOM   8961   C CA   . ARG A 1 574 ? 20.579  27.671  -2.094  0.02 20.35 ?  567  ARG A CA   1  
ATOM   8962   C C    . ARG A 1 574 ? 21.806  26.864  -2.457  0.02 20.12 ?  567  ARG A C    1  
ATOM   8963   O O    . ARG A 1 574 ? 22.171  26.803  -3.635  0.02 19.87 ?  567  ARG A O    1  
ATOM   8964   C CB   . ARG A 1 574 ? 20.983  29.141  -2.040  0.02 20.67 ?  567  ARG A CB   1  
ATOM   8965   C CG   . ARG A 1 574 ? 19.848  30.122  -2.213  0.02 20.86 ?  567  ARG A CG   1  
ATOM   8966   C CD   . ARG A 1 574 ? 19.119  30.009  -3.569  0.02 20.57 ?  567  ARG A CD   1  
ATOM   8967   N NE   . ARG A 1 574 ? 19.945  30.434  -4.694  0.02 20.44 ?  567  ARG A NE   1  
ATOM   8968   C CZ   . ARG A 1 574 ? 19.462  30.708  -5.902  0.02 20.28 ?  567  ARG A CZ   1  
ATOM   8969   N NH1  . ARG A 1 574 ? 18.163  30.597  -6.148  0.02 20.24 ?  567  ARG A NH1  1  
ATOM   8970   N NH2  . ARG A 1 574 ? 20.282  31.109  -6.852  0.02 20.20 ?  567  ARG A NH2  1  
ATOM   8971   H H    . ARG A 1 574 ? 20.022  27.770  -0.191  0.02 20.79 ?  567  ARG A H    1  
ATOM   8972   H HA   . ARG A 1 574 ? 19.927  27.555  -2.799  0.02 20.19 ?  567  ARG A HA   1  
ATOM   8973   H HB2  . ARG A 1 574 ? 21.412  29.318  -1.188  0.02 20.90 ?  567  ARG A HB2  1  
ATOM   8974   H HB3  . ARG A 1 574 ? 21.617  29.303  -2.754  0.02 20.57 ?  567  ARG A HB3  1  
ATOM   8975   H HG2  . ARG A 1 574 ? 19.193  29.968  -1.515  0.02 20.97 ?  567  ARG A HG2  1  
ATOM   8976   H HG3  . ARG A 1 574 ? 20.207  31.021  -2.141  0.02 21.09 ?  567  ARG A HG3  1  
ATOM   8977   H HD2  . ARG A 1 574 ? 18.841  29.096  -3.722  0.02 20.35 ?  567  ARG A HD2  1  
ATOM   8978   H HD3  . ARG A 1 574 ? 18.341  30.587  -3.550  0.02 20.72 ?  567  ARG A HD3  1  
ATOM   8979   H HE   . ARG A 1 574 ? 20.799  30.418  -4.598  0.02 20.40 ?  567  ARG A HE   1  
ATOM   8980   H HH11 . ARG A 1 574 ? 17.623  30.346  -5.529  0.02 20.31 ?  567  ARG A HH11 1  
ATOM   8981   H HH12 . ARG A 1 574 ? 17.857  30.778  -6.931  0.02 20.15 ?  567  ARG A HH12 1  
ATOM   8982   H HH21 . ARG A 1 574 ? 21.122  31.175  -6.687  0.02 20.24 ?  567  ARG A HH21 1  
ATOM   8983   H HH22 . ARG A 1 574 ? 19.983  31.284  -7.636  0.02 20.11 ?  567  ARG A HH22 1  
ATOM   8984   N N    . ASP A 1 575 ? 22.483  26.283  -1.467  0.02 20.24 ?  568  ASP A N    1  
ATOM   8985   C CA   . ASP A 1 575 ? 23.656  25.467  -1.746  0.02 20.05 ?  568  ASP A CA   1  
ATOM   8986   C C    . ASP A 1 575 ? 23.324  24.189  -2.504  0.02 19.67 ?  568  ASP A C    1  
ATOM   8987   O O    . ASP A 1 575 ? 24.250  23.501  -2.945  0.02 19.49 ?  568  ASP A O    1  
ATOM   8988   C CB   . ASP A 1 575 ? 24.375  25.144  -0.427  0.02 20.33 ?  568  ASP A CB   1  
ATOM   8989   C CG   . ASP A 1 575 ? 23.630  24.120  0.418   0.02 20.34 ?  568  ASP A CG   1  
ATOM   8990   O OD1  . ASP A 1 575 ? 24.148  22.990  0.567   0.02 20.24 ?  568  ASP A OD1  1  
ATOM   8991   O OD2  . ASP A 1 575 ? 22.529  24.441  0.915   0.02 20.47 -1 568  ASP A OD2  1  
ATOM   8992   H H    . ASP A 1 575 ? 22.280  26.346  -0.633  0.02 20.44 ?  568  ASP A H    1  
ATOM   8993   H HA   . ASP A 1 575 ? 24.263  25.981  -2.300  0.02 20.04 ?  568  ASP A HA   1  
ATOM   8994   H HB2  . ASP A 1 575 ? 25.259  24.799  -0.617  0.02 20.26 ?  568  ASP A HB2  1  
ATOM   8995   H HB3  . ASP A 1 575 ? 24.439  25.962  0.086   0.02 20.60 ?  568  ASP A HB3  1  
ATOM   8996   N N    . LEU A 1 576 ? 22.041  23.875  -2.686  0.02 19.56 ?  569  LEU A N    1  
ATOM   8997   C CA   . LEU A 1 576 ? 21.607  22.654  -3.352  0.02 19.23 ?  569  LEU A CA   1  
ATOM   8998   C C    . LEU A 1 576 ? 20.999  22.914  -4.713  0.02 19.00 ?  569  LEU A C    1  
ATOM   8999   O O    . LEU A 1 576 ? 20.622  21.957  -5.401  0.02 18.73 ?  569  LEU A O    1  
ATOM   9000   C CB   . LEU A 1 576 ? 20.576  21.898  -2.511  0.02 19.30 ?  569  LEU A CB   1  
ATOM   9001   C CG   . LEU A 1 576 ? 21.005  21.498  -1.101  0.02 19.57 ?  569  LEU A CG   1  
ATOM   9002   C CD1  . LEU A 1 576 ? 20.004  20.549  -0.494  0.02 19.60 ?  569  LEU A CD1  1  
ATOM   9003   C CD2  . LEU A 1 576 ? 22.378  20.866  -1.135  0.02 19.51 ?  569  LEU A CD2  1  
ATOM   9004   H H    . LEU A 1 576 ? 21.391  24.374  -2.433  0.02 19.69 ?  569  LEU A H    1  
ATOM   9005   H HA   . LEU A 1 576 ? 22.370  22.073  -3.488  0.02 19.12 ?  569  LEU A HA   1  
ATOM   9006   H HB2  . LEU A 1 576 ? 19.788  22.456  -2.424  0.02 19.40 ?  569  LEU A HB2  1  
ATOM   9007   H HB3  . LEU A 1 576 ? 20.343  21.087  -2.985  0.02 19.10 ?  569  LEU A HB3  1  
ATOM   9008   H HG   . LEU A 1 576 ? 21.048  22.290  -0.546  0.02 19.80 ?  569  LEU A HG   1  
ATOM   9009   H HD11 . LEU A 1 576 ? 20.433  20.060  0.225   0.02 19.76 ?  569  LEU A HD11 1  
ATOM   9010   H HD12 . LEU A 1 576 ? 19.253  21.058  -0.148  0.02 19.72 ?  569  LEU A HD12 1  
ATOM   9011   H HD13 . LEU A 1 576 ? 19.700  19.932  -1.177  0.02 19.38 ?  569  LEU A HD13 1  
ATOM   9012   H HD21 . LEU A 1 576 ? 22.617  20.576  -0.239  0.02 19.70 ?  569  LEU A HD21 1  
ATOM   9013   H HD22 . LEU A 1 576 ? 22.355  20.104  -1.733  0.02 19.28 ?  569  LEU A HD22 1  
ATOM   9014   H HD23 . LEU A 1 576 ? 23.023  21.518  -1.448  0.02 19.52 ?  569  LEU A HD23 1  
ATOM   9015   N N    . PHE A 1 577 ? 20.870  24.166  -5.097  0.02 19.14 ?  570  PHE A N    1  
ATOM   9016   C CA   . PHE A 1 577 ? 20.168  24.486  -6.323  0.02 18.98 ?  570  PHE A CA   1  
ATOM   9017   C C    . PHE A 1 577 ? 21.057  24.046  -7.490  0.02 18.70 ?  570  PHE A C    1  
ATOM   9018   O O    . PHE A 1 577 ? 22.274  24.137  -7.392  0.02 18.74 ?  570  PHE A O    1  
ATOM   9019   C CB   . PHE A 1 577 ? 19.805  25.985  -6.334  0.02 19.23 ?  570  PHE A CB   1  
ATOM   9020   C CG   . PHE A 1 577 ? 19.418  26.519  -7.688  0.02 19.11 ?  570  PHE A CG   1  
ATOM   9021   C CD1  . PHE A 1 577 ? 18.328  26.020  -8.382  0.02 18.97 ?  570  PHE A CD1  1  
ATOM   9022   C CD2  . PHE A 1 577 ? 20.156  27.511  -8.265  0.02 19.16 ?  570  PHE A CD2  1  
ATOM   9023   C CE1  . PHE A 1 577 ? 17.993  26.517  -9.603  0.02 18.89 ?  570  PHE A CE1  1  
ATOM   9024   C CE2  . PHE A 1 577 ? 19.813  28.011  -9.508  0.02 19.07 ?  570  PHE A CE2  1  
ATOM   9025   C CZ   . PHE A 1 577 ? 18.753  27.516  -10.168 0.02 18.94 ?  570  PHE A CZ   1  
ATOM   9026   O OXT  . PHE A 1 577 ? 20.631  23.513  -8.533  0.02 18.45 -1 570  PHE A OXT  1  
ATOM   9027   H H    . PHE A 1 577 ? 21.177  24.847  -4.673  0.02 19.34 ?  570  PHE A H    1  
ATOM   9028   H HA   . PHE A 1 577 ? 19.345  23.977  -6.359  0.02 18.91 ?  570  PHE A HA   1  
ATOM   9029   H HB2  . PHE A 1 577 ? 19.050  26.119  -5.742  0.02 19.38 ?  570  PHE A HB2  1  
ATOM   9030   H HB3  . PHE A 1 577 ? 20.560  26.499  -6.015  0.02 19.37 ?  570  PHE A HB3  1  
ATOM   9031   H HD1  . PHE A 1 577 ? 17.810  25.343  -8.010  0.02 18.96 ?  570  PHE A HD1  1  
ATOM   9032   H HD2  . PHE A 1 577 ? 20.892  27.860  -7.818  0.02 19.27 ?  570  PHE A HD2  1  
ATOM   9033   H HE1  . PHE A 1 577 ? 17.259  26.175  -10.059 0.02 18.81 ?  570  PHE A HE1  1  
ATOM   9034   H HE2  . PHE A 1 577 ? 20.320  28.688  -9.893  0.02 19.12 ?  570  PHE A HE2  1  
ATOM   9035   H HZ   . PHE A 1 577 ? 18.527  27.856  -11.002 0.02 18.89 ?  570  PHE A HZ   1  
HETATM 9036   P P1   . DPF B 2 .   ? 15.526  9.358   -22.894 0.02 16.58 ?  601  DPF A P1   1  
HETATM 9037   O O2   . DPF B 2 .   ? 16.634  8.365   -23.196 0.02 16.47 ?  601  DPF A O2   1  
HETATM 9038   O O3   . DPF B 2 .   ? 15.074  9.109   -21.391 0.02 16.65 ?  601  DPF A O3   1  
HETATM 9039   C C1   . DPF B 2 .   ? 14.221  10.111  -20.901 0.02 16.75 ?  601  DPF A C1   1  
HETATM 9040   C C4   . DPF B 2 .   ? 12.840  9.977   -21.515 0.02 16.88 ?  601  DPF A C4   1  
HETATM 9041   O O1   . DPF B 2 .   ? 14.236  9.010   -23.694 0.02 16.71 ?  601  DPF A O1   1  
HETATM 9042   C C2   . DPF B 2 .   ? 14.497  8.691   -25.008 0.02 16.71 ?  601  DPF A C2   1  
HETATM 9043   C C3   . DPF B 2 .   ? 14.819  7.219   -25.035 0.02 16.69 ?  601  DPF A C3   1  
HETATM 9044   H H41  . DPF B 2 .   ? 12.729  10.650  -22.215 0.02 16.88 ?  601  DPF A H41  1  
HETATM 9045   H H42  . DPF B 2 .   ? 12.170  10.120  -20.818 0.02 16.99 ?  601  DPF A H42  1  
HETATM 9046   H H43  . DPF B 2 .   ? 12.722  9.084   -21.890 0.02 16.89 ?  601  DPF A H43  1  
HETATM 9047   H H11  . DPF B 2 .   ? 14.140  10.037  -19.932 0.02 16.80 ?  601  DPF A H11  1  
HETATM 9048   H H12  . DPF B 2 .   ? 14.590  10.985  -21.123 0.02 16.70 ?  601  DPF A H12  1  
HETATM 9049   H H21  . DPF B 2 .   ? 15.265  9.206   -25.306 0.02 16.64 ?  601  DPF A H21  1  
HETATM 9050   H H22  . DPF B 2 .   ? 13.723  8.885   -25.564 0.02 16.82 ?  601  DPF A H22  1  
HETATM 9051   H H31  . DPF B 2 .   ? 14.018  6.732   -25.304 0.02 16.80 ?  601  DPF A H31  1  
HETATM 9052   H H32  . DPF B 2 .   ? 15.518  7.063   -25.689 0.02 16.64 ?  601  DPF A H32  1  
HETATM 9053   H H33  . DPF B 2 .   ? 15.111  6.916   -24.155 0.02 16.63 ?  601  DPF A H33  1  
HETATM 9054   O O    . HOH C 3 .   ? 30.435  28.403  -36.066 0.02 19.38 ?  701  HOH A O    1  
HETATM 9055   O O    . HOH C 3 .   ? 40.501  2.784   -16.858 0.02 17.66 ?  702  HOH A O    1  
HETATM 9056   O O    . HOH C 3 .   ? 2.011   15.341  -34.102 0.02 19.68 ?  703  HOH A O    1  
HETATM 9057   O O    . HOH C 3 .   ? 34.882  18.663  -8.992  0.02 18.52 ?  704  HOH A O    1  
HETATM 9058   O O    . HOH C 3 .   ? 37.731  17.585  -12.179 0.02 18.35 ?  705  HOH A O    1  
HETATM 9059   O O    . HOH C 3 .   ? 43.826  5.234   -24.682 0.02 17.83 ?  706  HOH A O    1  
HETATM 9060   O O    . HOH C 3 .   ? 23.284  0.439   -55.326 0.02 21.57 ?  707  HOH A O    1  
HETATM 9061   O O    . HOH C 3 .   ? 8.881   -0.962  -17.291 0.02 18.38 ?  708  HOH A O    1  
HETATM 9062   O O    . HOH C 3 .   ? 2.791   27.873  -2.705  0.02 22.07 ?  709  HOH A O    1  
HETATM 9063   O O    . HOH C 3 .   ? 40.416  0.706   -13.182 0.02 18.05 ?  710  HOH A O    1  
HETATM 9064   O O    . HOH C 3 .   ? 5.249   31.020  -39.299 0.02 21.69 ?  711  HOH A O    1  
HETATM 9065   O O    . HOH C 3 .   ? 4.929   12.275  -30.481 0.02 18.53 ?  712  HOH A O    1  
HETATM 9066   O O    . HOH C 3 .   ? 4.098   26.750  -0.697  0.02 22.12 ?  713  HOH A O    1  
HETATM 9067   O O    . HOH C 3 .   ? 23.474  33.027  -35.333 0.02 20.24 ?  714  HOH A O    1  
HETATM 9068   O O    . HOH C 3 .   ? 14.508  -1.677  -6.729  0.02 18.82 ?  715  HOH A O    1  
HETATM 9069   O O    . HOH C 3 .   ? 1.984   2.854   -32.125 0.02 19.80 ?  716  HOH A O    1  
HETATM 9070   O O    . HOH C 3 .   ? 37.732  -1.111  -13.291 0.02 17.81 ?  717  HOH A O    1  
HETATM 9071   O O    . HOH C 3 .   ? 16.897  8.801   -27.687 0.02 16.56 ?  718  HOH A O    1  
HETATM 9072   O O    . HOH C 3 .   ? 47.014  -2.539  -33.489 0.02 19.16 ?  719  HOH A O    1  
HETATM 9073   O O    . HOH C 3 .   ? 22.465  9.136   -7.873  0.02 17.40 ?  720  HOH A O    1  
HETATM 9074   O O    . HOH C 3 .   ? 10.371  9.034   -13.382 0.02 17.80 ?  721  HOH A O    1  
HETATM 9075   O O    . HOH C 3 .   ? 2.093   13.445  1.187   0.02 21.54 ?  722  HOH A O    1  
HETATM 9076   O O    . HOH C 3 .   ? 9.564   36.840  -26.398 0.02 21.08 ?  723  HOH A O    1  
HETATM 9077   O O    . HOH C 3 .   ? 18.530  8.470   -29.589 0.02 16.53 ?  724  HOH A O    1  
HETATM 9078   O O    . HOH C 3 .   ? 6.499   33.476  -30.686 0.02 20.85 ?  725  HOH A O    1  
HETATM 9079   O O    . HOH C 3 .   ? 38.917  21.023  -13.504 0.02 18.85 ?  726  HOH A O    1  
HETATM 9080   O O    . HOH C 3 .   ? 28.710  27.143  -7.366  0.02 19.63 ?  727  HOH A O    1  
HETATM 9081   O O    . HOH C 3 .   ? 8.163   -1.129  -1.919  0.02 20.61 ?  728  HOH A O    1  
HETATM 9082   O O    . HOH C 3 .   ? 10.310  39.124  -25.042 0.02 21.66 ?  729  HOH A O    1  
HETATM 9083   O O    . HOH C 3 .   ? 17.472  31.657  -46.364 0.02 21.88 ?  730  HOH A O    1  
HETATM 9084   O O    . HOH C 3 .   ? 22.686  0.783   -48.288 0.02 19.53 ?  731  HOH A O    1  
HETATM 9085   O O    . HOH C 3 .   ? 22.071  -17.542 3.162   0.02 23.43 ?  732  HOH A O    1  
HETATM 9086   O O    . HOH C 3 .   ? 11.643  24.849  -39.990 0.02 19.72 ?  733  HOH A O    1  
HETATM 9087   O O    . HOH C 3 .   ? 1.041   21.676  -33.295 0.02 20.18 ?  734  HOH A O    1  
HETATM 9088   O O    . HOH C 3 .   ? 42.417  5.370   -43.514 0.02 19.51 ?  735  HOH A O    1  
HETATM 9089   O O    . HOH C 3 .   ? 39.533  -0.069  -6.293  0.02 19.09 ?  736  HOH A O    1  
HETATM 9090   O O    . HOH C 3 .   ? 18.934  37.262  -29.322 0.02 20.74 ?  737  HOH A O    1  
HETATM 9091   O O    . HOH C 3 .   ? 38.817  -1.032  -34.194 0.02 17.73 ?  738  HOH A O    1  
HETATM 9092   O O    . HOH C 3 .   ? -7.529  15.530  -11.578 0.02 22.16 ?  739  HOH A O    1  
HETATM 9093   O O    . HOH C 3 .   ? 35.522  5.381   -54.467 0.02 21.29 ?  740  HOH A O    1  
HETATM 9094   O O    . HOH C 3 .   ? 26.575  14.756  -49.712 0.02 19.76 ?  741  HOH A O    1  
HETATM 9095   O O    . HOH C 3 .   ? -0.990  7.961   -27.184 0.02 19.94 ?  742  HOH A O    1  
HETATM 9096   O O    . HOH C 3 .   ? 44.769  -4.360  -28.374 0.02 18.51 ?  743  HOH A O    1  
HETATM 9097   O O    . HOH C 3 .   ? 23.544  13.247  -8.196  0.02 17.51 ?  744  HOH A O    1  
HETATM 9098   O O    . HOH C 3 .   ? 19.109  32.412  -40.114 0.02 20.64 ?  745  HOH A O    1  
HETATM 9099   O O    . HOH C 3 .   ? 35.651  17.951  -49.006 0.02 20.56 ?  746  HOH A O    1  
HETATM 9100   O O    . HOH C 3 .   ? 42.475  -9.743  -40.495 0.02 20.00 ?  747  HOH A O    1  
HETATM 9101   O O    . HOH C 3 .   ? -6.442  21.936  -13.912 0.02 21.95 ?  748  HOH A O    1  
HETATM 9102   O O    . HOH C 3 .   ? 33.726  -4.822  -29.697 0.02 17.31 ?  749  HOH A O    1  
HETATM 9103   O O    . HOH C 3 .   ? 6.052   27.152  -29.354 0.02 19.57 ?  750  HOH A O    1  
HETATM 9104   O O    . HOH C 3 .   ? 29.774  23.479  -21.427 0.02 17.62 ?  751  HOH A O    1  
HETATM 9105   O O    . HOH C 3 .   ? 13.831  -15.111 -19.013 0.02 20.24 ?  752  HOH A O    1  
HETATM 9106   O O    . HOH C 3 .   ? 13.001  15.236  -52.924 0.02 21.63 ?  753  HOH A O    1  
HETATM 9107   O O    . HOH C 3 .   ? 20.876  18.194  -44.595 0.02 19.00 ?  754  HOH A O    1  
HETATM 9108   O O    . HOH C 3 .   ? 35.969  -12.835 -21.163 0.02 18.63 ?  755  HOH A O    1  
HETATM 9109   O O    . HOH C 3 .   ? 29.186  -19.728 -7.438  0.02 21.56 ?  756  HOH A O    1  
HETATM 9110   O O    . HOH C 3 .   ? 33.220  -4.369  -55.460 0.02 22.04 ?  757  HOH A O    1  
HETATM 9111   O O    . HOH C 3 .   ? 36.693  1.546   -13.325 0.02 17.45 ?  758  HOH A O    1  
HETATM 9112   O O    . HOH C 3 .   ? 2.913   28.497  -14.518 0.02 20.42 ?  759  HOH A O    1  
HETATM 9113   O O    . HOH C 3 .   ? 37.840  22.361  -32.648 0.02 18.68 ?  760  HOH A O    1  
HETATM 9114   O O    . HOH C 3 .   ? 14.795  -15.863 -5.648  0.02 21.89 ?  761  HOH A O    1  
HETATM 9115   O O    . HOH C 3 .   ? 22.830  -0.533  -39.957 0.02 17.92 ?  762  HOH A O    1  
HETATM 9116   O O    . HOH C 3 .   ? 5.099   24.885  -36.484 0.02 20.21 ?  763  HOH A O    1  
HETATM 9117   O O    . HOH C 3 .   ? 45.651  -0.081  -39.791 0.02 19.44 ?  764  HOH A O    1  
HETATM 9118   O O    . HOH C 3 .   ? 30.692  -5.444  -39.591 0.02 18.29 ?  765  HOH A O    1  
HETATM 9119   O O    . HOH C 3 .   ? 29.554  -13.405 -17.477 0.02 18.66 ?  766  HOH A O    1  
HETATM 9120   O O    . HOH C 3 .   ? 22.602  34.144  -13.014 0.02 20.15 ?  767  HOH A O    1  
HETATM 9121   O O    . HOH C 3 .   ? 18.338  16.960  -10.240 0.02 17.51 ?  768  HOH A O    1  
HETATM 9122   O O    . HOH C 3 .   ? -8.296  15.410  -9.072  0.02 22.75 ?  769  HOH A O    1  
HETATM 9123   O O    . HOH C 3 .   ? -2.209  2.932   -34.527 0.02 21.25 ?  770  HOH A O    1  
HETATM 9124   O O    . HOH C 3 .   ? 7.391   8.643   -41.798 0.02 19.76 ?  771  HOH A O    1  
HETATM 9125   O O    . HOH C 3 .   ? 9.736   4.117   -45.177 0.02 20.15 ?  772  HOH A O    1  
HETATM 9126   O O    . HOH C 3 .   ? 26.191  22.078  -3.774  0.02 19.14 ?  773  HOH A O    1  
HETATM 9127   O O    . HOH C 3 .   ? 15.557  32.549  -40.518 0.02 20.95 ?  774  HOH A O    1  
HETATM 9128   O O    . HOH C 3 .   ? 45.113  6.773   -43.936 0.02 19.92 ?  775  HOH A O    1  
HETATM 9129   O O    . HOH C 3 .   ? 45.179  -5.191  -40.713 0.02 19.85 ?  776  HOH A O    1  
HETATM 9130   O O    . HOH C 3 .   ? 35.450  -10.376 -1.378  0.02 20.80 ?  777  HOH A O    1  
HETATM 9131   O O    . HOH C 3 .   ? 4.412   -0.475  -42.775 0.02 21.33 ?  778  HOH A O    1  
HETATM 9132   O O    . HOH C 3 .   ? 0.325   13.520  -1.305  0.02 21.54 ?  779  HOH A O    1  
HETATM 9133   O O    . HOH C 3 .   ? 0.808   -0.752  -27.083 0.02 20.17 ?  780  HOH A O    1  
HETATM 9134   O O    . HOH C 3 .   ? 34.918  -9.516  -9.734  0.02 19.02 ?  781  HOH A O    1  
HETATM 9135   O O    . HOH C 3 .   ? 17.919  0.180   -15.770 0.02 17.11 ?  782  HOH A O    1  
HETATM 9136   O O    . HOH C 3 .   ? 11.977  -4.446  -34.420 0.02 18.85 ?  783  HOH A O    1  
HETATM 9137   O O    . HOH C 3 .   ? 18.137  -12.879 0.890   0.02 22.14 ?  784  HOH A O    1  
HETATM 9138   O O    . HOH C 3 .   ? 26.508  -13.836 -24.176 0.02 18.59 ?  785  HOH A O    1  
HETATM 9139   O O    . HOH C 3 .   ? 27.371  -8.419  -32.659 0.02 17.83 ?  786  HOH A O    1  
HETATM 9140   O O    . HOH C 3 .   ? 13.195  12.251  -45.758 0.02 19.52 ?  787  HOH A O    1  
HETATM 9141   O O    . HOH C 3 .   ? 14.141  14.605  -28.211 0.02 16.98 ?  788  HOH A O    1  
HETATM 9142   O O    . HOH C 3 .   ? 30.158  13.659  -45.127 0.02 18.75 ?  789  HOH A O    1  
HETATM 9143   O O    . HOH C 3 .   ? 14.903  23.399  -49.849 0.02 21.36 ?  790  HOH A O    1  
HETATM 9144   O O    . HOH C 3 .   ? 12.849  -5.709  -18.624 0.02 18.40 ?  791  HOH A O    1  
HETATM 9145   O O    . HOH C 3 .   ? -3.435  0.610   -33.624 0.02 21.82 ?  792  HOH A O    1  
HETATM 9146   O O    . HOH C 3 .   ? 32.624  -3.494  -6.710  0.02 18.51 ?  793  HOH A O    1  
HETATM 9147   O O    . HOH C 3 .   ? 48.728  -4.459  -47.320 0.02 21.78 ?  794  HOH A O    1  
HETATM 9148   O O    . HOH C 3 .   ? 21.570  22.472  -44.574 0.02 19.34 ?  795  HOH A O    1  
HETATM 9149   O O    . HOH C 3 .   ? 16.534  16.619  -8.078  0.02 17.84 ?  796  HOH A O    1  
HETATM 9150   O O    . HOH C 3 .   ? 28.221  -8.137  -20.946 0.02 17.49 ?  797  HOH A O    1  
HETATM 9151   O O    . HOH C 3 .   ? 24.244  4.785   -37.499 0.02 17.13 ?  798  HOH A O    1  
HETATM 9152   O O    . HOH C 3 .   ? 6.994   -5.002  -46.721 0.02 22.25 ?  799  HOH A O    1  
HETATM 9153   O O    . HOH C 3 .   ? 22.531  -5.065  -21.936 0.02 17.14 ?  800  HOH A O    1  
HETATM 9154   O O    . HOH C 3 .   ? 25.857  0.476   -37.662 0.02 17.42 ?  801  HOH A O    1  
HETATM 9155   O O    . HOH C 3 .   ? 6.742   23.490  -22.899 0.02 18.66 ?  802  HOH A O    1  
HETATM 9156   O O    . HOH C 3 .   ? 4.464   -4.145  -13.325 0.02 20.05 ?  803  HOH A O    1  
HETATM 9157   O O    . HOH C 3 .   ? 39.510  3.854   -22.230 0.02 17.16 ?  804  HOH A O    1  
HETATM 9158   O O    . HOH C 3 .   ? 0.163   23.730  -16.961 0.02 20.16 ?  805  HOH A O    1  
HETATM 9159   O O    . HOH C 3 .   ? 14.936  -1.535  -17.156 0.02 17.57 ?  806  HOH A O    1  
HETATM 9160   O O    . HOH C 3 .   ? 35.624  3.516   -9.695  0.02 17.78 ?  807  HOH A O    1  
HETATM 9161   O O    . HOH C 3 .   ? 16.091  34.722  -8.938  0.02 20.98 ?  808  HOH A O    1  
HETATM 9162   O O    . HOH C 3 .   ? 28.502  21.160  -17.355 0.02 17.34 ?  809  HOH A O    1  
HETATM 9163   O O    . HOH C 3 .   ? 20.376  1.064   -4.313  0.02 18.44 ?  810  HOH A O    1  
HETATM 9164   O O    . HOH C 3 .   ? 14.854  9.469   -37.558 0.02 17.71 ?  811  HOH A O    1  
HETATM 9165   O O    . HOH C 3 .   ? 21.419  19.435  -4.914  0.02 18.50 ?  812  HOH A O    1  
HETATM 9166   O O    . HOH C 3 .   ? 24.938  6.359   -30.917 0.02 16.37 ?  813  HOH A O    1  
HETATM 9167   O O    . HOH C 3 .   ? 32.371  6.605   -58.130 0.02 22.29 ?  814  HOH A O    1  
HETATM 9168   O O    . HOH C 3 .   ? 44.097  -4.033  -47.947 0.02 21.05 ?  815  HOH A O    1  
HETATM 9169   O O    . HOH C 3 .   ? 28.794  -0.316  -35.578 0.02 17.15 ?  816  HOH A O    1  
HETATM 9170   O O    . HOH C 3 .   ? 4.592   28.271  -7.779  0.02 20.83 ?  817  HOH A O    1  
HETATM 9171   O O    . HOH C 3 .   ? 23.890  3.182   -2.569  0.02 18.52 ?  818  HOH A O    1  
HETATM 9172   O O    . HOH C 3 .   ? 31.566  10.709  -3.994  0.02 18.45 ?  819  HOH A O    1  
HETATM 9173   O O    . HOH C 3 .   ? 25.812  36.965  -25.256 0.02 20.66 ?  820  HOH A O    1  
HETATM 9174   O O    . HOH C 3 .   ? 19.445  -13.870 6.074   0.02 23.67 ?  821  HOH A O    1  
HETATM 9175   O O    . HOH C 3 .   ? 35.756  -5.525  -22.796 0.02 17.39 ?  822  HOH A O    1  
HETATM 9176   O O    . HOH C 3 .   ? 38.677  20.660  -25.852 0.02 18.22 ?  823  HOH A O    1  
HETATM 9177   O O    . HOH C 3 .   ? 9.080   13.685  -35.424 0.02 18.34 ?  824  HOH A O    1  
HETATM 9178   O O    . HOH C 3 .   ? -6.200  21.415  -18.479 0.02 21.57 ?  825  HOH A O    1  
HETATM 9179   O O    . HOH C 3 .   ? 16.043  29.362  -4.846  0.02 20.26 ?  826  HOH A O    1  
HETATM 9180   O O    . HOH C 3 .   ? 22.972  -1.286  -28.692 0.02 16.74 ?  827  HOH A O    1  
HETATM 9181   O O    . HOH C 3 .   ? 19.359  19.961  -23.091 0.02 16.92 ?  828  HOH A O    1  
HETATM 9182   O O    . HOH C 3 .   ? 36.670  0.000   0.000   0.02 20.02 ?  829  HOH A O    1  
HETATM 9183   O O    . HOH C 3 .   ? 33.285  19.056  -34.773 0.02 17.85 ?  830  HOH A O    1  
HETATM 9184   O O    . HOH C 3 .   ? 4.069   9.767   -43.609 0.02 20.78 ?  831  HOH A O    1  
HETATM 9185   O O    . HOH C 3 .   ? 17.653  8.224   -47.981 0.02 19.51 ?  832  HOH A O    1  
HETATM 9186   O O    . HOH C 3 .   ? 5.659   24.987  -19.718 0.02 19.09 ?  833  HOH A O    1  
HETATM 9187   O O    . HOH C 3 .   ? 4.195   0.611   -37.022 0.02 20.10 ?  834  HOH A O    1  
HETATM 9188   O O    . HOH C 3 .   ? 19.088  4.475   -3.955  0.02 18.32 ?  835  HOH A O    1  
HETATM 9189   O O    . HOH C 3 .   ? 27.468  32.034  -22.779 0.02 19.27 ?  836  HOH A O    1  
HETATM 9190   O O    . HOH C 3 .   ? 13.702  10.782  -40.904 0.02 18.43 ?  837  HOH A O    1  
HETATM 9191   O O    . HOH C 3 .   ? 41.816  0.854   -10.898 0.02 18.67 ?  838  HOH A O    1  
HETATM 9192   O O    . HOH C 3 .   ? 48.077  5.607   -31.228 0.02 19.02 ?  839  HOH A O    1  
HETATM 9193   O O    . HOH C 3 .   ? 24.577  -5.942  -23.658 0.02 17.15 ?  840  HOH A O    1  
HETATM 9194   O O    . HOH C 3 .   ? 34.519  16.882  -13.007 0.02 17.75 ?  841  HOH A O    1  
HETATM 9195   O O    . HOH C 3 .   ? 10.713  5.211   -47.769 0.02 20.45 ?  842  HOH A O    1  
HETATM 9196   O O    . HOH C 3 .   ? 8.711   21.430  -23.422 0.02 18.09 ?  843  HOH A O    1  
HETATM 9197   O O    . HOH C 3 .   ? 21.671  4.877   -47.222 0.02 19.08 ?  844  HOH A O    1  
HETATM 9198   O O    . HOH C 3 .   ? 47.374  1.155   -30.774 0.02 18.73 ?  845  HOH A O    1  
HETATM 9199   O O    . HOH C 3 .   ? 36.542  17.488  -15.841 0.02 17.79 ?  846  HOH A O    1  
HETATM 9200   O O    . HOH C 3 .   ? 27.489  34.306  -30.640 0.02 20.24 ?  847  HOH A O    1  
HETATM 9201   O O    . HOH C 3 .   ? -1.654  14.379  -4.756  0.02 21.33 ?  848  HOH A O    1  
HETATM 9202   O O    . HOH C 3 .   ? 21.960  17.621  -51.055 0.02 20.49 ?  849  HOH A O    1  
HETATM 9203   O O    . HOH C 3 .   ? 11.733  0.743   -1.867  0.02 19.78 ?  850  HOH A O    1  
HETATM 9204   O O    . HOH C 3 .   ? 19.204  4.200   -16.599 0.02 16.64 ?  851  HOH A O    1  
HETATM 9205   O O    . HOH C 3 .   ? 8.371   34.392  -25.405 0.02 20.54 ?  852  HOH A O    1  
HETATM 9206   O O    . HOH C 3 .   ? 21.353  11.699  -41.129 0.02 17.82 ?  853  HOH A O    1  
HETATM 9207   O O    . HOH C 3 .   ? 4.351   22.054  -29.190 0.02 19.15 ?  854  HOH A O    1  
HETATM 9208   O O    . HOH C 3 .   ? 24.259  0.843   -27.331 0.02 16.44 ?  855  HOH A O    1  
HETATM 9209   O O    . HOH C 3 .   ? 42.591  10.276  -35.705 0.02 18.44 ?  856  HOH A O    1  
HETATM 9210   O O    . HOH C 3 .   ? -2.906  -4.749  -29.935 0.02 22.16 ?  857  HOH A O    1  
HETATM 9211   O O    . HOH C 3 .   ? 11.171  24.072  -42.516 0.02 20.17 ?  858  HOH A O    1  
HETATM 9212   O O    . HOH C 3 .   ? 14.935  -3.418  -31.206 0.02 17.89 ?  859  HOH A O    1  
HETATM 9213   O O    . HOH C 3 .   ? 16.011  18.676  -28.181 0.02 17.10 ?  860  HOH A O    1  
HETATM 9214   O O    . HOH C 3 .   ? 31.570  -6.334  -28.362 0.02 17.30 ?  861  HOH A O    1  
HETATM 9215   O O    . HOH C 3 .   ? 20.905  -11.357 4.075   0.02 22.36 ?  862  HOH A O    1  
HETATM 9216   O O    . HOH C 3 .   ? 19.082  -3.333  -21.655 0.02 17.13 ?  863  HOH A O    1  
HETATM 9217   O O    . HOH C 3 .   ? 20.635  12.398  -48.663 0.02 19.55 ?  864  HOH A O    1  
HETATM 9218   O O    . HOH C 3 .   ? 28.658  -6.375  -19.093 0.02 17.29 ?  865  HOH A O    1  
HETATM 9219   O O    . HOH C 3 .   ? 29.058  8.854   -55.803 0.02 21.36 ?  866  HOH A O    1  
HETATM 9220   O O    . HOH C 3 .   ? 25.834  28.412  -18.159 0.02 18.49 ?  867  HOH A O    1  
HETATM 9221   O O    . HOH C 3 .   ? 16.928  5.819   -12.719 0.02 17.09 ?  868  HOH A O    1  
HETATM 9222   O O    . HOH C 3 .   ? 33.167  -8.961  -1.816  0.02 20.32 ?  869  HOH A O    1  
HETATM 9223   O O    . HOH C 3 .   ? 37.670  -5.323  -17.189 0.02 17.84 ?  870  HOH A O    1  
HETATM 9224   O O    . HOH C 3 .   ? 2.833   9.927   -2.508  0.02 20.77 ?  871  HOH A O    1  
HETATM 9225   O O    . HOH C 3 .   ? 23.123  -5.459  -4.435  0.02 19.07 ?  872  HOH A O    1  
HETATM 9226   O O    . HOH C 3 .   ? 12.905  1.744   -45.424 0.02 19.79 ?  873  HOH A O    1  
HETATM 9227   O O    . HOH C 3 .   ? 25.702  34.408  -32.795 0.02 20.26 ?  874  HOH A O    1  
HETATM 9228   O O    . HOH C 3 .   ? 39.927  3.094   -4.136  0.02 19.37 ?  875  HOH A O    1  
HETATM 9229   O O    . HOH C 3 .   ? 32.470  -5.455  -38.678 0.02 18.21 ?  876  HOH A O    1  
HETATM 9230   O O    . HOH C 3 .   ? 26.262  -3.124  -3.543  0.02 18.89 ?  877  HOH A O    1  
HETATM 9231   O O    . HOH C 3 .   ? 6.138   29.153  -37.184 0.02 20.78 ?  878  HOH A O    1  
HETATM 9232   O O    . HOH C 3 .   ? 37.147  5.385   -17.952 0.02 17.01 ?  879  HOH A O    1  
HETATM 9233   O O    . HOH C 3 .   ? 2.454   13.740  -5.850  0.02 20.19 ?  880  HOH A O    1  
HETATM 9234   O O    . HOH C 3 .   ? 20.257  4.473   -23.929 0.02 16.33 ?  881  HOH A O    1  
HETATM 9235   O O    . HOH C 3 .   ? 33.190  -6.296  1.054   0.02 20.64 ?  882  HOH A O    1  
HETATM 9236   O O    . HOH C 3 .   ? 42.413  4.312   -28.714 0.02 17.66 ?  883  HOH A O    1  
HETATM 9237   O O    . HOH C 3 .   ? -10.043 21.651  -13.895 0.02 23.07 ?  884  HOH A O    1  
HETATM 9238   O O    . HOH C 3 .   ? 45.518  -11.064 -37.318 0.02 20.26 ?  885  HOH A O    1  
HETATM 9239   O O    . HOH C 3 .   ? 33.482  21.018  -43.586 0.02 19.46 ?  886  HOH A O    1  
HETATM 9240   O O    . HOH C 3 .   ? -6.827  20.341  -7.121  0.02 22.78 ?  887  HOH A O    1  
HETATM 9241   O O    . HOH C 3 .   ? 23.935  8.503   -38.409 0.02 17.22 ?  888  HOH A O    1  
HETATM 9242   O O    . HOH C 3 .   ? 6.253   -1.389  -47.350 0.02 21.88 ?  889  HOH A O    1  
HETATM 9243   O O    . HOH C 3 .   ? 19.182  0.213   -43.716 0.02 18.82 ?  890  HOH A O    1  
HETATM 9244   O O    . HOH C 3 .   ? 33.903  -8.599  -33.899 0.02 18.17 ?  891  HOH A O    1  
HETATM 9245   O O    . HOH C 3 .   ? 16.054  37.839  -34.078 0.02 21.45 ?  892  HOH A O    1  
HETATM 9246   O O    . HOH C 3 .   ? 35.257  -2.605  -13.622 0.02 17.62 ?  893  HOH A O    1  
HETATM 9247   O O    . HOH C 3 .   ? 38.629  22.559  -20.800 0.02 18.55 ?  894  HOH A O    1  
HETATM 9248   O O    . HOH C 3 .   ? 17.450  19.474  -19.906 0.02 17.00 ?  895  HOH A O    1  
HETATM 9249   O O    . HOH C 3 .   ? 31.182  3.181   -0.706  0.02 19.17 ?  896  HOH A O    1  
HETATM 9250   O O    . HOH C 3 .   ? 23.595  -2.764  -8.747  0.02 17.92 ?  897  HOH A O    1  
HETATM 9251   O O    . HOH C 3 .   ? 24.093  -12.062 -26.052 0.02 18.35 ?  898  HOH A O    1  
HETATM 9252   O O    . HOH C 3 .   ? 6.619   16.583  -34.051 0.02 18.72 ?  899  HOH A O    1  
HETATM 9253   O O    . HOH C 3 .   ? 23.570  26.996  -6.058  0.02 19.51 ?  900  HOH A O    1  
HETATM 9254   O O    . HOH C 3 .   ? 0.970   20.141  -1.683  0.02 21.60 ?  901  HOH A O    1  
HETATM 9255   O O    . HOH C 3 .   ? 24.876  31.566  -11.954 0.02 19.66 ?  902  HOH A O    1  
HETATM 9256   O O    . HOH C 3 .   ? 5.245   21.679  -21.441 0.02 18.70 ?  903  HOH A O    1  
HETATM 9257   O O    . HOH C 3 .   ? 25.673  -4.723  -57.740 0.02 22.87 ?  904  HOH A O    1  
HETATM 9258   O O    . HOH C 3 .   ? 4.687   23.334  -33.475 0.02 19.64 ?  905  HOH A O    1  
HETATM 9259   O O    . HOH C 3 .   ? 32.565  31.757  -13.467 0.02 20.15 ?  906  HOH A O    1  
HETATM 9260   O O    . HOH C 3 .   ? -0.922  25.097  -4.446  0.02 22.02 ?  907  HOH A O    1  
HETATM 9261   O O    . HOH C 3 .   ? 4.560   23.189  -36.544 0.02 20.01 ?  908  HOH A O    1  
HETATM 9262   O O    . HOH C 3 .   ? 37.939  0.956   -19.491 0.02 17.17 ?  909  HOH A O    1  
HETATM 9263   O O    . HOH C 3 .   ? 26.170  2.180   -12.764 0.02 16.89 ?  910  HOH A O    1  
HETATM 9264   O O    . HOH C 3 .   ? 8.781   33.801  -20.736 0.02 20.30 ?  911  HOH A O    1  
HETATM 9265   O O    . HOH C 3 .   ? 24.435  -7.324  -2.860  0.02 19.65 ?  912  HOH A O    1  
HETATM 9266   O O    . HOH C 3 .   ? 28.542  -0.532  -43.711 0.02 18.45 ?  913  HOH A O    1  
HETATM 9267   O O    . HOH C 3 .   ? 36.275  12.841  -13.184 0.02 17.58 ?  914  HOH A O    1  
HETATM 9268   O O    . HOH C 3 .   ? 19.191  32.882  -9.607  0.02 20.14 ?  915  HOH A O    1  
HETATM 9269   O O    . HOH C 3 .   ? 41.397  2.799   -24.669 0.02 17.51 ?  916  HOH A O    1  
HETATM 9270   O O    . HOH C 3 .   ? 39.853  1.413   -28.641 0.02 17.35 ?  917  HOH A O    1  
HETATM 9271   O O    . HOH C 3 .   ? 39.950  3.192   -27.321 0.02 17.25 ?  918  HOH A O    1  
HETATM 9272   O O    . HOH C 3 .   ? 33.294  -10.322 -31.808 0.02 18.20 ?  919  HOH A O    1  
HETATM 9273   O O    . HOH C 3 .   ? 14.809  -6.675  -2.739  0.02 20.29 ?  920  HOH A O    1  
HETATM 9274   O O    . HOH C 3 .   ? 42.776  18.554  -29.410 0.02 18.78 ?  921  HOH A O    1  
HETATM 9275   O O    . HOH C 3 .   ? 25.568  -17.725 -5.947  0.02 21.29 ?  922  HOH A O    1  
HETATM 9276   O O    . HOH C 3 .   ? 15.525  -2.957  -22.389 0.02 17.44 ?  923  HOH A O    1  
HETATM 9277   O O    . HOH C 3 .   ? 33.414  -0.449  -14.267 0.02 17.18 ?  924  HOH A O    1  
HETATM 9278   O O    . HOH C 3 .   ? 37.013  3.353   -20.220 0.02 16.92 ?  925  HOH A O    1  
HETATM 9279   O O    . HOH C 3 .   ? 15.504  1.037   -29.498 0.02 17.21 ?  926  HOH A O    1  
HETATM 9280   O O    . HOH C 3 .   ? 41.055  6.094   -45.695 0.02 19.60 ?  927  HOH A O    1  
HETATM 9281   O O    . HOH C 3 .   ? 3.002   11.014  -27.266 0.02 18.81 ?  928  HOH A O    1  
HETATM 9282   O O    . HOH C 3 .   ? 10.902  12.933  -7.038  0.02 18.46 ?  929  HOH A O    1  
HETATM 9283   O O    . HOH C 3 .   ? 33.181  35.776  -17.662 0.02 21.15 ?  930  HOH A O    1  
HETATM 9284   O O    . HOH C 3 .   ? 39.963  4.617   -18.314 0.02 17.34 ?  931  HOH A O    1  
HETATM 9285   O O    . HOH C 3 .   ? 3.244   18.933  -42.858 0.02 21.03 ?  932  HOH A O    1  
HETATM 9286   O O    . HOH C 3 .   ? 13.961  18.101  -11.522 0.02 17.75 ?  933  HOH A O    1  
HETATM 9287   O O    . HOH C 3 .   ? 16.044  33.931  -13.818 0.02 20.05 ?  934  HOH A O    1  
HETATM 9288   O O    . HOH C 3 .   ? -9.708  19.060  -7.090  0.02 23.59 ?  935  HOH A O    1  
HETATM 9289   O O    . HOH C 3 .   ? 35.921  -15.140 -19.555 0.02 19.22 ?  936  HOH A O    1  
HETATM 9290   O O    . HOH C 3 .   ? 27.177  -6.526  -23.072 0.02 17.18 ?  937  HOH A O    1  
HETATM 9291   O O    . HOH C 3 .   ? 7.263   32.928  -18.625 0.02 20.35 ?  938  HOH A O    1  
HETATM 9292   O O    . HOH C 3 .   ? 4.570   28.145  -19.674 0.02 19.79 ?  939  HOH A O    1  
HETATM 9293   O O    . HOH C 3 .   ? 42.444  22.154  -37.200 0.02 20.02 ?  940  HOH A O    1  
HETATM 9294   O O    . HOH C 3 .   ? 20.586  31.307  -26.864 0.02 18.98 ?  941  HOH A O    1  
HETATM 9295   O O    . HOH C 3 .   ? 27.865  -3.258  -15.640 0.02 17.10 ?  942  HOH A O    1  
HETATM 9296   O O    . HOH C 3 .   ? 28.957  -4.335  -51.973 0.02 20.88 ?  943  HOH A O    1  
HETATM 9297   O O    . HOH C 3 .   ? 34.475  -5.554  -20.124 0.02 17.37 ?  944  HOH A O    1  
HETATM 9298   O O    . HOH C 3 .   ? 0.147   26.310  -17.893 0.02 20.47 ?  945  HOH A O    1  
HETATM 9299   O O    . HOH C 3 .   ? 33.045  -10.231 -13.703 0.02 18.50 ?  946  HOH A O    1  
HETATM 9300   O O    . HOH C 3 .   ? 7.951   11.177  -34.558 0.02 18.37 ?  947  HOH A O    1  
HETATM 9301   O O    . HOH C 3 .   ? -7.507  15.059  -17.934 0.02 21.72 ?  948  HOH A O    1  
HETATM 9302   O O    . HOH C 3 .   ? 21.553  33.611  -16.545 0.02 19.72 ?  949  HOH A O    1  
HETATM 9303   O O    . HOH C 3 .   ? 19.043  6.070   -14.492 0.02 16.74 ?  950  HOH A O    1  
HETATM 9304   O O    . HOH C 3 .   ? -0.146  20.136  -27.964 0.02 19.85 ?  951  HOH A O    1  
HETATM 9305   O O    . HOH C 3 .   ? 11.421  -17.353 -5.591  0.02 22.79 ?  952  HOH A O    1  
HETATM 9306   O O    . HOH C 3 .   ? -2.146  14.305  -25.471 0.02 20.08 ?  953  HOH A O    1  
HETATM 9307   O O    . HOH C 3 .   ? 11.160  7.607   6.756   0.02 21.66 ?  954  HOH A O    1  
HETATM 9308   O O    . HOH C 3 .   ? 30.657  23.962  -46.297 0.02 20.41 ?  955  HOH A O    1  
HETATM 9309   O O    . HOH C 3 .   ? 36.992  23.595  -27.468 0.02 18.54 ?  956  HOH A O    1  
HETATM 9310   O O    . HOH C 3 .   ? 36.002  13.147  -44.486 0.02 19.01 ?  957  HOH A O    1  
HETATM 9311   O O    . HOH C 3 .   ? 6.541   -6.574  -35.329 0.02 20.38 ?  958  HOH A O    1  
HETATM 9312   O O    . HOH C 3 .   ? 40.319  1.333   -50.833 0.02 20.88 ?  959  HOH A O    1  
HETATM 9313   O O    . HOH C 3 .   ? 11.157  24.223  -14.204 0.02 18.48 ?  960  HOH A O    1  
HETATM 9314   O O    . HOH C 3 .   ? 5.341   -1.375  -7.630  0.02 20.14 ?  961  HOH A O    1  
HETATM 9315   O O    . HOH C 3 .   ? 26.716  -1.487  -36.278 0.02 17.38 ?  962  HOH A O    1  
HETATM 9316   O O    . HOH C 3 .   ? -1.367  22.590  -18.823 0.02 20.31 ?  963  HOH A O    1  
HETATM 9317   O O    . HOH C 3 .   ? 6.102   29.524  -17.851 0.02 19.85 ?  964  HOH A O    1  
HETATM 9318   O O    . HOH C 3 .   ? 20.176  29.118  1.477   0.02 21.50 ?  965  HOH A O    1  
HETATM 9319   O O    . HOH C 3 .   ? 31.089  -1.577  -13.419 0.02 17.25 ?  966  HOH A O    1  
HETATM 9320   O O    . HOH C 3 .   ? -0.101  21.515  -21.194 0.02 19.83 ?  967  HOH A O    1  
HETATM 9321   O O    . HOH C 3 .   ? 25.134  13.878  -54.176 0.02 21.11 ?  968  HOH A O    1  
HETATM 9322   O O    . HOH C 3 .   ? 13.990  -14.263 -16.777 0.02 20.11 ?  969  HOH A O    1  
HETATM 9323   O O    . HOH C 3 .   ? 20.181  20.436  -20.869 0.02 16.93 ?  970  HOH A O    1  
HETATM 9324   O O    . HOH C 3 .   ? 16.376  18.658  -11.201 0.02 17.67 ?  971  HOH A O    1  
HETATM 9325   O O    . HOH C 3 .   ? 17.184  -3.298  -19.745 0.02 17.37 ?  972  HOH A O    1  
HETATM 9326   O O    . HOH C 3 .   ? 12.099  17.383  -54.648 0.02 22.51 ?  973  HOH A O    1  
HETATM 9327   O O    . HOH C 3 .   ? 9.587   30.279  -34.475 0.02 20.15 ?  974  HOH A O    1  
HETATM 9328   O O    . HOH C 3 .   ? 25.013  5.786   -2.382  0.02 18.45 ?  975  HOH A O    1  
HETATM 9329   O O    . HOH C 3 .   ? 15.425  -4.933  -41.839 0.02 19.50 ?  976  HOH A O    1  
HETATM 9330   O O    . HOH C 3 .   ? 23.269  5.845   -33.011 0.02 16.60 ?  977  HOH A O    1  
HETATM 9331   O O    . HOH C 3 .   ? 29.576  32.760  -21.435 0.02 19.77 ?  978  HOH A O    1  
HETATM 9332   O O    . HOH C 3 .   ? 29.015  -14.335 -21.189 0.02 18.70 ?  979  HOH A O    1  
HETATM 9333   O O    . HOH C 3 .   ? -3.464  13.353  -2.950  0.02 22.20 ?  980  HOH A O    1  
HETATM 9334   O O    . HOH C 3 .   ? 9.264   28.188  -43.837 0.02 21.38 ?  981  HOH A O    1  
HETATM 9335   O O    . HOH C 3 .   ? 13.424  10.997  -1.102  0.02 19.32 ?  982  HOH A O    1  
HETATM 9336   O O    . HOH C 3 .   ? 27.874  -6.835  0.514   0.02 20.34 ?  983  HOH A O    1  
HETATM 9337   O O    . HOH C 3 .   ? 15.836  7.846   -11.985 0.02 17.21 ?  984  HOH A O    1  
HETATM 9338   O O    . HOH C 3 .   ? -6.111  18.494  -4.021  0.02 23.01 ?  985  HOH A O    1  
HETATM 9339   O O    . HOH C 3 .   ? 31.967  -15.982 -13.070 0.02 19.75 ?  986  HOH A O    1  
HETATM 9340   O O    . HOH C 3 .   ? 32.395  -16.067 -16.983 0.02 19.43 ?  987  HOH A O    1  
HETATM 9341   O O    . HOH C 3 .   ? 41.109  -1.127  -17.458 0.02 17.90 ?  988  HOH A O    1  
HETATM 9342   O O    . HOH C 3 .   ? 11.378  -0.955  -50.301 0.02 21.62 ?  989  HOH A O    1  
HETATM 9343   O O    . HOH C 3 .   ? 11.940  32.495  -40.357 0.02 21.22 ?  990  HOH A O    1  
HETATM 9344   O O    . HOH C 3 .   ? 29.424  13.430  -4.335  0.02 18.39 ?  991  HOH A O    1  
HETATM 9345   O O    . HOH C 3 .   ? 14.349  36.331  -34.590 0.02 21.17 ?  992  HOH A O    1  
HETATM 9346   O O    . HOH C 3 .   ? -6.234  17.241  -20.235 0.02 21.19 ?  993  HOH A O    1  
HETATM 9347   O O    . HOH C 3 .   ? 36.814  9.761   -6.004  0.02 18.57 ?  994  HOH A O    1  
HETATM 9348   O O    . HOH C 3 .   ? 22.384  -17.676 -12.614 0.02 20.58 ?  995  HOH A O    1  
HETATM 9349   O O    . HOH C 3 .   ? 32.343  0.805   -0.647  0.02 19.30 ?  996  HOH A O    1  
HETATM 9350   O O    . HOH C 3 .   ? 23.561  16.780  -52.268 0.02 20.56 ?  997  HOH A O    1  
HETATM 9351   O O    . HOH C 3 .   ? 16.606  -2.426  -4.633  0.02 19.08 ?  998  HOH A O    1  
HETATM 9352   O O    . HOH C 3 .   ? 22.538  26.122  -9.761  0.02 18.73 ?  999  HOH A O    1  
HETATM 9353   O O    . HOH C 3 .   ? 5.143   22.223  -47.203 0.02 21.97 ?  1000 HOH A O    1  
HETATM 9354   O O    . HOH C 3 .   ? 14.531  -1.571  -29.049 0.02 17.53 ?  1001 HOH A O    1  
HETATM 9355   O O    . HOH C 3 .   ? 34.672  -1.832  -0.113  0.02 19.93 ?  1002 HOH A O    1  
HETATM 9356   O O    . HOH C 3 .   ? 30.818  -9.278  -0.502  0.02 20.48 ?  1003 HOH A O    1  
HETATM 9357   O O    . HOH C 3 .   ? 26.065  -16.969 -19.526 0.02 19.51 ?  1004 HOH A O    1  
HETATM 9358   O O    . HOH C 3 .   ? 3.881   32.989  -10.633 0.02 21.47 ?  1005 HOH A O    1  
HETATM 9359   O O    . HOH C 3 .   ? 42.588  -1.895  -21.908 0.02 17.91 ?  1006 HOH A O    1  
HETATM 9360   O O    . HOH C 3 .   ? -4.119  19.819  -1.645  0.02 22.87 ?  1007 HOH A O    1  
HETATM 9361   O O    . HOH C 3 .   ? 43.592  8.627   -21.141 0.02 17.94 ?  1008 HOH A O    1  
HETATM 9362   O O    . HOH C 3 .   ? 32.205  -10.971 -44.343 0.02 20.04 ?  1009 HOH A O    1  
HETATM 9363   O O    . HOH C 3 .   ? 23.937  15.684  -8.912  0.02 17.55 ?  1010 HOH A O    1  
HETATM 9364   O O    . HOH C 3 .   ? 12.886  37.017  -41.045 0.02 22.52 ?  1011 HOH A O    1  
HETATM 9365   O O    . HOH C 3 .   ? 21.631  31.483  -9.970  0.02 19.83 ?  1012 HOH A O    1  
HETATM 9366   O O    . HOH C 3 .   ? 19.723  -5.711  -46.761 0.02 20.23 ?  1013 HOH A O    1  
HETATM 9367   O O    . HOH C 3 .   ? 31.545  17.533  -50.389 0.02 20.51 ?  1014 HOH A O    1  
HETATM 9368   O O    . HOH C 3 .   ? 21.087  26.672  3.798   0.02 21.61 ?  1015 HOH A O    1  
HETATM 9369   O O    . HOH C 3 .   ? 5.974   24.330  4.804   0.02 22.67 ?  1016 HOH A O    1  
HETATM 9370   O O    . HOH C 3 .   ? 5.192   32.613  -13.296 0.02 20.95 ?  1017 HOH A O    1  
HETATM 9371   O O    . HOH C 3 .   ? 10.274  20.392  -54.763 0.02 23.00 ?  1018 HOH A O    1  
HETATM 9372   O O    . HOH C 3 .   ? 14.926  -3.977  -20.050 0.02 17.74 ?  1019 HOH A O    1  
HETATM 9373   O O    . HOH C 3 .   ? 17.404  -0.206  -3.810  0.02 18.85 ?  1020 HOH A O    1  
HETATM 9374   O O    . HOH C 3 .   ? 40.160  9.994   -13.223 0.02 17.98 ?  1021 HOH A O    1  
HETATM 9375   O O    . HOH C 3 .   ? 34.078  -15.204 -2.657  0.02 21.31 ?  1022 HOH A O    1  
HETATM 9376   O O    . HOH C 3 .   ? 33.344  16.805  -51.324 0.02 20.72 ?  1023 HOH A O    1  
HETATM 9377   O O    . HOH C 3 .   ? 5.311   1.050   -39.248 0.02 20.17 ?  1024 HOH A O    1  
HETATM 9378   O O    . HOH C 3 .   ? 33.554  -11.075 -11.407 0.02 18.98 ?  1025 HOH A O    1  
HETATM 9379   O O    . HOH C 3 .   ? 9.185   -4.901  -48.819 0.02 22.13 ?  1026 HOH A O    1  
HETATM 9380   O O    . HOH C 3 .   ? 23.147  27.486  2.301   0.02 21.42 ?  1027 HOH A O    1  
HETATM 9381   O O    . HOH C 3 .   ? 0.922   -10.113 -31.994 0.02 22.14 ?  1028 HOH A O    1  
HETATM 9382   O O    . HOH C 3 .   ? 25.587  -18.509 -7.580  0.02 21.25 ?  1029 HOH A O    1  
HETATM 9383   O O    . HOH C 3 .   ? 16.813  -12.572 -46.316 0.02 21.72 ?  1030 HOH A O    1  
HETATM 9384   O O    . HOH C 3 .   ? 2.422   -7.587  -41.654 0.02 22.68 ?  1031 HOH A O    1  
HETATM 9385   O O    . HOH C 3 .   ? 16.007  9.119   -34.827 0.02 17.23 ?  1032 HOH A O    1  
HETATM 9386   O O    . HOH C 3 .   ? 9.870   -0.676  -1.004  0.02 20.48 ?  1033 HOH A O    1  
HETATM 9387   O O    . HOH C 3 .   ? 12.124  38.752  -34.591 0.02 22.02 ?  1034 HOH A O    1  
HETATM 9388   O O    . HOH C 3 .   ? -4.488  -5.482  -36.413 0.02 23.74 ?  1035 HOH A O    1  
HETATM 9389   O O    . HOH C 3 .   ? 13.456  3.885   -22.869 0.02 17.00 ?  1036 HOH A O    1  
HETATM 9390   O O    . HOH C 3 .   ? 20.949  -1.901  -41.800 0.02 18.52 ?  1037 HOH A O    1  
HETATM 9391   O O    . HOH C 3 .   ? 38.200  -7.537  -12.956 0.02 18.52 ?  1038 HOH A O    1  
HETATM 9392   O O    . HOH C 3 .   ? 40.033  -2.166  -0.216  0.02 20.63 ?  1039 HOH A O    1  
HETATM 9393   O O    . HOH C 3 .   ? 18.283  -5.244  -38.063 0.02 18.50 ?  1040 HOH A O    1  
HETATM 9394   O O    . HOH C 3 .   ? 39.539  -11.663 -44.106 0.02 20.60 ?  1041 HOH A O    1  
HETATM 9395   O O    . HOH C 3 .   ? -6.546  17.987  -5.979  0.02 22.70 ?  1042 HOH A O    1  
HETATM 9396   O O    . HOH C 3 .   ? 31.199  -5.697  -53.837 0.02 21.64 ?  1043 HOH A O    1  
HETATM 9397   O O    . HOH C 3 .   ? 28.084  -16.518 -18.931 0.02 19.33 ?  1044 HOH A O    1  
HETATM 9398   O O    . HOH C 3 .   ? 19.317  23.708  -47.968 0.02 20.56 ?  1045 HOH A O    1  
HETATM 9399   O O    . HOH C 3 .   ? 7.799   26.565  -3.041  0.02 20.94 ?  1046 HOH A O    1  
HETATM 9400   O O    . HOH C 3 .   ? 26.797  12.510  -54.510 0.02 21.07 ?  1047 HOH A O    1  
HETATM 9401   O O    . HOH C 3 .   ? 6.412   31.410  -31.653 0.02 20.54 ?  1048 HOH A O    1  
HETATM 9402   O O    . HOH C 3 .   ? 34.318  -14.583 -9.410  0.02 20.24 ?  1049 HOH A O    1  
HETATM 9403   O O    . HOH C 3 .   ? 45.572  10.978  -35.717 0.02 19.05 ?  1050 HOH A O    1  
HETATM 9404   O O    . HOH C 3 .   ? 36.128  15.466  -11.287 0.02 18.04 ?  1051 HOH A O    1  
HETATM 9405   O O    . HOH C 3 .   ? 0.383   12.247  -4.380  0.02 20.91 ?  1052 HOH A O    1  
HETATM 9406   O O    . HOH C 3 .   ? 25.056  28.930  -0.939  0.02 20.92 ?  1053 HOH A O    1  
HETATM 9407   O O    . HOH C 3 .   ? 5.251   21.890  -49.668 0.02 22.52 ?  1054 HOH A O    1  
HETATM 9408   O O    . HOH C 3 .   ? -2.566  25.278  -6.772  0.02 21.92 ?  1055 HOH A O    1  
HETATM 9409   O O    . HOH C 3 .   ? 23.763  27.968  -9.023  0.02 19.22 ?  1056 HOH A O    1  
HETATM 9410   O O    . HOH C 3 .   ? -3.829  23.872  -19.809 0.02 21.12 ?  1057 HOH A O    1  
HETATM 9411   O O    . HOH C 3 .   ? 16.014  23.456  -52.001 0.02 21.83 ?  1058 HOH A O    1  
HETATM 9412   O O    . HOH C 3 .   ? 12.949  4.956   2.832   0.02 20.46 ?  1059 HOH A O    1  
HETATM 9413   O O    . HOH C 3 .   ? 8.012   26.001  -43.783 0.02 21.09 ?  1060 HOH A O    1  
HETATM 9414   O O    . HOH C 3 .   ? 37.621  -7.330  0.193   0.02 20.67 ?  1061 HOH A O    1  
HETATM 9415   O O    . HOH C 3 .   ? 19.663  40.065  -45.273 0.02 23.98 ?  1062 HOH A O    1  
HETATM 9416   O O    . HOH C 3 .   ? -1.025  13.409  -37.318 0.02 20.81 ?  1063 HOH A O    1  
HETATM 9417   O O    . HOH C 3 .   ? -5.339  10.434  -20.373 0.02 20.97 ?  1064 HOH A O    1  
HETATM 9418   O O    . HOH C 3 .   ? 30.053  32.588  -19.312 0.02 19.78 ?  1065 HOH A O    1  
HETATM 9419   O O    . HOH C 3 .   ? 12.685  1.394   -53.749 0.02 22.05 ?  1066 HOH A O    1  
HETATM 9420   O O    . HOH C 3 .   ? 20.767  -10.107 6.160   0.02 22.72 ?  1067 HOH A O    1  
HETATM 9421   O O    . HOH C 3 .   ? 6.884   30.995  -33.778 0.02 20.73 ?  1068 HOH A O    1  
HETATM 9422   O O    . HOH C 3 .   ? 15.517  13.331  -54.874 0.02 21.83 ?  1069 HOH A O    1  
HETATM 9423   O O    . HOH C 3 .   ? 34.259  15.663  -9.131  0.02 18.14 ?  1070 HOH A O    1  
HETATM 9424   O O    . HOH C 3 .   ? 2.313   29.508  -15.896 0.02 20.62 ?  1071 HOH A O    1  
HETATM 9425   O O    . HOH C 3 .   ? 4.201   30.889  -16.357 0.02 20.55 ?  1072 HOH A O    1  
HETATM 9426   O O    . HOH C 3 .   ? 7.340   34.312  -22.780 0.02 20.63 ?  1073 HOH A O    1  
HETATM 9427   O O    . HOH C 3 .   ? 26.055  -16.236 -23.221 0.02 19.17 ?  1074 HOH A O    1  
HETATM 9428   O O    . HOH C 3 .   ? 42.569  12.836  -14.746 0.02 18.50 ?  1075 HOH A O    1  
HETATM 9429   O O    . HOH C 3 .   ? -2.051  0.113   -20.405 0.02 20.92 ?  1076 HOH A O    1  
HETATM 9430   O O    . HOH C 3 .   ? 14.070  16.409  -9.051  0.02 17.89 ?  1077 HOH A O    1  
HETATM 9431   O O    . HOH C 3 .   ? 16.313  23.279  -47.568 0.02 20.65 ?  1078 HOH A O    1  
HETATM 9432   O O    . HOH C 3 .   ? 24.621  -17.897 2.369   0.02 23.34 ?  1079 HOH A O    1  
HETATM 9433   O O    . HOH C 3 .   ? 11.774  -14.201 -25.976 0.02 20.14 ?  1080 HOH A O    1  
HETATM 9434   O O    . HOH C 3 .   ? 10.373  36.243  -36.773 0.02 21.43 ?  1081 HOH A O    1  
HETATM 9435   O O    . HOH C 3 .   ? 46.401  -3.100  -30.715 0.02 18.87 ?  1082 HOH A O    1  
HETATM 9436   O O    . HOH C 3 .   ? 24.159  29.483  1.116   0.02 21.55 ?  1083 HOH A O    1  
HETATM 9437   O O    . HOH C 3 .   ? -3.611  12.718  -27.410 0.02 20.55 ?  1084 HOH A O    1  
HETATM 9438   O O    . HOH C 3 .   ? 18.033  -11.909 3.556   0.02 22.58 ?  1085 HOH A O    1  
HETATM 9439   O O    . HOH C 3 .   ? 38.399  12.369  -8.625  0.02 18.47 ?  1086 HOH A O    1  
HETATM 9440   O O    . HOH C 3 .   ? 15.400  16.316  -53.440 0.02 21.60 ?  1087 HOH A O    1  
HETATM 9441   O O    . HOH C 3 .   ? 23.540  -18.601 -6.220  0.02 21.61 ?  1088 HOH A O    1  
HETATM 9442   O O    . HOH C 3 .   ? -4.256  13.041  -23.701 0.02 20.58 ?  1089 HOH A O    1  
HETATM 9443   O O    . HOH C 3 .   ? 3.639   -11.116 -13.174 0.02 21.70 ?  1090 HOH A O    1  
HETATM 9444   O O    . HOH C 3 .   ? 19.093  6.818   -2.801  0.02 18.47 ?  1091 HOH A O    1  
HETATM 9445   O O    . HOH C 3 .   ? 6.147   33.292  -26.748 0.02 20.64 ?  1092 HOH A O    1  
HETATM 9446   O O    . HOH C 3 .   ? -3.725  -7.551  -29.170 0.02 22.91 ?  1093 HOH A O    1  
HETATM 9447   O O    . HOH C 3 .   ? -0.142  -6.732  -42.457 0.02 23.47 ?  1094 HOH A O    1  
HETATM 9448   O O    . HOH C 3 .   ? 20.673  29.936  -38.657 0.02 19.77 ?  1095 HOH A O    1  
HETATM 9449   O O    . HOH C 3 .   ? 29.858  -4.483  -49.222 0.02 20.16 ?  1096 HOH A O    1  
HETATM 9450   O O    . HOH C 3 .   ? -3.656  2.815   -10.562 0.02 21.35 ?  1097 HOH A O    1  
HETATM 9451   O O    . HOH C 3 .   ? 46.276  12.752  -36.812 0.02 19.50 ?  1098 HOH A O    1  
HETATM 9452   O O    . HOH C 3 .   ? -3.568  -4.406  -41.671 0.02 23.92 ?  1099 HOH A O    1  
ATOM   9453   N N    . VAL A 1 12  ? 2.545   -1.751  -27.720 0.02 19.75 ?  5    VAL A N    2  
ATOM   9454   C CA   . VAL A 1 12  ? 2.251   -1.362  -29.092 0.02 19.88 ?  5    VAL A CA   2  
ATOM   9455   C C    . VAL A 1 12  ? 1.206   -2.310  -29.700 0.02 20.35 ?  5    VAL A C    2  
ATOM   9456   O O    . VAL A 1 12  ? 1.210   -3.501  -29.429 0.02 20.51 ?  5    VAL A O    2  
ATOM   9457   C CB   . VAL A 1 12  ? 3.545   -1.336  -29.925 0.02 19.65 ?  5    VAL A CB   2  
ATOM   9458   C CG1  . VAL A 1 12  ? 3.261   -1.626  -31.368 0.02 19.75 ?  5    VAL A CG1  2  
ATOM   9459   C CG2  . VAL A 1 12  ? 4.248   0.020   -29.762 0.02 19.23 ?  5    VAL A CG2  2  
ATOM   9460   H HA   . VAL A 1 12  ? 1.884   -0.466  -29.087 0.02 19.85 ?  5    VAL A HA   2  
ATOM   9461   H HB   . VAL A 1 12  ? 4.141   -2.025  -29.593 0.02 19.75 ?  5    VAL A HB   2  
ATOM   9462   H HG11 . VAL A 1 12  ? 4.045   -1.398  -31.889 0.02 19.54 ?  5    VAL A HG11 2  
ATOM   9463   H HG12 . VAL A 1 12  ? 3.070   -2.567  -31.463 0.02 20.00 ?  5    VAL A HG12 2  
ATOM   9464   H HG13 . VAL A 1 12  ? 2.508   -1.094  -31.666 0.02 19.79 ?  5    VAL A HG13 2  
ATOM   9465   H HG21 . VAL A 1 12  ? 5.105   -0.017  -30.212 0.02 19.10 ?  5    VAL A HG21 2  
ATOM   9466   H HG22 . VAL A 1 12  ? 3.698   0.717   -30.150 0.02 19.15 ?  5    VAL A HG22 2  
ATOM   9467   H HG23 . VAL A 1 12  ? 4.379   0.191   -28.815 0.02 19.19 ?  5    VAL A HG23 2  
ATOM   9468   N N    . SER A 1 13  ? 0.327   -1.781  -30.547 0.02 20.60 ?  6    SER A N    2  
ATOM   9469   C CA   . SER A 1 13  ? -0.829  -2.533  -31.013 0.02 21.09 ?  6    SER A CA   2  
ATOM   9470   C C    . SER A 1 13  ? -0.457  -3.479  -32.154 0.02 21.25 ?  6    SER A C    2  
ATOM   9471   O O    . SER A 1 13  ? 0.497   -3.251  -32.904 0.02 21.00 ?  6    SER A O    2  
ATOM   9472   C CB   . SER A 1 13  ? -1.921  -1.585  -31.490 0.02 21.33 ?  6    SER A CB   2  
ATOM   9473   O OG   . SER A 1 13  ? -1.529  -0.920  -32.692 0.02 21.29 ?  6    SER A OG   2  
ATOM   9474   H H    . SER A 1 13  ? 0.382   -0.985  -30.867 0.02 20.50 ?  6    SER A H    2  
ATOM   9475   H HA   . SER A 1 13  ? -1.168  -3.048  -30.275 0.02 21.21 ?  6    SER A HA   2  
ATOM   9476   H HB2  . SER A 1 13  ? -2.723  -2.101  -31.663 0.02 21.67 ?  6    SER A HB2  2  
ATOM   9477   H HB3  . SER A 1 13  ? -2.096  -0.927  -30.802 0.02 21.20 ?  6    SER A HB3  2  
ATOM   9478   H HG   . SER A 1 13  ? -0.821  -0.490  -32.563 0.02 21.01 ?  6    SER A HG   2  
ATOM   9479   N N    . LEU A 1 14  ? -1.233  -4.555  -32.295 0.02 21.73 ?  7    LEU A N    2  
ATOM   9480   C CA   . LEU A 1 14  ? -0.994  -5.458  -33.419 0.02 21.96 ?  7    LEU A CA   2  
ATOM   9481   C C    . LEU A 1 14  ? -1.011  -4.703  -34.749 0.02 21.96 ?  7    LEU A C    2  
ATOM   9482   O O    . LEU A 1 14  ? -0.167  -4.960  -35.614 0.02 21.84 ?  7    LEU A O    2  
ATOM   9483   C CB   . LEU A 1 14  ? -2.002  -6.616  -33.427 0.02 22.52 ?  7    LEU A CB   2  
ATOM   9484   C CG   . LEU A 1 14  ? -1.624  -7.762  -34.390 0.02 22.80 ?  7    LEU A CG   2  
ATOM   9485   C CD1  . LEU A 1 14  ? -0.731  -8.810  -33.692 0.02 22.64 ?  7    LEU A CD1  2  
ATOM   9486   C CD2  . LEU A 1 14  ? -2.850  -8.416  -35.041 0.02 23.42 ?  7    LEU A CD2  2  
ATOM   9487   H H    . LEU A 1 14  ? -1.874  -4.782  -31.770 0.02 21.93 ?  7    LEU A H    2  
ATOM   9488   H HA   . LEU A 1 14  ? -0.109  -5.840  -33.317 0.02 21.77 ?  7    LEU A HA   2  
ATOM   9489   H HB2  . LEU A 1 14  ? -2.060  -6.986  -32.532 0.02 22.53 ?  7    LEU A HB2  2  
ATOM   9490   H HB3  . LEU A 1 14  ? -2.872  -6.282  -33.698 0.02 22.73 ?  7    LEU A HB3  2  
ATOM   9491   H HG   . LEU A 1 14  ? -1.103  -7.383  -35.112 0.02 22.72 ?  7    LEU A HG   2  
ATOM   9492   H HD11 . LEU A 1 14  ? 0.175   -8.466  -33.650 0.02 22.32 ?  7    LEU A HD11 2  
ATOM   9493   H HD12 . LEU A 1 14  ? -1.062  -8.972  -32.795 0.02 22.58 ?  7    LEU A HD12 2  
ATOM   9494   H HD13 . LEU A 1 14  ? -0.746  -9.634  -34.206 0.02 22.94 ?  7    LEU A HD13 2  
ATOM   9495   H HD21 . LEU A 1 14  ? -2.590  -9.268  -35.426 0.02 23.60 ?  7    LEU A HD21 2  
ATOM   9496   H HD22 . LEU A 1 14  ? -3.531  -8.555  -34.365 0.02 23.55 ?  7    LEU A HD22 2  
ATOM   9497   H HD23 . LEU A 1 14  ? -3.191  -7.832  -35.737 0.02 23.53 ?  7    LEU A HD23 2  
ATOM   9498   N N    . MET A 1 15  ? -1.945  -3.756  -34.939 0.02 22.14 ?  8    MET A N    2  
ATOM   9499   C CA   . MET A 1 15  ? -1.904  -2.932  -36.153 0.02 22.18 ?  8    MET A CA   2  
ATOM   9500   C C    . MET A 1 15  ? -0.502  -2.371  -36.375 0.02 21.68 ?  8    MET A C    2  
ATOM   9501   O O    . MET A 1 15  ? 0.064   -2.500  -37.469 0.02 21.68 ?  8    MET A O    2  
ATOM   9502   C CB   . MET A 1 15  ? -2.892  -1.765  -36.079 0.02 22.36 ?  8    MET A CB   2  
ATOM   9503   C CG   . MET A 1 15  ? -4.204  -1.876  -36.868 0.02 22.93 ?  8    MET A CG   2  
ATOM   9504   S SD   . MET A 1 15  ? -4.384  -1.121  -38.541 0.02 23.37 ?  8    MET A SD   2  
ATOM   9505   C CE   . MET A 1 15  ? -3.678  0.494   -38.315 0.02 23.33 ?  8    MET A CE   2  
ATOM   9506   H H    . MET A 1 15  ? -2.592  -3.579  -34.403 0.02 22.26 ?  8    MET A H    2  
ATOM   9507   H HA   . MET A 1 15  ? -2.146  -3.481  -36.914 0.02 22.43 ?  8    MET A HA   2  
ATOM   9508   H HB2  . MET A 1 15  ? -3.140  -1.646  -35.147 0.02 22.16 ?  8    MET A HB2  2  
ATOM   9509   H HB3  . MET A 1 15  ? -2.435  -0.970  -36.392 0.02 22.33 ?  8    MET A HB3  2  
ATOM   9510   H HG2  . MET A 1 15  ? -4.406  -2.817  -36.959 0.02 23.00 ?  8    MET A HG2  2  
ATOM   9511   H HG3  . MET A 1 15  ? -4.889  -1.464  -36.319 0.02 23.04 ?  8    MET A HG3  2  
ATOM   9512   H HE1  . MET A 1 15  ? -4.231  1.156   -38.756 0.02 23.30 ?  8    MET A HE1  2  
ATOM   9513   H HE2  . MET A 1 15  ? -3.630  0.681   -37.365 0.02 23.02 ?  8    MET A HE2  2  
ATOM   9514   H HE3  . MET A 1 15  ? -2.786  0.500   -38.697 0.02 23.68 ?  8    MET A HE3  2  
ATOM   9515   N N    . GLU A 1 16  ? 0.063   -1.722  -35.356 0.02 21.28 ?  9    GLU A N    2  
ATOM   9516   C CA   . GLU A 1 16  ? 1.384   -1.122  -35.520 0.02 20.84 ?  9    GLU A CA   2  
ATOM   9517   C C    . GLU A 1 16  ? 2.467   -2.185  -35.621 0.02 20.68 ?  9    GLU A C    2  
ATOM   9518   O O    . GLU A 1 16  ? 3.469   -1.981  -36.316 0.02 20.46 ?  9    GLU A O    2  
ATOM   9519   C CB   . GLU A 1 16  ? 1.720   -0.158  -34.372 0.02 20.49 ?  9    GLU A CB   2  
ATOM   9520   C CG   . GLU A 1 16  ? 1.115   1.260   -34.411 0.02 20.62 ?  9    GLU A CG   2  
ATOM   9521   C CD   . GLU A 1 16  ? 1.196   1.977   -35.742 0.02 20.56 ?  9    GLU A CD   2  
ATOM   9522   O OE1  . GLU A 1 16  ? 0.233   1.862   -36.515 0.02 20.60 ?  9    GLU A OE1  2  
ATOM   9523   O OE2  . GLU A 1 16  ? 2.182   2.695   -36.001 0.02 20.50 -1 9    GLU A OE2  2  
ATOM   9524   H H    . GLU A 1 16  ? -0.286  -1.617  -34.579 0.02 21.28 ?  9    GLU A H    2  
ATOM   9525   H HA   . GLU A 1 16  ? 1.387   -0.616  -36.349 0.02 20.88 ?  9    GLU A HA   2  
ATOM   9526   H HB2  . GLU A 1 16  ? 1.425   -0.566  -33.544 0.02 20.48 ?  9    GLU A HB2  2  
ATOM   9527   H HB3  . GLU A 1 16  ? 2.682   -0.049  -34.346 0.02 20.22 ?  9    GLU A HB3  2  
ATOM   9528   H HG2  . GLU A 1 16  ? 0.183   1.220   -34.148 0.02 20.93 ?  9    GLU A HG2  2  
ATOM   9529   H HG3  . GLU A 1 16  ? 1.609   1.799   -33.785 0.02 20.45 ?  9    GLU A HG3  2  
ATOM   9530   N N    . LYS A 1 17  ? 2.304   -3.318  -34.941 0.02 20.83 ?  10   LYS A N    2  
ATOM   9531   C CA   . LYS A 1 17  ? 3.306   -4.373  -35.054 0.02 20.73 ?  10   LYS A CA   2  
ATOM   9532   C C    . LYS A 1 17  ? 3.367   -4.905  -36.475 0.02 20.99 ?  10   LYS A C    2  
ATOM   9533   O O    . LYS A 1 17  ? 4.454   -5.058  -37.043 0.02 20.82 ?  10   LYS A O    2  
ATOM   9534   C CB   . LYS A 1 17  ? 3.010   -5.517  -34.089 0.02 20.88 ?  10   LYS A CB   2  
ATOM   9535   C CG   . LYS A 1 17  ? 3.256   -5.241  -32.616 0.02 20.56 ?  10   LYS A CG   2  
ATOM   9536   C CD   . LYS A 1 17  ? 2.492   -6.238  -31.726 0.02 20.83 ?  10   LYS A CD   2  
ATOM   9537   C CE   . LYS A 1 17  ? 2.904   -7.709  -31.971 0.02 21.14 ?  10   LYS A CE   2  
ATOM   9538   N NZ   . LYS A 1 17  ? 1.876   -8.746  -31.577 0.02 21.59 ?  10   LYS A NZ   2  
ATOM   9539   H H    . LYS A 1 17  ? 1.643   -3.498  -34.424 0.02 21.00 ?  10   LYS A H    2  
ATOM   9540   H HA   . LYS A 1 17  ? 4.174   -4.007  -34.827 0.02 20.41 ?  10   LYS A HA   2  
ATOM   9541   H HB2  . LYS A 1 17  ? 2.078   -5.769  -34.189 0.02 21.17 ?  10   LYS A HB2  2  
ATOM   9542   H HB3  . LYS A 1 17  ? 3.574   -6.265  -34.336 0.02 20.95 ?  10   LYS A HB3  2  
ATOM   9543   H HG2  . LYS A 1 17  ? 4.204   -5.320  -32.422 0.02 20.33 ?  10   LYS A HG2  2  
ATOM   9544   H HG3  . LYS A 1 17  ? 2.943   -4.352  -32.410 0.02 20.44 ?  10   LYS A HG3  2  
ATOM   9545   H HD2  . LYS A 1 17  ? 2.679   -6.038  -30.796 0.02 20.63 ?  10   LYS A HD2  2  
ATOM   9546   H HD3  . LYS A 1 17  ? 1.543   -6.150  -31.896 0.02 21.04 ?  10   LYS A HD3  2  
ATOM   9547   H HE2  . LYS A 1 17  ? 3.099   -7.837  -32.912 0.02 20.97 ?  10   LYS A HE2  2  
ATOM   9548   H HE3  . LYS A 1 17  ? 3.703   -7.885  -31.448 0.02 21.23 ?  10   LYS A HE3  2  
ATOM   9549   H HZ1  . LYS A 1 17  ? 1.822   -9.373  -32.208 0.02 21.85 ?  10   LYS A HZ1  2  
ATOM   9550   H HZ2  . LYS A 1 17  ? 2.108   -9.132  -30.808 0.02 21.62 ?  10   LYS A HZ2  2  
ATOM   9551   H HZ3  . LYS A 1 17  ? 1.076   -8.366  -31.482 0.02 21.59 ?  10   LYS A HZ3  2  
ATOM   9552   N N    . LEU A 1 18  ? 2.208   -5.223  -37.055 0.02 21.43 ?  11   LEU A N    2  
ATOM   9553   C CA   . LEU A 1 18  ? 2.162   -5.714  -38.426 0.02 21.73 ?  11   LEU A CA   2  
ATOM   9554   C C    . LEU A 1 18  ? 2.736   -4.681  -39.395 0.02 21.56 ?  11   LEU A C    2  
ATOM   9555   O O    . LEU A 1 18  ? 3.518   -5.022  -40.290 0.02 21.61 ?  11   LEU A O    2  
ATOM   9556   C CB   . LEU A 1 18  ? 0.723   -6.079  -38.777 0.02 22.28 ?  11   LEU A CB   2  
ATOM   9557   C CG   . LEU A 1 18  ? 0.148   -7.444  -38.346 0.02 22.65 ?  11   LEU A CG   2  
ATOM   9558   C CD1  . LEU A 1 18  ? 0.673   -8.022  -37.038 0.02 22.42 ?  11   LEU A CD1  2  
ATOM   9559   C CD2  . LEU A 1 18  ? -1.372  -7.323  -38.280 0.02 23.11 ?  11   LEU A CD2  2  
ATOM   9560   H H    . LEU A 1 18  ? 1.442   -5.163  -36.676 0.02 21.57 ?  11   LEU A H    2  
ATOM   9561   H HA   . LEU A 1 18  ? 2.694   -6.522  -38.497 0.02 21.73 ?  11   LEU A HA   2  
ATOM   9562   H HB2  . LEU A 1 18  ? 0.150   -5.404  -38.383 0.02 22.27 ?  11   LEU A HB2  2  
ATOM   9563   H HB3  . LEU A 1 18  ? 0.637   -6.039  -39.743 0.02 22.46 ?  11   LEU A HB3  2  
ATOM   9564   H HG   . LEU A 1 18  ? 0.355   -8.091  -39.038 0.02 22.82 ?  11   LEU A HG   2  
ATOM   9565   H HD11 . LEU A 1 18  ? 1.564   -8.378  -37.190 0.02 22.18 ?  11   LEU A HD11 2  
ATOM   9566   H HD12 . LEU A 1 18  ? 0.706   -7.323  -36.364 0.02 22.24 ?  11   LEU A HD12 2  
ATOM   9567   H HD13 . LEU A 1 18  ? 0.081   -8.735  -36.749 0.02 22.72 ?  11   LEU A HD13 2  
ATOM   9568   H HD21 . LEU A 1 18  ? -1.746  -8.168  -37.980 0.02 23.37 ?  11   LEU A HD21 2  
ATOM   9569   H HD22 . LEU A 1 18  ? -1.604  -6.618  -37.657 0.02 22.96 ?  11   LEU A HD22 2  
ATOM   9570   H HD23 . LEU A 1 18  ? -1.707  -7.105  -39.163 0.02 23.31 ?  11   LEU A HD23 2  
ATOM   9571   N N    . LYS A 1 19  ? 2.382   -3.405  -39.224 0.02 21.41 ?  12   LYS A N    2  
ATOM   9572   C CA   . LYS A 1 19  ? 2.978   -2.372  -40.066 0.02 21.27 ?  12   LYS A CA   2  
ATOM   9573   C C    . LYS A 1 19  ? 4.495   -2.353  -39.920 0.02 20.83 ?  12   LYS A C    2  
ATOM   9574   O O    . LYS A 1 19  ? 5.217   -2.115  -40.891 0.02 20.79 ?  12   LYS A O    2  
ATOM   9575   C CB   . LYS A 1 19  ? 2.407   -1.002  -39.714 0.02 21.22 ?  12   LYS A CB   2  
ATOM   9576   C CG   . LYS A 1 19  ? 1.007   -0.770  -40.253 0.02 21.70 ?  12   LYS A CG   2  
ATOM   9577   C CD   . LYS A 1 19  ? 0.434   0.533   -39.760 0.02 21.72 ?  12   LYS A CD   2  
ATOM   9578   C CE   . LYS A 1 19  ? 1.088   1.760   -40.368 0.02 21.32 ?  12   LYS A CE   2  
ATOM   9579   N NZ   . LYS A 1 19  ? 0.098   2.900   -40.528 0.02 21.42 ?  12   LYS A NZ   2  
ATOM   9580   H H    . LYS A 1 19  ? 1.817   -3.118  -38.646 0.02 21.39 ?  12   LYS A H    2  
ATOM   9581   H HA   . LYS A 1 19  ? 2.765   -2.556  -40.994 0.02 21.53 ?  12   LYS A HA   2  
ATOM   9582   H HB2  . LYS A 1 19  ? 2.377   -0.924  -38.749 0.02 21.13 ?  12   LYS A HB2  2  
ATOM   9583   H HB3  . LYS A 1 19  ? 2.984   -0.319  -40.085 0.02 21.00 ?  12   LYS A HB3  2  
ATOM   9584   H HG2  . LYS A 1 19  ? 1.029   -0.744  -41.223 0.02 21.75 ?  12   LYS A HG2  2  
ATOM   9585   H HG3  . LYS A 1 19  ? 0.430   -1.490  -39.952 0.02 21.97 ?  12   LYS A HG3  2  
ATOM   9586   H HD2  . LYS A 1 19  ? -0.513  0.563   -39.973 0.02 22.03 ?  12   LYS A HD2  2  
ATOM   9587   H HD3  . LYS A 1 19  ? 0.558   0.579   -38.800 0.02 21.74 ?  12   LYS A HD3  2  
ATOM   9588   H HE2  . LYS A 1 19  ? 1.802   2.058   -39.782 0.02 21.02 ?  12   LYS A HE2  2  
ATOM   9589   H HE3  . LYS A 1 19  ? 1.442   1.539   -41.243 0.02 21.32 ?  12   LYS A HE3  2  
ATOM   9590   H HZ1  . LYS A 1 19  ? -0.654  2.605   -40.903 0.02 21.62 ?  12   LYS A HZ1  2  
ATOM   9591   H HZ2  . LYS A 1 19  ? -0.096  3.244   -39.730 0.02 21.17 ?  12   LYS A HZ2  2  
ATOM   9592   H HZ3  . LYS A 1 19  ? 0.444   3.539   -41.044 0.02 21.57 ?  12   LYS A HZ3  2  
ATOM   9593   N N    . TRP A 1 20  ? 4.996   -2.594  -38.709 0.02 20.53 ?  13   TRP A N    2  
ATOM   9594   C CA   . TRP A 1 20  ? 6.430   -2.525  -38.475 0.02 20.14 ?  13   TRP A CA   2  
ATOM   9595   C C    . TRP A 1 20  ? 7.180   -3.561  -39.293 0.02 20.26 ?  13   TRP A C    2  
ATOM   9596   O O    . TRP A 1 20  ? 8.278   -3.290  -39.790 0.02 20.13 ?  13   TRP A O    2  
ATOM   9597   C CB   . TRP A 1 20  ? 6.723   -2.726  -36.998 0.02 19.87 ?  13   TRP A CB   2  
ATOM   9598   C CG   . TRP A 1 20  ? 8.175   -2.711  -36.723 0.02 19.47 ?  13   TRP A CG   2  
ATOM   9599   C CD1  . TRP A 1 20  ? 8.982   -3.779  -36.547 0.02 19.38 ?  13   TRP A CD1  2  
ATOM   9600   C CD2  . TRP A 1 20  ? 8.993   -1.555  -36.609 0.02 19.16 ?  13   TRP A CD2  2  
ATOM   9601   N NE1  . TRP A 1 20  ? 10.269  -3.362  -36.304 0.02 19.02 ?  13   TRP A NE1  2  
ATOM   9602   C CE2  . TRP A 1 20  ? 10.297  -1.990  -36.357 0.02 18.89 ?  13   TRP A CE2  2  
ATOM   9603   C CE3  . TRP A 1 20  ? 8.751   -0.185  -36.707 0.02 19.11 ?  13   TRP A CE3  2  
ATOM   9604   C CZ2  . TRP A 1 20  ? 11.351  -1.103  -36.185 0.02 18.58 ?  13   TRP A CZ2  2  
ATOM   9605   C CZ3  . TRP A 1 20  ? 9.787   0.682   -36.538 0.02 18.81 ?  13   TRP A CZ3  2  
ATOM   9606   C CH2  . TRP A 1 20  ? 11.078  0.224   -36.276 0.02 18.55 ?  13   TRP A CH2  2  
ATOM   9607   H H    . TRP A 1 20  ? 4.534   -2.796  -38.015 0.02 20.57 ?  13   TRP A H    2  
ATOM   9608   H HA   . TRP A 1 20  ? 6.748   -1.644  -38.722 0.02 20.00 ?  13   TRP A HA   2  
ATOM   9609   H HB2  . TRP A 1 20  ? 6.309   -2.010  -36.498 0.02 19.82 ?  13   TRP A HB2  2  
ATOM   9610   H HB3  . TRP A 1 20  ? 6.366   -3.582  -36.715 0.02 20.02 ?  13   TRP A HB3  2  
ATOM   9611   H HD1  . TRP A 1 20  ? 8.701   -4.665  -36.565 0.02 19.54 ?  13   TRP A HD1  2  
ATOM   9612   H HE1  . TRP A 1 20  ? 10.946  -3.872  -36.167 0.02 18.93 ?  13   TRP A HE1  2  
ATOM   9613   H HE3  . TRP A 1 20  ? 7.893   0.132   -36.877 0.02 19.30 ?  13   TRP A HE3  2  
ATOM   9614   H HZ2  . TRP A 1 20  ? 12.212  -1.408  -36.012 0.02 18.42 ?  13   TRP A HZ2  2  
ATOM   9615   H HZ3  . TRP A 1 20  ? 9.632   1.597   -36.597 0.02 18.79 ?  13   TRP A HZ3  2  
ATOM   9616   H HH2  . TRP A 1 20  ? 11.765  0.838   -36.169 0.02 18.36 ?  13   TRP A HH2  2  
ATOM   9617   N N    . LYS A 1 21  ? 6.603   -4.757  -39.447 0.02 20.51 ?  14   LYS A N    2  
ATOM   9618   C CA   . LYS A 1 21  ? 7.317   -5.825  -40.134 0.02 20.69 ?  14   LYS A CA   2  
ATOM   9619   C C    . LYS A 1 21  ? 7.169   -5.687  -41.638 0.02 20.91 ?  14   LYS A C    2  
ATOM   9620   O O    . LYS A 1 21  ? 8.015   -6.159  -42.412 0.02 20.89 ?  14   LYS A O    2  
ATOM   9621   C CB   . LYS A 1 21  ? 6.812   -7.180  -39.645 0.02 21.06 ?  14   LYS A CB   2  
ATOM   9622   C CG   . LYS A 1 21  ? 7.605   -7.677  -38.460 0.02 20.92 ?  14   LYS A CG   2  
ATOM   9623   C CD   . LYS A 1 21  ? 6.788   -8.505  -37.522 0.02 21.37 ?  14   LYS A CD   2  
ATOM   9624   C CE   . LYS A 1 21  ? 6.288   -9.787  -38.113 0.02 21.57 ?  14   LYS A CE   2  
ATOM   9625   N NZ   . LYS A 1 21  ? 6.099   -10.731 -36.989 0.02 22.01 ?  14   LYS A NZ   2  
ATOM   9626   H H    . LYS A 1 21  ? 5.816   -4.968  -39.180 0.02 20.61 ?  14   LYS A H    2  
ATOM   9627   H HA   . LYS A 1 21  ? 8.260   -5.763  -39.922 0.02 20.46 ?  14   LYS A HA   2  
ATOM   9628   H HB2  . LYS A 1 21  ? 5.884   -7.095  -39.376 0.02 21.29 ?  14   LYS A HB2  2  
ATOM   9629   H HB3  . LYS A 1 21  ? 6.894   -7.828  -40.363 0.02 21.20 ?  14   LYS A HB3  2  
ATOM   9630   H HG2  . LYS A 1 21  ? 8.346   -8.219  -38.775 0.02 20.71 ?  14   LYS A HG2  2  
ATOM   9631   H HG3  . LYS A 1 21  ? 7.936   -6.917  -37.957 0.02 20.79 ?  14   LYS A HG3  2  
ATOM   9632   H HD2  . LYS A 1 21  ? 7.324   -8.715  -36.740 0.02 21.31 ?  14   LYS A HD2  2  
ATOM   9633   H HD3  . LYS A 1 21  ? 6.002   -7.999  -37.269 0.02 21.62 ?  14   LYS A HD3  2  
ATOM   9634   H HE2  . LYS A 1 21  ? 5.435   -9.640  -38.550 0.02 21.68 ?  14   LYS A HE2  2  
ATOM   9635   H HE3  . LYS A 1 21  ? 6.943   -10.145 -38.732 0.02 21.32 ?  14   LYS A HE3  2  
ATOM   9636   H HZ1  . LYS A 1 21  ? 5.343   -10.540 -36.560 0.02 22.28 ?  14   LYS A HZ1  2  
ATOM   9637   H HZ2  . LYS A 1 21  ? 6.058   -11.566 -37.296 0.02 22.12 ?  14   LYS A HZ2  2  
ATOM   9638   H HZ3  . LYS A 1 21  ? 6.779   -10.667 -36.419 0.02 21.94 ?  14   LYS A HZ3  2  
ATOM   9639   N N    . ILE A 1 22  ? 6.103   -5.038  -42.081 0.02 21.17 ?  15   ILE A N    2  
ATOM   9640   C CA   . ILE A 1 22  ? 6.079   -4.585  -43.463 0.02 21.41 ?  15   ILE A CA   2  
ATOM   9641   C C    . ILE A 1 22  ? 7.139   -3.505  -43.679 0.02 21.07 ?  15   ILE A C    2  
ATOM   9642   O O    . ILE A 1 22  ? 7.637   -3.317  -44.802 0.02 21.12 ?  15   ILE A O    2  
ATOM   9643   C CB   . ILE A 1 22  ? 4.672   -4.100  -43.847 0.02 21.71 ?  15   ILE A CB   2  
ATOM   9644   C CG1  . ILE A 1 22  ? 3.640   -5.181  -43.480 0.02 22.13 ?  15   ILE A CG1  2  
ATOM   9645   C CG2  . ILE A 1 22  ? 4.647   -3.740  -45.324 0.02 21.94 ?  15   ILE A CG2  2  
ATOM   9646   C CD1  . ILE A 1 22  ? 2.570   -5.471  -44.508 0.02 22.63 ?  15   ILE A CD1  2  
ATOM   9647   H H    . ILE A 1 22  ? 5.401   -4.858  -41.618 0.02 21.23 ?  15   ILE A H    2  
ATOM   9648   H HA   . ILE A 1 22  ? 6.299   -5.334  -44.036 0.02 21.64 ?  15   ILE A HA   2  
ATOM   9649   H HB   . ILE A 1 22  ? 4.474   -3.301  -43.333 0.02 21.50 ?  15   ILE A HB   2  
ATOM   9650   H HG12 . ILE A 1 22  ? 4.114   -6.013  -43.321 0.02 22.02 ?  15   ILE A HG12 2  
ATOM   9651   H HG13 . ILE A 1 22  ? 3.186   -4.908  -42.665 0.02 22.23 ?  15   ILE A HG13 2  
ATOM   9652   H HG21 . ILE A 1 22  ? 5.299   -3.045  -45.496 0.02 21.70 ?  15   ILE A HG21 2  
ATOM   9653   H HG22 . ILE A 1 22  ? 4.864   -4.530  -45.844 0.02 22.09 ?  15   ILE A HG22 2  
ATOM   9654   H HG23 . ILE A 1 22  ? 3.766   -3.414  -45.560 0.02 22.20 ?  15   ILE A HG23 2  
ATOM   9655   H HD11 . ILE A 1 22  ? 1.967   -6.142  -44.152 0.02 22.87 ?  15   ILE A HD11 2  
ATOM   9656   H HD12 . ILE A 1 22  ? 2.079   -4.658  -44.698 0.02 22.79 ?  15   ILE A HD12 2  
ATOM   9657   H HD13 . ILE A 1 22  ? 2.990   -5.805  -45.316 0.02 22.55 ?  15   ILE A HD13 2  
ATOM   9658   N N    . LYS A 1 23  ? 7.525   -2.805  -42.605 0.02 20.74 ?  16   LYS A N    2  
ATOM   9659   C CA   . LYS A 1 23  ? 8.563   -1.785  -42.698 0.02 20.46 ?  16   LYS A CA   2  
ATOM   9660   C C    . LYS A 1 23  ? 9.970   -2.356  -42.546 0.02 20.20 ?  16   LYS A C    2  
ATOM   9661   O O    . LYS A 1 23  ? 10.900  -1.824  -43.159 0.02 20.11 ?  16   LYS A O    2  
ATOM   9662   C CB   . LYS A 1 23  ? 8.317   -0.699  -41.651 0.02 20.20 ?  16   LYS A CB   2  
ATOM   9663   C CG   . LYS A 1 23  ? 7.256   0.348   -42.031 0.02 20.39 ?  16   LYS A CG   2  
ATOM   9664   C CD   . LYS A 1 23  ? 6.180   -0.161  -42.983 0.02 20.90 ?  16   LYS A CD   2  
ATOM   9665   C CE   . LYS A 1 23  ? 5.598   1.002   -43.793 0.02 21.12 ?  16   LYS A CE   2  
ATOM   9666   N NZ   . LYS A 1 23  ? 5.437   0.709   -45.257 0.02 21.59 ?  16   LYS A NZ   2  
ATOM   9667   H H    . LYS A 1 23  ? 7.206   -2.905  -41.815 0.02 20.69 ?  16   LYS A H    2  
ATOM   9668   H HA   . LYS A 1 23  ? 8.523   -1.372  -43.572 0.02 20.66 ?  16   LYS A HA   2  
ATOM   9669   H HB2  . LYS A 1 23  ? 8.029   -1.119  -40.825 0.02 20.22 ?  16   LYS A HB2  2  
ATOM   9670   H HB3  . LYS A 1 23  ? 9.148   -0.219  -41.507 0.02 19.92 ?  16   LYS A HB3  2  
ATOM   9671   H HG2  . LYS A 1 23  ? 6.813   0.648   -41.224 0.02 20.28 ?  16   LYS A HG2  2  
ATOM   9672   H HG3  . LYS A 1 23  ? 7.706   1.096   -42.451 0.02 20.32 ?  16   LYS A HG3  2  
ATOM   9673   H HD2  . LYS A 1 23  ? 6.519   -0.799  -43.622 0.02 21.03 ?  16   LYS A HD2  2  
ATOM   9674   H HD3  . LYS A 1 23  ? 5.470   -0.554  -42.460 0.02 21.00 ?  16   LYS A HD3  2  
ATOM   9675   H HE2  . LYS A 1 23  ? 4.720   1.219   -43.440 0.02 21.17 ?  16   LYS A HE2  2  
ATOM   9676   H HE3  . LYS A 1 23  ? 6.184   1.773   -43.718 0.02 20.91 ?  16   LYS A HE3  2  
ATOM   9677   H HZ1  . LYS A 1 23  ? 5.435   1.469   -45.720 0.02 21.62 ?  16   LYS A HZ1  2  
ATOM   9678   H HZ2  . LYS A 1 23  ? 6.112   0.202   -45.539 0.02 21.62 ?  16   LYS A HZ2  2  
ATOM   9679   H HZ3  . LYS A 1 23  ? 4.673   0.271   -45.404 0.02 21.83 ?  16   LYS A HZ3  2  
ATOM   9680   N N    . CYS A 1 24  ? 10.157  -3.414  -41.747 0.02 20.10 ?  17   CYS A N    2  
ATOM   9681   C CA   . CYS A 1 24  ? 11.489  -4.005  -41.625 0.02 19.93 ?  17   CYS A CA   2  
ATOM   9682   C C    . CYS A 1 24  ? 11.857  -4.800  -42.876 0.02 20.21 ?  17   CYS A C    2  
ATOM   9683   O O    . CYS A 1 24  ? 13.046  -4.918  -43.215 0.02 20.09 ?  17   CYS A O    2  
ATOM   9684   C CB   . CYS A 1 24  ? 11.587  -4.878  -40.359 0.02 19.88 ?  17   CYS A CB   2  
ATOM   9685   S SG   . CYS A 1 24  ? 11.426  -3.993  -38.751 0.02 19.55 ?  17   CYS A SG   2  
ATOM   9686   H H    . CYS A 1 24  ? 9.546   -3.801  -41.283 0.02 20.15 ?  17   CYS A H    2  
ATOM   9687   H HA   . CYS A 1 24  ? 12.139  -3.295  -41.538 0.02 19.67 ?  17   CYS A HA   2  
ATOM   9688   H HB2  . CYS A 1 24  ? 10.885  -5.546  -40.392 0.02 20.14 ?  17   CYS A HB2  2  
ATOM   9689   H HB3  . CYS A 1 24  ? 12.454  -5.315  -40.351 0.02 19.79 ?  17   CYS A HB3  2  
ATOM   9690   H HG   . CYS A 1 24  ? 10.363  -3.441  -38.779 0.02 19.58 ?  17   CYS A HG   2  
ATOM   9691   N N    . ILE A 1 25  ? 10.861  -5.335  -43.588 0.02 20.63 ?  18   ILE A N    2  
ATOM   9692   C CA   . ILE A 1 25  ? 11.131  -6.047  -44.839 0.02 20.95 ?  18   ILE A CA   2  
ATOM   9693   C C    . ILE A 1 25  ? 11.443  -5.055  -45.943 0.02 21.03 ?  18   ILE A C    2  
ATOM   9694   O O    . ILE A 1 25  ? 12.207  -5.352  -46.871 0.02 21.08 ?  18   ILE A O    2  
ATOM   9695   C CB   . ILE A 1 25  ? 9.940   -6.944  -45.229 0.02 21.42 ?  18   ILE A CB   2  
ATOM   9696   C CG1  . ILE A 1 25  ? 9.682   -8.000  -44.166 0.02 21.39 ?  18   ILE A CG1  2  
ATOM   9697   C CG2  . ILE A 1 25  ? 10.235  -7.645  -46.568 0.02 21.81 ?  18   ILE A CG2  2  
ATOM   9698   C CD1  . ILE A 1 25  ? 8.439   -8.815  -44.391 0.02 21.84 ?  18   ILE A CD1  2  
ATOM   9699   H H    . ILE A 1 25  ? 10.028  -5.298  -43.375 0.02 20.75 ?  18   ILE A H    2  
ATOM   9700   H HA   . ILE A 1 25  ? 11.904  -6.621  -44.725 0.02 20.85 ?  18   ILE A HA   2  
ATOM   9701   H HB   . ILE A 1 25  ? 9.151   -6.390  -45.325 0.02 21.52 ?  18   ILE A HB   2  
ATOM   9702   H HG12 . ILE A 1 25  ? 10.432  -8.613  -44.156 0.02 21.38 ?  18   ILE A HG12 2  
ATOM   9703   H HG13 . ILE A 1 25  ? 9.601   -7.570  -43.303 0.02 21.12 ?  18   ILE A HG13 2  
ATOM   9704   H HG21 . ILE A 1 25  ? 10.041  -7.031  -47.291 0.02 21.86 ?  18   ILE A HG21 2  
ATOM   9705   H HG22 . ILE A 1 25  ? 11.169  -7.897  -46.592 0.02 21.73 ?  18   ILE A HG22 2  
ATOM   9706   H HG23 . ILE A 1 25  ? 9.680   -8.432  -46.655 0.02 22.12 ?  18   ILE A HG23 2  
ATOM   9707   H HD11 . ILE A 1 25  ? 7.819   -8.641  -43.665 0.02 21.96 ?  18   ILE A HD11 2  
ATOM   9708   H HD12 . ILE A 1 25  ? 8.033   -8.564  -45.236 0.02 22.10 ?  18   ILE A HD12 2  
ATOM   9709   H HD13 . ILE A 1 25  ? 8.673   -9.757  -44.402 0.02 21.76 ?  18   ILE A HD13 2  
ATOM   9710   N N    . GLU A 1 26  ? 10.828  -3.872  -45.870 0.02 21.07 ?  19   GLU A N    2  
ATOM   9711   C CA   . GLU A 1 26  ? 11.115  -2.781  -46.796 0.02 21.23 ?  19   GLU A CA   2  
ATOM   9712   C C    . GLU A 1 26  ? 12.521  -2.221  -46.581 0.02 20.87 ?  19   GLU A C    2  
ATOM   9713   O O    . GLU A 1 26  ? 13.215  -1.859  -47.538 0.02 20.99 ?  19   GLU A O    2  
ATOM   9714   C CB   . GLU A 1 26  ? 10.055  -1.700  -46.600 0.02 21.45 ?  19   GLU A CB   2  
ATOM   9715   C CG   . GLU A 1 26  ? 10.295  -0.371  -47.256 0.02 21.22 ?  19   GLU A CG   2  
ATOM   9716   C CD   . GLU A 1 26  ? 9.861   -0.348  -48.695 0.02 21.37 ?  19   GLU A CD   2  
ATOM   9717   O OE1  . GLU A 1 26  ? 10.377  0.549   -49.439 0.02 21.10 ?  19   GLU A OE1  2  
ATOM   9718   O OE2  . GLU A 1 26  ? 9.033   -1.234  -49.074 0.02 21.79 -1 19   GLU A OE2  2  
ATOM   9719   H H    . GLU A 1 26  ? 10.232  -3.676  -45.283 0.02 21.01 ?  19   GLU A H    2  
ATOM   9720   H HA   . GLU A 1 26  ? 11.048  -3.105  -47.706 0.02 21.49 ?  19   GLU A HA   2  
ATOM   9721   H HB2  . GLU A 1 26  ? 9.210   -2.038  -46.938 0.02 21.77 ?  19   GLU A HB2  2  
ATOM   9722   H HB3  . GLU A 1 26  ? 9.972   -1.534  -45.646 0.02 21.50 ?  19   GLU A HB3  2  
ATOM   9723   H HG2  . GLU A 1 26  ? 9.778   0.303   -46.786 0.02 21.32 ?  19   GLU A HG2  2  
ATOM   9724   H HG3  . GLU A 1 26  ? 11.235  -0.142  -47.226 0.02 20.89 ?  19   GLU A HG3  2  
ATOM   9725   N N    . ASN A 1 27  ? 12.956  -2.106  -45.332 0.02 20.46 ?  20   ASN A N    2  
ATOM   9726   C CA   . ASN A 1 27  ? 14.317  -1.647  -45.131 0.02 20.14 ?  20   ASN A CA   2  
ATOM   9727   C C    . ASN A 1 27  ? 15.331  -2.634  -45.697 0.02 20.10 ?  20   ASN A C    2  
ATOM   9728   O O    . ASN A 1 27  ? 16.331  -2.225  -46.296 0.02 19.96 ?  20   ASN A O    2  
ATOM   9729   C CB   . ASN A 1 27  ? 14.598  -1.418  -43.661 0.02 19.74 ?  20   ASN A CB   2  
ATOM   9730   C CG   . ASN A 1 27  ? 15.843  -0.619  -43.470 0.02 19.49 ?  20   ASN A CG   2  
ATOM   9731   O OD1  . ASN A 1 27  ? 16.317  0.032   -44.394 0.02 19.61 ?  20   ASN A OD1  2  
ATOM   9732   N ND2  . ASN A 1 27  ? 16.379  -0.672  -42.311 0.02 19.19 ?  20   ASN A ND2  2  
ATOM   9733   H H    . ASN A 1 27  ? 12.509  -2.272  -44.618 0.02 20.38 ?  20   ASN A H    2  
ATOM   9734   H HA   . ASN A 1 27  ? 14.422  -0.801  -45.592 0.02 20.23 ?  20   ASN A HA   2  
ATOM   9735   H HB2  . ASN A 1 27  ? 13.861  -0.931  -43.266 0.02 19.79 ?  20   ASN A HB2  2  
ATOM   9736   H HB3  . ASN A 1 27  ? 14.708  -2.273  -43.216 0.02 19.62 ?  20   ASN A HB3  2  
ATOM   9737   H HD21 . ASN A 1 27  ? 16.911  -0.044  -42.055 0.02 19.02 ?  20   ASN A HD21 2  
ATOM   9738   H HD22 . ASN A 1 27  ? 16.206  -1.334  -41.791 0.02 19.17 ?  20   ASN A HD22 2  
ATOM   9739   N N    . LYS A 1 28  ? 15.124  -3.920  -45.449 0.02 20.22 ?  21   LYS A N    2  
ATOM   9740   C CA   . LYS A 1 28  ? 15.805  -4.975  -46.187 0.02 20.32 ?  21   LYS A CA   2  
ATOM   9741   C C    . LYS A 1 28  ? 15.959  -4.648  -47.670 0.02 20.62 ?  21   LYS A C    2  
ATOM   9742   O O    . LYS A 1 28  ? 17.047  -4.265  -48.127 0.02 20.60 ?  21   LYS A O    2  
ATOM   9743   C CB   . LYS A 1 28  ? 15.005  -6.261  -46.028 0.02 20.55 ?  21   LYS A CB   2  
ATOM   9744   C CG   . LYS A 1 28  ? 15.737  -7.387  -45.392 0.02 20.38 ?  21   LYS A CG   2  
ATOM   9745   C CD   . LYS A 1 28  ? 16.776  -7.900  -46.302 0.02 20.56 ?  21   LYS A CD   2  
ATOM   9746   C CE   . LYS A 1 28  ? 17.377  -9.170  -45.735 0.02 21.00 ?  21   LYS A CE   2  
ATOM   9747   N NZ   . LYS A 1 28  ? 18.856  -9.182  -45.825 0.02 21.21 ?  21   LYS A NZ   2  
ATOM   9748   H H    . LYS A 1 28  ? 14.601  -4.210  -44.834 0.02 20.25 ?  21   LYS A H    2  
ATOM   9749   H HA   . LYS A 1 28  ? 16.686  -5.111  -45.811 0.02 20.08 ?  21   LYS A HA   2  
ATOM   9750   H HB2  . LYS A 1 28  ? 14.231  -6.075  -45.474 0.02 20.56 ?  21   LYS A HB2  2  
ATOM   9751   H HB3  . LYS A 1 28  ? 14.710  -6.577  -46.895 0.02 20.85 ?  21   LYS A HB3  2  
ATOM   9752   H HG2  . LYS A 1 28  ? 16.157  -7.079  -44.572 0.02 20.08 ?  21   LYS A HG2  2  
ATOM   9753   H HG3  . LYS A 1 28  ? 15.114  -8.107  -45.206 0.02 20.48 ?  21   LYS A HG3  2  
ATOM   9754   H HD2  . LYS A 1 28  ? 16.361  -8.104  -47.153 0.02 20.59 ?  21   LYS A HD2  2  
ATOM   9755   H HD3  . LYS A 1 28  ? 17.473  -7.236  -46.413 0.02 20.37 ?  21   LYS A HD3  2  
ATOM   9756   H HE2  . LYS A 1 28  ? 17.135  -9.241  -44.798 0.02 20.99 ?  21   LYS A HE2  2  
ATOM   9757   H HE3  . LYS A 1 28  ? 17.038  -9.936  -46.226 0.02 21.20 ?  21   LYS A HE3  2  
ATOM   9758   H HZ1  . LYS A 1 28  ? 19.105  -9.404  -46.652 0.02 21.27 ?  21   LYS A HZ1  2  
ATOM   9759   H HZ2  . LYS A 1 28  ? 19.180  -8.373  -45.631 0.02 21.03 ?  21   LYS A HZ2  2  
ATOM   9760   H HZ3  . LYS A 1 28  ? 19.188  -9.776  -45.252 0.02 21.48 ?  21   LYS A HZ3  2  
ATOM   9761   N N    . PHE A 1 29  ? 14.899  -4.859  -48.446 0.02 20.90 ?  22   PHE A N    2  
ATOM   9762   C CA   . PHE A 1 29  ? 15.029  -4.816  -49.892 0.02 21.24 ?  22   PHE A CA   2  
ATOM   9763   C C    . PHE A 1 29  ? 15.600  -3.484  -50.356 0.02 21.06 ?  22   PHE A C    2  
ATOM   9764   O O    . PHE A 1 29  ? 16.338  -3.444  -51.350 0.02 21.18 ?  22   PHE A O    2  
ATOM   9765   C CB   . PHE A 1 29  ? 13.674  -5.084  -50.560 0.02 21.63 ?  22   PHE A CB   2  
ATOM   9766   C CG   . PHE A 1 29  ? 13.247  -6.543  -50.550 0.02 22.00 ?  22   PHE A CG   2  
ATOM   9767   C CD1  . PHE A 1 29  ? 11.922  -6.888  -50.314 0.02 21.96 ?  22   PHE A CD1  2  
ATOM   9768   C CD2  . PHE A 1 29  ? 14.161  -7.562  -50.784 0.02 22.45 ?  22   PHE A CD2  2  
ATOM   9769   C CE1  . PHE A 1 29  ? 11.537  -8.213  -50.305 0.02 22.36 ?  22   PHE A CE1  2  
ATOM   9770   C CE2  . PHE A 1 29  ? 13.778  -8.880  -50.785 0.02 22.84 ?  22   PHE A CE2  2  
ATOM   9771   C CZ   . PHE A 1 29  ? 12.475  -9.211  -50.540 0.02 22.80 ?  22   PHE A CZ   2  
ATOM   9772   H H    . PHE A 1 29  ? 14.107  -5.035  -48.165 0.02 20.93 ?  22   PHE A H    2  
ATOM   9773   H HA   . PHE A 1 29  ? 15.648  -5.509  -50.165 0.02 21.37 ?  22   PHE A HA   2  
ATOM   9774   H HB2  . PHE A 1 29  ? 12.998  -4.571  -50.091 0.02 21.50 ?  22   PHE A HB2  2  
ATOM   9775   H HB3  . PHE A 1 29  ? 13.719  -4.797  -51.487 0.02 21.78 ?  22   PHE A HB3  2  
ATOM   9776   H HD1  . PHE A 1 29  ? 11.292  -6.225  -50.153 0.02 21.68 ?  22   PHE A HD1  2  
ATOM   9777   H HD2  . PHE A 1 29  ? 15.053  -7.351  -50.948 0.02 22.50 ?  22   PHE A HD2  2  
ATOM   9778   H HE1  . PHE A 1 29  ? 10.650  -8.438  -50.144 0.02 22.34 ?  22   PHE A HE1  2  
ATOM   9779   H HE2  . PHE A 1 29  ? 14.405  -9.547  -50.939 0.02 23.16 ?  22   PHE A HE2  2  
ATOM   9780   H HZ   . PHE A 1 29  ? 12.212  -10.103 -50.537 0.02 23.09 ?  22   PHE A HZ   2  
ATOM   9781   N N    . LEU A 1 30  ? 15.277  -2.386  -49.653 0.02 20.84 ?  23   LEU A N    2  
ATOM   9782   C CA   . LEU A 1 30  ? 15.794  -1.063  -50.014 0.02 20.66 ?  23   LEU A CA   2  
ATOM   9783   C C    . LEU A 1 30  ? 17.257  -0.916  -49.611 0.02 20.44 ?  23   LEU A C    2  
ATOM   9784   O O    . LEU A 1 30  ? 18.064  -0.344  -50.353 0.02 20.55 ?  23   LEU A O    2  
ATOM   9785   C CB   . LEU A 1 30  ? 14.942  0.039   -49.370 0.02 20.37 ?  23   LEU A CB   2  
ATOM   9786   C CG   . LEU A 1 30  ? 15.433  1.495   -49.443 0.02 20.30 ?  23   LEU A CG   2  
ATOM   9787   C CD1  . LEU A 1 30  ? 15.415  2.048   -50.857 0.02 20.65 ?  23   LEU A CD1  2  
ATOM   9788   C CD2  . LEU A 1 30  ? 14.587  2.379   -48.532 0.02 20.26 ?  23   LEU A CD2  2  
ATOM   9789   H H    . LEU A 1 30  ? 14.758  -2.382  -48.969 0.02 20.81 ?  23   LEU A H    2  
ATOM   9790   H HA   . LEU A 1 30  ? 15.739  -0.959  -50.976 0.02 20.90 ?  23   LEU A HA   2  
ATOM   9791   H HB2  . LEU A 1 30  ? 14.060  0.014   -49.774 0.02 20.50 ?  23   LEU A HB2  2  
ATOM   9792   H HB3  . LEU A 1 30  ? 14.860  -0.167  -48.426 0.02 20.11 ?  23   LEU A HB3  2  
ATOM   9793   H HG   . LEU A 1 30  ? 16.345  1.534   -49.121 0.02 20.05 ?  23   LEU A HG   2  
ATOM   9794   H HD11 . LEU A 1 30  ? 15.397  3.017   -50.811 0.02 20.60 ?  23   LEU A HD11 2  
ATOM   9795   H HD12 . LEU A 1 30  ? 16.209  1.751   -51.325 0.02 20.67 ?  23   LEU A HD12 2  
ATOM   9796   H HD13 . LEU A 1 30  ? 14.619  1.727   -51.308 0.02 20.91 ?  23   LEU A HD13 2  
ATOM   9797   H HD21 . LEU A 1 30  ? 14.507  1.946   -47.670 0.02 20.03 ?  23   LEU A HD21 2  
ATOM   9798   H HD22 . LEU A 1 30  ? 15.016  3.242   -48.435 0.02 20.24 ?  23   LEU A HD22 2  
ATOM   9799   H HD23 . LEU A 1 30  ? 13.707  2.488   -48.927 0.02 20.51 ?  23   LEU A HD23 2  
ATOM   9800   N N    . ASN A 1 31  ? 17.627  -1.429  -48.445 0.02 20.17 ?  24   ASN A N    2  
ATOM   9801   C CA   . ASN A 1 31  ? 19.050  -1.515  -48.147 0.02 19.95 ?  24   ASN A CA   2  
ATOM   9802   C C    . ASN A 1 31  ? 19.807  -1.945  -49.390 0.02 20.22 ?  24   ASN A C    2  
ATOM   9803   O O    . ASN A 1 31  ? 20.660  -1.208  -49.898 0.02 20.17 ?  24   ASN A O    2  
ATOM   9804   C CB   . ASN A 1 31  ? 19.318  -2.504  -47.013 0.02 19.59 ?  24   ASN A CB   2  
ATOM   9805   C CG   . ASN A 1 31  ? 20.750  -2.424  -46.526 0.02 19.27 ?  24   ASN A CG   2  
ATOM   9806   O OD1  . ASN A 1 31  ? 21.569  -3.320  -46.699 0.02 19.05 ?  24   ASN A OD1  2  
ATOM   9807   N ND2  . ASN A 1 31  ? 21.062  -1.302  -45.985 0.02 19.27 ?  24   ASN A ND2  2  
ATOM   9808   H H    . ASN A 1 31  ? 17.098  -1.733  -47.841 0.02 20.14 ?  24   ASN A H    2  
ATOM   9809   H HA   . ASN A 1 31  ? 19.375  -0.644  -47.877 0.02 19.89 ?  24   ASN A HA   2  
ATOM   9810   H HB2  . ASN A 1 31  ? 18.735  -2.291  -46.270 0.02 19.53 ?  24   ASN A HB2  2  
ATOM   9811   H HB3  . ASN A 1 31  ? 19.154  -3.408  -47.323 0.02 19.64 ?  24   ASN A HB3  2  
ATOM   9812   H HD21 . ASN A 1 31  ? 20.554  -0.619  -46.086 0.02 19.21 ?  24   ASN A HD21 2  
ATOM   9813   H HD22 . ASN A 1 31  ? 21.780  -1.251  -45.531 0.02 19.36 ?  24   ASN A HD22 2  
ATOM   9814   N N    . TYR A 1 32  ? 19.404  -3.085  -49.954 0.02 20.55 ?  25   TYR A N    2  
ATOM   9815   C CA   . TYR A 1 32  ? 20.164  -3.716  -51.026 0.02 20.86 ?  25   TYR A CA   2  
ATOM   9816   C C    . TYR A 1 32  ? 20.289  -2.784  -52.221 0.02 21.11 ?  25   TYR A C    2  
ATOM   9817   O O    . TYR A 1 32  ? 21.389  -2.599  -52.766 0.02 21.19 ?  25   TYR A O    2  
ATOM   9818   C CB   . TYR A 1 32  ? 19.500  -5.043  -51.414 0.02 21.20 ?  25   TYR A CB   2  
ATOM   9819   C CG   . TYR A 1 32  ? 20.207  -5.834  -52.490 0.02 21.52 ?  25   TYR A CG   2  
ATOM   9820   C CD1  . TYR A 1 32  ? 21.558  -6.134  -52.403 0.02 21.40 ?  25   TYR A CD1  2  
ATOM   9821   C CD2  . TYR A 1 32  ? 19.504  -6.306  -53.588 0.02 21.97 ?  25   TYR A CD2  2  
ATOM   9822   C CE1  . TYR A 1 32  ? 22.190  -6.851  -53.405 0.02 21.72 ?  25   TYR A CE1  2  
ATOM   9823   C CE2  . TYR A 1 32  ? 20.136  -7.036  -54.594 0.02 22.29 ?  25   TYR A CE2  2  
ATOM   9824   C CZ   . TYR A 1 32  ? 21.468  -7.307  -54.485 0.02 22.17 ?  25   TYR A CZ   2  
ATOM   9825   O OH   . TYR A 1 32  ? 22.094  -8.035  -55.479 0.02 22.53 ?  25   TYR A OH   2  
ATOM   9826   H H    . TYR A 1 32  ? 18.684  -3.504  -49.744 0.02 20.62 ?  25   TYR A H    2  
ATOM   9827   H HA   . TYR A 1 32  ? 21.056  -3.909  -50.703 0.02 20.72 ?  25   TYR A HA   2  
ATOM   9828   H HB2  . TYR A 1 32  ? 19.452  -5.606  -50.626 0.02 21.06 ?  25   TYR A HB2  2  
ATOM   9829   H HB3  . TYR A 1 32  ? 18.606  -4.859  -51.739 0.02 21.39 ?  25   TYR A HB3  2  
ATOM   9830   H HD1  . TYR A 1 32  ? 22.053  -5.827  -51.679 0.02 21.12 ?  25   TYR A HD1  2  
ATOM   9831   H HD2  . TYR A 1 32  ? 18.596  -6.120  -53.663 0.02 22.08 ?  25   TYR A HD2  2  
ATOM   9832   H HE1  . TYR A 1 32  ? 23.098  -7.043  -53.338 0.02 21.65 ?  25   TYR A HE1  2  
ATOM   9833   H HE2  . TYR A 1 32  ? 19.654  -7.345  -55.326 0.02 22.61 ?  25   TYR A HE2  2  
ATOM   9834   H HH   . TYR A 1 32  ? 22.914  -7.858  -55.483 0.02 22.42 ?  25   TYR A HH   2  
ATOM   9835   N N    . ARG A 1 33  ? 19.189  -2.137  -52.605 0.02 21.25 ?  26   ARG A N    2  
ATOM   9836   C CA   . ARG A 1 33  ? 19.247  -1.237  -53.747 0.02 21.52 ?  26   ARG A CA   2  
ATOM   9837   C C    . ARG A 1 33  ? 20.271  -0.134  -53.527 0.02 21.26 ?  26   ARG A C    2  
ATOM   9838   O O    . ARG A 1 33  ? 20.960  0.267   -54.462 0.02 21.48 ?  26   ARG A O    2  
ATOM   9839   C CB   . ARG A 1 33  ? 17.858  -0.656  -54.037 0.02 21.74 ?  26   ARG A CB   2  
ATOM   9840   C CG   . ARG A 1 33  ? 16.879  -1.647  -54.665 0.02 22.13 ?  26   ARG A CG   2  
ATOM   9841   C CD   . ARG A 1 33  ? 15.527  -0.995  -54.995 0.02 22.40 ?  26   ARG A CD   2  
ATOM   9842   N NE   . ARG A 1 33  ? 15.649  0.116   -55.929 0.02 22.52 ?  26   ARG A NE   2  
ATOM   9843   C CZ   . ARG A 1 33  ? 15.720  -0.018  -57.250 0.02 22.96 ?  26   ARG A CZ   2  
ATOM   9844   N NH1  . ARG A 1 33  ? 15.665  -1.223  -57.813 0.02 23.34 ?  26   ARG A NH1  2  
ATOM   9845   N NH2  . ARG A 1 33  ? 15.831  1.061   -58.005 0.02 23.06 ?  26   ARG A NH2  2  
ATOM   9846   H H    . ARG A 1 33  ? 18.420  -2.198  -52.229 0.02 21.21 ?  26   ARG A H    2  
ATOM   9847   H HA   . ARG A 1 33  ? 19.526  -1.741  -54.527 0.02 21.77 ?  26   ARG A HA   2  
ATOM   9848   H HB2  . ARG A 1 33  ? 17.469  -0.361  -53.201 0.02 21.51 ?  26   ARG A HB2  2  
ATOM   9849   H HB3  . ARG A 1 33  ? 17.944  0.096   -54.642 0.02 21.89 ?  26   ARG A HB3  2  
ATOM   9850   H HG2  . ARG A 1 33  ? 17.255  -1.998  -55.485 0.02 22.38 ?  26   ARG A HG2  2  
ATOM   9851   H HG3  . ARG A 1 33  ? 16.717  -2.367  -54.034 0.02 22.00 ?  26   ARG A HG3  2  
ATOM   9852   H HD2  . ARG A 1 33  ? 14.954  -1.659  -55.407 0.02 22.72 ?  26   ARG A HD2  2  
ATOM   9853   H HD3  . ARG A 1 33  ? 15.117  -0.665  -54.183 0.02 22.20 ?  26   ARG A HD3  2  
ATOM   9854   H HE   . ARG A 1 33  ? 15.663  0.914   -55.609 0.02 22.29 ?  26   ARG A HE   2  
ATOM   9855   H HH11 . ARG A 1 33  ? 15.594  -1.928  -57.330 0.02 23.29 ?  26   ARG A HH11 2  
ATOM   9856   H HH12 . ARG A 1 33  ? 15.710  -1.298  -58.665 0.02 23.63 ?  26   ARG A HH12 2  
ATOM   9857   H HH21 . ARG A 1 33  ? 15.860  1.838   -57.641 0.02 22.83 ?  26   ARG A HH21 2  
ATOM   9858   H HH22 . ARG A 1 33  ? 15.872  0.986   -58.860 0.02 23.36 ?  26   ARG A HH22 2  
ATOM   9859   N N    . LEU A 1 34  ? 20.431  0.338   -52.302 0.02 20.84 ?  27   LEU A N    2  
ATOM   9860   C CA   . LEU A 1 34  ? 21.283  1.489   -52.041 0.02 20.61 ?  27   LEU A CA   2  
ATOM   9861   C C    . LEU A 1 34  ? 22.715  1.092   -51.690 0.02 20.47 ?  27   LEU A C    2  
ATOM   9862   O O    . LEU A 1 34  ? 23.524  1.968   -51.373 0.02 20.31 ?  27   LEU A O    2  
ATOM   9863   C CB   . LEU A 1 34  ? 20.676  2.343   -50.908 0.02 20.26 ?  27   LEU A CB   2  
ATOM   9864   C CG   . LEU A 1 34  ? 19.273  2.943   -51.132 0.02 20.35 ?  27   LEU A CG   2  
ATOM   9865   C CD1  . LEU A 1 34  ? 18.622  3.423   -49.844 0.02 19.97 ?  27   LEU A CD1  2  
ATOM   9866   C CD2  . LEU A 1 34  ? 19.270  4.116   -52.102 0.02 20.62 ?  27   LEU A CD2  2  
ATOM   9867   H H    . LEU A 1 34  ? 20.058  0.007   -51.604 0.02 20.69 ?  27   LEU A H    2  
ATOM   9868   H HA   . LEU A 1 34  ? 21.318  2.045   -52.830 0.02 20.81 ?  27   LEU A HA   2  
ATOM   9869   H HB2  . LEU A 1 34  ? 20.620  1.775   -50.127 0.02 20.09 ?  27   LEU A HB2  2  
ATOM   9870   H HB3  . LEU A 1 34  ? 21.276  3.080   -50.720 0.02 20.12 ?  27   LEU A HB3  2  
ATOM   9871   H HG   . LEU A 1 34  ? 18.704  2.254   -51.511 0.02 20.50 ?  27   LEU A HG   2  
ATOM   9872   H HD11 . LEU A 1 34  ? 18.739  4.384   -49.772 0.02 19.92 ?  27   LEU A HD11 2  
ATOM   9873   H HD12 . LEU A 1 34  ? 17.676  3.212   -49.872 0.02 20.03 ?  27   LEU A HD12 2  
ATOM   9874   H HD13 . LEU A 1 34  ? 19.041  2.980   -49.090 0.02 19.77 ?  27   LEU A HD13 2  
ATOM   9875   H HD21 . LEU A 1 34  ? 18.420  4.573   -52.038 0.02 20.70 ?  27   LEU A HD21 2  
ATOM   9876   H HD22 . LEU A 1 34  ? 19.989  4.721   -51.866 0.02 20.48 ?  27   LEU A HD22 2  
ATOM   9877   H HD23 . LEU A 1 34  ? 19.398  3.777   -52.999 0.02 20.88 ?  27   LEU A HD23 2  
ATOM   9878   N N    . THR A 1 35  ? 23.035  -0.198  -51.694 0.02 20.53 ?  28   THR A N    2  
ATOM   9879   C CA   . THR A 1 35  ? 24.416  -0.637  -51.570 0.02 20.43 ?  28   THR A CA   2  
ATOM   9880   C C    . THR A 1 35  ? 25.067  -0.516  -52.936 0.02 20.79 ?  28   THR A C    2  
ATOM   9881   O O    . THR A 1 35  ? 24.451  -0.867  -53.939 0.02 21.13 ?  28   THR A O    2  
ATOM   9882   C CB   . THR A 1 35  ? 24.489  -2.087  -51.098 0.02 20.35 ?  28   THR A CB   2  
ATOM   9883   O OG1  . THR A 1 35  ? 23.747  -2.248  -49.887 0.02 20.06 ?  28   THR A OG1  2  
ATOM   9884   C CG2  . THR A 1 35  ? 25.962  -2.530  -50.892 0.02 20.25 ?  28   THR A CG2  2  
ATOM   9885   H H    . THR A 1 35  ? 22.472  -0.840  -51.772 0.02 20.66 ?  28   THR A H    2  
ATOM   9886   H HA   . THR A 1 35  ? 24.893  -0.076  -50.940 0.02 20.20 ?  28   THR A HA   2  
ATOM   9887   H HB   . THR A 1 35  ? 24.096  -2.654  -51.781 0.02 20.60 ?  28   THR A HB   2  
ATOM   9888   H HG1  . THR A 1 35  ? 23.023  -1.824  -49.936 0.02 20.10 ?  28   THR A HG1  2  
ATOM   9889   H HG21 . THR A 1 35  ? 26.018  -3.211  -50.205 0.02 20.36 ?  28   THR A HG21 2  
ATOM   9890   H HG22 . THR A 1 35  ? 26.319  -2.885  -51.720 0.02 20.38 ?  28   THR A HG22 2  
ATOM   9891   H HG23 . THR A 1 35  ? 26.496  -1.767  -50.623 0.02 19.98 ?  28   THR A HG23 2  
ATOM   9892   N N    . THR A 1 36  ? 26.291  -0.009  -52.984 0.02 20.76 ?  29   THR A N    2  
ATOM   9893   C CA   . THR A 1 36  ? 27.033  -0.016  -54.237 0.02 21.13 ?  29   THR A CA   2  
ATOM   9894   C C    . THR A 1 36  ? 28.100  -1.094  -54.163 0.02 21.18 ?  29   THR A C    2  
ATOM   9895   O O    . THR A 1 36  ? 28.242  -1.811  -53.170 0.02 20.94 ?  29   THR A O    2  
ATOM   9896   C CB   . THR A 1 36  ? 27.662  1.346   -54.548 0.02 21.14 ?  29   THR A CB   2  
ATOM   9897   O OG1  . THR A 1 36  ? 28.823  1.584   -53.735 0.02 20.88 ?  29   THR A OG1  2  
ATOM   9898   C CG2  . THR A 1 36  ? 26.654  2.491   -54.370 0.02 21.02 ?  29   THR A CG2  2  
ATOM   9899   H H    . THR A 1 36  ? 26.711  0.340   -52.324 0.02 20.54 ?  29   THR A H    2  
ATOM   9900   H HA   . THR A 1 36  ? 26.434  -0.239  -54.962 0.02 21.38 ?  29   THR A HA   2  
ATOM   9901   H HB   . THR A 1 36  ? 27.938  1.346   -55.477 0.02 21.43 ?  29   THR A HB   2  
ATOM   9902   H HG1  . THR A 1 36  ? 29.203  0.869   -53.526 0.02 20.75 ?  29   THR A HG1  2  
ATOM   9903   H HG21 . THR A 1 36  ? 27.019  3.319   -54.720 0.02 21.09 ?  29   THR A HG21 2  
ATOM   9904   H HG22 . THR A 1 36  ? 25.834  2.287   -54.846 0.02 21.19 ?  29   THR A HG22 2  
ATOM   9905   H HG23 . THR A 1 36  ? 26.451  2.610   -53.429 0.02 20.73 ?  29   THR A HG23 2  
ATOM   9906   N N    . ASN A 1 37  ? 28.879  -1.197  -55.240 0.02 21.53 ?  30   ASN A N    2  
ATOM   9907   C CA   . ASN A 1 37  ? 30.002  -2.112  -55.281 0.02 21.66 ?  30   ASN A CA   2  
ATOM   9908   C C    . ASN A 1 37  ? 31.343  -1.392  -55.126 0.02 21.55 ?  30   ASN A C    2  
ATOM   9909   O O    . ASN A 1 37  ? 32.393  -2.020  -55.305 0.02 21.69 ?  30   ASN A O    2  
ATOM   9910   C CB   . ASN A 1 37  ? 29.933  -2.942  -56.570 0.02 22.17 ?  30   ASN A CB   2  
ATOM   9911   C CG   . ASN A 1 37  ? 28.879  -4.058  -56.481 0.02 22.31 ?  30   ASN A CG   2  
ATOM   9912   O OD1  . ASN A 1 37  ? 28.741  -4.710  -55.449 0.02 22.07 ?  30   ASN A OD1  2  
ATOM   9913   N ND2  . ASN A 1 37  ? 28.141  -4.266  -57.560 0.02 22.73 ?  30   ASN A ND2  2  
ATOM   9914   H H    . ASN A 1 37  ? 28.773  -0.734  -55.953 0.02 21.72 ?  30   ASN A H    2  
ATOM   9915   H HA   . ASN A 1 37  ? 29.923  -2.734  -54.543 0.02 21.51 ?  30   ASN A HA   2  
ATOM   9916   H HB2  . ASN A 1 37  ? 29.700  -2.364  -57.312 0.02 22.34 ?  30   ASN A HB2  2  
ATOM   9917   H HB3  . ASN A 1 37  ? 30.795  -3.357  -56.728 0.02 22.27 ?  30   ASN A HB3  2  
ATOM   9918   H HD21 . ASN A 1 37  ? 28.443  -4.049  -58.336 0.02 22.95 ?  30   ASN A HD21 2  
ATOM   9919   H HD22 . ASN A 1 37  ? 27.363  -4.629  -57.487 0.02 22.79 ?  30   ASN A HD22 2  
ATOM   9920   N N    . GLU A 1 38  ? 31.331  -0.109  -54.740 0.02 21.31 ?  31   GLU A N    2  
ATOM   9921   C CA   . GLU A 1 38  ? 32.558  0.632   -54.425 0.02 21.22 ?  31   GLU A CA   2  
ATOM   9922   C C    . GLU A 1 38  ? 32.943  0.370   -52.975 0.02 20.82 ?  31   GLU A C    2  
ATOM   9923   O O    . GLU A 1 38  ? 32.630  1.146   -52.076 0.02 20.50 ?  31   GLU A O    2  
ATOM   9924   C CB   . GLU A 1 38  ? 32.387  2.129   -54.670 0.02 21.20 ?  31   GLU A CB   2  
ATOM   9925   C CG   . GLU A 1 38  ? 32.509  2.487   -56.128 0.02 21.60 ?  31   GLU A CG   2  
ATOM   9926   C CD   . GLU A 1 38  ? 32.431  3.979   -56.457 0.02 21.70 ?  31   GLU A CD   2  
ATOM   9927   O OE1  . GLU A 1 38  ? 32.404  4.286   -57.680 0.02 22.10 ?  31   GLU A OE1  2  
ATOM   9928   O OE2  . GLU A 1 38  ? 32.432  4.842   -55.577 0.02 21.41 -1 31   GLU A OE2  2  
ATOM   9929   H H    . GLU A 1 38  ? 30.619  0.361   -54.664 0.02 21.23 ?  31   GLU A H    2  
ATOM   9930   H HA   . GLU A 1 38  ? 33.281  0.308   -54.982 0.02 21.45 ?  31   GLU A HA   2  
ATOM   9931   H HB2  . GLU A 1 38  ? 31.515  2.414   -54.359 0.02 20.97 ?  31   GLU A HB2  2  
ATOM   9932   H HB3  . GLU A 1 38  ? 33.085  2.606   -54.198 0.02 21.18 ?  31   GLU A HB3  2  
ATOM   9933   H HG2  . GLU A 1 38  ? 33.367  2.162   -56.442 0.02 21.86 ?  31   GLU A HG2  2  
ATOM   9934   H HG3  . GLU A 1 38  ? 31.796  2.039   -56.608 0.02 21.58 ?  31   GLU A HG3  2  
ATOM   9935   N N    . THR A 1 39  ? 33.638  -0.746  -52.768 0.02 20.87 ?  32   THR A N    2  
ATOM   9936   C CA   . THR A 1 39  ? 34.250  -1.046  -51.486 0.02 20.56 ?  32   THR A CA   2  
ATOM   9937   C C    . THR A 1 39  ? 35.541  -0.238  -51.325 0.02 20.56 ?  32   THR A C    2  
ATOM   9938   O O    . THR A 1 39  ? 36.198  0.145   -52.304 0.02 20.87 ?  32   THR A O    2  
ATOM   9939   C CB   . THR A 1 39  ? 34.508  -2.552  -51.376 0.02 20.66 ?  32   THR A CB   2  
ATOM   9940   O OG1  . THR A 1 39  ? 35.301  -2.998  -52.483 0.02 21.08 ?  32   THR A OG1  2  
ATOM   9941   C CG2  . THR A 1 39  ? 33.171  -3.320  -51.400 0.02 20.61 ?  32   THR A CG2  2  
ATOM   9942   H H    . THR A 1 39  ? 33.765  -1.354  -53.359 0.02 21.09 ?  32   THR A H    2  
ATOM   9943   H HA   . THR A 1 39  ? 33.646  -0.789  -50.776 0.02 20.31 ?  32   THR A HA   2  
ATOM   9944   H HB   . THR A 1 39  ? 34.965  -2.755  -50.546 0.02 20.50 ?  32   THR A HB   2  
ATOM   9945   H HG1  . THR A 1 39  ? 36.005  -2.545  -52.533 0.02 21.14 ?  32   THR A HG1  2  
ATOM   9946   H HG21 . THR A 1 39  ? 32.996  -3.713  -50.530 0.02 20.36 ?  32   THR A HG21 2  
ATOM   9947   H HG22 . THR A 1 39  ? 32.444  -2.716  -51.621 0.02 20.83 ?  32   THR A HG22 2  
ATOM   9948   H HG23 . THR A 1 39  ? 33.205  -4.028  -52.063 0.02 20.63 ?  32   THR A HG23 2  
ATOM   9949   N N    . VAL A 1 40  ? 35.871  0.075   -50.070 0.02 20.23 ?  33   VAL A N    2  
ATOM   9950   C CA   . VAL A 1 40  ? 37.027  0.896   -49.731 0.02 20.21 ?  33   VAL A CA   2  
ATOM   9951   C C    . VAL A 1 40  ? 37.626  0.329   -48.454 0.02 19.97 ?  33   VAL A C    2  
ATOM   9952   O O    . VAL A 1 40  ? 36.923  -0.264  -47.637 0.02 19.74 ?  33   VAL A O    2  
ATOM   9953   C CB   . VAL A 1 40  ? 36.665  2.380   -49.538 0.02 20.07 ?  33   VAL A CB   2  
ATOM   9954   C CG1  . VAL A 1 40  ? 36.068  2.936   -50.793 0.02 20.35 ?  33   VAL A CG1  2  
ATOM   9955   C CG2  . VAL A 1 40  ? 35.673  2.548   -48.396 0.02 19.69 ?  33   VAL A CG2  2  
ATOM   9956   H H    . VAL A 1 40  ? 35.431  -0.198  -49.387 0.02 20.02 ?  33   VAL A H    2  
ATOM   9957   H HA   . VAL A 1 40  ? 37.692  0.837   -50.433 0.02 20.46 ?  33   VAL A HA   2  
ATOM   9958   H HB   . VAL A 1 40  ? 37.468  2.882   -49.328 0.02 20.07 ?  33   VAL A HB   2  
ATOM   9959   H HG11 . VAL A 1 40  ? 36.431  2.457   -51.555 0.02 20.59 ?  33   VAL A HG11 2  
ATOM   9960   H HG12 . VAL A 1 40  ? 35.106  2.815   -50.751 0.02 20.26 ?  33   VAL A HG12 2  
ATOM   9961   H HG13 . VAL A 1 40  ? 36.288  3.878   -50.855 0.02 20.40 ?  33   VAL A HG13 2  
ATOM   9962   H HG21 . VAL A 1 40  ? 34.985  1.869   -48.477 0.02 19.66 ?  33   VAL A HG21 2  
ATOM   9963   H HG22 . VAL A 1 40  ? 36.142  2.445   -47.554 0.02 19.52 ?  33   VAL A HG22 2  
ATOM   9964   H HG23 . VAL A 1 40  ? 35.273  3.429   -48.455 0.02 19.66 ?  33   VAL A HG23 2  
ATOM   9965   N N    . VAL A 1 41  ? 38.943  0.496   -48.305 0.02 20.07 ?  34   VAL A N    2  
ATOM   9966   C CA   . VAL A 1 41  ? 39.691  -0.019  -47.162 0.02 19.89 ?  34   VAL A CA   2  
ATOM   9967   C C    . VAL A 1 41  ? 40.331  1.156   -46.449 0.02 19.74 ?  34   VAL A C    2  
ATOM   9968   O O    . VAL A 1 41  ? 41.025  1.963   -47.073 0.02 19.92 ?  34   VAL A O    2  
ATOM   9969   C CB   . VAL A 1 41  ? 40.757  -1.060  -47.583 0.02 20.17 ?  34   VAL A CB   2  
ATOM   9970   C CG1  . VAL A 1 41  ? 41.575  -1.543  -46.368 0.02 20.02 ?  34   VAL A CG1  2  
ATOM   9971   C CG2  . VAL A 1 41  ? 40.108  -2.261  -48.273 0.02 20.32 ?  34   VAL A CG2  2  
ATOM   9972   H H    . VAL A 1 41  ? 39.434  0.925   -48.863 0.02 20.25 ?  34   VAL A H    2  
ATOM   9973   H HA   . VAL A 1 41  ? 39.078  -0.441  -46.540 0.02 19.71 ?  34   VAL A HA   2  
ATOM   9974   H HB   . VAL A 1 41  ? 41.372  -0.649  -48.208 0.02 20.39 ?  34   VAL A HB   2  
ATOM   9975   H HG11 . VAL A 1 41  ? 42.322  -2.076  -46.690 0.02 20.15 ?  34   VAL A HG11 2  
ATOM   9976   H HG12 . VAL A 1 41  ? 41.906  -0.780  -45.868 0.02 20.07 ?  34   VAL A HG12 2  
ATOM   9977   H HG13 . VAL A 1 41  ? 41.008  -2.091  -45.804 0.02 19.77 ?  34   VAL A HG13 2  
ATOM   9978   H HG21 . VAL A 1 41  ? 40.741  -2.998  -48.294 0.02 20.55 ?  34   VAL A HG21 2  
ATOM   9979   H HG22 . VAL A 1 41  ? 39.317  -2.520  -47.779 0.02 20.14 ?  34   VAL A HG22 2  
ATOM   9980   H HG23 . VAL A 1 41  ? 39.863  -2.009  -49.178 0.02 20.38 ?  34   VAL A HG23 2  
ATOM   9981   N N    . ALA A 1 42  ? 40.112  1.248   -45.140 0.02 19.43 ?  35   ALA A N    2  
ATOM   9982   C CA   . ALA A 1 42  ? 40.630  2.342   -44.345 0.02 19.30 ?  35   ALA A CA   2  
ATOM   9983   C C    . ALA A 1 42  ? 41.517  1.808   -43.231 0.02 19.23 ?  35   ALA A C    2  
ATOM   9984   O O    . ALA A 1 42  ? 41.493  0.623   -42.906 0.02 19.22 ?  35   ALA A O    2  
ATOM   9985   C CB   . ALA A 1 42  ? 39.495  3.182   -43.746 0.02 19.01 ?  35   ALA A CB   2  
ATOM   9986   H H    . ALA A 1 42  ? 39.666  0.672   -44.686 0.02 19.32 ?  35   ALA A H    2  
ATOM   9987   H HA   . ALA A 1 42  ? 41.171  2.917   -44.904 0.02 19.48 ?  35   ALA A HA   2  
ATOM   9988   H HB1  . ALA A 1 42  ? 39.864  3.926   -43.248 0.02 18.94 ?  35   ALA A HB1  2  
ATOM   9989   H HB2  . ALA A 1 42  ? 38.946  3.513   -44.471 0.02 19.09 ?  35   ALA A HB2  2  
ATOM   9990   H HB3  . ALA A 1 42  ? 38.970  2.615   -43.161 0.02 18.85 ?  35   ALA A HB3  2  
ATOM   9991   N N    . GLU A 1 43  ? 42.333  2.693   -42.685 0.02 19.21 ?  36   GLU A N    2  
ATOM   9992   C CA   . GLU A 1 43  ? 43.264  2.373   -41.615 0.02 19.19 ?  36   GLU A CA   2  
ATOM   9993   C C    . GLU A 1 43  ? 42.619  2.533   -40.246 0.02 18.87 ?  36   GLU A C    2  
ATOM   9994   O O    . GLU A 1 43  ? 41.863  3.474   -40.022 0.02 18.73 ?  36   GLU A O    2  
ATOM   9995   C CB   . GLU A 1 43  ? 44.467  3.308   -41.685 0.02 19.46 ?  36   GLU A CB   2  
ATOM   9996   C CG   . GLU A 1 43  ? 45.682  2.801   -40.961 0.02 19.71 ?  36   GLU A CG   2  
ATOM   9997   C CD   . GLU A 1 43  ? 46.218  1.558   -41.638 0.02 19.98 ?  36   GLU A CD   2  
ATOM   9998   O OE1  . GLU A 1 43  ? 46.703  0.617   -40.960 0.02 20.13 ?  36   GLU A OE1  2  
ATOM   9999   O OE2  . GLU A 1 43  ? 46.078  1.519   -42.871 0.02 20.07 -1 36   GLU A OE2  2  
ATOM   10000  H H    . GLU A 1 43  ? 42.367  3.517   -42.927 0.02 19.23 ?  36   GLU A H    2  
ATOM   10001  H HA   . GLU A 1 43  ? 43.564  1.457   -41.716 0.02 19.25 ?  36   GLU A HA   2  
ATOM   10002  H HB2  . GLU A 1 43  ? 44.708  3.441   -42.616 0.02 19.60 ?  36   GLU A HB2  2  
ATOM   10003  H HB3  . GLU A 1 43  ? 44.220  4.157   -41.292 0.02 19.35 ?  36   GLU A HB3  2  
ATOM   10004  H HG2  . GLU A 1 43  ? 46.372  3.482   -40.979 0.02 19.86 ?  36   GLU A HG2  2  
ATOM   10005  H HG3  . GLU A 1 43  ? 45.445  2.579   -40.047 0.02 19.58 ?  36   GLU A HG3  2  
ATOM   10006  N N    . THR A 1 44  ? 42.964  1.638   -39.320 0.02 18.78 ?  37   THR A N    2  
ATOM   10007  C CA   . THR A 1 44  ? 42.708  1.864   -37.898 0.02 18.54 ?  37   THR A CA   2  
ATOM   10008  C C    . THR A 1 44  ? 43.914  1.412   -37.101 0.02 18.67 ?  37   THR A C    2  
ATOM   10009  O O    . THR A 1 44  ? 44.715  0.603   -37.567 0.02 18.90 ?  37   THR A O    2  
ATOM   10010  C CB   . THR A 1 44  ? 41.474  1.122   -37.367 0.02 18.29 ?  37   THR A CB   2  
ATOM   10011  O OG1  . THR A 1 44  ? 41.797  -0.241  -37.090 0.02 18.36 ?  37   THR A OG1  2  
ATOM   10012  C CG2  . THR A 1 44  ? 40.348  1.156   -38.347 0.02 18.26 ?  37   THR A CG2  2  
ATOM   10013  H H    . THR A 1 44  ? 43.353  0.892   -39.490 0.02 18.87 ?  37   THR A H    2  
ATOM   10014  H HA   . THR A 1 44  ? 42.583  2.814   -37.747 0.02 18.48 ?  37   THR A HA   2  
ATOM   10015  H HB   . THR A 1 44  ? 41.173  1.550   -36.550 0.02 18.13 ?  37   THR A HB   2  
ATOM   10016  H HG1  . THR A 1 44  ? 41.216  -0.573  -36.585 0.02 18.23 ?  37   THR A HG1  2  
ATOM   10017  H HG21 . THR A 1 44  ? 39.617  0.610   -38.019 0.02 18.14 ?  37   THR A HG21 2  
ATOM   10018  H HG22 . THR A 1 44  ? 40.039  2.067   -38.465 0.02 18.21 ?  37   THR A HG22 2  
ATOM   10019  H HG23 . THR A 1 44  ? 40.643  0.805   -39.203 0.02 18.44 ?  37   THR A HG23 2  
ATOM   10020  N N    . GLU A 1 45  ? 43.987  1.872   -35.848 0.02 18.53 ?  38   GLU A N    2  
ATOM   10021  C CA   . GLU A 1 45  ? 45.102  1.489   -34.997 0.02 18.66 ?  38   GLU A CA   2  
ATOM   10022  C C    . GLU A 1 45  ? 45.119  -0.006  -34.736 0.02 18.70 ?  38   GLU A C    2  
ATOM   10023  O O    . GLU A 1 45  ? 46.138  -0.544  -34.292 0.02 18.89 ?  38   GLU A O    2  
ATOM   10024  C CB   . GLU A 1 45  ? 45.049  2.243   -33.658 0.02 18.51 ?  38   GLU A CB   2  
ATOM   10025  C CG   . GLU A 1 45  ? 43.941  1.804   -32.716 0.02 18.23 ?  38   GLU A CG   2  
ATOM   10026  C CD   . GLU A 1 45  ? 43.961  2.530   -31.373 0.02 18.13 ?  38   GLU A CD   2  
ATOM   10027  O OE1  . GLU A 1 45  ? 45.025  2.566   -30.699 0.02 18.26 ?  38   GLU A OE1  2  
ATOM   10028  O OE2  . GLU A 1 45  ? 42.885  3.046   -30.991 0.02 17.95 -1 38   GLU A OE2  2  
ATOM   10029  H H    . GLU A 1 45  ? 43.413  2.388   -35.473 0.02 18.37 ?  38   GLU A H    2  
ATOM   10030  H HA   . GLU A 1 45  ? 45.933  1.720   -35.442 0.02 18.87 ?  38   GLU A HA   2  
ATOM   10031  H HB2  . GLU A 1 45  ? 45.887  2.094   -33.196 0.02 18.64 ?  38   GLU A HB2  2  
ATOM   10032  H HB3  . GLU A 1 45  ? 44.937  3.189   -33.829 0.02 18.49 ?  38   GLU A HB3  2  
ATOM   10033  H HG2  . GLU A 1 45  ? 43.088  1.969   -33.144 0.02 18.11 ?  38   GLU A HG2  2  
ATOM   10034  H HG3  . GLU A 1 45  ? 44.044  0.862   -32.527 0.02 18.26 ?  38   GLU A HG3  2  
ATOM   10035  N N    . TYR A 1 46  ? 43.998  -0.674  -34.954 0.02 18.56 ?  39   TYR A N    2  
ATOM   10036  C CA   . TYR A 1 46  ? 43.862  -2.078  -34.645 0.02 18.60 ?  39   TYR A CA   2  
ATOM   10037  C C    . TYR A 1 46  ? 43.831  -2.944  -35.887 0.02 18.80 ?  39   TYR A C    2  
ATOM   10038  O O    . TYR A 1 46  ? 43.785  -4.173  -35.763 0.02 18.89 ?  39   TYR A O    2  
ATOM   10039  C CB   . TYR A 1 46  ? 42.585  -2.304  -33.839 0.02 18.34 ?  39   TYR A CB   2  
ATOM   10040  C CG   . TYR A 1 46  ? 42.574  -1.628  -32.489 0.02 18.17 ?  39   TYR A CG   2  
ATOM   10041  C CD1  . TYR A 1 46  ? 43.337  -2.111  -31.433 0.02 18.28 ?  39   TYR A CD1  2  
ATOM   10042  C CD2  . TYR A 1 46  ? 41.774  -0.515  -32.256 0.02 17.93 ?  39   TYR A CD2  2  
ATOM   10043  C CE1  . TYR A 1 46  ? 43.303  -1.500  -30.190 0.02 18.15 ?  39   TYR A CE1  2  
ATOM   10044  C CE2  . TYR A 1 46  ? 41.725  0.098   -31.005 0.02 17.79 ?  39   TYR A CE2  2  
ATOM   10045  C CZ   . TYR A 1 46  ? 42.509  -0.391  -29.981 0.02 17.91 ?  39   TYR A CZ   2  
ATOM   10046  O OH   . TYR A 1 46  ? 42.448  0.216   -28.735 0.02 17.80 ?  39   TYR A OH   2  
ATOM   10047  H H    . TYR A 1 46  ? 43.286  -0.325  -35.286 0.02 18.44 ?  39   TYR A H    2  
ATOM   10048  H HA   . TYR A 1 46  ? 44.608  -2.364  -34.099 0.02 18.70 ?  39   TYR A HA   2  
ATOM   10049  H HB2  . TYR A 1 46  ? 41.833  -1.957  -34.343 0.02 18.25 ?  39   TYR A HB2  2  
ATOM   10050  H HB3  . TYR A 1 46  ? 42.472  -3.255  -33.693 0.02 18.40 ?  39   TYR A HB3  2  
ATOM   10051  H HD1  . TYR A 1 46  ? 43.883  -2.855  -31.561 0.02 18.46 ?  39   TYR A HD1  2  
ATOM   10052  H HD2  . TYR A 1 46  ? 41.249  -0.181  -32.950 0.02 17.87 ?  39   TYR A HD2  2  
ATOM   10053  H HE1  . TYR A 1 46  ? 43.824  -1.839  -29.497 0.02 18.25 ?  39   TYR A HE1  2  
ATOM   10054  H HE2  . TYR A 1 46  ? 41.190  0.844   -30.867 0.02 17.64 ?  39   TYR A HE2  2  
ATOM   10055  H HH   . TYR A 1 46  ? 41.847  0.802   -28.730 0.02 17.65 ?  39   TYR A HH   2  
ATOM   10056  N N    . GLY A 1 47  ? 43.857  -2.335  -37.075 0.02 18.90 ?  40   GLY A N    2  
ATOM   10057  C CA   . GLY A 1 47  ? 43.811  -3.093  -38.310 0.02 19.11 ?  40   GLY A CA   2  
ATOM   10058  C C    . GLY A 1 47  ? 42.960  -2.403  -39.356 0.02 19.06 ?  40   GLY A C    2  
ATOM   10059  O O    . GLY A 1 47  ? 42.265  -1.421  -39.070 0.02 18.84 ?  40   GLY A O    2  
ATOM   10060  H H    . GLY A 1 47  ? 43.891  -1.487  -37.188 0.02 18.85 ?  40   GLY A H    2  
ATOM   10061  H HA2  . GLY A 1 47  ? 44.708  -3.191  -38.661 0.02 19.32 ?  40   GLY A HA2  2  
ATOM   10062  H HA3  . GLY A 1 47  ? 43.449  -3.975  -38.146 0.02 19.10 ?  40   GLY A HA3  2  
ATOM   10063  N N    . LYS A 1 48  ? 43.055  -2.898  -40.588 0.02 19.28 ?  41   LYS A N    2  
ATOM   10064  C CA   . LYS A 1 48  ? 42.339  -2.342  -41.716 0.02 19.31 ?  41   LYS A CA   2  
ATOM   10065  C C    . LYS A 1 48  ? 40.871  -2.750  -41.683 0.02 19.14 ?  41   LYS A C    2  
ATOM   10066  O O    . LYS A 1 48  ? 40.524  -3.863  -41.281 0.02 19.13 ?  41   LYS A O    2  
ATOM   10067  C CB   . LYS A 1 48  ? 42.987  -2.813  -43.018 0.02 19.67 ?  41   LYS A CB   2  
ATOM   10068  C CG   . LYS A 1 48  ? 44.478  -2.595  -43.055 0.02 19.89 ?  41   LYS A CG   2  
ATOM   10069  C CD   . LYS A 1 48  ? 45.242  -3.836  -43.588 0.02 20.23 ?  41   LYS A CD   2  
ATOM   10070  C CE   . LYS A 1 48  ? 46.737  -3.828  -43.229 0.02 20.56 ?  41   LYS A CE   2  
ATOM   10071  N NZ   . LYS A 1 48  ? 47.399  -5.176  -43.473 0.02 20.91 ?  41   LYS A NZ   2  
ATOM   10072  H H    . LYS A 1 48  ? 43.554  -3.567  -40.795 0.02 19.45 ?  41   LYS A H    2  
ATOM   10073  H HA   . LYS A 1 48  ? 42.397  -1.374  -41.690 0.02 19.22 ?  41   LYS A HA   2  
ATOM   10074  H HB2  . LYS A 1 48  ? 42.812  -3.758  -43.133 0.02 19.78 ?  41   LYS A HB2  2  
ATOM   10075  H HB3  . LYS A 1 48  ? 42.595  -2.318  -43.754 0.02 19.70 ?  41   LYS A HB3  2  
ATOM   10076  H HG2  . LYS A 1 48  ? 44.667  -1.848  -43.644 0.02 19.97 ?  41   LYS A HG2  2  
ATOM   10077  H HG3  . LYS A 1 48  ? 44.807  -2.404  -42.166 0.02 19.77 ?  41   LYS A HG3  2  
ATOM   10078  H HD2  . LYS A 1 48  ? 44.849  -4.634  -43.203 0.02 20.18 ?  41   LYS A HD2  2  
ATOM   10079  H HD3  . LYS A 1 48  ? 45.166  -3.860  -44.555 0.02 20.32 ?  41   LYS A HD3  2  
ATOM   10080  H HE2  . LYS A 1 48  ? 47.197  -3.166  -43.772 0.02 20.59 ?  41   LYS A HE2  2  
ATOM   10081  H HE3  . LYS A 1 48  ? 46.838  -3.616  -42.287 0.02 20.53 ?  41   LYS A HE3  2  
ATOM   10082  H HZ1  . LYS A 1 48  ? 48.238  -5.054  -43.746 0.02 20.88 ?  41   LYS A HZ1  2  
ATOM   10083  H HZ2  . LYS A 1 48  ? 47.412  -5.651  -42.721 0.02 21.12 ?  41   LYS A HZ2  2  
ATOM   10084  H HZ3  . LYS A 1 48  ? 46.953  -5.630  -44.095 0.02 20.95 ?  41   LYS A HZ3  2  
ATOM   10085  N N    . VAL A 1 49  ? 40.017  -1.854  -42.142 0.02 19.05 ?  42   VAL A N    2  
ATOM   10086  C CA   . VAL A 1 49  ? 38.584  -2.100  -42.205 0.02 18.92 ?  42   VAL A CA   2  
ATOM   10087  C C    . VAL A 1 49  ? 38.080  -1.852  -43.628 0.02 19.11 ?  42   VAL A C    2  
ATOM   10088  O O    . VAL A 1 49  ? 38.425  -0.847  -44.256 0.02 19.19 ?  42   VAL A O    2  
ATOM   10089  C CB   . VAL A 1 49  ? 37.810  -1.231  -41.183 0.02 18.59 ?  42   VAL A CB   2  
ATOM   10090  C CG1  . VAL A 1 49  ? 38.139  -1.658  -39.758 0.02 18.42 ?  42   VAL A CG1  2  
ATOM   10091  C CG2  . VAL A 1 49  ? 38.098  0.249   -41.372 0.02 18.56 ?  42   VAL A CG2  2  
ATOM   10092  H H    . VAL A 1 49  ? 40.247  -1.075  -42.428 0.02 19.09 ?  42   VAL A H    2  
ATOM   10093  H HA   . VAL A 1 49  ? 38.421  -3.033  -41.993 0.02 18.94 ?  42   VAL A HA   2  
ATOM   10094  H HB   . VAL A 1 49  ? 36.860  -1.370  -41.313 0.02 18.53 ?  42   VAL A HB   2  
ATOM   10095  H HG11 . VAL A 1 49  ? 37.452  -1.318  -39.165 0.02 18.23 ?  42   VAL A HG11 2  
ATOM   10096  H HG12 . VAL A 1 49  ? 38.169  -2.626  -39.716 0.02 18.48 ?  42   VAL A HG12 2  
ATOM   10097  H HG13 . VAL A 1 49  ? 39.002  -1.289  -39.514 0.02 18.47 ?  42   VAL A HG13 2  
ATOM   10098  H HG21 . VAL A 1 49  ? 37.525  0.762   -40.785 0.02 18.37 ?  42   VAL A HG21 2  
ATOM   10099  H HG22 . VAL A 1 49  ? 39.026  0.425   -41.160 0.02 18.64 ?  42   VAL A HG22 2  
ATOM   10100  H HG23 . VAL A 1 49  ? 37.921  0.488   -42.293 0.02 18.67 ?  42   VAL A HG23 2  
ATOM   10101  N N    . LYS A 1 50  ? 37.211  -2.752  -44.102 0.02 19.19 ?  43   LYS A N    2  
ATOM   10102  C CA   . LYS A 1 50  ? 36.589  -2.651  -45.418 0.02 19.39 ?  43   LYS A CA   2  
ATOM   10103  C C    . LYS A 1 50  ? 35.185  -2.076  -45.257 0.02 19.19 ?  43   LYS A C    2  
ATOM   10104  O O    . LYS A 1 50  ? 34.355  -2.656  -44.554 0.02 19.02 ?  43   LYS A O    2  
ATOM   10105  C CB   . LYS A 1 50  ? 36.541  -4.027  -46.100 0.02 19.67 ?  43   LYS A CB   2  
ATOM   10106  C CG   . LYS A 1 50  ? 35.917  -4.041  -47.508 0.02 19.93 ?  43   LYS A CG   2  
ATOM   10107  C CD   . LYS A 1 50  ? 35.146  -5.341  -47.833 0.02 20.18 ?  43   LYS A CD   2  
ATOM   10108  C CE   . LYS A 1 50  ? 36.067  -6.497  -48.099 0.02 20.45 ?  43   LYS A CE   2  
ATOM   10109  N NZ   . LYS A 1 50  ? 35.477  -7.503  -49.067 0.02 20.78 ?  43   LYS A NZ   2  
ATOM   10110  H H    . LYS A 1 50  ? 36.956  -3.443  -43.666 0.02 19.14 ?  43   LYS A H    2  
ATOM   10111  H HA   . LYS A 1 50  ? 37.105  -2.044  -45.967 0.02 19.51 ?  43   LYS A HA   2  
ATOM   10112  H HB2  . LYS A 1 50  ? 37.448  -4.354  -46.185 0.02 19.82 ?  43   LYS A HB2  2  
ATOM   10113  H HB3  . LYS A 1 50  ? 36.031  -4.641  -45.550 0.02 19.57 ?  43   LYS A HB3  2  
ATOM   10114  H HG2  . LYS A 1 50  ? 35.304  -3.296  -47.596 0.02 19.80 ?  43   LYS A HG2  2  
ATOM   10115  H HG3  . LYS A 1 50  ? 36.626  -3.962  -48.164 0.02 20.09 ?  43   LYS A HG3  2  
ATOM   10116  H HD2  . LYS A 1 50  ? 34.574  -5.577  -47.087 0.02 20.03 ?  43   LYS A HD2  2  
ATOM   10117  H HD3  . LYS A 1 50  ? 34.610  -5.202  -48.630 0.02 20.33 ?  43   LYS A HD3  2  
ATOM   10118  H HE2  . LYS A 1 50  ? 36.902  -6.165  -48.467 0.02 20.55 ?  43   LYS A HE2  2  
ATOM   10119  H HE3  . LYS A 1 50  ? 36.237  -6.957  -47.263 0.02 20.33 ?  43   LYS A HE3  2  
ATOM   10120  H HZ1  . LYS A 1 50  ? 34.614  -7.622  -48.891 0.02 20.71 ?  43   LYS A HZ1  2  
ATOM   10121  H HZ2  . LYS A 1 50  ? 35.561  -7.209  -49.902 0.02 20.87 ?  43   LYS A HZ2  2  
ATOM   10122  H HZ3  . LYS A 1 50  ? 35.901  -8.282  -48.994 0.02 20.98 ?  43   LYS A HZ3  2  
ATOM   10123  N N    . GLY A 1 51  ? 34.936  -0.925  -45.872 0.02 19.22 ?  44   GLY A N    2  
ATOM   10124  C CA   . GLY A 1 51  ? 33.606  -0.347  -45.934 0.02 19.09 ?  44   GLY A CA   2  
ATOM   10125  C C    . GLY A 1 51  ? 33.084  -0.272  -47.353 0.02 19.38 ?  44   GLY A C    2  
ATOM   10126  O O    . GLY A 1 51  ? 33.660  -0.880  -48.252 0.02 19.67 ?  44   GLY A O    2  
ATOM   10127  H H    . GLY A 1 51  ? 35.534  -0.447  -46.255 0.02 19.32 ?  44   GLY A H    2  
ATOM   10128  H HA2  . GLY A 1 51  ? 32.988  -0.877  -45.410 0.02 18.98 ?  44   GLY A HA2  2  
ATOM   10129  H HA3  . GLY A 1 51  ? 33.620  0.554   -45.576 0.02 18.96 ?  44   GLY A HA3  2  
ATOM   10130  N N    . VAL A 1 52  ? 32.007  0.478   -47.562 0.02 19.33 ?  45   VAL A N    2  
ATOM   10131  C CA   . VAL A 1 52  ? 31.343  0.498   -48.859 0.02 19.62 ?  45   VAL A CA   2  
ATOM   10132  C C    . VAL A 1 52  ? 30.578  1.804   -49.044 0.02 19.56 ?  45   VAL A C    2  
ATOM   10133  O O    . VAL A 1 52  ? 30.043  2.391   -48.095 0.02 19.28 ?  45   VAL A O    2  
ATOM   10134  C CB   . VAL A 1 52  ? 30.426  -0.727  -49.007 0.02 19.71 ?  45   VAL A CB   2  
ATOM   10135  C CG1  . VAL A 1 52  ? 29.289  -0.692  -47.980 0.02 19.43 ?  45   VAL A CG1  2  
ATOM   10136  C CG2  . VAL A 1 52  ? 29.881  -0.777  -50.418 0.02 20.08 ?  45   VAL A CG2  2  
ATOM   10137  H H    . VAL A 1 52  ? 31.638  0.983   -46.977 0.02 19.14 ?  45   VAL A H    2  
ATOM   10138  H HA   . VAL A 1 52  ? 32.025  0.447   -49.548 0.02 19.82 ?  45   VAL A HA   2  
ATOM   10139  H HB   . VAL A 1 52  ? 30.950  -1.528  -48.853 0.02 19.75 ?  45   VAL A HB   2  
ATOM   10140  H HG11 . VAL A 1 52  ? 28.986  -1.596  -47.823 0.02 19.46 ?  45   VAL A HG11 2  
ATOM   10141  H HG12 . VAL A 1 52  ? 29.616  -0.314  -47.149 0.02 19.21 ?  45   VAL A HG12 2  
ATOM   10142  H HG13 . VAL A 1 52  ? 28.564  -0.149  -48.327 0.02 19.48 ?  45   VAL A HG13 2  
ATOM   10143  H HG21 . VAL A 1 52  ? 29.537  -1.666  -50.594 0.02 20.19 ?  45   VAL A HG21 2  
ATOM   10144  H HG22 . VAL A 1 52  ? 29.168  -0.125  -50.499 0.02 20.05 ?  45   VAL A HG22 2  
ATOM   10145  H HG23 . VAL A 1 52  ? 30.594  -0.569  -51.038 0.02 20.25 ?  45   VAL A HG23 2  
ATOM   10146  N N    . LYS A 1 53  ? 30.536  2.274   -50.286 0.02 19.87 ?  46   LYS A N    2  
ATOM   10147  C CA   . LYS A 1 53  ? 29.704  3.417   -50.628 0.02 19.89 ?  46   LYS A CA   2  
ATOM   10148  C C    . LYS A 1 53  ? 28.248  2.997   -50.682 0.02 19.90 ?  46   LYS A C    2  
ATOM   10149  O O    . LYS A 1 53  ? 27.911  1.967   -51.264 0.02 20.12 ?  46   LYS A O    2  
ATOM   10150  C CB   . LYS A 1 53  ? 30.103  4.012   -51.986 0.02 20.27 ?  46   LYS A CB   2  
ATOM   10151  C CG   . LYS A 1 53  ? 29.226  5.223   -52.360 0.02 20.33 ?  46   LYS A CG   2  
ATOM   10152  C CD   . LYS A 1 53  ? 29.670  5.948   -53.640 0.02 20.72 ?  46   LYS A CD   2  
ATOM   10153  C CE   . LYS A 1 53  ? 30.966  6.687   -53.428 0.02 20.74 ?  46   LYS A CE   2  
ATOM   10154  N NZ   . LYS A 1 53  ? 31.354  7.372   -54.708 0.02 21.17 ?  46   LYS A NZ   2  
ATOM   10155  H H    . LYS A 1 53  ? 30.980  1.949   -50.942 0.02 20.07 ?  46   LYS A H    2  
ATOM   10156  H HA   . LYS A 1 53  ? 29.802  4.108   -49.961 0.02 19.70 ?  46   LYS A HA   2  
ATOM   10157  H HB2  . LYS A 1 53  ? 31.024  4.308   -51.949 0.02 20.29 ?  46   LYS A HB2  2  
ATOM   10158  H HB3  . LYS A 1 53  ? 29.998  3.327   -52.658 0.02 20.48 ?  46   LYS A HB3  2  
ATOM   10159  H HG2  . LYS A 1 53  ? 28.316  4.921   -52.498 0.02 20.35 ?  46   LYS A HG2  2  
ATOM   10160  H HG3  . LYS A 1 53  ? 29.253  5.863   -51.633 0.02 20.12 ?  46   LYS A HG3  2  
ATOM   10161  H HD2  . LYS A 1 53  ? 29.805  5.295   -54.343 0.02 20.95 ?  46   LYS A HD2  2  
ATOM   10162  H HD3  . LYS A 1 53  ? 28.995  6.591   -53.902 0.02 20.77 ?  46   LYS A HD3  2  
ATOM   10163  H HE2  . LYS A 1 53  ? 30.850  7.357   -52.737 0.02 20.55 ?  46   LYS A HE2  2  
ATOM   10164  H HE3  . LYS A 1 53  ? 31.666  6.062   -53.184 0.02 20.69 ?  46   LYS A HE3  2  
ATOM   10165  H HZ1  . LYS A 1 53  ? 31.006  8.189   -54.736 0.02 21.20 ?  46   LYS A HZ1  2  
ATOM   10166  H HZ2  . LYS A 1 53  ? 32.241  7.431   -54.763 0.02 21.23 ?  46   LYS A HZ2  2  
ATOM   10167  H HZ3  . LYS A 1 53  ? 31.050  6.903   -55.399 0.02 21.36 ?  46   LYS A HZ3  2  
ATOM   10168  N N    . ARG A 1 54  ? 27.382  3.824   -50.099 0.02 19.71 ?  47   ARG A N    2  
ATOM   10169  C CA   . ARG A 1 54  ? 25.943  3.639   -50.131 0.02 19.73 ?  47   ARG A CA   2  
ATOM   10170  C C    . ARG A 1 54  ? 25.288  4.896   -50.692 0.02 19.86 ?  47   ARG A C    2  
ATOM   10171  O O    . ARG A 1 54  ? 25.819  5.997   -50.570 0.02 19.80 ?  47   ARG A O    2  
ATOM   10172  C CB   . ARG A 1 54  ? 25.402  3.363   -48.707 0.02 19.38 ?  47   ARG A CB   2  
ATOM   10173  C CG   . ARG A 1 54  ? 25.987  2.153   -48.017 0.02 19.25 ?  47   ARG A CG   2  
ATOM   10174  C CD   . ARG A 1 54  ? 25.283  1.818   -46.684 0.02 18.96 ?  47   ARG A CD   2  
ATOM   10175  N NE   . ARG A 1 54  ? 25.972  0.693   -46.046 0.02 18.88 ?  47   ARG A NE   2  
ATOM   10176  C CZ   . ARG A 1 54  ? 25.785  -0.581  -46.350 0.02 19.05 ?  47   ARG A CZ   2  
ATOM   10177  N NH1  . ARG A 1 54  ? 24.887  -0.927  -47.248 0.02 19.32 ?  47   ARG A NH1  2  
ATOM   10178  N NH2  . ARG A 1 54  ? 26.496  -1.524  -45.749 0.02 18.98 ?  47   ARG A NH2  2  
ATOM   10179  H H    . ARG A 1 54  ? 27.616  4.529   -49.671 0.02 19.57 ?  47   ARG A H    2  
ATOM   10180  H HA   . ARG A 1 54  ? 25.717  2.888   -50.698 0.02 19.92 ?  47   ARG A HA   2  
ATOM   10181  H HB2  . ARG A 1 54  ? 25.600  4.140   -48.165 0.02 19.21 ?  47   ARG A HB2  2  
ATOM   10182  H HB3  . ARG A 1 54  ? 24.442  3.237   -48.765 0.02 19.42 ?  47   ARG A HB3  2  
ATOM   10183  H HG2  . ARG A 1 54  ? 25.889  1.383   -48.598 0.02 19.44 ?  47   ARG A HG2  2  
ATOM   10184  H HG3  . ARG A 1 54  ? 26.924  2.308   -47.829 0.02 19.18 ?  47   ARG A HG3  2  
ATOM   10185  H HD2  . ARG A 1 54  ? 25.333  2.587   -46.096 0.02 18.78 ?  47   ARG A HD2  2  
ATOM   10186  H HD3  . ARG A 1 54  ? 24.362  1.573   -46.854 0.02 19.04 ?  47   ARG A HD3  2  
ATOM   10187  H HE   . ARG A 1 54  ? 26.359  0.857   -45.301 0.02 18.71 ?  47   ARG A HE   2  
ATOM   10188  H HH11 . ARG A 1 54  ? 24.428  -0.327  -47.652 0.02 19.38 ?  47   ARG A HH11 2  
ATOM   10189  H HH12 . ARG A 1 54  ? 24.768  -1.757  -47.430 0.02 19.44 ?  47   ARG A HH12 2  
ATOM   10190  H HH21 . ARG A 1 54  ? 27.073  -1.306  -45.155 0.02 18.82 ?  47   ARG A HH21 2  
ATOM   10191  H HH22 . ARG A 1 54  ? 26.354  -2.351  -45.933 0.02 19.11 ?  47   ARG A HH22 2  
ATOM   10192  N N    . LEU A 1 55  ? 24.116  4.733   -51.296 0.02 20.07 ?  48   LEU A N    2  
ATOM   10193  C CA   . LEU A 1 55  ? 23.335  5.862   -51.775 0.02 20.22 ?  48   LEU A CA   2  
ATOM   10194  C C    . LEU A 1 55  ? 22.230  6.202   -50.786 0.02 19.97 ?  48   LEU A C    2  
ATOM   10195  O O    . LEU A 1 55  ? 21.967  5.462   -49.844 0.02 19.74 ?  48   LEU A O    2  
ATOM   10196  C CB   . LEU A 1 55  ? 22.735  5.536   -53.143 0.02 20.65 ?  48   LEU A CB   2  
ATOM   10197  C CG   . LEU A 1 55  ? 23.710  4.788   -54.054 0.02 20.94 ?  48   LEU A CG   2  
ATOM   10198  C CD1  . LEU A 1 55  ? 23.023  4.513   -55.380 0.02 21.39 ?  48   LEU A CD1  2  
ATOM   10199  C CD2  . LEU A 1 55  ? 24.996  5.579   -54.224 0.02 20.99 ?  48   LEU A CD2  2  
ATOM   10200  H H    . LEU A 1 55  ? 23.756  3.968   -51.449 0.02 20.15 ?  48   LEU A H    2  
ATOM   10201  H HA   . LEU A 1 55  ? 23.904  6.640   -51.869 0.02 20.24 ?  48   LEU A HA   2  
ATOM   10202  H HB2  . LEU A 1 55  ? 21.955  4.976   -53.023 0.02 20.65 ?  48   LEU A HB2  2  
ATOM   10203  H HB3  . LEU A 1 55  ? 22.486  6.365   -53.579 0.02 20.79 ?  48   LEU A HB3  2  
ATOM   10204  H HG   . LEU A 1 55  ? 23.929  3.936   -53.649 0.02 20.84 ?  48   LEU A HG   2  
ATOM   10205  H HD11 . LEU A 1 55  ? 22.238  5.079   -55.453 0.02 21.45 ?  48   LEU A HD11 2  
ATOM   10206  H HD12 . LEU A 1 55  ? 23.641  4.701   -56.102 0.02 21.61 ?  48   LEU A HD12 2  
ATOM   10207  H HD13 . LEU A 1 55  ? 22.757  3.581   -55.406 0.02 21.42 ?  48   LEU A HD13 2  
ATOM   10208  H HD21 . LEU A 1 55  ? 25.541  5.155   -54.907 0.02 21.19 ?  48   LEU A HD21 2  
ATOM   10209  H HD22 . LEU A 1 55  ? 24.776  6.487   -54.486 0.02 21.11 ?  48   LEU A HD22 2  
ATOM   10210  H HD23 . LEU A 1 55  ? 25.472  5.586   -53.378 0.02 20.72 ?  48   LEU A HD23 2  
ATOM   10211  N N    . THR A 1 56  ? 21.592  7.342   -51.008 0.02 20.05 ?  49   THR A N    2  
ATOM   10212  C CA   . THR A 1 56  ? 20.418  7.723   -50.237 0.02 19.90 ?  49   THR A CA   2  
ATOM   10213  C C    . THR A 1 56  ? 19.228  7.848   -51.176 0.02 20.25 ?  49   THR A C    2  
ATOM   10214  O O    . THR A 1 56  ? 19.369  7.834   -52.404 0.02 20.59 ?  49   THR A O    2  
ATOM   10215  C CB   . THR A 1 56  ? 20.628  9.047   -49.472 0.02 19.68 ?  49   THR A CB   2  
ATOM   10216  O OG1  . THR A 1 56  ? 20.622  10.153  -50.377 0.02 19.94 ?  49   THR A OG1  2  
ATOM   10217  C CG2  . THR A 1 56  ? 21.930  9.041   -48.729 0.02 19.41 ?  49   THR A CG2  2  
ATOM   10218  H H    . THR A 1 56  ? 21.813  7.912   -51.607 0.02 20.20 ?  49   THR A H    2  
ATOM   10219  H HA   . THR A 1 56  ? 20.219  7.027   -49.595 0.02 19.74 ?  49   THR A HA   2  
ATOM   10220  H HB   . THR A 1 56  ? 19.915  9.162   -48.827 0.02 19.55 ?  49   THR A HB   2  
ATOM   10221  H HG1  . THR A 1 56  ? 20.916  10.840  -50.000 0.02 19.84 ?  49   THR A HG1  2  
ATOM   10222  H HG21 . THR A 1 56  ? 21.873  9.617   -47.952 0.02 19.22 ?  49   THR A HG21 2  
ATOM   10223  H HG22 . THR A 1 56  ? 22.140  8.137   -48.439 0.02 19.33 ?  49   THR A HG22 2  
ATOM   10224  H HG23 . THR A 1 56  ? 22.643  9.360   -49.303 0.02 19.53 ?  49   THR A HG23 2  
ATOM   10225  N N    . VAL A 1 57  ? 18.037  7.979   -50.585 0.02 20.18 ?  50   VAL A N    2  
ATOM   10226  C CA   . VAL A 1 57  ? 16.849  8.214   -51.393 0.02 20.53 ?  50   VAL A CA   2  
ATOM   10227  C C    . VAL A 1 57  ? 16.864  9.592   -52.036 0.02 20.72 ?  50   VAL A C    2  
ATOM   10228  O O    . VAL A 1 57  ? 16.147  9.808   -53.023 0.02 21.09 ?  50   VAL A O    2  
ATOM   10229  C CB   . VAL A 1 57  ? 15.551  8.031   -50.583 0.02 20.46 ?  50   VAL A CB   2  
ATOM   10230  C CG1  . VAL A 1 57  ? 15.507  6.648   -49.922 0.02 20.32 ?  50   VAL A CG1  2  
ATOM   10231  C CG2  . VAL A 1 57  ? 15.354  9.176   -49.592 0.02 20.20 ?  50   VAL A CG2  2  
ATOM   10232  H H    . VAL A 1 57  ? 17.894  7.943   -49.739 0.02 19.96 ?  50   VAL A H    2  
ATOM   10233  H HA   . VAL A 1 57  ? 16.832  7.561   -52.108 0.02 20.75 ?  50   VAL A HA   2  
ATOM   10234  H HB   . VAL A 1 57  ? 14.811  8.070   -51.210 0.02 20.73 ?  50   VAL A HB   2  
ATOM   10235  H HG11 . VAL A 1 57  ? 14.583  6.368   -49.842 0.02 20.41 ?  50   VAL A HG11 2  
ATOM   10236  H HG12 . VAL A 1 57  ? 15.992  6.016   -50.475 0.02 20.45 ?  50   VAL A HG12 2  
ATOM   10237  H HG13 . VAL A 1 57  ? 15.920  6.697   -49.045 0.02 20.03 ?  50   VAL A HG13 2  
ATOM   10238  H HG21 . VAL A 1 57  ? 14.628  8.948   -48.992 0.02 20.21 ?  50   VAL A HG21 2  
ATOM   10239  H HG22 . VAL A 1 57  ? 16.172  9.307   -49.088 0.02 19.93 ?  50   VAL A HG22 2  
ATOM   10240  H HG23 . VAL A 1 57  ? 15.136  9.984   -50.080 0.02 20.32 ?  50   VAL A HG23 2  
ATOM   10241  N N    . TYR A 1 58  ? 17.687  10.515  -51.540 0.02 20.51 ?  51   TYR A N    2  
ATOM   10242  C CA   . TYR A 1 58  ? 17.890  11.802  -52.189 0.02 20.71 ?  51   TYR A CA   2  
ATOM   10243  C C    . TYR A 1 58  ? 18.995  11.742  -53.231 0.02 20.94 ?  51   TYR A C    2  
ATOM   10244  O O    . TYR A 1 58  ? 19.435  12.787  -53.726 0.02 21.12 ?  51   TYR A O    2  
ATOM   10245  C CB   . TYR A 1 58  ? 18.198  12.883  -51.152 0.02 20.42 ?  51   TYR A CB   2  
ATOM   10246  C CG   . TYR A 1 58  ? 17.028  13.169  -50.243 0.02 20.28 ?  51   TYR A CG   2  
ATOM   10247  C CD1  . TYR A 1 58  ? 15.945  13.910  -50.696 0.02 20.54 ?  51   TYR A CD1  2  
ATOM   10248  C CD2  . TYR A 1 58  ? 17.001  12.708  -48.956 0.02 19.91 ?  51   TYR A CD2  2  
ATOM   10249  C CE1  . TYR A 1 58  ? 14.877  14.175  -49.893 0.02 20.44 ?  51   TYR A CE1  2  
ATOM   10250  C CE2  . TYR A 1 58  ? 15.922  12.971  -48.141 0.02 19.81 ?  51   TYR A CE2  2  
ATOM   10251  C CZ   . TYR A 1 58  ? 14.873  13.705  -48.610 0.02 20.08 ?  51   TYR A CZ   2  
ATOM   10252  O OH   . TYR A 1 58  ? 13.786  13.961  -47.797 0.02 20.01 ?  51   TYR A OH   2  
ATOM   10253  H H    . TYR A 1 58  ? 18.153  10.411  -50.829 0.02 20.27 ?  51   TYR A H    2  
ATOM   10254  H HA   . TYR A 1 58  ? 17.071  12.055  -52.647 0.02 20.93 ?  51   TYR A HA   2  
ATOM   10255  H HB2  . TYR A 1 58  ? 18.942  12.596  -50.602 0.02 20.20 ?  51   TYR A HB2  2  
ATOM   10256  H HB3  . TYR A 1 58  ? 18.421  13.704  -51.612 0.02 20.58 ?  51   TYR A HB3  2  
ATOM   10257  H HD1  . TYR A 1 58  ? 15.946  14.231  -51.567 0.02 20.81 ?  51   TYR A HD1  2  
ATOM   10258  H HD2  . TYR A 1 58  ? 17.713  12.210  -48.629 0.02 19.74 ?  51   TYR A HD2  2  
ATOM   10259  H HE1  . TYR A 1 58  ? 14.160  14.671  -50.213 0.02 20.64 ?  51   TYR A HE1  2  
ATOM   10260  H HE2  . TYR A 1 58  ? 15.914  12.652  -47.266 0.02 19.58 ?  51   TYR A HE2  2  
ATOM   10261  H HH   . TYR A 1 58  ? 13.928  13.645  -47.034 0.02 19.79 ?  51   TYR A HH   2  
ATOM   10262  N N    . ASP A 1 59  ? 19.446  10.539  -53.562 0.02 20.96 ?  52   ASP A N    2  
ATOM   10263  C CA   . ASP A 1 59  ? 20.514  10.289  -54.518 0.02 21.22 ?  52   ASP A CA   2  
ATOM   10264  C C    . ASP A 1 59  ? 21.839  10.945  -54.130 0.02 21.03 ?  52   ASP A C    2  
ATOM   10265  O O    . ASP A 1 59  ? 22.668  11.217  -54.995 0.02 21.24 ?  52   ASP A O    2  
ATOM   10266  C CB   . ASP A 1 59  ? 20.056  10.713  -55.922 0.02 21.69 ?  52   ASP A CB   2  
ATOM   10267  C CG   . ASP A 1 59  ? 18.731  10.035  -56.337 0.02 21.96 ?  52   ASP A CG   2  
ATOM   10268  O OD1  . ASP A 1 59  ? 17.774  10.739  -56.730 0.02 22.26 ?  52   ASP A OD1  2  
ATOM   10269  O OD2  . ASP A 1 59  ? 18.635  8.797   -56.255 0.02 21.87 -1 52   ASP A OD2  2  
ATOM   10270  H H    . ASP A 1 59  ? 19.124  9.813   -53.238 0.02 20.83 ?  52   ASP A H    2  
ATOM   10271  H HA   . ASP A 1 59  ? 20.674  9.333   -54.541 0.02 21.25 ?  52   ASP A HA   2  
ATOM   10272  H HB2  . ASP A 1 59  ? 19.930  11.673  -55.940 0.02 21.69 ?  52   ASP A HB2  2  
ATOM   10273  H HB3  . ASP A 1 59  ? 20.737  10.457  -56.565 0.02 21.86 ?  52   ASP A HB3  2  
ATOM   10274  N N    . ASP A 1 60  ? 22.085  11.179  -52.838 0.02 20.65 ?  53   ASP A N    2  
ATOM   10275  C CA   . ASP A 1 60  ? 23.444  11.421  -52.350 0.02 20.48 ?  53   ASP A CA   2  
ATOM   10276  C C    . ASP A 1 60  ? 24.175  10.093  -52.173 0.02 20.30 ?  53   ASP A C    2  
ATOM   10277  O O    . ASP A 1 60  ? 23.604  9.027   -52.368 0.02 20.31 ?  53   ASP A O    2  
ATOM   10278  C CB   . ASP A 1 60  ? 23.444  12.156  -51.014 0.02 20.18 ?  53   ASP A CB   2  
ATOM   10279  C CG   . ASP A 1 60  ? 22.770  13.500  -51.083 0.02 20.39 ?  53   ASP A CG   2  
ATOM   10280  O OD1  . ASP A 1 60  ? 21.963  13.772  -50.196 0.02 20.56 ?  53   ASP A OD1  2  
ATOM   10281  O OD2  . ASP A 1 60  ? 23.043  14.300  -52.007 0.02 20.44 -1 53   ASP A OD2  2  
ATOM   10282  H H    . ASP A 1 60  ? 21.479  11.207  -52.230 0.02 20.51 ?  53   ASP A H    2  
ATOM   10283  H HA   . ASP A 1 60  ? 23.931  11.958  -52.992 0.02 20.70 ?  53   ASP A HA   2  
ATOM   10284  H HB2  . ASP A 1 60  ? 22.981  11.611  -50.360 0.02 19.97 ?  53   ASP A HB2  2  
ATOM   10285  H HB3  . ASP A 1 60  ? 24.363  12.300  -50.734 0.02 20.11 ?  53   ASP A HB3  2  
ATOM   10286  N N    . SER A 1 61  ? 25.444  10.162  -51.769 0.02 20.19 ?  54   SER A N    2  
ATOM   10287  C CA   . SER A 1 61  ? 26.224  8.958   -51.493 0.02 20.07 ?  54   SER A CA   2  
ATOM   10288  C C    . SER A 1 61  ? 27.225  9.215   -50.386 0.02 19.74 ?  54   SER A C    2  
ATOM   10289  O O    . SER A 1 61  ? 27.654  10.340  -50.172 0.02 19.71 ?  54   SER A O    2  
ATOM   10290  C CB   . SER A 1 61  ? 27.001  8.458   -52.708 0.02 20.39 ?  54   SER A CB   2  
ATOM   10291  O OG   . SER A 1 61  ? 27.863  9.457   -53.216 0.02 20.78 ?  54   SER A OG   2  
ATOM   10292  H H    . SER A 1 61  ? 25.877  10.895  -51.653 0.02 20.19 ?  54   SER A H    2  
ATOM   10293  H HA   . SER A 1 61  ? 25.628  8.253   -51.200 0.02 19.99 ?  54   SER A HA   2  
ATOM   10294  H HB2  . SER A 1 61  ? 27.541  7.703   -52.432 0.02 20.32 ?  54   SER A HB2  2  
ATOM   10295  H HB3  . SER A 1 61  ? 26.377  8.187   -53.400 0.02 20.40 ?  54   SER A HB3  2  
ATOM   10296  H HG   . SER A 1 61  ? 27.777  9.491   -54.051 0.02 20.95 ?  54   SER A HG   2  
ATOM   10297  N N    . TYR A 1 62  ? 27.622  8.135   -49.713 0.02 19.55 ?  55   TYR A N    2  
ATOM   10298  C CA   . TYR A 1 62  ? 28.565  8.214   -48.607 0.02 19.27 ?  55   TYR A CA   2  
ATOM   10299  C C    . TYR A 1 62  ? 29.252  6.873   -48.424 0.02 19.23 ?  55   TYR A C    2  
ATOM   10300  O O    . TYR A 1 62  ? 28.706  5.828   -48.769 0.02 19.32 ?  55   TYR A O    2  
ATOM   10301  C CB   . TYR A 1 62  ? 27.851  8.628   -47.313 0.02 18.95 ?  55   TYR A CB   2  
ATOM   10302  C CG   . TYR A 1 62  ? 26.827  7.639   -46.835 0.02 18.82 ?  55   TYR A CG   2  
ATOM   10303  C CD1  . TYR A 1 62  ? 25.551  7.646   -47.349 0.02 18.95 ?  55   TYR A CD1  2  
ATOM   10304  C CD2  . TYR A 1 62  ? 27.128  6.728   -45.837 0.02 18.60 ?  55   TYR A CD2  2  
ATOM   10305  C CE1  . TYR A 1 62  ? 24.601  6.730   -46.928 0.02 18.87 ?  55   TYR A CE1  2  
ATOM   10306  C CE2  . TYR A 1 62  ? 26.193  5.821   -45.400 0.02 18.51 ?  55   TYR A CE2  2  
ATOM   10307  C CZ   . TYR A 1 62  ? 24.927  5.835   -45.945 0.02 18.65 ?  55   TYR A CZ   2  
ATOM   10308  O OH   . TYR A 1 62  ? 23.964  4.950   -45.541 0.02 18.61 ?  55   TYR A OH   2  
ATOM   10309  H H    . TYR A 1 62  ? 27.353  7.337   -49.875 0.02 19.58 ?  55   TYR A H    2  
ATOM   10310  H HA   . TYR A 1 62  ? 29.248  8.868   -48.812 0.02 19.35 ?  55   TYR A HA   2  
ATOM   10311  H HB2  . TYR A 1 62  ? 28.508  8.736   -46.609 0.02 18.79 ?  55   TYR A HB2  2  
ATOM   10312  H HB3  . TYR A 1 62  ? 27.391  9.466   -47.470 0.02 19.00 ?  55   TYR A HB3  2  
ATOM   10313  H HD1  . TYR A 1 62  ? 25.337  8.250   -48.023 0.02 19.12 ?  55   TYR A HD1  2  
ATOM   10314  H HD2  . TYR A 1 62  ? 27.983  6.716   -45.474 0.02 18.52 ?  55   TYR A HD2  2  
ATOM   10315  H HE1  . TYR A 1 62  ? 23.747  6.734   -47.287 0.02 18.98 ?  55   TYR A HE1  2  
ATOM   10316  H HE2  . TYR A 1 62  ? 26.413  5.208   -44.739 0.02 18.38 ?  55   TYR A HE2  2  
ATOM   10317  H HH   . TYR A 1 62  ? 24.252  4.487   -44.903 0.02 18.48 ?  55   TYR A HH   2  
ATOM   10318  N N    . TYR A 1 63  ? 30.452  6.899   -47.864 0.02 19.12 ?  56   TYR A N    2  
ATOM   10319  C CA   . TYR A 1 63  ? 31.091  5.656   -47.482 0.02 19.06 ?  56   TYR A CA   2  
ATOM   10320  C C    . TYR A 1 63  ? 30.667  5.299   -46.071 0.02 18.72 ?  56   TYR A C    2  
ATOM   10321  O O    . TYR A 1 63  ? 30.472  6.185   -45.237 0.02 18.51 ?  56   TYR A O    2  
ATOM   10322  C CB   . TYR A 1 63  ? 32.607  5.761   -47.587 0.02 19.16 ?  56   TYR A CB   2  
ATOM   10323  C CG   . TYR A 1 63  ? 33.059  5.969   -49.014 0.02 19.53 ?  56   TYR A CG   2  
ATOM   10324  C CD1  . TYR A 1 63  ? 33.265  4.891   -49.854 0.02 19.80 ?  56   TYR A CD1  2  
ATOM   10325  C CD2  . TYR A 1 63  ? 33.277  7.240   -49.496 0.02 19.65 ?  56   TYR A CD2  2  
ATOM   10326  C CE1  . TYR A 1 63  ? 33.683  5.079   -51.161 0.02 20.17 ?  56   TYR A CE1  2  
ATOM   10327  C CE2  . TYR A 1 63  ? 33.684  7.444   -50.804 0.02 20.03 ?  56   TYR A CE2  2  
ATOM   10328  C CZ   . TYR A 1 63  ? 33.880  6.375   -51.616 0.02 20.29 ?  56   TYR A CZ   2  
ATOM   10329  O OH   . TYR A 1 63  ? 34.305  6.616   -52.905 0.02 20.69 ?  56   TYR A OH   2  
ATOM   10330  H H    . TYR A 1 63  ? 30.903  7.607   -47.694 0.02 19.10 ?  56   TYR A H    2  
ATOM   10331  H HA   . TYR A 1 63  ? 30.796  4.945   -48.068 0.02 19.20 ?  56   TYR A HA   2  
ATOM   10332  H HB2  . TYR A 1 63  ? 32.911  6.518   -47.064 0.02 19.03 ?  56   TYR A HB2  2  
ATOM   10333  H HB3  . TYR A 1 63  ? 33.004  4.940   -47.262 0.02 19.15 ?  56   TYR A HB3  2  
ATOM   10334  H HD1  . TYR A 1 63  ? 33.123  4.030   -49.537 0.02 19.75 ?  56   TYR A HD1  2  
ATOM   10335  H HD2  . TYR A 1 63  ? 33.136  7.972   -48.941 0.02 19.49 ?  56   TYR A HD2  2  
ATOM   10336  H HE1  . TYR A 1 63  ? 33.819  4.353   -51.722 0.02 20.36 ?  56   TYR A HE1  2  
ATOM   10337  H HE2  . TYR A 1 63  ? 33.829  8.308   -51.118 0.02 20.12 ?  56   TYR A HE2  2  
ATOM   10338  H HH   . TYR A 1 63  ? 34.165  7.420   -53.103 0.02 20.75 ?  56   TYR A HH   2  
ATOM   10339  N N    . SER A 1 64  ? 30.548  3.995   -45.830 0.02 18.70 ?  57   SER A N    2  
ATOM   10340  C CA   . SER A 1 64  ? 29.922  3.422   -44.642 0.02 18.44 ?  57   SER A CA   2  
ATOM   10341  C C    . SER A 1 64  ? 30.838  2.358   -44.066 0.02 18.40 ?  57   SER A C    2  
ATOM   10342  O O    . SER A 1 64  ? 31.183  1.400   -44.753 0.02 18.60 ?  57   SER A O    2  
ATOM   10343  C CB   . SER A 1 64  ? 28.573  2.800   -45.012 0.02 18.51 ?  57   SER A CB   2  
ATOM   10344  O OG   . SER A 1 64  ? 27.936  2.209   -43.884 0.02 18.32 ?  57   SER A OG   2  
ATOM   10345  H H    . SER A 1 64  ? 30.841  3.390   -46.364 0.02 18.85 ?  57   SER A H    2  
ATOM   10346  H HA   . SER A 1 64  ? 29.786  4.121   -43.986 0.02 18.27 ?  57   SER A HA   2  
ATOM   10347  H HB2  . SER A 1 64  ? 27.998  3.489   -45.379 0.02 18.51 ?  57   SER A HB2  2  
ATOM   10348  H HB3  . SER A 1 64  ? 28.719  2.110   -45.677 0.02 18.71 ?  57   SER A HB3  2  
ATOM   10349  H HG   . SER A 1 64  ? 27.577  1.486   -44.106 0.02 18.42 ?  57   SER A HG   2  
ATOM   10350  N N    . PHE A 1 65  ? 31.213  2.501   -42.798 0.02 18.16 ?  58   PHE A N    2  
ATOM   10351  C CA   . PHE A 1 65  ? 31.945  1.470   -42.081 0.02 18.11 ?  58   PHE A CA   2  
ATOM   10352  C C    . PHE A 1 65  ? 31.147  1.184   -40.820 0.02 17.86 ?  58   PHE A C    2  
ATOM   10353  O O    . PHE A 1 65  ? 30.967  2.084   -40.001 0.02 17.68 ?  58   PHE A O    2  
ATOM   10354  C CB   . PHE A 1 65  ? 33.357  1.920   -41.687 0.02 18.10 ?  58   PHE A CB   2  
ATOM   10355  C CG   . PHE A 1 65  ? 34.234  2.314   -42.828 0.02 18.35 ?  58   PHE A CG   2  
ATOM   10356  C CD1  . PHE A 1 65  ? 34.173  3.595   -43.333 0.02 18.40 ?  58   PHE A CD1  2  
ATOM   10357  C CD2  . PHE A 1 65  ? 35.169  1.440   -43.345 0.02 18.56 ?  58   PHE A CD2  2  
ATOM   10358  C CE1  . PHE A 1 65  ? 34.979  3.998   -44.384 0.02 18.67 ?  58   PHE A CE1  2  
ATOM   10359  C CE2  . PHE A 1 65  ? 35.996  1.832   -44.412 0.02 18.83 ?  58   PHE A CE2  2  
ATOM   10360  C CZ   . PHE A 1 65  ? 35.893  3.123   -44.911 0.02 18.88 ?  58   PHE A CZ   2  
ATOM   10361  H H    . PHE A 1 65  ? 31.051  3.200   -42.330 0.02 18.04 ?  58   PHE A H    2  
ATOM   10362  H HA   . PHE A 1 65  ? 32.004  0.662   -42.608 0.02 18.25 ?  58   PHE A HA   2  
ATOM   10363  H HB2  . PHE A 1 65  ? 33.273  2.692   -41.108 0.02 17.96 ?  58   PHE A HB2  2  
ATOM   10364  H HB3  . PHE A 1 65  ? 33.789  1.194   -41.214 0.02 18.09 ?  58   PHE A HB3  2  
ATOM   10365  H HD1  . PHE A 1 65  ? 33.551  4.189   -42.983 0.02 18.28 ?  58   PHE A HD1  2  
ATOM   10366  H HD2  . PHE A 1 65  ? 35.229  0.577   -43.009 0.02 18.55 ?  58   PHE A HD2  2  
ATOM   10367  H HE1  . PHE A 1 65  ? 34.910  4.862   -44.716 0.02 18.72 ?  58   PHE A HE1  2  
ATOM   10368  H HE2  . PHE A 1 65  ? 36.615  1.239   -44.766 0.02 18.99 ?  58   PHE A HE2  2  
ATOM   10369  H HZ   . PHE A 1 65  ? 36.437  3.397   -45.611 0.02 19.07 ?  58   PHE A HZ   2  
ATOM   10370  N N    . GLU A 1 66  ? 30.664  -0.043  -40.681 0.02 17.90 ?  59   GLU A N    2  
ATOM   10371  C CA   . GLU A 1 66  ? 29.887  -0.437  -39.514 0.02 17.72 ?  59   GLU A CA   2  
ATOM   10372  C C    . GLU A 1 66  ? 30.543  -1.619  -38.820 0.02 17.72 ?  59   GLU A C    2  
ATOM   10373  O O    . GLU A 1 66  ? 31.192  -2.446  -39.448 0.02 17.92 ?  59   GLU A O    2  
ATOM   10374  C CB   . GLU A 1 66  ? 28.448  -0.796  -39.933 0.02 17.79 ?  59   GLU A CB   2  
ATOM   10375  C CG   . GLU A 1 66  ? 27.704  0.369   -40.536 0.02 17.77 ?  59   GLU A CG   2  
ATOM   10376  C CD   . GLU A 1 66  ? 26.367  -0.013  -41.106 0.02 17.91 ?  59   GLU A CD   2  
ATOM   10377  O OE1  . GLU A 1 66  ? 26.333  -0.635  -42.201 0.02 18.17 ?  59   GLU A OE1  2  
ATOM   10378  O OE2  . GLU A 1 66  ? 25.354  0.308   -40.455 0.02 17.80 -1 59   GLU A OE2  2  
ATOM   10379  H H    . GLU A 1 66  ? 30.761  -0.672  -41.253 0.02 18.05 ?  59   GLU A H    2  
ATOM   10380  H HA   . GLU A 1 66  ? 29.855  0.300   -38.888 0.02 17.57 ?  59   GLU A HA   2  
ATOM   10381  H HB2  . GLU A 1 66  ? 28.466  -1.520  -40.575 0.02 17.97 ?  59   GLU A HB2  2  
ATOM   10382  H HB3  . GLU A 1 66  ? 27.961  -1.074  -39.143 0.02 17.70 ?  59   GLU A HB3  2  
ATOM   10383  H HG2  . GLU A 1 66  ? 27.559  1.041   -39.854 0.02 17.61 ?  59   GLU A HG2  2  
ATOM   10384  H HG3  . GLU A 1 66  ? 28.233  0.740   -41.257 0.02 17.86 ?  59   GLU A HG3  2  
ATOM   10385  N N    . GLY A 1 67  ? 30.355  -1.715  -37.502 0.02 17.53 ?  60   GLY A N    2  
ATOM   10386  C CA   . GLY A 1 67  ? 30.908  -2.852  -36.806 0.02 17.56 ?  60   GLY A CA   2  
ATOM   10387  C C    . GLY A 1 67  ? 32.392  -2.767  -36.563 0.02 17.59 ?  60   GLY A C    2  
ATOM   10388  O O    . GLY A 1 67  ? 33.077  -3.797  -36.571 0.02 17.73 ?  60   GLY A O    2  
ATOM   10389  H H    . GLY A 1 67  ? 29.934  -1.149  -37.018 0.02 17.40 ?  60   GLY A H    2  
ATOM   10390  H HA2  . GLY A 1 67  ? 30.474  -2.944  -35.942 0.02 17.44 ?  60   GLY A HA2  2  
ATOM   10391  H HA3  . GLY A 1 67  ? 30.735  -3.654  -37.321 0.02 17.71 ?  60   GLY A HA3  2  
ATOM   10392  N N    . ILE A 1 68  ? 32.900  -1.567  -36.316 0.02 17.48 ?  61   ILE A N    2  
ATOM   10393  C CA   . ILE A 1 68  ? 34.297  -1.364  -35.953 0.02 17.51 ?  61   ILE A CA   2  
ATOM   10394  C C    . ILE A 1 68  ? 34.426  -1.592  -34.452 0.02 17.37 ?  61   ILE A C    2  
ATOM   10395  O O    . ILE A 1 68  ? 33.846  -0.824  -33.671 0.02 17.19 ?  61   ILE A O    2  
ATOM   10396  C CB   . ILE A 1 68  ? 34.776  0.036   -36.337 0.02 17.50 ?  61   ILE A CB   2  
ATOM   10397  C CG1  . ILE A 1 68  ? 34.572  0.281   -37.833 0.02 17.67 ?  61   ILE A CG1  2  
ATOM   10398  C CG2  . ILE A 1 68  ? 36.285  0.222   -36.007 0.02 17.58 ?  61   ILE A CG2  2  
ATOM   10399  C CD1  . ILE A 1 68  ? 34.597  1.714   -38.174 0.02 17.74 ?  61   ILE A CD1  2  
ATOM   10400  H H    . ILE A 1 68  ? 32.445  -0.841  -36.351 0.02 17.41 ?  61   ILE A H    2  
ATOM   10401  H HA   . ILE A 1 68  ? 34.843  -2.012  -36.420 0.02 17.66 ?  61   ILE A HA   2  
ATOM   10402  H HB   . ILE A 1 68  ? 34.257  0.687   -35.845 0.02 17.36 ?  61   ILE A HB   2  
ATOM   10403  H HG12 . ILE A 1 68  ? 35.286  -0.153  -38.319 0.02 17.81 ?  61   ILE A HG12 2  
ATOM   10404  H HG13 . ILE A 1 68  ? 33.716  -0.074  -38.112 0.02 17.62 ?  61   ILE A HG13 2  
ATOM   10405  H HG21 . ILE A 1 68  ? 36.363  0.761   -35.206 0.02 17.55 ?  61   ILE A HG21 2  
ATOM   10406  H HG22 . ILE A 1 68  ? 36.692  -0.647  -35.866 0.02 17.51 ?  61   ILE A HG22 2  
ATOM   10407  H HG23 . ILE A 1 68  ? 36.719  0.678   -36.744 0.02 17.74 ?  61   ILE A HG23 2  
ATOM   10408  H HD11 . ILE A 1 68  ? 34.294  1.822   -39.091 0.02 17.85 ?  61   ILE A HD11 2  
ATOM   10409  H HD12 . ILE A 1 68  ? 34.009  2.194   -37.569 0.02 17.61 ?  61   ILE A HD12 2  
ATOM   10410  H HD13 . ILE A 1 68  ? 35.506  2.039   -38.084 0.02 17.82 ?  61   ILE A HD13 2  
ATOM   10411  N N    . PRO A 1 69  ? 35.179  -2.593  -33.998 0.02 17.47 ?  62   PRO A N    2  
ATOM   10412  C CA   . PRO A 1 69  ? 35.299  -2.806  -32.549 0.02 17.36 ?  62   PRO A CA   2  
ATOM   10413  C C    . PRO A 1 69  ? 36.185  -1.758  -31.911 0.02 17.30 ?  62   PRO A C    2  
ATOM   10414  O O    . PRO A 1 69  ? 37.226  -1.397  -32.446 0.02 17.42 ?  62   PRO A O    2  
ATOM   10415  C CB   . PRO A 1 69  ? 35.925  -4.199  -32.440 0.02 17.54 ?  62   PRO A CB   2  
ATOM   10416  C CG   . PRO A 1 69  ? 36.706  -4.349  -33.686 0.02 17.74 ?  62   PRO A CG   2  
ATOM   10417  C CD   . PRO A 1 69  ? 35.943  -3.600  -34.756 0.02 17.70 ?  62   PRO A CD   2  
ATOM   10418  H HA   . PRO A 1 69  ? 34.429  -2.804  -32.121 0.02 17.26 ?  62   PRO A HA   2  
ATOM   10419  H HB2  . PRO A 1 69  ? 36.502  -4.237  -31.665 0.02 17.53 ?  62   PRO A HB2  2  
ATOM   10420  H HB3  . PRO A 1 69  ? 35.229  -4.870  -32.388 0.02 17.56 ?  62   PRO A HB3  2  
ATOM   10421  H HG2  . PRO A 1 69  ? 37.586  -3.963  -33.557 0.02 17.75 ?  62   PRO A HG2  2  
ATOM   10422  H HG3  . PRO A 1 69  ? 36.782  -5.290  -33.909 0.02 17.87 ?  62   PRO A HG3  2  
ATOM   10423  H HD2  . PRO A 1 69  ? 36.557  -3.164  -35.366 0.02 17.78 ?  62   PRO A HD2  2  
ATOM   10424  H HD3  . PRO A 1 69  ? 35.345  -4.201  -35.225 0.02 17.77 ?  62   PRO A HD3  2  
ATOM   10425  N N    . TYR A 1 70  ? 35.759  -1.263  -30.747 0.02 17.14 ?  63   TYR A N    2  
ATOM   10426  C CA   . TYR A 1 70  ? 36.585  -0.361  -29.964 0.02 17.11 ?  63   TYR A CA   2  
ATOM   10427  C C    . TYR A 1 70  ? 36.930  -0.940  -28.605 0.02 17.12 ?  63   TYR A C    2  
ATOM   10428  O O    . TYR A 1 70  ? 37.663  -0.303  -27.858 0.02 17.13 ?  63   TYR A O    2  
ATOM   10429  C CB   . TYR A 1 70  ? 35.907  1.014   -29.793 0.02 16.95 ?  63   TYR A CB   2  
ATOM   10430  C CG   . TYR A 1 70  ? 34.637  1.060   -28.950 0.02 16.79 ?  63   TYR A CG   2  
ATOM   10431  C CD1  . TYR A 1 70  ? 34.711  1.122   -27.575 0.02 16.74 ?  63   TYR A CD1  2  
ATOM   10432  C CD2  . TYR A 1 70  ? 33.389  1.099   -29.535 0.02 16.72 ?  63   TYR A CD2  2  
ATOM   10433  C CE1  . TYR A 1 70  ? 33.580  1.185   -26.808 0.02 16.62 ?  63   TYR A CE1  2  
ATOM   10434  C CE2  . TYR A 1 70  ? 32.232  1.130   -28.761 0.02 16.61 ?  63   TYR A CE2  2  
ATOM   10435  C CZ   . TYR A 1 70  ? 32.345  1.188   -27.400 0.02 16.56 ?  63   TYR A CZ   2  
ATOM   10436  O OH   . TYR A 1 70  ? 31.209  1.254   -26.631 0.02 16.47 ?  63   TYR A OH   2  
ATOM   10437  H H    . TYR A 1 70  ? 34.999  -1.446  -30.395 0.02 17.06 ?  63   TYR A H    2  
ATOM   10438  H HA   . TYR A 1 70  ? 37.423  -0.214  -30.425 0.02 17.21 ?  63   TYR A HA   2  
ATOM   10439  H HB2  . TYR A 1 70  ? 36.540  1.620   -29.381 0.02 16.96 ?  63   TYR A HB2  2  
ATOM   10440  H HB3  . TYR A 1 70  ? 35.672  1.345   -30.674 0.02 16.96 ?  63   TYR A HB3  2  
ATOM   10441  H HD1  . TYR A 1 70  ? 35.544  1.111   -27.164 0.02 16.80 ?  63   TYR A HD1  2  
ATOM   10442  H HD2  . TYR A 1 70  ? 33.320  1.054   -30.461 0.02 16.77 ?  63   TYR A HD2  2  
ATOM   10443  H HE1  . TYR A 1 70  ? 33.651  1.209   -25.880 0.02 16.61 ?  63   TYR A HE1  2  
ATOM   10444  H HE2  . TYR A 1 70  ? 31.397  1.151   -29.164 0.02 16.58 ?  63   TYR A HE2  2  
ATOM   10445  H HH   . TYR A 1 70  ? 30.683  0.638   -26.842 0.02 16.49 ?  63   TYR A HH   2  
ATOM   10446  N N    . ALA A 1 71  ? 36.441  -2.126  -28.283 0.02 17.15 ?  64   ALA A N    2  
ATOM   10447  C CA   . ALA A 1 71  ? 36.752  -2.794  -27.029 0.02 17.20 ?  64   ALA A CA   2  
ATOM   10448  C C    . ALA A 1 71  ? 36.554  -4.289  -27.234 0.02 17.34 ?  64   ALA A C    2  
ATOM   10449  O O    . ALA A 1 71  ? 35.915  -4.718  -28.197 0.02 17.37 ?  64   ALA A O    2  
ATOM   10450  C CB   . ALA A 1 71  ? 35.862  -2.272  -25.895 0.02 17.04 ?  64   ALA A CB   2  
ATOM   10451  H H    . ALA A 1 71  ? 35.907  -2.575  -28.781 0.02 17.17 ?  64   ALA A H    2  
ATOM   10452  H HA   . ALA A 1 71  ? 37.677  -2.633  -26.793 0.02 17.28 ?  64   ALA A HA   2  
ATOM   10453  H HB1  . ALA A 1 71  ? 36.172  -2.631  -25.048 0.02 17.10 ?  64   ALA A HB1  2  
ATOM   10454  H HB2  . ALA A 1 71  ? 35.901  -1.305  -25.885 0.02 16.97 ?  64   ALA A HB2  2  
ATOM   10455  H HB3  . ALA A 1 71  ? 34.954  -2.560  -26.069 0.02 17.00 ?  64   ALA A HB3  2  
ATOM   10456  N N    . GLN A 1 72  ? 37.150  -5.079  -26.353 0.02 17.46 ?  65   GLN A N    2  
ATOM   10457  C CA   . GLN A 1 72  ? 36.945  -6.522  -26.370 0.02 17.62 ?  65   GLN A CA   2  
ATOM   10458  C C    . GLN A 1 72  ? 35.482  -6.846  -26.073 0.02 17.53 ?  65   GLN A C    2  
ATOM   10459  O O    . GLN A 1 72  ? 34.895  -6.244  -25.169 0.02 17.38 ?  65   GLN A O    2  
ATOM   10460  C CB   . GLN A 1 72  ? 37.820  -7.206  -25.316 0.02 17.76 ?  65   GLN A CB   2  
ATOM   10461  C CG   . GLN A 1 72  ? 39.248  -7.251  -25.687 0.02 17.90 ?  65   GLN A CG   2  
ATOM   10462  C CD   . GLN A 1 72  ? 39.614  -8.526  -26.397 0.02 18.17 ?  65   GLN A CD   2  
ATOM   10463  O OE1  . GLN A 1 72  ? 40.593  -9.182  -26.057 0.02 18.31 ?  65   GLN A OE1  2  
ATOM   10464  N NE2  . GLN A 1 72  ? 38.821  -8.889  -27.375 0.02 18.27 ?  65   GLN A NE2  2  
ATOM   10465  H H    . GLN A 1 72  ? 37.680  -4.804  -25.737 0.02 17.47 ?  65   GLN A H    2  
ATOM   10466  H HA   . GLN A 1 72  ? 37.183  -6.857  -27.242 0.02 17.72 ?  65   GLN A HA   2  
ATOM   10467  H HB2  . GLN A 1 72  ? 37.746  -6.714  -24.484 0.02 17.68 ?  65   GLN A HB2  2  
ATOM   10468  H HB3  . GLN A 1 72  ? 37.518  -8.120  -25.187 0.02 17.88 ?  65   GLN A HB3  2  
ATOM   10469  H HG2  . GLN A 1 72  ? 39.392  -6.530  -26.310 0.02 17.86 ?  65   GLN A HG2  2  
ATOM   10470  H HG3  . GLN A 1 72  ? 39.806  -7.157  -24.896 0.02 17.88 ?  65   GLN A HG3  2  
ATOM   10471  H HE21 . GLN A 1 72  ? 39.033  -9.550  -27.879 0.02 18.29 ?  65   GLN A HE21 2  
ATOM   10472  H HE22 . GLN A 1 72  ? 38.089  -8.473  -27.511 0.02 18.33 ?  65   GLN A HE22 2  
ATOM   10473  N N    . PRO A 1 73  ? 34.878  -7.798  -26.770 0.02 17.65 ?  66   PRO A N    2  
ATOM   10474  C CA   . PRO A 1 73  ? 33.530  -8.234  -26.398 0.02 17.63 ?  66   PRO A CA   2  
ATOM   10475  C C    . PRO A 1 73  ? 33.441  -8.458  -24.899 0.02 17.65 ?  66   PRO A C    2  
ATOM   10476  O O    . PRO A 1 73  ? 34.243  -9.214  -24.329 0.02 17.84 ?  66   PRO A O    2  
ATOM   10477  C CB   . PRO A 1 73  ? 33.350  -9.548  -27.162 0.02 17.85 ?  66   PRO A CB   2  
ATOM   10478  C CG   . PRO A 1 73  ? 34.237  -9.382  -28.388 0.02 17.90 ?  66   PRO A CG   2  
ATOM   10479  C CD   . PRO A 1 73  ? 35.383  -8.504  -27.969 0.02 17.82 ?  66   PRO A CD   2  
ATOM   10480  H HA   . PRO A 1 73  ? 32.880  -7.589  -26.710 0.02 17.50 ?  66   PRO A HA   2  
ATOM   10481  H HB2  . PRO A 1 73  ? 33.651  -10.288 -26.611 0.02 17.99 ?  66   PRO A HB2  2  
ATOM   10482  H HB3  . PRO A 1 73  ? 32.418  -9.658  -27.411 0.02 17.83 ?  66   PRO A HB3  2  
ATOM   10483  H HG2  . PRO A 1 73  ? 34.566  -10.250 -28.669 0.02 18.08 ?  66   PRO A HG2  2  
ATOM   10484  H HG3  . PRO A 1 73  ? 33.732  -8.965  -29.101 0.02 17.82 ?  66   PRO A HG3  2  
ATOM   10485  H HD2  . PRO A 1 73  ? 36.148  -9.049  -27.733 0.02 17.96 ?  66   PRO A HD2  2  
ATOM   10486  H HD3  . PRO A 1 73  ? 35.594  -7.861  -28.664 0.02 17.76 ?  66   PRO A HD3  2  
ATOM   10487  N N    . PRO A 1 74  ? 32.522  -7.860  -24.256 0.02 17.50 ?  67   PRO A N    2  
ATOM   10488  C CA   . PRO A 1 74  ? 32.518  -7.903  -22.777 0.02 17.52 ?  67   PRO A CA   2  
ATOM   10489  C C    . PRO A 1 74  ? 31.789  -9.129  -22.229 0.02 17.70 ?  67   PRO A C    2  
ATOM   10490  O O    . PRO A 1 74  ? 30.812  -9.025  -21.467 0.02 17.67 ?  67   PRO A O    2  
ATOM   10491  C CB   . PRO A 1 74  ? 31.820  -6.584  -22.420 0.02 17.30 ?  67   PRO A CB   2  
ATOM   10492  C CG   . PRO A 1 74  ? 30.847  -6.364  -23.537 0.02 17.21 ?  67   PRO A CG   2  
ATOM   10493  C CD   . PRO A 1 74  ? 31.549  -6.884  -24.784 0.02 17.30 ?  67   PRO A CD   2  
ATOM   10494  H HA   . PRO A 1 74  ? 33.424  -7.884  -22.439 0.02 17.58 ?  67   PRO A HA   2  
ATOM   10495  H HB2  . PRO A 1 74  ? 31.363  -6.670  -21.568 0.02 17.31 ?  67   PRO A HB2  2  
ATOM   10496  H HB3  . PRO A 1 74  ? 32.473  -5.868  -22.387 0.02 17.24 ?  67   PRO A HB3  2  
ATOM   10497  H HG2  . PRO A 1 74  ? 30.040  -6.872  -23.373 0.02 17.25 ?  67   PRO A HG2  2  
ATOM   10498  H HG3  . PRO A 1 74  ? 30.649  -5.422  -23.621 0.02 17.07 ?  67   PRO A HG3  2  
ATOM   10499  H HD2  . PRO A 1 74  ? 30.917  -7.324  -25.371 0.02 17.34 ?  67   PRO A HD2  2  
ATOM   10500  H HD3  . PRO A 1 74  ? 32.011  -6.159  -25.232 0.02 17.22 ?  67   PRO A HD3  2  
ATOM   10501  N N    . VAL A 1 75  ? 32.270  -10.311 -22.598 0.02 17.92 ?  68   VAL A N    2  
ATOM   10502  C CA   . VAL A 1 75  ? 31.626  -11.560 -22.219 0.02 18.14 ?  68   VAL A CA   2  
ATOM   10503  C C    . VAL A 1 75  ? 32.444  -12.268 -21.140 0.02 18.34 ?  68   VAL A C    2  
ATOM   10504  O O    . VAL A 1 75  ? 33.600  -11.933 -20.866 0.02 18.33 ?  68   VAL A O    2  
ATOM   10505  C CB   . VAL A 1 75  ? 31.404  -12.497 -23.424 0.02 18.30 ?  68   VAL A CB   2  
ATOM   10506  C CG1  . VAL A 1 75  ? 30.839  -11.722 -24.577 0.02 18.18 ?  68   VAL A CG1  2  
ATOM   10507  C CG2  . VAL A 1 75  ? 32.700  -13.233 -23.810 0.02 18.34 ?  68   VAL A CG2  2  
ATOM   10508  H H    . VAL A 1 75  ? 32.979  -10.414 -23.068 0.02 17.96 ?  68   VAL A H    2  
ATOM   10509  H HA   . VAL A 1 75  ? 30.756  -11.353 -21.854 0.02 18.09 ?  68   VAL A HA   2  
ATOM   10510  H HB   . VAL A 1 75  ? 30.749  -13.167 -23.170 0.02 18.49 ?  68   VAL A HB   2  
ATOM   10511  H HG11 . VAL A 1 75  ? 30.585  -12.338 -25.282 0.02 18.27 ?  68   VAL A HG11 2  
ATOM   10512  H HG12 . VAL A 1 75  ? 30.062  -11.227 -24.273 0.02 18.22 ?  68   VAL A HG12 2  
ATOM   10513  H HG13 . VAL A 1 75  ? 31.512  -11.107 -24.907 0.02 17.98 ?  68   VAL A HG13 2  
ATOM   10514  H HG21 . VAL A 1 75  ? 33.460  -12.648 -23.668 0.02 18.31 ?  68   VAL A HG21 2  
ATOM   10515  H HG22 . VAL A 1 75  ? 32.780  -14.023 -23.253 0.02 18.54 ?  68   VAL A HG22 2  
ATOM   10516  H HG23 . VAL A 1 75  ? 32.656  -13.488 -24.744 0.02 18.22 ?  68   VAL A HG23 2  
ATOM   10517  N N    . GLY A 1 76  ? 31.839  -13.305 -20.571 0.02 18.56 ?  69   GLY A N    2  
ATOM   10518  C CA   . GLY A 1 76  ? 32.533  -14.150 -19.604 0.02 18.81 ?  69   GLY A CA   2  
ATOM   10519  C C    . GLY A 1 76  ? 32.881  -13.398 -18.342 0.02 18.72 ?  69   GLY A C    2  
ATOM   10520  O O    . GLY A 1 76  ? 32.029  -12.729 -17.740 0.02 18.57 ?  69   GLY A O    2  
ATOM   10521  H H    . GLY A 1 76  ? 31.033  -13.549 -20.738 0.02 18.59 ?  69   GLY A H    2  
ATOM   10522  H HA2  . GLY A 1 76  ? 31.968  -14.901 -19.368 0.02 18.96 ?  69   GLY A HA2  2  
ATOM   10523  H HA3  . GLY A 1 76  ? 33.356  -14.485 -19.994 0.02 18.91 ?  69   GLY A HA3  2  
ATOM   10524  N N    . GLU A 1 77  ? 34.153  -13.478 -17.923 0.02 18.83 ?  70   GLU A N    2  
ATOM   10525  C CA   . GLU A 1 77  ? 34.593  -12.708 -16.755 0.02 18.80 ?  70   GLU A CA   2  
ATOM   10526  C C    . GLU A 1 77  ? 34.776  -11.228 -17.070 0.02 18.48 ?  70   GLU A C    2  
ATOM   10527  O O    . GLU A 1 77  ? 35.247  -10.479 -16.207 0.02 18.44 ?  70   GLU A O    2  
ATOM   10528  C CB   . GLU A 1 77  ? 35.908  -13.266 -16.156 0.02 19.02 ?  70   GLU A CB   2  
ATOM   10529  C CG   . GLU A 1 77  ? 35.849  -13.604 -14.610 0.02 19.19 ?  70   GLU A CG   2  
ATOM   10530  C CD   . GLU A 1 77  ? 35.366  -15.018 -14.374 0.02 19.50 ?  70   GLU A CD   2  
ATOM   10531  O OE1  . GLU A 1 77  ? 34.214  -15.317 -14.744 0.02 19.52 ?  70   GLU A OE1  2  
ATOM   10532  O OE2  . GLU A 1 77  ? 36.150  -15.832 -13.844 0.02 19.76 -1 70   GLU A OE2  2  
ATOM   10533  H H    . GLU A 1 77  ? 34.763  -13.957 -18.288 0.02 18.93 ?  70   GLU A H    2  
ATOM   10534  H HA   . GLU A 1 77  ? 33.912  -12.779 -16.071 0.02 18.88 ?  70   GLU A HA   2  
ATOM   10535  H HB2  . GLU A 1 77  ? 36.127  -14.095 -16.612 0.02 19.20 ?  70   GLU A HB2  2  
ATOM   10536  H HB3  . GLU A 1 77  ? 36.615  -12.617 -16.294 0.02 18.91 ?  70   GLU A HB3  2  
ATOM   10537  H HG2  . GLU A 1 77  ? 36.734  -13.523 -14.218 0.02 19.27 ?  70   GLU A HG2  2  
ATOM   10538  H HG3  . GLU A 1 77  ? 35.241  -12.993 -14.165 0.02 19.04 ?  70   GLU A HG3  2  
ATOM   10539  N N    . LEU A 1 78  ? 34.444  -10.785 -18.277 0.02 18.29 ?  71   LEU A N    2  
ATOM   10540  C CA   . LEU A 1 78  ? 34.402  -9.358  -18.560 0.02 18.02 ?  71   LEU A CA   2  
ATOM   10541  C C    . LEU A 1 78  ? 33.025  -8.764  -18.335 0.02 17.85 ?  71   LEU A C    2  
ATOM   10542  O O    . LEU A 1 78  ? 32.891  -7.537  -18.373 0.02 17.65 ?  71   LEU A O    2  
ATOM   10543  C CB   . LEU A 1 78  ? 34.825  -9.070  -20.004 0.02 17.91 ?  71   LEU A CB   2  
ATOM   10544  C CG   . LEU A 1 78  ? 36.197  -9.601  -20.379 0.02 18.06 ?  71   LEU A CG   2  
ATOM   10545  C CD1  . LEU A 1 78  ? 36.360  -9.576  -21.894 0.02 18.02 ?  71   LEU A CD1  2  
ATOM   10546  C CD2  . LEU A 1 78  ? 37.272  -8.782  -19.742 0.02 18.00 ?  71   LEU A CD2  2  
ATOM   10547  H H    . LEU A 1 78  ? 34.247  -11.288 -18.943 0.02 18.33 ?  71   LEU A H    2  
ATOM   10548  H HA   . LEU A 1 78  ? 35.019  -8.898  -17.976 0.02 18.02 ?  71   LEU A HA   2  
ATOM   10549  H HB2  . LEU A 1 78  ? 34.172  -9.456  -20.609 0.02 17.94 ?  71   LEU A HB2  2  
ATOM   10550  H HB3  . LEU A 1 78  ? 34.847  -8.111  -20.125 0.02 17.74 ?  71   LEU A HB3  2  
ATOM   10551  H HG   . LEU A 1 78  ? 36.288  -10.519 -20.075 0.02 18.24 ?  71   LEU A HG   2  
ATOM   10552  H HD11 . LEU A 1 78  ? 35.752  -10.219 -22.290 0.02 18.07 ?  71   LEU A HD11 2  
ATOM   10553  H HD12 . LEU A 1 78  ? 36.157  -8.684  -22.211 0.02 17.86 ?  71   LEU A HD12 2  
ATOM   10554  H HD13 . LEU A 1 78  ? 37.277  -9.807  -22.112 0.02 18.15 ?  71   LEU A HD13 2  
ATOM   10555  H HD21 . LEU A 1 78  ? 37.205  -8.853  -18.778 0.02 18.08 ?  71   LEU A HD21 2  
ATOM   10556  H HD22 . LEU A 1 78  ? 38.128  -9.123  -20.046 0.02 18.09 ?  71   LEU A HD22 2  
ATOM   10557  H HD23 . LEU A 1 78  ? 37.165  -7.858  -20.012 0.02 17.83 ?  71   LEU A HD23 2  
ATOM   10558  N N