data_5IWM
# 
_entry.id   5IWM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5IWM         
WWPDB D_1000219569 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5IWM 
_pdbx_database_status.recvd_initial_deposition_date   2016-03-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bax, B.D.'   1 
'Miles, T.J.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Bioorg.Med.Chem.Lett. 
_citation.journal_id_ASTM           BMCLE8 
_citation.journal_id_CSD            1127 
_citation.journal_id_ISSN           1464-3405 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            26 
_citation.language                  ? 
_citation.page_first                2464 
_citation.page_last                 2469 
_citation.title                     'Novel tricyclics (e.g., GSK945237) as potent inhibitors of bacterial type IIA topoisomerases.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.bmcl.2016.03.106 
_citation.pdbx_database_id_PubMed   27055939 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Miles, T.J.'               1  
primary 'Hennessy, A.J.'            2  
primary 'Bax, B.'                   3  
primary 'Brooks, G.'                4  
primary 'Brown, B.S.'               5  
primary 'Brown, P.'                 6  
primary 'Cailleau, N.'              7  
primary 'Chen, D.'                  8  
primary 'Dabbs, S.'                 9  
primary 'Davies, D.T.'              10 
primary 'Esken, J.M.'               11 
primary 'Giordano, I.'              12 
primary 'Hoover, J.L.'              13 
primary 'Jones, G.E.'               14 
primary 'Kusalakumari Sukmar, S.K.' 15 
primary 'Markwell, R.E.'            16 
primary 'Minthorn, E.A.'            17 
primary 'Rittenhouse, S.'           18 
primary 'Gwynn, M.N.'               19 
primary 'Pearson, N.D.'             20 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5IWM 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     93.785 
_cell.length_a_esd                 ? 
_cell.length_b                     93.785 
_cell.length_b_esd                 ? 
_cell.length_c                     413.350 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5IWM 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA gyrase subunit B,DNA gyrase subunit B' 22605.689 2   5.99.1.3,5.99.1.3 ? 
'UNP residues 409-543, 580-644,UNP residues 409-543, 580-644' ? 
2 polymer     man 'DNA gyrase subunit A' 55521.312 2   5.99.1.3          ? ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*CP*GP*TP*AP*GP*GP*TP*TP*CP*AP*CP*CP*GP*CP*AP*CP*A)-3')
;
6103.957  1   ?                 ? ?                                                             ? 
4 polymer     syn 
;DNA (5'-D(*TP*GP*TP*GP*CP*GP*GP*TP*GP*AP*AP*CP*CP*TP*AP*CP*GP*GP*CP*T)-3')
;
6165.977  1   ?                 ? ?                                                             ? 
5 non-polymer syn 'MANGANESE (II) ION' 54.938    2   ?                 ? ? ? 
6 non-polymer syn GLYCEROL 92.094    1   ?                 ? ?                                                             ? 
7 non-polymer syn 
;(1R)-1-[(4-{[(6,7-dihydro[1,4]dioxino[2,3-c]pyridazin-3-yl)methyl]amino}piperidin-1-yl)methyl]-9-fluoro-1,2-dihydro-4H-pyrrolo[3,2,1-ij]quinolin-4-one
;
451.493   1   ?                 ? ?                                                             ? 
8 water       nat water 18.015    258 ?                 ? ?                                                             ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTG
IGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNPEHRA
LLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
;
;MDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTG
IGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNPEHRA
LLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
;
B,D ? 
2 'polypeptide(L)'        no no 
;AELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPH
GDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRFTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLP
ARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSI
QMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNL
YKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRES
DTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFG
DDRRTEIQLG
;
;AELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPH
GDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRFTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLP
ARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSI
QMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNL
YKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRES
DTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFG
DDRRTEIQLG
;
A,C ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DC)(DG)(DT)(DA)(DG)(DG)(DT)(DT)(DC)(DA)(DC)(DC)(DG)(DC)(DA)(DC)(DA)' 
AGCCGTAGGTTCACCGCACA E   ? 
4 polydeoxyribonucleotide no no '(DT)(DG)(DT)(DG)(DC)(DG)(DG)(DT)(DG)(DA)(DA)(DC)(DC)(DT)(DA)(DC)(DG)(DG)(DC)(DT)' 
TGTGCGGTGAACCTACGGCT F   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   VAL n 
1 4   ALA n 
1 5   SER n 
1 6   LEU n 
1 7   PRO n 
1 8   GLY n 
1 9   LYS n 
1 10  LEU n 
1 11  ALA n 
1 12  ASP n 
1 13  CYS n 
1 14  SER n 
1 15  SER n 
1 16  LYS n 
1 17  SER n 
1 18  PRO n 
1 19  GLU n 
1 20  GLU n 
1 21  CYS n 
1 22  GLU n 
1 23  ILE n 
1 24  PHE n 
1 25  LEU n 
1 26  VAL n 
1 27  GLU n 
1 28  GLY n 
1 29  ASP n 
1 30  SER n 
1 31  ALA n 
1 32  GLY n 
1 33  GLY n 
1 34  SER n 
1 35  THR n 
1 36  LYS n 
1 37  SER n 
1 38  GLY n 
1 39  ARG n 
1 40  ASP n 
1 41  SER n 
1 42  ARG n 
1 43  THR n 
1 44  GLN n 
1 45  ALA n 
1 46  ILE n 
1 47  LEU n 
1 48  PRO n 
1 49  LEU n 
1 50  ARG n 
1 51  GLY n 
1 52  LYS n 
1 53  ILE n 
1 54  LEU n 
1 55  ASN n 
1 56  VAL n 
1 57  GLU n 
1 58  LYS n 
1 59  ALA n 
1 60  ARG n 
1 61  LEU n 
1 62  ASP n 
1 63  ARG n 
1 64  ILE n 
1 65  LEU n 
1 66  ASN n 
1 67  ASN n 
1 68  ASN n 
1 69  GLU n 
1 70  ILE n 
1 71  ARG n 
1 72  GLN n 
1 73  MET n 
1 74  ILE n 
1 75  THR n 
1 76  ALA n 
1 77  PHE n 
1 78  GLY n 
1 79  THR n 
1 80  GLY n 
1 81  ILE n 
1 82  GLY n 
1 83  GLY n 
1 84  ASP n 
1 85  PHE n 
1 86  ASP n 
1 87  LEU n 
1 88  ALA n 
1 89  LYS n 
1 90  ALA n 
1 91  ARG n 
1 92  TYR n 
1 93  HIS n 
1 94  LYS n 
1 95  ILE n 
1 96  VAL n 
1 97  ILE n 
1 98  MET n 
1 99  THR n 
1 100 ASP n 
1 101 ALA n 
1 102 ASP n 
1 103 VAL n 
1 104 ASP n 
1 105 GLY n 
1 106 ALA n 
1 107 HIS n 
1 108 ILE n 
1 109 ARG n 
1 110 THR n 
1 111 LEU n 
1 112 LEU n 
1 113 LEU n 
1 114 THR n 
1 115 PHE n 
1 116 PHE n 
1 117 TYR n 
1 118 ARG n 
1 119 PHE n 
1 120 MET n 
1 121 ARG n 
1 122 PRO n 
1 123 LEU n 
1 124 ILE n 
1 125 GLU n 
1 126 ALA n 
1 127 GLY n 
1 128 TYR n 
1 129 VAL n 
1 130 TYR n 
1 131 ILE n 
1 132 ALA n 
1 133 GLN n 
1 134 PRO n 
1 135 PRO n 
1 136 THR n 
1 137 GLY n 
1 138 TYR n 
1 139 LYS n 
1 140 GLY n 
1 141 LEU n 
1 142 GLY n 
1 143 GLU n 
1 144 MET n 
1 145 ASN n 
1 146 ALA n 
1 147 ASP n 
1 148 GLN n 
1 149 LEU n 
1 150 TRP n 
1 151 GLU n 
1 152 THR n 
1 153 THR n 
1 154 MET n 
1 155 ASN n 
1 156 PRO n 
1 157 GLU n 
1 158 HIS n 
1 159 ARG n 
1 160 ALA n 
1 161 LEU n 
1 162 LEU n 
1 163 GLN n 
1 164 VAL n 
1 165 LYS n 
1 166 LEU n 
1 167 GLU n 
1 168 ASP n 
1 169 ALA n 
1 170 ILE n 
1 171 GLU n 
1 172 ALA n 
1 173 ASP n 
1 174 GLN n 
1 175 THR n 
1 176 PHE n 
1 177 GLU n 
1 178 MET n 
1 179 LEU n 
1 180 MET n 
1 181 GLY n 
1 182 ASP n 
1 183 VAL n 
1 184 VAL n 
1 185 GLU n 
1 186 ASN n 
1 187 ARG n 
1 188 ARG n 
1 189 GLN n 
1 190 PHE n 
1 191 ILE n 
1 192 GLU n 
1 193 ASP n 
1 194 ASN n 
1 195 ALA n 
1 196 VAL n 
1 197 TYR n 
1 198 ALA n 
1 199 ASN n 
1 200 LEU n 
1 201 ASP n 
1 202 PHE n 
2 1   ALA n 
2 2   GLU n 
2 3   LEU n 
2 4   PRO n 
2 5   GLN n 
2 6   SER n 
2 7   ARG n 
2 8   ILE n 
2 9   ASN n 
2 10  GLU n 
2 11  ARG n 
2 12  ASN n 
2 13  ILE n 
2 14  THR n 
2 15  SER n 
2 16  GLU n 
2 17  MET n 
2 18  ARG n 
2 19  GLU n 
2 20  SER n 
2 21  PHE n 
2 22  LEU n 
2 23  ASP n 
2 24  TYR n 
2 25  ALA n 
2 26  MET n 
2 27  SER n 
2 28  VAL n 
2 29  ILE n 
2 30  VAL n 
2 31  ALA n 
2 32  ARG n 
2 33  ALA n 
2 34  LEU n 
2 35  PRO n 
2 36  ASP n 
2 37  VAL n 
2 38  ARG n 
2 39  ASP n 
2 40  GLY n 
2 41  LEU n 
2 42  LYS n 
2 43  PRO n 
2 44  VAL n 
2 45  HIS n 
2 46  ARG n 
2 47  ARG n 
2 48  ILE n 
2 49  LEU n 
2 50  TYR n 
2 51  GLY n 
2 52  LEU n 
2 53  ASN n 
2 54  GLU n 
2 55  GLN n 
2 56  GLY n 
2 57  MET n 
2 58  THR n 
2 59  PRO n 
2 60  ASP n 
2 61  LYS n 
2 62  SER n 
2 63  TYR n 
2 64  LYS n 
2 65  LYS n 
2 66  SER n 
2 67  ALA n 
2 68  ARG n 
2 69  ILE n 
2 70  VAL n 
2 71  GLY n 
2 72  ASP n 
2 73  VAL n 
2 74  MET n 
2 75  GLY n 
2 76  LYS n 
2 77  TYR n 
2 78  HIS n 
2 79  PRO n 
2 80  HIS n 
2 81  GLY n 
2 82  ASP n 
2 83  SER n 
2 84  SER n 
2 85  ILE n 
2 86  TYR n 
2 87  GLU n 
2 88  ALA n 
2 89  MET n 
2 90  VAL n 
2 91  ARG n 
2 92  MET n 
2 93  ALA n 
2 94  GLN n 
2 95  ASP n 
2 96  PHE n 
2 97  SER n 
2 98  TYR n 
2 99  ARG n 
2 100 TYR n 
2 101 PRO n 
2 102 LEU n 
2 103 VAL n 
2 104 ASP n 
2 105 GLY n 
2 106 GLN n 
2 107 GLY n 
2 108 ASN n 
2 109 PHE n 
2 110 GLY n 
2 111 SER n 
2 112 MET n 
2 113 ASP n 
2 114 GLY n 
2 115 ASP n 
2 116 GLY n 
2 117 ALA n 
2 118 ALA n 
2 119 ALA n 
2 120 MET n 
2 121 ARG n 
2 122 PHE n 
2 123 THR n 
2 124 GLU n 
2 125 ALA n 
2 126 ARG n 
2 127 MET n 
2 128 THR n 
2 129 LYS n 
2 130 ILE n 
2 131 THR n 
2 132 LEU n 
2 133 GLU n 
2 134 LEU n 
2 135 LEU n 
2 136 ARG n 
2 137 ASP n 
2 138 ILE n 
2 139 ASN n 
2 140 LYS n 
2 141 ASP n 
2 142 THR n 
2 143 ILE n 
2 144 ASP n 
2 145 PHE n 
2 146 ILE n 
2 147 ASP n 
2 148 ASN n 
2 149 TYR n 
2 150 ASP n 
2 151 GLY n 
2 152 ASN n 
2 153 GLU n 
2 154 ARG n 
2 155 GLU n 
2 156 PRO n 
2 157 SER n 
2 158 VAL n 
2 159 LEU n 
2 160 PRO n 
2 161 ALA n 
2 162 ARG n 
2 163 PHE n 
2 164 PRO n 
2 165 ASN n 
2 166 LEU n 
2 167 LEU n 
2 168 ALA n 
2 169 ASN n 
2 170 GLY n 
2 171 ALA n 
2 172 SER n 
2 173 GLY n 
2 174 ILE n 
2 175 ALA n 
2 176 VAL n 
2 177 GLY n 
2 178 MET n 
2 179 ALA n 
2 180 THR n 
2 181 ASN n 
2 182 ILE n 
2 183 PRO n 
2 184 PRO n 
2 185 HIS n 
2 186 ASN n 
2 187 LEU n 
2 188 THR n 
2 189 GLU n 
2 190 LEU n 
2 191 ILE n 
2 192 ASN n 
2 193 GLY n 
2 194 VAL n 
2 195 LEU n 
2 196 SER n 
2 197 LEU n 
2 198 SER n 
2 199 LYS n 
2 200 ASN n 
2 201 PRO n 
2 202 ASP n 
2 203 ILE n 
2 204 SER n 
2 205 ILE n 
2 206 ALA n 
2 207 GLU n 
2 208 LEU n 
2 209 MET n 
2 210 GLU n 
2 211 ASP n 
2 212 ILE n 
2 213 GLU n 
2 214 GLY n 
2 215 PRO n 
2 216 ASP n 
2 217 PHE n 
2 218 PRO n 
2 219 THR n 
2 220 ALA n 
2 221 GLY n 
2 222 LEU n 
2 223 ILE n 
2 224 LEU n 
2 225 GLY n 
2 226 LYS n 
2 227 SER n 
2 228 GLY n 
2 229 ILE n 
2 230 ARG n 
2 231 ARG n 
2 232 ALA n 
2 233 TYR n 
2 234 GLU n 
2 235 THR n 
2 236 GLY n 
2 237 ARG n 
2 238 GLY n 
2 239 SER n 
2 240 ILE n 
2 241 GLN n 
2 242 MET n 
2 243 ARG n 
2 244 SER n 
2 245 ARG n 
2 246 ALA n 
2 247 VAL n 
2 248 ILE n 
2 249 GLU n 
2 250 GLU n 
2 251 ARG n 
2 252 GLY n 
2 253 GLY n 
2 254 GLY n 
2 255 ARG n 
2 256 GLN n 
2 257 ARG n 
2 258 ILE n 
2 259 VAL n 
2 260 VAL n 
2 261 THR n 
2 262 GLU n 
2 263 ILE n 
2 264 PRO n 
2 265 PHE n 
2 266 GLN n 
2 267 VAL n 
2 268 ASN n 
2 269 LYS n 
2 270 ALA n 
2 271 ARG n 
2 272 MET n 
2 273 ILE n 
2 274 GLU n 
2 275 LYS n 
2 276 ILE n 
2 277 ALA n 
2 278 GLU n 
2 279 LEU n 
2 280 VAL n 
2 281 ARG n 
2 282 ASP n 
2 283 LYS n 
2 284 LYS n 
2 285 ILE n 
2 286 ASP n 
2 287 GLY n 
2 288 ILE n 
2 289 THR n 
2 290 ASP n 
2 291 LEU n 
2 292 ARG n 
2 293 ASP n 
2 294 GLU n 
2 295 THR n 
2 296 SER n 
2 297 LEU n 
2 298 ARG n 
2 299 THR n 
2 300 GLY n 
2 301 VAL n 
2 302 ARG n 
2 303 VAL n 
2 304 VAL n 
2 305 ILE n 
2 306 ASP n 
2 307 VAL n 
2 308 ARG n 
2 309 LYS n 
2 310 ASP n 
2 311 ALA n 
2 312 ASN n 
2 313 ALA n 
2 314 SER n 
2 315 VAL n 
2 316 ILE n 
2 317 LEU n 
2 318 ASN n 
2 319 ASN n 
2 320 LEU n 
2 321 TYR n 
2 322 LYS n 
2 323 GLN n 
2 324 THR n 
2 325 PRO n 
2 326 LEU n 
2 327 GLN n 
2 328 THR n 
2 329 SER n 
2 330 PHE n 
2 331 GLY n 
2 332 VAL n 
2 333 ASN n 
2 334 MET n 
2 335 ILE n 
2 336 ALA n 
2 337 LEU n 
2 338 VAL n 
2 339 ASN n 
2 340 GLY n 
2 341 ARG n 
2 342 PRO n 
2 343 LYS n 
2 344 LEU n 
2 345 ILE n 
2 346 ASN n 
2 347 LEU n 
2 348 LYS n 
2 349 GLU n 
2 350 ALA n 
2 351 LEU n 
2 352 VAL n 
2 353 HIS n 
2 354 TYR n 
2 355 LEU n 
2 356 GLU n 
2 357 HIS n 
2 358 GLN n 
2 359 LYS n 
2 360 THR n 
2 361 VAL n 
2 362 VAL n 
2 363 ARG n 
2 364 ARG n 
2 365 ARG n 
2 366 THR n 
2 367 GLN n 
2 368 TYR n 
2 369 ASN n 
2 370 LEU n 
2 371 ARG n 
2 372 LYS n 
2 373 ALA n 
2 374 LYS n 
2 375 ASP n 
2 376 ARG n 
2 377 ALA n 
2 378 HIS n 
2 379 ILE n 
2 380 LEU n 
2 381 GLU n 
2 382 GLY n 
2 383 LEU n 
2 384 ARG n 
2 385 ILE n 
2 386 ALA n 
2 387 LEU n 
2 388 ASP n 
2 389 HIS n 
2 390 ILE n 
2 391 ASP n 
2 392 GLU n 
2 393 ILE n 
2 394 ILE n 
2 395 SER n 
2 396 THR n 
2 397 ILE n 
2 398 ARG n 
2 399 GLU n 
2 400 SER n 
2 401 ASP n 
2 402 THR n 
2 403 ASP n 
2 404 LYS n 
2 405 VAL n 
2 406 ALA n 
2 407 MET n 
2 408 GLU n 
2 409 SER n 
2 410 LEU n 
2 411 GLN n 
2 412 GLN n 
2 413 ARG n 
2 414 PHE n 
2 415 LYS n 
2 416 LEU n 
2 417 SER n 
2 418 GLU n 
2 419 LYS n 
2 420 GLN n 
2 421 ALA n 
2 422 GLN n 
2 423 ALA n 
2 424 ILE n 
2 425 LEU n 
2 426 ASP n 
2 427 MET n 
2 428 ARG n 
2 429 LEU n 
2 430 ARG n 
2 431 ARG n 
2 432 LEU n 
2 433 THR n 
2 434 GLY n 
2 435 LEU n 
2 436 GLU n 
2 437 ARG n 
2 438 ASP n 
2 439 LYS n 
2 440 ILE n 
2 441 GLU n 
2 442 ALA n 
2 443 GLU n 
2 444 TYR n 
2 445 ASN n 
2 446 GLU n 
2 447 LEU n 
2 448 LEU n 
2 449 ASN n 
2 450 TYR n 
2 451 ILE n 
2 452 SER n 
2 453 GLU n 
2 454 LEU n 
2 455 GLU n 
2 456 THR n 
2 457 ILE n 
2 458 LEU n 
2 459 ALA n 
2 460 ASP n 
2 461 GLU n 
2 462 GLU n 
2 463 VAL n 
2 464 LEU n 
2 465 LEU n 
2 466 GLN n 
2 467 LEU n 
2 468 VAL n 
2 469 ARG n 
2 470 ASP n 
2 471 GLU n 
2 472 LEU n 
2 473 THR n 
2 474 GLU n 
2 475 ILE n 
2 476 ARG n 
2 477 ASP n 
2 478 ARG n 
2 479 PHE n 
2 480 GLY n 
2 481 ASP n 
2 482 ASP n 
2 483 ARG n 
2 484 ARG n 
2 485 THR n 
2 486 GLU n 
2 487 ILE n 
2 488 GLN n 
2 489 LEU n 
2 490 GLY n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DC  n 
3 5   DG  n 
3 6   DT  n 
3 7   DA  n 
3 8   DG  n 
3 9   DG  n 
3 10  DT  n 
3 11  DT  n 
3 12  DC  n 
3 13  DA  n 
3 14  DC  n 
3 15  DC  n 
3 16  DG  n 
3 17  DC  n 
3 18  DA  n 
3 19  DC  n 
3 20  DA  n 
4 1   DT  n 
4 2   DG  n 
4 3   DT  n 
4 4   DG  n 
4 5   DC  n 
4 6   DG  n 
4 7   DG  n 
4 8   DT  n 
4 9   DG  n 
4 10  DA  n 
4 11  DA  n 
4 12  DC  n 
4 13  DC  n 
4 14  DT  n 
4 15  DA  n 
4 16  DC  n 
4 17  DG  n 
4 18  DG  n 
4 19  DC  n 
4 20  DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 2   135 ? ? 'gyrB, SA0005' ? ?    ? ? ? ? 'Staphylococcus aureus' 158879 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 138 202 ? ? 'gyrB, SA0005' ? N315 ? ? ? ? 'Staphylococcus aureus' 158879 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   490 ? ? 'gyrA, SA0006' ? ?    ? ? ? ? 'Staphylococcus aureus' 1280   ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 20 'synthetic construct' ? 32630 ? 
4 1 sample 1 20 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP GYRB_STAAN P66937 ? 1 
;DVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGI
GGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPP
;
410 
2 UNP GYRB_STAAN P66937 ? 1 YKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF 580 
3 UNP GYRA_STAAN Q99XG5 ? 2 
;AELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPH
GDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLP
ARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSI
QMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNL
YKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRES
DTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFG
DDRRTEIQLG
;
2   
4 PDB 5IWM       5IWM   ? 3 ? 1   
5 PDB 5IWM       5IWM   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5IWM B 2   ? 135 ? P66937 410 ? 543 ? 410 543 
2 2 5IWM B 138 ? 202 ? P66937 580 ? 644 ? 580 644 
3 3 5IWM A 1   ? 490 ? Q99XG5 2   ? 491 ? 2   491 
4 1 5IWM D 2   ? 135 ? P66937 410 ? 543 ? 410 543 
5 2 5IWM D 138 ? 202 ? P66937 580 ? 644 ? 580 644 
6 3 5IWM C 1   ? 490 ? Q99XG5 2   ? 491 ? 2   491 
7 4 5IWM E 1   ? 20  ? 5IWM   1   ? 20  ? 1   20  
8 5 5IWM F 1   ? 20  ? 5IWM   1   ? 20  ? 1   20  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5IWM MET B 1   ? UNP P66937 ?   ?   'expression tag' 409 1 
1 5IWM THR B 136 ? UNP P66937 ?   ?   linker           544 2 
1 5IWM GLY B 137 ? UNP P66937 ?   ?   linker           545 3 
3 5IWM PHE A 122 ? UNP Q99XG5 TYR 123 conflict         123 4 
4 5IWM MET D 1   ? UNP P66937 ?   ?   'expression tag' 409 5 
4 5IWM THR D 136 ? UNP P66937 ?   ?   linker           544 6 
4 5IWM GLY D 137 ? UNP P66937 ?   ?   linker           545 7 
6 5IWM PHE C 122 ? UNP Q99XG5 TYR 123 conflict         123 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
6EJ non-polymer         . 
;(1R)-1-[(4-{[(6,7-dihydro[1,4]dioxino[2,3-c]pyridazin-3-yl)methyl]amino}piperidin-1-yl)methyl]-9-fluoro-1,2-dihydro-4H-pyrrolo[3,2,1-ij]quinolin-4-one
;
?                               'C24 H26 F N5 O3' 451.493 
ALA 'L-peptide linking' y ALANINE ?                               'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?                               'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                               'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ?                               'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ?                               'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ?                               'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE ?                               'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?                               'C2 H5 N O2'      75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'        92.094  
HIS 'L-peptide linking' y HISTIDINE ?                               'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ?                               'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                               'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ?                               'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ?                               'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?                               'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ?                               'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE ?                               'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ?                               'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ?                               'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ?                               'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                               'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?                               'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?                               'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5IWM 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.11 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         60.50 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          MICROBATCH 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '13% peg 5000MME, 100mM BisTris, pH 6.3' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 210' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2005-09-28 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9611 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9611 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5IWM 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.5 
_reflns.d_resolution_low                 25.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       65320 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             92.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.0 
_reflns.pdbx_Rmerge_I_obs                0.12 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.50 
_reflns_shell.d_res_low                   2.64 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.9 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        94.2 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.325 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             1.9 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -3.60 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][2]                            -3.60 
_refine.aniso_B[2][3]                            -0.00 
_refine.aniso_B[3][3]                            7.20 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               20.846 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.908 
_refine.correlation_coeff_Fo_to_Fc_free          0.857 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5IWM 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.50 
_refine.ls_d_res_low                             24.99 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     62688 
_refine.ls_number_reflns_R_free                  2631 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    92.50 
_refine.ls_percent_reflns_R_free                 4.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.18209 
_refine.ls_R_factor_R_free                       0.22402 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.18037 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      2xcs 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.103 
_refine.pdbx_overall_ESU_R_Free                  0.056 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             6.332 
_refine.overall_SU_ML                            0.149 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        10610 
_refine_hist.pdbx_number_atoms_nucleic_acid   814 
_refine_hist.pdbx_number_atoms_ligand         41 
_refine_hist.number_atoms_solvent             258 
_refine_hist.number_atoms_total               11723 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        24.99 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.011  0.018  12782 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.390  1.857  17591 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 2.136  5.000  1371  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 27.506 23.700 546   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 10.389 15.000 2038  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 13.814 15.000 121   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.088  0.200  1889  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.021  9238  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 1.360  1.995  5445  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 2.120  2.989  6823  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 1.774  2.135  7337  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 4.780  18.638 47863 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.500 
_refine_ls_shell.d_res_low                        2.564 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             175 
_refine_ls_shell.number_reflns_R_work             4692 
_refine_ls_shell.percent_reflns_obs               93.87 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.290 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.239 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5IWM 
_struct.title                        '2.5A structure of GSK945237 with S.aureus DNA gyrase and DNA.' 
_struct.pdbx_descriptor              'DNA gyrase subunit A, DNA gyrase subunit B/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5IWM 
_struct_keywords.text            'TYPE IIA TOPOISOMERASE, ANTIBACTERIAL, INHIBITOR, isomerase, fusion protein' 
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 7 ? 
K N N 8 ? 
L N N 8 ? 
M N N 8 ? 
N N N 8 ? 
O N N 8 ? 
P N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 28  ? ARG A 39  ? GLY B 436 ARG B 447 1 ? 12 
HELX_P HELX_P2  AA2 ARG A 60  ? ASN A 66  ? ARG B 468 ASN B 474 1 ? 7  
HELX_P HELX_P3  AA3 ASN A 67  ? GLY A 78  ? ASN B 475 GLY B 486 1 ? 12 
HELX_P HELX_P4  AA4 ILE A 81  ? PHE A 85  ? ILE B 489 PHE B 493 5 ? 5  
HELX_P HELX_P5  AA5 ASP A 86  ? ALA A 90  ? ASP B 494 ALA B 498 5 ? 5  
HELX_P HELX_P6  AA6 ASP A 102 ? MET A 120 ? ASP B 510 MET B 528 1 ? 19 
HELX_P HELX_P7  AA7 MET A 120 ? ALA A 126 ? MET B 528 ALA B 534 1 ? 7  
HELX_P HELX_P8  AA8 GLY A 140 ? MET A 144 ? GLY B 582 MET B 586 5 ? 5  
HELX_P HELX_P9  AA9 ASN A 145 ? MET A 154 ? ASN B 587 MET B 596 1 ? 10 
HELX_P HELX_P10 AB1 ASP A 168 ? GLY A 181 ? ASP B 610 GLY B 623 1 ? 14 
HELX_P HELX_P11 AB2 VAL A 183 ? ALA A 195 ? VAL B 625 ALA B 637 1 ? 13 
HELX_P HELX_P12 AB3 ILE B 13  ? ALA B 31  ? ILE A 14  ALA A 32  1 ? 19 
HELX_P HELX_P13 AB4 LYS B 42  ? GLN B 55  ? LYS A 43  GLN A 56  1 ? 14 
HELX_P HELX_P14 AB5 SER B 66  ? TYR B 77  ? SER A 67  TYR A 78  1 ? 12 
HELX_P HELX_P15 AB6 GLY B 81  ? ALA B 93  ? GLY A 82  ALA A 94  1 ? 13 
HELX_P HELX_P16 AB7 THR B 131 ? ARG B 136 ? THR A 132 ARG A 137 1 ? 6  
HELX_P HELX_P17 AB8 PRO B 164 ? GLY B 170 ? PRO A 165 GLY A 171 1 ? 7  
HELX_P HELX_P18 AB9 ASN B 186 ? LYS B 199 ? ASN A 187 LYS A 200 1 ? 14 
HELX_P HELX_P19 AC1 SER B 204 ? MET B 209 ? SER A 205 MET A 210 1 ? 6  
HELX_P HELX_P20 AC2 LYS B 226 ? GLY B 236 ? LYS A 227 GLY A 237 1 ? 11 
HELX_P HELX_P21 AC3 ASN B 268 ? ASP B 282 ? ASN A 269 ASP A 283 1 ? 15 
HELX_P HELX_P22 AC4 ASN B 312 ? THR B 324 ? ASN A 313 THR A 325 1 ? 13 
HELX_P HELX_P23 AC5 ASN B 346 ? HIS B 389 ? ASN A 347 HIS A 390 1 ? 44 
HELX_P HELX_P24 AC6 HIS B 389 ? GLU B 399 ? HIS A 390 GLU A 400 1 ? 11 
HELX_P HELX_P25 AC7 THR B 402 ? PHE B 414 ? THR A 403 PHE A 415 1 ? 13 
HELX_P HELX_P26 AC8 SER B 417 ? ASP B 426 ? SER A 418 ASP A 427 1 ? 10 
HELX_P HELX_P27 AC9 ARG B 428 ? THR B 433 ? ARG A 429 THR A 434 5 ? 6  
HELX_P HELX_P28 AD1 LEU B 435 ? ALA B 459 ? LEU A 436 ALA A 460 1 ? 25 
HELX_P HELX_P29 AD2 ASP B 460 ? GLY B 480 ? ASP A 461 GLY A 481 1 ? 21 
HELX_P HELX_P30 AD3 GLY C 28  ? ARG C 39  ? GLY D 436 ARG D 447 1 ? 12 
HELX_P HELX_P31 AD4 ARG C 60  ? ASN C 67  ? ARG D 468 ASN D 475 1 ? 8  
HELX_P HELX_P32 AD5 ASN C 67  ? GLY C 78  ? ASN D 475 GLY D 486 1 ? 12 
HELX_P HELX_P33 AD6 ILE C 81  ? PHE C 85  ? ILE D 489 PHE D 493 5 ? 5  
HELX_P HELX_P34 AD7 ASP C 86  ? ALA C 90  ? ASP D 494 ALA D 498 5 ? 5  
HELX_P HELX_P35 AD8 ASP C 102 ? MET C 120 ? ASP D 510 MET D 528 1 ? 19 
HELX_P HELX_P36 AD9 MET C 120 ? ALA C 126 ? MET D 528 ALA D 534 1 ? 7  
HELX_P HELX_P37 AE1 GLY C 140 ? MET C 144 ? GLY D 582 MET D 586 5 ? 5  
HELX_P HELX_P38 AE2 ASN C 145 ? MET C 154 ? ASN D 587 MET D 596 1 ? 10 
HELX_P HELX_P39 AE3 ASP C 168 ? GLY C 181 ? ASP D 610 GLY D 623 1 ? 14 
HELX_P HELX_P40 AE4 VAL C 183 ? ALA C 195 ? VAL D 625 ALA D 637 1 ? 13 
HELX_P HELX_P41 AE5 ILE D 13  ? ALA D 31  ? ILE C 14  ALA C 32  1 ? 19 
HELX_P HELX_P42 AE6 LYS D 42  ? GLN D 55  ? LYS C 43  GLN C 56  1 ? 14 
HELX_P HELX_P43 AE7 SER D 66  ? TYR D 77  ? SER C 67  TYR C 78  1 ? 12 
HELX_P HELX_P44 AE8 GLY D 81  ? MET D 92  ? GLY C 82  MET C 93  1 ? 12 
HELX_P HELX_P45 AE9 ILE D 130 ? ARG D 136 ? ILE C 131 ARG C 137 1 ? 7  
HELX_P HELX_P46 AF1 PRO D 164 ? GLY D 170 ? PRO C 165 GLY C 171 1 ? 7  
HELX_P HELX_P47 AF2 ASN D 186 ? ASN D 200 ? ASN C 187 ASN C 201 1 ? 15 
HELX_P HELX_P48 AF3 SER D 204 ? MET D 209 ? SER C 205 MET C 210 1 ? 6  
HELX_P HELX_P49 AF4 LYS D 226 ? GLY D 236 ? LYS C 227 GLY C 237 1 ? 11 
HELX_P HELX_P50 AF5 ASN D 268 ? ASP D 282 ? ASN C 269 ASP C 283 1 ? 15 
HELX_P HELX_P51 AF6 ASN D 312 ? THR D 324 ? ASN C 313 THR C 325 1 ? 13 
HELX_P HELX_P52 AF7 ASN D 346 ? HIS D 389 ? ASN C 347 HIS C 390 1 ? 44 
HELX_P HELX_P53 AF8 HIS D 389 ? GLU D 399 ? HIS C 390 GLU C 400 1 ? 11 
HELX_P HELX_P54 AF9 THR D 402 ? LYS D 415 ? THR C 403 LYS C 416 1 ? 14 
HELX_P HELX_P55 AG1 SER D 417 ? MET D 427 ? SER C 418 MET C 428 1 ? 11 
HELX_P HELX_P56 AG2 ARG D 428 ? LEU D 432 ? ARG C 429 LEU C 433 5 ? 5  
HELX_P HELX_P57 AG3 THR D 433 ? ALA D 459 ? THR C 434 ALA C 460 1 ? 27 
HELX_P HELX_P58 AG4 ASP D 460 ? GLY D 480 ? ASP C 461 GLY C 481 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A GLU 27  OE2   ? ? ? 1_555 G MN  .  MN ? ? B GLU 435  B MN  701  1_555 ? ? ? ? ? ? ?            1.930 ? 
metalc2  metalc ? ? A ASP 100 OD2   ? ? ? 1_555 G MN  .  MN ? ? B ASP 508  B MN  701  1_555 ? ? ? ? ? ? ?            2.103 ? 
metalc3  metalc ? ? C GLU 27  OE2   ? ? ? 1_555 H MN  .  MN ? ? D GLU 435  D MN  1001 1_555 ? ? ? ? ? ? ?            1.906 ? 
metalc4  metalc ? ? C ASP 100 OD2   ? ? ? 1_555 H MN  .  MN ? ? D ASP 508  D MN  1001 1_555 ? ? ? ? ? ? ?            1.988 ? 
metalc5  metalc ? ? E DG  8   "O3'" A ? ? 1_555 G MN  .  MN ? ? E DG  8    B MN  701  1_555 ? ? ? ? ? ? ?            2.694 ? 
metalc6  metalc ? ? E DG  8   "O3'" B ? ? 1_555 H MN  .  MN ? ? E DG  8    D MN  1001 1_555 ? ? ? ? ? ? ?            2.511 ? 
metalc7  metalc ? ? E DG  9   OP1   A ? ? 1_555 G MN  .  MN ? ? E DG  9    B MN  701  1_555 ? ? ? ? ? ? ?            2.276 ? 
metalc8  metalc ? ? E DG  9   OP1   B ? ? 1_555 H MN  .  MN ? ? E DG  9    D MN  1001 1_555 ? ? ? ? ? ? ?            2.476 ? 
metalc9  metalc ? ? F DT  8   "O3'" A ? ? 1_555 H MN  .  MN ? ? F DT  8    D MN  1001 1_555 ? ? ? ? ? ? ?            2.452 ? 
metalc10 metalc ? ? F DG  9   OP1   A ? ? 1_555 H MN  .  MN ? ? F DG  9    D MN  1001 1_555 ? ? ? ? ? ? ?            2.271 ? 
metalc11 metalc ? ? F DG  9   OP1   B ? ? 1_555 G MN  .  MN ? ? F DG  9    B MN  701  1_555 ? ? ? ? ? ? ?            2.298 ? 
metalc12 metalc ? ? G MN  .   MN    ? ? ? 1_555 K HOH .  O  ? ? B MN  701  B HOH 803  1_555 ? ? ? ? ? ? ?            2.046 ? 
metalc13 metalc ? ? G MN  .   MN    ? ? ? 1_555 K HOH .  O  ? ? B MN  701  B HOH 814  1_555 ? ? ? ? ? ? ?            2.529 ? 
metalc14 metalc ? ? H MN  .   MN    ? ? ? 1_555 M HOH .  O  ? ? D MN  1001 D HOH 1106 1_555 ? ? ? ? ? ? ?            2.367 ? 
metalc15 metalc ? ? H MN  .   MN    ? ? ? 1_555 M HOH .  O  ? ? D MN  1001 D HOH 1121 1_555 ? ? ? ? ? ? ?            1.943 ? 
hydrog1  hydrog ? ? E DG  2   N1    A ? ? 1_555 F DC  19 N3 A ? E DG  2    F DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? E DG  2   N2    A ? ? 1_555 F DC  19 O2 A ? E DG  2    F DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? E DG  2   O6    A ? ? 1_555 F DC  19 N4 A ? E DG  2    F DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? E DC  3   N3    A ? ? 1_555 F DG  18 N1 A ? E DC  3    F DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? E DC  3   N4    A ? ? 1_555 F DG  18 O6 A ? E DC  3    F DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? E DC  3   O2    A ? ? 1_555 F DG  18 N2 A ? E DC  3    F DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? E DC  4   N3    A ? ? 1_555 F DG  17 N1 A ? E DC  4    F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? E DC  4   N4    A ? ? 1_555 F DG  17 O6 A ? E DC  4    F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? E DC  4   O2    A ? ? 1_555 F DG  17 N2 A ? E DC  4    F DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? E DG  5   N1    A ? ? 1_555 F DC  16 N3 A ? E DG  5    F DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? E DG  5   N2    A ? ? 1_555 F DC  16 O2 A ? E DG  5    F DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? E DG  5   O6    A ? ? 1_555 F DC  16 N4 A ? E DG  5    F DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? E DT  6   N3    A ? ? 1_555 F DA  15 N1 A ? E DT  6    F DA  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? E DT  6   O4    A ? ? 1_555 F DA  15 N6 A ? E DT  6    F DA  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? E DA  7   N1    A ? ? 1_555 F DT  14 N3 A ? E DA  7    F DT  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? E DA  7   N6    A ? ? 1_555 F DT  14 O4 A ? E DA  7    F DT  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? E DG  8   N1    A ? ? 1_555 F DC  13 N3 A ? E DG  8    F DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? E DG  8   N2    A ? ? 1_555 F DC  13 O2 A ? E DG  8    F DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? E DG  8   O6    A ? ? 1_555 F DC  13 N4 A ? E DG  8    F DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? E DG  9   N1    A ? ? 1_555 F DC  12 N3 A ? E DG  9    F DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? E DG  9   N2    A ? ? 1_555 F DC  12 O2 A ? E DG  9    F DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? E DG  9   O6    A ? ? 1_555 F DC  12 N4 A ? E DG  9    F DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? E DT  10  N3    A ? ? 1_555 F DA  11 N1 A ? E DT  10   F DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? E DT  10  O4    A ? ? 1_555 F DA  11 N6 A ? E DT  10   F DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? E DT  11  N3    A ? ? 1_555 F DA  10 N1 A ? E DT  11   F DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? E DT  11  O4    A ? ? 1_555 F DA  10 N6 A ? E DT  11   F DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? E DC  12  N3    A ? ? 1_555 F DG  9  N1 A ? E DC  12   F DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? E DC  12  N4    A ? ? 1_555 F DG  9  O6 A ? E DC  12   F DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? E DC  12  O2    A ? ? 1_555 F DG  9  N2 A ? E DC  12   F DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? E DA  13  N1    A ? ? 1_555 F DT  8  N3 A ? E DA  13   F DT  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? E DA  13  N6    A ? ? 1_555 F DT  8  O4 A ? E DA  13   F DT  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? E DC  14  N3    A ? ? 1_555 F DG  7  N1 A ? E DC  14   F DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? E DC  14  N4    B ? ? 1_555 F DG  7  O6 B ? E DC  14   F DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? E DC  14  O2    A ? ? 1_555 F DG  7  N2 A ? E DC  14   F DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? E DC  15  N3    A ? ? 1_555 F DG  6  N1 A ? E DC  15   F DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? E DC  15  N4    A ? ? 1_555 F DG  6  O6 A ? E DC  15   F DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E DC  15  O2    A ? ? 1_555 F DG  6  N2 A ? E DC  15   F DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E DG  16  N1    A ? ? 1_555 F DC  5  N3 A ? E DG  16   F DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? E DG  16  N2    A ? ? 1_555 F DC  5  O2 A ? E DG  16   F DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? E DG  16  O6    A ? ? 1_555 F DC  5  N4 A ? E DG  16   F DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? E DC  17  N3    A ? ? 1_555 F DG  4  N1 A ? E DC  17   F DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? E DC  17  N4    A ? ? 1_555 F DG  4  O6 A ? E DC  17   F DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? E DC  17  O2    A ? ? 1_555 F DG  4  N2 A ? E DC  17   F DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? E DA  18  N1    A ? ? 1_555 F DT  3  N3 A ? E DA  18   F DT  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? E DA  18  N6    A ? ? 1_555 F DT  3  O4 A ? E DA  18   F DT  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? E DC  19  N3    A ? ? 1_555 F DG  2  N1 A ? E DC  19   F DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? E DC  19  N4    B ? ? 1_555 F DG  2  O6 B ? E DC  19   F DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? E DC  19  O2    A ? ? 1_555 F DG  2  N2 A ? E DC  19   F DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? E DA  20  N1    A ? ? 1_555 F DT  1  N3 A ? E DA  20   F DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? E DA  20  N6    A ? ? 1_555 F DT  1  O4 A ? E DA  20   F DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 489 B . ? LEU 490 A GLY 490 B ? GLY 491 A 1 0.38  
2 GLY 252 D . ? GLY 253 C GLY 253 D ? GLY 254 C 1 -3.39 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 6 ? 
AA9 ? 3 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? parallel      
AA8 3 4 ? parallel      
AA8 4 5 ? anti-parallel 
AA8 5 6 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A 44  ? PRO A 48  ? GLN B 452 PRO B 456 
AA1 2 GLU A 22  ? VAL A 26  ? GLU B 430 VAL B 434 
AA1 3 LYS A 94  ? ILE A 97  ? LYS B 502 ILE B 505 
AA1 4 VAL A 129 ? ILE A 131 ? VAL B 537 ILE B 539 
AA1 5 LEU A 162 ? LYS A 165 ? LEU B 604 LYS B 607 
AA1 6 GLU B 10  ? ASN B 12  ? GLU A 11  ASN A 13  
AA2 1 LYS B 64  ? LYS B 65  ? LYS A 65  LYS A 66  
AA2 2 GLU B 124 ? MET B 127 ? GLU A 125 MET A 128 
AA2 3 VAL B 103 ? GLN B 106 ? VAL A 104 GLN A 107 
AA3 1 PHE B 145 ? ASP B 147 ? PHE A 146 ASP A 148 
AA3 2 ARG B 154 ? PRO B 156 ? ARG A 155 PRO A 157 
AA4 1 ALA B 171 ? ILE B 174 ? ALA A 172 ILE A 175 
AA4 2 ALA B 179 ? ILE B 182 ? ALA A 180 ILE A 183 
AA5 1 GLN B 327 ? ASN B 333 ? GLN A 328 ASN A 334 
AA5 2 ARG B 237 ? ARG B 243 ? ARG A 238 ARG A 244 
AA5 3 LEU B 222 ? LEU B 224 ? LEU A 223 LEU A 225 
AA5 4 GLU B 486 ? GLN B 488 ? GLU A 487 GLN A 489 
AA6 1 ARG B 245 ? GLY B 252 ? ARG A 246 GLY A 253 
AA6 2 ARG B 255 ? GLU B 262 ? ARG A 256 GLU A 263 
AA6 3 VAL B 303 ? VAL B 307 ? VAL A 304 VAL A 308 
AA6 4 ILE B 288 ? ASP B 293 ? ILE A 289 ASP A 294 
AA7 1 ILE B 335 ? VAL B 338 ? ILE A 336 VAL A 339 
AA7 2 ARG B 341 ? LEU B 344 ? ARG A 342 LEU A 345 
AA8 1 GLN C 44  ? PRO C 48  ? GLN D 452 PRO D 456 
AA8 2 GLU C 22  ? VAL C 26  ? GLU D 430 VAL D 434 
AA8 3 LYS C 94  ? ILE C 97  ? LYS D 502 ILE D 505 
AA8 4 VAL C 129 ? ILE C 131 ? VAL D 537 ILE D 539 
AA8 5 LEU C 162 ? LYS C 165 ? LEU D 604 LYS D 607 
AA8 6 GLU D 10  ? ASN D 12  ? GLU C 11  ASN C 13  
AA9 1 LYS D 64  ? LYS D 65  ? LYS C 65  LYS C 66  
AA9 2 GLU D 124 ? MET D 127 ? GLU C 125 MET C 128 
AA9 3 VAL D 103 ? GLN D 106 ? VAL C 104 GLN C 107 
AB1 1 PHE D 145 ? ASP D 147 ? PHE C 146 ASP C 148 
AB1 2 ARG D 154 ? PRO D 156 ? ARG C 155 PRO C 157 
AB2 1 ALA D 171 ? ILE D 174 ? ALA C 172 ILE C 175 
AB2 2 ALA D 179 ? ILE D 182 ? ALA C 180 ILE C 183 
AB3 1 GLN D 327 ? ASN D 333 ? GLN C 328 ASN C 334 
AB3 2 ARG D 237 ? ARG D 243 ? ARG C 238 ARG C 244 
AB3 3 LEU D 222 ? LEU D 224 ? LEU C 223 LEU C 225 
AB3 4 GLU D 486 ? GLN D 488 ? GLU C 487 GLN C 489 
AB4 1 ARG D 245 ? GLU D 250 ? ARG C 246 GLU C 251 
AB4 2 GLN D 256 ? GLU D 262 ? GLN C 257 GLU C 263 
AB4 3 VAL D 303 ? VAL D 307 ? VAL C 304 VAL C 308 
AB4 4 ILE D 288 ? ASP D 293 ? ILE C 289 ASP C 294 
AB5 1 ILE D 335 ? VAL D 338 ? ILE C 336 VAL C 339 
AB5 2 ARG D 341 ? LEU D 344 ? ARG C 342 LEU C 345 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ALA A 45  ? O ALA B 453 N GLU A 22  ? N GLU B 430 
AA1 2 3 N ILE A 23  ? N ILE B 431 O VAL A 96  ? O VAL B 504 
AA1 3 4 N ILE A 95  ? N ILE B 503 O TYR A 130 ? O TYR B 538 
AA1 4 5 N VAL A 129 ? N VAL B 537 O VAL A 164 ? O VAL B 606 
AA1 5 6 N LYS A 165 ? N LYS B 607 O ARG B 11  ? O ARG A 12  
AA2 1 2 N LYS B 64  ? N LYS A 65  O ALA B 125 ? O ALA A 126 
AA2 2 3 O ARG B 126 ? O ARG A 127 N ASP B 104 ? N ASP A 105 
AA3 1 2 N ILE B 146 ? N ILE A 147 O GLU B 155 ? O GLU A 156 
AA4 1 2 N ALA B 171 ? N ALA A 172 O ILE B 182 ? O ILE A 183 
AA5 1 2 O PHE B 330 ? O PHE A 331 N ILE B 240 ? N ILE A 241 
AA5 2 3 O ARG B 243 ? O ARG A 244 N LEU B 222 ? N LEU A 223 
AA5 3 4 N ILE B 223 ? N ILE A 224 O GLN B 488 ? O GLN A 489 
AA6 1 2 N ARG B 251 ? N ARG A 252 O ARG B 255 ? O ARG A 256 
AA6 2 3 N VAL B 260 ? N VAL A 261 O VAL B 303 ? O VAL A 304 
AA6 3 4 O ASP B 306 ? O ASP A 307 N THR B 289 ? N THR A 290 
AA7 1 2 N VAL B 338 ? N VAL A 339 O ARG B 341 ? O ARG A 342 
AA8 1 2 O ALA C 45  ? O ALA D 453 N GLU C 22  ? N GLU D 430 
AA8 2 3 N LEU C 25  ? N LEU D 433 O VAL C 96  ? O VAL D 504 
AA8 3 4 N ILE C 95  ? N ILE D 503 O TYR C 130 ? O TYR D 538 
AA8 4 5 N ILE C 131 ? N ILE D 539 O LEU C 162 ? O LEU D 604 
AA8 5 6 N GLN C 163 ? N GLN D 605 O ARG D 11  ? O ARG C 12  
AA9 1 2 N LYS D 64  ? N LYS C 65  O ALA D 125 ? O ALA C 126 
AA9 2 3 O GLU D 124 ? O GLU C 125 N GLN D 106 ? N GLN C 107 
AB1 1 2 N ILE D 146 ? N ILE C 147 O GLU D 155 ? O GLU C 156 
AB2 1 2 N ALA D 171 ? N ALA C 172 O ILE D 182 ? O ILE C 183 
AB3 1 2 O PHE D 330 ? O PHE C 331 N ILE D 240 ? N ILE C 241 
AB3 2 3 O ARG D 243 ? O ARG C 244 N LEU D 222 ? N LEU C 223 
AB3 3 4 N ILE D 223 ? N ILE C 224 O GLU D 486 ? O GLU C 487 
AB4 1 2 N VAL D 247 ? N VAL C 248 O VAL D 259 ? O VAL C 260 
AB4 2 3 N VAL D 260 ? N VAL C 261 O VAL D 303 ? O VAL C 304 
AB4 3 4 O VAL D 304 ? O VAL C 305 N ARG D 292 ? N ARG C 293 
AB5 1 2 N VAL D 338 ? N VAL C 339 O ARG D 341 ? O ARG C 342 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B MN  701  ? 8  'binding site for residue MN B 701'  
AC2 Software D MN  1001 ? 8  'binding site for residue MN D 1001' 
AC3 Software C GOL 501  ? 5  'binding site for residue GOL C 501' 
AC4 Software F 6EJ 101  ? 14 'binding site for residue 6EJ F 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  GLU A 27  ? GLU B 435  . ? 1_555 ? 
2  AC1 8  ASP A 100 ? ASP B 508  . ? 1_555 ? 
3  AC1 8  HOH K .   ? HOH B 803  . ? 1_555 ? 
4  AC1 8  HOH K .   ? HOH B 814  . ? 1_555 ? 
5  AC1 8  DG  E 8   ? DG  E 8    . ? 1_555 ? 
6  AC1 8  DG  E 9   ? DG  E 9    . ? 1_555 ? 
7  AC1 8  DT  F 8   ? DT  F 8    . ? 1_555 ? 
8  AC1 8  DG  F 9   ? DG  F 9    . ? 1_555 ? 
9  AC2 8  GLU C 27  ? GLU D 435  . ? 1_555 ? 
10 AC2 8  ASP C 100 ? ASP D 508  . ? 1_555 ? 
11 AC2 8  HOH M .   ? HOH D 1106 . ? 1_555 ? 
12 AC2 8  HOH M .   ? HOH D 1121 . ? 1_555 ? 
13 AC2 8  DG  E 8   ? DG  E 8    . ? 1_555 ? 
14 AC2 8  DG  E 9   ? DG  E 9    . ? 1_555 ? 
15 AC2 8  DT  F 8   ? DT  F 8    . ? 1_555 ? 
16 AC2 8  DG  F 9   ? DG  F 9    . ? 1_555 ? 
17 AC3 5  PRO D 43  ? PRO C 44   . ? 1_555 ? 
18 AC3 5  ARG D 46  ? ARG C 47   . ? 1_555 ? 
19 AC3 5  ARG D 47  ? ARG C 48   . ? 1_555 ? 
20 AC3 5  GLU D 155 ? GLU C 156  . ? 1_555 ? 
21 AC3 5  HOH N .   ? HOH C 647  . ? 1_555 ? 
22 AC4 14 ALA B 67  ? ALA A 68   . ? 1_555 ? 
23 AC4 14 MET B 74  ? MET A 75   . ? 1_555 ? 
24 AC4 14 ASP B 82  ? ASP A 83   . ? 1_555 ? 
25 AC4 14 MET B 120 ? MET A 121  . ? 1_555 ? 
26 AC4 14 ALA D 67  ? ALA C 68   . ? 1_555 ? 
27 AC4 14 MET D 74  ? MET C 75   . ? 1_555 ? 
28 AC4 14 ASP D 82  ? ASP C 83   . ? 1_555 ? 
29 AC4 14 MET D 120 ? MET C 121  . ? 1_555 ? 
30 AC4 14 DT  E 10  ? DT  E 10   . ? 1_555 ? 
31 AC4 14 DT  E 11  ? DT  E 11   . ? 1_555 ? 
32 AC4 14 DA  F 10  ? DA  F 10   . ? 1_555 ? 
33 AC4 14 DA  F 11  ? DA  F 11   . ? 1_555 ? 
34 AC4 14 HOH P .   ? HOH F 212  . ? 1_555 ? 
35 AC4 14 HOH P .   ? HOH F 219  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5IWM 
_atom_sites.fract_transf_matrix[1][1]   0.010663 
_atom_sites.fract_transf_matrix[1][2]   0.006156 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012312 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002419 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A 1 9   ? 4.742   60.545  54.981 1.00 28.06 ? 417  LYS B N     1 
ATOM   2     C  CA    . LYS A 1 9   ? 4.858   59.063  55.215 1.00 27.74 ? 417  LYS B CA    1 
ATOM   3     C  C     . LYS A 1 9   ? 4.790   58.675  56.698 1.00 27.05 ? 417  LYS B C     1 
ATOM   4     O  O     . LYS A 1 9   ? 4.497   57.521  57.034 1.00 27.69 ? 417  LYS B O     1 
ATOM   5     C  CB    . LYS A 1 9   ? 6.157   58.512  54.604 1.00 25.86 ? 417  LYS B CB    1 
ATOM   6     N  N     . LEU A 1 10  ? 5.066   59.636  57.578 1.00 25.03 ? 418  LEU B N     1 
ATOM   7     C  CA    . LEU A 1 10  ? 5.067   59.410  59.032 1.00 24.70 ? 418  LEU B CA    1 
ATOM   8     C  C     . LEU A 1 10  ? 3.665   59.115  59.601 1.00 23.27 ? 418  LEU B C     1 
ATOM   9     O  O     . LEU A 1 10  ? 2.700   59.819  59.297 1.00 23.90 ? 418  LEU B O     1 
ATOM   10    C  CB    . LEU A 1 10  ? 5.677   60.623  59.744 1.00 24.64 ? 418  LEU B CB    1 
ATOM   11    C  CG    . LEU A 1 10  ? 5.720   60.694  61.277 1.00 27.15 ? 418  LEU B CG    1 
ATOM   12    C  CD1   . LEU A 1 10  ? 6.560   59.569  61.892 1.00 24.32 ? 418  LEU B CD1   1 
ATOM   13    C  CD2   . LEU A 1 10  ? 6.223   62.060  61.741 1.00 23.42 ? 418  LEU B CD2   1 
ATOM   14    N  N     . ALA A 1 11  ? 3.570   58.063  60.407 1.00 20.13 ? 419  ALA B N     1 
ATOM   15    C  CA    . ALA A 1 11  ? 2.322   57.684  61.068 1.00 19.57 ? 419  ALA B CA    1 
ATOM   16    C  C     . ALA A 1 11  ? 2.524   57.958  62.555 1.00 19.86 ? 419  ALA B C     1 
ATOM   17    O  O     . ALA A 1 11  ? 3.024   57.111  63.305 1.00 18.63 ? 419  ALA B O     1 
ATOM   18    C  CB    . ALA A 1 11  ? 1.982   56.221  60.822 1.00 19.10 ? 419  ALA B CB    1 
ATOM   19    N  N     . ASP A 1 12  ? 2.151   59.157  62.986 1.00 19.01 ? 420  ASP B N     1 
ATOM   20    C  CA    . ASP A 1 12  ? 2.335   59.573  64.358 1.00 18.36 ? 420  ASP B CA    1 
ATOM   21    C  C     . ASP A 1 12  ? 1.373   59.008  65.378 1.00 18.39 ? 420  ASP B C     1 
ATOM   22    O  O     . ASP A 1 12  ? 0.384   58.395  65.072 1.00 17.94 ? 420  ASP B O     1 
ATOM   23    C  CB    . ASP A 1 12  ? 2.265   61.093  64.436 1.00 17.75 ? 420  ASP B CB    1 
ATOM   24    C  CG    . ASP A 1 12  ? 3.285   61.663  65.386 1.00 17.51 ? 420  ASP B CG    1 
ATOM   25    O  OD1   . ASP A 1 12  ? 3.824   60.943  66.217 1.00 16.41 ? 420  ASP B OD1   1 
ATOM   26    O  OD2   . ASP A 1 12  ? 3.551   62.848  65.282 1.00 20.35 ? 420  ASP B OD2   1 
ATOM   27    N  N     . CYS A 1 13  ? 1.703   59.260  66.620 1.00 19.33 ? 421  CYS B N     1 
ATOM   28    C  CA    . CYS A 1 13  ? 0.882   58.804  67.735 1.00 21.25 ? 421  CYS B CA    1 
ATOM   29    C  C     . CYS A 1 13  ? 0.025   59.944  68.308 1.00 21.03 ? 421  CYS B C     1 
ATOM   30    O  O     . CYS A 1 13  ? 0.199   61.105  67.940 1.00 18.95 ? 421  CYS B O     1 
ATOM   31    C  CB    . CYS A 1 13  ? 1.764   58.193  68.819 1.00 21.22 ? 421  CYS B CB    1 
ATOM   32    S  SG    . CYS A 1 13  ? 3.130   59.259  69.321 1.00 23.79 ? 421  CYS B SG    1 
ATOM   33    N  N     . SER A 1 14  ? -0.897  59.591  69.203 1.00 21.79 ? 422  SER B N     1 
ATOM   34    C  CA    . SER A 1 14  ? -1.824  60.543  69.822 1.00 22.76 ? 422  SER B CA    1 
ATOM   35    C  C     . SER A 1 14  ? -1.150  61.527  70.781 1.00 24.03 ? 422  SER B C     1 
ATOM   36    O  O     . SER A 1 14  ? -1.309  62.741  70.650 1.00 24.05 ? 422  SER B O     1 
ATOM   37    C  CB    . SER A 1 14  ? -2.933  59.793  70.571 1.00 22.40 ? 422  SER B CB    1 
ATOM   38    O  OG    . SER A 1 14  ? -3.646  58.926  69.716 1.00 22.45 ? 422  SER B OG    1 
ATOM   39    N  N     . SER A 1 15  ? -0.410  60.991  71.752 1.00 24.34 ? 423  SER B N     1 
ATOM   40    C  CA    . SER A 1 15  ? 0.255   61.805  72.764 1.00 26.69 ? 423  SER B CA    1 
ATOM   41    C  C     . SER A 1 15  ? 1.310   62.741  72.181 1.00 29.17 ? 423  SER B C     1 
ATOM   42    O  O     . SER A 1 15  ? 1.931   62.441  71.155 1.00 31.27 ? 423  SER B O     1 
ATOM   43    C  CB    . SER A 1 15  ? 0.883   60.915  73.837 1.00 26.55 ? 423  SER B CB    1 
ATOM   44    O  OG    . SER A 1 15  ? 1.643   61.681  74.752 1.00 28.53 ? 423  SER B OG    1 
ATOM   45    N  N     . LYS A 1 16  ? 1.524   63.859  72.855 1.00 29.07 ? 424  LYS B N     1 
ATOM   46    C  CA    . LYS A 1 16  ? 2.512   64.814  72.416 1.00 30.40 ? 424  LYS B CA    1 
ATOM   47    C  C     . LYS A 1 16  ? 3.578   65.032  73.473 1.00 31.18 ? 424  LYS B C     1 
ATOM   48    O  O     . LYS A 1 16  ? 4.361   65.950  73.385 1.00 29.13 ? 424  LYS B O     1 
ATOM   49    C  CB    . LYS A 1 16  ? 1.847   66.109  71.986 1.00 31.73 ? 424  LYS B CB    1 
ATOM   50    C  CG    . LYS A 1 16  ? 1.248   66.052  70.592 1.00 34.76 ? 424  LYS B CG    1 
ATOM   51    C  CD    . LYS A 1 16  ? 2.348   65.977  69.540 1.00 36.31 ? 424  LYS B CD    1 
ATOM   52    C  CE    . LYS A 1 16  ? 1.776   65.664  68.166 1.00 39.94 ? 424  LYS B CE    1 
ATOM   53    N  NZ    . LYS A 1 16  ? 1.550   64.199  67.956 1.00 39.09 ? 424  LYS B NZ    1 
ATOM   54    N  N     . SER A 1 17  ? 3.585   64.154  74.472 1.00 30.52 ? 425  SER B N     1 
ATOM   55    C  CA    . SER A 1 17  ? 4.558   64.143  75.546 1.00 27.67 ? 425  SER B CA    1 
ATOM   56    C  C     . SER A 1 17  ? 5.728   63.277  75.066 1.00 26.83 ? 425  SER B C     1 
ATOM   57    O  O     . SER A 1 17  ? 5.617   62.058  75.003 1.00 26.61 ? 425  SER B O     1 
ATOM   58    C  CB    . SER A 1 17  ? 3.939   63.576  76.821 1.00 29.39 ? 425  SER B CB    1 
ATOM   59    O  OG    . SER A 1 17  ? 4.885   63.497  77.876 1.00 30.05 ? 425  SER B OG    1 
ATOM   60    N  N     . PRO A 1 18  ? 6.887   63.948  74.709 1.00 27.40 ? 426  PRO B N     1 
ATOM   61    C  CA    . PRO A 1 18  ? 7.972   63.090  74.213 1.00 28.50 ? 426  PRO B CA    1 
ATOM   62    C  C     . PRO A 1 18  ? 8.581   62.080  75.159 1.00 30.30 ? 426  PRO B C     1 
ATOM   63    O  O     . PRO A 1 18  ? 9.163   61.137  74.683 1.00 30.40 ? 426  PRO B O     1 
ATOM   64    C  CB    . PRO A 1 18  ? 9.050   64.087  73.802 1.00 26.23 ? 426  PRO B CB    1 
ATOM   65    C  CG    . PRO A 1 18  ? 8.315   65.288  73.456 1.00 25.12 ? 426  PRO B CG    1 
ATOM   66    C  CD    . PRO A 1 18  ? 7.385   65.370  74.607 1.00 27.30 ? 426  PRO B CD    1 
ATOM   67    N  N     . GLU A 1 19  ? 8.476   62.276  76.456 1.00 32.84 ? 427  GLU B N     1 
ATOM   68    C  CA    . GLU A 1 19  ? 9.056   61.321  77.380 1.00 33.96 ? 427  GLU B CA    1 
ATOM   69    C  C     . GLU A 1 19  ? 8.450   59.931  77.241 1.00 30.41 ? 427  GLU B C     1 
ATOM   70    O  O     . GLU A 1 19  ? 9.166   58.945  77.320 1.00 31.15 ? 427  GLU B O     1 
ATOM   71    C  CB    . GLU A 1 19  ? 8.928   61.816  78.819 1.00 41.10 ? 427  GLU B CB    1 
ATOM   72    C  CG    . GLU A 1 19  ? 7.521   62.210  79.224 1.00 49.69 ? 427  GLU B CG    1 
ATOM   73    C  CD    . GLU A 1 19  ? 7.449   62.735  80.636 1.00 58.42 ? 427  GLU B CD    1 
ATOM   74    O  OE1   . GLU A 1 19  ? 8.522   62.970  81.239 1.00 58.08 ? 427  GLU B OE1   1 
ATOM   75    O  OE2   . GLU A 1 19  ? 6.309   62.907  81.137 1.00 64.23 ? 427  GLU B OE2   1 
ATOM   76    N  N     . GLU A 1 20  ? 7.141   59.843  77.042 1.00 27.76 ? 428  GLU B N     1 
ATOM   77    C  CA    . GLU A 1 20  ? 6.501   58.541  76.886 1.00 26.57 ? 428  GLU B CA    1 
ATOM   78    C  C     . GLU A 1 20  ? 6.292   58.089  75.433 1.00 25.17 ? 428  GLU B C     1 
ATOM   79    O  O     . GLU A 1 20  ? 5.841   56.982  75.189 1.00 25.04 ? 428  GLU B O     1 
ATOM   80    C  CB    . GLU A 1 20  ? 5.179   58.486  77.647 1.00 28.59 ? 428  GLU B CB    1 
ATOM   81    C  CG    . GLU A 1 20  ? 4.071   59.353  77.080 1.00 28.41 ? 428  GLU B CG    1 
ATOM   82    C  CD    . GLU A 1 20  ? 2.744   59.096  77.753 1.00 28.74 ? 428  GLU B CD    1 
ATOM   83    O  OE1   . GLU A 1 20  ? 2.693   58.277  78.686 1.00 28.36 ? 428  GLU B OE1   1 
ATOM   84    O  OE2   . GLU A 1 20  ? 1.748   59.713  77.344 1.00 31.49 ? 428  GLU B OE2   1 
ATOM   85    N  N     . CYS A 1 21  ? 6.630   58.933  74.473 1.00 23.14 ? 429  CYS B N     1 
ATOM   86    C  CA    . CYS A 1 21  ? 6.464   58.619  73.070 1.00 21.17 ? 429  CYS B CA    1 
ATOM   87    C  C     . CYS A 1 21  ? 7.649   57.917  72.426 1.00 20.57 ? 429  CYS B C     1 
ATOM   88    O  O     . CYS A 1 21  ? 8.765   58.094  72.819 1.00 20.51 ? 429  CYS B O     1 
ATOM   89    C  CB    . CYS A 1 21  ? 6.137   59.872  72.287 1.00 20.18 ? 429  CYS B CB    1 
ATOM   90    S  SG    . CYS A 1 21  ? 4.444   60.353  72.427 1.00 23.55 ? 429  CYS B SG    1 
ATOM   91    N  N     . GLU A 1 22  ? 7.382   57.107  71.425 1.00 19.61 ? 430  GLU B N     1 
ATOM   92    C  CA    . GLU A 1 22  ? 8.462   56.376  70.756 1.00 20.15 ? 430  GLU B CA    1 
ATOM   93    C  C     . GLU A 1 22  ? 8.194   56.244  69.261 1.00 16.85 ? 430  GLU B C     1 
ATOM   94    O  O     . GLU A 1 22  ? 7.043   56.190  68.837 1.00 15.12 ? 430  GLU B O     1 
ATOM   95    C  CB    . GLU A 1 22  ? 8.714   55.016  71.438 1.00 19.31 ? 430  GLU B CB    1 
ATOM   96    C  CG    . GLU A 1 22  ? 7.482   54.152  71.619 1.00 22.73 ? 430  GLU B CG    1 
ATOM   97    C  CD    . GLU A 1 22  ? 7.671   53.019  72.629 1.00 24.84 ? 430  GLU B CD    1 
ATOM   98    O  OE1   . GLU A 1 22  ? 8.154   53.273  73.759 1.00 23.13 ? 430  GLU B OE1   1 
ATOM   99    O  OE2   . GLU A 1 22  ? 7.307   51.867  72.279 1.00 23.68 ? 430  GLU B OE2   1 
ATOM   100   N  N     . ILE A 1 23  ? 9.261   56.227  68.471 1.00 14.68 ? 431  ILE B N     1 
ATOM   101   C  CA    . ILE A 1 23  ? 9.135   56.118  67.013 1.00 14.86 ? 431  ILE B CA    1 
ATOM   102   C  C     . ILE A 1 23  ? 9.903   54.916  66.458 1.00 13.26 ? 431  ILE B C     1 
ATOM   103   O  O     . ILE A 1 23  ? 11.094  54.752  66.713 1.00 12.38 ? 431  ILE B O     1 
ATOM   104   C  CB    . ILE A 1 23  ? 9.527   57.441  66.275 1.00 14.75 ? 431  ILE B CB    1 
ATOM   105   C  CG1   . ILE A 1 23  ? 9.325   57.291  64.758 1.00 15.64 ? 431  ILE B CG1   1 
ATOM   106   C  CG2   . ILE A 1 23  ? 10.956  57.862  66.622 1.00 15.25 ? 431  ILE B CG2   1 
ATOM   107   C  CD1   . ILE A 1 23  ? 9.597   58.551  63.941 1.00 15.69 ? 431  ILE B CD1   1 
ATOM   108   N  N     . PHE A 1 24  ? 9.191   54.076  65.713 1.00 12.36 ? 432  PHE B N     1 
ATOM   109   C  CA    . PHE A 1 24  ? 9.776   52.886  65.103 1.00 11.66 ? 432  PHE B CA    1 
ATOM   110   C  C     . PHE A 1 24  ? 10.128  53.117  63.642 1.00 11.49 ? 432  PHE B C     1 
ATOM   111   O  O     . PHE A 1 24  ? 9.309   53.628  62.865 1.00 11.04 ? 432  PHE B O     1 
ATOM   112   C  CB    . PHE A 1 24  ? 8.829   51.691  65.222 1.00 11.39 ? 432  PHE B CB    1 
ATOM   113   C  CG    . PHE A 1 24  ? 8.716   51.144  66.622 1.00 12.27 ? 432  PHE B CG    1 
ATOM   114   C  CD1   . PHE A 1 24  ? 7.808   51.696  67.532 1.00 12.53 ? 432  PHE B CD1   1 
ATOM   115   C  CD2   . PHE A 1 24  ? 9.506   50.071  67.029 1.00 11.85 ? 432  PHE B CD2   1 
ATOM   116   C  CE1   . PHE A 1 24  ? 7.701   51.186  68.824 1.00 12.96 ? 432  PHE B CE1   1 
ATOM   117   C  CE2   . PHE A 1 24  ? 9.399   49.559  68.317 1.00 12.24 ? 432  PHE B CE2   1 
ATOM   118   C  CZ    . PHE A 1 24  ? 8.498   50.107  69.220 1.00 11.94 ? 432  PHE B CZ    1 
ATOM   119   N  N     . LEU A 1 25  ? 11.351  52.725  63.288 1.00 11.14 ? 433  LEU B N     1 
ATOM   120   C  CA    . LEU A 1 25  ? 11.870  52.845  61.927 1.00 11.25 ? 433  LEU B CA    1 
ATOM   121   C  C     . LEU A 1 25  ? 11.892  51.481  61.234 1.00 11.70 ? 433  LEU B C     1 
ATOM   122   O  O     . LEU A 1 25  ? 12.605  50.567  61.663 1.00 12.17 ? 433  LEU B O     1 
ATOM   123   C  CB    . LEU A 1 25  ? 13.283  53.444  61.943 1.00 10.62 ? 433  LEU B CB    1 
ATOM   124   C  CG    . LEU A 1 25  ? 13.485  54.812  62.610 1.00 9.98  ? 433  LEU B CG    1 
ATOM   125   C  CD1   . LEU A 1 25  ? 14.955  55.147  62.648 1.00 9.37  ? 433  LEU B CD1   1 
ATOM   126   C  CD2   . LEU A 1 25  ? 12.698  55.912  61.913 1.00 9.80  ? 433  LEU B CD2   1 
ATOM   127   N  N     . VAL A 1 26  ? 11.108  51.346  60.163 1.00 11.09 ? 434  VAL B N     1 
ATOM   128   C  CA    . VAL A 1 26  ? 11.040  50.097  59.394 1.00 10.40 ? 434  VAL B CA    1 
ATOM   129   C  C     . VAL A 1 26  ? 11.484  50.284  57.936 1.00 11.08 ? 434  VAL B C     1 
ATOM   130   O  O     . VAL A 1 26  ? 11.512  51.411  57.435 1.00 11.16 ? 434  VAL B O     1 
ATOM   131   C  CB    . VAL A 1 26  ? 9.629   49.449  59.490 1.00 10.25 ? 434  VAL B CB    1 
ATOM   132   C  CG1   . VAL A 1 26  ? 9.346   48.993  60.921 1.00 10.23 ? 434  VAL B CG1   1 
ATOM   133   C  CG2   . VAL A 1 26  ? 8.543   50.386  58.992 1.00 9.40  ? 434  VAL B CG2   1 
ATOM   134   N  N     . GLU A 1 27  ? 11.834  49.178  57.260 1.00 11.89 ? 435  GLU B N     1 
ATOM   135   C  CA    . GLU A 1 27  ? 12.357  49.234  55.868 1.00 12.89 ? 435  GLU B CA    1 
ATOM   136   C  C     . GLU A 1 27  ? 11.369  49.765  54.816 1.00 14.02 ? 435  GLU B C     1 
ATOM   137   O  O     . GLU A 1 27  ? 11.790  50.354  53.813 1.00 15.52 ? 435  GLU B O     1 
ATOM   138   C  CB    . GLU A 1 27  ? 12.888  47.859  55.434 1.00 12.56 ? 435  GLU B CB    1 
ATOM   139   C  CG    . GLU A 1 27  ? 14.108  47.364  56.208 1.00 12.47 ? 435  GLU B CG    1 
ATOM   140   C  CD    . GLU A 1 27  ? 14.576  45.957  55.814 1.00 12.90 ? 435  GLU B CD    1 
ATOM   141   O  OE1   . GLU A 1 27  ? 15.389  45.404  56.579 1.00 14.74 ? 435  GLU B OE1   1 
ATOM   142   O  OE2   . GLU A 1 27  ? 14.161  45.381  54.771 1.00 13.37 ? 435  GLU B OE2   1 
ATOM   143   N  N     . GLY A 1 28  ? 10.071  49.542  55.026 1.00 14.43 ? 436  GLY B N     1 
ATOM   144   C  CA    . GLY A 1 28  ? 9.062   49.996  54.074 1.00 14.64 ? 436  GLY B CA    1 
ATOM   145   C  C     . GLY A 1 28  ? 7.632   49.733  54.492 1.00 15.13 ? 436  GLY B C     1 
ATOM   146   O  O     . GLY A 1 28  ? 7.359   49.521  55.671 1.00 15.56 ? 436  GLY B O     1 
ATOM   147   N  N     . ASP A 1 29  ? 6.727   49.751  53.516 1.00 15.65 ? 437  ASP B N     1 
ATOM   148   C  CA    . ASP A 1 29  ? 5.295   49.553  53.737 1.00 16.30 ? 437  ASP B CA    1 
ATOM   149   C  C     . ASP A 1 29  ? 4.913   48.113  54.070 1.00 17.21 ? 437  ASP B C     1 
ATOM   150   O  O     . ASP A 1 29  ? 3.983   47.874  54.844 1.00 18.30 ? 437  ASP B O     1 
ATOM   151   C  CB    . ASP A 1 29  ? 4.476   50.044  52.539 1.00 17.17 ? 437  ASP B CB    1 
ATOM   152   C  CG    . ASP A 1 29  ? 4.549   51.562  52.350 1.00 18.89 ? 437  ASP B CG    1 
ATOM   153   O  OD1   . ASP A 1 29  ? 4.814   52.288  53.336 1.00 20.44 ? 437  ASP B OD1   1 
ATOM   154   O  OD2   . ASP A 1 29  ? 4.340   52.020  51.186 1.00 19.71 ? 437  ASP B OD2   1 
ATOM   155   N  N     . SER A 1 30  ? 5.636   47.146  53.507 1.00 17.32 ? 438  SER B N     1 
ATOM   156   C  CA    . SER A 1 30  ? 5.342   45.746  53.788 1.00 18.35 ? 438  SER B CA    1 
ATOM   157   C  C     . SER A 1 30  ? 5.580   45.467  55.262 1.00 19.08 ? 438  SER B C     1 
ATOM   158   O  O     . SER A 1 30  ? 4.860   44.692  55.878 1.00 17.69 ? 438  SER B O     1 
ATOM   159   C  CB    . SER A 1 30  ? 6.207   44.828  52.931 1.00 18.75 ? 438  SER B CB    1 
ATOM   160   O  OG    . SER A 1 30  ? 5.895   45.054  51.554 1.00 19.35 ? 438  SER B OG    1 
ATOM   161   N  N     . ALA A 1 31  ? 6.606   46.115  55.812 1.00 17.95 ? 439  ALA B N     1 
ATOM   162   C  CA    . ALA A 1 31  ? 6.947   45.978  57.217 1.00 16.36 ? 439  ALA B CA    1 
ATOM   163   C  C     . ALA A 1 31  ? 6.134   46.968  58.036 1.00 15.33 ? 439  ALA B C     1 
ATOM   164   O  O     . ALA A 1 31  ? 5.736   46.678  59.154 1.00 14.79 ? 439  ALA B O     1 
ATOM   165   C  CB    . ALA A 1 31  ? 8.431   46.213  57.431 1.00 17.38 ? 439  ALA B CB    1 
ATOM   166   N  N     . GLY A 1 32  ? 5.893   48.137  57.458 1.00 13.98 ? 440  GLY B N     1 
ATOM   167   C  CA    . GLY A 1 32  ? 5.114   49.189  58.098 1.00 14.46 ? 440  GLY B CA    1 
ATOM   168   C  C     . GLY A 1 32  ? 3.663   48.814  58.357 1.00 16.39 ? 440  GLY B C     1 
ATOM   169   O  O     . GLY A 1 32  ? 3.067   49.273  59.336 1.00 15.31 ? 440  GLY B O     1 
ATOM   170   N  N     . GLY A 1 33  ? 3.110   47.977  57.472 1.00 16.98 ? 441  GLY B N     1 
ATOM   171   C  CA    . GLY A 1 33  ? 1.726   47.500  57.562 1.00 16.20 ? 441  GLY B CA    1 
ATOM   172   C  C     . GLY A 1 33  ? 1.463   46.674  58.804 1.00 16.07 ? 441  GLY B C     1 
ATOM   173   O  O     . GLY A 1 33  ? 0.520   46.954  59.558 1.00 16.73 ? 441  GLY B O     1 
ATOM   174   N  N     . SER A 1 34  ? 2.292   45.651  59.015 1.00 15.67 ? 442  SER B N     1 
ATOM   175   C  CA    . SER A 1 34  ? 2.197   44.809  60.211 1.00 16.11 ? 442  SER B CA    1 
ATOM   176   C  C     . SER A 1 34  ? 2.492   45.628  61.469 1.00 16.91 ? 442  SER B C     1 
ATOM   177   O  O     . SER A 1 34  ? 1.922   45.374  62.525 1.00 18.04 ? 442  SER B O     1 
ATOM   178   C  CB    . SER A 1 34  ? 3.162   43.623  60.125 1.00 16.04 ? 442  SER B CB    1 
ATOM   179   O  OG    . SER A 1 34  ? 2.816   42.729  59.089 1.00 15.76 ? 442  SER B OG    1 
ATOM   180   N  N     . THR A 1 35  ? 3.381   46.614  61.340 1.00 17.92 ? 443  THR B N     1 
ATOM   181   C  CA    . THR A 1 35  ? 3.781   47.473  62.458 1.00 18.22 ? 443  THR B CA    1 
ATOM   182   C  C     . THR A 1 35  ? 2.642   48.402  62.896 1.00 19.97 ? 443  THR B C     1 
ATOM   183   O  O     . THR A 1 35  ? 2.391   48.554  64.093 1.00 19.29 ? 443  THR B O     1 
ATOM   184   C  CB    . THR A 1 35  ? 5.035   48.304  62.113 1.00 17.10 ? 443  THR B CB    1 
ATOM   185   O  OG1   . THR A 1 35  ? 6.070   47.442  61.641 1.00 15.98 ? 443  THR B OG1   1 
ATOM   186   C  CG2   . THR A 1 35  ? 5.542   49.070  63.332 1.00 17.67 ? 443  THR B CG2   1 
ATOM   187   N  N     . LYS A 1 36  ? 1.966   49.018  61.922 1.00 21.38 ? 444  LYS B N     1 
ATOM   188   C  CA    . LYS A 1 36  ? 0.848   49.912  62.206 1.00 21.13 ? 444  LYS B CA    1 
ATOM   189   C  C     . LYS A 1 36  ? -0.355  49.165  62.799 1.00 21.99 ? 444  LYS B C     1 
ATOM   190   O  O     . LYS A 1 36  ? -1.035  49.690  63.676 1.00 24.56 ? 444  LYS B O     1 
ATOM   191   C  CB    . LYS A 1 36  ? 0.486   50.769  60.974 1.00 22.57 ? 444  LYS B CB    1 
ATOM   192   C  CG    . LYS A 1 36  ? -0.755  51.652  61.146 1.00 25.99 ? 444  LYS B CG    1 
ATOM   193   C  CD    . LYS A 1 36  ? -0.737  52.974  60.329 1.00 25.58 ? 444  LYS B CD    1 
ATOM   194   C  CE    . LYS A 1 36  ? -0.704  52.826  58.806 1.00 29.10 ? 444  LYS B CE    1 
ATOM   195   N  NZ    . LYS A 1 36  ? 0.644   52.466  58.265 1.00 28.76 ? 444  LYS B NZ    1 
ATOM   196   N  N     . SER A 1 37  ? -0.580  47.934  62.349 1.00 21.01 ? 445  SER B N     1 
ATOM   197   C  CA    . SER A 1 37  ? -1.694  47.110  62.826 1.00 19.57 ? 445  SER B CA    1 
ATOM   198   C  C     . SER A 1 37  ? -1.481  46.524  64.222 1.00 19.00 ? 445  SER B C     1 
ATOM   199   O  O     . SER A 1 37  ? -2.442  46.242  64.931 1.00 17.56 ? 445  SER B O     1 
ATOM   200   C  CB    . SER A 1 37  ? -1.971  45.975  61.839 1.00 18.75 ? 445  SER B CB    1 
ATOM   201   O  OG    . SER A 1 37  ? -2.330  46.484  60.575 1.00 21.42 ? 445  SER B OG    1 
ATOM   202   N  N     . GLY A 1 38  ? -0.233  46.347  64.629 1.00 19.68 ? 446  GLY B N     1 
ATOM   203   C  CA    . GLY A 1 38  ? 0.052   45.777  65.933 1.00 20.75 ? 446  GLY B CA    1 
ATOM   204   C  C     . GLY A 1 38  ? 0.470   46.737  67.030 1.00 22.66 ? 446  GLY B C     1 
ATOM   205   O  O     . GLY A 1 38  ? 0.520   46.362  68.190 1.00 25.29 ? 446  GLY B O     1 
ATOM   206   N  N     . ARG A 1 39  ? 0.763   47.973  66.651 1.00 21.53 ? 447  ARG B N     1 
ATOM   207   C  CA    . ARG A 1 39  ? 1.221   49.017  67.565 1.00 21.51 ? 447  ARG B CA    1 
ATOM   208   C  C     . ARG A 1 39  ? 0.154   49.605  68.474 1.00 20.00 ? 447  ARG B C     1 
ATOM   209   O  O     . ARG A 1 39  ? -1.033  49.427  68.255 1.00 20.40 ? 447  ARG B O     1 
ATOM   210   C  CB    . ARG A 1 39  ? 1.804   50.179  66.757 1.00 19.45 ? 447  ARG B CB    1 
ATOM   211   C  CG    . ARG A 1 39  ? 0.742   51.025  66.076 1.00 18.53 ? 447  ARG B CG    1 
ATOM   212   C  CD    . ARG A 1 39  ? 1.272   52.343  65.564 1.00 18.81 ? 447  ARG B CD    1 
ATOM   213   N  NE    . ARG A 1 39  ? 0.231   53.088  64.866 1.00 20.16 ? 447  ARG B NE    1 
ATOM   214   C  CZ    . ARG A 1 39  ? 0.391   54.296  64.349 1.00 19.14 ? 447  ARG B CZ    1 
ATOM   215   N  NH1   . ARG A 1 39  ? -0.603  54.890  63.739 1.00 18.25 ? 447  ARG B NH1   1 
ATOM   216   N  NH2   . ARG A 1 39  ? 1.552   54.907  64.449 1.00 21.08 ? 447  ARG B NH2   1 
ATOM   217   N  N     . ASP A 1 40  ? 0.606   50.311  69.495 1.00 19.72 ? 448  ASP B N     1 
ATOM   218   C  CA    . ASP A 1 40  ? -0.277  51.030  70.385 1.00 19.71 ? 448  ASP B CA    1 
ATOM   219   C  C     . ASP A 1 40  ? -0.211  52.438  69.811 1.00 19.57 ? 448  ASP B C     1 
ATOM   220   O  O     . ASP A 1 40  ? 0.782   53.124  69.975 1.00 18.33 ? 448  ASP B O     1 
ATOM   221   C  CB    . ASP A 1 40  ? 0.248   51.003  71.816 1.00 22.98 ? 448  ASP B CB    1 
ATOM   222   C  CG    . ASP A 1 40  ? -0.629  51.790  72.768 1.00 25.29 ? 448  ASP B CG    1 
ATOM   223   O  OD1   . ASP A 1 40  ? -1.754  52.150  72.378 1.00 28.12 ? 448  ASP B OD1   1 
ATOM   224   O  OD2   . ASP A 1 40  ? -0.189  52.035  73.901 1.00 24.22 ? 448  ASP B OD2   1 
ATOM   225   N  N     . SER A 1 41  ? -1.252  52.861  69.110 1.00 19.90 ? 449  SER B N     1 
ATOM   226   C  CA    . SER A 1 41  ? -1.248  54.184  68.473 1.00 21.47 ? 449  SER B CA    1 
ATOM   227   C  C     . SER A 1 41  ? -1.240  55.394  69.428 1.00 22.37 ? 449  SER B C     1 
ATOM   228   O  O     . SER A 1 41  ? -1.180  56.536  68.975 1.00 22.31 ? 449  SER B O     1 
ATOM   229   C  CB    . SER A 1 41  ? -2.398  54.295  67.457 1.00 21.44 ? 449  SER B CB    1 
ATOM   230   O  OG    . SER A 1 41  ? -3.653  54.141  68.073 1.00 22.08 ? 449  SER B OG    1 
ATOM   231   N  N     . ARG A 1 42  ? -1.275  55.146  70.733 1.00 24.12 ? 450  ARG B N     1 
ATOM   232   C  CA    . ARG A 1 42  ? -1.267  56.241  71.700 1.00 24.43 ? 450  ARG B CA    1 
ATOM   233   C  C     . ARG A 1 42  ? 0.141   56.803  71.891 1.00 24.51 ? 450  ARG B C     1 
ATOM   234   O  O     . ARG A 1 42  ? 0.314   58.027  71.956 1.00 25.94 ? 450  ARG B O     1 
ATOM   235   C  CB    . ARG A 1 42  ? -1.864  55.811  73.051 1.00 25.74 ? 450  ARG B CB    1 
ATOM   236   C  CG    . ARG A 1 42  ? -2.158  56.986  73.986 1.00 27.64 ? 450  ARG B CG    1 
ATOM   237   C  CD    . ARG A 1 42  ? -2.705  56.593  75.358 1.00 28.26 ? 450  ARG B CD    1 
ATOM   238   N  NE    . ARG A 1 42  ? -1.722  55.847  76.162 1.00 27.83 ? 450  ARG B NE    1 
ATOM   239   C  CZ    . ARG A 1 42  ? -0.768  56.402  76.905 1.00 24.37 ? 450  ARG B CZ    1 
ATOM   240   N  NH1   . ARG A 1 42  ? -0.641  57.722  76.953 1.00 21.59 ? 450  ARG B NH1   1 
ATOM   241   N  NH2   . ARG A 1 42  ? 0.068   55.637  77.586 1.00 23.91 ? 450  ARG B NH2   1 
ATOM   242   N  N     . THR A 1 43  ? 1.139   55.919  71.962 1.00 22.24 ? 451  THR B N     1 
ATOM   243   C  CA    . THR A 1 43  ? 2.526   56.340  72.207 1.00 21.56 ? 451  THR B CA    1 
ATOM   244   C  C     . THR A 1 43  ? 3.585   55.831  71.218 1.00 22.23 ? 451  THR B C     1 
ATOM   245   O  O     . THR A 1 43  ? 4.777   56.103  71.398 1.00 21.42 ? 451  THR B O     1 
ATOM   246   C  CB    . THR A 1 43  ? 2.972   55.968  73.645 1.00 20.95 ? 451  THR B CB    1 
ATOM   247   O  OG1   . THR A 1 43  ? 2.676   54.591  73.895 1.00 19.26 ? 451  THR B OG1   1 
ATOM   248   C  CG2   . THR A 1 43  ? 2.253   56.823  74.679 1.00 19.65 ? 451  THR B CG2   1 
ATOM   249   N  N     . GLN A 1 44  ? 3.158   55.122  70.177 1.00 21.78 ? 452  GLN B N     1 
ATOM   250   C  CA    . GLN A 1 44  ? 4.097   54.549  69.202 1.00 20.47 ? 452  GLN B CA    1 
ATOM   251   C  C     . GLN A 1 44  ? 3.901   55.092  67.789 1.00 21.89 ? 452  GLN B C     1 
ATOM   252   O  O     . GLN A 1 44  ? 2.888   54.819  67.130 1.00 23.25 ? 452  GLN B O     1 
ATOM   253   C  CB    . GLN A 1 44  ? 4.033   53.014  69.203 1.00 19.93 ? 452  GLN B CB    1 
ATOM   254   C  CG    . GLN A 1 44  ? 4.417   52.378  70.538 1.00 19.17 ? 452  GLN B CG    1 
ATOM   255   C  CD    . GLN A 1 44  ? 4.294   50.858  70.546 1.00 17.59 ? 452  GLN B CD    1 
ATOM   256   O  OE1   . GLN A 1 44  ? 3.591   50.273  69.726 1.00 19.07 ? 452  GLN B OE1   1 
ATOM   257   N  NE2   . GLN A 1 44  ? 4.964   50.223  71.494 1.00 15.08 ? 452  GLN B NE2   1 
ATOM   258   N  N     . ALA A 1 45  ? 4.886   55.867  67.336 1.00 21.05 ? 453  ALA B N     1 
ATOM   259   C  CA    . ALA A 1 45  ? 4.881   56.434  65.996 1.00 18.76 ? 453  ALA B CA    1 
ATOM   260   C  C     . ALA A 1 45  ? 5.636   55.502  65.060 1.00 17.09 ? 453  ALA B C     1 
ATOM   261   O  O     . ALA A 1 45  ? 6.488   54.735  65.495 1.00 17.05 ? 453  ALA B O     1 
ATOM   262   C  CB    . ALA A 1 45  ? 5.506   57.829  66.002 1.00 18.10 ? 453  ALA B CB    1 
ATOM   263   N  N     . ILE A 1 46  ? 5.317   55.577  63.773 1.00 16.73 ? 454  ILE B N     1 
ATOM   264   C  CA    . ILE A 1 46  ? 5.935   54.704  62.774 1.00 15.07 ? 454  ILE B CA    1 
ATOM   265   C  C     . ILE A 1 46  ? 6.402   55.497  61.558 1.00 15.07 ? 454  ILE B C     1 
ATOM   266   O  O     . ILE A 1 46  ? 5.643   56.280  60.983 1.00 16.19 ? 454  ILE B O     1 
ATOM   267   C  CB    . ILE A 1 46  ? 4.949   53.600  62.315 1.00 15.07 ? 454  ILE B CB    1 
ATOM   268   C  CG1   . ILE A 1 46  ? 4.436   52.826  63.520 1.00 16.32 ? 454  ILE B CG1   1 
ATOM   269   C  CG2   . ILE A 1 46  ? 5.601   52.652  61.294 1.00 15.30 ? 454  ILE B CG2   1 
ATOM   270   C  CD1   . ILE A 1 46  ? 3.319   51.904  63.201 1.00 17.82 ? 454  ILE B CD1   1 
ATOM   271   N  N     . LEU A 1 47  ? 7.656   55.278  61.183 1.00 13.79 ? 455  LEU B N     1 
ATOM   272   C  CA    . LEU A 1 47  ? 8.227   55.908  60.008 1.00 13.37 ? 455  LEU B CA    1 
ATOM   273   C  C     . LEU A 1 47  ? 8.799   54.839  59.065 1.00 13.86 ? 455  LEU B C     1 
ATOM   274   O  O     . LEU A 1 47  ? 9.898   54.330  59.291 1.00 14.22 ? 455  LEU B O     1 
ATOM   275   C  CB    . LEU A 1 47  ? 9.295   56.948  60.385 1.00 12.85 ? 455  LEU B CB    1 
ATOM   276   C  CG    . LEU A 1 47  ? 10.062  57.669  59.266 1.00 12.35 ? 455  LEU B CG    1 
ATOM   277   C  CD1   . LEU A 1 47  ? 9.163   58.325  58.228 1.00 11.47 ? 455  LEU B CD1   1 
ATOM   278   C  CD2   . LEU A 1 47  ? 11.018  58.686  59.851 1.00 12.42 ? 455  LEU B CD2   1 
ATOM   279   N  N     . PRO A 1 48  ? 8.024   54.455  58.037 1.00 13.78 ? 456  PRO B N     1 
ATOM   280   C  CA    . PRO A 1 48  ? 8.583   53.531  57.061 1.00 14.31 ? 456  PRO B CA    1 
ATOM   281   C  C     . PRO A 1 48  ? 9.514   54.262  56.089 1.00 15.68 ? 456  PRO B C     1 
ATOM   282   O  O     . PRO A 1 48  ? 9.143   55.310  55.546 1.00 15.91 ? 456  PRO B O     1 
ATOM   283   C  CB    . PRO A 1 48  ? 7.344   52.982  56.329 1.00 14.76 ? 456  PRO B CB    1 
ATOM   284   C  CG    . PRO A 1 48  ? 6.283   54.011  56.518 1.00 14.45 ? 456  PRO B CG    1 
ATOM   285   C  CD    . PRO A 1 48  ? 6.617   54.810  57.747 1.00 13.40 ? 456  PRO B CD    1 
ATOM   286   N  N     . LEU A 1 49  ? 10.717  53.715  55.896 1.00 16.52 ? 457  LEU B N     1 
ATOM   287   C  CA    . LEU A 1 49  ? 11.706  54.271  54.969 1.00 17.24 ? 457  LEU B CA    1 
ATOM   288   C  C     . LEU A 1 49  ? 11.546  53.621  53.588 1.00 19.06 ? 457  LEU B C     1 
ATOM   289   O  O     . LEU A 1 49  ? 10.466  53.117  53.269 1.00 18.91 ? 457  LEU B O     1 
ATOM   290   C  CB    . LEU A 1 49  ? 13.129  54.093  55.516 1.00 17.21 ? 457  LEU B CB    1 
ATOM   291   C  CG    . LEU A 1 49  ? 13.445  54.682  56.905 1.00 17.09 ? 457  LEU B CG    1 
ATOM   292   C  CD1   . LEU A 1 49  ? 14.826  54.320  57.355 1.00 16.65 ? 457  LEU B CD1   1 
ATOM   293   C  CD2   . LEU A 1 49  ? 13.262  56.187  56.945 1.00 16.73 ? 457  LEU B CD2   1 
ATOM   294   N  N     . ARG A 1 50  ? 12.609  53.635  52.776 1.00 19.86 ? 458  ARG B N     1 
ATOM   295   C  CA    . ARG A 1 50  ? 12.565  53.080  51.414 1.00 20.96 ? 458  ARG B CA    1 
ATOM   296   C  C     . ARG A 1 50  ? 13.734  52.146  51.109 1.00 19.81 ? 458  ARG B C     1 
ATOM   297   O  O     . ARG A 1 50  ? 14.379  52.273  50.065 1.00 18.22 ? 458  ARG B O     1 
ATOM   298   C  CB    . ARG A 1 50  ? 12.556  54.216  50.376 1.00 22.98 ? 458  ARG B CB    1 
ATOM   299   C  CG    . ARG A 1 50  ? 11.260  54.993  50.258 1.00 24.53 ? 458  ARG B CG    1 
ATOM   300   C  CD    . ARG A 1 50  ? 10.188  54.221  49.540 1.00 27.78 ? 458  ARG B CD    1 
ATOM   301   N  NE    . ARG A 1 50  ? 8.920   54.948  49.486 1.00 29.57 ? 458  ARG B NE    1 
ATOM   302   C  CZ    . ARG A 1 50  ? 7.951   54.812  50.401 1.00 31.39 ? 458  ARG B CZ    1 
ATOM   303   N  NH1   . ARG A 1 50  ? 8.107   54.001  51.450 1.00 28.77 ? 458  ARG B NH1   1 
ATOM   304   N  NH2   . ARG A 1 50  ? 6.807   55.475  50.276 1.00 32.01 ? 458  ARG B NH2   1 
ATOM   305   N  N     . GLY A 1 51  ? 13.997  51.204  52.004 1.00 19.01 ? 459  GLY B N     1 
ATOM   306   C  CA    . GLY A 1 51  ? 15.087  50.254  51.809 1.00 17.99 ? 459  GLY B CA    1 
ATOM   307   C  C     . GLY A 1 51  ? 16.433  50.775  52.254 1.00 18.22 ? 459  GLY B C     1 
ATOM   308   O  O     . GLY A 1 51  ? 16.540  51.385  53.326 1.00 18.40 ? 459  GLY B O     1 
ATOM   309   N  N     . LYS A 1 52  ? 17.461  50.536  51.442 1.00 17.95 ? 460  LYS B N     1 
ATOM   310   C  CA    . LYS A 1 52  ? 18.822  50.967  51.767 1.00 17.20 ? 460  LYS B CA    1 
ATOM   311   C  C     . LYS A 1 52  ? 18.907  52.489  51.743 1.00 17.13 ? 460  LYS B C     1 
ATOM   312   O  O     . LYS A 1 52  ? 18.599  53.127  50.739 1.00 19.17 ? 460  LYS B O     1 
ATOM   313   C  CB    . LYS A 1 52  ? 19.859  50.359  50.793 1.00 16.47 ? 460  LYS B CB    1 
ATOM   314   C  CG    . LYS A 1 52  ? 19.987  48.826  50.793 1.00 15.45 ? 460  LYS B CG    1 
ATOM   315   C  CD    . LYS A 1 52  ? 20.651  48.274  52.020 1.00 15.45 ? 460  LYS B CD    1 
ATOM   316   C  CE    . LYS A 1 52  ? 20.760  46.734  52.030 1.00 15.72 ? 460  LYS B CE    1 
ATOM   317   N  NZ    . LYS A 1 52  ? 21.754  46.175  51.059 1.00 15.44 ? 460  LYS B NZ    1 
ATOM   318   N  N     . ILE A 1 53  ? 19.308  53.059  52.864 1.00 17.23 ? 461  ILE B N     1 
ATOM   319   C  CA    . ILE A 1 53  ? 19.473  54.493  52.976 1.00 16.39 ? 461  ILE B CA    1 
ATOM   320   C  C     . ILE A 1 53  ? 20.928  54.898  52.703 1.00 17.09 ? 461  ILE B C     1 
ATOM   321   O  O     . ILE A 1 53  ? 21.861  54.120  52.925 1.00 19.71 ? 461  ILE B O     1 
ATOM   322   C  CB    . ILE A 1 53  ? 18.967  55.024  54.353 1.00 16.94 ? 461  ILE B CB    1 
ATOM   323   C  CG1   . ILE A 1 53  ? 19.014  56.561  54.400 1.00 17.60 ? 461  ILE B CG1   1 
ATOM   324   C  CG2   . ILE A 1 53  ? 19.746  54.416  55.511 1.00 15.32 ? 461  ILE B CG2   1 
ATOM   325   C  CD1   . ILE A 1 53  ? 18.284  57.255  53.246 1.00 17.61 ? 461  ILE B CD1   1 
ATOM   326   N  N     . LEU A 1 54  ? 21.095  56.114  52.199 1.00 16.18 ? 462  LEU B N     1 
ATOM   327   C  CA    . LEU A 1 54  ? 22.379  56.718  51.874 1.00 15.88 ? 462  LEU B CA    1 
ATOM   328   C  C     . LEU A 1 54  ? 23.427  56.577  52.988 1.00 16.49 ? 462  LEU B C     1 
ATOM   329   O  O     . LEU A 1 54  ? 23.118  56.763  54.172 1.00 16.28 ? 462  LEU B O     1 
ATOM   330   C  CB    . LEU A 1 54  ? 22.152  58.206  51.584 1.00 14.60 ? 462  LEU B CB    1 
ATOM   331   C  CG    . LEU A 1 54  ? 23.296  59.096  51.119 1.00 14.32 ? 462  LEU B CG    1 
ATOM   332   C  CD1   . LEU A 1 54  ? 23.713  58.733  49.705 1.00 13.37 ? 462  LEU B CD1   1 
ATOM   333   C  CD2   . LEU A 1 54  ? 22.834  60.533  51.164 1.00 14.41 ? 462  LEU B CD2   1 
ATOM   334   N  N     . ASN A 1 55  ? 24.656  56.235  52.599 1.00 14.77 ? 463  ASN B N     1 
ATOM   335   C  CA    . ASN A 1 55  ? 25.759  56.127  53.550 1.00 15.50 ? 463  ASN B CA    1 
ATOM   336   C  C     . ASN A 1 55  ? 26.383  57.517  53.691 1.00 14.95 ? 463  ASN B C     1 
ATOM   337   O  O     . ASN A 1 55  ? 27.146  57.964  52.819 1.00 14.93 ? 463  ASN B O     1 
ATOM   338   C  CB    . ASN A 1 55  ? 26.791  55.082  53.079 1.00 16.44 ? 463  ASN B CB    1 
ATOM   339   C  CG    . ASN A 1 55  ? 27.952  54.895  54.059 1.00 17.17 ? 463  ASN B CG    1 
ATOM   340   O  OD1   . ASN A 1 55  ? 28.101  55.643  55.031 1.00 18.56 ? 463  ASN B OD1   1 
ATOM   341   N  ND2   . ASN A 1 55  ? 28.786  53.895  53.799 1.00 16.10 ? 463  ASN B ND2   1 
ATOM   342   N  N     . VAL A 1 56  ? 26.049  58.189  54.791 1.00 15.92 ? 464  VAL B N     1 
ATOM   343   C  CA    . VAL A 1 56  ? 26.516  59.562  55.036 1.00 17.49 ? 464  VAL B CA    1 
ATOM   344   C  C     . VAL A 1 56  ? 28.038  59.717  55.079 1.00 18.73 ? 464  VAL B C     1 
ATOM   345   O  O     . VAL A 1 56  ? 28.555  60.792  54.770 1.00 21.59 ? 464  VAL B O     1 
ATOM   346   C  CB    . VAL A 1 56  ? 25.846  60.218  56.280 1.00 17.36 ? 464  VAL B CB    1 
ATOM   347   C  CG1   . VAL A 1 56  ? 24.322  60.250  56.113 1.00 15.73 ? 464  VAL B CG1   1 
ATOM   348   C  CG2   . VAL A 1 56  ? 26.257  59.524  57.567 1.00 17.03 ? 464  VAL B CG2   1 
ATOM   349   N  N     . GLU A 1 57  ? 28.743  58.646  55.439 1.00 20.38 ? 465  GLU B N     1 
ATOM   350   C  CA    . GLU A 1 57  ? 30.207  58.652  55.460 1.00 22.94 ? 465  GLU B CA    1 
ATOM   351   C  C     . GLU A 1 57  ? 30.821  58.841  54.079 1.00 23.04 ? 465  GLU B C     1 
ATOM   352   O  O     . GLU A 1 57  ? 31.919  59.378  53.963 1.00 24.91 ? 465  GLU B O     1 
ATOM   353   C  CB    . GLU A 1 57  ? 30.759  57.368  56.094 1.00 25.24 ? 465  GLU B CB    1 
ATOM   354   C  CG    . GLU A 1 57  ? 30.777  57.373  57.608 1.00 27.54 ? 465  GLU B CG    1 
ATOM   355   C  CD    . GLU A 1 57  ? 31.862  58.254  58.184 1.00 29.11 ? 465  GLU B CD    1 
ATOM   356   O  OE1   . GLU A 1 57  ? 33.043  58.138  57.775 1.00 27.10 ? 465  GLU B OE1   1 
ATOM   357   O  OE2   . GLU A 1 57  ? 31.539  59.056  59.075 1.00 31.67 ? 465  GLU B OE2   1 
ATOM   358   N  N     . LYS A 1 58  ? 30.120  58.402  53.036 1.00 22.15 ? 466  LYS B N     1 
ATOM   359   C  CA    . LYS A 1 58  ? 30.633  58.519  51.671 1.00 19.81 ? 466  LYS B CA    1 
ATOM   360   C  C     . LYS A 1 58  ? 29.989  59.665  50.885 1.00 18.47 ? 466  LYS B C     1 
ATOM   361   O  O     . LYS A 1 58  ? 30.409  59.964  49.766 1.00 17.40 ? 466  LYS B O     1 
ATOM   362   C  CB    . LYS A 1 58  ? 30.425  57.199  50.911 1.00 20.23 ? 466  LYS B CB    1 
ATOM   363   C  CG    . LYS A 1 58  ? 31.143  55.990  51.486 1.00 20.27 ? 466  LYS B CG    1 
ATOM   364   C  CD    . LYS A 1 58  ? 30.766  54.740  50.707 1.00 20.51 ? 466  LYS B CD    1 
ATOM   365   C  CE    . LYS A 1 58  ? 31.419  53.499  51.304 1.00 22.69 ? 466  LYS B CE    1 
ATOM   366   N  NZ    . LYS A 1 58  ? 30.966  52.264  50.605 1.00 23.70 ? 466  LYS B NZ    1 
ATOM   367   N  N     . ALA A 1 59  ? 28.971  60.298  51.453 1.00 18.39 ? 467  ALA B N     1 
ATOM   368   C  CA    . ALA A 1 59  ? 28.278  61.379  50.758 1.00 18.04 ? 467  ALA B CA    1 
ATOM   369   C  C     . ALA A 1 59  ? 28.563  62.758  51.337 1.00 19.44 ? 467  ALA B C     1 
ATOM   370   O  O     . ALA A 1 59  ? 28.847  62.905  52.530 1.00 20.95 ? 467  ALA B O     1 
ATOM   371   C  CB    . ALA A 1 59  ? 26.788  61.115  50.728 1.00 18.62 ? 467  ALA B CB    1 
ATOM   372   N  N     . ARG A 1 60  ? 28.492  63.764  50.470 1.00 18.89 ? 468  ARG B N     1 
ATOM   373   C  CA    . ARG A 1 60  ? 28.703  65.156  50.871 1.00 19.26 ? 468  ARG B CA    1 
ATOM   374   C  C     . ARG A 1 60  ? 27.363  65.753  51.301 1.00 19.98 ? 468  ARG B C     1 
ATOM   375   O  O     . ARG A 1 60  ? 26.307  65.265  50.894 1.00 18.09 ? 468  ARG B O     1 
ATOM   376   C  CB    . ARG A 1 60  ? 29.341  65.960  49.738 1.00 17.72 ? 468  ARG B CB    1 
ATOM   377   C  CG    . ARG A 1 60  ? 30.729  65.464  49.384 1.00 17.30 ? 468  ARG B CG    1 
ATOM   378   C  CD    . ARG A 1 60  ? 31.350  66.226  48.231 1.00 15.78 ? 468  ARG B CD    1 
ATOM   379   N  NE    . ARG A 1 60  ? 32.759  65.809  48.064 1.00 14.99 ? 468  ARG B NE    1 
ATOM   380   C  CZ    . ARG A 1 60  ? 33.792  66.348  48.689 1.00 14.35 ? 468  ARG B CZ    1 
ATOM   381   N  NH1   . ARG A 1 60  ? 34.998  65.872  48.464 1.00 13.34 ? 468  ARG B NH1   1 
ATOM   382   N  NH2   . ARG A 1 60  ? 33.585  67.371  49.534 1.00 15.38 ? 468  ARG B NH2   1 
ATOM   383   N  N     . LEU A 1 61  ? 27.428  66.808  52.118 1.00 19.07 ? 469  LEU B N     1 
ATOM   384   C  CA    . LEU A 1 61  ? 26.245  67.453  52.699 1.00 20.01 ? 469  LEU B CA    1 
ATOM   385   C  C     . LEU A 1 61  ? 25.090  67.751  51.737 1.00 21.81 ? 469  LEU B C     1 
ATOM   386   O  O     . LEU A 1 61  ? 23.942  67.447  52.055 1.00 21.50 ? 469  LEU B O     1 
ATOM   387   C  CB    . LEU A 1 61  ? 26.647  68.721  53.464 1.00 20.61 ? 469  LEU B CB    1 
ATOM   388   C  CG    . LEU A 1 61  ? 25.636  69.301  54.455 1.00 21.57 ? 469  LEU B CG    1 
ATOM   389   C  CD1   . LEU A 1 61  ? 25.364  68.298  55.599 1.00 22.20 ? 469  LEU B CD1   1 
ATOM   390   C  CD2   . LEU A 1 61  ? 26.125  70.634  55.000 1.00 19.44 ? 469  LEU B CD2   1 
ATOM   391   N  N     . ASP A 1 62  ? 25.384  68.333  50.568 1.00 22.78 ? 470  ASP B N     1 
ATOM   392   C  CA    . ASP A 1 62  ? 24.338  68.632  49.580 1.00 23.31 ? 470  ASP B CA    1 
ATOM   393   C  C     . ASP A 1 62  ? 23.508  67.383  49.239 1.00 22.12 ? 470  ASP B C     1 
ATOM   394   O  O     . ASP A 1 62  ? 22.278  67.444  49.117 1.00 22.48 ? 470  ASP B O     1 
ATOM   395   C  CB    . ASP A 1 62  ? 24.919  69.279  48.303 1.00 26.48 ? 470  ASP B CB    1 
ATOM   396   C  CG    . ASP A 1 62  ? 25.788  68.298  47.454 1.00 31.58 ? 470  ASP B CG    1 
ATOM   397   O  OD1   . ASP A 1 62  ? 26.460  67.385  48.010 1.00 27.92 ? 470  ASP B OD1   1 
ATOM   398   O  OD2   . ASP A 1 62  ? 25.790  68.471  46.205 1.00 34.33 ? 470  ASP B OD2   1 
ATOM   399   N  N     . ARG A 1 63  ? 24.205  66.260  49.100 1.00 21.00 ? 471  ARG B N     1 
ATOM   400   C  CA    . ARG A 1 63  ? 23.610  64.967  48.782 1.00 21.89 ? 471  ARG B CA    1 
ATOM   401   C  C     . ARG A 1 63  ? 22.750  64.469  49.952 1.00 19.81 ? 471  ARG B C     1 
ATOM   402   O  O     . ARG A 1 63  ? 21.674  63.910  49.744 1.00 19.92 ? 471  ARG B O     1 
ATOM   403   C  CB    . ARG A 1 63  ? 24.734  63.963  48.492 1.00 22.72 ? 471  ARG B CB    1 
ATOM   404   C  CG    . ARG A 1 63  ? 24.293  62.584  48.073 1.00 26.11 ? 471  ARG B CG    1 
ATOM   405   C  CD    . ARG A 1 63  ? 23.934  62.505  46.604 1.00 28.03 ? 471  ARG B CD    1 
ATOM   406   N  NE    . ARG A 1 63  ? 23.339  61.213  46.282 1.00 27.92 ? 471  ARG B NE    1 
ATOM   407   C  CZ    . ARG A 1 63  ? 24.027  60.093  46.065 1.00 28.94 ? 471  ARG B CZ    1 
ATOM   408   N  NH1   . ARG A 1 63  ? 25.340  60.079  46.150 1.00 27.24 ? 471  ARG B NH1   1 
ATOM   409   N  NH2   . ARG A 1 63  ? 23.381  58.970  45.773 1.00 26.49 ? 471  ARG B NH2   1 
ATOM   410   N  N     . ILE A 1 64  ? 23.235  64.701  51.173 1.00 17.70 ? 472  ILE B N     1 
ATOM   411   C  CA    . ILE A 1 64  ? 22.570  64.267  52.401 1.00 18.07 ? 472  ILE B CA    1 
ATOM   412   C  C     . ILE A 1 64  ? 21.275  65.048  52.696 1.00 20.19 ? 472  ILE B C     1 
ATOM   413   O  O     . ILE A 1 64  ? 20.218  64.455  52.923 1.00 20.76 ? 472  ILE B O     1 
ATOM   414   C  CB    . ILE A 1 64  ? 23.542  64.317  53.616 1.00 15.71 ? 472  ILE B CB    1 
ATOM   415   C  CG1   . ILE A 1 64  ? 24.796  63.481  53.335 1.00 14.54 ? 472  ILE B CG1   1 
ATOM   416   C  CG2   . ILE A 1 64  ? 22.856  63.824  54.890 1.00 15.36 ? 472  ILE B CG2   1 
ATOM   417   C  CD1   . ILE A 1 64  ? 25.925  63.675  54.339 1.00 12.99 ? 472  ILE B CD1   1 
ATOM   418   N  N     . LEU A 1 65  ? 21.362  66.371  52.677 1.00 22.33 ? 473  LEU B N     1 
ATOM   419   C  CA    . LEU A 1 65  ? 20.218  67.228  52.962 1.00 25.04 ? 473  LEU B CA    1 
ATOM   420   C  C     . LEU A 1 65  ? 19.101  67.121  51.929 1.00 24.75 ? 473  LEU B C     1 
ATOM   421   O  O     . LEU A 1 65  ? 17.982  67.554  52.194 1.00 23.04 ? 473  LEU B O     1 
ATOM   422   C  CB    . LEU A 1 65  ? 20.658  68.691  53.091 1.00 26.59 ? 473  LEU B CB    1 
ATOM   423   C  CG    . LEU A 1 65  ? 21.589  69.064  54.255 1.00 28.66 ? 473  LEU B CG    1 
ATOM   424   C  CD1   . LEU A 1 65  ? 22.081  70.501  54.072 1.00 25.36 ? 473  LEU B CD1   1 
ATOM   425   C  CD2   . LEU A 1 65  ? 20.883  68.882  55.595 1.00 27.96 ? 473  LEU B CD2   1 
ATOM   426   N  N     . ASN A 1 66  ? 19.408  66.551  50.765 1.00 25.46 ? 474  ASN B N     1 
ATOM   427   C  CA    . ASN A 1 66  ? 18.414  66.398  49.697 1.00 25.65 ? 474  ASN B CA    1 
ATOM   428   C  C     . ASN A 1 66  ? 17.814  64.991  49.557 1.00 24.76 ? 474  ASN B C     1 
ATOM   429   O  O     . ASN A 1 66  ? 16.978  64.750  48.676 1.00 24.89 ? 474  ASN B O     1 
ATOM   430   C  CB    . ASN A 1 66  ? 18.957  66.895  48.344 1.00 29.81 ? 474  ASN B CB    1 
ATOM   431   C  CG    . ASN A 1 66  ? 19.038  68.423  48.258 1.00 35.09 ? 474  ASN B CG    1 
ATOM   432   O  OD1   . ASN A 1 66  ? 18.396  69.038  47.383 1.00 34.18 ? 474  ASN B OD1   1 
ATOM   433   N  ND2   . ASN A 1 66  ? 19.772  69.050  49.183 1.00 34.34 ? 474  ASN B ND2   1 
ATOM   434   N  N     . ASN A 1 67  ? 18.243  64.066  50.412 1.00 22.67 ? 475  ASN B N     1 
ATOM   435   C  CA    . ASN A 1 67  ? 17.699  62.710  50.410 1.00 24.00 ? 475  ASN B CA    1 
ATOM   436   C  C     . ASN A 1 67  ? 16.407  62.669  51.238 1.00 24.52 ? 475  ASN B C     1 
ATOM   437   O  O     . ASN A 1 67  ? 16.416  63.016  52.423 1.00 22.80 ? 475  ASN B O     1 
ATOM   438   C  CB    . ASN A 1 67  ? 18.733  61.704  50.918 1.00 23.75 ? 475  ASN B CB    1 
ATOM   439   C  CG    . ASN A 1 67  ? 18.137  60.336  51.217 1.00 26.12 ? 475  ASN B CG    1 
ATOM   440   O  OD1   . ASN A 1 67  ? 17.360  60.172  52.165 1.00 25.57 ? 475  ASN B OD1   1 
ATOM   441   N  ND2   . ASN A 1 67  ? 18.536  59.336  50.434 1.00 26.81 ? 475  ASN B ND2   1 
ATOM   442   N  N     . ASN A 1 68  ? 15.320  62.240  50.595 1.00 23.17 ? 476  ASN B N     1 
ATOM   443   C  CA    . ASN A 1 68  ? 13.982  62.179  51.196 1.00 23.53 ? 476  ASN B CA    1 
ATOM   444   C  C     . ASN A 1 68  ? 13.889  61.526  52.583 1.00 22.67 ? 476  ASN B C     1 
ATOM   445   O  O     . ASN A 1 68  ? 13.245  62.071  53.483 1.00 21.58 ? 476  ASN B O     1 
ATOM   446   C  CB    . ASN A 1 68  ? 12.969  61.501  50.247 1.00 25.01 ? 476  ASN B CB    1 
ATOM   447   C  CG    . ASN A 1 68  ? 12.798  62.250  48.923 1.00 27.66 ? 476  ASN B CG    1 
ATOM   448   O  OD1   . ASN A 1 68  ? 13.606  63.098  48.555 1.00 31.16 ? 476  ASN B OD1   1 
ATOM   449   N  ND2   . ASN A 1 68  ? 11.747  61.927  48.185 1.00 26.41 ? 476  ASN B ND2   1 
ATOM   450   N  N     . GLU A 1 69  ? 14.528  60.369  52.751 1.00 20.24 ? 477  GLU B N     1 
ATOM   451   C  CA    . GLU A 1 69  ? 14.460  59.646  54.019 1.00 20.02 ? 477  GLU B CA    1 
ATOM   452   C  C     . GLU A 1 69  ? 15.190  60.342  55.167 1.00 19.89 ? 477  GLU B C     1 
ATOM   453   O  O     . GLU A 1 69  ? 14.745  60.276  56.318 1.00 19.12 ? 477  GLU B O     1 
ATOM   454   C  CB    . GLU A 1 69  ? 14.912  58.188  53.859 1.00 19.69 ? 477  GLU B CB    1 
ATOM   455   C  CG    . GLU A 1 69  ? 13.956  57.328  53.013 1.00 21.74 ? 477  GLU B CG    1 
ATOM   456   C  CD    . GLU A 1 69  ? 14.001  57.670  51.529 1.00 23.43 ? 477  GLU B CD    1 
ATOM   457   O  OE1   . GLU A 1 69  ? 15.121  57.718  50.955 1.00 23.17 ? 477  GLU B OE1   1 
ATOM   458   O  OE2   . GLU A 1 69  ? 12.905  57.875  50.937 1.00 22.29 ? 477  GLU B OE2   1 
ATOM   459   N  N     . ILE A 1 70  ? 16.297  61.011  54.845 1.00 20.00 ? 478  ILE B N     1 
ATOM   460   C  CA    . ILE A 1 70  ? 17.059  61.778  55.825 1.00 22.34 ? 478  ILE B CA    1 
ATOM   461   C  C     . ILE A 1 70  ? 16.196  62.943  56.319 1.00 23.65 ? 478  ILE B C     1 
ATOM   462   O  O     . ILE A 1 70  ? 16.103  63.189  57.525 1.00 24.54 ? 478  ILE B O     1 
ATOM   463   C  CB    . ILE A 1 70  ? 18.386  62.336  55.225 1.00 21.71 ? 478  ILE B CB    1 
ATOM   464   C  CG1   . ILE A 1 70  ? 19.261  61.222  54.620 1.00 23.50 ? 478  ILE B CG1   1 
ATOM   465   C  CG2   . ILE A 1 70  ? 19.158  63.145  56.252 1.00 19.83 ? 478  ILE B CG2   1 
ATOM   466   C  CD1   . ILE A 1 70  ? 19.776  60.166  55.601 1.00 24.86 ? 478  ILE B CD1   1 
ATOM   467   N  N     . ARG A 1 71  ? 15.544  63.629  55.378 1.00 25.05 ? 479  ARG B N     1 
ATOM   468   C  CA    . ARG A 1 71  ? 14.695  64.790  55.676 1.00 27.17 ? 479  ARG B CA    1 
ATOM   469   C  C     . ARG A 1 71  ? 13.512  64.459  56.579 1.00 26.06 ? 479  ARG B C     1 
ATOM   470   O  O     . ARG A 1 71  ? 13.205  65.215  57.504 1.00 25.23 ? 479  ARG B O     1 
ATOM   471   C  CB    . ARG A 1 71  ? 14.226  65.463  54.382 1.00 29.57 ? 479  ARG B CB    1 
ATOM   472   C  CG    . ARG A 1 71  ? 15.375  66.056  53.589 1.00 35.53 ? 479  ARG B CG    1 
ATOM   473   C  CD    . ARG A 1 71  ? 15.017  66.408  52.141 1.00 43.95 ? 479  ARG B CD    1 
ATOM   474   N  NE    . ARG A 1 71  ? 14.145  67.569  52.014 1.00 51.09 ? 479  ARG B NE    1 
ATOM   475   C  CZ    . ARG A 1 71  ? 13.860  68.175  50.864 1.00 57.77 ? 479  ARG B CZ    1 
ATOM   476   N  NH1   . ARG A 1 71  ? 14.399  67.751  49.722 1.00 58.77 ? 479  ARG B NH1   1 
ATOM   477   N  NH2   . ARG A 1 71  ? 13.028  69.213  50.858 1.00 62.62 ? 479  ARG B NH2   1 
ATOM   478   N  N     . GLN A 1 72  ? 12.864  63.327  56.312 1.00 24.90 ? 480  GLN B N     1 
ATOM   479   C  CA    . GLN A 1 72  ? 11.717  62.888  57.105 1.00 23.63 ? 480  GLN B CA    1 
ATOM   480   C  C     . GLN A 1 72  ? 12.122  62.499  58.512 1.00 22.43 ? 480  GLN B C     1 
ATOM   481   O  O     . GLN A 1 72  ? 11.384  62.755  59.451 1.00 22.67 ? 480  GLN B O     1 
ATOM   482   C  CB    . GLN A 1 72  ? 10.978  61.734  56.423 1.00 24.85 ? 480  GLN B CB    1 
ATOM   483   C  CG    . GLN A 1 72  ? 10.289  62.148  55.130 1.00 27.49 ? 480  GLN B CG    1 
ATOM   484   C  CD    . GLN A 1 72  ? 9.655   60.977  54.407 1.00 33.49 ? 480  GLN B CD    1 
ATOM   485   O  OE1   . GLN A 1 72  ? 9.122   60.043  55.030 1.00 38.12 ? 480  GLN B OE1   1 
ATOM   486   N  NE2   . GLN A 1 72  ? 9.708   61.007  53.077 1.00 33.53 ? 480  GLN B NE2   1 
ATOM   487   N  N     . MET A 1 73  ? 13.290  61.882  58.661 1.00 21.50 ? 481  MET B N     1 
ATOM   488   C  CA    . MET A 1 73  ? 13.762  61.513  59.993 1.00 21.04 ? 481  MET B CA    1 
ATOM   489   C  C     . MET A 1 73  ? 14.056  62.754  60.825 1.00 20.47 ? 481  MET B C     1 
ATOM   490   O  O     . MET A 1 73  ? 13.667  62.825  61.990 1.00 19.28 ? 481  MET B O     1 
ATOM   491   C  CB    . MET A 1 73  ? 14.972  60.575  59.938 1.00 18.49 ? 481  MET B CB    1 
ATOM   492   C  CG    . MET A 1 73  ? 14.613  59.145  59.589 1.00 17.07 ? 481  MET B CG    1 
ATOM   493   S  SD    . MET A 1 73  ? 15.995  57.998  59.623 1.00 17.19 ? 481  MET B SD    1 
ATOM   494   C  CE    . MET A 1 73  ? 17.001  58.556  58.268 1.00 14.46 ? 481  MET B CE    1 
ATOM   495   N  N     . ILE A 1 74  ? 14.726  63.728  60.202 1.00 22.85 ? 482  ILE B N     1 
ATOM   496   C  CA    . ILE A 1 74  ? 15.054  65.012  60.827 1.00 20.30 ? 482  ILE B CA    1 
ATOM   497   C  C     . ILE A 1 74  ? 13.767  65.747  61.223 1.00 20.75 ? 482  ILE B C     1 
ATOM   498   O  O     . ILE A 1 74  ? 13.656  66.241  62.349 1.00 20.91 ? 482  ILE B O     1 
ATOM   499   C  CB    . ILE A 1 74  ? 15.913  65.894  59.881 1.00 18.86 ? 482  ILE B CB    1 
ATOM   500   C  CG1   . ILE A 1 74  ? 17.261  65.210  59.596 1.00 17.56 ? 482  ILE B CG1   1 
ATOM   501   C  CG2   . ILE A 1 74  ? 16.128  67.295  60.469 1.00 17.77 ? 482  ILE B CG2   1 
ATOM   502   C  CD1   . ILE A 1 74  ? 18.084  65.858  58.496 1.00 15.11 ? 482  ILE B CD1   1 
ATOM   503   N  N     . THR A 1 75  ? 12.805  65.794  60.302 1.00 20.25 ? 483  THR B N     1 
ATOM   504   C  CA    . THR A 1 75  ? 11.513  66.443  60.519 1.00 22.58 ? 483  THR B CA    1 
ATOM   505   C  C     . THR A 1 75  ? 10.720  65.744  61.624 1.00 25.08 ? 483  THR B C     1 
ATOM   506   O  O     . THR A 1 75  ? 10.099  66.406  62.466 1.00 26.64 ? 483  THR B O     1 
ATOM   507   C  CB    . THR A 1 75  ? 10.674  66.472  59.218 1.00 22.04 ? 483  THR B CB    1 
ATOM   508   O  OG1   . THR A 1 75  ? 11.386  67.192  58.213 1.00 24.57 ? 483  THR B OG1   1 
ATOM   509   C  CG2   . THR A 1 75  ? 9.321   67.139  59.434 1.00 21.03 ? 483  THR B CG2   1 
ATOM   510   N  N     . ALA A 1 76  ? 10.752  64.419  61.611 1.00 22.47 ? 484  ALA B N     1 
ATOM   511   C  CA    . ALA A 1 76  ? 10.061  63.625  62.600 1.00 22.20 ? 484  ALA B CA    1 
ATOM   512   C  C     . ALA A 1 76  ? 10.628  63.746  64.003 1.00 22.57 ? 484  ALA B C     1 
ATOM   513   O  O     . ALA A 1 76  ? 9.874   63.843  64.938 1.00 23.59 ? 484  ALA B O     1 
ATOM   514   C  CB    . ALA A 1 76  ? 9.991   62.178  62.181 1.00 20.24 ? 484  ALA B CB    1 
ATOM   515   N  N     . PHE A 1 77  ? 11.944  63.700  64.153 1.00 21.63 ? 485  PHE B N     1 
ATOM   516   C  CA    . PHE A 1 77  ? 12.556  63.847  65.463 1.00 22.94 ? 485  PHE B CA    1 
ATOM   517   C  C     . PHE A 1 77  ? 12.412  65.255  66.053 1.00 23.60 ? 485  PHE B C     1 
ATOM   518   O  O     . PHE A 1 77  ? 12.201  65.408  67.230 1.00 24.75 ? 485  PHE B O     1 
ATOM   519   C  CB    . PHE A 1 77  ? 14.013  63.405  65.480 1.00 23.10 ? 485  PHE B CB    1 
ATOM   520   C  CG    . PHE A 1 77  ? 14.235  62.026  64.961 1.00 24.75 ? 485  PHE B CG    1 
ATOM   521   C  CD1   . PHE A 1 77  ? 13.227  61.092  64.976 1.00 25.02 ? 485  PHE B CD1   1 
ATOM   522   C  CD2   . PHE A 1 77  ? 15.465  61.658  64.476 1.00 24.24 ? 485  PHE B CD2   1 
ATOM   523   C  CE1   . PHE A 1 77  ? 13.444  59.832  64.505 1.00 24.10 ? 485  PHE B CE1   1 
ATOM   524   C  CE2   . PHE A 1 77  ? 15.684  60.399  63.999 1.00 22.88 ? 485  PHE B CE2   1 
ATOM   525   C  CZ    . PHE A 1 77  ? 14.675  59.488  64.010 1.00 23.76 ? 485  PHE B CZ    1 
ATOM   526   N  N     . GLY A 1 78  ? 12.549  66.263  65.206 1.00 22.50 ? 486  GLY B N     1 
ATOM   527   C  CA    . GLY A 1 78  ? 12.445  67.649  65.586 1.00 24.11 ? 486  GLY B CA    1 
ATOM   528   C  C     . GLY A 1 78  ? 13.598  68.177  66.416 1.00 25.42 ? 486  GLY B C     1 
ATOM   529   O  O     . GLY A 1 78  ? 13.423  69.056  67.221 1.00 24.94 ? 486  GLY B O     1 
ATOM   530   N  N     . THR A 1 79  ? 14.776  67.628  66.211 1.00 25.13 ? 487  THR B N     1 
ATOM   531   C  CA    . THR A 1 79  ? 15.952  68.032  66.985 1.00 26.72 ? 487  THR B CA    1 
ATOM   532   C  C     . THR A 1 79  ? 16.947  68.894  66.206 1.00 29.07 ? 487  THR B C     1 
ATOM   533   O  O     . THR A 1 79  ? 17.766  69.592  66.808 1.00 29.43 ? 487  THR B O     1 
ATOM   534   C  CB    . THR A 1 79  ? 16.761  66.819  67.469 1.00 28.80 ? 487  THR B CB    1 
ATOM   535   O  OG1   . THR A 1 79  ? 17.271  66.101  66.332 1.00 32.72 ? 487  THR B OG1   1 
ATOM   536   C  CG2   . THR A 1 79  ? 15.917  65.894  68.334 1.00 28.40 ? 487  THR B CG2   1 
ATOM   537   N  N     . GLY A 1 80  ? 16.894  68.828  64.874 1.00 28.65 ? 488  GLY B N     1 
ATOM   538   C  CA    . GLY A 1 80  ? 17.857  69.539  64.043 1.00 29.64 ? 488  GLY B CA    1 
ATOM   539   C  C     . GLY A 1 80  ? 19.125  68.701  63.965 1.00 31.61 ? 488  GLY B C     1 
ATOM   540   O  O     . GLY A 1 80  ? 19.200  67.630  64.579 1.00 28.06 ? 488  GLY B O     1 
ATOM   541   N  N     . ILE A 1 81  ? 20.124  69.188  63.229 1.00 32.78 ? 489  ILE B N     1 
ATOM   542   C  CA    . ILE A 1 81  ? 21.374  68.429  63.028 1.00 33.54 ? 489  ILE B CA    1 
ATOM   543   C  C     . ILE A 1 81  ? 22.662  69.221  63.317 1.00 35.12 ? 489  ILE B C     1 
ATOM   544   O  O     . ILE A 1 81  ? 22.661  70.457  63.317 1.00 33.88 ? 489  ILE B O     1 
ATOM   545   C  CB    . ILE A 1 81  ? 21.463  67.855  61.589 1.00 30.67 ? 489  ILE B CB    1 
ATOM   546   C  CG1   . ILE A 1 81  ? 21.399  68.993  60.559 1.00 30.73 ? 489  ILE B CG1   1 
ATOM   547   C  CG2   . ILE A 1 81  ? 20.361  66.818  61.356 1.00 27.64 ? 489  ILE B CG2   1 
ATOM   548   C  CD1   . ILE A 1 81  ? 21.747  68.577  59.158 1.00 36.44 ? 489  ILE B CD1   1 
ATOM   549   N  N     . GLY A 1 82  ? 23.747  68.485  63.552 1.00 35.73 ? 490  GLY B N     1 
ATOM   550   C  CA    . GLY A 1 82  ? 25.071  69.067  63.805 1.00 36.50 ? 490  GLY B CA    1 
ATOM   551   C  C     . GLY A 1 82  ? 25.120  69.972  65.031 1.00 37.40 ? 490  GLY B C     1 
ATOM   552   O  O     . GLY A 1 82  ? 24.752  69.563  66.139 1.00 36.33 ? 490  GLY B O     1 
ATOM   553   N  N     . GLY A 1 83  ? 25.568  71.208  64.812 1.00 35.93 ? 491  GLY B N     1 
ATOM   554   C  CA    . GLY A 1 83  ? 25.676  72.199  65.873 1.00 36.23 ? 491  GLY B CA    1 
ATOM   555   C  C     . GLY A 1 83  ? 24.345  72.775  66.321 1.00 37.22 ? 491  GLY B C     1 
ATOM   556   O  O     . GLY A 1 83  ? 24.240  73.330  67.415 1.00 38.31 ? 491  GLY B O     1 
ATOM   557   N  N     . ASP A 1 84  ? 23.329  72.643  65.473 1.00 36.84 ? 492  ASP B N     1 
ATOM   558   C  CA    . ASP A 1 84  ? 21.984  73.144  65.779 1.00 38.10 ? 492  ASP B CA    1 
ATOM   559   C  C     . ASP A 1 84  ? 21.134  72.117  66.523 1.00 36.67 ? 492  ASP B C     1 
ATOM   560   O  O     . ASP A 1 84  ? 19.985  72.398  66.882 1.00 35.17 ? 492  ASP B O     1 
ATOM   561   C  CB    . ASP A 1 84  ? 21.263  73.570  64.493 1.00 39.16 ? 492  ASP B CB    1 
ATOM   562   C  CG    . ASP A 1 84  ? 22.036  74.597  63.694 1.00 41.85 ? 492  ASP B CG    1 
ATOM   563   O  OD1   . ASP A 1 84  ? 22.959  75.239  64.250 1.00 44.22 ? 492  ASP B OD1   1 
ATOM   564   O  OD2   . ASP A 1 84  ? 21.706  74.765  62.506 1.00 42.55 ? 492  ASP B OD2   1 
ATOM   565   N  N     . PHE A 1 85  ? 21.698  70.927  66.745 1.00 38.35 ? 493  PHE B N     1 
ATOM   566   C  CA    . PHE A 1 85  ? 20.998  69.851  67.442 1.00 37.92 ? 493  PHE B CA    1 
ATOM   567   C  C     . PHE A 1 85  ? 20.607  70.263  68.856 1.00 37.71 ? 493  PHE B C     1 
ATOM   568   O  O     . PHE A 1 85  ? 21.465  70.605  69.668 1.00 36.18 ? 493  PHE B O     1 
ATOM   569   C  CB    . PHE A 1 85  ? 21.852  68.579  67.490 1.00 36.34 ? 493  PHE B CB    1 
ATOM   570   C  CG    . PHE A 1 85  ? 21.176  67.415  68.168 1.00 35.71 ? 493  PHE B CG    1 
ATOM   571   C  CD1   . PHE A 1 85  ? 21.239  67.263  69.551 1.00 37.10 ? 493  PHE B CD1   1 
ATOM   572   C  CD2   . PHE A 1 85  ? 20.471  66.475  67.425 1.00 35.81 ? 493  PHE B CD2   1 
ATOM   573   C  CE1   . PHE A 1 85  ? 20.607  66.195  70.181 1.00 38.47 ? 493  PHE B CE1   1 
ATOM   574   C  CE2   . PHE A 1 85  ? 19.843  65.399  68.045 1.00 35.10 ? 493  PHE B CE2   1 
ATOM   575   C  CZ    . PHE A 1 85  ? 19.908  65.261  69.423 1.00 38.14 ? 493  PHE B CZ    1 
ATOM   576   N  N     . ASP A 1 86  ? 19.304  70.240  69.129 1.00 39.15 ? 494  ASP B N     1 
ATOM   577   C  CA    . ASP A 1 86  ? 18.772  70.557  70.446 1.00 38.88 ? 494  ASP B CA    1 
ATOM   578   C  C     . ASP A 1 86  ? 17.965  69.371  70.946 1.00 34.05 ? 494  ASP B C     1 
ATOM   579   O  O     . ASP A 1 86  ? 16.887  69.074  70.433 1.00 36.80 ? 494  ASP B O     1 
ATOM   580   C  CB    . ASP A 1 86  ? 17.919  71.836  70.416 1.00 40.09 ? 494  ASP B CB    1 
ATOM   581   C  CG    . ASP A 1 86  ? 17.499  72.304  71.811 1.00 40.87 ? 494  ASP B CG    1 
ATOM   582   O  OD1   . ASP A 1 86  ? 17.875  71.664  72.821 1.00 41.05 ? 494  ASP B OD1   1 
ATOM   583   O  OD2   . ASP A 1 86  ? 16.797  73.322  71.904 1.00 40.87 ? 494  ASP B OD2   1 
ATOM   584   N  N     . LEU A 1 87  ? 18.508  68.704  71.957 1.00 31.94 ? 495  LEU B N     1 
ATOM   585   C  CA    . LEU A 1 87  ? 17.911  67.520  72.565 1.00 29.27 ? 495  LEU B CA    1 
ATOM   586   C  C     . LEU A 1 87  ? 16.554  67.816  73.197 1.00 28.81 ? 495  LEU B C     1 
ATOM   587   O  O     . LEU A 1 87  ? 15.668  66.958  73.213 1.00 28.46 ? 495  LEU B O     1 
ATOM   588   C  CB    . LEU A 1 87  ? 18.867  66.943  73.617 1.00 30.75 ? 495  LEU B CB    1 
ATOM   589   C  CG    . LEU A 1 87  ? 18.526  65.642  74.348 1.00 32.62 ? 495  LEU B CG    1 
ATOM   590   C  CD1   . LEU A 1 87  ? 18.572  64.446  73.408 1.00 34.31 ? 495  LEU B CD1   1 
ATOM   591   C  CD2   . LEU A 1 87  ? 19.516  65.432  75.496 1.00 35.14 ? 495  LEU B CD2   1 
ATOM   592   N  N     . ALA A 1 88  ? 16.397  69.033  73.716 1.00 29.45 ? 496  ALA B N     1 
ATOM   593   C  CA    . ALA A 1 88  ? 15.157  69.443  74.375 1.00 29.16 ? 496  ALA B CA    1 
ATOM   594   C  C     . ALA A 1 88  ? 13.964  69.518  73.422 1.00 29.86 ? 496  ALA B C     1 
ATOM   595   O  O     . ALA A 1 88  ? 12.815  69.509  73.862 1.00 31.42 ? 496  ALA B O     1 
ATOM   596   C  CB    . ALA A 1 88  ? 15.357  70.769  75.119 1.00 27.21 ? 496  ALA B CB    1 
ATOM   597   N  N     . LYS A 1 89  ? 14.256  69.534  72.135 1.00 30.27 ? 497  LYS B N     1 
ATOM   598   C  CA    . LYS A 1 89  ? 13.233  69.574  71.130 1.00 31.11 ? 497  LYS B CA    1 
ATOM   599   C  C     . LYS A 1 89  ? 12.832  68.219  70.529 1.00 29.58 ? 497  LYS B C     1 
ATOM   600   O  O     . LYS A 1 89  ? 12.058  68.176  69.611 1.00 29.75 ? 497  LYS B O     1 
ATOM   601   C  CB    . LYS A 1 89  ? 13.604  70.582  70.055 1.00 34.56 ? 497  LYS B CB    1 
ATOM   602   C  CG    . LYS A 1 89  ? 13.630  72.010  70.562 1.00 35.83 ? 497  LYS B CG    1 
ATOM   603   C  CD    . LYS A 1 89  ? 13.416  73.011  69.449 1.00 35.30 ? 497  LYS B CD    1 
ATOM   604   C  CE    . LYS A 1 89  ? 14.107  74.323  69.802 1.00 34.91 ? 497  LYS B CE    1 
ATOM   605   N  NZ    . LYS A 1 89  ? 13.962  75.363  68.738 1.00 32.05 ? 497  LYS B NZ    1 
ATOM   606   N  N     . ALA A 1 90  ? 13.334  67.121  71.058 1.00 27.84 ? 498  ALA B N     1 
ATOM   607   C  CA    . ALA A 1 90  ? 12.973  65.793  70.568 1.00 28.78 ? 498  ALA B CA    1 
ATOM   608   C  C     . ALA A 1 90  ? 11.501  65.452  70.764 1.00 28.92 ? 498  ALA B C     1 
ATOM   609   O  O     . ALA A 1 90  ? 10.952  65.727  71.802 1.00 28.91 ? 498  ALA B O     1 
ATOM   610   C  CB    . ALA A 1 90  ? 13.820  64.744  71.251 1.00 25.81 ? 498  ALA B CB    1 
ATOM   611   N  N     . ARG A 1 91  ? 10.883  64.862  69.748 1.00 29.99 ? 499  ARG B N     1 
ATOM   612   C  CA    . ARG A 1 91  ? 9.486   64.472  69.817 1.00 26.84 ? 499  ARG B CA    1 
ATOM   613   C  C     . ARG A 1 91  ? 9.284   63.061  70.370 1.00 27.12 ? 499  ARG B C     1 
ATOM   614   O  O     . ARG A 1 91  ? 8.182   62.695  70.758 1.00 27.09 ? 499  ARG B O     1 
ATOM   615   C  CB    . ARG A 1 91  ? 8.803   64.693  68.472 1.00 28.87 ? 499  ARG B CB    1 
ATOM   616   C  CG    . ARG A 1 91  ? 8.904   66.147  68.041 1.00 28.86 ? 499  ARG B CG    1 
ATOM   617   C  CD    . ARG A 1 91  ? 8.234   66.443  66.716 1.00 29.68 ? 499  ARG B CD    1 
ATOM   618   N  NE    . ARG A 1 91  ? 6.802   66.226  66.760 1.00 27.27 ? 499  ARG B NE    1 
ATOM   619   C  CZ    . ARG A 1 91  ? 6.202   65.169  66.212 1.00 28.17 ? 499  ARG B CZ    1 
ATOM   620   N  NH1   . ARG A 1 91  ? 6.913   64.252  65.582 1.00 27.81 ? 499  ARG B NH1   1 
ATOM   621   N  NH2   . ARG A 1 91  ? 4.892   65.040  66.289 1.00 26.07 ? 499  ARG B NH2   1 
ATOM   622   N  N     . TYR A 1 92  ? 10.360  62.286  70.424 1.00 25.11 ? 500  TYR B N     1 
ATOM   623   C  CA    . TYR A 1 92  ? 10.314  60.952  70.983 1.00 24.06 ? 500  TYR B CA    1 
ATOM   624   C  C     . TYR A 1 92  ? 11.559  60.770  71.783 1.00 25.10 ? 500  TYR B C     1 
ATOM   625   O  O     . TYR A 1 92  ? 12.579  61.325  71.454 1.00 27.16 ? 500  TYR B O     1 
ATOM   626   C  CB    . TYR A 1 92  ? 10.226  59.868  69.891 1.00 22.41 ? 500  TYR B CB    1 
ATOM   627   C  CG    . TYR A 1 92  ? 9.280   60.235  68.796 1.00 20.35 ? 500  TYR B CG    1 
ATOM   628   C  CD1   . TYR A 1 92  ? 7.954   59.918  68.872 1.00 18.93 ? 500  TYR B CD1   1 
ATOM   629   C  CD2   . TYR A 1 92  ? 9.714   60.954  67.713 1.00 19.70 ? 500  TYR B CD2   1 
ATOM   630   C  CE1   . TYR A 1 92  ? 7.089   60.289  67.897 1.00 17.43 ? 500  TYR B CE1   1 
ATOM   631   C  CE2   . TYR A 1 92  ? 8.852   61.327  66.737 1.00 18.97 ? 500  TYR B CE2   1 
ATOM   632   C  CZ    . TYR A 1 92  ? 7.544   60.988  66.842 1.00 18.68 ? 500  TYR B CZ    1 
ATOM   633   O  OH    . TYR A 1 92  ? 6.701   61.366  65.854 1.00 20.02 ? 500  TYR B OH    1 
ATOM   634   N  N     . HIS A 1 93  ? 11.471  59.981  72.840 1.00 25.15 ? 501  HIS B N     1 
ATOM   635   C  CA    . HIS A 1 93  ? 12.616  59.706  73.664 1.00 26.22 ? 501  HIS B CA    1 
ATOM   636   C  C     . HIS A 1 93  ? 13.109  58.330  73.333 1.00 26.62 ? 501  HIS B C     1 
ATOM   637   O  O     . HIS A 1 93  ? 14.142  57.923  73.806 1.00 29.15 ? 501  HIS B O     1 
ATOM   638   C  CB    . HIS A 1 93  ? 12.313  59.860  75.144 1.00 30.29 ? 501  HIS B CB    1 
ATOM   639   C  CG    . HIS A 1 93  ? 12.280  61.274  75.617 1.00 30.70 ? 501  HIS B CG    1 
ATOM   640   N  ND1   . HIS A 1 93  ? 12.266  61.600  76.950 1.00 33.45 ? 501  HIS B ND1   1 
ATOM   641   C  CD2   . HIS A 1 93  ? 12.262  62.446  74.943 1.00 32.19 ? 501  HIS B CD2   1 
ATOM   642   C  CE1   . HIS A 1 93  ? 12.218  62.913  77.080 1.00 35.04 ? 501  HIS B CE1   1 
ATOM   643   N  NE2   . HIS A 1 93  ? 12.212  63.450  75.875 1.00 33.39 ? 501  HIS B NE2   1 
ATOM   644   N  N     . LYS A 1 94  ? 12.358  57.613  72.511 1.00 26.09 ? 502  LYS B N     1 
ATOM   645   C  CA    . LYS A 1 94  ? 12.800  56.306  72.032 1.00 24.78 ? 502  LYS B CA    1 
ATOM   646   C  C     . LYS A 1 94  ? 12.731  56.205  70.508 1.00 23.80 ? 502  LYS B C     1 
ATOM   647   O  O     . LYS A 1 94  ? 11.651  56.079  69.929 1.00 25.01 ? 502  LYS B O     1 
ATOM   648   C  CB    . LYS A 1 94  ? 12.032  55.152  72.679 1.00 24.08 ? 502  LYS B CB    1 
ATOM   649   C  CG    . LYS A 1 94  ? 12.393  54.875  74.122 1.00 23.39 ? 502  LYS B CG    1 
ATOM   650   C  CD    . LYS A 1 94  ? 11.759  53.569  74.598 1.00 25.06 ? 502  LYS B CD    1 
ATOM   651   C  CE    . LYS A 1 94  ? 12.186  53.206  76.007 1.00 24.06 ? 502  LYS B CE    1 
ATOM   652   N  NZ    . LYS A 1 94  ? 11.756  54.229  76.986 1.00 25.58 ? 502  LYS B NZ    1 
ATOM   653   N  N     . ILE A 1 95  ? 13.899  56.290  69.875 1.00 21.20 ? 503  ILE B N     1 
ATOM   654   C  CA    . ILE A 1 95  ? 14.024  56.115  68.437 1.00 17.81 ? 503  ILE B CA    1 
ATOM   655   C  C     . ILE A 1 95  ? 14.443  54.660  68.277 1.00 16.50 ? 503  ILE B C     1 
ATOM   656   O  O     . ILE A 1 95  ? 15.569  54.282  68.607 1.00 17.20 ? 503  ILE B O     1 
ATOM   657   C  CB    . ILE A 1 95  ? 15.051  57.103  67.794 1.00 17.62 ? 503  ILE B CB    1 
ATOM   658   C  CG1   . ILE A 1 95  ? 14.510  58.536  67.778 1.00 16.52 ? 503  ILE B CG1   1 
ATOM   659   C  CG2   . ILE A 1 95  ? 15.369  56.706  66.356 1.00 15.96 ? 503  ILE B CG2   1 
ATOM   660   C  CD1   . ILE A 1 95  ? 14.445  59.213  69.120 1.00 17.23 ? 503  ILE B CD1   1 
ATOM   661   N  N     . VAL A 1 96  ? 13.521  53.840  67.791 1.00 15.07 ? 504  VAL B N     1 
ATOM   662   C  CA    . VAL A 1 96  ? 13.767  52.405  67.698 1.00 13.98 ? 504  VAL B CA    1 
ATOM   663   C  C     . VAL A 1 96  ? 14.038  51.966  66.253 1.00 13.67 ? 504  VAL B C     1 
ATOM   664   O  O     . VAL A 1 96  ? 13.217  52.173  65.360 1.00 13.72 ? 504  VAL B O     1 
ATOM   665   C  CB    . VAL A 1 96  ? 12.581  51.595  68.299 1.00 13.76 ? 504  VAL B CB    1 
ATOM   666   C  CG1   . VAL A 1 96  ? 12.943  50.121  68.470 1.00 12.63 ? 504  VAL B CG1   1 
ATOM   667   C  CG2   . VAL A 1 96  ? 12.133  52.185  69.636 1.00 13.41 ? 504  VAL B CG2   1 
ATOM   668   N  N     . ILE A 1 97  ? 15.208  51.369  66.041 1.00 13.15 ? 505  ILE B N     1 
ATOM   669   C  CA    . ILE A 1 97  ? 15.578  50.819  64.744 1.00 12.84 ? 505  ILE B CA    1 
ATOM   670   C  C     . ILE A 1 97  ? 15.024  49.396  64.697 1.00 12.37 ? 505  ILE B C     1 
ATOM   671   O  O     . ILE A 1 97  ? 15.449  48.523  65.468 1.00 11.60 ? 505  ILE B O     1 
ATOM   672   C  CB    . ILE A 1 97  ? 17.114  50.802  64.536 1.00 13.64 ? 505  ILE B CB    1 
ATOM   673   C  CG1   . ILE A 1 97  ? 17.707  52.208  64.740 1.00 13.77 ? 505  ILE B CG1   1 
ATOM   674   C  CG2   . ILE A 1 97  ? 17.469  50.219  63.157 1.00 13.45 ? 505  ILE B CG2   1 
ATOM   675   C  CD1   . ILE A 1 97  ? 19.223  52.241  64.796 1.00 13.05 ? 505  ILE B CD1   1 
ATOM   676   N  N     . MET A 1 98  ? 14.064  49.178  63.803 1.00 11.94 ? 506  MET B N     1 
ATOM   677   C  CA    . MET A 1 98  ? 13.428  47.880  63.657 1.00 12.14 ? 506  MET B CA    1 
ATOM   678   C  C     . MET A 1 98  ? 13.426  47.434  62.200 1.00 12.23 ? 506  MET B C     1 
ATOM   679   O  O     . MET A 1 98  ? 12.380  47.407  61.542 1.00 12.43 ? 506  MET B O     1 
ATOM   680   C  CB    . MET A 1 98  ? 12.009  47.906  64.234 1.00 11.78 ? 506  MET B CB    1 
ATOM   681   C  CG    . MET A 1 98  ? 11.340  46.542  64.327 1.00 11.72 ? 506  MET B CG    1 
ATOM   682   S  SD    . MET A 1 98  ? 9.843   46.561  65.324 1.00 11.73 ? 506  MET B SD    1 
ATOM   683   C  CE    . MET A 1 98  ? 8.747   47.619  64.390 1.00 10.63 ? 506  MET B CE    1 
ATOM   684   N  N     . THR A 1 99  ? 14.613  47.097  61.703 1.00 11.99 ? 507  THR B N     1 
ATOM   685   C  CA    . THR A 1 99  ? 14.774  46.610  60.341 1.00 12.17 ? 507  THR B CA    1 
ATOM   686   C  C     . THR A 1 99  ? 14.499  45.113  60.307 1.00 12.34 ? 507  THR B C     1 
ATOM   687   O  O     . THR A 1 99  ? 14.441  44.479  61.359 1.00 13.29 ? 507  THR B O     1 
ATOM   688   C  CB    . THR A 1 99  ? 16.197  46.916  59.792 1.00 12.07 ? 507  THR B CB    1 
ATOM   689   O  OG1   . THR A 1 99  ? 17.178  46.187  60.528 1.00 11.37 ? 507  THR B OG1   1 
ATOM   690   C  CG2   . THR A 1 99  ? 16.506  48.416  59.852 1.00 12.41 ? 507  THR B CG2   1 
ATOM   691   N  N     . ASP A 1 100 ? 14.347  44.542  59.120 1.00 12.15 ? 508  ASP B N     1 
ATOM   692   C  CA    . ASP A 1 100 ? 14.091  43.111  58.995 1.00 11.87 ? 508  ASP B CA    1 
ATOM   693   C  C     . ASP A 1 100 ? 15.213  42.233  59.549 1.00 12.11 ? 508  ASP B C     1 
ATOM   694   O  O     . ASP A 1 100 ? 16.369  42.636  59.607 1.00 12.31 ? 508  ASP B O     1 
ATOM   695   C  CB    . ASP A 1 100 ? 13.785  42.750  57.551 1.00 11.47 ? 508  ASP B CB    1 
ATOM   696   C  CG    . ASP A 1 100 ? 12.511  43.377  57.059 1.00 11.79 ? 508  ASP B CG    1 
ATOM   697   O  OD1   . ASP A 1 100 ? 11.692  43.829  57.877 1.00 11.79 ? 508  ASP B OD1   1 
ATOM   698   O  OD2   . ASP A 1 100 ? 12.342  43.418  55.822 1.00 12.61 ? 508  ASP B OD2   1 
ATOM   699   N  N     . ALA A 1 101 ? 14.850  41.026  59.947 1.00 12.87 ? 509  ALA B N     1 
ATOM   700   C  CA    . ALA A 1 101 ? 15.806  40.087  60.524 1.00 13.56 ? 509  ALA B CA    1 
ATOM   701   C  C     . ALA A 1 101 ? 16.562  39.288  59.468 1.00 14.22 ? 509  ALA B C     1 
ATOM   702   O  O     . ALA A 1 101 ? 16.458  38.073  59.406 1.00 16.04 ? 509  ALA B O     1 
ATOM   703   C  CB    . ALA A 1 101 ? 15.109  39.145  61.486 1.00 12.28 ? 509  ALA B CB    1 
ATOM   704   N  N     . ASP A 1 102 ? 17.346  39.990  58.667 1.00 13.40 ? 510  ASP B N     1 
ATOM   705   C  CA    . ASP A 1 102 ? 18.165  39.375  57.654 1.00 13.23 ? 510  ASP B CA    1 
ATOM   706   C  C     . ASP A 1 102 ? 19.441  40.186  57.512 1.00 12.72 ? 510  ASP B C     1 
ATOM   707   O  O     . ASP A 1 102 ? 19.570  41.228  58.131 1.00 13.14 ? 510  ASP B O     1 
ATOM   708   C  CB    . ASP A 1 102 ? 17.409  39.193  56.322 1.00 13.58 ? 510  ASP B CB    1 
ATOM   709   C  CG    . ASP A 1 102 ? 17.032  40.515  55.674 1.00 14.13 ? 510  ASP B CG    1 
ATOM   710   O  OD1   . ASP A 1 102 ? 17.403  41.579  56.189 1.00 14.59 ? 510  ASP B OD1   1 
ATOM   711   O  OD2   . ASP A 1 102 ? 16.365  40.431  54.626 1.00 13.46 ? 510  ASP B OD2   1 
ATOM   712   N  N     . VAL A 1 103 ? 20.389  39.701  56.727 1.00 13.21 ? 511  VAL B N     1 
ATOM   713   C  CA    . VAL A 1 103 ? 21.678  40.384  56.554 1.00 13.23 ? 511  VAL B CA    1 
ATOM   714   C  C     . VAL A 1 103 ? 21.569  41.786  55.924 1.00 13.72 ? 511  VAL B C     1 
ATOM   715   O  O     . VAL A 1 103 ? 22.420  42.645  56.182 1.00 14.21 ? 511  VAL B O     1 
ATOM   716   C  CB    . VAL A 1 103 ? 22.705  39.521  55.776 1.00 12.85 ? 511  VAL B CB    1 
ATOM   717   C  CG1   . VAL A 1 103 ? 23.044  38.250  56.564 1.00 12.83 ? 511  VAL B CG1   1 
ATOM   718   C  CG2   . VAL A 1 103 ? 22.221  39.204  54.370 1.00 12.07 ? 511  VAL B CG2   1 
ATOM   719   N  N     . ASP A 1 104 ? 20.544  42.015  55.106 1.00 13.27 ? 512  ASP B N     1 
ATOM   720   C  CA    . ASP A 1 104 ? 20.336  43.331  54.502 1.00 12.81 ? 512  ASP B CA    1 
ATOM   721   C  C     . ASP A 1 104 ? 19.712  44.283  55.523 1.00 13.30 ? 512  ASP B C     1 
ATOM   722   O  O     . ASP A 1 104 ? 19.888  45.498  55.442 1.00 13.70 ? 512  ASP B O     1 
ATOM   723   C  CB    . ASP A 1 104 ? 19.485  43.237  53.243 1.00 11.93 ? 512  ASP B CB    1 
ATOM   724   C  CG    . ASP A 1 104 ? 20.209  42.569  52.105 1.00 11.88 ? 512  ASP B CG    1 
ATOM   725   O  OD1   . ASP A 1 104 ? 21.164  43.170  51.549 1.00 11.78 ? 512  ASP B OD1   1 
ATOM   726   O  OD2   . ASP A 1 104 ? 19.821  41.428  51.752 1.00 11.73 ? 512  ASP B OD2   1 
ATOM   727   N  N     . GLY A 1 105 ? 18.985  43.718  56.479 1.00 13.45 ? 513  GLY B N     1 
ATOM   728   C  CA    . GLY A 1 105 ? 18.390  44.499  57.558 1.00 13.68 ? 513  GLY B CA    1 
ATOM   729   C  C     . GLY A 1 105 ? 19.476  44.952  58.525 1.00 12.94 ? 513  GLY B C     1 
ATOM   730   O  O     . GLY A 1 105 ? 19.393  46.045  59.098 1.00 12.91 ? 513  GLY B O     1 
ATOM   731   N  N     . ALA A 1 106 ? 20.487  44.104  58.701 1.00 12.21 ? 514  ALA B N     1 
ATOM   732   C  CA    . ALA A 1 106 ? 21.630  44.417  59.556 1.00 12.20 ? 514  ALA B CA    1 
ATOM   733   C  C     . ALA A 1 106 ? 22.410  45.581  58.929 1.00 12.92 ? 514  ALA B C     1 
ATOM   734   O  O     . ALA A 1 106 ? 22.879  46.487  59.632 1.00 13.17 ? 514  ALA B O     1 
ATOM   735   C  CB    . ALA A 1 106 ? 22.536  43.187  59.729 1.00 11.26 ? 514  ALA B CB    1 
ATOM   736   N  N     . HIS A 1 107 ? 22.513  45.552  57.599 1.00 12.95 ? 515  HIS B N     1 
ATOM   737   C  CA    . HIS A 1 107 ? 23.211  46.587  56.834 1.00 13.00 ? 515  HIS B CA    1 
ATOM   738   C  C     . HIS A 1 107 ? 22.499  47.944  56.890 1.00 12.69 ? 515  HIS B C     1 
ATOM   739   O  O     . HIS A 1 107 ? 23.157  48.989  56.943 1.00 12.52 ? 515  HIS B O     1 
ATOM   740   C  CB    . HIS A 1 107 ? 23.452  46.114  55.392 1.00 12.96 ? 515  HIS B CB    1 
ATOM   741   C  CG    . HIS A 1 107 ? 24.273  47.057  54.570 1.00 12.74 ? 515  HIS B CG    1 
ATOM   742   N  ND1   . HIS A 1 107 ? 23.855  47.536  53.347 1.00 13.12 ? 515  HIS B ND1   1 
ATOM   743   C  CD2   . HIS A 1 107 ? 25.475  47.632  54.802 1.00 13.33 ? 515  HIS B CD2   1 
ATOM   744   C  CE1   . HIS A 1 107 ? 24.768  48.352  52.858 1.00 12.56 ? 515  HIS B CE1   1 
ATOM   745   N  NE2   . HIS A 1 107 ? 25.762  48.428  53.720 1.00 12.86 ? 515  HIS B NE2   1 
ATOM   746   N  N     . ILE A 1 108 ? 21.162  47.934  56.904 1.00 12.28 ? 516  ILE B N     1 
ATOM   747   C  CA    . ILE A 1 108 ? 20.396  49.186  57.004 1.00 12.06 ? 516  ILE B CA    1 
ATOM   748   C  C     . ILE A 1 108 ? 20.546  49.768  58.410 1.00 12.43 ? 516  ILE B C     1 
ATOM   749   O  O     . ILE A 1 108 ? 20.532  50.989  58.591 1.00 12.35 ? 516  ILE B O     1 
ATOM   750   C  CB    . ILE A 1 108 ? 18.914  49.011  56.629 1.00 11.66 ? 516  ILE B CB    1 
ATOM   751   C  CG1   . ILE A 1 108 ? 18.801  48.486  55.191 1.00 12.01 ? 516  ILE B CG1   1 
ATOM   752   C  CG2   . ILE A 1 108 ? 18.175  50.334  56.739 1.00 12.12 ? 516  ILE B CG2   1 
ATOM   753   C  CD1   . ILE A 1 108 ? 17.409  48.062  54.779 1.00 12.08 ? 516  ILE B CD1   1 
ATOM   754   N  N     . ARG A 1 109 ? 20.706  48.889  59.398 1.00 12.18 ? 517  ARG B N     1 
ATOM   755   C  CA    . ARG A 1 109 ? 20.913  49.324  60.773 1.00 11.94 ? 517  ARG B CA    1 
ATOM   756   C  C     . ARG A 1 109 ? 22.255  50.060  60.894 1.00 12.40 ? 517  ARG B C     1 
ATOM   757   O  O     . ARG A 1 109 ? 22.333  51.097  61.560 1.00 12.29 ? 517  ARG B O     1 
ATOM   758   C  CB    . ARG A 1 109 ? 20.825  48.152  61.746 1.00 11.64 ? 517  ARG B CB    1 
ATOM   759   C  CG    . ARG A 1 109 ? 21.109  48.538  63.196 1.00 11.85 ? 517  ARG B CG    1 
ATOM   760   C  CD    . ARG A 1 109 ? 20.631  47.507  64.205 1.00 11.25 ? 517  ARG B CD    1 
ATOM   761   N  NE    . ARG A 1 109 ? 21.215  46.202  63.994 1.00 11.62 ? 517  ARG B NE    1 
ATOM   762   C  CZ    . ARG A 1 109 ? 20.634  45.180  63.378 1.00 11.76 ? 517  ARG B CZ    1 
ATOM   763   N  NH1   . ARG A 1 109 ? 19.370  45.312  62.936 1.00 11.43 ? 517  ARG B NH1   1 
ATOM   764   N  NH2   . ARG A 1 109 ? 21.334  44.042  63.230 1.00 10.72 ? 517  ARG B NH2   1 
ATOM   765   N  N     . THR A 1 110 ? 23.287  49.533  60.230 1.00 12.17 ? 518  THR B N     1 
ATOM   766   C  CA    . THR A 1 110 ? 24.608  50.161  60.227 1.00 12.57 ? 518  THR B CA    1 
ATOM   767   C  C     . THR A 1 110 ? 24.559  51.517  59.514 1.00 12.96 ? 518  THR B C     1 
ATOM   768   O  O     . THR A 1 110 ? 25.217  52.465  59.935 1.00 13.91 ? 518  THR B O     1 
ATOM   769   C  CB    . THR A 1 110 ? 25.696  49.277  59.559 1.00 12.90 ? 518  THR B CB    1 
ATOM   770   O  OG1   . THR A 1 110 ? 25.443  49.165  58.149 1.00 13.39 ? 518  THR B OG1   1 
ATOM   771   C  CG2   . THR A 1 110 ? 25.757  47.885  60.207 1.00 12.53 ? 518  THR B CG2   1 
ATOM   772   N  N     . LEU A 1 111 ? 23.771  51.596  58.440 1.00 12.72 ? 519  LEU B N     1 
ATOM   773   C  CA    . LEU A 1 111 ? 23.605  52.833  57.669 1.00 11.72 ? 519  LEU B CA    1 
ATOM   774   C  C     . LEU A 1 111 ? 22.842  53.890  58.471 1.00 12.32 ? 519  LEU B C     1 
ATOM   775   O  O     . LEU A 1 111 ? 23.137  55.084  58.361 1.00 11.78 ? 519  LEU B O     1 
ATOM   776   C  CB    . LEU A 1 111 ? 22.917  52.553  56.332 1.00 11.49 ? 519  LEU B CB    1 
ATOM   777   C  CG    . LEU A 1 111 ? 23.660  51.684  55.313 1.00 10.72 ? 519  LEU B CG    1 
ATOM   778   C  CD1   . LEU A 1 111 ? 22.711  51.124  54.259 1.00 11.43 ? 519  LEU B CD1   1 
ATOM   779   C  CD2   . LEU A 1 111 ? 24.778  52.441  54.672 1.00 10.44 ? 519  LEU B CD2   1 
ATOM   780   N  N     . LEU A 1 112 ? 21.872  53.451  59.273 1.00 12.20 ? 520  LEU B N     1 
ATOM   781   C  CA    . LEU A 1 112 ? 21.118  54.369  60.142 1.00 12.73 ? 520  LEU B CA    1 
ATOM   782   C  C     . LEU A 1 112 ? 21.985  54.881  61.298 1.00 12.56 ? 520  LEU B C     1 
ATOM   783   O  O     . LEU A 1 112 ? 22.031  56.081  61.552 1.00 12.40 ? 520  LEU B O     1 
ATOM   784   C  CB    . LEU A 1 112 ? 19.824  53.724  60.670 1.00 12.27 ? 520  LEU B CB    1 
ATOM   785   C  CG    . LEU A 1 112 ? 18.681  53.506  59.667 1.00 12.13 ? 520  LEU B CG    1 
ATOM   786   C  CD1   . LEU A 1 112 ? 17.587  52.629  60.261 1.00 11.42 ? 520  LEU B CD1   1 
ATOM   787   C  CD2   . LEU A 1 112 ? 18.100  54.836  59.173 1.00 11.91 ? 520  LEU B CD2   1 
ATOM   788   N  N     . LEU A 1 113 ? 22.675  53.968  61.981 1.00 12.90 ? 521  LEU B N     1 
ATOM   789   C  CA    . LEU A 1 113 ? 23.571  54.331  63.082 1.00 13.43 ? 521  LEU B CA    1 
ATOM   790   C  C     . LEU A 1 113 ? 24.642  55.309  62.616 1.00 14.25 ? 521  LEU B C     1 
ATOM   791   O  O     . LEU A 1 113 ? 24.973  56.274  63.323 1.00 15.11 ? 521  LEU B O     1 
ATOM   792   C  CB    . LEU A 1 113 ? 24.226  53.094  63.692 1.00 12.63 ? 521  LEU B CB    1 
ATOM   793   C  CG    . LEU A 1 113 ? 23.351  52.122  64.484 1.00 12.77 ? 521  LEU B CG    1 
ATOM   794   C  CD1   . LEU A 1 113 ? 24.126  50.824  64.692 1.00 12.23 ? 521  LEU B CD1   1 
ATOM   795   C  CD2   . LEU A 1 113 ? 22.882  52.740  65.815 1.00 13.04 ? 521  LEU B CD2   1 
ATOM   796   N  N     . THR A 1 114 ? 25.175  55.058  61.421 1.00 14.21 ? 522  THR B N     1 
ATOM   797   C  CA    . THR A 1 114 ? 26.166  55.936  60.822 1.00 13.63 ? 522  THR B CA    1 
ATOM   798   C  C     . THR A 1 114 ? 25.579  57.343  60.779 1.00 14.58 ? 522  THR B C     1 
ATOM   799   O  O     . THR A 1 114 ? 26.200  58.282  61.266 1.00 16.44 ? 522  THR B O     1 
ATOM   800   C  CB    . THR A 1 114 ? 26.598  55.431  59.416 1.00 12.79 ? 522  THR B CB    1 
ATOM   801   O  OG1   . THR A 1 114 ? 27.182  54.135  59.543 1.00 11.82 ? 522  THR B OG1   1 
ATOM   802   C  CG2   . THR A 1 114 ? 27.620  56.357  58.779 1.00 11.48 ? 522  THR B CG2   1 
ATOM   803   N  N     . PHE A 1 115 ? 24.373  57.477  60.231 1.00 15.76 ? 523  PHE B N     1 
ATOM   804   C  CA    . PHE A 1 115 ? 23.695  58.777  60.161 1.00 17.29 ? 523  PHE B CA    1 
ATOM   805   C  C     . PHE A 1 115 ? 23.476  59.422  61.532 1.00 17.77 ? 523  PHE B C     1 
ATOM   806   O  O     . PHE A 1 115 ? 23.760  60.612  61.707 1.00 16.82 ? 523  PHE B O     1 
ATOM   807   C  CB    . PHE A 1 115 ? 22.367  58.688  59.391 1.00 17.46 ? 523  PHE B CB    1 
ATOM   808   C  CG    . PHE A 1 115 ? 21.514  59.925  59.516 1.00 18.98 ? 523  PHE B CG    1 
ATOM   809   C  CD1   . PHE A 1 115 ? 21.879  61.114  58.879 1.00 19.07 ? 523  PHE B CD1   1 
ATOM   810   C  CD2   . PHE A 1 115 ? 20.351  59.909  60.279 1.00 19.19 ? 523  PHE B CD2   1 
ATOM   811   C  CE1   . PHE A 1 115 ? 21.098  62.261  59.002 1.00 19.19 ? 523  PHE B CE1   1 
ATOM   812   C  CE2   . PHE A 1 115 ? 19.564  61.057  60.406 1.00 18.97 ? 523  PHE B CE2   1 
ATOM   813   C  CZ    . PHE A 1 115 ? 19.937  62.227  59.762 1.00 18.02 ? 523  PHE B CZ    1 
ATOM   814   N  N     . PHE A 1 116 ? 22.969  58.642  62.489 1.00 17.83 ? 524  PHE B N     1 
ATOM   815   C  CA    . PHE A 1 116 ? 22.719  59.150  63.844 1.00 17.98 ? 524  PHE B CA    1 
ATOM   816   C  C     . PHE A 1 116 ? 24.004  59.618  64.525 1.00 19.19 ? 524  PHE B C     1 
ATOM   817   O  O     . PHE A 1 116 ? 23.995  60.620  65.229 1.00 21.06 ? 524  PHE B O     1 
ATOM   818   C  CB    . PHE A 1 116 ? 22.000  58.120  64.730 1.00 17.76 ? 524  PHE B CB    1 
ATOM   819   C  CG    . PHE A 1 116 ? 20.636  57.707  64.224 1.00 18.75 ? 524  PHE B CG    1 
ATOM   820   C  CD1   . PHE A 1 116 ? 19.696  58.660  63.831 1.00 19.46 ? 524  PHE B CD1   1 
ATOM   821   C  CD2   . PHE A 1 116 ? 20.292  56.368  64.138 1.00 19.31 ? 524  PHE B CD2   1 
ATOM   822   C  CE1   . PHE A 1 116 ? 18.449  58.285  63.367 1.00 19.55 ? 524  PHE B CE1   1 
ATOM   823   C  CE2   . PHE A 1 116 ? 19.037  55.978  63.679 1.00 20.16 ? 524  PHE B CE2   1 
ATOM   824   C  CZ    . PHE A 1 116 ? 18.116  56.940  63.285 1.00 19.05 ? 524  PHE B CZ    1 
ATOM   825   N  N     . TYR A 1 117 ? 25.106  58.915  64.297 1.00 18.42 ? 525  TYR B N     1 
ATOM   826   C  CA    . TYR A 1 117 ? 26.382  59.273  64.920 1.00 20.71 ? 525  TYR B CA    1 
ATOM   827   C  C     . TYR A 1 117 ? 27.006  60.566  64.360 1.00 21.73 ? 525  TYR B C     1 
ATOM   828   O  O     . TYR A 1 117 ? 27.486  61.404  65.127 1.00 22.67 ? 525  TYR B O     1 
ATOM   829   C  CB    . TYR A 1 117 ? 27.372  58.107  64.816 1.00 18.81 ? 525  TYR B CB    1 
ATOM   830   C  CG    . TYR A 1 117 ? 28.626  58.274  65.648 1.00 19.31 ? 525  TYR B CG    1 
ATOM   831   C  CD1   . TYR A 1 117 ? 28.648  57.901  66.997 1.00 18.81 ? 525  TYR B CD1   1 
ATOM   832   C  CD2   . TYR A 1 117 ? 29.795  58.793  65.089 1.00 17.80 ? 525  TYR B CD2   1 
ATOM   833   C  CE1   . TYR A 1 117 ? 29.799  58.051  67.763 1.00 19.57 ? 525  TYR B CE1   1 
ATOM   834   C  CE2   . TYR A 1 117 ? 30.944  58.943  65.844 1.00 17.90 ? 525  TYR B CE2   1 
ATOM   835   C  CZ    . TYR A 1 117 ? 30.942  58.568  67.177 1.00 20.12 ? 525  TYR B CZ    1 
ATOM   836   O  OH    . TYR A 1 117 ? 32.086  58.712  67.928 1.00 21.10 ? 525  TYR B OH    1 
ATOM   837   N  N     . ARG A 1 118 ? 26.987  60.728  63.037 1.00 22.25 ? 526  ARG B N     1 
ATOM   838   C  CA    . ARG A 1 118 ? 27.577  61.908  62.393 1.00 22.35 ? 526  ARG B CA    1 
ATOM   839   C  C     . ARG A 1 118 ? 26.740  63.179  62.459 1.00 22.39 ? 526  ARG B C     1 
ATOM   840   O  O     . ARG A 1 118 ? 27.281  64.279  62.312 1.00 22.56 ? 526  ARG B O     1 
ATOM   841   C  CB    . ARG A 1 118 ? 27.947  61.626  60.932 1.00 22.33 ? 526  ARG B CB    1 
ATOM   842   C  CG    . ARG A 1 118 ? 29.025  60.575  60.739 1.00 24.72 ? 526  ARG B CG    1 
ATOM   843   C  CD    . ARG A 1 118 ? 30.252  60.841  61.599 1.00 23.74 ? 526  ARG B CD    1 
ATOM   844   N  NE    . ARG A 1 118 ? 31.303  59.867  61.314 1.00 27.90 ? 526  ARG B NE    1 
ATOM   845   C  CZ    . ARG A 1 118 ? 32.458  59.772  61.968 1.00 28.06 ? 526  ARG B CZ    1 
ATOM   846   N  NH1   . ARG A 1 118 ? 32.717  60.595  62.997 1.00 28.08 ? 526  ARG B NH1   1 
ATOM   847   N  NH2   . ARG A 1 118 ? 33.341  58.850  61.601 1.00 24.42 ? 526  ARG B NH2   1 
ATOM   848   N  N     . PHE A 1 119 ? 25.435  63.034  62.676 1.00 22.72 ? 527  PHE B N     1 
ATOM   849   C  CA    . PHE A 1 119 ? 24.538  64.199  62.714 1.00 22.74 ? 527  PHE B CA    1 
ATOM   850   C  C     . PHE A 1 119 ? 23.683  64.359  63.973 1.00 20.58 ? 527  PHE B C     1 
ATOM   851   O  O     . PHE A 1 119 ? 23.181  65.448  64.227 1.00 22.87 ? 527  PHE B O     1 
ATOM   852   C  CB    . PHE A 1 119 ? 23.668  64.247  61.456 1.00 21.54 ? 527  PHE B CB    1 
ATOM   853   C  CG    . PHE A 1 119 ? 24.457  64.435  60.190 1.00 22.56 ? 527  PHE B CG    1 
ATOM   854   C  CD1   . PHE A 1 119 ? 24.760  65.713  59.726 1.00 21.89 ? 527  PHE B CD1   1 
ATOM   855   C  CD2   . PHE A 1 119 ? 24.912  63.333  59.468 1.00 21.66 ? 527  PHE B CD2   1 
ATOM   856   C  CE1   . PHE A 1 119 ? 25.503  65.889  58.568 1.00 22.91 ? 527  PHE B CE1   1 
ATOM   857   C  CE2   . PHE A 1 119 ? 25.648  63.502  58.306 1.00 22.00 ? 527  PHE B CE2   1 
ATOM   858   C  CZ    . PHE A 1 119 ? 25.952  64.781  57.851 1.00 22.44 ? 527  PHE B CZ    1 
ATOM   859   N  N     . MET A 1 120 ? 23.522  63.297  64.754 1.00 20.16 ? 528  MET B N     1 
ATOM   860   C  CA    . MET A 1 120 ? 22.693  63.360  65.961 1.00 20.95 ? 528  MET B CA    1 
ATOM   861   C  C     . MET A 1 120 ? 23.343  62.620  67.120 1.00 21.29 ? 528  MET B C     1 
ATOM   862   O  O     . MET A 1 120 ? 22.670  61.959  67.907 1.00 22.21 ? 528  MET B O     1 
ATOM   863   C  CB    . MET A 1 120 ? 21.300  62.788  65.687 1.00 20.62 ? 528  MET B CB    1 
ATOM   864   C  CG    . MET A 1 120 ? 20.495  63.576  64.670 1.00 20.11 ? 528  MET B CG    1 
ATOM   865   S  SD    . MET A 1 120 ? 18.951  62.766  64.230 1.00 20.01 ? 528  MET B SD    1 
ATOM   866   C  CE    . MET A 1 120 ? 18.279  63.971  63.082 1.00 16.69 ? 528  MET B CE    1 
ATOM   867   N  N     . ARG A 1 121 ? 24.662  62.745  67.212 1.00 21.56 ? 529  ARG B N     1 
ATOM   868   C  CA    . ARG A 1 121 ? 25.465  62.110  68.254 1.00 23.66 ? 529  ARG B CA    1 
ATOM   869   C  C     . ARG A 1 121 ? 24.956  62.301  69.706 1.00 25.31 ? 529  ARG B C     1 
ATOM   870   O  O     . ARG A 1 121 ? 24.975  61.335  70.482 1.00 25.95 ? 529  ARG B O     1 
ATOM   871   C  CB    . ARG A 1 121 ? 26.926  62.542  68.100 1.00 25.69 ? 529  ARG B CB    1 
ATOM   872   C  CG    . ARG A 1 121 ? 27.907  61.933  69.094 1.00 28.98 ? 529  ARG B CG    1 
ATOM   873   C  CD    . ARG A 1 121 ? 29.316  62.374  68.786 1.00 29.99 ? 529  ARG B CD    1 
ATOM   874   N  NE    . ARG A 1 121 ? 30.210  62.220  69.914 1.00 35.49 ? 529  ARG B NE    1 
ATOM   875   C  CZ    . ARG A 1 121 ? 31.494  62.534  69.931 1.00 37.26 ? 529  ARG B CZ    1 
ATOM   876   N  NH1   . ARG A 1 121 ? 32.076  62.989  68.829 1.00 38.13 ? 529  ARG B NH1   1 
ATOM   877   N  NH2   . ARG A 1 121 ? 32.222  62.354  71.019 1.00 37.41 ? 529  ARG B NH2   1 
ATOM   878   N  N     . PRO A 1 122 ? 24.513  63.523  70.087 1.00 25.63 ? 530  PRO B N     1 
ATOM   879   C  CA    . PRO A 1 122 ? 24.009  63.684  71.461 1.00 25.17 ? 530  PRO B CA    1 
ATOM   880   C  C     . PRO A 1 122 ? 22.755  62.863  71.741 1.00 25.83 ? 530  PRO B C     1 
ATOM   881   O  O     . PRO A 1 122 ? 22.492  62.514  72.896 1.00 25.14 ? 530  PRO B O     1 
ATOM   882   C  CB    . PRO A 1 122 ? 23.696  65.184  71.569 1.00 24.99 ? 530  PRO B CB    1 
ATOM   883   C  CG    . PRO A 1 122 ? 24.487  65.824  70.472 1.00 28.64 ? 530  PRO B CG    1 
ATOM   884   C  CD    . PRO A 1 122 ? 24.475  64.808  69.354 1.00 27.47 ? 530  PRO B CD    1 
ATOM   885   N  N     . LEU A 1 123 ? 21.995  62.559  70.688 1.00 26.14 ? 531  LEU B N     1 
ATOM   886   C  CA    . LEU A 1 123 ? 20.785  61.749  70.796 1.00 24.70 ? 531  LEU B CA    1 
ATOM   887   C  C     . LEU A 1 123 ? 21.136  60.350  71.308 1.00 24.92 ? 531  LEU B C     1 
ATOM   888   O  O     . LEU A 1 123 ? 20.390  59.761  72.098 1.00 27.03 ? 531  LEU B O     1 
ATOM   889   C  CB    . LEU A 1 123 ? 20.081  61.663  69.442 1.00 25.85 ? 531  LEU B CB    1 
ATOM   890   C  CG    . LEU A 1 123 ? 18.692  61.029  69.342 1.00 26.50 ? 531  LEU B CG    1 
ATOM   891   C  CD1   . LEU A 1 123 ? 17.656  61.898  70.052 1.00 26.04 ? 531  LEU B CD1   1 
ATOM   892   C  CD2   . LEU A 1 123 ? 18.304  60.834  67.882 1.00 25.71 ? 531  LEU B CD2   1 
ATOM   893   N  N     . ILE A 1 124 ? 22.277  59.833  70.860 1.00 22.88 ? 532  ILE B N     1 
ATOM   894   C  CA    . ILE A 1 124 ? 22.759  58.526  71.291 1.00 22.59 ? 532  ILE B CA    1 
ATOM   895   C  C     . ILE A 1 124 ? 23.272  58.612  72.731 1.00 25.39 ? 532  ILE B C     1 
ATOM   896   O  O     . ILE A 1 124 ? 22.928  57.771  73.567 1.00 25.74 ? 532  ILE B O     1 
ATOM   897   C  CB    . ILE A 1 124 ? 23.873  57.987  70.360 1.00 21.51 ? 532  ILE B CB    1 
ATOM   898   C  CG1   . ILE A 1 124 ? 23.375  57.926  68.907 1.00 21.57 ? 532  ILE B CG1   1 
ATOM   899   C  CG2   . ILE A 1 124 ? 24.354  56.611  70.826 1.00 21.42 ? 532  ILE B CG2   1 
ATOM   900   C  CD1   . ILE A 1 124 ? 24.420  57.524  67.888 1.00 19.56 ? 532  ILE B CD1   1 
ATOM   901   N  N     . GLU A 1 125 ? 24.070  59.645  73.012 1.00 28.32 ? 533  GLU B N     1 
ATOM   902   C  CA    . GLU A 1 125 ? 24.674  59.880  74.334 1.00 30.73 ? 533  GLU B CA    1 
ATOM   903   C  C     . GLU A 1 125 ? 23.643  59.976  75.461 1.00 31.62 ? 533  GLU B C     1 
ATOM   904   O  O     . GLU A 1 125 ? 23.935  59.643  76.618 1.00 28.61 ? 533  GLU B O     1 
ATOM   905   C  CB    . GLU A 1 125 ? 25.556  61.133  74.302 1.00 31.10 ? 533  GLU B CB    1 
ATOM   906   C  CG    . GLU A 1 125 ? 26.776  60.985  73.386 1.00 32.69 ? 533  GLU B CG    1 
ATOM   907   C  CD    . GLU A 1 125 ? 27.539  62.287  73.164 1.00 38.88 ? 533  GLU B CD    1 
ATOM   908   O  OE1   . GLU A 1 125 ? 27.126  63.353  73.710 1.00 38.08 ? 533  GLU B OE1   1 
ATOM   909   O  OE2   . GLU A 1 125 ? 28.554  62.245  72.431 1.00 38.56 ? 533  GLU B OE2   1 
ATOM   910   N  N     . ALA A 1 126 ? 22.441  60.426  75.103 1.00 29.60 ? 534  ALA B N     1 
ATOM   911   C  CA    . ALA A 1 126 ? 21.337  60.550  76.046 1.00 24.86 ? 534  ALA B CA    1 
ATOM   912   C  C     . ALA A 1 126 ? 20.610  59.211  76.237 1.00 22.39 ? 534  ALA B C     1 
ATOM   913   O  O     . ALA A 1 126 ? 19.776  59.073  77.137 1.00 22.67 ? 534  ALA B O     1 
ATOM   914   C  CB    . ALA A 1 126 ? 20.371  61.626  75.581 1.00 23.40 ? 534  ALA B CB    1 
ATOM   915   N  N     . GLY A 1 127 ? 20.940  58.232  75.398 1.00 20.31 ? 535  GLY B N     1 
ATOM   916   C  CA    . GLY A 1 127 ? 20.316  56.908  75.456 1.00 19.93 ? 535  GLY B CA    1 
ATOM   917   C  C     . GLY A 1 127 ? 18.936  56.872  74.827 1.00 20.46 ? 535  GLY B C     1 
ATOM   918   O  O     . GLY A 1 127 ? 18.083  56.089  75.243 1.00 19.52 ? 535  GLY B O     1 
ATOM   919   N  N     . TYR A 1 128 ? 18.727  57.715  73.816 1.00 21.15 ? 536  TYR B N     1 
ATOM   920   C  CA    . TYR A 1 128 ? 17.449  57.813  73.118 1.00 22.18 ? 536  TYR B CA    1 
ATOM   921   C  C     . TYR A 1 128 ? 17.329  56.860  71.927 1.00 22.63 ? 536  TYR B C     1 
ATOM   922   O  O     . TYR A 1 128 ? 16.225  56.654  71.420 1.00 27.47 ? 536  TYR B O     1 
ATOM   923   C  CB    . TYR A 1 128 ? 17.217  59.256  72.648 1.00 23.98 ? 536  TYR B CB    1 
ATOM   924   C  CG    . TYR A 1 128 ? 16.778  60.262  73.717 1.00 23.00 ? 536  TYR B CG    1 
ATOM   925   C  CD1   . TYR A 1 128 ? 17.286  60.213  75.020 1.00 23.30 ? 536  TYR B CD1   1 
ATOM   926   C  CD2   . TYR A 1 128 ? 15.834  61.244  73.420 1.00 22.73 ? 536  TYR B CD2   1 
ATOM   927   C  CE1   . TYR A 1 128 ? 16.880  61.124  75.990 1.00 21.53 ? 536  TYR B CE1   1 
ATOM   928   C  CE2   . TYR A 1 128 ? 15.427  62.175  74.382 1.00 23.05 ? 536  TYR B CE2   1 
ATOM   929   C  CZ    . TYR A 1 128 ? 15.956  62.104  75.668 1.00 22.06 ? 536  TYR B CZ    1 
ATOM   930   O  OH    . TYR A 1 128 ? 15.563  63.010  76.625 1.00 20.86 ? 536  TYR B OH    1 
ATOM   931   N  N     . VAL A 1 129 ? 18.445  56.286  71.478 1.00 20.06 ? 537  VAL B N     1 
ATOM   932   C  CA    . VAL A 1 129 ? 18.433  55.367  70.326 1.00 17.92 ? 537  VAL B CA    1 
ATOM   933   C  C     . VAL A 1 129 ? 18.476  53.899  70.757 1.00 17.69 ? 537  VAL B C     1 
ATOM   934   O  O     . VAL A 1 129 ? 19.382  53.477  71.488 1.00 16.59 ? 537  VAL B O     1 
ATOM   935   C  CB    . VAL A 1 129 ? 19.577  55.665  69.318 1.00 17.03 ? 537  VAL B CB    1 
ATOM   936   C  CG1   . VAL A 1 129 ? 19.582  54.641  68.171 1.00 15.96 ? 537  VAL B CG1   1 
ATOM   937   C  CG2   . VAL A 1 129 ? 19.461  57.077  68.779 1.00 15.88 ? 537  VAL B CG2   1 
ATOM   938   N  N     . TYR A 1 130 ? 17.489  53.137  70.286 1.00 17.35 ? 538  TYR B N     1 
ATOM   939   C  CA    . TYR A 1 130 ? 17.325  51.722  70.637 1.00 17.90 ? 538  TYR B CA    1 
ATOM   940   C  C     . TYR A 1 130 ? 17.318  50.783  69.428 1.00 17.61 ? 538  TYR B C     1 
ATOM   941   O  O     . TYR A 1 130 ? 17.129  51.216  68.289 1.00 19.70 ? 538  TYR B O     1 
ATOM   942   C  CB    . TYR A 1 130 ? 16.023  51.524  71.434 1.00 17.33 ? 538  TYR B CB    1 
ATOM   943   C  CG    . TYR A 1 130 ? 15.982  52.213  72.781 1.00 17.50 ? 538  TYR B CG    1 
ATOM   944   C  CD1   . TYR A 1 130 ? 15.755  53.582  72.884 1.00 16.98 ? 538  TYR B CD1   1 
ATOM   945   C  CD2   . TYR A 1 130 ? 16.146  51.484  73.967 1.00 17.66 ? 538  TYR B CD2   1 
ATOM   946   C  CE1   . TYR A 1 130 ? 15.712  54.216  74.122 1.00 16.73 ? 538  TYR B CE1   1 
ATOM   947   C  CE2   . TYR A 1 130 ? 16.101  52.111  75.213 1.00 16.56 ? 538  TYR B CE2   1 
ATOM   948   C  CZ    . TYR A 1 130 ? 15.879  53.478  75.277 1.00 16.84 ? 538  TYR B CZ    1 
ATOM   949   O  OH    . TYR A 1 130 ? 15.828  54.125  76.496 1.00 18.21 ? 538  TYR B OH    1 
ATOM   950   N  N     . ILE A 1 131 ? 17.506  49.497  69.703 1.00 17.15 ? 539  ILE B N     1 
ATOM   951   C  CA    . ILE A 1 131 ? 17.505  48.470  68.669 1.00 17.31 ? 539  ILE B CA    1 
ATOM   952   C  C     . ILE A 1 131 ? 16.519  47.354  68.994 1.00 18.22 ? 539  ILE B C     1 
ATOM   953   O  O     . ILE A 1 131 ? 16.681  46.632  69.967 1.00 20.16 ? 539  ILE B O     1 
ATOM   954   C  CB    . ILE A 1 131 ? 18.888  47.836  68.457 1.00 16.57 ? 539  ILE B CB    1 
ATOM   955   C  CG1   . ILE A 1 131 ? 19.911  48.889  68.040 1.00 17.76 ? 539  ILE B CG1   1 
ATOM   956   C  CG2   . ILE A 1 131 ? 18.817  46.761  67.397 1.00 15.22 ? 539  ILE B CG2   1 
ATOM   957   C  CD1   . ILE A 1 131 ? 21.330  48.359  67.969 1.00 17.43 ? 539  ILE B CD1   1 
ATOM   958   N  N     . ALA A 1 132 ? 15.502  47.220  68.152 1.00 18.07 ? 540  ALA B N     1 
ATOM   959   C  CA    . ALA A 1 132 ? 14.494  46.192  68.301 1.00 17.11 ? 540  ALA B CA    1 
ATOM   960   C  C     . ALA A 1 132 ? 15.095  44.834  67.994 1.00 18.98 ? 540  ALA B C     1 
ATOM   961   O  O     . ALA A 1 132 ? 16.109  44.741  67.315 1.00 18.08 ? 540  ALA B O     1 
ATOM   962   C  CB    . ALA A 1 132 ? 13.316  46.471  67.383 1.00 15.58 ? 540  ALA B CB    1 
ATOM   963   N  N     . GLN A 1 133 ? 14.459  43.775  68.486 1.00 20.31 ? 541  GLN B N     1 
ATOM   964   C  CA    . GLN A 1 133 ? 14.966  42.436  68.234 1.00 21.37 ? 541  GLN B CA    1 
ATOM   965   C  C     . GLN A 1 133 ? 13.874  41.521  67.686 1.00 22.73 ? 541  GLN B C     1 
ATOM   966   O  O     . GLN A 1 133 ? 13.437  40.588  68.369 1.00 20.96 ? 541  GLN B O     1 
ATOM   967   C  CB    . GLN A 1 133 ? 15.574  41.849  69.499 1.00 24.26 ? 541  GLN B CB    1 
ATOM   968   C  CG    . GLN A 1 133 ? 16.915  42.453  69.879 1.00 26.77 ? 541  GLN B CG    1 
ATOM   969   C  CD    . GLN A 1 133 ? 17.623  41.681  70.976 1.00 28.55 ? 541  GLN B CD    1 
ATOM   970   O  OE1   . GLN A 1 133 ? 17.195  41.677  72.116 1.00 28.29 ? 541  GLN B OE1   1 
ATOM   971   N  NE2   . GLN A 1 133 ? 18.715  41.040  70.626 1.00 31.02 ? 541  GLN B NE2   1 
ATOM   972   N  N     . PRO A 1 134 ? 13.446  41.810  66.397 1.00 22.72 ? 542  PRO B N     1 
ATOM   973   C  CA    . PRO A 1 134 ? 12.411  40.897  65.900 1.00 22.61 ? 542  PRO B CA    1 
ATOM   974   C  C     . PRO A 1 134 ? 12.910  39.481  65.709 1.00 23.48 ? 542  PRO B C     1 
ATOM   975   O  O     . PRO A 1 134 ? 14.114  39.269  65.458 1.00 23.37 ? 542  PRO B O     1 
ATOM   976   C  CB    . PRO A 1 134 ? 11.976  41.517  64.563 1.00 23.56 ? 542  PRO B CB    1 
ATOM   977   C  CG    . PRO A 1 134 ? 13.144  42.277  64.090 1.00 24.25 ? 542  PRO B CG    1 
ATOM   978   C  CD    . PRO A 1 134 ? 13.677  42.889  65.353 1.00 22.67 ? 542  PRO B CD    1 
ATOM   979   N  N     . PRO A 1 135 ? 11.974  38.482  65.864 1.00 21.63 ? 543  PRO B N     1 
ATOM   980   C  CA    . PRO A 1 135 ? 12.509  37.110  65.724 1.00 20.39 ? 543  PRO B CA    1 
ATOM   981   C  C     . PRO A 1 135 ? 12.972  36.703  64.330 1.00 20.45 ? 543  PRO B C     1 
ATOM   982   O  O     . PRO A 1 135 ? 12.416  37.119  63.327 1.00 19.37 ? 543  PRO B O     1 
ATOM   983   C  CB    . PRO A 1 135 ? 11.309  36.236  66.114 1.00 21.29 ? 543  PRO B CB    1 
ATOM   984   C  CG    . PRO A 1 135 ? 10.131  37.000  65.666 1.00 21.96 ? 543  PRO B CG    1 
ATOM   985   C  CD    . PRO A 1 135 ? 10.485  38.378  66.156 1.00 22.41 ? 543  PRO B CD    1 
ATOM   986   N  N     . THR A 1 136 ? 13.996  35.866  64.291 1.00 20.04 ? 544  THR B N     1 
ATOM   987   C  CA    . THR A 1 136 ? 14.526  35.364  63.039 1.00 20.47 ? 544  THR B CA    1 
ATOM   988   C  C     . THR A 1 136 ? 13.593  34.308  62.491 1.00 20.10 ? 544  THR B C     1 
ATOM   989   O  O     . THR A 1 136 ? 12.715  33.819  63.194 1.00 18.14 ? 544  THR B O     1 
ATOM   990   C  CB    . THR A 1 136 ? 15.934  34.775  63.223 1.00 22.55 ? 544  THR B CB    1 
ATOM   991   O  OG1   . THR A 1 136 ? 15.842  33.553  63.977 1.00 25.64 ? 544  THR B OG1   1 
ATOM   992   C  CG2   . THR A 1 136 ? 16.815  35.746  63.976 1.00 21.87 ? 544  THR B CG2   1 
ATOM   993   N  N     . GLY A 1 137 ? 13.768  33.948  61.232 1.00 19.38 ? 545  GLY B N     1 
ATOM   994   C  CA    . GLY A 1 137 ? 12.901  32.953  60.608 1.00 20.75 ? 545  GLY B CA    1 
ATOM   995   C  C     . GLY A 1 137 ? 11.897  33.642  59.708 1.00 25.50 ? 545  GLY B C     1 
ATOM   996   O  O     . GLY A 1 137 ? 11.009  32.985  59.146 1.00 28.24 ? 545  GLY B O     1 
ATOM   997   N  N     . TYR A 1 138 ? 12.037  34.962  59.569 1.00 25.02 ? 580  TYR B N     1 
ATOM   998   C  CA    . TYR A 1 138 ? 11.163  35.763  58.727 1.00 24.13 ? 580  TYR B CA    1 
ATOM   999   C  C     . TYR A 1 138 ? 11.977  36.619  57.779 1.00 25.70 ? 580  TYR B C     1 
ATOM   1000  O  O     . TYR A 1 138 ? 12.938  37.250  58.190 1.00 26.83 ? 580  TYR B O     1 
ATOM   1001  C  CB    . TYR A 1 138 ? 10.311  36.699  59.576 1.00 25.28 ? 580  TYR B CB    1 
ATOM   1002  C  CG    . TYR A 1 138 ? 9.332   36.022  60.489 1.00 26.13 ? 580  TYR B CG    1 
ATOM   1003  C  CD1   . TYR A 1 138 ? 8.072   35.685  60.056 1.00 26.66 ? 580  TYR B CD1   1 
ATOM   1004  C  CD2   . TYR A 1 138 ? 9.670   35.749  61.801 1.00 27.52 ? 580  TYR B CD2   1 
ATOM   1005  C  CE1   . TYR A 1 138 ? 7.173   35.072  60.902 1.00 30.38 ? 580  TYR B CE1   1 
ATOM   1006  C  CE2   . TYR A 1 138 ? 8.785   35.136  62.649 1.00 26.57 ? 580  TYR B CE2   1 
ATOM   1007  C  CZ    . TYR A 1 138 ? 7.542   34.804  62.203 1.00 29.33 ? 580  TYR B CZ    1 
ATOM   1008  O  OH    . TYR A 1 138 ? 6.654   34.189  63.047 1.00 29.02 ? 580  TYR B OH    1 
ATOM   1009  N  N     . LYS A 1 139 ? 11.585  36.660  56.514 1.00 27.05 ? 581  LYS B N     1 
ATOM   1010  C  CA    . LYS A 1 139 ? 12.304  37.455  55.531 1.00 28.92 ? 581  LYS B CA    1 
ATOM   1011  C  C     . LYS A 1 139 ? 12.090  38.941  55.773 1.00 30.30 ? 581  LYS B C     1 
ATOM   1012  O  O     . LYS A 1 139 ? 12.964  39.770  55.494 1.00 30.59 ? 581  LYS B O     1 
ATOM   1013  C  CB    . LYS A 1 139 ? 11.857  37.071  54.125 1.00 30.29 ? 581  LYS B CB    1 
ATOM   1014  C  CG    . LYS A 1 139 ? 12.228  35.641  53.741 1.00 28.62 ? 581  LYS B CG    1 
ATOM   1015  C  CD    . LYS A 1 139 ? 11.737  35.324  52.337 1.00 28.36 ? 581  LYS B CD    1 
ATOM   1016  C  CE    . LYS A 1 139 ? 10.235  35.042  52.310 1.00 29.63 ? 581  LYS B CE    1 
ATOM   1017  N  NZ    . LYS A 1 139 ? 9.931   33.656  52.789 1.00 25.84 ? 581  LYS B NZ    1 
ATOM   1018  N  N     . GLY A 1 140 ? 10.931  39.274  56.323 1.00 25.99 ? 582  GLY B N     1 
ATOM   1019  C  CA    . GLY A 1 140 ? 10.574  40.649  56.612 1.00 21.97 ? 582  GLY B CA    1 
ATOM   1020  C  C     . GLY A 1 140 ? 9.473   40.677  57.666 1.00 22.54 ? 582  GLY B C     1 
ATOM   1021  O  O     . GLY A 1 140 ? 8.919   39.633  58.031 1.00 22.38 ? 582  GLY B O     1 
ATOM   1022  N  N     . LEU A 1 141 ? 9.171   41.867  58.167 1.00 19.85 ? 583  LEU B N     1 
ATOM   1023  C  CA    . LEU A 1 141 ? 8.122   42.057  59.159 1.00 18.24 ? 583  LEU B CA    1 
ATOM   1024  C  C     . LEU A 1 141 ? 6.737   41.772  58.574 1.00 17.67 ? 583  LEU B C     1 
ATOM   1025  O  O     . LEU A 1 141 ? 5.821   41.367  59.272 1.00 18.92 ? 583  LEU B O     1 
ATOM   1026  C  CB    . LEU A 1 141 ? 8.186   43.462  59.779 1.00 16.53 ? 583  LEU B CB    1 
ATOM   1027  C  CG    . LEU A 1 141 ? 9.450   43.800  60.566 1.00 16.69 ? 583  LEU B CG    1 
ATOM   1028  C  CD1   . LEU A 1 141 ? 9.225   45.028  61.431 1.00 16.95 ? 583  LEU B CD1   1 
ATOM   1029  C  CD2   . LEU A 1 141 ? 9.903   42.630  61.405 1.00 15.31 ? 583  LEU B CD2   1 
ATOM   1030  N  N     . GLY A 1 142 ? 6.611   41.990  57.280 1.00 18.91 ? 584  GLY B N     1 
ATOM   1031  C  CA    . GLY A 1 142 ? 5.379   41.788  56.539 1.00 18.64 ? 584  GLY B CA    1 
ATOM   1032  C  C     . GLY A 1 142 ? 4.940   40.349  56.551 1.00 18.81 ? 584  GLY B C     1 
ATOM   1033  O  O     . GLY A 1 142 ? 3.792   40.040  56.278 1.00 20.82 ? 584  GLY B O     1 
ATOM   1034  N  N     . GLU A 1 143 ? 5.876   39.459  56.837 1.00 18.49 ? 585  GLU B N     1 
ATOM   1035  C  CA    . GLU A 1 143 ? 5.612   38.039  56.915 1.00 20.08 ? 585  GLU B CA    1 
ATOM   1036  C  C     . GLU A 1 143 ? 4.963   37.623  58.239 1.00 21.78 ? 585  GLU B C     1 
ATOM   1037  O  O     . GLU A 1 143 ? 4.402   36.537  58.345 1.00 20.48 ? 585  GLU B O     1 
ATOM   1038  C  CB    . GLU A 1 143 ? 6.925   37.292  56.712 1.00 21.62 ? 585  GLU B CB    1 
ATOM   1039  C  CG    . GLU A 1 143 ? 6.800   35.795  56.543 1.00 22.13 ? 585  GLU B CG    1 
ATOM   1040  C  CD    . GLU A 1 143 ? 8.090   35.166  56.092 1.00 24.53 ? 585  GLU B CD    1 
ATOM   1041  O  OE1   . GLU A 1 143 ? 8.145   33.929  55.982 1.00 28.97 ? 585  GLU B OE1   1 
ATOM   1042  O  OE2   . GLU A 1 143 ? 9.067   35.891  55.853 1.00 21.92 ? 585  GLU B OE2   1 
ATOM   1043  N  N     . MET A 1 144 ? 5.037   38.487  59.248 1.00 22.55 ? 586  MET B N     1 
ATOM   1044  C  CA    . MET A 1 144 ? 4.480   38.211  60.551 1.00 21.81 ? 586  MET B CA    1 
ATOM   1045  C  C     . MET A 1 144 ? 3.088   38.797  60.665 1.00 20.56 ? 586  MET B C     1 
ATOM   1046  O  O     . MET A 1 144 ? 2.749   39.753  59.984 1.00 20.14 ? 586  MET B O     1 
ATOM   1047  C  CB    . MET A 1 144 ? 5.352   38.809  61.638 1.00 21.30 ? 586  MET B CB    1 
ATOM   1048  C  CG    . MET A 1 144 ? 6.832   38.549  61.486 1.00 20.58 ? 586  MET B CG    1 
ATOM   1049  S  SD    . MET A 1 144 ? 7.749   39.427  62.769 1.00 22.38 ? 586  MET B SD    1 
ATOM   1050  C  CE    . MET A 1 144 ? 6.935   38.803  64.230 1.00 21.26 ? 586  MET B CE    1 
ATOM   1051  N  N     . ASN A 1 145 ? 2.293   38.201  61.547 1.00 20.96 ? 587  ASN B N     1 
ATOM   1052  C  CA    . ASN A 1 145 ? 0.947   38.692  61.833 1.00 18.57 ? 587  ASN B CA    1 
ATOM   1053  C  C     . ASN A 1 145 ? 1.101   39.822  62.831 1.00 17.53 ? 587  ASN B C     1 
ATOM   1054  O  O     . ASN A 1 145 ? 2.022   39.803  63.643 1.00 18.33 ? 587  ASN B O     1 
ATOM   1055  C  CB    . ASN A 1 145 ? 0.057   37.585  62.409 1.00 18.26 ? 587  ASN B CB    1 
ATOM   1056  C  CG    . ASN A 1 145 ? -0.355  36.543  61.367 1.00 18.24 ? 587  ASN B CG    1 
ATOM   1057  O  OD1   . ASN A 1 145 ? -0.112  36.692  60.171 1.00 16.81 ? 587  ASN B OD1   1 
ATOM   1058  N  ND2   . ASN A 1 145 ? -0.985  35.477  61.836 1.00 17.26 ? 587  ASN B ND2   1 
ATOM   1059  N  N     . ALA A 1 146 ? 0.206   40.803  62.770 1.00 17.31 ? 588  ALA B N     1 
ATOM   1060  C  CA    . ALA A 1 146 ? 0.278   41.991  63.638 1.00 16.01 ? 588  ALA B CA    1 
ATOM   1061  C  C     . ALA A 1 146 ? 0.451   41.682  65.126 1.00 17.52 ? 588  ALA B C     1 
ATOM   1062  O  O     . ALA A 1 146 ? 1.246   42.342  65.802 1.00 17.44 ? 588  ALA B O     1 
ATOM   1063  C  CB    . ALA A 1 146 ? -0.931  42.895  63.410 1.00 14.25 ? 588  ALA B CB    1 
ATOM   1064  N  N     . ASP A 1 147 ? -0.281  40.680  65.629 1.00 17.76 ? 589  ASP B N     1 
ATOM   1065  C  CA    . ASP A 1 147 ? -0.194  40.289  67.043 1.00 17.91 ? 589  ASP B CA    1 
ATOM   1066  C  C     . ASP A 1 147 ? 1.170   39.708  67.409 1.00 17.64 ? 589  ASP B C     1 
ATOM   1067  O  O     . ASP A 1 147 ? 1.733   40.047  68.457 1.00 18.01 ? 589  ASP B O     1 
ATOM   1068  C  CB    . ASP A 1 147 ? -1.348  39.347  67.436 1.00 17.02 ? 589  ASP B CB    1 
ATOM   1069  C  CG    . ASP A 1 147 ? -1.422  38.082  66.567 1.00 17.63 ? 589  ASP B CG    1 
ATOM   1070  O  OD1   . ASP A 1 147 ? -0.654  37.941  65.592 1.00 18.19 ? 589  ASP B OD1   1 
ATOM   1071  O  OD2   . ASP A 1 147 ? -2.255  37.220  66.876 1.00 17.65 ? 589  ASP B OD2   1 
ATOM   1072  N  N     . GLN A 1 148 ? 1.683   38.896  66.498 1.00 17.54 ? 590  GLN B N     1 
ATOM   1073  C  CA    A GLN A 1 148 ? 3.024   38.245  66.718 0.50 18.17 ? 590  GLN B CA    1 
ATOM   1074  C  CA    B GLN A 1 148 ? 3.046   38.381  66.682 0.50 18.40 ? 590  GLN B CA    1 
ATOM   1075  C  C     . GLN A 1 148 ? 4.305   39.332  66.811 1.00 18.90 ? 590  GLN B C     1 
ATOM   1076  O  O     . GLN A 1 148 ? 5.340   39.364  67.556 1.00 22.11 ? 590  GLN B O     1 
ATOM   1077  C  CB    A GLN A 1 148 ? 3.341   37.280  65.566 0.50 17.51 ? 590  GLN B CB    1 
ATOM   1078  C  CB    B GLN A 1 148 ? 3.354   37.334  65.604 0.50 18.12 ? 590  GLN B CB    1 
ATOM   1079  C  CG    A GLN A 1 148 ? 2.525   35.987  65.524 0.50 17.09 ? 590  GLN B CG    1 
ATOM   1080  C  CG    B GLN A 1 148 ? 2.441   36.084  65.697 0.50 18.17 ? 590  GLN B CG    1 
ATOM   1081  C  CD    A GLN A 1 148 ? 2.894   35.082  64.343 0.50 16.21 ? 590  GLN B CD    1 
ATOM   1082  C  CD    B GLN A 1 148 ? 2.710   35.209  66.940 0.50 17.86 ? 590  GLN B CD    1 
ATOM   1083  O  OE1   A GLN A 1 148 ? 3.745   35.445  63.502 0.50 15.09 ? 590  GLN B OE1   1 
ATOM   1084  O  OE1   B GLN A 1 148 ? 3.856   35.077  67.405 0.50 16.81 ? 590  GLN B OE1   1 
ATOM   1085  N  NE2   A GLN A 1 148 ? 2.335   33.884  64.308 0.50 15.39 ? 590  GLN B NE2   1 
ATOM   1086  N  NE2   B GLN A 1 148 ? 1.645   34.583  67.471 0.50 17.46 ? 590  GLN B NE2   1 
ATOM   1087  N  N     . LEU A 1 149 ? 4.018   40.342  66.000 1.00 18.25 ? 591  LEU B N     1 
ATOM   1088  C  CA    . LEU A 1 149 ? 4.999   41.439  65.986 1.00 17.79 ? 591  LEU B CA    1 
ATOM   1089  C  C     . LEU A 1 149 ? 4.898   42.272  67.260 1.00 18.69 ? 591  LEU B C     1 
ATOM   1090  O  O     . LEU A 1 149 ? 5.912   42.691  67.818 1.00 19.62 ? 591  LEU B O     1 
ATOM   1091  C  CB    . LEU A 1 149 ? 4.820   42.324  64.750 1.00 15.99 ? 591  LEU B CB    1 
ATOM   1092  C  CG    . LEU A 1 149 ? 5.742   43.539  64.567 1.00 16.14 ? 591  LEU B CG    1 
ATOM   1093  C  CD1   . LEU A 1 149 ? 7.237   43.162  64.513 1.00 14.46 ? 591  LEU B CD1   1 
ATOM   1094  C  CD2   . LEU A 1 149 ? 5.336   44.309  63.315 1.00 15.70 ? 591  LEU B CD2   1 
ATOM   1095  N  N     . TRP A 1 150 ? 3.669   42.490  67.709 1.00 18.34 ? 592  TRP B N     1 
ATOM   1096  C  CA    . TRP A 1 150 ? 3.396   43.253  68.910 1.00 20.28 ? 592  TRP B CA    1 
ATOM   1097  C  C     . TRP A 1 150 ? 3.919   42.562  70.165 1.00 22.13 ? 592  TRP B C     1 
ATOM   1098  O  O     . TRP A 1 150 ? 4.659   43.161  70.930 1.00 23.10 ? 592  TRP B O     1 
ATOM   1099  C  CB    . TRP A 1 150 ? 1.888   43.511  69.030 1.00 21.54 ? 592  TRP B CB    1 
ATOM   1100  C  CG    . TRP A 1 150 ? 1.427   43.926  70.401 1.00 22.39 ? 592  TRP B CG    1 
ATOM   1101  C  CD1   . TRP A 1 150 ? 0.753   43.165  71.290 1.00 21.36 ? 592  TRP B CD1   1 
ATOM   1102  C  CD2   . TRP A 1 150 ? 1.639   45.193  71.029 1.00 22.00 ? 592  TRP B CD2   1 
ATOM   1103  N  NE1   . TRP A 1 150 ? 0.515   43.874  72.435 1.00 23.30 ? 592  TRP B NE1   1 
ATOM   1104  C  CE2   . TRP A 1 150 ? 1.054   45.125  72.298 1.00 22.88 ? 592  TRP B CE2   1 
ATOM   1105  C  CE3   . TRP A 1 150 ? 2.260   46.375  70.640 1.00 22.40 ? 592  TRP B CE3   1 
ATOM   1106  C  CZ2   . TRP A 1 150 ? 1.062   46.188  73.177 1.00 23.48 ? 592  TRP B CZ2   1 
ATOM   1107  C  CZ3   . TRP A 1 150 ? 2.275   47.427  71.508 1.00 24.28 ? 592  TRP B CZ3   1 
ATOM   1108  C  CH2   . TRP A 1 150 ? 1.678   47.334  72.764 1.00 25.65 ? 592  TRP B CH2   1 
ATOM   1109  N  N     . GLU A 1 151 ? 3.525   41.306  70.361 1.00 23.16 ? 593  GLU B N     1 
ATOM   1110  C  CA    . GLU A 1 151 ? 3.921   40.543  71.543 1.00 23.98 ? 593  GLU B CA    1 
ATOM   1111  C  C     . GLU A 1 151 ? 5.402   40.221  71.726 1.00 23.81 ? 593  GLU B C     1 
ATOM   1112  O  O     . GLU A 1 151 ? 5.879   40.158  72.856 1.00 23.18 ? 593  GLU B O     1 
ATOM   1113  C  CB    . GLU A 1 151 ? 3.087   39.263  71.670 1.00 25.15 ? 593  GLU B CB    1 
ATOM   1114  C  CG    . GLU A 1 151 ? 1.687   39.497  72.233 1.00 30.33 ? 593  GLU B CG    1 
ATOM   1115  C  CD    . GLU A 1 151 ? 1.694   40.047  73.658 1.00 32.10 ? 593  GLU B CD    1 
ATOM   1116  O  OE1   . GLU A 1 151 ? 2.707   39.886  74.377 1.00 34.17 ? 593  GLU B OE1   1 
ATOM   1117  O  OE2   . GLU A 1 151 ? 0.672   40.634  74.069 1.00 35.63 ? 593  GLU B OE2   1 
ATOM   1118  N  N     . THR A 1 152 ? 6.121   40.020  70.629 1.00 23.44 ? 594  THR B N     1 
ATOM   1119  C  CA    . THR A 1 152 ? 7.541   39.659  70.707 1.00 22.77 ? 594  THR B CA    1 
ATOM   1120  C  C     . THR A 1 152 ? 8.518   40.831  70.604 1.00 22.72 ? 594  THR B C     1 
ATOM   1121  O  O     . THR A 1 152 ? 9.630   40.760  71.123 1.00 22.98 ? 594  THR B O     1 
ATOM   1122  C  CB    . THR A 1 152 ? 7.923   38.632  69.616 1.00 23.59 ? 594  THR B CB    1 
ATOM   1123  O  OG1   . THR A 1 152 ? 7.627   39.179  68.324 1.00 23.49 ? 594  THR B OG1   1 
ATOM   1124  C  CG2   . THR A 1 152 ? 7.169   37.326  69.803 1.00 22.62 ? 594  THR B CG2   1 
ATOM   1125  N  N     . THR A 1 153 ? 8.117   41.893  69.915 1.00 22.66 ? 595  THR B N     1 
ATOM   1126  C  CA    . THR A 1 153 ? 9.016   43.022  69.691 1.00 20.05 ? 595  THR B CA    1 
ATOM   1127  C  C     . THR A 1 153 ? 8.562   44.425  70.081 1.00 18.75 ? 595  THR B C     1 
ATOM   1128  O  O     . THR A 1 153 ? 9.392   45.270  70.367 1.00 19.83 ? 595  THR B O     1 
ATOM   1129  C  CB    . THR A 1 153 ? 9.404   43.084  68.194 1.00 19.98 ? 595  THR B CB    1 
ATOM   1130  O  OG1   . THR A 1 153 ? 9.654   41.765  67.703 1.00 20.30 ? 595  THR B OG1   1 
ATOM   1131  C  CG2   . THR A 1 153 ? 10.629  43.938  67.983 1.00 21.21 ? 595  THR B CG2   1 
ATOM   1132  N  N     . MET A 1 154 ? 7.263   44.684  70.080 1.00 18.19 ? 596  MET B N     1 
ATOM   1133  C  CA    . MET A 1 154 ? 6.772   46.044  70.354 1.00 17.97 ? 596  MET B CA    1 
ATOM   1134  C  C     . MET A 1 154 ? 6.153   46.319  71.734 1.00 19.81 ? 596  MET B C     1 
ATOM   1135  O  O     . MET A 1 154 ? 6.191   47.463  72.207 1.00 17.65 ? 596  MET B O     1 
ATOM   1136  C  CB    . MET A 1 154 ? 5.796   46.477  69.252 1.00 17.81 ? 596  MET B CB    1 
ATOM   1137  C  CG    . MET A 1 154 ? 6.369   46.371  67.834 1.00 16.49 ? 596  MET B CG    1 
ATOM   1138  S  SD    . MET A 1 154 ? 5.274   47.041  66.555 1.00 16.14 ? 596  MET B SD    1 
ATOM   1139  C  CE    . MET A 1 154 ? 5.244   48.783  66.996 1.00 15.29 ? 596  MET B CE    1 
ATOM   1140  N  N     . ASN A 1 155 ? 5.586   45.286  72.365 1.00 19.61 ? 597  ASN B N     1 
ATOM   1141  C  CA    . ASN A 1 155 ? 4.938   45.414  73.674 1.00 21.72 ? 597  ASN B CA    1 
ATOM   1142  C  C     . ASN A 1 155 ? 5.941   45.620  74.815 1.00 23.04 ? 597  ASN B C     1 
ATOM   1143  O  O     . ASN A 1 155 ? 6.723   44.707  75.109 1.00 26.32 ? 597  ASN B O     1 
ATOM   1144  C  CB    . ASN A 1 155 ? 4.053   44.190  73.949 1.00 20.92 ? 597  ASN B CB    1 
ATOM   1145  C  CG    . ASN A 1 155 ? 3.250   44.301  75.251 1.00 21.45 ? 597  ASN B CG    1 
ATOM   1146  O  OD1   . ASN A 1 155 ? 2.901   43.285  75.847 1.00 22.79 ? 597  ASN B OD1   1 
ATOM   1147  N  ND2   . ASN A 1 155 ? 2.953   45.516  75.683 1.00 21.38 ? 597  ASN B ND2   1 
ATOM   1148  N  N     . PRO A 1 156 ? 5.896   46.845  75.457 1.00 24.80 ? 598  PRO B N     1 
ATOM   1149  C  CA    . PRO A 1 156 ? 6.900   47.013  76.529 1.00 29.00 ? 598  PRO B CA    1 
ATOM   1150  C  C     . PRO A 1 156 ? 6.927   45.986  77.669 1.00 31.98 ? 598  PRO B C     1 
ATOM   1151  O  O     . PRO A 1 156 ? 7.936   45.898  78.355 1.00 32.07 ? 598  PRO B O     1 
ATOM   1152  C  CB    . PRO A 1 156 ? 6.606   48.414  77.096 1.00 25.65 ? 598  PRO B CB    1 
ATOM   1153  C  CG    . PRO A 1 156 ? 5.193   48.687  76.747 1.00 28.25 ? 598  PRO B CG    1 
ATOM   1154  C  CD    . PRO A 1 156 ? 5.101   48.142  75.362 1.00 26.50 ? 598  PRO B CD    1 
ATOM   1155  N  N     . GLU A 1 157 ? 5.863   45.228  77.867 1.00 34.41 ? 599  GLU B N     1 
ATOM   1156  C  CA    . GLU A 1 157 ? 5.834   44.211  78.932 1.00 35.93 ? 599  GLU B CA    1 
ATOM   1157  C  C     . GLU A 1 157 ? 6.668   42.964  78.641 1.00 33.87 ? 599  GLU B C     1 
ATOM   1158  O  O     . GLU A 1 157 ? 7.152   42.319  79.568 1.00 32.13 ? 599  GLU B O     1 
ATOM   1159  C  CB    . GLU A 1 157 ? 4.395   43.806  79.282 1.00 39.49 ? 599  GLU B CB    1 
ATOM   1160  C  CG    . GLU A 1 157 ? 3.569   44.923  79.905 1.00 44.08 ? 599  GLU B CG    1 
ATOM   1161  C  CD    . GLU A 1 157 ? 2.189   44.461  80.370 1.00 49.88 ? 599  GLU B CD    1 
ATOM   1162  O  OE1   . GLU A 1 157 ? 1.295   45.330  80.533 1.00 47.10 ? 599  GLU B OE1   1 
ATOM   1163  O  OE2   . GLU A 1 157 ? 1.989   43.233  80.585 1.00 52.90 ? 599  GLU B OE2   1 
ATOM   1164  N  N     . HIS A 1 158 ? 6.791   42.638  77.356 1.00 36.40 ? 600  HIS B N     1 
ATOM   1165  C  CA    . HIS A 1 158 ? 7.515   41.448  76.909 1.00 38.43 ? 600  HIS B CA    1 
ATOM   1166  C  C     . HIS A 1 158 ? 8.744   41.680  76.043 1.00 34.55 ? 600  HIS B C     1 
ATOM   1167  O  O     . HIS A 1 158 ? 9.655   40.858  76.022 1.00 32.99 ? 600  HIS B O     1 
ATOM   1168  C  CB    . HIS A 1 158 ? 6.569   40.498  76.153 1.00 42.82 ? 600  HIS B CB    1 
ATOM   1169  C  CG    . HIS A 1 158 ? 5.380   40.046  76.941 1.00 49.06 ? 600  HIS B CG    1 
ATOM   1170  N  ND1   . HIS A 1 158 ? 4.162   40.690  76.876 1.00 52.82 ? 600  HIS B ND1   1 
ATOM   1171  C  CD2   . HIS A 1 158 ? 5.208   38.998  77.786 1.00 49.69 ? 600  HIS B CD2   1 
ATOM   1172  C  CE1   . HIS A 1 158 ? 3.296   40.073  77.659 1.00 55.26 ? 600  HIS B CE1   1 
ATOM   1173  N  NE2   . HIS A 1 158 ? 3.905   39.041  78.220 1.00 51.56 ? 600  HIS B NE2   1 
ATOM   1174  N  N     . ARG A 1 159 ? 8.752   42.779  75.305 1.00 29.56 ? 601  ARG B N     1 
ATOM   1175  C  CA    . ARG A 1 159 ? 9.846   43.084  74.394 1.00 24.14 ? 601  ARG B CA    1 
ATOM   1176  C  C     . ARG A 1 159 ? 11.202  43.268  75.052 1.00 23.95 ? 601  ARG B C     1 
ATOM   1177  O  O     . ARG A 1 159 ? 11.299  43.666  76.208 1.00 25.90 ? 601  ARG B O     1 
ATOM   1178  C  CB    . ARG A 1 159 ? 9.509   44.353  73.617 1.00 22.76 ? 601  ARG B CB    1 
ATOM   1179  C  CG    . ARG A 1 159 ? 9.679   45.633  74.422 1.00 22.02 ? 601  ARG B CG    1 
ATOM   1180  C  CD    . ARG A 1 159 ? 9.213   46.843  73.650 1.00 20.30 ? 601  ARG B CD    1 
ATOM   1181  N  NE    . ARG A 1 159 ? 9.479   48.080  74.367 1.00 20.06 ? 601  ARG B NE    1 
ATOM   1182  C  CZ    . ARG A 1 159 ? 9.024   49.273  73.993 1.00 19.32 ? 601  ARG B CZ    1 
ATOM   1183  N  NH1   . ARG A 1 159 ? 8.271   49.388  72.917 1.00 17.54 ? 601  ARG B NH1   1 
ATOM   1184  N  NH2   . ARG A 1 159 ? 9.313   50.341  74.700 1.00 18.75 ? 601  ARG B NH2   1 
ATOM   1185  N  N     . ALA A 1 160 ? 12.252  42.979  74.303 1.00 24.63 ? 602  ALA B N     1 
ATOM   1186  C  CA    . ALA A 1 160 ? 13.612  43.198  74.758 1.00 22.57 ? 602  ALA B CA    1 
ATOM   1187  C  C     . ALA A 1 160 ? 14.227  44.221  73.809 1.00 24.25 ? 602  ALA B C     1 
ATOM   1188  O  O     . ALA A 1 160 ? 14.523  43.906  72.669 1.00 24.92 ? 602  ALA B O     1 
ATOM   1189  C  CB    . ALA A 1 160 ? 14.408  41.912  74.745 1.00 19.63 ? 602  ALA B CB    1 
ATOM   1190  N  N     . LEU A 1 161 ? 14.407  45.448  74.275 1.00 23.72 ? 603  LEU B N     1 
ATOM   1191  C  CA    . LEU A 1 161 ? 14.995  46.482  73.443 1.00 23.91 ? 603  LEU B CA    1 
ATOM   1192  C  C     . LEU A 1 161 ? 16.443  46.726  73.841 1.00 25.53 ? 603  LEU B C     1 
ATOM   1193  O  O     . LEU A 1 161 ? 16.762  46.786  75.016 1.00 24.04 ? 603  LEU B O     1 
ATOM   1194  C  CB    . LEU A 1 161 ? 14.214  47.795  73.548 1.00 22.40 ? 603  LEU B CB    1 
ATOM   1195  C  CG    . LEU A 1 161 ? 12.820  47.926  72.948 1.00 24.50 ? 603  LEU B CG    1 
ATOM   1196  C  CD1   . LEU A 1 161 ? 12.379  49.376  72.989 1.00 24.00 ? 603  LEU B CD1   1 
ATOM   1197  C  CD2   . LEU A 1 161 ? 12.759  47.391  71.523 1.00 23.06 ? 603  LEU B CD2   1 
ATOM   1198  N  N     . LEU A 1 162 ? 17.313  46.863  72.846 1.00 25.55 ? 604  LEU B N     1 
ATOM   1199  C  CA    . LEU A 1 162 ? 18.722  47.111  73.075 1.00 25.22 ? 604  LEU B CA    1 
ATOM   1200  C  C     . LEU A 1 162 ? 19.084  48.591  72.997 1.00 24.58 ? 604  LEU B C     1 
ATOM   1201  O  O     . LEU A 1 162 ? 19.075  49.187  71.932 1.00 27.69 ? 604  LEU B O     1 
ATOM   1202  C  CB    . LEU A 1 162 ? 19.568  46.322  72.083 1.00 25.19 ? 604  LEU B CB    1 
ATOM   1203  C  CG    . LEU A 1 162 ? 19.501  44.799  72.192 1.00 27.72 ? 604  LEU B CG    1 
ATOM   1204  C  CD1   . LEU A 1 162 ? 20.384  44.144  71.141 1.00 25.69 ? 604  LEU B CD1   1 
ATOM   1205  C  CD2   . LEU A 1 162 ? 19.917  44.351  73.574 1.00 27.71 ? 604  LEU B CD2   1 
ATOM   1206  N  N     . GLN A 1 163 ? 19.403  49.183  74.140 1.00 23.38 ? 605  GLN B N     1 
ATOM   1207  C  CA    . GLN A 1 163 ? 19.805  50.587  74.184 1.00 22.36 ? 605  GLN B CA    1 
ATOM   1208  C  C     . GLN A 1 163 ? 21.249  50.755  73.684 1.00 22.98 ? 605  GLN B C     1 
ATOM   1209  O  O     . GLN A 1 163 ? 22.165  50.073  74.155 1.00 21.50 ? 605  GLN B O     1 
ATOM   1210  C  CB    . GLN A 1 163 ? 19.651  51.151  75.598 1.00 20.60 ? 605  GLN B CB    1 
ATOM   1211  C  CG    . GLN A 1 163 ? 19.881  52.662  75.697 1.00 19.67 ? 605  GLN B CG    1 
ATOM   1212  C  CD    . GLN A 1 163 ? 19.679  53.206  77.102 1.00 19.77 ? 605  GLN B CD    1 
ATOM   1213  O  OE1   . GLN A 1 163 ? 19.182  54.313  77.278 1.00 21.79 ? 605  GLN B OE1   1 
ATOM   1214  N  NE2   . GLN A 1 163 ? 20.046  52.436  78.098 1.00 19.00 ? 605  GLN B NE2   1 
ATOM   1215  N  N     . VAL A 1 164 ? 21.436  51.669  72.732 1.00 23.36 ? 606  VAL B N     1 
ATOM   1216  C  CA    . VAL A 1 164 ? 22.748  51.914  72.137 1.00 24.91 ? 606  VAL B CA    1 
ATOM   1217  C  C     . VAL A 1 164 ? 23.610  52.781  73.066 1.00 27.15 ? 606  VAL B C     1 
ATOM   1218  O  O     . VAL A 1 164 ? 23.192  53.859  73.490 1.00 27.75 ? 606  VAL B O     1 
ATOM   1219  C  CB    . VAL A 1 164 ? 22.636  52.555  70.726 1.00 23.49 ? 606  VAL B CB    1 
ATOM   1220  C  CG1   . VAL A 1 164 ? 24.009  52.749  70.106 1.00 22.47 ? 606  VAL B CG1   1 
ATOM   1221  C  CG2   . VAL A 1 164 ? 21.781  51.690  69.827 1.00 23.69 ? 606  VAL B CG2   1 
ATOM   1222  N  N     . LYS A 1 165 ? 24.808  52.285  73.371 1.00 29.36 ? 607  LYS B N     1 
ATOM   1223  C  CA    . LYS A 1 165 ? 25.747  52.967  74.253 1.00 30.09 ? 607  LYS B CA    1 
ATOM   1224  C  C     . LYS A 1 165 ? 27.037  53.381  73.552 1.00 31.45 ? 607  LYS B C     1 
ATOM   1225  O  O     . LYS A 1 165 ? 27.593  52.641  72.735 1.00 28.76 ? 607  LYS B O     1 
ATOM   1226  C  CB    . LYS A 1 165 ? 26.100  52.092  75.464 1.00 30.41 ? 607  LYS B CB    1 
ATOM   1227  C  CG    . LYS A 1 165 ? 24.961  51.849  76.452 1.00 32.54 ? 607  LYS B CG    1 
ATOM   1228  C  CD    . LYS A 1 165 ? 24.570  53.146  77.183 1.00 32.02 ? 607  LYS B CD    1 
ATOM   1229  C  CE    . LYS A 1 165 ? 23.399  52.900  78.134 1.00 30.39 ? 607  LYS B CE    1 
ATOM   1230  N  NZ    . LYS A 1 165 ? 22.955  54.160  78.775 1.00 30.99 ? 607  LYS B NZ    1 
ATOM   1231  N  N     . LEU A 1 166 ? 27.498  54.583  73.881 1.00 30.23 ? 608  LEU B N     1 
ATOM   1232  C  CA    . LEU A 1 166 ? 28.755  55.085  73.375 1.00 32.46 ? 608  LEU B CA    1 
ATOM   1233  C  C     . LEU A 1 166 ? 29.771  55.031  74.513 1.00 33.31 ? 608  LEU B C     1 
ATOM   1234  O  O     . LEU A 1 166 ? 29.621  55.710  75.522 1.00 28.95 ? 608  LEU B O     1 
ATOM   1235  C  CB    . LEU A 1 166 ? 28.584  56.513  72.834 1.00 31.23 ? 608  LEU B CB    1 
ATOM   1236  C  CG    . LEU A 1 166 ? 29.835  57.289  72.365 1.00 30.32 ? 608  LEU B CG    1 
ATOM   1237  C  CD1   . LEU A 1 166 ? 30.581  56.560  71.264 1.00 31.78 ? 608  LEU B CD1   1 
ATOM   1238  C  CD2   . LEU A 1 166 ? 29.451  58.686  71.922 1.00 28.31 ? 608  LEU B CD2   1 
ATOM   1239  N  N     . GLU A 1 167 ? 30.786  54.187  74.346 1.00 38.89 ? 609  GLU B N     1 
ATOM   1240  C  CA    . GLU A 1 167 ? 31.844  54.009  75.345 1.00 39.74 ? 609  GLU B CA    1 
ATOM   1241  C  C     . GLU A 1 167 ? 33.004  54.956  75.063 1.00 42.66 ? 609  GLU B C     1 
ATOM   1242  O  O     . GLU A 1 167 ? 33.197  55.948  75.778 1.00 39.63 ? 609  GLU B O     1 
ATOM   1243  C  CB    . GLU A 1 167 ? 32.349  52.562  75.332 1.00 43.03 ? 609  GLU B CB    1 
ATOM   1244  C  CG    . GLU A 1 167 ? 31.364  51.533  75.853 1.00 46.91 ? 609  GLU B CG    1 
ATOM   1245  C  CD    . GLU A 1 167 ? 31.221  51.548  77.362 1.00 53.08 ? 609  GLU B CD    1 
ATOM   1246  O  OE1   . GLU A 1 167 ? 32.204  51.900  78.054 1.00 55.26 ? 609  GLU B OE1   1 
ATOM   1247  O  OE2   . GLU A 1 167 ? 30.126  51.183  77.853 1.00 50.86 ? 609  GLU B OE2   1 
ATOM   1248  N  N     . ASP A 1 168 ? 33.765  54.640  74.014 1.00 40.42 ? 610  ASP B N     1 
ATOM   1249  C  CA    . ASP A 1 168 ? 34.933  55.419  73.626 1.00 36.75 ? 610  ASP B CA    1 
ATOM   1250  C  C     . ASP A 1 168 ? 34.709  56.132  72.279 1.00 33.30 ? 610  ASP B C     1 
ATOM   1251  O  O     . ASP A 1 168 ? 34.602  55.489  71.225 1.00 30.60 ? 610  ASP B O     1 
ATOM   1252  C  CB    . ASP A 1 168 ? 36.167  54.505  73.581 1.00 38.01 ? 610  ASP B CB    1 
ATOM   1253  C  CG    . ASP A 1 168 ? 37.443  55.244  73.218 1.00 44.09 ? 610  ASP B CG    1 
ATOM   1254  O  OD1   . ASP A 1 168 ? 37.513  56.479  73.410 1.00 50.03 ? 610  ASP B OD1   1 
ATOM   1255  O  OD2   . ASP A 1 168 ? 38.382  54.576  72.730 1.00 52.01 ? 610  ASP B OD2   1 
ATOM   1256  N  N     . ALA A 1 169 ? 34.642  57.460  72.337 1.00 27.79 ? 611  ALA B N     1 
ATOM   1257  C  CA    . ALA A 1 169 ? 34.432  58.309  71.162 1.00 27.19 ? 611  ALA B CA    1 
ATOM   1258  C  C     . ALA A 1 169 ? 35.505  58.114  70.081 1.00 28.62 ? 611  ALA B C     1 
ATOM   1259  O  O     . ALA A 1 169 ? 35.174  58.029  68.895 1.00 27.46 ? 611  ALA B O     1 
ATOM   1260  C  CB    . ALA A 1 169 ? 34.355  59.781  71.573 1.00 23.26 ? 611  ALA B CB    1 
ATOM   1261  N  N     . ILE A 1 170 ? 36.770  58.047  70.500 1.00 27.82 ? 612  ILE B N     1 
ATOM   1262  C  CA    . ILE A 1 170 ? 37.916  57.869  69.595 1.00 26.95 ? 612  ILE B CA    1 
ATOM   1263  C  C     . ILE A 1 170 ? 37.821  56.564  68.798 1.00 27.42 ? 612  ILE B C     1 
ATOM   1264  O  O     . ILE A 1 170 ? 38.034  56.550  67.582 1.00 26.87 ? 612  ILE B O     1 
ATOM   1265  C  CB    . ILE A 1 170 ? 39.281  57.936  70.368 1.00 28.35 ? 612  ILE B CB    1 
ATOM   1266  C  CG1   . ILE A 1 170 ? 39.454  59.295  71.085 1.00 28.33 ? 612  ILE B CG1   1 
ATOM   1267  C  CG2   . ILE A 1 170 ? 40.473  57.619  69.451 1.00 26.74 ? 612  ILE B CG2   1 
ATOM   1268  C  CD1   . ILE A 1 170 ? 39.482  60.533  70.187 1.00 25.80 ? 612  ILE B CD1   1 
ATOM   1269  N  N     . GLU A 1 171 ? 37.473  55.487  69.477 1.00 28.83 ? 613  GLU B N     1 
ATOM   1270  C  CA    . GLU A 1 171 ? 37.342  54.191  68.851 1.00 27.51 ? 613  GLU B CA    1 
ATOM   1271  C  C     . GLU A 1 171 ? 36.125  54.129  67.956 1.00 25.47 ? 613  GLU B C     1 
ATOM   1272  O  O     . GLU A 1 171 ? 36.138  53.483  66.949 1.00 24.17 ? 613  GLU B O     1 
ATOM   1273  C  CB    . GLU A 1 171 ? 37.264  53.121  69.914 1.00 28.52 ? 613  GLU B CB    1 
ATOM   1274  C  CG    . GLU A 1 171 ? 37.076  51.733  69.368 1.00 30.84 ? 613  GLU B CG    1 
ATOM   1275  C  CD    . GLU A 1 171 ? 36.891  50.742  70.477 1.00 32.94 ? 613  GLU B CD    1 
ATOM   1276  O  OE1   . GLU A 1 171 ? 36.084  51.080  71.397 1.00 29.19 ? 613  GLU B OE1   1 
ATOM   1277  O  OE2   . GLU A 1 171 ? 37.555  49.651  70.422 1.00 34.33 ? 613  GLU B OE2   1 
ATOM   1278  N  N     . ALA A 1 172 ? 35.074  54.813  68.349 1.00 24.85 ? 614  ALA B N     1 
ATOM   1279  C  CA    . ALA A 1 172 ? 33.847  54.887  67.562 1.00 22.20 ? 614  ALA B CA    1 
ATOM   1280  C  C     . ALA A 1 172 ? 34.077  55.670  66.273 1.00 24.10 ? 614  ALA B C     1 
ATOM   1281  O  O     . ALA A 1 172 ? 33.569  55.288  65.218 1.00 22.58 ? 614  ALA B O     1 
ATOM   1282  C  CB    . ALA A 1 172 ? 32.734  55.509  68.372 1.00 21.22 ? 614  ALA B CB    1 
ATOM   1283  N  N     . ASP A 1 173 ? 34.849  56.756  66.363 1.00 23.85 ? 615  ASP B N     1 
ATOM   1284  C  CA    . ASP A 1 173 ? 35.201  57.574  65.196 1.00 25.97 ? 615  ASP B CA    1 
ATOM   1285  C  C     . ASP A 1 173 ? 35.986  56.766  64.180 1.00 25.63 ? 615  ASP B C     1 
ATOM   1286  O  O     . ASP A 1 173 ? 35.817  56.950  62.973 1.00 24.30 ? 615  ASP B O     1 
ATOM   1287  C  CB    . ASP A 1 173 ? 36.041  58.787  65.599 1.00 26.94 ? 615  ASP B CB    1 
ATOM   1288  C  CG    . ASP A 1 173 ? 35.267  59.796  66.423 1.00 31.44 ? 615  ASP B CG    1 
ATOM   1289  O  OD1   . ASP A 1 173 ? 34.021  59.864  66.302 1.00 32.02 ? 615  ASP B OD1   1 
ATOM   1290  O  OD2   . ASP A 1 173 ? 35.922  60.542  67.188 1.00 34.31 ? 615  ASP B OD2   1 
ATOM   1291  N  N     . GLN A 1 174 ? 36.848  55.878  64.684 1.00 25.51 ? 616  GLN B N     1 
ATOM   1292  C  CA    . GLN A 1 174 ? 37.692  55.037  63.840 1.00 27.49 ? 616  GLN B CA    1 
ATOM   1293  C  C     . GLN A 1 174 ? 36.895  53.913  63.195 1.00 24.52 ? 616  GLN B C     1 
ATOM   1294  O  O     . GLN A 1 174 ? 37.107  53.594  62.025 1.00 24.26 ? 616  GLN B O     1 
ATOM   1295  C  CB    . GLN A 1 174 ? 38.882  54.485  64.638 1.00 29.72 ? 616  GLN B CB    1 
ATOM   1296  C  CG    . GLN A 1 174 ? 39.872  55.574  65.085 1.00 34.43 ? 616  GLN B CG    1 
ATOM   1297  C  CD    . GLN A 1 174 ? 40.965  55.085  66.019 1.00 37.58 ? 616  GLN B CD    1 
ATOM   1298  O  OE1   . GLN A 1 174 ? 41.146  53.883  66.214 1.00 42.32 ? 616  GLN B OE1   1 
ATOM   1299  N  NE2   . GLN A 1 174 ? 41.694  56.020  66.606 1.00 37.13 ? 616  GLN B NE2   1 
ATOM   1300  N  N     . THR A 1 175 ? 35.970  53.347  63.952 1.00 22.42 ? 617  THR B N     1 
ATOM   1301  C  CA    . THR A 1 175 ? 35.110  52.262  63.502 1.00 20.54 ? 617  THR B CA    1 
ATOM   1302  C  C     . THR A 1 175 ? 34.177  52.728  62.385 1.00 21.09 ? 617  THR B C     1 
ATOM   1303  O  O     . THR A 1 175 ? 33.976  52.033  61.429 1.00 23.20 ? 617  THR B O     1 
ATOM   1304  C  CB    . THR A 1 175 ? 34.357  51.640  64.688 1.00 20.64 ? 617  THR B CB    1 
ATOM   1305  O  OG1   . THR A 1 175 ? 35.317  51.214  65.646 1.00 19.53 ? 617  THR B OG1   1 
ATOM   1306  C  CG2   . THR A 1 175 ? 33.582  50.478  64.297 1.00 19.83 ? 617  THR B CG2   1 
ATOM   1307  N  N     . PHE A 1 176 ? 33.637  53.926  62.502 1.00 20.83 ? 618  PHE B N     1 
ATOM   1308  C  CA    . PHE A 1 176 ? 32.770  54.482  61.465 1.00 19.64 ? 618  PHE B CA    1 
ATOM   1309  C  C     . PHE A 1 176 ? 33.555  54.828  60.202 1.00 19.90 ? 618  PHE B C     1 
ATOM   1310  O  O     . PHE A 1 176 ? 33.021  54.746  59.100 1.00 20.49 ? 618  PHE B O     1 
ATOM   1311  C  CB    . PHE A 1 176 ? 31.938  55.670  61.976 1.00 18.11 ? 618  PHE B CB    1 
ATOM   1312  C  CG    . PHE A 1 176 ? 30.746  55.261  62.805 1.00 17.63 ? 618  PHE B CG    1 
ATOM   1313  C  CD1   . PHE A 1 176 ? 29.591  54.771  62.197 1.00 17.31 ? 618  PHE B CD1   1 
ATOM   1314  C  CD2   . PHE A 1 176 ? 30.780  55.335  64.200 1.00 16.74 ? 618  PHE B CD2   1 
ATOM   1315  C  CE1   . PHE A 1 176 ? 28.495  54.382  62.960 1.00 16.14 ? 618  PHE B CE1   1 
ATOM   1316  C  CE2   . PHE A 1 176 ? 29.689  54.955  64.966 1.00 15.25 ? 618  PHE B CE2   1 
ATOM   1317  C  CZ    . PHE A 1 176 ? 28.546  54.474  64.346 1.00 15.68 ? 618  PHE B CZ    1 
ATOM   1318  N  N     . GLU A 1 177 ? 34.824  55.204  60.367 1.00 21.25 ? 619  GLU B N     1 
ATOM   1319  C  CA    . GLU A 1 177 ? 35.708  55.504  59.235 1.00 21.87 ? 619  GLU B CA    1 
ATOM   1320  C  C     . GLU A 1 177 ? 36.116  54.252  58.484 1.00 20.71 ? 619  GLU B C     1 
ATOM   1321  O  O     . GLU A 1 177 ? 35.993  54.187  57.271 1.00 22.13 ? 619  GLU B O     1 
ATOM   1322  C  CB    . GLU A 1 177 ? 36.954  56.281  59.682 1.00 25.26 ? 619  GLU B CB    1 
ATOM   1323  C  CG    . GLU A 1 177 ? 36.885  57.779  59.460 1.00 30.93 ? 619  GLU B CG    1 
ATOM   1324  C  CD    . GLU A 1 177 ? 37.020  58.150  57.968 1.00 34.91 ? 619  GLU B CD    1 
ATOM   1325  O  OE1   . GLU A 1 177 ? 38.019  57.696  57.345 1.00 36.12 ? 619  GLU B OE1   1 
ATOM   1326  O  OE2   . GLU A 1 177 ? 36.158  58.876  57.409 1.00 30.34 ? 619  GLU B OE2   1 
ATOM   1327  N  N     . MET A 1 178 ? 36.566  53.264  59.223 1.00 18.39 ? 620  MET B N     1 
ATOM   1328  C  CA    . MET A 1 178 ? 37.019  52.010  58.685 1.00 17.92 ? 620  MET B CA    1 
ATOM   1329  C  C     . MET A 1 178 ? 35.953  51.244  57.907 1.00 17.85 ? 620  MET B C     1 
ATOM   1330  O  O     . MET A 1 178 ? 36.190  50.806  56.803 1.00 17.96 ? 620  MET B O     1 
ATOM   1331  C  CB    . MET A 1 178 ? 37.582  51.154  59.814 1.00 18.11 ? 620  MET B CB    1 
ATOM   1332  C  CG    . MET A 1 178 ? 38.057  49.788  59.384 1.00 19.08 ? 620  MET B CG    1 
ATOM   1333  S  SD    . MET A 1 178 ? 38.633  48.803  60.761 1.00 21.76 ? 620  MET B SD    1 
ATOM   1334  C  CE    . MET A 1 178 ? 37.139  48.752  61.739 1.00 21.23 ? 620  MET B CE    1 
ATOM   1335  N  N     . LEU A 1 179 ? 34.783  51.095  58.500 1.00 16.18 ? 621  LEU B N     1 
ATOM   1336  C  CA    . LEU A 1 179 ? 33.710  50.347  57.894 1.00 15.08 ? 621  LEU B CA    1 
ATOM   1337  C  C     . LEU A 1 179 ? 32.859  51.063  56.884 1.00 15.03 ? 621  LEU B C     1 
ATOM   1338  O  O     . LEU A 1 179 ? 32.493  50.491  55.893 1.00 15.41 ? 621  LEU B O     1 
ATOM   1339  C  CB    . LEU A 1 179 ? 32.788  49.787  58.970 1.00 14.05 ? 621  LEU B CB    1 
ATOM   1340  C  CG    . LEU A 1 179 ? 33.403  49.014  60.121 1.00 13.14 ? 621  LEU B CG    1 
ATOM   1341  C  CD1   . LEU A 1 179 ? 32.364  48.686  61.158 1.00 12.48 ? 621  LEU B CD1   1 
ATOM   1342  C  CD2   . LEU A 1 179 ? 34.128  47.772  59.674 1.00 12.46 ? 621  LEU B CD2   1 
ATOM   1343  N  N     . MET A 1 180 ? 32.529  52.310  57.149 1.00 14.30 ? 622  MET B N     1 
ATOM   1344  C  CA    . MET A 1 180 ? 31.635  53.031  56.258 1.00 14.28 ? 622  MET B CA    1 
ATOM   1345  C  C     . MET A 1 180 ? 32.306  54.037  55.330 1.00 14.58 ? 622  MET B C     1 
ATOM   1346  O  O     . MET A 1 180 ? 31.677  54.514  54.385 1.00 13.84 ? 622  MET B O     1 
ATOM   1347  C  CB    . MET A 1 180 ? 30.534  53.714  57.076 1.00 13.77 ? 622  MET B CB    1 
ATOM   1348  C  CG    . MET A 1 180 ? 29.945  52.829  58.174 1.00 13.72 ? 622  MET B CG    1 
ATOM   1349  S  SD    . MET A 1 180 ? 29.365  51.193  57.641 1.00 12.83 ? 622  MET B SD    1 
ATOM   1350  C  CE    . MET A 1 180 ? 27.992  51.651  56.601 1.00 11.54 ? 622  MET B CE    1 
ATOM   1351  N  N     . GLY A 1 181 ? 33.574  54.348  55.597 1.00 16.40 ? 623  GLY B N     1 
ATOM   1352  C  CA    . GLY A 1 181 ? 34.335  55.319  54.800 1.00 15.28 ? 623  GLY B CA    1 
ATOM   1353  C  C     . GLY A 1 181 ? 34.726  54.832  53.401 1.00 17.08 ? 623  GLY B C     1 
ATOM   1354  O  O     . GLY A 1 181 ? 34.568  53.651  53.052 1.00 16.42 ? 623  GLY B O     1 
ATOM   1355  N  N     . ASP A 1 182 ? 35.265  55.756  52.613 1.00 18.60 ? 624  ASP B N     1 
ATOM   1356  C  CA    . ASP A 1 182 ? 35.627  55.492  51.223 1.00 20.91 ? 624  ASP B CA    1 
ATOM   1357  C  C     . ASP A 1 182 ? 36.874  54.621  50.973 1.00 20.61 ? 624  ASP B C     1 
ATOM   1358  O  O     . ASP A 1 182 ? 37.036  54.075  49.884 1.00 21.29 ? 624  ASP B O     1 
ATOM   1359  C  CB    . ASP A 1 182 ? 35.684  56.788  50.405 1.00 25.41 ? 624  ASP B CB    1 
ATOM   1360  C  CG    . ASP A 1 182 ? 36.600  57.835  51.022 1.00 30.54 ? 624  ASP B CG    1 
ATOM   1361  O  OD1   . ASP A 1 182 ? 37.197  57.587  52.110 1.00 33.10 ? 624  ASP B OD1   1 
ATOM   1362  O  OD2   . ASP A 1 182 ? 36.683  58.942  50.421 1.00 33.60 ? 624  ASP B OD2   1 
ATOM   1363  N  N     . VAL A 1 183 ? 37.744  54.491  51.969 1.00 20.25 ? 625  VAL B N     1 
ATOM   1364  C  CA    . VAL A 1 183 ? 38.950  53.663  51.819 1.00 19.61 ? 625  VAL B CA    1 
ATOM   1365  C  C     . VAL A 1 183 ? 38.646  52.166  51.949 1.00 18.78 ? 625  VAL B C     1 
ATOM   1366  O  O     . VAL A 1 183 ? 38.432  51.649  53.046 1.00 20.11 ? 625  VAL B O     1 
ATOM   1367  C  CB    . VAL A 1 183 ? 40.110  54.123  52.747 1.00 18.66 ? 625  VAL B CB    1 
ATOM   1368  C  CG1   . VAL A 1 183 ? 41.341  53.238  52.546 1.00 18.31 ? 625  VAL B CG1   1 
ATOM   1369  C  CG2   . VAL A 1 183 ? 40.466  55.583  52.461 1.00 16.88 ? 625  VAL B CG2   1 
ATOM   1370  N  N     . VAL A 1 184 ? 38.629  51.492  50.809 1.00 18.28 ? 626  VAL B N     1 
ATOM   1371  C  CA    . VAL A 1 184 ? 38.300  50.066  50.703 1.00 18.44 ? 626  VAL B CA    1 
ATOM   1372  C  C     . VAL A 1 184 ? 39.300  49.128  51.399 1.00 18.85 ? 626  VAL B C     1 
ATOM   1373  O  O     . VAL A 1 184 ? 38.898  48.111  51.961 1.00 20.27 ? 626  VAL B O     1 
ATOM   1374  C  CB    . VAL A 1 184 ? 38.142  49.655  49.214 1.00 17.38 ? 626  VAL B CB    1 
ATOM   1375  C  CG1   . VAL A 1 184 ? 37.858  48.165  49.079 1.00 16.53 ? 626  VAL B CG1   1 
ATOM   1376  C  CG2   . VAL A 1 184 ? 37.035  50.476  48.557 1.00 17.70 ? 626  VAL B CG2   1 
ATOM   1377  N  N     . GLU A 1 185 ? 40.584  49.472  51.360 1.00 18.20 ? 627  GLU B N     1 
ATOM   1378  C  CA    . GLU A 1 185 ? 41.622  48.627  51.940 1.00 20.45 ? 627  GLU B CA    1 
ATOM   1379  C  C     . GLU A 1 185 ? 41.432  48.330  53.442 1.00 21.43 ? 627  GLU B C     1 
ATOM   1380  O  O     . GLU A 1 185 ? 41.532  47.169  53.864 1.00 20.47 ? 627  GLU B O     1 
ATOM   1381  C  CB    . GLU A 1 185 ? 43.027  49.189  51.659 1.00 20.72 ? 627  GLU B CB    1 
ATOM   1382  C  CG    . GLU A 1 185 ? 44.179  48.308  52.139 1.00 21.34 ? 627  GLU B CG    1 
ATOM   1383  C  CD    . GLU A 1 185 ? 44.135  46.890  51.570 1.00 25.24 ? 627  GLU B CD    1 
ATOM   1384  O  OE1   . GLU A 1 185 ? 43.519  46.660  50.500 1.00 25.26 ? 627  GLU B OE1   1 
ATOM   1385  O  OE2   . GLU A 1 185 ? 44.728  45.992  52.192 1.00 27.14 ? 627  GLU B OE2   1 
ATOM   1386  N  N     . ASN A 1 186 ? 41.163  49.374  54.227 1.00 21.52 ? 628  ASN B N     1 
ATOM   1387  C  CA    . ASN A 1 186 ? 40.947  49.236  55.663 1.00 22.89 ? 628  ASN B CA    1 
ATOM   1388  C  C     . ASN A 1 186 ? 39.789  48.285  55.955 1.00 23.55 ? 628  ASN B C     1 
ATOM   1389  O  O     . ASN A 1 186 ? 39.870  47.424  56.839 1.00 22.44 ? 628  ASN B O     1 
ATOM   1390  C  CB    . ASN A 1 186 ? 40.672  50.598  56.300 1.00 25.04 ? 628  ASN B CB    1 
ATOM   1391  C  CG    . ASN A 1 186 ? 41.839  51.571  56.141 1.00 25.13 ? 628  ASN B CG    1 
ATOM   1392  O  OD1   . ASN A 1 186 ? 42.991  51.167  56.027 1.00 27.87 ? 628  ASN B OD1   1 
ATOM   1393  N  ND2   . ASN A 1 186 ? 41.537  52.861  56.143 1.00 25.59 ? 628  ASN B ND2   1 
ATOM   1394  N  N     . ARG A 1 187 ? 38.715  48.466  55.188 1.00 21.49 ? 629  ARG B N     1 
ATOM   1395  C  CA    . ARG A 1 187 ? 37.527  47.634  55.263 1.00 21.01 ? 629  ARG B CA    1 
ATOM   1396  C  C     . ARG A 1 187 ? 37.845  46.194  54.819 1.00 20.99 ? 629  ARG B C     1 
ATOM   1397  O  O     . ARG A 1 187 ? 37.350  45.244  55.410 1.00 19.39 ? 629  ARG B O     1 
ATOM   1398  C  CB    . ARG A 1 187 ? 36.402  48.279  54.441 1.00 20.40 ? 629  ARG B CB    1 
ATOM   1399  C  CG    . ARG A 1 187 ? 35.140  47.446  54.262 1.00 18.62 ? 629  ARG B CG    1 
ATOM   1400  C  CD    . ARG A 1 187 ? 33.938  48.292  53.810 1.00 17.48 ? 629  ARG B CD    1 
ATOM   1401  N  NE    . ARG A 1 187 ? 34.181  49.120  52.627 1.00 16.80 ? 629  ARG B NE    1 
ATOM   1402  C  CZ    . ARG A 1 187 ? 34.425  50.429  52.650 1.00 16.32 ? 629  ARG B CZ    1 
ATOM   1403  N  NH1   . ARG A 1 187 ? 34.466  51.093  53.801 1.00 16.48 ? 629  ARG B NH1   1 
ATOM   1404  N  NH2   . ARG A 1 187 ? 34.619  51.086  51.517 1.00 15.03 ? 629  ARG B NH2   1 
ATOM   1405  N  N     . ARG A 1 188 ? 38.711  46.031  53.825 1.00 21.48 ? 630  ARG B N     1 
ATOM   1406  C  CA    . ARG A 1 188 ? 39.105  44.699  53.380 1.00 21.69 ? 630  ARG B CA    1 
ATOM   1407  C  C     . ARG A 1 188 ? 39.976  44.039  54.446 1.00 23.44 ? 630  ARG B C     1 
ATOM   1408  O  O     . ARG A 1 188 ? 39.882  42.847  54.687 1.00 24.15 ? 630  ARG B O     1 
ATOM   1409  C  CB    . ARG A 1 188 ? 39.868  44.754  52.065 1.00 20.32 ? 630  ARG B CB    1 
ATOM   1410  C  CG    . ARG A 1 188 ? 40.148  43.381  51.489 1.00 20.67 ? 630  ARG B CG    1 
ATOM   1411  C  CD    . ARG A 1 188 ? 41.374  43.370  50.603 1.00 19.88 ? 630  ARG B CD    1 
ATOM   1412  N  NE    . ARG A 1 188 ? 42.569  43.746  51.334 1.00 21.04 ? 630  ARG B NE    1 
ATOM   1413  C  CZ    . ARG A 1 188 ? 43.311  42.898  52.038 1.00 21.91 ? 630  ARG B CZ    1 
ATOM   1414  N  NH1   . ARG A 1 188 ? 42.976  41.608  52.107 1.00 21.45 ? 630  ARG B NH1   1 
ATOM   1415  N  NH2   . ARG A 1 188 ? 44.382  43.333  52.669 1.00 20.41 ? 630  ARG B NH2   1 
ATOM   1416  N  N     . GLN A 1 189 ? 40.829  44.833  55.079 1.00 24.10 ? 631  GLN B N     1 
ATOM   1417  C  CA    . GLN A 1 189 ? 41.691  44.339  56.147 1.00 22.94 ? 631  GLN B CA    1 
ATOM   1418  C  C     . GLN A 1 189 ? 40.874  43.885  57.371 1.00 21.37 ? 631  GLN B C     1 
ATOM   1419  O  O     . GLN A 1 189 ? 41.188  42.866  57.988 1.00 21.71 ? 631  GLN B O     1 
ATOM   1420  C  CB    . GLN A 1 189 ? 42.725  45.407  56.530 1.00 26.28 ? 631  GLN B CB    1 
ATOM   1421  C  CG    . GLN A 1 189 ? 43.772  44.967  57.567 1.00 27.77 ? 631  GLN B CG    1 
ATOM   1422  C  CD    . GLN A 1 189 ? 44.713  43.867  57.058 1.00 29.24 ? 631  GLN B CD    1 
ATOM   1423  O  OE1   . GLN A 1 189 ? 45.207  43.914  55.929 1.00 29.47 ? 631  GLN B OE1   1 
ATOM   1424  N  NE2   . GLN A 1 189 ? 44.977  42.885  57.907 1.00 29.04 ? 631  GLN B NE2   1 
ATOM   1425  N  N     . PHE A 1 190 ? 39.809  44.611  57.694 1.00 19.72 ? 632  PHE B N     1 
ATOM   1426  C  CA    . PHE A 1 190 ? 38.950  44.261  58.808 1.00 19.98 ? 632  PHE B CA    1 
ATOM   1427  C  C     . PHE A 1 190 ? 38.265  42.921  58.578 1.00 20.89 ? 632  PHE B C     1 
ATOM   1428  O  O     . PHE A 1 190 ? 38.215  42.092  59.455 1.00 20.89 ? 632  PHE B O     1 
ATOM   1429  C  CB    . PHE A 1 190 ? 37.919  45.356  59.063 1.00 21.29 ? 632  PHE B CB    1 
ATOM   1430  C  CG    . PHE A 1 190 ? 36.787  44.932  59.954 1.00 20.75 ? 632  PHE B CG    1 
ATOM   1431  C  CD1   . PHE A 1 190 ? 36.899  45.030  61.314 1.00 20.77 ? 632  PHE B CD1   1 
ATOM   1432  C  CD2   . PHE A 1 190 ? 35.646  44.432  59.424 1.00 20.78 ? 632  PHE B CD2   1 
ATOM   1433  C  CE1   . PHE A 1 190 ? 35.870  44.640  62.129 1.00 19.94 ? 632  PHE B CE1   1 
ATOM   1434  C  CE2   . PHE A 1 190 ? 34.620  44.019  60.235 1.00 21.32 ? 632  PHE B CE2   1 
ATOM   1435  C  CZ    . PHE A 1 190 ? 34.727  44.129  61.603 1.00 19.24 ? 632  PHE B CZ    1 
ATOM   1436  N  N     . ILE A 1 191 ? 37.744  42.736  57.377 1.00 20.24 ? 633  ILE B N     1 
ATOM   1437  C  CA    . ILE A 1 191 ? 37.071  41.503  56.987 1.00 19.25 ? 633  ILE B CA    1 
ATOM   1438  C  C     . ILE A 1 191 ? 38.006  40.307  57.129 1.00 20.89 ? 633  ILE B C     1 
ATOM   1439  O  O     . ILE A 1 191 ? 37.647  39.310  57.762 1.00 21.52 ? 633  ILE B O     1 
ATOM   1440  C  CB    . ILE A 1 191 ? 36.521  41.570  55.537 1.00 18.95 ? 633  ILE B CB    1 
ATOM   1441  C  CG1   . ILE A 1 191 ? 35.545  42.744  55.385 1.00 18.10 ? 633  ILE B CG1   1 
ATOM   1442  C  CG2   . ILE A 1 191 ? 35.860  40.244  55.143 1.00 17.13 ? 633  ILE B CG2   1 
ATOM   1443  C  CD1   . ILE A 1 191 ? 35.073  42.974  53.960 1.00 16.83 ? 633  ILE B CD1   1 
ATOM   1444  N  N     . GLU A 1 192 ? 39.205  40.423  56.558 1.00 22.09 ? 634  GLU B N     1 
ATOM   1445  C  CA    . GLU A 1 192 ? 40.198  39.359  56.620 1.00 24.11 ? 634  GLU B CA    1 
ATOM   1446  C  C     . GLU A 1 192 ? 40.534  38.962  58.057 1.00 23.26 ? 634  GLU B C     1 
ATOM   1447  O  O     . GLU A 1 192 ? 40.470  37.785  58.408 1.00 26.98 ? 634  GLU B O     1 
ATOM   1448  C  CB    . GLU A 1 192 ? 41.469  39.764  55.864 1.00 27.08 ? 634  GLU B CB    1 
ATOM   1449  C  CG    . GLU A 1 192 ? 42.539  38.676  55.838 1.00 31.54 ? 634  GLU B CG    1 
ATOM   1450  C  CD    . GLU A 1 192 ? 43.856  39.119  55.204 1.00 36.89 ? 634  GLU B CD    1 
ATOM   1451  O  OE1   . GLU A 1 192 ? 44.910  38.602  55.692 1.00 37.06 ? 634  GLU B OE1   1 
ATOM   1452  O  OE2   . GLU A 1 192 ? 43.835  39.961  54.261 1.00 40.87 ? 634  GLU B OE2   1 
ATOM   1453  N  N     . ASP A 1 193 ? 40.857  39.952  58.885 1.00 23.08 ? 635  ASP B N     1 
ATOM   1454  C  CA    . ASP A 1 193 ? 41.261  39.726  60.282 1.00 23.35 ? 635  ASP B CA    1 
ATOM   1455  C  C     . ASP A 1 193 ? 40.162  39.255  61.251 1.00 23.77 ? 635  ASP B C     1 
ATOM   1456  O  O     . ASP A 1 193 ? 40.474  38.828  62.368 1.00 21.92 ? 635  ASP B O     1 
ATOM   1457  C  CB    . ASP A 1 193 ? 41.925  40.989  60.849 1.00 22.29 ? 635  ASP B CB    1 
ATOM   1458  C  CG    . ASP A 1 193 ? 43.240  41.330  60.163 1.00 22.47 ? 635  ASP B CG    1 
ATOM   1459  O  OD1   . ASP A 1 193 ? 43.823  40.453  59.482 1.00 21.57 ? 635  ASP B OD1   1 
ATOM   1460  O  OD2   . ASP A 1 193 ? 43.704  42.484  60.322 1.00 20.95 ? 635  ASP B OD2   1 
ATOM   1461  N  N     . ASN A 1 194 ? 38.900  39.322  60.834 1.00 22.75 ? 636  ASN B N     1 
ATOM   1462  C  CA    . ASN A 1 194 ? 37.782  38.962  61.714 1.00 24.17 ? 636  ASN B CA    1 
ATOM   1463  C  C     . ASN A 1 194 ? 36.781  37.954  61.156 1.00 25.85 ? 636  ASN B C     1 
ATOM   1464  O  O     . ASN A 1 194 ? 35.888  37.501  61.870 1.00 26.75 ? 636  ASN B O     1 
ATOM   1465  C  CB    . ASN A 1 194 ? 37.058  40.232  62.172 1.00 23.95 ? 636  ASN B CB    1 
ATOM   1466  C  CG    . ASN A 1 194 ? 37.941  41.123  63.034 1.00 25.15 ? 636  ASN B CG    1 
ATOM   1467  O  OD1   . ASN A 1 194 ? 38.346  40.747  64.128 1.00 26.19 ? 636  ASN B OD1   1 
ATOM   1468  N  ND2   . ASN A 1 194 ? 38.240  42.315  62.541 1.00 24.85 ? 636  ASN B ND2   1 
ATOM   1469  N  N     . ALA A 1 195 ? 36.918  37.631  59.881 1.00 26.43 ? 637  ALA B N     1 
ATOM   1470  C  CA    . ALA A 1 195 ? 36.002  36.708  59.258 1.00 28.84 ? 637  ALA B CA    1 
ATOM   1471  C  C     . ALA A 1 195 ? 36.255  35.285  59.716 1.00 34.48 ? 637  ALA B C     1 
ATOM   1472  O  O     . ALA A 1 195 ? 37.380  34.792  59.700 1.00 34.54 ? 637  ALA B O     1 
ATOM   1473  C  CB    . ALA A 1 195 ? 36.140  36.785  57.751 1.00 33.31 ? 637  ALA B CB    1 
ATOM   1474  N  N     . VAL A 1 196 ? 35.186  34.624  60.137 1.00 36.64 ? 638  VAL B N     1 
ATOM   1475  C  CA    . VAL A 1 196 ? 35.280  33.246  60.532 1.00 36.24 ? 638  VAL B CA    1 
ATOM   1476  C  C     . VAL A 1 196 ? 34.313  32.526  59.617 1.00 39.43 ? 638  VAL B C     1 
ATOM   1477  O  O     . VAL A 1 196 ? 33.100  32.749  59.688 1.00 38.79 ? 638  VAL B O     1 
ATOM   1478  C  CB    . VAL A 1 196 ? 34.866  33.053  61.997 1.00 36.97 ? 638  VAL B CB    1 
ATOM   1479  C  CG1   . VAL A 1 196 ? 34.756  31.572  62.324 1.00 35.33 ? 638  VAL B CG1   1 
ATOM   1480  C  CG2   . VAL A 1 196 ? 35.867  33.736  62.917 1.00 32.63 ? 638  VAL B CG2   1 
ATOM   1481  N  N     . TYR A 1 197 ? 34.845  31.675  58.749 1.00 40.99 ? 639  TYR B N     1 
ATOM   1482  C  CA    . TYR A 1 197 ? 34.009  30.939  57.807 1.00 41.95 ? 639  TYR B CA    1 
ATOM   1483  C  C     . TYR A 1 197 ? 33.523  29.605  58.368 1.00 45.04 ? 639  TYR B C     1 
ATOM   1484  O  O     . TYR A 1 197 ? 33.969  28.559  57.958 1.00 53.78 ? 639  TYR B O     1 
ATOM   1485  C  CB    . TYR A 1 197 ? 34.773  30.743  56.497 1.00 37.58 ? 639  TYR B CB    1 
ATOM   1486  C  CG    . TYR A 1 197 ? 35.210  32.039  55.852 1.00 35.83 ? 639  TYR B CG    1 
ATOM   1487  C  CD1   . TYR A 1 197 ? 34.409  32.675  54.913 1.00 34.71 ? 639  TYR B CD1   1 
ATOM   1488  C  CD2   . TYR A 1 197 ? 36.413  32.634  56.181 1.00 35.28 ? 639  TYR B CD2   1 
ATOM   1489  C  CE1   . TYR A 1 197 ? 34.802  33.851  54.316 1.00 30.59 ? 639  TYR B CE1   1 
ATOM   1490  C  CE2   . TYR A 1 197 ? 36.814  33.816  55.588 1.00 31.15 ? 639  TYR B CE2   1 
ATOM   1491  C  CZ    . TYR A 1 197 ? 36.006  34.420  54.664 1.00 30.73 ? 639  TYR B CZ    1 
ATOM   1492  O  OH    . TYR A 1 197 ? 36.374  35.600  54.074 1.00 29.47 ? 639  TYR B OH    1 
ATOM   1493  N  N     . ILE B 2 8   ? 19.163  41.490  78.273 1.00 44.65 ? 9    ILE A N     1 
ATOM   1494  C  CA    . ILE B 2 8   ? 19.843  42.027  77.062 1.00 48.86 ? 9    ILE A CA    1 
ATOM   1495  C  C     . ILE B 2 8   ? 19.493  43.494  76.984 1.00 46.71 ? 9    ILE A C     1 
ATOM   1496  O  O     . ILE B 2 8   ? 18.885  43.953  76.035 1.00 52.30 ? 9    ILE A O     1 
ATOM   1497  C  CB    . ILE B 2 8   ? 19.403  41.319  75.757 1.00 44.31 ? 9    ILE A CB    1 
ATOM   1498  N  N     . ASN B 2 9   ? 19.868  44.220  78.022 1.00 43.95 ? 10   ASN A N     1 
ATOM   1499  C  CA    . ASN B 2 9   ? 19.617  45.654  78.115 1.00 44.26 ? 10   ASN A CA    1 
ATOM   1500  C  C     . ASN B 2 9   ? 20.384  46.647  77.248 1.00 42.84 ? 10   ASN A C     1 
ATOM   1501  O  O     . ASN B 2 9   ? 19.826  47.601  76.765 1.00 38.38 ? 10   ASN A O     1 
ATOM   1502  C  CB    . ASN B 2 9   ? 19.738  46.070  79.572 1.00 46.09 ? 10   ASN A CB    1 
ATOM   1503  C  CG    . ASN B 2 9   ? 18.760  45.329  80.467 1.00 52.14 ? 10   ASN A CG    1 
ATOM   1504  O  OD1   . ASN B 2 9   ? 17.528  45.385  80.278 1.00 50.78 ? 10   ASN A OD1   1 
ATOM   1505  N  ND2   . ASN B 2 9   ? 19.301  44.611  81.453 1.00 49.54 ? 10   ASN A ND2   1 
ATOM   1506  N  N     . GLU B 2 10  ? 21.675  46.433  77.081 1.00 42.38 ? 11   GLU A N     1 
ATOM   1507  C  CA    . GLU B 2 10  ? 22.525  47.373  76.382 1.00 38.13 ? 11   GLU A CA    1 
ATOM   1508  C  C     . GLU B 2 10  ? 23.377  46.784  75.295 1.00 35.07 ? 11   GLU A C     1 
ATOM   1509  O  O     . GLU B 2 10  ? 23.660  45.594  75.273 1.00 32.37 ? 11   GLU A O     1 
ATOM   1510  C  CB    . GLU B 2 10  ? 23.505  47.996  77.358 1.00 39.20 ? 11   GLU A CB    1 
ATOM   1511  C  CG    . GLU B 2 10  ? 22.899  48.782  78.490 1.00 45.13 ? 11   GLU A CG    1 
ATOM   1512  C  CD    . GLU B 2 10  ? 23.961  49.529  79.270 1.00 49.96 ? 11   GLU A CD    1 
ATOM   1513  O  OE1   . GLU B 2 10  ? 23.633  50.045  80.356 1.00 54.79 ? 11   GLU A OE1   1 
ATOM   1514  O  OE2   . GLU B 2 10  ? 25.122  49.612  78.796 1.00 48.00 ? 11   GLU A OE2   1 
ATOM   1515  N  N     . ARG B 2 11  ? 23.794  47.667  74.398 1.00 30.17 ? 12   ARG A N     1 
ATOM   1516  C  CA    . ARG B 2 11  ? 24.630  47.311  73.276 1.00 27.73 ? 12   ARG A CA    1 
ATOM   1517  C  C     . ARG B 2 11  ? 25.582  48.451  72.908 1.00 24.93 ? 12   ARG A C     1 
ATOM   1518  O  O     . ARG B 2 11  ? 25.170  49.546  72.559 1.00 23.02 ? 12   ARG A O     1 
ATOM   1519  C  CB    . ARG B 2 11  ? 23.737  46.916  72.095 1.00 28.12 ? 12   ARG A CB    1 
ATOM   1520  C  CG    . ARG B 2 11  ? 24.465  46.613  70.798 1.00 29.82 ? 12   ARG A CG    1 
ATOM   1521  C  CD    . ARG B 2 11  ? 25.341  45.395  70.943 1.00 30.97 ? 12   ARG A CD    1 
ATOM   1522  N  NE    . ARG B 2 11  ? 25.609  44.763  69.677 1.00 31.57 ? 12   ARG A NE    1 
ATOM   1523  C  CZ    . ARG B 2 11  ? 26.356  43.681  69.541 1.00 30.07 ? 12   ARG A CZ    1 
ATOM   1524  N  NH1   . ARG B 2 11  ? 26.910  43.120  70.588 1.00 28.20 ? 12   ARG A NH1   1 
ATOM   1525  N  NH2   . ARG B 2 11  ? 26.553  43.176  68.351 1.00 32.05 ? 12   ARG A NH2   1 
ATOM   1526  N  N     . ASN B 2 12  ? 26.867  48.175  72.998 1.00 22.65 ? 13   ASN A N     1 
ATOM   1527  C  CA    . ASN B 2 12  ? 27.893  49.146  72.618 1.00 22.34 ? 13   ASN A CA    1 
ATOM   1528  C  C     . ASN B 2 12  ? 27.832  49.410  71.105 1.00 20.16 ? 13   ASN A C     1 
ATOM   1529  O  O     . ASN B 2 12  ? 27.815  48.468  70.301 1.00 21.75 ? 13   ASN A O     1 
ATOM   1530  C  CB    . ASN B 2 12  ? 29.276  48.594  73.029 1.00 25.28 ? 13   ASN A CB    1 
ATOM   1531  C  CG    . ASN B 2 12  ? 30.427  49.501  72.620 1.00 27.56 ? 13   ASN A CG    1 
ATOM   1532  O  OD1   . ASN B 2 12  ? 30.348  50.249  71.642 1.00 29.50 ? 13   ASN A OD1   1 
ATOM   1533  N  ND2   . ASN B 2 12  ? 31.516  49.421  73.366 1.00 30.53 ? 13   ASN A ND2   1 
ATOM   1534  N  N     . ILE B 2 13  ? 27.803  50.689  70.734 1.00 18.61 ? 14   ILE A N     1 
ATOM   1535  C  CA    . ILE B 2 13  ? 27.684  51.094  69.330 1.00 17.80 ? 14   ILE A CA    1 
ATOM   1536  C  C     . ILE B 2 13  ? 28.796  50.525  68.442 1.00 18.01 ? 14   ILE A C     1 
ATOM   1537  O  O     . ILE B 2 13  ? 28.535  50.105  67.316 1.00 18.03 ? 14   ILE A O     1 
ATOM   1538  C  CB    . ILE B 2 13  ? 27.548  52.634  69.155 1.00 17.82 ? 14   ILE A CB    1 
ATOM   1539  C  CG1   . ILE B 2 13  ? 27.021  52.963  67.743 1.00 17.59 ? 14   ILE A CG1   1 
ATOM   1540  C  CG2   . ILE B 2 13  ? 28.856  53.363  69.502 1.00 17.98 ? 14   ILE A CG2   1 
ATOM   1541  C  CD1   . ILE B 2 13  ? 26.605  54.392  67.510 1.00 16.32 ? 14   ILE A CD1   1 
ATOM   1542  N  N     . THR B 2 14  ? 30.017  50.515  68.952 1.00 18.40 ? 15   THR A N     1 
ATOM   1543  C  CA    . THR B 2 14  ? 31.147  49.992  68.214 1.00 19.47 ? 15   THR A CA    1 
ATOM   1544  C  C     . THR B 2 14  ? 31.007  48.496  67.981 1.00 20.04 ? 15   THR A C     1 
ATOM   1545  O  O     . THR B 2 14  ? 31.276  48.023  66.913 1.00 21.20 ? 15   THR A O     1 
ATOM   1546  C  CB    . THR B 2 14  ? 32.486  50.268  68.942 1.00 19.73 ? 15   THR A CB    1 
ATOM   1547  O  OG1   . THR B 2 14  ? 32.692  51.666  69.026 1.00 19.97 ? 15   THR A OG1   1 
ATOM   1548  C  CG2   . THR B 2 14  ? 33.651  49.676  68.213 1.00 18.63 ? 15   THR A CG2   1 
ATOM   1549  N  N     . SER B 2 15  ? 30.611  47.765  69.009 1.00 20.42 ? 16   SER A N     1 
ATOM   1550  C  CA    . SER B 2 15  ? 30.448  46.335  68.914 1.00 19.56 ? 16   SER A CA    1 
ATOM   1551  C  C     . SER B 2 15  ? 29.334  45.955  67.965 1.00 20.23 ? 16   SER A C     1 
ATOM   1552  O  O     . SER B 2 15  ? 29.446  45.004  67.232 1.00 20.07 ? 16   SER A O     1 
ATOM   1553  C  CB    . SER B 2 15  ? 30.269  45.740  70.283 1.00 20.40 ? 16   SER A CB    1 
ATOM   1554  O  OG    . SER B 2 15  ? 31.472  45.870  70.971 1.00 20.03 ? 16   SER A OG    1 
ATOM   1555  N  N     . GLU B 2 16  ? 28.256  46.722  68.001 1.00 18.77 ? 17   GLU A N     1 
ATOM   1556  C  CA    . GLU B 2 16  ? 27.143  46.528  67.119 1.00 17.45 ? 17   GLU A CA    1 
ATOM   1557  C  C     . GLU B 2 16  ? 27.546  46.776  65.679 1.00 16.77 ? 17   GLU A C     1 
ATOM   1558  O  O     . GLU B 2 16  ? 27.176  46.034  64.809 1.00 16.60 ? 17   GLU A O     1 
ATOM   1559  C  CB    . GLU B 2 16  ? 26.020  47.486  67.503 1.00 16.64 ? 17   GLU A CB    1 
ATOM   1560  C  CG    . GLU B 2 16  ? 24.849  47.567  66.540 1.00 15.74 ? 17   GLU A CG    1 
ATOM   1561  C  CD    . GLU B 2 16  ? 24.148  46.228  66.360 1.00 16.78 ? 17   GLU A CD    1 
ATOM   1562  O  OE1   . GLU B 2 16  ? 24.117  45.388  67.276 1.00 16.03 ? 17   GLU A OE1   1 
ATOM   1563  O  OE2   . GLU B 2 16  ? 23.619  46.039  65.267 1.00 16.34 ? 17   GLU A OE2   1 
ATOM   1564  N  N     . MET B 2 17  ? 28.306  47.828  65.434 1.00 14.97 ? 18   MET A N     1 
ATOM   1565  C  CA    . MET B 2 17  ? 28.708  48.147  64.090 1.00 15.22 ? 18   MET A CA    1 
ATOM   1566  C  C     . MET B 2 17  ? 29.608  47.095  63.455 1.00 16.16 ? 18   MET A C     1 
ATOM   1567  O  O     . MET B 2 17  ? 29.415  46.741  62.319 1.00 15.59 ? 18   MET A O     1 
ATOM   1568  C  CB    . MET B 2 17  ? 29.372  49.514  64.032 1.00 14.31 ? 18   MET A CB    1 
ATOM   1569  C  CG    . MET B 2 17  ? 28.459  50.700  64.082 1.00 13.47 ? 18   MET A CG    1 
ATOM   1570  S  SD    . MET B 2 17  ? 27.330  50.951  62.717 1.00 14.45 ? 18   MET A SD    1 
ATOM   1571  C  CE    . MET B 2 17  ? 28.520  51.110  61.360 1.00 12.62 ? 18   MET A CE    1 
ATOM   1572  N  N     . ARG B 2 18  ? 30.574  46.607  64.216 1.00 17.08 ? 19   ARG A N     1 
ATOM   1573  C  CA    . ARG B 2 18  ? 31.497  45.591  63.759 1.00 17.61 ? 19   ARG A CA    1 
ATOM   1574  C  C     . ARG B 2 18  ? 30.827  44.295  63.497 1.00 16.28 ? 19   ARG A C     1 
ATOM   1575  O  O     . ARG B 2 18  ? 31.082  43.662  62.513 1.00 16.17 ? 19   ARG A O     1 
ATOM   1576  C  CB    . ARG B 2 18  ? 32.569  45.338  64.797 1.00 18.43 ? 19   ARG A CB    1 
ATOM   1577  C  CG    . ARG B 2 18  ? 33.544  46.465  64.945 1.00 21.17 ? 19   ARG A CG    1 
ATOM   1578  C  CD    . ARG B 2 18  ? 34.492  46.130  66.080 1.00 24.37 ? 19   ARG A CD    1 
ATOM   1579  N  NE    . ARG B 2 18  ? 35.339  47.265  66.330 1.00 27.65 ? 19   ARG A NE    1 
ATOM   1580  C  CZ    . ARG B 2 18  ? 36.580  47.358  65.867 1.00 32.53 ? 19   ARG A CZ    1 
ATOM   1581  N  NH1   . ARG B 2 18  ? 37.106  46.324  65.173 1.00 32.24 ? 19   ARG A NH1   1 
ATOM   1582  N  NH2   . ARG B 2 18  ? 37.254  48.475  66.096 1.00 30.68 ? 19   ARG A NH2   1 
ATOM   1583  N  N     . GLU B 2 19  ? 29.947  43.922  64.405 1.00 15.67 ? 20   GLU A N     1 
ATOM   1584  C  CA    A GLU B 2 19  ? 29.331  42.536  64.269 0.50 15.52 ? 20   GLU A CA    1 
ATOM   1585  C  CA    B GLU B 2 19  ? 29.255  42.646  64.253 0.50 15.83 ? 20   GLU A CA    1 
ATOM   1586  C  C     . GLU B 2 19  ? 28.090  42.474  63.121 1.00 15.12 ? 20   GLU A C     1 
ATOM   1587  O  O     . GLU B 2 19  ? 28.070  41.618  62.272 1.00 14.90 ? 20   GLU A O     1 
ATOM   1588  C  CB    A GLU B 2 19  ? 28.722  42.098  65.615 0.50 16.37 ? 20   GLU A CB    1 
ATOM   1589  C  CB    B GLU B 2 19  ? 28.716  42.236  65.619 0.50 17.17 ? 20   GLU A CB    1 
ATOM   1590  C  CG    A GLU B 2 19  ? 29.762  41.863  66.746 0.50 16.82 ? 20   GLU A CG    1 
ATOM   1591  C  CG    B GLU B 2 19  ? 28.007  40.896  65.612 0.50 18.64 ? 20   GLU A CG    1 
ATOM   1592  C  CD    A GLU B 2 19  ? 29.156  41.503  68.104 0.50 17.41 ? 20   GLU A CD    1 
ATOM   1593  C  CD    B GLU B 2 19  ? 27.707  40.376  66.969 0.50 19.84 ? 20   GLU A CD    1 
ATOM   1594  O  OE1   A GLU B 2 19  ? 29.848  41.701  69.120 0.50 17.15 ? 20   GLU A OE1   1 
ATOM   1595  O  OE1   B GLU B 2 19  ? 28.298  40.903  67.966 0.50 21.44 ? 20   GLU A OE1   1 
ATOM   1596  O  OE2   A GLU B 2 19  ? 28.004  41.036  68.163 0.50 18.71 ? 20   GLU A OE2   1 
ATOM   1597  O  OE2   B GLU B 2 19  ? 26.881  39.446  66.998 0.50 19.96 ? 20   GLU A OE2   1 
ATOM   1598  N  N     . SER B 2 20  ? 27.305  43.530  63.073 1.00 13.91 ? 21   SER A N     1 
ATOM   1599  C  CA    . SER B 2 20  ? 26.359  43.723  61.981 1.00 13.18 ? 21   SER A CA    1 
ATOM   1600  C  C     . SER B 2 20  ? 27.026  43.906  60.639 1.00 12.54 ? 21   SER A C     1 
ATOM   1601  O  O     . SER B 2 20  ? 26.585  43.335  59.690 1.00 11.25 ? 21   SER A O     1 
ATOM   1602  C  CB    . SER B 2 20  ? 25.408  44.859  62.263 1.00 13.05 ? 21   SER A CB    1 
ATOM   1603  O  OG    . SER B 2 20  ? 24.560  44.527  63.320 1.00 12.93 ? 21   SER A OG    1 
ATOM   1604  N  N     . PHE B 2 21  ? 28.077  44.702  60.568 1.00 12.18 ? 22   PHE A N     1 
ATOM   1605  C  CA    . PHE B 2 21  ? 28.748  44.913  59.316 1.00 12.93 ? 22   PHE A CA    1 
ATOM   1606  C  C     . PHE B 2 21  ? 29.479  43.699  58.731 1.00 13.27 ? 22   PHE A C     1 
ATOM   1607  O  O     . PHE B 2 21  ? 29.427  43.467  57.546 1.00 13.66 ? 22   PHE A O     1 
ATOM   1608  C  CB    . PHE B 2 21  ? 29.648  46.148  59.350 1.00 13.08 ? 22   PHE A CB    1 
ATOM   1609  C  CG    . PHE B 2 21  ? 29.961  46.683  57.992 1.00 13.09 ? 22   PHE A CG    1 
ATOM   1610  C  CD1   . PHE B 2 21  ? 29.075  47.516  57.351 1.00 13.20 ? 22   PHE A CD1   1 
ATOM   1611  C  CD2   . PHE B 2 21  ? 31.105  46.299  57.338 1.00 12.41 ? 22   PHE A CD2   1 
ATOM   1612  C  CE1   . PHE B 2 21  ? 29.347  47.982  56.096 1.00 12.75 ? 22   PHE A CE1   1 
ATOM   1613  C  CE2   . PHE B 2 21  ? 31.379  46.752  56.095 1.00 11.85 ? 22   PHE A CE2   1 
ATOM   1614  C  CZ    . PHE B 2 21  ? 30.495  47.602  55.469 1.00 12.48 ? 22   PHE A CZ    1 
ATOM   1615  N  N     . LEU B 2 22  ? 30.154  42.949  59.583 1.00 13.30 ? 23   LEU A N     1 
ATOM   1616  C  CA    . LEU B 2 22  ? 30.894  41.788  59.170 1.00 14.26 ? 23   LEU A CA    1 
ATOM   1617  C  C     . LEU B 2 22  ? 29.928  40.707  58.763 1.00 14.46 ? 23   LEU A C     1 
ATOM   1618  O  O     . LEU B 2 22  ? 30.199  39.924  57.905 1.00 15.07 ? 23   LEU A O     1 
ATOM   1619  C  CB    . LEU B 2 22  ? 31.811  41.317  60.284 1.00 14.12 ? 23   LEU A CB    1 
ATOM   1620  C  CG    . LEU B 2 22  ? 32.769  40.189  59.940 1.00 15.08 ? 23   LEU A CG    1 
ATOM   1621  C  CD1   . LEU B 2 22  ? 33.982  40.671  59.132 1.00 15.16 ? 23   LEU A CD1   1 
ATOM   1622  C  CD2   . LEU B 2 22  ? 33.176  39.498  61.234 1.00 15.43 ? 23   LEU A CD2   1 
ATOM   1623  N  N     . ASP B 2 23  ? 28.784  40.697  59.404 1.00 14.57 ? 24   ASP A N     1 
ATOM   1624  C  CA    . ASP B 2 23  ? 27.762  39.746  59.057 1.00 15.59 ? 24   ASP A CA    1 
ATOM   1625  C  C     . ASP B 2 23  ? 27.239  40.029  57.650 1.00 14.60 ? 24   ASP A C     1 
ATOM   1626  O  O     . ASP B 2 23  ? 27.085  39.120  56.848 1.00 14.52 ? 24   ASP A O     1 
ATOM   1627  C  CB    . ASP B 2 23  ? 26.632  39.834  60.077 1.00 18.09 ? 24   ASP A CB    1 
ATOM   1628  C  CG    . ASP B 2 23  ? 25.489  38.911  59.770 1.00 22.64 ? 24   ASP A CG    1 
ATOM   1629  O  OD1   . ASP B 2 23  ? 25.707  37.909  59.041 1.00 24.10 ? 24   ASP A OD1   1 
ATOM   1630  O  OD2   . ASP B 2 23  ? 24.373  39.230  60.271 1.00 23.45 ? 24   ASP A OD2   1 
ATOM   1631  N  N     . TYR B 2 24  ? 26.984  41.294  57.355 1.00 12.87 ? 25   TYR A N     1 
ATOM   1632  C  CA    . TYR B 2 24  ? 26.513  41.657  56.033 1.00 12.25 ? 25   TYR A CA    1 
ATOM   1633  C  C     . TYR B 2 24  ? 27.583  41.380  54.985 1.00 11.97 ? 25   TYR A C     1 
ATOM   1634  O  O     . TYR B 2 24  ? 27.307  40.800  53.947 1.00 12.34 ? 25   TYR A O     1 
ATOM   1635  C  CB    . TYR B 2 24  ? 26.087  43.129  55.970 1.00 11.40 ? 25   TYR A CB    1 
ATOM   1636  C  CG    . TYR B 2 24  ? 25.747  43.589  54.569 1.00 10.65 ? 25   TYR A CG    1 
ATOM   1637  C  CD1   . TYR B 2 24  ? 24.598  43.142  53.933 1.00 10.45 ? 25   TYR A CD1   1 
ATOM   1638  C  CD2   . TYR B 2 24  ? 26.575  44.458  53.880 1.00 10.28 ? 25   TYR A CD2   1 
ATOM   1639  C  CE1   . TYR B 2 24  ? 24.282  43.551  52.663 1.00 9.80  ? 25   TYR A CE1   1 
ATOM   1640  C  CE2   . TYR B 2 24  ? 26.276  44.864  52.604 1.00 9.80  ? 25   TYR A CE2   1 
ATOM   1641  C  CZ    . TYR B 2 24  ? 25.119  44.416  51.997 1.00 9.80  ? 25   TYR A CZ    1 
ATOM   1642  O  OH    . TYR B 2 24  ? 24.815  44.821  50.728 1.00 8.81  ? 25   TYR A OH    1 
ATOM   1643  N  N     . ALA B 2 25  ? 28.803  41.799  55.278 1.00 12.22 ? 26   ALA A N     1 
ATOM   1644  C  CA    . ALA B 2 25  ? 29.924  41.639  54.365 1.00 12.44 ? 26   ALA A CA    1 
ATOM   1645  C  C     . ALA B 2 25  ? 30.250  40.186  54.056 1.00 13.09 ? 26   ALA A C     1 
ATOM   1646  O  O     . ALA B 2 25  ? 30.510  39.838  52.923 1.00 12.50 ? 26   ALA A O     1 
ATOM   1647  C  CB    . ALA B 2 25  ? 31.145  42.364  54.902 1.00 10.93 ? 26   ALA A CB    1 
ATOM   1648  N  N     A MET B 2 26  ? 30.228  39.353  55.086 0.50 14.04 ? 27   MET A N     1 
ATOM   1649  N  N     B MET B 2 26  ? 30.387  39.230  54.967 0.50 14.17 ? 27   MET A N     1 
ATOM   1650  C  CA    A MET B 2 26  ? 30.510  37.938  54.939 0.50 14.95 ? 27   MET A CA    1 
ATOM   1651  C  CA    B MET B 2 26  ? 30.606  37.841  54.582 0.50 15.00 ? 27   MET A CA    1 
ATOM   1652  C  C     A MET B 2 26  ? 29.478  37.268  54.045 0.50 13.83 ? 27   MET A C     1 
ATOM   1653  C  C     B MET B 2 26  ? 29.423  37.279  53.802 0.50 13.99 ? 27   MET A C     1 
ATOM   1654  O  O     A MET B 2 26  ? 29.814  36.443  53.215 0.50 13.68 ? 27   MET A O     1 
ATOM   1655  O  O     B MET B 2 26  ? 29.593  36.384  52.976 0.50 14.21 ? 27   MET A O     1 
ATOM   1656  C  CB    A MET B 2 26  ? 30.527  37.268  56.310 0.50 16.12 ? 27   MET A CB    1 
ATOM   1657  C  CB    B MET B 2 26  ? 30.893  36.978  55.813 0.50 16.69 ? 27   MET A CB    1 
ATOM   1658  C  CG    A MET B 2 26  ? 31.806  37.492  57.088 0.50 17.67 ? 27   MET A CG    1 
ATOM   1659  C  CG    B MET B 2 26  ? 32.251  37.216  56.496 0.50 18.51 ? 27   MET A CG    1 
ATOM   1660  S  SD    A MET B 2 26  ? 33.093  36.360  56.476 0.50 21.85 ? 27   MET A SD    1 
ATOM   1661  S  SD    B MET B 2 26  ? 32.690  36.140  57.908 0.50 21.64 ? 27   MET A SD    1 
ATOM   1662  C  CE    A MET B 2 26  ? 32.317  34.778  56.867 0.50 20.00 ? 27   MET A CE    1 
ATOM   1663  C  CE    B MET B 2 26  ? 31.373  36.216  59.119 0.50 18.92 ? 27   MET A CE    1 
ATOM   1664  N  N     . SER B 2 27  ? 28.219  37.640  54.230 1.00 13.19 ? 28   SER A N     1 
ATOM   1665  C  CA    . SER B 2 27  ? 27.117  37.097  53.459 1.00 12.17 ? 28   SER A CA    1 
ATOM   1666  C  C     . SER B 2 27  ? 27.225  37.461  51.987 1.00 11.38 ? 28   SER A C     1 
ATOM   1667  O  O     . SER B 2 27  ? 27.010  36.629  51.124 1.00 10.64 ? 28   SER A O     1 
ATOM   1668  C  CB    . SER B 2 27  ? 25.788  37.588  54.036 1.00 12.28 ? 28   SER A CB    1 
ATOM   1669  O  OG    . SER B 2 27  ? 24.689  37.038  53.346 1.00 12.65 ? 28   SER A OG    1 
ATOM   1670  N  N     . VAL B 2 28  ? 27.579  38.702  51.711 1.00 11.24 ? 29   VAL A N     1 
ATOM   1671  C  CA    . VAL B 2 28  ? 27.735  39.185  50.347 1.00 11.21 ? 29   VAL A CA    1 
ATOM   1672  C  C     . VAL B 2 28  ? 28.889  38.471  49.653 1.00 11.70 ? 29   VAL A C     1 
ATOM   1673  O  O     . VAL B 2 28  ? 28.755  38.014  48.543 1.00 13.42 ? 29   VAL A O     1 
ATOM   1674  C  CB    . VAL B 2 28  ? 27.856  40.734  50.307 1.00 11.39 ? 29   VAL A CB    1 
ATOM   1675  C  CG1   . VAL B 2 28  ? 28.353  41.251  48.970 1.00 11.19 ? 29   VAL A CG1   1 
ATOM   1676  C  CG2   . VAL B 2 28  ? 26.508  41.353  50.632 1.00 10.81 ? 29   VAL A CG2   1 
ATOM   1677  N  N     . ILE B 2 29  ? 30.008  38.359  50.348 1.00 11.61 ? 30   ILE A N     1 
ATOM   1678  C  CA    . ILE B 2 29  ? 31.205  37.698  49.870 1.00 11.93 ? 30   ILE A CA    1 
ATOM   1679  C  C     . ILE B 2 29  ? 31.020  36.223  49.560 1.00 12.15 ? 30   ILE A C     1 
ATOM   1680  O  O     . ILE B 2 29  ? 31.395  35.777  48.512 1.00 12.37 ? 30   ILE A O     1 
ATOM   1681  C  CB    . ILE B 2 29  ? 32.384  37.904  50.870 1.00 12.35 ? 30   ILE A CB    1 
ATOM   1682  C  CG1   . ILE B 2 29  ? 32.860  39.351  50.849 1.00 12.71 ? 30   ILE A CG1   1 
ATOM   1683  C  CG2   . ILE B 2 29  ? 33.553  36.977  50.599 1.00 12.17 ? 30   ILE A CG2   1 
ATOM   1684  C  CD1   . ILE B 2 29  ? 33.752  39.724  51.998 1.00 11.64 ? 30   ILE A CD1   1 
ATOM   1685  N  N     . VAL B 2 30  ? 30.443  35.480  50.484 1.00 12.56 ? 31   VAL A N     1 
ATOM   1686  C  CA    . VAL B 2 30  ? 30.288  34.048  50.298 1.00 11.92 ? 31   VAL A CA    1 
ATOM   1687  C  C     . VAL B 2 30  ? 28.937  33.594  49.761 1.00 11.09 ? 31   VAL A C     1 
ATOM   1688  O  O     . VAL B 2 30  ? 28.827  32.482  49.270 1.00 12.10 ? 31   VAL A O     1 
ATOM   1689  C  CB    . VAL B 2 30  ? 30.591  33.277  51.599 1.00 12.26 ? 31   VAL A CB    1 
ATOM   1690  C  CG1   . VAL B 2 30  ? 31.889  33.764  52.213 1.00 11.70 ? 31   VAL A CG1   1 
ATOM   1691  C  CG2   . VAL B 2 30  ? 29.450  33.409  52.582 1.00 12.56 ? 31   VAL A CG2   1 
ATOM   1692  N  N     . ALA B 2 31  ? 27.918  34.434  49.835 1.00 10.24 ? 32   ALA A N     1 
ATOM   1693  C  CA    . ALA B 2 31  ? 26.605  34.022  49.369 1.00 9.14  ? 32   ALA A CA    1 
ATOM   1694  C  C     . ALA B 2 31  ? 25.814  35.032  48.540 1.00 8.34  ? 32   ALA A C     1 
ATOM   1695  O  O     . ALA B 2 31  ? 24.655  35.278  48.807 1.00 7.85  ? 32   ALA A O     1 
ATOM   1696  C  CB    . ALA B 2 31  ? 25.777  33.543  50.555 1.00 9.04  ? 32   ALA A CB    1 
ATOM   1697  N  N     . ARG B 2 32  ? 26.441  35.589  47.514 1.00 8.34  ? 33   ARG A N     1 
ATOM   1698  C  CA    . ARG B 2 32  ? 25.766  36.548  46.638 1.00 7.96  ? 33   ARG A CA    1 
ATOM   1699  C  C     . ARG B 2 32  ? 26.567  37.037  45.431 1.00 7.88  ? 33   ARG A C     1 
ATOM   1700  O  O     . ARG B 2 32  ? 26.309  36.641  44.313 1.00 7.73  ? 33   ARG A O     1 
ATOM   1701  C  CB    . ARG B 2 32  ? 25.266  37.746  47.437 1.00 7.65  ? 33   ARG A CB    1 
ATOM   1702  C  CG    . ARG B 2 32  ? 24.553  38.777  46.602 1.00 7.63  ? 33   ARG A CG    1 
ATOM   1703  C  CD    . ARG B 2 32  ? 24.063  39.932  47.445 1.00 7.52  ? 33   ARG A CD    1 
ATOM   1704  N  NE    . ARG B 2 32  ? 23.106  39.499  48.471 1.00 7.66  ? 33   ARG A NE    1 
ATOM   1705  C  CZ    . ARG B 2 32  ? 22.552  40.327  49.330 1.00 7.80  ? 33   ARG A CZ    1 
ATOM   1706  N  NH1   . ARG B 2 32  ? 22.809  41.650  49.283 1.00 7.95  ? 33   ARG A NH1   1 
ATOM   1707  N  NH2   . ARG B 2 32  ? 21.688  39.874  50.209 1.00 7.62  ? 33   ARG A NH2   1 
ATOM   1708  N  N     . ALA B 2 33  ? 27.536  37.894  45.668 1.00 8.01  ? 34   ALA A N     1 
ATOM   1709  C  CA    . ALA B 2 33  ? 28.321  38.507  44.620 1.00 8.21  ? 34   ALA A CA    1 
ATOM   1710  C  C     . ALA B 2 33  ? 29.492  37.736  44.008 1.00 8.14  ? 34   ALA A C     1 
ATOM   1711  O  O     . ALA B 2 33  ? 29.900  38.028  42.908 1.00 8.64  ? 34   ALA A O     1 
ATOM   1712  C  CB    . ALA B 2 33  ? 28.788  39.858  45.081 1.00 7.64  ? 34   ALA A CB    1 
ATOM   1713  N  N     . LEU B 2 34  ? 30.022  36.762  44.708 1.00 7.36  ? 35   LEU A N     1 
ATOM   1714  C  CA    . LEU B 2 34  ? 31.165  36.020  44.194 1.00 7.61  ? 35   LEU A CA    1 
ATOM   1715  C  C     . LEU B 2 34  ? 30.823  34.609  43.718 1.00 7.79  ? 35   LEU A C     1 
ATOM   1716  O  O     . LEU B 2 34  ? 30.034  33.903  44.364 1.00 7.53  ? 35   LEU A O     1 
ATOM   1717  C  CB    . LEU B 2 34  ? 32.302  35.982  45.238 1.00 7.73  ? 35   LEU A CB    1 
ATOM   1718  C  CG    . LEU B 2 34  ? 32.886  37.335  45.718 1.00 7.53  ? 35   LEU A CG    1 
ATOM   1719  C  CD1   . LEU B 2 34  ? 33.884  37.131  46.833 1.00 7.49  ? 35   LEU A CD1   1 
ATOM   1720  C  CD2   . LEU B 2 34  ? 33.531  38.107  44.581 1.00 7.63  ? 35   LEU A CD2   1 
ATOM   1721  N  N     . PRO B 2 35  ? 31.377  34.205  42.553 1.00 8.09  ? 36   PRO A N     1 
ATOM   1722  C  CA    . PRO B 2 35  ? 31.158  32.871  41.999 1.00 8.43  ? 36   PRO A CA    1 
ATOM   1723  C  C     . PRO B 2 35  ? 32.080  31.833  42.619 1.00 8.80  ? 36   PRO A C     1 
ATOM   1724  O  O     . PRO B 2 35  ? 33.176  32.173  43.068 1.00 8.90  ? 36   PRO A O     1 
ATOM   1725  C  CB    . PRO B 2 35  ? 31.532  33.050  40.534 1.00 8.09  ? 36   PRO A CB    1 
ATOM   1726  C  CG    . PRO B 2 35  ? 32.595  34.088  40.564 1.00 8.26  ? 36   PRO A CG    1 
ATOM   1727  C  CD    . PRO B 2 35  ? 32.212  35.033  41.668 1.00 8.17  ? 36   PRO A CD    1 
ATOM   1728  N  N     . ASP B 2 36  ? 31.634  30.581  42.644 1.00 9.15  ? 37   ASP A N     1 
ATOM   1729  C  CA    . ASP B 2 36  ? 32.442  29.490  43.175 1.00 9.43  ? 37   ASP A CA    1 
ATOM   1730  C  C     . ASP B 2 36  ? 33.382  29.003  42.076 1.00 9.63  ? 37   ASP A C     1 
ATOM   1731  O  O     . ASP B 2 36  ? 32.975  28.871  40.923 1.00 10.21 ? 37   ASP A O     1 
ATOM   1732  C  CB    . ASP B 2 36  ? 31.546  28.368  43.681 1.00 9.11  ? 37   ASP A CB    1 
ATOM   1733  C  CG    . ASP B 2 36  ? 32.318  27.277  44.397 1.00 9.18  ? 37   ASP A CG    1 
ATOM   1734  O  OD1   . ASP B 2 36  ? 33.200  26.637  43.778 1.00 8.97  ? 37   ASP A OD1   1 
ATOM   1735  O  OD2   . ASP B 2 36  ? 32.031  27.072  45.587 1.00 9.03  ? 37   ASP A OD2   1 
ATOM   1736  N  N     . VAL B 2 37  ? 34.642  28.779  42.412 1.00 9.58  ? 38   VAL A N     1 
ATOM   1737  C  CA    . VAL B 2 37  ? 35.617  28.349  41.415 1.00 9.94  ? 38   VAL A CA    1 
ATOM   1738  C  C     . VAL B 2 37  ? 35.306  27.018  40.723 1.00 9.92  ? 38   VAL A C     1 
ATOM   1739  O  O     . VAL B 2 37  ? 35.739  26.793  39.605 1.00 10.20 ? 38   VAL A O     1 
ATOM   1740  C  CB    . VAL B 2 37  ? 37.045  28.328  41.995 1.00 9.67  ? 38   VAL A CB    1 
ATOM   1741  C  CG1   . VAL B 2 37  ? 37.222  27.153  42.944 1.00 10.23 ? 38   VAL A CG1   1 
ATOM   1742  C  CG2   . VAL B 2 37  ? 38.075  28.280  40.888 1.00 9.82  ? 38   VAL A CG2   1 
ATOM   1743  N  N     . ARG B 2 38  ? 34.552  26.152  41.385 1.00 9.70  ? 39   ARG A N     1 
ATOM   1744  C  CA    . ARG B 2 38  ? 34.218  24.832  40.847 1.00 9.51  ? 39   ARG A CA    1 
ATOM   1745  C  C     . ARG B 2 38  ? 33.191  24.848  39.706 1.00 9.34  ? 39   ARG A C     1 
ATOM   1746  O  O     . ARG B 2 38  ? 33.453  24.275  38.643 1.00 8.82  ? 39   ARG A O     1 
ATOM   1747  C  CB    . ARG B 2 38  ? 33.791  23.901  41.981 1.00 9.54  ? 39   ARG A CB    1 
ATOM   1748  C  CG    . ARG B 2 38  ? 34.913  23.635  42.991 1.00 9.78  ? 39   ARG A CG    1 
ATOM   1749  C  CD    . ARG B 2 38  ? 34.376  23.025  44.281 1.00 9.79  ? 39   ARG A CD    1 
ATOM   1750  N  NE    . ARG B 2 38  ? 33.543  23.975  45.030 1.00 9.89  ? 39   ARG A NE    1 
ATOM   1751  C  CZ    . ARG B 2 38  ? 32.808  23.658  46.093 1.00 10.13 ? 39   ARG A CZ    1 
ATOM   1752  N  NH1   . ARG B 2 38  ? 32.770  22.396  46.541 1.00 10.06 ? 39   ARG A NH1   1 
ATOM   1753  N  NH2   . ARG B 2 38  ? 32.093  24.596  46.703 1.00 10.28 ? 39   ARG A NH2   1 
ATOM   1754  N  N     . ASP B 2 39  ? 32.052  25.518  39.911 1.00 9.19  ? 40   ASP A N     1 
ATOM   1755  C  CA    . ASP B 2 39  ? 30.996  25.554  38.893 1.00 9.11  ? 40   ASP A CA    1 
ATOM   1756  C  C     . ASP B 2 39  ? 30.781  26.910  38.220 1.00 9.31  ? 40   ASP A C     1 
ATOM   1757  O  O     . ASP B 2 39  ? 29.954  27.020  37.303 1.00 9.59  ? 40   ASP A O     1 
ATOM   1758  C  CB    . ASP B 2 39  ? 29.672  25.011  39.447 1.00 8.81  ? 40   ASP A CB    1 
ATOM   1759  C  CG    . ASP B 2 39  ? 29.129  25.829  40.615 1.00 9.02  ? 40   ASP A CG    1 
ATOM   1760  O  OD1   . ASP B 2 39  ? 29.772  26.823  41.026 1.00 9.61  ? 40   ASP A OD1   1 
ATOM   1761  O  OD2   . ASP B 2 39  ? 28.048  25.463  41.127 1.00 8.87  ? 40   ASP A OD2   1 
ATOM   1762  N  N     . GLY B 2 40  ? 31.520  27.924  38.676 1.00 8.81  ? 41   GLY A N     1 
ATOM   1763  C  CA    . GLY B 2 40  ? 31.445  29.286  38.129 1.00 8.94  ? 41   GLY A CA    1 
ATOM   1764  C  C     . GLY B 2 40  ? 30.142  30.032  38.385 1.00 9.29  ? 41   GLY A C     1 
ATOM   1765  O  O     . GLY B 2 40  ? 29.797  30.956  37.652 1.00 8.72  ? 41   GLY A O     1 
ATOM   1766  N  N     . LEU B 2 41  ? 29.431  29.657  39.444 1.00 9.86  ? 42   LEU A N     1 
ATOM   1767  C  CA    . LEU B 2 41  ? 28.129  30.246  39.717 1.00 10.36 ? 42   LEU A CA    1 
ATOM   1768  C  C     . LEU B 2 41  ? 27.989  30.947  41.067 1.00 10.49 ? 42   LEU A C     1 
ATOM   1769  O  O     . LEU B 2 41  ? 28.654  30.599  42.041 1.00 10.98 ? 42   LEU A O     1 
ATOM   1770  C  CB    . LEU B 2 41  ? 27.045  29.168  39.605 1.00 10.55 ? 42   LEU A CB    1 
ATOM   1771  C  CG    . LEU B 2 41  ? 26.966  28.351  38.304 1.00 10.67 ? 42   LEU A CG    1 
ATOM   1772  C  CD1   . LEU B 2 41  ? 26.001  27.183  38.467 1.00 10.75 ? 42   LEU A CD1   1 
ATOM   1773  C  CD2   . LEU B 2 41  ? 26.592  29.216  37.090 1.00 10.89 ? 42   LEU A CD2   1 
ATOM   1774  N  N     . LYS B 2 42  ? 27.084  31.903  41.096 1.00 9.70  ? 43   LYS A N     1 
ATOM   1775  C  CA    . LYS B 2 42  ? 26.751  32.605  42.291 1.00 10.03 ? 43   LYS A CA    1 
ATOM   1776  C  C     . LYS B 2 42  ? 25.510  31.882  42.770 1.00 9.83  ? 43   LYS A C     1 
ATOM   1777  O  O     . LYS B 2 42  ? 24.853  31.221  41.973 1.00 9.63  ? 43   LYS A O     1 
ATOM   1778  C  CB    . LYS B 2 42  ? 26.432  34.065  41.981 1.00 10.10 ? 43   LYS A CB    1 
ATOM   1779  C  CG    . LYS B 2 42  ? 27.609  34.871  41.454 1.00 9.18  ? 43   LYS A CG    1 
ATOM   1780  C  CD    . LYS B 2 42  ? 27.168  36.242  41.037 1.00 9.18  ? 43   LYS A CD    1 
ATOM   1781  C  CE    . LYS B 2 42  ? 28.233  36.948  40.229 1.00 9.06  ? 43   LYS A CE    1 
ATOM   1782  N  NZ    . LYS B 2 42  ? 27.864  38.403  40.033 1.00 9.62  ? 43   LYS A NZ    1 
ATOM   1783  N  N     . PRO B 2 43  ? 25.201  31.994  44.120 1.00 9.42  ? 44   PRO A N     1 
ATOM   1784  C  CA    . PRO B 2 43  ? 23.974  31.278  44.523 1.00 9.29  ? 44   PRO A CA    1 
ATOM   1785  C  C     . PRO B 2 43  ? 22.727  31.519  43.692 1.00 9.32  ? 44   PRO A C     1 
ATOM   1786  O  O     . PRO B 2 43  ? 22.048  30.556  43.389 1.00 10.18 ? 44   PRO A O     1 
ATOM   1787  C  CB    . PRO B 2 43  ? 23.728  31.802  45.936 1.00 9.32  ? 44   PRO A CB    1 
ATOM   1788  C  CG    . PRO B 2 43  ? 25.078  31.963  46.493 1.00 8.72  ? 44   PRO A CG    1 
ATOM   1789  C  CD    . PRO B 2 43  ? 25.828  32.602  45.369 1.00 9.22  ? 44   PRO A CD    1 
ATOM   1790  N  N     . VAL B 2 44  ? 22.425  32.764  43.346 1.00 8.75  ? 45   VAL A N     1 
ATOM   1791  C  CA    . VAL B 2 44  ? 21.211  33.051  42.555 1.00 8.51  ? 45   VAL A CA    1 
ATOM   1792  C  C     . VAL B 2 44  ? 21.095  32.180  41.293 1.00 8.49  ? 45   VAL A C     1 
ATOM   1793  O  O     . VAL B 2 44  ? 20.054  31.573  41.049 1.00 9.32  ? 45   VAL A O     1 
ATOM   1794  C  CB    . VAL B 2 44  ? 21.024  34.587  42.247 1.00 8.34  ? 45   VAL A CB    1 
ATOM   1795  C  CG1   . VAL B 2 44  ? 22.120  35.120  41.322 1.00 7.98  ? 45   VAL A CG1   1 
ATOM   1796  C  CG2   . VAL B 2 44  ? 19.646  34.860  41.655 1.00 8.04  ? 45   VAL A CG2   1 
ATOM   1797  N  N     . HIS B 2 45  ? 22.166  32.098  40.515 1.00 8.81  ? 46   HIS A N     1 
ATOM   1798  C  CA    . HIS B 2 45  ? 22.166  31.324  39.266 1.00 8.47  ? 46   HIS A CA    1 
ATOM   1799  C  C     . HIS B 2 45  ? 22.137  29.822  39.491 1.00 8.04  ? 46   HIS A C     1 
ATOM   1800  O  O     . HIS B 2 45  ? 21.529  29.091  38.704 1.00 8.06  ? 46   HIS A O     1 
ATOM   1801  C  CB    . HIS B 2 45  ? 23.382  31.688  38.412 1.00 8.94  ? 46   HIS A CB    1 
ATOM   1802  C  CG    . HIS B 2 45  ? 23.500  33.154  38.134 1.00 9.33  ? 46   HIS A CG    1 
ATOM   1803  N  ND1   . HIS B 2 45  ? 24.348  33.977  38.840 1.00 9.91  ? 46   HIS A ND1   1 
ATOM   1804  C  CD2   . HIS B 2 45  ? 22.865  33.945  37.238 1.00 9.35  ? 46   HIS A CD2   1 
ATOM   1805  C  CE1   . HIS B 2 45  ? 24.243  35.209  38.381 1.00 10.03 ? 46   HIS A CE1   1 
ATOM   1806  N  NE2   . HIS B 2 45  ? 23.343  35.217  37.410 1.00 9.99  ? 46   HIS A NE2   1 
ATOM   1807  N  N     . ARG B 2 46  ? 22.801  29.354  40.536 1.00 7.74  ? 47   ARG A N     1 
ATOM   1808  C  CA    . ARG B 2 46  ? 22.823  27.932  40.819 1.00 7.73  ? 47   ARG A CA    1 
ATOM   1809  C  C     . ARG B 2 46  ? 21.420  27.477  41.200 1.00 8.04  ? 47   ARG A C     1 
ATOM   1810  O  O     . ARG B 2 46  ? 20.963  26.419  40.787 1.00 8.51  ? 47   ARG A O     1 
ATOM   1811  C  CB    . ARG B 2 46  ? 23.823  27.610  41.936 1.00 7.21  ? 47   ARG A CB    1 
ATOM   1812  C  CG    . ARG B 2 46  ? 24.136  26.134  42.073 1.00 6.71  ? 47   ARG A CG    1 
ATOM   1813  C  CD    . ARG B 2 46  ? 25.051  25.826  43.241 1.00 6.53  ? 47   ARG A CD    1 
ATOM   1814  N  NE    . ARG B 2 46  ? 26.411  26.312  43.055 1.00 6.25  ? 47   ARG A NE    1 
ATOM   1815  C  CZ    . ARG B 2 46  ? 26.906  27.406  43.624 1.00 6.03  ? 47   ARG A CZ    1 
ATOM   1816  N  NH1   . ARG B 2 46  ? 26.162  28.136  44.431 1.00 5.63  ? 47   ARG A NH1   1 
ATOM   1817  N  NH2   . ARG B 2 46  ? 28.151  27.761  43.396 1.00 5.66  ? 47   ARG A NH2   1 
ATOM   1818  N  N     . ARG B 2 47  ? 20.748  28.301  41.990 1.00 8.23  ? 48   ARG A N     1 
ATOM   1819  C  CA    . ARG B 2 47  ? 19.405  28.018  42.444 1.00 8.08  ? 48   ARG A CA    1 
ATOM   1820  C  C     . ARG B 2 47  ? 18.421  28.031  41.284 1.00 8.21  ? 48   ARG A C     1 
ATOM   1821  O  O     . ARG B 2 47  ? 17.437  27.308  41.294 1.00 8.58  ? 48   ARG A O     1 
ATOM   1822  C  CB    . ARG B 2 47  ? 19.011  29.011  43.542 1.00 7.98  ? 48   ARG A CB    1 
ATOM   1823  C  CG    . ARG B 2 47  ? 19.851  28.855  44.793 1.00 7.78  ? 48   ARG A CG    1 
ATOM   1824  C  CD    . ARG B 2 47  ? 19.676  29.961  45.809 1.00 7.48  ? 48   ARG A CD    1 
ATOM   1825  N  NE    . ARG B 2 47  ? 20.373  29.615  47.041 1.00 7.26  ? 48   ARG A NE    1 
ATOM   1826  C  CZ    . ARG B 2 47  ? 20.487  30.391  48.110 1.00 7.33  ? 48   ARG A CZ    1 
ATOM   1827  N  NH1   . ARG B 2 47  ? 19.959  31.602  48.135 1.00 7.45  ? 48   ARG A NH1   1 
ATOM   1828  N  NH2   . ARG B 2 47  ? 21.134  29.940  49.158 1.00 7.35  ? 48   ARG A NH2   1 
ATOM   1829  N  N     . ILE B 2 48  ? 18.703  28.850  40.279 1.00 7.85  ? 49   ILE A N     1 
ATOM   1830  C  CA    . ILE B 2 48  ? 17.846  28.932  39.101 1.00 8.07  ? 49   ILE A CA    1 
ATOM   1831  C  C     . ILE B 2 48  ? 17.959  27.637  38.294 1.00 9.08  ? 49   ILE A C     1 
ATOM   1832  O  O     . ILE B 2 48  ? 16.963  26.947  38.061 1.00 8.94  ? 49   ILE A O     1 
ATOM   1833  C  CB    . ILE B 2 48  ? 18.155  30.185  38.232 1.00 7.52  ? 49   ILE A CB    1 
ATOM   1834  C  CG1   . ILE B 2 48  ? 17.614  31.450  38.938 1.00 6.86  ? 49   ILE A CG1   1 
ATOM   1835  C  CG2   . ILE B 2 48  ? 17.524  30.050  36.844 1.00 7.45  ? 49   ILE A CG2   1 
ATOM   1836  C  CD1   . ILE B 2 48  ? 17.979  32.783  38.266 1.00 5.93  ? 49   ILE A CD1   1 
ATOM   1837  N  N     . LEU B 2 49  ? 19.180  27.292  37.903 1.00 10.43 ? 50   LEU A N     1 
ATOM   1838  C  CA    . LEU B 2 49  ? 19.449  26.084  37.135 1.00 11.91 ? 50   LEU A CA    1 
ATOM   1839  C  C     . LEU B 2 49  ? 18.939  24.828  37.832 1.00 12.96 ? 50   LEU A C     1 
ATOM   1840  O  O     . LEU B 2 49  ? 18.402  23.938  37.189 1.00 13.19 ? 50   LEU A O     1 
ATOM   1841  C  CB    . LEU B 2 49  ? 20.944  25.960  36.845 1.00 11.88 ? 50   LEU A CB    1 
ATOM   1842  C  CG    . LEU B 2 49  ? 21.568  27.175  36.160 1.00 11.38 ? 50   LEU A CG    1 
ATOM   1843  C  CD1   . LEU B 2 49  ? 23.059  26.971  35.970 1.00 11.67 ? 50   LEU A CD1   1 
ATOM   1844  C  CD2   . LEU B 2 49  ? 20.886  27.485  34.842 1.00 11.20 ? 50   LEU A CD2   1 
ATOM   1845  N  N     . TYR B 2 50  ? 19.106  24.769  39.146 1.00 14.26 ? 51   TYR A N     1 
ATOM   1846  C  CA    . TYR B 2 50  ? 18.631  23.625  39.930 1.00 15.02 ? 51   TYR A CA    1 
ATOM   1847  C  C     . TYR B 2 50  ? 17.108  23.521  39.906 1.00 16.74 ? 51   TYR A C     1 
ATOM   1848  O  O     . TYR B 2 50  ? 16.557  22.424  39.797 1.00 18.08 ? 51   TYR A O     1 
ATOM   1849  C  CB    . TYR B 2 50  ? 19.155  23.675  41.374 1.00 15.15 ? 51   TYR A CB    1 
ATOM   1850  C  CG    . TYR B 2 50  ? 18.720  22.503  42.232 1.00 14.72 ? 51   TYR A CG    1 
ATOM   1851  C  CD1   . TYR B 2 50  ? 19.166  21.205  41.956 1.00 14.54 ? 51   TYR A CD1   1 
ATOM   1852  C  CD2   . TYR B 2 50  ? 17.885  22.694  43.334 1.00 15.24 ? 51   TYR A CD2   1 
ATOM   1853  C  CE1   . TYR B 2 50  ? 18.768  20.119  42.740 1.00 14.43 ? 51   TYR A CE1   1 
ATOM   1854  C  CE2   . TYR B 2 50  ? 17.485  21.612  44.133 1.00 15.12 ? 51   TYR A CE2   1 
ATOM   1855  C  CZ    . TYR B 2 50  ? 17.936  20.334  43.827 1.00 14.55 ? 51   TYR A CZ    1 
ATOM   1856  O  OH    . TYR B 2 50  ? 17.557  19.271  44.603 1.00 16.22 ? 51   TYR A OH    1 
ATOM   1857  N  N     . GLY B 2 51  ? 16.440  24.666  39.986 1.00 16.86 ? 52   GLY A N     1 
ATOM   1858  C  CA    . GLY B 2 51  ? 14.994  24.720  39.941 1.00 16.76 ? 52   GLY A CA    1 
ATOM   1859  C  C     . GLY B 2 51  ? 14.486  24.214  38.607 1.00 17.67 ? 52   GLY A C     1 
ATOM   1860  O  O     . GLY B 2 51  ? 13.487  23.516  38.545 1.00 18.50 ? 52   GLY A O     1 
ATOM   1861  N  N     . LEU B 2 52  ? 15.183  24.569  37.537 1.00 17.25 ? 53   LEU A N     1 
ATOM   1862  C  CA    . LEU B 2 52  ? 14.829  24.130  36.195 1.00 18.90 ? 53   LEU A CA    1 
ATOM   1863  C  C     . LEU B 2 52  ? 15.016  22.624  36.034 1.00 20.19 ? 53   LEU A C     1 
ATOM   1864  O  O     . LEU B 2 52  ? 14.294  21.981  35.280 1.00 20.33 ? 53   LEU A O     1 
ATOM   1865  C  CB    . LEU B 2 52  ? 15.662  24.857  35.136 1.00 16.35 ? 53   LEU A CB    1 
ATOM   1866  C  CG    . LEU B 2 52  ? 15.629  26.379  35.079 1.00 17.13 ? 53   LEU A CG    1 
ATOM   1867  C  CD1   . LEU B 2 52  ? 16.559  26.894  33.998 1.00 15.10 ? 53   LEU A CD1   1 
ATOM   1868  C  CD2   . LEU B 2 52  ? 14.218  26.907  34.867 1.00 16.97 ? 53   LEU A CD2   1 
ATOM   1869  N  N     . ASN B 2 53  ? 15.993  22.076  36.748 1.00 19.42 ? 54   ASN A N     1 
ATOM   1870  C  CA    . ASN B 2 53  ? 16.267  20.656  36.674 1.00 21.58 ? 54   ASN A CA    1 
ATOM   1871  C  C     . ASN B 2 53  ? 15.254  19.817  37.456 1.00 22.80 ? 54   ASN A C     1 
ATOM   1872  O  O     . ASN B 2 53  ? 14.839  18.769  37.000 1.00 20.55 ? 54   ASN A O     1 
ATOM   1873  C  CB    . ASN B 2 53  ? 17.693  20.364  37.137 1.00 21.18 ? 54   ASN A CB    1 
ATOM   1874  C  CG    . ASN B 2 53  ? 18.200  19.025  36.648 1.00 21.74 ? 54   ASN A CG    1 
ATOM   1875  O  OD1   . ASN B 2 53  ? 18.599  18.178  37.439 1.00 21.14 ? 54   ASN A OD1   1 
ATOM   1876  N  ND2   . ASN B 2 53  ? 18.179  18.828  35.341 1.00 21.19 ? 54   ASN A ND2   1 
ATOM   1877  N  N     . GLU B 2 54  ? 14.853  20.316  38.617 1.00 26.24 ? 55   GLU A N     1 
ATOM   1878  C  CA    . GLU B 2 54  ? 13.897  19.632  39.469 1.00 29.50 ? 55   GLU A CA    1 
ATOM   1879  C  C     . GLU B 2 54  ? 12.500  19.529  38.865 1.00 28.38 ? 55   GLU A C     1 
ATOM   1880  O  O     . GLU B 2 54  ? 11.745  18.633  39.210 1.00 27.93 ? 55   GLU A O     1 
ATOM   1881  C  CB    . GLU B 2 54  ? 13.823  20.325  40.824 1.00 31.45 ? 55   GLU A CB    1 
ATOM   1882  C  CG    . GLU B 2 54  ? 15.055  20.111  41.673 1.00 32.60 ? 55   GLU A CG    1 
ATOM   1883  C  CD    . GLU B 2 54  ? 15.278  18.647  41.991 1.00 36.84 ? 55   GLU A CD    1 
ATOM   1884  O  OE1   . GLU B 2 54  ? 14.550  18.115  42.855 1.00 34.45 ? 55   GLU A OE1   1 
ATOM   1885  O  OE2   . GLU B 2 54  ? 16.182  18.042  41.384 1.00 37.51 ? 55   GLU A OE2   1 
ATOM   1886  N  N     . GLN B 2 55  ? 12.159  20.442  37.967 1.00 26.56 ? 56   GLN A N     1 
ATOM   1887  C  CA    . GLN B 2 55  ? 10.851  20.430  37.344 1.00 27.53 ? 56   GLN A CA    1 
ATOM   1888  C  C     . GLN B 2 55  ? 10.878  19.828  35.949 1.00 27.30 ? 56   GLN A C     1 
ATOM   1889  O  O     . GLN B 2 55  ? 9.890   19.858  35.234 1.00 27.66 ? 56   GLN A O     1 
ATOM   1890  C  CB    . GLN B 2 55  ? 10.276  21.839  37.288 1.00 28.95 ? 56   GLN A CB    1 
ATOM   1891  C  CG    . GLN B 2 55  ? 10.214  22.516  38.639 1.00 32.14 ? 56   GLN A CG    1 
ATOM   1892  C  CD    . GLN B 2 55  ? 9.572   21.627  39.687 1.00 34.14 ? 56   GLN A CD    1 
ATOM   1893  O  OE1   . GLN B 2 55  ? 8.579   20.947  39.417 1.00 31.61 ? 56   GLN A OE1   1 
ATOM   1894  N  NE2   . GLN B 2 55  ? 10.139  21.623  40.883 1.00 35.88 ? 56   GLN A NE2   1 
ATOM   1895  N  N     . GLY B 2 56  ? 12.027  19.281  35.579 1.00 25.77 ? 57   GLY A N     1 
ATOM   1896  C  CA    . GLY B 2 56  ? 12.222  18.672  34.270 1.00 25.39 ? 57   GLY A CA    1 
ATOM   1897  C  C     . GLY B 2 56  ? 12.108  19.666  33.130 1.00 26.30 ? 57   GLY A C     1 
ATOM   1898  O  O     . GLY B 2 56  ? 11.489  19.379  32.106 1.00 26.33 ? 57   GLY A O     1 
ATOM   1899  N  N     . MET B 2 57  ? 12.684  20.846  33.304 1.00 28.60 ? 58   MET A N     1 
ATOM   1900  C  CA    . MET B 2 57  ? 12.615  21.870  32.275 1.00 27.46 ? 58   MET A CA    1 
ATOM   1901  C  C     . MET B 2 57  ? 13.781  21.735  31.307 1.00 30.09 ? 58   MET A C     1 
ATOM   1902  O  O     . MET B 2 57  ? 14.527  22.673  31.058 1.00 26.82 ? 58   MET A O     1 
ATOM   1903  C  CB    . MET B 2 57  ? 12.570  23.246  32.911 1.00 27.68 ? 58   MET A CB    1 
ATOM   1904  C  CG    . MET B 2 57  ? 11.386  23.403  33.850 1.00 27.66 ? 58   MET A CG    1 
ATOM   1905  S  SD    . MET B 2 57  ? 11.211  25.070  34.486 1.00 29.38 ? 58   MET A SD    1 
ATOM   1906  C  CE    . MET B 2 57  ? 9.617   24.980  35.276 1.00 26.81 ? 58   MET A CE    1 
ATOM   1907  N  N     . THR B 2 58  ? 13.913  20.525  30.777 1.00 29.92 ? 59   THR A N     1 
ATOM   1908  C  CA    . THR B 2 58  ? 14.947  20.142  29.840 1.00 28.06 ? 59   THR A CA    1 
ATOM   1909  C  C     . THR B 2 58  ? 14.794  20.656  28.403 1.00 28.72 ? 59   THR A C     1 
ATOM   1910  O  O     . THR B 2 58  ? 13.697  21.030  27.978 1.00 30.87 ? 59   THR A O     1 
ATOM   1911  C  CB    . THR B 2 58  ? 15.128  18.621  29.863 1.00 29.07 ? 59   THR A CB    1 
ATOM   1912  O  OG1   . THR B 2 58  ? 13.869  17.988  29.642 1.00 27.33 ? 59   THR A OG1   1 
ATOM   1913  C  CG2   . THR B 2 58  ? 15.653  18.194  31.216 1.00 29.14 ? 59   THR A CG2   1 
ATOM   1914  N  N     . PRO B 2 59  ? 15.960  20.676  27.644 1.00 28.34 ? 60   PRO A N     1 
ATOM   1915  C  CA    . PRO B 2 59  ? 15.786  21.201  26.269 1.00 30.70 ? 60   PRO A CA    1 
ATOM   1916  C  C     . PRO B 2 59  ? 14.718  20.534  25.383 1.00 28.92 ? 60   PRO A C     1 
ATOM   1917  O  O     . PRO B 2 59  ? 14.106  21.230  24.585 1.00 28.52 ? 60   PRO A O     1 
ATOM   1918  C  CB    . PRO B 2 59  ? 17.181  21.026  25.647 1.00 28.94 ? 60   PRO A CB    1 
ATOM   1919  C  CG    . PRO B 2 59  ? 18.107  21.139  26.790 1.00 29.38 ? 60   PRO A CG    1 
ATOM   1920  C  CD    . PRO B 2 59  ? 17.423  20.318  27.832 1.00 27.24 ? 60   PRO A CD    1 
ATOM   1921  N  N     . ASP B 2 60  ? 14.517  19.227  25.511 1.00 28.47 ? 61   ASP A N     1 
ATOM   1922  C  CA    . ASP B 2 60  ? 13.501  18.488  24.744 1.00 29.72 ? 61   ASP A CA    1 
ATOM   1923  C  C     . ASP B 2 60  ? 12.051  18.813  25.144 1.00 29.64 ? 61   ASP A C     1 
ATOM   1924  O  O     . ASP B 2 60  ? 11.121  18.514  24.396 1.00 28.81 ? 61   ASP A O     1 
ATOM   1925  C  CB    . ASP B 2 60  ? 13.747  16.974  24.815 1.00 29.31 ? 61   ASP A CB    1 
ATOM   1926  C  CG    . ASP B 2 60  ? 13.745  16.435  26.235 1.00 34.56 ? 61   ASP A CG    1 
ATOM   1927  O  OD1   . ASP B 2 60  ? 14.017  17.205  27.182 1.00 34.55 ? 61   ASP A OD1   1 
ATOM   1928  O  OD2   . ASP B 2 60  ? 13.473  15.225  26.415 1.00 37.99 ? 61   ASP A OD2   1 
ATOM   1929  N  N     . LYS B 2 61  ? 11.868  19.413  26.320 1.00 29.03 ? 62   LYS A N     1 
ATOM   1930  C  CA    . LYS B 2 61  ? 10.533  19.774  26.792 1.00 30.43 ? 62   LYS A CA    1 
ATOM   1931  C  C     . LYS B 2 61  ? 10.146  21.169  26.317 1.00 30.83 ? 62   LYS A C     1 
ATOM   1932  O  O     . LYS B 2 61  ? 11.012  21.942  25.890 1.00 32.52 ? 62   LYS A O     1 
ATOM   1933  C  CB    . LYS B 2 61  ? 10.460  19.687  28.321 1.00 31.23 ? 62   LYS A CB    1 
ATOM   1934  C  CG    . LYS B 2 61  ? 10.774  18.307  28.890 1.00 33.74 ? 62   LYS A CG    1 
ATOM   1935  C  CD    . LYS B 2 61  ? 9.822   17.233  28.357 1.00 34.38 ? 62   LYS A CD    1 
ATOM   1936  C  CE    . LYS B 2 61  ? 10.223  15.856  28.868 1.00 39.04 ? 62   LYS A CE    1 
ATOM   1937  N  NZ    . LYS B 2 61  ? 10.140  15.832  30.362 1.00 37.86 ? 62   LYS A NZ    1 
ATOM   1938  N  N     . SER B 2 62  ? 8.856   21.500  26.382 1.00 29.32 ? 63   SER A N     1 
ATOM   1939  C  CA    . SER B 2 62  ? 8.413   22.828  25.962 1.00 30.38 ? 63   SER A CA    1 
ATOM   1940  C  C     . SER B 2 62  ? 8.854   23.886  26.975 1.00 29.32 ? 63   SER A C     1 
ATOM   1941  O  O     . SER B 2 62  ? 9.230   23.562  28.110 1.00 29.36 ? 63   SER A O     1 
ATOM   1942  C  CB    . SER B 2 62  ? 6.893   22.887  25.747 1.00 30.36 ? 63   SER A CB    1 
ATOM   1943  O  OG    . SER B 2 62  ? 6.195   22.757  26.976 1.00 32.06 ? 63   SER A OG    1 
ATOM   1944  N  N     . TYR B 2 63  ? 8.825   25.145  26.539 1.00 27.67 ? 64   TYR A N     1 
ATOM   1945  C  CA    . TYR B 2 63  ? 9.170   26.275  27.392 1.00 23.82 ? 64   TYR A CA    1 
ATOM   1946  C  C     . TYR B 2 63  ? 8.178   26.366  28.545 1.00 23.71 ? 64   TYR A C     1 
ATOM   1947  O  O     . TYR B 2 63  ? 6.980   26.114  28.370 1.00 21.71 ? 64   TYR A O     1 
ATOM   1948  C  CB    . TYR B 2 63  ? 9.146   27.579  26.596 1.00 22.09 ? 64   TYR A CB    1 
ATOM   1949  C  CG    . TYR B 2 63  ? 10.225  27.703  25.553 1.00 21.17 ? 64   TYR A CG    1 
ATOM   1950  C  CD1   . TYR B 2 63  ? 11.484  28.189  25.898 1.00 20.12 ? 64   TYR A CD1   1 
ATOM   1951  C  CD2   . TYR B 2 63  ? 9.994   27.361  24.224 1.00 20.05 ? 64   TYR A CD2   1 
ATOM   1952  C  CE1   . TYR B 2 63  ? 12.481  28.317  24.959 1.00 18.78 ? 64   TYR A CE1   1 
ATOM   1953  C  CE2   . TYR B 2 63  ? 10.994  27.485  23.271 1.00 19.47 ? 64   TYR A CE2   1 
ATOM   1954  C  CZ    . TYR B 2 63  ? 12.239  27.963  23.651 1.00 18.94 ? 64   TYR A CZ    1 
ATOM   1955  O  OH    . TYR B 2 63  ? 13.251  28.089  22.736 1.00 17.41 ? 64   TYR A OH    1 
ATOM   1956  N  N     . LYS B 2 64  ? 8.685   26.718  29.721 1.00 22.65 ? 65   LYS A N     1 
ATOM   1957  C  CA    . LYS B 2 64  ? 7.847   26.873  30.902 1.00 22.33 ? 65   LYS A CA    1 
ATOM   1958  C  C     . LYS B 2 64  ? 7.802   28.347  31.295 1.00 20.42 ? 65   LYS A C     1 
ATOM   1959  O  O     . LYS B 2 64  ? 8.760   29.078  31.082 1.00 20.03 ? 65   LYS A O     1 
ATOM   1960  C  CB    . LYS B 2 64  ? 8.365   26.007  32.054 1.00 24.30 ? 65   LYS A CB    1 
ATOM   1961  C  CG    . LYS B 2 64  ? 8.582   24.520  31.696 1.00 26.11 ? 65   LYS A CG    1 
ATOM   1962  C  CD    . LYS B 2 64  ? 7.303   23.817  31.215 1.00 27.43 ? 65   LYS A CD    1 
ATOM   1963  C  CE    . LYS B 2 64  ? 7.593   22.362  30.841 1.00 28.98 ? 65   LYS A CE    1 
ATOM   1964  N  NZ    . LYS B 2 64  ? 6.414   21.664  30.264 1.00 27.81 ? 65   LYS A NZ    1 
ATOM   1965  N  N     . LYS B 2 65  ? 6.682   28.759  31.825 1.00 19.54 ? 66   LYS A N     1 
ATOM   1966  C  CA    . LYS B 2 65  ? 6.455   30.120  32.206 1.00 20.14 ? 66   LYS A CA    1 
ATOM   1967  C  C     . LYS B 2 65  ? 7.447   30.664  33.166 1.00 20.74 ? 66   LYS A C     1 
ATOM   1968  O  O     . LYS B 2 65  ? 7.710   30.058  34.165 1.00 23.22 ? 66   LYS A O     1 
ATOM   1969  C  CB    . LYS B 2 65  ? 5.066   30.272  32.771 1.00 20.21 ? 66   LYS A CB    1 
ATOM   1970  C  CG    . LYS B 2 65  ? 3.960   29.964  31.781 1.00 21.97 ? 66   LYS A CG    1 
ATOM   1971  C  CD    . LYS B 2 65  ? 3.702   31.205  30.926 1.00 25.59 ? 66   LYS A CD    1 
ATOM   1972  C  CE    . LYS B 2 65  ? 2.500   31.117  29.984 1.00 25.55 ? 66   LYS A CE    1 
ATOM   1973  N  NZ    . LYS B 2 65  ? 2.307   29.778  29.372 1.00 23.68 ? 66   LYS A NZ    1 
ATOM   1974  N  N     . SER B 2 66  ? 8.003   31.829  32.840 1.00 17.70 ? 67   SER A N     1 
ATOM   1975  C  CA    . SER B 2 66  ? 8.975   32.516  33.638 1.00 16.91 ? 67   SER A CA    1 
ATOM   1976  C  C     . SER B 2 66  ? 8.502   32.827  35.049 1.00 16.35 ? 67   SER A C     1 
ATOM   1977  O  O     . SER B 2 66  ? 9.210   32.642  35.985 1.00 16.26 ? 67   SER A O     1 
ATOM   1978  C  CB    . SER B 2 66  ? 9.389   33.808  32.943 1.00 17.44 ? 67   SER A CB    1 
ATOM   1979  O  OG    . SER B 2 66  ? 10.348  33.637  31.972 1.00 16.39 ? 67   SER A OG    1 
ATOM   1980  N  N     . ALA B 2 67  ? 7.282   33.309  35.174 1.00 16.08 ? 68   ALA A N     1 
ATOM   1981  C  CA    . ALA B 2 67  ? 6.724   33.597  36.456 1.00 17.42 ? 68   ALA A CA    1 
ATOM   1982  C  C     . ALA B 2 67  ? 6.715   32.376  37.371 1.00 18.39 ? 68   ALA A C     1 
ATOM   1983  O  O     . ALA B 2 67  ? 7.043   32.469  38.514 1.00 18.77 ? 68   ALA A O     1 
ATOM   1984  C  CB    . ALA B 2 67  ? 5.364   34.203  36.291 1.00 15.30 ? 68   ALA A CB    1 
ATOM   1985  N  N     A ARG B 2 68  ? 6.356   31.215  36.834 0.50 18.39 ? 69   ARG A N     1 
ATOM   1986  N  N     B ARG B 2 68  ? 6.385   31.249  36.755 0.50 18.48 ? 69   ARG A N     1 
ATOM   1987  C  CA    A ARG B 2 68  ? 6.350   29.986  37.628 0.50 19.24 ? 69   ARG A CA    1 
ATOM   1988  C  CA    B ARG B 2 68  ? 6.328   29.974  37.455 0.50 19.36 ? 69   ARG A CA    1 
ATOM   1989  C  C     A ARG B 2 68  ? 7.760   29.615  38.105 0.50 19.89 ? 69   ARG A C     1 
ATOM   1990  C  C     B ARG B 2 68  ? 7.692   29.556  38.004 0.50 19.97 ? 69   ARG A C     1 
ATOM   1991  O  O     A ARG B 2 68  ? 7.952   29.189  39.240 0.50 21.35 ? 69   ARG A O     1 
ATOM   1992  O  O     B ARG B 2 68  ? 7.801   29.126  39.148 0.50 21.42 ? 69   ARG A O     1 
ATOM   1993  C  CB    A ARG B 2 68  ? 5.708   28.835  36.846 0.50 18.63 ? 69   ARG A CB    1 
ATOM   1994  C  CB    B ARG B 2 68  ? 5.757   28.895  36.532 0.50 19.13 ? 69   ARG A CB    1 
ATOM   1995  C  CG    A ARG B 2 68  ? 4.226   29.123  36.466 0.50 18.71 ? 69   ARG A CG    1 
ATOM   1996  C  CG    B ARG B 2 68  ? 5.700   27.505  37.147 0.50 18.39 ? 69   ARG A CG    1 
ATOM   1997  C  CD    A ARG B 2 68  ? 3.266   27.968  36.129 0.50 17.54 ? 69   ARG A CD    1 
ATOM   1998  C  CD    B ARG B 2 68  ? 6.988   26.740  36.888 0.50 19.28 ? 69   ARG A CD    1 
ATOM   1999  N  NE    A ARG B 2 68  ? 3.317   26.855  37.082 0.50 16.71 ? 69   ARG A NE    1 
ATOM   2000  N  NE    B ARG B 2 68  ? 6.824   25.311  37.139 0.50 19.81 ? 69   ARG A NE    1 
ATOM   2001  C  CZ    A ARG B 2 68  ? 3.043   25.596  36.748 0.50 16.04 ? 69   ARG A CZ    1 
ATOM   2002  C  CZ    B ARG B 2 68  ? 6.327   24.452  36.252 0.50 19.89 ? 69   ARG A CZ    1 
ATOM   2003  N  NH1   A ARG B 2 68  ? 2.664   25.311  35.514 0.50 15.72 ? 69   ARG A NH1   1 
ATOM   2004  N  NH1   B ARG B 2 68  ? 6.214   23.152  36.545 0.50 18.75 ? 69   ARG A NH1   1 
ATOM   2005  N  NH2   A ARG B 2 68  ? 3.133   24.625  37.636 0.50 16.24 ? 69   ARG A NH2   1 
ATOM   2006  N  NH2   B ARG B 2 68  ? 5.948   24.900  35.064 0.50 19.55 ? 69   ARG A NH2   1 
ATOM   2007  N  N     . ILE B 2 69  ? 8.738   29.790  37.220 1.00 21.06 ? 70   ILE A N     1 
ATOM   2008  C  CA    . ILE B 2 69  ? 10.124  29.521  37.501 1.00 19.85 ? 70   ILE A CA    1 
ATOM   2009  C  C     . ILE B 2 69  ? 10.569  30.361  38.642 1.00 18.81 ? 70   ILE A C     1 
ATOM   2010  O  O     . ILE B 2 69  ? 11.024  29.818  39.569 1.00 19.40 ? 70   ILE A O     1 
ATOM   2011  C  CB    . ILE B 2 69  ? 11.034  29.784  36.279 1.00 19.24 ? 70   ILE A CB    1 
ATOM   2012  C  CG1   . ILE B 2 69  ? 10.763  28.775  35.212 1.00 19.64 ? 70   ILE A CG1   1 
ATOM   2013  C  CG2   . ILE B 2 69  ? 12.478  29.722  36.634 1.00 19.02 ? 70   ILE A CG2   1 
ATOM   2014  C  CD1   . ILE B 2 69  ? 11.324  29.153  33.878 1.00 17.88 ? 70   ILE A CD1   1 
ATOM   2015  N  N     . VAL B 2 70  ? 10.448  31.677  38.527 1.00 16.56 ? 71   VAL A N     1 
ATOM   2016  C  CA    . VAL B 2 70  ? 10.854  32.609  39.526 1.00 16.01 ? 71   VAL A CA    1 
ATOM   2017  C  C     . VAL B 2 70  ? 10.203  32.345  40.855 1.00 16.93 ? 71   VAL A C     1 
ATOM   2018  O  O     . VAL B 2 70  ? 10.831  32.456  41.843 1.00 19.58 ? 71   VAL A O     1 
ATOM   2019  C  CB    . VAL B 2 70  ? 10.631  34.069  39.079 1.00 14.92 ? 71   VAL A CB    1 
ATOM   2020  C  CG1   . VAL B 2 70  ? 11.017  35.046  40.143 1.00 13.66 ? 71   VAL A CG1   1 
ATOM   2021  C  CG2   . VAL B 2 70  ? 11.483  34.399  37.913 1.00 13.75 ? 71   VAL A CG2   1 
ATOM   2022  N  N     . GLY B 2 71  ? 8.941   31.980  40.849 1.00 17.30 ? 72   GLY A N     1 
ATOM   2023  C  CA    . GLY B 2 71  ? 8.163   31.719  42.018 1.00 17.28 ? 72   GLY A CA    1 
ATOM   2024  C  C     . GLY B 2 71  ? 8.481   30.483  42.787 1.00 18.56 ? 72   GLY A C     1 
ATOM   2025  O  O     . GLY B 2 71  ? 8.375   30.479  43.955 1.00 20.30 ? 72   GLY A O     1 
ATOM   2026  N  N     . ASP B 2 72  ? 8.925   29.447  42.098 1.00 19.36 ? 73   ASP A N     1 
ATOM   2027  C  CA    . ASP B 2 72  ? 9.326   28.228  42.759 1.00 21.15 ? 73   ASP A CA    1 
ATOM   2028  C  C     . ASP B 2 72  ? 10.722  28.431  43.348 1.00 20.12 ? 73   ASP A C     1 
ATOM   2029  O  O     . ASP B 2 72  ? 11.007  27.978  44.446 1.00 19.79 ? 73   ASP A O     1 
ATOM   2030  C  CB    . ASP B 2 72  ? 9.333   27.058  41.787 1.00 24.88 ? 73   ASP A CB    1 
ATOM   2031  C  CG    . ASP B 2 72  ? 7.940   26.555  41.485 1.00 31.48 ? 73   ASP A CG    1 
ATOM   2032  O  OD1   . ASP B 2 72  ? 6.974   27.066  42.085 1.00 30.21 ? 73   ASP A OD1   1 
ATOM   2033  O  OD2   . ASP B 2 72  ? 7.783   25.662  40.645 1.00 35.28 ? 73   ASP A OD2   1 
ATOM   2034  N  N     . VAL B 2 73  ? 11.583  29.124  42.610 1.00 18.43 ? 74   VAL A N     1 
ATOM   2035  C  CA    . VAL B 2 73  ? 12.940  29.387  43.060 1.00 16.77 ? 74   VAL A CA    1 
ATOM   2036  C  C     . VAL B 2 73  ? 12.938  30.314  44.267 1.00 16.96 ? 74   VAL A C     1 
ATOM   2037  O  O     . VAL B 2 73  ? 13.669  30.104  45.221 1.00 18.58 ? 74   VAL A O     1 
ATOM   2038  C  CB    . VAL B 2 73  ? 13.825  29.947  41.925 1.00 15.78 ? 74   VAL A CB    1 
ATOM   2039  C  CG1   . VAL B 2 73  ? 15.140  30.480  42.464 1.00 13.32 ? 74   VAL A CG1   1 
ATOM   2040  C  CG2   . VAL B 2 73  ? 14.070  28.873  40.879 1.00 14.78 ? 74   VAL A CG2   1 
ATOM   2041  N  N     . MET B 2 74  ? 12.100  31.340  44.225 1.00 16.15 ? 75   MET A N     1 
ATOM   2042  C  CA    . MET B 2 74  ? 11.981  32.272  45.324 1.00 15.02 ? 75   MET A CA    1 
ATOM   2043  C  C     . MET B 2 74  ? 11.498  31.588  46.602 1.00 14.87 ? 75   MET A C     1 
ATOM   2044  O  O     . MET B 2 74  ? 12.033  31.819  47.677 1.00 13.72 ? 75   MET A O     1 
ATOM   2045  C  CB    . MET B 2 74  ? 11.041  33.399  44.925 1.00 15.10 ? 75   MET A CB    1 
ATOM   2046  C  CG    . MET B 2 74  ? 10.850  34.483  45.972 1.00 15.36 ? 75   MET A CG    1 
ATOM   2047  S  SD    . MET B 2 74  ? 10.466  36.087  45.248 1.00 18.99 ? 75   MET A SD    1 
ATOM   2048  C  CE    . MET B 2 74  ? 9.152   35.674  44.095 1.00 16.09 ? 75   MET A CE    1 
ATOM   2049  N  N     . GLY B 2 75  ? 10.482  30.742  46.470 1.00 15.99 ? 76   GLY A N     1 
ATOM   2050  C  CA    . GLY B 2 75  ? 9.890   30.040  47.612 1.00 16.60 ? 76   GLY A CA    1 
ATOM   2051  C  C     . GLY B 2 75  ? 10.748  28.968  48.256 1.00 16.13 ? 76   GLY A C     1 
ATOM   2052  O  O     . GLY B 2 75  ? 10.845  28.884  49.485 1.00 15.29 ? 76   GLY A O     1 
ATOM   2053  N  N     . LYS B 2 76  ? 11.407  28.165  47.433 1.00 16.76 ? 77   LYS A N     1 
ATOM   2054  C  CA    . LYS B 2 76  ? 12.244  27.073  47.929 1.00 16.38 ? 77   LYS A CA    1 
ATOM   2055  C  C     . LYS B 2 76  ? 13.717  27.359  48.208 1.00 16.57 ? 77   LYS A C     1 
ATOM   2056  O  O     . LYS B 2 76  ? 14.262  26.853  49.178 1.00 18.64 ? 77   LYS A O     1 
ATOM   2057  C  CB    . LYS B 2 76  ? 12.202  25.902  46.960 1.00 16.21 ? 77   LYS A CB    1 
ATOM   2058  C  CG    . LYS B 2 76  ? 10.816  25.425  46.584 1.00 16.44 ? 77   LYS A CG    1 
ATOM   2059  C  CD    . LYS B 2 76  ? 10.947  24.250  45.625 1.00 16.34 ? 77   LYS A CD    1 
ATOM   2060  C  CE    . LYS B 2 76  ? 9.604   23.688  45.238 1.00 15.43 ? 77   LYS A CE    1 
ATOM   2061  N  NZ    . LYS B 2 76  ? 9.821   22.465  44.395 1.00 15.34 ? 77   LYS A NZ    1 
ATOM   2062  N  N     . TYR B 2 77  ? 14.373  28.132  47.356 1.00 15.19 ? 78   TYR A N     1 
ATOM   2063  C  CA    . TYR B 2 77  ? 15.800  28.353  47.525 1.00 15.01 ? 78   TYR A CA    1 
ATOM   2064  C  C     . TYR B 2 77  ? 16.323  29.767  47.716 1.00 15.16 ? 78   TYR A C     1 
ATOM   2065  O  O     . TYR B 2 77  ? 17.277  29.968  48.444 1.00 15.33 ? 78   TYR A O     1 
ATOM   2066  C  CB    . TYR B 2 77  ? 16.555  27.745  46.331 1.00 15.69 ? 78   TYR A CB    1 
ATOM   2067  C  CG    . TYR B 2 77  ? 15.942  26.481  45.781 1.00 15.10 ? 78   TYR A CG    1 
ATOM   2068  C  CD1   . TYR B 2 77  ? 15.943  25.306  46.516 1.00 14.39 ? 78   TYR A CD1   1 
ATOM   2069  C  CD2   . TYR B 2 77  ? 15.364  26.461  44.518 1.00 14.38 ? 78   TYR A CD2   1 
ATOM   2070  C  CE1   . TYR B 2 77  ? 15.387  24.156  46.015 1.00 14.20 ? 78   TYR A CE1   1 
ATOM   2071  C  CE2   . TYR B 2 77  ? 14.812  25.309  44.011 1.00 14.16 ? 78   TYR A CE2   1 
ATOM   2072  C  CZ    . TYR B 2 77  ? 14.827  24.158  44.774 1.00 14.98 ? 78   TYR A CZ    1 
ATOM   2073  O  OH    . TYR B 2 77  ? 14.270  23.004  44.279 1.00 16.73 ? 78   TYR A OH    1 
ATOM   2074  N  N     . HIS B 2 78  ? 15.715  30.735  47.051 1.00 13.93 ? 79   HIS A N     1 
ATOM   2075  C  CA    . HIS B 2 78  ? 16.197  32.104  47.101 1.00 12.60 ? 79   HIS A CA    1 
ATOM   2076  C  C     . HIS B 2 78  ? 15.285  33.109  47.805 1.00 12.04 ? 79   HIS A C     1 
ATOM   2077  O  O     . HIS B 2 78  ? 14.412  33.697  47.160 1.00 12.51 ? 79   HIS A O     1 
ATOM   2078  C  CB    . HIS B 2 78  ? 16.472  32.558  45.673 1.00 11.43 ? 79   HIS A CB    1 
ATOM   2079  C  CG    . HIS B 2 78  ? 17.572  33.563  45.557 1.00 10.85 ? 79   HIS A CG    1 
ATOM   2080  N  ND1   . HIS B 2 78  ? 18.886  33.258  45.838 1.00 10.99 ? 79   HIS A ND1   1 
ATOM   2081  C  CD2   . HIS B 2 78  ? 17.557  34.858  45.173 1.00 10.70 ? 79   HIS A CD2   1 
ATOM   2082  C  CE1   . HIS B 2 78  ? 19.630  34.327  45.640 1.00 11.10 ? 79   HIS A CE1   1 
ATOM   2083  N  NE2   . HIS B 2 78  ? 18.847  35.311  45.235 1.00 11.56 ? 79   HIS A NE2   1 
ATOM   2084  N  N     . PRO B 2 79  ? 15.529  33.323  49.150 1.00 11.84 ? 80   PRO A N     1 
ATOM   2085  C  CA    . PRO B 2 79  ? 14.603  34.293  49.778 1.00 12.31 ? 80   PRO A CA    1 
ATOM   2086  C  C     . PRO B 2 79  ? 15.000  35.759  49.606 1.00 12.43 ? 80   PRO A C     1 
ATOM   2087  O  O     . PRO B 2 79  ? 15.418  36.428  50.527 1.00 11.64 ? 80   PRO A O     1 
ATOM   2088  C  CB    . PRO B 2 79  ? 14.623  33.886  51.255 1.00 12.08 ? 80   PRO A CB    1 
ATOM   2089  C  CG    . PRO B 2 79  ? 16.029  33.464  51.491 1.00 11.28 ? 80   PRO A CG    1 
ATOM   2090  C  CD    . PRO B 2 79  ? 16.518  32.854  50.210 1.00 11.38 ? 80   PRO A CD    1 
ATOM   2091  N  N     . HIS B 2 80  ? 14.829  36.230  48.379 1.00 14.16 ? 81   HIS A N     1 
ATOM   2092  C  CA    . HIS B 2 80  ? 15.146  37.587  47.963 1.00 13.70 ? 81   HIS A CA    1 
ATOM   2093  C  C     . HIS B 2 80  ? 14.128  38.040  46.926 1.00 13.37 ? 81   HIS A C     1 
ATOM   2094  O  O     . HIS B 2 80  ? 13.345  37.265  46.445 1.00 12.63 ? 81   HIS A O     1 
ATOM   2095  C  CB    . HIS B 2 80  ? 16.566  37.657  47.416 1.00 13.00 ? 81   HIS A CB    1 
ATOM   2096  C  CG    . HIS B 2 80  ? 17.592  37.145  48.358 1.00 13.55 ? 81   HIS A CG    1 
ATOM   2097  N  ND1   . HIS B 2 80  ? 18.036  37.883  49.447 1.00 13.11 ? 81   HIS A ND1   1 
ATOM   2098  C  CD2   . HIS B 2 80  ? 18.257  35.962  48.402 1.00 13.37 ? 81   HIS A CD2   1 
ATOM   2099  C  CE1   . HIS B 2 80  ? 18.932  37.168  50.111 1.00 13.64 ? 81   HIS A CE1   1 
ATOM   2100  N  NE2   . HIS B 2 80  ? 19.084  36.002  49.501 1.00 13.43 ? 81   HIS A NE2   1 
ATOM   2101  N  N     . GLY B 2 81  ? 14.151  39.337  46.622 1.00 13.75 ? 82   GLY A N     1 
ATOM   2102  C  CA    . GLY B 2 81  ? 13.230  39.923  45.666 1.00 13.75 ? 82   GLY A CA    1 
ATOM   2103  C  C     . GLY B 2 81  ? 13.181  39.185  44.330 1.00 16.07 ? 82   GLY A C     1 
ATOM   2104  O  O     . GLY B 2 81  ? 14.172  38.638  43.844 1.00 15.70 ? 82   GLY A O     1 
ATOM   2105  N  N     . ASP B 2 82  ? 11.996  39.191  43.741 1.00 17.31 ? 83   ASP A N     1 
ATOM   2106  C  CA    . ASP B 2 82  ? 11.736  38.509  42.476 1.00 19.00 ? 83   ASP A CA    1 
ATOM   2107  C  C     . ASP B 2 82  ? 12.493  39.088  41.289 1.00 18.09 ? 83   ASP A C     1 
ATOM   2108  O  O     . ASP B 2 82  ? 12.816  38.378  40.348 1.00 19.06 ? 83   ASP A O     1 
ATOM   2109  C  CB    . ASP B 2 82  ? 10.228  38.466  42.185 1.00 20.45 ? 83   ASP A CB    1 
ATOM   2110  C  CG    . ASP B 2 82  ? 9.620   39.830  42.074 1.00 22.81 ? 83   ASP A CG    1 
ATOM   2111  O  OD1   . ASP B 2 82  ? 9.712   40.614  43.046 1.00 24.52 ? 83   ASP A OD1   1 
ATOM   2112  O  OD2   . ASP B 2 82  ? 9.040   40.139  41.014 1.00 23.23 ? 83   ASP A OD2   1 
ATOM   2113  N  N     . SER B 2 83  ? 12.777  40.374  41.329 1.00 17.93 ? 84   SER A N     1 
ATOM   2114  C  CA    . SER B 2 83  ? 13.508  41.035  40.267 1.00 15.69 ? 84   SER A CA    1 
ATOM   2115  C  C     . SER B 2 83  ? 14.927  40.549  40.154 1.00 15.00 ? 84   SER A C     1 
ATOM   2116  O  O     . SER B 2 83  ? 15.426  40.429  39.071 1.00 16.46 ? 84   SER A O     1 
ATOM   2117  C  CB    . SER B 2 83  ? 13.540  42.528  40.521 1.00 15.98 ? 84   SER A CB    1 
ATOM   2118  O  OG    . SER B 2 83  ? 12.314  43.079  40.169 1.00 17.86 ? 84   SER A OG    1 
ATOM   2119  N  N     . SER B 2 84  ? 15.571  40.286  41.276 1.00 12.41 ? 85   SER A N     1 
ATOM   2120  C  CA    . SER B 2 84  ? 16.918  39.814  41.263 1.00 11.77 ? 85   SER A CA    1 
ATOM   2121  C  C     . SER B 2 84  ? 16.986  38.477  40.620 1.00 11.35 ? 85   SER A C     1 
ATOM   2122  O  O     . SER B 2 84  ? 17.889  38.226  39.881 1.00 11.85 ? 85   SER A O     1 
ATOM   2123  C  CB    . SER B 2 84  ? 17.543  39.774  42.655 1.00 11.39 ? 85   SER A CB    1 
ATOM   2124  O  OG    . SER B 2 84  ? 17.827  41.064  43.117 1.00 10.60 ? 85   SER A OG    1 
ATOM   2125  N  N     . ILE B 2 85  ? 16.021  37.616  40.898 1.00 11.02 ? 86   ILE A N     1 
ATOM   2126  C  CA    . ILE B 2 85  ? 15.972  36.287  40.315 1.00 11.06 ? 86   ILE A CA    1 
ATOM   2127  C  C     . ILE B 2 85  ? 15.662  36.333  38.828 1.00 11.91 ? 86   ILE A C     1 
ATOM   2128  O  O     . ILE B 2 85  ? 16.312  35.704  38.046 1.00 11.81 ? 86   ILE A O     1 
ATOM   2129  C  CB    . ILE B 2 85  ? 14.920  35.385  41.003 1.00 10.69 ? 86   ILE A CB    1 
ATOM   2130  C  CG1   . ILE B 2 85  ? 15.257  35.193  42.467 1.00 10.18 ? 86   ILE A CG1   1 
ATOM   2131  C  CG2   . ILE B 2 85  ? 14.797  34.048  40.310 1.00 9.86  ? 86   ILE A CG2   1 
ATOM   2132  C  CD1   . ILE B 2 85  ? 14.053  34.895  43.314 1.00 10.72 ? 86   ILE A CD1   1 
ATOM   2133  N  N     . TYR B 2 86  ? 14.640  37.085  38.458 1.00 11.01 ? 87   TYR A N     1 
ATOM   2134  C  CA    . TYR B 2 86  ? 14.237  37.155  37.063 1.00 10.56 ? 87   TYR A CA    1 
ATOM   2135  C  C     . TYR B 2 86  ? 15.339  37.701  36.162 1.00 10.54 ? 87   TYR A C     1 
ATOM   2136  O  O     . TYR B 2 86  ? 15.745  37.040  35.211 1.00 10.56 ? 87   TYR A O     1 
ATOM   2137  C  CB    . TYR B 2 86  ? 12.935  37.946  36.912 1.00 9.79  ? 87   TYR A CB    1 
ATOM   2138  C  CG    . TYR B 2 86  ? 12.422  38.010  35.495 1.00 9.22  ? 87   TYR A CG    1 
ATOM   2139  C  CD1   . TYR B 2 86  ? 12.130  36.842  34.784 1.00 9.24  ? 87   TYR A CD1   1 
ATOM   2140  C  CD2   . TYR B 2 86  ? 12.198  39.234  34.870 1.00 9.12  ? 87   TYR A CD2   1 
ATOM   2141  C  CE1   . TYR B 2 86  ? 11.651  36.895  33.478 1.00 9.26  ? 87   TYR A CE1   1 
ATOM   2142  C  CE2   . TYR B 2 86  ? 11.712  39.300  33.560 1.00 9.14  ? 87   TYR A CE2   1 
ATOM   2143  C  CZ    . TYR B 2 86  ? 11.440  38.131  32.882 1.00 9.16  ? 87   TYR A CZ    1 
ATOM   2144  O  OH    . TYR B 2 86  ? 10.951  38.186  31.607 1.00 10.10 ? 87   TYR A OH    1 
ATOM   2145  N  N     . GLU B 2 87  ? 15.842  38.883  36.486 1.00 10.76 ? 88   GLU A N     1 
ATOM   2146  C  CA    . GLU B 2 87  ? 16.905  39.527  35.740 1.00 11.00 ? 88   GLU A CA    1 
ATOM   2147  C  C     . GLU B 2 87  ? 18.161  38.666  35.606 1.00 10.76 ? 88   GLU A C     1 
ATOM   2148  O  O     . GLU B 2 87  ? 18.864  38.763  34.637 1.00 10.98 ? 88   GLU A O     1 
ATOM   2149  C  CB    . GLU B 2 87  ? 17.211  40.905  36.329 1.00 12.13 ? 88   GLU A CB    1 
ATOM   2150  C  CG    . GLU B 2 87  ? 16.167  41.931  35.933 1.00 13.35 ? 88   GLU A CG    1 
ATOM   2151  C  CD    . GLU B 2 87  ? 16.157  43.171  36.796 1.00 15.67 ? 88   GLU A CD    1 
ATOM   2152  O  OE1   . GLU B 2 87  ? 15.075  43.593  37.188 1.00 16.78 ? 88   GLU A OE1   1 
ATOM   2153  O  OE2   . GLU B 2 87  ? 17.213  43.733  37.135 1.00 17.67 ? 88   GLU A OE2   1 
ATOM   2154  N  N     . ALA B 2 88  ? 18.399  37.820  36.595 1.00 10.40 ? 89   ALA A N     1 
ATOM   2155  C  CA    . ALA B 2 88  ? 19.512  36.908  36.606 1.00 10.63 ? 89   ALA A CA    1 
ATOM   2156  C  C     . ALA B 2 88  ? 19.302  35.762  35.633 1.00 10.89 ? 89   ALA A C     1 
ATOM   2157  O  O     . ALA B 2 88  ? 20.230  35.312  35.009 1.00 11.07 ? 89   ALA A O     1 
ATOM   2158  C  CB    . ALA B 2 88  ? 19.759  36.398  37.995 1.00 10.33 ? 89   ALA A CB    1 
ATOM   2159  N  N     . MET B 2 89  ? 18.064  35.312  35.522 1.00 10.81 ? 90   MET A N     1 
ATOM   2160  C  CA    . MET B 2 89  ? 17.698  34.267  34.578 1.00 11.63 ? 90   MET A CA    1 
ATOM   2161  C  C     . MET B 2 89  ? 17.796  34.843  33.173 1.00 11.58 ? 90   MET A C     1 
ATOM   2162  O  O     . MET B 2 89  ? 18.296  34.189  32.259 1.00 11.38 ? 90   MET A O     1 
ATOM   2163  C  CB    . MET B 2 89  ? 16.266  33.764  34.830 1.00 12.83 ? 90   MET A CB    1 
ATOM   2164  C  CG    . MET B 2 89  ? 15.913  32.531  34.017 1.00 14.08 ? 90   MET A CG    1 
ATOM   2165  S  SD    . MET B 2 89  ? 14.204  31.969  34.096 1.00 14.78 ? 90   MET A SD    1 
ATOM   2166  C  CE    . MET B 2 89  ? 13.362  33.220  33.133 1.00 13.90 ? 90   MET A CE    1 
ATOM   2167  N  N     . VAL B 2 90  ? 17.321  36.078  33.027 1.00 11.45 ? 91   VAL A N     1 
ATOM   2168  C  CA    . VAL B 2 90  ? 17.329  36.808  31.759 1.00 10.90 ? 91   VAL A CA    1 
ATOM   2169  C  C     . VAL B 2 90  ? 18.728  36.909  31.154 1.00 11.24 ? 91   VAL A C     1 
ATOM   2170  O  O     . VAL B 2 90  ? 18.901  36.657  29.955 1.00 12.18 ? 91   VAL A O     1 
ATOM   2171  C  CB    . VAL B 2 90  ? 16.680  38.208  31.906 1.00 10.75 ? 91   VAL A CB    1 
ATOM   2172  C  CG1   . VAL B 2 90  ? 16.902  39.070  30.662 1.00 9.90  ? 91   VAL A CG1   1 
ATOM   2173  C  CG2   . VAL B 2 90  ? 15.191  38.068  32.230 1.00 10.27 ? 91   VAL A CG2   1 
ATOM   2174  N  N     A ARG B 2 91  ? 19.711  37.271  31.981 0.50 10.82 ? 92   ARG A N     1 
ATOM   2175  N  N     B ARG B 2 91  ? 19.742  37.253  31.944 0.50 10.76 ? 92   ARG A N     1 
ATOM   2176  C  CA    A ARG B 2 91  ? 21.106  37.388  31.539 0.50 10.84 ? 92   ARG A CA    1 
ATOM   2177  C  CA    B ARG B 2 91  ? 21.107  37.376  31.451 0.50 10.74 ? 92   ARG A CA    1 
ATOM   2178  C  C     A ARG B 2 91  ? 21.656  36.092  30.953 0.50 10.64 ? 92   ARG A C     1 
ATOM   2179  C  C     B ARG B 2 91  ? 21.682  36.066  30.938 0.50 10.60 ? 92   ARG A C     1 
ATOM   2180  O  O     A ARG B 2 91  ? 22.268  36.097  29.884 0.50 10.71 ? 92   ARG A O     1 
ATOM   2181  O  O     B ARG B 2 91  ? 22.320  36.029  29.901 0.50 10.72 ? 92   ARG A O     1 
ATOM   2182  C  CB    A ARG B 2 91  ? 22.006  37.856  32.681 0.50 11.13 ? 92   ARG A CB    1 
ATOM   2183  C  CB    B ARG B 2 91  ? 22.018  37.936  32.541 0.50 10.90 ? 92   ARG A CB    1 
ATOM   2184  C  CG    A ARG B 2 91  ? 21.963  39.342  32.912 0.50 11.60 ? 92   ARG A CG    1 
ATOM   2185  C  CG    B ARG B 2 91  ? 21.668  39.355  32.936 0.50 11.26 ? 92   ARG A CG    1 
ATOM   2186  C  CD    A ARG B 2 91  ? 22.905  39.728  34.044 0.50 12.03 ? 92   ARG A CD    1 
ATOM   2187  C  CD    B ARG B 2 91  ? 22.497  39.838  34.124 0.50 11.54 ? 92   ARG A CD    1 
ATOM   2188  N  NE    A ARG B 2 91  ? 24.219  39.090  33.957 0.50 12.21 ? 92   ARG A NE    1 
ATOM   2189  N  NE    B ARG B 2 91  ? 21.885  40.998  34.766 0.50 11.43 ? 92   ARG A NE    1 
ATOM   2190  C  CZ    A ARG B 2 91  ? 25.153  39.448  33.084 0.50 12.20 ? 92   ARG A CZ    1 
ATOM   2191  C  CZ    B ARG B 2 91  ? 21.345  40.986  35.980 0.50 11.41 ? 92   ARG A CZ    1 
ATOM   2192  N  NH1   A ARG B 2 91  ? 24.878  40.406  32.211 0.50 12.66 ? 92   ARG A NH1   1 
ATOM   2193  N  NH1   B ARG B 2 91  ? 21.347  39.884  36.723 0.50 11.29 ? 92   ARG A NH1   1 
ATOM   2194  N  NH2   A ARG B 2 91  ? 26.343  38.863  33.076 0.50 11.39 ? 92   ARG A NH2   1 
ATOM   2195  N  NH2   B ARG B 2 91  ? 20.818  42.089  36.471 0.50 11.39 ? 92   ARG A NH2   1 
ATOM   2196  N  N     . MET B 2 92  ? 21.418  34.992  31.658 1.00 10.89 ? 93   MET A N     1 
ATOM   2197  C  CA    . MET B 2 92  ? 21.873  33.660  31.233 1.00 10.93 ? 93   MET A CA    1 
ATOM   2198  C  C     . MET B 2 92  ? 21.283  33.227  29.876 1.00 11.23 ? 93   MET A C     1 
ATOM   2199  O  O     . MET B 2 92  ? 21.774  32.284  29.254 1.00 11.60 ? 93   MET A O     1 
ATOM   2200  C  CB    . MET B 2 92  ? 21.538  32.608  32.304 1.00 11.26 ? 93   MET A CB    1 
ATOM   2201  C  CG    . MET B 2 92  ? 22.340  32.706  33.595 1.00 12.48 ? 93   MET A CG    1 
ATOM   2202  S  SD    . MET B 2 92  ? 22.012  31.389  34.808 1.00 13.47 ? 93   MET A SD    1 
ATOM   2203  C  CE    . MET B 2 92  ? 20.400  31.847  35.401 1.00 12.55 ? 93   MET A CE    1 
ATOM   2204  N  N     . ALA B 2 93  ? 20.242  33.925  29.423 1.00 11.05 ? 94   ALA A N     1 
ATOM   2205  C  CA    . ALA B 2 93  ? 19.571  33.620  28.153 1.00 11.15 ? 94   ALA A CA    1 
ATOM   2206  C  C     . ALA B 2 93  ? 20.041  34.469  26.971 1.00 10.84 ? 94   ALA A C     1 
ATOM   2207  O  O     . ALA B 2 93  ? 19.676  34.190  25.830 1.00 11.52 ? 94   ALA A O     1 
ATOM   2208  C  CB    . ALA B 2 93  ? 18.045  33.754  28.315 1.00 10.89 ? 94   ALA A CB    1 
ATOM   2209  N  N     . GLN B 2 94  ? 20.845  35.492  27.253 1.00 10.36 ? 95   GLN A N     1 
ATOM   2210  C  CA    . GLN B 2 94  ? 21.326  36.446  26.239 1.00 10.30 ? 95   GLN A CA    1 
ATOM   2211  C  C     . GLN B 2 94  ? 22.610  36.012  25.569 1.00 10.15 ? 95   GLN A C     1 
ATOM   2212  O  O     . GLN B 2 94  ? 23.589  35.710  26.250 1.00 11.03 ? 95   GLN A O     1 
ATOM   2213  C  CB    . GLN B 2 94  ? 21.530  37.823  26.875 1.00 9.48  ? 95   GLN A CB    1 
ATOM   2214  C  CG    . GLN B 2 94  ? 20.285  38.457  27.470 1.00 9.21  ? 95   GLN A CG    1 
ATOM   2215  C  CD    . GLN B 2 94  ? 20.614  39.675  28.305 1.00 9.80  ? 95   GLN A CD    1 
ATOM   2216  O  OE1   . GLN B 2 94  ? 21.757  39.849  28.752 1.00 9.95  ? 95   GLN A OE1   1 
ATOM   2217  N  NE2   . GLN B 2 94  ? 19.612  40.534  28.529 1.00 9.17  ? 95   GLN A NE2   1 
ATOM   2218  N  N     . ASP B 2 95  ? 22.624  36.009  24.245 1.00 10.38 ? 96   ASP A N     1 
ATOM   2219  C  CA    . ASP B 2 95  ? 23.824  35.584  23.512 1.00 10.58 ? 96   ASP A CA    1 
ATOM   2220  C  C     . ASP B 2 95  ? 24.923  36.645  23.493 1.00 10.41 ? 96   ASP A C     1 
ATOM   2221  O  O     . ASP B 2 95  ? 26.060  36.351  23.130 1.00 10.66 ? 96   ASP A O     1 
ATOM   2222  C  CB    . ASP B 2 95  ? 23.491  35.069  22.103 1.00 10.68 ? 96   ASP A CB    1 
ATOM   2223  C  CG    . ASP B 2 95  ? 22.803  36.103  21.240 1.00 11.71 ? 96   ASP A CG    1 
ATOM   2224  O  OD1   . ASP B 2 95  ? 22.960  37.333  21.465 1.00 11.85 ? 96   ASP A OD1   1 
ATOM   2225  O  OD2   . ASP B 2 95  ? 22.073  35.679  20.316 1.00 12.49 ? 96   ASP A OD2   1 
ATOM   2226  N  N     . PHE B 2 96  ? 24.574  37.865  23.890 1.00 9.77  ? 97   PHE A N     1 
ATOM   2227  C  CA    . PHE B 2 96  ? 25.539  38.964  23.991 1.00 9.99  ? 97   PHE A CA    1 
ATOM   2228  C  C     . PHE B 2 96  ? 26.115  39.126  25.412 1.00 10.36 ? 97   PHE A C     1 
ATOM   2229  O  O     . PHE B 2 96  ? 27.026  39.940  25.621 1.00 10.93 ? 97   PHE A O     1 
ATOM   2230  C  CB    . PHE B 2 96  ? 24.951  40.290  23.477 1.00 9.66  ? 97   PHE A CB    1 
ATOM   2231  C  CG    . PHE B 2 96  ? 23.634  40.671  24.100 1.00 9.20  ? 97   PHE A CG    1 
ATOM   2232  C  CD1   . PHE B 2 96  ? 23.596  41.385  25.308 1.00 9.06  ? 97   PHE A CD1   1 
ATOM   2233  C  CD2   . PHE B 2 96  ? 22.424  40.345  23.474 1.00 8.45  ? 97   PHE A CD2   1 
ATOM   2234  C  CE1   . PHE B 2 96  ? 22.371  41.750  25.886 1.00 8.59  ? 97   PHE A CE1   1 
ATOM   2235  C  CE2   . PHE B 2 96  ? 21.206  40.705  24.027 1.00 8.13  ? 97   PHE A CE2   1 
ATOM   2236  C  CZ    . PHE B 2 96  ? 21.176  41.403  25.246 1.00 8.51  ? 97   PHE A CZ    1 
ATOM   2237  N  N     . SER B 2 97  ? 25.587  38.356  26.371 1.00 9.90  ? 98   SER A N     1 
ATOM   2238  C  CA    . SER B 2 97  ? 26.055  38.392  27.767 1.00 9.77  ? 98   SER A CA    1 
ATOM   2239  C  C     . SER B 2 97  ? 26.815  37.121  28.168 1.00 10.25 ? 98   SER A C     1 
ATOM   2240  O  O     . SER B 2 97  ? 27.820  37.184  28.883 1.00 10.20 ? 98   SER A O     1 
ATOM   2241  C  CB    . SER B 2 97  ? 24.907  38.630  28.749 1.00 9.27  ? 98   SER A CB    1 
ATOM   2242  O  OG    . SER B 2 97  ? 24.459  39.968  28.724 1.00 8.87  ? 98   SER A OG    1 
ATOM   2243  N  N     . TYR B 2 98  ? 26.314  35.972  27.718 1.00 9.49  ? 99   TYR A N     1 
ATOM   2244  C  CA    . TYR B 2 98  ? 26.941  34.702  28.013 1.00 9.21  ? 99   TYR A CA    1 
ATOM   2245  C  C     . TYR B 2 98  ? 27.566  34.072  26.781 1.00 8.95  ? 99   TYR A C     1 
ATOM   2246  O  O     . TYR B 2 98  ? 26.884  33.824  25.791 1.00 8.87  ? 99   TYR A O     1 
ATOM   2247  C  CB    . TYR B 2 98  ? 25.930  33.747  28.649 1.00 9.55  ? 99   TYR A CB    1 
ATOM   2248  C  CG    . TYR B 2 98  ? 25.813  33.892  30.143 1.00 9.17  ? 99   TYR A CG    1 
ATOM   2249  C  CD1   . TYR B 2 98  ? 25.306  35.048  30.714 1.00 9.38  ? 99   TYR A CD1   1 
ATOM   2250  C  CD2   . TYR B 2 98  ? 26.184  32.844  30.987 1.00 9.31  ? 99   TYR A CD2   1 
ATOM   2251  C  CE1   . TYR B 2 98  ? 25.195  35.177  32.093 1.00 9.55  ? 99   TYR A CE1   1 
ATOM   2252  C  CE2   . TYR B 2 98  ? 26.067  32.954  32.356 1.00 9.53  ? 99   TYR A CE2   1 
ATOM   2253  C  CZ    . TYR B 2 98  ? 25.574  34.135  32.904 1.00 9.88  ? 99   TYR A CZ    1 
ATOM   2254  O  OH    . TYR B 2 98  ? 25.455  34.262  34.265 1.00 11.28 ? 99   TYR A OH    1 
ATOM   2255  N  N     . ARG B 2 99  ? 28.866  33.811  26.857 1.00 9.03  ? 100  ARG A N     1 
ATOM   2256  C  CA    . ARG B 2 99  ? 29.617  33.183  25.787 1.00 8.88  ? 100  ARG A CA    1 
ATOM   2257  C  C     . ARG B 2 99  ? 28.931  31.866  25.424 1.00 9.30  ? 100  ARG A C     1 
ATOM   2258  O  O     . ARG B 2 99  ? 28.809  31.517  24.265 1.00 9.23  ? 100  ARG A O     1 
ATOM   2259  C  CB    . ARG B 2 99  ? 31.059  32.965  26.234 1.00 8.96  ? 100  ARG A CB    1 
ATOM   2260  C  CG    . ARG B 2 99  ? 31.998  32.434  25.166 1.00 9.44  ? 100  ARG A CG    1 
ATOM   2261  C  CD    . ARG B 2 99  ? 32.012  33.310  23.927 1.00 9.38  ? 100  ARG A CD    1 
ATOM   2262  N  NE    . ARG B 2 99  ? 32.852  32.745  22.889 1.00 10.01 ? 100  ARG A NE    1 
ATOM   2263  C  CZ    . ARG B 2 99  ? 32.485  31.774  22.060 1.00 10.54 ? 100  ARG A CZ    1 
ATOM   2264  N  NH1   . ARG B 2 99  ? 31.282  31.232  22.136 1.00 11.04 ? 100  ARG A NH1   1 
ATOM   2265  N  NH2   . ARG B 2 99  ? 33.335  31.337  21.154 1.00 10.54 ? 100  ARG A NH2   1 
ATOM   2266  N  N     . TYR B 2 100 ? 28.480  31.141  26.439 1.00 10.05 ? 101  TYR A N     1 
ATOM   2267  C  CA    . TYR B 2 100 ? 27.743  29.905  26.248 1.00 10.24 ? 101  TYR A CA    1 
ATOM   2268  C  C     . TYR B 2 100 ? 26.466  30.036  27.062 1.00 11.28 ? 101  TYR A C     1 
ATOM   2269  O  O     . TYR B 2 100 ? 26.458  29.763  28.257 1.00 12.63 ? 101  TYR A O     1 
ATOM   2270  C  CB    . TYR B 2 100 ? 28.578  28.701  26.667 1.00 10.82 ? 101  TYR A CB    1 
ATOM   2271  C  CG    . TYR B 2 100 ? 29.870  28.625  25.899 1.00 10.80 ? 101  TYR A CG    1 
ATOM   2272  C  CD1   . TYR B 2 100 ? 29.889  28.126  24.604 1.00 10.98 ? 101  TYR A CD1   1 
ATOM   2273  C  CD2   . TYR B 2 100 ? 31.051  29.092  26.437 1.00 10.65 ? 101  TYR A CD2   1 
ATOM   2274  C  CE1   . TYR B 2 100 ? 31.053  28.076  23.880 1.00 11.15 ? 101  TYR A CE1   1 
ATOM   2275  C  CE2   . TYR B 2 100 ? 32.223  29.048  25.724 1.00 10.89 ? 101  TYR A CE2   1 
ATOM   2276  C  CZ    . TYR B 2 100 ? 32.221  28.537  24.444 1.00 11.20 ? 101  TYR A CZ    1 
ATOM   2277  O  OH    . TYR B 2 100 ? 33.379  28.486  23.725 1.00 10.63 ? 101  TYR A OH    1 
ATOM   2278  N  N     . PRO B 2 101 ? 25.351  30.487  26.370 1.00 11.63 ? 102  PRO A N     1 
ATOM   2279  C  CA    . PRO B 2 101 ? 24.138  30.648  27.200 1.00 11.89 ? 102  PRO A CA    1 
ATOM   2280  C  C     . PRO B 2 101 ? 23.688  29.452  28.024 1.00 13.12 ? 102  PRO A C     1 
ATOM   2281  O  O     . PRO B 2 101 ? 23.699  28.320  27.567 1.00 16.36 ? 102  PRO A O     1 
ATOM   2282  C  CB    . PRO B 2 101 ? 23.062  31.028  26.181 1.00 10.75 ? 102  PRO A CB    1 
ATOM   2283  C  CG    . PRO B 2 101 ? 23.801  31.810  25.174 1.00 11.04 ? 102  PRO A CG    1 
ATOM   2284  C  CD    . PRO B 2 101 ? 25.009  30.953  24.959 1.00 10.96 ? 102  PRO A CD    1 
ATOM   2285  N  N     . LEU B 2 102 ? 23.271  29.721  29.249 1.00 12.42 ? 103  LEU A N     1 
ATOM   2286  C  CA    . LEU B 2 102 ? 22.819  28.670  30.145 1.00 11.56 ? 103  LEU A CA    1 
ATOM   2287  C  C     . LEU B 2 102 ? 21.305  28.500  30.145 1.00 11.84 ? 103  LEU A C     1 
ATOM   2288  O  O     . LEU B 2 102 ? 20.794  27.503  30.615 1.00 11.71 ? 103  LEU A O     1 
ATOM   2289  C  CB    . LEU B 2 102 ? 23.335  28.937  31.555 1.00 10.80 ? 103  LEU A CB    1 
ATOM   2290  C  CG    . LEU B 2 102 ? 24.862  28.970  31.671 1.00 9.97  ? 103  LEU A CG    1 
ATOM   2291  C  CD1   . LEU B 2 102 ? 25.298  29.287  33.086 1.00 9.29  ? 103  LEU A CD1   1 
ATOM   2292  C  CD2   . LEU B 2 102 ? 25.469  27.662  31.200 1.00 9.53  ? 103  LEU A CD2   1 
ATOM   2293  N  N     . VAL B 2 103 ? 20.597  29.480  29.605 1.00 11.83 ? 104  VAL A N     1 
ATOM   2294  C  CA    . VAL B 2 103 ? 19.134  29.453  29.554 1.00 13.25 ? 104  VAL A CA    1 
ATOM   2295  C  C     . VAL B 2 103 ? 18.608  29.739  28.140 1.00 13.17 ? 104  VAL A C     1 
ATOM   2296  O  O     . VAL B 2 103 ? 19.179  30.540  27.399 1.00 13.07 ? 104  VAL A O     1 
ATOM   2297  C  CB    . VAL B 2 103 ? 18.492  30.424  30.626 1.00 14.15 ? 104  VAL A CB    1 
ATOM   2298  C  CG1   . VAL B 2 103 ? 16.996  30.659  30.375 1.00 12.26 ? 104  VAL A CG1   1 
ATOM   2299  C  CG2   . VAL B 2 103 ? 18.715  29.893  32.043 1.00 12.41 ? 104  VAL A CG2   1 
ATOM   2300  N  N     . ASP B 2 104 ? 17.525  29.051  27.792 1.00 14.51 ? 105  ASP A N     1 
ATOM   2301  C  CA    . ASP B 2 104 ? 16.853  29.164  26.500 1.00 15.89 ? 105  ASP A CA    1 
ATOM   2302  C  C     . ASP B 2 104 ? 15.597  30.008  26.693 1.00 15.64 ? 105  ASP A C     1 
ATOM   2303  O  O     . ASP B 2 104 ? 14.709  29.640  27.443 1.00 15.08 ? 105  ASP A O     1 
ATOM   2304  C  CB    . ASP B 2 104 ? 16.495  27.766  25.987 1.00 16.29 ? 105  ASP A CB    1 
ATOM   2305  C  CG    . ASP B 2 104 ? 15.882  27.778  24.605 1.00 18.41 ? 105  ASP A CG    1 
ATOM   2306  O  OD1   . ASP B 2 104 ? 15.430  28.837  24.135 1.00 18.68 ? 105  ASP A OD1   1 
ATOM   2307  O  OD2   . ASP B 2 104 ? 15.836  26.714  23.976 1.00 19.56 ? 105  ASP A OD2   1 
ATOM   2308  N  N     . GLY B 2 105 ? 15.525  31.140  26.019 1.00 15.10 ? 106  GLY A N     1 
ATOM   2309  C  CA    . GLY B 2 105 ? 14.398  32.051  26.178 1.00 14.66 ? 106  GLY A CA    1 
ATOM   2310  C  C     . GLY B 2 105 ? 13.482  32.261  24.985 1.00 16.20 ? 106  GLY A C     1 
ATOM   2311  O  O     . GLY B 2 105 ? 13.925  32.283  23.840 1.00 15.97 ? 106  GLY A O     1 
ATOM   2312  N  N     . GLN B 2 106 ? 12.197  32.435  25.285 1.00 17.85 ? 107  GLN A N     1 
ATOM   2313  C  CA    . GLN B 2 106 ? 11.158  32.676  24.292 1.00 20.32 ? 107  GLN A CA    1 
ATOM   2314  C  C     . GLN B 2 106 ? 10.413  33.929  24.727 1.00 18.69 ? 107  GLN A C     1 
ATOM   2315  O  O     . GLN B 2 106 ? 9.839   33.972  25.823 1.00 16.83 ? 107  GLN A O     1 
ATOM   2316  C  CB    . GLN B 2 106 ? 10.224  31.450  24.196 1.00 24.88 ? 107  GLN A CB    1 
ATOM   2317  C  CG    . GLN B 2 106 ? 9.128   31.502  23.124 1.00 32.25 ? 107  GLN A CG    1 
ATOM   2318  C  CD    . GLN B 2 106 ? 7.854   32.229  23.559 1.00 46.04 ? 107  GLN A CD    1 
ATOM   2319  O  OE1   . GLN B 2 106 ? 7.613   32.468  24.765 1.00 59.40 ? 107  GLN A OE1   1 
ATOM   2320  N  NE2   . GLN B 2 106 ? 7.027   32.601  22.558 1.00 48.81 ? 107  GLN A NE2   1 
ATOM   2321  N  N     . GLY B 2 107 ? 10.452  34.945  23.864 1.00 16.84 ? 108  GLY A N     1 
ATOM   2322  C  CA    . GLY B 2 107 ? 9.829   36.245  24.131 1.00 14.37 ? 108  GLY A CA    1 
ATOM   2323  C  C     . GLY B 2 107 ? 10.871  37.343  24.187 1.00 14.40 ? 108  GLY A C     1 
ATOM   2324  O  O     . GLY B 2 107 ? 12.034  37.137  23.810 1.00 14.25 ? 108  GLY A O     1 
ATOM   2325  N  N     . ASN B 2 108 ? 10.462  38.522  24.650 1.00 14.71 ? 109  ASN A N     1 
ATOM   2326  C  CA    . ASN B 2 108 ? 11.376  39.664  24.768 1.00 13.44 ? 109  ASN A CA    1 
ATOM   2327  C  C     . ASN B 2 108 ? 12.339  39.475  25.938 1.00 13.41 ? 109  ASN A C     1 
ATOM   2328  O  O     . ASN B 2 108 ? 11.942  39.547  27.099 1.00 13.81 ? 109  ASN A O     1 
ATOM   2329  C  CB    . ASN B 2 108 ? 10.569  40.961  24.906 1.00 13.66 ? 109  ASN A CB    1 
ATOM   2330  C  CG    . ASN B 2 108 ? 11.434  42.173  25.216 1.00 13.68 ? 109  ASN A CG    1 
ATOM   2331  O  OD1   . ASN B 2 108 ? 12.667  42.127  25.131 1.00 14.68 ? 109  ASN A OD1   1 
ATOM   2332  N  ND2   . ASN B 2 108 ? 10.785  43.275  25.579 1.00 12.51 ? 109  ASN A ND2   1 
ATOM   2333  N  N     . PHE B 2 109 ? 13.607  39.224  25.614 1.00 13.73 ? 110  PHE A N     1 
ATOM   2334  C  CA    . PHE B 2 109 ? 14.656  39.004  26.626 1.00 14.04 ? 110  PHE A CA    1 
ATOM   2335  C  C     . PHE B 2 109 ? 15.763  40.061  26.651 1.00 14.87 ? 110  PHE A C     1 
ATOM   2336  O  O     . PHE B 2 109 ? 16.901  39.770  27.022 1.00 15.58 ? 110  PHE A O     1 
ATOM   2337  C  CB    . PHE B 2 109 ? 15.271  37.595  26.490 1.00 13.95 ? 110  PHE A CB    1 
ATOM   2338  C  CG    . PHE B 2 109 ? 14.518  36.526  27.226 1.00 13.66 ? 110  PHE A CG    1 
ATOM   2339  C  CD1   . PHE B 2 109 ? 13.386  35.930  26.672 1.00 13.37 ? 110  PHE A CD1   1 
ATOM   2340  C  CD2   . PHE B 2 109 ? 14.950  36.105  28.487 1.00 13.05 ? 110  PHE A CD2   1 
ATOM   2341  C  CE1   . PHE B 2 109 ? 12.691  34.939  27.366 1.00 12.70 ? 110  PHE A CE1   1 
ATOM   2342  C  CE2   . PHE B 2 109 ? 14.260  35.103  29.180 1.00 12.46 ? 110  PHE A CE2   1 
ATOM   2343  C  CZ    . PHE B 2 109 ? 13.130  34.531  28.618 1.00 11.66 ? 110  PHE A CZ    1 
ATOM   2344  N  N     . GLY B 2 110 ? 15.424  41.286  26.262 1.00 14.77 ? 111  GLY A N     1 
ATOM   2345  C  CA    . GLY B 2 110 ? 16.381  42.388  26.281 1.00 15.54 ? 111  GLY A CA    1 
ATOM   2346  C  C     . GLY B 2 110 ? 17.192  42.576  25.018 1.00 16.87 ? 111  GLY A C     1 
ATOM   2347  O  O     . GLY B 2 110 ? 17.046  41.831  24.048 1.00 18.15 ? 111  GLY A O     1 
ATOM   2348  N  N     . SER B 2 111 ? 18.059  43.582  25.034 1.00 17.42 ? 112  SER A N     1 
ATOM   2349  C  CA    . SER B 2 111 ? 18.889  43.912  23.878 1.00 16.56 ? 112  SER A CA    1 
ATOM   2350  C  C     . SER B 2 111 ? 20.201  44.534  24.331 1.00 16.96 ? 112  SER A C     1 
ATOM   2351  O  O     . SER B 2 111 ? 20.357  44.919  25.492 1.00 16.75 ? 112  SER A O     1 
ATOM   2352  C  CB    . SER B 2 111 ? 18.150  44.889  22.969 1.00 14.98 ? 112  SER A CB    1 
ATOM   2353  O  OG    . SER B 2 111 ? 17.896  46.121  23.634 1.00 15.29 ? 112  SER A OG    1 
ATOM   2354  N  N     . MET B 2 112 ? 21.140  44.627  23.396 1.00 19.16 ? 113  MET A N     1 
ATOM   2355  C  CA    . MET B 2 112 ? 22.445  45.236  23.630 1.00 21.13 ? 113  MET A CA    1 
ATOM   2356  C  C     . MET B 2 112 ? 22.297  46.731  23.886 1.00 19.76 ? 113  MET A C     1 
ATOM   2357  O  O     . MET B 2 112 ? 23.207  47.362  24.418 1.00 20.87 ? 113  MET A O     1 
ATOM   2358  C  CB    . MET B 2 112 ? 23.338  45.056  22.406 1.00 24.05 ? 113  MET A CB    1 
ATOM   2359  C  CG    . MET B 2 112 ? 23.534  43.643  21.939 1.00 26.50 ? 113  MET A CG    1 
ATOM   2360  S  SD    . MET B 2 112 ? 24.508  43.684  20.409 1.00 31.82 ? 113  MET A SD    1 
ATOM   2361  C  CE    . MET B 2 112 ? 24.523  41.902  20.014 1.00 33.43 ? 113  MET A CE    1 
ATOM   2362  N  N     . ASP B 2 113 ? 21.154  47.284  23.487 1.00 20.24 ? 114  ASP A N     1 
ATOM   2363  C  CA    . ASP B 2 113 ? 20.860  48.712  23.639 1.00 20.91 ? 114  ASP A CA    1 
ATOM   2364  C  C     . ASP B 2 113 ? 20.381  49.092  25.042 1.00 20.71 ? 114  ASP A C     1 
ATOM   2365  O  O     . ASP B 2 113 ? 19.994  50.239  25.274 1.00 21.51 ? 114  ASP A O     1 
ATOM   2366  C  CB    . ASP B 2 113 ? 19.847  49.183  22.588 1.00 20.25 ? 114  ASP A CB    1 
ATOM   2367  C  CG    . ASP B 2 113 ? 20.401  49.161  21.173 1.00 22.64 ? 114  ASP A CG    1 
ATOM   2368  O  OD1   . ASP B 2 113 ? 21.639  49.055  20.995 1.00 23.93 ? 114  ASP A OD1   1 
ATOM   2369  O  OD2   . ASP B 2 113 ? 19.588  49.268  20.225 1.00 23.36 ? 114  ASP A OD2   1 
ATOM   2370  N  N     . GLY B 2 114 ? 20.468  48.137  25.962 1.00 21.83 ? 115  GLY A N     1 
ATOM   2371  C  CA    . GLY B 2 114 ? 20.078  48.332  27.346 1.00 24.38 ? 115  GLY A CA    1 
ATOM   2372  C  C     . GLY B 2 114 ? 18.623  48.062  27.682 1.00 27.40 ? 115  GLY A C     1 
ATOM   2373  O  O     . GLY B 2 114 ? 18.207  48.255  28.821 1.00 29.27 ? 115  GLY A O     1 
ATOM   2374  N  N     . ASP B 2 115 ? 17.850  47.608  26.702 1.00 27.13 ? 116  ASP A N     1 
ATOM   2375  C  CA    . ASP B 2 115 ? 16.444  47.311  26.945 1.00 26.59 ? 116  ASP A CA    1 
ATOM   2376  C  C     . ASP B 2 115 ? 16.278  46.121  27.888 1.00 25.96 ? 116  ASP A C     1 
ATOM   2377  O  O     . ASP B 2 115 ? 16.951  45.102  27.746 1.00 28.28 ? 116  ASP A O     1 
ATOM   2378  C  CB    . ASP B 2 115 ? 15.721  47.029  25.626 1.00 31.97 ? 116  ASP A CB    1 
ATOM   2379  C  CG    . ASP B 2 115 ? 15.701  48.227  24.703 1.00 37.66 ? 116  ASP A CG    1 
ATOM   2380  O  OD1   . ASP B 2 115 ? 16.271  49.277  25.076 1.00 48.43 ? 116  ASP A OD1   1 
ATOM   2381  O  OD2   . ASP B 2 115 ? 15.116  48.119  23.604 1.00 38.39 ? 116  ASP A OD2   1 
ATOM   2382  N  N     . GLY B 2 116 ? 15.366  46.268  28.849 1.00 22.91 ? 117  GLY A N     1 
ATOM   2383  C  CA    . GLY B 2 116 ? 15.076  45.214  29.812 1.00 18.61 ? 117  GLY A CA    1 
ATOM   2384  C  C     . GLY B 2 116 ? 14.164  44.158  29.217 1.00 16.53 ? 117  GLY A C     1 
ATOM   2385  O  O     . GLY B 2 116 ? 13.475  44.419  28.229 1.00 15.68 ? 117  GLY A O     1 
ATOM   2386  N  N     . ALA B 2 117 ? 14.146  42.968  29.802 1.00 15.25 ? 118  ALA A N     1 
ATOM   2387  C  CA    . ALA B 2 117 ? 13.279  41.921  29.293 1.00 15.00 ? 118  ALA A CA    1 
ATOM   2388  C  C     . ALA B 2 117 ? 11.820  42.307  29.521 1.00 15.05 ? 118  ALA A C     1 
ATOM   2389  O  O     . ALA B 2 117 ? 11.523  43.183  30.330 1.00 16.40 ? 118  ALA A O     1 
ATOM   2390  C  CB    . ALA B 2 117 ? 13.591  40.597  29.975 1.00 13.56 ? 118  ALA A CB    1 
ATOM   2391  N  N     . ALA B 2 118 ? 10.915  41.658  28.795 1.00 14.44 ? 119  ALA A N     1 
ATOM   2392  C  CA    . ALA B 2 118 ? 9.483   41.868  28.982 1.00 14.02 ? 119  ALA A CA    1 
ATOM   2393  C  C     . ALA B 2 118 ? 9.115   41.326  30.367 1.00 14.14 ? 119  ALA A C     1 
ATOM   2394  O  O     . ALA B 2 118 ? 9.802   40.446  30.892 1.00 13.57 ? 119  ALA A O     1 
ATOM   2395  C  CB    . ALA B 2 118 ? 8.702   41.143  27.901 1.00 12.05 ? 119  ALA A CB    1 
ATOM   2396  N  N     . ALA B 2 119 ? 8.026   41.821  30.946 1.00 14.76 ? 120  ALA A N     1 
ATOM   2397  C  CA    . ALA B 2 119 ? 7.577   41.354  32.258 1.00 15.47 ? 120  ALA A CA    1 
ATOM   2398  C  C     . ALA B 2 119 ? 7.515   39.833  32.278 1.00 15.64 ? 120  ALA A C     1 
ATOM   2399  O  O     . ALA B 2 119 ? 7.115   39.217  31.297 1.00 16.14 ? 120  ALA A O     1 
ATOM   2400  C  CB    . ALA B 2 119 ? 6.222   41.953  32.581 1.00 16.22 ? 120  ALA A CB    1 
ATOM   2401  N  N     . MET B 2 120 ? 7.911   39.228  33.388 1.00 15.85 ? 121  MET A N     1 
ATOM   2402  C  CA    . MET B 2 120 ? 7.931   37.764  33.492 1.00 17.06 ? 121  MET A CA    1 
ATOM   2403  C  C     . MET B 2 120 ? 6.652   37.019  33.092 1.00 16.99 ? 121  MET A C     1 
ATOM   2404  O  O     . MET B 2 120 ? 6.725   35.866  32.703 1.00 17.75 ? 121  MET A O     1 
ATOM   2405  C  CB    . MET B 2 120 ? 8.448   37.297  34.860 1.00 17.99 ? 121  MET A CB    1 
ATOM   2406  C  CG    . MET B 2 120 ? 7.594   37.682  36.049 1.00 19.46 ? 121  MET A CG    1 
ATOM   2407  S  SD    . MET B 2 120 ? 8.283   37.099  37.607 1.00 20.36 ? 121  MET A SD    1 
ATOM   2408  C  CE    . MET B 2 120 ? 9.672   38.170  37.825 1.00 22.08 ? 121  MET A CE    1 
ATOM   2409  N  N     A ARG B 2 121 ? 5.497   37.683  33.181 0.50 15.96 ? 122  ARG A N     1 
ATOM   2410  N  N     B ARG B 2 121 ? 5.457   37.602  33.170 0.50 16.63 ? 122  ARG A N     1 
ATOM   2411  C  CA    A ARG B 2 121 ? 4.234   37.037  32.801 0.50 15.77 ? 122  ARG A CA    1 
ATOM   2412  C  CA    B ARG B 2 121 ? 4.274   36.886  32.748 0.50 16.70 ? 122  ARG A CA    1 
ATOM   2413  C  C     A ARG B 2 121 ? 4.178   36.702  31.305 0.50 15.16 ? 122  ARG A C     1 
ATOM   2414  C  C     B ARG B 2 121 ? 4.300   36.575  31.263 0.50 15.74 ? 122  ARG A C     1 
ATOM   2415  O  O     A ARG B 2 121 ? 3.469   35.782  30.896 0.50 15.07 ? 122  ARG A O     1 
ATOM   2416  O  O     B ARG B 2 121 ? 3.577   35.724  30.811 0.50 15.62 ? 122  ARG A O     1 
ATOM   2417  C  CB    A ARG B 2 121 ? 3.010   37.891  33.212 0.50 15.61 ? 122  ARG A CB    1 
ATOM   2418  C  CB    B ARG B 2 121 ? 2.998   37.600  33.176 0.50 17.62 ? 122  ARG A CB    1 
ATOM   2419  C  CG    A ARG B 2 121 ? 2.889   39.283  32.591 0.50 15.23 ? 122  ARG A CG    1 
ATOM   2420  C  CG    B ARG B 2 121 ? 2.741   38.921  32.497 0.50 18.24 ? 122  ARG A CG    1 
ATOM   2421  C  CD    A ARG B 2 121 ? 1.548   39.940  32.927 0.50 14.94 ? 122  ARG A CD    1 
ATOM   2422  C  CD    B ARG B 2 121 ? 1.625   39.698  33.175 0.50 19.10 ? 122  ARG A CD    1 
ATOM   2423  N  NE    A ARG B 2 121 ? 0.433   39.341  32.172 0.50 14.73 ? 122  ARG A NE    1 
ATOM   2424  N  NE    B ARG B 2 121 ? 1.518   40.995  32.537 0.50 19.67 ? 122  ARG A NE    1 
ATOM   2425  C  CZ    A ARG B 2 121 ? -0.377  40.006  31.343 0.50 13.68 ? 122  ARG A CZ    1 
ATOM   2426  C  CZ    B ARG B 2 121 ? 2.000   42.110  33.068 0.50 20.32 ? 122  ARG A CZ    1 
ATOM   2427  N  NH1   A ARG B 2 121 ? -0.230  41.314  31.156 0.50 13.43 ? 122  ARG A NH1   1 
ATOM   2428  N  NH1   B ARG B 2 121 ? 2.546   42.082  34.288 0.50 20.43 ? 122  ARG A NH1   1 
ATOM   2429  N  NH2   A ARG B 2 121 ? -1.337  39.352  30.709 0.50 12.86 ? 122  ARG A NH2   1 
ATOM   2430  N  NH2   B ARG B 2 121 ? 1.909   43.252  32.399 0.50 19.98 ? 122  ARG A NH2   1 
ATOM   2431  N  N     . PHE B 2 122 ? 4.943   37.443  30.504 1.00 14.98 ? 123  PHE A N     1 
ATOM   2432  C  CA    . PHE B 2 122 ? 4.974   37.246  29.060 1.00 14.04 ? 123  PHE A CA    1 
ATOM   2433  C  C     . PHE B 2 122 ? 6.006   36.232  28.571 1.00 15.05 ? 123  PHE A C     1 
ATOM   2434  O  O     . PHE B 2 122 ? 5.802   35.579  27.551 1.00 14.24 ? 123  PHE A O     1 
ATOM   2435  C  CB    . PHE B 2 122 ? 5.227   38.570  28.341 1.00 13.29 ? 123  PHE A CB    1 
ATOM   2436  C  CG    . PHE B 2 122 ? 4.157   39.595  28.553 1.00 13.57 ? 123  PHE A CG    1 
ATOM   2437  C  CD1   . PHE B 2 122 ? 2.856   39.393  28.050 1.00 13.37 ? 123  PHE A CD1   1 
ATOM   2438  C  CD2   . PHE B 2 122 ? 4.425   40.763  29.269 1.00 12.90 ? 123  PHE A CD2   1 
ATOM   2439  C  CE1   . PHE B 2 122 ? 1.874   40.348  28.244 1.00 12.93 ? 123  PHE A CE1   1 
ATOM   2440  C  CE2   . PHE B 2 122 ? 3.438   41.723  29.461 1.00 13.03 ? 123  PHE A CE2   1 
ATOM   2441  C  CZ    . PHE B 2 122 ? 2.160   41.512  28.954 1.00 13.04 ? 123  PHE A CZ    1 
ATOM   2442  N  N     . THR B 2 123 ? 7.111   36.107  29.298 1.00 15.61 ? 124  THR A N     1 
ATOM   2443  C  CA    . THR B 2 123 ? 8.209   35.254  28.863 1.00 15.31 ? 124  THR A CA    1 
ATOM   2444  C  C     . THR B 2 123 ? 8.140   33.812  29.379 1.00 15.42 ? 124  THR A C     1 
ATOM   2445  O  O     . THR B 2 123 ? 7.421   33.500  30.325 1.00 14.96 ? 124  THR A O     1 
ATOM   2446  C  CB    . THR B 2 123 ? 9.582   35.896  29.194 1.00 15.20 ? 124  THR A CB    1 
ATOM   2447  O  OG1   . THR B 2 123 ? 9.715   36.061  30.611 1.00 16.01 ? 124  THR A OG1   1 
ATOM   2448  C  CG2   . THR B 2 123 ? 9.709   37.251  28.530 1.00 14.41 ? 124  THR A CG2   1 
ATOM   2449  N  N     . GLU B 2 124 ? 8.888   32.942  28.716 1.00 15.59 ? 125  GLU A N     1 
ATOM   2450  C  CA    . GLU B 2 124 ? 8.993   31.533  29.057 1.00 16.03 ? 125  GLU A CA    1 
ATOM   2451  C  C     . GLU B 2 124 ? 10.451  31.124  28.882 1.00 15.67 ? 125  GLU A C     1 
ATOM   2452  O  O     . GLU B 2 124 ? 11.179  31.710  28.074 1.00 15.17 ? 125  GLU A O     1 
ATOM   2453  C  CB    . GLU B 2 124 ? 8.097   30.682  28.140 1.00 18.12 ? 125  GLU A CB    1 
ATOM   2454  C  CG    . GLU B 2 124 ? 6.596   30.962  28.251 1.00 20.17 ? 125  GLU A CG    1 
ATOM   2455  C  CD    . GLU B 2 124 ? 5.739   30.165  27.274 1.00 23.35 ? 125  GLU A CD    1 
ATOM   2456  O  OE1   . GLU B 2 124 ? 6.290   29.336  26.496 1.00 25.20 ? 125  GLU A OE1   1 
ATOM   2457  O  OE2   . GLU B 2 124 ? 4.498   30.382  27.272 1.00 24.57 ? 125  GLU A OE2   1 
ATOM   2458  N  N     . ALA B 2 125 ? 10.880  30.114  29.624 1.00 16.01 ? 126  ALA A N     1 
ATOM   2459  C  CA    . ALA B 2 125 ? 12.263  29.658  29.542 1.00 15.63 ? 126  ALA A CA    1 
ATOM   2460  C  C     . ALA B 2 125 ? 12.440  28.173  29.830 1.00 15.00 ? 126  ALA A C     1 
ATOM   2461  O  O     . ALA B 2 125 ? 11.528  27.511  30.322 1.00 13.17 ? 126  ALA A O     1 
ATOM   2462  C  CB    . ALA B 2 125 ? 13.158  30.487  30.473 1.00 15.15 ? 126  ALA A CB    1 
ATOM   2463  N  N     . ARG B 2 126 ? 13.639  27.689  29.513 1.00 15.59 ? 127  ARG A N     1 
ATOM   2464  C  CA    . ARG B 2 126 ? 14.048  26.308  29.722 1.00 14.85 ? 127  ARG A CA    1 
ATOM   2465  C  C     . ARG B 2 126 ? 15.578  26.196  29.716 1.00 14.81 ? 127  ARG A C     1 
ATOM   2466  O  O     . ARG B 2 126 ? 16.276  27.135  29.381 1.00 14.41 ? 127  ARG A O     1 
ATOM   2467  C  CB    . ARG B 2 126 ? 13.429  25.389  28.673 1.00 14.75 ? 127  ARG A CB    1 
ATOM   2468  C  CG    . ARG B 2 126 ? 13.818  25.708  27.247 1.00 16.41 ? 127  ARG A CG    1 
ATOM   2469  C  CD    . ARG B 2 126 ? 13.204  24.721  26.278 1.00 19.08 ? 127  ARG A CD    1 
ATOM   2470  N  NE    . ARG B 2 126 ? 13.541  25.045  24.903 1.00 20.74 ? 127  ARG A NE    1 
ATOM   2471  C  CZ    . ARG B 2 126 ? 12.901  24.567  23.845 1.00 22.22 ? 127  ARG A CZ    1 
ATOM   2472  N  NH1   . ARG B 2 126 ? 11.881  23.742  23.998 1.00 24.12 ? 127  ARG A NH1   1 
ATOM   2473  N  NH2   . ARG B 2 126 ? 13.279  24.924  22.635 1.00 20.93 ? 127  ARG A NH2   1 
ATOM   2474  N  N     . MET B 2 127 ? 16.092  25.040  30.103 1.00 15.32 ? 128  MET A N     1 
ATOM   2475  C  CA    . MET B 2 127 ? 17.527  24.801  30.125 1.00 15.43 ? 128  MET A CA    1 
ATOM   2476  C  C     . MET B 2 127 ? 18.092  24.698  28.709 1.00 15.64 ? 128  MET A C     1 
ATOM   2477  O  O     . MET B 2 127 ? 17.405  24.265  27.797 1.00 15.41 ? 128  MET A O     1 
ATOM   2478  C  CB    . MET B 2 127 ? 17.834  23.486  30.823 1.00 16.44 ? 128  MET A CB    1 
ATOM   2479  C  CG    . MET B 2 127 ? 17.692  23.477  32.325 1.00 18.52 ? 128  MET A CG    1 
ATOM   2480  S  SD    . MET B 2 127 ? 17.893  21.792  32.927 1.00 20.01 ? 128  MET A SD    1 
ATOM   2481  C  CE    . MET B 2 127 ? 19.284  21.294  31.963 1.00 19.06 ? 128  MET A CE    1 
ATOM   2482  N  N     . THR B 2 128 ? 19.353  25.093  28.542 1.00 14.35 ? 129  THR A N     1 
ATOM   2483  C  CA    . THR B 2 128 ? 20.020  24.946  27.261 1.00 13.97 ? 129  THR A CA    1 
ATOM   2484  C  C     . THR B 2 128 ? 20.672  23.587  27.290 1.00 14.32 ? 129  THR A C     1 
ATOM   2485  O  O     . THR B 2 128 ? 20.847  23.022  28.353 1.00 14.61 ? 129  THR A O     1 
ATOM   2486  C  CB    . THR B 2 128 ? 21.084  26.020  26.956 1.00 13.85 ? 129  THR A CB    1 
ATOM   2487  O  OG1   . THR B 2 128 ? 22.093  26.008  27.974 1.00 14.27 ? 129  THR A OG1   1 
ATOM   2488  C  CG2   . THR B 2 128 ? 20.469  27.374  26.852 1.00 13.45 ? 129  THR A CG2   1 
ATOM   2489  N  N     . LYS B 2 129 ? 21.014  23.046  26.133 1.00 15.02 ? 130  LYS A N     1 
ATOM   2490  C  CA    . LYS B 2 129 ? 21.644  21.731  26.084 1.00 15.57 ? 130  LYS A CA    1 
ATOM   2491  C  C     . LYS B 2 129 ? 22.948  21.664  26.872 1.00 15.18 ? 130  LYS A C     1 
ATOM   2492  O  O     . LYS B 2 129 ? 23.256  20.653  27.476 1.00 14.24 ? 130  LYS A O     1 
ATOM   2493  C  CB    . LYS B 2 129 ? 21.863  21.292  24.643 1.00 16.13 ? 130  LYS A CB    1 
ATOM   2494  C  CG    . LYS B 2 129 ? 20.627  20.698  24.005 1.00 18.16 ? 130  LYS A CG    1 
ATOM   2495  C  CD    . LYS B 2 129 ? 20.817  20.487  22.521 1.00 19.41 ? 130  LYS A CD    1 
ATOM   2496  C  CE    . LYS B 2 129 ? 19.456  20.078  21.930 1.00 22.19 ? 130  LYS A CE    1 
ATOM   2497  N  NZ    . LYS B 2 129 ? 19.392  20.157  20.434 1.00 22.21 ? 130  LYS A NZ    1 
ATOM   2498  N  N     . ILE B 2 130 ? 23.707  22.755  26.857 1.00 14.75 ? 131  ILE A N     1 
ATOM   2499  C  CA    . ILE B 2 130 ? 24.981  22.809  27.575 1.00 14.61 ? 131  ILE A CA    1 
ATOM   2500  C  C     . ILE B 2 130 ? 24.809  22.846  29.097 1.00 15.00 ? 131  ILE A C     1 
ATOM   2501  O  O     . ILE B 2 130 ? 25.731  22.507  29.842 1.00 18.34 ? 131  ILE A O     1 
ATOM   2502  C  CB    . ILE B 2 130 ? 25.895  23.953  27.065 1.00 13.48 ? 131  ILE A CB    1 
ATOM   2503  C  CG1   . ILE B 2 130 ? 27.364  23.675  27.434 1.00 13.56 ? 131  ILE A CG1   1 
ATOM   2504  C  CG2   . ILE B 2 130 ? 25.396  25.331  27.531 1.00 12.34 ? 131  ILE A CG2   1 
ATOM   2505  C  CD1   . ILE B 2 130 ? 28.372  24.591  26.740 1.00 13.38 ? 131  ILE A CD1   1 
ATOM   2506  N  N     . THR B 2 131 ? 23.636  23.252  29.555 1.00 14.60 ? 132  THR A N     1 
ATOM   2507  C  CA    . THR B 2 131 ? 23.364  23.329  30.981 1.00 14.13 ? 132  THR A CA    1 
ATOM   2508  C  C     . THR B 2 131 ? 23.203  21.932  31.579 1.00 14.50 ? 132  THR A C     1 
ATOM   2509  O  O     . THR B 2 131 ? 23.475  21.721  32.751 1.00 15.18 ? 132  THR A O     1 
ATOM   2510  C  CB    . THR B 2 131 ? 22.144  24.225  31.273 1.00 13.72 ? 132  THR A CB    1 
ATOM   2511  O  OG1   . THR B 2 131 ? 22.470  25.574  30.938 1.00 14.31 ? 132  THR A OG1   1 
ATOM   2512  C  CG2   . THR B 2 131 ? 21.774  24.181  32.735 1.00 12.73 ? 132  THR A CG2   1 
ATOM   2513  N  N     . LEU B 2 132 ? 22.778  20.988  30.758 1.00 14.12 ? 133  LEU A N     1 
ATOM   2514  C  CA    . LEU B 2 132 ? 22.601  19.613  31.188 1.00 14.27 ? 133  LEU A CA    1 
ATOM   2515  C  C     . LEU B 2 132 ? 23.924  19.062  31.673 1.00 14.85 ? 133  LEU A C     1 
ATOM   2516  O  O     . LEU B 2 132 ? 23.969  18.210  32.545 1.00 14.00 ? 133  LEU A O     1 
ATOM   2517  C  CB    . LEU B 2 132 ? 22.095  18.746  30.035 1.00 14.07 ? 133  LEU A CB    1 
ATOM   2518  C  CG    . LEU B 2 132 ? 20.696  19.016  29.478 1.00 13.83 ? 133  LEU A CG    1 
ATOM   2519  C  CD1   . LEU B 2 132 ? 20.529  18.284  28.160 1.00 13.04 ? 133  LEU A CD1   1 
ATOM   2520  C  CD2   . LEU B 2 132 ? 19.628  18.601  30.468 1.00 13.59 ? 133  LEU A CD2   1 
ATOM   2521  N  N     . GLU B 2 133 ? 25.000  19.574  31.089 1.00 16.51 ? 134  GLU A N     1 
ATOM   2522  C  CA    . GLU B 2 133 ? 26.356  19.162  31.438 1.00 18.68 ? 134  GLU A CA    1 
ATOM   2523  C  C     . GLU B 2 133 ? 26.777  19.648  32.822 1.00 17.69 ? 134  GLU A C     1 
ATOM   2524  O  O     . GLU B 2 133 ? 27.590  19.008  33.474 1.00 17.39 ? 134  GLU A O     1 
ATOM   2525  C  CB    . GLU B 2 133 ? 27.359  19.599  30.363 1.00 19.34 ? 134  GLU A CB    1 
ATOM   2526  C  CG    . GLU B 2 133 ? 27.072  19.016  28.968 1.00 21.39 ? 134  GLU A CG    1 
ATOM   2527  C  CD    . GLU B 2 133 ? 26.994  17.497  28.936 1.00 20.64 ? 134  GLU A CD    1 
ATOM   2528  O  OE1   . GLU B 2 133 ? 26.278  16.960  28.071 1.00 22.48 ? 134  GLU A OE1   1 
ATOM   2529  O  OE2   . GLU B 2 133 ? 27.632  16.831  29.777 1.00 24.28 ? 134  GLU A OE2   1 
ATOM   2530  N  N     . LEU B 2 134 ? 26.223  20.779  33.256 1.00 17.47 ? 135  LEU A N     1 
ATOM   2531  C  CA    . LEU B 2 134 ? 26.496  21.303  34.595 1.00 16.32 ? 135  LEU A CA    1 
ATOM   2532  C  C     . LEU B 2 134 ? 25.794  20.443  35.637 1.00 17.01 ? 135  LEU A C     1 
ATOM   2533  O  O     . LEU B 2 134 ? 26.323  20.206  36.721 1.00 17.89 ? 135  LEU A O     1 
ATOM   2534  C  CB    . LEU B 2 134 ? 26.029  22.756  34.738 1.00 15.66 ? 135  LEU A CB    1 
ATOM   2535  C  CG    . LEU B 2 134 ? 26.761  23.899  34.025 1.00 15.62 ? 135  LEU A CG    1 
ATOM   2536  C  CD1   . LEU B 2 134 ? 26.030  25.206  34.207 1.00 13.21 ? 135  LEU A CD1   1 
ATOM   2537  C  CD2   . LEU B 2 134 ? 28.200  24.016  34.525 1.00 15.62 ? 135  LEU A CD2   1 
ATOM   2538  N  N     . LEU B 2 135 ? 24.600  19.982  35.292 1.00 17.93 ? 136  LEU A N     1 
ATOM   2539  C  CA    . LEU B 2 135 ? 23.789  19.178  36.188 1.00 18.51 ? 136  LEU A CA    1 
ATOM   2540  C  C     . LEU B 2 135 ? 23.978  17.677  36.052 1.00 18.46 ? 136  LEU A C     1 
ATOM   2541  O  O     . LEU B 2 135 ? 23.444  16.919  36.848 1.00 17.48 ? 136  LEU A O     1 
ATOM   2542  C  CB    . LEU B 2 135 ? 22.314  19.541  35.992 1.00 18.68 ? 136  LEU A CB    1 
ATOM   2543  C  CG    . LEU B 2 135 ? 21.956  21.009  36.252 1.00 19.62 ? 136  LEU A CG    1 
ATOM   2544  C  CD1   . LEU B 2 135 ? 20.652  21.403  35.589 1.00 20.06 ? 136  LEU A CD1   1 
ATOM   2545  C  CD2   . LEU B 2 135 ? 21.933  21.307  37.739 1.00 18.08 ? 136  LEU A CD2   1 
ATOM   2546  N  N     . ARG B 2 136 ? 24.741  17.253  35.044 1.00 18.73 ? 137  ARG A N     1 
ATOM   2547  C  CA    . ARG B 2 136 ? 24.973  15.829  34.794 1.00 18.97 ? 137  ARG A CA    1 
ATOM   2548  C  C     . ARG B 2 136 ? 25.587  15.154  36.022 1.00 18.49 ? 137  ARG A C     1 
ATOM   2549  O  O     . ARG B 2 136 ? 26.588  15.626  36.562 1.00 18.56 ? 137  ARG A O     1 
ATOM   2550  C  CB    . ARG B 2 136 ? 25.874  15.632  33.563 1.00 21.29 ? 137  ARG A CB    1 
ATOM   2551  C  CG    . ARG B 2 136 ? 25.624  14.315  32.833 1.00 24.73 ? 137  ARG A CG    1 
ATOM   2552  C  CD    . ARG B 2 136 ? 26.407  14.199  31.518 1.00 26.76 ? 137  ARG A CD    1 
ATOM   2553  N  NE    . ARG B 2 136 ? 27.778  13.741  31.722 1.00 31.29 ? 137  ARG A NE    1 
ATOM   2554  C  CZ    . ARG B 2 136 ? 28.645  13.442  30.748 1.00 33.76 ? 137  ARG A CZ    1 
ATOM   2555  N  NH1   . ARG B 2 136 ? 28.305  13.560  29.480 1.00 35.01 ? 137  ARG A NH1   1 
ATOM   2556  N  NH2   . ARG B 2 136 ? 29.863  13.017  31.059 1.00 35.22 ? 137  ARG A NH2   1 
ATOM   2557  N  N     . ASP B 2 137 ? 24.957  14.064  36.459 1.00 17.59 ? 138  ASP A N     1 
ATOM   2558  C  CA    . ASP B 2 137 ? 25.389  13.261  37.609 1.00 17.61 ? 138  ASP A CA    1 
ATOM   2559  C  C     . ASP B 2 137 ? 25.104  13.895  38.978 1.00 17.75 ? 138  ASP A C     1 
ATOM   2560  O  O     . ASP B 2 137 ? 25.703  13.500  39.983 1.00 17.04 ? 138  ASP A O     1 
ATOM   2561  C  CB    . ASP B 2 137 ? 26.890  12.895  37.508 1.00 19.15 ? 138  ASP A CB    1 
ATOM   2562  C  CG    . ASP B 2 137 ? 27.254  12.223  36.192 1.00 20.10 ? 138  ASP A CG    1 
ATOM   2563  O  OD1   . ASP B 2 137 ? 26.413  11.523  35.590 1.00 21.06 ? 138  ASP A OD1   1 
ATOM   2564  O  OD2   . ASP B 2 137 ? 28.414  12.394  35.774 1.00 23.28 ? 138  ASP A OD2   1 
ATOM   2565  N  N     . ILE B 2 138 ? 24.192  14.869  39.019 1.00 16.48 ? 139  ILE A N     1 
ATOM   2566  C  CA    . ILE B 2 138 ? 23.835  15.531  40.284 1.00 16.31 ? 139  ILE A CA    1 
ATOM   2567  C  C     . ILE B 2 138 ? 23.069  14.589  41.233 1.00 17.28 ? 139  ILE A C     1 
ATOM   2568  O  O     . ILE B 2 138 ? 23.071  14.780  42.444 1.00 16.51 ? 139  ILE A O     1 
ATOM   2569  C  CB    . ILE B 2 138 ? 23.037  16.848  40.054 1.00 15.03 ? 139  ILE A CB    1 
ATOM   2570  C  CG1   . ILE B 2 138 ? 23.063  17.723  41.312 1.00 14.55 ? 139  ILE A CG1   1 
ATOM   2571  C  CG2   . ILE B 2 138 ? 21.611  16.565  39.545 1.00 14.22 ? 139  ILE A CG2   1 
ATOM   2572  C  CD1   . ILE B 2 138 ? 22.442  19.095  41.139 1.00 15.08 ? 139  ILE A CD1   1 
ATOM   2573  N  N     . ASN B 2 139 ? 22.432  13.577  40.656 1.00 17.65 ? 140  ASN A N     1 
ATOM   2574  C  CA    . ASN B 2 139 ? 21.648  12.594  41.401 1.00 19.83 ? 140  ASN A CA    1 
ATOM   2575  C  C     . ASN B 2 139 ? 22.366  11.261  41.543 1.00 20.24 ? 140  ASN A C     1 
ATOM   2576  O  O     . ASN B 2 139 ? 21.729  10.210  41.642 1.00 20.98 ? 140  ASN A O     1 
ATOM   2577  C  CB    . ASN B 2 139 ? 20.279  12.403  40.735 1.00 18.55 ? 140  ASN A CB    1 
ATOM   2578  C  CG    . ASN B 2 139 ? 19.383  13.613  40.916 1.00 18.74 ? 140  ASN A CG    1 
ATOM   2579  O  OD1   . ASN B 2 139 ? 19.353  14.224  41.999 1.00 17.18 ? 140  ASN A OD1   1 
ATOM   2580  N  ND2   . ASN B 2 139 ? 18.644  13.967  39.862 1.00 17.03 ? 140  ASN A ND2   1 
ATOM   2581  N  N     . LYS B 2 140 ? 23.694  11.328  41.551 1.00 20.06 ? 141  LYS A N     1 
ATOM   2582  C  CA    . LYS B 2 140 ? 24.559  10.167  41.712 1.00 19.87 ? 141  LYS A CA    1 
ATOM   2583  C  C     . LYS B 2 140 ? 25.580  10.436  42.815 1.00 18.88 ? 141  LYS A C     1 
ATOM   2584  O  O     . LYS B 2 140 ? 26.728  9.989   42.725 1.00 20.55 ? 141  LYS A O     1 
ATOM   2585  C  CB    . LYS B 2 140 ? 25.272  9.834   40.393 1.00 21.00 ? 141  LYS A CB    1 
ATOM   2586  C  CG    . LYS B 2 140 ? 24.340  9.467   39.258 1.00 23.96 ? 141  LYS A CG    1 
ATOM   2587  C  CD    . LYS B 2 140 ? 25.089  9.317   37.952 1.00 28.00 ? 141  LYS A CD    1 
ATOM   2588  C  CE    . LYS B 2 140 ? 24.116  9.118   36.791 1.00 28.74 ? 141  LYS A CE    1 
ATOM   2589  N  NZ    . LYS B 2 140 ? 24.851  9.095   35.494 1.00 31.55 ? 141  LYS A NZ    1 
ATOM   2590  N  N     . ASP B 2 141 ? 25.161  11.188  43.831 1.00 17.78 ? 142  ASP A N     1 
ATOM   2591  C  CA    . ASP B 2 141 ? 25.992  11.522  45.005 1.00 19.32 ? 142  ASP A CA    1 
ATOM   2592  C  C     . ASP B 2 141 ? 27.368  12.126  44.654 1.00 18.38 ? 142  ASP A C     1 
ATOM   2593  O  O     . ASP B 2 141 ? 28.375  11.842  45.305 1.00 19.54 ? 142  ASP A O     1 
ATOM   2594  C  CB    . ASP B 2 141 ? 26.153  10.287  45.911 1.00 18.80 ? 142  ASP A CB    1 
ATOM   2595  C  CG    . ASP B 2 141 ? 26.802  10.610  47.242 1.00 20.40 ? 142  ASP A CG    1 
ATOM   2596  O  OD1   . ASP B 2 141 ? 26.715  11.774  47.709 1.00 22.87 ? 142  ASP A OD1   1 
ATOM   2597  O  OD2   . ASP B 2 141 ? 27.425  9.687   47.819 1.00 22.28 ? 142  ASP A OD2   1 
ATOM   2598  N  N     . THR B 2 142 ? 27.398  12.961  43.624 1.00 16.95 ? 143  THR A N     1 
ATOM   2599  C  CA    . THR B 2 142 ? 28.636  13.586  43.191 1.00 15.64 ? 143  THR A CA    1 
ATOM   2600  C  C     . THR B 2 142 ? 28.955  14.844  43.982 1.00 14.17 ? 143  THR A C     1 
ATOM   2601  O  O     . THR B 2 142 ? 30.126  15.168  44.203 1.00 13.45 ? 143  THR A O     1 
ATOM   2602  C  CB    . THR B 2 142 ? 28.601  13.935  41.705 1.00 15.93 ? 143  THR A CB    1 
ATOM   2603  O  OG1   . THR B 2 142 ? 27.433  14.720  41.431 1.00 16.81 ? 143  THR A OG1   1 
ATOM   2604  C  CG2   . THR B 2 142 ? 28.582  12.661  40.866 1.00 17.37 ? 143  THR A CG2   1 
ATOM   2605  N  N     . ILE B 2 143 ? 27.910  15.546  44.409 1.00 13.11 ? 144  ILE A N     1 
ATOM   2606  C  CA    . ILE B 2 143 ? 28.071  16.799  45.146 1.00 13.14 ? 144  ILE A CA    1 
ATOM   2607  C  C     . ILE B 2 143 ? 27.271  16.810  46.460 1.00 13.34 ? 144  ILE A C     1 
ATOM   2608  O  O     . ILE B 2 143 ? 26.303  16.056  46.610 1.00 12.49 ? 144  ILE A O     1 
ATOM   2609  C  CB    . ILE B 2 143 ? 27.770  18.047  44.233 1.00 12.20 ? 144  ILE A CB    1 
ATOM   2610  C  CG1   . ILE B 2 143 ? 26.356  18.009  43.631 1.00 11.69 ? 144  ILE A CG1   1 
ATOM   2611  C  CG2   . ILE B 2 143 ? 28.775  18.132  43.093 1.00 11.47 ? 144  ILE A CG2   1 
ATOM   2612  C  CD1   . ILE B 2 143 ? 25.225  18.412  44.568 1.00 10.88 ? 144  ILE A CD1   1 
ATOM   2613  N  N     . ASP B 2 144 ? 27.701  17.653  47.400 1.00 13.25 ? 145  ASP A N     1 
ATOM   2614  C  CA    . ASP B 2 144 ? 27.046  17.778  48.704 1.00 13.88 ? 145  ASP A CA    1 
ATOM   2615  C  C     . ASP B 2 144 ? 25.797  18.654  48.681 1.00 13.79 ? 145  ASP A C     1 
ATOM   2616  O  O     . ASP B 2 144 ? 25.824  19.777  48.181 1.00 14.30 ? 145  ASP A O     1 
ATOM   2617  C  CB    . ASP B 2 144 ? 28.018  18.326  49.765 1.00 14.03 ? 145  ASP A CB    1 
ATOM   2618  C  CG    . ASP B 2 144 ? 29.070  17.301  50.207 1.00 14.58 ? 145  ASP A CG    1 
ATOM   2619  O  OD1   . ASP B 2 144 ? 28.968  16.104  49.875 1.00 14.12 ? 145  ASP A OD1   1 
ATOM   2620  O  OD2   . ASP B 2 144 ? 29.987  17.673  50.956 1.00 15.64 ? 145  ASP A OD2   1 
ATOM   2621  N  N     . PHE B 2 145 ? 24.705  18.136  49.227 1.00 13.95 ? 146  PHE A N     1 
ATOM   2622  C  CA    . PHE B 2 145 ? 23.471  18.888  49.378 1.00 12.65 ? 146  PHE A CA    1 
ATOM   2623  C  C     . PHE B 2 145 ? 23.443  19.491  50.775 1.00 13.31 ? 146  PHE A C     1 
ATOM   2624  O  O     . PHE B 2 145 ? 24.069  18.961  51.693 1.00 13.47 ? 146  PHE A O     1 
ATOM   2625  C  CB    . PHE B 2 145 ? 22.234  18.003  49.179 1.00 12.41 ? 146  PHE A CB    1 
ATOM   2626  C  CG    . PHE B 2 145 ? 21.907  17.694  47.736 1.00 12.33 ? 146  PHE A CG    1 
ATOM   2627  C  CD1   . PHE B 2 145 ? 21.076  18.539  47.007 1.00 11.69 ? 146  PHE A CD1   1 
ATOM   2628  C  CD2   . PHE B 2 145 ? 22.400  16.538  47.125 1.00 12.65 ? 146  PHE A CD2   1 
ATOM   2629  C  CE1   . PHE B 2 145 ? 20.764  18.255  45.668 1.00 11.53 ? 146  PHE A CE1   1 
ATOM   2630  C  CE2   . PHE B 2 145 ? 22.079  16.245  45.779 1.00 12.88 ? 146  PHE A CE2   1 
ATOM   2631  C  CZ    . PHE B 2 145 ? 21.260  17.102  45.054 1.00 11.35 ? 146  PHE A CZ    1 
ATOM   2632  N  N     . ILE B 2 146 ? 22.711  20.586  50.931 1.00 14.19 ? 147  ILE A N     1 
ATOM   2633  C  CA    . ILE B 2 146 ? 22.578  21.246  52.220 1.00 15.08 ? 147  ILE A CA    1 
ATOM   2634  C  C     . ILE B 2 146 ? 21.134  21.650  52.422 1.00 17.44 ? 147  ILE A C     1 
ATOM   2635  O  O     . ILE B 2 146 ? 20.351  21.667  51.483 1.00 18.38 ? 147  ILE A O     1 
ATOM   2636  C  CB    . ILE B 2 146 ? 23.439  22.511  52.332 1.00 14.16 ? 147  ILE A CB    1 
ATOM   2637  C  CG1   . ILE B 2 146 ? 23.181  23.441  51.134 1.00 13.16 ? 147  ILE A CG1   1 
ATOM   2638  C  CG2   . ILE B 2 146 ? 24.906  22.155  52.457 1.00 13.15 ? 147  ILE A CG2   1 
ATOM   2639  C  CD1   . ILE B 2 146 ? 24.057  24.678  51.139 1.00 11.88 ? 147  ILE A CD1   1 
ATOM   2640  N  N     . ASP B 2 147 ? 20.786  21.972  53.660 1.00 17.88 ? 148  ASP A N     1 
ATOM   2641  C  CA    . ASP B 2 147 ? 19.443  22.410  53.972 1.00 18.26 ? 148  ASP A CA    1 
ATOM   2642  C  C     . ASP B 2 147 ? 19.280  23.804  53.403 1.00 18.22 ? 148  ASP A C     1 
ATOM   2643  O  O     . ASP B 2 147 ? 20.251  24.532  53.250 1.00 19.84 ? 148  ASP A O     1 
ATOM   2644  C  CB    . ASP B 2 147 ? 19.208  22.435  55.482 1.00 18.45 ? 148  ASP A CB    1 
ATOM   2645  C  CG    . ASP B 2 147 ? 19.151  21.047  56.086 1.00 22.10 ? 148  ASP A CG    1 
ATOM   2646  O  OD1   . ASP B 2 147 ? 19.093  20.055  55.340 1.00 22.64 ? 148  ASP A OD1   1 
ATOM   2647  O  OD2   . ASP B 2 147 ? 19.147  20.934  57.313 1.00 24.11 ? 148  ASP A OD2   1 
ATOM   2648  N  N     . ASN B 2 148 ? 18.048  24.166  53.081 1.00 17.88 ? 149  ASN A N     1 
ATOM   2649  C  CA    . ASN B 2 148 ? 17.727  25.477  52.545 1.00 17.55 ? 149  ASN A CA    1 
ATOM   2650  C  C     . ASN B 2 148 ? 17.558  26.533  53.650 1.00 17.56 ? 149  ASN A C     1 
ATOM   2651  O  O     . ASN B 2 148 ? 17.754  26.246  54.824 1.00 18.05 ? 149  ASN A O     1 
ATOM   2652  C  CB    . ASN B 2 148 ? 16.502  25.408  51.648 1.00 18.00 ? 149  ASN A CB    1 
ATOM   2653  C  CG    . ASN B 2 148 ? 15.225  25.203  52.427 1.00 18.90 ? 149  ASN A CG    1 
ATOM   2654  O  OD1   . ASN B 2 148 ? 15.176  24.405  53.354 1.00 18.61 ? 149  ASN A OD1   1 
ATOM   2655  N  ND2   . ASN B 2 148 ? 14.191  25.925  52.053 1.00 18.46 ? 149  ASN A ND2   1 
ATOM   2656  N  N     . TYR B 2 149 ? 17.233  27.760  53.264 1.00 15.70 ? 150  TYR A N     1 
ATOM   2657  C  CA    . TYR B 2 149 ? 17.063  28.855  54.219 1.00 15.62 ? 150  TYR A CA    1 
ATOM   2658  C  C     . TYR B 2 149 ? 16.080  28.618  55.391 1.00 15.68 ? 150  TYR A C     1 
ATOM   2659  O  O     . TYR B 2 149 ? 16.291  29.135  56.474 1.00 16.79 ? 150  TYR A O     1 
ATOM   2660  C  CB    . TYR B 2 149 ? 16.750  30.170  53.484 1.00 14.05 ? 150  TYR A CB    1 
ATOM   2661  C  CG    . TYR B 2 149 ? 15.364  30.250  52.900 1.00 14.20 ? 150  TYR A CG    1 
ATOM   2662  C  CD1   . TYR B 2 149 ? 15.106  29.816  51.611 1.00 14.74 ? 150  TYR A CD1   1 
ATOM   2663  C  CD2   . TYR B 2 149 ? 14.312  30.759  53.637 1.00 13.81 ? 150  TYR A CD2   1 
ATOM   2664  C  CE1   . TYR B 2 149 ? 13.839  29.885  51.075 1.00 14.16 ? 150  TYR A CE1   1 
ATOM   2665  C  CE2   . TYR B 2 149 ? 13.041  30.825  53.116 1.00 13.37 ? 150  TYR A CE2   1 
ATOM   2666  C  CZ    . TYR B 2 149 ? 12.807  30.390  51.840 1.00 14.30 ? 150  TYR A CZ    1 
ATOM   2667  O  OH    . TYR B 2 149 ? 11.541  30.465  51.324 1.00 13.69 ? 150  TYR A OH    1 
ATOM   2668  N  N     . ASP B 2 150 ? 15.022  27.844  55.177 1.00 15.53 ? 151  ASP A N     1 
ATOM   2669  C  CA    . ASP B 2 150 ? 14.042  27.578  56.239 1.00 18.10 ? 151  ASP A CA    1 
ATOM   2670  C  C     . ASP B 2 150 ? 14.048  26.134  56.765 1.00 18.72 ? 151  ASP A C     1 
ATOM   2671  O  O     . ASP B 2 150 ? 13.398  25.829  57.766 1.00 17.46 ? 151  ASP A O     1 
ATOM   2672  C  CB    . ASP B 2 150 ? 12.619  28.022  55.828 1.00 18.88 ? 151  ASP A CB    1 
ATOM   2673  C  CG    . ASP B 2 150 ? 12.103  27.301  54.576 1.00 20.35 ? 151  ASP A CG    1 
ATOM   2674  O  OD1   . ASP B 2 150 ? 12.657  26.241  54.196 1.00 21.48 ? 151  ASP A OD1   1 
ATOM   2675  O  OD2   . ASP B 2 150 ? 11.121  27.802  53.979 1.00 20.13 ? 151  ASP A OD2   1 
ATOM   2676  N  N     . GLY B 2 151 ? 14.784  25.258  56.083 1.00 19.27 ? 152  GLY A N     1 
ATOM   2677  C  CA    . GLY B 2 151 ? 14.909  23.863  56.493 1.00 19.81 ? 152  GLY A CA    1 
ATOM   2678  C  C     . GLY B 2 151 ? 13.877  22.926  55.888 1.00 20.13 ? 152  GLY A C     1 
ATOM   2679  O  O     . GLY B 2 151 ? 13.862  21.748  56.214 1.00 22.97 ? 152  GLY A O     1 
ATOM   2680  N  N     . ASN B 2 152 ? 13.017  23.447  55.016 1.00 19.27 ? 153  ASN A N     1 
ATOM   2681  C  CA    . ASN B 2 152 ? 11.974  22.636  54.369 1.00 19.73 ? 153  ASN A CA    1 
ATOM   2682  C  C     . ASN B 2 152 ? 12.382  22.010  53.034 1.00 19.96 ? 153  ASN A C     1 
ATOM   2683  O  O     . ASN B 2 152 ? 11.662  21.172  52.494 1.00 20.34 ? 153  ASN A O     1 
ATOM   2684  C  CB    . ASN B 2 152 ? 10.687  23.454  54.188 1.00 20.56 ? 153  ASN A CB    1 
ATOM   2685  C  CG    . ASN B 2 152 ? 10.061  23.860  55.509 1.00 22.38 ? 153  ASN A CG    1 
ATOM   2686  O  OD1   . ASN B 2 152 ? 10.234  23.178  56.523 1.00 25.07 ? 153  ASN A OD1   1 
ATOM   2687  N  ND2   . ASN B 2 152 ? 9.328   24.966  55.511 1.00 22.34 ? 153  ASN A ND2   1 
ATOM   2688  N  N     . GLU B 2 153 ? 13.523  22.437  52.490 1.00 19.24 ? 154  GLU A N     1 
ATOM   2689  C  CA    . GLU B 2 153 ? 13.996  21.920  51.213 1.00 17.87 ? 154  GLU A CA    1 
ATOM   2690  C  C     . GLU B 2 153 ? 15.493  21.614  51.280 1.00 18.12 ? 154  GLU A C     1 
ATOM   2691  O  O     . GLU B 2 153 ? 16.170  21.937  52.266 1.00 17.20 ? 154  GLU A O     1 
ATOM   2692  C  CB    . GLU B 2 153 ? 13.730  22.918  50.075 1.00 17.90 ? 154  GLU A CB    1 
ATOM   2693  C  CG    . GLU B 2 153 ? 12.289  23.404  49.910 1.00 19.02 ? 154  GLU A CG    1 
ATOM   2694  C  CD    . GLU B 2 153 ? 11.279  22.336  49.509 1.00 20.61 ? 154  GLU A CD    1 
ATOM   2695  O  OE1   . GLU B 2 153 ? 11.676  21.276  48.947 1.00 20.20 ? 154  GLU A OE1   1 
ATOM   2696  O  OE2   . GLU B 2 153 ? 10.070  22.586  49.747 1.00 20.61 ? 154  GLU A OE2   1 
ATOM   2697  N  N     . ARG B 2 154 ? 15.990  20.982  50.222 1.00 17.03 ? 155  ARG A N     1 
ATOM   2698  C  CA    . ARG B 2 154 ? 17.407  20.675  50.079 1.00 17.11 ? 155  ARG A CA    1 
ATOM   2699  C  C     . ARG B 2 154 ? 17.904  21.334  48.788 1.00 17.59 ? 155  ARG A C     1 
ATOM   2700  O  O     . ARG B 2 154 ? 17.162  21.409  47.790 1.00 17.63 ? 155  ARG A O     1 
ATOM   2701  C  CB    . ARG B 2 154 ? 17.628  19.159  50.030 1.00 17.56 ? 155  ARG A CB    1 
ATOM   2702  C  CG    . ARG B 2 154 ? 17.229  18.411  51.312 1.00 18.38 ? 155  ARG A CG    1 
ATOM   2703  C  CD    . ARG B 2 154 ? 18.248  18.567  52.437 1.00 18.69 ? 155  ARG A CD    1 
ATOM   2704  N  NE    . ARG B 2 154 ? 19.451  17.763  52.194 1.00 18.94 ? 155  ARG A NE    1 
ATOM   2705  C  CZ    . ARG B 2 154 ? 20.542  17.768  52.964 1.00 18.38 ? 155  ARG A CZ    1 
ATOM   2706  N  NH1   . ARG B 2 154 ? 20.615  18.553  54.038 1.00 17.40 ? 155  ARG A NH1   1 
ATOM   2707  N  NH2   . ARG B 2 154 ? 21.570  16.990  52.648 1.00 17.83 ? 155  ARG A NH2   1 
ATOM   2708  N  N     . GLU B 2 155 ? 19.145  21.802  48.791 1.00 16.13 ? 156  GLU A N     1 
ATOM   2709  C  CA    . GLU B 2 155 ? 19.709  22.422  47.610 1.00 15.61 ? 156  GLU A CA    1 
ATOM   2710  C  C     . GLU B 2 155 ? 21.169  22.042  47.435 1.00 16.36 ? 156  GLU A C     1 
ATOM   2711  O  O     . GLU B 2 155 ? 21.824  21.610  48.382 1.00 15.08 ? 156  GLU A O     1 
ATOM   2712  C  CB    . GLU B 2 155 ? 19.563  23.940  47.667 1.00 15.03 ? 156  GLU A CB    1 
ATOM   2713  C  CG    . GLU B 2 155 ? 20.336  24.589  48.798 1.00 14.71 ? 156  GLU A CG    1 
ATOM   2714  C  CD    . GLU B 2 155 ? 20.401  26.082  48.667 1.00 15.50 ? 156  GLU A CD    1 
ATOM   2715  O  OE1   . GLU B 2 155 ? 20.537  26.755  49.703 1.00 16.02 ? 156  GLU A OE1   1 
ATOM   2716  O  OE2   . GLU B 2 155 ? 20.330  26.586  47.525 1.00 14.85 ? 156  GLU A OE2   1 
ATOM   2717  N  N     . PRO B 2 156 ? 21.680  22.221  46.153 1.00 17.89 ? 157  PRO A N     1 
ATOM   2718  C  CA    . PRO B 2 156 ? 23.091  21.837  46.018 1.00 17.96 ? 157  PRO A CA    1 
ATOM   2719  C  C     . PRO B 2 156 ? 24.057  22.968  46.353 1.00 19.22 ? 157  PRO A C     1 
ATOM   2720  O  O     . PRO B 2 156 ? 23.798  24.118  46.018 1.00 19.05 ? 157  PRO A O     1 
ATOM   2721  C  CB    . PRO B 2 156 ? 23.219  21.464  44.527 1.00 17.18 ? 157  PRO A CB    1 
ATOM   2722  C  CG    . PRO B 2 156 ? 21.933  21.808  43.874 1.00 17.02 ? 157  PRO A CG    1 
ATOM   2723  C  CD    . PRO B 2 156 ? 21.215  22.712  44.799 1.00 16.52 ? 157  PRO A CD    1 
ATOM   2724  N  N     . SER B 2 157 ? 25.158  22.624  47.009 1.00 19.84 ? 158  SER A N     1 
ATOM   2725  C  CA    . SER B 2 157 ? 26.175  23.618  47.368 1.00 19.90 ? 158  SER A CA    1 
ATOM   2726  C  C     . SER B 2 157 ? 26.995  23.992  46.146 1.00 19.67 ? 158  SER A C     1 
ATOM   2727  O  O     . SER B 2 157 ? 27.508  25.111  46.040 1.00 19.96 ? 158  SER A O     1 
ATOM   2728  C  CB    . SER B 2 157 ? 27.120  23.055  48.442 1.00 20.36 ? 158  SER A CB    1 
ATOM   2729  O  OG    . SER B 2 157 ? 27.796  21.903  47.961 1.00 20.55 ? 158  SER A OG    1 
ATOM   2730  N  N     . VAL B 2 158 ? 27.120  23.039  45.229 1.00 17.89 ? 159  VAL A N     1 
ATOM   2731  C  CA    . VAL B 2 158 ? 27.879  23.217  43.995 1.00 16.10 ? 159  VAL A CA    1 
ATOM   2732  C  C     . VAL B 2 158 ? 27.329  22.217  42.963 1.00 15.28 ? 159  VAL A C     1 
ATOM   2733  O  O     . VAL B 2 158 ? 26.729  21.205  43.337 1.00 15.20 ? 159  VAL A O     1 
ATOM   2734  C  CB    . VAL B 2 158 ? 29.408  23.018  44.247 1.00 15.56 ? 159  VAL A CB    1 
ATOM   2735  C  CG1   . VAL B 2 158 ? 29.730  21.561  44.579 1.00 15.15 ? 159  VAL A CG1   1 
ATOM   2736  C  CG2   . VAL B 2 158 ? 30.238  23.509  43.065 1.00 14.82 ? 159  VAL A CG2   1 
ATOM   2737  N  N     . LEU B 2 159 ? 27.500  22.518  41.679 1.00 14.12 ? 160  LEU A N     1 
ATOM   2738  C  CA    . LEU B 2 159 ? 27.038  21.620  40.624 1.00 13.95 ? 160  LEU A CA    1 
ATOM   2739  C  C     . LEU B 2 159 ? 28.209  20.799  40.068 1.00 13.79 ? 160  LEU A C     1 
ATOM   2740  O  O     . LEU B 2 159 ? 29.357  21.251  40.108 1.00 15.06 ? 160  LEU A O     1 
ATOM   2741  C  CB    . LEU B 2 159 ? 26.357  22.399  39.495 1.00 13.97 ? 160  LEU A CB    1 
ATOM   2742  C  CG    . LEU B 2 159 ? 25.235  23.403  39.815 1.00 14.85 ? 160  LEU A CG    1 
ATOM   2743  C  CD1   . LEU B 2 159 ? 24.594  23.851  38.518 1.00 14.78 ? 160  LEU A CD1   1 
ATOM   2744  C  CD2   . LEU B 2 159 ? 24.164  22.835  40.739 1.00 14.56 ? 160  LEU A CD2   1 
ATOM   2745  N  N     . PRO B 2 160 ? 27.935  19.573  39.583 1.00 13.42 ? 161  PRO A N     1 
ATOM   2746  C  CA    . PRO B 2 160 ? 28.974  18.741  38.969 1.00 12.88 ? 161  PRO A CA    1 
ATOM   2747  C  C     . PRO B 2 160 ? 29.861  19.501  37.980 1.00 12.18 ? 161  PRO A C     1 
ATOM   2748  O  O     . PRO B 2 160 ? 31.074  19.285  37.960 1.00 11.73 ? 161  PRO A O     1 
ATOM   2749  C  CB    . PRO B 2 160 ? 28.164  17.670  38.232 1.00 12.94 ? 161  PRO A CB    1 
ATOM   2750  C  CG    . PRO B 2 160 ? 26.932  17.510  39.072 1.00 13.02 ? 161  PRO A CG    1 
ATOM   2751  C  CD    . PRO B 2 160 ? 26.628  18.876  39.632 1.00 12.88 ? 161  PRO A CD    1 
ATOM   2752  N  N     . ALA B 2 161 ? 29.256  20.379  37.176 1.00 12.26 ? 162  ALA A N     1 
ATOM   2753  C  CA    . ALA B 2 161 ? 29.965  21.210  36.186 1.00 11.86 ? 162  ALA A CA    1 
ATOM   2754  C  C     . ALA B 2 161 ? 30.924  20.424  35.294 1.00 11.60 ? 162  ALA A C     1 
ATOM   2755  O  O     . ALA B 2 161 ? 32.143  20.559  35.395 1.00 12.43 ? 162  ALA A O     1 
ATOM   2756  C  CB    . ALA B 2 161 ? 30.682  22.375  36.869 1.00 11.12 ? 162  ALA A CB    1 
ATOM   2757  N  N     . ARG B 2 162 ? 30.371  19.624  34.390 1.00 11.56 ? 163  ARG A N     1 
ATOM   2758  C  CA    . ARG B 2 162 ? 31.208  18.807  33.519 1.00 11.81 ? 163  ARG A CA    1 
ATOM   2759  C  C     . ARG B 2 162 ? 32.027  19.601  32.486 1.00 13.10 ? 163  ARG A C     1 
ATOM   2760  O  O     . ARG B 2 162 ? 32.743  19.009  31.670 1.00 13.59 ? 163  ARG A O     1 
ATOM   2761  C  CB    . ARG B 2 162 ? 30.412  17.662  32.898 1.00 11.98 ? 163  ARG A CB    1 
ATOM   2762  C  CG    . ARG B 2 162 ? 29.639  16.796  33.921 1.00 12.97 ? 163  ARG A CG    1 
ATOM   2763  C  CD    . ARG B 2 162 ? 30.483  16.285  35.099 1.00 13.39 ? 163  ARG A CD    1 
ATOM   2764  N  NE    . ARG B 2 162 ? 31.696  15.625  34.661 1.00 14.98 ? 163  ARG A NE    1 
ATOM   2765  C  CZ    . ARG B 2 162 ? 31.749  14.375  34.189 1.00 16.51 ? 163  ARG A CZ    1 
ATOM   2766  N  NH1   . ARG B 2 162 ? 30.633  13.648  34.098 1.00 15.44 ? 163  ARG A NH1   1 
ATOM   2767  N  NH2   . ARG B 2 162 ? 32.909  13.863  33.792 1.00 16.93 ? 163  ARG A NH2   1 
ATOM   2768  N  N     . PHE B 2 163 ? 31.928  20.937  32.536 1.00 12.83 ? 164  PHE A N     1 
ATOM   2769  C  CA    . PHE B 2 163 ? 32.753  21.820  31.699 1.00 12.11 ? 164  PHE A CA    1 
ATOM   2770  C  C     . PHE B 2 163 ? 33.230  23.022  32.542 1.00 11.86 ? 164  PHE A C     1 
ATOM   2771  O  O     . PHE B 2 163 ? 32.517  23.444  33.457 1.00 11.22 ? 164  PHE A O     1 
ATOM   2772  C  CB    . PHE B 2 163 ? 32.060  22.223  30.386 1.00 12.23 ? 164  PHE A CB    1 
ATOM   2773  C  CG    . PHE B 2 163 ? 30.945  23.238  30.538 1.00 12.14 ? 164  PHE A CG    1 
ATOM   2774  C  CD1   . PHE B 2 163 ? 29.653  22.830  30.828 1.00 12.76 ? 164  PHE A CD1   1 
ATOM   2775  C  CD2   . PHE B 2 163 ? 31.184  24.588  30.333 1.00 11.69 ? 164  PHE A CD2   1 
ATOM   2776  C  CE1   . PHE B 2 163 ? 28.617  23.762  30.946 1.00 12.47 ? 164  PHE A CE1   1 
ATOM   2777  C  CE2   . PHE B 2 163 ? 30.160  25.522  30.437 1.00 11.65 ? 164  PHE A CE2   1 
ATOM   2778  C  CZ    . PHE B 2 163 ? 28.869  25.109  30.749 1.00 11.74 ? 164  PHE A CZ    1 
ATOM   2779  N  N     . PRO B 2 164 ? 34.453  23.543  32.267 1.00 11.04 ? 165  PRO A N     1 
ATOM   2780  C  CA    . PRO B 2 164 ? 35.019  24.663  33.043 1.00 10.99 ? 165  PRO A CA    1 
ATOM   2781  C  C     . PRO B 2 164 ? 34.228  25.965  32.909 1.00 10.44 ? 165  PRO A C     1 
ATOM   2782  O  O     . PRO B 2 164 ? 34.685  26.914  32.262 1.00 10.79 ? 165  PRO A O     1 
ATOM   2783  C  CB    . PRO B 2 164 ? 36.438  24.816  32.459 1.00 11.04 ? 165  PRO A CB    1 
ATOM   2784  C  CG    . PRO B 2 164 ? 36.357  24.216  31.102 1.00 10.82 ? 165  PRO A CG    1 
ATOM   2785  C  CD    . PRO B 2 164 ? 35.372  23.100  31.204 1.00 10.58 ? 165  PRO A CD    1 
ATOM   2786  N  N     . ASN B 2 165 ? 33.061  26.005  33.545 1.00 10.42 ? 166  ASN A N     1 
ATOM   2787  C  CA    . ASN B 2 165 ? 32.133  27.138  33.443 1.00 10.30 ? 166  ASN A CA    1 
ATOM   2788  C  C     . ASN B 2 165 ? 32.657  28.501  33.909 1.00 9.77  ? 166  ASN A C     1 
ATOM   2789  O  O     . ASN B 2 165 ? 32.372  29.518  33.274 1.00 9.85  ? 166  ASN A O     1 
ATOM   2790  C  CB    . ASN B 2 165 ? 30.814  26.811  34.147 1.00 11.24 ? 166  ASN A CB    1 
ATOM   2791  C  CG    . ASN B 2 165 ? 29.731  27.841  33.868 1.00 12.05 ? 166  ASN A CG    1 
ATOM   2792  O  OD1   . ASN B 2 165 ? 29.550  28.282  32.731 1.00 12.73 ? 166  ASN A OD1   1 
ATOM   2793  N  ND2   . ASN B 2 165 ? 28.987  28.213  34.905 1.00 11.56 ? 166  ASN A ND2   1 
ATOM   2794  N  N     . LEU B 2 166 ? 33.398  28.537  35.006 1.00 9.20  ? 167  LEU A N     1 
ATOM   2795  C  CA    . LEU B 2 166 ? 33.936  29.795  35.532 1.00 9.27  ? 167  LEU A CA    1 
ATOM   2796  C  C     . LEU B 2 166 ? 34.701  30.623  34.508 1.00 9.20  ? 167  LEU A C     1 
ATOM   2797  O  O     . LEU B 2 166 ? 34.503  31.823  34.407 1.00 9.62  ? 167  LEU A O     1 
ATOM   2798  C  CB    . LEU B 2 166 ? 34.824  29.542  36.751 1.00 8.88  ? 167  LEU A CB    1 
ATOM   2799  C  CG    . LEU B 2 166 ? 35.481  30.783  37.359 1.00 8.85  ? 167  LEU A CG    1 
ATOM   2800  C  CD1   . LEU B 2 166 ? 34.438  31.785  37.824 1.00 8.36  ? 167  LEU A CD1   1 
ATOM   2801  C  CD2   . LEU B 2 166 ? 36.427  30.441  38.489 1.00 9.00  ? 167  LEU A CD2   1 
ATOM   2802  N  N     . LEU B 2 167 ? 35.590  29.980  33.759 1.00 9.09  ? 168  LEU A N     1 
ATOM   2803  C  CA    . LEU B 2 167 ? 36.371  30.679  32.754 1.00 8.42  ? 168  LEU A CA    1 
ATOM   2804  C  C     . LEU B 2 167 ? 35.620  30.835  31.443 1.00 8.59  ? 168  LEU A C     1 
ATOM   2805  O  O     . LEU B 2 167 ? 35.784  31.840  30.765 1.00 9.60  ? 168  LEU A O     1 
ATOM   2806  C  CB    . LEU B 2 167 ? 37.710  29.973  32.538 1.00 8.43  ? 168  LEU A CB    1 
ATOM   2807  C  CG    . LEU B 2 167 ? 38.644  29.986  33.760 1.00 8.39  ? 168  LEU A CG    1 
ATOM   2808  C  CD1   . LEU B 2 167 ? 39.825  29.041  33.544 1.00 8.11  ? 168  LEU A CD1   1 
ATOM   2809  C  CD2   . LEU B 2 167 ? 39.107  31.401  34.133 1.00 8.00  ? 168  LEU A CD2   1 
ATOM   2810  N  N     . ALA B 2 168 ? 34.779  29.854  31.110 1.00 8.18  ? 169  ALA A N     1 
ATOM   2811  C  CA    . ALA B 2 168 ? 34.007  29.862  29.868 1.00 7.95  ? 169  ALA A CA    1 
ATOM   2812  C  C     . ALA B 2 168 ? 33.046  31.035  29.772 1.00 7.91  ? 169  ALA A C     1 
ATOM   2813  O  O     . ALA B 2 168 ? 33.015  31.751  28.768 1.00 7.44  ? 169  ALA A O     1 
ATOM   2814  C  CB    . ALA B 2 168 ? 33.255  28.541  29.705 1.00 7.73  ? 169  ALA A CB    1 
ATOM   2815  N  N     . ASN B 2 169 ? 32.254  31.225  30.826 1.00 8.16  ? 170  ASN A N     1 
ATOM   2816  C  CA    . ASN B 2 169 ? 31.284  32.312  30.866 1.00 7.75  ? 170  ASN A CA    1 
ATOM   2817  C  C     . ASN B 2 169 ? 31.753  33.519  31.671 1.00 7.84  ? 170  ASN A C     1 
ATOM   2818  O  O     . ASN B 2 169 ? 31.214  34.605  31.532 1.00 7.56  ? 170  ASN A O     1 
ATOM   2819  C  CB    . ASN B 2 169 ? 29.930  31.788  31.364 1.00 7.83  ? 170  ASN A CB    1 
ATOM   2820  C  CG    . ASN B 2 169 ? 29.090  31.154  30.250 1.00 7.94  ? 170  ASN A CG    1 
ATOM   2821  O  OD1   . ASN B 2 169 ? 28.998  31.690  29.133 1.00 7.97  ? 170  ASN A OD1   1 
ATOM   2822  N  ND2   . ASN B 2 169 ? 28.436  30.036  30.561 1.00 7.84  ? 170  ASN A ND2   1 
ATOM   2823  N  N     . GLY B 2 170 ? 32.763  33.320  32.518 1.00 8.40  ? 171  GLY A N     1 
ATOM   2824  C  CA    . GLY B 2 170 ? 33.293  34.395  33.359 1.00 8.36  ? 171  GLY A CA    1 
ATOM   2825  C  C     . GLY B 2 170 ? 32.288  34.904  34.380 1.00 9.03  ? 171  GLY A C     1 
ATOM   2826  O  O     . GLY B 2 170 ? 31.258  34.271  34.621 1.00 8.54  ? 171  GLY A O     1 
ATOM   2827  N  N     . ALA B 2 171 ? 32.593  36.058  34.977 1.00 9.37  ? 172  ALA A N     1 
ATOM   2828  C  CA    . ALA B 2 171 ? 31.727  36.676  35.985 1.00 10.10 ? 172  ALA A CA    1 
ATOM   2829  C  C     . ALA B 2 171 ? 32.206  38.064  36.352 1.00 11.81 ? 172  ALA A C     1 
ATOM   2830  O  O     . ALA B 2 171 ? 33.377  38.405  36.185 1.00 12.49 ? 172  ALA A O     1 
ATOM   2831  C  CB    . ALA B 2 171 ? 31.641  35.822  37.250 1.00 10.17 ? 172  ALA A CB    1 
ATOM   2832  N  N     . SER B 2 172 ? 31.303  38.856  36.891 1.00 12.58 ? 173  SER A N     1 
ATOM   2833  C  CA    . SER B 2 172 ? 31.563  40.189  37.354 1.00 13.46 ? 173  SER A CA    1 
ATOM   2834  C  C     . SER B 2 172 ? 30.665  40.459  38.551 1.00 13.59 ? 173  SER A C     1 
ATOM   2835  O  O     . SER B 2 172 ? 29.457  40.469  38.431 1.00 14.30 ? 173  SER A O     1 
ATOM   2836  C  CB    . SER B 2 172 ? 31.341  41.218  36.246 1.00 14.15 ? 173  SER A CB    1 
ATOM   2837  O  OG    . SER B 2 172 ? 30.199  40.919  35.491 1.00 18.50 ? 173  SER A OG    1 
ATOM   2838  N  N     . GLY B 2 173 ? 31.264  40.696  39.698 1.00 13.87 ? 174  GLY A N     1 
ATOM   2839  C  CA    . GLY B 2 173 ? 30.519  40.997  40.891 1.00 12.95 ? 174  GLY A CA    1 
ATOM   2840  C  C     . GLY B 2 173 ? 31.127  42.017  41.813 1.00 12.84 ? 174  GLY A C     1 
ATOM   2841  O  O     . GLY B 2 173 ? 32.308  42.082  41.952 1.00 14.26 ? 174  GLY A O     1 
ATOM   2842  N  N     . ILE B 2 174 ? 30.289  42.831  42.435 1.00 11.87 ? 175  ILE A N     1 
ATOM   2843  C  CA    . ILE B 2 174 ? 30.718  43.848  43.373 1.00 10.19 ? 175  ILE A CA    1 
ATOM   2844  C  C     . ILE B 2 174 ? 30.267  43.371  44.737 1.00 10.16 ? 175  ILE A C     1 
ATOM   2845  O  O     . ILE B 2 174 ? 29.097  43.234  44.999 1.00 9.34  ? 175  ILE A O     1 
ATOM   2846  C  CB    . ILE B 2 174 ? 30.053  45.194  43.059 1.00 9.90  ? 175  ILE A CB    1 
ATOM   2847  C  CG1   . ILE B 2 174 ? 30.444  45.670  41.659 1.00 9.78  ? 175  ILE A CG1   1 
ATOM   2848  C  CG2   . ILE B 2 174 ? 30.441  46.251  44.097 1.00 9.17  ? 175  ILE A CG2   1 
ATOM   2849  C  CD1   . ILE B 2 174 ? 29.418  46.595  41.037 1.00 9.19  ? 175  ILE A CD1   1 
ATOM   2850  N  N     . ALA B 2 175 ? 31.223  43.137  45.612 1.00 9.77  ? 176  ALA A N     1 
ATOM   2851  C  CA    . ALA B 2 175 ? 30.949  42.675  46.961 1.00 9.72  ? 176  ALA A CA    1 
ATOM   2852  C  C     . ALA B 2 175 ? 31.256  43.775  47.978 1.00 9.88  ? 176  ALA A C     1 
ATOM   2853  O  O     . ALA B 2 175 ? 31.114  44.940  47.701 1.00 9.82  ? 176  ALA A O     1 
ATOM   2854  C  CB    . ALA B 2 175 ? 31.764  41.439  47.249 1.00 8.90  ? 176  ALA A CB    1 
ATOM   2855  N  N     . VAL B 2 176 ? 31.665  43.375  49.163 1.00 9.57  ? 177  VAL A N     1 
ATOM   2856  C  CA    . VAL B 2 176 ? 32.097  44.309  50.161 1.00 9.85  ? 177  VAL A CA    1 
ATOM   2857  C  C     . VAL B 2 176 ? 33.546  43.987  50.404 1.00 9.61  ? 177  VAL A C     1 
ATOM   2858  O  O     . VAL B 2 176 ? 33.912  42.876  50.648 1.00 10.31 ? 177  VAL A O     1 
ATOM   2859  C  CB    . VAL B 2 176 ? 31.235  44.239  51.466 1.00 10.00 ? 177  VAL A CB    1 
ATOM   2860  C  CG1   . VAL B 2 176 ? 31.747  45.228  52.495 1.00 9.71  ? 177  VAL A CG1   1 
ATOM   2861  C  CG2   . VAL B 2 176 ? 29.781  44.519  51.178 1.00 9.36  ? 177  VAL A CG2   1 
ATOM   2862  N  N     . GLY B 2 177 ? 34.376  44.992  50.263 1.00 10.07 ? 178  GLY A N     1 
ATOM   2863  C  CA    . GLY B 2 177 ? 35.823  44.893  50.485 1.00 9.77  ? 178  GLY A CA    1 
ATOM   2864  C  C     . GLY B 2 177 ? 36.592  44.388  49.303 1.00 10.38 ? 178  GLY A C     1 
ATOM   2865  O  O     . GLY B 2 177 ? 37.788  44.380  49.323 1.00 9.43  ? 178  GLY A O     1 
ATOM   2866  N  N     . MET B 2 178 ? 35.877  43.933  48.284 1.00 10.22 ? 179  MET A N     1 
ATOM   2867  C  CA    . MET B 2 178 ? 36.458  43.322  47.110 1.00 10.14 ? 179  MET A CA    1 
ATOM   2868  C  C     . MET B 2 178 ? 35.446  43.257  45.986 1.00 10.19 ? 179  MET A C     1 
ATOM   2869  O  O     . MET B 2 178 ? 34.278  43.439  46.197 1.00 10.11 ? 179  MET A O     1 
ATOM   2870  C  CB    . MET B 2 178 ? 36.943  41.911  47.447 1.00 10.63 ? 179  MET A CB    1 
ATOM   2871  C  CG    . MET B 2 178 ? 35.896  40.951  47.955 1.00 10.58 ? 179  MET A CG    1 
ATOM   2872  S  SD    . MET B 2 178 ? 36.518  39.619  48.907 1.00 12.87 ? 179  MET A SD    1 
ATOM   2873  C  CE    . MET B 2 178 ? 37.010  40.461  50.403 1.00 12.35 ? 179  MET A CE    1 
ATOM   2874  N  N     . ALA B 2 179 ? 35.922  42.973  44.790 1.00 10.02 ? 180  ALA A N     1 
ATOM   2875  C  CA    . ALA B 2 179 ? 35.072  42.779  43.636 1.00 9.83  ? 180  ALA A CA    1 
ATOM   2876  C  C     . ALA B 2 179 ? 35.727  41.748  42.744 1.00 9.83  ? 180  ALA A C     1 
ATOM   2877  O  O     . ALA B 2 179 ? 36.841  41.355  42.961 1.00 8.94  ? 180  ALA A O     1 
ATOM   2878  C  CB    . ALA B 2 179 ? 34.862  44.088  42.878 1.00 9.60  ? 180  ALA A CB    1 
ATOM   2879  N  N     . THR B 2 180 ? 35.014  41.291  41.741 1.00 9.54  ? 181  THR A N     1 
ATOM   2880  C  CA    . THR B 2 180 ? 35.587  40.311  40.814 1.00 9.08  ? 181  THR A CA    1 
ATOM   2881  C  C     . THR B 2 180 ? 35.209  40.616  39.376 1.00 9.44  ? 181  THR A C     1 
ATOM   2882  O  O     . THR B 2 180 ? 34.102  41.096  39.095 1.00 9.72  ? 181  THR A O     1 
ATOM   2883  C  CB    . THR B 2 180 ? 35.169  38.872  41.149 1.00 8.75  ? 181  THR A CB    1 
ATOM   2884  O  OG1   . THR B 2 180 ? 35.898  37.954  40.323 1.00 8.84  ? 181  THR A OG1   1 
ATOM   2885  C  CG2   . THR B 2 180 ? 33.666  38.665  40.931 1.00 8.56  ? 181  THR A CG2   1 
ATOM   2886  N  N     . ASN B 2 181 ? 36.133  40.317  38.464 1.00 9.53  ? 182  ASN A N     1 
ATOM   2887  C  CA    . ASN B 2 181 ? 35.901  40.546  37.053 1.00 10.15 ? 182  ASN A CA    1 
ATOM   2888  C  C     . ASN B 2 181 ? 36.717  39.527  36.271 1.00 10.49 ? 182  ASN A C     1 
ATOM   2889  O  O     . ASN B 2 181 ? 37.921  39.704  36.045 1.00 11.01 ? 182  ASN A O     1 
ATOM   2890  C  CB    . ASN B 2 181 ? 36.267  41.991  36.675 1.00 10.47 ? 182  ASN A CB    1 
ATOM   2891  C  CG    . ASN B 2 181 ? 35.458  42.510  35.493 1.00 11.22 ? 182  ASN A CG    1 
ATOM   2892  O  OD1   . ASN B 2 181 ? 34.283  42.171  35.328 1.00 11.04 ? 182  ASN A OD1   1 
ATOM   2893  N  ND2   . ASN B 2 181 ? 36.075  43.363  34.683 1.00 10.68 ? 182  ASN A ND2   1 
ATOM   2894  N  N     . ILE B 2 182 ? 36.044  38.448  35.882 1.00 10.18 ? 183  ILE A N     1 
ATOM   2895  C  CA    . ILE B 2 182 ? 36.639  37.344  35.145 1.00 10.03 ? 183  ILE A CA    1 
ATOM   2896  C  C     . ILE B 2 182 ? 36.039  37.310  33.745 1.00 10.29 ? 183  ILE A C     1 
ATOM   2897  O  O     . ILE B 2 182 ? 34.830  37.116  33.599 1.00 11.58 ? 183  ILE A O     1 
ATOM   2898  C  CB    . ILE B 2 182 ? 36.365  35.980  35.847 1.00 9.50  ? 183  ILE A CB    1 
ATOM   2899  C  CG1   . ILE B 2 182 ? 36.885  35.989  37.285 1.00 9.18  ? 183  ILE A CG1   1 
ATOM   2900  C  CG2   . ILE B 2 182 ? 36.980  34.831  35.044 1.00 9.89  ? 183  ILE A CG2   1 
ATOM   2901  C  CD1   . ILE B 2 182 ? 36.615  34.721  38.079 1.00 8.64  ? 183  ILE A CD1   1 
ATOM   2902  N  N     . PRO B 2 183 ? 36.875  37.467  32.709 1.00 10.20 ? 184  PRO A N     1 
ATOM   2903  C  CA    . PRO B 2 183 ? 36.348  37.473  31.335 1.00 10.14 ? 184  PRO A CA    1 
ATOM   2904  C  C     . PRO B 2 183 ? 35.962  36.072  30.825 1.00 9.98  ? 184  PRO A C     1 
ATOM   2905  O  O     . PRO B 2 183 ? 36.418  35.071  31.375 1.00 9.81  ? 184  PRO A O     1 
ATOM   2906  C  CB    . PRO B 2 183 ? 37.514  38.052  30.513 1.00 9.90  ? 184  PRO A CB    1 
ATOM   2907  C  CG    . PRO B 2 183 ? 38.732  37.734  31.281 1.00 10.11 ? 184  PRO A CG    1 
ATOM   2908  C  CD    . PRO B 2 183 ? 38.344  37.619  32.746 1.00 10.07 ? 184  PRO A CD    1 
ATOM   2909  N  N     . PRO B 2 184 ? 35.094  36.005  29.804 1.00 10.29 ? 185  PRO A N     1 
ATOM   2910  C  CA    . PRO B 2 184 ? 34.732  34.710  29.220 1.00 10.71 ? 185  PRO A CA    1 
ATOM   2911  C  C     . PRO B 2 184 ? 35.859  34.175  28.316 1.00 11.60 ? 185  PRO A C     1 
ATOM   2912  O  O     . PRO B 2 184 ? 36.763  34.935  27.948 1.00 12.76 ? 185  PRO A O     1 
ATOM   2913  C  CB    . PRO B 2 184 ? 33.482  35.035  28.406 1.00 10.91 ? 185  PRO A CB    1 
ATOM   2914  C  CG    . PRO B 2 184 ? 33.644  36.464  28.028 1.00 10.03 ? 185  PRO A CG    1 
ATOM   2915  C  CD    . PRO B 2 184 ? 34.373  37.122  29.161 1.00 9.99  ? 185  PRO A CD    1 
ATOM   2916  N  N     . HIS B 2 185 ? 35.804  32.887  27.977 1.00 11.39 ? 186  HIS A N     1 
ATOM   2917  C  CA    . HIS B 2 185 ? 36.827  32.226  27.170 1.00 10.91 ? 186  HIS A CA    1 
ATOM   2918  C  C     . HIS B 2 185 ? 36.229  31.177  26.227 1.00 10.56 ? 186  HIS A C     1 
ATOM   2919  O  O     . HIS B 2 185 ? 35.078  30.771  26.387 1.00 9.41  ? 186  HIS A O     1 
ATOM   2920  C  CB    . HIS B 2 185 ? 37.816  31.507  28.093 1.00 12.20 ? 186  HIS A CB    1 
ATOM   2921  C  CG    . HIS B 2 185 ? 38.591  32.416  28.999 1.00 12.07 ? 186  HIS A CG    1 
ATOM   2922  N  ND1   . HIS B 2 185 ? 38.060  32.953  30.150 1.00 11.03 ? 186  HIS A ND1   1 
ATOM   2923  C  CD2   . HIS B 2 185 ? 39.873  32.846  28.935 1.00 12.42 ? 186  HIS A CD2   1 
ATOM   2924  C  CE1   . HIS B 2 185 ? 38.972  33.699  30.747 1.00 11.82 ? 186  HIS A CE1   1 
ATOM   2925  N  NE2   . HIS B 2 185 ? 40.082  33.650  30.034 1.00 12.53 ? 186  HIS A NE2   1 
ATOM   2926  N  N     . ASN B 2 186 ? 37.023  30.726  25.257 1.00 11.44 ? 187  ASN A N     1 
ATOM   2927  C  CA    . ASN B 2 186 ? 36.591  29.699  24.306 1.00 11.40 ? 187  ASN A CA    1 
ATOM   2928  C  C     . ASN B 2 186 ? 36.691  28.311  24.921 1.00 12.16 ? 187  ASN A C     1 
ATOM   2929  O  O     . ASN B 2 186 ? 37.734  27.933  25.458 1.00 13.92 ? 187  ASN A O     1 
ATOM   2930  C  CB    . ASN B 2 186 ? 37.382  29.793  23.001 1.00 12.01 ? 187  ASN A CB    1 
ATOM   2931  C  CG    . ASN B 2 186 ? 36.957  28.744  21.986 1.00 12.42 ? 187  ASN A CG    1 
ATOM   2932  O  OD1   . ASN B 2 186 ? 37.369  27.593  22.070 1.00 12.13 ? 187  ASN A OD1   1 
ATOM   2933  N  ND2   . ASN B 2 186 ? 36.159  29.149  21.000 1.00 12.16 ? 187  ASN A ND2   1 
ATOM   2934  N  N     . LEU B 2 187 ? 35.600  27.556  24.836 1.00 12.91 ? 188  LEU A N     1 
ATOM   2935  C  CA    . LEU B 2 187 ? 35.495  26.226  25.446 1.00 12.37 ? 188  LEU A CA    1 
ATOM   2936  C  C     . LEU B 2 187 ? 36.485  25.198  24.905 1.00 11.89 ? 188  LEU A C     1 
ATOM   2937  O  O     . LEU B 2 187 ? 37.007  24.374  25.666 1.00 12.56 ? 188  LEU A O     1 
ATOM   2938  C  CB    . LEU B 2 187 ? 34.060  25.686  25.329 1.00 11.53 ? 188  LEU A CB    1 
ATOM   2939  C  CG    . LEU B 2 187 ? 33.755  24.432  26.166 1.00 11.32 ? 188  LEU A CG    1 
ATOM   2940  C  CD1   . LEU B 2 187 ? 33.918  24.692  27.658 1.00 10.28 ? 188  LEU A CD1   1 
ATOM   2941  C  CD2   . LEU B 2 187 ? 32.359  23.927  25.857 1.00 11.34 ? 188  LEU A CD2   1 
ATOM   2942  N  N     . THR B 2 188 ? 36.727  25.236  23.601 1.00 12.06 ? 189  THR A N     1 
ATOM   2943  C  CA    . THR B 2 188 ? 37.671  24.319  22.955 1.00 11.18 ? 189  THR A CA    1 
ATOM   2944  C  C     . THR B 2 188 ? 39.060  24.555  23.515 1.00 10.46 ? 189  THR A C     1 
ATOM   2945  O  O     . THR B 2 188 ? 39.772  23.603  23.843 1.00 10.25 ? 189  THR A O     1 
ATOM   2946  C  CB    . THR B 2 188 ? 37.678  24.529  21.433 1.00 11.00 ? 189  THR A CB    1 
ATOM   2947  O  OG1   . THR B 2 188 ? 36.332  24.489  20.947 1.00 11.31 ? 189  THR A OG1   1 
ATOM   2948  C  CG2   . THR B 2 188 ? 38.545  23.466  20.723 1.00 10.18 ? 189  THR A CG2   1 
ATOM   2949  N  N     . GLU B 2 189 ? 39.421  25.831  23.629 1.00 10.72 ? 190  GLU A N     1 
ATOM   2950  C  CA    . GLU B 2 189 ? 40.698  26.262  24.193 1.00 11.29 ? 190  GLU A CA    1 
ATOM   2951  C  C     . GLU B 2 189 ? 40.821  25.838  25.655 1.00 11.75 ? 190  GLU A C     1 
ATOM   2952  O  O     . GLU B 2 189 ? 41.853  25.283  26.059 1.00 12.27 ? 190  GLU A O     1 
ATOM   2953  C  CB    . GLU B 2 189 ? 40.863  27.777  24.058 1.00 11.66 ? 190  GLU A CB    1 
ATOM   2954  C  CG    . GLU B 2 189 ? 41.036  28.277  22.616 1.00 13.15 ? 190  GLU A CG    1 
ATOM   2955  C  CD    . GLU B 2 189 ? 41.299  29.780  22.510 1.00 14.64 ? 190  GLU A CD    1 
ATOM   2956  O  OE1   . GLU B 2 189 ? 41.402  30.451  23.559 1.00 16.73 ? 190  GLU A OE1   1 
ATOM   2957  O  OE2   . GLU B 2 189 ? 41.390  30.299  21.380 1.00 14.91 ? 190  GLU A OE2   1 
ATOM   2958  N  N     . LEU B 2 190 ? 39.767  26.079  26.438 1.00 11.19 ? 191  LEU A N     1 
ATOM   2959  C  CA    . LEU B 2 190 ? 39.766  25.733  27.862 1.00 11.43 ? 191  LEU A CA    1 
ATOM   2960  C  C     . LEU B 2 190 ? 39.968  24.258  28.110 1.00 11.26 ? 191  LEU A C     1 
ATOM   2961  O  O     . LEU B 2 190 ? 40.800  23.875  28.927 1.00 10.30 ? 191  LEU A O     1 
ATOM   2962  C  CB    . LEU B 2 190 ? 38.481  26.181  28.557 1.00 11.18 ? 191  LEU A CB    1 
ATOM   2963  C  CG    . LEU B 2 190 ? 38.218  27.658  28.814 1.00 11.77 ? 191  LEU A CG    1 
ATOM   2964  C  CD1   . LEU B 2 190 ? 36.892  27.768  29.562 1.00 11.55 ? 191  LEU A CD1   1 
ATOM   2965  C  CD2   . LEU B 2 190 ? 39.356  28.300  29.606 1.00 11.52 ? 191  LEU A CD2   1 
ATOM   2966  N  N     . ILE B 2 191 ? 39.191  23.431  27.411 1.00 12.57 ? 192  ILE A N     1 
ATOM   2967  C  CA    . ILE B 2 191 ? 39.291  21.977  27.590 1.00 13.01 ? 192  ILE A CA    1 
ATOM   2968  C  C     . ILE B 2 191 ? 40.680  21.484  27.199 1.00 12.67 ? 192  ILE A C     1 
ATOM   2969  O  O     . ILE B 2 191 ? 41.267  20.675  27.919 1.00 12.84 ? 192  ILE A O     1 
ATOM   2970  C  CB    . ILE B 2 191 ? 38.124  21.204  26.941 1.00 13.25 ? 192  ILE A CB    1 
ATOM   2971  C  CG1   . ILE B 2 191 ? 36.813  21.594  27.640 1.00 13.84 ? 192  ILE A CG1   1 
ATOM   2972  C  CG2   . ILE B 2 191 ? 38.336  19.691  27.076 1.00 13.76 ? 192  ILE A CG2   1 
ATOM   2973  C  CD1   . ILE B 2 191 ? 35.546  20.967  27.064 1.00 13.27 ? 192  ILE A CD1   1 
ATOM   2974  N  N     . ASN B 2 192 ? 41.222  22.000  26.095 1.00 12.99 ? 193  ASN A N     1 
ATOM   2975  C  CA    . ASN B 2 192 ? 42.592  21.640  25.702 1.00 13.01 ? 193  ASN A CA    1 
ATOM   2976  C  C     . ASN B 2 192 ? 43.607  21.971  26.806 1.00 12.03 ? 193  ASN A C     1 
ATOM   2977  O  O     . ASN B 2 192 ? 44.506  21.177  27.082 1.00 11.23 ? 193  ASN A O     1 
ATOM   2978  C  CB    . ASN B 2 192 ? 42.977  22.284  24.373 1.00 13.42 ? 193  ASN A CB    1 
ATOM   2979  C  CG    . ASN B 2 192 ? 42.266  21.651  23.193 1.00 14.51 ? 193  ASN A CG    1 
ATOM   2980  O  OD1   . ASN B 2 192 ? 41.713  20.553  23.295 1.00 14.73 ? 193  ASN A OD1   1 
ATOM   2981  N  ND2   . ASN B 2 192 ? 42.282  22.348  22.053 1.00 13.64 ? 193  ASN A ND2   1 
ATOM   2982  N  N     . GLY B 2 193 ? 43.435  23.133  27.441 1.00 11.45 ? 194  GLY A N     1 
ATOM   2983  C  CA    . GLY B 2 193 ? 44.288  23.557  28.557 1.00 11.21 ? 194  GLY A CA    1 
ATOM   2984  C  C     . GLY B 2 193 ? 44.187  22.569  29.706 1.00 12.04 ? 194  GLY A C     1 
ATOM   2985  O  O     . GLY B 2 193 ? 45.202  22.085  30.219 1.00 12.24 ? 194  GLY A O     1 
ATOM   2986  N  N     . VAL B 2 194 ? 42.953  22.248  30.090 1.00 12.09 ? 195  VAL A N     1 
ATOM   2987  C  CA    . VAL B 2 194 ? 42.694  21.284  31.165 1.00 12.87 ? 195  VAL A CA    1 
ATOM   2988  C  C     . VAL B 2 194 ? 43.367  19.941  30.861 1.00 13.36 ? 195  VAL A C     1 
ATOM   2989  O  O     . VAL B 2 194 ? 43.932  19.315  31.758 1.00 13.13 ? 195  VAL A O     1 
ATOM   2990  C  CB    . VAL B 2 194 ? 41.176  21.082  31.425 1.00 12.50 ? 195  VAL A CB    1 
ATOM   2991  C  CG1   . VAL B 2 194 ? 40.953  19.982  32.449 1.00 13.15 ? 195  VAL A CG1   1 
ATOM   2992  C  CG2   . VAL B 2 194 ? 40.531  22.386  31.915 1.00 12.23 ? 195  VAL A CG2   1 
ATOM   2993  N  N     . LEU B 2 195 ? 43.317  19.522  29.596 1.00 13.43 ? 196  LEU A N     1 
ATOM   2994  C  CA    . LEU B 2 195 ? 43.932  18.264  29.172 1.00 13.70 ? 196  LEU A CA    1 
ATOM   2995  C  C     . LEU B 2 195 ? 45.454  18.283  29.353 1.00 14.44 ? 196  LEU A C     1 
ATOM   2996  O  O     . LEU B 2 195 ? 46.025  17.372  29.954 1.00 15.55 ? 196  LEU A O     1 
ATOM   2997  C  CB    . LEU B 2 195 ? 43.566  17.912  27.725 1.00 12.23 ? 196  LEU A CB    1 
ATOM   2998  C  CG    . LEU B 2 195 ? 42.098  17.642  27.385 1.00 13.33 ? 196  LEU A CG    1 
ATOM   2999  C  CD1   . LEU B 2 195 ? 41.958  17.334  25.879 1.00 12.32 ? 196  LEU A CD1   1 
ATOM   3000  C  CD2   . LEU B 2 195 ? 41.479  16.529  28.245 1.00 11.68 ? 196  LEU A CD2   1 
ATOM   3001  N  N     . SER B 2 196 ? 46.103  19.329  28.847 1.00 14.59 ? 197  SER A N     1 
ATOM   3002  C  CA    . SER B 2 196 ? 47.549  19.479  28.985 1.00 15.15 ? 197  SER A CA    1 
ATOM   3003  C  C     . SER B 2 196 ? 47.958  19.521  30.455 1.00 15.17 ? 197  SER A C     1 
ATOM   3004  O  O     . SER B 2 196 ? 48.992  18.964  30.830 1.00 16.30 ? 197  SER A O     1 
ATOM   3005  C  CB    . SER B 2 196 ? 48.029  20.723  28.242 1.00 13.92 ? 197  SER A CB    1 
ATOM   3006  O  OG    . SER B 2 196 ? 47.659  20.645  26.879 1.00 13.21 ? 197  SER A OG    1 
ATOM   3007  N  N     . LEU B 2 197 ? 47.135  20.170  31.283 1.00 18.17 ? 198  LEU A N     1 
ATOM   3008  C  CA    . LEU B 2 197 ? 47.379  20.257  32.731 1.00 20.56 ? 198  LEU A CA    1 
ATOM   3009  C  C     . LEU B 2 197 ? 47.293  18.889  33.403 1.00 21.96 ? 198  LEU A C     1 
ATOM   3010  O  O     . LEU B 2 197 ? 48.091  18.583  34.288 1.00 25.01 ? 198  LEU A O     1 
ATOM   3011  C  CB    . LEU B 2 197 ? 46.396  21.223  33.395 1.00 21.72 ? 198  LEU A CB    1 
ATOM   3012  C  CG    . LEU B 2 197 ? 46.389  21.292  34.937 1.00 21.26 ? 198  LEU A CG    1 
ATOM   3013  C  CD1   . LEU B 2 197 ? 47.667  21.902  35.512 1.00 21.26 ? 198  LEU A CD1   1 
ATOM   3014  C  CD2   . LEU B 2 197 ? 45.169  22.063  35.429 1.00 20.41 ? 198  LEU A CD2   1 
ATOM   3015  N  N     . SER B 2 198 ? 46.326  18.071  32.983 1.00 20.63 ? 199  SER A N     1 
ATOM   3016  C  CA    . SER B 2 198 ? 46.157  16.738  33.562 1.00 21.87 ? 199  SER A CA    1 
ATOM   3017  C  C     . SER B 2 198 ? 47.308  15.814  33.168 1.00 23.34 ? 199  SER A C     1 
ATOM   3018  O  O     . SER B 2 198 ? 47.514  14.768  33.788 1.00 26.73 ? 199  SER A O     1 
ATOM   3019  C  CB    . SER B 2 198 ? 44.814  16.128  33.160 1.00 18.89 ? 199  SER A CB    1 
ATOM   3020  O  OG    . SER B 2 198 ? 44.735  15.961  31.758 1.00 18.57 ? 199  SER A OG    1 
ATOM   3021  N  N     . LYS B 2 199 ? 48.053  16.216  32.146 1.00 23.87 ? 200  LYS A N     1 
ATOM   3022  C  CA    . LYS B 2 199 ? 49.204  15.455  31.658 1.00 24.28 ? 200  LYS A CA    1 
ATOM   3023  C  C     . LYS B 2 199 ? 50.527  16.021  32.171 1.00 23.36 ? 200  LYS A C     1 
ATOM   3024  O  O     . LYS B 2 199 ? 51.586  15.430  31.939 1.00 26.19 ? 200  LYS A O     1 
ATOM   3025  C  CB    . LYS B 2 199 ? 49.210  15.412  30.124 1.00 21.84 ? 200  LYS A CB    1 
ATOM   3026  C  CG    . LYS B 2 199 ? 48.046  14.663  29.510 1.00 22.63 ? 200  LYS A CG    1 
ATOM   3027  C  CD    . LYS B 2 199 ? 48.007  14.838  28.003 1.00 25.15 ? 200  LYS A CD    1 
ATOM   3028  C  CE    . LYS B 2 199 ? 46.856  14.073  27.367 1.00 28.64 ? 200  LYS A CE    1 
ATOM   3029  N  NZ    . LYS B 2 199 ? 46.647  14.524  25.943 1.00 29.36 ? 200  LYS A NZ    1 
ATOM   3030  N  N     . ASN B 2 200 ? 50.460  17.155  32.871 1.00 22.39 ? 201  ASN A N     1 
ATOM   3031  C  CA    . ASN B 2 200 ? 51.649  17.839  33.387 1.00 19.19 ? 201  ASN A CA    1 
ATOM   3032  C  C     . ASN B 2 200 ? 51.325  18.808  34.539 1.00 19.23 ? 201  ASN A C     1 
ATOM   3033  O  O     . ASN B 2 200 ? 51.051  19.982  34.298 1.00 19.67 ? 201  ASN A O     1 
ATOM   3034  C  CB    . ASN B 2 200 ? 52.351  18.571  32.230 1.00 18.83 ? 201  ASN A CB    1 
ATOM   3035  C  CG    . ASN B 2 200 ? 53.674  19.222  32.633 1.00 21.01 ? 201  ASN A CG    1 
ATOM   3036  O  OD1   . ASN B 2 200 ? 54.163  19.071  33.763 1.00 22.23 ? 201  ASN A OD1   1 
ATOM   3037  N  ND2   . ASN B 2 200 ? 54.266  19.944  31.687 1.00 19.12 ? 201  ASN A ND2   1 
ATOM   3038  N  N     . PRO B 2 201 ? 51.340  18.320  35.792 1.00 19.61 ? 202  PRO A N     1 
ATOM   3039  C  CA    . PRO B 2 201 ? 51.084  19.178  36.970 1.00 19.25 ? 202  PRO A CA    1 
ATOM   3040  C  C     . PRO B 2 201 ? 52.038  20.377  37.079 1.00 21.51 ? 202  PRO A C     1 
ATOM   3041  O  O     . PRO B 2 201 ? 51.721  21.350  37.775 1.00 21.60 ? 202  PRO A O     1 
ATOM   3042  C  CB    . PRO B 2 201 ? 51.332  18.233  38.159 1.00 18.74 ? 202  PRO A CB    1 
ATOM   3043  C  CG    . PRO B 2 201 ? 51.099  16.857  37.603 1.00 19.13 ? 202  PRO A CG    1 
ATOM   3044  C  CD    . PRO B 2 201 ? 51.570  16.907  36.177 1.00 18.31 ? 202  PRO A CD    1 
ATOM   3045  N  N     . ASP B 2 202 ? 53.183  20.310  36.399 1.00 19.28 ? 203  ASP A N     1 
ATOM   3046  C  CA    . ASP B 2 202 ? 54.185  21.376  36.442 1.00 18.71 ? 203  ASP A CA    1 
ATOM   3047  C  C     . ASP B 2 202 ? 54.100  22.314  35.230 1.00 18.91 ? 203  ASP A C     1 
ATOM   3048  O  O     . ASP B 2 202 ? 54.978  23.162  35.025 1.00 16.89 ? 203  ASP A O     1 
ATOM   3049  C  CB    . ASP B 2 202 ? 55.596  20.790  36.542 1.00 18.50 ? 203  ASP A CB    1 
ATOM   3050  C  CG    . ASP B 2 202 ? 55.798  19.945  37.783 1.00 20.10 ? 203  ASP A CG    1 
ATOM   3051  O  OD1   . ASP B 2 202 ? 55.448  20.407  38.906 1.00 19.94 ? 203  ASP A OD1   1 
ATOM   3052  O  OD2   . ASP B 2 202 ? 56.327  18.802  37.625 1.00 20.01 ? 203  ASP A OD2   1 
ATOM   3053  N  N     . ILE B 2 203 ? 53.041  22.169  34.437 1.00 19.97 ? 204  ILE A N     1 
ATOM   3054  C  CA    . ILE B 2 203 ? 52.859  23.009  33.255 1.00 18.64 ? 204  ILE A CA    1 
ATOM   3055  C  C     . ILE B 2 203 ? 52.841  24.478  33.672 1.00 18.04 ? 204  ILE A C     1 
ATOM   3056  O  O     . ILE B 2 203 ? 52.229  24.833  34.694 1.00 18.17 ? 204  ILE A O     1 
ATOM   3057  C  CB    . ILE B 2 203 ? 51.580  22.625  32.457 1.00 18.60 ? 204  ILE A CB    1 
ATOM   3058  C  CG1   . ILE B 2 203 ? 51.657  23.154  31.018 1.00 17.91 ? 204  ILE A CG1   1 
ATOM   3059  C  CG2   . ILE B 2 203 ? 50.309  23.065  33.187 1.00 18.83 ? 204  ILE A CG2   1 
ATOM   3060  C  CD1   . ILE B 2 203 ? 50.555  22.654  30.107 1.00 16.84 ? 204  ILE A CD1   1 
ATOM   3061  N  N     . SER B 2 204 ? 53.534  25.310  32.901 1.00 16.50 ? 205  SER A N     1 
ATOM   3062  C  CA    . SER B 2 204 ? 53.637  26.745  33.176 1.00 17.07 ? 205  SER A CA    1 
ATOM   3063  C  C     . SER B 2 204 ? 52.479  27.536  32.525 1.00 16.58 ? 205  SER A C     1 
ATOM   3064  O  O     . SER B 2 204 ? 51.725  27.005  31.705 1.00 15.60 ? 205  SER A O     1 
ATOM   3065  C  CB    . SER B 2 204 ? 54.975  27.290  32.662 1.00 16.26 ? 205  SER A CB    1 
ATOM   3066  O  OG    . SER B 2 204 ? 55.038  27.232  31.240 1.00 15.97 ? 205  SER A OG    1 
ATOM   3067  N  N     . ILE B 2 205 ? 52.371  28.809  32.897 1.00 16.40 ? 206  ILE A N     1 
ATOM   3068  C  CA    . ILE B 2 205 ? 51.382  29.718  32.345 1.00 17.66 ? 206  ILE A CA    1 
ATOM   3069  C  C     . ILE B 2 205 ? 51.626  29.903  30.839 1.00 17.07 ? 206  ILE A C     1 
ATOM   3070  O  O     . ILE B 2 205 ? 50.714  29.740  30.025 1.00 17.09 ? 206  ILE A O     1 
ATOM   3071  C  CB    . ILE B 2 205 ? 51.389  31.102  33.066 1.00 19.09 ? 206  ILE A CB    1 
ATOM   3072  C  CG1   . ILE B 2 205 ? 51.270  30.946  34.594 1.00 19.11 ? 206  ILE A CG1   1 
ATOM   3073  C  CG2   . ILE B 2 205 ? 50.313  32.041  32.508 1.00 17.64 ? 206  ILE A CG2   1 
ATOM   3074  C  CD1   . ILE B 2 205 ? 49.928  30.461  35.109 1.00 19.76 ? 206  ILE A CD1   1 
ATOM   3075  N  N     . ALA B 2 206 ? 52.868  30.220  30.484 1.00 18.78 ? 207  ALA A N     1 
ATOM   3076  C  CA    . ALA B 2 206 ? 53.275  30.409  29.070 1.00 19.96 ? 207  ALA A CA    1 
ATOM   3077  C  C     . ALA B 2 206 ? 52.958  29.193  28.201 1.00 20.24 ? 207  ALA A C     1 
ATOM   3078  O  O     . ALA B 2 206 ? 52.603  29.338  27.029 1.00 21.07 ? 207  ALA A O     1 
ATOM   3079  C  CB    . ALA B 2 206 ? 54.760  30.761  28.980 1.00 19.45 ? 207  ALA A CB    1 
ATOM   3080  N  N     . GLU B 2 207 ? 53.072  27.999  28.782 1.00 21.75 ? 208  GLU A N     1 
ATOM   3081  C  CA    . GLU B 2 207 ? 52.774  26.767  28.060 1.00 22.57 ? 208  GLU A CA    1 
ATOM   3082  C  C     . GLU B 2 207 ? 51.259  26.560  27.936 1.00 21.53 ? 208  GLU A C     1 
ATOM   3083  O  O     . GLU B 2 207 ? 50.782  26.086  26.903 1.00 20.17 ? 208  GLU A O     1 
ATOM   3084  C  CB    . GLU B 2 207 ? 53.459  25.577  28.720 1.00 24.94 ? 208  GLU A CB    1 
ATOM   3085  C  CG    . GLU B 2 207 ? 53.522  24.346  27.832 1.00 30.87 ? 208  GLU A CG    1 
ATOM   3086  C  CD    . GLU B 2 207 ? 54.382  23.236  28.421 1.00 36.78 ? 208  GLU A CD    1 
ATOM   3087  O  OE1   . GLU B 2 207 ? 54.123  22.062  28.040 1.00 36.72 ? 208  GLU A OE1   1 
ATOM   3088  O  OE2   . GLU B 2 207 ? 55.285  23.541  29.270 1.00 39.44 ? 208  GLU A OE2   1 
ATOM   3089  N  N     . LEU B 2 208 ? 50.513  26.923  28.981 1.00 19.40 ? 209  LEU A N     1 
ATOM   3090  C  CA    . LEU B 2 208 ? 49.052  26.842  28.947 1.00 18.19 ? 209  LEU A CA    1 
ATOM   3091  C  C     . LEU B 2 208 ? 48.480  27.765  27.873 1.00 18.24 ? 209  LEU A C     1 
ATOM   3092  O  O     . LEU B 2 208 ? 47.524  27.410  27.183 1.00 18.66 ? 209  LEU A O     1 
ATOM   3093  C  CB    . LEU B 2 208 ? 48.446  27.196  30.308 1.00 17.64 ? 209  LEU A CB    1 
ATOM   3094  C  CG    . LEU B 2 208 ? 48.521  26.199  31.469 1.00 16.77 ? 209  LEU A CG    1 
ATOM   3095  C  CD1   . LEU B 2 208 ? 48.076  26.863  32.752 1.00 15.38 ? 209  LEU A CD1   1 
ATOM   3096  C  CD2   . LEU B 2 208 ? 47.672  24.961  31.186 1.00 16.13 ? 209  LEU A CD2   1 
ATOM   3097  N  N     . MET B 2 209 ? 49.080  28.947  27.726 1.00 18.12 ? 210  MET A N     1 
ATOM   3098  C  CA    . MET B 2 209 ? 48.640  29.923  26.721 1.00 18.91 ? 210  MET A CA    1 
ATOM   3099  C  C     . MET B 2 209 ? 48.772  29.443  25.267 1.00 18.58 ? 210  MET A C     1 
ATOM   3100  O  O     . MET B 2 209 ? 48.303  30.114  24.344 1.00 20.28 ? 210  MET A O     1 
ATOM   3101  C  CB    . MET B 2 209 ? 49.300  31.287  26.941 1.00 17.79 ? 210  MET A CB    1 
ATOM   3102  C  CG    . MET B 2 209 ? 48.794  31.993  28.189 1.00 18.40 ? 210  MET A CG    1 
ATOM   3103  S  SD    . MET B 2 209 ? 49.559  33.589  28.511 1.00 22.69 ? 210  MET A SD    1 
ATOM   3104  C  CE    . MET B 2 209 ? 49.096  34.512  27.015 1.00 18.92 ? 210  MET A CE    1 
ATOM   3105  N  N     . GLU B 2 210 ? 49.412  28.289  25.074 1.00 19.45 ? 211  GLU A N     1 
ATOM   3106  C  CA    . GLU B 2 210 ? 49.498  27.662  23.756 1.00 18.95 ? 211  GLU A CA    1 
ATOM   3107  C  C     . GLU B 2 210 ? 48.103  27.116  23.412 1.00 17.34 ? 211  GLU A C     1 
ATOM   3108  O  O     . GLU B 2 210 ? 47.734  27.044  22.245 1.00 17.89 ? 211  GLU A O     1 
ATOM   3109  C  CB    . GLU B 2 210 ? 50.546  26.542  23.726 1.00 19.98 ? 211  GLU A CB    1 
ATOM   3110  C  CG    . GLU B 2 210 ? 51.990  27.000  23.960 1.00 21.56 ? 211  GLU A CG    1 
ATOM   3111  C  CD    . GLU B 2 210 ? 53.007  25.851  23.904 1.00 23.26 ? 211  GLU A CD    1 
ATOM   3112  O  OE1   . GLU B 2 210 ? 54.149  26.023  24.400 1.00 24.20 ? 211  GLU A OE1   1 
ATOM   3113  O  OE2   . GLU B 2 210 ? 52.694  24.774  23.356 1.00 24.63 ? 211  GLU A OE2   1 
ATOM   3114  N  N     . ASP B 2 211 ? 47.342  26.757  24.442 1.00 16.58 ? 212  ASP A N     1 
ATOM   3115  C  CA    . ASP B 2 211 ? 45.952  26.287  24.310 1.00 15.99 ? 212  ASP A CA    1 
ATOM   3116  C  C     . ASP B 2 211 ? 44.957  27.447  24.448 1.00 15.56 ? 212  ASP A C     1 
ATOM   3117  O  O     . ASP B 2 211 ? 44.130  27.674  23.562 1.00 14.66 ? 212  ASP A O     1 
ATOM   3118  C  CB    . ASP B 2 211 ? 45.643  25.218  25.370 1.00 15.45 ? 212  ASP A CB    1 
ATOM   3119  C  CG    . ASP B 2 211 ? 46.321  23.884  25.081 1.00 15.53 ? 212  ASP A CG    1 
ATOM   3120  O  OD1   . ASP B 2 211 ? 46.333  23.457  23.910 1.00 14.70 ? 212  ASP A OD1   1 
ATOM   3121  O  OD2   . ASP B 2 211 ? 46.806  23.245  26.041 1.00 15.47 ? 212  ASP A OD2   1 
ATOM   3122  N  N     . ILE B 2 212 ? 45.070  28.177  25.561 1.00 15.64 ? 213  ILE A N     1 
ATOM   3123  C  CA    . ILE B 2 212 ? 44.216  29.326  25.892 1.00 16.14 ? 213  ILE A CA    1 
ATOM   3124  C  C     . ILE B 2 212 ? 44.929  30.624  25.483 1.00 16.73 ? 213  ILE A C     1 
ATOM   3125  O  O     . ILE B 2 212 ? 45.674  31.214  26.279 1.00 15.98 ? 213  ILE A O     1 
ATOM   3126  C  CB    . ILE B 2 212 ? 43.887  29.332  27.418 1.00 15.44 ? 213  ILE A CB    1 
ATOM   3127  C  CG1   . ILE B 2 212 ? 43.280  27.987  27.846 1.00 16.38 ? 213  ILE A CG1   1 
ATOM   3128  C  CG2   . ILE B 2 212 ? 42.960  30.488  27.780 1.00 15.71 ? 213  ILE A CG2   1 
ATOM   3129  C  CD1   . ILE B 2 212 ? 43.248  27.745  29.368 1.00 15.30 ? 213  ILE A CD1   1 
ATOM   3130  N  N     A GLU B 2 213 ? 44.672  31.053  24.253 0.50 17.55 ? 214  GLU A N     1 
ATOM   3131  N  N     B GLU B 2 213 ? 44.705  31.065  24.249 0.50 16.68 ? 214  GLU A N     1 
ATOM   3132  C  CA    A GLU B 2 213 ? 45.289  32.246  23.651 0.50 18.06 ? 214  GLU A CA    1 
ATOM   3133  C  CA    B GLU B 2 213 ? 45.365  32.272  23.722 0.50 16.58 ? 214  GLU A CA    1 
ATOM   3134  C  C     A GLU B 2 213 ? 44.883  33.566  24.320 0.50 17.73 ? 214  GLU A C     1 
ATOM   3135  C  C     B GLU B 2 213 ? 44.951  33.543  24.471 0.50 16.73 ? 214  GLU A C     1 
ATOM   3136  O  O     A GLU B 2 213 ? 45.626  34.552  24.267 0.50 17.92 ? 214  GLU A O     1 
ATOM   3137  O  O     B GLU B 2 213 ? 45.751  34.475  24.619 0.50 16.70 ? 214  GLU A O     1 
ATOM   3138  C  CB    A GLU B 2 213 ? 44.974  32.282  22.150 0.50 18.85 ? 214  GLU A CB    1 
ATOM   3139  C  CB    B GLU B 2 213 ? 45.098  32.445  22.224 0.50 16.09 ? 214  GLU A CB    1 
ATOM   3140  C  CG    A GLU B 2 213 ? 45.547  31.085  21.398 0.50 20.85 ? 214  GLU A CG    1 
ATOM   3141  C  CG    B GLU B 2 213 ? 45.999  33.492  21.556 0.50 16.05 ? 214  GLU A CG    1 
ATOM   3142  C  CD    A GLU B 2 213 ? 44.994  30.892  19.991 0.50 21.36 ? 214  GLU A CD    1 
ATOM   3143  C  CD    B GLU B 2 213 ? 45.599  33.847  20.129 0.50 16.35 ? 214  GLU A CD    1 
ATOM   3144  O  OE1   A GLU B 2 213 ? 44.186  31.735  19.516 0.50 21.39 ? 214  GLU A OE1   1 
ATOM   3145  O  OE1   B GLU B 2 213 ? 44.423  33.584  19.731 0.50 16.09 ? 214  GLU A OE1   1 
ATOM   3146  O  OE2   A GLU B 2 213 ? 45.338  29.856  19.381 0.50 21.80 ? 214  GLU A OE2   1 
ATOM   3147  O  OE2   B GLU B 2 213 ? 46.470  34.418  19.427 0.50 15.26 ? 214  GLU A OE2   1 
ATOM   3148  N  N     . GLY B 2 214 ? 43.709  33.572  24.946 1.00 16.33 ? 215  GLY A N     1 
ATOM   3149  C  CA    . GLY B 2 214 ? 43.197  34.739  25.652 1.00 15.31 ? 215  GLY A CA    1 
ATOM   3150  C  C     . GLY B 2 214 ? 41.690  34.685  25.773 1.00 15.20 ? 215  GLY A C     1 
ATOM   3151  O  O     . GLY B 2 214 ? 41.070  33.720  25.322 1.00 16.15 ? 215  GLY A O     1 
ATOM   3152  N  N     . PRO B 2 215 ? 41.081  35.727  26.373 1.00 14.27 ? 216  PRO A N     1 
ATOM   3153  C  CA    . PRO B 2 215 ? 39.626  35.757  26.518 1.00 12.85 ? 216  PRO A CA    1 
ATOM   3154  C  C     . PRO B 2 215 ? 38.917  35.679  25.172 1.00 12.58 ? 216  PRO A C     1 
ATOM   3155  O  O     . PRO B 2 215 ? 39.492  36.049  24.149 1.00 12.43 ? 216  PRO A O     1 
ATOM   3156  C  CB    . PRO B 2 215 ? 39.366  37.132  27.145 1.00 12.26 ? 216  PRO A CB    1 
ATOM   3157  C  CG    . PRO B 2 215 ? 40.646  37.521  27.765 1.00 12.18 ? 216  PRO A CG    1 
ATOM   3158  C  CD    . PRO B 2 215 ? 41.719  36.927  26.933 1.00 13.16 ? 216  PRO A CD    1 
ATOM   3159  N  N     . ASP B 2 216 ? 37.680  35.188  25.183 1.00 13.16 ? 217  ASP A N     1 
ATOM   3160  C  CA    . ASP B 2 216 ? 36.854  35.101  23.981 1.00 12.83 ? 217  ASP A CA    1 
ATOM   3161  C  C     . ASP B 2 216 ? 35.462  35.620  24.344 1.00 12.55 ? 217  ASP A C     1 
ATOM   3162  O  O     . ASP B 2 216 ? 34.716  34.966  25.084 1.00 12.49 ? 217  ASP A O     1 
ATOM   3163  C  CB    . ASP B 2 216 ? 36.809  33.661  23.455 1.00 13.71 ? 217  ASP A CB    1 
ATOM   3164  C  CG    . ASP B 2 216 ? 36.176  33.560  22.069 1.00 15.26 ? 217  ASP A CG    1 
ATOM   3165  O  OD1   . ASP B 2 216 ? 36.072  34.600  21.383 1.00 15.99 ? 217  ASP A OD1   1 
ATOM   3166  O  OD2   . ASP B 2 216 ? 35.801  32.439  21.655 1.00 14.55 ? 217  ASP A OD2   1 
ATOM   3167  N  N     . PHE B 2 217 ? 35.125  36.802  23.835 1.00 11.99 ? 218  PHE A N     1 
ATOM   3168  C  CA    . PHE B 2 217 ? 33.852  37.461  24.160 1.00 11.36 ? 218  PHE A CA    1 
ATOM   3169  C  C     . PHE B 2 217 ? 32.668  37.072  23.269 1.00 11.54 ? 218  PHE A C     1 
ATOM   3170  O  O     . PHE B 2 217 ? 32.827  36.899  22.058 1.00 11.63 ? 218  PHE A O     1 
ATOM   3171  C  CB    . PHE B 2 217 ? 34.013  38.980  24.145 1.00 11.04 ? 218  PHE A CB    1 
ATOM   3172  C  CG    . PHE B 2 217 ? 35.149  39.482  24.997 1.00 11.59 ? 218  PHE A CG    1 
ATOM   3173  C  CD1   . PHE B 2 217 ? 35.071  39.447  26.389 1.00 10.80 ? 218  PHE A CD1   1 
ATOM   3174  C  CD2   . PHE B 2 217 ? 36.295  40.021  24.403 1.00 10.94 ? 218  PHE A CD2   1 
ATOM   3175  C  CE1   . PHE B 2 217 ? 36.116  39.922  27.172 1.00 10.57 ? 218  PHE A CE1   1 
ATOM   3176  C  CE2   . PHE B 2 217 ? 37.342  40.493  25.190 1.00 11.01 ? 218  PHE A CE2   1 
ATOM   3177  C  CZ    . PHE B 2 217 ? 37.246  40.447  26.578 1.00 10.84 ? 218  PHE A CZ    1 
ATOM   3178  N  N     . PRO B 2 218 ? 31.466  36.956  23.868 1.00 11.26 ? 219  PRO A N     1 
ATOM   3179  C  CA    . PRO B 2 218 ? 30.266  36.633  23.104 1.00 12.19 ? 219  PRO A CA    1 
ATOM   3180  C  C     . PRO B 2 218 ? 29.974  37.685  22.030 1.00 12.70 ? 219  PRO A C     1 
ATOM   3181  O  O     . PRO B 2 218 ? 29.279  37.395  21.054 1.00 12.52 ? 219  PRO A O     1 
ATOM   3182  C  CB    . PRO B 2 218 ? 29.154  36.625  24.156 1.00 11.58 ? 219  PRO A CB    1 
ATOM   3183  C  CG    . PRO B 2 218 ? 29.716  37.315  25.353 1.00 11.21 ? 219  PRO A CG    1 
ATOM   3184  C  CD    . PRO B 2 218 ? 31.185  37.100  25.310 1.00 11.11 ? 219  PRO A CD    1 
ATOM   3185  N  N     . THR B 2 219 ? 30.534  38.881  22.216 1.00 12.73 ? 220  THR A N     1 
ATOM   3186  C  CA    . THR B 2 219 ? 30.366  40.001  21.296 1.00 13.37 ? 220  THR A CA    1 
ATOM   3187  C  C     . THR B 2 219 ? 31.517  40.126  20.286 1.00 14.56 ? 220  THR A C     1 
ATOM   3188  O  O     . THR B 2 219 ? 31.604  41.110  19.547 1.00 13.56 ? 220  THR A O     1 
ATOM   3189  C  CB    . THR B 2 219 ? 30.243  41.318  22.076 1.00 14.09 ? 220  THR A CB    1 
ATOM   3190  O  OG1   . THR B 2 219 ? 31.225  41.327  23.126 1.00 14.44 ? 220  THR A OG1   1 
ATOM   3191  C  CG2   . THR B 2 219 ? 28.863  41.465  22.705 1.00 12.96 ? 220  THR A CG2   1 
ATOM   3192  N  N     . ALA B 2 220 ? 32.392  39.121  20.259 1.00 14.90 ? 221  ALA A N     1 
ATOM   3193  C  CA    . ALA B 2 220 ? 33.539  39.081  19.348 1.00 14.42 ? 221  ALA A CA    1 
ATOM   3194  C  C     . ALA B 2 220 ? 34.462  40.290  19.515 1.00 14.86 ? 221  ALA A C     1 
ATOM   3195  O  O     . ALA B 2 220 ? 34.984  40.516  20.610 1.00 14.96 ? 221  ALA A O     1 
ATOM   3196  C  CB    . ALA B 2 220 ? 33.085  38.901  17.885 1.00 14.10 ? 221  ALA A CB    1 
ATOM   3197  N  N     . GLY B 2 221 ? 34.659  41.065  18.444 1.00 15.43 ? 222  GLY A N     1 
ATOM   3198  C  CA    . GLY B 2 221 ? 35.532  42.243  18.477 1.00 14.25 ? 222  GLY A CA    1 
ATOM   3199  C  C     . GLY B 2 221 ? 37.010  41.898  18.454 1.00 14.21 ? 222  GLY A C     1 
ATOM   3200  O  O     . GLY B 2 221 ? 37.390  40.778  18.102 1.00 14.35 ? 222  GLY A O     1 
ATOM   3201  N  N     . LEU B 2 222 ? 37.848  42.864  18.830 1.00 15.00 ? 223  LEU A N     1 
ATOM   3202  C  CA    . LEU B 2 222 ? 39.308  42.682  18.843 1.00 15.47 ? 223  LEU A CA    1 
ATOM   3203  C  C     . LEU B 2 222 ? 39.960  42.969  20.194 1.00 15.70 ? 223  LEU A C     1 
ATOM   3204  O  O     . LEU B 2 222 ? 39.403  43.680  21.025 1.00 16.00 ? 223  LEU A O     1 
ATOM   3205  C  CB    . LEU B 2 222 ? 39.986  43.559  17.779 1.00 15.73 ? 223  LEU A CB    1 
ATOM   3206  C  CG    . LEU B 2 222 ? 39.904  43.268  16.278 1.00 17.20 ? 223  LEU A CG    1 
ATOM   3207  C  CD1   . LEU B 2 222 ? 38.490  43.303  15.743 1.00 17.68 ? 223  LEU A CD1   1 
ATOM   3208  C  CD2   . LEU B 2 222 ? 40.759  44.307  15.544 1.00 18.26 ? 223  LEU A CD2   1 
ATOM   3209  N  N     . ILE B 2 223 ? 41.150  42.398  20.382 1.00 15.55 ? 224  ILE A N     1 
ATOM   3210  C  CA    . ILE B 2 223 ? 42.000  42.627  21.549 1.00 14.89 ? 224  ILE A CA    1 
ATOM   3211  C  C     . ILE B 2 223 ? 43.376  43.085  21.054 1.00 15.52 ? 224  ILE A C     1 
ATOM   3212  O  O     . ILE B 2 223 ? 43.925  42.506  20.116 1.00 13.72 ? 224  ILE A O     1 
ATOM   3213  C  CB    . ILE B 2 223 ? 42.157  41.375  22.439 1.00 14.01 ? 224  ILE A CB    1 
ATOM   3214  C  CG1   . ILE B 2 223 ? 40.837  41.028  23.133 1.00 13.50 ? 224  ILE A CG1   1 
ATOM   3215  C  CG2   . ILE B 2 223 ? 43.236  41.610  23.497 1.00 13.93 ? 224  ILE A CG2   1 
ATOM   3216  C  CD1   . ILE B 2 223 ? 40.892  39.754  23.967 1.00 12.12 ? 224  ILE A CD1   1 
ATOM   3217  N  N     . LEU B 2 224 ? 43.918  44.121  21.697 1.00 17.46 ? 225  LEU A N     1 
ATOM   3218  C  CA    . LEU B 2 224 ? 45.218  44.698  21.353 1.00 18.62 ? 225  LEU A CA    1 
ATOM   3219  C  C     . LEU B 2 224 ? 46.356  44.229  22.260 1.00 19.40 ? 225  LEU A C     1 
ATOM   3220  O  O     . LEU B 2 224 ? 46.365  44.511  23.459 1.00 21.28 ? 225  LEU A O     1 
ATOM   3221  C  CB    . LEU B 2 224 ? 45.147  46.219  21.429 1.00 21.33 ? 225  LEU A CB    1 
ATOM   3222  C  CG    . LEU B 2 224 ? 44.230  47.012  20.505 1.00 23.37 ? 225  LEU A CG    1 
ATOM   3223  C  CD1   . LEU B 2 224 ? 44.172  48.466  21.003 1.00 23.20 ? 225  LEU A CD1   1 
ATOM   3224  C  CD2   . LEU B 2 224 ? 44.680  46.926  19.042 1.00 22.40 ? 225  LEU A CD2   1 
ATOM   3225  N  N     . GLY B 2 225 ? 47.314  43.524  21.678 1.00 21.00 ? 226  GLY A N     1 
ATOM   3226  C  CA    . GLY B 2 225 ? 48.463  43.025  22.405 1.00 20.75 ? 226  GLY A CA    1 
ATOM   3227  C  C     . GLY B 2 225 ? 48.222  41.766  23.199 1.00 21.47 ? 226  GLY A C     1 
ATOM   3228  O  O     . GLY B 2 225 ? 47.113  41.248  23.233 1.00 22.64 ? 226  GLY A O     1 
ATOM   3229  N  N     . LYS B 2 226 ? 49.274  41.278  23.845 1.00 22.70 ? 227  LYS A N     1 
ATOM   3230  C  CA    . LYS B 2 226 ? 49.196  40.076  24.668 1.00 23.14 ? 227  LYS A CA    1 
ATOM   3231  C  C     . LYS B 2 226 ? 49.746  40.341  26.054 1.00 21.49 ? 227  LYS A C     1 
ATOM   3232  O  O     . LYS B 2 226 ? 49.548  39.548  26.956 1.00 23.06 ? 227  LYS A O     1 
ATOM   3233  C  CB    . LYS B 2 226 ? 49.957  38.914  24.023 1.00 25.09 ? 227  LYS A CB    1 
ATOM   3234  C  CG    . LYS B 2 226 ? 49.487  38.557  22.628 1.00 31.39 ? 227  LYS A CG    1 
ATOM   3235  C  CD    . LYS B 2 226 ? 50.351  37.446  22.028 1.00 33.09 ? 227  LYS A CD    1 
ATOM   3236  C  CE    . LYS B 2 226 ? 49.986  37.247  20.559 1.00 37.42 ? 227  LYS A CE    1 
ATOM   3237  N  NZ    . LYS B 2 226 ? 50.522  35.985  19.992 1.00 36.33 ? 227  LYS A NZ    1 
ATOM   3238  N  N     . SER B 2 227 ? 50.419  41.464  26.226 1.00 20.97 ? 228  SER A N     1 
ATOM   3239  C  CA    . SER B 2 227 ? 50.987  41.802  27.523 1.00 20.98 ? 228  SER A CA    1 
ATOM   3240  C  C     . SER B 2 227 ? 49.943  41.846  28.636 1.00 18.62 ? 228  SER A C     1 
ATOM   3241  O  O     . SER B 2 227 ? 50.166  41.302  29.698 1.00 17.94 ? 228  SER A O     1 
ATOM   3242  C  CB    . SER B 2 227 ? 51.789  43.103  27.459 1.00 20.99 ? 228  SER A CB    1 
ATOM   3243  O  OG    . SER B 2 227 ? 50.994  44.171  26.986 1.00 23.33 ? 228  SER A OG    1 
ATOM   3244  N  N     . GLY B 2 228 ? 48.819  42.496  28.382 1.00 16.57 ? 229  GLY A N     1 
ATOM   3245  C  CA    . GLY B 2 228 ? 47.750  42.597  29.363 1.00 16.33 ? 229  GLY A CA    1 
ATOM   3246  C  C     . GLY B 2 228 ? 47.170  41.236  29.689 1.00 16.85 ? 229  GLY A C     1 
ATOM   3247  O  O     . GLY B 2 228 ? 46.850  40.947  30.834 1.00 15.88 ? 229  GLY A O     1 
ATOM   3248  N  N     . ILE B 2 229 ? 47.017  40.412  28.660 1.00 16.11 ? 230  ILE A N     1 
ATOM   3249  C  CA    . ILE B 2 229 ? 46.519  39.059  28.806 1.00 16.19 ? 230  ILE A CA    1 
ATOM   3250  C  C     . ILE B 2 229 ? 47.492  38.194  29.605 1.00 17.73 ? 230  ILE A C     1 
ATOM   3251  O  O     . ILE B 2 229 ? 47.094  37.403  30.441 1.00 18.46 ? 230  ILE A O     1 
ATOM   3252  C  CB    . ILE B 2 229 ? 46.259  38.407  27.429 1.00 15.87 ? 230  ILE A CB    1 
ATOM   3253  C  CG1   . ILE B 2 229 ? 45.123  39.123  26.707 1.00 15.23 ? 230  ILE A CG1   1 
ATOM   3254  C  CG2   . ILE B 2 229 ? 45.912  36.942  27.580 1.00 14.81 ? 230  ILE A CG2   1 
ATOM   3255  C  CD1   . ILE B 2 229 ? 44.874  38.610  25.314 1.00 14.78 ? 230  ILE A CD1   1 
ATOM   3256  N  N     . ARG B 2 230 ? 48.778  38.349  29.324 1.00 19.37 ? 231  ARG A N     1 
ATOM   3257  C  CA    . ARG B 2 230 ? 49.812  37.598  30.011 1.00 19.43 ? 231  ARG A CA    1 
ATOM   3258  C  C     . ARG B 2 230 ? 49.867  37.945  31.489 1.00 19.10 ? 231  ARG A C     1 
ATOM   3259  O  O     . ARG B 2 230 ? 49.995  37.076  32.336 1.00 22.27 ? 231  ARG A O     1 
ATOM   3260  C  CB    . ARG B 2 230 ? 51.162  37.869  29.358 1.00 21.07 ? 231  ARG A CB    1 
ATOM   3261  C  CG    . ARG B 2 230 ? 52.276  36.944  29.790 1.00 22.55 ? 231  ARG A CG    1 
ATOM   3262  C  CD    . ARG B 2 230 ? 53.552  37.240  29.023 1.00 23.94 ? 231  ARG A CD    1 
ATOM   3263  N  NE    . ARG B 2 230 ? 53.435  36.892  27.602 1.00 25.87 ? 231  ARG A NE    1 
ATOM   3264  C  CZ    . ARG B 2 230 ? 53.279  37.791  26.627 1.00 25.89 ? 231  ARG A CZ    1 
ATOM   3265  N  NH1   . ARG B 2 230 ? 53.216  39.091  26.906 1.00 27.05 ? 231  ARG A NH1   1 
ATOM   3266  N  NH2   . ARG B 2 230 ? 53.193  37.392  25.378 1.00 24.02 ? 231  ARG A NH2   1 
ATOM   3267  N  N     . ARG B 2 231 ? 49.764  39.229  31.782 1.00 17.50 ? 232  ARG A N     1 
ATOM   3268  C  CA    . ARG B 2 231 ? 49.802  39.709  33.140 1.00 18.43 ? 232  ARG A CA    1 
ATOM   3269  C  C     . ARG B 2 231 ? 48.617  39.172  33.939 1.00 17.20 ? 232  ARG A C     1 
ATOM   3270  O  O     . ARG B 2 231 ? 48.766  38.754  35.083 1.00 16.05 ? 232  ARG A O     1 
ATOM   3271  C  CB    . ARG B 2 231 ? 49.774  41.230  33.132 1.00 20.81 ? 232  ARG A CB    1 
ATOM   3272  C  CG    . ARG B 2 231 ? 50.107  41.878  34.453 1.00 27.12 ? 232  ARG A CG    1 
ATOM   3273  C  CD    . ARG B 2 231 ? 50.381  43.362  34.226 1.00 35.09 ? 232  ARG A CD    1 
ATOM   3274  N  NE    . ARG B 2 231 ? 50.897  43.990  35.442 1.00 49.13 ? 232  ARG A NE    1 
ATOM   3275  C  CZ    . ARG B 2 231 ? 52.172  43.944  35.820 1.00 54.45 ? 232  ARG A CZ    1 
ATOM   3276  N  NH1   . ARG B 2 231 ? 53.070  43.299  35.076 1.00 59.82 ? 232  ARG A NH1   1 
ATOM   3277  N  NH2   . ARG B 2 231 ? 52.539  44.540  36.941 1.00 59.39 ? 232  ARG A NH2   1 
ATOM   3278  N  N     . ALA B 2 232 ? 47.445  39.183  33.318 1.00 13.97 ? 233  ALA A N     1 
ATOM   3279  C  CA    . ALA B 2 232 ? 46.249  38.703  33.969 1.00 12.98 ? 233  ALA A CA    1 
ATOM   3280  C  C     . ALA B 2 232 ? 46.319  37.213  34.303 1.00 12.21 ? 233  ALA A C     1 
ATOM   3281  O  O     . ALA B 2 232 ? 45.957  36.809  35.395 1.00 11.50 ? 233  ALA A O     1 
ATOM   3282  C  CB    . ALA B 2 232 ? 45.027  39.013  33.112 1.00 12.27 ? 233  ALA A CB    1 
ATOM   3283  N  N     . TYR B 2 233 ? 46.792  36.407  33.357 1.00 12.07 ? 234  TYR A N     1 
ATOM   3284  C  CA    . TYR B 2 233 ? 46.917  34.972  33.579 1.00 12.46 ? 234  TYR A CA    1 
ATOM   3285  C  C     . TYR B 2 233 ? 47.947  34.622  34.644 1.00 13.26 ? 234  TYR A C     1 
ATOM   3286  O  O     . TYR B 2 233 ? 47.754  33.706  35.418 1.00 15.06 ? 234  TYR A O     1 
ATOM   3287  C  CB    . TYR B 2 233 ? 47.167  34.201  32.275 1.00 11.82 ? 234  TYR A CB    1 
ATOM   3288  C  CG    . TYR B 2 233 ? 45.988  34.188  31.331 1.00 11.55 ? 234  TYR A CG    1 
ATOM   3289  C  CD1   . TYR B 2 233 ? 44.696  34.426  31.799 1.00 12.03 ? 234  TYR A CD1   1 
ATOM   3290  C  CD2   . TYR B 2 233 ? 46.151  33.934  29.991 1.00 11.19 ? 234  TYR A CD2   1 
ATOM   3291  C  CE1   . TYR B 2 233 ? 43.619  34.419  30.946 1.00 11.94 ? 234  TYR A CE1   1 
ATOM   3292  C  CE2   . TYR B 2 233 ? 45.076  33.926  29.130 1.00 11.11 ? 234  TYR A CE2   1 
ATOM   3293  C  CZ    . TYR B 2 233 ? 43.813  34.167  29.615 1.00 11.31 ? 234  TYR A CZ    1 
ATOM   3294  O  OH    . TYR B 2 233 ? 42.746  34.151  28.761 1.00 11.83 ? 234  TYR A OH    1 
ATOM   3295  N  N     . GLU B 2 234 ? 49.062  35.339  34.642 1.00 13.91 ? 235  GLU A N     1 
ATOM   3296  C  CA    . GLU B 2 234 ? 50.131  35.157  35.616 1.00 13.71 ? 235  GLU A CA    1 
ATOM   3297  C  C     . GLU B 2 234 ? 49.805  35.562  37.049 1.00 14.38 ? 235  GLU A C     1 
ATOM   3298  O  O     . GLU B 2 234 ? 50.211  34.899  37.990 1.00 14.38 ? 235  GLU A O     1 
ATOM   3299  C  CB    . GLU B 2 234 ? 51.377  35.904  35.174 1.00 15.83 ? 235  GLU A CB    1 
ATOM   3300  C  CG    . GLU B 2 234 ? 52.202  35.194  34.127 1.00 18.47 ? 235  GLU A CG    1 
ATOM   3301  C  CD    . GLU B 2 234 ? 53.199  36.120  33.467 1.00 21.49 ? 235  GLU A CD    1 
ATOM   3302  O  OE1   . GLU B 2 234 ? 53.797  35.692  32.458 1.00 24.58 ? 235  GLU A OE1   1 
ATOM   3303  O  OE2   . GLU B 2 234 ? 53.365  37.270  33.949 1.00 21.06 ? 235  GLU A OE2   1 
ATOM   3304  N  N     . THR B 2 235 ? 49.109  36.678  37.215 1.00 13.20 ? 236  THR A N     1 
ATOM   3305  C  CA    . THR B 2 235 ? 48.805  37.187  38.542 1.00 12.21 ? 236  THR A CA    1 
ATOM   3306  C  C     . THR B 2 235 ? 47.333  37.260  38.949 1.00 13.28 ? 236  THR A C     1 
ATOM   3307  O  O     . THR B 2 235 ? 47.021  37.376  40.126 1.00 12.22 ? 236  THR A O     1 
ATOM   3308  C  CB    . THR B 2 235 ? 49.398  38.596  38.698 1.00 11.98 ? 236  THR A CB    1 
ATOM   3309  O  OG1   . THR B 2 235 ? 48.800  39.474  37.743 1.00 11.35 ? 236  THR A OG1   1 
ATOM   3310  C  CG2   . THR B 2 235 ? 50.882  38.564  38.461 1.00 11.16 ? 236  THR A CG2   1 
ATOM   3311  N  N     . GLY B 2 236 ? 46.437  37.179  37.974 1.00 14.01 ? 237  GLY A N     1 
ATOM   3312  C  CA    . GLY B 2 236 ? 45.015  37.295  38.211 1.00 12.92 ? 237  GLY A CA    1 
ATOM   3313  C  C     . GLY B 2 236 ? 44.528  38.722  38.024 1.00 14.11 ? 237  GLY A C     1 
ATOM   3314  O  O     . GLY B 2 236 ? 43.349  39.011  38.173 1.00 14.33 ? 237  GLY A O     1 
ATOM   3315  N  N     . ARG B 2 237 ? 45.450  39.614  37.695 1.00 13.49 ? 238  ARG A N     1 
ATOM   3316  C  CA    . ARG B 2 237 ? 45.123  41.012  37.452 1.00 13.94 ? 238  ARG A CA    1 
ATOM   3317  C  C     . ARG B 2 237 ? 45.803  41.523  36.184 1.00 13.29 ? 238  ARG A C     1 
ATOM   3318  O  O     . ARG B 2 237 ? 46.948  41.212  35.923 1.00 12.11 ? 238  ARG A O     1 
ATOM   3319  C  CB    . ARG B 2 237 ? 45.440  41.885  38.666 1.00 14.07 ? 238  ARG A CB    1 
ATOM   3320  C  CG    . ARG B 2 237 ? 44.296  41.923  39.659 1.00 16.28 ? 238  ARG A CG    1 
ATOM   3321  C  CD    . ARG B 2 237 ? 44.653  42.529  41.004 1.00 16.23 ? 238  ARG A CD    1 
ATOM   3322  N  NE    . ARG B 2 237 ? 44.672  43.982  40.987 1.00 19.31 ? 238  ARG A NE    1 
ATOM   3323  C  CZ    . ARG B 2 237 ? 43.689  44.730  40.498 1.00 22.30 ? 238  ARG A CZ    1 
ATOM   3324  N  NH1   . ARG B 2 237 ? 42.621  44.164  39.955 1.00 24.67 ? 238  ARG A NH1   1 
ATOM   3325  N  NH2   . ARG B 2 237 ? 43.772  46.045  40.517 1.00 23.67 ? 238  ARG A NH2   1 
ATOM   3326  N  N     . GLY B 2 238 ? 45.087  42.316  35.402 1.00 12.94 ? 239  GLY A N     1 
ATOM   3327  C  CA    . GLY B 2 238 ? 45.629  42.843  34.161 1.00 12.93 ? 239  GLY A CA    1 
ATOM   3328  C  C     . GLY B 2 238 ? 44.597  43.653  33.419 1.00 13.45 ? 239  GLY A C     1 
ATOM   3329  O  O     . GLY B 2 238 ? 43.387  43.447  33.591 1.00 13.91 ? 239  GLY A O     1 
ATOM   3330  N  N     . SER B 2 239 ? 45.084  44.576  32.594 1.00 13.13 ? 240  SER A N     1 
ATOM   3331  C  CA    . SER B 2 239 ? 44.229  45.459  31.810 1.00 13.14 ? 240  SER A CA    1 
ATOM   3332  C  C     . SER B 2 239 ? 44.292  45.051  30.344 1.00 14.03 ? 240  SER A C     1 
ATOM   3333  O  O     . SER B 2 239 ? 45.341  45.154  29.688 1.00 15.17 ? 240  SER A O     1 
ATOM   3334  C  CB    . SER B 2 239 ? 44.673  46.910  31.999 1.00 13.19 ? 240  SER A CB    1 
ATOM   3335  O  OG    . SER B 2 239 ? 43.830  47.802  31.304 1.00 14.42 ? 240  SER A OG    1 
ATOM   3336  N  N     . ILE B 2 240 ? 43.165  44.568  29.829 1.00 14.63 ? 241  ILE A N     1 
ATOM   3337  C  CA    . ILE B 2 240 ? 43.080  44.130  28.440 1.00 14.33 ? 241  ILE A CA    1 
ATOM   3338  C  C     . ILE B 2 240 ? 42.314  45.157  27.611 1.00 15.72 ? 241  ILE A C     1 
ATOM   3339  O  O     . ILE B 2 240 ? 41.229  45.578  28.009 1.00 17.12 ? 241  ILE A O     1 
ATOM   3340  C  CB    . ILE B 2 240 ? 42.433  42.733  28.347 1.00 13.76 ? 241  ILE A CB    1 
ATOM   3341  C  CG1   . ILE B 2 240 ? 43.328  41.699  29.061 1.00 12.63 ? 241  ILE A CG1   1 
ATOM   3342  C  CG2   . ILE B 2 240 ? 42.176  42.349  26.892 1.00 12.69 ? 241  ILE A CG2   1 
ATOM   3343  C  CD1   . ILE B 2 240 ? 42.706  40.332  29.259 1.00 12.20 ? 241  ILE A CD1   1 
ATOM   3344  N  N     . GLN B 2 241 ? 42.888  45.574  26.481 1.00 16.48 ? 242  GLN A N     1 
ATOM   3345  C  CA    . GLN B 2 241 ? 42.255  46.552  25.590 1.00 16.84 ? 242  GLN A CA    1 
ATOM   3346  C  C     . GLN B 2 241 ? 41.358  45.891  24.549 1.00 16.33 ? 242  GLN A C     1 
ATOM   3347  O  O     . GLN B 2 241 ? 41.839  45.218  23.641 1.00 15.12 ? 242  GLN A O     1 
ATOM   3348  C  CB    . GLN B 2 241 ? 43.301  47.439  24.883 1.00 19.21 ? 242  GLN A CB    1 
ATOM   3349  C  CG    . GLN B 2 241 ? 44.169  48.301  25.798 1.00 21.98 ? 242  GLN A CG    1 
ATOM   3350  C  CD    . GLN B 2 241 ? 43.358  49.271  26.657 1.00 24.86 ? 242  GLN A CD    1 
ATOM   3351  O  OE1   . GLN B 2 241 ? 42.232  49.660  26.295 1.00 25.64 ? 242  GLN A OE1   1 
ATOM   3352  N  NE2   . GLN B 2 241 ? 43.927  49.654  27.806 1.00 21.97 ? 242  GLN A NE2   1 
ATOM   3353  N  N     . MET B 2 242 ? 40.050  46.097  24.696 1.00 17.38 ? 243  MET A N     1 
ATOM   3354  C  CA    . MET B 2 242 ? 39.061  45.573  23.756 1.00 16.75 ? 243  MET A CA    1 
ATOM   3355  C  C     . MET B 2 242 ? 38.776  46.631  22.719 1.00 17.79 ? 243  MET A C     1 
ATOM   3356  O  O     . MET B 2 242 ? 38.614  47.807  23.047 1.00 22.00 ? 243  MET A O     1 
ATOM   3357  C  CB    . MET B 2 242 ? 37.752  45.229  24.465 1.00 16.62 ? 243  MET A CB    1 
ATOM   3358  C  CG    . MET B 2 242 ? 37.856  44.196  25.566 1.00 16.29 ? 243  MET A CG    1 
ATOM   3359  S  SD    . MET B 2 242 ? 36.258  43.914  26.321 1.00 16.20 ? 243  MET A SD    1 
ATOM   3360  C  CE    . MET B 2 242 ? 35.924  45.484  27.128 1.00 16.36 ? 243  MET A CE    1 
ATOM   3361  N  N     . ARG B 2 243 ? 38.693  46.221  21.464 1.00 16.51 ? 244  ARG A N     1 
ATOM   3362  C  CA    . ARG B 2 243 ? 38.448  47.159  20.388 1.00 16.51 ? 244  ARG A CA    1 
ATOM   3363  C  C     . ARG B 2 243 ? 37.364  46.635  19.461 1.00 17.90 ? 244  ARG A C     1 
ATOM   3364  O  O     . ARG B 2 243 ? 37.314  45.436  19.173 1.00 19.34 ? 244  ARG A O     1 
ATOM   3365  C  CB    . ARG B 2 243 ? 39.759  47.435  19.635 1.00 15.91 ? 244  ARG A CB    1 
ATOM   3366  C  CG    . ARG B 2 243 ? 39.623  48.325  18.419 1.00 14.09 ? 244  ARG A CG    1 
ATOM   3367  C  CD    . ARG B 2 243 ? 40.978  48.717  17.857 1.00 14.47 ? 244  ARG A CD    1 
ATOM   3368  N  NE    . ARG B 2 243 ? 41.674  49.725  18.652 1.00 13.66 ? 244  ARG A NE    1 
ATOM   3369  C  CZ    . ARG B 2 243 ? 42.849  50.256  18.316 1.00 14.56 ? 244  ARG A CZ    1 
ATOM   3370  N  NH1   . ARG B 2 243 ? 43.471  49.862  17.203 1.00 14.35 ? 244  ARG A NH1   1 
ATOM   3371  N  NH2   . ARG B 2 243 ? 43.416  51.181  19.088 1.00 14.13 ? 244  ARG A NH2   1 
ATOM   3372  N  N     . SER B 2 244 ? 36.495  47.540  19.013 1.00 17.02 ? 245  SER A N     1 
ATOM   3373  C  CA    . SER B 2 244 ? 35.406  47.200  18.100 1.00 16.97 ? 245  SER A CA    1 
ATOM   3374  C  C     . SER B 2 244 ? 35.947  46.798  16.745 1.00 17.02 ? 245  SER A C     1 
ATOM   3375  O  O     . SER B 2 244 ? 37.074  47.150  16.396 1.00 18.53 ? 245  SER A O     1 
ATOM   3376  C  CB    . SER B 2 244 ? 34.495  48.414  17.888 1.00 16.96 ? 245  SER A CB    1 
ATOM   3377  O  OG    . SER B 2 244 ? 33.885  48.836  19.086 1.00 18.27 ? 245  SER A OG    1 
ATOM   3378  N  N     . ARG B 2 245 ? 35.149  46.053  15.985 1.00 16.48 ? 246  ARG A N     1 
ATOM   3379  C  CA    . ARG B 2 245 ? 35.545  45.697  14.630 1.00 14.70 ? 246  ARG A CA    1 
ATOM   3380  C  C     . ARG B 2 245 ? 34.957  46.765  13.740 1.00 14.84 ? 246  ARG A C     1 
ATOM   3381  O  O     . ARG B 2 245 ? 33.736  46.873  13.608 1.00 15.42 ? 246  ARG A O     1 
ATOM   3382  C  CB    . ARG B 2 245 ? 35.076  44.303  14.217 1.00 13.72 ? 246  ARG A CB    1 
ATOM   3383  C  CG    . ARG B 2 245 ? 35.455  43.958  12.778 1.00 12.28 ? 246  ARG A CG    1 
ATOM   3384  C  CD    . ARG B 2 245 ? 35.214  42.505  12.414 1.00 11.37 ? 246  ARG A CD    1 
ATOM   3385  N  NE    . ARG B 2 245 ? 36.034  41.602  13.211 1.00 11.12 ? 246  ARG A NE    1 
ATOM   3386  C  CZ    . ARG B 2 245 ? 37.307  41.312  12.966 1.00 11.53 ? 246  ARG A CZ    1 
ATOM   3387  N  NH1   . ARG B 2 245 ? 37.963  41.883  11.937 1.00 11.29 ? 246  ARG A NH1   1 
ATOM   3388  N  NH2   . ARG B 2 245 ? 37.950  40.468  13.761 1.00 11.37 ? 246  ARG A NH2   1 
ATOM   3389  N  N     . ALA B 2 246 ? 35.830  47.569  13.148 1.00 14.31 ? 247  ALA A N     1 
ATOM   3390  C  CA    . ALA B 2 246 ? 35.396  48.658  12.295 1.00 13.93 ? 247  ALA A CA    1 
ATOM   3391  C  C     . ALA B 2 246 ? 36.187  48.666  11.002 1.00 14.99 ? 247  ALA A C     1 
ATOM   3392  O  O     . ALA B 2 246 ? 37.386  48.358  10.997 1.00 15.13 ? 247  ALA A O     1 
ATOM   3393  C  CB    . ALA B 2 246 ? 35.554  49.983  13.024 1.00 14.42 ? 247  ALA A CB    1 
ATOM   3394  N  N     . VAL B 2 247 ? 35.514  49.015  9.903  1.00 14.05 ? 248  VAL A N     1 
ATOM   3395  C  CA    . VAL B 2 247 ? 36.160  49.101  8.595  1.00 14.31 ? 248  VAL A CA    1 
ATOM   3396  C  C     . VAL B 2 247 ? 35.885  50.466  7.947  1.00 14.87 ? 248  VAL A C     1 
ATOM   3397  O  O     . VAL B 2 247 ? 34.957  51.175  8.337  1.00 15.87 ? 248  VAL A O     1 
ATOM   3398  C  CB    . VAL B 2 247 ? 35.744  47.939  7.630  1.00 15.60 ? 248  VAL A CB    1 
ATOM   3399  C  CG1   . VAL B 2 247 ? 36.224  46.580  8.154  1.00 15.17 ? 248  VAL A CG1   1 
ATOM   3400  C  CG2   . VAL B 2 247 ? 34.233  47.936  7.366  1.00 15.71 ? 248  VAL A CG2   1 
ATOM   3401  N  N     . ILE B 2 248 ? 36.713  50.842  6.977  1.00 14.71 ? 249  ILE A N     1 
ATOM   3402  C  CA    . ILE B 2 248 ? 36.500  52.079  6.233  1.00 14.14 ? 249  ILE A CA    1 
ATOM   3403  C  C     . ILE B 2 248 ? 36.130  51.713  4.797  1.00 15.26 ? 249  ILE A C     1 
ATOM   3404  O  O     . ILE B 2 248 ? 36.903  51.036  4.103  1.00 17.24 ? 249  ILE A O     1 
ATOM   3405  C  CB    . ILE B 2 248 ? 37.740  52.990  6.265  1.00 13.54 ? 249  ILE A CB    1 
ATOM   3406  C  CG1   . ILE B 2 248 ? 38.045  53.413  7.715  1.00 13.48 ? 249  ILE A CG1   1 
ATOM   3407  C  CG2   . ILE B 2 248 ? 37.542  54.213  5.374  1.00 12.89 ? 249  ILE A CG2   1 
ATOM   3408  C  CD1   . ILE B 2 248 ? 39.403  54.068  7.905  1.00 12.40 ? 249  ILE A CD1   1 
ATOM   3409  N  N     . GLU B 2 249 ? 34.941  52.125  4.369  1.00 14.93 ? 250  GLU A N     1 
ATOM   3410  C  CA    . GLU B 2 249 ? 34.472  51.844  3.016  1.00 16.50 ? 250  GLU A CA    1 
ATOM   3411  C  C     . GLU B 2 249 ? 33.878  53.082  2.341  1.00 18.67 ? 250  GLU A C     1 
ATOM   3412  O  O     . GLU B 2 249 ? 33.503  54.052  3.010  1.00 20.19 ? 250  GLU A O     1 
ATOM   3413  C  CB    . GLU B 2 249 ? 33.456  50.686  3.013  1.00 14.78 ? 250  GLU A CB    1 
ATOM   3414  C  CG    . GLU B 2 249 ? 32.122  50.992  3.684  1.00 15.94 ? 250  GLU A CG    1 
ATOM   3415  C  CD    . GLU B 2 249 ? 31.094  49.885  3.538  1.00 16.36 ? 250  GLU A CD    1 
ATOM   3416  O  OE1   . GLU B 2 249 ? 31.462  48.749  3.158  1.00 17.05 ? 250  GLU A OE1   1 
ATOM   3417  O  OE2   . GLU B 2 249 ? 29.896  50.145  3.802  1.00 17.54 ? 250  GLU A OE2   1 
ATOM   3418  N  N     . GLU B 2 250 ? 33.791  53.021  1.016  1.00 20.61 ? 251  GLU A N     1 
ATOM   3419  C  CA    . GLU B 2 250 ? 33.257  54.097  0.178  1.00 20.68 ? 251  GLU A CA    1 
ATOM   3420  C  C     . GLU B 2 250 ? 31.728  54.137  0.151  1.00 20.78 ? 251  GLU A C     1 
ATOM   3421  O  O     . GLU B 2 250 ? 31.085  53.092  0.129  1.00 23.02 ? 251  GLU A O     1 
ATOM   3422  C  CB    . GLU B 2 250 ? 33.808  53.934  -1.246 1.00 21.35 ? 251  GLU A CB    1 
ATOM   3423  C  CG    . GLU B 2 250 ? 33.666  52.514  -1.794 1.00 20.69 ? 251  GLU A CG    1 
ATOM   3424  C  CD    . GLU B 2 250 ? 34.427  52.299  -3.083 1.00 22.70 ? 251  GLU A CD    1 
ATOM   3425  O  OE1   . GLU B 2 250 ? 34.145  53.037  -4.055 1.00 23.12 ? 251  GLU A OE1   1 
ATOM   3426  O  OE2   . GLU B 2 250 ? 35.292  51.380  -3.148 1.00 23.08 ? 251  GLU A OE2   1 
ATOM   3427  N  N     . ARG B 2 251 ? 31.156  55.342  0.149  1.00 21.47 ? 252  ARG A N     1 
ATOM   3428  C  CA    . ARG B 2 251 ? 29.692  55.521  0.104  1.00 24.29 ? 252  ARG A CA    1 
ATOM   3429  C  C     . ARG B 2 251 ? 29.176  56.290  -1.125 1.00 26.43 ? 252  ARG A C     1 
ATOM   3430  O  O     . ARG B 2 251 ? 27.968  56.537  -1.252 1.00 28.12 ? 252  ARG A O     1 
ATOM   3431  C  CB    . ARG B 2 251 ? 29.164  56.176  1.402  1.00 25.59 ? 252  ARG A CB    1 
ATOM   3432  C  CG    . ARG B 2 251 ? 29.840  57.482  1.765  1.00 25.49 ? 252  ARG A CG    1 
ATOM   3433  C  CD    . ARG B 2 251 ? 29.025  58.301  2.747  1.00 26.33 ? 252  ARG A CD    1 
ATOM   3434  N  NE    . ARG B 2 251 ? 29.732  59.538  3.108  1.00 26.27 ? 252  ARG A NE    1 
ATOM   3435  C  CZ    . ARG B 2 251 ? 29.151  60.629  3.592  1.00 26.24 ? 252  ARG A CZ    1 
ATOM   3436  N  NH1   . ARG B 2 251 ? 29.886  61.689  3.893  1.00 29.90 ? 252  ARG A NH1   1 
ATOM   3437  N  NH2   . ARG B 2 251 ? 27.841  60.672  3.765  1.00 29.86 ? 252  ARG A NH2   1 
ATOM   3438  N  N     . GLY B 2 252 ? 30.084  56.681  -2.015 1.00 26.56 ? 253  GLY A N     1 
ATOM   3439  C  CA    . GLY B 2 252 ? 29.693  57.381  -3.242 1.00 27.83 ? 253  GLY A CA    1 
ATOM   3440  C  C     . GLY B 2 252 ? 30.174  58.814  -3.349 1.00 30.98 ? 253  GLY A C     1 
ATOM   3441  O  O     . GLY B 2 252 ? 30.115  59.580  -2.377 1.00 32.76 ? 253  GLY A O     1 
ATOM   3442  N  N     . GLY B 2 253 ? 30.646  59.170  -4.548 1.00 29.43 ? 254  GLY A N     1 
ATOM   3443  C  CA    . GLY B 2 253 ? 31.091  60.529  -4.854 1.00 30.39 ? 254  GLY A CA    1 
ATOM   3444  C  C     . GLY B 2 253 ? 32.381  60.956  -4.180 1.00 31.55 ? 254  GLY A C     1 
ATOM   3445  O  O     . GLY B 2 253 ? 32.575  62.132  -3.888 1.00 34.32 ? 254  GLY A O     1 
ATOM   3446  N  N     . GLY B 2 254 ? 33.270  60.006  -3.938 1.00 33.15 ? 255  GLY A N     1 
ATOM   3447  C  CA    . GLY B 2 254 ? 34.554  60.293  -3.306 1.00 31.60 ? 255  GLY A CA    1 
ATOM   3448  C  C     . GLY B 2 254 ? 34.436  60.448  -1.800 1.00 28.87 ? 255  GLY A C     1 
ATOM   3449  O  O     . GLY B 2 254 ? 35.356  60.944  -1.144 1.00 26.20 ? 255  GLY A O     1 
ATOM   3450  N  N     . ARG B 2 255 ? 33.294  60.030  -1.261 1.00 26.61 ? 256  ARG A N     1 
ATOM   3451  C  CA    . ARG B 2 255 ? 33.062  60.096  0.176  1.00 27.52 ? 256  ARG A CA    1 
ATOM   3452  C  C     . ARG B 2 255 ? 33.144  58.725  0.837  1.00 26.25 ? 256  ARG A C     1 
ATOM   3453  O  O     . ARG B 2 255 ? 32.780  57.706  0.237  1.00 24.72 ? 256  ARG A O     1 
ATOM   3454  C  CB    . ARG B 2 255 ? 31.728  60.776  0.493  1.00 30.13 ? 256  ARG A CB    1 
ATOM   3455  C  CG    . ARG B 2 255 ? 31.728  62.282  0.251  1.00 34.35 ? 256  ARG A CG    1 
ATOM   3456  C  CD    . ARG B 2 255 ? 30.418  62.914  0.691  1.00 36.24 ? 256  ARG A CD    1 
ATOM   3457  N  NE    . ARG B 2 255 ? 29.287  62.386  -0.068 1.00 43.00 ? 256  ARG A NE    1 
ATOM   3458  C  CZ    . ARG B 2 255 ? 28.800  62.925  -1.179 1.00 46.00 ? 256  ARG A CZ    1 
ATOM   3459  N  NH1   . ARG B 2 255 ? 29.338  64.050  -1.669 1.00 44.95 ? 256  ARG A NH1   1 
ATOM   3460  N  NH2   . ARG B 2 255 ? 27.755  62.345  -1.774 1.00 41.94 ? 256  ARG A NH2   1 
ATOM   3461  N  N     . GLN B 2 256 ? 33.622  58.716  2.082  1.00 23.43 ? 257  GLN A N     1 
ATOM   3462  C  CA    . GLN B 2 256 ? 33.804  57.484  2.845  1.00 20.21 ? 257  GLN A CA    1 
ATOM   3463  C  C     . GLN B 2 256 ? 32.987  57.410  4.121  1.00 19.56 ? 257  GLN A C     1 
ATOM   3464  O  O     . GLN B 2 256 ? 32.459  58.415  4.596  1.00 20.98 ? 257  GLN A O     1 
ATOM   3465  C  CB    . GLN B 2 256 ? 35.280  57.323  3.191  1.00 20.82 ? 257  GLN A CB    1 
ATOM   3466  C  CG    . GLN B 2 256 ? 36.157  56.961  2.006  1.00 19.77 ? 257  GLN A CG    1 
ATOM   3467  C  CD    . GLN B 2 256 ? 37.624  57.000  2.350  1.00 19.59 ? 257  GLN A CD    1 
ATOM   3468  O  OE1   . GLN B 2 256 ? 38.106  57.960  2.963  1.00 19.64 ? 257  GLN A OE1   1 
ATOM   3469  N  NE2   . GLN B 2 256 ? 38.353  55.982  1.917  1.00 20.42 ? 257  GLN A NE2   1 
ATOM   3470  N  N     . ARG B 2 257 ? 32.886  56.204  4.675  1.00 18.67 ? 258  ARG A N     1 
ATOM   3471  C  CA    . ARG B 2 257 ? 32.177  55.984  5.937  1.00 16.93 ? 258  ARG A CA    1 
ATOM   3472  C  C     . ARG B 2 257 ? 32.884  54.923  6.775  1.00 16.55 ? 258  ARG A C     1 
ATOM   3473  O  O     . ARG B 2 257 ? 33.668  54.119  6.252  1.00 16.38 ? 258  ARG A O     1 
ATOM   3474  C  CB    . ARG B 2 257 ? 30.722  55.595  5.687  1.00 16.41 ? 258  ARG A CB    1 
ATOM   3475  C  CG    . ARG B 2 257 ? 30.520  54.268  4.973  1.00 16.54 ? 258  ARG A CG    1 
ATOM   3476  C  CD    . ARG B 2 257 ? 29.072  54.102  4.516  1.00 16.22 ? 258  ARG A CD    1 
ATOM   3477  N  NE    . ARG B 2 257 ? 28.866  52.837  3.815  1.00 15.98 ? 258  ARG A NE    1 
ATOM   3478  C  CZ    . ARG B 2 257 ? 27.800  52.548  3.069  1.00 14.96 ? 258  ARG A CZ    1 
ATOM   3479  N  NH1   . ARG B 2 257 ? 26.822  53.470  2.899  1.00 13.65 ? 258  ARG A NH1   1 
ATOM   3480  N  NH2   . ARG B 2 257 ? 27.711  51.352  2.487  1.00 13.08 ? 258  ARG A NH2   1 
ATOM   3481  N  N     . ILE B 2 258 ? 32.621  54.943  8.078  1.00 15.30 ? 259  ILE A N     1 
ATOM   3482  C  CA    . ILE B 2 258 ? 33.156  53.945  8.999  1.00 14.14 ? 259  ILE A CA    1 
ATOM   3483  C  C     . ILE B 2 258 ? 31.991  53.022  9.360  1.00 13.73 ? 259  ILE A C     1 
ATOM   3484  O  O     . ILE B 2 258 ? 30.893  53.495  9.674  1.00 14.01 ? 259  ILE A O     1 
ATOM   3485  C  CB    . ILE B 2 258 ? 33.766  54.593  10.268 1.00 14.46 ? 259  ILE A CB    1 
ATOM   3486  C  CG1   . ILE B 2 258 ? 34.843  55.624  9.892  1.00 14.05 ? 259  ILE A CG1   1 
ATOM   3487  C  CG2   . ILE B 2 258 ? 34.342  53.521  11.206 1.00 14.95 ? 259  ILE A CG2   1 
ATOM   3488  C  CD1   . ILE B 2 258 ? 35.251  56.568  11.025 1.00 13.80 ? 259  ILE A CD1   1 
ATOM   3489  N  N     . VAL B 2 259 ? 32.217  51.715  9.274  1.00 13.80 ? 260  VAL A N     1 
ATOM   3490  C  CA    . VAL B 2 259 ? 31.186  50.715  9.566  1.00 12.72 ? 260  VAL A CA    1 
ATOM   3491  C  C     . VAL B 2 259 ? 31.639  49.781  10.693 1.00 12.36 ? 260  VAL A C     1 
ATOM   3492  O  O     . VAL B 2 259 ? 32.651  49.079  10.564 1.00 12.11 ? 260  VAL A O     1 
ATOM   3493  C  CB    . VAL B 2 259 ? 30.784  49.909  8.304  1.00 13.15 ? 260  VAL A CB    1 
ATOM   3494  C  CG1   . VAL B 2 259 ? 29.844  48.755  8.657  1.00 12.36 ? 260  VAL A CG1   1 
ATOM   3495  C  CG2   . VAL B 2 259 ? 30.140  50.820  7.261  1.00 12.78 ? 260  VAL A CG2   1 
ATOM   3496  N  N     . VAL B 2 260 ? 30.881  49.788  11.789 1.00 11.16 ? 261  VAL A N     1 
ATOM   3497  C  CA    . VAL B 2 260 ? 31.172  48.976  12.968 1.00 10.86 ? 261  VAL A CA    1 
ATOM   3498  C  C     . VAL B 2 260 ? 30.207  47.788  13.037 1.00 10.77 ? 261  VAL A C     1 
ATOM   3499  O  O     . VAL B 2 260 ? 28.993  47.977  13.086 1.00 10.79 ? 261  VAL A O     1 
ATOM   3500  C  CB    . VAL B 2 260 ? 31.100  49.819  14.275 1.00 10.64 ? 261  VAL A CB    1 
ATOM   3501  C  CG1   . VAL B 2 260 ? 31.407  48.968  15.508 1.00 10.32 ? 261  VAL A CG1   1 
ATOM   3502  C  CG2   . VAL B 2 260 ? 32.061  51.009  14.195 1.00 10.30 ? 261  VAL A CG2   1 
ATOM   3503  N  N     . THR B 2 261 ? 30.756  46.572  13.058 1.00 9.93  ? 262  THR A N     1 
ATOM   3504  C  CA    . THR B 2 261 ? 29.935  45.365  13.052 1.00 10.44 ? 262  THR A CA    1 
ATOM   3505  C  C     . THR B 2 261 ? 30.014  44.548  14.335 1.00 11.19 ? 262  THR A C     1 
ATOM   3506  O  O     . THR B 2 261 ? 29.220  43.629  14.545 1.00 11.80 ? 262  THR A O     1 
ATOM   3507  C  CB    . THR B 2 261 ? 30.268  44.449  11.832 1.00 10.05 ? 262  THR A CB    1 
ATOM   3508  O  OG1   . THR B 2 261 ? 31.670  44.150  11.817 1.00 9.27  ? 262  THR A OG1   1 
ATOM   3509  C  CG2   . THR B 2 261 ? 29.885  45.125  10.513 1.00 9.70  ? 262  THR A CG2   1 
ATOM   3510  N  N     . GLU B 2 262 ? 30.973  44.887  15.192 1.00 11.66 ? 263  GLU A N     1 
ATOM   3511  C  CA    . GLU B 2 262 ? 31.175  44.200  16.465 1.00 11.77 ? 263  GLU A CA    1 
ATOM   3512  C  C     . GLU B 2 262 ? 31.681  45.220  17.470 1.00 12.55 ? 263  GLU A C     1 
ATOM   3513  O  O     . GLU B 2 262 ? 32.562  46.028  17.158 1.00 12.99 ? 263  GLU A O     1 
ATOM   3514  C  CB    . GLU B 2 262 ? 32.202  43.081  16.318 1.00 12.28 ? 263  GLU A CB    1 
ATOM   3515  C  CG    . GLU B 2 262 ? 31.790  41.939  15.392 1.00 12.36 ? 263  GLU A CG    1 
ATOM   3516  C  CD    . GLU B 2 262 ? 32.952  41.021  15.020 1.00 12.96 ? 263  GLU A CD    1 
ATOM   3517  O  OE1   . GLU B 2 262 ? 32.711  40.050  14.277 1.00 13.41 ? 263  GLU A OE1   1 
ATOM   3518  O  OE2   . GLU B 2 262 ? 34.096  41.266  15.463 1.00 12.13 ? 263  GLU A OE2   1 
ATOM   3519  N  N     . ILE B 2 263 ? 31.117  45.178  18.676 1.00 12.01 ? 264  ILE A N     1 
ATOM   3520  C  CA    . ILE B 2 263 ? 31.495  46.099  19.756 1.00 12.42 ? 264  ILE A CA    1 
ATOM   3521  C  C     . ILE B 2 263 ? 32.091  45.334  20.958 1.00 12.38 ? 264  ILE A C     1 
ATOM   3522  O  O     . ILE B 2 263 ? 31.918  44.115  21.065 1.00 11.51 ? 264  ILE A O     1 
ATOM   3523  C  CB    . ILE B 2 263 ? 30.303  46.990  20.221 1.00 12.15 ? 264  ILE A CB    1 
ATOM   3524  C  CG1   . ILE B 2 263 ? 29.177  46.137  20.800 1.00 12.77 ? 264  ILE A CG1   1 
ATOM   3525  C  CG2   . ILE B 2 263 ? 29.808  47.873  19.062 1.00 12.61 ? 264  ILE A CG2   1 
ATOM   3526  C  CD1   . ILE B 2 263 ? 28.046  46.910  21.453 1.00 13.64 ? 264  ILE A CD1   1 
ATOM   3527  N  N     . PRO B 2 264 ? 32.788  46.053  21.864 1.00 12.30 ? 265  PRO A N     1 
ATOM   3528  C  CA    . PRO B 2 264 ? 33.377  45.433  23.050 1.00 13.15 ? 265  PRO A CA    1 
ATOM   3529  C  C     . PRO B 2 264 ? 32.361  44.816  23.995 1.00 14.26 ? 265  PRO A C     1 
ATOM   3530  O  O     . PRO B 2 264 ? 31.198  45.226  24.005 1.00 15.31 ? 265  PRO A O     1 
ATOM   3531  C  CB    . PRO B 2 264 ? 34.107  46.598  23.736 1.00 12.39 ? 265  PRO A CB    1 
ATOM   3532  C  CG    . PRO B 2 264 ? 34.266  47.641  22.680 1.00 11.84 ? 265  PRO A CG    1 
ATOM   3533  C  CD    . PRO B 2 264 ? 33.062  47.495  21.813 1.00 12.06 ? 265  PRO A CD    1 
ATOM   3534  N  N     . PHE B 2 265 ? 32.808  43.837  24.777 1.00 15.31 ? 266  PHE A N     1 
ATOM   3535  C  CA    . PHE B 2 265 ? 31.973  43.132  25.757 1.00 15.91 ? 266  PHE A CA    1 
ATOM   3536  C  C     . PHE B 2 265 ? 31.422  44.088  26.807 1.00 16.20 ? 266  PHE A C     1 
ATOM   3537  O  O     . PHE B 2 265 ? 32.116  45.026  27.225 1.00 17.26 ? 266  PHE A O     1 
ATOM   3538  C  CB    . PHE B 2 265 ? 32.801  42.004  26.396 1.00 15.02 ? 266  PHE A CB    1 
ATOM   3539  C  CG    . PHE B 2 265 ? 32.044  41.146  27.395 1.00 16.19 ? 266  PHE A CG    1 
ATOM   3540  C  CD1   . PHE B 2 265 ? 30.830  40.539  27.062 1.00 15.71 ? 266  PHE A CD1   1 
ATOM   3541  C  CD2   . PHE B 2 265 ? 32.596  40.866  28.643 1.00 17.19 ? 266  PHE A CD2   1 
ATOM   3542  C  CE1   . PHE B 2 265 ? 30.160  39.736  27.976 1.00 15.72 ? 266  PHE A CE1   1 
ATOM   3543  C  CE2   . PHE B 2 265 ? 31.925  40.052  29.568 1.00 17.11 ? 266  PHE A CE2   1 
ATOM   3544  C  CZ    . PHE B 2 265 ? 30.708  39.490  29.229 1.00 16.48 ? 266  PHE A CZ    1 
ATOM   3545  N  N     . GLN B 2 266 ? 30.175  43.867  27.204 1.00 15.47 ? 267  GLN A N     1 
ATOM   3546  C  CA    . GLN B 2 266 ? 29.501  44.675  28.244 1.00 16.75 ? 267  GLN A CA    1 
ATOM   3547  C  C     . GLN B 2 266 ? 29.317  46.170  27.930 1.00 17.08 ? 267  GLN A C     1 
ATOM   3548  O  O     . GLN B 2 266 ? 29.103  46.971  28.839 1.00 18.30 ? 267  GLN A O     1 
ATOM   3549  C  CB    . GLN B 2 266 ? 30.180  44.472  29.616 1.00 17.22 ? 267  GLN A CB    1 
ATOM   3550  C  CG    . GLN B 2 266 ? 30.033  43.054  30.174 1.00 18.58 ? 267  GLN A CG    1 
ATOM   3551  C  CD    . GLN B 2 266 ? 30.737  42.862  31.514 1.00 19.30 ? 267  GLN A CD    1 
ATOM   3552  O  OE1   . GLN B 2 266 ? 31.750  43.480  31.790 1.00 19.77 ? 267  GLN A OE1   1 
ATOM   3553  N  NE2   . GLN B 2 266 ? 30.183  41.983  32.359 1.00 19.43 ? 267  GLN A NE2   1 
ATOM   3554  N  N     . VAL B 2 267 ? 29.395  46.542  26.655 1.00 17.88 ? 268  VAL A N     1 
ATOM   3555  C  CA    . VAL B 2 267 ? 29.205  47.940  26.241 1.00 17.03 ? 268  VAL A CA    1 
ATOM   3556  C  C     . VAL B 2 267 ? 27.816  48.114  25.639 1.00 17.58 ? 268  VAL A C     1 
ATOM   3557  O  O     . VAL B 2 267 ? 27.433  47.387  24.730 1.00 19.90 ? 268  VAL A O     1 
ATOM   3558  C  CB    . VAL B 2 267 ? 30.280  48.416  25.223 1.00 16.93 ? 268  VAL A CB    1 
ATOM   3559  C  CG1   . VAL B 2 267 ? 29.942  49.805  24.679 1.00 15.71 ? 268  VAL A CG1   1 
ATOM   3560  C  CG2   . VAL B 2 267 ? 31.667  48.422  25.860 1.00 15.32 ? 268  VAL A CG2   1 
ATOM   3561  N  N     . ASN B 2 268 ? 27.067  49.080  26.157 1.00 16.52 ? 269  ASN A N     1 
ATOM   3562  C  CA    . ASN B 2 268 ? 25.730  49.375  25.662 1.00 15.82 ? 269  ASN A CA    1 
ATOM   3563  C  C     . ASN B 2 268 ? 25.812  50.160  24.346 1.00 14.87 ? 269  ASN A C     1 
ATOM   3564  O  O     . ASN B 2 268 ? 26.270  51.310  24.324 1.00 13.52 ? 269  ASN A O     1 
ATOM   3565  C  CB    . ASN B 2 268 ? 24.941  50.127  26.736 1.00 15.98 ? 269  ASN A CB    1 
ATOM   3566  C  CG    . ASN B 2 268 ? 23.544  50.506  26.296 1.00 17.06 ? 269  ASN A CG    1 
ATOM   3567  O  OD1   . ASN B 2 268 ? 23.322  50.970  25.171 1.00 18.66 ? 269  ASN A OD1   1 
ATOM   3568  N  ND2   . ASN B 2 268 ? 22.590  50.342  27.201 1.00 17.10 ? 269  ASN A ND2   1 
ATOM   3569  N  N     . LYS B 2 269 ? 25.357  49.524  23.264 1.00 13.62 ? 270  LYS A N     1 
ATOM   3570  C  CA    . LYS B 2 269 ? 25.418  50.098  21.905 1.00 13.61 ? 270  LYS A CA    1 
ATOM   3571  C  C     . LYS B 2 269 ? 24.768  51.483  21.774 1.00 13.91 ? 270  LYS A C     1 
ATOM   3572  O  O     . LYS B 2 269 ? 25.416  52.425  21.338 1.00 14.13 ? 270  LYS A O     1 
ATOM   3573  C  CB    . LYS B 2 269 ? 24.863  49.099  20.877 1.00 12.76 ? 270  LYS A CB    1 
ATOM   3574  C  CG    . LYS B 2 269 ? 24.988  49.511  19.417 1.00 11.96 ? 270  LYS A CG    1 
ATOM   3575  C  CD    . LYS B 2 269 ? 24.744  48.334  18.450 1.00 11.70 ? 270  LYS A CD    1 
ATOM   3576  C  CE    . LYS B 2 269 ? 23.355  47.672  18.573 1.00 10.77 ? 270  LYS A CE    1 
ATOM   3577  N  NZ    . LYS B 2 269 ? 22.214  48.580  18.279 1.00 10.18 ? 270  LYS A NZ    1 
ATOM   3578  N  N     . ALA B 2 270 ? 23.505  51.603  22.169 1.00 15.04 ? 271  ALA A N     1 
ATOM   3579  C  CA    . ALA B 2 270 ? 22.792  52.884  22.120 1.00 16.05 ? 271  ALA A CA    1 
ATOM   3580  C  C     . ALA B 2 270 ? 23.527  53.965  22.927 1.00 18.05 ? 271  ALA A C     1 
ATOM   3581  O  O     . ALA B 2 270 ? 23.669  55.099  22.464 1.00 19.65 ? 271  ALA A O     1 
ATOM   3582  C  CB    . ALA B 2 270 ? 21.358  52.724  22.607 1.00 14.54 ? 271  ALA A CB    1 
ATOM   3583  N  N     . ARG B 2 271 ? 24.007  53.597  24.112 1.00 18.34 ? 272  ARG A N     1 
ATOM   3584  C  CA    . ARG B 2 271 ? 24.751  54.506  24.987 1.00 20.57 ? 272  ARG A CA    1 
ATOM   3585  C  C     . ARG B 2 271 ? 26.092  54.933  24.373 1.00 19.88 ? 272  ARG A C     1 
ATOM   3586  O  O     . ARG B 2 271 ? 26.537  56.065  24.582 1.00 21.46 ? 272  ARG A O     1 
ATOM   3587  C  CB    . ARG B 2 271 ? 24.974  53.847  26.352 1.00 21.80 ? 272  ARG A CB    1 
ATOM   3588  C  CG    . ARG B 2 271 ? 25.787  54.665  27.352 1.00 24.05 ? 272  ARG A CG    1 
ATOM   3589  C  CD    . ARG B 2 271 ? 26.099  53.806  28.564 1.00 24.22 ? 272  ARG A CD    1 
ATOM   3590  N  NE    . ARG B 2 271 ? 24.886  53.538  29.333 1.00 28.04 ? 272  ARG A NE    1 
ATOM   3591  C  CZ    . ARG B 2 271 ? 24.654  52.411  30.020 1.00 26.60 ? 272  ARG A CZ    1 
ATOM   3592  N  NH1   . ARG B 2 271 ? 25.541  51.434  30.001 1.00 23.80 ? 272  ARG A NH1   1 
ATOM   3593  N  NH2   . ARG B 2 271 ? 23.535  52.255  30.691 1.00 27.35 ? 272  ARG A NH2   1 
ATOM   3594  N  N     . MET B 2 272 ? 26.731  54.025  23.640 1.00 18.85 ? 273  MET A N     1 
ATOM   3595  C  CA    . MET B 2 272 ? 28.006  54.322  22.975 1.00 20.68 ? 273  MET A CA    1 
ATOM   3596  C  C     . MET B 2 272 ? 27.757  55.348  21.867 1.00 21.48 ? 273  MET A C     1 
ATOM   3597  O  O     . MET B 2 272 ? 28.447  56.363  21.786 1.00 20.73 ? 273  MET A O     1 
ATOM   3598  C  CB    . MET B 2 272 ? 28.622  53.045  22.386 1.00 19.83 ? 273  MET A CB    1 
ATOM   3599  C  CG    . MET B 2 272 ? 29.994  53.246  21.773 1.00 19.28 ? 273  MET A CG    1 
ATOM   3600  S  SD    . MET B 2 272 ? 30.635  51.782  20.928 1.00 20.67 ? 273  MET A SD    1 
ATOM   3601  C  CE    . MET B 2 272 ? 29.578  51.731  19.464 1.00 18.99 ? 273  MET A CE    1 
ATOM   3602  N  N     . ILE B 2 273 ? 26.750  55.067  21.036 1.00 20.97 ? 274  ILE A N     1 
ATOM   3603  C  CA    . ILE B 2 273 ? 26.324  55.947  19.952 1.00 21.64 ? 274  ILE A CA    1 
ATOM   3604  C  C     . ILE B 2 273 ? 25.995  57.358  20.463 1.00 23.81 ? 274  ILE A C     1 
ATOM   3605  O  O     . ILE B 2 273 ? 26.401  58.353  19.839 1.00 26.15 ? 274  ILE A O     1 
ATOM   3606  C  CB    . ILE B 2 273 ? 25.105  55.355  19.197 1.00 21.07 ? 274  ILE A CB    1 
ATOM   3607  C  CG1   . ILE B 2 273 ? 25.519  54.095  18.430 1.00 18.82 ? 274  ILE A CG1   1 
ATOM   3608  C  CG2   . ILE B 2 273 ? 24.480  56.389  18.248 1.00 20.05 ? 274  ILE A CG2   1 
ATOM   3609  C  CD1   . ILE B 2 273 ? 24.353  53.317  17.832 1.00 18.96 ? 274  ILE A CD1   1 
ATOM   3610  N  N     A GLU B 2 274 ? 25.275  57.447  21.582 0.50 23.52 ? 275  GLU A N     1 
ATOM   3611  N  N     B GLU B 2 274 ? 25.273  57.428  21.585 0.50 23.68 ? 275  GLU A N     1 
ATOM   3612  C  CA    A GLU B 2 274 ? 24.903  58.744  22.147 0.50 23.49 ? 275  GLU A CA    1 
ATOM   3613  C  CA    B GLU B 2 274 ? 24.892  58.694  22.219 0.50 23.71 ? 275  GLU A CA    1 
ATOM   3614  C  C     A GLU B 2 274 ? 26.129  59.562  22.568 0.50 23.57 ? 275  GLU A C     1 
ATOM   3615  C  C     B GLU B 2 274 ? 26.103  59.544  22.601 0.50 23.72 ? 275  GLU A C     1 
ATOM   3616  O  O     A GLU B 2 274 ? 26.146  60.783  22.395 0.50 24.83 ? 275  GLU A O     1 
ATOM   3617  O  O     B GLU B 2 274 ? 26.084  60.765  22.436 0.50 25.05 ? 275  GLU A O     1 
ATOM   3618  C  CB    A GLU B 2 274 ? 23.904  58.589  23.303 0.50 23.87 ? 275  GLU A CB    1 
ATOM   3619  C  CB    B GLU B 2 274 ? 24.013  58.440  23.452 0.50 24.36 ? 275  GLU A CB    1 
ATOM   3620  C  CG    A GLU B 2 274 ? 23.315  59.915  23.778 0.50 24.52 ? 275  GLU A CG    1 
ATOM   3621  C  CG    B GLU B 2 274 ? 22.598  57.977  23.132 0.50 25.00 ? 275  GLU A CG    1 
ATOM   3622  C  CD    A GLU B 2 274 ? 22.475  60.642  22.716 0.50 23.95 ? 275  GLU A CD    1 
ATOM   3623  C  CD    B GLU B 2 274 ? 21.814  57.553  24.361 0.50 26.54 ? 275  GLU A CD    1 
ATOM   3624  O  OE1   A GLU B 2 274 ? 21.840  59.977  21.881 0.50 23.14 ? 275  GLU A OE1   1 
ATOM   3625  O  OE1   B GLU B 2 274 ? 22.309  57.772  25.493 0.50 26.52 ? 275  GLU A OE1   1 
ATOM   3626  O  OE2   A GLU B 2 274 ? 22.436  61.891  22.719 0.50 23.47 ? 275  GLU A OE2   1 
ATOM   3627  O  OE2   B GLU B 2 274 ? 20.700  57.001  24.189 0.50 26.48 ? 275  GLU A OE2   1 
ATOM   3628  N  N     . LYS B 2 275 ? 27.151  58.887  23.103 1.00 23.01 ? 276  LYS A N     1 
ATOM   3629  C  CA    . LYS B 2 275 ? 28.391  59.556  23.502 1.00 22.15 ? 276  LYS A CA    1 
ATOM   3630  C  C     . LYS B 2 275 ? 29.172  60.057  22.280 1.00 22.49 ? 276  LYS A C     1 
ATOM   3631  O  O     . LYS B 2 275 ? 29.862  61.080  22.353 1.00 20.85 ? 276  LYS A O     1 
ATOM   3632  C  CB    . LYS B 2 275 ? 29.264  58.642  24.359 1.00 24.40 ? 276  LYS A CB    1 
ATOM   3633  C  CG    . LYS B 2 275 ? 28.711  58.354  25.755 1.00 25.47 ? 276  LYS A CG    1 
ATOM   3634  C  CD    . LYS B 2 275 ? 29.593  57.375  26.515 1.00 27.47 ? 276  LYS A CD    1 
ATOM   3635  C  CE    . LYS B 2 275 ? 29.035  57.108  27.918 1.00 31.72 ? 276  LYS A CE    1 
ATOM   3636  N  NZ    . LYS B 2 275 ? 29.791  56.006  28.631 1.00 29.43 ? 276  LYS A NZ    1 
ATOM   3637  N  N     . ILE B 2 276 ? 29.056  59.333  21.165 1.00 21.96 ? 277  ILE A N     1 
ATOM   3638  C  CA    . ILE B 2 276 ? 29.699  59.716  19.901 1.00 21.28 ? 277  ILE A CA    1 
ATOM   3639  C  C     . ILE B 2 276 ? 28.999  60.945  19.326 1.00 19.69 ? 277  ILE A C     1 
ATOM   3640  O  O     . ILE B 2 276 ? 29.648  61.832  18.791 1.00 18.30 ? 277  ILE A O     1 
ATOM   3641  C  CB    . ILE B 2 276 ? 29.705  58.550  18.862 1.00 22.31 ? 277  ILE A CB    1 
ATOM   3642  C  CG1   . ILE B 2 276 ? 30.528  57.363  19.388 1.00 21.64 ? 277  ILE A CG1   1 
ATOM   3643  C  CG2   . ILE B 2 276 ? 30.240  59.025  17.498 1.00 21.92 ? 277  ILE A CG2   1 
ATOM   3644  C  CD1   . ILE B 2 276 ? 30.527  56.140  18.479 1.00 21.64 ? 277  ILE A CD1   1 
ATOM   3645  N  N     . ALA B 2 277 ? 27.672  60.986  19.453 1.00 21.58 ? 278  ALA A N     1 
ATOM   3646  C  CA    . ALA B 2 277 ? 26.862  62.112  18.987 1.00 22.44 ? 278  ALA A CA    1 
ATOM   3647  C  C     . ALA B 2 277 ? 27.139  63.345  19.835 1.00 26.30 ? 278  ALA A C     1 
ATOM   3648  O  O     . ALA B 2 277 ? 27.102  64.466  19.325 1.00 26.97 ? 278  ALA A O     1 
ATOM   3649  C  CB    . ALA B 2 277 ? 25.393  61.768  19.033 1.00 19.47 ? 278  ALA A CB    1 
ATOM   3650  N  N     . GLU B 2 278 ? 27.420  63.124  21.124 1.00 28.79 ? 279  GLU A N     1 
ATOM   3651  C  CA    . GLU B 2 278 ? 27.718  64.200  22.070 1.00 30.67 ? 279  GLU A CA    1 
ATOM   3652  C  C     . GLU B 2 278 ? 29.028  64.904  21.702 1.00 30.54 ? 279  GLU A C     1 
ATOM   3653  O  O     . GLU B 2 278 ? 29.108  66.135  21.751 1.00 31.49 ? 279  GLU A O     1 
ATOM   3654  C  CB    . GLU B 2 278 ? 27.776  63.661  23.513 1.00 31.09 ? 279  GLU A CB    1 
ATOM   3655  C  CG    . GLU B 2 278 ? 27.960  64.736  24.593 1.00 33.56 ? 279  GLU A CG    1 
ATOM   3656  C  CD    . GLU B 2 278 ? 28.202  64.188  26.000 1.00 37.16 ? 279  GLU A CD    1 
ATOM   3657  O  OE1   . GLU B 2 278 ? 28.765  63.086  26.136 1.00 37.30 ? 279  GLU A OE1   1 
ATOM   3658  O  OE2   . GLU B 2 278 ? 27.846  64.887  26.979 1.00 39.58 ? 279  GLU A OE2   1 
ATOM   3659  N  N     . LEU B 2 279 ? 30.040  64.124  21.331 1.00 30.91 ? 280  LEU A N     1 
ATOM   3660  C  CA    . LEU B 2 279 ? 31.340  64.673  20.928 1.00 33.47 ? 280  LEU A CA    1 
ATOM   3661  C  C     . LEU B 2 279 ? 31.268  65.546  19.676 1.00 33.68 ? 280  LEU A C     1 
ATOM   3662  O  O     . LEU B 2 279 ? 31.958  66.562  19.587 1.00 36.98 ? 280  LEU A O     1 
ATOM   3663  C  CB    . LEU B 2 279 ? 32.387  63.571  20.726 1.00 34.04 ? 280  LEU A CB    1 
ATOM   3664  C  CG    . LEU B 2 279 ? 32.914  62.798  21.935 1.00 37.40 ? 280  LEU A CG    1 
ATOM   3665  C  CD1   . LEU B 2 279 ? 34.070  61.934  21.452 1.00 41.04 ? 280  LEU A CD1   1 
ATOM   3666  C  CD2   . LEU B 2 279 ? 33.384  63.733  23.049 1.00 36.15 ? 280  LEU A CD2   1 
ATOM   3667  N  N     . VAL B 2 280 ? 30.436  65.139  18.717 1.00 32.32 ? 281  VAL A N     1 
ATOM   3668  C  CA    . VAL B 2 280 ? 30.246  65.879  17.468 1.00 31.37 ? 281  VAL A CA    1 
ATOM   3669  C  C     . VAL B 2 280 ? 29.484  67.178  17.737 1.00 34.29 ? 281  VAL A C     1 
ATOM   3670  O  O     . VAL B 2 280 ? 29.838  68.237  17.207 1.00 36.13 ? 281  VAL A O     1 
ATOM   3671  C  CB    . VAL B 2 280 ? 29.500  65.016  16.417 1.00 28.60 ? 281  VAL A CB    1 
ATOM   3672  C  CG1   . VAL B 2 280 ? 29.244  65.804  15.138 1.00 26.74 ? 281  VAL A CG1   1 
ATOM   3673  C  CG2   . VAL B 2 280 ? 30.287  63.748  16.115 1.00 26.26 ? 281  VAL A CG2   1 
ATOM   3674  N  N     . ARG B 2 281 ? 28.451  67.081  18.571 1.00 35.30 ? 282  ARG A N     1 
ATOM   3675  C  CA    . ARG B 2 281 ? 27.619  68.224  18.955 1.00 36.39 ? 282  ARG A CA    1 
ATOM   3676  C  C     . ARG B 2 281 ? 28.418  69.247  19.762 1.00 35.75 ? 282  ARG A C     1 
ATOM   3677  O  O     . ARG B 2 281 ? 28.242  70.447  19.582 1.00 39.06 ? 282  ARG A O     1 
ATOM   3678  C  CB    . ARG B 2 281 ? 26.385  67.739  19.744 1.00 36.71 ? 282  ARG A CB    1 
ATOM   3679  C  CG    . ARG B 2 281 ? 25.435  68.838  20.214 1.00 43.15 ? 282  ARG A CG    1 
ATOM   3680  C  CD    . ARG B 2 281 ? 24.192  68.294  20.921 1.00 45.44 ? 282  ARG A CD    1 
ATOM   3681  N  NE    . ARG B 2 281 ? 24.505  67.523  22.129 1.00 46.69 ? 282  ARG A NE    1 
ATOM   3682  C  CZ    . ARG B 2 281 ? 24.559  66.189  22.178 1.00 47.55 ? 282  ARG A CZ    1 
ATOM   3683  N  NH1   . ARG B 2 281 ? 24.311  65.460  21.093 1.00 47.02 ? 282  ARG A NH1   1 
ATOM   3684  N  NH2   . ARG B 2 281 ? 24.856  65.580  23.314 1.00 44.40 ? 282  ARG A NH2   1 
ATOM   3685  N  N     . ASP B 2 282 ? 29.297  68.770  20.640 1.00 36.01 ? 283  ASP A N     1 
ATOM   3686  C  CA    . ASP B 2 282 ? 30.134  69.655  21.461 1.00 37.04 ? 283  ASP A CA    1 
ATOM   3687  C  C     . ASP B 2 282 ? 31.430  70.038  20.744 1.00 34.52 ? 283  ASP A C     1 
ATOM   3688  O  O     . ASP B 2 282 ? 32.272  70.738  21.310 1.00 36.02 ? 283  ASP A O     1 
ATOM   3689  C  CB    . ASP B 2 282 ? 30.445  69.017  22.826 1.00 35.72 ? 283  ASP A CB    1 
ATOM   3690  C  CG    . ASP B 2 282 ? 29.197  68.770  23.664 1.00 37.04 ? 283  ASP A CG    1 
ATOM   3691  O  OD1   . ASP B 2 282 ? 28.124  69.325  23.347 1.00 34.18 ? 283  ASP A OD1   1 
ATOM   3692  O  OD2   . ASP B 2 282 ? 29.292  68.013  24.654 1.00 38.95 ? 283  ASP A OD2   1 
ATOM   3693  N  N     . LYS B 2 283 ? 31.577  69.567  19.507 1.00 34.53 ? 284  LYS A N     1 
ATOM   3694  C  CA    . LYS B 2 283 ? 32.743  69.848  18.649 1.00 34.25 ? 284  LYS A CA    1 
ATOM   3695  C  C     . LYS B 2 283 ? 34.097  69.378  19.200 1.00 31.66 ? 284  LYS A C     1 
ATOM   3696  O  O     . LYS B 2 283 ? 35.135  69.991  18.939 1.00 33.36 ? 284  LYS A O     1 
ATOM   3697  C  CB    . LYS B 2 283 ? 32.783  71.333  18.229 1.00 38.23 ? 284  LYS A CB    1 
ATOM   3698  C  CG    . LYS B 2 283 ? 31.582  71.758  17.386 1.00 40.86 ? 284  LYS A CG    1 
ATOM   3699  C  CD    . LYS B 2 283 ? 31.650  73.219  17.000 1.00 49.24 ? 284  LYS A CD    1 
ATOM   3700  C  CE    . LYS B 2 283 ? 30.427  73.614  16.169 1.00 61.03 ? 284  LYS A CE    1 
ATOM   3701  N  NZ    . LYS B 2 283 ? 30.442  75.050  15.774 1.00 64.54 ? 284  LYS A NZ    1 
ATOM   3702  N  N     . LYS B 2 284 ? 34.081  68.277  19.942 1.00 29.26 ? 285  LYS A N     1 
ATOM   3703  C  CA    . LYS B 2 284 ? 35.304  67.704  20.508 1.00 27.79 ? 285  LYS A CA    1 
ATOM   3704  C  C     . LYS B 2 284 ? 35.968  66.737  19.518 1.00 30.43 ? 285  LYS A C     1 
ATOM   3705  O  O     . LYS B 2 284 ? 36.946  66.064  19.847 1.00 31.25 ? 285  LYS A O     1 
ATOM   3706  C  CB    . LYS B 2 284 ? 35.018  67.020  21.844 1.00 26.95 ? 285  LYS A CB    1 
ATOM   3707  C  CG    . LYS B 2 284 ? 34.540  67.975  22.936 1.00 27.44 ? 285  LYS A CG    1 
ATOM   3708  C  CD    . LYS B 2 284 ? 34.259  67.272  24.251 1.00 24.62 ? 285  LYS A CD    1 
ATOM   3709  C  CE    . LYS B 2 284 ? 34.068  68.331  25.362 1.00 23.10 ? 285  LYS A CE    1 
ATOM   3710  N  NZ    . LYS B 2 284 ? 33.697  67.731  26.670 1.00 23.28 ? 285  LYS A NZ    1 
ATOM   3711  N  N     . ILE B 2 285 ? 35.417  66.684  18.303 1.00 31.17 ? 286  ILE A N     1 
ATOM   3712  C  CA    . ILE B 2 285 ? 35.924  65.857  17.209 1.00 30.56 ? 286  ILE A CA    1 
ATOM   3713  C  C     . ILE B 2 285 ? 35.333  66.378  15.900 1.00 30.60 ? 286  ILE A C     1 
ATOM   3714  O  O     . ILE B 2 285 ? 34.161  66.777  15.857 1.00 28.23 ? 286  ILE A O     1 
ATOM   3715  C  CB    . ILE B 2 285 ? 35.588  64.346  17.414 1.00 30.41 ? 286  ILE A CB    1 
ATOM   3716  C  CG1   . ILE B 2 285 ? 36.418  63.467  16.467 1.00 29.38 ? 286  ILE A CG1   1 
ATOM   3717  C  CG2   . ILE B 2 285 ? 34.074  64.079  17.308 1.00 28.66 ? 286  ILE A CG2   1 
ATOM   3718  C  CD1   . ILE B 2 285 ? 36.347  61.984  16.755 1.00 28.42 ? 286  ILE A CD1   1 
ATOM   3719  N  N     . ASP B 2 286 ? 36.140  66.394  14.843 1.00 30.67 ? 287  ASP A N     1 
ATOM   3720  C  CA    . ASP B 2 286 ? 35.648  66.860  13.547 1.00 35.09 ? 287  ASP A CA    1 
ATOM   3721  C  C     . ASP B 2 286 ? 35.785  65.803  12.463 1.00 30.62 ? 287  ASP A C     1 
ATOM   3722  O  O     . ASP B 2 286 ? 36.584  64.874  12.582 1.00 29.92 ? 287  ASP A O     1 
ATOM   3723  C  CB    . ASP B 2 286 ? 36.363  68.156  13.109 1.00 41.45 ? 287  ASP A CB    1 
ATOM   3724  C  CG    . ASP B 2 286 ? 37.852  67.960  12.895 1.00 45.79 ? 287  ASP A CG    1 
ATOM   3725  O  OD1   . ASP B 2 286 ? 38.449  67.078  13.557 1.00 51.77 ? 287  ASP A OD1   1 
ATOM   3726  O  OD2   . ASP B 2 286 ? 38.421  68.702  12.057 1.00 48.74 ? 287  ASP A OD2   1 
ATOM   3727  N  N     . GLY B 2 287 ? 34.996  65.969  11.406 1.00 28.20 ? 288  GLY A N     1 
ATOM   3728  C  CA    . GLY B 2 287 ? 35.026  65.072  10.256 1.00 27.13 ? 288  GLY A CA    1 
ATOM   3729  C  C     . GLY B 2 287 ? 33.804  64.188  10.122 1.00 26.42 ? 288  GLY A C     1 
ATOM   3730  O  O     . GLY B 2 287 ? 33.643  63.518  9.111  1.00 25.57 ? 288  GLY A O     1 
ATOM   3731  N  N     . ILE B 2 288 ? 32.939  64.201  11.132 1.00 25.23 ? 289  ILE A N     1 
ATOM   3732  C  CA    . ILE B 2 288 ? 31.733  63.370  11.144 1.00 24.04 ? 289  ILE A CA    1 
ATOM   3733  C  C     . ILE B 2 288 ? 30.522  64.153  10.636 1.00 25.32 ? 289  ILE A C     1 
ATOM   3734  O  O     . ILE B 2 288 ? 30.205  65.231  11.150 1.00 27.14 ? 289  ILE A O     1 
ATOM   3735  C  CB    . ILE B 2 288 ? 31.491  62.762  12.556 1.00 22.52 ? 289  ILE A CB    1 
ATOM   3736  C  CG1   . ILE B 2 288 ? 32.732  61.967  13.001 1.00 19.87 ? 289  ILE A CG1   1 
ATOM   3737  C  CG2   . ILE B 2 288 ? 30.229  61.905  12.573 1.00 20.29 ? 289  ILE A CG2   1 
ATOM   3738  C  CD1   . ILE B 2 288 ? 32.690  61.415  14.403 1.00 19.20 ? 289  ILE A CD1   1 
ATOM   3739  N  N     . THR B 2 289 ? 29.862  63.609  9.612  1.00 25.83 ? 290  THR A N     1 
ATOM   3740  C  CA    . THR B 2 289 ? 28.693  64.257  8.998  1.00 25.81 ? 290  THR A CA    1 
ATOM   3741  C  C     . THR B 2 289 ? 27.371  63.575  9.346  1.00 27.87 ? 290  THR A C     1 
ATOM   3742  O  O     . THR B 2 289 ? 26.316  64.204  9.273  1.00 31.82 ? 290  THR A O     1 
ATOM   3743  C  CB    . THR B 2 289 ? 28.804  64.389  7.442  1.00 24.99 ? 290  THR A CB    1 
ATOM   3744  O  OG1   . THR B 2 289 ? 28.848  63.094  6.834  1.00 24.39 ? 290  THR A OG1   1 
ATOM   3745  C  CG2   . THR B 2 289 ? 30.036  65.186  7.035  1.00 25.06 ? 290  THR A CG2   1 
ATOM   3746  N  N     . ASP B 2 290 ? 27.425  62.294  9.703  1.00 27.75 ? 291  ASP A N     1 
ATOM   3747  C  CA    . ASP B 2 290 ? 26.216  61.557  10.081 1.00 27.41 ? 291  ASP A CA    1 
ATOM   3748  C  C     . ASP B 2 290 ? 26.538  60.355  10.974 1.00 26.34 ? 291  ASP A C     1 
ATOM   3749  O  O     . ASP B 2 290 ? 27.633  59.800  10.907 1.00 27.40 ? 291  ASP A O     1 
ATOM   3750  C  CB    . ASP B 2 290 ? 25.430  61.117  8.829  1.00 26.97 ? 291  ASP A CB    1 
ATOM   3751  C  CG    . ASP B 2 290 ? 23.948  60.920  9.109  1.00 27.17 ? 291  ASP A CG    1 
ATOM   3752  O  OD1   . ASP B 2 290 ? 23.507  61.145  10.252 1.00 25.29 ? 291  ASP A OD1   1 
ATOM   3753  O  OD2   . ASP B 2 290 ? 23.212  60.556  8.173  1.00 28.62 ? 291  ASP A OD2   1 
ATOM   3754  N  N     . LEU B 2 291 ? 25.570  59.968  11.796 1.00 23.94 ? 292  LEU A N     1 
ATOM   3755  C  CA    . LEU B 2 291 ? 25.692  58.835  12.713 1.00 22.74 ? 292  LEU A CA    1 
ATOM   3756  C  C     . LEU B 2 291 ? 24.385  58.045  12.772 1.00 21.11 ? 292  LEU A C     1 
ATOM   3757  O  O     . LEU B 2 291 ? 23.400  58.510  13.334 1.00 19.85 ? 292  LEU A O     1 
ATOM   3758  C  CB    . LEU B 2 291 ? 26.080  59.331  14.117 1.00 22.93 ? 292  LEU A CB    1 
ATOM   3759  C  CG    . LEU B 2 291 ? 26.178  58.345  15.280 1.00 20.87 ? 292  LEU A CG    1 
ATOM   3760  C  CD1   . LEU B 2 291 ? 27.322  57.360  15.089 1.00 20.13 ? 292  LEU A CD1   1 
ATOM   3761  C  CD2   . LEU B 2 291 ? 26.354  59.131  16.558 1.00 20.78 ? 292  LEU A CD2   1 
ATOM   3762  N  N     . ARG B 2 292 ? 24.387  56.846  12.193 1.00 23.08 ? 293  ARG A N     1 
ATOM   3763  C  CA    . ARG B 2 292 ? 23.181  56.001  12.149 1.00 20.17 ? 293  ARG A CA    1 
ATOM   3764  C  C     . ARG B 2 292 ? 23.443  54.617  12.727 1.00 19.56 ? 293  ARG A C     1 
ATOM   3765  O  O     . ARG B 2 292 ? 24.568  54.128  12.690 1.00 21.02 ? 293  ARG A O     1 
ATOM   3766  C  CB    . ARG B 2 292 ? 22.672  55.848  10.716 1.00 20.57 ? 293  ARG A CB    1 
ATOM   3767  C  CG    . ARG B 2 292 ? 22.467  57.153  9.953  1.00 21.97 ? 293  ARG A CG    1 
ATOM   3768  C  CD    . ARG B 2 292 ? 21.876  56.921  8.554  1.00 22.39 ? 293  ARG A CD    1 
ATOM   3769  N  NE    . ARG B 2 292 ? 22.675  56.004  7.743  1.00 19.98 ? 293  ARG A NE    1 
ATOM   3770  C  CZ    . ARG B 2 292 ? 23.732  56.361  7.008  1.00 20.02 ? 293  ARG A CZ    1 
ATOM   3771  N  NH1   . ARG B 2 292 ? 24.155  57.619  6.995  1.00 18.57 ? 293  ARG A NH1   1 
ATOM   3772  N  NH2   . ARG B 2 292 ? 24.387  55.442  6.292  1.00 17.65 ? 293  ARG A NH2   1 
ATOM   3773  N  N     . ASP B 2 293 ? 22.399  53.999  13.261 1.00 18.14 ? 294  ASP A N     1 
ATOM   3774  C  CA    . ASP B 2 293 ? 22.464  52.646  13.773 1.00 17.46 ? 294  ASP A CA    1 
ATOM   3775  C  C     . ASP B 2 293 ? 21.600  51.767  12.865 1.00 19.22 ? 294  ASP A C     1 
ATOM   3776  O  O     . ASP B 2 293 ? 20.374  51.729  13.001 1.00 18.57 ? 294  ASP A O     1 
ATOM   3777  C  CB    . ASP B 2 293 ? 21.977  52.582  15.221 1.00 16.98 ? 294  ASP A CB    1 
ATOM   3778  C  CG    . ASP B 2 293 ? 22.113  51.186  15.835 1.00 17.50 ? 294  ASP A CG    1 
ATOM   3779  O  OD1   . ASP B 2 293 ? 22.747  50.296  15.222 1.00 17.71 ? 294  ASP A OD1   1 
ATOM   3780  O  OD2   . ASP B 2 293 ? 21.594  50.988  16.953 1.00 18.50 ? 294  ASP A OD2   1 
ATOM   3781  N  N     . GLU B 2 294 ? 22.256  51.070  11.939 1.00 18.82 ? 295  GLU A N     1 
ATOM   3782  C  CA    . GLU B 2 294 ? 21.583  50.217  10.956 1.00 19.31 ? 295  GLU A CA    1 
ATOM   3783  C  C     . GLU B 2 294 ? 21.481  48.736  11.365 1.00 19.66 ? 295  GLU A C     1 
ATOM   3784  O  O     . GLU B 2 294 ? 21.438  47.848  10.505 1.00 21.95 ? 295  GLU A O     1 
ATOM   3785  C  CB    . GLU B 2 294 ? 22.272  50.344  9.586  1.00 18.72 ? 295  GLU A CB    1 
ATOM   3786  C  CG    . GLU B 2 294 ? 22.207  51.747  8.975  1.00 19.02 ? 295  GLU A CG    1 
ATOM   3787  C  CD    . GLU B 2 294 ? 22.916  51.883  7.623  1.00 18.09 ? 295  GLU A CD    1 
ATOM   3788  O  OE1   . GLU B 2 294 ? 23.545  50.910  7.136  1.00 19.09 ? 295  GLU A OE1   1 
ATOM   3789  O  OE2   . GLU B 2 294 ? 22.839  52.987  7.045  1.00 17.75 ? 295  GLU A OE2   1 
ATOM   3790  N  N     . THR B 2 295 ? 21.428  48.473  12.667 1.00 17.97 ? 296  THR A N     1 
ATOM   3791  C  CA    . THR B 2 295 ? 21.336  47.113  13.188 1.00 17.81 ? 296  THR A CA    1 
ATOM   3792  C  C     . THR B 2 295 ? 19.952  46.481  12.961 1.00 21.50 ? 296  THR A C     1 
ATOM   3793  O  O     . THR B 2 295 ? 18.918  47.078  13.293 1.00 23.22 ? 296  THR A O     1 
ATOM   3794  C  CB    . THR B 2 295 ? 21.693  47.076  14.704 1.00 16.96 ? 296  THR A CB    1 
ATOM   3795  O  OG1   . THR B 2 295 ? 23.028  47.558  14.897 1.00 14.94 ? 296  THR A OG1   1 
ATOM   3796  C  CG2   . THR B 2 295 ? 21.577  45.658  15.285 1.00 15.86 ? 296  THR A CG2   1 
ATOM   3797  N  N     A SER B 2 296 ? 19.951  45.303  12.362 0.50 21.74 ? 297  SER A N     1 
ATOM   3798  N  N     B SER B 2 296 ? 20.051  45.303  12.362 0.50 22.14 ? 297  SER A N     1 
ATOM   3799  C  CA    A SER B 2 296 ? 18.739  44.562  12.058 0.50 22.77 ? 297  SER A CA    1 
ATOM   3800  C  CA    B SER B 2 296 ? 18.842  44.561  12.057 0.50 23.52 ? 297  SER A CA    1 
ATOM   3801  C  C     A SER B 2 296 ? 18.971  43.091  12.302 0.50 22.97 ? 297  SER A C     1 
ATOM   3802  C  C     B SER B 2 296 ? 19.065  43.092  12.299 0.50 23.45 ? 297  SER A C     1 
ATOM   3803  O  O     A SER B 2 296 ? 20.107  42.654  12.398 0.50 23.21 ? 297  SER A O     1 
ATOM   3804  O  O     B SER B 2 296 ? 20.207  42.654  12.398 0.50 23.62 ? 297  SER A O     1 
ATOM   3805  C  CB    A SER B 2 296 ? 18.313  44.780  10.610 0.50 24.03 ? 297  SER A CB    1 
ATOM   3806  C  CB    B SER B 2 296 ? 18.414  44.780  10.610 0.50 25.43 ? 297  SER A CB    1 
ATOM   3807  O  OG    A SER B 2 296 ? 17.442  45.887  10.509 0.50 24.40 ? 297  SER A OG    1 
ATOM   3808  O  OG    B SER B 2 296 ? 17.263  44.022  10.313 0.50 27.75 ? 297  SER A OG    1 
ATOM   3809  N  N     . LEU B 2 297 ? 17.906  42.326  12.419 1.00 23.72 ? 298  LEU A N     1 
ATOM   3810  C  CA    . LEU B 2 297 ? 18.061  40.902  12.636 1.00 26.80 ? 298  LEU A CA    1 
ATOM   3811  C  C     . LEU B 2 297 ? 18.771  40.306  11.431 1.00 28.88 ? 298  LEU A C     1 
ATOM   3812  O  O     . LEU B 2 297 ? 19.657  39.476  11.582 1.00 31.06 ? 298  LEU A O     1 
ATOM   3813  C  CB    . LEU B 2 297 ? 16.716  40.222  12.890 1.00 25.06 ? 298  LEU A CB    1 
ATOM   3814  C  CG    . LEU B 2 297 ? 16.098  40.528  14.260 1.00 23.38 ? 298  LEU A CG    1 
ATOM   3815  C  CD1   . LEU B 2 297 ? 14.710  39.907  14.389 1.00 22.73 ? 298  LEU A CD1   1 
ATOM   3816  C  CD2   . LEU B 2 297 ? 17.014  40.046  15.391 1.00 21.15 ? 298  LEU A CD2   1 
ATOM   3817  N  N     . ARG B 2 298 ? 18.356  40.750  10.249 1.00 29.95 ? 299  ARG A N     1 
ATOM   3818  C  CA    . ARG B 2 298 ? 18.904  40.361  8.950  1.00 28.72 ? 299  ARG A CA    1 
ATOM   3819  C  C     . ARG B 2 298 ? 20.342  40.827  8.665  1.00 29.15 ? 299  ARG A C     1 
ATOM   3820  O  O     . ARG B 2 298 ? 21.171  40.070  8.194  1.00 32.39 ? 299  ARG A O     1 
ATOM   3821  C  CB    . ARG B 2 298 ? 17.992  40.927  7.859  1.00 27.26 ? 299  ARG A CB    1 
ATOM   3822  C  CG    . ARG B 2 298 ? 16.602  40.305  7.766  1.00 30.25 ? 299  ARG A CG    1 
ATOM   3823  C  CD    . ARG B 2 298 ? 15.764  40.395  9.034  1.00 28.46 ? 299  ARG A CD    1 
ATOM   3824  N  NE    . ARG B 2 298 ? 15.270  41.734  9.296  1.00 28.42 ? 299  ARG A NE    1 
ATOM   3825  C  CZ    . ARG B 2 298 ? 14.352  42.030  10.205 1.00 27.96 ? 299  ARG A CZ    1 
ATOM   3826  N  NH1   . ARG B 2 298 ? 13.988  43.271  10.395 1.00 28.29 ? 299  ARG A NH1   1 
ATOM   3827  N  NH2   . ARG B 2 298 ? 13.802  41.082  10.950 1.00 26.78 ? 299  ARG A NH2   1 
ATOM   3828  N  N     . THR B 2 299 ? 20.611  42.085  8.977  1.00 27.62 ? 300  THR A N     1 
ATOM   3829  C  CA    . THR B 2 299 ? 21.900  42.746  8.816  1.00 23.35 ? 300  THR A CA    1 
ATOM   3830  C  C     . THR B 2 299 ? 22.954  42.454  9.875  1.00 22.94 ? 300  THR A C     1 
ATOM   3831  O  O     . THR B 2 299 ? 24.126  42.265  9.576  1.00 22.68 ? 300  THR A O     1 
ATOM   3832  C  CB    . THR B 2 299 ? 21.719  44.272  8.691  1.00 27.07 ? 300  THR A CB    1 
ATOM   3833  O  OG1   . THR B 2 299 ? 20.736  44.555  7.692  1.00 26.06 ? 300  THR A OG1   1 
ATOM   3834  C  CG2   . THR B 2 299 ? 23.016  44.933  8.297  1.00 27.03 ? 300  THR A CG2   1 
ATOM   3835  N  N     . GLY B 2 300 ? 22.510  42.426  11.123 1.00 20.75 ? 301  GLY A N     1 
ATOM   3836  C  CA    . GLY B 2 300 ? 23.337  42.203  12.253 1.00 17.01 ? 301  GLY A CA    1 
ATOM   3837  C  C     . GLY B 2 300 ? 23.762  43.548  12.759 1.00 16.60 ? 301  GLY A C     1 
ATOM   3838  O  O     . GLY B 2 300 ? 23.350  44.510  12.275 1.00 14.50 ? 301  GLY A O     1 
ATOM   3839  N  N     . VAL B 2 301 ? 24.645  43.568  13.718 1.00 16.33 ? 302  VAL A N     1 
ATOM   3840  C  CA    . VAL B 2 301 ? 25.140  44.838  14.238 1.00 15.61 ? 302  VAL A CA    1 
ATOM   3841  C  C     . VAL B 2 301 ? 25.814  45.627  13.110 1.00 16.34 ? 302  VAL A C     1 
ATOM   3842  O  O     . VAL B 2 301 ? 26.669  45.091  12.387 1.00 17.71 ? 302  VAL A O     1 
ATOM   3843  C  CB    . VAL B 2 301 ? 26.111  44.642  15.433 1.00 15.42 ? 302  VAL A CB    1 
ATOM   3844  C  CG1   . VAL B 2 301 ? 26.601  45.983  15.965 1.00 14.80 ? 302  VAL A CG1   1 
ATOM   3845  C  CG2   . VAL B 2 301 ? 25.438  43.846  16.551 1.00 14.20 ? 302  VAL A CG2   1 
ATOM   3846  N  N     . ARG B 2 302 ? 25.396  46.880  12.941 1.00 14.92 ? 303  ARG A N     1 
ATOM   3847  C  CA    . ARG B 2 302 ? 25.949  47.742  11.912 1.00 14.63 ? 303  ARG A CA    1 
ATOM   3848  C  C     . ARG B 2 302 ? 25.754  49.215  12.273 1.00 15.35 ? 303  ARG A C     1 
ATOM   3849  O  O     . ARG B 2 302 ? 24.655  49.759  12.138 1.00 15.33 ? 303  ARG A O     1 
ATOM   3850  C  CB    . ARG B 2 302 ? 25.330  47.429  10.537 1.00 13.64 ? 303  ARG A CB    1 
ATOM   3851  C  CG    . ARG B 2 302 ? 25.862  48.302  9.390  1.00 11.75 ? 303  ARG A CG    1 
ATOM   3852  C  CD    . ARG B 2 302 ? 25.142  47.996  8.085  1.00 11.16 ? 303  ARG A CD    1 
ATOM   3853  N  NE    . ARG B 2 302 ? 25.568  48.883  7.002  1.00 11.07 ? 303  ARG A NE    1 
ATOM   3854  C  CZ    . ARG B 2 302 ? 26.645  48.679  6.236  1.00 10.01 ? 303  ARG A CZ    1 
ATOM   3855  N  NH1   . ARG B 2 302 ? 27.415  47.618  6.423  1.00 8.88  ? 303  ARG A NH1   1 
ATOM   3856  N  NH2   . ARG B 2 302 ? 26.957  49.555  5.290  1.00 10.30 ? 303  ARG A NH2   1 
ATOM   3857  N  N     . VAL B 2 303 ? 26.825  49.847  12.740 1.00 15.49 ? 304  VAL A N     1 
ATOM   3858  C  CA    . VAL B 2 303 ? 26.786  51.261  13.079 1.00 15.66 ? 304  VAL A CA    1 
ATOM   3859  C  C     . VAL B 2 303 ? 27.584  51.999  12.013 1.00 16.20 ? 304  VAL A C     1 
ATOM   3860  O  O     . VAL B 2 303 ? 28.728  51.645  11.715 1.00 15.63 ? 304  VAL A O     1 
ATOM   3861  C  CB    . VAL B 2 303 ? 27.341  51.566  14.495 1.00 15.36 ? 304  VAL A CB    1 
ATOM   3862  C  CG1   . VAL B 2 303 ? 27.117  53.039  14.844 1.00 15.18 ? 304  VAL A CG1   1 
ATOM   3863  C  CG2   . VAL B 2 303 ? 26.669  50.683  15.546 1.00 14.92 ? 304  VAL A CG2   1 
ATOM   3864  N  N     . VAL B 2 304 ? 26.963  53.023  11.440 1.00 15.52 ? 305  VAL A N     1 
ATOM   3865  C  CA    . VAL B 2 304 ? 27.577  53.792  10.363 1.00 16.11 ? 305  VAL A CA    1 
ATOM   3866  C  C     . VAL B 2 304 ? 27.983  55.195  10.820 1.00 15.18 ? 305  VAL A C     1 
ATOM   3867  O  O     . VAL B 2 304 ? 27.208  55.897  11.470 1.00 14.24 ? 305  VAL A O     1 
ATOM   3868  C  CB    . VAL B 2 304 ? 26.632  53.844  9.129  1.00 15.79 ? 305  VAL A CB    1 
ATOM   3869  C  CG1   . VAL B 2 304 ? 27.181  54.767  8.055  1.00 16.75 ? 305  VAL A CG1   1 
ATOM   3870  C  CG2   . VAL B 2 304 ? 26.410  52.434  8.573  1.00 14.63 ? 305  VAL A CG2   1 
ATOM   3871  N  N     . ILE B 2 305 ? 29.214  55.579  10.495 1.00 15.91 ? 306  ILE A N     1 
ATOM   3872  C  CA    . ILE B 2 305 ? 29.725  56.909  10.816 1.00 15.70 ? 306  ILE A CA    1 
ATOM   3873  C  C     . ILE B 2 305 ? 30.239  57.552  9.519  1.00 16.65 ? 306  ILE A C     1 
ATOM   3874  O  O     . ILE B 2 305 ? 31.337  57.249  9.058  1.00 15.96 ? 306  ILE A O     1 
ATOM   3875  C  CB    . ILE B 2 305 ? 30.842  56.857  11.896 1.00 15.32 ? 306  ILE A CB    1 
ATOM   3876  C  CG1   . ILE B 2 305 ? 30.401  56.009  13.107 1.00 14.43 ? 306  ILE A CG1   1 
ATOM   3877  C  CG2   . ILE B 2 305 ? 31.256  58.271  12.319 1.00 14.98 ? 306  ILE A CG2   1 
ATOM   3878  C  CD1   . ILE B 2 305 ? 31.459  55.828  14.168 1.00 14.00 ? 306  ILE A CD1   1 
ATOM   3879  N  N     . ASP B 2 306 ? 29.424  58.420  8.921  1.00 17.94 ? 307  ASP A N     1 
ATOM   3880  C  CA    . ASP B 2 306 ? 29.799  59.117  7.690  1.00 17.67 ? 307  ASP A CA    1 
ATOM   3881  C  C     . ASP B 2 306 ? 30.849  60.196  7.941  1.00 19.77 ? 307  ASP A C     1 
ATOM   3882  O  O     . ASP B 2 306 ? 30.697  61.041  8.825  1.00 22.43 ? 307  ASP A O     1 
ATOM   3883  C  CB    . ASP B 2 306 ? 28.574  59.727  6.997  1.00 16.87 ? 307  ASP A CB    1 
ATOM   3884  C  CG    . ASP B 2 306 ? 27.626  58.679  6.420  1.00 16.14 ? 307  ASP A CG    1 
ATOM   3885  O  OD1   . ASP B 2 306 ? 28.069  57.546  6.126  1.00 16.13 ? 307  ASP A OD1   1 
ATOM   3886  O  OD2   . ASP B 2 306 ? 26.429  59.002  6.245  1.00 15.59 ? 307  ASP A OD2   1 
ATOM   3887  N  N     . VAL B 2 307 ? 31.908  60.150  7.145  1.00 21.74 ? 308  VAL A N     1 
ATOM   3888  C  CA    . VAL B 2 307 ? 33.025  61.083  7.218  1.00 21.87 ? 308  VAL A CA    1 
ATOM   3889  C  C     . VAL B 2 307 ? 32.857  62.167  6.148  1.00 24.85 ? 308  VAL A C     1 
ATOM   3890  O  O     . VAL B 2 307 ? 32.269  61.915  5.090  1.00 27.05 ? 308  VAL A O     1 
ATOM   3891  C  CB    . VAL B 2 307 ? 34.377  60.330  7.029  1.00 23.35 ? 308  VAL A CB    1 
ATOM   3892  C  CG1   . VAL B 2 307 ? 35.550  61.290  6.948  1.00 21.48 ? 308  VAL A CG1   1 
ATOM   3893  C  CG2   . VAL B 2 307 ? 34.594  59.310  8.157  1.00 23.74 ? 308  VAL A CG2   1 
ATOM   3894  N  N     . ARG B 2 308 ? 33.359  63.370  6.430  1.00 24.77 ? 309  ARG A N     1 
ATOM   3895  C  CA    . ARG B 2 308 ? 33.288  64.485  5.485  1.00 27.49 ? 309  ARG A CA    1 
ATOM   3896  C  C     . ARG B 2 308 ? 34.276  64.244  4.349  1.00 26.50 ? 309  ARG A C     1 
ATOM   3897  O  O     . ARG B 2 308 ? 35.362  63.713  4.574  1.00 28.07 ? 309  ARG A O     1 
ATOM   3898  C  CB    . ARG B 2 308 ? 33.560  65.828  6.189  1.00 27.98 ? 309  ARG A CB    1 
ATOM   3899  C  CG    . ARG B 2 308 ? 33.386  67.058  5.285  1.00 31.38 ? 309  ARG A CG    1 
ATOM   3900  C  CD    . ARG B 2 308 ? 33.654  68.387  5.992  1.00 31.46 ? 309  ARG A CD    1 
ATOM   3901  N  NE    . ARG B 2 308 ? 35.010  68.491  6.525  1.00 33.05 ? 309  ARG A NE    1 
ATOM   3902  C  CZ    . ARG B 2 308 ? 35.315  68.364  7.819  1.00 35.80 ? 309  ARG A CZ    1 
ATOM   3903  N  NH1   . ARG B 2 308 ? 34.367  68.133  8.721  1.00 37.53 ? 309  ARG A NH1   1 
ATOM   3904  N  NH2   . ARG B 2 308 ? 36.573  68.486  8.231  1.00 31.55 ? 309  ARG A NH2   1 
ATOM   3905  N  N     . LYS B 2 309 ? 33.886  64.631  3.140  1.00 28.29 ? 310  LYS A N     1 
ATOM   3906  C  CA    . LYS B 2 309 ? 34.702  64.450  1.937  1.00 30.72 ? 310  LYS A CA    1 
ATOM   3907  C  C     . LYS B 2 309 ? 36.103  65.035  2.097  1.00 31.21 ? 310  LYS A C     1 
ATOM   3908  O  O     . LYS B 2 309 ? 36.257  66.196  2.483  1.00 32.37 ? 310  LYS A O     1 
ATOM   3909  C  CB    . LYS B 2 309 ? 34.006  65.049  0.711  1.00 31.09 ? 310  LYS A CB    1 
ATOM   3910  C  CG    . LYS B 2 309 ? 34.606  64.626  -0.624 1.00 32.03 ? 310  LYS A CG    1 
ATOM   3911  C  CD    . LYS B 2 309 ? 33.819  65.218  -1.791 1.00 35.18 ? 310  LYS A CD    1 
ATOM   3912  C  CE    . LYS B 2 309 ? 34.337  64.721  -3.134 1.00 34.74 ? 310  LYS A CE    1 
ATOM   3913  N  NZ    . LYS B 2 309 ? 35.771  65.052  -3.337 1.00 35.04 ? 310  LYS A NZ    1 
ATOM   3914  N  N     . ASP B 2 310 ? 37.111  64.210  1.804  1.00 29.78 ? 311  ASP A N     1 
ATOM   3915  C  CA    . ASP B 2 310 ? 38.535  64.576  1.890  1.00 33.88 ? 311  ASP A CA    1 
ATOM   3916  C  C     . ASP B 2 310 ? 39.141  64.535  3.303  1.00 31.49 ? 311  ASP A C     1 
ATOM   3917  O  O     . ASP B 2 310 ? 40.341  64.768  3.473  1.00 33.63 ? 311  ASP A O     1 
ATOM   3918  C  CB    . ASP B 2 310 ? 38.830  65.928  1.207  1.00 39.11 ? 311  ASP A CB    1 
ATOM   3919  C  CG    . ASP B 2 310 ? 38.471  65.922  -0.273 1.00 42.89 ? 311  ASP A CG    1 
ATOM   3920  O  OD1   . ASP B 2 310 ? 38.331  64.828  -0.872 1.00 40.73 ? 311  ASP A OD1   1 
ATOM   3921  O  OD2   . ASP B 2 310 ? 38.336  67.029  -0.839 1.00 50.05 ? 311  ASP A OD2   1 
ATOM   3922  N  N     . ALA B 2 311 ? 38.320  64.232  4.305  1.00 27.61 ? 312  ALA A N     1 
ATOM   3923  C  CA    . ALA B 2 311 ? 38.818  64.096  5.667  1.00 27.14 ? 312  ALA A CA    1 
ATOM   3924  C  C     . ALA B 2 311 ? 39.379  62.692  5.840  1.00 28.09 ? 312  ALA A C     1 
ATOM   3925  O  O     . ALA B 2 311 ? 38.821  61.721  5.320  1.00 32.52 ? 312  ALA A O     1 
ATOM   3926  C  CB    . ALA B 2 311 ? 37.714  64.362  6.674  1.00 26.70 ? 312  ALA A CB    1 
ATOM   3927  N  N     . ASN B 2 312 ? 40.498  62.581  6.547  1.00 27.59 ? 313  ASN A N     1 
ATOM   3928  C  CA    . ASN B 2 312 ? 41.131  61.292  6.778  1.00 25.78 ? 313  ASN A CA    1 
ATOM   3929  C  C     . ASN B 2 312 ? 40.295  60.472  7.775  1.00 26.78 ? 313  ASN A C     1 
ATOM   3930  O  O     . ASN B 2 312 ? 40.226  60.807  8.965  1.00 28.12 ? 313  ASN A O     1 
ATOM   3931  C  CB    . ASN B 2 312 ? 42.569  61.497  7.252  1.00 26.24 ? 313  ASN A CB    1 
ATOM   3932  C  CG    . ASN B 2 312 ? 43.383  60.203  7.279  1.00 27.52 ? 313  ASN A CG    1 
ATOM   3933  O  OD1   . ASN B 2 312 ? 42.901  59.145  7.698  1.00 27.65 ? 313  ASN A OD1   1 
ATOM   3934  N  ND2   . ASN B 2 312 ? 44.642  60.293  6.866  1.00 25.54 ? 313  ASN A ND2   1 
ATOM   3935  N  N     . ALA B 2 313 ? 39.664  59.410  7.264  1.00 23.71 ? 314  ALA A N     1 
ATOM   3936  C  CA    . ALA B 2 313 ? 38.790  58.527  8.052  1.00 22.68 ? 314  ALA A CA    1 
ATOM   3937  C  C     . ALA B 2 313 ? 39.494  57.687  9.118  1.00 22.37 ? 314  ALA A C     1 
ATOM   3938  O  O     . ALA B 2 313 ? 38.884  57.329  10.127 1.00 24.78 ? 314  ALA A O     1 
ATOM   3939  C  CB    . ALA B 2 313 ? 37.981  57.619  7.133  1.00 23.38 ? 314  ALA A CB    1 
ATOM   3940  N  N     . SER B 2 314 ? 40.761  57.362  8.889  1.00 21.53 ? 315  SER A N     1 
ATOM   3941  C  CA    . SER B 2 314 ? 41.539  56.573  9.842  1.00 21.27 ? 315  SER A CA    1 
ATOM   3942  C  C     . SER B 2 314 ? 41.883  57.385  11.089 1.00 22.18 ? 315  SER A C     1 
ATOM   3943  O  O     . SER B 2 314 ? 41.967  56.828  12.190 1.00 24.10 ? 315  SER A O     1 
ATOM   3944  C  CB    . SER B 2 314 ? 42.820  56.032  9.191  1.00 22.22 ? 315  SER A CB    1 
ATOM   3945  O  OG    . SER B 2 314 ? 42.515  55.170  8.104  1.00 23.09 ? 315  SER A OG    1 
ATOM   3946  N  N     . VAL B 2 315 ? 42.083  58.694  10.901 1.00 20.74 ? 316  VAL A N     1 
ATOM   3947  C  CA    . VAL B 2 315 ? 42.392  59.610  11.999 1.00 20.84 ? 316  VAL A CA    1 
ATOM   3948  C  C     . VAL B 2 315 ? 41.163  59.733  12.900 1.00 21.16 ? 316  VAL A C     1 
ATOM   3949  O  O     . VAL B 2 315 ? 41.281  59.706  14.124 1.00 22.12 ? 316  VAL A O     1 
ATOM   3950  C  CB    . VAL B 2 315 ? 42.825  61.019  11.483 1.00 21.31 ? 316  VAL A CB    1 
ATOM   3951  C  CG1   . VAL B 2 315 ? 42.983  62.017  12.638 1.00 19.47 ? 316  VAL A CG1   1 
ATOM   3952  C  CG2   . VAL B 2 315 ? 44.106  60.938  10.678 1.00 19.88 ? 316  VAL A CG2   1 
ATOM   3953  N  N     . ILE B 2 316 ? 39.993  59.872  12.276 1.00 19.80 ? 317  ILE A N     1 
ATOM   3954  C  CA    . ILE B 2 316 ? 38.727  59.979  12.995 1.00 20.09 ? 317  ILE A CA    1 
ATOM   3955  C  C     . ILE B 2 316 ? 38.462  58.702  13.805 1.00 21.60 ? 317  ILE A C     1 
ATOM   3956  O  O     . ILE B 2 316 ? 38.035  58.772  14.954 1.00 20.74 ? 317  ILE A O     1 
ATOM   3957  C  CB    . ILE B 2 316 ? 37.556  60.290  12.032 1.00 20.23 ? 317  ILE A CB    1 
ATOM   3958  C  CG1   . ILE B 2 316 ? 37.796  61.637  11.337 1.00 18.78 ? 317  ILE A CG1   1 
ATOM   3959  C  CG2   . ILE B 2 316 ? 36.210  60.299  12.775 1.00 21.14 ? 317  ILE A CG2   1 
ATOM   3960  C  CD1   . ILE B 2 316 ? 36.819  61.954  10.252 1.00 17.92 ? 317  ILE A CD1   1 
ATOM   3961  N  N     . LEU B 2 317 ? 38.739  57.546  13.195 1.00 20.55 ? 318  LEU A N     1 
ATOM   3962  C  CA    . LEU B 2 317 ? 38.585  56.259  13.855 1.00 19.69 ? 318  LEU A CA    1 
ATOM   3963  C  C     . LEU B 2 317 ? 39.469  56.213  15.098 1.00 22.17 ? 318  LEU A C     1 
ATOM   3964  O  O     . LEU B 2 317 ? 38.976  55.948  16.203 1.00 22.43 ? 318  LEU A O     1 
ATOM   3965  C  CB    . LEU B 2 317 ? 38.924  55.111  12.896 1.00 18.93 ? 318  LEU A CB    1 
ATOM   3966  C  CG    . LEU B 2 317 ? 38.797  53.659  13.393 1.00 17.70 ? 318  LEU A CG    1 
ATOM   3967  C  CD1   . LEU B 2 317 ? 37.392  53.333  13.861 1.00 15.59 ? 318  LEU A CD1   1 
ATOM   3968  C  CD2   . LEU B 2 317 ? 39.252  52.668  12.316 1.00 15.29 ? 318  LEU A CD2   1 
ATOM   3969  N  N     . ASN B 2 318 ? 40.761  56.485  14.920 1.00 23.86 ? 319  ASN A N     1 
ATOM   3970  C  CA    . ASN B 2 318 ? 41.710  56.516  16.038 1.00 24.89 ? 319  ASN A CA    1 
ATOM   3971  C  C     . ASN B 2 318 ? 41.224  57.385  17.187 1.00 24.56 ? 319  ASN A C     1 
ATOM   3972  O  O     . ASN B 2 318 ? 41.273  56.959  18.348 1.00 28.27 ? 319  ASN A O     1 
ATOM   3973  C  CB    . ASN B 2 318 ? 43.104  56.966  15.588 1.00 25.97 ? 319  ASN A CB    1 
ATOM   3974  C  CG    . ASN B 2 318 ? 43.862  55.855  14.860 1.00 28.58 ? 319  ASN A CG    1 
ATOM   3975  O  OD1   . ASN B 2 318 ? 43.689  54.670  15.137 1.00 27.07 ? 319  ASN A OD1   1 
ATOM   3976  N  ND2   . ASN B 2 318 ? 44.736  56.235  13.943 1.00 32.15 ? 319  ASN A ND2   1 
ATOM   3977  N  N     . ASN B 2 319 ? 40.757  58.591  16.862 1.00 22.58 ? 320  ASN A N     1 
ATOM   3978  C  CA    . ASN B 2 319 ? 40.231  59.517  17.868 1.00 22.90 ? 320  ASN A CA    1 
ATOM   3979  C  C     . ASN B 2 319 ? 39.014  58.926  18.573 1.00 23.74 ? 320  ASN A C     1 
ATOM   3980  O  O     . ASN B 2 319 ? 38.920  58.968  19.799 1.00 25.88 ? 320  ASN A O     1 
ATOM   3981  C  CB    . ASN B 2 319 ? 39.903  60.877  17.248 1.00 24.00 ? 320  ASN A CB    1 
ATOM   3982  C  CG    . ASN B 2 319 ? 41.147  61.615  16.762 1.00 23.93 ? 320  ASN A CG    1 
ATOM   3983  O  OD1   . ASN B 2 319 ? 42.242  61.449  17.310 1.00 24.61 ? 320  ASN A OD1   1 
ATOM   3984  N  ND2   . ASN B 2 319 ? 40.980  62.440  15.737 1.00 23.44 ? 320  ASN A ND2   1 
ATOM   3985  N  N     . LEU B 2 320 ? 38.107  58.341  17.793 1.00 22.56 ? 321  LEU A N     1 
ATOM   3986  C  CA    . LEU B 2 320 ? 36.919  57.693  18.340 1.00 21.35 ? 321  LEU A CA    1 
ATOM   3987  C  C     . LEU B 2 320 ? 37.267  56.616  19.371 1.00 20.11 ? 321  LEU A C     1 
ATOM   3988  O  O     . LEU B 2 320 ? 36.580  56.488  20.379 1.00 20.49 ? 321  LEU A O     1 
ATOM   3989  C  CB    . LEU B 2 320 ? 36.051  57.113  17.222 1.00 22.31 ? 321  LEU A CB    1 
ATOM   3990  C  CG    . LEU B 2 320 ? 35.291  58.083  16.319 1.00 21.67 ? 321  LEU A CG    1 
ATOM   3991  C  CD1   . LEU B 2 320 ? 34.713  57.321  15.134 1.00 24.32 ? 321  LEU A CD1   1 
ATOM   3992  C  CD2   . LEU B 2 320 ? 34.194  58.818  17.070 1.00 21.42 ? 321  LEU A CD2   1 
ATOM   3993  N  N     . TYR B 2 321 ? 38.328  55.851  19.118 1.00 20.69 ? 322  TYR A N     1 
ATOM   3994  C  CA    . TYR B 2 321 ? 38.770  54.820  20.057 1.00 19.05 ? 322  TYR A CA    1 
ATOM   3995  C  C     . TYR B 2 321 ? 39.175  55.430  21.395 1.00 19.52 ? 322  TYR A C     1 
ATOM   3996  O  O     . TYR B 2 321 ? 38.750  54.957  22.452 1.00 19.71 ? 322  TYR A O     1 
ATOM   3997  C  CB    . TYR B 2 321 ? 39.935  53.991  19.501 1.00 18.51 ? 322  TYR A CB    1 
ATOM   3998  C  CG    . TYR B 2 321 ? 39.594  53.047  18.362 1.00 18.61 ? 322  TYR A CG    1 
ATOM   3999  C  CD1   . TYR B 2 321 ? 38.516  52.165  18.450 1.00 19.09 ? 322  TYR A CD1   1 
ATOM   4000  C  CD2   . TYR B 2 321 ? 40.400  52.981  17.221 1.00 19.04 ? 322  TYR A CD2   1 
ATOM   4001  C  CE1   . TYR B 2 321 ? 38.209  51.294  17.409 1.00 18.11 ? 322  TYR A CE1   1 
ATOM   4002  C  CE2   . TYR B 2 321 ? 40.110  52.100  16.186 1.00 17.94 ? 322  TYR A CE2   1 
ATOM   4003  C  CZ    . TYR B 2 321 ? 39.021  51.265  16.288 1.00 17.27 ? 322  TYR A CZ    1 
ATOM   4004  O  OH    . TYR B 2 321 ? 38.732  50.395  15.268 1.00 17.66 ? 322  TYR A OH    1 
ATOM   4005  N  N     . LYS B 2 322 ? 39.977  56.491  21.330 1.00 20.29 ? 323  LYS A N     1 
ATOM   4006  C  CA    . LYS B 2 322 ? 40.478  57.185  22.515 1.00 21.68 ? 323  LYS A CA    1 
ATOM   4007  C  C     . LYS B 2 322 ? 39.396  57.944  23.259 1.00 22.05 ? 323  LYS A C     1 
ATOM   4008  O  O     . LYS B 2 322 ? 39.401  57.985  24.489 1.00 21.86 ? 323  LYS A O     1 
ATOM   4009  C  CB    . LYS B 2 322 ? 41.564  58.193  22.136 1.00 24.23 ? 323  LYS A CB    1 
ATOM   4010  C  CG    . LYS B 2 322 ? 42.828  57.608  21.554 1.00 28.68 ? 323  LYS A CG    1 
ATOM   4011  C  CD    . LYS B 2 322 ? 43.737  58.768  21.094 1.00 31.65 ? 323  LYS A CD    1 
ATOM   4012  C  CE    . LYS B 2 322 ? 44.991  58.290  20.389 1.00 30.07 ? 323  LYS A CE    1 
ATOM   4013  N  NZ    . LYS B 2 322 ? 45.737  59.467  19.867 1.00 33.43 ? 323  LYS A NZ    1 
ATOM   4014  N  N     . GLN B 2 323 ? 38.473  58.532  22.502 1.00 21.80 ? 324  GLN A N     1 
ATOM   4015  C  CA    . GLN B 2 323 ? 37.440  59.406  23.067 1.00 21.25 ? 324  GLN A CA    1 
ATOM   4016  C  C     . GLN B 2 323 ? 36.079  58.773  23.379 1.00 18.30 ? 324  GLN A C     1 
ATOM   4017  O  O     . GLN B 2 323 ? 35.270  59.382  24.076 1.00 17.86 ? 324  GLN A O     1 
ATOM   4018  C  CB    . GLN B 2 323 ? 37.250  60.632  22.162 1.00 22.26 ? 324  GLN A CB    1 
ATOM   4019  C  CG    . GLN B 2 323 ? 38.532  61.421  21.894 1.00 23.90 ? 324  GLN A CG    1 
ATOM   4020  C  CD    . GLN B 2 323 ? 38.335  62.540  20.876 1.00 27.07 ? 324  GLN A CD    1 
ATOM   4021  O  OE1   . GLN B 2 323 ? 37.302  63.209  20.850 1.00 31.87 ? 324  GLN A OE1   1 
ATOM   4022  N  NE2   . GLN B 2 323 ? 39.322  62.738  20.011 1.00 28.27 ? 324  GLN A NE2   1 
ATOM   4023  N  N     . THR B 2 324 ? 35.821  57.573  22.872 1.00 17.61 ? 325  THR A N     1 
ATOM   4024  C  CA    . THR B 2 324 ? 34.527  56.914  23.111 1.00 17.69 ? 325  THR A CA    1 
ATOM   4025  C  C     . THR B 2 324 ? 34.709  55.450  23.529 1.00 17.71 ? 325  THR A C     1 
ATOM   4026  O  O     . THR B 2 324 ? 35.806  54.910  23.401 1.00 18.13 ? 325  THR A O     1 
ATOM   4027  C  CB    . THR B 2 324 ? 33.625  56.958  21.859 1.00 18.22 ? 325  THR A CB    1 
ATOM   4028  O  OG1   . THR B 2 324 ? 34.225  56.193  20.805 1.00 18.08 ? 325  THR A OG1   1 
ATOM   4029  C  CG2   . THR B 2 324 ? 33.384  58.390  21.394 1.00 16.56 ? 325  THR A CG2   1 
ATOM   4030  N  N     . PRO B 2 325 ? 33.644  54.799  24.024 1.00 18.12 ? 326  PRO A N     1 
ATOM   4031  C  CA    . PRO B 2 325 ? 33.761  53.383  24.403 1.00 18.71 ? 326  PRO A CA    1 
ATOM   4032  C  C     . PRO B 2 325 ? 33.922  52.419  23.208 1.00 18.86 ? 326  PRO A C     1 
ATOM   4033  O  O     . PRO B 2 325 ? 33.746  51.209  23.366 1.00 18.11 ? 326  PRO A O     1 
ATOM   4034  C  CB    . PRO B 2 325 ? 32.435  53.096  25.144 1.00 17.43 ? 326  PRO A CB    1 
ATOM   4035  C  CG    . PRO B 2 325 ? 31.864  54.428  25.465 1.00 18.46 ? 326  PRO A CG    1 
ATOM   4036  C  CD    . PRO B 2 325 ? 32.285  55.309  24.303 1.00 18.64 ? 326  PRO A CD    1 
ATOM   4037  N  N     . LEU B 2 326 ? 34.261  52.951  22.028 1.00 19.53 ? 327  LEU A N     1 
ATOM   4038  C  CA    . LEU B 2 326 ? 34.494  52.130  20.831 1.00 17.72 ? 327  LEU A CA    1 
ATOM   4039  C  C     . LEU B 2 326 ? 35.729  51.268  21.099 1.00 16.92 ? 327  LEU A C     1 
ATOM   4040  O  O     . LEU B 2 326 ? 35.941  50.243  20.451 1.00 17.25 ? 327  LEU A O     1 
ATOM   4041  C  CB    . LEU B 2 326 ? 34.682  53.019  19.599 1.00 18.06 ? 327  LEU A CB    1 
ATOM   4042  C  CG    . LEU B 2 326 ? 34.548  52.416  18.200 1.00 18.55 ? 327  LEU A CG    1 
ATOM   4043  C  CD1   . LEU B 2 326 ? 33.115  51.936  17.952 1.00 17.85 ? 327  LEU A CD1   1 
ATOM   4044  C  CD2   . LEU B 2 326 ? 34.962  53.419  17.127 1.00 16.47 ? 327  LEU A CD2   1 
ATOM   4045  N  N     . GLN B 2 327 ? 36.537  51.719  22.056 1.00 16.27 ? 328  GLN A N     1 
ATOM   4046  C  CA    . GLN B 2 327 ? 37.676  50.979  22.597 1.00 16.99 ? 328  GLN A CA    1 
ATOM   4047  C  C     . GLN B 2 327 ? 37.607  51.151  24.116 1.00 17.52 ? 328  GLN A C     1 
ATOM   4048  O  O     . GLN B 2 327 ? 37.837  52.251  24.636 1.00 18.75 ? 328  GLN A O     1 
ATOM   4049  C  CB    . GLN B 2 327 ? 39.013  51.487  22.063 1.00 16.69 ? 328  GLN A CB    1 
ATOM   4050  C  CG    . GLN B 2 327 ? 40.213  50.782  22.699 1.00 17.83 ? 328  GLN A CG    1 
ATOM   4051  C  CD    . GLN B 2 327 ? 41.560  51.301  22.215 1.00 18.47 ? 328  GLN A CD    1 
ATOM   4052  O  OE1   . GLN B 2 327 ? 41.703  51.735  21.076 1.00 19.95 ? 328  GLN A OE1   1 
ATOM   4053  N  NE2   . GLN B 2 327 ? 42.556  51.238  23.079 1.00 18.97 ? 328  GLN A NE2   1 
ATOM   4054  N  N     . THR B 2 328 ? 37.254  50.068  24.807 1.00 17.16 ? 329  THR A N     1 
ATOM   4055  C  CA    . THR B 2 328 ? 37.122  50.044  26.267 1.00 17.08 ? 329  THR A CA    1 
ATOM   4056  C  C     . THR B 2 328 ? 38.037  48.958  26.833 1.00 17.49 ? 329  THR A C     1 
ATOM   4057  O  O     . THR B 2 328 ? 38.265  47.932  26.181 1.00 18.61 ? 329  THR A O     1 
ATOM   4058  C  CB    . THR B 2 328 ? 35.667  49.705  26.692 1.00 17.46 ? 329  THR A CB    1 
ATOM   4059  O  OG1   . THR B 2 328 ? 34.747  50.585  26.037 1.00 16.39 ? 329  THR A OG1   1 
ATOM   4060  C  CG2   . THR B 2 328 ? 35.484  49.825  28.219 1.00 18.31 ? 329  THR A CG2   1 
ATOM   4061  N  N     . SER B 2 329 ? 38.554  49.171  28.036 1.00 16.07 ? 330  SER A N     1 
ATOM   4062  C  CA    . SER B 2 329 ? 39.411  48.160  28.648 1.00 15.15 ? 330  SER A CA    1 
ATOM   4063  C  C     . SER B 2 329 ? 38.649  47.266  29.631 1.00 14.39 ? 330  SER A C     1 
ATOM   4064  O  O     . SER B 2 329 ? 37.729  47.714  30.316 1.00 13.32 ? 330  SER A O     1 
ATOM   4065  C  CB    . SER B 2 329 ? 40.621  48.797  29.342 1.00 15.42 ? 330  SER A CB    1 
ATOM   4066  O  OG    . SER B 2 329 ? 40.230  49.500  30.496 1.00 15.89 ? 330  SER A OG    1 
ATOM   4067  N  N     . PHE B 2 330 ? 39.042  45.996  29.668 1.00 12.83 ? 331  PHE A N     1 
ATOM   4068  C  CA    . PHE B 2 330 ? 38.480  45.039  30.604 1.00 11.70 ? 331  PHE A CA    1 
ATOM   4069  C  C     . PHE B 2 330 ? 39.511  44.867  31.708 1.00 10.92 ? 331  PHE A C     1 
ATOM   4070  O  O     . PHE B 2 330 ? 40.608  44.363  31.466 1.00 10.82 ? 331  PHE A O     1 
ATOM   4071  C  CB    . PHE B 2 330 ? 38.206  43.699  29.911 1.00 11.49 ? 331  PHE A CB    1 
ATOM   4072  C  CG    . PHE B 2 330 ? 37.361  42.759  30.729 1.00 11.51 ? 331  PHE A CG    1 
ATOM   4073  C  CD1   . PHE B 2 330 ? 37.922  42.016  31.770 1.00 11.62 ? 331  PHE A CD1   1 
ATOM   4074  C  CD2   . PHE B 2 330 ? 35.993  42.637  30.489 1.00 11.25 ? 331  PHE A CD2   1 
ATOM   4075  C  CE1   . PHE B 2 330 ? 37.136  41.151  32.532 1.00 11.27 ? 331  PHE A CE1   1 
ATOM   4076  C  CE2   . PHE B 2 330 ? 35.212  41.764  31.221 1.00 10.75 ? 331  PHE A CE2   1 
ATOM   4077  C  CZ    . PHE B 2 330 ? 35.783  41.025  32.254 1.00 10.95 ? 331  PHE A CZ    1 
ATOM   4078  N  N     . GLY B 2 331 ? 39.169  45.312  32.912 1.00 10.52 ? 332  GLY A N     1 
ATOM   4079  C  CA    . GLY B 2 331 ? 40.068  45.213  34.057 1.00 9.96  ? 332  GLY A CA    1 
ATOM   4080  C  C     . GLY B 2 331 ? 39.902  43.865  34.730 1.00 9.73  ? 332  GLY A C     1 
ATOM   4081  O  O     . GLY B 2 331 ? 39.014  43.682  35.560 1.00 10.21 ? 332  GLY A O     1 
ATOM   4082  N  N     . VAL B 2 332 ? 40.769  42.926  34.369 1.00 8.71  ? 333  VAL A N     1 
ATOM   4083  C  CA    . VAL B 2 332 ? 40.733  41.583  34.925 1.00 8.36  ? 333  VAL A CA    1 
ATOM   4084  C  C     . VAL B 2 332 ? 41.141  41.585  36.401 1.00 8.52  ? 333  VAL A C     1 
ATOM   4085  O  O     . VAL B 2 332 ? 42.195  42.103  36.771 1.00 8.19  ? 333  VAL A O     1 
ATOM   4086  C  CB    . VAL B 2 332 ? 41.622  40.614  34.123 1.00 8.01  ? 333  VAL A CB    1 
ATOM   4087  C  CG1   . VAL B 2 332 ? 41.602  39.246  34.735 1.00 7.86  ? 333  VAL A CG1   1 
ATOM   4088  C  CG2   . VAL B 2 332 ? 41.156  40.543  32.688 1.00 7.92  ? 333  VAL A CG2   1 
ATOM   4089  N  N     . ASN B 2 333 ? 40.265  41.011  37.221 1.00 8.82  ? 334  ASN A N     1 
ATOM   4090  C  CA    . ASN B 2 333 ? 40.443  40.889  38.661 1.00 9.20  ? 334  ASN A CA    1 
ATOM   4091  C  C     . ASN B 2 333 ? 39.774  39.562  38.996 1.00 8.91  ? 334  ASN A C     1 
ATOM   4092  O  O     . ASN B 2 333 ? 38.573  39.520  39.256 1.00 8.86  ? 334  ASN A O     1 
ATOM   4093  C  CB    . ASN B 2 333 ? 39.753  42.062  39.368 1.00 9.21  ? 334  ASN A CB    1 
ATOM   4094  C  CG    . ASN B 2 333 ? 39.988  42.090  40.879 1.00 9.83  ? 334  ASN A CG    1 
ATOM   4095  O  OD1   . ASN B 2 333 ? 39.358  42.899  41.576 1.00 9.28  ? 334  ASN A OD1   1 
ATOM   4096  N  ND2   . ASN B 2 333 ? 40.873  41.222  41.379 1.00 9.73  ? 334  ASN A ND2   1 
ATOM   4097  N  N     . MET B 2 334 ? 40.547  38.480  38.965 1.00 8.94  ? 335  MET A N     1 
ATOM   4098  C  CA    . MET B 2 334 ? 39.986  37.140  39.153 1.00 9.11  ? 335  MET A CA    1 
ATOM   4099  C  C     . MET B 2 334 ? 39.859  36.642  40.589 1.00 9.15  ? 335  MET A C     1 
ATOM   4100  O  O     . MET B 2 334 ? 40.671  35.840  41.061 1.00 9.39  ? 335  MET A O     1 
ATOM   4101  C  CB    . MET B 2 334 ? 40.708  36.106  38.283 1.00 9.97  ? 335  MET A CB    1 
ATOM   4102  C  CG    . MET B 2 334 ? 40.605  36.394  36.783 1.00 10.99 ? 335  MET A CG    1 
ATOM   4103  S  SD    . MET B 2 334 ? 41.023  35.006  35.710 1.00 12.26 ? 335  MET A SD    1 
ATOM   4104  C  CE    . MET B 2 334 ? 42.793  34.814  35.975 1.00 11.05 ? 335  MET A CE    1 
ATOM   4105  N  N     . ILE B 2 335 ? 38.802  37.084  41.249 1.00 8.93  ? 336  ILE A N     1 
ATOM   4106  C  CA    . ILE B 2 335 ? 38.517  36.666  42.590 1.00 8.59  ? 336  ILE A CA    1 
ATOM   4107  C  C     . ILE B 2 335 ? 37.353  35.683  42.530 1.00 8.82  ? 336  ILE A C     1 
ATOM   4108  O  O     . ILE B 2 335 ? 36.334  35.935  41.902 1.00 7.50  ? 336  ILE A O     1 
ATOM   4109  C  CB    . ILE B 2 335 ? 38.219  37.860  43.504 1.00 8.40  ? 336  ILE A CB    1 
ATOM   4110  C  CG1   . ILE B 2 335 ? 39.512  38.629  43.766 1.00 8.49  ? 336  ILE A CG1   1 
ATOM   4111  C  CG2   . ILE B 2 335 ? 37.600  37.392  44.812 1.00 8.14  ? 336  ILE A CG2   1 
ATOM   4112  C  CD1   . ILE B 2 335 ? 39.341  39.897  44.566 1.00 8.09  ? 336  ILE A CD1   1 
ATOM   4113  N  N     . ALA B 2 336 ? 37.547  34.547  43.178 1.00 9.42  ? 337  ALA A N     1 
ATOM   4114  C  CA    . ALA B 2 336 ? 36.541  33.490  43.233 1.00 10.10 ? 337  ALA A CA    1 
ATOM   4115  C  C     . ALA B 2 336 ? 36.640  32.730  44.543 1.00 11.41 ? 337  ALA A C     1 
ATOM   4116  O  O     . ALA B 2 336 ? 37.675  32.760  45.218 1.00 12.69 ? 337  ALA A O     1 
ATOM   4117  C  CB    . ALA B 2 336 ? 36.716  32.535  42.063 1.00 10.00 ? 337  ALA A CB    1 
ATOM   4118  N  N     . LEU B 2 337 ? 35.556  32.057  44.914 1.00 12.56 ? 338  LEU A N     1 
ATOM   4119  C  CA    . LEU B 2 337 ? 35.523  31.279  46.147 1.00 12.60 ? 338  LEU A CA    1 
ATOM   4120  C  C     . LEU B 2 337 ? 36.275  29.947  46.028 1.00 14.10 ? 338  LEU A C     1 
ATOM   4121  O  O     . LEU B 2 337 ? 35.934  29.087  45.200 1.00 13.34 ? 338  LEU A O     1 
ATOM   4122  C  CB    . LEU B 2 337 ? 34.072  31.050  46.581 1.00 13.22 ? 338  LEU A CB    1 
ATOM   4123  C  CG    . LEU B 2 337 ? 33.202  32.272  46.900 1.00 13.06 ? 338  LEU A CG    1 
ATOM   4124  C  CD1   . LEU B 2 337 ? 31.770  31.845  47.194 1.00 11.19 ? 338  LEU A CD1   1 
ATOM   4125  C  CD2   . LEU B 2 337 ? 33.787  33.117  48.055 1.00 12.26 ? 338  LEU A CD2   1 
ATOM   4126  N  N     A VAL B 2 338 ? 37.304  29.797  46.841 0.50 14.86 ? 339  VAL A N     1 
ATOM   4127  N  N     B VAL B 2 338 ? 37.397  29.796  46.838 0.50 15.03 ? 339  VAL A N     1 
ATOM   4128  C  CA    A VAL B 2 338 ? 38.068  28.556  46.916 0.50 15.07 ? 339  VAL A CA    1 
ATOM   4129  C  CA    B VAL B 2 338 ? 38.174  28.560  46.911 0.50 15.40 ? 339  VAL A CA    1 
ATOM   4130  C  C     A VAL B 2 338 ? 37.859  28.080  48.340 0.50 15.34 ? 339  VAL A C     1 
ATOM   4131  C  C     B VAL B 2 338 ? 37.964  28.081  48.333 0.50 15.88 ? 339  VAL A C     1 
ATOM   4132  O  O     A VAL B 2 338 ? 38.284  28.755  49.290 0.50 15.19 ? 339  VAL A O     1 
ATOM   4133  O  O     B VAL B 2 338 ? 38.379  28.752  49.292 0.50 15.76 ? 339  VAL A O     1 
ATOM   4134  C  CB    A VAL B 2 338 ? 39.572  28.793  46.634 0.50 15.24 ? 339  VAL A CB    1 
ATOM   4135  C  CB    B VAL B 2 338 ? 39.673  28.797  46.632 0.50 15.54 ? 339  VAL A CB    1 
ATOM   4136  C  CG1   A VAL B 2 338 ? 40.352  27.502  46.733 0.50 15.91 ? 339  VAL A CG1   1 
ATOM   4137  C  CG1   B VAL B 2 338 ? 40.469  27.525  46.837 0.50 16.20 ? 339  VAL A CG1   1 
ATOM   4138  C  CG2   A VAL B 2 338 ? 39.768  29.413  45.259 0.50 16.01 ? 339  VAL A CG2   1 
ATOM   4139  C  CG2   B VAL B 2 338 ? 39.876  29.315  45.219 0.50 16.26 ? 339  VAL A CG2   1 
ATOM   4140  N  N     A ASN B 2 339 ? 37.227  26.923  48.530 0.50 15.86 ? 340  ASN A N     1 
ATOM   4141  N  N     B ASN B 2 339 ? 37.253  26.961  48.406 0.50 16.58 ? 340  ASN A N     1 
ATOM   4142  C  CA    A ASN B 2 339 ? 36.796  26.465  49.866 0.50 16.04 ? 340  ASN A CA    1 
ATOM   4143  C  CA    B ASN B 2 339 ? 36.950  26.332  49.679 0.50 17.05 ? 340  ASN A CA    1 
ATOM   4144  C  C     A ASN B 2 339 ? 36.057  27.529  50.657 0.50 16.98 ? 340  ASN A C     1 
ATOM   4145  C  C     B ASN B 2 339 ? 36.253  27.326  50.597 0.50 17.69 ? 340  ASN A C     1 
ATOM   4146  O  O     A ASN B 2 339 ? 36.338  27.735  51.818 0.50 16.06 ? 340  ASN A O     1 
ATOM   4147  O  O     B ASN B 2 339 ? 36.599  27.431  51.752 0.50 16.44 ? 340  ASN A O     1 
ATOM   4148  C  CB    A ASN B 2 339 ? 37.972  26.004  50.697 0.50 15.61 ? 340  ASN A CB    1 
ATOM   4149  C  CB    B ASN B 2 339 ? 38.237  25.843  50.323 0.50 17.18 ? 340  ASN A CB    1 
ATOM   4150  C  CG    A ASN B 2 339 ? 38.847  25.032  49.957 0.50 15.49 ? 340  ASN A CG    1 
ATOM   4151  C  CG    B ASN B 2 339 ? 37.998  25.122  51.623 0.50 17.10 ? 340  ASN A CG    1 
ATOM   4152  O  OD1   A ASN B 2 339 ? 38.395  23.957  49.562 0.50 15.21 ? 340  ASN A OD1   1 
ATOM   4153  O  OD1   B ASN B 2 339 ? 36.870  24.718  51.921 0.50 16.92 ? 340  ASN A OD1   1 
ATOM   4154  N  ND2   A ASN B 2 339 ? 40.104  25.409  49.753 0.50 15.12 ? 340  ASN A ND2   1 
ATOM   4155  N  ND2   B ASN B 2 339 ? 39.065  24.962  52.421 0.50 17.14 ? 340  ASN A ND2   1 
ATOM   4156  N  N     A GLY B 2 340 ? 35.099  28.190  50.011 0.50 16.99 ? 341  GLY A N     1 
ATOM   4157  N  N     B GLY B 2 340 ? 35.273  28.055  50.041 0.50 17.96 ? 341  GLY A N     1 
ATOM   4158  C  CA    A GLY B 2 340 ? 34.311  29.148  50.724 0.50 17.68 ? 341  GLY A CA    1 
ATOM   4159  C  CA    B GLY B 2 340 ? 34.460  28.977  50.824 0.50 18.06 ? 341  GLY A CA    1 
ATOM   4160  C  C     A GLY B 2 340 ? 35.036  30.350  51.249 0.50 18.64 ? 341  GLY A C     1 
ATOM   4161  C  C     B GLY B 2 340 ? 34.988  30.356  51.153 0.50 18.97 ? 341  GLY A C     1 
ATOM   4162  O  O     A GLY B 2 340 ? 34.497  31.055  52.073 0.50 19.85 ? 341  GLY A O     1 
ATOM   4163  O  O     B GLY B 2 340 ? 34.476  31.003  52.052 0.50 20.13 ? 341  GLY A O     1 
ATOM   4164  N  N     . ARG B 2 341 ? 36.126  30.706  50.593 1.00 18.06 ? 342  ARG A N     1 
ATOM   4165  C  CA    . ARG B 2 341 ? 36.812  31.917  50.897 1.00 18.88 ? 342  ARG A CA    1 
ATOM   4166  C  C     . ARG B 2 341 ? 37.132  32.682  49.638 1.00 17.01 ? 342  ARG A C     1 
ATOM   4167  O  O     . ARG B 2 341 ? 37.566  32.117  48.681 1.00 16.66 ? 342  ARG A O     1 
ATOM   4168  C  CB    . ARG B 2 341 ? 38.083  31.644  51.669 1.00 21.76 ? 342  ARG A CB    1 
ATOM   4169  C  CG    . ARG B 2 341 ? 37.835  31.207  53.081 1.00 25.55 ? 342  ARG A CG    1 
ATOM   4170  C  CD    . ARG B 2 341 ? 38.943  30.299  53.542 1.00 29.03 ? 342  ARG A CD    1 
ATOM   4171  N  NE    . ARG B 2 341 ? 38.701  29.746  54.857 1.00 32.42 ? 342  ARG A NE    1 
ATOM   4172  C  CZ    . ARG B 2 341 ? 37.730  28.878  55.116 1.00 33.55 ? 342  ARG A CZ    1 
ATOM   4173  N  NH1   . ARG B 2 341 ? 37.569  28.430  56.347 1.00 35.81 ? 342  ARG A NH1   1 
ATOM   4174  N  NH2   . ARG B 2 341 ? 36.902  28.482  54.158 1.00 33.12 ? 342  ARG A NH2   1 
ATOM   4175  N  N     . PRO B 2 342 ? 37.077  34.009  49.737 1.00 15.80 ? 343  PRO A N     1 
ATOM   4176  C  CA    . PRO B 2 342 ? 37.464  34.691  48.499 1.00 15.24 ? 343  PRO A CA    1 
ATOM   4177  C  C     . PRO B 2 342 ? 38.960  34.637  48.270 1.00 15.76 ? 343  PRO A C     1 
ATOM   4178  O  O     . PRO B 2 342 ? 39.738  34.824  49.197 1.00 16.19 ? 343  PRO A O     1 
ATOM   4179  C  CB    . PRO B 2 342 ? 37.003  36.122  48.744 1.00 16.05 ? 343  PRO A CB    1 
ATOM   4180  C  CG    . PRO B 2 342 ? 37.193  36.317  50.190 1.00 15.90 ? 343  PRO A CG    1 
ATOM   4181  C  CD    . PRO B 2 342 ? 36.681  35.040  50.763 1.00 15.50 ? 343  PRO A CD    1 
ATOM   4182  N  N     . LYS B 2 343 ? 39.371  34.368  47.043 1.00 15.95 ? 344  LYS A N     1 
ATOM   4183  C  CA    . LYS B 2 343 ? 40.796  34.282  46.767 1.00 17.03 ? 344  LYS A CA    1 
ATOM   4184  C  C     . LYS B 2 343 ? 41.144  34.735  45.354 1.00 17.41 ? 344  LYS A C     1 
ATOM   4185  O  O     . LYS B 2 343 ? 40.470  34.369  44.392 1.00 17.31 ? 344  LYS A O     1 
ATOM   4186  C  CB    . LYS B 2 343 ? 41.282  32.858  47.015 1.00 20.03 ? 344  LYS A CB    1 
ATOM   4187  C  CG    . LYS B 2 343 ? 42.795  32.677  47.037 1.00 22.60 ? 344  LYS A CG    1 
ATOM   4188  C  CD    . LYS B 2 343 ? 43.173  31.240  47.427 1.00 22.49 ? 344  LYS A CD    1 
ATOM   4189  C  CE    . LYS B 2 343 ? 44.675  31.055  47.337 1.00 26.21 ? 344  LYS A CE    1 
ATOM   4190  N  NZ    . LYS B 2 343 ? 45.208  31.464  45.975 1.00 29.30 ? 344  LYS A NZ    1 
ATOM   4191  N  N     . LEU B 2 344 ? 42.196  35.545  45.249 1.00 16.62 ? 345  LEU A N     1 
ATOM   4192  C  CA    . LEU B 2 344 ? 42.699  36.010  43.969 1.00 15.57 ? 345  LEU A CA    1 
ATOM   4193  C  C     . LEU B 2 344 ? 43.511  34.872  43.370 1.00 16.33 ? 345  LEU A C     1 
ATOM   4194  O  O     . LEU B 2 344 ? 44.486  34.413  43.975 1.00 15.61 ? 345  LEU A O     1 
ATOM   4195  C  CB    . LEU B 2 344 ? 43.576  37.251  44.161 1.00 15.62 ? 345  LEU A CB    1 
ATOM   4196  C  CG    . LEU B 2 344 ? 44.204  37.928  42.930 1.00 16.24 ? 345  LEU A CG    1 
ATOM   4197  C  CD1   . LEU B 2 344 ? 43.146  38.479  41.972 1.00 16.62 ? 345  LEU A CD1   1 
ATOM   4198  C  CD2   . LEU B 2 344 ? 45.118  39.046  43.361 1.00 15.74 ? 345  LEU A CD2   1 
ATOM   4199  N  N     . ILE B 2 345 ? 43.099  34.412  42.191 1.00 15.81 ? 346  ILE A N     1 
ATOM   4200  C  CA    . ILE B 2 345 ? 43.747  33.289  41.521 1.00 15.34 ? 346  ILE A CA    1 
ATOM   4201  C  C     . ILE B 2 345 ? 44.193  33.585  40.078 1.00 16.07 ? 346  ILE A C     1 
ATOM   4202  O  O     . ILE B 2 345 ? 43.617  34.427  39.387 1.00 16.07 ? 346  ILE A O     1 
ATOM   4203  C  CB    . ILE B 2 345 ? 42.830  32.037  41.529 1.00 16.00 ? 346  ILE A CB    1 
ATOM   4204  C  CG1   . ILE B 2 345 ? 41.535  32.297  40.739 1.00 15.57 ? 346  ILE A CG1   1 
ATOM   4205  C  CG2   . ILE B 2 345 ? 42.522  31.609  42.959 1.00 15.04 ? 346  ILE A CG2   1 
ATOM   4206  C  CD1   . ILE B 2 345 ? 40.576  31.125  40.699 1.00 16.31 ? 346  ILE A CD1   1 
ATOM   4207  N  N     . ASN B 2 346 ? 45.232  32.885  39.639 1.00 16.20 ? 347  ASN A N     1 
ATOM   4208  C  CA    . ASN B 2 346 ? 45.735  33.017  38.282 1.00 15.42 ? 347  ASN A CA    1 
ATOM   4209  C  C     . ASN B 2 346 ? 45.070  31.964  37.384 1.00 15.09 ? 347  ASN A C     1 
ATOM   4210  O  O     . ASN B 2 346 ? 44.186  31.235  37.837 1.00 17.73 ? 347  ASN A O     1 
ATOM   4211  C  CB    . ASN B 2 346 ? 47.267  32.911  38.260 1.00 16.14 ? 347  ASN A CB    1 
ATOM   4212  C  CG    . ASN B 2 346 ? 47.784  31.588  38.828 1.00 17.47 ? 347  ASN A CG    1 
ATOM   4213  O  OD1   . ASN B 2 346 ? 47.409  30.507  38.373 1.00 17.71 ? 347  ASN A OD1   1 
ATOM   4214  N  ND2   . ASN B 2 346 ? 48.671  31.676  39.808 1.00 17.10 ? 347  ASN A ND2   1 
ATOM   4215  N  N     . LEU B 2 347 ? 45.492  31.883  36.122 1.00 13.53 ? 348  LEU A N     1 
ATOM   4216  C  CA    . LEU B 2 347 ? 44.902  30.944  35.167 1.00 11.74 ? 348  LEU A CA    1 
ATOM   4217  C  C     . LEU B 2 347 ? 45.098  29.481  35.562 1.00 12.09 ? 348  LEU A C     1 
ATOM   4218  O  O     . LEU B 2 347 ? 44.179  28.665  35.411 1.00 11.53 ? 348  LEU A O     1 
ATOM   4219  C  CB    . LEU B 2 347 ? 45.460  31.170  33.760 1.00 11.34 ? 348  LEU A CB    1 
ATOM   4220  C  CG    . LEU B 2 347 ? 44.828  30.340  32.636 1.00 12.17 ? 348  LEU A CG    1 
ATOM   4221  C  CD1   . LEU B 2 347 ? 43.368  30.719  32.412 1.00 12.15 ? 348  LEU A CD1   1 
ATOM   4222  C  CD2   . LEU B 2 347 ? 45.592  30.495  31.346 1.00 12.08 ? 348  LEU A CD2   1 
ATOM   4223  N  N     . LYS B 2 348 ? 46.300  29.148  36.048 1.00 11.80 ? 349  LYS A N     1 
ATOM   4224  C  CA    . LYS B 2 348 ? 46.602  27.784  36.425 1.00 12.39 ? 349  LYS A CA    1 
ATOM   4225  C  C     . LYS B 2 348 ? 45.815  27.349  37.661 1.00 13.21 ? 349  LYS A C     1 
ATOM   4226  O  O     . LYS B 2 348 ? 45.180  26.288  37.646 1.00 13.92 ? 349  LYS A O     1 
ATOM   4227  C  CB    . LYS B 2 348 ? 48.099  27.564  36.620 1.00 12.91 ? 349  LYS A CB    1 
ATOM   4228  C  CG    . LYS B 2 348 ? 48.438  26.121  36.950 1.00 12.47 ? 349  LYS A CG    1 
ATOM   4229  C  CD    . LYS B 2 348 ? 49.927  25.888  36.993 1.00 11.78 ? 349  LYS A CD    1 
ATOM   4230  C  CE    . LYS B 2 348 ? 50.197  24.456  37.431 1.00 11.68 ? 349  LYS A CE    1 
ATOM   4231  N  NZ    . LYS B 2 348 ? 51.633  24.140  37.355 1.00 11.83 ? 349  LYS A NZ    1 
ATOM   4232  N  N     . GLU B 2 349 ? 45.931  28.178  38.706 1.00 13.33 ? 350  GLU A N     1 
ATOM   4233  C  CA    . GLU B 2 349 ? 45.221  27.862  39.944 1.00 13.48 ? 350  GLU A CA    1 
ATOM   4234  C  C     . GLU B 2 349 ? 43.728  27.630  39.674 1.00 13.30 ? 350  GLU A C     1 
ATOM   4235  O  O     . GLU B 2 349 ? 43.117  26.757  40.284 1.00 12.36 ? 350  GLU A O     1 
ATOM   4236  C  CB    . GLU B 2 349 ? 45.430  28.940  41.016 1.00 14.74 ? 350  GLU A CB    1 
ATOM   4237  C  CG    . GLU B 2 349 ? 44.868  28.531  42.377 1.00 17.26 ? 350  GLU A CG    1 
ATOM   4238  C  CD    . GLU B 2 349 ? 45.127  29.533  43.503 1.00 20.59 ? 350  GLU A CD    1 
ATOM   4239  O  OE1   . GLU B 2 349 ? 45.868  30.543  43.293 1.00 19.21 ? 350  GLU A OE1   1 
ATOM   4240  O  OE2   . GLU B 2 349 ? 44.583  29.297  44.617 1.00 20.80 ? 350  GLU A OE2   1 
ATOM   4241  N  N     . ALA B 2 350 ? 43.076  28.376  38.733 1.00 12.89 ? 351  ALA A N     1 
ATOM   4242  C  CA    . ALA B 2 350 ? 41.677  28.210  38.362 1.00 12.91 ? 351  ALA A CA    1 
ATOM   4243  C  C     . ALA B 2 350 ? 41.469  26.846  37.717 1.00 11.80 ? 351  ALA A C     1 
ATOM   4244  O  O     . ALA B 2 350 ? 40.568  26.116  38.086 1.00 10.98 ? 351  ALA A O     1 
ATOM   4245  C  CB    . ALA B 2 350 ? 41.231  29.328  37.431 1.00 12.47 ? 351  ALA A CB    1 
ATOM   4246  N  N     . LEU B 2 351 ? 42.314  26.511  36.752 1.00 12.54 ? 352  LEU A N     1 
ATOM   4247  C  CA    . LEU B 2 351 ? 42.232  25.204  36.083 1.00 13.12 ? 352  LEU A CA    1 
ATOM   4248  C  C     . LEU B 2 351 ? 42.495  24.031  37.034 1.00 12.68 ? 352  LEU A C     1 
ATOM   4249  O  O     . LEU B 2 351 ? 41.893  22.970  36.878 1.00 13.23 ? 352  LEU A O     1 
ATOM   4250  C  CB    . LEU B 2 351 ? 43.180  25.142  34.880 1.00 13.04 ? 352  LEU A CB    1 
ATOM   4251  C  CG    . LEU B 2 351 ? 42.927  26.111  33.715 1.00 13.21 ? 352  LEU A CG    1 
ATOM   4252  C  CD1   . LEU B 2 351 ? 44.070  26.021  32.707 1.00 13.18 ? 352  LEU A CD1   1 
ATOM   4253  C  CD2   . LEU B 2 351 ? 41.593  25.835  33.037 1.00 13.71 ? 352  LEU A CD2   1 
ATOM   4254  N  N     . VAL B 2 352 ? 43.389  24.230  38.008 1.00 12.46 ? 353  VAL A N     1 
ATOM   4255  C  CA    . VAL B 2 352 ? 43.733  23.203  39.000 1.00 12.86 ? 353  VAL A CA    1 
ATOM   4256  C  C     . VAL B 2 352 ? 42.532  22.829  39.865 1.00 13.21 ? 353  VAL A C     1 
ATOM   4257  O  O     . VAL B 2 352 ? 42.147  21.661  39.938 1.00 12.87 ? 353  VAL A O     1 
ATOM   4258  C  CB    . VAL B 2 352 ? 44.947  23.625  39.891 1.00 13.13 ? 353  VAL A CB    1 
ATOM   4259  C  CG1   . VAL B 2 352 ? 45.094  22.720  41.110 1.00 12.89 ? 353  VAL A CG1   1 
ATOM   4260  C  CG2   . VAL B 2 352 ? 46.236  23.634  39.075 1.00 12.19 ? 353  VAL A CG2   1 
ATOM   4261  N  N     . HIS B 2 353 ? 41.937  23.828  40.505 1.00 14.14 ? 354  HIS A N     1 
ATOM   4262  C  CA    . HIS B 2 353 ? 40.761  23.616  41.337 1.00 15.14 ? 354  HIS A CA    1 
ATOM   4263  C  C     . HIS B 2 353 ? 39.594  23.025  40.547 1.00 15.76 ? 354  HIS A C     1 
ATOM   4264  O  O     . HIS B 2 353 ? 38.811  22.232  41.086 1.00 16.70 ? 354  HIS A O     1 
ATOM   4265  C  CB    . HIS B 2 353 ? 40.347  24.909  42.039 1.00 15.80 ? 354  HIS A CB    1 
ATOM   4266  C  CG    . HIS B 2 353 ? 41.340  25.396  43.047 1.00 16.50 ? 354  HIS A CG    1 
ATOM   4267  N  ND1   . HIS B 2 353 ? 41.597  24.723  44.217 1.00 17.70 ? 354  HIS A ND1   1 
ATOM   4268  C  CD2   . HIS B 2 353 ? 42.100  26.513  43.084 1.00 16.78 ? 354  HIS A CD2   1 
ATOM   4269  C  CE1   . HIS B 2 353 ? 42.501  25.385  44.919 1.00 18.14 ? 354  HIS A CE1   1 
ATOM   4270  N  NE2   . HIS B 2 353 ? 42.823  26.476  44.253 1.00 17.91 ? 354  HIS A NE2   1 
ATOM   4271  N  N     . TYR B 2 354 ? 39.479  23.371  39.275 1.00 16.73 ? 355  TYR A N     1 
ATOM   4272  C  CA    . TYR B 2 354 ? 38.407  22.826  38.460 1.00 17.85 ? 355  TYR A CA    1 
ATOM   4273  C  C     . TYR B 2 354 ? 38.661  21.353  38.161 1.00 18.85 ? 355  TYR A C     1 
ATOM   4274  O  O     . TYR B 2 354 ? 37.752  20.530  38.239 1.00 18.77 ? 355  TYR A O     1 
ATOM   4275  C  CB    . TYR B 2 354 ? 38.208  23.619  37.163 1.00 17.64 ? 355  TYR A CB    1 
ATOM   4276  C  CG    . TYR B 2 354 ? 37.277  22.912  36.210 1.00 17.40 ? 355  TYR A CG    1 
ATOM   4277  C  CD1   . TYR B 2 354 ? 35.909  22.873  36.450 1.00 17.31 ? 355  TYR A CD1   1 
ATOM   4278  C  CD2   . TYR B 2 354 ? 37.762  22.245  35.101 1.00 16.58 ? 355  TYR A CD2   1 
ATOM   4279  C  CE1   . TYR B 2 354 ? 35.055  22.205  35.609 1.00 16.88 ? 355  TYR A CE1   1 
ATOM   4280  C  CE2   . TYR B 2 354 ? 36.924  21.581  34.249 1.00 17.26 ? 355  TYR A CE2   1 
ATOM   4281  C  CZ    . TYR B 2 354 ? 35.563  21.562  34.512 1.00 19.27 ? 355  TYR A CZ    1 
ATOM   4282  O  OH    . TYR B 2 354 ? 34.722  20.906  33.661 1.00 18.43 ? 355  TYR A OH    1 
ATOM   4283  N  N     . LEU B 2 355 ? 39.904  21.026  37.824 1.00 19.06 ? 356  LEU A N     1 
ATOM   4284  C  CA    . LEU B 2 355 ? 40.278  19.638  37.531 1.00 18.89 ? 356  LEU A CA    1 
ATOM   4285  C  C     . LEU B 2 355 ? 40.101  18.735  38.748 1.00 18.09 ? 356  LEU A C     1 
ATOM   4286  O  O     . LEU B 2 355 ? 39.720  17.572  38.607 1.00 20.71 ? 356  LEU A O     1 
ATOM   4287  C  CB    . LEU B 2 355 ? 41.711  19.547  36.991 1.00 19.77 ? 356  LEU A CB    1 
ATOM   4288  C  CG    . LEU B 2 355 ? 42.277  18.173  36.582 1.00 21.43 ? 356  LEU A CG    1 
ATOM   4289  C  CD1   . LEU B 2 355 ? 41.402  17.451  35.568 1.00 22.73 ? 356  LEU A CD1   1 
ATOM   4290  C  CD2   . LEU B 2 355 ? 43.696  18.301  36.041 1.00 21.51 ? 356  LEU A CD2   1 
ATOM   4291  N  N     . GLU B 2 356 ? 40.384  19.270  39.934 1.00 16.61 ? 357  GLU A N     1 
ATOM   4292  C  CA    . GLU B 2 356 ? 40.234  18.516  41.173 1.00 16.73 ? 357  GLU A CA    1 
ATOM   4293  C  C     . GLU B 2 356 ? 38.765  18.280  41.481 1.00 16.43 ? 357  GLU A C     1 
ATOM   4294  O  O     . GLU B 2 356 ? 38.402  17.278  42.095 1.00 15.68 ? 357  GLU A O     1 
ATOM   4295  C  CB    . GLU B 2 356 ? 40.934  19.223  42.344 1.00 17.32 ? 357  GLU A CB    1 
ATOM   4296  C  CG    . GLU B 2 356 ? 42.457  19.220  42.268 1.00 18.56 ? 357  GLU A CG    1 
ATOM   4297  C  CD    . GLU B 2 356 ? 43.056  17.803  42.155 1.00 19.52 ? 357  GLU A CD    1 
ATOM   4298  O  OE1   . GLU B 2 356 ? 42.523  16.857  42.773 1.00 17.71 ? 357  GLU A OE1   1 
ATOM   4299  O  OE2   . GLU B 2 356 ? 44.077  17.655  41.432 1.00 21.44 ? 357  GLU A OE2   1 
ATOM   4300  N  N     . HIS B 2 357 ? 37.924  19.216  41.045 1.00 16.15 ? 358  HIS A N     1 
ATOM   4301  C  CA    . HIS B 2 357 ? 36.485  19.093  41.207 1.00 14.43 ? 358  HIS A CA    1 
ATOM   4302  C  C     . HIS B 2 357 ? 35.974  17.987  40.277 1.00 14.03 ? 358  HIS A C     1 
ATOM   4303  O  O     . HIS B 2 357 ? 35.100  17.204  40.659 1.00 14.25 ? 358  HIS A O     1 
ATOM   4304  C  CB    . HIS B 2 357 ? 35.795  20.442  40.961 1.00 13.82 ? 358  HIS A CB    1 
ATOM   4305  C  CG    . HIS B 2 357 ? 34.299  20.381  40.949 1.00 12.93 ? 358  HIS A CG    1 
ATOM   4306  N  ND1   . HIS B 2 357 ? 33.557  19.977  42.042 1.00 13.06 ? 358  HIS A ND1   1 
ATOM   4307  C  CD2   . HIS B 2 357 ? 33.403  20.713  39.990 1.00 12.74 ? 358  HIS A CD2   1 
ATOM   4308  C  CE1   . HIS B 2 357 ? 32.272  20.034  41.747 1.00 12.80 ? 358  HIS A CE1   1 
ATOM   4309  N  NE2   . HIS B 2 357 ? 32.149  20.480  40.508 1.00 12.83 ? 358  HIS A NE2   1 
ATOM   4310  N  N     . GLN B 2 358 ? 36.547  17.911  39.080 1.00 13.82 ? 359  GLN A N     1 
ATOM   4311  C  CA    . GLN B 2 358 ? 36.174  16.879  38.104 1.00 14.80 ? 359  GLN A CA    1 
ATOM   4312  C  C     . GLN B 2 358 ? 36.629  15.479  38.520 1.00 15.84 ? 359  GLN A C     1 
ATOM   4313  O  O     . GLN B 2 358 ? 35.932  14.492  38.275 1.00 16.04 ? 359  GLN A O     1 
ATOM   4314  C  CB    . GLN B 2 358 ? 36.690  17.231  36.700 1.00 14.11 ? 359  GLN A CB    1 
ATOM   4315  C  CG    . GLN B 2 358 ? 36.052  18.472  36.121 1.00 13.43 ? 359  GLN A CG    1 
ATOM   4316  C  CD    . GLN B 2 358 ? 34.531  18.347  36.038 1.00 13.37 ? 359  GLN A CD    1 
ATOM   4317  O  OE1   . GLN B 2 358 ? 33.998  17.586  35.225 1.00 13.38 ? 359  GLN A OE1   1 
ATOM   4318  N  NE2   . GLN B 2 358 ? 33.831  19.099  36.876 1.00 12.72 ? 359  GLN A NE2   1 
ATOM   4319  N  N     . LYS B 2 359 ? 37.796  15.405  39.152 1.00 16.81 ? 360  LYS A N     1 
ATOM   4320  C  CA    . LYS B 2 359 ? 38.331  14.140  39.641 1.00 18.15 ? 360  LYS A CA    1 
ATOM   4321  C  C     . LYS B 2 359 ? 37.454  13.600  40.774 1.00 19.43 ? 360  LYS A C     1 
ATOM   4322  O  O     . LYS B 2 359 ? 37.185  12.393  40.851 1.00 21.48 ? 360  LYS A O     1 
ATOM   4323  C  CB    . LYS B 2 359 ? 39.796  14.308  40.067 1.00 19.62 ? 360  LYS A CB    1 
ATOM   4324  C  CG    . LYS B 2 359 ? 40.742  14.577  38.879 1.00 20.66 ? 360  LYS A CG    1 
ATOM   4325  C  CD    . LYS B 2 359 ? 42.106  15.138  39.294 1.00 22.27 ? 360  LYS A CD    1 
ATOM   4326  C  CE    . LYS B 2 359 ? 42.937  14.142  40.078 1.00 24.29 ? 360  LYS A CE    1 
ATOM   4327  N  NZ    . LYS B 2 359 ? 44.214  14.763  40.516 1.00 28.29 ? 360  LYS A NZ    1 
ATOM   4328  N  N     . THR B 2 360 ? 36.984  14.510  41.625 1.00 18.72 ? 361  THR A N     1 
ATOM   4329  C  CA    . THR B 2 360 ? 36.112  14.177  42.749 1.00 19.26 ? 361  THR A CA    1 
ATOM   4330  C  C     . THR B 2 360 ? 34.700  13.753  42.295 1.00 20.24 ? 361  THR A C     1 
ATOM   4331  O  O     . THR B 2 360 ? 34.160  12.756  42.791 1.00 20.77 ? 361  THR A O     1 
ATOM   4332  C  CB    . THR B 2 360 ? 36.049  15.351  43.752 1.00 19.01 ? 361  THR A CB    1 
ATOM   4333  O  OG1   . THR B 2 360 ? 37.386  15.619  44.229 1.00 18.50 ? 361  THR A OG1   1 
ATOM   4334  C  CG2   . THR B 2 360 ? 35.134  15.038  44.939 1.00 16.41 ? 361  THR A CG2   1 
ATOM   4335  N  N     . VAL B 2 361 ? 34.118  14.499  41.356 1.00 18.93 ? 362  VAL A N     1 
ATOM   4336  C  CA    . VAL B 2 361 ? 32.786  14.199  40.823 1.00 18.69 ? 362  VAL A CA    1 
ATOM   4337  C  C     . VAL B 2 361 ? 32.716  12.809  40.199 1.00 19.21 ? 362  VAL A C     1 
ATOM   4338  O  O     . VAL B 2 361 ? 31.866  12.000  40.574 1.00 18.81 ? 362  VAL A O     1 
ATOM   4339  C  CB    . VAL B 2 361 ? 32.314  15.279  39.794 1.00 19.41 ? 362  VAL A CB    1 
ATOM   4340  C  CG1   . VAL B 2 361 ? 31.163  14.760  38.921 1.00 17.83 ? 362  VAL A CG1   1 
ATOM   4341  C  CG2   . VAL B 2 361 ? 31.920  16.581  40.516 1.00 19.10 ? 362  VAL A CG2   1 
ATOM   4342  N  N     . VAL B 2 362 ? 33.621  12.541  39.253 1.00 20.06 ? 363  VAL A N     1 
ATOM   4343  C  CA    . VAL B 2 362 ? 33.686  11.256  38.546 1.00 18.81 ? 363  VAL A CA    1 
ATOM   4344  C  C     . VAL B 2 362 ? 33.968  10.084  39.503 1.00 19.44 ? 363  VAL A C     1 
ATOM   4345  O  O     . VAL B 2 362 ? 33.445  8.984   39.306 1.00 19.77 ? 363  VAL A O     1 
ATOM   4346  C  CB    . VAL B 2 362 ? 34.710  11.306  37.374 1.00 19.76 ? 363  VAL A CB    1 
ATOM   4347  C  CG1   . VAL B 2 362 ? 34.823  9.955   36.659 1.00 18.23 ? 363  VAL A CG1   1 
ATOM   4348  C  CG2   . VAL B 2 362 ? 34.316  12.390  36.375 1.00 19.25 ? 363  VAL A CG2   1 
ATOM   4349  N  N     . ARG B 2 363 ? 34.778  10.320  40.539 1.00 19.70 ? 364  ARG A N     1 
ATOM   4350  C  CA    . ARG B 2 363 ? 35.064  9.282   41.534 1.00 19.43 ? 364  ARG A CA    1 
ATOM   4351  C  C     . ARG B 2 363 ? 33.822  8.968   42.357 1.00 18.23 ? 364  ARG A C     1 
ATOM   4352  O  O     . ARG B 2 363 ? 33.469  7.800   42.537 1.00 17.94 ? 364  ARG A O     1 
ATOM   4353  C  CB    . ARG B 2 363 ? 36.196  9.689   42.477 1.00 21.23 ? 364  ARG A CB    1 
ATOM   4354  C  CG    . ARG B 2 363 ? 36.446  8.655   43.580 1.00 24.31 ? 364  ARG A CG    1 
ATOM   4355  C  CD    . ARG B 2 363 ? 37.433  9.126   44.641 1.00 27.80 ? 364  ARG A CD    1 
ATOM   4356  N  NE    . ARG B 2 363 ? 38.731  9.461   44.062 1.00 31.41 ? 364  ARG A NE    1 
ATOM   4357  C  CZ    . ARG B 2 363 ? 39.674  8.572   43.753 1.00 33.88 ? 364  ARG A CZ    1 
ATOM   4358  N  NH1   . ARG B 2 363 ? 39.486  7.269   43.947 1.00 34.27 ? 364  ARG A NH1   1 
ATOM   4359  N  NH2   . ARG B 2 363 ? 40.814  8.996   43.234 1.00 37.73 ? 364  ARG A NH2   1 
ATOM   4360  N  N     . ARG B 2 364 ? 33.178  10.017  42.871 1.00 17.67 ? 365  ARG A N     1 
ATOM   4361  C  CA    . ARG B 2 364 ? 31.970  9.866   43.676 1.00 17.29 ? 365  ARG A CA    1 
ATOM   4362  C  C     . ARG B 2 364 ? 30.852  9.228   42.856 1.00 16.78 ? 365  ARG A C     1 
ATOM   4363  O  O     . ARG B 2 364 ? 30.003  8.530   43.404 1.00 18.40 ? 365  ARG A O     1 
ATOM   4364  C  CB    . ARG B 2 364 ? 31.535  11.200  44.294 1.00 17.92 ? 365  ARG A CB    1 
ATOM   4365  C  CG    . ARG B 2 364 ? 32.436  11.656  45.451 1.00 18.18 ? 365  ARG A CG    1 
ATOM   4366  C  CD    . ARG B 2 364 ? 32.058  13.042  46.033 1.00 15.29 ? 365  ARG A CD    1 
ATOM   4367  N  NE    . ARG B 2 364 ? 30.707  13.075  46.586 1.00 15.03 ? 365  ARG A NE    1 
ATOM   4368  C  CZ    . ARG B 2 364 ? 30.234  14.010  47.412 1.00 13.60 ? 365  ARG A CZ    1 
ATOM   4369  N  NH1   . ARG B 2 364 ? 31.001  15.012  47.838 1.00 12.56 ? 365  ARG A NH1   1 
ATOM   4370  N  NH2   . ARG B 2 364 ? 28.985  13.922  47.839 1.00 12.84 ? 365  ARG A NH2   1 
ATOM   4371  N  N     . ARG B 2 365 ? 30.882  9.444   41.543 1.00 16.06 ? 366  ARG A N     1 
ATOM   4372  C  CA    . ARG B 2 365 ? 29.906  8.848   40.638 1.00 15.90 ? 366  ARG A CA    1 
ATOM   4373  C  C     . ARG B 2 365 ? 30.123  7.340   40.538 1.00 15.99 ? 366  ARG A C     1 
ATOM   4374  O  O     . ARG B 2 365 ? 29.171  6.565   40.613 1.00 16.65 ? 366  ARG A O     1 
ATOM   4375  C  CB    . ARG B 2 365 ? 30.006  9.470   39.249 1.00 14.46 ? 366  ARG A CB    1 
ATOM   4376  C  CG    . ARG B 2 365 ? 28.889  9.050   38.301 1.00 13.88 ? 366  ARG A CG    1 
ATOM   4377  C  CD    . ARG B 2 365 ? 29.181  9.526   36.902 1.00 14.09 ? 366  ARG A CD    1 
ATOM   4378  N  NE    . ARG B 2 365 ? 30.278  8.793   36.306 1.00 14.73 ? 366  ARG A NE    1 
ATOM   4379  C  CZ    . ARG B 2 365 ? 30.933  9.172   35.201 1.00 16.98 ? 366  ARG A CZ    1 
ATOM   4380  N  NH1   . ARG B 2 365 ? 30.604  10.295  34.576 1.00 17.23 ? 366  ARG A NH1   1 
ATOM   4381  N  NH2   . ARG B 2 365 ? 31.940  8.429   34.739 1.00 16.55 ? 366  ARG A NH2   1 
ATOM   4382  N  N     . THR B 2 366 ? 31.378  6.935   40.364 1.00 16.30 ? 367  THR A N     1 
ATOM   4383  C  CA    . THR B 2 366 ? 31.725  5.522   40.241 1.00 16.06 ? 367  THR A CA    1 
ATOM   4384  C  C     . THR B 2 366 ? 31.429  4.773   41.546 1.00 16.57 ? 367  THR A C     1 
ATOM   4385  O  O     . THR B 2 366 ? 30.959  3.631   41.508 1.00 16.45 ? 367  THR A O     1 
ATOM   4386  C  CB    . THR B 2 366 ? 33.191  5.346   39.825 1.00 15.55 ? 367  THR A CB    1 
ATOM   4387  O  OG1   . THR B 2 366 ? 33.418  6.087   38.622 1.00 15.75 ? 367  THR A OG1   1 
ATOM   4388  C  CG2   . THR B 2 366 ? 33.522  3.873   39.572 1.00 16.01 ? 367  THR A CG2   1 
ATOM   4389  N  N     . GLN B 2 367 ? 31.688  5.423   42.679 1.00 16.59 ? 368  GLN A N     1 
ATOM   4390  C  CA    . GLN B 2 367 ? 31.406  4.842   43.990 1.00 17.72 ? 368  GLN A CA    1 
ATOM   4391  C  C     . GLN B 2 367 ? 29.902  4.639   44.194 1.00 18.23 ? 368  GLN A C     1 
ATOM   4392  O  O     . GLN B 2 367 ? 29.479  3.626   44.753 1.00 18.30 ? 368  GLN A O     1 
ATOM   4393  C  CB    . GLN B 2 367 ? 32.000  5.703   45.118 1.00 18.31 ? 368  GLN A CB    1 
ATOM   4394  C  CG    . GLN B 2 367 ? 33.520  5.653   45.195 1.00 18.87 ? 368  GLN A CG    1 
ATOM   4395  C  CD    . GLN B 2 367 ? 34.135  6.655   46.171 1.00 19.34 ? 368  GLN A CD    1 
ATOM   4396  O  OE1   . GLN B 2 367 ? 35.278  6.478   46.609 1.00 19.81 ? 368  GLN A OE1   1 
ATOM   4397  N  NE2   . GLN B 2 367 ? 33.393  7.707   46.509 1.00 18.33 ? 368  GLN A NE2   1 
ATOM   4398  N  N     . TYR B 2 368 ? 29.106  5.604   43.728 1.00 18.74 ? 369  TYR A N     1 
ATOM   4399  C  CA    . TYR B 2 368 ? 27.648  5.542   43.825 1.00 18.38 ? 369  TYR A CA    1 
ATOM   4400  C  C     . TYR B 2 368 ? 27.091  4.375   43.001 1.00 19.41 ? 369  TYR A C     1 
ATOM   4401  O  O     . TYR B 2 368 ? 26.282  3.586   43.500 1.00 20.10 ? 369  TYR A O     1 
ATOM   4402  C  CB    . TYR B 2 368 ? 27.026  6.863   43.365 1.00 17.52 ? 369  TYR A CB    1 
ATOM   4403  C  CG    . TYR B 2 368 ? 25.512  6.836   43.238 1.00 16.92 ? 369  TYR A CG    1 
ATOM   4404  C  CD1   . TYR B 2 368 ? 24.898  6.455   42.041 1.00 17.08 ? 369  TYR A CD1   1 
ATOM   4405  C  CD2   . TYR B 2 368 ? 24.694  7.191   44.315 1.00 15.47 ? 369  TYR A CD2   1 
ATOM   4406  C  CE1   . TYR B 2 368 ? 23.509  6.421   41.922 1.00 17.88 ? 369  TYR A CE1   1 
ATOM   4407  C  CE2   . TYR B 2 368 ? 23.312  7.160   44.205 1.00 15.28 ? 369  TYR A CE2   1 
ATOM   4408  C  CZ    . TYR B 2 368 ? 22.724  6.784   43.021 1.00 16.61 ? 369  TYR A CZ    1 
ATOM   4409  O  OH    . TYR B 2 368 ? 21.351  6.758   42.889 1.00 19.49 ? 369  TYR A OH    1 
ATOM   4410  N  N     . ASN B 2 369 ? 27.516  4.288   41.739 1.00 18.97 ? 370  ASN A N     1 
ATOM   4411  C  CA    . ASN B 2 369 ? 27.100  3.215   40.841 1.00 19.04 ? 370  ASN A CA    1 
ATOM   4412  C  C     . ASN B 2 369 ? 27.495  1.852   41.377 1.00 19.62 ? 370  ASN A C     1 
ATOM   4413  O  O     . ASN B 2 369 ? 26.803  0.870   41.135 1.00 21.64 ? 370  ASN A O     1 
ATOM   4414  C  CB    . ASN B 2 369 ? 27.695  3.403   39.444 1.00 19.63 ? 370  ASN A CB    1 
ATOM   4415  C  CG    . ASN B 2 369 ? 27.088  4.567   38.695 1.00 18.84 ? 370  ASN A CG    1 
ATOM   4416  O  OD1   . ASN B 2 369 ? 25.882  4.820   38.790 1.00 20.00 ? 370  ASN A OD1   1 
ATOM   4417  N  ND2   . ASN B 2 369 ? 27.915  5.266   37.920 1.00 18.38 ? 370  ASN A ND2   1 
ATOM   4418  N  N     . LEU B 2 370 ? 28.605  1.801   42.107 1.00 19.22 ? 371  LEU A N     1 
ATOM   4419  C  CA    . LEU B 2 370 ? 29.075  0.554   42.691 1.00 19.67 ? 371  LEU A CA    1 
ATOM   4420  C  C     . LEU B 2 370 ? 28.155  0.090   43.826 1.00 21.03 ? 371  LEU A C     1 
ATOM   4421  O  O     . LEU B 2 370 ? 27.814  -1.093  43.890 1.00 24.55 ? 371  LEU A O     1 
ATOM   4422  C  CB    . LEU B 2 370 ? 30.533  0.678   43.152 1.00 17.71 ? 371  LEU A CB    1 
ATOM   4423  C  CG    . LEU B 2 370 ? 31.235  -0.586  43.671 1.00 16.56 ? 371  LEU A CG    1 
ATOM   4424  C  CD1   . LEU B 2 370 ? 31.274  -1.657  42.608 1.00 16.42 ? 371  LEU A CD1   1 
ATOM   4425  C  CD2   . LEU B 2 370 ? 32.637  -0.267  44.160 1.00 15.30 ? 371  LEU A CD2   1 
ATOM   4426  N  N     . ARG B 2 371 ? 27.746  1.014   44.699 1.00 21.20 ? 372  ARG A N     1 
ATOM   4427  C  CA    . ARG B 2 371 ? 26.829  0.688   45.811 1.00 20.44 ? 372  ARG A CA    1 
ATOM   4428  C  C     . ARG B 2 371 ? 25.489  0.245   45.237 1.00 20.50 ? 372  ARG A C     1 
ATOM   4429  O  O     . ARG B 2 371 ? 24.959  -0.800  45.614 1.00 22.30 ? 372  ARG A O     1 
ATOM   4430  C  CB    . ARG B 2 371 ? 26.602  1.879   46.747 1.00 20.07 ? 372  ARG A CB    1 
ATOM   4431  C  CG    . ARG B 2 371 ? 27.854  2.473   47.393 1.00 21.34 ? 372  ARG A CG    1 
ATOM   4432  C  CD    . ARG B 2 371 ? 27.507  3.463   48.532 1.00 20.34 ? 372  ARG A CD    1 
ATOM   4433  N  NE    . ARG B 2 371 ? 26.655  4.575   48.120 1.00 18.64 ? 372  ARG A NE    1 
ATOM   4434  C  CZ    . ARG B 2 371 ? 27.109  5.746   47.641 1.00 18.37 ? 372  ARG A CZ    1 
ATOM   4435  N  NH1   . ARG B 2 371 ? 28.416  5.978   47.504 1.00 15.85 ? 372  ARG A NH1   1 
ATOM   4436  N  NH2   . ARG B 2 371 ? 26.236  6.697   47.301 1.00 16.52 ? 372  ARG A NH2   1 
ATOM   4437  N  N     . LYS B 2 372 ? 24.964  1.054   44.317 1.00 20.24 ? 373  LYS A N     1 
ATOM   4438  C  CA    . LYS B 2 372 ? 23.694  0.795   43.634 1.00 21.61 ? 373  LYS A CA    1 
ATOM   4439  C  C     . LYS B 2 372 ? 23.665  -0.580  42.946 1.00 19.33 ? 373  LYS A C     1 
ATOM   4440  O  O     . LYS B 2 372 ? 22.655  -1.276  43.004 1.00 18.06 ? 373  LYS A O     1 
ATOM   4441  C  CB    . LYS B 2 372 ? 23.389  1.923   42.629 1.00 22.71 ? 373  LYS A CB    1 
ATOM   4442  C  CG    . LYS B 2 372 ? 22.102  1.751   41.833 1.00 25.84 ? 373  LYS A CG    1 
ATOM   4443  C  CD    . LYS B 2 372 ? 21.995  2.797   40.723 1.00 27.69 ? 373  LYS A CD    1 
ATOM   4444  C  CE    . LYS B 2 372 ? 20.855  2.498   39.751 1.00 29.05 ? 373  LYS A CE    1 
ATOM   4445  N  NZ    . LYS B 2 372 ? 19.540  2.612   40.458 1.00 32.42 ? 373  LYS A NZ    1 
ATOM   4446  N  N     . ALA B 2 373 ? 24.777  -0.961  42.330 1.00 18.87 ? 374  ALA A N     1 
ATOM   4447  C  CA    . ALA B 2 373 ? 24.899  -2.245  41.647 1.00 17.19 ? 374  ALA A CA    1 
ATOM   4448  C  C     . ALA B 2 373 ? 24.943  -3.419  42.623 1.00 17.98 ? 374  ALA A C     1 
ATOM   4449  O  O     . ALA B 2 373 ? 24.292  -4.426  42.409 1.00 16.06 ? 374  ALA A O     1 
ATOM   4450  C  CB    . ALA B 2 373 ? 26.120  -2.252  40.753 1.00 16.55 ? 374  ALA A CB    1 
ATOM   4451  N  N     . LYS B 2 374 ? 25.720  -3.285  43.691 1.00 19.29 ? 375  LYS A N     1 
ATOM   4452  C  CA    . LYS B 2 374 ? 25.820  -4.332  44.714 1.00 19.38 ? 375  LYS A CA    1 
ATOM   4453  C  C     . LYS B 2 374 ? 24.470  -4.568  45.385 1.00 19.31 ? 375  LYS A C     1 
ATOM   4454  O  O     . LYS B 2 374 ? 24.102  -5.710  45.677 1.00 16.48 ? 375  LYS A O     1 
ATOM   4455  C  CB    . LYS B 2 374 ? 26.895  -4.008  45.758 1.00 20.39 ? 375  LYS A CB    1 
ATOM   4456  C  CG    . LYS B 2 374 ? 28.324  -4.135  45.245 1.00 21.04 ? 375  LYS A CG    1 
ATOM   4457  C  CD    . LYS B 2 374 ? 29.311  -3.916  46.378 1.00 22.58 ? 375  LYS A CD    1 
ATOM   4458  C  CE    . LYS B 2 374 ? 30.744  -4.129  45.911 1.00 25.30 ? 375  LYS A CE    1 
ATOM   4459  N  NZ    . LYS B 2 374 ? 31.715  -3.885  47.024 1.00 26.31 ? 375  LYS A NZ    1 
ATOM   4460  N  N     . ASP B 2 375 ? 23.737  -3.480  45.620 1.00 20.50 ? 376  ASP A N     1 
ATOM   4461  C  CA    . ASP B 2 375 ? 22.390  -3.560  46.183 1.00 19.87 ? 376  ASP A CA    1 
ATOM   4462  C  C     . ASP B 2 375 ? 21.489  -4.310  45.207 1.00 17.79 ? 376  ASP A C     1 
ATOM   4463  O  O     . ASP B 2 375 ? 20.701  -5.160  45.615 1.00 17.39 ? 376  ASP A O     1 
ATOM   4464  C  CB    . ASP B 2 375 ? 21.829  -2.163  46.477 1.00 21.84 ? 376  ASP A CB    1 
ATOM   4465  C  CG    . ASP B 2 375 ? 22.502  -1.489  47.674 1.00 24.48 ? 376  ASP A CG    1 
ATOM   4466  O  OD1   . ASP B 2 375 ? 23.138  -2.187  48.493 1.00 27.11 ? 376  ASP A OD1   1 
ATOM   4467  O  OD2   . ASP B 2 375 ? 22.391  -0.255  47.806 1.00 24.55 ? 376  ASP A OD2   1 
ATOM   4468  N  N     . ARG B 2 376 ? 21.630  -4.025  43.919 1.00 15.98 ? 377  ARG A N     1 
ATOM   4469  C  CA    . ARG B 2 376 ? 20.825  -4.680  42.902 1.00 15.79 ? 377  ARG A CA    1 
ATOM   4470  C  C     . ARG B 2 376 ? 21.136  -6.176  42.756 1.00 16.45 ? 377  ARG A C     1 
ATOM   4471  O  O     . ARG B 2 376 ? 20.235  -6.976  42.574 1.00 15.41 ? 377  ARG A O     1 
ATOM   4472  C  CB    . ARG B 2 376 ? 20.962  -3.964  41.568 1.00 14.69 ? 377  ARG A CB    1 
ATOM   4473  C  CG    . ARG B 2 376 ? 20.057  -4.512  40.479 1.00 14.53 ? 377  ARG A CG    1 
ATOM   4474  C  CD    . ARG B 2 376 ? 18.603  -4.558  40.915 1.00 13.10 ? 377  ARG A CD    1 
ATOM   4475  N  NE    . ARG B 2 376 ? 17.770  -5.142  39.878 1.00 12.83 ? 377  ARG A NE    1 
ATOM   4476  C  CZ    . ARG B 2 376 ? 16.491  -5.477  40.039 1.00 12.22 ? 377  ARG A CZ    1 
ATOM   4477  N  NH1   . ARG B 2 376 ? 15.884  -5.276  41.216 1.00 11.73 ? 377  ARG A NH1   1 
ATOM   4478  N  NH2   . ARG B 2 376 ? 15.821  -6.009  39.035 1.00 10.93 ? 377  ARG A NH2   1 
ATOM   4479  N  N     . ALA B 2 377 ? 22.412  -6.533  42.845 1.00 17.27 ? 378  ALA A N     1 
ATOM   4480  C  CA    . ALA B 2 377 ? 22.841  -7.915  42.748 1.00 17.58 ? 378  ALA A CA    1 
ATOM   4481  C  C     . ALA B 2 377 ? 22.325  -8.707  43.948 1.00 18.70 ? 378  ALA A C     1 
ATOM   4482  O  O     . ALA B 2 377 ? 21.953  -9.863  43.822 1.00 21.09 ? 378  ALA A O     1 
ATOM   4483  C  CB    . ALA B 2 377 ? 24.352  -7.996  42.670 1.00 17.71 ? 378  ALA A CB    1 
ATOM   4484  N  N     . HIS B 2 378 ? 22.308  -8.062  45.103 1.00 18.17 ? 379  HIS A N     1 
ATOM   4485  C  CA    . HIS B 2 378 ? 21.795  -8.654  46.331 1.00 18.71 ? 379  HIS A CA    1 
ATOM   4486  C  C     . HIS B 2 378 ? 20.302  -8.978  46.221 1.00 19.32 ? 379  HIS A C     1 
ATOM   4487  O  O     . HIS B 2 378 ? 19.860  -10.050 46.647 1.00 20.48 ? 379  HIS A O     1 
ATOM   4488  C  CB    . HIS B 2 378 ? 22.057  -7.711  47.512 1.00 19.46 ? 379  HIS A CB    1 
ATOM   4489  C  CG    . HIS B 2 378 ? 21.550  -8.223  48.822 1.00 20.51 ? 379  HIS A CG    1 
ATOM   4490  N  ND1   . HIS B 2 378 ? 22.267  -9.113  49.603 1.00 20.80 ? 379  HIS A ND1   1 
ATOM   4491  C  CD2   . HIS B 2 378 ? 20.400  -7.964  49.494 1.00 20.28 ? 379  HIS A CD2   1 
ATOM   4492  C  CE1   . HIS B 2 378 ? 21.575  -9.372  50.706 1.00 19.57 ? 379  HIS A CE1   1 
ATOM   4493  N  NE2   . HIS B 2 378 ? 20.441  -8.693  50.661 1.00 19.02 ? 379  HIS A NE2   1 
ATOM   4494  N  N     . ILE B 2 379 ? 19.529  -8.052  45.660 1.00 18.24 ? 380  ILE A N     1 
ATOM   4495  C  CA    . ILE B 2 379 ? 18.094  -8.266  45.470 1.00 16.99 ? 380  ILE A CA    1 
ATOM   4496  C  C     . ILE B 2 379 ? 17.853  -9.412  44.489 1.00 18.06 ? 380  ILE A C     1 
ATOM   4497  O  O     . ILE B 2 379 ? 17.031  -10.297 44.745 1.00 20.67 ? 380  ILE A O     1 
ATOM   4498  C  CB    . ILE B 2 379 ? 17.369  -6.962  45.004 1.00 16.85 ? 380  ILE A CB    1 
ATOM   4499  C  CG1   . ILE B 2 379 ? 17.358  -5.899  46.121 1.00 15.03 ? 380  ILE A CG1   1 
ATOM   4500  C  CG2   . ILE B 2 379 ? 15.948  -7.254  44.490 1.00 15.26 ? 380  ILE A CG2   1 
ATOM   4501  C  CD1   . ILE B 2 379 ? 16.584  -6.288  47.370 1.00 15.42 ? 380  ILE A CD1   1 
ATOM   4502  N  N     . LEU B 2 380 ? 18.585  -9.412  43.379 1.00 17.37 ? 381  LEU A N     1 
ATOM   4503  C  CA    . LEU B 2 380 ? 18.455  -10.448 42.360 1.00 16.79 ? 381  LEU A CA    1 
ATOM   4504  C  C     . LEU B 2 380 ? 18.733  -11.854 42.881 1.00 17.20 ? 381  LEU A C     1 
ATOM   4505  O  O     . LEU B 2 380 ? 18.169  -12.818 42.396 1.00 17.14 ? 381  LEU A O     1 
ATOM   4506  C  CB    . LEU B 2 380 ? 19.330  -10.129 41.153 1.00 16.22 ? 381  LEU A CB    1 
ATOM   4507  C  CG    . LEU B 2 380 ? 18.856  -8.944  40.311 1.00 15.50 ? 381  LEU A CG    1 
ATOM   4508  C  CD1   . LEU B 2 380 ? 19.814  -8.693  39.162 1.00 15.36 ? 381  LEU A CD1   1 
ATOM   4509  C  CD2   . LEU B 2 380 ? 17.436  -9.155  39.809 1.00 14.57 ? 381  LEU A CD2   1 
ATOM   4510  N  N     . GLU B 2 381 ? 19.605  -11.956 43.874 1.00 17.52 ? 382  GLU A N     1 
ATOM   4511  C  CA    . GLU B 2 381 ? 19.917  -13.238 44.510 1.00 17.65 ? 382  GLU A CA    1 
ATOM   4512  C  C     . GLU B 2 381 ? 18.714  -13.747 45.293 1.00 18.07 ? 382  GLU A C     1 
ATOM   4513  O  O     . GLU B 2 381 ? 18.451  -14.945 45.324 1.00 19.10 ? 382  GLU A O     1 
ATOM   4514  C  CB    . GLU B 2 381 ? 21.141  -13.103 45.416 1.00 17.70 ? 382  GLU A CB    1 
ATOM   4515  C  CG    . GLU B 2 381 ? 22.431  -12.943 44.635 1.00 18.13 ? 382  GLU A CG    1 
ATOM   4516  C  CD    . GLU B 2 381 ? 23.588  -12.460 45.485 1.00 19.60 ? 382  GLU A CD    1 
ATOM   4517  O  OE1   . GLU B 2 381 ? 23.425  -12.317 46.723 1.00 18.27 ? 382  GLU A OE1   1 
ATOM   4518  O  OE2   . GLU B 2 381 ? 24.674  -12.206 44.904 1.00 19.56 ? 382  GLU A OE2   1 
ATOM   4519  N  N     . GLY B 2 382 ? 17.983  -12.818 45.907 1.00 18.88 ? 383  GLY A N     1 
ATOM   4520  C  CA    . GLY B 2 382 ? 16.768  -13.128 46.658 1.00 17.03 ? 383  GLY A CA    1 
ATOM   4521  C  C     . GLY B 2 382 ? 15.612  -13.487 45.742 1.00 17.45 ? 383  GLY A C     1 
ATOM   4522  O  O     . GLY B 2 382 ? 14.740  -14.267 46.118 1.00 17.24 ? 383  GLY A O     1 
ATOM   4523  N  N     . LEU B 2 383 ? 15.597  -12.919 44.537 1.00 17.83 ? 384  LEU A N     1 
ATOM   4524  C  CA    . LEU B 2 383 ? 14.538  -13.225 43.565 1.00 19.52 ? 384  LEU A CA    1 
ATOM   4525  C  C     . LEU B 2 383 ? 14.765  -14.571 42.871 1.00 21.04 ? 384  LEU A C     1 
ATOM   4526  O  O     . LEU B 2 383 ? 13.803  -15.251 42.487 1.00 21.18 ? 384  LEU A O     1 
ATOM   4527  C  CB    . LEU B 2 383 ? 14.388  -12.104 42.530 1.00 19.00 ? 384  LEU A CB    1 
ATOM   4528  C  CG    . LEU B 2 383 ? 14.066  -10.695 43.044 1.00 19.89 ? 384  LEU A CG    1 
ATOM   4529  C  CD1   . LEU B 2 383 ? 13.936  -9.728  41.879 1.00 18.58 ? 384  LEU A CD1   1 
ATOM   4530  C  CD2   . LEU B 2 383 ? 12.796  -10.679 43.891 1.00 18.47 ? 384  LEU A CD2   1 
ATOM   4531  N  N     . ARG B 2 384 ? 16.040  -14.939 42.703 1.00 21.01 ? 385  ARG A N     1 
ATOM   4532  C  CA    . ARG B 2 384 ? 16.424  -16.217 42.095 1.00 21.74 ? 385  ARG A CA    1 
ATOM   4533  C  C     . ARG B 2 384 ? 15.959  -17.369 42.983 1.00 19.47 ? 385  ARG A C     1 
ATOM   4534  O  O     . ARG B 2 384 ? 15.383  -18.348 42.503 1.00 18.64 ? 385  ARG A O     1 
ATOM   4535  C  CB    . ARG B 2 384 ? 17.939  -16.292 41.905 1.00 23.76 ? 385  ARG A CB    1 
ATOM   4536  C  CG    . ARG B 2 384 ? 18.524  -15.187 41.019 1.00 27.82 ? 385  ARG A CG    1 
ATOM   4537  C  CD    . ARG B 2 384 ? 20.046  -15.133 41.136 1.00 28.16 ? 385  ARG A CD    1 
ATOM   4538  N  NE    . ARG B 2 384 ? 20.721  -16.119 40.298 1.00 30.74 ? 385  ARG A NE    1 
ATOM   4539  C  CZ    . ARG B 2 384 ? 21.995  -16.493 40.459 1.00 31.91 ? 385  ARG A CZ    1 
ATOM   4540  N  NH1   . ARG B 2 384 ? 22.727  -16.003 41.462 1.00 30.47 ? 385  ARG A NH1   1 
ATOM   4541  N  NH2   . ARG B 2 384 ? 22.529  -17.385 39.638 1.00 35.52 ? 385  ARG A NH2   1 
ATOM   4542  N  N     . ILE B 2 385 ? 16.203  -17.230 44.286 1.00 18.80 ? 386  ILE A N     1 
ATOM   4543  C  CA    . ILE B 2 385 ? 15.806  -18.224 45.274 1.00 17.88 ? 386  ILE A CA    1 
ATOM   4544  C  C     . ILE B 2 385 ? 14.277  -18.334 45.300 1.00 18.91 ? 386  ILE A C     1 
ATOM   4545  O  O     . ILE B 2 385 ? 13.733  -19.447 45.332 1.00 19.51 ? 386  ILE A O     1 
ATOM   4546  C  CB    . ILE B 2 385 ? 16.385  -17.907 46.683 1.00 16.99 ? 386  ILE A CB    1 
ATOM   4547  C  CG1   . ILE B 2 385 ? 17.913  -17.917 46.641 1.00 17.24 ? 386  ILE A CG1   1 
ATOM   4548  C  CG2   . ILE B 2 385 ? 15.883  -18.918 47.727 1.00 16.31 ? 386  ILE A CG2   1 
ATOM   4549  C  CD1   . ILE B 2 385 ? 18.599  -17.443 47.922 1.00 16.35 ? 386  ILE A CD1   1 
ATOM   4550  N  N     . ALA B 2 386 ? 13.601  -17.184 45.264 1.00 18.16 ? 387  ALA A N     1 
ATOM   4551  C  CA    . ALA B 2 386 ? 12.136  -17.135 45.258 1.00 18.61 ? 387  ALA A CA    1 
ATOM   4552  C  C     . ALA B 2 386 ? 11.519  -17.865 44.061 1.00 18.21 ? 387  ALA A C     1 
ATOM   4553  O  O     . ALA B 2 386 ? 10.641  -18.710 44.238 1.00 19.76 ? 387  ALA A O     1 
ATOM   4554  C  CB    . ALA B 2 386 ? 11.644  -15.690 45.317 1.00 17.98 ? 387  ALA A CB    1 
ATOM   4555  N  N     . LEU B 2 387 ? 11.980  -17.561 42.854 1.00 17.65 ? 388  LEU A N     1 
ATOM   4556  C  CA    . LEU B 2 387 ? 11.445  -18.198 41.652 1.00 19.69 ? 388  LEU A CA    1 
ATOM   4557  C  C     . LEU B 2 387 ? 11.797  -19.676 41.519 1.00 20.47 ? 388  LEU A C     1 
ATOM   4558  O  O     . LEU B 2 387 ? 11.016  -20.442 40.977 1.00 21.32 ? 388  LEU A O     1 
ATOM   4559  C  CB    . LEU B 2 387 ? 11.840  -17.425 40.395 1.00 20.61 ? 388  LEU A CB    1 
ATOM   4560  C  CG    . LEU B 2 387 ? 11.343  -15.981 40.300 1.00 20.82 ? 388  LEU A CG    1 
ATOM   4561  C  CD1   . LEU B 2 387 ? 11.964  -15.267 39.107 1.00 24.03 ? 388  LEU A CD1   1 
ATOM   4562  C  CD2   . LEU B 2 387 ? 9.849   -15.906 40.241 1.00 21.37 ? 388  LEU A CD2   1 
ATOM   4563  N  N     . ASP B 2 388 ? 12.967  -20.077 42.009 1.00 22.49 ? 389  ASP A N     1 
ATOM   4564  C  CA    . ASP B 2 388 ? 13.374  -21.484 41.950 1.00 24.32 ? 389  ASP A CA    1 
ATOM   4565  C  C     . ASP B 2 388 ? 12.547  -22.357 42.885 1.00 26.16 ? 389  ASP A C     1 
ATOM   4566  O  O     . ASP B 2 388 ? 12.351  -23.546 42.614 1.00 26.91 ? 389  ASP A O     1 
ATOM   4567  C  CB    . ASP B 2 388 ? 14.863  -21.661 42.261 1.00 24.76 ? 389  ASP A CB    1 
ATOM   4568  C  CG    . ASP B 2 388 ? 15.767  -21.207 41.116 1.00 27.24 ? 389  ASP A CG    1 
ATOM   4569  O  OD1   . ASP B 2 388 ? 15.272  -21.037 39.973 1.00 24.93 ? 389  ASP A OD1   1 
ATOM   4570  O  OD2   . ASP B 2 388 ? 16.986  -21.034 41.368 1.00 29.60 ? 389  ASP A OD2   1 
ATOM   4571  N  N     . HIS B 2 389 ? 12.075  -21.764 43.978 1.00 23.75 ? 390  HIS A N     1 
ATOM   4572  C  CA    . HIS B 2 389 ? 11.269  -22.447 44.973 1.00 23.81 ? 390  HIS A CA    1 
ATOM   4573  C  C     . HIS B 2 389 ? 9.979   -21.671 45.191 1.00 23.58 ? 390  HIS A C     1 
ATOM   4574  O  O     . HIS B 2 389 ? 9.558   -21.453 46.309 1.00 22.92 ? 390  HIS A O     1 
ATOM   4575  C  CB    . HIS B 2 389 ? 12.021  -22.542 46.303 1.00 24.94 ? 390  HIS A CB    1 
ATOM   4576  C  CG    . HIS B 2 389 ? 13.434  -23.001 46.185 1.00 25.97 ? 390  HIS A CG    1 
ATOM   4577  N  ND1   . HIS B 2 389 ? 13.777  -24.326 46.051 1.00 25.77 ? 390  HIS A ND1   1 
ATOM   4578  C  CD2   . HIS B 2 389 ? 14.596  -22.314 46.228 1.00 26.52 ? 390  HIS A CD2   1 
ATOM   4579  C  CE1   . HIS B 2 389 ? 15.092  -24.436 46.035 1.00 26.99 ? 390  HIS A CE1   1 
ATOM   4580  N  NE2   . HIS B 2 389 ? 15.614  -23.228 46.131 1.00 26.29 ? 390  HIS A NE2   1 
ATOM   4581  N  N     . ILE B 2 390 ? 9.359   -21.245 44.103 1.00 24.23 ? 391  ILE A N     1 
ATOM   4582  C  CA    . ILE B 2 390 ? 8.137   -20.453 44.168 1.00 25.64 ? 391  ILE A CA    1 
ATOM   4583  C  C     . ILE B 2 390 ? 6.958   -21.057 44.947 1.00 26.94 ? 391  ILE A C     1 
ATOM   4584  O  O     . ILE B 2 390 ? 6.280   -20.346 45.677 1.00 27.29 ? 391  ILE A O     1 
ATOM   4585  C  CB    . ILE B 2 390 ? 7.676   -20.011 42.768 1.00 23.96 ? 391  ILE A CB    1 
ATOM   4586  C  CG1   . ILE B 2 390 ? 6.614   -18.921 42.873 1.00 24.13 ? 391  ILE A CG1   1 
ATOM   4587  C  CG2   . ILE B 2 390 ? 7.158   -21.193 41.969 1.00 23.55 ? 391  ILE A CG2   1 
ATOM   4588  C  CD1   . ILE B 2 390 ? 7.102   -17.670 43.569 1.00 24.48 ? 391  ILE A CD1   1 
ATOM   4589  N  N     . ASP B 2 391 ? 6.723   -22.346 44.801 1.00 26.94 ? 392  ASP A N     1 
ATOM   4590  C  CA    . ASP B 2 391 ? 5.632   -22.999 45.476 1.00 28.77 ? 392  ASP A CA    1 
ATOM   4591  C  C     . ASP B 2 391 ? 5.804   -22.949 46.969 1.00 28.97 ? 392  ASP A C     1 
ATOM   4592  O  O     . ASP B 2 391 ? 4.855   -22.740 47.687 1.00 27.36 ? 392  ASP A O     1 
ATOM   4593  C  CB    . ASP B 2 391 ? 5.527   -24.440 45.034 1.00 29.37 ? 392  ASP A CB    1 
ATOM   4594  C  CG    . ASP B 2 391 ? 5.071   -24.561 43.635 1.00 31.09 ? 392  ASP A CG    1 
ATOM   4595  O  OD1   . ASP B 2 391 ? 4.196   -23.761 43.239 1.00 25.54 ? 392  ASP A OD1   1 
ATOM   4596  O  OD2   . ASP B 2 391 ? 5.625   -25.450 42.935 1.00 34.39 ? 392  ASP A OD2   1 
ATOM   4597  N  N     . GLU B 2 392 ? 7.032   -23.153 47.417 1.00 26.11 ? 393  GLU A N     1 
ATOM   4598  C  CA    . GLU B 2 392 ? 7.354   -23.094 48.822 1.00 27.11 ? 393  GLU A CA    1 
ATOM   4599  C  C     . GLU B 2 392 ? 7.160   -21.682 49.360 1.00 27.84 ? 393  GLU A C     1 
ATOM   4600  O  O     . GLU B 2 392 ? 6.652   -21.497 50.453 1.00 29.51 ? 393  GLU A O     1 
ATOM   4601  C  CB    . GLU B 2 392 ? 8.773   -23.570 49.072 1.00 29.78 ? 393  GLU A CB    1 
ATOM   4602  C  CG    . GLU B 2 392 ? 9.056   -24.987 48.590 1.00 35.21 ? 393  GLU A CG    1 
ATOM   4603  C  CD    . GLU B 2 392 ? 9.649   -25.034 47.158 1.00 37.99 ? 393  GLU A CD    1 
ATOM   4604  O  OE1   . GLU B 2 392 ? 8.889   -25.004 46.171 1.00 32.31 ? 393  GLU A OE1   1 
ATOM   4605  O  OE2   . GLU B 2 392 ? 10.876  -25.158 47.037 1.00 40.97 ? 393  GLU A OE2   1 
ATOM   4606  N  N     . ILE B 2 393 ? 7.574   -20.695 48.575 1.00 23.67 ? 394  ILE A N     1 
ATOM   4607  C  CA    . ILE B 2 393 ? 7.450   -19.298 48.946 1.00 21.92 ? 394  ILE A CA    1 
ATOM   4608  C  C     . ILE B 2 393 ? 5.991   -18.885 49.094 1.00 21.97 ? 394  ILE A C     1 
ATOM   4609  O  O     . ILE B 2 393 ? 5.632   -18.207 50.033 1.00 21.86 ? 394  ILE A O     1 
ATOM   4610  C  CB    . ILE B 2 393 ? 8.091   -18.376 47.874 1.00 21.31 ? 394  ILE A CB    1 
ATOM   4611  C  CG1   . ILE B 2 393 ? 9.551   -18.737 47.627 1.00 21.92 ? 394  ILE A CG1   1 
ATOM   4612  C  CG2   . ILE B 2 393 ? 7.972   -16.919 48.257 1.00 21.03 ? 394  ILE A CG2   1 
ATOM   4613  C  CD1   . ILE B 2 393 ? 10.525  -18.146 48.609 1.00 21.03 ? 394  ILE A CD1   1 
ATOM   4614  N  N     . ILE B 2 394 ? 5.166   -19.293 48.153 1.00 21.00 ? 395  ILE A N     1 
ATOM   4615  C  CA    . ILE B 2 394 ? 3.761   -18.975 48.167 1.00 23.79 ? 395  ILE A CA    1 
ATOM   4616  C  C     . ILE B 2 394 ? 2.995   -19.579 49.347 1.00 25.08 ? 395  ILE A C     1 
ATOM   4617  O  O     . ILE B 2 394 ? 2.156   -18.921 49.922 1.00 26.05 ? 395  ILE A O     1 
ATOM   4618  C  CB    . ILE B 2 394 ? 3.089   -19.397 46.856 1.00 23.61 ? 395  ILE A CB    1 
ATOM   4619  C  CG1   . ILE B 2 394 ? 3.864   -18.840 45.674 1.00 25.49 ? 395  ILE A CG1   1 
ATOM   4620  C  CG2   . ILE B 2 394 ? 1.656   -18.936 46.818 1.00 22.37 ? 395  ILE A CG2   1 
ATOM   4621  C  CD1   . ILE B 2 394 ? 3.565   -17.406 45.345 1.00 27.31 ? 395  ILE A CD1   1 
ATOM   4622  N  N     . SER B 2 395 ? 3.290   -20.814 49.715 1.00 23.64 ? 396  SER A N     1 
ATOM   4623  C  CA    . SER B 2 395 ? 2.603   -21.418 50.838 1.00 24.52 ? 396  SER A CA    1 
ATOM   4624  C  C     . SER B 2 395 ? 3.005   -20.751 52.140 1.00 25.47 ? 396  SER A C     1 
ATOM   4625  O  O     . SER B 2 395 ? 2.209   -20.593 53.031 1.00 28.22 ? 396  SER A O     1 
ATOM   4626  C  CB    . SER B 2 395 ? 2.786   -22.934 50.872 1.00 24.98 ? 396  SER A CB    1 
ATOM   4627  O  OG    . SER B 2 395 ? 4.131   -23.324 50.814 1.00 30.00 ? 396  SER A OG    1 
ATOM   4628  N  N     . THR B 2 396 ? 4.260   -20.349 52.216 1.00 26.60 ? 397  THR A N     1 
ATOM   4629  C  CA    . THR B 2 396 ? 4.792   -19.648 53.370 1.00 27.29 ? 397  THR A CA    1 
ATOM   4630  C  C     . THR B 2 396 ? 4.102   -18.311 53.596 1.00 27.21 ? 397  THR A C     1 
ATOM   4631  O  O     . THR B 2 396 ? 3.922   -17.898 54.723 1.00 30.01 ? 397  THR A O     1 
ATOM   4632  C  CB    . THR B 2 396 ? 6.303   -19.389 53.219 1.00 27.37 ? 397  THR A CB    1 
ATOM   4633  O  OG1   . THR B 2 396 ? 7.002   -20.621 53.052 1.00 25.95 ? 397  THR A OG1   1 
ATOM   4634  C  CG2   . THR B 2 396 ? 6.838   -18.681 54.421 1.00 26.22 ? 397  THR A CG2   1 
ATOM   4635  N  N     . ILE B 2 397 ? 3.728   -17.633 52.521 1.00 25.10 ? 398  ILE A N     1 
ATOM   4636  C  CA    . ILE B 2 397 ? 3.050   -16.347 52.627 1.00 24.72 ? 398  ILE A CA    1 
ATOM   4637  C  C     . ILE B 2 397 ? 1.589   -16.537 53.044 1.00 24.38 ? 398  ILE A C     1 
ATOM   4638  O  O     . ILE B 2 397 ? 1.108   -15.854 53.955 1.00 24.51 ? 398  ILE A O     1 
ATOM   4639  C  CB    . ILE B 2 397 ? 3.150   -15.542 51.306 1.00 24.41 ? 398  ILE A CB    1 
ATOM   4640  C  CG1   . ILE B 2 397 ? 4.625   -15.283 50.954 1.00 22.82 ? 398  ILE A CG1   1 
ATOM   4641  C  CG2   . ILE B 2 397 ? 2.366   -14.232 51.410 1.00 22.69 ? 398  ILE A CG2   1 
ATOM   4642  C  CD1   . ILE B 2 397 ? 4.861   -14.652 49.582 1.00 22.19 ? 398  ILE A CD1   1 
ATOM   4643  N  N     . ARG B 2 398 ? 0.906   -17.474 52.383 1.00 24.72 ? 399  ARG A N     1 
ATOM   4644  C  CA    . ARG B 2 398 ? -0.506  -17.782 52.645 1.00 25.14 ? 399  ARG A CA    1 
ATOM   4645  C  C     . ARG B 2 398 ? -0.780  -18.190 54.091 1.00 26.61 ? 399  ARG A C     1 
ATOM   4646  O  O     . ARG B 2 398 ? -1.774  -17.758 54.677 1.00 28.25 ? 399  ARG A O     1 
ATOM   4647  C  CB    . ARG B 2 398 ? -1.006  -18.886 51.708 1.00 26.02 ? 399  ARG A CB    1 
ATOM   4648  C  CG    . ARG B 2 398 ? -1.053  -18.505 50.233 1.00 29.07 ? 399  ARG A CG    1 
ATOM   4649  C  CD    . ARG B 2 398 ? -1.431  -19.695 49.355 1.00 27.19 ? 399  ARG A CD    1 
ATOM   4650  N  NE    . ARG B 2 398 ? -2.800  -20.140 49.565 1.00 28.57 ? 399  ARG A NE    1 
ATOM   4651  C  CZ    . ARG B 2 398 ? -3.345  -21.203 48.930 1.00 28.87 ? 399  ARG A CZ    1 
ATOM   4652  N  NH1   . ARG B 2 398 ? -4.609  -21.539 49.137 1.00 27.58 ? 399  ARG A NH1   1 
ATOM   4653  N  NH2   . ARG B 2 398 ? -2.622  -21.930 48.073 1.00 27.53 ? 399  ARG A NH2   1 
ATOM   4654  N  N     . GLU B 2 399 ? 0.104   -19.014 54.654 1.00 27.39 ? 400  GLU A N     1 
ATOM   4655  C  CA    . GLU B 2 399 ? -0.030  -19.503 56.029 1.00 28.88 ? 400  GLU A CA    1 
ATOM   4656  C  C     . GLU B 2 399 ? 0.266   -18.411 57.062 1.00 29.87 ? 400  GLU A C     1 
ATOM   4657  O  O     . GLU B 2 399 ? 0.012   -18.598 58.253 1.00 32.52 ? 400  GLU A O     1 
ATOM   4658  C  CB    . GLU B 2 399 ? 0.888   -20.711 56.269 1.00 31.26 ? 400  GLU A CB    1 
ATOM   4659  C  CG    . GLU B 2 399 ? 2.383   -20.360 56.278 1.00 36.87 ? 400  GLU A CG    1 
ATOM   4660  C  CD    . GLU B 2 399 ? 3.304   -21.546 56.528 1.00 38.71 ? 400  GLU A CD    1 
ATOM   4661  O  OE1   . GLU B 2 399 ? 4.502   -21.301 56.788 1.00 35.69 ? 400  GLU A OE1   1 
ATOM   4662  O  OE2   . GLU B 2 399 ? 2.838   -22.715 56.463 1.00 44.57 ? 400  GLU A OE2   1 
ATOM   4663  N  N     . SER B 2 400 ? 0.812   -17.289 56.603 1.00 27.86 ? 401  SER A N     1 
ATOM   4664  C  CA    . SER B 2 400 ? 1.132   -16.167 57.476 1.00 29.20 ? 401  SER A CA    1 
ATOM   4665  C  C     . SER B 2 400 ? -0.049  -15.201 57.494 1.00 33.32 ? 401  SER A C     1 
ATOM   4666  O  O     . SER B 2 400 ? -0.620  -14.879 56.446 1.00 31.02 ? 401  SER A O     1 
ATOM   4667  C  CB    . SER B 2 400 ? 2.393   -15.439 57.001 1.00 29.60 ? 401  SER A CB    1 
ATOM   4668  O  OG    . SER B 2 400 ? 3.496   -16.322 56.869 1.00 34.86 ? 401  SER A OG    1 
ATOM   4669  N  N     . ASP B 2 401 ? -0.412  -14.749 58.689 1.00 33.27 ? 402  ASP A N     1 
ATOM   4670  C  CA    . ASP B 2 401 ? -1.518  -13.819 58.851 1.00 35.68 ? 402  ASP A CA    1 
ATOM   4671  C  C     . ASP B 2 401 ? -1.120  -12.370 58.579 1.00 35.51 ? 402  ASP A C     1 
ATOM   4672  O  O     . ASP B 2 401 ? -1.852  -11.650 57.896 1.00 39.11 ? 402  ASP A O     1 
ATOM   4673  C  CB    . ASP B 2 401 ? -2.206  -13.983 60.217 1.00 39.09 ? 402  ASP A CB    1 
ATOM   4674  C  CG    . ASP B 2 401 ? -1.221  -14.055 61.374 1.00 47.34 ? 402  ASP A CG    1 
ATOM   4675  O  OD1   . ASP B 2 401 ? 0.017   -14.184 61.136 1.00 50.09 ? 402  ASP A OD1   1 
ATOM   4676  O  OD2   . ASP B 2 401 ? -1.706  -14.045 62.537 1.00 50.26 ? 402  ASP A OD2   1 
ATOM   4677  N  N     . THR B 2 402 ? 0.037   -11.950 59.092 1.00 35.02 ? 403  THR A N     1 
ATOM   4678  C  CA    . THR B 2 402 ? 0.531   -10.579 58.875 1.00 36.38 ? 403  THR A CA    1 
ATOM   4679  C  C     . THR B 2 402 ? 1.775   -10.537 57.980 1.00 36.04 ? 403  THR A C     1 
ATOM   4680  O  O     . THR B 2 402 ? 2.348   -11.575 57.639 1.00 32.44 ? 403  THR A O     1 
ATOM   4681  C  CB    . THR B 2 402 ? 0.859   -9.845  60.201 1.00 38.13 ? 403  THR A CB    1 
ATOM   4682  O  OG1   . THR B 2 402 ? 1.974   -10.481 60.836 1.00 43.23 ? 403  THR A OG1   1 
ATOM   4683  C  CG2   . THR B 2 402 ? -0.336  -9.835  61.154 1.00 39.23 ? 403  THR A CG2   1 
ATOM   4684  N  N     . ASP B 2 403 ? 2.185   -9.329  57.617 1.00 36.73 ? 404  ASP A N     1 
ATOM   4685  C  CA    . ASP B 2 403 ? 3.357   -9.100  56.787 1.00 38.18 ? 404  ASP A CA    1 
ATOM   4686  C  C     . ASP B 2 403 ? 4.632   -9.376  57.564 1.00 38.33 ? 404  ASP A C     1 
ATOM   4687  O  O     . ASP B 2 403 ? 5.593   -9.909  57.021 1.00 33.97 ? 404  ASP A O     1 
ATOM   4688  C  CB    . ASP B 2 403 ? 3.384   -7.661  56.281 1.00 45.33 ? 404  ASP A CB    1 
ATOM   4689  C  CG    . ASP B 2 403 ? 2.410   -7.428  55.151 1.00 53.43 ? 404  ASP A CG    1 
ATOM   4690  O  OD1   . ASP B 2 403 ? 2.218   -8.352  54.318 1.00 57.32 ? 404  ASP A OD1   1 
ATOM   4691  O  OD2   . ASP B 2 403 ? 1.825   -6.321  55.091 1.00 56.07 ? 404  ASP A OD2   1 
ATOM   4692  N  N     . LYS B 2 404 ? 4.634   -8.997  58.839 1.00 39.23 ? 405  LYS A N     1 
ATOM   4693  C  CA    . LYS B 2 404 ? 5.782   -9.209  59.697 1.00 39.32 ? 405  LYS A CA    1 
ATOM   4694  C  C     . LYS B 2 404 ? 6.100   -10.690 59.805 1.00 35.90 ? 405  LYS A C     1 
ATOM   4695  O  O     . LYS B 2 404 ? 7.254   -11.086 59.735 1.00 40.74 ? 405  LYS A O     1 
ATOM   4696  C  CB    . LYS B 2 404 ? 5.536   -8.605  61.082 1.00 39.59 ? 405  LYS A CB    1 
ATOM   4697  C  CG    . LYS B 2 404 ? 6.672   -8.820  62.059 1.00 40.01 ? 405  LYS A CG    1 
ATOM   4698  C  CD    . LYS B 2 404 ? 6.692   -7.730  63.125 1.00 41.76 ? 405  LYS A CD    1 
ATOM   4699  C  CE    . LYS B 2 404 ? 7.480   -8.195  64.347 1.00 42.82 ? 405  LYS A CE    1 
ATOM   4700  N  NZ    . LYS B 2 404 ? 6.940   -9.458  64.943 1.00 43.49 ? 405  LYS A NZ    1 
ATOM   4701  N  N     . VAL B 2 405 ? 5.066   -11.498 59.979 1.00 31.90 ? 406  VAL A N     1 
ATOM   4702  C  CA    . VAL B 2 405 ? 5.238   -12.933 60.092 1.00 32.67 ? 406  VAL A CA    1 
ATOM   4703  C  C     . VAL B 2 405 ? 5.795   -13.532 58.806 1.00 34.01 ? 406  VAL A C     1 
ATOM   4704  O  O     . VAL B 2 405 ? 6.659   -14.394 58.840 1.00 35.73 ? 406  VAL A O     1 
ATOM   4705  C  CB    . VAL B 2 405 ? 3.914   -13.624 60.466 1.00 31.45 ? 406  VAL A CB    1 
ATOM   4706  C  CG1   . VAL B 2 405 ? 4.115   -15.119 60.621 1.00 28.08 ? 406  VAL A CG1   1 
ATOM   4707  C  CG2   . VAL B 2 405 ? 3.361   -13.025 61.741 1.00 29.02 ? 406  VAL A CG2   1 
ATOM   4708  N  N     . ALA B 2 406 ? 5.297   -13.062 57.671 1.00 33.45 ? 407  ALA A N     1 
ATOM   4709  C  CA    . ALA B 2 406 ? 5.754   -13.555 56.384 1.00 34.38 ? 407  ALA A CA    1 
ATOM   4710  C  C     . ALA B 2 406 ? 7.228   -13.252 56.169 1.00 33.30 ? 407  ALA A C     1 
ATOM   4711  O  O     . ALA B 2 406 ? 7.969   -14.088 55.674 1.00 30.79 ? 407  ALA A O     1 
ATOM   4712  C  CB    . ALA B 2 406 ? 4.919   -12.959 55.262 1.00 33.70 ? 407  ALA A CB    1 
ATOM   4713  N  N     . MET B 2 407 ? 7.645   -12.051 56.553 1.00 33.24 ? 408  MET A N     1 
ATOM   4714  C  CA    . MET B 2 407 ? 9.030   -11.633 56.400 1.00 32.53 ? 408  MET A CA    1 
ATOM   4715  C  C     . MET B 2 407 ? 9.966   -12.508 57.214 1.00 33.95 ? 408  MET A C     1 
ATOM   4716  O  O     . MET B 2 407 ? 11.005  -12.935 56.728 1.00 35.71 ? 408  MET A O     1 
ATOM   4717  C  CB    . MET B 2 407 ? 9.187   -10.199 56.889 1.00 30.44 ? 408  MET A CB    1 
ATOM   4718  C  CG    . MET B 2 407 ? 8.525   -9.151  56.022 1.00 32.39 ? 408  MET A CG    1 
ATOM   4719  S  SD    . MET B 2 407 ? 9.611   -8.630  54.692 1.00 34.70 ? 408  MET A SD    1 
ATOM   4720  C  CE    . MET B 2 407 ? 11.023  -8.065  55.629 1.00 35.20 ? 408  MET A CE    1 
ATOM   4721  N  N     . GLU B 2 408 ? 9.579   -12.771 58.455 1.00 33.75 ? 409  GLU A N     1 
ATOM   4722  C  CA    . GLU B 2 408 ? 10.370  -13.589 59.358 1.00 34.92 ? 409  GLU A CA    1 
ATOM   4723  C  C     . GLU B 2 408 ? 10.502  -15.030 58.889 1.00 34.46 ? 409  GLU A C     1 
ATOM   4724  O  O     . GLU B 2 408 ? 11.562  -15.629 59.001 1.00 35.09 ? 409  GLU A O     1 
ATOM   4725  C  CB    . GLU B 2 408 ? 9.829   -13.484 60.787 1.00 39.98 ? 409  GLU A CB    1 
ATOM   4726  C  CG    . GLU B 2 408 ? 10.327  -12.228 61.497 1.00 46.96 ? 409  GLU A CG    1 
ATOM   4727  C  CD    . GLU B 2 408 ? 9.278   -11.565 62.378 1.00 51.98 ? 409  GLU A CD    1 
ATOM   4728  O  OE1   . GLU B 2 408 ? 8.355   -12.258 62.857 1.00 62.85 ? 409  GLU A OE1   1 
ATOM   4729  O  OE2   . GLU B 2 408 ? 9.383   -10.345 62.597 1.00 49.73 ? 409  GLU A OE2   1 
ATOM   4730  N  N     . SER B 2 409 ? 9.413   -15.584 58.374 1.00 31.62 ? 410  SER A N     1 
ATOM   4731  C  CA    . SER B 2 409 ? 9.424   -16.942 57.864 1.00 29.74 ? 410  SER A CA    1 
ATOM   4732  C  C     . SER B 2 409 ? 10.327  -17.065 56.646 1.00 29.65 ? 410  SER A C     1 
ATOM   4733  O  O     . SER B 2 409 ? 11.073  -18.023 56.513 1.00 29.88 ? 410  SER A O     1 
ATOM   4734  C  CB    . SER B 2 409 ? 8.009   -17.389 57.512 1.00 33.66 ? 410  SER A CB    1 
ATOM   4735  O  OG    . SER B 2 409 ? 7.138   -17.246 58.624 1.00 35.53 ? 410  SER A OG    1 
ATOM   4736  N  N     . LEU B 2 410 ? 10.250  -16.082 55.758 1.00 27.91 ? 411  LEU A N     1 
ATOM   4737  C  CA    . LEU B 2 410 ? 11.056  -16.067 54.546 1.00 27.23 ? 411  LEU A CA    1 
ATOM   4738  C  C     . LEU B 2 410 ? 12.544  -15.963 54.837 1.00 29.37 ? 411  LEU A C     1 
ATOM   4739  O  O     . LEU B 2 410 ? 13.357  -16.598 54.181 1.00 28.37 ? 411  LEU A O     1 
ATOM   4740  C  CB    . LEU B 2 410 ? 10.642  -14.915 53.631 1.00 25.63 ? 411  LEU A CB    1 
ATOM   4741  C  CG    . LEU B 2 410 ? 9.247   -14.922 53.017 1.00 26.38 ? 411  LEU A CG    1 
ATOM   4742  C  CD1   . LEU B 2 410 ? 8.937   -13.590 52.376 1.00 24.67 ? 411  LEU A CD1   1 
ATOM   4743  C  CD2   . LEU B 2 410 ? 9.084   -16.058 52.015 1.00 28.94 ? 411  LEU A CD2   1 
ATOM   4744  N  N     . GLN B 2 411 ? 12.892  -15.137 55.815 1.00 30.90 ? 412  GLN A N     1 
ATOM   4745  C  CA    . GLN B 2 411 ? 14.279  -14.931 56.195 1.00 31.07 ? 412  GLN A CA    1 
ATOM   4746  C  C     . GLN B 2 411 ? 14.982  -16.157 56.774 1.00 34.54 ? 412  GLN A C     1 
ATOM   4747  O  O     . GLN B 2 411 ? 16.142  -16.411 56.462 1.00 35.76 ? 412  GLN A O     1 
ATOM   4748  C  CB    . GLN B 2 411 ? 14.409  -13.738 57.144 1.00 28.45 ? 412  GLN A CB    1 
ATOM   4749  C  CG    . GLN B 2 411 ? 14.168  -12.402 56.464 1.00 28.01 ? 412  GLN A CG    1 
ATOM   4750  C  CD    . GLN B 2 411 ? 14.260  -11.219 57.409 1.00 27.08 ? 412  GLN A CD    1 
ATOM   4751  O  OE1   . GLN B 2 411 ? 15.295  -10.968 58.011 1.00 28.38 ? 412  GLN A OE1   1 
ATOM   4752  N  NE2   . GLN B 2 411 ? 13.177  -10.479 57.528 1.00 25.88 ? 412  GLN A NE2   1 
ATOM   4753  N  N     . GLN B 2 412 ? 14.290  -16.915 57.615 1.00 33.73 ? 413  GLN A N     1 
ATOM   4754  C  CA    . GLN B 2 412 ? 14.899  -18.084 58.235 1.00 35.42 ? 413  GLN A CA    1 
ATOM   4755  C  C     . GLN B 2 412 ? 14.828  -19.361 57.404 1.00 36.40 ? 413  GLN A C     1 
ATOM   4756  O  O     . GLN B 2 412 ? 15.785  -20.136 57.374 1.00 37.20 ? 413  GLN A O     1 
ATOM   4757  C  CB    . GLN B 2 412 ? 14.309  -18.338 59.623 1.00 36.50 ? 413  GLN A CB    1 
ATOM   4758  C  CG    . GLN B 2 412 ? 14.570  -17.236 60.633 1.00 42.19 ? 413  GLN A CG    1 
ATOM   4759  C  CD    . GLN B 2 412 ? 16.007  -17.135 61.052 1.00 42.31 ? 413  GLN A CD    1 
ATOM   4760  O  OE1   . GLN B 2 412 ? 16.815  -18.054 60.820 1.00 40.68 ? 413  GLN A OE1   1 
ATOM   4761  N  NE2   . GLN B 2 412 ? 16.352  -15.998 61.659 1.00 38.96 ? 413  GLN A NE2   1 
ATOM   4762  N  N     . ARG B 2 413 ? 13.700  -19.578 56.740 1.00 31.95 ? 414  ARG A N     1 
ATOM   4763  C  CA    . ARG B 2 413 ? 13.503  -20.773 55.920 1.00 30.96 ? 414  ARG A CA    1 
ATOM   4764  C  C     . ARG B 2 413 ? 14.335  -20.759 54.640 1.00 29.45 ? 414  ARG A C     1 
ATOM   4765  O  O     . ARG B 2 413 ? 14.891  -21.788 54.253 1.00 30.20 ? 414  ARG A O     1 
ATOM   4766  C  CB    . ARG B 2 413 ? 12.010  -20.967 55.602 1.00 31.16 ? 414  ARG A CB    1 
ATOM   4767  C  CG    . ARG B 2 413 ? 11.642  -22.267 54.866 1.00 33.02 ? 414  ARG A CG    1 
ATOM   4768  C  CD    . ARG B 2 413 ? 10.121  -22.460 54.763 1.00 37.02 ? 414  ARG A CD    1 
ATOM   4769  N  NE    . ARG B 2 413 ? 9.490   -22.565 56.092 1.00 40.61 ? 414  ARG A NE    1 
ATOM   4770  C  CZ    . ARG B 2 413 ? 8.173   -22.613 56.318 1.00 39.31 ? 414  ARG A CZ    1 
ATOM   4771  N  NH1   . ARG B 2 413 ? 7.311   -22.583 55.309 1.00 42.24 ? 414  ARG A NH1   1 
ATOM   4772  N  NH2   . ARG B 2 413 ? 7.721   -22.697 57.553 1.00 37.72 ? 414  ARG A NH2   1 
ATOM   4773  N  N     . PHE B 2 414 ? 14.437  -19.597 54.007 1.00 28.88 ? 415  PHE A N     1 
ATOM   4774  C  CA    . PHE B 2 414 ? 15.171  -19.468 52.760 1.00 30.22 ? 415  PHE A CA    1 
ATOM   4775  C  C     . PHE B 2 414 ? 16.530  -18.759 52.797 1.00 32.91 ? 415  PHE A C     1 
ATOM   4776  O  O     . PHE B 2 414 ? 17.117  -18.507 51.754 1.00 33.40 ? 415  PHE A O     1 
ATOM   4777  C  CB    . PHE B 2 414 ? 14.288  -18.826 51.705 1.00 31.01 ? 415  PHE A CB    1 
ATOM   4778  C  CG    . PHE B 2 414 ? 13.067  -19.620 51.378 1.00 31.44 ? 415  PHE A CG    1 
ATOM   4779  C  CD1   . PHE B 2 414 ? 11.900  -19.445 52.095 1.00 31.66 ? 415  PHE A CD1   1 
ATOM   4780  C  CD2   . PHE B 2 414 ? 13.080  -20.538 50.355 1.00 29.69 ? 415  PHE A CD2   1 
ATOM   4781  C  CE1   . PHE B 2 414 ? 10.780  -20.173 51.794 1.00 28.94 ? 415  PHE A CE1   1 
ATOM   4782  C  CE2   . PHE B 2 414 ? 11.951  -21.261 50.050 1.00 30.17 ? 415  PHE A CE2   1 
ATOM   4783  C  CZ    . PHE B 2 414 ? 10.801  -21.077 50.768 1.00 30.22 ? 415  PHE A CZ    1 
ATOM   4784  N  N     . LYS B 2 415 ? 17.026  -18.455 53.986 1.00 29.58 ? 416  LYS A N     1 
ATOM   4785  C  CA    . LYS B 2 415 ? 18.323  -17.788 54.159 1.00 29.14 ? 416  LYS A CA    1 
ATOM   4786  C  C     . LYS B 2 415 ? 18.367  -16.434 53.439 1.00 28.61 ? 416  LYS A C     1 
ATOM   4787  O  O     . LYS B 2 415 ? 19.260  -16.173 52.619 1.00 29.67 ? 416  LYS A O     1 
ATOM   4788  C  CB    . LYS B 2 415 ? 19.471  -18.684 53.674 1.00 30.15 ? 416  LYS A CB    1 
ATOM   4789  C  CG    . LYS B 2 415 ? 19.681  -19.975 54.443 1.00 30.48 ? 416  LYS A CG    1 
ATOM   4790  C  CD    . LYS B 2 415 ? 20.882  -20.743 53.886 1.00 35.32 ? 416  LYS A CD    1 
ATOM   4791  C  CE    . LYS B 2 415 ? 22.165  -19.914 53.964 1.00 35.95 ? 416  LYS A CE    1 
ATOM   4792  N  NZ    . LYS B 2 415 ? 23.333  -20.589 53.342 1.00 38.37 ? 416  LYS A NZ    1 
ATOM   4793  N  N     . LEU B 2 416 ? 17.407  -15.575 53.761 1.00 27.74 ? 417  LEU A N     1 
ATOM   4794  C  CA    . LEU B 2 416 ? 17.281  -14.274 53.109 1.00 25.56 ? 417  LEU A CA    1 
ATOM   4795  C  C     . LEU B 2 416 ? 17.431  -13.083 54.053 1.00 24.42 ? 417  LEU A C     1 
ATOM   4796  O  O     . LEU B 2 416 ? 17.125  -13.178 55.244 1.00 26.34 ? 417  LEU A O     1 
ATOM   4797  C  CB    . LEU B 2 416 ? 15.920  -14.182 52.413 1.00 24.15 ? 417  LEU A CB    1 
ATOM   4798  C  CG    . LEU B 2 416 ? 15.554  -15.202 51.334 1.00 23.32 ? 417  LEU A CG    1 
ATOM   4799  C  CD1   . LEU B 2 416 ? 14.071  -15.092 51.008 1.00 23.59 ? 417  LEU A CD1   1 
ATOM   4800  C  CD2   . LEU B 2 416 ? 16.408  -15.043 50.076 1.00 21.21 ? 417  LEU A CD2   1 
ATOM   4801  N  N     . SER B 2 417 ? 17.888  -11.959 53.504 1.00 21.05 ? 418  SER A N     1 
ATOM   4802  C  CA    . SER B 2 417 ? 18.017  -10.732 54.269 1.00 19.58 ? 418  SER A CA    1 
ATOM   4803  C  C     . SER B 2 417 ? 16.650  -10.054 54.345 1.00 20.77 ? 418  SER A C     1 
ATOM   4804  O  O     . SER B 2 417 ? 15.691  -10.487 53.694 1.00 19.91 ? 418  SER A O     1 
ATOM   4805  C  CB    . SER B 2 417 ? 19.036  -9.790  53.625 1.00 18.74 ? 418  SER A CB    1 
ATOM   4806  O  OG    . SER B 2 417 ? 18.589  -9.340  52.357 1.00 19.50 ? 418  SER A OG    1 
ATOM   4807  N  N     . GLU B 2 418 ? 16.569  -8.991  55.139 1.00 21.70 ? 419  GLU A N     1 
ATOM   4808  C  CA    . GLU B 2 418 ? 15.336  -8.236  55.308 1.00 22.90 ? 419  GLU A CA    1 
ATOM   4809  C  C     . GLU B 2 418 ? 14.898  -7.594  53.983 1.00 20.86 ? 419  GLU A C     1 
ATOM   4810  O  O     . GLU B 2 418 ? 13.709  -7.595  53.656 1.00 20.65 ? 419  GLU A O     1 
ATOM   4811  C  CB    . GLU B 2 418 ? 15.516  -7.178  56.401 1.00 26.83 ? 419  GLU A CB    1 
ATOM   4812  C  CG    . GLU B 2 418 ? 14.254  -6.387  56.725 1.00 32.84 ? 419  GLU A CG    1 
ATOM   4813  C  CD    . GLU B 2 418 ? 14.465  -5.336  57.802 1.00 39.35 ? 419  GLU A CD    1 
ATOM   4814  O  OE1   . GLU B 2 418 ? 13.523  -4.568  58.075 1.00 42.95 ? 419  GLU A OE1   1 
ATOM   4815  O  OE2   . GLU B 2 418 ? 15.577  -5.265  58.378 1.00 48.73 ? 419  GLU A OE2   1 
ATOM   4816  N  N     . LYS B 2 419 ? 15.864  -7.074  53.226 1.00 19.11 ? 420  LYS A N     1 
ATOM   4817  C  CA    . LYS B 2 419 ? 15.590  -6.430  51.940 1.00 18.35 ? 420  LYS A CA    1 
ATOM   4818  C  C     . LYS B 2 419 ? 15.133  -7.430  50.875 1.00 18.69 ? 420  LYS A C     1 
ATOM   4819  O  O     . LYS B 2 419 ? 14.218  -7.142  50.102 1.00 18.59 ? 420  LYS A O     1 
ATOM   4820  C  CB    . LYS B 2 419 ? 16.806  -5.640  51.448 1.00 18.11 ? 420  LYS A CB    1 
ATOM   4821  C  CG    . LYS B 2 419 ? 17.178  -4.449  52.327 1.00 19.58 ? 420  LYS A CG    1 
ATOM   4822  C  CD    . LYS B 2 419 ? 18.428  -3.747  51.774 1.00 20.95 ? 420  LYS A CD    1 
ATOM   4823  C  CE    . LYS B 2 419 ? 18.979  -2.733  52.787 1.00 20.23 ? 420  LYS A CE    1 
ATOM   4824  N  NZ    . LYS B 2 419 ? 20.161  -2.021  52.277 1.00 19.50 ? 420  LYS A NZ    1 
ATOM   4825  N  N     . GLN B 2 420 ? 15.786  -8.594  50.845 1.00 18.17 ? 421  GLN A N     1 
ATOM   4826  C  CA    . GLN B 2 420 ? 15.448  -9.667  49.910 1.00 18.06 ? 421  GLN A CA    1 
ATOM   4827  C  C     . GLN B 2 420 ? 14.017  -10.163 50.125 1.00 19.07 ? 421  GLN A C     1 
ATOM   4828  O  O     . GLN B 2 420 ? 13.279  -10.373 49.165 1.00 18.81 ? 421  GLN A O     1 
ATOM   4829  C  CB    . GLN B 2 420 ? 16.444  -10.831 50.021 1.00 17.11 ? 421  GLN A CB    1 
ATOM   4830  C  CG    . GLN B 2 420 ? 17.812  -10.562 49.395 1.00 16.21 ? 421  GLN A CG    1 
ATOM   4831  C  CD    . GLN B 2 420 ? 18.852  -11.631 49.731 1.00 15.95 ? 421  GLN A CD    1 
ATOM   4832  O  OE1   . GLN B 2 420 ? 18.825  -12.228 50.808 1.00 16.70 ? 421  GLN A OE1   1 
ATOM   4833  N  NE2   . GLN B 2 420 ? 19.786  -11.856 48.814 1.00 15.05 ? 421  GLN A NE2   1 
ATOM   4834  N  N     . ALA B 2 421 ? 13.634  -10.340 51.387 1.00 19.55 ? 422  ALA A N     1 
ATOM   4835  C  CA    . ALA B 2 421 ? 12.290  -10.801 51.730 1.00 20.60 ? 422  ALA A CA    1 
ATOM   4836  C  C     . ALA B 2 421 ? 11.234  -9.782  51.302 1.00 20.58 ? 422  ALA A C     1 
ATOM   4837  O  O     . ALA B 2 421 ? 10.210  -10.150 50.733 1.00 21.12 ? 422  ALA A O     1 
ATOM   4838  C  CB    . ALA B 2 421 ? 12.182  -11.106 53.228 1.00 20.45 ? 422  ALA A CB    1 
ATOM   4839  N  N     . GLN B 2 422 ? 11.506  -8.504  51.567 1.00 21.79 ? 423  GLN A N     1 
ATOM   4840  C  CA    . GLN B 2 422 ? 10.604  -7.402  51.222 1.00 22.83 ? 423  GLN A CA    1 
ATOM   4841  C  C     . GLN B 2 422 ? 10.346  -7.305  49.704 1.00 21.12 ? 423  GLN A C     1 
ATOM   4842  O  O     . GLN B 2 422 ? 9.204   -7.129  49.274 1.00 23.20 ? 423  GLN A O     1 
ATOM   4843  C  CB    . GLN B 2 422 ? 11.155  -6.082  51.787 1.00 25.81 ? 423  GLN A CB    1 
ATOM   4844  C  CG    . GLN B 2 422 ? 10.292  -4.833  51.546 1.00 31.63 ? 423  GLN A CG    1 
ATOM   4845  C  CD    . GLN B 2 422 ? 8.942   -4.856  52.276 1.00 36.37 ? 423  GLN A CD    1 
ATOM   4846  O  OE1   . GLN B 2 422 ? 7.918   -4.451  51.714 1.00 38.14 ? 423  GLN A OE1   1 
ATOM   4847  N  NE2   . GLN B 2 422 ? 8.942   -5.326  53.530 1.00 34.61 ? 423  GLN A NE2   1 
ATOM   4848  N  N     . ALA B 2 423 ? 11.404  -7.435  48.907 1.00 19.84 ? 424  ALA A N     1 
ATOM   4849  C  CA    . ALA B 2 423 ? 11.317  -7.363  47.450 1.00 19.17 ? 424  ALA A CA    1 
ATOM   4850  C  C     . ALA B 2 423 ? 10.498  -8.513  46.863 1.00 20.65 ? 424  ALA A C     1 
ATOM   4851  O  O     . ALA B 2 423 ? 9.888   -8.373  45.796 1.00 20.19 ? 424  ALA A O     1 
ATOM   4852  C  CB    . ALA B 2 423 ? 12.709  -7.346  46.842 1.00 20.54 ? 424  ALA A CB    1 
ATOM   4853  N  N     . ILE B 2 424 ? 10.503  -9.652  47.559 1.00 20.29 ? 425  ILE A N     1 
ATOM   4854  C  CA    . ILE B 2 424 ? 9.729   -10.822 47.161 1.00 21.33 ? 425  ILE A CA    1 
ATOM   4855  C  C     . ILE B 2 424 ? 8.257   -10.549 47.457 1.00 21.95 ? 425  ILE A C     1 
ATOM   4856  O  O     . ILE B 2 424 ? 7.376   -10.888 46.659 1.00 23.06 ? 425  ILE A O     1 
ATOM   4857  C  CB    . ILE B 2 424 ? 10.226  -12.117 47.861 1.00 20.99 ? 425  ILE A CB    1 
ATOM   4858  C  CG1   . ILE B 2 424 ? 11.680  -12.409 47.469 1.00 18.12 ? 425  ILE A CG1   1 
ATOM   4859  C  CG2   . ILE B 2 424 ? 9.351   -13.320 47.491 1.00 21.16 ? 425  ILE A CG2   1 
ATOM   4860  C  CD1   . ILE B 2 424 ? 12.338  -13.495 48.288 1.00 18.71 ? 425  ILE A CD1   1 
ATOM   4861  N  N     . LEU B 2 425 ? 7.982   -9.904  48.578 1.00 22.76 ? 426  LEU A N     1 
ATOM   4862  C  CA    . LEU B 2 425 ? 6.603   -9.577  48.917 1.00 22.53 ? 426  LEU A CA    1 
ATOM   4863  C  C     . LEU B 2 425 ? 6.044   -8.498  47.984 1.00 23.28 ? 426  LEU A C     1 
ATOM   4864  O  O     . LEU B 2 425 ? 4.872   -8.525  47.638 1.00 23.49 ? 426  LEU A O     1 
ATOM   4865  C  CB    . LEU B 2 425 ? 6.477   -9.185  50.385 1.00 21.91 ? 426  LEU A CB    1 
ATOM   4866  C  CG    . LEU B 2 425 ? 6.700   -10.328 51.372 1.00 25.42 ? 426  LEU A CG    1 
ATOM   4867  C  CD1   . LEU B 2 425 ? 6.605   -9.836  52.803 1.00 26.70 ? 426  LEU A CD1   1 
ATOM   4868  C  CD2   . LEU B 2 425 ? 5.716   -11.452 51.138 1.00 24.17 ? 426  LEU A CD2   1 
ATOM   4869  N  N     . ASP B 2 426 ? 6.888   -7.558  47.574 1.00 23.16 ? 427  ASP A N     1 
ATOM   4870  C  CA    . ASP B 2 426 ? 6.466   -6.487  46.653 1.00 25.61 ? 427  ASP A CA    1 
ATOM   4871  C  C     . ASP B 2 426 ? 6.325   -6.957  45.202 1.00 22.83 ? 427  ASP A C     1 
ATOM   4872  O  O     . ASP B 2 426 ? 5.788   -6.237  44.372 1.00 25.39 ? 427  ASP A O     1 
ATOM   4873  C  CB    . ASP B 2 426 ? 7.428   -5.294  46.720 1.00 26.12 ? 427  ASP A CB    1 
ATOM   4874  C  CG    . ASP B 2 426 ? 7.406   -4.594  48.075 1.00 31.37 ? 427  ASP A CG    1 
ATOM   4875  O  OD1   . ASP B 2 426 ? 6.416   -4.757  48.842 1.00 27.71 ? 427  ASP A OD1   1 
ATOM   4876  O  OD2   . ASP B 2 426 ? 8.384   -3.871  48.373 1.00 33.36 ? 427  ASP A OD2   1 
ATOM   4877  N  N     . MET B 2 427 ? 6.799   -8.171  44.925 1.00 21.97 ? 428  MET A N     1 
ATOM   4878  C  CA    . MET B 2 427 ? 6.790   -8.771  43.588 1.00 21.74 ? 428  MET A CA    1 
ATOM   4879  C  C     . MET B 2 427 ? 5.369   -9.099  43.088 1.00 20.98 ? 428  MET A C     1 
ATOM   4880  O  O     . MET B 2 427 ? 4.584   -9.742  43.779 1.00 19.43 ? 428  MET A O     1 
ATOM   4881  C  CB    . MET B 2 427 ? 7.709   -10.005 43.594 1.00 21.75 ? 428  MET A CB    1 
ATOM   4882  C  CG    . MET B 2 427 ? 7.912   -10.715 42.272 1.00 25.05 ? 428  MET A CG    1 
ATOM   4883  S  SD    . MET B 2 427 ? 9.331   -11.900 42.257 1.00 28.28 ? 428  MET A SD    1 
ATOM   4884  C  CE    . MET B 2 427 ? 8.864   -13.052 43.538 1.00 24.03 ? 428  MET A CE    1 
ATOM   4885  N  N     . ARG B 2 428 ? 5.046   -8.629  41.885 1.00 20.73 ? 429  ARG A N     1 
ATOM   4886  C  CA    . ARG B 2 428 ? 3.729   -8.861  41.287 1.00 21.86 ? 429  ARG A CA    1 
ATOM   4887  C  C     . ARG B 2 428 ? 3.639   -10.254 40.683 1.00 21.22 ? 429  ARG A C     1 
ATOM   4888  O  O     . ARG B 2 428 ? 4.669   -10.867 40.386 1.00 21.14 ? 429  ARG A O     1 
ATOM   4889  C  CB    . ARG B 2 428 ? 3.406   -7.792  40.234 1.00 22.15 ? 429  ARG A CB    1 
ATOM   4890  C  CG    . ARG B 2 428 ? 3.457   -6.362  40.784 1.00 23.96 ? 429  ARG A CG    1 
ATOM   4891  C  CD    . ARG B 2 428 ? 2.924   -5.363  39.746 1.00 26.58 ? 429  ARG A CD    1 
ATOM   4892  N  NE    . ARG B 2 428 ? 3.185   -3.974  40.132 1.00 29.56 ? 429  ARG A NE    1 
ATOM   4893  C  CZ    . ARG B 2 428 ? 2.448   -3.264  40.986 1.00 30.31 ? 429  ARG A CZ    1 
ATOM   4894  N  NH1   . ARG B 2 428 ? 1.369   -3.798  41.569 1.00 28.33 ? 429  ARG A NH1   1 
ATOM   4895  N  NH2   . ARG B 2 428 ? 2.813   -2.013  41.274 1.00 29.84 ? 429  ARG A NH2   1 
ATOM   4896  N  N     . LEU B 2 429 ? 2.414   -10.754 40.505 1.00 19.48 ? 430  LEU A N     1 
ATOM   4897  C  CA    . LEU B 2 429 ? 2.189   -12.095 39.951 1.00 18.00 ? 430  LEU A CA    1 
ATOM   4898  C  C     . LEU B 2 429 ? 2.658   -12.258 38.501 1.00 18.21 ? 430  LEU A C     1 
ATOM   4899  O  O     . LEU B 2 429 ? 3.000   -13.365 38.083 1.00 16.67 ? 430  LEU A O     1 
ATOM   4900  C  CB    . LEU B 2 429 ? 0.723   -12.525 40.082 1.00 17.60 ? 430  LEU A CB    1 
ATOM   4901  C  CG    . LEU B 2 429 ? 0.154   -12.867 41.466 1.00 17.53 ? 430  LEU A CG    1 
ATOM   4902  C  CD1   . LEU B 2 429 ? -1.291  -13.334 41.311 1.00 17.09 ? 430  LEU A CD1   1 
ATOM   4903  C  CD2   . LEU B 2 429 ? 0.931   -13.974 42.155 1.00 18.04 ? 430  LEU A CD2   1 
ATOM   4904  N  N     . ARG B 2 430 ? 2.680   -11.166 37.739 1.00 18.26 ? 431  ARG A N     1 
ATOM   4905  C  CA    . ARG B 2 430 ? 3.120   -11.238 36.354 1.00 20.12 ? 431  ARG A CA    1 
ATOM   4906  C  C     . ARG B 2 430 ? 4.624   -11.507 36.236 1.00 22.11 ? 431  ARG A C     1 
ATOM   4907  O  O     . ARG B 2 430 ? 5.117   -11.835 35.168 1.00 23.44 ? 431  ARG A O     1 
ATOM   4908  C  CB    . ARG B 2 430 ? 2.736   -9.976  35.595 1.00 18.76 ? 431  ARG A CB    1 
ATOM   4909  C  CG    . ARG B 2 430 ? 3.420   -8.722  36.116 1.00 17.96 ? 431  ARG A CG    1 
ATOM   4910  C  CD    . ARG B 2 430 ? 3.066   -7.522  35.280 1.00 17.97 ? 431  ARG A CD    1 
ATOM   4911  N  NE    . ARG B 2 430 ? 1.679   -7.117  35.448 1.00 19.67 ? 431  ARG A NE    1 
ATOM   4912  C  CZ    . ARG B 2 430 ? 0.815   -7.026  34.428 1.00 18.81 ? 431  ARG A CZ    1 
ATOM   4913  N  NH1   . ARG B 2 430 ? 1.205   -7.321  33.174 1.00 17.13 ? 431  ARG A NH1   1 
ATOM   4914  N  NH2   . ARG B 2 430 ? -0.426  -6.638  34.670 1.00 18.90 ? 431  ARG A NH2   1 
ATOM   4915  N  N     . ARG B 2 431 ? 5.332   -11.373 37.349 1.00 22.57 ? 432  ARG A N     1 
ATOM   4916  C  CA    . ARG B 2 431 ? 6.762   -11.625 37.413 1.00 24.96 ? 432  ARG A CA    1 
ATOM   4917  C  C     . ARG B 2 431 ? 7.052   -13.136 37.474 1.00 25.78 ? 432  ARG A C     1 
ATOM   4918  O  O     . ARG B 2 431 ? 8.212   -13.559 37.469 1.00 27.72 ? 432  ARG A O     1 
ATOM   4919  C  CB    . ARG B 2 431 ? 7.331   -10.922 38.647 1.00 26.38 ? 432  ARG A CB    1 
ATOM   4920  C  CG    . ARG B 2 431 ? 8.825   -10.707 38.666 1.00 28.23 ? 432  ARG A CG    1 
ATOM   4921  C  CD    . ARG B 2 431 ? 9.218   -9.494  37.833 1.00 29.59 ? 432  ARG A CD    1 
ATOM   4922  N  NE    . ARG B 2 431 ? 10.567  -9.033  38.177 1.00 29.29 ? 432  ARG A NE    1 
ATOM   4923  C  CZ    . ARG B 2 431 ? 10.843  -8.237  39.211 1.00 29.19 ? 432  ARG A CZ    1 
ATOM   4924  N  NH1   . ARG B 2 431 ? 9.866   -7.809  40.032 1.00 26.89 ? 432  ARG A NH1   1 
ATOM   4925  N  NH2   . ARG B 2 431 ? 12.103  -7.883  39.438 1.00 28.96 ? 432  ARG A NH2   1 
ATOM   4926  N  N     . LEU B 2 432 ? 5.996   -13.941 37.525 1.00 25.74 ? 433  LEU A N     1 
ATOM   4927  C  CA    . LEU B 2 432 ? 6.131   -15.398 37.592 1.00 25.49 ? 433  LEU A CA    1 
ATOM   4928  C  C     . LEU B 2 432 ? 6.052   -16.081 36.232 1.00 26.11 ? 433  LEU A C     1 
ATOM   4929  O  O     . LEU B 2 432 ? 6.076   -17.305 36.147 1.00 24.69 ? 433  LEU A O     1 
ATOM   4930  C  CB    . LEU B 2 432 ? 5.078   -16.004 38.522 1.00 25.65 ? 433  LEU A CB    1 
ATOM   4931  C  CG    . LEU B 2 432 ? 5.280   -15.922 40.034 1.00 25.08 ? 433  LEU A CG    1 
ATOM   4932  C  CD1   . LEU B 2 432 ? 4.970   -14.532 40.540 1.00 25.37 ? 433  LEU A CD1   1 
ATOM   4933  C  CD2   . LEU B 2 432 ? 4.384   -16.915 40.732 1.00 26.76 ? 433  LEU A CD2   1 
ATOM   4934  N  N     . THR B 2 433 ? 5.969   -15.285 35.175 1.00 26.70 ? 434  THR A N     1 
ATOM   4935  C  CA    . THR B 2 433 ? 5.903   -15.806 33.805 1.00 26.64 ? 434  THR A CA    1 
ATOM   4936  C  C     . THR B 2 433 ? 7.135   -16.633 33.435 1.00 28.77 ? 434  THR A C     1 
ATOM   4937  O  O     . THR B 2 433 ? 8.196   -16.496 34.047 1.00 29.69 ? 434  THR A O     1 
ATOM   4938  C  CB    . THR B 2 433 ? 5.639   -14.692 32.751 1.00 26.03 ? 434  THR A CB    1 
ATOM   4939  O  OG1   . THR B 2 433 ? 6.589   -13.638 32.898 1.00 27.47 ? 434  THR A OG1   1 
ATOM   4940  C  CG2   . THR B 2 433 ? 4.243   -14.122 32.910 1.00 27.18 ? 434  THR A CG2   1 
ATOM   4941  N  N     . GLY B 2 434 ? 6.972   -17.487 32.424 1.00 33.37 ? 435  GLY A N     1 
ATOM   4942  C  CA    . GLY B 2 434 ? 7.994   -18.443 31.977 1.00 35.27 ? 435  GLY A CA    1 
ATOM   4943  C  C     . GLY B 2 434 ? 9.373   -17.962 31.569 1.00 38.00 ? 435  GLY A C     1 
ATOM   4944  O  O     . GLY B 2 434 ? 10.332  -18.734 31.625 1.00 39.60 ? 435  GLY A O     1 
ATOM   4945  N  N     . LEU B 2 435 ? 9.489   -16.704 31.161 1.00 39.87 ? 436  LEU A N     1 
ATOM   4946  C  CA    . LEU B 2 435 ? 10.775  -16.163 30.700 1.00 39.91 ? 436  LEU A CA    1 
ATOM   4947  C  C     . LEU B 2 435 ? 11.493  -15.229 31.689 1.00 41.83 ? 436  LEU A C     1 
ATOM   4948  O  O     . LEU B 2 435 ? 12.623  -14.804 31.429 1.00 46.99 ? 436  LEU A O     1 
ATOM   4949  C  CB    . LEU B 2 435 ? 10.616  -15.499 29.326 1.00 40.26 ? 436  LEU A CB    1 
ATOM   4950  C  CG    . LEU B 2 435 ? 10.244  -16.433 28.152 1.00 42.51 ? 436  LEU A CG    1 
ATOM   4951  C  CD1   . LEU B 2 435 ? 9.876   -15.657 26.894 1.00 40.09 ? 436  LEU A CD1   1 
ATOM   4952  C  CD2   . LEU B 2 435 ? 11.296  -17.536 27.900 1.00 39.84 ? 436  LEU A CD2   1 
ATOM   4953  N  N     . GLU B 2 436 ? 10.849  -14.928 32.821 1.00 40.26 ? 437  GLU A N     1 
ATOM   4954  C  CA    . GLU B 2 436 ? 11.423  -14.048 33.843 1.00 36.05 ? 437  GLU A CA    1 
ATOM   4955  C  C     . GLU B 2 436 ? 12.661  -14.607 34.535 1.00 34.13 ? 437  GLU A C     1 
ATOM   4956  O  O     . GLU B 2 436 ? 13.597  -13.862 34.832 1.00 36.42 ? 437  GLU A O     1 
ATOM   4957  C  CB    . GLU B 2 436 ? 10.371  -13.669 34.894 1.00 39.83 ? 437  GLU A CB    1 
ATOM   4958  C  CG    . GLU B 2 436 ? 9.389   -12.568 34.469 1.00 38.50 ? 437  GLU A CG    1 
ATOM   4959  C  CD    . GLU B 2 436 ? 10.002  -11.160 34.504 1.00 39.62 ? 437  GLU A CD    1 
ATOM   4960  O  OE1   . GLU B 2 436 ? 11.096  -10.976 35.064 1.00 37.04 ? 437  GLU A OE1   1 
ATOM   4961  O  OE2   . GLU B 2 436 ? 9.382   -10.222 33.978 1.00 42.52 ? 437  GLU A OE2   1 
ATOM   4962  N  N     . ARG B 2 437 ? 12.662  -15.911 34.790 1.00 34.17 ? 438  ARG A N     1 
ATOM   4963  C  CA    . ARG B 2 437 ? 13.781  -16.578 35.459 1.00 34.64 ? 438  ARG A CA    1 
ATOM   4964  C  C     . ARG B 2 437 ? 15.088  -16.446 34.666 1.00 34.65 ? 438  ARG A C     1 
ATOM   4965  O  O     . ARG B 2 437 ? 16.172  -16.320 35.253 1.00 37.76 ? 438  ARG A O     1 
ATOM   4966  C  CB    . ARG B 2 437 ? 13.445  -18.049 35.751 1.00 35.33 ? 438  ARG A CB    1 
ATOM   4967  C  CG    . ARG B 2 437 ? 14.528  -18.829 36.506 1.00 35.20 ? 438  ARG A CG    1 
ATOM   4968  C  CD    . ARG B 2 437 ? 14.814  -18.229 37.870 1.00 33.50 ? 438  ARG A CD    1 
ATOM   4969  N  NE    . ARG B 2 437 ? 15.940  -18.880 38.547 1.00 30.94 ? 438  ARG A NE    1 
ATOM   4970  C  CZ    . ARG B 2 437 ? 17.210  -18.488 38.454 1.00 29.85 ? 438  ARG A CZ    1 
ATOM   4971  N  NH1   . ARG B 2 437 ? 17.544  -17.444 37.701 1.00 29.77 ? 438  ARG A NH1   1 
ATOM   4972  N  NH2   . ARG B 2 437 ? 18.152  -19.147 39.115 1.00 27.08 ? 438  ARG A NH2   1 
ATOM   4973  N  N     . ASP B 2 438 ? 14.981  -16.472 33.339 1.00 36.20 ? 439  ASP A N     1 
ATOM   4974  C  CA    . ASP B 2 438 ? 16.147  -16.313 32.471 1.00 35.10 ? 439  ASP A CA    1 
ATOM   4975  C  C     . ASP B 2 438 ? 16.512  -14.841 32.330 1.00 32.05 ? 439  ASP A C     1 
ATOM   4976  O  O     . ASP B 2 438 ? 17.688  -14.497 32.247 1.00 28.96 ? 439  ASP A O     1 
ATOM   4977  C  CB    . ASP B 2 438 ? 15.893  -16.954 31.098 1.00 35.60 ? 439  ASP A CB    1 
ATOM   4978  C  CG    . ASP B 2 438 ? 15.747  -18.466 31.176 1.00 36.35 ? 439  ASP A CG    1 
ATOM   4979  O  OD1   . ASP B 2 438 ? 16.194  -19.063 32.181 1.00 34.08 ? 439  ASP A OD1   1 
ATOM   4980  O  OD2   . ASP B 2 438 ? 15.185  -19.047 30.215 1.00 38.61 ? 439  ASP A OD2   1 
ATOM   4981  N  N     . LYS B 2 439 ? 15.495  -13.979 32.317 1.00 30.44 ? 440  LYS A N     1 
ATOM   4982  C  CA    . LYS B 2 439 ? 15.694  -12.533 32.220 1.00 31.07 ? 440  LYS A CA    1 
ATOM   4983  C  C     . LYS B 2 439 ? 16.456  -11.988 33.439 1.00 28.73 ? 440  LYS A C     1 
ATOM   4984  O  O     . LYS B 2 439 ? 17.270  -11.077 33.316 1.00 27.67 ? 440  LYS A O     1 
ATOM   4985  C  CB    . LYS B 2 439 ? 14.351  -11.816 32.041 1.00 31.99 ? 440  LYS A CB    1 
ATOM   4986  C  CG    . LYS B 2 439 ? 14.471  -10.326 31.796 1.00 33.06 ? 440  LYS A CG    1 
ATOM   4987  C  CD    . LYS B 2 439 ? 13.120  -9.691  31.531 1.00 39.47 ? 440  LYS A CD    1 
ATOM   4988  C  CE    . LYS B 2 439 ? 13.244  -8.164  31.541 1.00 42.86 ? 440  LYS A CE    1 
ATOM   4989  N  NZ    . LYS B 2 439 ? 11.958  -7.504  31.189 1.00 46.08 ? 440  LYS A NZ    1 
ATOM   4990  N  N     . ILE B 2 440 ? 16.181  -12.565 34.607 1.00 28.75 ? 441  ILE A N     1 
ATOM   4991  C  CA    . ILE B 2 440 ? 16.856  -12.194 35.852 1.00 30.49 ? 441  ILE A CA    1 
ATOM   4992  C  C     . ILE B 2 440 ? 18.307  -12.675 35.857 1.00 32.94 ? 441  ILE A C     1 
ATOM   4993  O  O     . ILE B 2 440 ? 19.215  -11.930 36.253 1.00 37.26 ? 441  ILE A O     1 
ATOM   4994  C  CB    . ILE B 2 440 ? 16.082  -12.712 37.099 1.00 29.36 ? 441  ILE A CB    1 
ATOM   4995  C  CG1   . ILE B 2 440 ? 14.786  -11.904 37.269 1.00 29.80 ? 441  ILE A CG1   1 
ATOM   4996  C  CG2   . ILE B 2 440 ? 16.934  -12.617 38.357 1.00 27.01 ? 441  ILE A CG2   1 
ATOM   4997  C  CD1   . ILE B 2 440 ? 13.886  -12.355 38.392 1.00 34.51 ? 441  ILE A CD1   1 
ATOM   4998  N  N     . GLU B 2 441 ? 18.514  -13.911 35.404 1.00 31.73 ? 442  GLU A N     1 
ATOM   4999  C  CA    . GLU B 2 441 ? 19.846  -14.519 35.332 1.00 30.43 ? 442  GLU A CA    1 
ATOM   5000  C  C     . GLU B 2 441 ? 20.781  -13.692 34.445 1.00 29.63 ? 442  GLU A C     1 
ATOM   5001  O  O     . GLU B 2 441 ? 21.954  -13.505 34.775 1.00 34.56 ? 442  GLU A O     1 
ATOM   5002  C  CB    . GLU B 2 441 ? 19.741  -15.965 34.829 1.00 30.56 ? 442  GLU A CB    1 
ATOM   5003  C  CG    . GLU B 2 441 ? 21.043  -16.759 34.860 1.00 33.37 ? 442  GLU A CG    1 
ATOM   5004  C  CD    . GLU B 2 441 ? 21.579  -16.981 36.265 1.00 37.23 ? 442  GLU A CD    1 
ATOM   5005  O  OE1   . GLU B 2 441 ? 20.770  -17.086 37.213 1.00 39.82 ? 442  GLU A OE1   1 
ATOM   5006  O  OE2   . GLU B 2 441 ? 22.815  -17.058 36.421 1.00 40.18 ? 442  GLU A OE2   1 
ATOM   5007  N  N     . ALA B 2 442 ? 20.249  -13.196 33.327 1.00 27.30 ? 443  ALA A N     1 
ATOM   5008  C  CA    . ALA B 2 442 ? 21.003  -12.355 32.398 1.00 27.74 ? 443  ALA A CA    1 
ATOM   5009  C  C     . ALA B 2 442 ? 21.429  -11.039 33.058 1.00 29.44 ? 443  ALA A C     1 
ATOM   5010  O  O     . ALA B 2 442 ? 22.606  -10.675 33.003 1.00 32.46 ? 443  ALA A O     1 
ATOM   5011  C  CB    . ALA B 2 442 ? 20.190  -12.080 31.138 1.00 24.73 ? 443  ALA A CB    1 
ATOM   5012  N  N     . GLU B 2 443 ? 20.491  -10.365 33.711 1.00 26.08 ? 444  GLU A N     1 
ATOM   5013  C  CA    . GLU B 2 443 ? 20.779  -9.117  34.393 1.00 26.90 ? 444  GLU A CA    1 
ATOM   5014  C  C     . GLU B 2 443 ? 21.796  -9.285  35.515 1.00 26.12 ? 444  GLU A C     1 
ATOM   5015  O  O     . GLU B 2 443 ? 22.668  -8.450  35.695 1.00 28.49 ? 444  GLU A O     1 
ATOM   5016  C  CB    . GLU B 2 443 ? 19.497  -8.488  34.938 1.00 27.68 ? 444  GLU A CB    1 
ATOM   5017  C  CG    . GLU B 2 443 ? 19.691  -7.079  35.468 1.00 28.71 ? 444  GLU A CG    1 
ATOM   5018  C  CD    . GLU B 2 443 ? 18.570  -6.635  36.388 1.00 30.07 ? 444  GLU A CD    1 
ATOM   5019  O  OE1   . GLU B 2 443 ? 18.788  -5.690  37.159 1.00 28.25 ? 444  GLU A OE1   1 
ATOM   5020  O  OE2   . GLU B 2 443 ? 17.472  -7.222  36.343 1.00 32.20 ? 444  GLU A OE2   1 
ATOM   5021  N  N     . TYR B 2 444 ? 21.673  -10.362 36.276 1.00 26.29 ? 445  TYR A N     1 
ATOM   5022  C  CA    . TYR B 2 444 ? 22.593  -10.620 37.375 1.00 27.10 ? 445  TYR A CA    1 
ATOM   5023  C  C     . TYR B 2 444 ? 24.026  -10.820 36.879 1.00 30.04 ? 445  TYR A C     1 
ATOM   5024  O  O     . TYR B 2 444 ? 24.965  -10.304 37.473 1.00 29.09 ? 445  TYR A O     1 
ATOM   5025  C  CB    . TYR B 2 444 ? 22.114  -11.824 38.187 1.00 27.50 ? 445  TYR A CB    1 
ATOM   5026  C  CG    . TYR B 2 444 ? 23.030  -12.242 39.311 1.00 27.53 ? 445  TYR A CG    1 
ATOM   5027  C  CD1   . TYR B 2 444 ? 23.162  -11.462 40.448 1.00 28.01 ? 445  TYR A CD1   1 
ATOM   5028  C  CD2   . TYR B 2 444 ? 23.752  -13.415 39.242 1.00 25.69 ? 445  TYR A CD2   1 
ATOM   5029  C  CE1   . TYR B 2 444 ? 23.997  -11.842 41.477 1.00 26.96 ? 445  TYR A CE1   1 
ATOM   5030  C  CE2   . TYR B 2 444 ? 24.582  -13.798 40.265 1.00 25.29 ? 445  TYR A CE2   1 
ATOM   5031  C  CZ    . TYR B 2 444 ? 24.700  -13.009 41.380 1.00 25.87 ? 445  TYR A CZ    1 
ATOM   5032  O  OH    . TYR B 2 444 ? 25.532  -13.394 42.397 1.00 25.73 ? 445  TYR A OH    1 
ATOM   5033  N  N     . ASN B 2 445 ? 24.180  -11.568 35.791 1.00 29.14 ? 446  ASN A N     1 
ATOM   5034  C  CA    . ASN B 2 445 ? 25.485  -11.820 35.197 1.00 31.09 ? 446  ASN A CA    1 
ATOM   5035  C  C     . ASN B 2 445 ? 26.112  -10.546 34.675 1.00 30.87 ? 446  ASN A C     1 
ATOM   5036  O  O     . ASN B 2 445 ? 27.305  -10.317 34.819 1.00 30.27 ? 446  ASN A O     1 
ATOM   5037  C  CB    . ASN B 2 445 ? 25.367  -12.806 34.040 1.00 33.76 ? 446  ASN A CB    1 
ATOM   5038  C  CG    . ASN B 2 445 ? 25.167  -14.225 34.504 1.00 38.10 ? 446  ASN A CG    1 
ATOM   5039  O  OD1   . ASN B 2 445 ? 25.735  -14.646 35.511 1.00 44.76 ? 446  ASN A OD1   1 
ATOM   5040  N  ND2   . ASN B 2 445 ? 24.361  -14.977 33.775 1.00 35.74 ? 446  ASN A ND2   1 
ATOM   5041  N  N     . GLU B 2 446 ? 25.282  -9.722  34.052 1.00 31.94 ? 447  GLU A N     1 
ATOM   5042  C  CA    . GLU B 2 446 ? 25.724  -8.463  33.495 1.00 33.77 ? 447  GLU A CA    1 
ATOM   5043  C  C     . GLU B 2 446 ? 26.211  -7.567  34.622 1.00 31.02 ? 447  GLU A C     1 
ATOM   5044  O  O     . GLU B 2 446 ? 27.204  -6.862  34.484 1.00 29.53 ? 447  GLU A O     1 
ATOM   5045  C  CB    . GLU B 2 446 ? 24.574  -7.806  32.740 1.00 36.24 ? 447  GLU A CB    1 
ATOM   5046  C  CG    . GLU B 2 446 ? 24.970  -6.601  31.913 1.00 45.36 ? 447  GLU A CG    1 
ATOM   5047  C  CD    . GLU B 2 446 ? 23.762  -5.947  31.258 1.00 52.00 ? 447  GLU A CD    1 
ATOM   5048  O  OE1   . GLU B 2 446 ? 23.964  -5.023  30.432 1.00 47.80 ? 447  GLU A OE1   1 
ATOM   5049  O  OE2   . GLU B 2 446 ? 22.607  -6.360  31.573 1.00 53.99 ? 447  GLU A OE2   1 
ATOM   5050  N  N     . LEU B 2 447 ? 25.493  -7.607  35.734 1.00 27.86 ? 448  LEU A N     1 
ATOM   5051  C  CA    . LEU B 2 447 ? 25.828  -6.817  36.903 1.00 28.41 ? 448  LEU A CA    1 
ATOM   5052  C  C     . LEU B 2 447 ? 27.166  -7.195  37.516 1.00 27.47 ? 448  LEU A C     1 
ATOM   5053  O  O     . LEU B 2 447 ? 27.926  -6.333  37.927 1.00 26.62 ? 448  LEU A O     1 
ATOM   5054  C  CB    . LEU B 2 447 ? 24.727  -6.928  37.954 1.00 26.17 ? 448  LEU A CB    1 
ATOM   5055  C  CG    . LEU B 2 447 ? 23.649  -5.863  37.924 1.00 27.69 ? 448  LEU A CG    1 
ATOM   5056  C  CD1   . LEU B 2 447 ? 22.758  -6.025  39.134 1.00 31.43 ? 448  LEU A CD1   1 
ATOM   5057  C  CD2   . LEU B 2 447 ? 24.277  -4.471  37.898 1.00 24.65 ? 448  LEU A CD2   1 
ATOM   5058  N  N     . LEU B 2 448 ? 27.444  -8.490  37.574 1.00 27.93 ? 449  LEU A N     1 
ATOM   5059  C  CA    . LEU B 2 448 ? 28.692  -8.967  38.143 1.00 29.32 ? 449  LEU A CA    1 
ATOM   5060  C  C     . LEU B 2 448 ? 29.843  -8.440  37.322 1.00 30.06 ? 449  LEU A C     1 
ATOM   5061  O  O     . LEU B 2 448 ? 30.862  -8.038  37.858 1.00 32.38 ? 449  LEU A O     1 
ATOM   5062  C  CB    . LEU B 2 448 ? 28.721  -10.490 38.160 1.00 28.24 ? 449  LEU A CB    1 
ATOM   5063  C  CG    . LEU B 2 448 ? 27.592  -11.151 38.937 1.00 27.01 ? 449  LEU A CG    1 
ATOM   5064  C  CD1   . LEU B 2 448 ? 27.569  -12.639 38.650 1.00 28.15 ? 449  LEU A CD1   1 
ATOM   5065  C  CD2   . LEU B 2 448 ? 27.761  -10.881 40.413 1.00 26.44 ? 449  LEU A CD2   1 
ATOM   5066  N  N     . ASN B 2 449 ? 29.668  -8.459  36.009 1.00 30.89 ? 450  ASN A N     1 
ATOM   5067  C  CA    . ASN B 2 449 ? 30.663  -7.948  35.090 1.00 29.73 ? 450  ASN A CA    1 
ATOM   5068  C  C     . ASN B 2 449 ? 30.826  -6.439  35.262 1.00 28.03 ? 450  ASN A C     1 
ATOM   5069  O  O     . ASN B 2 449 ? 31.931  -5.912  35.229 1.00 24.77 ? 450  ASN A O     1 
ATOM   5070  C  CB    . ASN B 2 449 ? 30.281  -8.302  33.658 1.00 31.13 ? 450  ASN A CB    1 
ATOM   5071  C  CG    . ASN B 2 449 ? 31.315  -7.858  32.661 1.00 33.91 ? 450  ASN A CG    1 
ATOM   5072  O  OD1   . ASN B 2 449 ? 32.441  -8.363  32.649 1.00 35.10 ? 450  ASN A OD1   1 
ATOM   5073  N  ND2   . ASN B 2 449 ? 30.949  -6.904  31.817 1.00 36.26 ? 450  ASN A ND2   1 
ATOM   5074  N  N     . TYR B 2 450 ? 29.695  -5.760  35.432 1.00 25.85 ? 451  TYR A N     1 
ATOM   5075  C  CA    . TYR B 2 450 ? 29.633  -4.319  35.637 1.00 25.62 ? 451  TYR A CA    1 
ATOM   5076  C  C     . TYR B 2 450 ? 30.278  -3.899  36.953 1.00 24.98 ? 451  TYR A C     1 
ATOM   5077  O  O     . TYR B 2 450 ? 30.956  -2.884  37.014 1.00 25.11 ? 451  TYR A O     1 
ATOM   5078  C  CB    . TYR B 2 450 ? 28.179  -3.843  35.563 1.00 27.69 ? 451  TYR A CB    1 
ATOM   5079  C  CG    . TYR B 2 450 ? 27.958  -2.358  35.783 1.00 27.35 ? 451  TYR A CG    1 
ATOM   5080  C  CD1   . TYR B 2 450 ? 28.505  -1.419  34.930 1.00 26.28 ? 451  TYR A CD1   1 
ATOM   5081  C  CD2   . TYR B 2 450 ? 27.174  -1.906  36.828 1.00 25.87 ? 451  TYR A CD2   1 
ATOM   5082  C  CE1   . TYR B 2 450 ? 28.296  -0.077  35.117 1.00 25.51 ? 451  TYR A CE1   1 
ATOM   5083  C  CE2   . TYR B 2 450 ? 26.953  -0.566  37.027 1.00 25.22 ? 451  TYR A CE2   1 
ATOM   5084  C  CZ    . TYR B 2 450 ? 27.517  0.349   36.169 1.00 26.10 ? 451  TYR A CZ    1 
ATOM   5085  O  OH    . TYR B 2 450 ? 27.300  1.687   36.365 1.00 25.94 ? 451  TYR A OH    1 
ATOM   5086  N  N     . ILE B 2 451 ? 30.058  -4.680  38.001 1.00 24.25 ? 452  ILE A N     1 
ATOM   5087  C  CA    . ILE B 2 451 ? 30.632  -4.381  39.305 1.00 26.53 ? 452  ILE A CA    1 
ATOM   5088  C  C     . ILE B 2 451 ? 32.146  -4.416  39.191 1.00 29.70 ? 452  ILE A C     1 
ATOM   5089  O  O     . ILE B 2 451 ? 32.846  -3.584  39.764 1.00 30.03 ? 452  ILE A O     1 
ATOM   5090  C  CB    . ILE B 2 451 ? 30.160  -5.383  40.389 1.00 25.44 ? 452  ILE A CB    1 
ATOM   5091  C  CG1   . ILE B 2 451 ? 28.692  -5.134  40.738 1.00 24.18 ? 452  ILE A CG1   1 
ATOM   5092  C  CG2   . ILE B 2 451 ? 31.000  -5.273  41.652 1.00 22.81 ? 452  ILE A CG2   1 
ATOM   5093  C  CD1   . ILE B 2 451 ? 28.131  -6.096  41.757 1.00 23.86 ? 452  ILE A CD1   1 
ATOM   5094  N  N     . SER B 2 452 ? 32.635  -5.391  38.436 1.00 28.50 ? 453  SER A N     1 
ATOM   5095  C  CA    . SER B 2 452 ? 34.058  -5.574  38.220 1.00 29.41 ? 453  SER A CA    1 
ATOM   5096  C  C     . SER B 2 452 ? 34.674  -4.391  37.491 1.00 27.92 ? 453  SER A C     1 
ATOM   5097  O  O     . SER B 2 452 ? 35.775  -3.972  37.798 1.00 31.37 ? 453  SER A O     1 
ATOM   5098  C  CB    . SER B 2 452 ? 34.296  -6.855  37.426 1.00 31.45 ? 453  SER A CB    1 
ATOM   5099  O  OG    . SER B 2 452 ? 35.654  -7.218  37.434 1.00 36.00 ? 453  SER A OG    1 
ATOM   5100  N  N     . GLU B 2 453 ? 33.954  -3.862  36.518 1.00 27.92 ? 454  GLU A N     1 
ATOM   5101  C  CA    . GLU B 2 453 ? 34.424  -2.731  35.740 1.00 29.82 ? 454  GLU A CA    1 
ATOM   5102  C  C     . GLU B 2 453 ? 34.570  -1.478  36.585 1.00 31.17 ? 454  GLU A C     1 
ATOM   5103  O  O     . GLU B 2 453 ? 35.459  -0.666  36.350 1.00 33.20 ? 454  GLU A O     1 
ATOM   5104  C  CB    . GLU B 2 453 ? 33.467  -2.457  34.590 1.00 29.44 ? 454  GLU A CB    1 
ATOM   5105  C  CG    . GLU B 2 453 ? 33.472  -3.546  33.531 1.00 31.36 ? 454  GLU A CG    1 
ATOM   5106  C  CD    . GLU B 2 453 ? 32.442  -3.277  32.451 1.00 32.13 ? 454  GLU A CD    1 
ATOM   5107  O  OE1   . GLU B 2 453 ? 31.329  -2.825  32.777 1.00 27.97 ? 454  GLU A OE1   1 
ATOM   5108  O  OE2   . GLU B 2 453 ? 32.762  -3.529  31.277 1.00 32.51 ? 454  GLU A OE2   1 
ATOM   5109  N  N     . LEU B 2 454 ? 33.687  -1.330  37.567 1.00 29.81 ? 455  LEU A N     1 
ATOM   5110  C  CA    . LEU B 2 454 ? 33.702  -0.167  38.455 1.00 28.62 ? 455  LEU A CA    1 
ATOM   5111  C  C     . LEU B 2 454 ? 34.808  -0.251  39.501 1.00 29.47 ? 455  LEU A C     1 
ATOM   5112  O  O     . LEU B 2 454 ? 35.414  0.760   39.847 1.00 32.31 ? 455  LEU A O     1 
ATOM   5113  C  CB    . LEU B 2 454 ? 32.340  0.021   39.138 1.00 27.11 ? 455  LEU A CB    1 
ATOM   5114  C  CG    . LEU B 2 454 ? 31.105  0.156   38.241 1.00 27.05 ? 455  LEU A CG    1 
ATOM   5115  C  CD1   . LEU B 2 454 ? 29.855  0.184   39.095 1.00 24.44 ? 455  LEU A CD1   1 
ATOM   5116  C  CD2   . LEU B 2 454 ? 31.166  1.364   37.293 1.00 25.91 ? 455  LEU A CD2   1 
ATOM   5117  N  N     . GLU B 2 455 ? 35.061  -1.453  40.008 1.00 30.01 ? 456  GLU A N     1 
ATOM   5118  C  CA    . GLU B 2 455 ? 36.125  -1.669  40.986 1.00 28.55 ? 456  GLU A CA    1 
ATOM   5119  C  C     . GLU B 2 455 ? 37.502  -1.462  40.349 1.00 28.19 ? 456  GLU A C     1 
ATOM   5120  O  O     . GLU B 2 455 ? 38.417  -0.950  40.995 1.00 29.13 ? 456  GLU A O     1 
ATOM   5121  C  CB    . GLU B 2 455 ? 35.994  -3.049  41.630 1.00 28.42 ? 456  GLU A CB    1 
ATOM   5122  C  CG    . GLU B 2 455 ? 34.750  -3.176  42.510 1.00 31.84 ? 456  GLU A CG    1 
ATOM   5123  C  CD    . GLU B 2 455 ? 34.562  -4.561  43.115 1.00 32.70 ? 456  GLU A CD    1 
ATOM   5124  O  OE1   . GLU B 2 455 ? 33.953  -4.641  44.208 1.00 32.10 ? 456  GLU A OE1   1 
ATOM   5125  O  OE2   . GLU B 2 455 ? 35.019  -5.558  42.511 1.00 31.67 ? 456  GLU A OE2   1 
ATOM   5126  N  N     . THR B 2 456 ? 37.625  -1.846  39.075 1.00 25.48 ? 457  THR A N     1 
ATOM   5127  C  CA    . THR B 2 456 ? 38.843  -1.671  38.289 1.00 25.20 ? 457  THR A CA    1 
ATOM   5128  C  C     . THR B 2 456 ? 39.268  -0.191  38.245 1.00 25.04 ? 457  THR A C     1 
ATOM   5129  O  O     . THR B 2 456 ? 40.439  0.134   38.467 1.00 25.27 ? 457  THR A O     1 
ATOM   5130  C  CB    . THR B 2 456 ? 38.637  -2.210  36.841 1.00 26.41 ? 457  THR A CB    1 
ATOM   5131  O  OG1   . THR B 2 456 ? 38.317  -3.608  36.896 1.00 25.09 ? 457  THR A OG1   1 
ATOM   5132  C  CG2   . THR B 2 456 ? 39.885  -2.005  35.965 1.00 23.18 ? 457  THR A CG2   1 
ATOM   5133  N  N     . ILE B 2 457 ? 38.304  0.687   37.971 1.00 23.29 ? 458  ILE A N     1 
ATOM   5134  C  CA    . ILE B 2 457 ? 38.516  2.137   37.899 1.00 22.90 ? 458  ILE A CA    1 
ATOM   5135  C  C     . ILE B 2 457 ? 38.946  2.763   39.234 1.00 22.14 ? 458  ILE A C     1 
ATOM   5136  O  O     . ILE B 2 457 ? 39.871  3.577   39.273 1.00 21.04 ? 458  ILE A O     1 
ATOM   5137  C  CB    . ILE B 2 457 ? 37.254  2.858   37.342 1.00 24.06 ? 458  ILE A CB    1 
ATOM   5138  C  CG1   . ILE B 2 457 ? 37.027  2.455   35.872 1.00 24.48 ? 458  ILE A CG1   1 
ATOM   5139  C  CG2   . ILE B 2 457 ? 37.373  4.379   37.476 1.00 21.32 ? 458  ILE A CG2   1 
ATOM   5140  C  CD1   . ILE B 2 457 ? 35.740  2.991   35.265 1.00 26.08 ? 458  ILE A CD1   1 
ATOM   5141  N  N     . LEU B 2 458 ? 38.283  2.372   40.321 1.00 21.79 ? 459  LEU A N     1 
ATOM   5142  C  CA    . LEU B 2 458 ? 38.584  2.904   41.653 1.00 20.75 ? 459  LEU A CA    1 
ATOM   5143  C  C     . LEU B 2 458 ? 39.892  2.393   42.259 1.00 20.38 ? 459  LEU A C     1 
ATOM   5144  O  O     . LEU B 2 458 ? 40.397  2.965   43.222 1.00 19.99 ? 459  LEU A O     1 
ATOM   5145  C  CB    . LEU B 2 458 ? 37.424  2.626   42.611 1.00 21.75 ? 459  LEU A CB    1 
ATOM   5146  C  CG    . LEU B 2 458 ? 36.087  3.336   42.384 1.00 21.32 ? 459  LEU A CG    1 
ATOM   5147  C  CD1   . LEU B 2 458 ? 35.009  2.709   43.256 1.00 22.73 ? 459  LEU A CD1   1 
ATOM   5148  C  CD2   . LEU B 2 458 ? 36.188  4.840   42.629 1.00 22.62 ? 459  LEU A CD2   1 
ATOM   5149  N  N     . ALA B 2 459 ? 40.433  1.319   41.692 1.00 21.51 ? 460  ALA A N     1 
ATOM   5150  C  CA    . ALA B 2 459 ? 41.676  0.735   42.185 1.00 22.25 ? 460  ALA A CA    1 
ATOM   5151  C  C     . ALA B 2 459 ? 42.903  1.327   41.490 1.00 23.44 ? 460  ALA A C     1 
ATOM   5152  O  O     . ALA B 2 459 ? 44.030  1.107   41.930 1.00 24.75 ? 460  ALA A O     1 
ATOM   5153  C  CB    . ALA B 2 459 ? 41.644  -0.781  42.035 1.00 21.07 ? 460  ALA A CB    1 
ATOM   5154  N  N     . ASP B 2 460 ? 42.676  2.075   40.411 1.00 24.16 ? 461  ASP A N     1 
ATOM   5155  C  CA    . ASP B 2 460 ? 43.764  2.684   39.645 1.00 24.39 ? 461  ASP A CA    1 
ATOM   5156  C  C     . ASP B 2 460 ? 43.467  4.146   39.305 1.00 24.31 ? 461  ASP A C     1 
ATOM   5157  O  O     . ASP B 2 460 ? 42.573  4.440   38.505 1.00 25.05 ? 461  ASP A O     1 
ATOM   5158  C  CB    . ASP B 2 460 ? 44.038  1.865   38.378 1.00 24.26 ? 461  ASP A CB    1 
ATOM   5159  C  CG    . ASP B 2 460 ? 45.251  2.355   37.596 1.00 25.49 ? 461  ASP A CG    1 
ATOM   5160  O  OD1   . ASP B 2 460 ? 45.808  3.428   37.915 1.00 24.85 ? 461  ASP A OD1   1 
ATOM   5161  O  OD2   . ASP B 2 460 ? 45.652  1.646   36.645 1.00 25.84 ? 461  ASP A OD2   1 
ATOM   5162  N  N     . GLU B 2 461 ? 44.245  5.043   39.905 1.00 25.17 ? 462  GLU A N     1 
ATOM   5163  C  CA    . GLU B 2 461 ? 44.101  6.499   39.715 1.00 25.61 ? 462  GLU A CA    1 
ATOM   5164  C  C     . GLU B 2 461 ? 44.263  6.991   38.275 1.00 23.58 ? 462  GLU A C     1 
ATOM   5165  O  O     . GLU B 2 461 ? 43.700  8.023   37.910 1.00 24.44 ? 462  GLU A O     1 
ATOM   5166  C  CB    . GLU B 2 461 ? 45.079  7.255   40.627 1.00 24.23 ? 462  GLU A CB    1 
ATOM   5167  C  CG    . GLU B 2 461 ? 44.827  7.066   42.123 1.00 30.44 ? 462  GLU A CG    1 
ATOM   5168  C  CD    . GLU B 2 461 ? 43.502  7.686   42.588 1.00 34.37 ? 462  GLU A CD    1 
ATOM   5169  O  OE1   . GLU B 2 461 ? 43.052  8.692   41.983 1.00 36.04 ? 462  GLU A OE1   1 
ATOM   5170  O  OE2   . GLU B 2 461 ? 42.914  7.182   43.572 1.00 36.02 ? 462  GLU A OE2   1 
ATOM   5171  N  N     . GLU B 2 462 ? 45.018  6.256   37.465 1.00 21.85 ? 463  GLU A N     1 
ATOM   5172  C  CA    . GLU B 2 462 ? 45.252  6.646   36.073 1.00 22.50 ? 463  GLU A CA    1 
ATOM   5173  C  C     . GLU B 2 462 ? 44.050  6.352   35.154 1.00 22.23 ? 463  GLU A C     1 
ATOM   5174  O  O     . GLU B 2 462 ? 43.804  7.082   34.189 1.00 21.76 ? 463  GLU A O     1 
ATOM   5175  C  CB    . GLU B 2 462 ? 46.550  6.011   35.533 1.00 24.45 ? 463  GLU A CB    1 
ATOM   5176  C  CG    . GLU B 2 462 ? 46.999  6.538   34.165 1.00 25.36 ? 463  GLU A CG    1 
ATOM   5177  C  CD    . GLU B 2 462 ? 47.245  8.057   34.153 1.00 29.11 ? 463  GLU A CD    1 
ATOM   5178  O  OE1   . GLU B 2 462 ? 46.804  8.722   33.187 1.00 24.81 ? 463  GLU A OE1   1 
ATOM   5179  O  OE2   . GLU B 2 462 ? 47.867  8.578   35.136 1.00 30.62 ? 463  GLU A OE2   1 
ATOM   5180  N  N     . VAL B 2 463 ? 43.306  5.289   35.462 1.00 21.04 ? 464  VAL A N     1 
ATOM   5181  C  CA    . VAL B 2 463 ? 42.123  4.916   34.681 1.00 20.81 ? 464  VAL A CA    1 
ATOM   5182  C  C     . VAL B 2 463 ? 40.990  5.904   34.976 1.00 20.73 ? 464  VAL A C     1 
ATOM   5183  O  O     . VAL B 2 463 ? 40.176  6.214   34.099 1.00 21.54 ? 464  VAL A O     1 
ATOM   5184  C  CB    . VAL B 2 463 ? 41.687  3.439   34.947 1.00 21.34 ? 464  VAL A CB    1 
ATOM   5185  C  CG1   . VAL B 2 463 ? 40.493  3.046   34.079 1.00 19.57 ? 464  VAL A CG1   1 
ATOM   5186  C  CG2   . VAL B 2 463 ? 42.850  2.478   34.702 1.00 18.83 ? 464  VAL A CG2   1 
ATOM   5187  N  N     . LEU B 2 464 ? 40.961  6.409   36.211 1.00 21.17 ? 465  LEU A N     1 
ATOM   5188  C  CA    . LEU B 2 464 ? 39.971  7.403   36.641 1.00 20.47 ? 465  LEU A CA    1 
ATOM   5189  C  C     . LEU B 2 464 ? 40.216  8.761   35.979 1.00 20.97 ? 465  LEU A C     1 
ATOM   5190  O  O     . LEU B 2 464 ? 39.277  9.398   35.483 1.00 20.57 ? 465  LEU A O     1 
ATOM   5191  C  CB    . LEU B 2 464 ? 39.983  7.557   38.162 1.00 22.76 ? 465  LEU A CB    1 
ATOM   5192  C  CG    . LEU B 2 464 ? 39.133  8.669   38.791 1.00 25.06 ? 465  LEU A CG    1 
ATOM   5193  C  CD1   . LEU B 2 464 ? 37.645  8.484   38.499 1.00 27.75 ? 465  LEU A CD1   1 
ATOM   5194  C  CD2   . LEU B 2 464 ? 39.371  8.766   40.279 1.00 24.83 ? 465  LEU A CD2   1 
ATOM   5195  N  N     . LEU B 2 465 ? 41.478  9.195   35.986 1.00 19.94 ? 466  LEU A N     1 
ATOM   5196  C  CA    . LEU B 2 465 ? 41.867  10.468  35.383 1.00 20.53 ? 466  LEU A CA    1 
ATOM   5197  C  C     . LEU B 2 465 ? 41.634  10.450  33.876 1.00 20.82 ? 466  LEU A C     1 
ATOM   5198  O  O     . LEU B 2 465 ? 41.126  11.422  33.309 1.00 22.58 ? 466  LEU A O     1 
ATOM   5199  C  CB    . LEU B 2 465 ? 43.327  10.803  35.718 1.00 19.90 ? 466  LEU A CB    1 
ATOM   5200  C  CG    . LEU B 2 465 ? 43.931  12.125  35.232 1.00 20.66 ? 466  LEU A CG    1 
ATOM   5201  C  CD1   . LEU B 2 465 ? 43.049  13.338  35.586 1.00 18.03 ? 466  LEU A CD1   1 
ATOM   5202  C  CD2   . LEU B 2 465 ? 45.345  12.273  35.806 1.00 20.13 ? 466  LEU A CD2   1 
ATOM   5203  N  N     . GLN B 2 466 ? 41.992  9.337   33.238 1.00 20.16 ? 467  GLN A N     1 
ATOM   5204  C  CA    . GLN B 2 466 ? 41.787  9.165   31.804 1.00 20.51 ? 467  GLN A CA    1 
ATOM   5205  C  C     . GLN B 2 466 ? 40.297  9.243   31.461 1.00 20.91 ? 467  GLN A C     1 
ATOM   5206  O  O     . GLN B 2 466 ? 39.926  9.768   30.408 1.00 21.20 ? 467  GLN A O     1 
ATOM   5207  C  CB    . GLN B 2 466 ? 42.379  7.835   31.328 1.00 18.08 ? 467  GLN A CB    1 
ATOM   5208  C  CG    . GLN B 2 466 ? 42.210  7.561   29.838 1.00 17.77 ? 467  GLN A CG    1 
ATOM   5209  C  CD    . GLN B 2 466 ? 42.936  8.558   28.949 1.00 18.14 ? 467  GLN A CD    1 
ATOM   5210  O  OE1   . GLN B 2 466 ? 44.047  8.999   29.260 1.00 18.60 ? 467  GLN A OE1   1 
ATOM   5211  N  NE2   . GLN B 2 466 ? 42.315  8.916   27.825 1.00 17.57 ? 467  GLN A NE2   1 
ATOM   5212  N  N     . LEU B 2 467 ? 39.455  8.725   32.362 1.00 19.39 ? 468  LEU A N     1 
ATOM   5213  C  CA    . LEU B 2 467 ? 38.007  8.741   32.180 1.00 19.02 ? 468  LEU A CA    1 
ATOM   5214  C  C     . LEU B 2 467 ? 37.476  10.178  32.184 1.00 20.54 ? 468  LEU A C     1 
ATOM   5215  O  O     . LEU B 2 467 ? 36.553  10.513  31.427 1.00 20.21 ? 468  LEU A O     1 
ATOM   5216  C  CB    . LEU B 2 467 ? 37.318  7.888   33.250 1.00 18.14 ? 468  LEU A CB    1 
ATOM   5217  C  CG    . LEU B 2 467 ? 35.790  7.732   33.200 1.00 16.72 ? 468  LEU A CG    1 
ATOM   5218  C  CD1   . LEU B 2 467 ? 35.325  7.216   31.851 1.00 15.24 ? 468  LEU A CD1   1 
ATOM   5219  C  CD2   . LEU B 2 467 ? 35.298  6.827   34.334 1.00 14.52 ? 468  LEU A CD2   1 
ATOM   5220  N  N     . VAL B 2 468 ? 38.066  11.019  33.031 1.00 20.68 ? 469  VAL A N     1 
ATOM   5221  C  CA    . VAL B 2 468 ? 37.712  12.434  33.084 1.00 20.98 ? 469  VAL A CA    1 
ATOM   5222  C  C     . VAL B 2 468 ? 38.091  13.077  31.747 1.00 20.44 ? 469  VAL A C     1 
ATOM   5223  O  O     . VAL B 2 468 ? 37.314  13.857  31.184 1.00 20.86 ? 469  VAL A O     1 
ATOM   5224  C  CB    . VAL B 2 468 ? 38.421  13.161  34.255 1.00 22.18 ? 469  VAL A CB    1 
ATOM   5225  C  CG1   . VAL B 2 468 ? 38.158  14.665  34.216 1.00 23.50 ? 469  VAL A CG1   1 
ATOM   5226  C  CG2   . VAL B 2 468 ? 37.988  12.575  35.593 1.00 20.99 ? 469  VAL A CG2   1 
ATOM   5227  N  N     . ARG B 2 469 ? 39.274  12.722  31.238 1.00 19.21 ? 470  ARG A N     1 
ATOM   5228  C  CA    . ARG B 2 469 ? 39.770  13.237  29.957 1.00 18.14 ? 470  ARG A CA    1 
ATOM   5229  C  C     . ARG B 2 469 ? 38.820  12.940  28.808 1.00 18.14 ? 470  ARG A C     1 
ATOM   5230  O  O     . ARG B 2 469 ? 38.490  13.839  28.035 1.00 17.77 ? 470  ARG A O     1 
ATOM   5231  C  CB    . ARG B 2 469 ? 41.156  12.667  29.636 1.00 19.73 ? 470  ARG A CB    1 
ATOM   5232  C  CG    . ARG B 2 469 ? 42.256  13.107  30.570 1.00 18.73 ? 470  ARG A CG    1 
ATOM   5233  C  CD    . ARG B 2 469 ? 43.475  12.236  30.364 1.00 19.58 ? 470  ARG A CD    1 
ATOM   5234  N  NE    . ARG B 2 469 ? 44.564  12.583  31.279 1.00 18.40 ? 470  ARG A NE    1 
ATOM   5235  C  CZ    . ARG B 2 469 ? 45.560  11.769  31.603 1.00 18.18 ? 470  ARG A CZ    1 
ATOM   5236  N  NH1   . ARG B 2 469 ? 45.604  10.536  31.117 1.00 16.09 ? 470  ARG A NH1   1 
ATOM   5237  N  NH2   . ARG B 2 469 ? 46.502  12.181  32.443 1.00 20.37 ? 470  ARG A NH2   1 
ATOM   5238  N  N     . ASP B 2 470 ? 38.382  11.682  28.710 1.00 18.11 ? 471  ASP A N     1 
ATOM   5239  C  CA    . ASP B 2 470 ? 37.445  11.240  27.660 1.00 18.55 ? 471  ASP A CA    1 
ATOM   5240  C  C     . ASP B 2 470 ? 36.130  12.008  27.721 1.00 18.11 ? 471  ASP A C     1 
ATOM   5241  O  O     . ASP B 2 470 ? 35.615  12.457  26.690 1.00 18.63 ? 471  ASP A O     1 
ATOM   5242  C  CB    . ASP B 2 470 ? 37.159  9.735   27.762 1.00 18.02 ? 471  ASP A CB    1 
ATOM   5243  C  CG    . ASP B 2 470 ? 38.404  8.872   27.580 1.00 19.20 ? 471  ASP A CG    1 
ATOM   5244  O  OD1   . ASP B 2 470 ? 39.492  9.420   27.256 1.00 18.54 ? 471  ASP A OD1   1 
ATOM   5245  O  OD2   . ASP B 2 470 ? 38.244  7.632   27.792 1.00 19.30 ? 471  ASP A OD2   1 
ATOM   5246  N  N     . GLU B 2 471 ? 35.596  12.158  28.930 1.00 16.65 ? 472  GLU A N     1 
ATOM   5247  C  CA    . GLU B 2 471 ? 34.345  12.882  29.115 1.00 16.87 ? 472  GLU A CA    1 
ATOM   5248  C  C     . GLU B 2 471 ? 34.514  14.372  28.842 1.00 17.19 ? 472  GLU A C     1 
ATOM   5249  O  O     . GLU B 2 471 ? 33.584  15.007  28.365 1.00 18.60 ? 472  GLU A O     1 
ATOM   5250  C  CB    . GLU B 2 471 ? 33.732  12.612  30.491 1.00 17.00 ? 472  GLU A CB    1 
ATOM   5251  C  CG    . GLU B 2 471 ? 33.313  11.157  30.675 1.00 17.09 ? 472  GLU A CG    1 
ATOM   5252  C  CD    . GLU B 2 471 ? 32.534  10.915  31.948 1.00 18.15 ? 472  GLU A CD    1 
ATOM   5253  O  OE1   . GLU B 2 471 ? 32.062  11.889  32.560 1.00 17.37 ? 472  GLU A OE1   1 
ATOM   5254  O  OE2   . GLU B 2 471 ? 32.371  9.741   32.331 1.00 20.92 ? 472  GLU A OE2   1 
ATOM   5255  N  N     . LEU B 2 472 ? 35.691  14.920  29.136 1.00 16.93 ? 473  LEU A N     1 
ATOM   5256  C  CA    . LEU B 2 472 ? 35.980  16.317  28.809 1.00 16.49 ? 473  LEU A CA    1 
ATOM   5257  C  C     . LEU B 2 472 ? 36.104  16.485  27.298 1.00 17.17 ? 473  LEU A C     1 
ATOM   5258  O  O     . LEU B 2 472 ? 35.536  17.415  26.716 1.00 17.46 ? 473  LEU A O     1 
ATOM   5259  C  CB    . LEU B 2 472 ? 37.251  16.813  29.504 1.00 15.59 ? 473  LEU A CB    1 
ATOM   5260  C  CG    . LEU B 2 472 ? 37.141  17.171  30.993 1.00 15.34 ? 473  LEU A CG    1 
ATOM   5261  C  CD1   . LEU B 2 472 ? 38.526  17.430  31.567 1.00 15.61 ? 473  LEU A CD1   1 
ATOM   5262  C  CD2   . LEU B 2 472 ? 36.237  18.371  31.209 1.00 14.60 ? 473  LEU A CD2   1 
ATOM   5263  N  N     . THR B 2 473 ? 36.840  15.569  26.670 1.00 16.68 ? 474  THR A N     1 
ATOM   5264  C  CA    . THR B 2 473 ? 37.051  15.573  25.228 1.00 16.74 ? 474  THR A CA    1 
ATOM   5265  C  C     . THR B 2 473 ? 35.707  15.459  24.507 1.00 16.49 ? 474  THR A C     1 
ATOM   5266  O  O     . THR B 2 473 ? 35.498  16.074  23.458 1.00 16.05 ? 474  THR A O     1 
ATOM   5267  C  CB    . THR B 2 473 ? 37.971  14.396  24.803 1.00 16.92 ? 474  THR A CB    1 
ATOM   5268  O  OG1   . THR B 2 473 ? 39.184  14.431  25.568 1.00 19.24 ? 474  THR A OG1   1 
ATOM   5269  C  CG2   . THR B 2 473 ? 38.313  14.463  23.319 1.00 17.14 ? 474  THR A CG2   1 
ATOM   5270  N  N     . GLU B 2 474 ? 34.801  14.678  25.088 1.00 16.29 ? 475  GLU A N     1 
ATOM   5271  C  CA    . GLU B 2 474 ? 33.474  14.454  24.519 1.00 17.44 ? 475  GLU A CA    1 
ATOM   5272  C  C     . GLU B 2 474 ? 32.654  15.760  24.538 1.00 16.30 ? 475  GLU A C     1 
ATOM   5273  O  O     . GLU B 2 474 ? 31.953  16.071  23.570 1.00 15.62 ? 475  GLU A O     1 
ATOM   5274  C  CB    . GLU B 2 474 ? 32.786  13.286  25.247 1.00 19.26 ? 475  GLU A CB    1 
ATOM   5275  C  CG    . GLU B 2 474 ? 31.593  12.657  24.534 1.00 21.94 ? 475  GLU A CG    1 
ATOM   5276  C  CD    . GLU B 2 474 ? 30.290  13.448  24.707 1.00 24.62 ? 475  GLU A CD    1 
ATOM   5277  O  OE1   . GLU B 2 474 ? 29.391  13.286  23.854 1.00 29.63 ? 475  GLU A OE1   1 
ATOM   5278  O  OE2   . GLU B 2 474 ? 30.157  14.221  25.683 1.00 23.19 ? 475  GLU A OE2   1 
ATOM   5279  N  N     . ILE B 2 475 ? 32.770  16.524  25.627 1.00 16.00 ? 476  ILE A N     1 
ATOM   5280  C  CA    . ILE B 2 475 ? 32.098  17.824  25.751 1.00 15.52 ? 476  ILE A CA    1 
ATOM   5281  C  C     . ILE B 2 475 ? 32.670  18.750  24.677 1.00 15.53 ? 476  ILE A C     1 
ATOM   5282  O  O     . ILE B 2 475 ? 31.929  19.368  23.910 1.00 14.46 ? 476  ILE A O     1 
ATOM   5283  C  CB    . ILE B 2 475 ? 32.306  18.473  27.159 1.00 15.34 ? 476  ILE A CB    1 
ATOM   5284  C  CG1   . ILE B 2 475 ? 31.894  17.530  28.303 1.00 15.24 ? 476  ILE A CG1   1 
ATOM   5285  C  CG2   . ILE B 2 475 ? 31.573  19.811  27.275 1.00 15.22 ? 476  ILE A CG2   1 
ATOM   5286  C  CD1   . ILE B 2 475 ? 30.458  17.135  28.327 1.00 13.45 ? 476  ILE A CD1   1 
ATOM   5287  N  N     . ARG B 2 476 ? 34.001  18.817  24.632 1.00 16.29 ? 477  ARG A N     1 
ATOM   5288  C  CA    . ARG B 2 476 ? 34.738  19.631  23.673 1.00 16.03 ? 477  ARG A CA    1 
ATOM   5289  C  C     . ARG B 2 476 ? 34.225  19.429  22.240 1.00 16.35 ? 477  ARG A C     1 
ATOM   5290  O  O     . ARG B 2 476 ? 33.794  20.386  21.601 1.00 16.03 ? 477  ARG A O     1 
ATOM   5291  C  CB    . ARG B 2 476 ? 36.229  19.311  23.765 1.00 17.54 ? 477  ARG A CB    1 
ATOM   5292  C  CG    . ARG B 2 476 ? 37.131  20.184  22.897 1.00 20.53 ? 477  ARG A CG    1 
ATOM   5293  C  CD    . ARG B 2 476 ? 38.529  19.591  22.778 1.00 22.47 ? 477  ARG A CD    1 
ATOM   5294  N  NE    . ARG B 2 476 ? 38.546  18.406  21.917 1.00 24.22 ? 477  ARG A NE    1 
ATOM   5295  C  CZ    . ARG B 2 476 ? 39.610  17.623  21.717 1.00 26.17 ? 477  ARG A CZ    1 
ATOM   5296  N  NH1   . ARG B 2 476 ? 40.764  17.868  22.331 1.00 26.10 ? 477  ARG A NH1   1 
ATOM   5297  N  NH2   . ARG B 2 476 ? 39.515  16.579  20.906 1.00 25.08 ? 477  ARG A NH2   1 
ATOM   5298  N  N     . ASP B 2 477 ? 34.253  18.186  21.752 1.00 16.43 ? 478  ASP A N     1 
ATOM   5299  C  CA    . ASP B 2 477 ? 33.813  17.856  20.379 1.00 17.06 ? 478  ASP A CA    1 
ATOM   5300  C  C     . ASP B 2 477 ? 32.350  18.208  20.088 1.00 17.58 ? 478  ASP A C     1 
ATOM   5301  O  O     . ASP B 2 477 ? 32.013  18.620  18.976 1.00 19.36 ? 478  ASP A O     1 
ATOM   5302  C  CB    . ASP B 2 477 ? 34.038  16.368  20.073 1.00 17.34 ? 478  ASP A CB    1 
ATOM   5303  C  CG    . ASP B 2 477 ? 35.506  15.980  20.054 1.00 17.70 ? 478  ASP A CG    1 
ATOM   5304  O  OD1   . ASP B 2 477 ? 36.356  16.819  19.695 1.00 17.21 ? 478  ASP A OD1   1 
ATOM   5305  O  OD2   . ASP B 2 477 ? 35.808  14.812  20.381 1.00 18.58 ? 478  ASP A OD2   1 
ATOM   5306  N  N     . ARG B 2 478 ? 31.494  18.049  21.094 1.00 16.74 ? 479  ARG A N     1 
ATOM   5307  C  CA    . ARG B 2 478 ? 30.072  18.306  20.934 1.00 16.30 ? 479  ARG A CA    1 
ATOM   5308  C  C     . ARG B 2 478 ? 29.659  19.779  21.124 1.00 15.38 ? 479  ARG A C     1 
ATOM   5309  O  O     . ARG B 2 478 ? 28.736  20.246  20.460 1.00 16.93 ? 479  ARG A O     1 
ATOM   5310  C  CB    . ARG B 2 478 ? 29.272  17.352  21.837 1.00 17.02 ? 479  ARG A CB    1 
ATOM   5311  C  CG    . ARG B 2 478 ? 27.760  17.406  21.675 1.00 18.20 ? 479  ARG A CG    1 
ATOM   5312  C  CD    . ARG B 2 478 ? 27.103  16.142  22.223 1.00 21.89 ? 479  ARG A CD    1 
ATOM   5313  N  NE    . ARG B 2 478 ? 27.514  15.833  23.596 1.00 22.00 ? 479  ARG A NE    1 
ATOM   5314  C  CZ    . ARG B 2 478 ? 26.820  16.144  24.688 1.00 21.48 ? 479  ARG A CZ    1 
ATOM   5315  N  NH1   . ARG B 2 478 ? 25.649  16.767  24.593 1.00 19.91 ? 479  ARG A NH1   1 
ATOM   5316  N  NH2   . ARG B 2 478 ? 27.301  15.820  25.881 1.00 21.17 ? 479  ARG A NH2   1 
ATOM   5317  N  N     . PHE B 2 479 ? 30.352  20.510  21.995 1.00 13.82 ? 480  PHE A N     1 
ATOM   5318  C  CA    . PHE B 2 479 ? 30.001  21.910  22.278 1.00 12.77 ? 480  PHE A CA    1 
ATOM   5319  C  C     . PHE B 2 479 ? 31.054  22.938  21.899 1.00 13.10 ? 480  PHE A C     1 
ATOM   5320  O  O     . PHE B 2 479 ? 30.766  24.138  21.878 1.00 13.96 ? 480  PHE A O     1 
ATOM   5321  C  CB    . PHE B 2 479 ? 29.632  22.104  23.757 1.00 11.58 ? 480  PHE A CB    1 
ATOM   5322  C  CG    . PHE B 2 479 ? 28.385  21.384  24.174 1.00 10.50 ? 480  PHE A CG    1 
ATOM   5323  C  CD1   . PHE B 2 479 ? 27.129  21.909  23.867 1.00 10.23 ? 480  PHE A CD1   1 
ATOM   5324  C  CD2   . PHE B 2 479 ? 28.461  20.190  24.882 1.00 9.90  ? 480  PHE A CD2   1 
ATOM   5325  C  CE1   . PHE B 2 479 ? 25.960  21.241  24.242 1.00 9.19  ? 480  PHE A CE1   1 
ATOM   5326  C  CE2   . PHE B 2 479 ? 27.297  19.519  25.276 1.00 9.45  ? 480  PHE A CE2   1 
ATOM   5327  C  CZ    . PHE B 2 479 ? 26.044  20.050  24.954 1.00 9.51  ? 480  PHE A CZ    1 
ATOM   5328  N  N     . GLY B 2 480 ? 32.275  22.482  21.621 1.00 13.13 ? 481  GLY A N     1 
ATOM   5329  C  CA    . GLY B 2 480 ? 33.362  23.381  21.238 1.00 12.10 ? 481  GLY A CA    1 
ATOM   5330  C  C     . GLY B 2 480 ? 33.083  24.110  19.939 1.00 12.75 ? 481  GLY A C     1 
ATOM   5331  O  O     . GLY B 2 480 ? 32.562  23.517  18.977 1.00 12.95 ? 481  GLY A O     1 
ATOM   5332  N  N     . ASP B 2 481 ? 33.420  25.393  19.894 1.00 12.23 ? 482  ASP A N     1 
ATOM   5333  C  CA    . ASP B 2 481 ? 33.205  26.208  18.706 1.00 12.07 ? 482  ASP A CA    1 
ATOM   5334  C  C     . ASP B 2 481 ? 34.417  27.062  18.353 1.00 13.12 ? 482  ASP A C     1 
ATOM   5335  O  O     . ASP B 2 481 ? 35.411  27.050  19.052 1.00 13.02 ? 482  ASP A O     1 
ATOM   5336  C  CB    . ASP B 2 481 ? 31.996  27.114  18.906 1.00 12.28 ? 482  ASP A CB    1 
ATOM   5337  C  CG    . ASP B 2 481 ? 32.091  27.941  20.171 1.00 12.28 ? 482  ASP A CG    1 
ATOM   5338  O  OD1   . ASP B 2 481 ? 32.983  27.679  20.989 1.00 12.82 ? 482  ASP A OD1   1 
ATOM   5339  O  OD2   . ASP B 2 481 ? 31.270  28.848  20.346 1.00 11.02 ? 482  ASP A OD2   1 
ATOM   5340  N  N     . ASP B 2 482 ? 34.317  27.803  17.260 1.00 13.54 ? 483  ASP A N     1 
ATOM   5341  C  CA    . ASP B 2 482 ? 35.370  28.701  16.810 1.00 14.51 ? 483  ASP A CA    1 
ATOM   5342  C  C     . ASP B 2 482 ? 35.546  29.925  17.696 1.00 14.29 ? 483  ASP A C     1 
ATOM   5343  O  O     . ASP B 2 482 ? 34.606  30.393  18.333 1.00 14.23 ? 483  ASP A O     1 
ATOM   5344  C  CB    . ASP B 2 482 ? 35.102  29.173  15.361 1.00 14.21 ? 483  ASP A CB    1 
ATOM   5345  C  CG    . ASP B 2 482 ? 35.228  28.054  14.335 1.00 14.93 ? 483  ASP A CG    1 
ATOM   5346  O  OD1   . ASP B 2 482 ? 35.584  26.902  14.717 1.00 15.85 ? 483  ASP A OD1   1 
ATOM   5347  O  OD2   . ASP B 2 482 ? 34.958  28.352  13.150 1.00 15.05 ? 483  ASP A OD2   1 
ATOM   5348  N  N     . ARG B 2 483 ? 36.777  30.423  17.724 1.00 13.92 ? 484  ARG A N     1 
ATOM   5349  C  CA    . ARG B 2 483 ? 37.116  31.650  18.427 1.00 12.44 ? 484  ARG A CA    1 
ATOM   5350  C  C     . ARG B 2 483 ? 36.372  32.830  17.772 1.00 12.18 ? 484  ARG A C     1 
ATOM   5351  O  O     . ARG B 2 483 ? 36.337  32.944  16.543 1.00 11.38 ? 484  ARG A O     1 
ATOM   5352  C  CB    . ARG B 2 483 ? 38.632  31.852  18.393 1.00 11.48 ? 484  ARG A CB    1 
ATOM   5353  C  CG    . ARG B 2 483 ? 39.083  33.277  18.626 1.00 12.88 ? 484  ARG A CG    1 
ATOM   5354  C  CD    . ARG B 2 483 ? 40.544  33.349  19.044 1.00 13.40 ? 484  ARG A CD    1 
ATOM   5355  N  NE    . ARG B 2 483 ? 40.745  32.838  20.393 1.00 13.28 ? 484  ARG A NE    1 
ATOM   5356  C  CZ    . ARG B 2 483 ? 40.629  33.565  21.511 1.00 13.18 ? 484  ARG A CZ    1 
ATOM   5357  N  NH1   . ARG B 2 483 ? 40.313  34.856  21.457 1.00 11.87 ? 484  ARG A NH1   1 
ATOM   5358  N  NH2   . ARG B 2 483 ? 40.834  32.990  22.699 1.00 13.09 ? 484  ARG A NH2   1 
ATOM   5359  N  N     . ARG B 2 484 ? 35.797  33.698  18.598 1.00 12.33 ? 485  ARG A N     1 
ATOM   5360  C  CA    . ARG B 2 484 ? 35.061  34.861  18.116 1.00 12.07 ? 485  ARG A CA    1 
ATOM   5361  C  C     . ARG B 2 484 ? 35.878  36.146  18.169 1.00 13.55 ? 485  ARG A C     1 
ATOM   5362  O  O     . ARG B 2 484 ? 35.883  36.908  17.221 1.00 14.90 ? 485  ARG A O     1 
ATOM   5363  C  CB    . ARG B 2 484 ? 33.776  35.044  18.904 1.00 11.52 ? 485  ARG A CB    1 
ATOM   5364  C  CG    . ARG B 2 484 ? 32.790  33.908  18.769 1.00 11.21 ? 485  ARG A CG    1 
ATOM   5365  C  CD    . ARG B 2 484 ? 31.548  34.175  19.603 1.00 10.96 ? 485  ARG A CD    1 
ATOM   5366  N  NE    . ARG B 2 484 ? 30.506  33.197  19.346 1.00 10.85 ? 485  ARG A NE    1 
ATOM   5367  C  CZ    . ARG B 2 484 ? 29.373  33.130  20.035 1.00 11.16 ? 485  ARG A CZ    1 
ATOM   5368  N  NH1   . ARG B 2 484 ? 29.150  33.988  21.023 1.00 12.22 ? 485  ARG A NH1   1 
ATOM   5369  N  NH2   . ARG B 2 484 ? 28.461  32.224  19.761 1.00 9.92  ? 485  ARG A NH2   1 
ATOM   5370  N  N     . THR B 2 485 ? 36.563  36.382  19.279 1.00 14.41 ? 486  THR A N     1 
ATOM   5371  C  CA    . THR B 2 485 ? 37.377  37.587  19.430 1.00 15.28 ? 486  THR A CA    1 
ATOM   5372  C  C     . THR B 2 485 ? 38.769  37.397  18.832 1.00 16.03 ? 486  THR A C     1 
ATOM   5373  O  O     . THR B 2 485 ? 39.468  36.448  19.176 1.00 16.81 ? 486  THR A O     1 
ATOM   5374  C  CB    . THR B 2 485 ? 37.520  37.975  20.925 1.00 15.28 ? 486  THR A CB    1 
ATOM   5375  O  OG1   . THR B 2 485 ? 36.225  38.109  21.519 1.00 15.55 ? 486  THR A OG1   1 
ATOM   5376  C  CG2   . THR B 2 485 ? 38.277  39.285  21.082 1.00 14.81 ? 486  THR A CG2   1 
ATOM   5377  N  N     . GLU B 2 486 ? 39.175  38.310  17.954 1.00 17.57 ? 487  GLU A N     1 
ATOM   5378  C  CA    . GLU B 2 486 ? 40.495  38.245  17.321 1.00 16.88 ? 487  GLU A CA    1 
ATOM   5379  C  C     . GLU B 2 486 ? 41.543  38.993  18.144 1.00 18.57 ? 487  GLU A C     1 
ATOM   5380  O  O     . GLU B 2 486 ? 41.348  40.155  18.504 1.00 18.06 ? 487  GLU A O     1 
ATOM   5381  C  CB    . GLU B 2 486 ? 40.438  38.805  15.904 1.00 16.74 ? 487  GLU A CB    1 
ATOM   5382  C  CG    . GLU B 2 486 ? 41.791  38.833  15.185 1.00 17.36 ? 487  GLU A CG    1 
ATOM   5383  C  CD    . GLU B 2 486 ? 41.744  39.584  13.863 1.00 16.50 ? 487  GLU A CD    1 
ATOM   5384  O  OE1   . GLU B 2 486 ? 40.632  39.889  13.369 1.00 16.40 ? 487  GLU A OE1   1 
ATOM   5385  O  OE2   . GLU B 2 486 ? 42.817  39.871  13.314 1.00 16.98 ? 487  GLU A OE2   1 
ATOM   5386  N  N     . ILE B 2 487 ? 42.653  38.316  18.434 1.00 19.24 ? 488  ILE A N     1 
ATOM   5387  C  CA    . ILE B 2 487 ? 43.750  38.909  19.202 1.00 19.68 ? 488  ILE A CA    1 
ATOM   5388  C  C     . ILE B 2 487 ? 44.855  39.407  18.268 1.00 21.48 ? 488  ILE A C     1 
ATOM   5389  O  O     . ILE B 2 487 ? 45.624  38.619  17.708 1.00 21.25 ? 488  ILE A O     1 
ATOM   5390  C  CB    . ILE B 2 487 ? 44.320  37.916  20.255 1.00 18.79 ? 488  ILE A CB    1 
ATOM   5391  C  CG1   . ILE B 2 487 ? 43.216  37.486  21.230 1.00 17.86 ? 488  ILE A CG1   1 
ATOM   5392  C  CG2   . ILE B 2 487 ? 45.507  38.537  20.999 1.00 17.17 ? 488  ILE A CG2   1 
ATOM   5393  C  CD1   . ILE B 2 487 ? 43.576  36.341  22.152 1.00 17.20 ? 488  ILE A CD1   1 
ATOM   5394  N  N     . GLN B 2 488 ? 44.914  40.723  18.091 1.00 23.51 ? 489  GLN A N     1 
ATOM   5395  C  CA    . GLN B 2 488 ? 45.920  41.338  17.234 1.00 26.43 ? 489  GLN A CA    1 
ATOM   5396  C  C     . GLN B 2 488 ? 47.106  41.840  18.045 1.00 30.05 ? 489  GLN A C     1 
ATOM   5397  O  O     . GLN B 2 488 ? 46.943  42.342  19.165 1.00 27.60 ? 489  GLN A O     1 
ATOM   5398  C  CB    . GLN B 2 488 ? 45.327  42.465  16.380 1.00 25.31 ? 489  GLN A CB    1 
ATOM   5399  C  CG    . GLN B 2 488 ? 44.443  41.959  15.242 1.00 25.17 ? 489  GLN A CG    1 
ATOM   5400  C  CD    . GLN B 2 488 ? 43.982  43.063  14.287 1.00 24.23 ? 489  GLN A CD    1 
ATOM   5401  O  OE1   . GLN B 2 488 ? 44.240  44.246  14.498 1.00 24.63 ? 489  GLN A OE1   1 
ATOM   5402  N  NE2   . GLN B 2 488 ? 43.298  42.667  13.229 1.00 21.14 ? 489  GLN A NE2   1 
ATOM   5403  N  N     . LEU B 2 489 ? 48.289  41.707  17.464 1.00 33.72 ? 490  LEU A N     1 
ATOM   5404  C  CA    . LEU B 2 489 ? 49.500  42.161  18.111 1.00 41.52 ? 490  LEU A CA    1 
ATOM   5405  C  C     . LEU B 2 489 ? 50.113  43.312  17.326 1.00 44.39 ? 490  LEU A C     1 
ATOM   5406  O  O     . LEU B 2 489 ? 50.324  43.200  16.127 1.00 49.26 ? 490  LEU A O     1 
ATOM   5407  C  CB    . LEU B 2 489 ? 50.492  41.014  18.287 1.00 45.94 ? 490  LEU A CB    1 
ATOM   5408  C  CG    . LEU B 2 489 ? 50.700  40.071  17.111 1.00 48.72 ? 490  LEU A CG    1 
ATOM   5409  C  CD1   . LEU B 2 489 ? 51.653  40.693  16.101 1.00 47.32 ? 490  LEU A CD1   1 
ATOM   5410  C  CD2   . LEU B 2 489 ? 51.240  38.749  17.637 1.00 49.72 ? 490  LEU A CD2   1 
ATOM   5411  N  N     . GLY B 2 490 ? 50.396  44.429  17.990 1.00 47.77 ? 491  GLY A N     1 
ATOM   5412  C  CA    . GLY B 2 490 ? 50.157  44.596  19.416 1.00 48.50 ? 491  GLY A CA    1 
ATOM   5413  C  C     . GLY B 2 490 ? 49.862  46.034  19.758 1.00 50.07 ? 491  GLY A C     1 
ATOM   5414  O  O     . GLY B 2 490 ? 49.113  46.240  20.750 1.00 52.87 ? 491  GLY A O     1 
ATOM   5415  O  OXT   . GLY B 2 490 ? 50.342  46.926  19.052 1.00 45.53 ? 491  GLY A OXT   1 
ATOM   5416  N  N     . LYS C 1 9   ? 10.715  59.047  24.640 1.00 24.00 ? 417  LYS D N     1 
ATOM   5417  C  CA    . LYS C 1 9   ? 9.959   57.777  24.547 1.00 27.55 ? 417  LYS D CA    1 
ATOM   5418  C  C     . LYS C 1 9   ? 9.874   57.233  23.118 1.00 26.54 ? 417  LYS D C     1 
ATOM   5419  O  O     . LYS C 1 9   ? 9.842   56.018  22.923 1.00 26.08 ? 417  LYS D O     1 
ATOM   5420  C  CB    . LYS C 1 9   ? 8.556   57.959  25.114 1.00 26.68 ? 417  LYS D CB    1 
ATOM   5421  N  N     . LEU C 1 10  ? 9.858   58.131  22.137 1.00 26.33 ? 418  LEU D N     1 
ATOM   5422  C  CA    . LEU C 1 10  ? 9.770   57.750  20.722 1.00 24.75 ? 418  LEU D CA    1 
ATOM   5423  C  C     . LEU C 1 10  ? 11.118  57.241  20.202 1.00 24.92 ? 418  LEU D C     1 
ATOM   5424  O  O     . LEU C 1 10  ? 12.125  57.948  20.278 1.00 23.81 ? 418  LEU D O     1 
ATOM   5425  C  CB    . LEU C 1 10  ? 9.335   58.962  19.881 1.00 24.69 ? 418  LEU D CB    1 
ATOM   5426  C  CG    . LEU C 1 10  ? 8.699   58.886  18.482 1.00 25.90 ? 418  LEU D CG    1 
ATOM   5427  C  CD1   . LEU C 1 10  ? 8.799   60.260  17.835 1.00 26.76 ? 418  LEU D CD1   1 
ATOM   5428  C  CD2   . LEU C 1 10  ? 9.310   57.871  17.530 1.00 26.83 ? 418  LEU D CD2   1 
ATOM   5429  N  N     . ALA C 1 11  ? 11.129  56.012  19.686 1.00 24.68 ? 419  ALA D N     1 
ATOM   5430  C  CA    . ALA C 1 11  ? 12.323  55.421  19.075 1.00 21.76 ? 419  ALA D CA    1 
ATOM   5431  C  C     . ALA C 1 11  ? 12.160  55.574  17.568 1.00 23.25 ? 419  ALA D C     1 
ATOM   5432  O  O     . ALA C 1 11  ? 11.612  54.701  16.883 1.00 21.63 ? 419  ALA D O     1 
ATOM   5433  C  CB    . ALA C 1 11  ? 12.477  53.963  19.468 1.00 22.08 ? 419  ALA D CB    1 
ATOM   5434  N  N     . ASP C 1 12  ? 12.638  56.712  17.063 1.00 25.35 ? 420  ASP D N     1 
ATOM   5435  C  CA    . ASP C 1 12  ? 12.471  57.102  15.662 1.00 27.73 ? 420  ASP D CA    1 
ATOM   5436  C  C     . ASP C 1 12  ? 13.310  56.288  14.670 1.00 28.48 ? 420  ASP D C     1 
ATOM   5437  O  O     . ASP C 1 12  ? 14.202  55.533  15.057 1.00 29.01 ? 420  ASP D O     1 
ATOM   5438  C  CB    . ASP C 1 12  ? 12.752  58.609  15.530 1.00 29.61 ? 420  ASP D CB    1 
ATOM   5439  C  CG    . ASP C 1 12  ? 12.030  59.243  14.350 1.00 30.10 ? 420  ASP D CG    1 
ATOM   5440  O  OD1   . ASP C 1 12  ? 11.333  58.523  13.606 1.00 32.67 ? 420  ASP D OD1   1 
ATOM   5441  O  OD2   . ASP C 1 12  ? 12.145  60.476  14.183 1.00 26.73 ? 420  ASP D OD2   1 
ATOM   5442  N  N     . CYS C 1 13  ? 12.999  56.456  13.390 1.00 31.96 ? 421  CYS D N     1 
ATOM   5443  C  CA    . CYS C 1 13  ? 13.688  55.766  12.290 1.00 32.79 ? 421  CYS D CA    1 
ATOM   5444  C  C     . CYS C 1 13  ? 14.732  56.667  11.609 1.00 34.34 ? 421  CYS D C     1 
ATOM   5445  O  O     . CYS C 1 13  ? 14.821  57.860  11.913 1.00 32.16 ? 421  CYS D O     1 
ATOM   5446  C  CB    . CYS C 1 13  ? 12.673  55.226  11.279 1.00 29.93 ? 421  CYS D CB    1 
ATOM   5447  S  SG    . CYS C 1 13  ? 11.484  56.449  10.688 1.00 29.27 ? 421  CYS D SG    1 
ATOM   5448  N  N     . SER C 1 14  ? 15.518  56.082  10.698 1.00 38.03 ? 422  SER D N     1 
ATOM   5449  C  CA    . SER C 1 14  ? 16.594  56.794  9.991  1.00 39.26 ? 422  SER D CA    1 
ATOM   5450  C  C     . SER C 1 14  ? 16.102  57.803  8.957  1.00 35.91 ? 422  SER D C     1 
ATOM   5451  O  O     . SER C 1 14  ? 16.418  58.993  9.041  1.00 35.09 ? 422  SER D O     1 
ATOM   5452  C  CB    . SER C 1 14  ? 17.537  55.807  9.296  1.00 37.97 ? 422  SER D CB    1 
ATOM   5453  O  OG    . SER C 1 14  ? 18.150  54.942  10.224 1.00 44.62 ? 422  SER D OG    1 
ATOM   5454  N  N     . SER C 1 15  ? 15.344  57.313  7.978  1.00 34.02 ? 423  SER D N     1 
ATOM   5455  C  CA    . SER C 1 15  ? 14.835  58.138  6.886  1.00 37.00 ? 423  SER D CA    1 
ATOM   5456  C  C     . SER C 1 15  ? 13.941  59.277  7.375  1.00 38.90 ? 423  SER D C     1 
ATOM   5457  O  O     . SER C 1 15  ? 13.242  59.144  8.386  1.00 42.69 ? 423  SER D O     1 
ATOM   5458  C  CB    . SER C 1 15  ? 14.067  57.269  5.884  1.00 34.90 ? 423  SER D CB    1 
ATOM   5459  O  OG    . SER C 1 15  ? 13.531  58.040  4.823  1.00 40.78 ? 423  SER D OG    1 
ATOM   5460  N  N     . LYS C 1 16  ? 13.986  60.399  6.663  1.00 38.64 ? 424  LYS D N     1 
ATOM   5461  C  CA    . LYS C 1 16  ? 13.155  61.556  6.999  1.00 39.60 ? 424  LYS D CA    1 
ATOM   5462  C  C     . LYS C 1 16  ? 12.159  61.886  5.890  1.00 38.67 ? 424  LYS D C     1 
ATOM   5463  O  O     . LYS C 1 16  ? 11.620  62.993  5.830  1.00 41.45 ? 424  LYS D O     1 
ATOM   5464  C  CB    . LYS C 1 16  ? 14.008  62.768  7.397  1.00 37.91 ? 424  LYS D CB    1 
ATOM   5465  C  CG    . LYS C 1 16  ? 14.646  62.655  8.786  1.00 40.21 ? 424  LYS D CG    1 
ATOM   5466  C  CD    . LYS C 1 16  ? 13.598  62.756  9.898  1.00 40.28 ? 424  LYS D CD    1 
ATOM   5467  C  CE    . LYS C 1 16  ? 14.199  62.556  11.292 1.00 40.36 ? 424  LYS D CE    1 
ATOM   5468  N  NZ    . LYS C 1 16  ? 14.706  61.173  11.520 1.00 38.55 ? 424  LYS D NZ    1 
ATOM   5469  N  N     . SER C 1 17  ? 11.916  60.906  5.024  1.00 39.26 ? 425  SER D N     1 
ATOM   5470  C  CA    . SER C 1 17  ? 10.942  61.027  3.947  1.00 37.96 ? 425  SER D CA    1 
ATOM   5471  C  C     . SER C 1 17  ? 9.666   60.315  4.408  1.00 36.75 ? 425  SER D C     1 
ATOM   5472  O  O     . SER C 1 17  ? 9.624   59.085  4.445  1.00 35.33 ? 425  SER D O     1 
ATOM   5473  C  CB    . SER C 1 17  ? 11.489  60.416  2.653  1.00 40.43 ? 425  SER D CB    1 
ATOM   5474  O  OG    . SER C 1 17  ? 10.556  60.538  1.593  1.00 45.06 ? 425  SER D OG    1 
ATOM   5475  N  N     . PRO C 1 18  ? 8.623   61.093  4.768  1.00 38.19 ? 426  PRO D N     1 
ATOM   5476  C  CA    . PRO C 1 18  ? 7.359   60.572  5.301  1.00 36.37 ? 426  PRO D CA    1 
ATOM   5477  C  C     . PRO C 1 18  ? 6.611   59.606  4.385  1.00 38.61 ? 426  PRO D C     1 
ATOM   5478  O  O     . PRO C 1 18  ? 5.845   58.775  4.876  1.00 44.89 ? 426  PRO D O     1 
ATOM   5479  C  CB    . PRO C 1 18  ? 6.525   61.834  5.526  1.00 33.76 ? 426  PRO D CB    1 
ATOM   5480  C  CG    . PRO C 1 18  ? 7.522   62.926  5.662  1.00 35.70 ? 426  PRO D CG    1 
ATOM   5481  C  CD    . PRO C 1 18  ? 8.589   62.565  4.681  1.00 39.13 ? 426  PRO D CD    1 
ATOM   5482  N  N     . GLU C 1 19  ? 6.832   59.718  3.075  1.00 36.19 ? 427  GLU D N     1 
ATOM   5483  C  CA    . GLU C 1 19  ? 6.178   58.867  2.073  1.00 37.89 ? 427  GLU D CA    1 
ATOM   5484  C  C     . GLU C 1 19  ? 6.490   57.372  2.252  1.00 35.76 ? 427  GLU D C     1 
ATOM   5485  O  O     . GLU C 1 19  ? 5.663   56.518  1.925  1.00 36.80 ? 427  GLU D O     1 
ATOM   5486  C  CB    . GLU C 1 19  ? 6.553   59.311  0.642  1.00 44.09 ? 427  GLU D CB    1 
ATOM   5487  C  CG    . GLU C 1 19  ? 6.085   60.715  0.228  1.00 49.75 ? 427  GLU D CG    1 
ATOM   5488  C  CD    . GLU C 1 19  ? 6.816   61.854  0.948  1.00 57.49 ? 427  GLU D CD    1 
ATOM   5489  O  OE1   . GLU C 1 19  ? 7.978   61.666  1.384  1.00 59.87 ? 427  GLU D OE1   1 
ATOM   5490  O  OE2   . GLU C 1 19  ? 6.226   62.955  1.076  1.00 57.52 ? 427  GLU D OE2   1 
ATOM   5491  N  N     . GLU C 1 20  ? 7.677   57.068  2.770  1.00 33.28 ? 428  GLU D N     1 
ATOM   5492  C  CA    . GLU C 1 20  ? 8.100   55.686  2.981  1.00 35.20 ? 428  GLU D CA    1 
ATOM   5493  C  C     . GLU C 1 20  ? 8.179   55.277  4.460  1.00 33.49 ? 428  GLU D C     1 
ATOM   5494  O  O     . GLU C 1 20  ? 8.359   54.096  4.767  1.00 30.65 ? 428  GLU D O     1 
ATOM   5495  C  CB    . GLU C 1 20  ? 9.448   55.430  2.300  1.00 34.68 ? 428  GLU D CB    1 
ATOM   5496  C  CG    . GLU C 1 20  ? 10.613  56.247  2.859  1.00 34.33 ? 428  GLU D CG    1 
ATOM   5497  C  CD    . GLU C 1 20  ? 11.963  55.809  2.310  1.00 36.17 ? 428  GLU D CD    1 
ATOM   5498  O  OE1   . GLU C 1 20  ? 12.031  54.778  1.608  1.00 39.08 ? 428  GLU D OE1   1 
ATOM   5499  O  OE2   . GLU C 1 20  ? 12.966  56.501  2.591  1.00 35.08 ? 428  GLU D OE2   1 
ATOM   5500  N  N     . CYS C 1 21  ? 8.051   56.252  5.360  1.00 33.47 ? 429  CYS D N     1 
ATOM   5501  C  CA    . CYS C 1 21  ? 8.125   55.999  6.803  1.00 33.67 ? 429  CYS D CA    1 
ATOM   5502  C  C     . CYS C 1 21  ? 6.802   55.569  7.437  1.00 31.30 ? 429  CYS D C     1 
ATOM   5503  O  O     . CYS C 1 21  ? 5.720   55.888  6.933  1.00 34.28 ? 429  CYS D O     1 
ATOM   5504  C  CB    . CYS C 1 21  ? 8.691   57.219  7.537  1.00 35.90 ? 429  CYS D CB    1 
ATOM   5505  S  SG    . CYS C 1 21  ? 10.450  57.511  7.237  1.00 39.31 ? 429  CYS D SG    1 
ATOM   5506  N  N     . GLU C 1 22  ? 6.913   54.836  8.542  1.00 28.03 ? 430  GLU D N     1 
ATOM   5507  C  CA    . GLU C 1 22  ? 5.760   54.337  9.305  1.00 26.90 ? 430  GLU D CA    1 
ATOM   5508  C  C     . GLU C 1 22  ? 6.040   54.292  10.810 1.00 24.44 ? 430  GLU D C     1 
ATOM   5509  O  O     . GLU C 1 22  ? 7.185   54.101  11.227 1.00 21.96 ? 430  GLU D O     1 
ATOM   5510  C  CB    . GLU C 1 22  ? 5.281   52.975  8.764  1.00 25.10 ? 430  GLU D CB    1 
ATOM   5511  C  CG    . GLU C 1 22  ? 6.390   52.047  8.301  1.00 27.27 ? 430  GLU D CG    1 
ATOM   5512  C  CD    . GLU C 1 22  ? 5.872   50.840  7.533  1.00 26.27 ? 430  GLU D CD    1 
ATOM   5513  O  OE1   . GLU C 1 22  ? 5.808   50.909  6.292  1.00 25.08 ? 430  GLU D OE1   1 
ATOM   5514  O  OE2   . GLU C 1 22  ? 5.502   49.832  8.169  1.00 26.93 ? 430  GLU D OE2   1 
ATOM   5515  N  N     . ILE C 1 23  ? 4.994   54.491  11.612 1.00 22.10 ? 431  ILE D N     1 
ATOM   5516  C  CA    . ILE C 1 23  ? 5.122   54.493  13.073 1.00 21.37 ? 431  ILE D CA    1 
ATOM   5517  C  C     . ILE C 1 23  ? 4.154   53.526  13.768 1.00 21.04 ? 431  ILE D C     1 
ATOM   5518  O  O     . ILE C 1 23  ? 2.936   53.664  13.679 1.00 24.49 ? 431  ILE D O     1 
ATOM   5519  C  CB    . ILE C 1 23  ? 5.035   55.936  13.666 1.00 21.79 ? 431  ILE D CB    1 
ATOM   5520  C  CG1   . ILE C 1 23  ? 5.287   55.916  15.183 1.00 22.18 ? 431  ILE D CG1   1 
ATOM   5521  C  CG2   . ILE C 1 23  ? 3.707   56.613  13.288 1.00 22.68 ? 431  ILE D CG2   1 
ATOM   5522  C  CD1   . ILE C 1 23  ? 5.383   57.279  15.845 1.00 21.42 ? 431  ILE D CD1   1 
ATOM   5523  N  N     . PHE C 1 24  ? 4.720   52.533  14.446 1.00 20.14 ? 432  PHE D N     1 
ATOM   5524  C  CA    . PHE C 1 24  ? 3.944   51.512  15.150 1.00 17.98 ? 432  PHE D CA    1 
ATOM   5525  C  C     . PHE C 1 24  ? 3.660   51.906  16.587 1.00 17.06 ? 432  PHE D C     1 
ATOM   5526  O  O     . PHE C 1 24  ? 4.571   52.253  17.341 1.00 16.48 ? 432  PHE D O     1 
ATOM   5527  C  CB    . PHE C 1 24  ? 4.670   50.162  15.117 1.00 17.62 ? 432  PHE D CB    1 
ATOM   5528  C  CG    . PHE C 1 24  ? 4.686   49.522  13.764 1.00 18.73 ? 432  PHE D CG    1 
ATOM   5529  C  CD1   . PHE C 1 24  ? 5.602   49.928  12.791 1.00 18.96 ? 432  PHE D CD1   1 
ATOM   5530  C  CD2   . PHE C 1 24  ? 3.777   48.504  13.454 1.00 19.58 ? 432  PHE D CD2   1 
ATOM   5531  C  CE1   . PHE C 1 24  ? 5.615   49.335  11.531 1.00 19.40 ? 432  PHE D CE1   1 
ATOM   5532  C  CE2   . PHE C 1 24  ? 3.783   47.901  12.196 1.00 21.26 ? 432  PHE D CE2   1 
ATOM   5533  C  CZ    . PHE C 1 24  ? 4.701   48.321  11.229 1.00 20.56 ? 432  PHE D CZ    1 
ATOM   5534  N  N     . LEU C 1 25  ? 2.386   51.841  16.955 1.00 15.44 ? 433  LEU D N     1 
ATOM   5535  C  CA    . LEU C 1 25  ? 1.946   52.173  18.300 1.00 14.88 ? 433  LEU D CA    1 
ATOM   5536  C  C     . LEU C 1 25  ? 1.699   50.882  19.076 1.00 13.69 ? 433  LEU D C     1 
ATOM   5537  O  O     . LEU C 1 25  ? 0.857   50.064  18.696 1.00 12.99 ? 433  LEU D O     1 
ATOM   5538  C  CB    . LEU C 1 25  ? 0.693   53.049  18.238 1.00 16.63 ? 433  LEU D CB    1 
ATOM   5539  C  CG    . LEU C 1 25  ? 0.853   54.367  17.439 1.00 16.23 ? 433  LEU D CG    1 
ATOM   5540  C  CD1   . LEU C 1 25  ? -0.503  55.040  17.200 1.00 16.72 ? 433  LEU D CD1   1 
ATOM   5541  C  CD2   . LEU C 1 25  ? 1.825   55.335  18.112 1.00 14.51 ? 433  LEU D CD2   1 
ATOM   5542  N  N     . VAL C 1 26  ? 2.476   50.680  20.136 1.00 12.48 ? 434  VAL D N     1 
ATOM   5543  C  CA    . VAL C 1 26  ? 2.357   49.479  20.968 1.00 11.79 ? 434  VAL D CA    1 
ATOM   5544  C  C     . VAL C 1 26  ? 1.905   49.830  22.381 1.00 11.86 ? 434  VAL D C     1 
ATOM   5545  O  O     . VAL C 1 26  ? 1.915   51.000  22.769 1.00 11.20 ? 434  VAL D O     1 
ATOM   5546  C  CB    . VAL C 1 26  ? 3.669   48.641  21.002 1.00 11.14 ? 434  VAL D CB    1 
ATOM   5547  C  CG1   . VAL C 1 26  ? 4.023   48.126  19.612 1.00 10.55 ? 434  VAL D CG1   1 
ATOM   5548  C  CG2   . VAL C 1 26  ? 4.825   49.426  21.612 1.00 10.45 ? 434  VAL D CG2   1 
ATOM   5549  N  N     . GLU C 1 27  ? 1.519   48.809  23.145 1.00 12.96 ? 435  GLU D N     1 
ATOM   5550  C  CA    . GLU C 1 27  ? 1.020   49.003  24.518 1.00 13.67 ? 435  GLU D CA    1 
ATOM   5551  C  C     . GLU C 1 27  ? 2.062   49.445  25.550 1.00 14.07 ? 435  GLU D C     1 
ATOM   5552  O  O     . GLU C 1 27  ? 1.722   50.185  26.470 1.00 14.81 ? 435  GLU D O     1 
ATOM   5553  C  CB    . GLU C 1 27  ? 0.290   47.743  25.005 1.00 13.77 ? 435  GLU D CB    1 
ATOM   5554  C  CG    . GLU C 1 27  ? -0.987  47.459  24.226 1.00 13.74 ? 435  GLU D CG    1 
ATOM   5555  C  CD    . GLU C 1 27  ? -1.830  46.347  24.827 1.00 15.53 ? 435  GLU D CD    1 
ATOM   5556  O  OE1   . GLU C 1 27  ? -2.827  45.957  24.178 1.00 15.32 ? 435  GLU D OE1   1 
ATOM   5557  O  OE2   . GLU C 1 27  ? -1.506  45.856  25.930 1.00 15.35 ? 435  GLU D OE2   1 
ATOM   5558  N  N     . GLY C 1 28  ? 3.311   48.999  25.410 1.00 14.05 ? 436  GLY D N     1 
ATOM   5559  C  CA    . GLY C 1 28  ? 4.357   49.351  26.369 1.00 13.73 ? 436  GLY D CA    1 
ATOM   5560  C  C     . GLY C 1 28  ? 5.741   48.836  26.015 1.00 14.14 ? 436  GLY D C     1 
ATOM   5561  O  O     . GLY C 1 28  ? 5.977   48.413  24.880 1.00 14.62 ? 436  GLY D O     1 
ATOM   5562  N  N     . ASP C 1 29  ? 6.657   48.883  26.985 1.00 13.78 ? 437  ASP D N     1 
ATOM   5563  C  CA    . ASP C 1 29  ? 8.038   48.423  26.794 1.00 13.65 ? 437  ASP D CA    1 
ATOM   5564  C  C     . ASP C 1 29  ? 8.192   46.892  26.674 1.00 13.15 ? 437  ASP D C     1 
ATOM   5565  O  O     . ASP C 1 29  ? 9.128   46.429  26.017 1.00 13.13 ? 437  ASP D O     1 
ATOM   5566  C  CB    . ASP C 1 29  ? 8.965   48.973  27.884 1.00 13.70 ? 437  ASP D CB    1 
ATOM   5567  C  CG    . ASP C 1 29  ? 9.214   50.484  27.729 1.00 14.61 ? 437  ASP D CG    1 
ATOM   5568  O  OD1   . ASP C 1 29  ? 8.968   51.048  26.610 1.00 13.33 ? 437  ASP D OD1   1 
ATOM   5569  O  OD2   . ASP C 1 29  ? 9.671   51.097  28.739 1.00 14.28 ? 437  ASP D OD2   1 
ATOM   5570  N  N     . SER C 1 30  ? 7.291   46.119  27.302 1.00 11.92 ? 438  SER D N     1 
ATOM   5571  C  CA    . SER C 1 30  ? 7.321   44.665  27.171 1.00 13.05 ? 438  SER D CA    1 
ATOM   5572  C  C     . SER C 1 30  ? 7.067   44.283  25.710 1.00 13.54 ? 438  SER D C     1 
ATOM   5573  O  O     . SER C 1 30  ? 7.717   43.381  25.168 1.00 13.73 ? 438  SER D O     1 
ATOM   5574  C  CB    . SER C 1 30  ? 6.285   43.976  28.071 1.00 13.37 ? 438  SER D CB    1 
ATOM   5575  O  OG    . SER C 1 30  ? 6.594   44.099  29.436 1.00 14.74 ? 438  SER D OG    1 
ATOM   5576  N  N     . ALA C 1 31  ? 6.126   44.987  25.079 1.00 12.79 ? 439  ALA D N     1 
ATOM   5577  C  CA    . ALA C 1 31  ? 5.822   44.790  23.676 1.00 12.90 ? 439  ALA D CA    1 
ATOM   5578  C  C     . ALA C 1 31  ? 6.834   45.538  22.813 1.00 13.34 ? 439  ALA D C     1 
ATOM   5579  O  O     . ALA C 1 31  ? 7.265   45.032  21.771 1.00 12.62 ? 439  ALA D O     1 
ATOM   5580  C  CB    . ALA C 1 31  ? 4.408   45.259  23.367 1.00 13.62 ? 439  ALA D CB    1 
ATOM   5581  N  N     . GLY C 1 32  ? 7.231   46.731  23.262 1.00 13.77 ? 440  GLY D N     1 
ATOM   5582  C  CA    . GLY C 1 32  ? 8.176   47.574  22.523 1.00 13.65 ? 440  GLY D CA    1 
ATOM   5583  C  C     . GLY C 1 32  ? 9.511   46.918  22.222 1.00 14.38 ? 440  GLY D C     1 
ATOM   5584  O  O     . GLY C 1 32  ? 10.091  47.154  21.165 1.00 15.58 ? 440  GLY D O     1 
ATOM   5585  N  N     . GLY C 1 33  ? 9.998   46.094  23.153 1.00 13.86 ? 441  GLY D N     1 
ATOM   5586  C  CA    . GLY C 1 33  ? 11.267  45.393  22.989 1.00 14.13 ? 441  GLY D CA    1 
ATOM   5587  C  C     . GLY C 1 33  ? 11.280  44.455  21.794 1.00 14.61 ? 441  GLY D C     1 
ATOM   5588  O  O     . GLY C 1 33  ? 12.186  44.526  20.953 1.00 15.20 ? 441  GLY D O     1 
ATOM   5589  N  N     . SER C 1 34  ? 10.282  43.577  21.711 1.00 14.91 ? 442  SER D N     1 
ATOM   5590  C  CA    . SER C 1 34  ? 10.173  42.647  20.582 1.00 15.76 ? 442  SER D CA    1 
ATOM   5591  C  C     . SER C 1 34  ? 9.993   43.420  19.284 1.00 16.70 ? 442  SER D C     1 
ATOM   5592  O  O     . SER C 1 34  ? 10.438  42.977  18.226 1.00 20.78 ? 442  SER D O     1 
ATOM   5593  C  CB    . SER C 1 34  ? 8.998   41.684  20.762 1.00 15.63 ? 442  SER D CB    1 
ATOM   5594  O  OG    . SER C 1 34  ? 9.163   40.865  21.904 1.00 15.19 ? 442  SER D OG    1 
ATOM   5595  N  N     . THR C 1 35  ? 9.346   44.581  19.383 1.00 15.51 ? 443  THR D N     1 
ATOM   5596  C  CA    . THR C 1 35  ? 9.068   45.445  18.239 1.00 15.58 ? 443  THR D CA    1 
ATOM   5597  C  C     . THR C 1 35  ? 10.332  46.115  17.714 1.00 15.59 ? 443  THR D C     1 
ATOM   5598  O  O     . THR C 1 35  ? 10.582  46.109  16.512 1.00 14.46 ? 443  THR D O     1 
ATOM   5599  C  CB    . THR C 1 35  ? 7.991   46.518  18.590 1.00 15.88 ? 443  THR D CB    1 
ATOM   5600  O  OG1   . THR C 1 35  ? 6.877   45.897  19.240 1.00 17.04 ? 443  THR D OG1   1 
ATOM   5601  C  CG2   . THR C 1 35  ? 7.482   47.221  17.341 1.00 16.16 ? 443  THR D CG2   1 
ATOM   5602  N  N     . LYS C 1 36  ? 11.124  46.691  18.620 1.00 17.31 ? 444  LYS D N     1 
ATOM   5603  C  CA    . LYS C 1 36  ? 12.373  47.383  18.262 1.00 17.58 ? 444  LYS D CA    1 
ATOM   5604  C  C     . LYS C 1 36  ? 13.426  46.436  17.672 1.00 17.96 ? 444  LYS D C     1 
ATOM   5605  O  O     . LYS C 1 36  ? 14.146  46.806  16.736 1.00 16.76 ? 444  LYS D O     1 
ATOM   5606  C  CB    . LYS C 1 36  ? 12.941  48.148  19.457 1.00 17.81 ? 444  LYS D CB    1 
ATOM   5607  C  CG    . LYS C 1 36  ? 12.050  49.288  19.928 1.00 20.27 ? 444  LYS D CG    1 
ATOM   5608  C  CD    . LYS C 1 36  ? 12.520  49.909  21.238 1.00 20.69 ? 444  LYS D CD    1 
ATOM   5609  C  CE    . LYS C 1 36  ? 11.484  50.908  21.743 1.00 20.99 ? 444  LYS D CE    1 
ATOM   5610  N  NZ    . LYS C 1 36  ? 11.813  51.505  23.078 1.00 19.79 ? 444  LYS D NZ    1 
ATOM   5611  N  N     . SER C 1 37  ? 13.496  45.222  18.212 1.00 17.81 ? 445  SER D N     1 
ATOM   5612  C  CA    . SER C 1 37  ? 14.446  44.215  17.742 1.00 20.33 ? 445  SER D CA    1 
ATOM   5613  C  C     . SER C 1 37  ? 14.051  43.616  16.394 1.00 21.86 ? 445  SER D C     1 
ATOM   5614  O  O     . SER C 1 37  ? 14.917  43.236  15.608 1.00 24.50 ? 445  SER D O     1 
ATOM   5615  C  CB    . SER C 1 37  ? 14.589  43.081  18.764 1.00 19.97 ? 445  SER D CB    1 
ATOM   5616  O  OG    . SER C 1 37  ? 15.048  43.570  20.006 1.00 22.91 ? 445  SER D OG    1 
ATOM   5617  N  N     . GLY C 1 38  ? 12.791  43.556  16.118 1.00 20.58 ? 446  GLY D N     1 
ATOM   5618  C  CA    . GLY C 1 38  ? 12.316  43.050  14.909 1.00 21.72 ? 446  GLY D CA    1 
ATOM   5619  C  C     . GLY C 1 38  ? 12.040  43.952  13.767 1.00 22.98 ? 446  GLY D C     1 
ATOM   5620  O  O     . GLY C 1 38  ? 11.761  43.447  12.809 1.00 22.73 ? 446  GLY D O     1 
ATOM   5621  N  N     . ARG C 1 39  ? 12.122  45.247  13.892 1.00 21.56 ? 447  ARG D N     1 
ATOM   5622  C  CA    . ARG C 1 39  ? 11.815  46.151  12.845 1.00 21.94 ? 447  ARG D CA    1 
ATOM   5623  C  C     . ARG C 1 39  ? 12.893  46.448  11.889 1.00 23.59 ? 447  ARG D C     1 
ATOM   5624  O  O     . ARG C 1 39  ? 13.860  45.877  11.900 1.00 22.40 ? 447  ARG D O     1 
ATOM   5625  C  CB    . ARG C 1 39  ? 11.402  47.458  13.436 1.00 22.07 ? 447  ARG D CB    1 
ATOM   5626  C  CG    . ARG C 1 39  ? 12.423  48.065  14.257 1.00 21.81 ? 447  ARG D CG    1 
ATOM   5627  C  CD    . ARG C 1 39  ? 12.438  49.514  14.248 1.00 22.24 ? 447  ARG D CD    1 
ATOM   5628  N  NE    . ARG C 1 39  ? 13.398  49.981  15.186 1.00 22.35 ? 447  ARG D NE    1 
ATOM   5629  C  CZ    . ARG C 1 39  ? 13.494  51.179  15.731 1.00 21.65 ? 447  ARG D CZ    1 
ATOM   5630  N  NH1   . ARG C 1 39  ? 14.433  51.339  16.569 1.00 20.40 ? 447  ARG D NH1   1 
ATOM   5631  N  NH2   . ARG C 1 39  ? 12.731  52.133  15.493 1.00 20.38 ? 447  ARG D NH2   1 
ATOM   5632  N  N     . ASP C 1 40  ? 12.625  47.372  11.021 1.00 24.23 ? 448  ASP D N     1 
ATOM   5633  C  CA    . ASP C 1 40  ? 13.561  47.963  10.153 1.00 23.99 ? 448  ASP D CA    1 
ATOM   5634  C  C     . ASP C 1 40  ? 13.691  49.374  10.657 1.00 22.73 ? 448  ASP D C     1 
ATOM   5635  O  O     . ASP C 1 40  ? 12.886  50.101  10.433 1.00 21.70 ? 448  ASP D O     1 
ATOM   5636  C  CB    . ASP C 1 40  ? 13.125  47.934  8.716  1.00 25.28 ? 448  ASP D CB    1 
ATOM   5637  C  CG    . ASP C 1 40  ? 14.144  48.523  7.803  1.00 31.06 ? 448  ASP D CG    1 
ATOM   5638  O  OD1   . ASP C 1 40  ? 15.253  48.762  8.217  1.00 29.04 ? 448  ASP D OD1   1 
ATOM   5639  O  OD2   . ASP C 1 40  ? 13.894  48.739  6.665  1.00 33.44 ? 448  ASP D OD2   1 
ATOM   5640  N  N     . SER C 1 41  ? 14.733  49.708  11.378 1.00 22.56 ? 449  SER D N     1 
ATOM   5641  C  CA    . SER C 1 41  ? 14.914  51.068  11.901 1.00 24.33 ? 449  SER D CA    1 
ATOM   5642  C  C     . SER C 1 41  ? 15.143  52.134  10.831 1.00 23.82 ? 449  SER D C     1 
ATOM   5643  O  O     . SER C 1 41  ? 15.264  53.317  11.146 1.00 25.67 ? 449  SER D O     1 
ATOM   5644  C  CB    . SER C 1 41  ? 16.045  51.111  12.938 1.00 24.96 ? 449  SER D CB    1 
ATOM   5645  O  OG    . SER C 1 41  ? 17.296  50.845  12.344 1.00 27.01 ? 449  SER D OG    1 
ATOM   5646  N  N     . ARG C 1 42  ? 15.187  51.734  9.571  1.00 24.51 ? 450  ARG D N     1 
ATOM   5647  C  CA    . ARG C 1 42  ? 15.379  52.704  8.510  1.00 24.03 ? 450  ARG D CA    1 
ATOM   5648  C  C     . ARG C 1 42  ? 14.072  53.418  8.211  1.00 23.47 ? 450  ARG D C     1 
ATOM   5649  O  O     . ARG C 1 42  ? 14.044  54.622  8.024  1.00 24.59 ? 450  ARG D O     1 
ATOM   5650  C  CB    . ARG C 1 42  ? 15.907  52.026  7.250  1.00 26.29 ? 450  ARG D CB    1 
ATOM   5651  C  CG    . ARG C 1 42  ? 15.799  52.876  6.001  1.00 26.91 ? 450  ARG D CG    1 
ATOM   5652  C  CD    . ARG C 1 42  ? 16.213  52.098  4.761  1.00 28.67 ? 450  ARG D CD    1 
ATOM   5653  N  NE    . ARG C 1 42  ? 15.395  52.431  3.594  1.00 30.23 ? 450  ARG D NE    1 
ATOM   5654  C  CZ    . ARG C 1 42  ? 14.983  53.662  3.288  1.00 29.83 ? 450  ARG D CZ    1 
ATOM   5655  N  NH1   . ARG C 1 42  ? 14.239  53.847  2.213  1.00 31.90 ? 450  ARG D NH1   1 
ATOM   5656  N  NH2   . ARG C 1 42  ? 15.318  54.702  4.041  1.00 26.58 ? 450  ARG D NH2   1 
ATOM   5657  N  N     . THR C 1 43  ? 12.987  52.660  8.178  1.00 23.11 ? 451  THR D N     1 
ATOM   5658  C  CA    . THR C 1 43  ? 11.668  53.208  7.862  1.00 22.78 ? 451  THR D CA    1 
ATOM   5659  C  C     . THR C 1 43  ? 10.583  52.993  8.927  1.00 23.16 ? 451  THR D C     1 
ATOM   5660  O  O     . THR C 1 43  ? 9.480   53.542  8.817  1.00 22.79 ? 451  THR D O     1 
ATOM   5661  C  CB    . THR C 1 43  ? 11.142  52.610  6.537  1.00 23.18 ? 451  THR D CB    1 
ATOM   5662  O  OG1   . THR C 1 43  ? 11.213  51.189  6.597  1.00 23.29 ? 451  THR D OG1   1 
ATOM   5663  C  CG2   . THR C 1 43  ? 11.968  53.093  5.350  1.00 22.61 ? 451  THR D CG2   1 
ATOM   5664  N  N     . GLN C 1 44  ? 10.888  52.204  9.958  1.00 22.41 ? 452  GLN D N     1 
ATOM   5665  C  CA    . GLN C 1 44  ? 9.884   51.882  10.981 1.00 19.44 ? 452  GLN D CA    1 
ATOM   5666  C  C     . GLN C 1 44  ? 10.139  52.481  12.359 1.00 19.09 ? 452  GLN D C     1 
ATOM   5667  O  O     . GLN C 1 44  ? 11.048  52.065  13.085 1.00 17.49 ? 452  GLN D O     1 
ATOM   5668  C  CB    . GLN C 1 44  ? 9.685   50.370  11.087 1.00 17.71 ? 452  GLN D CB    1 
ATOM   5669  C  CG    . GLN C 1 44  ? 9.062   49.716  9.858  1.00 16.10 ? 452  GLN D CG    1 
ATOM   5670  C  CD    . GLN C 1 44  ? 9.070   48.197  9.935  1.00 14.60 ? 452  GLN D CD    1 
ATOM   5671  O  OE1   . GLN C 1 44  ? 9.865   47.612  10.669 1.00 15.01 ? 452  GLN D OE1   1 
ATOM   5672  N  NE2   . GLN C 1 44  ? 8.200   47.556  9.175  1.00 14.21 ? 452  GLN D NE2   1 
ATOM   5673  N  N     . ALA C 1 45  ? 9.311   53.464  12.700 1.00 19.90 ? 453  ALA D N     1 
ATOM   5674  C  CA    . ALA C 1 45  ? 9.356   54.145  13.987 1.00 18.83 ? 453  ALA D CA    1 
ATOM   5675  C  C     . ALA C 1 45  ? 8.457   53.417  14.982 1.00 19.69 ? 453  ALA D C     1 
ATOM   5676  O  O     . ALA C 1 45  ? 7.485   52.752  14.593 1.00 19.39 ? 453  ALA D O     1 
ATOM   5677  C  CB    . ALA C 1 45  ? 8.915   55.587  13.831 1.00 18.56 ? 453  ALA D CB    1 
ATOM   5678  N  N     . ILE C 1 46  ? 8.788   53.541  16.265 1.00 20.08 ? 454  ILE D N     1 
ATOM   5679  C  CA    . ILE C 1 46  ? 8.036   52.867  17.321 1.00 18.34 ? 454  ILE D CA    1 
ATOM   5680  C  C     . ILE C 1 46  ? 7.807   53.794  18.503 1.00 17.01 ? 454  ILE D C     1 
ATOM   5681  O  O     . ILE C 1 46  ? 8.744   54.419  19.006 1.00 16.27 ? 454  ILE D O     1 
ATOM   5682  C  CB    . ILE C 1 46  ? 8.765   51.592  17.797 1.00 19.07 ? 454  ILE D CB    1 
ATOM   5683  C  CG1   . ILE C 1 46  ? 8.991   50.644  16.613 1.00 19.63 ? 454  ILE D CG1   1 
ATOM   5684  C  CG2   . ILE C 1 46  ? 7.993   50.899  18.918 1.00 17.20 ? 454  ILE D CG2   1 
ATOM   5685  C  CD1   . ILE C 1 46  ? 9.970   49.551  16.893 1.00 20.75 ? 454  ILE D CD1   1 
ATOM   5686  N  N     . LEU C 1 47  ? 6.549   53.880  18.932 1.00 15.60 ? 455  LEU D N     1 
ATOM   5687  C  CA    . LEU C 1 47  ? 6.183   54.684  20.085 1.00 15.22 ? 455  LEU D CA    1 
ATOM   5688  C  C     . LEU C 1 47  ? 5.401   53.838  21.083 1.00 16.18 ? 455  LEU D C     1 
ATOM   5689  O  O     . LEU C 1 47  ? 4.207   53.601  20.899 1.00 17.35 ? 455  LEU D O     1 
ATOM   5690  C  CB    . LEU C 1 47  ? 5.394   55.942  19.677 1.00 14.33 ? 455  LEU D CB    1 
ATOM   5691  C  CG    . LEU C 1 47  ? 4.764   56.844  20.770 1.00 13.58 ? 455  LEU D CG    1 
ATOM   5692  C  CD1   . LEU C 1 47  ? 5.771   57.383  21.797 1.00 12.61 ? 455  LEU D CD1   1 
ATOM   5693  C  CD2   . LEU C 1 47  ? 3.972   57.987  20.145 1.00 12.40 ? 455  LEU D CD2   1 
ATOM   5694  N  N     . PRO C 1 48  ? 6.095   53.330  22.118 1.00 16.36 ? 456  PRO D N     1 
ATOM   5695  C  CA    . PRO C 1 48  ? 5.392   52.592  23.165 1.00 15.80 ? 456  PRO D CA    1 
ATOM   5696  C  C     . PRO C 1 48  ? 4.651   53.533  24.116 1.00 16.73 ? 456  PRO D C     1 
ATOM   5697  O  O     . PRO C 1 48  ? 5.195   54.546  24.538 1.00 17.27 ? 456  PRO D O     1 
ATOM   5698  C  CB    . PRO C 1 48  ? 6.512   51.831  23.881 1.00 14.87 ? 456  PRO D CB    1 
ATOM   5699  C  CG    . PRO C 1 48  ? 7.756   52.588  23.594 1.00 15.79 ? 456  PRO D CG    1 
ATOM   5700  C  CD    . PRO C 1 48  ? 7.555   53.359  22.323 1.00 15.02 ? 456  PRO D CD    1 
ATOM   5701  N  N     . LEU C 1 49  ? 3.409   53.181  24.437 1.00 19.30 ? 457  LEU D N     1 
ATOM   5702  C  CA    . LEU C 1 49  ? 2.566   53.961  25.335 1.00 19.43 ? 457  LEU D CA    1 
ATOM   5703  C  C     . LEU C 1 49  ? 2.595   53.312  26.714 1.00 20.45 ? 457  LEU D C     1 
ATOM   5704  O  O     . LEU C 1 49  ? 3.563   52.620  27.047 1.00 19.99 ? 457  LEU D O     1 
ATOM   5705  C  CB    . LEU C 1 49  ? 1.136   54.031  24.786 1.00 20.23 ? 457  LEU D CB    1 
ATOM   5706  C  CG    . LEU C 1 49  ? 0.976   54.535  23.335 1.00 22.96 ? 457  LEU D CG    1 
ATOM   5707  C  CD1   . LEU C 1 49  ? -0.465  54.405  22.851 1.00 24.03 ? 457  LEU D CD1   1 
ATOM   5708  C  CD2   . LEU C 1 49  ? 1.475   55.974  23.155 1.00 22.49 ? 457  LEU D CD2   1 
ATOM   5709  N  N     . ARG C 1 50  ? 1.560   53.552  27.529 1.00 22.03 ? 458  ARG D N     1 
ATOM   5710  C  CA    . ARG C 1 50  ? 1.477   52.963  28.873 1.00 21.97 ? 458  ARG D CA    1 
ATOM   5711  C  C     . ARG C 1 50  ? 0.066   52.408  29.145 1.00 20.18 ? 458  ARG D C     1 
ATOM   5712  O  O     . ARG C 1 50  ? -0.609  52.827  30.092 1.00 17.92 ? 458  ARG D O     1 
ATOM   5713  C  CB    . ARG C 1 50  ? 1.877   53.982  29.954 1.00 23.64 ? 458  ARG D CB    1 
ATOM   5714  C  CG    . ARG C 1 50  ? 3.300   54.555  29.841 1.00 27.24 ? 458  ARG D CG    1 
ATOM   5715  C  CD    . ARG C 1 50  ? 4.373   53.556  30.206 1.00 31.25 ? 458  ARG D CD    1 
ATOM   5716  N  NE    . ARG C 1 50  ? 5.739   54.074  30.084 1.00 32.46 ? 458  ARG D NE    1 
ATOM   5717  C  CZ    . ARG C 1 50  ? 6.566   53.803  29.071 1.00 36.64 ? 458  ARG D CZ    1 
ATOM   5718  N  NH1   . ARG C 1 50  ? 6.183   53.008  28.067 1.00 37.63 ? 458  ARG D NH1   1 
ATOM   5719  N  NH2   . ARG C 1 50  ? 7.801   54.317  29.066 1.00 36.06 ? 458  ARG D NH2   1 
ATOM   5720  N  N     . GLY C 1 51  ? -0.361  51.464  28.307 1.00 18.00 ? 459  GLY D N     1 
ATOM   5721  C  CA    . GLY C 1 51  ? -1.658  50.805  28.445 1.00 18.55 ? 459  GLY D CA    1 
ATOM   5722  C  C     . GLY C 1 51  ? -2.860  51.612  27.994 1.00 19.25 ? 459  GLY D C     1 
ATOM   5723  O  O     . GLY C 1 51  ? -2.769  52.383  27.038 1.00 17.91 ? 459  GLY D O     1 
ATOM   5724  N  N     . LYS C 1 52  ? -3.992  51.427  28.690 1.00 19.64 ? 460  LYS D N     1 
ATOM   5725  C  CA    . LYS C 1 52  ? -5.240  52.133  28.372 1.00 19.34 ? 460  LYS D CA    1 
ATOM   5726  C  C     . LYS C 1 52  ? -4.970  53.630  28.308 1.00 20.32 ? 460  LYS D C     1 
ATOM   5727  O  O     . LYS C 1 52  ? -4.390  54.195  29.244 1.00 20.87 ? 460  LYS D O     1 
ATOM   5728  C  CB    . LYS C 1 52  ? -6.329  51.863  29.430 1.00 17.67 ? 460  LYS D CB    1 
ATOM   5729  C  CG    . LYS C 1 52  ? -6.738  50.402  29.678 1.00 15.95 ? 460  LYS D CG    1 
ATOM   5730  C  CD    . LYS C 1 52  ? -7.416  49.766  28.481 1.00 16.50 ? 460  LYS D CD    1 
ATOM   5731  C  CE    . LYS C 1 52  ? -7.823  48.320  28.748 1.00 15.22 ? 460  LYS D CE    1 
ATOM   5732  N  NZ    . LYS C 1 52  ? -9.031  48.208  29.591 1.00 15.01 ? 460  LYS D NZ    1 
ATOM   5733  N  N     . ILE C 1 53  ? -5.361  54.261  27.201 1.00 20.23 ? 461  ILE D N     1 
ATOM   5734  C  CA    . ILE C 1 53  ? -5.163  55.707  27.053 1.00 19.50 ? 461  ILE D CA    1 
ATOM   5735  C  C     . ILE C 1 53  ? -6.427  56.454  27.440 1.00 19.87 ? 461  ILE D C     1 
ATOM   5736  O  O     . ILE C 1 53  ? -7.514  55.864  27.521 1.00 22.67 ? 461  ILE D O     1 
ATOM   5737  C  CB    . ILE C 1 53  ? -4.771  56.141  25.611 1.00 20.00 ? 461  ILE D CB    1 
ATOM   5738  C  CG1   . ILE C 1 53  ? -5.952  56.006  24.650 1.00 19.31 ? 461  ILE D CG1   1 
ATOM   5739  C  CG2   . ILE C 1 53  ? -3.514  55.407  25.131 1.00 20.54 ? 461  ILE D CG2   1 
ATOM   5740  C  CD1   . ILE C 1 53  ? -5.844  56.859  23.400 1.00 21.52 ? 461  ILE D CD1   1 
ATOM   5741  N  N     . LEU C 1 54  ? -6.289  57.750  27.648 1.00 18.43 ? 462  LEU D N     1 
ATOM   5742  C  CA    . LEU C 1 54  ? -7.407  58.607  27.989 1.00 18.85 ? 462  LEU D CA    1 
ATOM   5743  C  C     . LEU C 1 54  ? -8.520  58.547  26.942 1.00 18.27 ? 462  LEU D C     1 
ATOM   5744  O  O     . LEU C 1 54  ? -8.250  58.593  25.745 1.00 17.35 ? 462  LEU D O     1 
ATOM   5745  C  CB    . LEU C 1 54  ? -6.900  60.039  28.171 1.00 18.35 ? 462  LEU D CB    1 
ATOM   5746  C  CG    . LEU C 1 54  ? -7.828  61.161  28.621 1.00 20.19 ? 462  LEU D CG    1 
ATOM   5747  C  CD1   . LEU C 1 54  ? -8.427  60.902  29.996 1.00 19.46 ? 462  LEU D CD1   1 
ATOM   5748  C  CD2   . LEU C 1 54  ? -7.037  62.467  28.610 1.00 20.06 ? 462  LEU D CD2   1 
ATOM   5749  N  N     . ASN C 1 55  ? -9.763  58.412  27.398 1.00 18.99 ? 463  ASN D N     1 
ATOM   5750  C  CA    . ASN C 1 55  ? -10.921 58.417  26.502 1.00 20.88 ? 463  ASN D CA    1 
ATOM   5751  C  C     . ASN C 1 55  ? -11.342 59.862  26.222 1.00 22.69 ? 463  ASN D C     1 
ATOM   5752  O  O     . ASN C 1 55  ? -11.928 60.525  27.087 1.00 23.08 ? 463  ASN D O     1 
ATOM   5753  C  CB    . ASN C 1 55  ? -12.077 57.618  27.113 1.00 22.87 ? 463  ASN D CB    1 
ATOM   5754  C  CG    . ASN C 1 55  ? -13.347 57.657  26.256 1.00 25.73 ? 463  ASN D CG    1 
ATOM   5755  O  OD1   . ASN C 1 55  ? -13.435 58.383  25.255 1.00 26.57 ? 463  ASN D OD1   1 
ATOM   5756  N  ND2   . ASN C 1 55  ? -14.340 56.875  26.650 1.00 26.08 ? 463  ASN D ND2   1 
ATOM   5757  N  N     . VAL C 1 56  ? -11.044 60.338  25.017 1.00 24.30 ? 464  VAL D N     1 
ATOM   5758  C  CA    . VAL C 1 56  ? -11.324 61.737  24.625 1.00 27.75 ? 464  VAL D CA    1 
ATOM   5759  C  C     . VAL C 1 56  ? -12.809 62.117  24.486 1.00 28.88 ? 464  VAL D C     1 
ATOM   5760  O  O     . VAL C 1 56  ? -13.147 63.303  24.496 1.00 30.88 ? 464  VAL D O     1 
ATOM   5761  C  CB    . VAL C 1 56  ? -10.563 62.148  23.337 1.00 27.02 ? 464  VAL D CB    1 
ATOM   5762  C  CG1   . VAL C 1 56  ? -9.056  62.190  23.592 1.00 27.20 ? 464  VAL D CG1   1 
ATOM   5763  C  CG2   . VAL C 1 56  ? -10.909 61.219  22.174 1.00 26.86 ? 464  VAL D CG2   1 
ATOM   5764  N  N     . GLU C 1 57  ? -13.678 61.116  24.359 1.00 27.27 ? 465  GLU D N     1 
ATOM   5765  C  CA    . GLU C 1 57  ? -15.117 61.339  24.230 1.00 27.20 ? 465  GLU D CA    1 
ATOM   5766  C  C     . GLU C 1 57  ? -15.760 61.685  25.589 1.00 27.92 ? 465  GLU D C     1 
ATOM   5767  O  O     . GLU C 1 57  ? -16.843 62.265  25.625 1.00 30.04 ? 465  GLU D O     1 
ATOM   5768  C  CB    . GLU C 1 57  ? -15.790 60.098  23.629 1.00 26.19 ? 465  GLU D CB    1 
ATOM   5769  C  CG    . GLU C 1 57  ? -17.188 60.309  23.041 1.00 24.73 ? 465  GLU D CG    1 
ATOM   5770  C  CD    . GLU C 1 57  ? -17.180 60.941  21.649 1.00 25.90 ? 465  GLU D CD    1 
ATOM   5771  O  OE1   . GLU C 1 57  ? -16.106 61.031  21.015 1.00 24.47 ? 465  GLU D OE1   1 
ATOM   5772  O  OE2   . GLU C 1 57  ? -18.274 61.327  21.176 1.00 27.10 ? 465  GLU D OE2   1 
ATOM   5773  N  N     . LYS C 1 58  ? -15.086 61.328  26.687 1.00 26.74 ? 466  LYS D N     1 
ATOM   5774  C  CA    . LYS C 1 58  ? -15.578 61.580  28.052 1.00 27.57 ? 466  LYS D CA    1 
ATOM   5775  C  C     . LYS C 1 58  ? -14.783 62.647  28.811 1.00 30.09 ? 466  LYS D C     1 
ATOM   5776  O  O     . LYS C 1 58  ? -15.304 63.259  29.742 1.00 31.11 ? 466  LYS D O     1 
ATOM   5777  C  CB    . LYS C 1 58  ? -15.562 60.296  28.896 1.00 27.44 ? 466  LYS D CB    1 
ATOM   5778  C  CG    . LYS C 1 58  ? -16.510 59.188  28.455 1.00 26.99 ? 466  LYS D CG    1 
ATOM   5779  C  CD    . LYS C 1 58  ? -16.326 57.957  29.337 1.00 26.15 ? 466  LYS D CD    1 
ATOM   5780  C  CE    . LYS C 1 58  ? -17.116 56.773  28.817 1.00 25.52 ? 466  LYS D CE    1 
ATOM   5781  N  NZ    . LYS C 1 58  ? -16.851 55.539  29.598 1.00 26.39 ? 466  LYS D NZ    1 
ATOM   5782  N  N     . ALA C 1 59  ? -13.522 62.850  28.426 1.00 33.65 ? 467  ALA D N     1 
ATOM   5783  C  CA    . ALA C 1 59  ? -12.642 63.819  29.096 1.00 32.30 ? 467  ALA D CA    1 
ATOM   5784  C  C     . ALA C 1 59  ? -12.741 65.241  28.532 1.00 34.13 ? 467  ALA D C     1 
ATOM   5785  O  O     . ALA C 1 59  ? -13.073 65.436  27.361 1.00 34.78 ? 467  ALA D O     1 
ATOM   5786  C  CB    . ALA C 1 59  ? -11.200 63.327  29.068 1.00 30.56 ? 467  ALA D CB    1 
ATOM   5787  N  N     . ARG C 1 60  ? -12.444 66.222  29.384 1.00 37.68 ? 468  ARG D N     1 
ATOM   5788  C  CA    . ARG C 1 60  ? -12.494 67.645  29.032 1.00 40.37 ? 468  ARG D CA    1 
ATOM   5789  C  C     . ARG C 1 60  ? -11.292 68.094  28.196 1.00 41.98 ? 468  ARG D C     1 
ATOM   5790  O  O     . ARG C 1 60  ? -10.191 67.553  28.335 1.00 40.50 ? 468  ARG D O     1 
ATOM   5791  C  CB    . ARG C 1 60  ? -12.632 68.504  30.295 1.00 43.23 ? 468  ARG D CB    1 
ATOM   5792  C  CG    . ARG C 1 60  ? -14.016 68.432  30.940 1.00 47.19 ? 468  ARG D CG    1 
ATOM   5793  C  CD    . ARG C 1 60  ? -14.108 69.192  32.267 1.00 50.75 ? 468  ARG D CD    1 
ATOM   5794  N  NE    . ARG C 1 60  ? -13.321 68.575  33.345 1.00 48.61 ? 468  ARG D NE    1 
ATOM   5795  C  CZ    . ARG C 1 60  ? -13.360 68.946  34.622 1.00 49.26 ? 468  ARG D CZ    1 
ATOM   5796  N  NH1   . ARG C 1 60  ? -14.155 69.934  35.023 1.00 49.01 ? 468  ARG D NH1   1 
ATOM   5797  N  NH2   . ARG C 1 60  ? -12.604 68.319  35.513 1.00 47.52 ? 468  ARG D NH2   1 
ATOM   5798  N  N     . LEU C 1 61  ? -11.520 69.094  27.341 1.00 44.80 ? 469  LEU D N     1 
ATOM   5799  C  CA    . LEU C 1 61  ? -10.509 69.644  26.424 1.00 42.53 ? 469  LEU D CA    1 
ATOM   5800  C  C     . LEU C 1 61  ? -9.129  69.902  27.036 1.00 42.48 ? 469  LEU D C     1 
ATOM   5801  O  O     . LEU C 1 61  ? -8.117  69.530  26.447 1.00 45.99 ? 469  LEU D O     1 
ATOM   5802  C  CB    . LEU C 1 61  ? -11.035 70.915  25.737 1.00 44.09 ? 469  LEU D CB    1 
ATOM   5803  C  CG    . LEU C 1 61  ? -10.141 71.655  24.724 1.00 47.40 ? 469  LEU D CG    1 
ATOM   5804  C  CD1   . LEU C 1 61  ? -9.705  70.759  23.562 1.00 47.52 ? 469  LEU D CD1   1 
ATOM   5805  C  CD2   . LEU C 1 61  ? -10.815 72.887  24.177 1.00 45.96 ? 469  LEU D CD2   1 
ATOM   5806  N  N     A ASP C 1 62  ? -9.093  70.541  28.201 0.50 42.78 ? 470  ASP D N     1 
ATOM   5807  N  N     B ASP C 1 62  ? -9.162  70.509  28.208 0.50 42.30 ? 470  ASP D N     1 
ATOM   5808  C  CA    A ASP C 1 62  ? -7.834  70.866  28.881 0.50 44.15 ? 470  ASP D CA    1 
ATOM   5809  C  CA    B ASP C 1 62  ? -7.965  70.872  28.950 0.50 43.13 ? 470  ASP D CA    1 
ATOM   5810  C  C     A ASP C 1 62  ? -7.078  69.645  29.427 0.50 43.95 ? 470  ASP D C     1 
ATOM   5811  C  C     B ASP C 1 62  ? -7.152  69.662  29.376 0.50 43.23 ? 470  ASP D C     1 
ATOM   5812  O  O     A ASP C 1 62  ? -5.843  69.628  29.459 0.50 46.20 ? 470  ASP D O     1 
ATOM   5813  O  O     B ASP C 1 62  ? -5.945  69.697  29.362 0.50 45.38 ? 470  ASP D O     1 
ATOM   5814  C  CB    A ASP C 1 62  ? -8.067  71.920  29.985 0.50 44.08 ? 470  ASP D CB    1 
ATOM   5815  C  CB    B ASP C 1 62  ? -8.328  71.721  30.187 0.50 41.99 ? 470  ASP D CB    1 
ATOM   5816  C  CG    A ASP C 1 62  ? -9.139  71.508  31.010 0.50 42.82 ? 470  ASP D CG    1 
ATOM   5817  C  CG    B ASP C 1 62  ? -7.201  72.679  30.607 0.50 39.31 ? 470  ASP D CG    1 
ATOM   5818  O  OD1   A ASP C 1 62  ? -9.214  70.319  31.378 0.50 37.63 ? 470  ASP D OD1   1 
ATOM   5819  O  OD1   B ASP C 1 62  ? -6.036  72.393  30.256 0.50 37.38 ? 470  ASP D OD1   1 
ATOM   5820  O  OD2   A ASP C 1 62  ? -9.900  72.394  31.469 0.50 42.15 ? 470  ASP D OD2   1 
ATOM   5821  O  OD2   B ASP C 1 62  ? -7.481  73.696  31.284 0.50 36.69 ? 470  ASP D OD2   1 
ATOM   5822  N  N     . ARG C 1 63  ? -7.832  68.631  29.846 1.00 44.55 ? 471  ARG D N     1 
ATOM   5823  C  CA    . ARG C 1 63  ? -7.280  67.401  30.407 1.00 44.18 ? 471  ARG D CA    1 
ATOM   5824  C  C     . ARG C 1 63  ? -6.562  66.587  29.326 1.00 43.08 ? 471  ARG D C     1 
ATOM   5825  O  O     . ARG C 1 63  ? -5.519  65.974  29.581 1.00 41.37 ? 471  ARG D O     1 
ATOM   5826  C  CB    . ARG C 1 63  ? -8.417  66.580  31.029 1.00 43.77 ? 471  ARG D CB    1 
ATOM   5827  C  CG    . ARG C 1 63  ? -7.984  65.385  31.861 1.00 44.77 ? 471  ARG D CG    1 
ATOM   5828  C  CD    . ARG C 1 63  ? -9.188  64.577  32.304 1.00 46.77 ? 471  ARG D CD    1 
ATOM   5829  N  NE    . ARG C 1 63  ? -8.804  63.457  33.162 1.00 49.45 ? 471  ARG D NE    1 
ATOM   5830  C  CZ    . ARG C 1 63  ? -9.623  62.470  33.536 1.00 52.40 ? 471  ARG D CZ    1 
ATOM   5831  N  NH1   . ARG C 1 63  ? -10.885 62.430  33.104 1.00 49.35 ? 471  ARG D NH1   1 
ATOM   5832  N  NH2   . ARG C 1 63  ? -9.158  61.501  34.310 1.00 57.36 ? 471  ARG D NH2   1 
ATOM   5833  N  N     . ILE C 1 64  ? -7.133  66.604  28.125 1.00 39.58 ? 472  ILE D N     1 
ATOM   5834  C  CA    . ILE C 1 64  ? -6.600  65.894  26.957 1.00 41.06 ? 472  ILE D CA    1 
ATOM   5835  C  C     . ILE C 1 64  ? -5.240  66.438  26.516 1.00 41.91 ? 472  ILE D C     1 
ATOM   5836  O  O     . ILE C 1 64  ? -4.311  65.671  26.256 1.00 42.98 ? 472  ILE D O     1 
ATOM   5837  C  CB    . ILE C 1 64  ? -7.596  65.963  25.769 1.00 36.33 ? 472  ILE D CB    1 
ATOM   5838  C  CG1   . ILE C 1 64  ? -8.949  65.357  26.172 1.00 33.36 ? 472  ILE D CG1   1 
ATOM   5839  C  CG2   . ILE C 1 64  ? -7.010  65.274  24.532 1.00 37.96 ? 472  ILE D CG2   1 
ATOM   5840  C  CD1   . ILE C 1 64  ? -10.086 65.644  25.214 1.00 33.08 ? 472  ILE D CD1   1 
ATOM   5841  N  N     . LEU C 1 65  ? -5.135  67.765  26.452 1.00 45.32 ? 473  LEU D N     1 
ATOM   5842  C  CA    . LEU C 1 65  ? -3.913  68.456  26.020 1.00 43.78 ? 473  LEU D CA    1 
ATOM   5843  C  C     . LEU C 1 65  ? -2.790  68.366  27.052 1.00 39.93 ? 473  LEU D C     1 
ATOM   5844  O  O     . LEU C 1 65  ? -1.626  68.614  26.736 1.00 42.66 ? 473  LEU D O     1 
ATOM   5845  C  CB    . LEU C 1 65  ? -4.218  69.930  25.707 1.00 42.01 ? 473  LEU D CB    1 
ATOM   5846  C  CG    . LEU C 1 65  ? -5.414  70.242  24.797 1.00 41.55 ? 473  LEU D CG    1 
ATOM   5847  C  CD1   . LEU C 1 65  ? -5.603  71.734  24.595 1.00 39.11 ? 473  LEU D CD1   1 
ATOM   5848  C  CD2   . LEU C 1 65  ? -5.304  69.543  23.453 1.00 39.85 ? 473  LEU D CD2   1 
ATOM   5849  N  N     . ASN C 1 66  ? -3.150  68.008  28.282 1.00 37.36 ? 474  ASN D N     1 
ATOM   5850  C  CA    . ASN C 1 66  ? -2.192  67.888  29.379 1.00 38.43 ? 474  ASN D CA    1 
ATOM   5851  C  C     . ASN C 1 66  ? -1.712  66.439  29.538 1.00 34.71 ? 474  ASN D C     1 
ATOM   5852  O  O     . ASN C 1 66  ? -0.686  66.183  30.171 1.00 32.06 ? 474  ASN D O     1 
ATOM   5853  C  CB    . ASN C 1 66  ? -2.831  68.403  30.678 1.00 45.80 ? 474  ASN D CB    1 
ATOM   5854  C  CG    . ASN C 1 66  ? -1.810  68.712  31.773 1.00 56.05 ? 474  ASN D CG    1 
ATOM   5855  O  OD1   . ASN C 1 66  ? -0.593  68.697  31.551 1.00 60.11 ? 474  ASN D OD1   1 
ATOM   5856  N  ND2   . ASN C 1 66  ? -2.311  69.012  32.969 1.00 58.25 ? 474  ASN D ND2   1 
ATOM   5857  N  N     . ASN C 1 67  ? -2.458  65.504  28.948 1.00 30.65 ? 475  ASN D N     1 
ATOM   5858  C  CA    . ASN C 1 67  ? -2.141  64.079  29.014 1.00 30.76 ? 475  ASN D CA    1 
ATOM   5859  C  C     . ASN C 1 67  ? -0.841  63.728  28.291 1.00 30.55 ? 475  ASN D C     1 
ATOM   5860  O  O     . ASN C 1 67  ? -0.701  63.956  27.085 1.00 30.55 ? 475  ASN D O     1 
ATOM   5861  C  CB    . ASN C 1 67  ? -3.315  63.246  28.487 1.00 32.59 ? 475  ASN D CB    1 
ATOM   5862  C  CG    . ASN C 1 67  ? -3.078  61.749  28.611 1.00 34.47 ? 475  ASN D CG    1 
ATOM   5863  O  OD1   . ASN C 1 67  ? -2.264  61.167  27.890 1.00 36.99 ? 475  ASN D OD1   1 
ATOM   5864  N  ND2   . ASN C 1 67  ? -3.818  61.112  29.509 1.00 32.96 ? 475  ASN D ND2   1 
ATOM   5865  N  N     . ASN C 1 68  ? 0.085   63.154  29.052 1.00 30.28 ? 476  ASN D N     1 
ATOM   5866  C  CA    . ASN C 1 68  ? 1.428   62.797  28.598 1.00 32.94 ? 476  ASN D CA    1 
ATOM   5867  C  C     . ASN C 1 68  ? 1.514   61.942  27.319 1.00 35.20 ? 476  ASN D C     1 
ATOM   5868  O  O     . ASN C 1 68  ? 2.347   62.221  26.450 1.00 32.84 ? 476  ASN D O     1 
ATOM   5869  C  CB    . ASN C 1 68  ? 2.201   62.142  29.750 1.00 38.31 ? 476  ASN D CB    1 
ATOM   5870  C  CG    . ASN C 1 68  ? 3.698   62.044  29.490 1.00 44.64 ? 476  ASN D CG    1 
ATOM   5871  O  OD1   . ASN C 1 68  ? 4.356   61.129  29.988 1.00 53.98 ? 476  ASN D OD1   1 
ATOM   5872  N  ND2   . ASN C 1 68  ? 4.243   62.980  28.722 1.00 45.30 ? 476  ASN D ND2   1 
ATOM   5873  N  N     . GLU C 1 69  ? 0.665   60.917  27.205 1.00 33.54 ? 477  GLU D N     1 
ATOM   5874  C  CA    . GLU C 1 69  ? 0.670   60.037  26.024 1.00 32.79 ? 477  GLU D CA    1 
ATOM   5875  C  C     . GLU C 1 69  ? 0.072   60.703  24.797 1.00 33.68 ? 477  GLU D C     1 
ATOM   5876  O  O     . GLU C 1 69  ? 0.504   60.444  23.668 1.00 29.91 ? 477  GLU D O     1 
ATOM   5877  C  CB    . GLU C 1 69  ? -0.038  58.698  26.306 1.00 35.68 ? 477  GLU D CB    1 
ATOM   5878  C  CG    . GLU C 1 69  ? 0.804   57.687  27.110 1.00 35.31 ? 477  GLU D CG    1 
ATOM   5879  C  CD    . GLU C 1 69  ? 1.128   58.150  28.520 1.00 35.10 ? 477  GLU D CD    1 
ATOM   5880  O  OE1   . GLU C 1 69  ? 0.341   58.920  29.131 1.00 38.51 ? 477  GLU D OE1   1 
ATOM   5881  O  OE2   . GLU C 1 69  ? 2.179   57.735  29.034 1.00 40.96 ? 477  GLU D OE2   1 
ATOM   5882  N  N     . ILE C 1 70  ? -0.931  61.552  25.032 1.00 34.03 ? 478  ILE D N     1 
ATOM   5883  C  CA    . ILE C 1 70  ? -1.600  62.311  23.972 1.00 30.18 ? 478  ILE D CA    1 
ATOM   5884  C  C     . ILE C 1 70  ? -0.605  63.273  23.320 1.00 32.19 ? 478  ILE D C     1 
ATOM   5885  O  O     . ILE C 1 70  ? -0.549  63.373  22.091 1.00 32.26 ? 478  ILE D O     1 
ATOM   5886  C  CB    . ILE C 1 70  ? -2.841  63.077  24.514 1.00 29.81 ? 478  ILE D CB    1 
ATOM   5887  C  CG1   . ILE C 1 70  ? -3.921  62.104  25.022 1.00 27.96 ? 478  ILE D CG1   1 
ATOM   5888  C  CG2   . ILE C 1 70  ? -3.415  64.021  23.462 1.00 31.14 ? 478  ILE D CG2   1 
ATOM   5889  C  CD1   . ILE C 1 70  ? -4.503  61.165  23.982 1.00 24.72 ? 478  ILE D CD1   1 
ATOM   5890  N  N     . ARG C 1 71  ? 0.189   63.956  24.141 1.00 31.25 ? 479  ARG D N     1 
ATOM   5891  C  CA    . ARG C 1 71  ? 1.191   64.886  23.630 1.00 34.40 ? 479  ARG D CA    1 
ATOM   5892  C  C     . ARG C 1 71  ? 2.269   64.182  22.811 1.00 31.36 ? 479  ARG D C     1 
ATOM   5893  O  O     . ARG C 1 71  ? 2.690   64.699  21.774 1.00 33.32 ? 479  ARG D O     1 
ATOM   5894  C  CB    . ARG C 1 71  ? 1.826   65.711  24.755 1.00 34.28 ? 479  ARG D CB    1 
ATOM   5895  C  CG    . ARG C 1 71  ? 0.931   66.802  25.304 1.00 40.23 ? 479  ARG D CG    1 
ATOM   5896  C  CD    . ARG C 1 71  ? 1.638   67.633  26.371 1.00 44.29 ? 479  ARG D CD    1 
ATOM   5897  N  NE    . ARG C 1 71  ? 1.932   66.853  27.579 1.00 52.13 ? 479  ARG D NE    1 
ATOM   5898  C  CZ    . ARG C 1 71  ? 2.500   67.350  28.676 1.00 57.56 ? 479  ARG D CZ    1 
ATOM   5899  N  NH1   . ARG C 1 71  ? 2.884   68.628  28.714 1.00 58.41 ? 479  ARG D NH1   1 
ATOM   5900  N  NH2   . ARG C 1 71  ? 2.722   66.568  29.725 1.00 58.61 ? 479  ARG D NH2   1 
ATOM   5901  N  N     . GLN C 1 72  ? 2.698   63.007  23.266 1.00 29.39 ? 480  GLN D N     1 
ATOM   5902  C  CA    . GLN C 1 72  ? 3.733   62.234  22.573 1.00 29.65 ? 480  GLN D CA    1 
ATOM   5903  C  C     . GLN C 1 72  ? 3.308   61.834  21.166 1.00 28.68 ? 480  GLN D C     1 
ATOM   5904  O  O     . GLN C 1 72  ? 4.115   61.873  20.242 1.00 29.68 ? 480  GLN D O     1 
ATOM   5905  C  CB    . GLN C 1 72  ? 4.169   61.014  23.391 1.00 30.80 ? 480  GLN D CB    1 
ATOM   5906  C  CG    . GLN C 1 72  ? 4.919   61.379  24.677 1.00 33.89 ? 480  GLN D CG    1 
ATOM   5907  C  CD    . GLN C 1 72  ? 5.347   60.157  25.501 1.00 37.64 ? 480  GLN D CD    1 
ATOM   5908  O  OE1   . GLN C 1 72  ? 5.420   59.034  24.994 1.00 37.35 ? 480  GLN D OE1   1 
ATOM   5909  N  NE2   . GLN C 1 72  ? 5.641   60.382  26.786 1.00 36.86 ? 480  GLN D NE2   1 
ATOM   5910  N  N     . MET C 1 73  ? 2.040   61.470  21.004 1.00 28.26 ? 481  MET D N     1 
ATOM   5911  C  CA    . MET C 1 73  ? 1.515   61.103  19.694 1.00 28.48 ? 481  MET D CA    1 
ATOM   5912  C  C     . MET C 1 73  ? 1.432   62.303  18.742 1.00 31.19 ? 481  MET D C     1 
ATOM   5913  O  O     . MET C 1 73  ? 1.788   62.192  17.569 1.00 32.82 ? 481  MET D O     1 
ATOM   5914  C  CB    . MET C 1 73  ? 0.163   60.403  19.813 1.00 25.64 ? 481  MET D CB    1 
ATOM   5915  C  CG    . MET C 1 73  ? 0.251   58.969  20.309 1.00 27.17 ? 481  MET D CG    1 
ATOM   5916  S  SD    . MET C 1 73  ? -1.343  58.126  20.292 1.00 25.30 ? 481  MET D SD    1 
ATOM   5917  C  CE    . MET C 1 73  ? -2.208  58.977  21.621 1.00 25.77 ? 481  MET D CE    1 
ATOM   5918  N  N     . ILE C 1 74  ? 0.971   63.444  19.254 1.00 30.41 ? 482  ILE D N     1 
ATOM   5919  C  CA    . ILE C 1 74  ? 0.872   64.666  18.454 1.00 29.96 ? 482  ILE D CA    1 
ATOM   5920  C  C     . ILE C 1 74  ? 2.275   65.124  18.041 1.00 29.70 ? 482  ILE D C     1 
ATOM   5921  O  O     . ILE C 1 74  ? 2.506   65.478  16.883 1.00 26.94 ? 482  ILE D O     1 
ATOM   5922  C  CB    . ILE C 1 74  ? 0.124   65.798  19.207 1.00 29.47 ? 482  ILE D CB    1 
ATOM   5923  C  CG1   . ILE C 1 74  ? -1.264  65.321  19.659 1.00 25.96 ? 482  ILE D CG1   1 
ATOM   5924  C  CG2   . ILE C 1 74  ? 0.007   67.051  18.332 1.00 24.55 ? 482  ILE D CG2   1 
ATOM   5925  C  CD1   . ILE C 1 74  ? -2.004  66.290  20.553 1.00 24.76 ? 482  ILE D CD1   1 
ATOM   5926  N  N     . THR C 1 75  ? 3.207   65.097  18.992 1.00 29.33 ? 483  THR D N     1 
ATOM   5927  C  CA    . THR C 1 75  ? 4.599   65.465  18.738 1.00 27.68 ? 483  THR D CA    1 
ATOM   5928  C  C     . THR C 1 75  ? 5.200   64.488  17.720 1.00 28.91 ? 483  THR D C     1 
ATOM   5929  O  O     . THR C 1 75  ? 5.983   64.886  16.854 1.00 28.39 ? 483  THR D O     1 
ATOM   5930  C  CB    . THR C 1 75  ? 5.434   65.458  20.045 1.00 26.81 ? 483  THR D CB    1 
ATOM   5931  O  OG1   . THR C 1 75  ? 4.800   66.281  21.030 1.00 27.47 ? 483  THR D OG1   1 
ATOM   5932  C  CG2   . THR C 1 75  ? 6.858   65.959  19.805 1.00 25.38 ? 483  THR D CG2   1 
ATOM   5933  N  N     . ALA C 1 76  ? 4.817   63.218  17.821 1.00 28.59 ? 484  ALA D N     1 
ATOM   5934  C  CA    . ALA C 1 76  ? 5.303   62.194  16.903 1.00 31.44 ? 484  ALA D CA    1 
ATOM   5935  C  C     . ALA C 1 76  ? 4.803   62.425  15.474 1.00 30.11 ? 484  ALA D C     1 
ATOM   5936  O  O     . ALA C 1 76  ? 5.594   62.389  14.525 1.00 24.42 ? 484  ALA D O     1 
ATOM   5937  C  CB    . ALA C 1 76  ? 4.920   60.798  17.394 1.00 32.96 ? 484  ALA D CB    1 
ATOM   5938  N  N     . PHE C 1 77  ? 3.499   62.679  15.329 1.00 30.92 ? 485  PHE D N     1 
ATOM   5939  C  CA    . PHE C 1 77  ? 2.908   62.899  14.007 1.00 32.41 ? 485  PHE D CA    1 
ATOM   5940  C  C     . PHE C 1 77  ? 3.261   64.266  13.417 1.00 33.37 ? 485  PHE D C     1 
ATOM   5941  O  O     . PHE C 1 77  ? 3.358   64.410  12.199 1.00 31.06 ? 485  PHE D O     1 
ATOM   5942  C  CB    . PHE C 1 77  ? 1.388   62.684  14.012 1.00 32.76 ? 485  PHE D CB    1 
ATOM   5943  C  CG    . PHE C 1 77  ? 0.945   61.384  14.638 1.00 33.62 ? 485  PHE D CG    1 
ATOM   5944  C  CD1   . PHE C 1 77  ? 1.606   60.186  14.369 1.00 33.28 ? 485  PHE D CD1   1 
ATOM   5945  C  CD2   . PHE C 1 77  ? -0.179  61.348  15.460 1.00 33.70 ? 485  PHE D CD2   1 
ATOM   5946  C  CE1   . PHE C 1 77  ? 1.187   58.995  14.952 1.00 31.02 ? 485  PHE D CE1   1 
ATOM   5947  C  CE2   . PHE C 1 77  ? -0.610  60.159  16.034 1.00 31.31 ? 485  PHE D CE2   1 
ATOM   5948  C  CZ    . PHE C 1 77  ? 0.071   58.982  15.775 1.00 30.22 ? 485  PHE D CZ    1 
ATOM   5949  N  N     . GLY C 1 78  ? 3.444   65.256  14.290 1.00 36.82 ? 486  GLY D N     1 
ATOM   5950  C  CA    . GLY C 1 78  ? 3.815   66.623  13.906 1.00 37.92 ? 486  GLY D CA    1 
ATOM   5951  C  C     . GLY C 1 78  ? 2.832   67.376  13.022 1.00 43.14 ? 486  GLY D C     1 
ATOM   5952  O  O     . GLY C 1 78  ? 3.244   68.189  12.187 1.00 45.56 ? 486  GLY D O     1 
ATOM   5953  N  N     . THR C 1 79  ? 1.538   67.122  13.212 1.00 40.34 ? 487  THR D N     1 
ATOM   5954  C  CA    . THR C 1 79  ? 0.494   67.765  12.410 1.00 37.86 ? 487  THR D CA    1 
ATOM   5955  C  C     . THR C 1 79  ? -0.373  68.760  13.188 1.00 39.04 ? 487  THR D C     1 
ATOM   5956  O  O     . THR C 1 79  ? -1.062  69.580  12.589 1.00 42.82 ? 487  THR D O     1 
ATOM   5957  C  CB    . THR C 1 79  ? -0.458  66.733  11.756 1.00 37.57 ? 487  THR D CB    1 
ATOM   5958  O  OG1   . THR C 1 79  ? -1.116  65.965  12.774 1.00 37.39 ? 487  THR D OG1   1 
ATOM   5959  C  CG2   . THR C 1 79  ? 0.298   65.803  10.827 1.00 37.11 ? 487  THR D CG2   1 
ATOM   5960  N  N     . GLY C 1 80  ? -0.344  68.684  14.512 1.00 39.83 ? 488  GLY D N     1 
ATOM   5961  C  CA    . GLY C 1 80  ? -1.205  69.532  15.333 1.00 40.60 ? 488  GLY D CA    1 
ATOM   5962  C  C     . GLY C 1 80  ? -2.595  68.924  15.354 1.00 41.98 ? 488  GLY D C     1 
ATOM   5963  O  O     . GLY C 1 80  ? -2.844  67.917  14.684 1.00 36.78 ? 488  GLY D O     1 
ATOM   5964  N  N     . ILE C 1 81  ? -3.509  69.524  16.113 1.00 44.81 ? 489  ILE D N     1 
ATOM   5965  C  CA    . ILE C 1 81  ? -4.873  68.980  16.233 1.00 47.63 ? 489  ILE D CA    1 
ATOM   5966  C  C     . ILE C 1 81  ? -5.995  69.990  16.006 1.00 49.99 ? 489  ILE D C     1 
ATOM   5967  O  O     . ILE C 1 81  ? -5.836  71.193  16.250 1.00 48.28 ? 489  ILE D O     1 
ATOM   5968  C  CB    . ILE C 1 81  ? -5.102  68.266  17.594 1.00 47.19 ? 489  ILE D CB    1 
ATOM   5969  C  CG1   . ILE C 1 81  ? -4.662  69.165  18.759 1.00 47.90 ? 489  ILE D CG1   1 
ATOM   5970  C  CG2   . ILE C 1 81  ? -4.370  66.935  17.627 1.00 44.19 ? 489  ILE D CG2   1 
ATOM   5971  C  CD1   . ILE C 1 81  ? -4.968  68.589  20.123 1.00 53.03 ? 489  ILE D CD1   1 
ATOM   5972  N  N     . GLY C 1 82  ? -7.133  69.472  15.545 1.00 49.71 ? 490  GLY D N     1 
ATOM   5973  C  CA    . GLY C 1 82  ? -8.326  70.280  15.297 1.00 51.65 ? 490  GLY D CA    1 
ATOM   5974  C  C     . GLY C 1 82  ? -8.173  71.243  14.137 1.00 51.91 ? 490  GLY D C     1 
ATOM   5975  O  O     . GLY C 1 82  ? -7.982  70.828  12.994 1.00 45.78 ? 490  GLY D O     1 
ATOM   5976  N  N     . GLY C 1 83  ? -8.258  72.535  14.451 1.00 56.84 ? 491  GLY D N     1 
ATOM   5977  C  CA    . GLY C 1 83  ? -8.154  73.606  13.459 1.00 61.00 ? 491  GLY D CA    1 
ATOM   5978  C  C     . GLY C 1 83  ? -6.746  73.883  12.964 1.00 58.78 ? 491  GLY D C     1 
ATOM   5979  O  O     . GLY C 1 83  ? -6.571  74.403  11.859 1.00 57.25 ? 491  GLY D O     1 
ATOM   5980  N  N     . ASP C 1 84  ? -5.748  73.537  13.775 1.00 55.70 ? 492  ASP D N     1 
ATOM   5981  C  CA    . ASP C 1 84  ? -4.334  73.746  13.421 1.00 54.50 ? 492  ASP D CA    1 
ATOM   5982  C  C     . ASP C 1 84  ? -3.708  72.543  12.703 1.00 51.35 ? 492  ASP D C     1 
ATOM   5983  O  O     . ASP C 1 84  ? -2.491  72.484  12.526 1.00 53.34 ? 492  ASP D O     1 
ATOM   5984  C  CB    . ASP C 1 84  ? -3.509  74.104  14.665 1.00 54.36 ? 492  ASP D CB    1 
ATOM   5985  C  CG    . ASP C 1 84  ? -3.960  75.402  15.326 1.00 55.30 ? 492  ASP D CG    1 
ATOM   5986  O  OD1   . ASP C 1 84  ? -4.932  76.027  14.838 1.00 52.05 ? 492  ASP D OD1   1 
ATOM   5987  O  OD2   . ASP C 1 84  ? -3.335  75.797  16.336 1.00 54.95 ? 492  ASP D OD2   1 
ATOM   5988  N  N     . PHE C 1 85  ? -4.552  71.598  12.285 1.00 49.26 ? 493  PHE D N     1 
ATOM   5989  C  CA    . PHE C 1 85  ? -4.108  70.390  11.596 1.00 47.04 ? 493  PHE D CA    1 
ATOM   5990  C  C     . PHE C 1 85  ? -3.604  70.701  10.193 1.00 48.01 ? 493  PHE D C     1 
ATOM   5991  O  O     . PHE C 1 85  ? -4.231  71.462  9.458  1.00 54.76 ? 493  PHE D O     1 
ATOM   5992  C  CB    . PHE C 1 85  ? -5.252  69.370  11.533 1.00 46.53 ? 493  PHE D CB    1 
ATOM   5993  C  CG    . PHE C 1 85  ? -4.829  68.002  11.051 1.00 46.56 ? 493  PHE D CG    1 
ATOM   5994  C  CD1   . PHE C 1 85  ? -4.848  67.685  9.691  1.00 43.34 ? 493  PHE D CD1   1 
ATOM   5995  C  CD2   . PHE C 1 85  ? -4.421  67.027  11.960 1.00 41.05 ? 493  PHE D CD2   1 
ATOM   5996  C  CE1   . PHE C 1 85  ? -4.459  66.424  9.246  1.00 44.31 ? 493  PHE D CE1   1 
ATOM   5997  C  CE2   . PHE C 1 85  ? -4.032  65.762  11.526 1.00 39.07 ? 493  PHE D CE2   1 
ATOM   5998  C  CZ    . PHE C 1 85  ? -4.050  65.460  10.166 1.00 43.31 ? 493  PHE D CZ    1 
ATOM   5999  N  N     . ASP C 1 86  ? -2.470  70.102  9.830  1.00 48.02 ? 494  ASP D N     1 
ATOM   6000  C  CA    . ASP C 1 86  ? -1.860  70.279  8.511  1.00 39.54 ? 494  ASP D CA    1 
ATOM   6001  C  C     . ASP C 1 86  ? -1.284  68.933  8.061  1.00 38.33 ? 494  ASP D C     1 
ATOM   6002  O  O     . ASP C 1 86  ? -0.331  68.422  8.657  1.00 38.45 ? 494  ASP D O     1 
ATOM   6003  C  CB    . ASP C 1 86  ? -0.777  71.365  8.567  1.00 37.47 ? 494  ASP D CB    1 
ATOM   6004  C  CG    . ASP C 1 86  ? -0.316  71.825  7.182  1.00 37.34 ? 494  ASP D CG    1 
ATOM   6005  O  OD1   . ASP C 1 86  ? -0.916  71.417  6.160  1.00 39.21 ? 494  ASP D OD1   1 
ATOM   6006  O  OD2   . ASP C 1 86  ? 0.650   72.617  7.120  1.00 30.40 ? 494  ASP D OD2   1 
ATOM   6007  N  N     . LEU C 1 87  ? -1.875  68.357  7.019  1.00 35.12 ? 495  LEU D N     1 
ATOM   6008  C  CA    . LEU C 1 87  ? -1.464  67.043  6.520  1.00 35.72 ? 495  LEU D CA    1 
ATOM   6009  C  C     . LEU C 1 87  ? -0.085  67.037  5.854  1.00 35.95 ? 495  LEU D C     1 
ATOM   6010  O  O     . LEU C 1 87  ? 0.617   66.024  5.876  1.00 30.87 ? 495  LEU D O     1 
ATOM   6011  C  CB    . LEU C 1 87  ? -2.513  66.476  5.562  1.00 33.92 ? 495  LEU D CB    1 
ATOM   6012  C  CG    . LEU C 1 87  ? -2.340  65.026  5.103  1.00 35.92 ? 495  LEU D CG    1 
ATOM   6013  C  CD1   . LEU C 1 87  ? -2.460  64.060  6.277  1.00 37.14 ? 495  LEU D CD1   1 
ATOM   6014  C  CD2   . LEU C 1 87  ? -3.345  64.673  4.032  1.00 35.81 ? 495  LEU D CD2   1 
ATOM   6015  N  N     . ALA C 1 88  ? 0.291   68.172  5.263  1.00 38.70 ? 496  ALA D N     1 
ATOM   6016  C  CA    . ALA C 1 88  ? 1.582   68.302  4.586  1.00 37.32 ? 496  ALA D CA    1 
ATOM   6017  C  C     . ALA C 1 88  ? 2.764   68.208  5.558  1.00 36.30 ? 496  ALA D C     1 
ATOM   6018  O  O     . ALA C 1 88  ? 3.901   67.992  5.131  1.00 32.53 ? 496  ALA D O     1 
ATOM   6019  C  CB    . ALA C 1 88  ? 1.635   69.600  3.789  1.00 40.39 ? 496  ALA D CB    1 
ATOM   6020  N  N     . LYS C 1 89  ? 2.483   68.361  6.853  1.00 34.76 ? 497  LYS D N     1 
ATOM   6021  C  CA    . LYS C 1 89  ? 3.503   68.295  7.907  1.00 36.72 ? 497  LYS D CA    1 
ATOM   6022  C  C     . LYS C 1 89  ? 3.567   66.920  8.588  1.00 34.25 ? 497  LYS D C     1 
ATOM   6023  O  O     . LYS C 1 89  ? 4.299   66.731  9.563  1.00 34.18 ? 497  LYS D O     1 
ATOM   6024  C  CB    . LYS C 1 89  ? 3.278   69.411  8.943  1.00 40.29 ? 497  LYS D CB    1 
ATOM   6025  C  CG    . LYS C 1 89  ? 3.449   70.832  8.383  1.00 45.14 ? 497  LYS D CG    1 
ATOM   6026  C  CD    . LYS C 1 89  ? 3.105   71.935  9.393  1.00 46.05 ? 497  LYS D CD    1 
ATOM   6027  C  CE    . LYS C 1 89  ? 4.054   71.998  10.591 1.00 49.37 ? 497  LYS D CE    1 
ATOM   6028  N  NZ    . LYS C 1 89  ? 5.455   72.339  10.198 1.00 55.09 ? 497  LYS D NZ    1 
ATOM   6029  N  N     . ALA C 1 90  ? 2.799   65.968  8.062  1.00 32.02 ? 498  ALA D N     1 
ATOM   6030  C  CA    . ALA C 1 90  ? 2.763   64.602  8.588  1.00 32.04 ? 498  ALA D CA    1 
ATOM   6031  C  C     . ALA C 1 90  ? 4.120   63.930  8.450  1.00 34.26 ? 498  ALA D C     1 
ATOM   6032  O  O     . ALA C 1 90  ? 4.706   63.891  7.362  1.00 33.33 ? 498  ALA D O     1 
ATOM   6033  C  CB    . ALA C 1 90  ? 1.691   63.778  7.893  1.00 29.39 ? 498  ALA D CB    1 
ATOM   6034  N  N     . ARG C 1 91  ? 4.606   63.410  9.571  1.00 32.39 ? 499  ARG D N     1 
ATOM   6035  C  CA    . ARG C 1 91  ? 5.905   62.757  9.666  1.00 30.24 ? 499  ARG D CA    1 
ATOM   6036  C  C     . ARG C 1 91  ? 5.904   61.319  9.128  1.00 30.23 ? 499  ARG D C     1 
ATOM   6037  O  O     . ARG C 1 91  ? 6.952   60.795  8.747  1.00 29.21 ? 499  ARG D O     1 
ATOM   6038  C  CB    . ARG C 1 91  ? 6.333   62.761  11.133 1.00 31.44 ? 499  ARG D CB    1 
ATOM   6039  C  CG    . ARG C 1 91  ? 6.584   64.147  11.726 1.00 34.84 ? 499  ARG D CG    1 
ATOM   6040  C  CD    . ARG C 1 91  ? 8.056   64.510  11.704 1.00 38.40 ? 499  ARG D CD    1 
ATOM   6041  N  NE    . ARG C 1 91  ? 8.795   63.632  12.618 1.00 42.88 ? 499  ARG D NE    1 
ATOM   6042  C  CZ    . ARG C 1 91  ? 10.089  63.720  12.892 1.00 43.73 ? 499  ARG D CZ    1 
ATOM   6043  N  NH1   . ARG C 1 91  ? 10.851  64.638  12.311 1.00 41.90 ? 499  ARG D NH1   1 
ATOM   6044  N  NH2   . ARG C 1 91  ? 10.621  62.854  13.752 1.00 46.21 ? 499  ARG D NH2   1 
ATOM   6045  N  N     . TYR C 1 92  ? 4.733   60.684  9.107  1.00 29.85 ? 500  TYR D N     1 
ATOM   6046  C  CA    . TYR C 1 92  ? 4.596   59.294  8.658  1.00 28.59 ? 500  TYR D CA    1 
ATOM   6047  C  C     . TYR C 1 92  ? 3.332   59.097  7.820  1.00 31.31 ? 500  TYR D C     1 
ATOM   6048  O  O     . TYR C 1 92  ? 2.243   59.506  8.224  1.00 31.53 ? 500  TYR D O     1 
ATOM   6049  C  CB    . TYR C 1 92  ? 4.554   58.337  9.866  1.00 25.99 ? 500  TYR D CB    1 
ATOM   6050  C  CG    . TYR C 1 92  ? 5.679   58.517  10.869 1.00 25.91 ? 500  TYR D CG    1 
ATOM   6051  C  CD1   . TYR C 1 92  ? 6.916   57.897  10.684 1.00 25.01 ? 500  TYR D CD1   1 
ATOM   6052  C  CD2   . TYR C 1 92  ? 5.511   59.319  11.994 1.00 24.32 ? 500  TYR D CD2   1 
ATOM   6053  C  CE1   . TYR C 1 92  ? 7.949   58.073  11.595 1.00 24.40 ? 500  TYR D CE1   1 
ATOM   6054  C  CE2   . TYR C 1 92  ? 6.540   59.499  12.913 1.00 22.48 ? 500  TYR D CE2   1 
ATOM   6055  C  CZ    . TYR C 1 92  ? 7.748   58.876  12.713 1.00 24.40 ? 500  TYR D CZ    1 
ATOM   6056  O  OH    . TYR C 1 92  ? 8.766   59.060  13.620 1.00 26.14 ? 500  TYR D OH    1 
ATOM   6057  N  N     . HIS C 1 93  ? 3.476   58.478  6.653  1.00 34.67 ? 501  HIS D N     1 
ATOM   6058  C  CA    . HIS C 1 93  ? 2.321   58.178  5.799  1.00 35.98 ? 501  HIS D CA    1 
ATOM   6059  C  C     . HIS C 1 93  ? 1.588   56.916  6.243  1.00 33.55 ? 501  HIS D C     1 
ATOM   6060  O  O     . HIS C 1 93  ? 0.598   56.520  5.627  1.00 33.51 ? 501  HIS D O     1 
ATOM   6061  C  CB    . HIS C 1 93  ? 2.722   58.093  4.328  1.00 39.57 ? 501  HIS D CB    1 
ATOM   6062  C  CG    . HIS C 1 93  ? 2.724   59.418  3.630  1.00 44.23 ? 501  HIS D CG    1 
ATOM   6063  N  ND1   . HIS C 1 93  ? 1.928   59.680  2.533  1.00 45.28 ? 501  HIS D ND1   1 
ATOM   6064  C  CD2   . HIS C 1 93  ? 3.388   60.569  3.896  1.00 43.44 ? 501  HIS D CD2   1 
ATOM   6065  C  CE1   . HIS C 1 93  ? 2.130   60.921  2.132  1.00 47.69 ? 501  HIS D CE1   1 
ATOM   6066  N  NE2   . HIS C 1 93  ? 3.005   61.485  2.948  1.00 45.07 ? 501  HIS D NE2   1 
ATOM   6067  N  N     . LYS C 1 94  ? 2.096   56.283  7.303  1.00 30.05 ? 502  LYS D N     1 
ATOM   6068  C  CA    . LYS C 1 94  ? 1.467   55.097  7.891  1.00 28.14 ? 502  LYS D CA    1 
ATOM   6069  C  C     . LYS C 1 94  ? 1.566   55.081  9.420  1.00 25.86 ? 502  LYS D C     1 
ATOM   6070  O  O     . LYS C 1 94  ? 2.644   54.880  9.982  1.00 23.47 ? 502  LYS D O     1 
ATOM   6071  C  CB    . LYS C 1 94  ? 2.017   53.800  7.296  1.00 25.27 ? 502  LYS D CB    1 
ATOM   6072  C  CG    . LYS C 1 94  ? 1.639   53.568  5.852  1.00 25.57 ? 502  LYS D CG    1 
ATOM   6073  C  CD    . LYS C 1 94  ? 2.138   52.226  5.358  1.00 26.58 ? 502  LYS D CD    1 
ATOM   6074  C  CE    . LYS C 1 94  ? 1.789   52.066  3.882  1.00 28.05 ? 502  LYS D CE    1 
ATOM   6075  N  NZ    . LYS C 1 94  ? 2.361   50.820  3.328  1.00 29.31 ? 502  LYS D NZ    1 
ATOM   6076  N  N     . ILE C 1 95  ? 0.433   55.337  10.072 1.00 25.63 ? 503  ILE D N     1 
ATOM   6077  C  CA    . ILE C 1 95  ? 0.314   55.277  11.529 1.00 25.41 ? 503  ILE D CA    1 
ATOM   6078  C  C     . ILE C 1 95  ? -0.319  53.921  11.791 1.00 25.06 ? 503  ILE D C     1 
ATOM   6079  O  O     . ILE C 1 95  ? -1.487  53.692  11.462 1.00 26.09 ? 503  ILE D O     1 
ATOM   6080  C  CB    . ILE C 1 95  ? -0.568  56.417  12.110 1.00 26.23 ? 503  ILE D CB    1 
ATOM   6081  C  CG1   . ILE C 1 95  ? 0.092   57.793  11.922 1.00 26.48 ? 503  ILE D CG1   1 
ATOM   6082  C  CG2   . ILE C 1 95  ? -0.818  56.206  13.595 1.00 27.61 ? 503  ILE D CG2   1 
ATOM   6083  C  CD1   . ILE C 1 95  ? 0.045   58.344  10.518 1.00 26.57 ? 503  ILE D CD1   1 
ATOM   6084  N  N     . VAL C 1 96  ? 0.458   53.011  12.359 1.00 24.23 ? 504  VAL D N     1 
ATOM   6085  C  CA    . VAL C 1 96  ? -0.017  51.645  12.570 1.00 22.69 ? 504  VAL D CA    1 
ATOM   6086  C  C     . VAL C 1 96  ? -0.346  51.353  14.035 1.00 22.39 ? 504  VAL D C     1 
ATOM   6087  O  O     . VAL C 1 96  ? 0.515   51.469  14.909 1.00 24.20 ? 504  VAL D O     1 
ATOM   6088  C  CB    . VAL C 1 96  ? 1.004   50.607  12.044 1.00 21.14 ? 504  VAL D CB    1 
ATOM   6089  C  CG1   . VAL C 1 96  ? 0.410   49.213  12.075 1.00 20.52 ? 504  VAL D CG1   1 
ATOM   6090  C  CG2   . VAL C 1 96  ? 1.443   50.954  10.627 1.00 20.51 ? 504  VAL D CG2   1 
ATOM   6091  N  N     . ILE C 1 97  ? -1.599  50.982  14.284 1.00 21.09 ? 505  ILE D N     1 
ATOM   6092  C  CA    . ILE C 1 97  ? -2.038  50.600  15.619 1.00 19.01 ? 505  ILE D CA    1 
ATOM   6093  C  C     . ILE C 1 97  ? -1.765  49.108  15.761 1.00 17.79 ? 505  ILE D C     1 
ATOM   6094  O  O     . ILE C 1 97  ? -2.317  48.292  15.020 1.00 17.29 ? 505  ILE D O     1 
ATOM   6095  C  CB    . ILE C 1 97  ? -3.535  50.887  15.858 1.00 18.13 ? 505  ILE D CB    1 
ATOM   6096  C  CG1   . ILE C 1 97  ? -3.860  52.346  15.541 1.00 17.92 ? 505  ILE D CG1   1 
ATOM   6097  C  CG2   . ILE C 1 97  ? -3.919  50.526  17.287 1.00 18.50 ? 505  ILE D CG2   1 
ATOM   6098  C  CD1   . ILE C 1 97  ? -5.344  52.686  15.568 1.00 18.01 ? 505  ILE D CD1   1 
ATOM   6099  N  N     . MET C 1 98  ? -0.901  48.767  16.710 1.00 17.15 ? 506  MET D N     1 
ATOM   6100  C  CA    . MET C 1 98  ? -0.514  47.385  16.943 1.00 16.79 ? 506  MET D CA    1 
ATOM   6101  C  C     . MET C 1 98  ? -0.596  47.071  18.433 1.00 17.01 ? 506  MET D C     1 
ATOM   6102  O  O     . MET C 1 98  ? 0.425   46.938  19.113 1.00 16.53 ? 506  MET D O     1 
ATOM   6103  C  CB    . MET C 1 98  ? 0.898   47.133  16.380 1.00 17.33 ? 506  MET D CB    1 
ATOM   6104  C  CG    . MET C 1 98  ? 1.365   45.683  16.405 1.00 17.18 ? 506  MET D CG    1 
ATOM   6105  S  SD    . MET C 1 98  ? 2.858   45.367  15.448 1.00 17.30 ? 506  MET D SD    1 
ATOM   6106  C  CE    . MET C 1 98  ? 4.094   46.290  16.365 1.00 15.75 ? 506  MET D CE    1 
ATOM   6107  N  N     . THR C 1 99  ? -1.824  46.986  18.943 1.00 16.80 ? 507  THR D N     1 
ATOM   6108  C  CA    . THR C 1 99  ? -2.047  46.640  20.345 1.00 16.35 ? 507  THR D CA    1 
ATOM   6109  C  C     . THR C 1 99  ? -1.885  45.132  20.506 1.00 16.33 ? 507  THR D C     1 
ATOM   6110  O  O     . THR C 1 99  ? -1.688  44.424  19.520 1.00 16.25 ? 507  THR D O     1 
ATOM   6111  C  CB    . THR C 1 99  ? -3.448  47.053  20.827 1.00 16.58 ? 507  THR D CB    1 
ATOM   6112  O  OG1   . THR C 1 99  ? -4.436  46.470  19.974 1.00 18.30 ? 507  THR D OG1   1 
ATOM   6113  C  CG2   . THR C 1 99  ? -3.614  48.572  20.838 1.00 17.30 ? 507  THR D CG2   1 
ATOM   6114  N  N     . ASP C 1 100 ? -1.959  44.641  21.742 1.00 15.88 ? 508  ASP D N     1 
ATOM   6115  C  CA    . ASP C 1 100 ? -1.850  43.201  21.992 1.00 15.88 ? 508  ASP D CA    1 
ATOM   6116  C  C     . ASP C 1 100 ? -3.085  42.495  21.432 1.00 15.11 ? 508  ASP D C     1 
ATOM   6117  O  O     . ASP C 1 100 ? -4.137  43.109  21.269 1.00 13.94 ? 508  ASP D O     1 
ATOM   6118  C  CB    . ASP C 1 100 ? -1.670  42.910  23.491 1.00 15.13 ? 508  ASP D CB    1 
ATOM   6119  C  CG    . ASP C 1 100 ? -0.353  43.457  24.056 1.00 16.32 ? 508  ASP D CG    1 
ATOM   6120  O  OD1   . ASP C 1 100 ? 0.644   43.577  23.310 1.00 15.51 ? 508  ASP D OD1   1 
ATOM   6121  O  OD2   . ASP C 1 100 ? -0.308  43.750  25.268 1.00 15.66 ? 508  ASP D OD2   1 
ATOM   6122  N  N     . ALA C 1 101 ? -2.944  41.208  21.129 1.00 15.59 ? 509  ALA D N     1 
ATOM   6123  C  CA    . ALA C 1 101 ? -4.032  40.411  20.538 1.00 16.49 ? 509  ALA D CA    1 
ATOM   6124  C  C     . ALA C 1 101 ? -5.000  39.846  21.591 1.00 16.27 ? 509  ALA D C     1 
ATOM   6125  O  O     . ALA C 1 101 ? -5.299  38.644  21.589 1.00 18.55 ? 509  ALA D O     1 
ATOM   6126  C  CB    . ALA C 1 101 ? -3.448  39.271  19.691 1.00 15.79 ? 509  ALA D CB    1 
ATOM   6127  N  N     . ASP C 1 102 ? -5.477  40.705  22.488 1.00 14.46 ? 510  ASP D N     1 
ATOM   6128  C  CA    . ASP C 1 102 ? -6.458  40.304  23.488 1.00 14.07 ? 510  ASP D CA    1 
ATOM   6129  C  C     . ASP C 1 102 ? -7.591  41.325  23.611 1.00 13.45 ? 510  ASP D C     1 
ATOM   6130  O  O     . ASP C 1 102 ? -7.560  42.365  22.939 1.00 12.73 ? 510  ASP D O     1 
ATOM   6131  C  CB    . ASP C 1 102 ? -5.800  39.970  24.849 1.00 15.03 ? 510  ASP D CB    1 
ATOM   6132  C  CG    . ASP C 1 102 ? -5.027  41.142  25.452 1.00 16.08 ? 510  ASP D CG    1 
ATOM   6133  O  OD1   . ASP C 1 102 ? -4.964  42.243  24.858 1.00 18.09 ? 510  ASP D OD1   1 
ATOM   6134  O  OD2   . ASP C 1 102 ? -4.479  40.935  26.544 1.00 16.01 ? 510  ASP D OD2   1 
ATOM   6135  N  N     . VAL C 1 103 ? -8.588  41.026  24.450 1.00 12.40 ? 511  VAL D N     1 
ATOM   6136  C  CA    . VAL C 1 103 ? -9.751  41.914  24.611 1.00 12.42 ? 511  VAL D CA    1 
ATOM   6137  C  C     . VAL C 1 103 ? -9.358  43.331  25.065 1.00 11.95 ? 511  VAL D C     1 
ATOM   6138  O  O     . VAL C 1 103 ? -9.920  44.324  24.584 1.00 12.07 ? 511  VAL D O     1 
ATOM   6139  C  CB    . VAL C 1 103 ? -10.858 41.294  25.524 1.00 13.15 ? 511  VAL D CB    1 
ATOM   6140  C  CG1   . VAL C 1 103 ? -11.348 39.976  24.917 1.00 13.16 ? 511  VAL D CG1   1 
ATOM   6141  C  CG2   . VAL C 1 103 ? -10.369 41.100  26.978 1.00 12.56 ? 511  VAL D CG2   1 
ATOM   6142  N  N     . ASP C 1 104 ? -8.381  43.412  25.963 1.00 11.17 ? 512  ASP D N     1 
ATOM   6143  C  CA    . ASP C 1 104 ? -7.876  44.691  26.450 1.00 11.25 ? 512  ASP D CA    1 
ATOM   6144  C  C     . ASP C 1 104 ? -7.092  45.454  25.367 1.00 11.64 ? 512  ASP D C     1 
ATOM   6145  O  O     . ASP C 1 104 ? -6.981  46.683  25.423 1.00 10.79 ? 512  ASP D O     1 
ATOM   6146  C  CB    . ASP C 1 104 ? -7.034  44.488  27.705 1.00 10.86 ? 512  ASP D CB    1 
ATOM   6147  C  CG    . ASP C 1 104 ? -7.856  44.029  28.895 1.00 10.65 ? 512  ASP D CG    1 
ATOM   6148  O  OD1   . ASP C 1 104 ? -8.710  44.801  29.353 1.00 10.75 ? 512  ASP D OD1   1 
ATOM   6149  O  OD2   . ASP C 1 104 ? -7.623  42.905  29.396 1.00 10.11 ? 512  ASP D OD2   1 
ATOM   6150  N  N     . GLY C 1 105 ? -6.550  44.711  24.394 1.00 12.04 ? 513  GLY D N     1 
ATOM   6151  C  CA    . GLY C 1 105 ? -5.841  45.293  23.259 1.00 11.42 ? 513  GLY D CA    1 
ATOM   6152  C  C     . GLY C 1 105 ? -6.847  45.852  22.267 1.00 12.39 ? 513  GLY D C     1 
ATOM   6153  O  O     . GLY C 1 105 ? -6.644  46.921  21.689 1.00 12.16 ? 513  GLY D O     1 
ATOM   6154  N  N     . ALA C 1 106 ? -7.942  45.124  22.066 1.00 12.75 ? 514  ALA D N     1 
ATOM   6155  C  CA    . ALA C 1 106 ? -9.005  45.571  21.176 1.00 13.39 ? 514  ALA D CA    1 
ATOM   6156  C  C     . ALA C 1 106 ? -9.626  46.857  21.734 1.00 14.12 ? 514  ALA D C     1 
ATOM   6157  O  O     . ALA C 1 106 ? -9.956  47.768  20.971 1.00 14.10 ? 514  ALA D O     1 
ATOM   6158  C  CB    . ALA C 1 106 ? -10.063 44.488  21.018 1.00 13.80 ? 514  ALA D CB    1 
ATOM   6159  N  N     . HIS C 1 107 ? -9.755  46.928  23.063 1.00 12.92 ? 515  HIS D N     1 
ATOM   6160  C  CA    . HIS C 1 107 ? -10.301 48.107  23.734 1.00 13.16 ? 515  HIS D CA    1 
ATOM   6161  C  C     . HIS C 1 107 ? -9.389  49.327  23.559 1.00 13.26 ? 515  HIS D C     1 
ATOM   6162  O  O     . HIS C 1 107 ? -9.871  50.426  23.308 1.00 14.04 ? 515  HIS D O     1 
ATOM   6163  C  CB    . HIS C 1 107 ? -10.563 47.820  25.221 1.00 12.83 ? 515  HIS D CB    1 
ATOM   6164  C  CG    . HIS C 1 107 ? -11.150 48.977  25.974 1.00 13.97 ? 515  HIS D CG    1 
ATOM   6165  N  ND1   . HIS C 1 107 ? -10.569 49.501  27.104 1.00 14.53 ? 515  HIS D ND1   1 
ATOM   6166  C  CD2   . HIS C 1 107 ? -12.257 49.722  25.749 1.00 14.41 ? 515  HIS D CD2   1 
ATOM   6167  C  CE1   . HIS C 1 107 ? -11.295 50.511  27.551 1.00 14.46 ? 515  HIS D CE1   1 
ATOM   6168  N  NE2   . HIS C 1 107 ? -12.337 50.653  26.759 1.00 14.04 ? 515  HIS D NE2   1 
ATOM   6169  N  N     . ILE C 1 108 ? -8.078  49.122  23.675 1.00 12.97 ? 516  ILE D N     1 
ATOM   6170  C  CA    . ILE C 1 108 ? -7.104  50.207  23.502 1.00 13.25 ? 516  ILE D CA    1 
ATOM   6171  C  C     . ILE C 1 108 ? -7.130  50.740  22.055 1.00 13.31 ? 516  ILE D C     1 
ATOM   6172  O  O     . ILE C 1 108 ? -6.933  51.934  21.824 1.00 12.71 ? 516  ILE D O     1 
ATOM   6173  C  CB    . ILE C 1 108 ? -5.673  49.787  23.937 1.00 12.32 ? 516  ILE D CB    1 
ATOM   6174  C  CG1   . ILE C 1 108 ? -5.652  49.466  25.436 1.00 12.62 ? 516  ILE D CG1   1 
ATOM   6175  C  CG2   . ILE C 1 108 ? -4.675  50.895  23.656 1.00 12.77 ? 516  ILE D CG2   1 
ATOM   6176  C  CD1   . ILE C 1 108 ? -4.359  48.845  25.954 1.00 12.33 ? 516  ILE D CD1   1 
ATOM   6177  N  N     . ARG C 1 109 ? -7.399  49.853  21.100 1.00 13.73 ? 517  ARG D N     1 
ATOM   6178  C  CA    . ARG C 1 109 ? -7.491  50.238  19.697 1.00 14.83 ? 517  ARG D CA    1 
ATOM   6179  C  C     . ARG C 1 109 ? -8.652  51.216  19.544 1.00 16.93 ? 517  ARG D C     1 
ATOM   6180  O  O     . ARG C 1 109 ? -8.496  52.288  18.953 1.00 18.39 ? 517  ARG D O     1 
ATOM   6181  C  CB    . ARG C 1 109 ? -7.736  49.017  18.802 1.00 14.75 ? 517  ARG D CB    1 
ATOM   6182  C  CG    . ARG C 1 109 ? -7.124  49.137  17.418 1.00 14.82 ? 517  ARG D CG    1 
ATOM   6183  C  CD    . ARG C 1 109 ? -7.708  48.205  16.370 1.00 13.96 ? 517  ARG D CD    1 
ATOM   6184  N  NE    . ARG C 1 109 ? -8.223  46.951  16.874 1.00 15.46 ? 517  ARG D NE    1 
ATOM   6185  C  CZ    . ARG C 1 109 ? -7.515  45.871  17.215 1.00 16.11 ? 517  ARG D CZ    1 
ATOM   6186  N  NH1   . ARG C 1 109 ? -6.187  45.878  17.118 1.00 17.70 ? 517  ARG D NH1   1 
ATOM   6187  N  NH2   . ARG C 1 109 ? -8.166  44.793  17.654 1.00 15.09 ? 517  ARG D NH2   1 
ATOM   6188  N  N     . THR C 1 110 ? -9.811  50.859  20.106 1.00 16.68 ? 518  THR D N     1 
ATOM   6189  C  CA    . THR C 1 110 ? -10.989 51.719  20.027 1.00 16.46 ? 518  THR D CA    1 
ATOM   6190  C  C     . THR C 1 110 ? -10.721 53.068  20.674 1.00 16.54 ? 518  THR D C     1 
ATOM   6191  O  O     . THR C 1 110 ? -11.228 54.085  20.197 1.00 16.62 ? 518  THR D O     1 
ATOM   6192  C  CB    . THR C 1 110 ? -12.248 51.086  20.664 1.00 16.02 ? 518  THR D CB    1 
ATOM   6193  O  OG1   . THR C 1 110 ? -12.043 50.898  22.070 1.00 19.12 ? 518  THR D OG1   1 
ATOM   6194  C  CG2   . THR C 1 110 ? -12.582 49.767  20.038 1.00 15.35 ? 518  THR D CG2   1 
ATOM   6195  N  N     . LEU C 1 111 ? -9.928  53.069  21.746 1.00 16.52 ? 519  LEU D N     1 
ATOM   6196  C  CA    . LEU C 1 111 ? -9.562  54.307  22.445 1.00 18.99 ? 519  LEU D CA    1 
ATOM   6197  C  C     . LEU C 1 111 ? -8.707  55.211  21.564 1.00 20.09 ? 519  LEU D C     1 
ATOM   6198  O  O     . LEU C 1 111 ? -8.893  56.427  21.548 1.00 24.01 ? 519  LEU D O     1 
ATOM   6199  C  CB    . LEU C 1 111 ? -8.840  54.014  23.763 1.00 17.74 ? 519  LEU D CB    1 
ATOM   6200  C  CG    . LEU C 1 111 ? -9.639  53.454  24.952 1.00 17.73 ? 519  LEU D CG    1 
ATOM   6201  C  CD1   . LEU C 1 111 ? -8.691  52.988  26.054 1.00 17.07 ? 519  LEU D CD1   1 
ATOM   6202  C  CD2   . LEU C 1 111 ? -10.619 54.479  25.495 1.00 17.05 ? 519  LEU D CD2   1 
ATOM   6203  N  N     . LEU C 1 112 ? -7.773  54.601  20.839 1.00 22.14 ? 520  LEU D N     1 
ATOM   6204  C  CA    . LEU C 1 112 ? -6.879  55.319  19.927 1.00 23.46 ? 520  LEU D CA    1 
ATOM   6205  C  C     . LEU C 1 112 ? -7.638  55.809  18.713 1.00 22.96 ? 520  LEU D C     1 
ATOM   6206  O  O     . LEU C 1 112 ? -7.437  56.941  18.275 1.00 23.85 ? 520  LEU D O     1 
ATOM   6207  C  CB    . LEU C 1 112 ? -5.719  54.423  19.486 1.00 23.28 ? 520  LEU D CB    1 
ATOM   6208  C  CG    . LEU C 1 112 ? -4.667  54.114  20.551 1.00 24.27 ? 520  LEU D CG    1 
ATOM   6209  C  CD1   . LEU C 1 112 ? -3.874  52.875  20.174 1.00 23.18 ? 520  LEU D CD1   1 
ATOM   6210  C  CD2   . LEU C 1 112 ? -3.758  55.317  20.755 1.00 24.68 ? 520  LEU D CD2   1 
ATOM   6211  N  N     . LEU C 1 113 ? -8.500  54.946  18.172 1.00 22.73 ? 521  LEU D N     1 
ATOM   6212  C  CA    . LEU C 1 113 ? -9.345  55.294  17.028 1.00 22.00 ? 521  LEU D CA    1 
ATOM   6213  C  C     . LEU C 1 113 ? -10.226 56.484  17.388 1.00 21.66 ? 521  LEU D C     1 
ATOM   6214  O  O     . LEU C 1 113 ? -10.366 57.420  16.598 1.00 22.71 ? 521  LEU D O     1 
ATOM   6215  C  CB    . LEU C 1 113 ? -10.192 54.098  16.575 1.00 22.12 ? 521  LEU D CB    1 
ATOM   6216  C  CG    . LEU C 1 113 ? -9.484  52.960  15.827 1.00 21.77 ? 521  LEU D CG    1 
ATOM   6217  C  CD1   . LEU C 1 113 ? -10.375 51.737  15.725 1.00 21.47 ? 521  LEU D CD1   1 
ATOM   6218  C  CD2   . LEU C 1 113 ? -9.029  53.390  14.448 1.00 21.79 ? 521  LEU D CD2   1 
ATOM   6219  N  N     . THR C 1 114 ? -10.790 56.450  18.595 1.00 20.70 ? 522  THR D N     1 
ATOM   6220  C  CA    . THR C 1 114 ? -11.612 57.542  19.105 1.00 19.88 ? 522  THR D CA    1 
ATOM   6221  C  C     . THR C 1 114 ? -10.796 58.836  19.105 1.00 20.53 ? 522  THR D C     1 
ATOM   6222  O  O     . THR C 1 114 ? -11.279 59.882  18.676 1.00 20.87 ? 522  THR D O     1 
ATOM   6223  C  CB    . THR C 1 114 ? -12.140 57.226  20.516 1.00 20.78 ? 522  THR D CB    1 
ATOM   6224  O  OG1   . THR C 1 114 ? -12.888 56.007  20.477 1.00 21.35 ? 522  THR D OG1   1 
ATOM   6225  C  CG2   . THR C 1 114 ? -13.033 58.348  21.039 1.00 20.43 ? 522  THR D CG2   1 
ATOM   6226  N  N     . PHE C 1 115 ? -9.552  58.748  19.566 1.00 21.95 ? 523  PHE D N     1 
ATOM   6227  C  CA    . PHE C 1 115 ? -8.647  59.893  19.583 1.00 23.07 ? 523  PHE D CA    1 
ATOM   6228  C  C     . PHE C 1 115 ? -8.322  60.425  18.178 1.00 23.35 ? 523  PHE D C     1 
ATOM   6229  O  O     . PHE C 1 115 ? -8.361  61.638  17.956 1.00 26.05 ? 523  PHE D O     1 
ATOM   6230  C  CB    . PHE C 1 115 ? -7.372  59.563  20.360 1.00 24.49 ? 523  PHE D CB    1 
ATOM   6231  C  CG    . PHE C 1 115 ? -6.299  60.610  20.234 1.00 27.86 ? 523  PHE D CG    1 
ATOM   6232  C  CD1   . PHE C 1 115 ? -6.418  61.838  20.879 1.00 25.85 ? 523  PHE D CD1   1 
ATOM   6233  C  CD2   . PHE C 1 115 ? -5.156  60.363  19.467 1.00 28.53 ? 523  PHE D CD2   1 
ATOM   6234  C  CE1   . PHE C 1 115 ? -5.437  62.801  20.758 1.00 24.95 ? 523  PHE D CE1   1 
ATOM   6235  C  CE2   . PHE C 1 115 ? -4.165  61.322  19.344 1.00 28.18 ? 523  PHE D CE2   1 
ATOM   6236  C  CZ    . PHE C 1 115 ? -4.310  62.553  19.988 1.00 27.03 ? 523  PHE D CZ    1 
ATOM   6237  N  N     . PHE C 1 116 ? -8.029  59.526  17.238 1.00 22.88 ? 524  PHE D N     1 
ATOM   6238  C  CA    . PHE C 1 116 ? -7.694  59.944  15.870 1.00 24.89 ? 524  PHE D CA    1 
ATOM   6239  C  C     . PHE C 1 116 ? -8.867  60.577  15.119 1.00 27.74 ? 524  PHE D C     1 
ATOM   6240  O  O     . PHE C 1 116 ? -8.667  61.435  14.264 1.00 27.06 ? 524  PHE D O     1 
ATOM   6241  C  CB    . PHE C 1 116 ? -7.117  58.794  15.023 1.00 23.45 ? 524  PHE D CB    1 
ATOM   6242  C  CG    . PHE C 1 116 ? -5.843  58.201  15.559 1.00 22.91 ? 524  PHE D CG    1 
ATOM   6243  C  CD1   . PHE C 1 116 ? -4.832  59.013  16.077 1.00 23.69 ? 524  PHE D CD1   1 
ATOM   6244  C  CD2   . PHE C 1 116 ? -5.617  56.836  15.476 1.00 22.16 ? 524  PHE D CD2   1 
ATOM   6245  C  CE1   . PHE C 1 116 ? -3.650  58.451  16.560 1.00 23.64 ? 524  PHE D CE1   1 
ATOM   6246  C  CE2   . PHE C 1 116 ? -4.431  56.279  15.939 1.00 21.51 ? 524  PHE D CE2   1 
ATOM   6247  C  CZ    . PHE C 1 116 ? -3.451  57.088  16.481 1.00 20.87 ? 524  PHE D CZ    1 
ATOM   6248  N  N     . TYR C 1 117 ? -10.085 60.147  15.438 1.00 29.94 ? 525  TYR D N     1 
ATOM   6249  C  CA    . TYR C 1 117 ? -11.282 60.647  14.761 1.00 31.89 ? 525  TYR D CA    1 
ATOM   6250  C  C     . TYR C 1 117 ? -11.756 62.018  15.244 1.00 32.08 ? 525  TYR D C     1 
ATOM   6251  O  O     . TYR C 1 117 ? -12.349 62.775  14.475 1.00 33.78 ? 525  TYR D O     1 
ATOM   6252  C  CB    . TYR C 1 117 ? -12.423 59.629  14.881 1.00 32.42 ? 525  TYR D CB    1 
ATOM   6253  C  CG    . TYR C 1 117 ? -13.660 59.997  14.095 1.00 36.19 ? 525  TYR D CG    1 
ATOM   6254  C  CD1   . TYR C 1 117 ? -13.726 59.754  12.724 1.00 37.64 ? 525  TYR D CD1   1 
ATOM   6255  C  CD2   . TYR C 1 117 ? -14.768 60.576  14.715 1.00 37.83 ? 525  TYR D CD2   1 
ATOM   6256  C  CE1   . TYR C 1 117 ? -14.861 60.084  11.988 1.00 41.86 ? 525  TYR D CE1   1 
ATOM   6257  C  CE2   . TYR C 1 117 ? -15.909 60.913  13.992 1.00 39.65 ? 525  TYR D CE2   1 
ATOM   6258  C  CZ    . TYR C 1 117 ? -15.951 60.661  12.626 1.00 41.52 ? 525  TYR D CZ    1 
ATOM   6259  O  OH    . TYR C 1 117 ? -17.067 60.986  11.882 1.00 42.19 ? 525  TYR D OH    1 
ATOM   6260  N  N     . ARG C 1 118 ? -11.498 62.332  16.510 1.00 31.31 ? 526  ARG D N     1 
ATOM   6261  C  CA    . ARG C 1 118 ? -11.970 63.589  17.096 1.00 31.58 ? 526  ARG D CA    1 
ATOM   6262  C  C     . ARG C 1 118 ? -10.987 64.748  17.005 1.00 32.63 ? 526  ARG D C     1 
ATOM   6263  O  O     . ARG C 1 118 ? -11.388 65.905  17.111 1.00 30.42 ? 526  ARG D O     1 
ATOM   6264  C  CB    . ARG C 1 118 ? -12.399 63.378  18.558 1.00 28.40 ? 526  ARG D CB    1 
ATOM   6265  C  CG    . ARG C 1 118 ? -13.630 62.503  18.736 1.00 29.94 ? 526  ARG D CG    1 
ATOM   6266  C  CD    . ARG C 1 118 ? -14.827 63.115  18.021 1.00 31.68 ? 526  ARG D CD    1 
ATOM   6267  N  NE    . ARG C 1 118 ? -16.011 62.265  18.072 1.00 33.22 ? 526  ARG D NE    1 
ATOM   6268  C  CZ    . ARG C 1 118 ? -17.128 62.499  17.397 1.00 35.53 ? 526  ARG D CZ    1 
ATOM   6269  N  NH1   . ARG C 1 118 ? -17.222 63.566  16.607 1.00 37.36 ? 526  ARG D NH1   1 
ATOM   6270  N  NH2   . ARG C 1 118 ? -18.153 61.665  17.499 1.00 37.53 ? 526  ARG D NH2   1 
ATOM   6271  N  N     . PHE C 1 119 ? -9.710  64.437  16.806 1.00 33.21 ? 527  PHE D N     1 
ATOM   6272  C  CA    . PHE C 1 119 ? -8.679  65.475  16.763 1.00 34.00 ? 527  PHE D CA    1 
ATOM   6273  C  C     . PHE C 1 119 ? -7.787  65.454  15.519 1.00 30.87 ? 527  PHE D C     1 
ATOM   6274  O  O     . PHE C 1 119 ? -7.135  66.450  15.212 1.00 33.59 ? 527  PHE D O     1 
ATOM   6275  C  CB    . PHE C 1 119 ? -7.828  65.412  18.035 1.00 34.18 ? 527  PHE D CB    1 
ATOM   6276  C  CG    . PHE C 1 119 ? -8.584  65.752  19.284 1.00 36.92 ? 527  PHE D CG    1 
ATOM   6277  C  CD1   . PHE C 1 119 ? -9.298  64.771  19.976 1.00 39.37 ? 527  PHE D CD1   1 
ATOM   6278  C  CD2   . PHE C 1 119 ? -8.592  67.055  19.776 1.00 36.45 ? 527  PHE D CD2   1 
ATOM   6279  C  CE1   . PHE C 1 119 ? -10.006 65.090  21.131 1.00 35.27 ? 527  PHE D CE1   1 
ATOM   6280  C  CE2   . PHE C 1 119 ? -9.306  67.378  20.924 1.00 35.43 ? 527  PHE D CE2   1 
ATOM   6281  C  CZ    . PHE C 1 119 ? -10.008 66.387  21.605 1.00 34.84 ? 527  PHE D CZ    1 
ATOM   6282  N  N     . MET C 1 120 ? -7.763  64.326  14.819 1.00 29.54 ? 528  MET D N     1 
ATOM   6283  C  CA    . MET C 1 120 ? -6.943  64.164  13.618 1.00 30.30 ? 528  MET D CA    1 
ATOM   6284  C  C     . MET C 1 120 ? -7.734  63.443  12.530 1.00 28.98 ? 528  MET D C     1 
ATOM   6285  O  O     . MET C 1 120 ? -7.191  62.617  11.795 1.00 29.34 ? 528  MET D O     1 
ATOM   6286  C  CB    . MET C 1 120 ? -5.668  63.379  13.941 1.00 27.26 ? 528  MET D CB    1 
ATOM   6287  C  CG    . MET C 1 120 ? -4.743  64.074  14.915 1.00 29.60 ? 528  MET D CG    1 
ATOM   6288  S  SD    . MET C 1 120 ? -3.349  63.043  15.348 1.00 31.77 ? 528  MET D SD    1 
ATOM   6289  C  CE    . MET C 1 120 ? -2.450  64.129  16.439 1.00 29.12 ? 528  MET D CE    1 
ATOM   6290  N  N     . ARG C 1 121 ? -9.019  63.771  12.443 1.00 27.76 ? 529  ARG D N     1 
ATOM   6291  C  CA    . ARG C 1 121 ? -9.940  63.172  11.476 1.00 28.89 ? 529  ARG D CA    1 
ATOM   6292  C  C     . ARG C 1 121 ? -9.404  63.073  10.029 1.00 29.31 ? 529  ARG D C     1 
ATOM   6293  O  O     . ARG C 1 121 ? -9.564  62.028  9.395  1.00 28.90 ? 529  ARG D O     1 
ATOM   6294  C  CB    . ARG C 1 121 ? -11.283 63.896  11.526 1.00 30.32 ? 529  ARG D CB    1 
ATOM   6295  C  CG    . ARG C 1 121 ? -12.357 63.343  10.609 1.00 34.47 ? 529  ARG D CG    1 
ATOM   6296  C  CD    . ARG C 1 121 ? -13.614 64.160  10.778 1.00 41.04 ? 529  ARG D CD    1 
ATOM   6297  N  NE    . ARG C 1 121 ? -14.608 63.879  9.756  1.00 46.41 ? 529  ARG D NE    1 
ATOM   6298  C  CZ    . ARG C 1 121 ? -15.794 64.468  9.677  1.00 44.59 ? 529  ARG D CZ    1 
ATOM   6299  N  NH1   . ARG C 1 121 ? -16.162 65.345  10.594 1.00 45.53 ? 529  ARG D NH1   1 
ATOM   6300  N  NH2   . ARG C 1 121 ? -16.635 64.162  8.706  1.00 47.98 ? 529  ARG D NH2   1 
ATOM   6301  N  N     . PRO C 1 122 ? -8.766  64.155  9.513  1.00 29.55 ? 530  PRO D N     1 
ATOM   6302  C  CA    . PRO C 1 122 ? -8.221  64.128  8.147  1.00 31.31 ? 530  PRO D CA    1 
ATOM   6303  C  C     . PRO C 1 122 ? -7.117  63.092  7.923  1.00 31.09 ? 530  PRO D C     1 
ATOM   6304  O  O     . PRO C 1 122 ? -6.789  62.778  6.778  1.00 29.18 ? 530  PRO D O     1 
ATOM   6305  C  CB    . PRO C 1 122 ? -7.639  65.536  7.972  1.00 31.99 ? 530  PRO D CB    1 
ATOM   6306  C  CG    . PRO C 1 122 ? -8.343  66.373  8.986  1.00 32.00 ? 530  PRO D CG    1 
ATOM   6307  C  CD    . PRO C 1 122 ? -8.539  65.466  10.150 1.00 29.45 ? 530  PRO D CD    1 
ATOM   6308  N  N     . LEU C 1 123 ? -6.552  62.583  9.015  1.00 30.56 ? 531  LEU D N     1 
ATOM   6309  C  CA    . LEU C 1 123 ? -5.490  61.585  8.965  1.00 27.47 ? 531  LEU D CA    1 
ATOM   6310  C  C     . LEU C 1 123 ? -6.091  60.237  8.589  1.00 27.96 ? 531  LEU D C     1 
ATOM   6311  O  O     . LEU C 1 123 ? -5.437  59.400  7.964  1.00 26.90 ? 531  LEU D O     1 
ATOM   6312  C  CB    . LEU C 1 123 ? -4.798  61.504  10.324 1.00 28.26 ? 531  LEU D CB    1 
ATOM   6313  C  CG    . LEU C 1 123 ? -3.418  60.867  10.455 1.00 29.47 ? 531  LEU D CG    1 
ATOM   6314  C  CD1   . LEU C 1 123 ? -2.365  61.694  9.745  1.00 26.89 ? 531  LEU D CD1   1 
ATOM   6315  C  CD2   . LEU C 1 123 ? -3.085  60.744  11.932 1.00 28.00 ? 531  LEU D CD2   1 
ATOM   6316  N  N     . ILE C 1 124 ? -7.349  60.041  8.970  1.00 29.17 ? 532  ILE D N     1 
ATOM   6317  C  CA    . ILE C 1 124 ? -8.083  58.821  8.658  1.00 29.94 ? 532  ILE D CA    1 
ATOM   6318  C  C     . ILE C 1 124 ? -8.648  58.913  7.231  1.00 32.83 ? 532  ILE D C     1 
ATOM   6319  O  O     . ILE C 1 124 ? -8.701  57.906  6.508  1.00 31.63 ? 532  ILE D O     1 
ATOM   6320  C  CB    . ILE C 1 124 ? -9.206  58.573  9.691  1.00 28.71 ? 532  ILE D CB    1 
ATOM   6321  C  CG1   . ILE C 1 124 ? -8.610  58.504  11.106 1.00 28.95 ? 532  ILE D CG1   1 
ATOM   6322  C  CG2   . ILE C 1 124 ? -9.994  57.311  9.352  1.00 25.97 ? 532  ILE D CG2   1 
ATOM   6323  C  CD1   . ILE C 1 124 ? -9.629  58.400  12.230 1.00 28.51 ? 532  ILE D CD1   1 
ATOM   6324  N  N     . GLU C 1 125 ? -9.044  60.124  6.832  1.00 34.00 ? 533  GLU D N     1 
ATOM   6325  C  CA    . GLU C 1 125 ? -9.597  60.375  5.494  1.00 38.09 ? 533  GLU D CA    1 
ATOM   6326  C  C     . GLU C 1 125 ? -8.542  60.229  4.390  1.00 38.39 ? 533  GLU D C     1 
ATOM   6327  O  O     . GLU C 1 125 ? -8.866  59.855  3.261  1.00 39.14 ? 533  GLU D O     1 
ATOM   6328  C  CB    . GLU C 1 125 ? -10.275 61.751  5.427  1.00 39.64 ? 533  GLU D CB    1 
ATOM   6329  C  CG    . GLU C 1 125 ? -11.610 61.823  6.194  1.00 42.99 ? 533  GLU D CG    1 
ATOM   6330  C  CD    . GLU C 1 125 ? -12.165 63.243  6.363  1.00 42.97 ? 533  GLU D CD    1 
ATOM   6331  O  OE1   . GLU C 1 125 ? -13.363 63.384  6.662  1.00 42.64 ? 533  GLU D OE1   1 
ATOM   6332  O  OE2   . GLU C 1 125 ? -11.412 64.221  6.225  1.00 43.20 ? 533  GLU D OE2   1 
ATOM   6333  N  N     . ALA C 1 126 ? -7.286  60.514  4.729  1.00 35.28 ? 534  ALA D N     1 
ATOM   6334  C  CA    . ALA C 1 126 ? -6.169  60.413  3.787  1.00 33.69 ? 534  ALA D CA    1 
ATOM   6335  C  C     . ALA C 1 126 ? -5.595  58.991  3.668  1.00 33.16 ? 534  ALA D C     1 
ATOM   6336  O  O     . ALA C 1 126 ? -4.683  58.755  2.876  1.00 33.53 ? 534  ALA D O     1 
ATOM   6337  C  CB    . ALA C 1 126 ? -5.072  61.400  4.168  1.00 30.58 ? 534  ALA D CB    1 
ATOM   6338  N  N     . GLY C 1 127 ? -6.128  58.060  4.463  1.00 31.93 ? 535  GLY D N     1 
ATOM   6339  C  CA    . GLY C 1 127 ? -5.683  56.664  4.456  1.00 30.61 ? 535  GLY D CA    1 
ATOM   6340  C  C     . GLY C 1 127 ? -4.371  56.406  5.184  1.00 31.45 ? 535  GLY D C     1 
ATOM   6341  O  O     . GLY C 1 127 ? -3.700  55.407  4.923  1.00 32.05 ? 535  GLY D O     1 
ATOM   6342  N  N     . TYR C 1 128 ? -4.010  57.306  6.101  1.00 29.02 ? 536  TYR D N     1 
ATOM   6343  C  CA    . TYR C 1 128 ? -2.771  57.207  6.874  1.00 27.72 ? 536  TYR D CA    1 
ATOM   6344  C  C     . TYR C 1 128 ? -2.827  56.242  8.075  1.00 28.93 ? 536  TYR D C     1 
ATOM   6345  O  O     . TYR C 1 128 ? -1.780  55.779  8.545  1.00 29.62 ? 536  TYR D O     1 
ATOM   6346  C  CB    . TYR C 1 128 ? -2.366  58.594  7.369  1.00 29.70 ? 536  TYR D CB    1 
ATOM   6347  C  CG    . TYR C 1 128 ? -1.654  59.495  6.368  1.00 30.88 ? 536  TYR D CG    1 
ATOM   6348  C  CD1   . TYR C 1 128 ? -2.052  59.572  5.027  1.00 31.30 ? 536  TYR D CD1   1 
ATOM   6349  C  CD2   . TYR C 1 128 ? -0.623  60.331  6.794  1.00 32.17 ? 536  TYR D CD2   1 
ATOM   6350  C  CE1   . TYR C 1 128 ? -1.399  60.417  4.137  1.00 31.97 ? 536  TYR D CE1   1 
ATOM   6351  C  CE2   . TYR C 1 128 ? 0.025   61.186  5.919  1.00 32.90 ? 536  TYR D CE2   1 
ATOM   6352  C  CZ    . TYR C 1 128 ? -0.361  61.232  4.594  1.00 34.53 ? 536  TYR D CZ    1 
ATOM   6353  O  OH    . TYR C 1 128 ? 0.301   62.096  3.743  1.00 36.75 ? 536  TYR D OH    1 
ATOM   6354  N  N     . VAL C 1 129 ? -4.034  55.943  8.562  1.00 25.55 ? 537  VAL D N     1 
ATOM   6355  C  CA    . VAL C 1 129 ? -4.207  55.068  9.732  1.00 21.86 ? 537  VAL D CA    1 
ATOM   6356  C  C     . VAL C 1 129 ? -4.400  53.588  9.361  1.00 22.15 ? 537  VAL D C     1 
ATOM   6357  O  O     . VAL C 1 129 ? -5.231  53.247  8.519  1.00 20.38 ? 537  VAL D O     1 
ATOM   6358  C  CB    . VAL C 1 129 ? -5.346  55.568  10.651 1.00 21.28 ? 537  VAL D CB    1 
ATOM   6359  C  CG1   . VAL C 1 129 ? -5.525  54.660  11.860 1.00 22.06 ? 537  VAL D CG1   1 
ATOM   6360  C  CG2   . VAL C 1 129 ? -5.065  57.002  11.105 1.00 20.55 ? 537  VAL D CG2   1 
ATOM   6361  N  N     . TYR C 1 130 ? -3.614  52.727  10.010 1.00 22.41 ? 538  TYR D N     1 
ATOM   6362  C  CA    . TYR C 1 130 ? -3.636  51.289  9.762  1.00 22.14 ? 538  TYR D CA    1 
ATOM   6363  C  C     . TYR C 1 130 ? -3.756  50.464  11.044 1.00 20.86 ? 538  TYR D C     1 
ATOM   6364  O  O     . TYR C 1 130 ? -3.373  50.906  12.128 1.00 23.63 ? 538  TYR D O     1 
ATOM   6365  C  CB    . TYR C 1 130 ? -2.372  50.865  9.000  1.00 22.99 ? 538  TYR D CB    1 
ATOM   6366  C  CG    . TYR C 1 130 ? -2.249  51.460  7.614  1.00 26.25 ? 538  TYR D CG    1 
ATOM   6367  C  CD1   . TYR C 1 130 ? -1.697  52.730  7.425  1.00 26.64 ? 538  TYR D CD1   1 
ATOM   6368  C  CD2   . TYR C 1 130 ? -2.675  50.756  6.489  1.00 27.36 ? 538  TYR D CD2   1 
ATOM   6369  C  CE1   . TYR C 1 130 ? -1.585  53.287  6.167  1.00 25.68 ? 538  TYR D CE1   1 
ATOM   6370  C  CE2   . TYR C 1 130 ? -2.562  51.303  5.212  1.00 26.52 ? 538  TYR D CE2   1 
ATOM   6371  C  CZ    . TYR C 1 130 ? -2.013  52.572  5.059  1.00 27.54 ? 538  TYR D CZ    1 
ATOM   6372  O  OH    . TYR C 1 130 ? -1.891  53.135  3.803  1.00 28.90 ? 538  TYR D OH    1 
ATOM   6373  N  N     . ILE C 1 131 ? -4.275  49.251  10.898 1.00 18.32 ? 539  ILE D N     1 
ATOM   6374  C  CA    . ILE C 1 131 ? -4.440  48.314  12.001 1.00 16.00 ? 539  ILE D CA    1 
ATOM   6375  C  C     . ILE C 1 131 ? -3.602  47.080  11.714 1.00 15.59 ? 539  ILE D C     1 
ATOM   6376  O  O     . ILE C 1 131 ? -3.818  46.388  10.715 1.00 14.72 ? 539  ILE D O     1 
ATOM   6377  C  CB    . ILE C 1 131 ? -5.925  47.912  12.185 1.00 15.88 ? 539  ILE D CB    1 
ATOM   6378  C  CG1   . ILE C 1 131 ? -6.760  49.145  12.544 1.00 15.27 ? 539  ILE D CG1   1 
ATOM   6379  C  CG2   . ILE C 1 131 ? -6.069  46.821  13.250 1.00 15.63 ? 539  ILE D CG2   1 
ATOM   6380  C  CD1   . ILE C 1 131 ? -8.248  48.896  12.598 1.00 16.04 ? 539  ILE D CD1   1 
ATOM   6381  N  N     . ALA C 1 132 ? -2.631  46.817  12.583 1.00 15.80 ? 540  ALA D N     1 
ATOM   6382  C  CA    . ALA C 1 132 ? -1.767  45.654  12.437 1.00 16.34 ? 540  ALA D CA    1 
ATOM   6383  C  C     . ALA C 1 132 ? -2.526  44.404  12.851 1.00 16.58 ? 540  ALA D C     1 
ATOM   6384  O  O     . ALA C 1 132 ? -3.555  44.490  13.515 1.00 15.26 ? 540  ALA D O     1 
ATOM   6385  C  CB    . ALA C 1 132 ? -0.503  45.820  13.259 1.00 15.92 ? 540  ALA D CB    1 
ATOM   6386  N  N     . GLN C 1 133 ? -2.018  43.243  12.448 1.00 18.90 ? 541  GLN D N     1 
ATOM   6387  C  CA    . GLN C 1 133 ? -2.672  41.972  12.783 1.00 20.61 ? 541  GLN D CA    1 
ATOM   6388  C  C     . GLN C 1 133 ? -1.723  40.908  13.347 1.00 20.58 ? 541  GLN D C     1 
ATOM   6389  O  O     . GLN C 1 133 ? -1.327  39.984  12.633 1.00 20.23 ? 541  GLN D O     1 
ATOM   6390  C  CB    . GLN C 1 133 ? -3.453  41.424  11.585 1.00 21.28 ? 541  GLN D CB    1 
ATOM   6391  C  CG    . GLN C 1 133 ? -4.735  42.167  11.291 1.00 22.05 ? 541  GLN D CG    1 
ATOM   6392  C  CD    . GLN C 1 133 ? -5.501  41.575  10.122 1.00 24.19 ? 541  GLN D CD    1 
ATOM   6393  O  OE1   . GLN C 1 133 ? -6.655  41.186  10.266 1.00 26.50 ? 541  GLN D OE1   1 
ATOM   6394  N  NE2   . GLN C 1 133 ? -4.857  41.488  8.964  1.00 22.99 ? 541  GLN D NE2   1 
ATOM   6395  N  N     . PRO C 1 134 ? -1.365  41.037  14.635 1.00 20.82 ? 542  PRO D N     1 
ATOM   6396  C  CA    . PRO C 1 134 ? -0.496  40.048  15.270 1.00 20.80 ? 542  PRO D CA    1 
ATOM   6397  C  C     . PRO C 1 134 ? -1.255  38.744  15.505 1.00 21.45 ? 542  PRO D C     1 
ATOM   6398  O  O     . PRO C 1 134 ? -2.478  38.783  15.655 1.00 23.09 ? 542  PRO D O     1 
ATOM   6399  C  CB    . PRO C 1 134 ? -0.126  40.704  16.609 1.00 20.05 ? 542  PRO D CB    1 
ATOM   6400  C  CG    . PRO C 1 134 ? -0.619  42.117  16.530 1.00 21.56 ? 542  PRO D CG    1 
ATOM   6401  C  CD    . PRO C 1 134 ? -1.743  42.116  15.565 1.00 20.27 ? 542  PRO D CD    1 
ATOM   6402  N  N     . PRO C 1 135 ? -0.552  37.598  15.526 1.00 21.81 ? 543  PRO D N     1 
ATOM   6403  C  CA    . PRO C 1 135 ? -1.170  36.277  15.721 1.00 23.13 ? 543  PRO D CA    1 
ATOM   6404  C  C     . PRO C 1 135 ? -1.847  36.102  17.087 1.00 26.18 ? 543  PRO D C     1 
ATOM   6405  O  O     . PRO C 1 135 ? -1.355  36.603  18.100 1.00 28.24 ? 543  PRO D O     1 
ATOM   6406  C  CB    . PRO C 1 135 ? 0.024   35.312  15.639 1.00 20.29 ? 543  PRO D CB    1 
ATOM   6407  C  CG    . PRO C 1 135 ? 1.084   36.058  14.939 1.00 21.00 ? 543  PRO D CG    1 
ATOM   6408  C  CD    . PRO C 1 135 ? 0.906   37.488  15.339 1.00 20.20 ? 543  PRO D CD    1 
ATOM   6409  N  N     . THR C 1 136 ? -2.967  35.381  17.096 1.00 27.30 ? 544  THR D N     1 
ATOM   6410  C  CA    . THR C 1 136 ? -3.708  35.078  18.318 1.00 29.03 ? 544  THR D CA    1 
ATOM   6411  C  C     . THR C 1 136 ? -2.959  33.989  19.103 1.00 28.53 ? 544  THR D C     1 
ATOM   6412  O  O     . THR C 1 136 ? -2.104  33.288  18.548 1.00 28.45 ? 544  THR D O     1 
ATOM   6413  C  CB    . THR C 1 136 ? -5.136  34.577  18.001 1.00 30.85 ? 544  THR D CB    1 
ATOM   6414  O  OG1   . THR C 1 136 ? -5.061  33.425  17.144 1.00 30.74 ? 544  THR D OG1   1 
ATOM   6415  C  CG2   . THR C 1 136 ? -5.958  35.673  17.309 1.00 30.72 ? 544  THR D CG2   1 
ATOM   6416  N  N     . GLY C 1 137 ? -3.280  33.845  20.385 1.00 25.73 ? 545  GLY D N     1 
ATOM   6417  C  CA    . GLY C 1 137 ? -2.614  32.854  21.228 1.00 26.51 ? 545  GLY D CA    1 
ATOM   6418  C  C     . GLY C 1 137 ? -1.395  33.422  21.949 1.00 26.79 ? 545  GLY D C     1 
ATOM   6419  O  O     . GLY C 1 137 ? -0.578  32.679  22.499 1.00 24.05 ? 545  GLY D O     1 
ATOM   6420  N  N     . TYR C 1 138 ? -1.281  34.751  21.922 1.00 24.39 ? 580  TYR D N     1 
ATOM   6421  C  CA    . TYR C 1 138 ? -0.221  35.486  22.599 1.00 23.50 ? 580  TYR D CA    1 
ATOM   6422  C  C     . TYR C 1 138 ? -0.848  36.534  23.493 1.00 22.83 ? 580  TYR D C     1 
ATOM   6423  O  O     . TYR C 1 138 ? -1.659  37.345  23.032 1.00 27.35 ? 580  TYR D O     1 
ATOM   6424  C  CB    . TYR C 1 138 ? 0.698   36.176  21.602 1.00 22.50 ? 580  TYR D CB    1 
ATOM   6425  C  CG    . TYR C 1 138 ? 1.553   35.243  20.782 1.00 24.16 ? 580  TYR D CG    1 
ATOM   6426  C  CD1   . TYR C 1 138 ? 2.734   34.706  21.303 1.00 24.28 ? 580  TYR D CD1   1 
ATOM   6427  C  CD2   . TYR C 1 138 ? 1.183   34.890  19.481 1.00 22.89 ? 580  TYR D CD2   1 
ATOM   6428  C  CE1   . TYR C 1 138 ? 3.526   33.846  20.549 1.00 23.47 ? 580  TYR D CE1   1 
ATOM   6429  C  CE2   . TYR C 1 138 ? 1.969   34.036  18.720 1.00 22.24 ? 580  TYR D CE2   1 
ATOM   6430  C  CZ    . TYR C 1 138 ? 3.137   33.515  19.261 1.00 23.53 ? 580  TYR D CZ    1 
ATOM   6431  O  OH    . TYR C 1 138 ? 3.918   32.669  18.510 1.00 24.89 ? 580  TYR D OH    1 
ATOM   6432  N  N     . LYS C 1 139 ? -0.468  36.524  24.765 1.00 22.32 ? 581  LYS D N     1 
ATOM   6433  C  CA    . LYS C 1 139 ? -0.986  37.483  25.739 1.00 23.39 ? 581  LYS D CA    1 
ATOM   6434  C  C     . LYS C 1 139 ? -0.503  38.897  25.425 1.00 22.75 ? 581  LYS D C     1 
ATOM   6435  O  O     . LYS C 1 139 ? -1.165  39.881  25.766 1.00 23.70 ? 581  LYS D O     1 
ATOM   6436  C  CB    . LYS C 1 139 ? -0.562  37.076  27.163 1.00 24.04 ? 581  LYS D CB    1 
ATOM   6437  C  CG    . LYS C 1 139 ? -1.093  35.713  27.620 1.00 22.91 ? 581  LYS D CG    1 
ATOM   6438  C  CD    . LYS C 1 139 ? -0.583  35.361  29.033 1.00 21.88 ? 581  LYS D CD    1 
ATOM   6439  C  CE    . LYS C 1 139 ? 0.833   34.770  29.017 1.00 24.01 ? 581  LYS D CE    1 
ATOM   6440  N  NZ    . LYS C 1 139 ? 1.868   35.777  28.625 1.00 23.08 ? 581  LYS D NZ    1 
ATOM   6441  N  N     . GLY C 1 140 ? 0.651   38.979  24.765 1.00 19.78 ? 582  GLY D N     1 
ATOM   6442  C  CA    . GLY C 1 140 ? 1.261   40.251  24.383 1.00 17.38 ? 582  GLY D CA    1 
ATOM   6443  C  C     . GLY C 1 140 ? 2.366   40.053  23.374 1.00 16.26 ? 582  GLY D C     1 
ATOM   6444  O  O     . GLY C 1 140 ? 2.799   38.923  23.129 1.00 16.53 ? 582  GLY D O     1 
ATOM   6445  N  N     . LEU C 1 141 ? 2.832   41.147  22.783 1.00 15.09 ? 583  LEU D N     1 
ATOM   6446  C  CA    . LEU C 1 141 ? 3.900   41.075  21.782 1.00 16.03 ? 583  LEU D CA    1 
ATOM   6447  C  C     . LEU C 1 141 ? 5.253   40.762  22.416 1.00 16.31 ? 583  LEU D C     1 
ATOM   6448  O  O     . LEU C 1 141 ? 6.155   40.280  21.738 1.00 17.66 ? 583  LEU D O     1 
ATOM   6449  C  CB    . LEU C 1 141 ? 3.974   42.360  20.955 1.00 16.15 ? 583  LEU D CB    1 
ATOM   6450  C  CG    . LEU C 1 141 ? 2.700   42.873  20.281 1.00 16.04 ? 583  LEU D CG    1 
ATOM   6451  C  CD1   . LEU C 1 141 ? 3.048   44.108  19.463 1.00 16.68 ? 583  LEU D CD1   1 
ATOM   6452  C  CD2   . LEU C 1 141 ? 2.027   41.820  19.417 1.00 14.46 ? 583  LEU D CD2   1 
ATOM   6453  N  N     . GLY C 1 142 ? 5.384   41.038  23.709 1.00 16.59 ? 584  GLY D N     1 
ATOM   6454  C  CA    . GLY C 1 142 ? 6.603   40.727  24.464 1.00 15.89 ? 584  GLY D CA    1 
ATOM   6455  C  C     . GLY C 1 142 ? 6.771   39.233  24.673 1.00 16.47 ? 584  GLY D C     1 
ATOM   6456  O  O     . GLY C 1 142 ? 7.843   38.773  25.084 1.00 16.24 ? 584  GLY D O     1 
ATOM   6457  N  N     . GLU C 1 143 ? 5.706   38.481  24.391 1.00 16.25 ? 585  GLU D N     1 
ATOM   6458  C  CA    . GLU C 1 143 ? 5.700   37.024  24.486 1.00 16.87 ? 585  GLU D CA    1 
ATOM   6459  C  C     . GLU C 1 143 ? 6.235   36.378  23.202 1.00 17.38 ? 585  GLU D C     1 
ATOM   6460  O  O     . GLU C 1 143 ? 6.554   35.185  23.181 1.00 18.24 ? 585  GLU D O     1 
ATOM   6461  C  CB    . GLU C 1 143 ? 4.274   36.534  24.767 1.00 18.49 ? 585  GLU D CB    1 
ATOM   6462  C  CG    . GLU C 1 143 ? 4.118   35.021  24.875 1.00 19.10 ? 585  GLU D CG    1 
ATOM   6463  C  CD    . GLU C 1 143 ? 2.731   34.591  25.310 1.00 20.74 ? 585  GLU D CD    1 
ATOM   6464  O  OE1   . GLU C 1 143 ? 2.591   33.379  25.636 1.00 19.63 ? 585  GLU D OE1   1 
ATOM   6465  O  OE2   . GLU C 1 143 ? 1.822   35.450  25.363 1.00 21.08 ? 585  GLU D OE2   1 
ATOM   6466  N  N     . MET C 1 144 ? 6.343   37.175  22.142 1.00 17.10 ? 586  MET D N     1 
ATOM   6467  C  CA    . MET C 1 144 ? 6.814   36.710  20.841 1.00 17.39 ? 586  MET D CA    1 
ATOM   6468  C  C     . MET C 1 144 ? 8.287   37.006  20.624 1.00 18.06 ? 586  MET D C     1 
ATOM   6469  O  O     . MET C 1 144 ? 8.807   38.007  21.133 1.00 18.97 ? 586  MET D O     1 
ATOM   6470  C  CB    . MET C 1 144 ? 6.053   37.420  19.719 1.00 17.16 ? 586  MET D CB    1 
ATOM   6471  C  CG    . MET C 1 144 ? 4.548   37.311  19.773 1.00 16.88 ? 586  MET D CG    1 
ATOM   6472  S  SD    . MET C 1 144 ? 3.793   38.229  18.426 1.00 16.21 ? 586  MET D SD    1 
ATOM   6473  C  CE    . MET C 1 144 ? 4.272   37.234  17.016 1.00 15.54 ? 586  MET D CE    1 
ATOM   6474  N  N     . ASN C 1 145 ? 8.946   36.149  19.847 1.00 17.48 ? 587  ASN D N     1 
ATOM   6475  C  CA    . ASN C 1 145 ? 10.335  36.396  19.457 1.00 17.77 ? 587  ASN D CA    1 
ATOM   6476  C  C     . ASN C 1 145 ? 10.362  37.442  18.364 1.00 16.98 ? 587  ASN D C     1 
ATOM   6477  O  O     . ASN C 1 145 ? 9.485   37.465  17.499 1.00 17.10 ? 587  ASN D O     1 
ATOM   6478  C  CB    . ASN C 1 145 ? 11.027  35.116  18.979 1.00 17.53 ? 587  ASN D CB    1 
ATOM   6479  C  CG    . ASN C 1 145 ? 11.291  34.137  20.097 1.00 17.15 ? 587  ASN D CG    1 
ATOM   6480  O  OD1   . ASN C 1 145 ? 11.415  34.524  21.253 1.00 18.45 ? 587  ASN D OD1   1 
ATOM   6481  N  ND2   . ASN C 1 145 ? 11.406  32.869  19.756 1.00 16.95 ? 587  ASN D ND2   1 
ATOM   6482  N  N     . ALA C 1 146 ? 11.363  38.312  18.413 1.00 16.71 ? 588  ALA D N     1 
ATOM   6483  C  CA    . ALA C 1 146 ? 11.524  39.396  17.444 1.00 15.82 ? 588  ALA D CA    1 
ATOM   6484  C  C     . ALA C 1 146 ? 11.230  38.983  15.995 1.00 16.27 ? 588  ALA D C     1 
ATOM   6485  O  O     . ALA C 1 146 ? 10.469  39.661  15.294 1.00 15.52 ? 588  ALA D O     1 
ATOM   6486  C  CB    . ALA C 1 146 ? 12.912  40.002  17.566 1.00 15.48 ? 588  ALA D CB    1 
ATOM   6487  N  N     . ASP C 1 147 ? 11.812  37.865  15.565 1.00 17.58 ? 589  ASP D N     1 
ATOM   6488  C  CA    . ASP C 1 147 ? 11.657  37.373  14.193 1.00 17.65 ? 589  ASP D CA    1 
ATOM   6489  C  C     . ASP C 1 147 ? 10.219  37.013  13.822 1.00 19.51 ? 589  ASP D C     1 
ATOM   6490  O  O     . ASP C 1 147 ? 9.733   37.426  12.763 1.00 20.15 ? 589  ASP D O     1 
ATOM   6491  C  CB    . ASP C 1 147 ? 12.645  36.236  13.869 1.00 17.52 ? 589  ASP D CB    1 
ATOM   6492  C  CG    . ASP C 1 147 ? 12.545  35.051  14.837 1.00 18.28 ? 589  ASP D CG    1 
ATOM   6493  O  OD1   . ASP C 1 147 ? 11.825  35.117  15.840 1.00 21.95 ? 589  ASP D OD1   1 
ATOM   6494  O  OD2   . ASP C 1 147 ? 13.159  34.014  14.605 1.00 17.58 ? 589  ASP D OD2   1 
ATOM   6495  N  N     . GLN C 1 148 ? 9.539   36.267  14.686 1.00 19.90 ? 590  GLN D N     1 
ATOM   6496  C  CA    . GLN C 1 148 ? 8.159   35.852  14.411 1.00 22.62 ? 590  GLN D CA    1 
ATOM   6497  C  C     . GLN C 1 148 ? 7.172   37.026  14.389 1.00 22.69 ? 590  GLN D C     1 
ATOM   6498  O  O     . GLN C 1 148 ? 6.120   36.937  13.756 1.00 23.83 ? 590  GLN D O     1 
ATOM   6499  C  CB    . GLN C 1 148 ? 7.702   34.684  15.318 1.00 24.97 ? 590  GLN D CB    1 
ATOM   6500  C  CG    . GLN C 1 148 ? 7.722   34.938  16.820 1.00 29.93 ? 590  GLN D CG    1 
ATOM   6501  C  CD    . GLN C 1 148 ? 7.661   33.651  17.665 1.00 33.72 ? 590  GLN D CD    1 
ATOM   6502  O  OE1   . GLN C 1 148 ? 7.498   33.706  18.896 1.00 32.36 ? 590  GLN D OE1   1 
ATOM   6503  N  NE2   . GLN C 1 148 ? 7.796   32.497  17.012 1.00 34.64 ? 590  GLN D NE2   1 
ATOM   6504  N  N     . LEU C 1 149 ? 7.528   38.124  15.057 1.00 19.82 ? 591  LEU D N     1 
ATOM   6505  C  CA    . LEU C 1 149 ? 6.710   39.336  15.063 1.00 17.18 ? 591  LEU D CA    1 
ATOM   6506  C  C     . LEU C 1 149 ? 6.921   40.095  13.762 1.00 16.53 ? 591  LEU D C     1 
ATOM   6507  O  O     . LEU C 1 149 ? 5.987   40.687  13.213 1.00 15.21 ? 591  LEU D O     1 
ATOM   6508  C  CB    . LEU C 1 149 ? 7.053   40.234  16.259 1.00 15.93 ? 591  LEU D CB    1 
ATOM   6509  C  CG    . LEU C 1 149 ? 6.393   41.622  16.358 1.00 15.28 ? 591  LEU D CG    1 
ATOM   6510  C  CD1   . LEU C 1 149 ? 4.869   41.533  16.414 1.00 15.60 ? 591  LEU D CD1   1 
ATOM   6511  C  CD2   . LEU C 1 149 ? 6.926   42.387  17.556 1.00 15.19 ? 591  LEU D CD2   1 
ATOM   6512  N  N     . TRP C 1 150 ? 8.115   40.086  13.253 1.00 16.98 ? 592  TRP D N     1 
ATOM   6513  C  CA    . TRP C 1 150 ? 8.455   40.725  11.994 1.00 16.69 ? 592  TRP D CA    1 
ATOM   6514  C  C     . TRP C 1 150 ? 7.891   40.027  10.786 1.00 17.68 ? 592  TRP D C     1 
ATOM   6515  O  O     . TRP C 1 150 ? 7.285   40.621  10.016 1.00 18.58 ? 592  TRP D O     1 
ATOM   6516  C  CB    . TRP C 1 150 ? 9.938   41.011  11.894 1.00 15.39 ? 592  TRP D CB    1 
ATOM   6517  C  CG    . TRP C 1 150 ? 10.516  41.043  10.549 1.00 15.92 ? 592  TRP D CG    1 
ATOM   6518  C  CD1   . TRP C 1 150 ? 10.964  40.028  9.918  1.00 15.16 ? 592  TRP D CD1   1 
ATOM   6519  C  CD2   . TRP C 1 150 ? 10.632  42.130  9.695  1.00 16.04 ? 592  TRP D CD2   1 
ATOM   6520  N  NE1   . TRP C 1 150 ? 11.346  40.338  8.772  1.00 15.45 ? 592  TRP D NE1   1 
ATOM   6521  C  CE2   . TRP C 1 150 ? 11.182  41.655  8.574  1.00 16.35 ? 592  TRP D CE2   1 
ATOM   6522  C  CE3   . TRP C 1 150 ? 10.318  43.476  9.778  1.00 16.88 ? 592  TRP D CE3   1 
ATOM   6523  C  CZ2   . TRP C 1 150 ? 11.472  42.438  7.525  1.00 17.28 ? 592  TRP D CZ2   1 
ATOM   6524  C  CZ3   . TRP C 1 150 ? 10.577  44.222  8.775  1.00 18.42 ? 592  TRP D CZ3   1 
ATOM   6525  C  CH2   . TRP C 1 150 ? 11.138  43.713  7.626  1.00 17.71 ? 592  TRP D CH2   1 
ATOM   6526  N  N     . GLU C 1 151 ? 8.126   38.753  10.679 1.00 19.16 ? 593  GLU D N     1 
ATOM   6527  C  CA    . GLU C 1 151 ? 7.594   37.988  9.549  1.00 22.30 ? 593  GLU D CA    1 
ATOM   6528  C  C     . GLU C 1 151 ? 6.078   38.001  9.441  1.00 22.95 ? 593  GLU D C     1 
ATOM   6529  O  O     . GLU C 1 151 ? 5.538   38.173  8.350  1.00 21.92 ? 593  GLU D O     1 
ATOM   6530  C  CB    . GLU C 1 151 ? 8.124   36.542  9.550  1.00 23.01 ? 593  GLU D CB    1 
ATOM   6531  C  CG    . GLU C 1 151 ? 9.610   36.416  9.200  1.00 25.48 ? 593  GLU D CG    1 
ATOM   6532  C  CD    . GLU C 1 151 ? 9.953   36.939  7.799  1.00 27.55 ? 593  GLU D CD    1 
ATOM   6533  O  OE1   . GLU C 1 151 ? 9.042   37.064  6.947  1.00 30.10 ? 593  GLU D OE1   1 
ATOM   6534  O  OE2   . GLU C 1 151 ? 11.142  37.224  7.541  1.00 28.79 ? 593  GLU D OE2   1 
ATOM   6535  N  N     . THR C 1 152 ? 5.396   37.841  10.573 1.00 24.03 ? 594  THR D N     1 
ATOM   6536  C  CA    . THR C 1 152 ? 3.937   37.775  10.583 1.00 23.17 ? 594  THR D CA    1 
ATOM   6537  C  C     . THR C 1 152 ? 3.210   39.111  10.607 1.00 22.72 ? 594  THR D C     1 
ATOM   6538  O  O     . THR C 1 152 ? 2.131   39.231  10.032 1.00 24.90 ? 594  THR D O     1 
ATOM   6539  C  CB    . THR C 1 152 ? 3.412   36.969  11.801 1.00 25.53 ? 594  THR D CB    1 
ATOM   6540  O  OG1   . THR C 1 152 ? 3.796   37.631  13.016 1.00 23.37 ? 594  THR D OG1   1 
ATOM   6541  C  CG2   . THR C 1 152 ? 3.938   35.528  11.790 1.00 24.35 ? 594  THR D CG2   1 
ATOM   6542  N  N     . THR C 1 153 ? 3.791   40.118  11.249 1.00 22.01 ? 595  THR D N     1 
ATOM   6543  C  CA    . THR C 1 153 ? 3.059   41.369  11.471 1.00 20.71 ? 595  THR D CA    1 
ATOM   6544  C  C     . THR C 1 153 ? 3.667   42.652  10.884 1.00 21.43 ? 595  THR D C     1 
ATOM   6545  O  O     . THR C 1 153 ? 2.924   43.548  10.479 1.00 21.44 ? 595  THR D O     1 
ATOM   6546  C  CB    . THR C 1 153 ? 2.820   41.561  12.989 1.00 20.96 ? 595  THR D CB    1 
ATOM   6547  O  OG1   . THR C 1 153 ? 2.420   40.317  13.575 1.00 21.12 ? 595  THR D OG1   1 
ATOM   6548  C  CG2   . THR C 1 153 ? 1.764   42.612  13.267 1.00 22.10 ? 595  THR D CG2   1 
ATOM   6549  N  N     . MET C 1 154 ? 4.996   42.740  10.829 1.00 22.22 ? 596  MET D N     1 
ATOM   6550  C  CA    . MET C 1 154 ? 5.664   43.976  10.410 1.00 21.17 ? 596  MET D CA    1 
ATOM   6551  C  C     . MET C 1 154 ? 6.338   43.980  9.027  1.00 22.65 ? 596  MET D C     1 
ATOM   6552  O  O     . MET C 1 154 ? 6.550   45.048  8.449  1.00 19.61 ? 596  MET D O     1 
ATOM   6553  C  CB    . MET C 1 154 ? 6.687   44.399  11.470 1.00 20.32 ? 596  MET D CB    1 
ATOM   6554  C  CG    . MET C 1 154 ? 6.098   44.544  12.869 1.00 18.81 ? 596  MET D CG    1 
ATOM   6555  S  SD    . MET C 1 154 ? 7.290   45.080  14.116 1.00 19.27 ? 596  MET D SD    1 
ATOM   6556  C  CE    . MET C 1 154 ? 7.613   46.759  13.585 1.00 18.67 ? 596  MET D CE    1 
ATOM   6557  N  N     . ASN C 1 155 ? 6.679   42.802  8.515  1.00 24.14 ? 597  ASN D N     1 
ATOM   6558  C  CA    . ASN C 1 155 ? 7.376   42.688  7.231  1.00 28.91 ? 597  ASN D CA    1 
ATOM   6559  C  C     . ASN C 1 155 ? 6.513   43.104  6.034  1.00 29.17 ? 597  ASN D C     1 
ATOM   6560  O  O     . ASN C 1 155 ? 5.525   42.434  5.735  1.00 29.54 ? 597  ASN D O     1 
ATOM   6561  C  CB    . ASN C 1 155 ? 7.895   41.258  7.040  1.00 27.64 ? 597  ASN D CB    1 
ATOM   6562  C  CG    . ASN C 1 155 ? 8.846   41.117  5.863  1.00 26.01 ? 597  ASN D CG    1 
ATOM   6563  O  OD1   . ASN C 1 155 ? 8.875   41.945  4.955  1.00 25.11 ? 597  ASN D OD1   1 
ATOM   6564  N  ND2   . ASN C 1 155 ? 9.633   40.054  5.885  1.00 23.99 ? 597  ASN D ND2   1 
ATOM   6565  N  N     . PRO C 1 156 ? 6.906   44.247  5.350  1.00 31.20 ? 598  PRO D N     1 
ATOM   6566  C  CA    . PRO C 1 156 ? 6.016   44.621  4.237  1.00 34.42 ? 598  PRO D CA    1 
ATOM   6567  C  C     . PRO C 1 156 ? 5.677   43.493  3.260  1.00 36.20 ? 598  PRO D C     1 
ATOM   6568  O  O     . PRO C 1 156 ? 4.588   43.483  2.703  1.00 37.82 ? 598  PRO D O     1 
ATOM   6569  C  CB    . PRO C 1 156 ? 6.793   45.723  3.523  1.00 36.72 ? 598  PRO D CB    1 
ATOM   6570  C  CG    . PRO C 1 156 ? 7.503   46.409  4.617  1.00 35.63 ? 598  PRO D CG    1 
ATOM   6571  C  CD    . PRO C 1 156 ? 8.043   45.259  5.393  1.00 33.20 ? 598  PRO D CD    1 
ATOM   6572  N  N     A GLU C 1 157 ? 6.600   42.561  3.065  0.50 35.35 ? 599  GLU D N     1 
ATOM   6573  N  N     B GLU C 1 157 ? 6.584   42.549  3.070  0.50 35.24 ? 599  GLU D N     1 
ATOM   6574  C  CA    A GLU C 1 157 ? 6.375   41.434  2.177  0.50 33.65 ? 599  GLU D CA    1 
ATOM   6575  C  CA    B GLU C 1 157 ? 6.359   41.440  2.181  0.50 33.54 ? 599  GLU D CA    1 
ATOM   6576  C  C     A GLU C 1 157 ? 5.234   40.502  2.545  0.50 35.20 ? 599  GLU D C     1 
ATOM   6577  C  C     B GLU C 1 157 ? 5.236   40.506  2.552  0.50 34.95 ? 599  GLU D C     1 
ATOM   6578  O  O     A GLU C 1 157 ? 4.496   40.073  1.684  0.50 37.38 ? 599  GLU D O     1 
ATOM   6579  O  O     B GLU C 1 157 ? 4.677   39.892  1.675  0.50 36.54 ? 599  GLU D O     1 
ATOM   6580  C  CB    A GLU C 1 157 ? 7.637   40.585  2.039  0.50 32.04 ? 599  GLU D CB    1 
ATOM   6581  C  CB    B GLU C 1 157 ? 7.630   40.627  2.049  0.50 31.84 ? 599  GLU D CB    1 
ATOM   6582  C  CG    A GLU C 1 157 ? 8.865   41.349  1.542  0.50 30.53 ? 599  GLU D CG    1 
ATOM   6583  C  CG    B GLU C 1 157 ? 8.590   41.087  0.974  0.50 30.26 ? 599  GLU D CG    1 
ATOM   6584  C  CD    A GLU C 1 157 ? 8.647   42.134  0.248  0.50 29.15 ? 599  GLU D CD    1 
ATOM   6585  C  CD    B GLU C 1 157 ? 9.895   40.320  1.015  0.50 29.10 ? 599  GLU D CD    1 
ATOM   6586  O  OE1   A GLU C 1 157 ? 7.641   41.893  -0.451 0.50 26.85 ? 599  GLU D OE1   1 
ATOM   6587  O  OE1   B GLU C 1 157 ? 10.282  39.891  2.117  0.50 29.92 ? 599  GLU D OE1   1 
ATOM   6588  O  OE2   A GLU C 1 157 ? 9.507   42.990  -0.081 0.50 27.83 ? 599  GLU D OE2   1 
ATOM   6589  O  OE2   B GLU C 1 157 ? 10.536  40.145  -0.034 0.50 27.74 ? 599  GLU D OE2   1 
ATOM   6590  N  N     . HIS C 1 158 ? 5.112   40.162  3.826  1.00 35.16 ? 600  HIS D N     1 
ATOM   6591  C  CA    . HIS C 1 158 ? 4.094   39.213  4.288  1.00 36.52 ? 600  HIS D CA    1 
ATOM   6592  C  C     . HIS C 1 158 ? 3.011   39.675  5.237  1.00 35.43 ? 600  HIS D C     1 
ATOM   6593  O  O     . HIS C 1 158 ? 2.188   38.889  5.625  1.00 37.20 ? 600  HIS D O     1 
ATOM   6594  C  CB    . HIS C 1 158 ? 4.766   38.005  4.941  1.00 39.23 ? 600  HIS D CB    1 
ATOM   6595  C  CG    . HIS C 1 158 ? 5.975   37.509  4.224  1.00 47.29 ? 600  HIS D CG    1 
ATOM   6596  N  ND1   . HIS C 1 158 ? 7.252   37.690  4.715  1.00 46.97 ? 600  HIS D ND1   1 
ATOM   6597  C  CD2   . HIS C 1 158 ? 6.106   36.821  3.060  1.00 48.32 ? 600  HIS D CD2   1 
ATOM   6598  C  CE1   . HIS C 1 158 ? 8.122   37.143  3.884  1.00 48.46 ? 600  HIS D CE1   1 
ATOM   6599  N  NE2   . HIS C 1 158 ? 7.453   36.605  2.874  1.00 48.20 ? 600  HIS D NE2   1 
ATOM   6600  N  N     . ARG C 1 159 ? 3.009   40.935  5.628  1.00 35.25 ? 601  ARG D N     1 
ATOM   6601  C  CA    . ARG C 1 159 ? 2.004   41.418  6.571  1.00 31.39 ? 601  ARG D CA    1 
ATOM   6602  C  C     . ARG C 1 159 ? 0.670   41.808  5.929  1.00 32.22 ? 601  ARG D C     1 
ATOM   6603  O  O     . ARG C 1 159 ? 0.629   42.259  4.791  1.00 32.25 ? 601  ARG D O     1 
ATOM   6604  C  CB    . ARG C 1 159 ? 2.564   42.618  7.321  1.00 27.89 ? 601  ARG D CB    1 
ATOM   6605  C  CG    . ARG C 1 159 ? 2.850   43.786  6.406  1.00 25.47 ? 601  ARG D CG    1 
ATOM   6606  C  CD    . ARG C 1 159 ? 3.533   44.943  7.103  1.00 23.44 ? 601  ARG D CD    1 
ATOM   6607  N  NE    . ARG C 1 159 ? 3.442   46.137  6.280  1.00 22.95 ? 601  ARG D NE    1 
ATOM   6608  C  CZ    . ARG C 1 159 ? 4.088   47.267  6.518  1.00 22.61 ? 601  ARG D CZ    1 
ATOM   6609  N  NH1   . ARG C 1 159 ? 4.901   47.366  7.553  1.00 21.68 ? 601  ARG D NH1   1 
ATOM   6610  N  NH2   . ARG C 1 159 ? 3.924   48.297  5.710  1.00 19.57 ? 601  ARG D NH2   1 
ATOM   6611  N  N     . ALA C 1 160 ? -0.420  41.641  6.672  1.00 30.96 ? 602  ALA D N     1 
ATOM   6612  C  CA    . ALA C 1 160 ? -1.734  42.037  6.203  1.00 29.53 ? 602  ALA D CA    1 
ATOM   6613  C  C     . ALA C 1 160 ? -2.246  43.231  7.017  1.00 31.32 ? 602  ALA D C     1 
ATOM   6614  O  O     . ALA C 1 160 ? -2.992  43.060  7.980  1.00 33.90 ? 602  ALA D O     1 
ATOM   6615  C  CB    . ALA C 1 160 ? -2.705  40.860  6.274  1.00 25.55 ? 602  ALA D CB    1 
ATOM   6616  N  N     . LEU C 1 161 ? -1.830  44.431  6.632  1.00 31.30 ? 603  LEU D N     1 
ATOM   6617  C  CA    . LEU C 1 161 ? -2.293  45.644  7.299  1.00 29.27 ? 603  LEU D CA    1 
ATOM   6618  C  C     . LEU C 1 161 ? -3.691  46.012  6.829  1.00 31.25 ? 603  LEU D C     1 
ATOM   6619  O  O     . LEU C 1 161 ? -3.999  45.917  5.645  1.00 31.75 ? 603  LEU D O     1 
ATOM   6620  C  CB    . LEU C 1 161 ? -1.343  46.835  7.084  1.00 28.09 ? 603  LEU D CB    1 
ATOM   6621  C  CG    . LEU C 1 161 ? 0.058   46.871  7.692  1.00 27.51 ? 603  LEU D CG    1 
ATOM   6622  C  CD1   . LEU C 1 161 ? 0.728   48.188  7.343  1.00 24.94 ? 603  LEU D CD1   1 
ATOM   6623  C  CD2   . LEU C 1 161 ? 0.025   46.687  9.206  1.00 27.94 ? 603  LEU D CD2   1 
ATOM   6624  N  N     . LEU C 1 162 ? -4.529  46.424  7.773  1.00 33.46 ? 604  LEU D N     1 
ATOM   6625  C  CA    . LEU C 1 162 ? -5.888  46.825  7.463  1.00 32.22 ? 604  LEU D CA    1 
ATOM   6626  C  C     . LEU C 1 162 ? -5.939  48.344  7.468  1.00 34.35 ? 604  LEU D C     1 
ATOM   6627  O  O     . LEU C 1 162 ? -5.617  48.978  8.475  1.00 34.13 ? 604  LEU D O     1 
ATOM   6628  C  CB    . LEU C 1 162 ? -6.879  46.244  8.476  1.00 33.42 ? 604  LEU D CB    1 
ATOM   6629  C  CG    . LEU C 1 162 ? -7.008  44.727  8.622  1.00 36.92 ? 604  LEU D CG    1 
ATOM   6630  C  CD1   . LEU C 1 162 ? -8.000  44.389  9.728  1.00 37.75 ? 604  LEU D CD1   1 
ATOM   6631  C  CD2   . LEU C 1 162 ? -7.418  44.050  7.308  1.00 37.17 ? 604  LEU D CD2   1 
ATOM   6632  N  N     . GLN C 1 163 ? -6.317  48.920  6.331  1.00 32.82 ? 605  GLN D N     1 
ATOM   6633  C  CA    . GLN C 1 163 ? -6.414  50.364  6.197  1.00 30.12 ? 605  GLN D CA    1 
ATOM   6634  C  C     . GLN C 1 163 ? -7.758  50.852  6.729  1.00 28.33 ? 605  GLN D C     1 
ATOM   6635  O  O     . GLN C 1 163 ? -8.812  50.345  6.333  1.00 26.49 ? 605  GLN D O     1 
ATOM   6636  C  CB    . GLN C 1 163 ? -6.245  50.771  4.733  1.00 31.58 ? 605  GLN D CB    1 
ATOM   6637  C  CG    . GLN C 1 163 ? -6.162  52.272  4.506  1.00 33.74 ? 605  GLN D CG    1 
ATOM   6638  C  CD    . GLN C 1 163 ? -5.971  52.628  3.046  1.00 34.84 ? 605  GLN D CD    1 
ATOM   6639  O  OE1   . GLN C 1 163 ? -6.531  51.983  2.167  1.00 36.09 ? 605  GLN D OE1   1 
ATOM   6640  N  NE2   . GLN C 1 163 ? -5.208  53.681  2.788  1.00 32.01 ? 605  GLN D NE2   1 
ATOM   6641  N  N     . VAL C 1 164 ? -7.723  51.826  7.623  1.00 26.77 ? 606  VAL D N     1 
ATOM   6642  C  CA    . VAL C 1 164 ? -8.948  52.351  8.181  1.00 29.90 ? 606  VAL D CA    1 
ATOM   6643  C  C     . VAL C 1 164 ? -9.579  53.303  7.186  1.00 31.35 ? 606  VAL D C     1 
ATOM   6644  O  O     . VAL C 1 164 ? -8.957  54.260  6.747  1.00 32.54 ? 606  VAL D O     1 
ATOM   6645  C  CB    . VAL C 1 164 ? -8.697  53.064  9.520  1.00 29.85 ? 606  VAL D CB    1 
ATOM   6646  C  CG1   . VAL C 1 164 ? -9.969  53.731  10.004 1.00 33.22 ? 606  VAL D CG1   1 
ATOM   6647  C  CG2   . VAL C 1 164 ? -8.176  52.083  10.553 1.00 28.40 ? 606  VAL D CG2   1 
ATOM   6648  N  N     . LYS C 1 165 ? -10.826 53.029  6.834  1.00 31.38 ? 607  LYS D N     1 
ATOM   6649  C  CA    . LYS C 1 165 ? -11.545 53.847  5.873  1.00 32.08 ? 607  LYS D CA    1 
ATOM   6650  C  C     . LYS C 1 165 ? -12.826 54.411  6.467  1.00 32.47 ? 607  LYS D C     1 
ATOM   6651  O  O     . LYS C 1 165 ? -13.565 53.719  7.151  1.00 27.64 ? 607  LYS D O     1 
ATOM   6652  C  CB    . LYS C 1 165 ? -11.860 53.034  4.624  1.00 32.40 ? 607  LYS D CB    1 
ATOM   6653  N  N     . LEU C 1 166 ? -13.073 55.686  6.200  1.00 35.30 ? 608  LEU D N     1 
ATOM   6654  C  CA    . LEU C 1 166 ? -14.271 56.345  6.680  1.00 37.25 ? 608  LEU D CA    1 
ATOM   6655  C  C     . LEU C 1 166 ? -15.300 56.422  5.557  1.00 37.63 ? 608  LEU D C     1 
ATOM   6656  O  O     . LEU C 1 166 ? -15.084 57.088  4.562  1.00 39.12 ? 608  LEU D O     1 
ATOM   6657  C  CB    . LEU C 1 166 ? -13.918 57.748  7.169  1.00 36.40 ? 608  LEU D CB    1 
ATOM   6658  C  CG    . LEU C 1 166 ? -15.047 58.733  7.480  1.00 35.66 ? 608  LEU D CG    1 
ATOM   6659  C  CD1   . LEU C 1 166 ? -16.046 58.138  8.458  1.00 33.09 ? 608  LEU D CD1   1 
ATOM   6660  C  CD2   . LEU C 1 166 ? -14.460 60.015  8.037  1.00 38.56 ? 608  LEU D CD2   1 
ATOM   6661  N  N     . GLU C 1 167 ? -16.421 55.739  5.740  1.00 41.96 ? 609  GLU D N     1 
ATOM   6662  C  CA    . GLU C 1 167 ? -17.517 55.713  4.761  1.00 45.31 ? 609  GLU D CA    1 
ATOM   6663  C  C     . GLU C 1 167 ? -18.574 56.796  4.977  1.00 46.31 ? 609  GLU D C     1 
ATOM   6664  O  O     . GLU C 1 167 ? -18.663 57.740  4.192  1.00 47.36 ? 609  GLU D O     1 
ATOM   6665  C  CB    . GLU C 1 167 ? -18.164 54.325  4.678  1.00 46.30 ? 609  GLU D CB    1 
ATOM   6666  C  CG    . GLU C 1 167 ? -17.275 53.245  4.055  1.00 53.11 ? 609  GLU D CG    1 
ATOM   6667  C  CD    . GLU C 1 167 ? -16.962 53.481  2.576  1.00 53.24 ? 609  GLU D CD    1 
ATOM   6668  O  OE1   . GLU C 1 167 ? -17.563 54.374  1.942  1.00 54.07 ? 609  GLU D OE1   1 
ATOM   6669  O  OE2   . GLU C 1 167 ? -16.113 52.747  2.028  1.00 49.12 ? 609  GLU D OE2   1 
ATOM   6670  N  N     . ASP C 1 168 ? -19.371 56.653  6.034  1.00 46.52 ? 610  ASP D N     1 
ATOM   6671  C  CA    . ASP C 1 168 ? -20.419 57.622  6.340  1.00 44.04 ? 610  ASP D CA    1 
ATOM   6672  C  C     . ASP C 1 168 ? -20.027 58.432  7.571  1.00 43.28 ? 610  ASP D C     1 
ATOM   6673  O  O     . ASP C 1 168 ? -19.814 57.878  8.647  1.00 43.16 ? 610  ASP D O     1 
ATOM   6674  C  CB    . ASP C 1 168 ? -21.763 56.905  6.539  1.00 44.42 ? 610  ASP D CB    1 
ATOM   6675  C  CG    . ASP C 1 168 ? -22.951 57.868  6.624  1.00 48.49 ? 610  ASP D CG    1 
ATOM   6676  O  OD1   . ASP C 1 168 ? -22.785 59.034  7.052  1.00 46.62 ? 610  ASP D OD1   1 
ATOM   6677  O  OD2   . ASP C 1 168 ? -24.067 57.443  6.246  1.00 51.24 ? 610  ASP D OD2   1 
ATOM   6678  N  N     . ALA C 1 169 ? -19.929 59.747  7.395  1.00 43.49 ? 611  ALA D N     1 
ATOM   6679  C  CA    . ALA C 1 169 ? -19.550 60.662  8.478  1.00 44.31 ? 611  ALA D CA    1 
ATOM   6680  C  C     . ALA C 1 169 ? -20.646 60.841  9.538  1.00 43.68 ? 611  ALA D C     1 
ATOM   6681  O  O     . ALA C 1 169 ? -20.361 61.215  10.674 1.00 39.65 ? 611  ALA D O     1 
ATOM   6682  C  CB    . ALA C 1 169 ? -19.131 62.013  7.906  1.00 39.94 ? 611  ALA D CB    1 
ATOM   6683  N  N     . ILE C 1 170 ? -21.892 60.577  9.154  1.00 43.81 ? 612  ILE D N     1 
ATOM   6684  C  CA    . ILE C 1 170 ? -23.029 60.701  10.061 1.00 44.88 ? 612  ILE D CA    1 
ATOM   6685  C  C     . ILE C 1 170 ? -23.108 59.467  10.953 1.00 44.84 ? 612  ILE D C     1 
ATOM   6686  O  O     . ILE C 1 170 ? -23.240 59.578  12.176 1.00 46.44 ? 612  ILE D O     1 
ATOM   6687  C  CB    . ILE C 1 170 ? -24.368 60.894  9.291  1.00 44.84 ? 612  ILE D CB    1 
ATOM   6688  C  CG1   . ILE C 1 170 ? -24.274 62.073  8.293  1.00 45.52 ? 612  ILE D CG1   1 
ATOM   6689  C  CG2   . ILE C 1 170 ? -25.549 61.034  10.258 1.00 41.16 ? 612  ILE D CG2   1 
ATOM   6690  C  CD1   . ILE C 1 170 ? -23.918 63.435  8.890  1.00 41.27 ? 612  ILE D CD1   1 
ATOM   6691  N  N     . GLU C 1 171 ? -23.008 58.294  10.330 1.00 42.20 ? 613  GLU D N     1 
ATOM   6692  C  CA    . GLU C 1 171 ? -23.052 57.027  11.044 1.00 37.06 ? 613  GLU D CA    1 
ATOM   6693  C  C     . GLU C 1 171 ? -21.847 56.886  11.985 1.00 36.44 ? 613  GLU D C     1 
ATOM   6694  O  O     . GLU C 1 171 ? -21.964 56.288  13.057 1.00 34.97 ? 613  GLU D O     1 
ATOM   6695  C  CB    . GLU C 1 171 ? -23.091 55.869  10.053 1.00 34.68 ? 613  GLU D CB    1 
ATOM   6696  C  CG    . GLU C 1 171 ? -23.410 54.521  10.683 1.00 34.86 ? 613  GLU D CG    1 
ATOM   6697  C  CD    . GLU C 1 171 ? -23.169 53.364  9.722  1.00 36.42 ? 613  GLU D CD    1 
ATOM   6698  O  OE1   . GLU C 1 171 ? -23.856 52.312  9.838  1.00 39.17 ? 613  GLU D OE1   1 
ATOM   6699  O  OE2   . GLU C 1 171 ? -22.270 53.494  8.852  1.00 37.26 ? 613  GLU D OE2   1 
ATOM   6700  N  N     . ALA C 1 172 ? -20.702 57.440  11.579 1.00 33.44 ? 614  ALA D N     1 
ATOM   6701  C  CA    . ALA C 1 172 ? -19.477 57.390  12.383 1.00 32.06 ? 614  ALA D CA    1 
ATOM   6702  C  C     . ALA C 1 172 ? -19.578 58.255  13.635 1.00 33.96 ? 614  ALA D C     1 
ATOM   6703  O  O     . ALA C 1 172 ? -19.128 57.838  14.698 1.00 34.85 ? 614  ALA D O     1 
ATOM   6704  C  CB    . ALA C 1 172 ? -18.263 57.779  11.556 1.00 28.34 ? 614  ALA D CB    1 
ATOM   6705  N  N     . ASP C 1 173 ? -20.165 59.448  13.501 1.00 35.13 ? 615  ASP D N     1 
ATOM   6706  C  CA    . ASP C 1 173 ? -20.368 60.360  14.631 1.00 36.25 ? 615  ASP D CA    1 
ATOM   6707  C  C     . ASP C 1 173 ? -21.279 59.725  15.682 1.00 35.98 ? 615  ASP D C     1 
ATOM   6708  O  O     . ASP C 1 173 ? -21.066 59.890  16.882 1.00 34.86 ? 615  ASP D O     1 
ATOM   6709  C  CB    . ASP C 1 173 ? -20.988 61.693  14.174 1.00 42.05 ? 615  ASP D CB    1 
ATOM   6710  C  CG    . ASP C 1 173 ? -20.033 62.549  13.358 1.00 45.43 ? 615  ASP D CG    1 
ATOM   6711  O  OD1   . ASP C 1 173 ? -18.802 62.345  13.432 1.00 46.04 ? 615  ASP D OD1   1 
ATOM   6712  O  OD2   . ASP C 1 173 ? -20.532 63.445  12.641 1.00 43.80 ? 615  ASP D OD2   1 
ATOM   6713  N  N     . GLN C 1 174 ? -22.294 59.007  15.208 1.00 35.16 ? 616  GLN D N     1 
ATOM   6714  C  CA    . GLN C 1 174 ? -23.265 58.317  16.059 1.00 35.45 ? 616  GLN D CA    1 
ATOM   6715  C  C     . GLN C 1 174 ? -22.674 57.071  16.724 1.00 33.90 ? 616  GLN D C     1 
ATOM   6716  O  O     . GLN C 1 174 ? -23.103 56.688  17.813 1.00 34.32 ? 616  GLN D O     1 
ATOM   6717  C  CB    . GLN C 1 174 ? -24.511 57.938  15.245 1.00 35.01 ? 616  GLN D CB    1 
ATOM   6718  C  CG    . GLN C 1 174 ? -25.276 59.144  14.696 1.00 42.09 ? 616  GLN D CG    1 
ATOM   6719  C  CD    . GLN C 1 174 ? -26.345 58.777  13.677 1.00 44.78 ? 616  GLN D CD    1 
ATOM   6720  O  OE1   . GLN C 1 174 ? -26.405 57.633  13.190 1.00 47.96 ? 616  GLN D OE1   1 
ATOM   6721  N  NE2   . GLN C 1 174 ? -27.180 59.750  13.328 1.00 43.65 ? 616  GLN D NE2   1 
ATOM   6722  N  N     . THR C 1 175 ? -21.697 56.449  16.067 1.00 29.09 ? 617  THR D N     1 
ATOM   6723  C  CA    . THR C 1 175 ? -21.047 55.243  16.597 1.00 27.56 ? 617  THR D CA    1 
ATOM   6724  C  C     . THR C 1 175 ? -20.107 55.580  17.763 1.00 25.39 ? 617  THR D C     1 
ATOM   6725  O  O     . THR C 1 175 ? -20.201 54.970  18.832 1.00 22.38 ? 617  THR D O     1 
ATOM   6726  C  CB    . THR C 1 175 ? -20.290 54.462  15.499 1.00 25.99 ? 617  THR D CB    1 
ATOM   6727  O  OG1   . THR C 1 175 ? -21.190 54.118  14.450 1.00 26.85 ? 617  THR D OG1   1 
ATOM   6728  C  CG2   . THR C 1 175 ? -19.707 53.191  16.055 1.00 27.03 ? 617  THR D CG2   1 
ATOM   6729  N  N     . PHE C 1 176 ? -19.221 56.550  17.549 1.00 22.42 ? 618  PHE D N     1 
ATOM   6730  C  CA    . PHE C 1 176 ? -18.284 56.979  18.586 1.00 24.19 ? 618  PHE D CA    1 
ATOM   6731  C  C     . PHE C 1 176 ? -18.994 57.547  19.816 1.00 24.35 ? 618  PHE D C     1 
ATOM   6732  O  O     . PHE C 1 176 ? -18.556 57.324  20.944 1.00 21.91 ? 618  PHE D O     1 
ATOM   6733  C  CB    . PHE C 1 176 ? -17.246 57.973  18.036 1.00 22.81 ? 618  PHE D CB    1 
ATOM   6734  C  CG    . PHE C 1 176 ? -16.194 57.339  17.155 1.00 21.14 ? 618  PHE D CG    1 
ATOM   6735  C  CD1   . PHE C 1 176 ? -15.024 56.822  17.705 1.00 20.22 ? 618  PHE D CD1   1 
ATOM   6736  C  CD2   . PHE C 1 176 ? -16.362 57.276  15.771 1.00 21.98 ? 618  PHE D CD2   1 
ATOM   6737  C  CE1   . PHE C 1 176 ? -14.043 56.239  16.891 1.00 19.57 ? 618  PHE D CE1   1 
ATOM   6738  C  CE2   . PHE C 1 176 ? -15.385 56.692  14.947 1.00 19.97 ? 618  PHE D CE2   1 
ATOM   6739  C  CZ    . PHE C 1 176 ? -14.227 56.180  15.511 1.00 19.88 ? 618  PHE D CZ    1 
ATOM   6740  N  N     . GLU C 1 177 ? -20.091 58.269  19.592 1.00 28.56 ? 619  GLU D N     1 
ATOM   6741  C  CA    . GLU C 1 177 ? -20.882 58.849  20.682 1.00 30.94 ? 619  GLU D CA    1 
ATOM   6742  C  C     . GLU C 1 177 ? -21.574 57.747  21.484 1.00 28.07 ? 619  GLU D C     1 
ATOM   6743  O  O     . GLU C 1 177 ? -21.658 57.819  22.709 1.00 28.97 ? 619  GLU D O     1 
ATOM   6744  C  CB    . GLU C 1 177 ? -21.930 59.825  20.128 1.00 39.50 ? 619  GLU D CB    1 
ATOM   6745  C  CG    . GLU C 1 177 ? -22.797 60.506  21.194 1.00 47.66 ? 619  GLU D CG    1 
ATOM   6746  C  CD    . GLU C 1 177 ? -23.960 61.310  20.603 1.00 57.18 ? 619  GLU D CD    1 
ATOM   6747  O  OE1   . GLU C 1 177 ? -24.852 61.734  21.370 1.00 60.91 ? 619  GLU D OE1   1 
ATOM   6748  O  OE2   . GLU C 1 177 ? -23.998 61.531  19.376 1.00 55.64 ? 619  GLU D OE2   1 
ATOM   6749  N  N     . MET C 1 178 ? -22.068 56.734  20.777 1.00 26.05 ? 620  MET D N     1 
ATOM   6750  C  CA    . MET C 1 178 ? -22.767 55.613  21.393 1.00 23.48 ? 620  MET D CA    1 
ATOM   6751  C  C     . MET C 1 178 ? -21.853 54.705  22.227 1.00 22.35 ? 620  MET D C     1 
ATOM   6752  O  O     . MET C 1 178 ? -22.176 54.374  23.369 1.00 22.19 ? 620  MET D O     1 
ATOM   6753  C  CB    . MET C 1 178 ? -23.489 54.796  20.316 1.00 24.27 ? 620  MET D CB    1 
ATOM   6754  C  CG    . MET C 1 178 ? -24.126 53.505  20.828 1.00 26.60 ? 620  MET D CG    1 
ATOM   6755  S  SD    . MET C 1 178 ? -24.969 52.538  19.570 1.00 31.08 ? 620  MET D SD    1 
ATOM   6756  C  CE    . MET C 1 178 ? -23.639 52.077  18.468 1.00 30.86 ? 620  MET D CE    1 
ATOM   6757  N  N     . LEU C 1 179 ? -20.719 54.307  21.651 1.00 19.04 ? 621  LEU D N     1 
ATOM   6758  C  CA    . LEU C 1 179 ? -19.794 53.384  22.313 1.00 17.76 ? 621  LEU D CA    1 
ATOM   6759  C  C     . LEU C 1 179 ? -18.871 54.026  23.355 1.00 15.91 ? 621  LEU D C     1 
ATOM   6760  O  O     . LEU C 1 179 ? -18.606 53.425  24.393 1.00 15.41 ? 621  LEU D O     1 
ATOM   6761  C  CB    . LEU C 1 179 ? -18.943 52.635  21.277 1.00 16.75 ? 621  LEU D CB    1 
ATOM   6762  C  CG    . LEU C 1 179 ? -19.600 51.854  20.135 1.00 17.20 ? 621  LEU D CG    1 
ATOM   6763  C  CD1   . LEU C 1 179 ? -18.547 51.392  19.149 1.00 17.43 ? 621  LEU D CD1   1 
ATOM   6764  C  CD2   . LEU C 1 179 ? -20.435 50.681  20.614 1.00 17.34 ? 621  LEU D CD2   1 
ATOM   6765  N  N     . MET C 1 180 ? -18.394 55.234  23.082 1.00 15.94 ? 622  MET D N     1 
ATOM   6766  C  CA    . MET C 1 180 ? -17.423 55.889  23.959 1.00 16.93 ? 622  MET D CA    1 
ATOM   6767  C  C     . MET C 1 180 ? -17.975 57.077  24.747 1.00 17.25 ? 622  MET D C     1 
ATOM   6768  O  O     . MET C 1 180 ? -17.281 57.635  25.598 1.00 17.17 ? 622  MET D O     1 
ATOM   6769  C  CB    . MET C 1 180 ? -16.202 56.339  23.144 1.00 17.21 ? 622  MET D CB    1 
ATOM   6770  C  CG    . MET C 1 180 ? -15.734 55.350  22.074 1.00 17.49 ? 622  MET D CG    1 
ATOM   6771  S  SD    . MET C 1 180 ? -15.290 53.706  22.670 1.00 18.79 ? 622  MET D SD    1 
ATOM   6772  C  CE    . MET C 1 180 ? -13.842 54.076  23.668 1.00 16.97 ? 622  MET D CE    1 
ATOM   6773  N  N     . GLY C 1 181 ? -19.214 57.464  24.463 1.00 17.97 ? 623  GLY D N     1 
ATOM   6774  C  CA    . GLY C 1 181 ? -19.842 58.614  25.120 1.00 16.56 ? 623  GLY D CA    1 
ATOM   6775  C  C     . GLY C 1 181 ? -20.251 58.395  26.561 1.00 16.70 ? 623  GLY D C     1 
ATOM   6776  O  O     . GLY C 1 181 ? -20.264 57.269  27.056 1.00 17.03 ? 623  GLY D O     1 
ATOM   6777  N  N     . ASP C 1 182 ? -20.615 59.487  27.218 1.00 17.18 ? 624  ASP D N     1 
ATOM   6778  C  CA    . ASP C 1 182 ? -20.989 59.494  28.630 1.00 17.91 ? 624  ASP D CA    1 
ATOM   6779  C  C     . ASP C 1 182 ? -22.363 58.888  28.962 1.00 19.54 ? 624  ASP D C     1 
ATOM   6780  O  O     . ASP C 1 182 ? -22.697 58.730  30.136 1.00 20.46 ? 624  ASP D O     1 
ATOM   6781  C  CB    . ASP C 1 182 ? -20.938 60.929  29.159 1.00 17.42 ? 624  ASP D CB    1 
ATOM   6782  N  N     . VAL C 1 183 ? -23.158 58.541  27.947 1.00 21.16 ? 625  VAL D N     1 
ATOM   6783  C  CA    . VAL C 1 183 ? -24.481 57.949  28.181 1.00 22.27 ? 625  VAL D CA    1 
ATOM   6784  C  C     . VAL C 1 183 ? -24.423 56.418  28.214 1.00 23.28 ? 625  VAL D C     1 
ATOM   6785  O  O     . VAL C 1 183 ? -24.230 55.773  27.178 1.00 25.34 ? 625  VAL D O     1 
ATOM   6786  C  CB    . VAL C 1 183 ? -25.552 58.439  27.162 1.00 22.66 ? 625  VAL D CB    1 
ATOM   6787  C  CG1   . VAL C 1 183 ? -26.928 57.865  27.511 1.00 23.23 ? 625  VAL D CG1   1 
ATOM   6788  C  CG2   . VAL C 1 183 ? -25.633 59.972  27.163 1.00 21.76 ? 625  VAL D CG2   1 
ATOM   6789  N  N     . VAL C 1 184 ? -24.602 55.853  29.411 1.00 22.62 ? 626  VAL D N     1 
ATOM   6790  C  CA    . VAL C 1 184 ? -24.529 54.401  29.635 1.00 21.64 ? 626  VAL D CA    1 
ATOM   6791  C  C     . VAL C 1 184 ? -25.606 53.598  28.911 1.00 21.72 ? 626  VAL D C     1 
ATOM   6792  O  O     . VAL C 1 184 ? -25.290 52.639  28.203 1.00 22.54 ? 626  VAL D O     1 
ATOM   6793  C  CB    . VAL C 1 184 ? -24.586 54.046  31.141 1.00 21.29 ? 626  VAL D CB    1 
ATOM   6794  C  CG1   . VAL C 1 184 ? -24.509 52.536  31.341 1.00 19.67 ? 626  VAL D CG1   1 
ATOM   6795  C  CG2   . VAL C 1 184 ? -23.460 54.737  31.896 1.00 20.38 ? 626  VAL D CG2   1 
ATOM   6796  N  N     . GLU C 1 185 ? -26.866 53.997  29.090 1.00 21.53 ? 627  GLU D N     1 
ATOM   6797  C  CA    . GLU C 1 185 ? -28.019 53.292  28.520 1.00 22.09 ? 627  GLU D CA    1 
ATOM   6798  C  C     . GLU C 1 185 ? -27.931 52.938  27.023 1.00 21.40 ? 627  GLU D C     1 
ATOM   6799  O  O     . GLU C 1 185 ? -28.295 51.826  26.629 1.00 20.93 ? 627  GLU D O     1 
ATOM   6800  C  CB    . GLU C 1 185 ? -29.330 54.025  28.858 1.00 22.65 ? 627  GLU D CB    1 
ATOM   6801  C  CG    . GLU C 1 185 ? -30.615 53.376  28.309 1.00 24.05 ? 627  GLU D CG    1 
ATOM   6802  C  CD    . GLU C 1 185 ? -30.816 51.924  28.739 1.00 24.75 ? 627  GLU D CD    1 
ATOM   6803  O  OE1   . GLU C 1 185 ? -30.176 51.462  29.717 1.00 24.50 ? 627  GLU D OE1   1 
ATOM   6804  O  OE2   . GLU C 1 185 ? -31.638 51.237  28.091 1.00 26.34 ? 627  GLU D OE2   1 
ATOM   6805  N  N     . ASN C 1 186 ? -27.458 53.879  26.207 1.00 22.06 ? 628  ASN D N     1 
ATOM   6806  C  CA    . ASN C 1 186 ? -27.304 53.658  24.759 1.00 23.55 ? 628  ASN D CA    1 
ATOM   6807  C  C     . ASN C 1 186 ? -26.314 52.542  24.470 1.00 23.04 ? 628  ASN D C     1 
ATOM   6808  O  O     . ASN C 1 186 ? -26.498 51.743  23.545 1.00 24.05 ? 628  ASN D O     1 
ATOM   6809  C  CB    . ASN C 1 186 ? -26.840 54.937  24.062 1.00 26.05 ? 628  ASN D CB    1 
ATOM   6810  C  CG    . ASN C 1 186 ? -27.863 56.054  24.148 1.00 27.82 ? 628  ASN D CG    1 
ATOM   6811  O  OD1   . ASN C 1 186 ? -29.071 55.822  24.141 1.00 30.39 ? 628  ASN D OD1   1 
ATOM   6812  N  ND2   . ASN C 1 186 ? -27.382 57.284  24.208 1.00 29.15 ? 628  ASN D ND2   1 
ATOM   6813  N  N     . ARG C 1 187 ? -25.267 52.501  25.288 1.00 21.45 ? 629  ARG D N     1 
ATOM   6814  C  CA    . ARG C 1 187 ? -24.218 51.506  25.198 1.00 20.24 ? 629  ARG D CA    1 
ATOM   6815  C  C     . ARG C 1 187 ? -24.720 50.141  25.713 1.00 20.34 ? 629  ARG D C     1 
ATOM   6816  O  O     . ARG C 1 187 ? -24.350 49.101  25.169 1.00 20.48 ? 629  ARG D O     1 
ATOM   6817  C  CB    . ARG C 1 187 ? -22.981 52.036  25.940 1.00 19.64 ? 629  ARG D CB    1 
ATOM   6818  C  CG    . ARG C 1 187 ? -21.800 51.100  26.074 1.00 18.85 ? 629  ARG D CG    1 
ATOM   6819  C  CD    . ARG C 1 187 ? -20.531 51.841  26.499 1.00 18.18 ? 629  ARG D CD    1 
ATOM   6820  N  NE    . ARG C 1 187 ? -20.705 52.769  27.621 1.00 17.86 ? 629  ARG D NE    1 
ATOM   6821  C  CZ    . ARG C 1 187 ? -20.700 54.098  27.512 1.00 17.92 ? 629  ARG D CZ    1 
ATOM   6822  N  NH1   . ARG C 1 187 ? -20.534 54.679  26.331 1.00 16.63 ? 629  ARG D NH1   1 
ATOM   6823  N  NH2   . ARG C 1 187 ? -20.858 54.854  28.593 1.00 16.40 ? 629  ARG D NH2   1 
ATOM   6824  N  N     . ARG C 1 188 ? -25.586 50.149  26.728 1.00 20.85 ? 630  ARG D N     1 
ATOM   6825  C  CA    . ARG C 1 188 ? -26.175 48.907  27.250 1.00 22.40 ? 630  ARG D CA    1 
ATOM   6826  C  C     . ARG C 1 188 ? -27.105 48.280  26.206 1.00 23.67 ? 630  ARG D C     1 
ATOM   6827  O  O     . ARG C 1 188 ? -27.084 47.059  25.996 1.00 24.39 ? 630  ARG D O     1 
ATOM   6828  C  CB    . ARG C 1 188 ? -26.966 49.152  28.533 1.00 20.42 ? 630  ARG D CB    1 
ATOM   6829  C  CG    . ARG C 1 188 ? -27.502 47.871  29.162 1.00 19.76 ? 630  ARG D CG    1 
ATOM   6830  C  CD    . ARG C 1 188 ? -28.613 48.129  30.165 1.00 20.48 ? 630  ARG D CD    1 
ATOM   6831  N  NE    . ARG C 1 188 ? -29.781 48.727  29.511 1.00 24.72 ? 630  ARG D NE    1 
ATOM   6832  C  CZ    . ARG C 1 188 ? -30.741 48.037  28.891 1.00 25.93 ? 630  ARG D CZ    1 
ATOM   6833  N  NH1   . ARG C 1 188 ? -30.696 46.720  28.825 1.00 24.70 ? 630  ARG D NH1   1 
ATOM   6834  N  NH2   . ARG C 1 188 ? -31.749 48.676  28.332 1.00 28.40 ? 630  ARG D NH2   1 
ATOM   6835  N  N     . GLN C 1 189 ? -27.916 49.127  25.568 1.00 24.56 ? 631  GLN D N     1 
ATOM   6836  C  CA    . GLN C 1 189 ? -28.854 48.702  24.530 1.00 25.95 ? 631  GLN D CA    1 
ATOM   6837  C  C     . GLN C 1 189 ? -28.111 48.076  23.342 1.00 26.56 ? 631  GLN D C     1 
ATOM   6838  O  O     . GLN C 1 189 ? -28.516 47.027  22.838 1.00 26.82 ? 631  GLN D O     1 
ATOM   6839  C  CB    . GLN C 1 189 ? -29.740 49.878  24.087 1.00 26.63 ? 631  GLN D CB    1 
ATOM   6840  C  CG    . GLN C 1 189 ? -30.866 49.519  23.105 1.00 26.40 ? 631  GLN D CG    1 
ATOM   6841  C  CD    . GLN C 1 189 ? -31.879 48.517  23.665 1.00 29.83 ? 631  GLN D CD    1 
ATOM   6842  O  OE1   . GLN C 1 189 ? -32.134 48.466  24.867 1.00 29.48 ? 631  GLN D OE1   1 
ATOM   6843  N  NE2   . GLN C 1 189 ? -32.466 47.718  22.783 1.00 29.72 ? 631  GLN D NE2   1 
ATOM   6844  N  N     . PHE C 1 190 ? -27.020 48.713  22.913 1.00 26.25 ? 632  PHE D N     1 
ATOM   6845  C  CA    . PHE C 1 190 ? -26.197 48.189  21.824 1.00 28.40 ? 632  PHE D CA    1 
ATOM   6846  C  C     . PHE C 1 190 ? -25.727 46.765  22.131 1.00 29.77 ? 632  PHE D C     1 
ATOM   6847  O  O     . PHE C 1 190 ? -25.749 45.896  21.253 1.00 33.45 ? 632  PHE D O     1 
ATOM   6848  C  CB    . PHE C 1 190 ? -25.001 49.116  21.543 1.00 28.27 ? 632  PHE D CB    1 
ATOM   6849  C  CG    . PHE C 1 190 ? -23.948 48.499  20.666 1.00 27.87 ? 632  PHE D CG    1 
ATOM   6850  C  CD1   . PHE C 1 190 ? -24.097 48.459  19.288 1.00 27.24 ? 632  PHE D CD1   1 
ATOM   6851  C  CD2   . PHE C 1 190 ? -22.798 47.947  21.231 1.00 29.92 ? 632  PHE D CD2   1 
ATOM   6852  C  CE1   . PHE C 1 190 ? -23.119 47.869  18.477 1.00 24.79 ? 632  PHE D CE1   1 
ATOM   6853  C  CE2   . PHE C 1 190 ? -21.815 47.359  20.429 1.00 28.71 ? 632  PHE D CE2   1 
ATOM   6854  C  CZ    . PHE C 1 190 ? -21.982 47.326  19.047 1.00 26.11 ? 632  PHE D CZ    1 
ATOM   6855  N  N     . ILE C 1 191 ? -25.307 46.540  23.376 1.00 29.04 ? 633  ILE D N     1 
ATOM   6856  C  CA    . ILE C 1 191 ? -24.845 45.228  23.821 1.00 26.75 ? 633  ILE D CA    1 
ATOM   6857  C  C     . ILE C 1 191 ? -25.978 44.198  23.777 1.00 27.43 ? 633  ILE D C     1 
ATOM   6858  O  O     . ILE C 1 191 ? -25.794 43.101  23.260 1.00 30.31 ? 633  ILE D O     1 
ATOM   6859  C  CB    . ILE C 1 191 ? -24.207 45.292  25.239 1.00 25.66 ? 633  ILE D CB    1 
ATOM   6860  C  CG1   . ILE C 1 191 ? -22.951 46.176  25.216 1.00 23.29 ? 633  ILE D CG1   1 
ATOM   6861  C  CG2   . ILE C 1 191 ? -23.869 43.887  25.747 1.00 24.62 ? 633  ILE D CG2   1 
ATOM   6862  C  CD1   . ILE C 1 191 ? -22.392 46.526  26.576 1.00 23.74 ? 633  ILE D CD1   1 
ATOM   6863  N  N     . GLU C 1 192 ? -27.146 44.568  24.298 1.00 27.16 ? 634  GLU D N     1 
ATOM   6864  C  CA    . GLU C 1 192 ? -28.312 43.685  24.328 1.00 27.08 ? 634  GLU D CA    1 
ATOM   6865  C  C     . GLU C 1 192 ? -28.725 43.229  22.923 1.00 26.65 ? 634  GLU D C     1 
ATOM   6866  O  O     . GLU C 1 192 ? -29.002 42.046  22.698 1.00 25.70 ? 634  GLU D O     1 
ATOM   6867  C  CB    . GLU C 1 192 ? -29.477 44.378  25.051 1.00 30.54 ? 634  GLU D CB    1 
ATOM   6868  C  CG    . GLU C 1 192 ? -30.748 43.528  25.250 1.00 32.71 ? 634  GLU D CG    1 
ATOM   6869  C  CD    . GLU C 1 192 ? -31.853 44.296  25.991 1.00 35.68 ? 634  GLU D CD    1 
ATOM   6870  O  OE1   . GLU C 1 192 ? -33.036 43.927  25.916 1.00 36.50 ? 634  GLU D OE1   1 
ATOM   6871  O  OE2   . GLU C 1 192 ? -31.560 45.295  26.668 1.00 37.22 ? 634  GLU D OE2   1 
ATOM   6872  N  N     . ASP C 1 193 ? -28.729 44.166  21.980 1.00 25.88 ? 635  ASP D N     1 
ATOM   6873  C  CA    . ASP C 1 193 ? -29.132 43.891  20.601 1.00 25.20 ? 635  ASP D CA    1 
ATOM   6874  C  C     . ASP C 1 193 ? -28.115 43.086  19.787 1.00 27.45 ? 635  ASP D C     1 
ATOM   6875  O  O     . ASP C 1 193 ? -28.499 42.317  18.896 1.00 25.60 ? 635  ASP D O     1 
ATOM   6876  C  CB    . ASP C 1 193 ? -29.460 45.200  19.885 1.00 24.16 ? 635  ASP D CB    1 
ATOM   6877  C  CG    . ASP C 1 193 ? -30.622 45.937  20.512 1.00 24.80 ? 635  ASP D CG    1 
ATOM   6878  O  OD1   . ASP C 1 193 ? -31.509 45.273  21.103 1.00 26.28 ? 635  ASP D OD1   1 
ATOM   6879  O  OD2   . ASP C 1 193 ? -30.660 47.178  20.408 1.00 25.09 ? 635  ASP D OD2   1 
ATOM   6880  N  N     . ASN C 1 194 ? -26.833 43.258  20.107 1.00 26.86 ? 636  ASN D N     1 
ATOM   6881  C  CA    . ASN C 1 194 ? -25.752 42.604  19.369 1.00 26.55 ? 636  ASN D CA    1 
ATOM   6882  C  C     . ASN C 1 194 ? -25.021 41.449  20.072 1.00 26.79 ? 636  ASN D C     1 
ATOM   6883  O  O     . ASN C 1 194 ? -24.181 40.784  19.460 1.00 26.82 ? 636  ASN D O     1 
ATOM   6884  C  CB    . ASN C 1 194 ? -24.759 43.668  18.894 1.00 26.82 ? 636  ASN D CB    1 
ATOM   6885  C  CG    . ASN C 1 194 ? -25.349 44.565  17.826 1.00 27.04 ? 636  ASN D CG    1 
ATOM   6886  O  OD1   . ASN C 1 194 ? -25.415 44.197  16.661 1.00 26.13 ? 636  ASN D OD1   1 
ATOM   6887  N  ND2   . ASN C 1 194 ? -25.752 45.768  18.221 1.00 28.50 ? 636  ASN D ND2   1 
ATOM   6888  N  N     . ALA C 1 195 ? -25.351 41.204  21.336 1.00 26.47 ? 637  ALA D N     1 
ATOM   6889  C  CA    . ALA C 1 195 ? -24.710 40.133  22.106 1.00 27.26 ? 637  ALA D CA    1 
ATOM   6890  C  C     . ALA C 1 195 ? -25.040 38.729  21.598 1.00 28.28 ? 637  ALA D C     1 
ATOM   6891  O  O     . ALA C 1 195 ? -26.197 38.415  21.319 1.00 27.99 ? 637  ALA D O     1 
ATOM   6892  C  CB    . ALA C 1 195 ? -25.076 40.248  23.575 1.00 27.71 ? 637  ALA D CB    1 
ATOM   6893  N  N     . VAL C 1 196 ? -24.006 37.899  21.481 1.00 30.15 ? 638  VAL D N     1 
ATOM   6894  C  CA    . VAL C 1 196 ? -24.136 36.497  21.071 1.00 33.28 ? 638  VAL D CA    1 
ATOM   6895  C  C     . VAL C 1 196 ? -23.278 35.677  22.028 1.00 35.87 ? 638  VAL D C     1 
ATOM   6896  O  O     . VAL C 1 196 ? -22.072 35.902  22.147 1.00 37.87 ? 638  VAL D O     1 
ATOM   6897  C  CB    . VAL C 1 196 ? -23.711 36.265  19.585 1.00 32.69 ? 638  VAL D CB    1 
ATOM   6898  C  CG1   . VAL C 1 196 ? -23.662 34.778  19.249 1.00 29.29 ? 638  VAL D CG1   1 
ATOM   6899  C  CG2   . VAL C 1 196 ? -24.652 36.998  18.629 1.00 31.42 ? 638  VAL D CG2   1 
ATOM   6900  N  N     . TYR C 1 197 ? -23.902 34.729  22.715 1.00 35.14 ? 639  TYR D N     1 
ATOM   6901  C  CA    . TYR C 1 197 ? -23.221 33.931  23.728 1.00 33.91 ? 639  TYR D CA    1 
ATOM   6902  C  C     . TYR C 1 197 ? -22.831 32.521  23.275 1.00 37.00 ? 639  TYR D C     1 
ATOM   6903  O  O     . TYR C 1 197 ? -23.678 31.677  22.992 1.00 41.69 ? 639  TYR D O     1 
ATOM   6904  C  CB    . TYR C 1 197 ? -24.067 33.900  25.006 1.00 34.00 ? 639  TYR D CB    1 
ATOM   6905  C  CG    . TYR C 1 197 ? -24.316 35.280  25.598 1.00 33.50 ? 639  TYR D CG    1 
ATOM   6906  C  CD1   . TYR C 1 197 ? -23.420 35.828  26.525 1.00 35.96 ? 639  TYR D CD1   1 
ATOM   6907  C  CD2   . TYR C 1 197 ? -25.420 36.041  25.230 1.00 33.33 ? 639  TYR D CD2   1 
ATOM   6908  C  CE1   . TYR C 1 197 ? -23.626 37.087  27.075 1.00 31.46 ? 639  TYR D CE1   1 
ATOM   6909  C  CE2   . TYR C 1 197 ? -25.640 37.310  25.774 1.00 33.83 ? 639  TYR D CE2   1 
ATOM   6910  C  CZ    . TYR C 1 197 ? -24.734 37.825  26.705 1.00 32.10 ? 639  TYR D CZ    1 
ATOM   6911  O  OH    . TYR C 1 197 ? -24.925 39.076  27.258 1.00 29.59 ? 639  TYR D OH    1 
ATOM   6912  N  N     . ASN D 2 9   ? -8.060  43.590  3.360  1.00 38.59 ? 10   ASN C N     1 
ATOM   6913  C  CA    . ASN D 2 9   ? -6.999  44.590  3.395  1.00 41.64 ? 10   ASN C CA    1 
ATOM   6914  C  C     . ASN D 2 9   ? -7.504  46.001  3.677  1.00 42.17 ? 10   ASN C C     1 
ATOM   6915  O  O     . ASN D 2 9   ? -6.737  46.942  3.786  1.00 41.51 ? 10   ASN C O     1 
ATOM   6916  C  CB    . ASN D 2 9   ? -6.264  44.573  2.075  1.00 44.06 ? 10   ASN C CB    1 
ATOM   6917  C  CG    . ASN D 2 9   ? -4.791  44.851  2.244  1.00 46.94 ? 10   ASN C CG    1 
ATOM   6918  O  OD1   . ASN D 2 9   ? -4.117  45.242  1.294  1.00 49.36 ? 10   ASN C OD1   1 
ATOM   6919  N  ND2   . ASN D 2 9   ? -4.276  44.635  3.453  1.00 43.81 ? 10   ASN C ND2   1 
ATOM   6920  N  N     . GLU D 2 10  ? -8.808  46.143  3.766  1.00 42.59 ? 11   GLU C N     1 
ATOM   6921  C  CA    . GLU D 2 10  ? -9.403  47.427  4.013  1.00 45.12 ? 11   GLU C CA    1 
ATOM   6922  C  C     . GLU D 2 10  ? -10.382 47.228  5.147  1.00 43.26 ? 11   GLU C C     1 
ATOM   6923  O  O     . GLU D 2 10  ? -11.073 46.217  5.198  1.00 40.66 ? 11   GLU C O     1 
ATOM   6924  C  CB    . GLU D 2 10  ? -10.104 47.917  2.756  1.00 48.70 ? 11   GLU C CB    1 
ATOM   6925  C  CG    . GLU D 2 10  ? -10.437 49.388  2.774  1.00 52.92 ? 11   GLU C CG    1 
ATOM   6926  C  CD    . GLU D 2 10  ? -10.584 49.955  1.397  1.00 58.98 ? 11   GLU C CD    1 
ATOM   6927  O  OE1   . GLU D 2 10  ? -11.468 50.825  1.218  1.00 69.00 ? 11   GLU C OE1   1 
ATOM   6928  O  OE2   . GLU D 2 10  ? -9.812  49.538  0.507  1.00 57.77 ? 11   GLU C OE2   1 
ATOM   6929  N  N     . ARG D 2 11  ? -10.437 48.182  6.069  1.00 36.78 ? 12   ARG C N     1 
ATOM   6930  C  CA    . ARG D 2 11  ? -11.332 48.036  7.201  1.00 37.24 ? 12   ARG C CA    1 
ATOM   6931  C  C     . ARG D 2 11  ? -12.137 49.286  7.484  1.00 34.65 ? 12   ARG C C     1 
ATOM   6932  O  O     . ARG D 2 11  ? -11.575 50.341  7.711  1.00 34.99 ? 12   ARG C O     1 
ATOM   6933  C  CB    . ARG D 2 11  ? -10.536 47.649  8.434  1.00 38.93 ? 12   ARG C CB    1 
ATOM   6934  C  CG    . ARG D 2 11  ? -11.346 47.547  9.706  1.00 39.14 ? 12   ARG C CG    1 
ATOM   6935  C  CD    . ARG D 2 11  ? -12.330 46.399  9.651  1.00 37.92 ? 12   ARG C CD    1 
ATOM   6936  N  NE    . ARG D 2 11  ? -12.627 45.927  10.989 1.00 41.41 ? 12   ARG C NE    1 
ATOM   6937  C  CZ    . ARG D 2 11  ? -13.577 45.053  11.271 1.00 42.06 ? 12   ARG C CZ    1 
ATOM   6938  N  NH1   . ARG D 2 11  ? -14.330 44.553  10.308 1.00 38.63 ? 12   ARG C NH1   1 
ATOM   6939  N  NH2   . ARG D 2 11  ? -13.776 44.674  12.517 1.00 43.60 ? 12   ARG C NH2   1 
ATOM   6940  N  N     . ASN D 2 12  ? -13.457 49.151  7.482  1.00 30.79 ? 13   ASN C N     1 
ATOM   6941  C  CA    . ASN D 2 12  ? -14.351 50.265  7.767  1.00 28.84 ? 13   ASN C CA    1 
ATOM   6942  C  C     . ASN D 2 12  ? -14.300 50.645  9.252  1.00 27.63 ? 13   ASN C C     1 
ATOM   6943  O  O     . ASN D 2 12  ? -14.478 49.786  10.116 1.00 27.79 ? 13   ASN C O     1 
ATOM   6944  C  CB    . ASN D 2 12  ? -15.787 49.925  7.345  1.00 30.20 ? 13   ASN C CB    1 
ATOM   6945  C  CG    . ASN D 2 12  ? -16.769 51.051  7.628  1.00 33.08 ? 13   ASN C CG    1 
ATOM   6946  O  OD1   . ASN D 2 12  ? -17.816 50.836  8.238  1.00 36.29 ? 13   ASN C OD1   1 
ATOM   6947  N  ND2   . ASN D 2 12  ? -16.424 52.252  7.213  1.00 37.15 ? 13   ASN C ND2   1 
ATOM   6948  N  N     . ILE D 2 13  ? -14.065 51.929  9.533  1.00 24.35 ? 14   ILE C N     1 
ATOM   6949  C  CA    . ILE D 2 13  ? -13.932 52.436  10.901 1.00 25.03 ? 14   ILE C CA    1 
ATOM   6950  C  C     . ILE D 2 13  ? -15.155 52.192  11.810 1.00 27.13 ? 14   ILE C C     1 
ATOM   6951  O  O     . ILE D 2 13  ? -15.009 51.946  13.004 1.00 26.48 ? 14   ILE C O     1 
ATOM   6952  C  CB    . ILE D 2 13  ? -13.494 53.941  10.937 1.00 22.52 ? 14   ILE C CB    1 
ATOM   6953  C  CG1   . ILE D 2 13  ? -13.048 54.364  12.348 1.00 20.70 ? 14   ILE C CG1   1 
ATOM   6954  C  CG2   . ILE D 2 13  ? -14.569 54.861  10.361 1.00 22.16 ? 14   ILE C CG2   1 
ATOM   6955  C  CD1   . ILE D 2 13  ? -12.406 55.731  12.460 1.00 19.13 ? 14   ILE C CD1   1 
ATOM   6956  N  N     . THR D 2 14  ? -16.356 52.255  11.227 1.00 29.06 ? 15   THR C N     1 
ATOM   6957  C  CA    . THR D 2 14  ? -17.589 52.046  11.981 1.00 26.19 ? 15   THR C CA    1 
ATOM   6958  C  C     . THR D 2 14  ? -17.725 50.580  12.401 1.00 25.58 ? 15   THR C C     1 
ATOM   6959  O  O     . THR D 2 14  ? -18.136 50.286  13.527 1.00 24.32 ? 15   THR C O     1 
ATOM   6960  C  CB    . THR D 2 14  ? -18.812 52.535  11.176 1.00 23.74 ? 15   THR C CB    1 
ATOM   6961  O  OG1   . THR D 2 14  ? -18.697 53.963  11.034 1.00 26.54 ? 15   THR C OG1   1 
ATOM   6962  C  CG2   . THR D 2 14  ? -20.115 52.260  11.906 1.00 22.16 ? 15   THR C CG2   1 
ATOM   6963  N  N     . SER D 2 15  ? -17.358 49.676  11.491 1.00 25.01 ? 16   SER C N     1 
ATOM   6964  C  CA    . SER D 2 15  ? -17.416 48.241  11.758 1.00 23.28 ? 16   SER C CA    1 
ATOM   6965  C  C     . SER D 2 15  ? -16.353 47.825  12.775 1.00 23.97 ? 16   SER C C     1 
ATOM   6966  O  O     . SER D 2 15  ? -16.618 47.016  13.667 1.00 26.93 ? 16   SER C O     1 
ATOM   6967  C  CB    . SER D 2 15  ? -17.270 47.442  10.463 1.00 23.43 ? 16   SER C CB    1 
ATOM   6968  O  OG    . SER D 2 15  ? -18.336 47.731  9.572  1.00 26.63 ? 16   SER C OG    1 
ATOM   6969  N  N     . GLU D 2 16  ? -15.155 48.386  12.637 1.00 23.83 ? 17   GLU C N     1 
ATOM   6970  C  CA    . GLU D 2 16  ? -14.048 48.104  13.542 1.00 23.47 ? 17   GLU C CA    1 
ATOM   6971  C  C     . GLU D 2 16  ? -14.404 48.485  14.973 1.00 21.47 ? 17   GLU C C     1 
ATOM   6972  O  O     . GLU D 2 16  ? -14.150 47.717  15.906 1.00 20.88 ? 17   GLU C O     1 
ATOM   6973  C  CB    . GLU D 2 16  ? -12.780 48.842  13.092 1.00 24.95 ? 17   GLU C CB    1 
ATOM   6974  C  CG    . GLU D 2 16  ? -11.583 48.697  14.041 1.00 24.63 ? 17   GLU C CG    1 
ATOM   6975  C  CD    . GLU D 2 16  ? -11.122 47.259  14.232 1.00 24.77 ? 17   GLU C CD    1 
ATOM   6976  O  OE1   . GLU D 2 16  ? -11.379 46.398  13.357 1.00 26.75 ? 17   GLU C OE1   1 
ATOM   6977  O  OE2   . GLU D 2 16  ? -10.484 46.994  15.272 1.00 25.56 ? 17   GLU C OE2   1 
ATOM   6978  N  N     . MET D 2 17  ? -14.990 49.668  15.132 1.00 19.43 ? 18   MET C N     1 
ATOM   6979  C  CA    . MET D 2 17  ? -15.412 50.157  16.439 1.00 18.85 ? 18   MET C CA    1 
ATOM   6980  C  C     . MET D 2 17  ? -16.463 49.261  17.081 1.00 19.26 ? 18   MET C C     1 
ATOM   6981  O  O     . MET D 2 17  ? -16.345 48.916  18.251 1.00 17.31 ? 18   MET C O     1 
ATOM   6982  C  CB    . MET D 2 17  ? -15.912 51.602  16.345 1.00 17.54 ? 18   MET C CB    1 
ATOM   6983  C  CG    . MET D 2 17  ? -14.797 52.636  16.169 1.00 17.83 ? 18   MET C CG    1 
ATOM   6984  S  SD    . MET D 2 17  ? -13.667 52.728  17.583 1.00 16.74 ? 18   MET C SD    1 
ATOM   6985  C  CE    . MET D 2 17  ? -14.715 53.338  18.896 1.00 15.54 ? 18   MET C CE    1 
ATOM   6986  N  N     . ARG D 2 18  ? -17.469 48.873  16.302 1.00 20.28 ? 19   ARG C N     1 
ATOM   6987  C  CA    . ARG D 2 18  ? -18.561 48.021  16.791 1.00 21.84 ? 19   ARG C CA    1 
ATOM   6988  C  C     . ARG D 2 18  ? -18.121 46.606  17.152 1.00 22.89 ? 19   ARG C C     1 
ATOM   6989  O  O     . ARG D 2 18  ? -18.621 46.038  18.125 1.00 23.70 ? 19   ARG C O     1 
ATOM   6990  C  CB    . ARG D 2 18  ? -19.702 47.964  15.776 1.00 22.64 ? 19   ARG C CB    1 
ATOM   6991  C  CG    . ARG D 2 18  ? -20.488 49.270  15.667 1.00 22.66 ? 19   ARG C CG    1 
ATOM   6992  C  CD    . ARG D 2 18  ? -21.413 49.258  14.432 1.00 24.64 ? 19   ARG C CD    1 
ATOM   6993  N  NE    . ARG D 2 18  ? -22.401 48.188  14.469 1.00 24.12 ? 19   ARG C NE    1 
ATOM   6994  C  CZ    . ARG D 2 18  ? -23.593 48.274  15.077 1.00 25.39 ? 19   ARG C CZ    1 
ATOM   6995  N  NH1   . ARG D 2 18  ? -23.955 49.386  15.710 1.00 23.81 ? 19   ARG C NH1   1 
ATOM   6996  N  NH2   . ARG D 2 18  ? -24.437 47.254  15.048 1.00 24.98 ? 19   ARG C NH2   1 
ATOM   6997  N  N     . GLU D 2 19  ? -17.197 46.043  16.374 1.00 21.84 ? 20   GLU C N     1 
ATOM   6998  C  CA    . GLU D 2 19  ? -16.720 44.684  16.609 1.00 20.46 ? 20   GLU C CA    1 
ATOM   6999  C  C     . GLU D 2 19  ? -15.730 44.588  17.766 1.00 19.85 ? 20   GLU C C     1 
ATOM   7000  O  O     . GLU D 2 19  ? -15.872 43.722  18.630 1.00 19.22 ? 20   GLU C O     1 
ATOM   7001  C  CB    . GLU D 2 19  ? -16.129 44.072  15.335 1.00 22.18 ? 20   GLU C CB    1 
ATOM   7002  C  CG    . GLU D 2 19  ? -17.168 43.788  14.259 1.00 28.73 ? 20   GLU C CG    1 
ATOM   7003  C  CD    . GLU D 2 19  ? -16.589 43.147  12.999 1.00 33.71 ? 20   GLU C CD    1 
ATOM   7004  O  OE1   . GLU D 2 19  ? -17.227 43.279  11.932 1.00 35.69 ? 20   GLU C OE1   1 
ATOM   7005  O  OE2   . GLU D 2 19  ? -15.500 42.524  13.068 1.00 32.25 ? 20   GLU C OE2   1 
ATOM   7006  N  N     . SER D 2 20  ? -14.733 45.470  17.780 1.00 18.03 ? 21   SER C N     1 
ATOM   7007  C  CA    . SER D 2 20  ? -13.727 45.478  18.845 1.00 17.42 ? 21   SER C CA    1 
ATOM   7008  C  C     . SER D 2 20  ? -14.316 45.849  20.208 1.00 16.95 ? 21   SER C C     1 
ATOM   7009  O  O     . SER D 2 20  ? -14.022 45.184  21.205 1.00 16.94 ? 21   SER C O     1 
ATOM   7010  C  CB    . SER D 2 20  ? -12.545 46.395  18.501 1.00 16.89 ? 21   SER C CB    1 
ATOM   7011  O  OG    . SER D 2 20  ? -11.771 45.852  17.435 1.00 18.00 ? 21   SER C OG    1 
ATOM   7012  N  N     . PHE D 2 21  ? -15.152 46.888  20.255 1.00 14.84 ? 22   PHE C N     1 
ATOM   7013  C  CA    . PHE D 2 21  ? -15.762 47.308  21.517 1.00 15.39 ? 22   PHE C CA    1 
ATOM   7014  C  C     . PHE D 2 21  ? -16.732 46.252  22.051 1.00 15.33 ? 22   PHE C C     1 
ATOM   7015  O  O     . PHE D 2 21  ? -16.795 46.026  23.259 1.00 15.67 ? 22   PHE C O     1 
ATOM   7016  C  CB    . PHE D 2 21  ? -16.440 48.675  21.404 1.00 14.90 ? 22   PHE C CB    1 
ATOM   7017  C  CG    . PHE D 2 21  ? -16.799 49.290  22.737 1.00 14.99 ? 22   PHE C CG    1 
ATOM   7018  C  CD1   . PHE D 2 21  ? -15.884 50.094  23.412 1.00 14.54 ? 22   PHE C CD1   1 
ATOM   7019  C  CD2   . PHE D 2 21  ? -18.057 49.075  23.312 1.00 14.08 ? 22   PHE C CD2   1 
ATOM   7020  C  CE1   . PHE D 2 21  ? -16.219 50.693  24.627 1.00 14.16 ? 22   PHE C CE1   1 
ATOM   7021  C  CE2   . PHE D 2 21  ? -18.388 49.641  24.535 1.00 13.95 ? 22   PHE C CE2   1 
ATOM   7022  C  CZ    . PHE D 2 21  ? -17.456 50.445  25.206 1.00 13.89 ? 22   PHE C CZ    1 
ATOM   7023  N  N     . LEU D 2 22  ? -17.469 45.601  21.158 1.00 15.31 ? 23   LEU C N     1 
ATOM   7024  C  CA    . LEU D 2 22  ? -18.388 44.531  21.559 1.00 16.35 ? 23   LEU C CA    1 
ATOM   7025  C  C     . LEU D 2 22  ? -17.569 43.376  22.124 1.00 16.71 ? 23   LEU C C     1 
ATOM   7026  O  O     . LEU D 2 22  ? -17.915 42.817  23.162 1.00 16.95 ? 23   LEU C O     1 
ATOM   7027  C  CB    . LEU D 2 22  ? -19.245 44.058  20.373 1.00 15.29 ? 23   LEU C CB    1 
ATOM   7028  C  CG    . LEU D 2 22  ? -20.388 43.060  20.588 1.00 15.56 ? 23   LEU C CG    1 
ATOM   7029  C  CD1   . LEU D 2 22  ? -21.469 43.605  21.522 1.00 13.12 ? 23   LEU C CD1   1 
ATOM   7030  C  CD2   . LEU D 2 22  ? -20.963 42.625  19.226 1.00 15.47 ? 23   LEU C CD2   1 
ATOM   7031  N  N     . ASP D 2 23  ? -16.470 43.046  21.441 1.00 16.60 ? 24   ASP C N     1 
ATOM   7032  C  CA    . ASP D 2 23  ? -15.563 41.979  21.865 1.00 17.42 ? 24   ASP C CA    1 
ATOM   7033  C  C     . ASP D 2 23  ? -15.107 42.245  23.307 1.00 16.73 ? 24   ASP C C     1 
ATOM   7034  O  O     . ASP D 2 23  ? -15.139 41.347  24.148 1.00 17.39 ? 24   ASP C O     1 
ATOM   7035  C  CB    . ASP D 2 23  ? -14.367 41.870  20.903 1.00 18.99 ? 24   ASP C CB    1 
ATOM   7036  C  CG    . ASP D 2 23  ? -13.465 40.658  21.185 1.00 23.18 ? 24   ASP C CG    1 
ATOM   7037  O  OD1   . ASP D 2 23  ? -13.861 39.730  21.949 1.00 22.41 ? 24   ASP C OD1   1 
ATOM   7038  O  OD2   . ASP D 2 23  ? -12.321 40.652  20.642 1.00 24.12 ? 24   ASP C OD2   1 
ATOM   7039  N  N     . TYR D 2 24  ? -14.710 43.485  23.584 1.00 16.25 ? 25   TYR C N     1 
ATOM   7040  C  CA    . TYR D 2 24  ? -14.285 43.864  24.924 1.00 14.45 ? 25   TYR C CA    1 
ATOM   7041  C  C     . TYR D 2 24  ? -15.457 43.918  25.922 1.00 15.15 ? 25   TYR C C     1 
ATOM   7042  O  O     . TYR D 2 24  ? -15.341 43.410  27.043 1.00 16.26 ? 25   TYR C O     1 
ATOM   7043  C  CB    . TYR D 2 24  ? -13.520 45.193  24.903 1.00 13.19 ? 25   TYR C CB    1 
ATOM   7044  C  CG    . TYR D 2 24  ? -13.141 45.694  26.289 1.00 11.85 ? 25   TYR C CG    1 
ATOM   7045  C  CD1   . TYR D 2 24  ? -12.064 45.141  26.985 1.00 11.13 ? 25   TYR C CD1   1 
ATOM   7046  C  CD2   . TYR D 2 24  ? -13.860 46.723  26.894 1.00 11.35 ? 25   TYR C CD2   1 
ATOM   7047  C  CE1   . TYR D 2 24  ? -11.719 45.595  28.255 1.00 10.71 ? 25   TYR C CE1   1 
ATOM   7048  C  CE2   . TYR D 2 24  ? -13.527 47.189  28.167 1.00 11.51 ? 25   TYR C CE2   1 
ATOM   7049  C  CZ    . TYR D 2 24  ? -12.451 46.618  28.840 1.00 10.86 ? 25   TYR C CZ    1 
ATOM   7050  O  OH    . TYR D 2 24  ? -12.140 47.082  30.091 1.00 10.61 ? 25   TYR C OH    1 
ATOM   7051  N  N     . ALA D 2 25  ? -16.571 44.531  25.519 1.00 14.53 ? 26   ALA C N     1 
ATOM   7052  C  CA    . ALA D 2 25  ? -17.736 44.648  26.395 1.00 15.38 ? 26   ALA C CA    1 
ATOM   7053  C  C     . ALA D 2 25  ? -18.212 43.289  26.886 1.00 15.19 ? 26   ALA C C     1 
ATOM   7054  O  O     . ALA D 2 25  ? -18.418 43.092  28.079 1.00 14.40 ? 26   ALA C O     1 
ATOM   7055  C  CB    . ALA D 2 25  ? -18.871 45.393  25.696 1.00 15.84 ? 26   ALA C CB    1 
ATOM   7056  N  N     . MET D 2 26  ? -18.359 42.354  25.951 1.00 16.89 ? 27   MET C N     1 
ATOM   7057  C  CA    . MET D 2 26  ? -18.830 41.004  26.247 1.00 17.46 ? 27   MET C CA    1 
ATOM   7058  C  C     . MET D 2 26  ? -17.894 40.256  27.189 1.00 16.48 ? 27   MET C C     1 
ATOM   7059  O  O     . MET D 2 26  ? -18.347 39.584  28.114 1.00 16.24 ? 27   MET C O     1 
ATOM   7060  C  CB    . MET D 2 26  ? -19.011 40.207  24.949 1.00 19.55 ? 27   MET C CB    1 
ATOM   7061  C  CG    . MET D 2 26  ? -20.081 40.764  24.005 1.00 24.32 ? 27   MET C CG    1 
ATOM   7062  S  SD    . MET D 2 26  ? -21.755 40.791  24.733 1.00 34.85 ? 27   MET C SD    1 
ATOM   7063  C  CE    . MET D 2 26  ? -21.927 39.007  25.012 1.00 30.94 ? 27   MET C CE    1 
ATOM   7064  N  N     . SER D 2 27  ? -16.595 40.391  26.954 1.00 15.01 ? 28   SER C N     1 
ATOM   7065  C  CA    . SER D 2 27  ? -15.585 39.699  27.737 1.00 14.83 ? 28   SER C CA    1 
ATOM   7066  C  C     . SER D 2 27  ? -15.565 40.127  29.211 1.00 13.72 ? 28   SER C C     1 
ATOM   7067  O  O     . SER D 2 27  ? -15.407 39.293  30.107 1.00 13.36 ? 28   SER C O     1 
ATOM   7068  C  CB    . SER D 2 27  ? -14.216 39.887  27.096 1.00 15.35 ? 28   SER C CB    1 
ATOM   7069  O  OG    . SER D 2 27  ? -13.248 39.086  27.741 1.00 17.43 ? 28   SER C OG    1 
ATOM   7070  N  N     . VAL D 2 28  ? -15.774 41.406  29.450 1.00 12.24 ? 29   VAL C N     1 
ATOM   7071  C  CA    . VAL D 2 28  ? -15.781 41.929  30.790 1.00 10.58 ? 29   VAL C CA    1 
ATOM   7072  C  C     . VAL D 2 28  ? -17.049 41.543  31.547 1.00 10.69 ? 29   VAL C C     1 
ATOM   7073  O  O     . VAL D 2 28  ? -17.021 41.365  32.741 1.00 10.17 ? 29   VAL C O     1 
ATOM   7074  C  CB    . VAL D 2 28  ? -15.531 43.450  30.777 1.00 10.72 ? 29   VAL C CB    1 
ATOM   7075  C  CG1   . VAL D 2 28  ? -15.706 44.062  32.144 1.00 10.73 ? 29   VAL C CG1   1 
ATOM   7076  C  CG2   . VAL D 2 28  ? -14.137 43.732  30.279 1.00 10.31 ? 29   VAL C CG2   1 
ATOM   7077  N  N     . ILE D 2 29  ? -18.145 41.402  30.809 1.00 10.14 ? 30   ILE C N     1 
ATOM   7078  C  CA    . ILE D 2 29  ? -19.456 41.039  31.310 1.00 8.93  ? 30   ILE C CA    1 
ATOM   7079  C  C     . ILE D 2 29  ? -19.516 39.569  31.701 1.00 9.17  ? 30   ILE C C     1 
ATOM   7080  O  O     . ILE D 2 29  ? -19.946 39.235  32.783 1.00 9.62  ? 30   ILE C O     1 
ATOM   7081  C  CB    . ILE D 2 29  ? -20.552 41.370  30.266 1.00 8.56  ? 30   ILE C CB    1 
ATOM   7082  C  CG1   . ILE D 2 29  ? -20.827 42.861  30.209 1.00 8.51  ? 30   ILE C CG1   1 
ATOM   7083  C  CG2   . ILE D 2 29  ? -21.870 40.663  30.536 1.00 8.03  ? 30   ILE C CG2   1 
ATOM   7084  C  CD1   . ILE D 2 29  ? -21.659 43.264  29.012 1.00 8.07  ? 30   ILE C CD1   1 
ATOM   7085  N  N     . VAL D 2 30  ? -19.073 38.695  30.815 1.00 8.96  ? 31   VAL C N     1 
ATOM   7086  C  CA    . VAL D 2 30  ? -19.132 37.271  31.064 1.00 8.84  ? 31   VAL C CA    1 
ATOM   7087  C  C     . VAL D 2 30  ? -17.883 36.625  31.644 1.00 8.47  ? 31   VAL C C     1 
ATOM   7088  O  O     . VAL D 2 30  ? -17.958 35.524  32.137 1.00 8.56  ? 31   VAL C O     1 
ATOM   7089  C  CB    . VAL D 2 30  ? -19.584 36.497  29.806 1.00 8.88  ? 31   VAL C CB    1 
ATOM   7090  C  CG1   . VAL D 2 30  ? -20.899 37.041  29.306 1.00 8.95  ? 31   VAL C CG1   1 
ATOM   7091  C  CG2   . VAL D 2 30  ? -18.523 36.536  28.716 1.00 8.49  ? 31   VAL C CG2   1 
ATOM   7092  N  N     . ALA D 2 31  ? -16.749 37.304  31.592 1.00 8.32  ? 32   ALA C N     1 
ATOM   7093  C  CA    . ALA D 2 31  ? -15.528 36.722  32.112 1.00 8.49  ? 32   ALA C CA    1 
ATOM   7094  C  C     . ALA D 2 31  ? -14.639 37.651  32.928 1.00 8.69  ? 32   ALA C C     1 
ATOM   7095  O  O     . ALA D 2 31  ? -13.416 37.542  32.863 1.00 8.78  ? 32   ALA C O     1 
ATOM   7096  C  CB    . ALA D 2 31  ? -14.728 36.097  30.978 1.00 8.28  ? 32   ALA C CB    1 
ATOM   7097  N  N     . ARG D 2 32  ? -15.233 38.554  33.700 1.00 8.46  ? 33   ARG C N     1 
ATOM   7098  C  CA    . ARG D 2 32  ? -14.405 39.458  34.496 1.00 8.57  ? 33   ARG C CA    1 
ATOM   7099  C  C     . ARG D 2 32  ? -15.041 40.186  35.679 1.00 9.07  ? 33   ARG C C     1 
ATOM   7100  O  O     . ARG D 2 32  ? -14.646 39.981  36.814 1.00 9.45  ? 33   ARG C O     1 
ATOM   7101  C  CB    . ARG D 2 32  ? -13.724 40.486  33.595 1.00 8.53  ? 33   ARG C CB    1 
ATOM   7102  C  CG    . ARG D 2 32  ? -12.772 41.400  34.342 1.00 8.66  ? 33   ARG C CG    1 
ATOM   7103  C  CD    . ARG D 2 32  ? -12.108 42.413  33.434 1.00 8.44  ? 33   ARG C CD    1 
ATOM   7104  N  NE    . ARG D 2 32  ? -11.183 41.760  32.510 1.00 8.47  ? 33   ARG C NE    1 
ATOM   7105  C  CZ    . ARG D 2 32  ? -10.467 42.402  31.602 1.00 8.74  ? 33   ARG C CZ    1 
ATOM   7106  N  NH1   . ARG D 2 32  ? -10.550 43.730  31.483 1.00 8.59  ? 33   ARG C NH1   1 
ATOM   7107  N  NH2   . ARG D 2 32  ? -9.673  41.719  30.813 1.00 8.40  ? 33   ARG C NH2   1 
ATOM   7108  N  N     . ALA D 2 33  ? -16.006 41.062  35.437 1.00 8.83  ? 34   ALA C N     1 
ATOM   7109  C  CA    . ALA D 2 33  ? -16.606 41.835  36.501 1.00 8.31  ? 34   ALA C CA    1 
ATOM   7110  C  C     . ALA D 2 33  ? -17.896 41.307  37.138 1.00 8.93  ? 34   ALA C C     1 
ATOM   7111  O  O     . ALA D 2 33  ? -18.267 41.725  38.226 1.00 8.58  ? 34   ALA C O     1 
ATOM   7112  C  CB    . ALA D 2 33  ? -16.801 43.254  36.044 1.00 7.83  ? 34   ALA C CB    1 
ATOM   7113  N  N     . LEU D 2 34  ? -18.576 40.409  36.450 1.00 9.09  ? 35   LEU C N     1 
ATOM   7114  C  CA    . LEU D 2 34  ? -19.826 39.857  36.971 1.00 9.63  ? 35   LEU C CA    1 
ATOM   7115  C  C     . LEU D 2 34  ? -19.686 38.433  37.504 1.00 10.32 ? 35   LEU C C     1 
ATOM   7116  O  O     . LEU D 2 34  ? -19.028 37.589  36.863 1.00 10.79 ? 35   LEU C O     1 
ATOM   7117  C  CB    . LEU D 2 34  ? -20.930 39.899  35.901 1.00 9.64  ? 35   LEU C CB    1 
ATOM   7118  C  CG    . LEU D 2 34  ? -21.305 41.264  35.293 1.00 9.34  ? 35   LEU C CG    1 
ATOM   7119  C  CD1   . LEU D 2 34  ? -22.462 41.101  34.312 1.00 8.97  ? 35   LEU C CD1   1 
ATOM   7120  C  CD2   . LEU D 2 34  ? -21.671 42.272  36.370 1.00 8.64  ? 35   LEU C CD2   1 
ATOM   7121  N  N     . PRO D 2 35  ? -20.308 38.152  38.679 1.00 10.03 ? 36   PRO C N     1 
ATOM   7122  C  CA    . PRO D 2 35  ? -20.243 36.834  39.299 1.00 9.93  ? 36   PRO C CA    1 
ATOM   7123  C  C     . PRO D 2 35  ? -21.317 35.873  38.791 1.00 10.48 ? 36   PRO C C     1 
ATOM   7124  O  O     . PRO D 2 35  ? -22.391 36.299  38.358 1.00 11.19 ? 36   PRO C O     1 
ATOM   7125  C  CB    . PRO D 2 35  ? -20.504 37.151  40.764 1.00 10.35 ? 36   PRO C CB    1 
ATOM   7126  C  CG    . PRO D 2 35  ? -21.437 38.319  40.727 1.00 9.94  ? 36   PRO C CG    1 
ATOM   7127  C  CD    . PRO D 2 35  ? -21.114 39.088  39.476 1.00 10.11 ? 36   PRO C CD    1 
ATOM   7128  N  N     . ASP D 2 36  ? -21.041 34.591  38.865 1.00 10.61 ? 37   ASP C N     1 
ATOM   7129  C  CA    . ASP D 2 36  ? -21.994 33.592  38.453 1.00 10.75 ? 37   ASP C CA    1 
ATOM   7130  C  C     . ASP D 2 36  ? -23.015 33.448  39.583 1.00 10.57 ? 37   ASP C C     1 
ATOM   7131  O  O     . ASP D 2 36  ? -22.662 33.511  40.742 1.00 10.05 ? 37   ASP C O     1 
ATOM   7132  C  CB    . ASP D 2 36  ? -21.267 32.276  38.187 1.00 11.05 ? 37   ASP C CB    1 
ATOM   7133  C  CG    . ASP D 2 36  ? -22.079 31.303  37.376 1.00 11.59 ? 37   ASP C CG    1 
ATOM   7134  O  OD1   . ASP D 2 36  ? -23.117 30.837  37.833 1.00 11.55 ? 37   ASP C OD1   1 
ATOM   7135  O  OD2   . ASP D 2 36  ? -21.658 30.979  36.266 1.00 12.61 ? 37   ASP C OD2   1 
ATOM   7136  N  N     . VAL D 2 37  ? -24.279 33.269  39.234 1.00 10.27 ? 38   VAL C N     1 
ATOM   7137  C  CA    . VAL D 2 37  ? -25.337 33.124  40.240 1.00 9.58  ? 38   VAL C CA    1 
ATOM   7138  C  C     . VAL D 2 37  ? -25.193 31.830  41.075 1.00 9.52  ? 38   VAL C C     1 
ATOM   7139  O  O     . VAL D 2 37  ? -25.694 31.755  42.210 1.00 9.38  ? 38   VAL C O     1 
ATOM   7140  C  CB    . VAL D 2 37  ? -26.735 33.182  39.580 1.00 9.77  ? 38   VAL C CB    1 
ATOM   7141  C  CG1   . VAL D 2 37  ? -27.043 31.879  38.820 1.00 9.12  ? 38   VAL C CG1   1 
ATOM   7142  C  CG2   . VAL D 2 37  ? -27.820 33.463  40.608 1.00 9.88  ? 38   VAL C CG2   1 
ATOM   7143  N  N     . ARG D 2 38  ? -24.487 30.836  40.529 1.00 8.62  ? 39   ARG C N     1 
ATOM   7144  C  CA    . ARG D 2 38  ? -24.341 29.532  41.190 1.00 7.87  ? 39   ARG C CA    1 
ATOM   7145  C  C     . ARG D 2 38  ? -23.268 29.464  42.298 1.00 7.75  ? 39   ARG C C     1 
ATOM   7146  O  O     . ARG D 2 38  ? -23.532 28.955  43.383 1.00 7.18  ? 39   ARG C O     1 
ATOM   7147  C  CB    . ARG D 2 38  ? -24.127 28.442  40.139 1.00 7.84  ? 39   ARG C CB    1 
ATOM   7148  C  CG    . ARG D 2 38  ? -25.279 28.278  39.132 1.00 7.39  ? 39   ARG C CG    1 
ATOM   7149  C  CD    . ARG D 2 38  ? -24.841 27.467  37.929 1.00 7.55  ? 39   ARG C CD    1 
ATOM   7150  N  NE    . ARG D 2 38  ? -23.807 28.174  37.148 1.00 8.13  ? 39   ARG C NE    1 
ATOM   7151  C  CZ    . ARG D 2 38  ? -23.066 27.627  36.182 1.00 7.70  ? 39   ARG C CZ    1 
ATOM   7152  N  NH1   . ARG D 2 38  ? -23.204 26.358  35.874 1.00 7.82  ? 39   ARG C NH1   1 
ATOM   7153  N  NH2   . ARG D 2 38  ? -22.173 28.357  35.540 1.00 7.19  ? 39   ARG C NH2   1 
ATOM   7154  N  N     . ASP D 2 39  ? -22.088 29.997  42.036 1.00 7.84  ? 40   ASP C N     1 
ATOM   7155  C  CA    . ASP D 2 39  ? -21.038 29.991  43.033 1.00 7.90  ? 40   ASP C CA    1 
ATOM   7156  C  C     . ASP D 2 39  ? -20.689 31.382  43.553 1.00 7.88  ? 40   ASP C C     1 
ATOM   7157  O  O     . ASP D 2 39  ? -19.883 31.525  44.448 1.00 7.96  ? 40   ASP C O     1 
ATOM   7158  C  CB    . ASP D 2 39  ? -19.801 29.212  42.548 1.00 8.05  ? 40   ASP C CB    1 
ATOM   7159  C  CG    . ASP D 2 39  ? -19.128 29.831  41.334 1.00 8.74  ? 40   ASP C CG    1 
ATOM   7160  O  OD1   . ASP D 2 39  ? -19.545 30.888  40.847 1.00 8.83  ? 40   ASP C OD1   1 
ATOM   7161  O  OD2   . ASP D 2 39  ? -18.163 29.232  40.870 1.00 8.59  ? 40   ASP C OD2   1 
ATOM   7162  N  N     . GLY D 2 40  ? -21.317 32.394  42.971 1.00 7.81  ? 41   GLY C N     1 
ATOM   7163  C  CA    . GLY D 2 40  ? -21.122 33.789  43.328 1.00 7.72  ? 41   GLY C CA    1 
ATOM   7164  C  C     . GLY D 2 40  ? -19.718 34.301  43.098 1.00 8.24  ? 41   GLY C C     1 
ATOM   7165  O  O     . GLY D 2 40  ? -19.292 35.238  43.743 1.00 8.11  ? 41   GLY C O     1 
ATOM   7166  N  N     . LEU D 2 41  ? -19.013 33.672  42.170 1.00 8.25  ? 42   LEU C N     1 
ATOM   7167  C  CA    . LEU D 2 41  ? -17.645 34.029  41.872 1.00 8.46  ? 42   LEU C CA    1 
ATOM   7168  C  C     . LEU D 2 41  ? -17.379 34.657  40.509 1.00 9.12  ? 42   LEU C C     1 
ATOM   7169  O  O     . LEU D 2 41  ? -18.123 34.519  39.565 1.00 9.58  ? 42   LEU C O     1 
ATOM   7170  C  CB    . LEU D 2 41  ? -16.744 32.809  42.022 1.00 8.00  ? 42   LEU C CB    1 
ATOM   7171  C  CG    . LEU D 2 41  ? -16.572 32.149  43.383 1.00 7.80  ? 42   LEU C CG    1 
ATOM   7172  C  CD1   . LEU D 2 41  ? -15.813 30.850  43.260 1.00 7.23  ? 42   LEU C CD1   1 
ATOM   7173  C  CD2   . LEU D 2 41  ? -15.884 33.063  44.376 1.00 7.65  ? 42   LEU C CD2   1 
ATOM   7174  N  N     . LYS D 2 42  ? -16.270 35.359  40.447 1.00 9.26  ? 43   LYS C N     1 
ATOM   7175  C  CA    . LYS D 2 42  ? -15.790 35.964  39.235 1.00 10.13 ? 43   LYS C CA    1 
ATOM   7176  C  C     . LYS D 2 42  ? -14.718 35.003  38.734 1.00 10.64 ? 43   LYS C C     1 
ATOM   7177  O  O     . LYS D 2 42  ? -14.293 34.147  39.488 1.00 10.91 ? 43   LYS C O     1 
ATOM   7178  C  CB    . LYS D 2 42  ? -15.223 37.357  39.494 1.00 10.84 ? 43   LYS C CB    1 
ATOM   7179  C  CG    . LYS D 2 42  ? -16.273 38.450  39.659 1.00 11.31 ? 43   LYS C CG    1 
ATOM   7180  C  CD    . LYS D 2 42  ? -15.642 39.744  40.130 1.00 10.82 ? 43   LYS C CD    1 
ATOM   7181  C  CE    . LYS D 2 42  ? -16.631 40.647  40.838 1.00 10.82 ? 43   LYS C CE    1 
ATOM   7182  N  NZ    . LYS D 2 42  ? -16.142 42.050  40.959 1.00 10.47 ? 43   LYS C NZ    1 
ATOM   7183  N  N     . PRO D 2 43  ? -14.295 35.151  37.422 1.00 10.79 ? 44   PRO C N     1 
ATOM   7184  C  CA    . PRO D 2 43  ? -13.246 34.196  37.004 1.00 10.89 ? 44   PRO C CA    1 
ATOM   7185  C  C     . PRO D 2 43  ? -11.962 34.184  37.815 1.00 11.06 ? 44   PRO C C     1 
ATOM   7186  O  O     . PRO D 2 43  ? -11.436 33.128  38.050 1.00 11.98 ? 44   PRO C O     1 
ATOM   7187  C  CB    . PRO D 2 43  ? -12.923 34.646  35.584 1.00 10.61 ? 44   PRO C CB    1 
ATOM   7188  C  CG    . PRO D 2 43  ? -14.186 35.168  35.081 1.00 10.94 ? 44   PRO C CG    1 
ATOM   7189  C  CD    . PRO D 2 43  ? -14.641 36.003  36.209 1.00 10.80 ? 44   PRO C CD    1 
ATOM   7190  N  N     . VAL D 2 44  ? -11.465 35.342  38.220 1.00 10.32 ? 45   VAL C N     1 
ATOM   7191  C  CA    . VAL D 2 44  ? -10.224 35.426  38.994 1.00 9.76  ? 45   VAL C CA    1 
ATOM   7192  C  C     . VAL D 2 44  ? -10.335 34.775  40.364 1.00 10.01 ? 45   VAL C C     1 
ATOM   7193  O  O     . VAL D 2 44  ? -9.428  34.122  40.808 1.00 10.31 ? 45   VAL C O     1 
ATOM   7194  C  CB    . VAL D 2 44  ? -9.744  36.895  39.124 1.00 9.54  ? 45   VAL C CB    1 
ATOM   7195  C  CG1   . VAL D 2 44  ? -10.568 37.687  40.132 1.00 8.69  ? 45   VAL C CG1   1 
ATOM   7196  C  CG2   . VAL D 2 44  ? -8.283  36.933  39.484 1.00 9.44  ? 45   VAL C CG2   1 
ATOM   7197  N  N     . HIS D 2 45  ? -11.456 34.979  41.031 1.00 10.36 ? 46   HIS C N     1 
ATOM   7198  C  CA    . HIS D 2 45  ? -11.671 34.390  42.337 1.00 10.19 ? 46   HIS C CA    1 
ATOM   7199  C  C     . HIS D 2 45  ? -11.758 32.860  42.292 1.00 10.42 ? 46   HIS C C     1 
ATOM   7200  O  O     . HIS D 2 45  ? -11.219 32.194  43.153 1.00 10.71 ? 46   HIS C O     1 
ATOM   7201  C  CB    . HIS D 2 45  ? -12.879 35.029  43.032 1.00 9.94  ? 46   HIS C CB    1 
ATOM   7202  C  CG    . HIS D 2 45  ? -12.702 36.478  43.344 1.00 9.81  ? 46   HIS C CG    1 
ATOM   7203  N  ND1   . HIS D 2 45  ? -13.313 37.470  42.616 1.00 10.27 ? 46   HIS C ND1   1 
ATOM   7204  C  CD2   . HIS D 2 45  ? -11.989 37.104  44.305 1.00 9.81  ? 46   HIS C CD2   1 
ATOM   7205  C  CE1   . HIS D 2 45  ? -12.979 38.645  43.118 1.00 10.13 ? 46   HIS C CE1   1 
ATOM   7206  N  NE2   . HIS D 2 45  ? -12.174 38.449  44.141 1.00 9.95  ? 46   HIS C NE2   1 
ATOM   7207  N  N     . ARG D 2 46  ? -12.428 32.343  41.268 1.00 10.31 ? 47   ARG C N     1 
ATOM   7208  C  CA    . ARG D 2 46  ? -12.611 30.914  41.052 1.00 10.51 ? 47   ARG C CA    1 
ATOM   7209  C  C     . ARG D 2 46  ? -11.307 30.217  40.678 1.00 11.01 ? 47   ARG C C     1 
ATOM   7210  O  O     . ARG D 2 46  ? -11.088 29.077  41.030 1.00 10.38 ? 47   ARG C O     1 
ATOM   7211  C  CB    . ARG D 2 46  ? -13.685 30.662  39.979 1.00 9.88  ? 47   ARG C CB    1 
ATOM   7212  C  CG    . ARG D 2 46  ? -14.136 29.219  39.848 1.00 9.97  ? 47   ARG C CG    1 
ATOM   7213  C  CD    . ARG D 2 46  ? -15.210 28.992  38.794 1.00 9.08  ? 47   ARG C CD    1 
ATOM   7214  N  NE    . ARG D 2 46  ? -16.366 29.867  38.950 1.00 9.15  ? 47   ARG C NE    1 
ATOM   7215  C  CZ    . ARG D 2 46  ? -16.584 30.938  38.210 1.00 9.43  ? 47   ARG C CZ    1 
ATOM   7216  N  NH1   . ARG D 2 46  ? -15.750 31.264  37.258 1.00 9.77  ? 47   ARG C NH1   1 
ATOM   7217  N  NH2   . ARG D 2 46  ? -17.636 31.672  38.411 1.00 9.51  ? 47   ARG C NH2   1 
ATOM   7218  N  N     . ARG D 2 47  ? -10.458 30.931  39.959 1.00 11.20 ? 48   ARG C N     1 
ATOM   7219  C  CA    . ARG D 2 47  ? -9.164  30.432  39.525 1.00 11.81 ? 48   ARG C CA    1 
ATOM   7220  C  C     . ARG D 2 47  ? -8.169  30.382  40.681 1.00 11.79 ? 48   ARG C C     1 
ATOM   7221  O  O     . ARG D 2 47  ? -7.336  29.499  40.746 1.00 12.00 ? 48   ARG C O     1 
ATOM   7222  C  CB    . ARG D 2 47  ? -8.632  31.265  38.360 1.00 11.95 ? 48   ARG C CB    1 
ATOM   7223  C  CG    . ARG D 2 47  ? -9.363  31.004  37.065 1.00 12.71 ? 48   ARG C CG    1 
ATOM   7224  C  CD    . ARG D 2 47  ? -9.074  32.008  35.975 1.00 13.45 ? 48   ARG C CD    1 
ATOM   7225  N  NE    . ARG D 2 47  ? -9.914  31.742  34.820 1.00 13.77 ? 48   ARG C NE    1 
ATOM   7226  C  CZ    . ARG D 2 47  ? -9.957  32.466  33.714 1.00 14.16 ? 48   ARG C CZ    1 
ATOM   7227  N  NH1   . ARG D 2 47  ? -9.201  33.535  33.578 1.00 13.23 ? 48   ARG C NH1   1 
ATOM   7228  N  NH2   . ARG D 2 47  ? -10.761 32.110  32.744 1.00 13.96 ? 48   ARG C NH2   1 
ATOM   7229  N  N     . ILE D 2 48  ? -8.273  31.340  41.591 1.00 11.47 ? 49   ILE C N     1 
ATOM   7230  C  CA    . ILE D 2 48  ? -7.437  31.371  42.779 1.00 11.28 ? 49   ILE C CA    1 
ATOM   7231  C  C     . ILE D 2 48  ? -7.770  30.219  43.724 1.00 12.01 ? 49   ILE C C     1 
ATOM   7232  O  O     . ILE D 2 48  ? -6.888  29.586  44.263 1.00 12.37 ? 49   ILE C O     1 
ATOM   7233  C  CB    . ILE D 2 48  ? -7.583  32.695  43.540 1.00 9.73  ? 49   ILE C CB    1 
ATOM   7234  C  CG1   . ILE D 2 48  ? -7.109  33.863  42.686 1.00 9.30  ? 49   ILE C CG1   1 
ATOM   7235  C  CG2   . ILE D 2 48  ? -6.819  32.658  44.844 1.00 9.74  ? 49   ILE C CG2   1 
ATOM   7236  C  CD1   . ILE D 2 48  ? -7.399  35.209  43.296 1.00 7.99  ? 49   ILE C CD1   1 
ATOM   7237  N  N     . LEU D 2 49  ? -9.058  29.977  43.925 1.00 12.31 ? 50   LEU C N     1 
ATOM   7238  C  CA    . LEU D 2 49  ? -9.519  28.915  44.802 1.00 12.77 ? 50   LEU C CA    1 
ATOM   7239  C  C     . LEU D 2 49  ? -9.198  27.533  44.272 1.00 13.72 ? 50   LEU C C     1 
ATOM   7240  O  O     . LEU D 2 49  ? -8.843  26.643  45.015 1.00 14.79 ? 50   LEU C O     1 
ATOM   7241  C  CB    . LEU D 2 49  ? -10.993 29.082  45.148 1.00 11.38 ? 50   LEU C CB    1 
ATOM   7242  C  CG    . LEU D 2 49  ? -11.311 30.417  45.825 1.00 10.86 ? 50   LEU C CG    1 
ATOM   7243  C  CD1   . LEU D 2 49  ? -12.783 30.562  46.111 1.00 10.09 ? 50   LEU C CD1   1 
ATOM   7244  C  CD2   . LEU D 2 49  ? -10.495 30.640  47.075 1.00 10.41 ? 50   LEU C CD2   1 
ATOM   7245  N  N     . TYR D 2 50  ? -9.332  27.379  42.967 1.00 14.30 ? 51   TYR C N     1 
ATOM   7246  C  CA    . TYR D 2 50  ? -9.060  26.140  42.313 1.00 15.34 ? 51   TYR C CA    1 
ATOM   7247  C  C     . TYR D 2 50  ? -7.569  25.846  42.374 1.00 16.84 ? 51   TYR C C     1 
ATOM   7248  O  O     . TYR D 2 50  ? -7.164  24.698  42.540 1.00 18.55 ? 51   TYR C O     1 
ATOM   7249  C  CB    . TYR D 2 50  ? -9.580  26.182  40.878 1.00 15.80 ? 51   TYR C CB    1 
ATOM   7250  C  CG    . TYR D 2 50  ? -9.309  24.940  40.105 1.00 15.50 ? 51   TYR C CG    1 
ATOM   7251  C  CD1   . TYR D 2 50  ? -9.827  23.729  40.512 1.00 16.61 ? 51   TYR C CD1   1 
ATOM   7252  C  CD2   . TYR D 2 50  ? -8.531  24.964  38.984 1.00 15.57 ? 51   TYR C CD2   1 
ATOM   7253  C  CE1   . TYR D 2 50  ? -9.568  22.578  39.818 1.00 16.32 ? 51   TYR C CE1   1 
ATOM   7254  C  CE2   . TYR D 2 50  ? -8.276  23.817  38.281 1.00 15.40 ? 51   TYR C CE2   1 
ATOM   7255  C  CZ    . TYR D 2 50  ? -8.803  22.627  38.709 1.00 16.31 ? 51   TYR C CZ    1 
ATOM   7256  O  OH    . TYR D 2 50  ? -8.558  21.475  38.029 1.00 17.72 ? 51   TYR C OH    1 
ATOM   7257  N  N     . GLY D 2 51  ? -6.765  26.892  42.254 1.00 15.85 ? 52   GLY C N     1 
ATOM   7258  C  CA    . GLY D 2 51  ? -5.328  26.751  42.331 1.00 15.55 ? 52   GLY C CA    1 
ATOM   7259  C  C     . GLY D 2 51  ? -4.919  26.217  43.682 1.00 17.13 ? 52   GLY C C     1 
ATOM   7260  O  O     . GLY D 2 51  ? -4.063  25.358  43.770 1.00 20.39 ? 52   GLY C O     1 
ATOM   7261  N  N     . LEU D 2 52  ? -5.531  26.714  44.742 1.00 19.00 ? 53   LEU C N     1 
ATOM   7262  C  CA    . LEU D 2 52  ? -5.269  26.263  46.097 1.00 20.43 ? 53   LEU C CA    1 
ATOM   7263  C  C     . LEU D 2 52  ? -5.730  24.825  46.299 1.00 22.39 ? 53   LEU C C     1 
ATOM   7264  O  O     . LEU D 2 52  ? -5.138  24.087  47.030 1.00 25.14 ? 53   LEU C O     1 
ATOM   7265  C  CB    . LEU D 2 52  ? -5.960  27.152  47.108 1.00 18.60 ? 53   LEU C CB    1 
ATOM   7266  C  CG    . LEU D 2 52  ? -5.583  28.604  47.242 1.00 19.09 ? 53   LEU C CG    1 
ATOM   7267  C  CD1   . LEU D 2 52  ? -6.760  29.394  47.747 1.00 19.54 ? 53   LEU C CD1   1 
ATOM   7268  C  CD2   . LEU D 2 52  ? -4.373  28.813  48.130 1.00 19.22 ? 53   LEU C CD2   1 
ATOM   7269  N  N     . ASN D 2 53  ? -6.809  24.447  45.642 1.00 23.62 ? 54   ASN C N     1 
ATOM   7270  C  CA    . ASN D 2 53  ? -7.328  23.088  45.682 1.00 26.60 ? 54   ASN C CA    1 
ATOM   7271  C  C     . ASN D 2 53  ? -6.461  22.036  44.979 1.00 29.67 ? 54   ASN C C     1 
ATOM   7272  O  O     . ASN D 2 53  ? -6.266  20.943  45.490 1.00 28.52 ? 54   ASN C O     1 
ATOM   7273  C  CB    . ASN D 2 53  ? -8.729  23.073  45.078 1.00 25.83 ? 54   ASN C CB    1 
ATOM   7274  C  CG    . ASN D 2 53  ? -9.383  21.713  45.155 1.00 26.02 ? 54   ASN C CG    1 
ATOM   7275  O  OD1   . ASN D 2 53  ? -9.893  21.318  46.197 1.00 24.30 ? 54   ASN C OD1   1 
ATOM   7276  N  ND2   . ASN D 2 53  ? -9.391  21.003  44.041 1.00 27.62 ? 54   ASN C ND2   1 
ATOM   7277  N  N     . GLU D 2 54  ? -5.941  22.386  43.807 1.00 31.51 ? 55   GLU C N     1 
ATOM   7278  C  CA    . GLU D 2 54  ? -5.118  21.471  43.020 1.00 32.78 ? 55   GLU C CA    1 
ATOM   7279  C  C     . GLU D 2 54  ? -3.728  21.277  43.595 1.00 31.40 ? 55   GLU C C     1 
ATOM   7280  O  O     . GLU D 2 54  ? -3.088  20.267  43.357 1.00 30.87 ? 55   GLU C O     1 
ATOM   7281  C  CB    . GLU D 2 54  ? -5.062  21.915  41.563 1.00 32.43 ? 55   GLU C CB    1 
ATOM   7282  C  CG    . GLU D 2 54  ? -6.372  21.698  40.841 1.00 34.95 ? 55   GLU C CG    1 
ATOM   7283  C  CD    . GLU D 2 54  ? -6.728  20.232  40.719 1.00 35.77 ? 55   GLU C CD    1 
ATOM   7284  O  OE1   . GLU D 2 54  ? -6.114  19.550  39.884 1.00 40.66 ? 55   GLU C OE1   1 
ATOM   7285  O  OE2   . GLU D 2 54  ? -7.630  19.760  41.445 1.00 35.98 ? 55   GLU C OE2   1 
ATOM   7286  N  N     . GLN D 2 55  ? -3.269  22.286  44.321 1.00 31.71 ? 56   GLN C N     1 
ATOM   7287  C  CA    . GLN D 2 55  ? -1.962  22.274  44.950 1.00 32.33 ? 56   GLN C CA    1 
ATOM   7288  C  C     . GLN D 2 55  ? -2.044  21.757  46.372 1.00 30.27 ? 56   GLN C C     1 
ATOM   7289  O  O     . GLN D 2 55  ? -1.068  21.720  47.078 1.00 28.57 ? 56   GLN C O     1 
ATOM   7290  C  CB    . GLN D 2 55  ? -1.319  23.658  44.917 1.00 34.52 ? 56   GLN C CB    1 
ATOM   7291  C  CG    . GLN D 2 55  ? -0.847  24.098  43.548 1.00 38.27 ? 56   GLN C CG    1 
ATOM   7292  C  CD    . GLN D 2 55  ? -0.134  22.991  42.776 1.00 42.21 ? 56   GLN C CD    1 
ATOM   7293  O  OE1   . GLN D 2 55  ? 0.866   22.413  43.247 1.00 38.59 ? 56   GLN C OE1   1 
ATOM   7294  N  NE2   . GLN D 2 55  ? -0.637  22.699  41.588 1.00 38.06 ? 56   GLN C NE2   1 
ATOM   7295  N  N     . GLY D 2 56  ? -3.243  21.352  46.750 1.00 29.83 ? 57   GLY C N     1 
ATOM   7296  C  CA    . GLY D 2 56  ? -3.535  20.806  48.048 1.00 31.56 ? 57   GLY C CA    1 
ATOM   7297  C  C     . GLY D 2 56  ? -3.294  21.702  49.230 1.00 35.58 ? 57   GLY C C     1 
ATOM   7298  O  O     . GLY D 2 56  ? -2.930  21.228  50.287 1.00 37.11 ? 57   GLY C O     1 
ATOM   7299  N  N     . MET D 2 57  ? -3.499  22.994  49.049 1.00 31.12 ? 58   MET C N     1 
ATOM   7300  C  CA    . MET D 2 57  ? -3.279  23.951  50.100 1.00 31.03 ? 58   MET C CA    1 
ATOM   7301  C  C     . MET D 2 57  ? -4.496  24.075  50.981 1.00 29.39 ? 58   MET C C     1 
ATOM   7302  O  O     . MET D 2 57  ? -5.156  25.090  51.017 1.00 26.12 ? 58   MET C O     1 
ATOM   7303  C  CB    . MET D 2 57  ? -2.938  25.291  49.490 1.00 31.91 ? 58   MET C CB    1 
ATOM   7304  C  CG    . MET D 2 57  ? -1.662  25.277  48.714 1.00 36.53 ? 58   MET C CG    1 
ATOM   7305  S  SD    . MET D 2 57  ? -1.712  26.604  47.530 1.00 46.17 ? 58   MET C SD    1 
ATOM   7306  C  CE    . MET D 2 57  ? -0.004  26.731  47.049 1.00 43.27 ? 58   MET C CE    1 
ATOM   7307  N  N     . THR D 2 58  ? -4.760  23.000  51.692 1.00 29.38 ? 59   THR C N     1 
ATOM   7308  C  CA    . THR D 2 58  ? -5.877  22.876  52.590 1.00 29.88 ? 59   THR C CA    1 
ATOM   7309  C  C     . THR D 2 58  ? -5.626  23.456  53.974 1.00 32.14 ? 59   THR C C     1 
ATOM   7310  O  O     . THR D 2 58  ? -4.481  23.637  54.352 1.00 35.77 ? 59   THR C O     1 
ATOM   7311  C  CB    . THR D 2 58  ? -6.312  21.413  52.660 1.00 27.10 ? 59   THR C CB    1 
ATOM   7312  O  OG1   . THR D 2 58  ? -5.182  20.599  52.916 1.00 27.11 ? 59   THR C OG1   1 
ATOM   7313  C  CG2   . THR D 2 58  ? -6.873  21.005  51.370 1.00 22.89 ? 59   THR C CG2   1 
ATOM   7314  N  N     . PRO D 2 59  ? -6.748  23.765  54.731 1.00 35.84 ? 60   PRO C N     1 
ATOM   7315  C  CA    . PRO D 2 59  ? -6.441  24.335  56.063 1.00 35.65 ? 60   PRO C CA    1 
ATOM   7316  C  C     . PRO D 2 59  ? -5.667  23.467  57.052 1.00 35.41 ? 60   PRO C C     1 
ATOM   7317  O  O     . PRO D 2 59  ? -5.110  24.025  57.964 1.00 36.05 ? 60   PRO C O     1 
ATOM   7318  C  CB    . PRO D 2 59  ? -7.817  24.733  56.626 1.00 36.70 ? 60   PRO C CB    1 
ATOM   7319  C  CG    . PRO D 2 59  ? -8.806  23.954  55.881 1.00 37.15 ? 60   PRO C CG    1 
ATOM   7320  C  CD    . PRO D 2 59  ? -8.254  23.817  54.514 1.00 37.60 ? 60   PRO C CD    1 
ATOM   7321  N  N     . ASP D 2 60  ? -5.619  22.150  56.869 1.00 36.99 ? 61   ASP C N     1 
ATOM   7322  C  CA    . ASP D 2 60  ? -4.841  21.243  57.724 1.00 39.04 ? 61   ASP C CA    1 
ATOM   7323  C  C     . ASP D 2 60  ? -3.343  21.297  57.405 1.00 40.52 ? 61   ASP C C     1 
ATOM   7324  O  O     . ASP D 2 60  ? -2.512  20.977  58.259 1.00 41.63 ? 61   ASP C O     1 
ATOM   7325  C  CB    . ASP D 2 60  ? -5.369  19.802  57.648 1.00 40.08 ? 61   ASP C CB    1 
ATOM   7326  C  CG    . ASP D 2 60  ? -5.451  19.273  56.212 1.00 46.70 ? 61   ASP C CG    1 
ATOM   7327  O  OD1   . ASP D 2 60  ? -5.958  20.004  55.332 1.00 47.68 ? 61   ASP C OD1   1 
ATOM   7328  O  OD2   . ASP D 2 60  ? -5.038  18.115  55.970 1.00 46.57 ? 61   ASP C OD2   1 
ATOM   7329  N  N     . LYS D 2 61  ? -3.008  21.689  56.173 1.00 39.33 ? 62   LYS C N     1 
ATOM   7330  C  CA    . LYS D 2 61  ? -1.614  21.833  55.755 1.00 36.42 ? 62   LYS C CA    1 
ATOM   7331  C  C     . LYS D 2 61  ? -1.082  23.196  56.180 1.00 35.42 ? 62   LYS C C     1 
ATOM   7332  O  O     . LYS D 2 61  ? -1.850  24.061  56.607 1.00 34.44 ? 62   LYS C O     1 
ATOM   7333  C  CB    . LYS D 2 61  ? -1.456  21.638  54.236 1.00 37.52 ? 62   LYS C CB    1 
ATOM   7334  C  CG    . LYS D 2 61  ? -1.314  20.189  53.765 1.00 37.63 ? 62   LYS C CG    1 
ATOM   7335  C  CD    . LYS D 2 61  ? -2.532  19.338  54.068 1.00 38.55 ? 62   LYS C CD    1 
ATOM   7336  C  CE    . LYS D 2 61  ? -2.309  17.885  53.666 1.00 39.90 ? 62   LYS C CE    1 
ATOM   7337  N  NZ    . LYS D 2 61  ? -3.489  17.033  54.000 1.00 38.53 ? 62   LYS C NZ    1 
ATOM   7338  N  N     . SER D 2 62  ? 0.231   23.380  56.071 1.00 32.28 ? 63   SER C N     1 
ATOM   7339  C  CA    . SER D 2 62  ? 0.864   24.642  56.440 1.00 30.09 ? 63   SER C CA    1 
ATOM   7340  C  C     . SER D 2 62  ? 0.686   25.702  55.343 1.00 29.96 ? 63   SER C C     1 
ATOM   7341  O  O     . SER D 2 62  ? 0.331   25.392  54.203 1.00 28.48 ? 63   SER C O     1 
ATOM   7342  C  CB    . SER D 2 62  ? 2.347   24.435  56.777 1.00 28.60 ? 63   SER C CB    1 
ATOM   7343  O  OG    . SER D 2 62  ? 3.075   23.974  55.647 1.00 28.67 ? 63   SER C OG    1 
ATOM   7344  N  N     . TYR D 2 63  ? 0.927   26.959  55.717 1.00 28.55 ? 64   TYR C N     1 
ATOM   7345  C  CA    . TYR D 2 63  ? 0.820   28.093  54.805 1.00 26.10 ? 64   TYR C CA    1 
ATOM   7346  C  C     . TYR D 2 63  ? 1.826   28.010  53.650 1.00 27.86 ? 64   TYR C C     1 
ATOM   7347  O  O     . TYR D 2 63  ? 3.029   27.822  53.877 1.00 29.13 ? 64   TYR C O     1 
ATOM   7348  C  CB    . TYR D 2 63  ? 1.013   29.405  55.564 1.00 23.11 ? 64   TYR C CB    1 
ATOM   7349  C  CG    . TYR D 2 63  ? -0.107  29.789  56.514 1.00 22.73 ? 64   TYR C CG    1 
ATOM   7350  C  CD1   . TYR D 2 63  ? -1.235  30.471  56.044 1.00 24.30 ? 64   TYR C CD1   1 
ATOM   7351  C  CD2   . TYR D 2 63  ? -0.031  29.508  57.876 1.00 21.79 ? 64   TYR C CD2   1 
ATOM   7352  C  CE1   . TYR D 2 63  ? -2.263  30.850  56.903 1.00 22.67 ? 64   TYR C CE1   1 
ATOM   7353  C  CE2   . TYR D 2 63  ? -1.055  29.876  58.747 1.00 22.77 ? 64   TYR C CE2   1 
ATOM   7354  C  CZ    . TYR D 2 63  ? -2.174  30.556  58.251 1.00 22.98 ? 64   TYR C CZ    1 
ATOM   7355  O  OH    . TYR D 2 63  ? -3.196  30.938  59.096 1.00 19.50 ? 64   TYR C OH    1 
ATOM   7356  N  N     . LYS D 2 64  ? 1.321   28.205  52.433 1.00 25.57 ? 65   LYS C N     1 
ATOM   7357  C  CA    . LYS D 2 64  ? 2.113   28.191  51.218 1.00 24.28 ? 65   LYS C CA    1 
ATOM   7358  C  C     . LYS D 2 64  ? 2.413   29.605  50.768 1.00 23.45 ? 65   LYS C C     1 
ATOM   7359  O  O     . LYS D 2 64  ? 1.731   30.530  51.128 1.00 23.93 ? 65   LYS C O     1 
ATOM   7360  C  CB    . LYS D 2 64  ? 1.419   27.415  50.106 1.00 25.29 ? 65   LYS C CB    1 
ATOM   7361  C  CG    . LYS D 2 64  ? 0.924   26.058  50.529 1.00 27.80 ? 65   LYS C CG    1 
ATOM   7362  C  CD    . LYS D 2 64  ? 2.081   25.157  50.926 1.00 30.16 ? 65   LYS C CD    1 
ATOM   7363  C  CE    . LYS D 2 64  ? 1.577   23.935  51.670 1.00 27.01 ? 65   LYS C CE    1 
ATOM   7364  N  NZ    . LYS D 2 64  ? 2.615   22.887  51.724 1.00 27.63 ? 65   LYS C NZ    1 
ATOM   7365  N  N     . LYS D 2 65  ? 3.448   29.760  49.967 1.00 21.93 ? 66   LYS C N     1 
ATOM   7366  C  CA    . LYS D 2 65  ? 3.867   31.090  49.514 1.00 19.14 ? 66   LYS C CA    1 
ATOM   7367  C  C     . LYS D 2 65  ? 2.943   31.730  48.472 1.00 18.48 ? 66   LYS C C     1 
ATOM   7368  O  O     . LYS D 2 65  ? 2.615   31.117  47.450 1.00 17.14 ? 66   LYS C O     1 
ATOM   7369  C  CB    . LYS D 2 65  ? 5.290   31.035  48.954 1.00 21.17 ? 66   LYS C CB    1 
ATOM   7370  C  CG    . LYS D 2 65  ? 6.365   30.492  49.904 1.00 21.37 ? 66   LYS C CG    1 
ATOM   7371  C  CD    . LYS D 2 65  ? 6.711   31.498  51.014 1.00 23.22 ? 66   LYS C CD    1 
ATOM   7372  C  CE    . LYS D 2 65  ? 7.802   30.953  51.933 1.00 23.99 ? 66   LYS C CE    1 
ATOM   7373  N  NZ    . LYS D 2 65  ? 7.401   29.645  52.547 1.00 25.48 ? 66   LYS C NZ    1 
ATOM   7374  N  N     . SER D 2 66  ? 2.549   32.979  48.736 1.00 17.07 ? 67   SER C N     1 
ATOM   7375  C  CA    . SER D 2 66  ? 1.678   33.736  47.848 1.00 14.86 ? 67   SER C CA    1 
ATOM   7376  C  C     . SER D 2 66  ? 2.250   33.819  46.446 1.00 14.10 ? 67   SER C C     1 
ATOM   7377  O  O     . SER D 2 66  ? 1.512   33.739  45.461 1.00 14.72 ? 67   SER C O     1 
ATOM   7378  C  CB    . SER D 2 66  ? 1.423   35.142  48.399 1.00 14.67 ? 67   SER C CB    1 
ATOM   7379  O  OG    . SER D 2 66  ? 0.733   35.083  49.635 1.00 15.20 ? 67   SER C OG    1 
ATOM   7380  N  N     . ALA D 2 67  ? 3.565   33.974  46.365 1.00 12.81 ? 68   ALA C N     1 
ATOM   7381  C  CA    . ALA D 2 67  ? 4.283   34.050  45.096 1.00 12.49 ? 68   ALA C CA    1 
ATOM   7382  C  C     . ALA D 2 67  ? 4.040   32.823  44.220 1.00 12.40 ? 68   ALA C C     1 
ATOM   7383  O  O     . ALA D 2 67  ? 3.767   32.960  43.027 1.00 12.95 ? 68   ALA C O     1 
ATOM   7384  C  CB    . ALA D 2 67  ? 5.768   34.247  45.353 1.00 12.84 ? 68   ALA C CB    1 
ATOM   7385  N  N     . ARG D 2 68  ? 4.130   31.633  44.816 1.00 13.11 ? 69   ARG C N     1 
ATOM   7386  C  CA    . ARG D 2 68  ? 3.904   30.373  44.100 1.00 13.30 ? 69   ARG C CA    1 
ATOM   7387  C  C     . ARG D 2 68  ? 2.437   30.261  43.692 1.00 12.11 ? 69   ARG C C     1 
ATOM   7388  O  O     . ARG D 2 68  ? 2.140   29.896  42.557 1.00 11.56 ? 69   ARG C O     1 
ATOM   7389  C  CB    . ARG D 2 68  ? 4.337   29.153  44.926 1.00 14.99 ? 69   ARG C CB    1 
ATOM   7390  C  CG    . ARG D 2 68  ? 5.828   29.143  45.320 1.00 18.17 ? 69   ARG C CG    1 
ATOM   7391  C  CD    . ARG D 2 68  ? 6.314   27.788  45.835 1.00 20.06 ? 69   ARG C CD    1 
ATOM   7392  N  NE    . ARG D 2 68  ? 6.132   26.743  44.824 1.00 23.82 ? 69   ARG C NE    1 
ATOM   7393  C  CZ    . ARG D 2 68  ? 6.228   25.422  45.048 1.00 25.56 ? 69   ARG C CZ    1 
ATOM   7394  N  NH1   . ARG D 2 68  ? 6.508   24.960  46.275 1.00 27.59 ? 69   ARG C NH1   1 
ATOM   7395  N  NH2   . ARG D 2 68  ? 6.015   24.582  44.045 1.00 24.53 ? 69   ARG C NH2   1 
ATOM   7396  N  N     . ILE D 2 69  ? 1.529   30.605  44.589 1.00 11.54 ? 70   ILE C N     1 
ATOM   7397  C  CA    . ILE D 2 69  ? 0.107   30.591  44.317 1.00 10.99 ? 70   ILE C CA    1 
ATOM   7398  C  C     . ILE D 2 69  ? -0.212  31.462  43.130 1.00 10.96 ? 70   ILE C C     1 
ATOM   7399  O  O     . ILE D 2 69  ? -0.763  31.020  42.173 1.00 11.08 ? 70   ILE C O     1 
ATOM   7400  C  CB    . ILE D 2 69  ? -0.740  31.098  45.516 1.00 10.96 ? 70   ILE C CB    1 
ATOM   7401  C  CG1   . ILE D 2 69  ? -0.582  30.210  46.733 1.00 10.12 ? 70   ILE C CG1   1 
ATOM   7402  C  CG2   . ILE D 2 69  ? -2.209  31.171  45.148 1.00 10.58 ? 70   ILE C CG2   1 
ATOM   7403  C  CD1   . ILE D 2 69  ? -1.034  30.872  48.012 1.00 10.12 ? 70   ILE C CD1   1 
ATOM   7404  N  N     . VAL D 2 70  ? 0.124   32.729  43.233 1.00 12.00 ? 71   VAL C N     1 
ATOM   7405  C  CA    . VAL D 2 70  ? -0.111  33.692  42.145 1.00 12.52 ? 71   VAL C CA    1 
ATOM   7406  C  C     . VAL D 2 70  ? 0.590   33.257  40.855 1.00 13.52 ? 71   VAL C C     1 
ATOM   7407  O  O     . VAL D 2 70  ? 0.021   33.347  39.764 1.00 14.15 ? 71   VAL C O     1 
ATOM   7408  C  CB    . VAL D 2 70  ? 0.296   35.123  42.561 1.00 11.74 ? 71   VAL C CB    1 
ATOM   7409  C  CG1   . VAL D 2 70  ? 0.184   36.090  41.390 1.00 10.90 ? 71   VAL C CG1   1 
ATOM   7410  C  CG2   . VAL D 2 70  ? -0.556  35.604  43.738 1.00 10.74 ? 71   VAL C CG2   1 
ATOM   7411  N  N     . GLY D 2 71  ? 1.801   32.782  40.957 1.00 15.07 ? 72   GLY C N     1 
ATOM   7412  C  CA    . GLY D 2 71  ? 2.539   32.321  39.816 1.00 16.15 ? 72   GLY C CA    1 
ATOM   7413  C  C     . GLY D 2 71  ? 1.928   31.147  39.082 1.00 18.59 ? 72   GLY C C     1 
ATOM   7414  O  O     . GLY D 2 71  ? 2.027   31.066  37.894 1.00 19.04 ? 72   GLY C O     1 
ATOM   7415  N  N     . ASP D 2 72  ? 1.309   30.237  39.814 1.00 18.82 ? 73   ASP C N     1 
ATOM   7416  C  CA    . ASP D 2 72  ? 0.669   29.086  39.252 1.00 19.15 ? 73   ASP C CA    1 
ATOM   7417  C  C     . ASP D 2 72  ? -0.648  29.444  38.631 1.00 16.82 ? 73   ASP C C     1 
ATOM   7418  O  O     . ASP D 2 72  ? -0.891  29.084  37.547 1.00 14.95 ? 73   ASP C O     1 
ATOM   7419  C  CB    . ASP D 2 72  ? 0.541   27.998  40.273 1.00 23.03 ? 73   ASP C CB    1 
ATOM   7420  C  CG    . ASP D 2 72  ? 1.829   27.282  40.479 1.00 31.40 ? 73   ASP C CG    1 
ATOM   7421  O  OD1   . ASP D 2 72  ? 2.839   27.586  39.824 1.00 32.97 ? 73   ASP C OD1   1 
ATOM   7422  O  OD2   . ASP D 2 72  ? 1.873   26.412  41.340 1.00 39.68 ? 73   ASP C OD2   1 
ATOM   7423  N  N     . VAL D 2 73  ? -1.465  30.203  39.343 1.00 14.34 ? 74   VAL C N     1 
ATOM   7424  C  CA    . VAL D 2 73  ? -2.749  30.664  38.824 1.00 12.40 ? 74   VAL C CA    1 
ATOM   7425  C  C     . VAL D 2 73  ? -2.601  31.437  37.506 1.00 12.72 ? 74   VAL C C     1 
ATOM   7426  O  O     . VAL D 2 73  ? -3.320  31.174  36.538 1.00 12.13 ? 74   VAL C O     1 
ATOM   7427  C  CB    . VAL D 2 73  ? -3.495  31.552  39.856 1.00 12.62 ? 74   VAL C CB    1 
ATOM   7428  C  CG1   . VAL D 2 73  ? -4.778  32.125  39.263 1.00 10.65 ? 74   VAL C CG1   1 
ATOM   7429  C  CG2   . VAL D 2 73  ? -3.801  30.775  41.126 1.00 12.42 ? 74   VAL C CG2   1 
ATOM   7430  N  N     . MET D 2 74  ? -1.661  32.376  37.481 1.00 12.28 ? 75   MET C N     1 
ATOM   7431  C  CA    . MET D 2 74  ? -1.414  33.214  36.319 1.00 12.89 ? 75   MET C CA    1 
ATOM   7432  C  C     . MET D 2 74  ? -1.054  32.384  35.086 1.00 12.98 ? 75   MET C C     1 
ATOM   7433  O  O     . MET D 2 74  ? -1.615  32.582  34.013 1.00 12.73 ? 75   MET C O     1 
ATOM   7434  C  CB    . MET D 2 74  ? -0.259  34.162  36.625 1.00 15.21 ? 75   MET C CB    1 
ATOM   7435  C  CG    . MET D 2 74  ? -0.297  35.482  35.870 1.00 17.02 ? 75   MET C CG    1 
ATOM   7436  S  SD    . MET D 2 74  ? 1.207   36.439  36.095 1.00 19.88 ? 75   MET C SD    1 
ATOM   7437  C  CE    . MET D 2 74  ? 1.677   36.033  37.773 1.00 21.89 ? 75   MET C CE    1 
ATOM   7438  N  N     . GLY D 2 75  ? -0.122  31.444  35.260 1.00 11.65 ? 76   GLY C N     1 
ATOM   7439  C  CA    . GLY D 2 75  ? 0.349   30.602  34.173 1.00 10.95 ? 76   GLY C CA    1 
ATOM   7440  C  C     . GLY D 2 75  ? -0.640  29.558  33.691 1.00 10.92 ? 76   GLY C C     1 
ATOM   7441  O  O     . GLY D 2 75  ? -0.827  29.375  32.490 1.00 11.01 ? 76   GLY C O     1 
ATOM   7442  N  N     . LYS D 2 76  ? -1.298  28.916  34.603 1.00 10.69 ? 77   LYS C N     1 
ATOM   7443  C  CA    . LYS D 2 76  ? -2.235  27.892  34.271 1.00 10.69 ? 77   LYS C CA    1 
ATOM   7444  C  C     . LYS D 2 76  ? -3.645  28.322  33.883 1.00 10.83 ? 77   LYS C C     1 
ATOM   7445  O  O     . LYS D 2 76  ? -4.229  27.803  32.995 1.00 11.43 ? 77   LYS C O     1 
ATOM   7446  C  CB    . LYS D 2 76  ? -2.343  26.922  35.422 1.00 12.08 ? 77   LYS C CB    1 
ATOM   7447  C  CG    . LYS D 2 76  ? -1.284  25.861  35.497 1.00 11.88 ? 77   LYS C CG    1 
ATOM   7448  C  CD    . LYS D 2 76  ? -1.227  25.233  36.866 1.00 11.48 ? 77   LYS C CD    1 
ATOM   7449  C  CE    . LYS D 2 76  ? -0.821  23.789  36.731 1.00 11.46 ? 77   LYS C CE    1 
ATOM   7450  N  NZ    . LYS D 2 76  ? -0.424  23.126  37.979 1.00 11.03 ? 77   LYS C NZ    1 
ATOM   7451  N  N     . TYR D 2 77  ? -4.219  29.284  34.601 1.00 10.98 ? 78   TYR C N     1 
ATOM   7452  C  CA    . TYR D 2 77  ? -5.596  29.696  34.342 1.00 11.72 ? 78   TYR C CA    1 
ATOM   7453  C  C     . TYR D 2 77  ? -5.884  31.169  34.056 1.00 11.55 ? 78   TYR C C     1 
ATOM   7454  O  O     . TYR D 2 77  ? -6.715  31.486  33.222 1.00 11.28 ? 78   TYR C O     1 
ATOM   7455  C  CB    . TYR D 2 77  ? -6.488  29.249  35.502 1.00 11.99 ? 78   TYR C CB    1 
ATOM   7456  C  CG    . TYR D 2 77  ? -6.066  27.946  36.119 1.00 12.64 ? 78   TYR C CG    1 
ATOM   7457  C  CD1   . TYR D 2 77  ? -6.349  26.742  35.505 1.00 12.54 ? 78   TYR C CD1   1 
ATOM   7458  C  CD2   . TYR D 2 77  ? -5.375  27.920  37.322 1.00 13.05 ? 78   TYR C CD2   1 
ATOM   7459  C  CE1   . TYR D 2 77  ? -5.962  25.552  36.058 1.00 13.04 ? 78   TYR C CE1   1 
ATOM   7460  C  CE2   . TYR D 2 77  ? -4.990  26.735  37.891 1.00 13.42 ? 78   TYR C CE2   1 
ATOM   7461  C  CZ    . TYR D 2 77  ? -5.284  25.548  37.254 1.00 14.07 ? 78   TYR C CZ    1 
ATOM   7462  O  OH    . TYR D 2 77  ? -4.897  24.350  37.810 1.00 14.10 ? 78   TYR C OH    1 
ATOM   7463  N  N     . HIS D 2 78  ? -5.201  32.058  34.762 1.00 10.55 ? 79   HIS C N     1 
ATOM   7464  C  CA    . HIS D 2 78  ? -5.404  33.505  34.623 1.00 10.12 ? 79   HIS C CA    1 
ATOM   7465  C  C     . HIS D 2 78  ? -4.337  34.261  33.803 1.00 10.16 ? 79   HIS C C     1 
ATOM   7466  O  O     . HIS D 2 78  ? -3.292  34.647  34.298 1.00 11.07 ? 79   HIS C O     1 
ATOM   7467  C  CB    . HIS D 2 78  ? -5.616  34.133  36.000 1.00 9.40  ? 79   HIS C CB    1 
ATOM   7468  C  CG    . HIS D 2 78  ? -6.553  35.299  35.992 1.00 9.44  ? 79   HIS C CG    1 
ATOM   7469  N  ND1   . HIS D 2 78  ? -7.890  35.175  35.676 1.00 8.87  ? 79   HIS C ND1   1 
ATOM   7470  C  CD2   . HIS D 2 78  ? -6.347  36.610  36.258 1.00 9.30  ? 79   HIS C CD2   1 
ATOM   7471  C  CE1   . HIS D 2 78  ? -8.468  36.358  35.750 1.00 8.86  ? 79   HIS C CE1   1 
ATOM   7472  N  NE2   . HIS D 2 78  ? -7.552  37.246  36.102 1.00 9.53  ? 79   HIS C NE2   1 
ATOM   7473  N  N     . PRO D 2 79  ? -4.712  34.458  32.468 1.00 10.78 ? 80   PRO C N     1 
ATOM   7474  C  CA    . PRO D 2 79  ? -3.717  35.129  31.605 1.00 10.68 ? 80   PRO C CA    1 
ATOM   7475  C  C     . PRO D 2 79  ? -3.728  36.642  31.765 1.00 10.96 ? 80   PRO C C     1 
ATOM   7476  O  O     . PRO D 2 79  ? -3.895  37.369  30.793 1.00 10.79 ? 80   PRO C O     1 
ATOM   7477  C  CB    . PRO D 2 79  ? -4.162  34.736  30.184 1.00 10.37 ? 80   PRO C CB    1 
ATOM   7478  C  CG    . PRO D 2 79  ? -5.653  34.561  30.299 1.00 10.23 ? 80   PRO C CG    1 
ATOM   7479  C  CD    . PRO D 2 79  ? -5.937  34.089  31.712 1.00 10.28 ? 80   PRO C CD    1 
ATOM   7480  N  N     . HIS D 2 80  ? -3.540  37.116  32.987 1.00 11.65 ? 81   HIS C N     1 
ATOM   7481  C  CA    . HIS D 2 80  ? -3.566  38.553  33.252 1.00 11.95 ? 81   HIS C CA    1 
ATOM   7482  C  C     . HIS D 2 80  ? -2.495  38.966  34.257 1.00 11.73 ? 81   HIS C C     1 
ATOM   7483  O  O     . HIS D 2 80  ? -1.686  38.142  34.685 1.00 12.94 ? 81   HIS C O     1 
ATOM   7484  C  CB    . HIS D 2 80  ? -4.967  38.992  33.707 1.00 11.74 ? 81   HIS C CB    1 
ATOM   7485  C  CG    . HIS D 2 80  ? -6.057  38.647  32.737 1.00 11.72 ? 81   HIS C CG    1 
ATOM   7486  N  ND1   . HIS D 2 80  ? -6.319  39.405  31.609 1.00 11.73 ? 81   HIS C ND1   1 
ATOM   7487  C  CD2   . HIS D 2 80  ? -6.951  37.635  32.726 1.00 11.71 ? 81   HIS C CD2   1 
ATOM   7488  C  CE1   . HIS D 2 80  ? -7.322  38.866  30.939 1.00 11.51 ? 81   HIS C CE1   1 
ATOM   7489  N  NE2   . HIS D 2 80  ? -7.731  37.795  31.599 1.00 12.15 ? 81   HIS C NE2   1 
ATOM   7490  N  N     . GLY D 2 81  ? -2.490  40.253  34.608 1.00 11.73 ? 82   GLY C N     1 
ATOM   7491  C  CA    . GLY D 2 81  ? -1.523  40.824  35.546 1.00 11.48 ? 82   GLY C CA    1 
ATOM   7492  C  C     . GLY D 2 81  ? -1.503  40.148  36.902 1.00 11.88 ? 82   GLY C C     1 
ATOM   7493  O  O     . GLY D 2 81  ? -2.557  39.844  37.473 1.00 11.19 ? 82   GLY C O     1 
ATOM   7494  N  N     . ASP D 2 82  ? -0.298  39.941  37.424 1.00 12.48 ? 83   ASP C N     1 
ATOM   7495  C  CA    . ASP D 2 82  ? -0.095  39.321  38.723 1.00 12.89 ? 83   ASP C CA    1 
ATOM   7496  C  C     . ASP D 2 82  ? -0.607  40.173  39.880 1.00 13.13 ? 83   ASP C C     1 
ATOM   7497  O  O     . ASP D 2 82  ? -1.008  39.637  40.906 1.00 13.66 ? 83   ASP C O     1 
ATOM   7498  C  CB    . ASP D 2 82  ? 1.379   38.959  38.933 1.00 14.69 ? 83   ASP C CB    1 
ATOM   7499  C  CG    . ASP D 2 82  ? 2.305   40.154  38.797 1.00 16.47 ? 83   ASP C CG    1 
ATOM   7500  O  OD1   . ASP D 2 82  ? 2.404   40.705  37.672 1.00 18.02 ? 83   ASP C OD1   1 
ATOM   7501  O  OD2   . ASP D 2 82  ? 2.931   40.548  39.795 1.00 14.75 ? 83   ASP C OD2   1 
ATOM   7502  N  N     . SER D 2 83  ? -0.599  41.488  39.715 1.00 12.93 ? 84   SER C N     1 
ATOM   7503  C  CA    . SER D 2 83  ? -1.071  42.400  40.765 1.00 12.71 ? 84   SER C CA    1 
ATOM   7504  C  C     . SER D 2 83  ? -2.575  42.288  40.981 1.00 12.29 ? 84   SER C C     1 
ATOM   7505  O  O     . SER D 2 83  ? -3.054  42.450  42.088 1.00 12.28 ? 84   SER C O     1 
ATOM   7506  C  CB    . SER D 2 83  ? -0.665  43.847  40.460 1.00 12.56 ? 84   SER C CB    1 
ATOM   7507  O  OG    . SER D 2 83  ? -1.282  44.315  39.261 1.00 14.88 ? 84   SER C OG    1 
ATOM   7508  N  N     . SER D 2 84  ? -3.307  42.006  39.916 1.00 11.62 ? 85   SER C N     1 
ATOM   7509  C  CA    . SER D 2 84  ? -4.762  41.827  39.980 1.00 11.43 ? 85   SER C CA    1 
ATOM   7510  C  C     . SER D 2 84  ? -5.115  40.544  40.716 1.00 12.21 ? 85   SER C C     1 
ATOM   7511  O  O     . SER D 2 84  ? -6.028  40.533  41.553 1.00 13.30 ? 85   SER C O     1 
ATOM   7512  C  CB    . SER D 2 84  ? -5.399  41.832  38.579 1.00 11.78 ? 85   SER C CB    1 
ATOM   7513  O  OG    . SER D 2 84  ? -5.441  43.147  38.035 1.00 11.03 ? 85   SER C OG    1 
ATOM   7514  N  N     . ILE D 2 85  ? -4.380  39.478  40.405 1.00 12.39 ? 86   ILE C N     1 
ATOM   7515  C  CA    . ILE D 2 85  ? -4.573  38.164  41.032 1.00 12.27 ? 86   ILE C CA    1 
ATOM   7516  C  C     . ILE D 2 85  ? -4.285  38.243  42.525 1.00 12.28 ? 86   ILE C C     1 
ATOM   7517  O  O     . ILE D 2 85  ? -5.107  37.847  43.350 1.00 12.16 ? 86   ILE C O     1 
ATOM   7518  C  CB    . ILE D 2 85  ? -3.668  37.076  40.382 1.00 12.08 ? 86   ILE C CB    1 
ATOM   7519  C  CG1   . ILE D 2 85  ? -3.886  37.039  38.866 1.00 11.81 ? 86   ILE C CG1   1 
ATOM   7520  C  CG2   . ILE D 2 85  ? -3.909  35.700  41.034 1.00 11.37 ? 86   ILE C CG2   1 
ATOM   7521  C  CD1   . ILE D 2 85  ? -3.056  36.024  38.142 1.00 11.51 ? 86   ILE C CD1   1 
ATOM   7522  N  N     . TYR D 2 86  ? -3.108  38.768  42.859 1.00 12.52 ? 87   TYR C N     1 
ATOM   7523  C  CA    . TYR D 2 86  ? -2.699  38.894  44.249 1.00 11.40 ? 87   TYR C CA    1 
ATOM   7524  C  C     . TYR D 2 86  ? -3.669  39.746  45.062 1.00 11.67 ? 87   TYR C C     1 
ATOM   7525  O  O     . TYR D 2 86  ? -4.036  39.365  46.178 1.00 12.81 ? 87   TYR C O     1 
ATOM   7526  C  CB    . TYR D 2 86  ? -1.262  39.413  44.348 1.00 10.59 ? 87   TYR C CB    1 
ATOM   7527  C  CG    . TYR D 2 86  ? -0.750  39.527  45.765 1.00 10.60 ? 87   TYR C CG    1 
ATOM   7528  C  CD1   . TYR D 2 86  ? -0.677  38.391  46.591 1.00 10.67 ? 87   TYR C CD1   1 
ATOM   7529  C  CD2   . TYR D 2 86  ? -0.328  40.749  46.284 1.00 10.01 ? 87   TYR C CD2   1 
ATOM   7530  C  CE1   . TYR D 2 86  ? -0.216  38.485  47.894 1.00 10.44 ? 87   TYR C CE1   1 
ATOM   7531  C  CE2   . TYR D 2 86  ? 0.147   40.849  47.581 1.00 9.93  ? 87   TYR C CE2   1 
ATOM   7532  C  CZ    . TYR D 2 86  ? 0.198   39.713  48.383 1.00 10.06 ? 87   TYR C CZ    1 
ATOM   7533  O  OH    . TYR D 2 86  ? 0.656   39.804  49.672 1.00 9.17  ? 87   TYR C OH    1 
ATOM   7534  N  N     . GLU D 2 87  ? -4.104  40.874  44.503 1.00 12.03 ? 88   GLU C N     1 
ATOM   7535  C  CA    . GLU D 2 87  ? -5.025  41.775  45.213 1.00 12.74 ? 88   GLU C CA    1 
ATOM   7536  C  C     . GLU D 2 87  ? -6.411  41.169  45.452 1.00 12.72 ? 88   GLU C C     1 
ATOM   7537  O  O     . GLU D 2 87  ? -7.043  41.453  46.472 1.00 12.14 ? 88   GLU C O     1 
ATOM   7538  C  CB    . GLU D 2 87  ? -5.106  43.146  44.540 1.00 13.00 ? 88   GLU C CB    1 
ATOM   7539  C  CG    . GLU D 2 87  ? -3.791  43.917  44.608 1.00 14.55 ? 88   GLU C CG    1 
ATOM   7540  C  CD    . GLU D 2 87  ? -3.841  45.291  43.956 1.00 15.66 ? 88   GLU C CD    1 
ATOM   7541  O  OE1   . GLU D 2 87  ? -2.742  45.891  43.823 1.00 16.60 ? 88   GLU C OE1   1 
ATOM   7542  O  OE2   . GLU D 2 87  ? -4.956  45.766  43.581 1.00 17.22 ? 88   GLU C OE2   1 
ATOM   7543  N  N     . ALA D 2 88  ? -6.859  40.330  44.520 1.00 11.64 ? 89   ALA C N     1 
ATOM   7544  C  CA    . ALA D 2 88  ? -8.127  39.612  44.653 1.00 12.04 ? 89   ALA C CA    1 
ATOM   7545  C  C     . ALA D 2 88  ? -8.019  38.556  45.759 1.00 12.93 ? 89   ALA C C     1 
ATOM   7546  O  O     . ALA D 2 88  ? -8.945  38.401  46.559 1.00 13.58 ? 89   ALA C O     1 
ATOM   7547  C  CB    . ALA D 2 88  ? -8.534  38.976  43.333 1.00 10.93 ? 89   ALA C CB    1 
ATOM   7548  N  N     . MET D 2 89  ? -6.886  37.848  45.808 1.00 13.14 ? 90   MET C N     1 
ATOM   7549  C  CA    . MET D 2 89  ? -6.649  36.852  46.848 1.00 14.25 ? 90   MET C CA    1 
ATOM   7550  C  C     . MET D 2 89  ? -6.602  37.503  48.234 1.00 14.42 ? 90   MET C C     1 
ATOM   7551  O  O     . MET D 2 89  ? -7.154  36.964  49.194 1.00 13.38 ? 90   MET C O     1 
ATOM   7552  C  CB    . MET D 2 89  ? -5.348  36.090  46.600 1.00 16.57 ? 90   MET C CB    1 
ATOM   7553  C  CG    . MET D 2 89  ? -5.135  34.929  47.571 1.00 17.79 ? 90   MET C CG    1 
ATOM   7554  S  SD    . MET D 2 89  ? -3.506  34.166  47.445 1.00 19.48 ? 90   MET C SD    1 
ATOM   7555  C  CE    . MET D 2 89  ? -2.473  35.451  48.138 1.00 17.76 ? 90   MET C CE    1 
ATOM   7556  N  N     . VAL D 2 90  ? -5.939  38.656  48.324 1.00 14.33 ? 91   VAL C N     1 
ATOM   7557  C  CA    . VAL D 2 90  ? -5.818  39.401  49.576 1.00 15.03 ? 91   VAL C CA    1 
ATOM   7558  C  C     . VAL D 2 90  ? -7.191  39.823  50.104 1.00 14.86 ? 91   VAL C C     1 
ATOM   7559  O  O     . VAL D 2 90  ? -7.491  39.649  51.290 1.00 12.74 ? 91   VAL C O     1 
ATOM   7560  C  CB    . VAL D 2 90  ? -4.891  40.643  49.429 1.00 15.58 ? 91   VAL C CB    1 
ATOM   7561  C  CG1   . VAL D 2 90  ? -5.060  41.609  50.601 1.00 15.32 ? 91   VAL C CG1   1 
ATOM   7562  C  CG2   . VAL D 2 90  ? -3.432  40.216  49.273 1.00 15.61 ? 91   VAL C CG2   1 
ATOM   7563  N  N     . ARG D 2 91  ? -8.022  40.354  49.213 1.00 15.20 ? 92   ARG C N     1 
ATOM   7564  C  CA    . ARG D 2 91  ? -9.364  40.783  49.590 1.00 16.23 ? 92   ARG C CA    1 
ATOM   7565  C  C     . ARG D 2 91  ? -10.168 39.628  50.217 1.00 16.13 ? 92   ARG C C     1 
ATOM   7566  O  O     . ARG D 2 91  ? -10.889 39.831  51.196 1.00 17.51 ? 92   ARG C O     1 
ATOM   7567  C  CB    . ARG D 2 91  ? -10.103 41.433  48.408 1.00 16.91 ? 92   ARG C CB    1 
ATOM   7568  C  CG    . ARG D 2 91  ? -11.478 41.916  48.796 1.00 19.70 ? 92   ARG C CG    1 
ATOM   7569  C  CD    . ARG D 2 91  ? -12.180 42.784  47.755 1.00 22.41 ? 92   ARG C CD    1 
ATOM   7570  N  NE    . ARG D 2 91  ? -13.514 43.113  48.284 1.00 22.64 ? 92   ARG C NE    1 
ATOM   7571  C  CZ    . ARG D 2 91  ? -14.618 42.430  47.992 1.00 24.28 ? 92   ARG C CZ    1 
ATOM   7572  N  NH1   . ARG D 2 91  ? -14.567 41.405  47.132 1.00 24.19 ? 92   ARG C NH1   1 
ATOM   7573  N  NH2   . ARG D 2 91  ? -15.778 42.767  48.560 1.00 25.05 ? 92   ARG C NH2   1 
ATOM   7574  N  N     . MET D 2 92  ? -10.003 38.421  49.677 1.00 15.18 ? 93   MET C N     1 
ATOM   7575  C  CA    . MET D 2 92  ? -10.689 37.222  50.182 1.00 14.19 ? 93   MET C CA    1 
ATOM   7576  C  C     . MET D 2 92  ? -10.256 36.802  51.592 1.00 14.53 ? 93   MET C C     1 
ATOM   7577  O  O     . MET D 2 92  ? -10.956 36.019  52.250 1.00 15.70 ? 93   MET C O     1 
ATOM   7578  C  CB    . MET D 2 92  ? -10.512 36.041  49.215 1.00 14.01 ? 93   MET C CB    1 
ATOM   7579  C  CG    . MET D 2 92  ? -11.192 36.220  47.870 1.00 13.67 ? 93   MET C CG    1 
ATOM   7580  S  SD    . MET D 2 92  ? -11.240 34.699  46.901 1.00 13.97 ? 93   MET C SD    1 
ATOM   7581  C  CE    . MET D 2 92  ? -9.529  34.538  46.367 1.00 12.48 ? 93   MET C CE    1 
ATOM   7582  N  N     . ALA D 2 93  ? -9.116  37.325  52.045 1.00 13.68 ? 94   ALA C N     1 
ATOM   7583  C  CA    . ALA D 2 93  ? -8.568  37.024  53.380 1.00 12.09 ? 94   ALA C CA    1 
ATOM   7584  C  C     . ALA D 2 93  ? -8.923  38.064  54.448 1.00 11.67 ? 94   ALA C C     1 
ATOM   7585  O  O     . ALA D 2 93  ? -8.691  37.843  55.634 1.00 12.51 ? 94   ALA C O     1 
ATOM   7586  C  CB    . ALA D 2 93  ? -7.051  36.876  53.293 1.00 11.92 ? 94   ALA C CB    1 
ATOM   7587  N  N     . GLN D 2 94  ? -9.477  39.191  54.019 1.00 11.01 ? 95   GLN C N     1 
ATOM   7588  C  CA    . GLN D 2 94  ? -9.801  40.302  54.915 1.00 10.32 ? 95   GLN C CA    1 
ATOM   7589  C  C     . GLN D 2 94  ? -11.167 40.142  55.585 1.00 10.62 ? 95   GLN C C     1 
ATOM   7590  O  O     . GLN D 2 94  ? -12.207 40.107  54.897 1.00 11.34 ? 95   GLN C O     1 
ATOM   7591  C  CB    . GLN D 2 94  ? -9.731  41.624  54.148 1.00 9.15  ? 95   GLN C CB    1 
ATOM   7592  C  CG    . GLN D 2 94  ? -8.363  41.971  53.611 1.00 8.19  ? 95   GLN C CG    1 
ATOM   7593  C  CD    . GLN D 2 94  ? -8.369  43.228  52.743 1.00 8.43  ? 95   GLN C CD    1 
ATOM   7594  O  OE1   . GLN D 2 94  ? -9.390  43.584  52.133 1.00 7.65  ? 95   GLN C OE1   1 
ATOM   7595  N  NE2   . GLN D 2 94  ? -7.221  43.906  52.681 1.00 8.62  ? 95   GLN C NE2   1 
ATOM   7596  N  N     . ASP D 2 95  ? -11.167 40.070  56.912 1.00 10.50 ? 96   ASP C N     1 
ATOM   7597  C  CA    . ASP D 2 95  ? -12.417 39.868  57.671 1.00 10.68 ? 96   ASP C CA    1 
ATOM   7598  C  C     . ASP D 2 95  ? -13.330 41.095  57.697 1.00 10.44 ? 96   ASP C C     1 
ATOM   7599  O  O     . ASP D 2 95  ? -14.426 41.036  58.232 1.00 10.13 ? 96   ASP C O     1 
ATOM   7600  C  CB    . ASP D 2 95  ? -12.163 39.315  59.092 1.00 11.32 ? 96   ASP C CB    1 
ATOM   7601  C  CG    . ASP D 2 95  ? -11.425 40.289  60.003 1.00 12.59 ? 96   ASP C CG    1 
ATOM   7602  O  OD1   . ASP D 2 95  ? -10.972 41.375  59.570 1.00 12.73 ? 96   ASP C OD1   1 
ATOM   7603  O  OD2   . ASP D 2 95  ? -11.316 39.949  61.195 1.00 15.62 ? 96   ASP C OD2   1 
ATOM   7604  N  N     . PHE D 2 96  ? -12.861 42.198  57.112 1.00 10.71 ? 97   PHE C N     1 
ATOM   7605  C  CA    . PHE D 2 96  ? -13.659 43.421  56.992 1.00 10.86 ? 97   PHE C CA    1 
ATOM   7606  C  C     . PHE D 2 96  ? -14.270 43.580  55.586 1.00 10.51 ? 97   PHE C C     1 
ATOM   7607  O  O     . PHE D 2 96  ? -15.146 44.425  55.389 1.00 9.86  ? 97   PHE C O     1 
ATOM   7608  C  CB    . PHE D 2 96  ? -12.861 44.667  57.422 1.00 10.99 ? 97   PHE C CB    1 
ATOM   7609  C  CG    . PHE D 2 96  ? -11.521 44.797  56.759 1.00 11.36 ? 97   PHE C CG    1 
ATOM   7610  C  CD1   . PHE D 2 96  ? -10.392 44.176  57.311 1.00 11.77 ? 97   PHE C CD1   1 
ATOM   7611  C  CD2   . PHE D 2 96  ? -11.376 45.534  55.586 1.00 11.73 ? 97   PHE C CD2   1 
ATOM   7612  C  CE1   . PHE D 2 96  ? -9.145  44.282  56.692 1.00 11.40 ? 97   PHE C CE1   1 
ATOM   7613  C  CE2   . PHE D 2 96  ? -10.123 45.650  54.967 1.00 11.62 ? 97   PHE C CE2   1 
ATOM   7614  C  CZ    . PHE D 2 96  ? -9.010  45.023  55.519 1.00 11.14 ? 97   PHE C CZ    1 
ATOM   7615  N  N     . SER D 2 97  ? -13.820 42.748  54.637 1.00 10.47 ? 98   SER C N     1 
ATOM   7616  C  CA    . SER D 2 97  ? -14.321 42.780  53.244 1.00 10.27 ? 98   SER C CA    1 
ATOM   7617  C  C     . SER D 2 97  ? -15.193 41.571  52.939 1.00 9.87  ? 98   SER C C     1 
ATOM   7618  O  O     . SER D 2 97  ? -16.172 41.669  52.210 1.00 9.20  ? 98   SER C O     1 
ATOM   7619  C  CB    . SER D 2 97  ? -13.156 42.813  52.241 1.00 10.77 ? 98   SER C CB    1 
ATOM   7620  O  OG    . SER D 2 97  ? -12.260 43.884  52.495 1.00 11.76 ? 98   SER C OG    1 
ATOM   7621  N  N     . TYR D 2 98  ? -14.823 40.439  53.516 1.00 10.60 ? 99   TYR C N     1 
ATOM   7622  C  CA    . TYR D 2 98  ? -15.559 39.193  53.333 1.00 10.10 ? 99   TYR C CA    1 
ATOM   7623  C  C     . TYR D 2 98  ? -16.261 38.728  54.603 1.00 9.98  ? 99   TYR C C     1 
ATOM   7624  O  O     . TYR D 2 98  ? -15.620 38.441  55.602 1.00 10.05 ? 99   TYR C O     1 
ATOM   7625  C  CB    . TYR D 2 98  ? -14.644 38.093  52.800 1.00 9.90  ? 99   TYR C CB    1 
ATOM   7626  C  CG    . TYR D 2 98  ? -14.538 38.073  51.303 1.00 10.43 ? 99   TYR C CG    1 
ATOM   7627  C  CD1   . TYR D 2 98  ? -13.877 39.085  50.618 1.00 10.41 ? 99   TYR C CD1   1 
ATOM   7628  C  CD2   . TYR D 2 98  ? -15.110 37.051  50.562 1.00 10.17 ? 99   TYR C CD2   1 
ATOM   7629  C  CE1   . TYR D 2 98  ? -13.788 39.073  49.247 1.00 10.46 ? 99   TYR C CE1   1 
ATOM   7630  C  CE2   . TYR D 2 98  ? -15.024 37.041  49.190 1.00 10.29 ? 99   TYR C CE2   1 
ATOM   7631  C  CZ    . TYR D 2 98  ? -14.355 38.047  48.545 1.00 10.61 ? 99   TYR C CZ    1 
ATOM   7632  O  OH    . TYR D 2 98  ? -14.271 38.022  47.178 1.00 12.14 ? 99   TYR C OH    1 
ATOM   7633  N  N     . ARG D 2 99  ? -17.590 38.653  54.538 1.00 10.06 ? 100  ARG C N     1 
ATOM   7634  C  CA    . ARG D 2 99  ? -18.437 38.202  55.635 1.00 9.99  ? 100  ARG C CA    1 
ATOM   7635  C  C     . ARG D 2 99  ? -17.994 36.814  56.099 1.00 9.79  ? 100  ARG C C     1 
ATOM   7636  O  O     . ARG D 2 99  ? -18.011 36.516  57.280 1.00 9.77  ? 100  ARG C O     1 
ATOM   7637  C  CB    . ARG D 2 99  ? -19.907 38.194  55.187 1.00 10.70 ? 100  ARG C CB    1 
ATOM   7638  C  CG    . ARG D 2 99  ? -20.919 37.887  56.277 1.00 11.32 ? 100  ARG C CG    1 
ATOM   7639  C  CD    . ARG D 2 99  ? -20.804 38.873  57.420 1.00 12.74 ? 100  ARG C CD    1 
ATOM   7640  N  NE    . ARG D 2 99  ? -21.703 38.552  58.516 1.00 13.24 ? 100  ARG C NE    1 
ATOM   7641  C  CZ    . ARG D 2 99  ? -21.490 37.592  59.405 1.00 14.27 ? 100  ARG C CZ    1 
ATOM   7642  N  NH1   . ARG D 2 99  ? -20.403 36.842  59.324 1.00 14.17 ? 100  ARG C NH1   1 
ATOM   7643  N  NH2   . ARG D 2 99  ? -22.361 37.379  60.368 1.00 12.36 ? 100  ARG C NH2   1 
ATOM   7644  N  N     . TYR D 2 100 ? -17.576 35.994  55.146 1.00 9.64  ? 101  TYR C N     1 
ATOM   7645  C  CA    . TYR D 2 100 ? -17.064 34.660  55.405 1.00 9.98  ? 101  TYR C CA    1 
ATOM   7646  C  C     . TYR D 2 100 ? -15.773 34.519  54.616 1.00 9.79  ? 101  TYR C C     1 
ATOM   7647  O  O     . TYR D 2 100 ? -15.774 34.035  53.492 1.00 10.97 ? 101  TYR C O     1 
ATOM   7648  C  CB    . TYR D 2 100 ? -18.104 33.589  55.062 1.00 9.92  ? 101  TYR C CB    1 
ATOM   7649  C  CG    . TYR D 2 100 ? -19.368 33.783  55.864 1.00 9.62  ? 101  TYR C CG    1 
ATOM   7650  C  CD1   . TYR D 2 100 ? -19.453 33.328  57.177 1.00 9.18  ? 101  TYR C CD1   1 
ATOM   7651  C  CD2   . TYR D 2 100 ? -20.457 34.467  55.337 1.00 9.01  ? 101  TYR C CD2   1 
ATOM   7652  C  CE1   . TYR D 2 100 ? -20.584 33.536  57.930 1.00 8.63  ? 101  TYR C CE1   1 
ATOM   7653  C  CE2   . TYR D 2 100 ? -21.592 34.675  56.083 1.00 8.38  ? 101  TYR C CE2   1 
ATOM   7654  C  CZ    . TYR D 2 100 ? -21.652 34.213  57.378 1.00 8.74  ? 101  TYR C CZ    1 
ATOM   7655  O  OH    . TYR D 2 100 ? -22.782 34.412  58.132 1.00 8.71  ? 101  TYR C OH    1 
ATOM   7656  N  N     . PRO D 2 101 ? -14.630 34.994  55.250 1.00 9.53  ? 102  PRO C N     1 
ATOM   7657  C  CA    . PRO D 2 101 ? -13.384 34.889  54.458 1.00 9.19  ? 102  PRO C CA    1 
ATOM   7658  C  C     . PRO D 2 101 ? -13.119 33.573  53.739 1.00 9.84  ? 102  PRO C C     1 
ATOM   7659  O  O     . PRO D 2 101 ? -13.416 32.508  54.254 1.00 10.84 ? 102  PRO C O     1 
ATOM   7660  C  CB    . PRO D 2 101 ? -12.292 35.123  55.498 1.00 8.71  ? 102  PRO C CB    1 
ATOM   7661  C  CG    . PRO D 2 101 ? -12.881 36.133  56.389 1.00 9.04  ? 102  PRO C CG    1 
ATOM   7662  C  CD    . PRO D 2 101 ? -14.279 35.629  56.595 1.00 8.93  ? 102  PRO C CD    1 
ATOM   7663  N  N     . LEU D 2 102 ? -12.541 33.664  52.547 1.00 9.82  ? 103  LEU C N     1 
ATOM   7664  C  CA    . LEU D 2 102 ? -12.250 32.477  51.738 1.00 10.29 ? 103  LEU C CA    1 
ATOM   7665  C  C     . LEU D 2 102 ? -10.759 32.132  51.719 1.00 10.39 ? 103  LEU C C     1 
ATOM   7666  O  O     . LEU D 2 102 ? -10.374 31.023  51.350 1.00 9.57  ? 103  LEU C O     1 
ATOM   7667  C  CB    . LEU D 2 102 ? -12.787 32.661  50.311 1.00 9.66  ? 103  LEU C CB    1 
ATOM   7668  C  CG    . LEU D 2 102 ? -14.285 32.939  50.185 1.00 9.60  ? 103  LEU C CG    1 
ATOM   7669  C  CD1   . LEU D 2 102 ? -14.674 33.229  48.766 1.00 9.02  ? 103  LEU C CD1   1 
ATOM   7670  C  CD2   . LEU D 2 102 ? -15.125 31.790  50.741 1.00 9.60  ? 103  LEU C CD2   1 
ATOM   7671  N  N     . VAL D 2 103 ? -9.932  33.094  52.111 1.00 10.60 ? 104  VAL C N     1 
ATOM   7672  C  CA    . VAL D 2 103 ? -8.494  32.888  52.165 1.00 10.74 ? 104  VAL C CA    1 
ATOM   7673  C  C     . VAL D 2 103 ? -7.985  33.136  53.583 1.00 11.01 ? 104  VAL C C     1 
ATOM   7674  O  O     . VAL D 2 103 ? -8.332  34.124  54.215 1.00 12.18 ? 104  VAL C O     1 
ATOM   7675  C  CB    . VAL D 2 103 ? -7.743  33.751  51.114 1.00 10.61 ? 104  VAL C CB    1 
ATOM   7676  C  CG1   . VAL D 2 103 ? -6.237  33.696  51.326 1.00 10.86 ? 104  VAL C CG1   1 
ATOM   7677  C  CG2   . VAL D 2 103 ? -8.085  33.285  49.701 1.00 10.09 ? 104  VAL C CG2   1 
ATOM   7678  N  N     . ASP D 2 104 ? -7.209  32.186  54.087 1.00 11.68 ? 105  ASP C N     1 
ATOM   7679  C  CA    . ASP D 2 104 ? -6.585  32.269  55.397 1.00 12.11 ? 105  ASP C CA    1 
ATOM   7680  C  C     . ASP D 2 104 ? -5.158  32.729  55.128 1.00 12.16 ? 105  ASP C C     1 
ATOM   7681  O  O     . ASP D 2 104 ? -4.344  31.966  54.609 1.00 11.73 ? 105  ASP C O     1 
ATOM   7682  C  CB    . ASP D 2 104 ? -6.620  30.893  56.081 1.00 12.35 ? 105  ASP C CB    1 
ATOM   7683  C  CG    . ASP D 2 104 ? -5.841  30.851  57.377 1.00 13.19 ? 105  ASP C CG    1 
ATOM   7684  O  OD1   . ASP D 2 104 ? -5.390  31.917  57.853 1.00 16.41 ? 105  ASP C OD1   1 
ATOM   7685  O  OD2   . ASP D 2 104 ? -5.664  29.742  57.922 1.00 12.72 ? 105  ASP C OD2   1 
ATOM   7686  N  N     . GLY D 2 105 ? -4.861  33.978  55.469 1.00 13.43 ? 106  GLY C N     1 
ATOM   7687  C  CA    . GLY D 2 105 ? -3.544  34.540  55.196 1.00 13.59 ? 106  GLY C CA    1 
ATOM   7688  C  C     . GLY D 2 105 ? -2.631  34.754  56.384 1.00 14.52 ? 106  GLY C C     1 
ATOM   7689  O  O     . GLY D 2 105 ? -3.085  35.026  57.491 1.00 14.70 ? 106  GLY C O     1 
ATOM   7690  N  N     . GLN D 2 106 ? -1.329  34.617  56.139 1.00 16.07 ? 107  GLN C N     1 
ATOM   7691  C  CA    . GLN D 2 106 ? -0.316  34.859  57.156 1.00 17.04 ? 107  GLN C CA    1 
ATOM   7692  C  C     . GLN D 2 106 ? 0.559   36.020  56.705 1.00 16.35 ? 107  GLN C C     1 
ATOM   7693  O  O     . GLN D 2 106 ? 1.089   36.019  55.588 1.00 16.80 ? 107  GLN C O     1 
ATOM   7694  C  CB    . GLN D 2 106 ? 0.510   33.600  57.445 1.00 19.05 ? 107  GLN C CB    1 
ATOM   7695  C  CG    . GLN D 2 106 ? 1.666   33.823  58.423 1.00 22.93 ? 107  GLN C CG    1 
ATOM   7696  C  CD    . GLN D 2 106 ? 2.276   32.520  58.924 1.00 29.04 ? 107  GLN C CD    1 
ATOM   7697  O  OE1   . GLN D 2 106 ? 1.581   31.683  59.520 1.00 32.69 ? 107  GLN C OE1   1 
ATOM   7698  N  NE2   . GLN D 2 106 ? 3.575   32.345  58.724 1.00 29.53 ? 107  GLN C NE2   1 
ATOM   7699  N  N     . GLY D 2 107 ? 0.684   37.012  57.579 1.00 15.22 ? 108  GLY C N     1 
ATOM   7700  C  CA    . GLY D 2 107 ? 1.469   38.210  57.305 1.00 16.39 ? 108  GLY C CA    1 
ATOM   7701  C  C     . GLY D 2 107 ? 0.601   39.442  57.148 1.00 15.82 ? 108  GLY C C     1 
ATOM   7702  O  O     . GLY D 2 107 ? -0.563  39.451  57.547 1.00 16.94 ? 108  GLY C O     1 
ATOM   7703  N  N     . ASN D 2 108 ? 1.173   40.487  56.568 1.00 15.63 ? 109  ASN C N     1 
ATOM   7704  C  CA    . ASN D 2 108 ? 0.441   41.733  56.331 1.00 16.46 ? 109  ASN C CA    1 
ATOM   7705  C  C     . ASN D 2 108 ? -0.543  41.589  55.162 1.00 14.76 ? 109  ASN C C     1 
ATOM   7706  O  O     . ASN D 2 108 ? -0.128  41.435  54.014 1.00 13.81 ? 109  ASN C O     1 
ATOM   7707  C  CB    . ASN D 2 108 ? 1.431   42.887  56.089 1.00 16.73 ? 109  ASN C CB    1 
ATOM   7708  C  CG    . ASN D 2 108 ? 0.735   44.199  55.759 1.00 18.47 ? 109  ASN C CG    1 
ATOM   7709  O  OD1   . ASN D 2 108 ? -0.409  44.440  56.168 1.00 18.87 ? 109  ASN C OD1   1 
ATOM   7710  N  ND2   . ASN D 2 108 ? 1.423   45.062  55.014 1.00 19.09 ? 109  ASN C ND2   1 
ATOM   7711  N  N     . PHE D 2 109 ? -1.836  41.627  55.474 1.00 14.80 ? 110  PHE C N     1 
ATOM   7712  C  CA    . PHE D 2 109 ? -2.913  41.520  54.468 1.00 14.40 ? 110  PHE C CA    1 
ATOM   7713  C  C     . PHE D 2 109 ? -3.817  42.762  54.298 1.00 14.92 ? 110  PHE C C     1 
ATOM   7714  O  O     . PHE D 2 109 ? -4.936  42.663  53.785 1.00 15.95 ? 110  PHE C O     1 
ATOM   7715  C  CB    . PHE D 2 109 ? -3.734  40.235  54.671 1.00 14.37 ? 110  PHE C CB    1 
ATOM   7716  C  CG    . PHE D 2 109 ? -3.149  39.031  53.964 1.00 14.18 ? 110  PHE C CG    1 
ATOM   7717  C  CD1   . PHE D 2 109 ? -2.090  38.328  54.517 1.00 14.24 ? 110  PHE C CD1   1 
ATOM   7718  C  CD2   . PHE D 2 109 ? -3.664  38.612  52.740 1.00 14.02 ? 110  PHE C CD2   1 
ATOM   7719  C  CE1   . PHE D 2 109 ? -1.551  37.223  53.857 1.00 14.69 ? 110  PHE C CE1   1 
ATOM   7720  C  CE2   . PHE D 2 109 ? -3.126  37.515  52.073 1.00 13.86 ? 110  PHE C CE2   1 
ATOM   7721  C  CZ    . PHE D 2 109 ? -2.071  36.812  52.630 1.00 13.76 ? 110  PHE C CZ    1 
ATOM   7722  N  N     . GLY D 2 110 ? -3.319  43.932  54.710 1.00 14.91 ? 111  GLY C N     1 
ATOM   7723  C  CA    . GLY D 2 110 ? -4.065  45.183  54.576 1.00 14.29 ? 111  GLY C CA    1 
ATOM   7724  C  C     . GLY D 2 110 ? -4.909  45.549  55.778 1.00 16.16 ? 111  GLY C C     1 
ATOM   7725  O  O     . GLY D 2 110 ? -5.105  44.731  56.688 1.00 17.23 ? 111  GLY C O     1 
ATOM   7726  N  N     . SER D 2 111 ? -5.424  46.779  55.779 1.00 16.51 ? 112  SER C N     1 
ATOM   7727  C  CA    . SER D 2 111 ? -6.258  47.278  56.878 1.00 17.55 ? 112  SER C CA    1 
ATOM   7728  C  C     . SER D 2 111 ? -7.508  48.029  56.403 1.00 17.55 ? 112  SER C C     1 
ATOM   7729  O  O     . SER D 2 111 ? -7.698  48.246  55.201 1.00 17.57 ? 112  SER C O     1 
ATOM   7730  C  CB    . SER D 2 111 ? -5.434  48.184  57.796 1.00 16.78 ? 112  SER C CB    1 
ATOM   7731  O  OG    . SER D 2 111 ? -5.050  49.373  57.124 1.00 17.11 ? 112  SER C OG    1 
ATOM   7732  N  N     . MET D 2 112 ? -8.345  48.419  57.362 1.00 18.15 ? 113  MET C N     1 
ATOM   7733  C  CA    . MET D 2 112 ? -9.576  49.182  57.099 1.00 18.39 ? 113  MET C CA    1 
ATOM   7734  C  C     . MET D 2 112 ? -9.239  50.612  56.682 1.00 18.74 ? 113  MET C C     1 
ATOM   7735  O  O     . MET D 2 112 ? -10.103 51.333  56.181 1.00 18.92 ? 113  MET C O     1 
ATOM   7736  C  CB    . MET D 2 112 ? -10.468 49.234  58.358 1.00 19.76 ? 113  MET C CB    1 
ATOM   7737  C  CG    . MET D 2 112 ? -10.942 47.891  58.892 1.00 21.65 ? 113  MET C CG    1 
ATOM   7738  S  SD    . MET D 2 112 ? -12.021 48.103  60.337 1.00 25.13 ? 113  MET C SD    1 
ATOM   7739  C  CE    . MET D 2 112 ? -13.553 48.653  59.612 1.00 22.15 ? 113  MET C CE    1 
ATOM   7740  N  N     . ASP D 2 113 ? -7.989  51.013  56.910 1.00 18.66 ? 114  ASP C N     1 
ATOM   7741  C  CA    . ASP D 2 113 ? -7.503  52.348  56.562 1.00 20.52 ? 114  ASP C CA    1 
ATOM   7742  C  C     . ASP D 2 113 ? -7.018  52.463  55.113 1.00 22.16 ? 114  ASP C C     1 
ATOM   7743  O  O     . ASP D 2 113 ? -6.468  53.494  54.728 1.00 24.34 ? 114  ASP C O     1 
ATOM   7744  C  CB    . ASP D 2 113 ? -6.380  52.771  57.515 1.00 20.30 ? 114  ASP C CB    1 
ATOM   7745  C  CG    . ASP D 2 113 ? -6.873  53.058  58.921 1.00 20.18 ? 114  ASP C CG    1 
ATOM   7746  O  OD1   . ASP D 2 113 ? -8.098  53.172  59.142 1.00 20.10 ? 114  ASP C OD1   1 
ATOM   7747  O  OD2   . ASP D 2 113 ? -6.020  53.198  59.813 1.00 21.73 ? 114  ASP C OD2   1 
ATOM   7748  N  N     . GLY D 2 114 ? -7.210  51.404  54.325 1.00 21.97 ? 115  GLY C N     1 
ATOM   7749  C  CA    . GLY D 2 114 ? -6.823  51.406  52.917 1.00 23.82 ? 115  GLY C CA    1 
ATOM   7750  C  C     . GLY D 2 114 ? -5.391  50.980  52.636 1.00 25.87 ? 115  GLY C C     1 
ATOM   7751  O  O     . GLY D 2 114 ? -4.986  50.911  51.470 1.00 27.02 ? 115  GLY C O     1 
ATOM   7752  N  N     . ASP D 2 115 ? -4.627  50.704  53.694 1.00 24.24 ? 116  ASP C N     1 
ATOM   7753  C  CA    . ASP D 2 115 ? -3.256  50.222  53.547 1.00 25.94 ? 116  ASP C CA    1 
ATOM   7754  C  C     . ASP D 2 115 ? -3.295  48.926  52.756 1.00 25.48 ? 116  ASP C C     1 
ATOM   7755  O  O     . ASP D 2 115 ? -4.129  48.055  53.022 1.00 23.31 ? 116  ASP C O     1 
ATOM   7756  C  CB    . ASP D 2 115 ? -2.616  49.953  54.917 1.00 31.54 ? 116  ASP C CB    1 
ATOM   7757  C  CG    . ASP D 2 115 ? -2.583  51.184  55.808 1.00 36.33 ? 116  ASP C CG    1 
ATOM   7758  O  OD1   . ASP D 2 115 ? -2.370  52.297  55.277 1.00 41.75 ? 116  ASP C OD1   1 
ATOM   7759  O  OD2   . ASP D 2 115 ? -2.756  51.038  57.038 1.00 36.44 ? 116  ASP C OD2   1 
ATOM   7760  N  N     . GLY D 2 116 ? -2.414  48.810  51.766 1.00 24.11 ? 117  GLY C N     1 
ATOM   7761  C  CA    . GLY D 2 116 ? -2.356  47.608  50.947 1.00 20.70 ? 117  GLY C CA    1 
ATOM   7762  C  C     . GLY D 2 116 ? -1.655  46.493  51.699 1.00 21.54 ? 117  GLY C C     1 
ATOM   7763  O  O     . GLY D 2 116 ? -1.145  46.692  52.806 1.00 22.15 ? 117  GLY C O     1 
ATOM   7764  N  N     . ALA D 2 117 ? -1.639  45.308  51.102 1.00 19.18 ? 118  ALA C N     1 
ATOM   7765  C  CA    . ALA D 2 117 ? -0.978  44.162  51.688 1.00 17.27 ? 118  ALA C CA    1 
ATOM   7766  C  C     . ALA D 2 117 ? 0.503   44.229  51.354 1.00 17.65 ? 118  ALA C C     1 
ATOM   7767  O  O     . ALA D 2 117 ? 0.906   44.936  50.422 1.00 18.14 ? 118  ALA C O     1 
ATOM   7768  C  CB    . ALA D 2 117 ? -1.572  42.870  51.168 1.00 17.30 ? 118  ALA C CB    1 
ATOM   7769  N  N     . ALA D 2 118 ? 1.301   43.496  52.125 1.00 15.39 ? 119  ALA C N     1 
ATOM   7770  C  CA    . ALA D 2 118 ? 2.723   43.406  51.909 1.00 15.32 ? 119  ALA C CA    1 
ATOM   7771  C  C     . ALA D 2 118 ? 2.974   42.736  50.567 1.00 16.24 ? 119  ALA C C     1 
ATOM   7772  O  O     . ALA D 2 118 ? 2.111   41.996  50.077 1.00 16.67 ? 119  ALA C O     1 
ATOM   7773  C  CB    . ALA D 2 118 ? 3.362   42.590  53.033 1.00 13.86 ? 119  ALA C CB    1 
ATOM   7774  N  N     . ALA D 2 119 ? 4.151   42.998  49.979 1.00 16.05 ? 120  ALA C N     1 
ATOM   7775  C  CA    . ALA D 2 119 ? 4.545   42.389  48.703 1.00 16.11 ? 120  ALA C CA    1 
ATOM   7776  C  C     . ALA D 2 119 ? 4.350   40.881  48.792 1.00 17.43 ? 120  ALA C C     1 
ATOM   7777  O  O     . ALA D 2 119 ? 4.595   40.278  49.847 1.00 19.40 ? 120  ALA C O     1 
ATOM   7778  C  CB    . ALA D 2 119 ? 5.991   42.718  48.397 1.00 16.01 ? 120  ALA C CB    1 
ATOM   7779  N  N     . MET D 2 120 ? 3.894   40.272  47.705 1.00 18.18 ? 121  MET C N     1 
ATOM   7780  C  CA    . MET D 2 120 ? 3.608   38.829  47.678 1.00 17.88 ? 121  MET C CA    1 
ATOM   7781  C  C     . MET D 2 120 ? 4.715   37.863  48.112 1.00 18.15 ? 121  MET C C     1 
ATOM   7782  O  O     . MET D 2 120 ? 4.419   36.756  48.534 1.00 19.47 ? 121  MET C O     1 
ATOM   7783  C  CB    . MET D 2 120 ? 2.973   38.400  46.345 1.00 18.43 ? 121  MET C CB    1 
ATOM   7784  C  CG    . MET D 2 120 ? 3.881   38.481  45.142 1.00 19.24 ? 121  MET C CG    1 
ATOM   7785  S  SD    . MET D 2 120 ? 3.136   37.802  43.649 1.00 19.62 ? 121  MET C SD    1 
ATOM   7786  C  CE    . MET D 2 120 ? 1.960   39.068  43.239 1.00 20.35 ? 121  MET C CE    1 
ATOM   7787  N  N     . ARG D 2 121 ? 5.978   38.275  48.037 1.00 17.62 ? 122  ARG C N     1 
ATOM   7788  C  CA    . ARG D 2 121 ? 7.059   37.387  48.453 1.00 17.18 ? 122  ARG C CA    1 
ATOM   7789  C  C     . ARG D 2 121 ? 7.047   37.143  49.958 1.00 17.21 ? 122  ARG C C     1 
ATOM   7790  O  O     . ARG D 2 121 ? 7.473   36.094  50.425 1.00 16.20 ? 122  ARG C O     1 
ATOM   7791  C  CB    . ARG D 2 121 ? 8.415   37.934  48.009 1.00 18.65 ? 122  ARG C CB    1 
ATOM   7792  C  CG    . ARG D 2 121 ? 8.793   39.249  48.671 1.00 22.13 ? 122  ARG C CG    1 
ATOM   7793  C  CD    . ARG D 2 121 ? 10.081  39.823  48.106 1.00 23.38 ? 122  ARG C CD    1 
ATOM   7794  N  NE    . ARG D 2 121 ? 10.305  41.157  48.659 1.00 26.71 ? 122  ARG C NE    1 
ATOM   7795  C  CZ    . ARG D 2 121 ? 10.166  42.281  47.961 1.00 27.00 ? 122  ARG C CZ    1 
ATOM   7796  N  NH1   . ARG D 2 121 ? 9.795   42.247  46.685 1.00 27.97 ? 122  ARG C NH1   1 
ATOM   7797  N  NH2   . ARG D 2 121 ? 10.377  43.444  48.542 1.00 27.18 ? 122  ARG C NH2   1 
ATOM   7798  N  N     . PHE D 2 122 ? 6.549   38.116  50.714 1.00 16.67 ? 123  PHE C N     1 
ATOM   7799  C  CA    . PHE D 2 122 ? 6.495   38.012  52.165 1.00 16.97 ? 123  PHE C CA    1 
ATOM   7800  C  C     . PHE D 2 122 ? 5.293   37.264  52.742 1.00 17.08 ? 123  PHE C C     1 
ATOM   7801  O  O     . PHE D 2 122 ? 5.401   36.627  53.777 1.00 17.35 ? 123  PHE C O     1 
ATOM   7802  C  CB    . PHE D 2 122 ? 6.522   39.405  52.793 1.00 15.17 ? 123  PHE C CB    1 
ATOM   7803  C  CG    . PHE D 2 122 ? 7.773   40.180  52.519 1.00 15.22 ? 123  PHE C CG    1 
ATOM   7804  C  CD1   . PHE D 2 122 ? 8.999   39.765  53.039 1.00 13.90 ? 123  PHE C CD1   1 
ATOM   7805  C  CD2   . PHE D 2 122 ? 7.728   41.341  51.770 1.00 15.36 ? 123  PHE C CD2   1 
ATOM   7806  C  CE1   . PHE D 2 122 ? 10.134  40.486  52.783 1.00 13.58 ? 123  PHE C CE1   1 
ATOM   7807  C  CE2   . PHE D 2 122 ? 8.882   42.063  51.538 1.00 15.01 ? 123  PHE C CE2   1 
ATOM   7808  C  CZ    . PHE D 2 122 ? 10.084  41.633  52.035 1.00 13.99 ? 123  PHE C CZ    1 
ATOM   7809  N  N     . THR D 2 123 ? 4.154   37.359  52.081 1.00 17.45 ? 124  THR C N     1 
ATOM   7810  C  CA    . THR D 2 123 ? 2.928   36.743  52.591 1.00 16.23 ? 124  THR C CA    1 
ATOM   7811  C  C     . THR D 2 123 ? 2.733   35.285  52.212 1.00 17.25 ? 124  THR C C     1 
ATOM   7812  O  O     . THR D 2 123 ? 3.280   34.800  51.218 1.00 17.90 ? 124  THR C O     1 
ATOM   7813  C  CB    . THR D 2 123 ? 1.684   37.536  52.154 1.00 15.80 ? 124  THR C CB    1 
ATOM   7814  O  OG1   . THR D 2 123 ? 1.605   37.548  50.727 1.00 14.72 ? 124  THR C OG1   1 
ATOM   7815  C  CG2   . THR D 2 123 ? 1.750   38.968  52.677 1.00 14.56 ? 124  THR C CG2   1 
ATOM   7816  N  N     . GLU D 2 124 ? 1.941   34.597  53.032 1.00 18.28 ? 125  GLU C N     1 
ATOM   7817  C  CA    . GLU D 2 124 ? 1.605   33.187  52.834 1.00 18.66 ? 125  GLU C CA    1 
ATOM   7818  C  C     . GLU D 2 124 ? 0.088   32.994  52.985 1.00 18.76 ? 125  GLU C C     1 
ATOM   7819  O  O     . GLU D 2 124 ? -0.584  33.800  53.644 1.00 19.68 ? 125  GLU C O     1 
ATOM   7820  C  CB    . GLU D 2 124 ? 2.395   32.298  53.803 1.00 20.01 ? 125  GLU C CB    1 
ATOM   7821  C  CG    . GLU D 2 124 ? 3.907   32.288  53.539 1.00 24.26 ? 125  GLU C CG    1 
ATOM   7822  C  CD    . GLU D 2 124 ? 4.718   31.535  54.590 1.00 28.04 ? 125  GLU C CD    1 
ATOM   7823  O  OE1   . GLU D 2 124 ? 4.167   31.150  55.652 1.00 27.48 ? 125  GLU C OE1   1 
ATOM   7824  O  OE2   . GLU D 2 124 ? 5.933   31.354  54.363 1.00 31.09 ? 125  GLU C OE2   1 
ATOM   7825  N  N     . ALA D 2 125 ? -0.446  31.937  52.370 1.00 17.08 ? 126  ALA C N     1 
ATOM   7826  C  CA    . ALA D 2 125 ? -1.888  31.690  52.376 1.00 15.34 ? 126  ALA C CA    1 
ATOM   7827  C  C     . ALA D 2 125 ? -2.299  30.232  52.168 1.00 16.60 ? 126  ALA C C     1 
ATOM   7828  O  O     . ALA D 2 125 ? -1.502  29.383  51.739 1.00 16.72 ? 126  ALA C O     1 
ATOM   7829  C  CB    . ALA D 2 125 ? -2.582  32.579  51.332 1.00 14.75 ? 126  ALA C CB    1 
ATOM   7830  N  N     . ARG D 2 126 ? -3.556  29.987  52.484 1.00 16.60 ? 127  ARG C N     1 
ATOM   7831  C  CA    . ARG D 2 126 ? -4.220  28.714  52.357 1.00 17.99 ? 127  ARG C CA    1 
ATOM   7832  C  C     . ARG D 2 126 ? -5.732  28.915  52.395 1.00 16.86 ? 127  ARG C C     1 
ATOM   7833  O  O     . ARG D 2 126 ? -6.221  30.010  52.539 1.00 14.87 ? 127  ARG C O     1 
ATOM   7834  C  CB    . ARG D 2 126 ? -3.772  27.752  53.445 1.00 19.45 ? 127  ARG C CB    1 
ATOM   7835  C  CG    . ARG D 2 126 ? -4.048  28.238  54.848 1.00 21.45 ? 127  ARG C CG    1 
ATOM   7836  C  CD    . ARG D 2 126 ? -3.424  27.312  55.840 1.00 20.27 ? 127  ARG C CD    1 
ATOM   7837  N  NE    . ARG D 2 126 ? -3.665  27.749  57.185 1.00 22.54 ? 127  ARG C NE    1 
ATOM   7838  C  CZ    . ARG D 2 126 ? -3.185  27.134  58.249 1.00 23.78 ? 127  ARG C CZ    1 
ATOM   7839  N  NH1   . ARG D 2 126 ? -2.442  26.065  58.100 1.00 21.44 ? 127  ARG C NH1   1 
ATOM   7840  N  NH2   . ARG D 2 126 ? -3.442  27.595  59.453 1.00 22.13 ? 127  ARG C NH2   1 
ATOM   7841  N  N     . MET D 2 127 ? -6.472  27.835  52.247 1.00 16.36 ? 128  MET C N     1 
ATOM   7842  C  CA    . MET D 2 127 ? -7.912  27.927  52.284 1.00 17.02 ? 128  MET C CA    1 
ATOM   7843  C  C     . MET D 2 127 ? -8.401  28.082  53.713 1.00 15.61 ? 128  MET C C     1 
ATOM   7844  O  O     . MET D 2 127 ? -7.730  27.691  54.669 1.00 16.53 ? 128  MET C O     1 
ATOM   7845  C  CB    . MET D 2 127 ? -8.548  26.655  51.772 1.00 17.78 ? 128  MET C CB    1 
ATOM   7846  C  CG    . MET D 2 127 ? -8.122  26.119  50.428 1.00 20.55 ? 128  MET C CG    1 
ATOM   7847  S  SD    . MET D 2 127 ? -8.992  24.564  50.158 1.00 22.42 ? 128  MET C SD    1 
ATOM   7848  C  CE    . MET D 2 127 ? -8.130  23.907  48.774 1.00 21.04 ? 128  MET C CE    1 
ATOM   7849  N  N     . THR D 2 128 ? -9.583  28.631  53.862 1.00 13.27 ? 129  THR C N     1 
ATOM   7850  C  CA    . THR D 2 128 ? -10.195 28.668  55.185 1.00 12.78 ? 129  THR C CA    1 
ATOM   7851  C  C     . THR D 2 128 ? -10.984 27.367  55.244 1.00 13.21 ? 129  THR C C     1 
ATOM   7852  O  O     . THR D 2 128 ? -11.095 26.660  54.230 1.00 14.47 ? 129  THR C O     1 
ATOM   7853  C  CB    . THR D 2 128 ? -11.143 29.870  55.377 1.00 12.31 ? 129  THR C CB    1 
ATOM   7854  O  OG1   . THR D 2 128 ? -12.143 29.848  54.343 1.00 12.01 ? 129  THR C OG1   1 
ATOM   7855  C  CG2   . THR D 2 128 ? -10.382 31.178  55.313 1.00 11.11 ? 129  THR C CG2   1 
ATOM   7856  N  N     . LYS D 2 129 ? -11.537 27.036  56.396 1.00 13.32 ? 130  LYS C N     1 
ATOM   7857  C  CA    . LYS D 2 129 ? -12.304 25.806  56.497 1.00 12.79 ? 130  LYS C CA    1 
ATOM   7858  C  C     . LYS D 2 129 ? -13.576 25.868  55.647 1.00 11.54 ? 130  LYS C C     1 
ATOM   7859  O  O     . LYS D 2 129 ? -14.002 24.857  55.104 1.00 11.72 ? 130  LYS C O     1 
ATOM   7860  C  CB    . LYS D 2 129 ? -12.588 25.465  57.951 1.00 13.77 ? 130  LYS C CB    1 
ATOM   7861  C  CG    . LYS D 2 129 ? -11.349 25.080  58.722 1.00 15.85 ? 130  LYS C CG    1 
ATOM   7862  C  CD    . LYS D 2 129 ? -11.605 25.152  60.230 1.00 19.45 ? 130  LYS C CD    1 
ATOM   7863  C  CE    . LYS D 2 129 ? -10.250 25.240  60.973 1.00 21.62 ? 130  LYS C CE    1 
ATOM   7864  N  NZ    . LYS D 2 129 ? -10.414 25.017  62.429 1.00 25.41 ? 130  LYS C NZ    1 
ATOM   7865  N  N     . ILE D 2 130 ? -14.171 27.045  55.520 1.00 10.27 ? 131  ILE C N     1 
ATOM   7866  C  CA    . ILE D 2 130 ? -15.381 27.191  54.714 1.00 10.22 ? 131  ILE C CA    1 
ATOM   7867  C  C     . ILE D 2 130 ? -15.155 27.016  53.208 1.00 10.59 ? 131  ILE C C     1 
ATOM   7868  O  O     . ILE D 2 130 ? -16.013 26.487  52.519 1.00 10.73 ? 131  ILE C O     1 
ATOM   7869  C  CB    . ILE D 2 130 ? -16.137 28.499  55.021 1.00 9.84  ? 131  ILE C CB    1 
ATOM   7870  C  CG1   . ILE D 2 130 ? -17.633 28.299  54.795 1.00 9.66  ? 131  ILE C CG1   1 
ATOM   7871  C  CG2   . ILE D 2 130 ? -15.587 29.660  54.207 1.00 9.85  ? 131  ILE C CG2   1 
ATOM   7872  C  CD1   . ILE D 2 130 ? -18.485 29.436  55.303 1.00 9.33  ? 131  ILE C CD1   1 
ATOM   7873  N  N     . THR D 2 131 ? -14.008 27.450  52.706 1.00 10.80 ? 132  THR C N     1 
ATOM   7874  C  CA    . THR D 2 131 ? -13.680 27.308  51.278 1.00 11.51 ? 132  THR C CA    1 
ATOM   7875  C  C     . THR D 2 131 ? -13.713 25.839  50.827 1.00 11.27 ? 132  THR C C     1 
ATOM   7876  O  O     . THR D 2 131 ? -14.004 25.555  49.660 1.00 11.58 ? 132  THR C O     1 
ATOM   7877  C  CB    . THR D 2 131 ? -12.350 28.024  50.899 1.00 11.62 ? 132  THR C CB    1 
ATOM   7878  O  OG1   . THR D 2 131 ? -12.526 29.439  51.028 1.00 10.99 ? 132  THR C OG1   1 
ATOM   7879  C  CG2   . THR D 2 131 ? -11.938 27.733  49.462 1.00 11.44 ? 132  THR C CG2   1 
ATOM   7880  N  N     . LEU D 2 132 ? -13.484 24.931  51.764 1.00 11.56 ? 133  LEU C N     1 
ATOM   7881  C  CA    . LEU D 2 132 ? -13.548 23.509  51.492 1.00 12.16 ? 133  LEU C CA    1 
ATOM   7882  C  C     . LEU D 2 132 ? -14.958 23.118  51.053 1.00 12.77 ? 133  LEU C C     1 
ATOM   7883  O  O     . LEU D 2 132 ? -15.135 22.162  50.325 1.00 13.29 ? 133  LEU C O     1 
ATOM   7884  C  CB    . LEU D 2 132 ? -13.157 22.712  52.727 1.00 11.77 ? 133  LEU C CB    1 
ATOM   7885  C  CG    . LEU D 2 132 ? -11.675 22.564  53.046 1.00 12.64 ? 133  LEU C CG    1 
ATOM   7886  C  CD1   . LEU D 2 132 ? -11.457 22.177  54.496 1.00 11.95 ? 133  LEU C CD1   1 
ATOM   7887  C  CD2   . LEU D 2 132 ? -11.009 21.573  52.088 1.00 12.33 ? 133  LEU C CD2   1 
ATOM   7888  N  N     . GLU D 2 133 ? -15.954 23.878  51.506 1.00 12.92 ? 134  GLU C N     1 
ATOM   7889  C  CA    . GLU D 2 133 ? -17.342 23.627  51.159 1.00 12.49 ? 134  GLU C CA    1 
ATOM   7890  C  C     . GLU D 2 133 ? -17.664 24.100  49.746 1.00 12.17 ? 134  GLU C C     1 
ATOM   7891  O  O     . GLU D 2 133 ? -18.585 23.618  49.122 1.00 11.76 ? 134  GLU C O     1 
ATOM   7892  C  CB    . GLU D 2 133 ? -18.286 24.261  52.177 1.00 12.93 ? 134  GLU C CB    1 
ATOM   7893  C  CG    . GLU D 2 133 ? -18.191 23.647  53.565 1.00 13.45 ? 134  GLU C CG    1 
ATOM   7894  C  CD    . GLU D 2 133 ? -18.169 22.134  53.541 1.00 14.12 ? 134  GLU C CD    1 
ATOM   7895  O  OE1   . GLU D 2 133 ? -17.472 21.547  54.374 1.00 15.11 ? 134  GLU C OE1   1 
ATOM   7896  O  OE2   . GLU D 2 133 ? -18.837 21.534  52.685 1.00 13.82 ? 134  GLU C OE2   1 
ATOM   7897  N  N     . LEU D 2 134 ? -16.888 25.047  49.246 1.00 11.89 ? 135  LEU C N     1 
ATOM   7898  C  CA    . LEU D 2 134 ? -17.058 25.526  47.885 1.00 11.36 ? 135  LEU C CA    1 
ATOM   7899  C  C     . LEU D 2 134 ? -16.452 24.508  46.934 1.00 11.61 ? 135  LEU C C     1 
ATOM   7900  O  O     . LEU D 2 134 ? -16.923 24.332  45.816 1.00 11.00 ? 135  LEU C O     1 
ATOM   7901  C  CB    . LEU D 2 134 ? -16.360 26.868  47.687 1.00 10.87 ? 135  LEU C CB    1 
ATOM   7902  C  CG    . LEU D 2 134 ? -17.034 28.139  48.207 1.00 11.70 ? 135  LEU C CG    1 
ATOM   7903  C  CD1   . LEU D 2 134 ? -16.063 29.301  48.107 1.00 11.38 ? 135  LEU C CD1   1 
ATOM   7904  C  CD2   . LEU D 2 134 ? -18.297 28.464  47.445 1.00 11.52 ? 135  LEU C CD2   1 
ATOM   7905  N  N     . LEU D 2 135 ? -15.411 23.830  47.392 1.00 12.31 ? 136  LEU C N     1 
ATOM   7906  C  CA    . LEU D 2 135 ? -14.685 22.882  46.554 1.00 13.85 ? 136  LEU C CA    1 
ATOM   7907  C  C     . LEU D 2 135 ? -15.062 21.420  46.755 1.00 13.98 ? 136  LEU C C     1 
ATOM   7908  O  O     . LEU D 2 135 ? -14.605 20.565  46.009 1.00 13.47 ? 136  LEU C O     1 
ATOM   7909  C  CB    . LEU D 2 135 ? -13.174 23.076  46.752 1.00 13.10 ? 136  LEU C CB    1 
ATOM   7910  C  CG    . LEU D 2 135 ? -12.612 24.423  46.280 1.00 13.09 ? 136  LEU C CG    1 
ATOM   7911  C  CD1   . LEU D 2 135 ? -11.326 24.782  47.021 1.00 12.40 ? 136  LEU C CD1   1 
ATOM   7912  C  CD2   . LEU D 2 135 ? -12.416 24.440  44.763 1.00 12.94 ? 136  LEU C CD2   1 
ATOM   7913  N  N     . ARG D 2 136 ? -15.942 21.140  47.705 1.00 15.47 ? 137  ARG C N     1 
ATOM   7914  C  CA    . ARG D 2 136 ? -16.343 19.778  48.016 1.00 17.79 ? 137  ARG C CA    1 
ATOM   7915  C  C     . ARG D 2 136 ? -16.858 18.940  46.861 1.00 18.51 ? 137  ARG C C     1 
ATOM   7916  O  O     . ARG D 2 136 ? -17.878 19.208  46.280 1.00 18.63 ? 137  ARG C O     1 
ATOM   7917  C  CB    . ARG D 2 136 ? -17.410 19.788  49.112 1.00 19.93 ? 137  ARG C CB    1 
ATOM   7918  C  CG    . ARG D 2 136 ? -17.400 18.537  49.953 1.00 21.01 ? 137  ARG C CG    1 
ATOM   7919  C  CD    . ARG D 2 136 ? -18.783 18.170  50.420 1.00 25.95 ? 137  ARG C CD    1 
ATOM   7920  N  NE    . ARG D 2 136 ? -19.198 18.893  51.603 1.00 25.85 ? 137  ARG C NE    1 
ATOM   7921  C  CZ    . ARG D 2 136 ? -20.195 18.518  52.386 1.00 27.27 ? 137  ARG C CZ    1 
ATOM   7922  N  NH1   . ARG D 2 136 ? -20.860 17.362  52.150 1.00 24.89 ? 137  ARG C NH1   1 
ATOM   7923  N  NH2   . ARG D 2 136 ? -20.507 19.270  53.422 1.00 26.85 ? 137  ARG C NH2   1 
ATOM   7924  N  N     . ASP D 2 137 ? -16.123 17.890  46.564 1.00 19.25 ? 138  ASP C N     1 
ATOM   7925  C  CA    . ASP D 2 137 ? -16.509 16.958  45.505 1.00 20.05 ? 138  ASP C CA    1 
ATOM   7926  C  C     . ASP D 2 137 ? -16.419 17.539  44.080 1.00 19.96 ? 138  ASP C C     1 
ATOM   7927  O  O     . ASP D 2 137 ? -17.177 17.150  43.185 1.00 18.91 ? 138  ASP C O     1 
ATOM   7928  C  CB    . ASP D 2 137 ? -17.909 16.379  45.798 1.00 22.63 ? 138  ASP C CB    1 
ATOM   7929  C  CG    . ASP D 2 137 ? -18.028 15.803  47.226 1.00 25.14 ? 138  ASP C CG    1 
ATOM   7930  O  OD1   . ASP D 2 137 ? -17.073 15.124  47.698 1.00 25.96 ? 138  ASP C OD1   1 
ATOM   7931  O  OD2   . ASP D 2 137 ? -19.092 16.022  47.863 1.00 25.07 ? 138  ASP C OD2   1 
ATOM   7932  N  N     . ILE D 2 138 ? -15.463 18.436  43.866 1.00 20.01 ? 139  ILE C N     1 
ATOM   7933  C  CA    . ILE D 2 138 ? -15.261 19.038  42.554 1.00 19.85 ? 139  ILE C CA    1 
ATOM   7934  C  C     . ILE D 2 138 ? -14.599 18.036  41.610 1.00 21.40 ? 139  ILE C C     1 
ATOM   7935  O  O     . ILE D 2 138 ? -14.649 18.194  40.394 1.00 20.32 ? 139  ILE C O     1 
ATOM   7936  C  CB    . ILE D 2 138 ? -14.442 20.343  42.635 1.00 18.08 ? 139  ILE C CB    1 
ATOM   7937  C  CG1   . ILE D 2 138 ? -14.328 20.983  41.262 1.00 16.59 ? 139  ILE C CG1   1 
ATOM   7938  C  CG2   . ILE D 2 138 ? -13.065 20.100  43.237 1.00 17.73 ? 139  ILE C CG2   1 
ATOM   7939  C  CD1   . ILE D 2 138 ? -13.686 22.354  41.274 1.00 15.88 ? 139  ILE C CD1   1 
ATOM   7940  N  N     . ASN D 2 139 ? -13.994 16.999  42.184 1.00 23.07 ? 140  ASN C N     1 
ATOM   7941  C  CA    . ASN D 2 139 ? -13.350 15.945  41.406 1.00 27.14 ? 140  ASN C CA    1 
ATOM   7942  C  C     . ASN D 2 139 ? -14.205 14.685  41.295 1.00 28.56 ? 140  ASN C C     1 
ATOM   7943  O  O     . ASN D 2 139 ? -13.715 13.613  40.905 1.00 32.03 ? 140  ASN C O     1 
ATOM   7944  C  CB    . ASN D 2 139 ? -11.965 15.641  41.979 1.00 28.08 ? 140  ASN C CB    1 
ATOM   7945  C  CG    . ASN D 2 139 ? -11.004 16.810  41.815 1.00 30.44 ? 140  ASN C CG    1 
ATOM   7946  O  OD1   . ASN D 2 139 ? -10.939 17.441  40.738 1.00 28.42 ? 140  ASN C OD1   1 
ATOM   7947  N  ND2   . ASN D 2 139 ? -10.248 17.103  42.877 1.00 30.82 ? 140  ASN C ND2   1 
ATOM   7948  N  N     . LYS D 2 140 ? -15.487 14.825  41.630 1.00 25.22 ? 141  LYS C N     1 
ATOM   7949  C  CA    . LYS D 2 140 ? -16.435 13.724  41.540 1.00 22.77 ? 141  LYS C CA    1 
ATOM   7950  C  C     . LYS D 2 140 ? -17.484 13.987  40.443 1.00 20.40 ? 141  LYS C C     1 
ATOM   7951  O  O     . LYS D 2 140 ? -18.664 13.654  40.597 1.00 18.46 ? 141  LYS C O     1 
ATOM   7952  C  CB    . LYS D 2 140 ? -17.076 13.460  42.902 1.00 25.95 ? 141  LYS C CB    1 
ATOM   7953  C  CG    . LYS D 2 140 ? -16.077 13.000  43.959 1.00 29.73 ? 141  LYS C CG    1 
ATOM   7954  C  CD    . LYS D 2 140 ? -16.744 12.800  45.303 1.00 32.85 ? 141  LYS C CD    1 
ATOM   7955  C  CE    . LYS D 2 140 ? -15.729 12.369  46.359 1.00 37.84 ? 141  LYS C CE    1 
ATOM   7956  N  NZ    . LYS D 2 140 ? -16.389 12.311  47.705 1.00 37.31 ? 141  LYS C NZ    1 
ATOM   7957  N  N     . ASP D 2 141 ? -17.021 14.590  39.341 1.00 18.25 ? 142  ASP C N     1 
ATOM   7958  C  CA    . ASP D 2 141 ? -17.840 14.909  38.167 1.00 16.23 ? 142  ASP C CA    1 
ATOM   7959  C  C     . ASP D 2 141 ? -19.167 15.645  38.488 1.00 16.25 ? 142  ASP C C     1 
ATOM   7960  O  O     . ASP D 2 141 ? -20.212 15.392  37.868 1.00 16.65 ? 142  ASP C O     1 
ATOM   7961  C  CB    . ASP D 2 141 ? -18.087 13.654  37.323 1.00 15.00 ? 142  ASP C CB    1 
ATOM   7962  C  CG    . ASP D 2 141 ? -18.735 13.962  35.991 1.00 15.22 ? 142  ASP C CG    1 
ATOM   7963  O  OD1   . ASP D 2 141 ? -18.276 14.895  35.307 1.00 15.79 ? 142  ASP C OD1   1 
ATOM   7964  O  OD2   . ASP D 2 141 ? -19.735 13.290  35.637 1.00 15.75 ? 142  ASP C OD2   1 
ATOM   7965  N  N     . THR D 2 142 ? -19.114 16.559  39.456 1.00 14.86 ? 143  THR C N     1 
ATOM   7966  C  CA    . THR D 2 142 ? -20.287 17.346  39.846 1.00 13.52 ? 143  THR C CA    1 
ATOM   7967  C  C     . THR D 2 142 ? -20.482 18.574  38.955 1.00 13.37 ? 143  THR C C     1 
ATOM   7968  O  O     . THR D 2 142 ? -21.610 18.983  38.677 1.00 13.54 ? 143  THR C O     1 
ATOM   7969  C  CB    . THR D 2 142 ? -20.210 17.805  41.309 1.00 12.80 ? 143  THR C CB    1 
ATOM   7970  O  OG1   . THR D 2 142 ? -18.960 18.459  41.527 1.00 13.24 ? 143  THR C OG1   1 
ATOM   7971  C  CG2   . THR D 2 142 ? -20.324 16.615  42.257 1.00 12.57 ? 143  THR C CG2   1 
ATOM   7972  N  N     . ILE D 2 143 ? -19.372 19.150  38.502 1.00 13.41 ? 144  ILE C N     1 
ATOM   7973  C  CA    . ILE D 2 143 ? -19.404 20.348  37.666 1.00 12.29 ? 144  ILE C CA    1 
ATOM   7974  C  C     . ILE D 2 143 ? -18.627 20.128  36.381 1.00 12.73 ? 144  ILE C C     1 
ATOM   7975  O  O     . ILE D 2 143 ? -17.771 19.246  36.329 1.00 14.05 ? 144  ILE C O     1 
ATOM   7976  C  CB    . ILE D 2 143 ? -18.905 21.605  38.447 1.00 11.97 ? 144  ILE C CB    1 
ATOM   7977  C  CG1   . ILE D 2 143 ? -17.454 21.431  38.953 1.00 11.35 ? 144  ILE C CG1   1 
ATOM   7978  C  CG2   . ILE D 2 143 ? -19.852 21.931  39.617 1.00 11.93 ? 144  ILE C CG2   1 
ATOM   7979  C  CD1   . ILE D 2 143 ? -16.368 21.727  37.915 1.00 10.78 ? 144  ILE C CD1   1 
ATOM   7980  N  N     . ASP D 2 144 ? -18.929 20.909  35.353 1.00 13.06 ? 145  ASP C N     1 
ATOM   7981  C  CA    . ASP D 2 144 ? -18.268 20.793  34.050 1.00 14.00 ? 145  ASP C CA    1 
ATOM   7982  C  C     . ASP D 2 144 ? -16.932 21.540  33.964 1.00 14.22 ? 145  ASP C C     1 
ATOM   7983  O  O     . ASP D 2 144 ? -16.870 22.748  34.226 1.00 13.83 ? 145  ASP C O     1 
ATOM   7984  C  CB    . ASP D 2 144 ? -19.183 21.278  32.904 1.00 13.87 ? 145  ASP C CB    1 
ATOM   7985  C  CG    . ASP D 2 144 ? -20.384 20.356  32.659 1.00 15.28 ? 145  ASP C CG    1 
ATOM   7986  O  OD1   . ASP D 2 144 ? -20.404 19.197  33.161 1.00 15.08 ? 145  ASP C OD1   1 
ATOM   7987  O  OD2   . ASP D 2 144 ? -21.316 20.793  31.945 1.00 14.79 ? 145  ASP C OD2   1 
ATOM   7988  N  N     . PHE D 2 145 ? -15.900 20.823  33.538 1.00 13.05 ? 146  PHE C N     1 
ATOM   7989  C  CA    . PHE D 2 145 ? -14.577 21.375  33.334 1.00 12.88 ? 146  PHE C CA    1 
ATOM   7990  C  C     . PHE D 2 145 ? -14.452 21.877  31.902 1.00 13.24 ? 146  PHE C C     1 
ATOM   7991  O  O     . PHE D 2 145 ? -15.094 21.361  31.006 1.00 13.15 ? 146  PHE C O     1 
ATOM   7992  C  CB    . PHE D 2 145 ? -13.501 20.329  33.610 1.00 13.20 ? 146  PHE C CB    1 
ATOM   7993  C  CG    . PHE D 2 145 ? -13.120 20.217  35.048 1.00 13.79 ? 146  PHE C CG    1 
ATOM   7994  C  CD1   . PHE D 2 145 ? -13.758 19.310  35.878 1.00 14.30 ? 146  PHE C CD1   1 
ATOM   7995  C  CD2   . PHE D 2 145 ? -12.141 21.025  35.582 1.00 14.01 ? 146  PHE C CD2   1 
ATOM   7996  C  CE1   . PHE D 2 145 ? -13.418 19.213  37.204 1.00 15.51 ? 146  PHE C CE1   1 
ATOM   7997  C  CE2   . PHE D 2 145 ? -11.796 20.937  36.908 1.00 14.40 ? 146  PHE C CE2   1 
ATOM   7998  C  CZ    . PHE D 2 145 ? -12.433 20.036  37.724 1.00 14.96 ? 146  PHE C CZ    1 
ATOM   7999  N  N     . ILE D 2 146 ? -13.603 22.870  31.697 1.00 13.81 ? 147  ILE C N     1 
ATOM   8000  C  CA    . ILE D 2 146 ? -13.384 23.428  30.374 1.00 14.28 ? 147  ILE C CA    1 
ATOM   8001  C  C     . ILE D 2 146 ? -11.913 23.659  30.095 1.00 15.13 ? 147  ILE C C     1 
ATOM   8002  O  O     . ILE D 2 146 ? -11.098 23.644  30.993 1.00 18.72 ? 147  ILE C O     1 
ATOM   8003  C  CB    . ILE D 2 146 ? -14.127 24.764  30.198 1.00 13.91 ? 147  ILE C CB    1 
ATOM   8004  C  CG1   . ILE D 2 146 ? -13.773 25.713  31.329 1.00 12.99 ? 147  ILE C CG1   1 
ATOM   8005  C  CG2   . ILE D 2 146 ? -15.625 24.553  30.180 1.00 13.09 ? 147  ILE C CG2   1 
ATOM   8006  C  CD1   . ILE D 2 146 ? -14.063 27.149  31.020 1.00 10.98 ? 147  ILE C CD1   1 
ATOM   8007  N  N     . ASP D 2 147 ? -11.582 23.869  28.835 1.00 15.69 ? 148  ASP C N     1 
ATOM   8008  C  CA    . ASP D 2 147 ? -10.211 24.158  28.439 1.00 15.87 ? 148  ASP C CA    1 
ATOM   8009  C  C     . ASP D 2 147 ? -9.795  25.521  28.980 1.00 16.46 ? 148  ASP C C     1 
ATOM   8010  O  O     . ASP D 2 147 ? -10.618 26.435  29.081 1.00 15.56 ? 148  ASP C O     1 
ATOM   8011  C  CB    . ASP D 2 147 ? -10.067 24.151  26.911 1.00 16.00 ? 148  ASP C CB    1 
ATOM   8012  C  CG    . ASP D 2 147 ? -9.995  22.747  26.326 1.00 17.08 ? 148  ASP C CG    1 
ATOM   8013  O  OD1   . ASP D 2 147 ? -9.739  21.767  27.065 1.00 16.13 ? 148  ASP C OD1   1 
ATOM   8014  O  OD2   . ASP D 2 147 ? -10.189 22.635  25.093 1.00 18.51 ? 148  ASP C OD2   1 
ATOM   8015  N  N     . ASN D 2 148 ? -8.522  25.655  29.339 1.00 16.64 ? 149  ASN C N     1 
ATOM   8016  C  CA    . ASN D 2 148 ? -8.032  26.941  29.821 1.00 16.86 ? 149  ASN C CA    1 
ATOM   8017  C  C     . ASN D 2 148 ? -7.800  27.850  28.608 1.00 17.97 ? 149  ASN C C     1 
ATOM   8018  O  O     . ASN D 2 148 ? -8.123  27.465  27.476 1.00 20.35 ? 149  ASN C O     1 
ATOM   8019  C  CB    . ASN D 2 148 ? -6.770  26.786  30.676 1.00 16.10 ? 149  ASN C CB    1 
ATOM   8020  C  CG    . ASN D 2 148 ? -5.574  26.316  29.877 1.00 16.18 ? 149  ASN C CG    1 
ATOM   8021  O  OD1   . ASN D 2 148 ? -5.710  25.630  28.866 1.00 15.84 ? 149  ASN C OD1   1 
ATOM   8022  N  ND2   . ASN D 2 148 ? -4.386  26.678  30.340 1.00 15.18 ? 149  ASN C ND2   1 
ATOM   8023  N  N     . TYR D 2 149 ? -7.235  29.033  28.838 1.00 16.48 ? 150  TYR C N     1 
ATOM   8024  C  CA    . TYR D 2 149 ? -6.986  29.988  27.757 1.00 15.66 ? 150  TYR C CA    1 
ATOM   8025  C  C     . TYR D 2 149 ? -6.078  29.492  26.622 1.00 15.81 ? 150  TYR C C     1 
ATOM   8026  O  O     . TYR D 2 149 ? -6.113  30.056  25.529 1.00 14.94 ? 150  TYR C O     1 
ATOM   8027  C  CB    . TYR D 2 149 ? -6.440  31.312  28.317 1.00 15.48 ? 150  TYR C CB    1 
ATOM   8028  C  CG    . TYR D 2 149 ? -5.020  31.241  28.864 1.00 15.12 ? 150  TYR C CG    1 
ATOM   8029  C  CD1   . TYR D 2 149 ? -4.766  30.712  30.135 1.00 15.32 ? 150  TYR C CD1   1 
ATOM   8030  C  CD2   . TYR D 2 149 ? -3.938  31.730  28.125 1.00 14.35 ? 150  TYR C CD2   1 
ATOM   8031  C  CE1   . TYR D 2 149 ? -3.481  30.641  30.648 1.00 15.47 ? 150  TYR C CE1   1 
ATOM   8032  C  CE2   . TYR D 2 149 ? -2.634  31.670  28.631 1.00 14.62 ? 150  TYR C CE2   1 
ATOM   8033  C  CZ    . TYR D 2 149 ? -2.410  31.126  29.888 1.00 15.46 ? 150  TYR C CZ    1 
ATOM   8034  O  OH    . TYR D 2 149 ? -1.138  31.056  30.416 1.00 14.95 ? 150  TYR C OH    1 
ATOM   8035  N  N     . ASP D 2 150 ? -5.271  28.453  26.860 1.00 16.19 ? 151  ASP C N     1 
ATOM   8036  C  CA    . ASP D 2 150 ? -4.331  28.001  25.818 1.00 16.62 ? 151  ASP C CA    1 
ATOM   8037  C  C     . ASP D 2 150 ? -4.380  26.534  25.393 1.00 18.62 ? 151  ASP C C     1 
ATOM   8038  O  O     . ASP D 2 150 ? -3.537  26.092  24.604 1.00 21.92 ? 151  ASP C O     1 
ATOM   8039  C  CB    . ASP D 2 150 ? -2.885  28.432  26.142 1.00 16.91 ? 151  ASP C CB    1 
ATOM   8040  C  CG    . ASP D 2 150 ? -2.305  27.735  27.371 1.00 17.48 ? 151  ASP C CG    1 
ATOM   8041  O  OD1   . ASP D 2 150 ? -3.006  26.932  28.022 1.00 17.34 ? 151  ASP C OD1   1 
ATOM   8042  O  OD2   . ASP D 2 150 ? -1.127  27.997  27.683 1.00 16.80 ? 151  ASP C OD2   1 
ATOM   8043  N  N     . GLY D 2 151 ? -5.362  25.782  25.897 1.00 19.02 ? 152  GLY C N     1 
ATOM   8044  C  CA    . GLY D 2 151 ? -5.517  24.374  25.555 1.00 17.41 ? 152  GLY C CA    1 
ATOM   8045  C  C     . GLY D 2 151 ? -4.565  23.421  26.266 1.00 20.51 ? 152  GLY C C     1 
ATOM   8046  O  O     . GLY D 2 151 ? -4.516  22.224  25.937 1.00 21.15 ? 152  GLY C O     1 
ATOM   8047  N  N     . ASN D 2 152 ? -3.819  23.928  27.249 1.00 20.02 ? 153  ASN C N     1 
ATOM   8048  C  CA    . ASN D 2 152 ? -2.850  23.107  27.999 1.00 18.60 ? 153  ASN C CA    1 
ATOM   8049  C  C     . ASN D 2 152 ? -3.298  22.679  29.395 1.00 17.20 ? 153  ASN C C     1 
ATOM   8050  O  O     . ASN D 2 152 ? -2.659  21.833  30.024 1.00 16.28 ? 153  ASN C O     1 
ATOM   8051  C  CB    . ASN D 2 152 ? -1.485  23.813  28.075 1.00 19.93 ? 153  ASN C CB    1 
ATOM   8052  C  CG    . ASN D 2 152 ? -0.799  23.931  26.715 1.00 21.26 ? 153  ASN C CG    1 
ATOM   8053  O  OD1   . ASN D 2 152 ? -0.960  23.079  25.842 1.00 23.16 ? 153  ASN C OD1   1 
ATOM   8054  N  ND2   . ASN D 2 152 ? -0.014  24.987  26.543 1.00 22.38 ? 153  ASN C ND2   1 
ATOM   8055  N  N     . GLU D 2 153 ? -4.385  23.271  29.882 1.00 16.72 ? 154  GLU C N     1 
ATOM   8056  C  CA    . GLU D 2 153 ? -4.913  22.945  31.210 1.00 14.87 ? 154  GLU C CA    1 
ATOM   8057  C  C     . GLU D 2 153 ? -6.426  22.799  31.197 1.00 13.64 ? 154  GLU C C     1 
ATOM   8058  O  O     . GLU D 2 153 ? -7.079  23.033  30.181 1.00 14.88 ? 154  GLU C O     1 
ATOM   8059  C  CB    . GLU D 2 153 ? -4.511  24.007  32.245 1.00 14.01 ? 154  GLU C CB    1 
ATOM   8060  C  CG    . GLU D 2 153 ? -3.013  24.235  32.406 1.00 14.07 ? 154  GLU C CG    1 
ATOM   8061  C  CD    . GLU D 2 153 ? -2.261  23.024  32.937 1.00 14.66 ? 154  GLU C CD    1 
ATOM   8062  O  OE1   . GLU D 2 153 ? -2.897  22.120  33.540 1.00 13.72 ? 154  GLU C OE1   1 
ATOM   8063  O  OE2   . GLU D 2 153 ? -1.017  22.983  32.746 1.00 15.05 ? 154  GLU C OE2   1 
ATOM   8064  N  N     . ARG D 2 154 ? -6.981  22.424  32.337 1.00 13.37 ? 155  ARG C N     1 
ATOM   8065  C  CA    . ARG D 2 154 ? -8.415  22.281  32.473 1.00 13.05 ? 155  ARG C CA    1 
ATOM   8066  C  C     . ARG D 2 154 ? -8.857  23.051  33.697 1.00 13.02 ? 155  ARG C C     1 
ATOM   8067  O  O     . ARG D 2 154 ? -8.213  22.987  34.741 1.00 13.04 ? 155  ARG C O     1 
ATOM   8068  C  CB    . ARG D 2 154 ? -8.800  20.809  32.586 1.00 13.02 ? 155  ARG C CB    1 
ATOM   8069  C  CG    . ARG D 2 154 ? -8.589  20.018  31.303 1.00 13.20 ? 155  ARG C CG    1 
ATOM   8070  C  CD    . ARG D 2 154 ? -9.640  20.320  30.247 1.00 13.56 ? 155  ARG C CD    1 
ATOM   8071  N  NE    . ARG D 2 154 ? -10.868 19.564  30.469 1.00 14.28 ? 155  ARG C NE    1 
ATOM   8072  C  CZ    . ARG D 2 154 ? -11.933 19.615  29.669 1.00 14.99 ? 155  ARG C CZ    1 
ATOM   8073  N  NH1   . ARG D 2 154 ? -11.922 20.374  28.589 1.00 14.72 ? 155  ARG C NH1   1 
ATOM   8074  N  NH2   . ARG D 2 154 ? -13.008 18.905  29.948 1.00 14.41 ? 155  ARG C NH2   1 
ATOM   8075  N  N     . GLU D 2 155 ? -9.943  23.792  33.570 1.00 12.24 ? 156  GLU C N     1 
ATOM   8076  C  CA    . GLU D 2 155 ? -10.438 24.558  34.690 1.00 11.65 ? 156  GLU C CA    1 
ATOM   8077  C  C     . GLU D 2 155 ? -11.932 24.421  34.926 1.00 11.49 ? 156  GLU C C     1 
ATOM   8078  O  O     . GLU D 2 155 ? -12.695 24.213  33.998 1.00 12.32 ? 156  GLU C O     1 
ATOM   8079  C  CB    . GLU D 2 155 ? -10.073 26.027  34.526 1.00 11.78 ? 156  GLU C CB    1 
ATOM   8080  C  CG    . GLU D 2 155 ? -10.659 26.656  33.286 1.00 12.46 ? 156  GLU C CG    1 
ATOM   8081  C  CD    . GLU D 2 155 ? -10.669 28.156  33.328 1.00 12.48 ? 156  GLU C CD    1 
ATOM   8082  O  OE1   . GLU D 2 155 ? -11.083 28.733  32.323 1.00 13.40 ? 156  GLU C OE1   1 
ATOM   8083  O  OE2   . GLU D 2 155 ? -10.333 28.755  34.358 1.00 10.97 ? 156  GLU C OE2   1 
ATOM   8084  N  N     . PRO D 2 156 ? -12.341 24.554  36.249 1.00 10.72 ? 157  PRO C N     1 
ATOM   8085  C  CA    . PRO D 2 156 ? -13.799 24.456  36.444 1.00 10.15 ? 157  PRO C CA    1 
ATOM   8086  C  C     . PRO D 2 156 ? -14.557 25.660  35.910 1.00 10.73 ? 157  PRO C C     1 
ATOM   8087  O  O     . PRO D 2 156 ? -14.065 26.779  35.948 1.00 10.35 ? 157  PRO C O     1 
ATOM   8088  C  CB    . PRO D 2 156 ? -13.952 24.375  37.952 1.00 10.00 ? 157  PRO C CB    1 
ATOM   8089  C  CG    . PRO D 2 156 ? -12.835 25.146  38.476 1.00 10.55 ? 157  PRO C CG    1 
ATOM   8090  C  CD    . PRO D 2 156 ? -11.701 24.739  37.616 1.00 10.20 ? 157  PRO C CD    1 
ATOM   8091  N  N     . SER D 2 157 ? -15.758 25.414  35.408 1.00 10.84 ? 158  SER C N     1 
ATOM   8092  C  CA    . SER D 2 157 ? -16.610 26.458  34.861 1.00 10.45 ? 158  SER C CA    1 
ATOM   8093  C  C     . SER D 2 157 ? -17.351 27.127  35.995 1.00 10.60 ? 158  SER C C     1 
ATOM   8094  O  O     . SER D 2 157 ? -17.686 28.288  35.925 1.00 11.36 ? 158  SER C O     1 
ATOM   8095  C  CB    . SER D 2 157 ? -17.581 25.891  33.822 1.00 10.35 ? 158  SER C CB    1 
ATOM   8096  O  OG    . SER D 2 157 ? -18.535 25.028  34.395 1.00 9.83  ? 158  SER C OG    1 
ATOM   8097  N  N     . VAL D 2 158 ? -17.601 26.356  37.034 1.00 9.44  ? 159  VAL C N     1 
ATOM   8098  C  CA    . VAL D 2 158 ? -18.276 26.825  38.225 1.00 9.10  ? 159  VAL C CA    1 
ATOM   8099  C  C     . VAL D 2 158 ? -17.907 25.910  39.388 1.00 8.97  ? 159  VAL C C     1 
ATOM   8100  O  O     . VAL D 2 158 ? -17.425 24.833  39.178 1.00 8.44  ? 159  VAL C O     1 
ATOM   8101  C  CB    . VAL D 2 158 ? -19.808 26.886  38.022 1.00 8.81  ? 159  VAL C CB    1 
ATOM   8102  C  CG1   . VAL D 2 158 ? -20.385 25.526  37.740 1.00 8.72  ? 159  VAL C CG1   1 
ATOM   8103  C  CG2   . VAL D 2 158 ? -20.517 27.545  39.188 1.00 9.11  ? 159  VAL C CG2   1 
ATOM   8104  N  N     . LEU D 2 159 ? -18.122 26.364  40.611 1.00 8.56  ? 160  LEU C N     1 
ATOM   8105  C  CA    . LEU D 2 159 ? -17.811 25.552  41.780 1.00 8.11  ? 160  LEU C CA    1 
ATOM   8106  C  C     . LEU D 2 159 ? -19.003 24.830  42.428 1.00 8.29  ? 160  LEU C C     1 
ATOM   8107  O  O     . LEU D 2 159 ? -20.118 25.310  42.387 1.00 8.65  ? 160  LEU C O     1 
ATOM   8108  C  CB    . LEU D 2 159 ? -17.083 26.369  42.852 1.00 7.88  ? 160  LEU C CB    1 
ATOM   8109  C  CG    . LEU D 2 159 ? -15.728 27.033  42.626 1.00 7.44  ? 160  LEU C CG    1 
ATOM   8110  C  CD1   . LEU D 2 159 ? -15.024 27.210  43.949 1.00 7.49  ? 160  LEU C CD1   1 
ATOM   8111  C  CD2   . LEU D 2 159 ? -14.891 26.183  41.724 1.00 7.97  ? 160  LEU C CD2   1 
ATOM   8112  N  N     . PRO D 2 160 ? -18.695 23.597  43.033 1.00 8.27  ? 161  PRO C N     1 
ATOM   8113  C  CA    . PRO D 2 160 ? -19.821 22.943  43.706 1.00 8.13  ? 161  PRO C CA    1 
ATOM   8114  C  C     . PRO D 2 160 ? -20.612 23.889  44.624 1.00 8.36  ? 161  PRO C C     1 
ATOM   8115  O  O     . PRO D 2 160 ? -21.848 23.818  44.661 1.00 8.58  ? 161  PRO C O     1 
ATOM   8116  C  CB    . PRO D 2 160 ? -19.143 21.831  44.512 1.00 7.77  ? 161  PRO C CB    1 
ATOM   8117  C  CG    . PRO D 2 160 ? -17.968 21.458  43.692 1.00 7.58  ? 161  PRO C CG    1 
ATOM   8118  C  CD    . PRO D 2 160 ? -17.466 22.770  43.121 1.00 7.92  ? 161  PRO C CD    1 
ATOM   8119  N  N     . ALA D 2 161 ? -19.900 24.765  45.343 1.00 8.32  ? 162  ALA C N     1 
ATOM   8120  C  CA    . ALA D 2 161 ? -20.497 25.760  46.238 1.00 8.31  ? 162  ALA C CA    1 
ATOM   8121  C  C     . ALA D 2 161 ? -21.612 25.183  47.117 1.00 8.46  ? 162  ALA C C     1 
ATOM   8122  O  O     . ALA D 2 161 ? -22.798 25.366  46.829 1.00 8.10  ? 162  ALA C O     1 
ATOM   8123  C  CB    . ALA D 2 161 ? -20.999 26.964  45.437 1.00 8.37  ? 162  ALA C CB    1 
ATOM   8124  N  N     . ARG D 2 162 ? -21.225 24.503  48.198 1.00 8.80  ? 163  ARG C N     1 
ATOM   8125  C  CA    . ARG D 2 162 ? -22.197 23.848  49.074 1.00 9.41  ? 163  ARG C CA    1 
ATOM   8126  C  C     . ARG D 2 162 ? -22.853 24.773  50.109 1.00 10.12 ? 163  ARG C C     1 
ATOM   8127  O  O     . ARG D 2 162 ? -23.517 24.312  51.049 1.00 10.02 ? 163  ARG C O     1 
ATOM   8128  C  CB    . ARG D 2 162 ? -21.618 22.574  49.717 1.00 10.04 ? 163  ARG C CB    1 
ATOM   8129  C  CG    . ARG D 2 162 ? -21.020 21.557  48.717 1.00 10.44 ? 163  ARG C CG    1 
ATOM   8130  C  CD    . ARG D 2 162 ? -22.003 21.079  47.633 1.00 10.82 ? 163  ARG C CD    1 
ATOM   8131  N  NE    . ARG D 2 162 ? -23.264 20.646  48.218 1.00 11.04 ? 163  ARG C NE    1 
ATOM   8132  C  CZ    . ARG D 2 162 ? -23.473 19.461  48.781 1.00 9.96  ? 163  ARG C CZ    1 
ATOM   8133  N  NH1   . ARG D 2 162 ? -22.501 18.569  48.832 1.00 9.73  ? 163  ARG C NH1   1 
ATOM   8134  N  NH2   . ARG D 2 162 ? -24.657 19.180  49.305 1.00 9.43  ? 163  ARG C NH2   1 
ATOM   8135  N  N     . PHE D 2 163 ? -22.670 26.078  49.912 1.00 10.48 ? 164  PHE C N     1 
ATOM   8136  C  CA    . PHE D 2 163 ? -23.352 27.113  50.693 1.00 10.57 ? 164  PHE C CA    1 
ATOM   8137  C  C     . PHE D 2 163 ? -23.638 28.271  49.723 1.00 10.38 ? 164  PHE C C     1 
ATOM   8138  O  O     . PHE D 2 163 ? -22.881 28.466  48.770 1.00 10.47 ? 164  PHE C O     1 
ATOM   8139  C  CB    . PHE D 2 163 ? -22.568 27.535  51.947 1.00 10.33 ? 164  PHE C CB    1 
ATOM   8140  C  CG    . PHE D 2 163 ? -21.297 28.283  51.664 1.00 11.12 ? 164  PHE C CG    1 
ATOM   8141  C  CD1   . PHE D 2 163 ? -21.303 29.672  51.562 1.00 11.30 ? 164  PHE C CD1   1 
ATOM   8142  C  CD2   . PHE D 2 163 ? -20.088 27.603  51.531 1.00 11.13 ? 164  PHE C CD2   1 
ATOM   8143  C  CE1   . PHE D 2 163 ? -20.127 30.378  51.316 1.00 11.52 ? 164  PHE C CE1   1 
ATOM   8144  C  CE2   . PHE D 2 163 ? -18.905 28.297  51.283 1.00 11.75 ? 164  PHE C CE2   1 
ATOM   8145  C  CZ    . PHE D 2 163 ? -18.919 29.688  51.174 1.00 11.56 ? 164  PHE C CZ    1 
ATOM   8146  N  N     . PRO D 2 164 ? -24.751 29.010  49.927 1.00 10.60 ? 165  PRO C N     1 
ATOM   8147  C  CA    . PRO D 2 164 ? -25.093 30.106  48.996 1.00 10.97 ? 165  PRO C CA    1 
ATOM   8148  C  C     . PRO D 2 164 ? -24.105 31.279  49.065 1.00 11.56 ? 165  PRO C C     1 
ATOM   8149  O  O     . PRO D 2 164 ? -24.382 32.292  49.703 1.00 11.43 ? 165  PRO C O     1 
ATOM   8150  C  CB    . PRO D 2 164 ? -26.501 30.520  49.441 1.00 10.59 ? 165  PRO C CB    1 
ATOM   8151  C  CG    . PRO D 2 164 ? -26.593 30.098  50.868 1.00 10.64 ? 165  PRO C CG    1 
ATOM   8152  C  CD    . PRO D 2 164 ? -25.746 28.871  51.007 1.00 10.22 ? 165  PRO C CD    1 
ATOM   8153  N  N     . ASN D 2 165 ? -22.965 31.133  48.391 1.00 12.92 ? 166  ASN C N     1 
ATOM   8154  C  CA    . ASN D 2 165 ? -21.893 32.135  48.429 1.00 12.94 ? 166  ASN C CA    1 
ATOM   8155  C  C     . ASN D 2 165 ? -22.221 33.503  47.822 1.00 12.93 ? 166  ASN C C     1 
ATOM   8156  O  O     . ASN D 2 165 ? -21.805 34.527  48.366 1.00 13.95 ? 166  ASN C O     1 
ATOM   8157  C  CB    . ASN D 2 165 ? -20.620 31.581  47.794 1.00 13.32 ? 166  ASN C CB    1 
ATOM   8158  C  CG    . ASN D 2 165 ? -19.425 32.491  48.000 1.00 13.05 ? 166  ASN C CG    1 
ATOM   8159  O  OD1   . ASN D 2 165 ? -19.045 32.789  49.136 1.00 12.44 ? 166  ASN C OD1   1 
ATOM   8160  N  ND2   . ASN D 2 165 ? -18.806 32.909  46.900 1.00 11.98 ? 166  ASN C ND2   1 
ATOM   8161  N  N     . LEU D 2 166 ? -22.952 33.533  46.710 1.00 12.11 ? 167  LEU C N     1 
ATOM   8162  C  CA    . LEU D 2 166 ? -23.312 34.809  46.085 1.00 11.72 ? 167  LEU C CA    1 
ATOM   8163  C  C     . LEU D 2 166 ? -23.917 35.793  47.091 1.00 11.64 ? 167  LEU C C     1 
ATOM   8164  O  O     . LEU D 2 166 ? -23.447 36.928  47.206 1.00 12.45 ? 167  LEU C O     1 
ATOM   8165  C  CB    . LEU D 2 166 ? -24.261 34.625  44.889 1.00 11.53 ? 167  LEU C CB    1 
ATOM   8166  C  CG    . LEU D 2 166 ? -24.706 35.928  44.203 1.00 11.69 ? 167  LEU C CG    1 
ATOM   8167  C  CD1   . LEU D 2 166 ? -23.528 36.732  43.671 1.00 10.78 ? 167  LEU C CD1   1 
ATOM   8168  C  CD2   . LEU D 2 166 ? -25.735 35.677  43.090 1.00 12.19 ? 167  LEU C CD2   1 
ATOM   8169  N  N     . LEU D 2 167 ? -24.941 35.351  47.819 1.00 10.53 ? 168  LEU C N     1 
ATOM   8170  C  CA    . LEU D 2 167 ? -25.616 36.209  48.797 1.00 10.20 ? 168  LEU C CA    1 
ATOM   8171  C  C     . LEU D 2 167 ? -24.871 36.345  50.132 1.00 10.73 ? 168  LEU C C     1 
ATOM   8172  O  O     . LEU D 2 167 ? -24.989 37.368  50.791 1.00 10.34 ? 168  LEU C O     1 
ATOM   8173  C  CB    . LEU D 2 167 ? -27.058 35.733  49.024 1.00 9.16  ? 168  LEU C CB    1 
ATOM   8174  C  CG    . LEU D 2 167 ? -27.961 35.813  47.783 1.00 8.25  ? 168  LEU C CG    1 
ATOM   8175  C  CD1   . LEU D 2 167 ? -29.239 35.015  47.971 1.00 7.85  ? 168  LEU C CD1   1 
ATOM   8176  C  CD2   . LEU D 2 167 ? -28.259 37.255  47.367 1.00 8.07  ? 168  LEU C CD2   1 
ATOM   8177  N  N     . ALA D 2 168 ? -24.100 35.326  50.507 1.00 10.34 ? 169  ALA C N     1 
ATOM   8178  C  CA    . ALA D 2 168 ? -23.366 35.326  51.773 1.00 10.65 ? 169  ALA C CA    1 
ATOM   8179  C  C     . ALA D 2 168 ? -22.227 36.340  51.816 1.00 10.61 ? 169  ALA C C     1 
ATOM   8180  O  O     . ALA D 2 168 ? -22.055 37.044  52.807 1.00 9.29  ? 169  ALA C O     1 
ATOM   8181  C  CB    . ALA D 2 168 ? -22.835 33.920  52.075 1.00 9.92  ? 169  ALA C CB    1 
ATOM   8182  N  N     . ASN D 2 169 ? -21.451 36.393  50.735 1.00 11.29 ? 170  ASN C N     1 
ATOM   8183  C  CA    . ASN D 2 169 ? -20.316 37.298  50.645 1.00 10.87 ? 170  ASN C CA    1 
ATOM   8184  C  C     . ASN D 2 169 ? -20.564 38.523  49.769 1.00 10.24 ? 170  ASN C C     1 
ATOM   8185  O  O     . ASN D 2 169 ? -19.805 39.489  49.818 1.00 10.44 ? 170  ASN C O     1 
ATOM   8186  C  CB    . ASN D 2 169 ? -19.069 36.533  50.195 1.00 11.15 ? 170  ASN C CB    1 
ATOM   8187  C  CG    . ASN D 2 169 ? -18.387 35.792  51.341 1.00 11.62 ? 170  ASN C CG    1 
ATOM   8188  O  OD1   . ASN D 2 169 ? -18.120 36.371  52.402 1.00 12.01 ? 170  ASN C OD1   1 
ATOM   8189  N  ND2   . ASN D 2 169 ? -18.066 34.517  51.122 1.00 10.95 ? 170  ASN C ND2   1 
ATOM   8190  N  N     . GLY D 2 170 ? -21.634 38.479  48.986 1.00 10.00 ? 171  GLY C N     1 
ATOM   8191  C  CA    . GLY D 2 170 ? -21.983 39.567  48.079 1.00 9.79  ? 171  GLY C CA    1 
ATOM   8192  C  C     . GLY D 2 170 ? -20.924 39.789  47.018 1.00 9.74  ? 171  GLY C C     1 
ATOM   8193  O  O     . GLY D 2 170 ? -19.996 39.004  46.897 1.00 9.02  ? 171  GLY C O     1 
ATOM   8194  N  N     . ALA D 2 171 ? -21.076 40.853  46.240 1.00 10.07 ? 172  ALA C N     1 
ATOM   8195  C  CA    . ALA D 2 171 ? -20.119 41.186  45.190 1.00 10.10 ? 172  ALA C CA    1 
ATOM   8196  C  C     . ALA D 2 171 ? -20.268 42.586  44.604 1.00 10.62 ? 172  ALA C C     1 
ATOM   8197  O  O     . ALA D 2 171 ? -21.351 43.154  44.568 1.00 10.48 ? 172  ALA C O     1 
ATOM   8198  C  CB    . ALA D 2 171 ? -20.179 40.149  44.075 1.00 10.47 ? 172  ALA C CB    1 
ATOM   8199  N  N     . SER D 2 172 ? -19.147 43.133  44.154 1.00 11.11 ? 173  SER C N     1 
ATOM   8200  C  CA    . SER D 2 172 ? -19.100 44.455  43.537 1.00 11.97 ? 173  SER C CA    1 
ATOM   8201  C  C     . SER D 2 172 ? -18.355 44.364  42.211 1.00 12.09 ? 173  SER C C     1 
ATOM   8202  O  O     . SER D 2 172 ? -17.265 43.815  42.145 1.00 11.98 ? 173  SER C O     1 
ATOM   8203  C  CB    . SER D 2 172 ? -18.391 45.433  44.452 1.00 12.93 ? 173  SER C CB    1 
ATOM   8204  O  OG    . SER D 2 172 ? -19.172 45.669  45.603 1.00 17.50 ? 173  SER C OG    1 
ATOM   8205  N  N     . GLY D 2 173 ? -18.940 44.894  41.154 1.00 11.12 ? 174  GLY C N     1 
ATOM   8206  C  CA    . GLY D 2 173 ? -18.308 44.849  39.864 1.00 11.46 ? 174  GLY C CA    1 
ATOM   8207  C  C     . GLY D 2 173 ? -18.705 45.885  38.859 1.00 11.12 ? 174  GLY C C     1 
ATOM   8208  O  O     . GLY D 2 173 ? -19.856 46.110  38.617 1.00 11.37 ? 174  GLY C O     1 
ATOM   8209  N  N     . ILE D 2 174 ? -17.711 46.518  38.263 1.00 10.90 ? 175  ILE C N     1 
ATOM   8210  C  CA    . ILE D 2 174 ? -17.946 47.542  37.269 1.00 10.70 ? 175  ILE C CA    1 
ATOM   8211  C  C     . ILE D 2 174 ? -17.571 46.911  35.945 1.00 11.33 ? 175  ILE C C     1 
ATOM   8212  O  O     . ILE D 2 174 ? -16.474 46.466  35.758 1.00 11.08 ? 175  ILE C O     1 
ATOM   8213  C  CB    . ILE D 2 174 ? -17.040 48.760  37.518 1.00 10.41 ? 175  ILE C CB    1 
ATOM   8214  C  CG1   . ILE D 2 174 ? -17.203 49.290  38.923 1.00 10.35 ? 175  ILE C CG1   1 
ATOM   8215  C  CG2   . ILE D 2 174 ? -17.369 49.910  36.579 1.00 10.51 ? 175  ILE C CG2   1 
ATOM   8216  C  CD1   . ILE D 2 174 ? -16.018 50.144  39.352 1.00 10.11 ? 175  ILE C CD1   1 
ATOM   8217  N  N     . ALA D 2 175 ? -18.512 46.878  35.029 1.00 12.18 ? 176  ALA C N     1 
ATOM   8218  C  CA    . ALA D 2 175 ? -18.288 46.329  33.712 1.00 12.20 ? 176  ALA C CA    1 
ATOM   8219  C  C     . ALA D 2 175 ? -18.498 47.373  32.637 1.00 13.44 ? 176  ALA C C     1 
ATOM   8220  O  O     . ALA D 2 175 ? -18.115 48.522  32.799 1.00 13.84 ? 176  ALA C O     1 
ATOM   8221  C  CB    . ALA D 2 175 ? -19.184 45.127  33.494 1.00 11.35 ? 176  ALA C CB    1 
ATOM   8222  N  N     . VAL D 2 176 ? -19.080 46.977  31.519 1.00 14.03 ? 177  VAL C N     1 
ATOM   8223  C  CA    . VAL D 2 176 ? -19.393 47.892  30.455 1.00 13.16 ? 177  VAL C CA    1 
ATOM   8224  C  C     . VAL D 2 176 ? -20.880 47.824  30.265 1.00 12.48 ? 177  VAL C C     1 
ATOM   8225  O  O     . VAL D 2 176 ? -21.445 46.771  30.074 1.00 13.13 ? 177  VAL C O     1 
ATOM   8226  C  CB    . VAL D 2 176 ? -18.686 47.512  29.158 1.00 13.70 ? 177  VAL C CB    1 
ATOM   8227  C  CG1   . VAL D 2 176 ? -18.814 48.624  28.140 1.00 12.59 ? 177  VAL C CG1   1 
ATOM   8228  C  CG2   . VAL D 2 176 ? -17.226 47.224  29.445 1.00 14.96 ? 177  VAL C CG2   1 
ATOM   8229  N  N     . GLY D 2 177 ? -21.512 48.978  30.373 1.00 12.31 ? 178  GLY C N     1 
ATOM   8230  C  CA    . GLY D 2 177 ? -22.937 49.133  30.179 1.00 11.37 ? 178  GLY C CA    1 
ATOM   8231  C  C     . GLY D 2 177 ? -23.763 48.673  31.338 1.00 11.76 ? 178  GLY C C     1 
ATOM   8232  O  O     . GLY D 2 177 ? -24.966 48.744  31.284 1.00 11.42 ? 178  GLY C O     1 
ATOM   8233  N  N     . MET D 2 178 ? -23.101 48.171  32.369 1.00 11.28 ? 179  MET C N     1 
ATOM   8234  C  CA    . MET D 2 178 ? -23.746 47.704  33.579 1.00 11.04 ? 179  MET C CA    1 
ATOM   8235  C  C     . MET D 2 178 ? -22.729 47.504  34.682 1.00 10.77 ? 179  MET C C     1 
ATOM   8236  O  O     . MET D 2 178 ? -21.547 47.431  34.446 1.00 11.11 ? 179  MET C O     1 
ATOM   8237  C  CB    . MET D 2 178 ? -24.485 46.388  33.321 1.00 11.89 ? 179  MET C CB    1 
ATOM   8238  C  CG    . MET D 2 178 ? -23.622 45.254  32.832 1.00 12.06 ? 179  MET C CG    1 
ATOM   8239  S  SD    . MET D 2 178 ? -24.541 43.953  32.093 1.00 14.13 ? 179  MET C SD    1 
ATOM   8240  C  CE    . MET D 2 178 ? -24.982 44.719  30.516 1.00 13.67 ? 179  MET C CE    1 
ATOM   8241  N  N     . ALA D 2 179 ? -23.223 47.421  35.898 1.00 9.95  ? 180  ALA C N     1 
ATOM   8242  C  CA    . ALA D 2 179 ? -22.415 47.209  37.065 1.00 9.75  ? 180  ALA C CA    1 
ATOM   8243  C  C     . ALA D 2 179 ? -23.197 46.321  38.007 1.00 9.55  ? 180  ALA C C     1 
ATOM   8244  O  O     . ALA D 2 179 ? -24.340 46.042  37.772 1.00 9.07  ? 180  ALA C O     1 
ATOM   8245  C  CB    . ALA D 2 179 ? -22.077 48.529  37.727 1.00 9.27  ? 180  ALA C CB    1 
ATOM   8246  N  N     . THR D 2 180 ? -22.549 45.856  39.064 1.00 9.55  ? 181  THR C N     1 
ATOM   8247  C  CA    . THR D 2 180 ? -23.207 45.022  40.066 1.00 9.39  ? 181  THR C CA    1 
ATOM   8248  C  C     . THR D 2 180 ? -22.847 45.415  41.502 1.00 8.85  ? 181  THR C C     1 
ATOM   8249  O  O     . THR D 2 180 ? -21.737 45.833  41.787 1.00 8.60  ? 181  THR C O     1 
ATOM   8250  C  CB    . THR D 2 180 ? -22.928 43.515  39.840 1.00 9.62  ? 181  THR C CB    1 
ATOM   8251  O  OG1   . THR D 2 180 ? -23.702 42.742  40.756 1.00 10.53 ? 181  THR C OG1   1 
ATOM   8252  C  CG2   . THR D 2 180 ? -21.472 43.195  40.051 1.00 9.55  ? 181  THR C CG2   1 
ATOM   8253  N  N     . ASN D 2 181 ? -23.817 45.283  42.394 1.00 9.24  ? 182  ASN C N     1 
ATOM   8254  C  CA    . ASN D 2 181 ? -23.636 45.603  43.797 1.00 8.98  ? 182  ASN C CA    1 
ATOM   8255  C  C     . ASN D 2 181 ? -24.572 44.771  44.679 1.00 9.33  ? 182  ASN C C     1 
ATOM   8256  O  O     . ASN D 2 181 ? -25.684 45.178  44.962 1.00 8.95  ? 182  ASN C O     1 
ATOM   8257  C  CB    . ASN D 2 181 ? -23.842 47.092  44.041 1.00 8.67  ? 182  ASN C CB    1 
ATOM   8258  C  CG    . ASN D 2 181 ? -23.028 47.600  45.216 1.00 9.56  ? 182  ASN C CG    1 
ATOM   8259  O  OD1   . ASN D 2 181 ? -21.952 47.076  45.512 1.00 9.20  ? 182  ASN C OD1   1 
ATOM   8260  N  ND2   . ASN D 2 181 ? -23.535 48.616  45.892 1.00 8.58  ? 182  ASN C ND2   1 
ATOM   8261  N  N     . ILE D 2 182 ? -24.091 43.608  45.113 1.00 8.82  ? 183  ILE C N     1 
ATOM   8262  C  CA    . ILE D 2 182 ? -24.868 42.691  45.949 1.00 8.45  ? 183  ILE C CA    1 
ATOM   8263  C  C     . ILE D 2 182 ? -24.275 42.674  47.353 1.00 8.63  ? 183  ILE C C     1 
ATOM   8264  O  O     . ILE D 2 182 ? -23.066 42.468  47.505 1.00 8.71  ? 183  ILE C O     1 
ATOM   8265  C  CB    . ILE D 2 182 ? -24.850 41.255  45.366 1.00 8.61  ? 183  ILE C CB    1 
ATOM   8266  C  CG1   . ILE D 2 182 ? -25.305 41.269  43.902 1.00 8.46  ? 183  ILE C CG1   1 
ATOM   8267  C  CG2   . ILE D 2 182 ? -25.693 40.295  46.222 1.00 8.34  ? 183  ILE C CG2   1 
ATOM   8268  C  CD1   . ILE D 2 182 ? -25.153 39.941  43.199 1.00 8.62  ? 183  ILE C CD1   1 
ATOM   8269  N  N     . PRO D 2 183 ? -25.114 42.878  48.389 1.00 8.44  ? 184  PRO C N     1 
ATOM   8270  C  CA    . PRO D 2 183 ? -24.574 42.916  49.750 1.00 8.30  ? 184  PRO C CA    1 
ATOM   8271  C  C     . PRO D 2 183 ? -24.439 41.526  50.382 1.00 7.97  ? 184  PRO C C     1 
ATOM   8272  O  O     . PRO D 2 183 ? -25.158 40.609  49.989 1.00 7.77  ? 184  PRO C O     1 
ATOM   8273  C  CB    . PRO D 2 183 ? -25.619 43.751  50.502 1.00 8.31  ? 184  PRO C CB    1 
ATOM   8274  C  CG    . PRO D 2 183 ? -26.907 43.455  49.812 1.00 8.30  ? 184  PRO C CG    1 
ATOM   8275  C  CD    . PRO D 2 183 ? -26.576 43.067  48.375 1.00 8.39  ? 184  PRO C CD    1 
ATOM   8276  N  N     . PRO D 2 184 ? -23.513 41.368  51.350 1.00 7.74  ? 185  PRO C N     1 
ATOM   8277  C  CA    . PRO D 2 184 ? -23.346 40.078  52.038 1.00 7.54  ? 185  PRO C CA    1 
ATOM   8278  C  C     . PRO D 2 184 ? -24.520 39.783  52.975 1.00 7.61  ? 185  PRO C C     1 
ATOM   8279  O  O     . PRO D 2 184 ? -25.279 40.684  53.321 1.00 8.00  ? 185  PRO C O     1 
ATOM   8280  C  CB    . PRO D 2 184 ? -22.056 40.269  52.846 1.00 7.12  ? 185  PRO C CB    1 
ATOM   8281  C  CG    . PRO D 2 184 ? -21.983 41.742  53.088 1.00 7.41  ? 185  PRO C CG    1 
ATOM   8282  C  CD    . PRO D 2 184 ? -22.565 42.386  51.846 1.00 7.31  ? 185  PRO C CD    1 
ATOM   8283  N  N     . HIS D 2 185 ? -24.665 38.530  53.383 1.00 7.72  ? 186  HIS C N     1 
ATOM   8284  C  CA    . HIS D 2 185 ? -25.761 38.140  54.255 1.00 8.08  ? 186  HIS C CA    1 
ATOM   8285  C  C     . HIS D 2 185 ? -25.326 37.168  55.335 1.00 8.50  ? 186  HIS C C     1 
ATOM   8286  O  O     . HIS D 2 185 ? -24.233 36.604  55.276 1.00 7.94  ? 186  HIS C O     1 
ATOM   8287  C  CB    . HIS D 2 185 ? -26.883 37.501  53.436 1.00 8.17  ? 186  HIS C CB    1 
ATOM   8288  C  CG    . HIS D 2 185 ? -27.605 38.461  52.547 1.00 8.32  ? 186  HIS C CG    1 
ATOM   8289  N  ND1   . HIS D 2 185 ? -27.086 38.902  51.351 1.00 8.48  ? 186  HIS C ND1   1 
ATOM   8290  C  CD2   . HIS D 2 185 ? -28.815 39.052  52.682 1.00 8.52  ? 186  HIS C CD2   1 
ATOM   8291  C  CE1   . HIS D 2 185 ? -27.943 39.733  50.785 1.00 9.01  ? 186  HIS C CE1   1 
ATOM   8292  N  NE2   . HIS D 2 185 ? -28.998 39.845  51.575 1.00 9.30  ? 186  HIS C NE2   1 
ATOM   8293  N  N     . ASN D 2 186 ? -26.203 36.981  56.323 1.00 8.80  ? 187  ASN C N     1 
ATOM   8294  C  CA    . ASN D 2 186 ? -25.948 36.033  57.390 1.00 9.32  ? 187  ASN C CA    1 
ATOM   8295  C  C     . ASN D 2 186 ? -26.193 34.633  56.859 1.00 9.56  ? 187  ASN C C     1 
ATOM   8296  O  O     . ASN D 2 186 ? -27.248 34.369  56.268 1.00 10.58 ? 187  ASN C O     1 
ATOM   8297  C  CB    . ASN D 2 186 ? -26.852 36.349  58.582 1.00 9.25  ? 187  ASN C CB    1 
ATOM   8298  C  CG    . ASN D 2 186 ? -26.681 35.356  59.714 1.00 8.88  ? 187  ASN C CG    1 
ATOM   8299  O  OD1   . ASN D 2 186 ? -27.226 34.244  59.674 1.00 8.37  ? 187  ASN C OD1   1 
ATOM   8300  N  ND2   . ASN D 2 186 ? -25.939 35.757  60.741 1.00 8.02  ? 187  ASN C ND2   1 
ATOM   8301  N  N     . LEU D 2 187 ? -25.221 33.744  57.064 1.00 9.97  ? 188  LEU C N     1 
ATOM   8302  C  CA    . LEU D 2 187 ? -25.294 32.368  56.543 1.00 10.87 ? 188  LEU C CA    1 
ATOM   8303  C  C     . LEU D 2 187 ? -26.444 31.537  57.128 1.00 11.50 ? 188  LEU C C     1 
ATOM   8304  O  O     . LEU D 2 187 ? -27.071 30.750  56.408 1.00 11.92 ? 188  LEU C O     1 
ATOM   8305  C  CB    . LEU D 2 187 ? -23.946 31.642  56.689 1.00 11.10 ? 188  LEU C CB    1 
ATOM   8306  C  CG    . LEU D 2 187 ? -23.750 30.252  56.039 1.00 12.54 ? 188  LEU C CG    1 
ATOM   8307  C  CD1   . LEU D 2 187 ? -24.029 30.231  54.536 1.00 11.73 ? 188  LEU C CD1   1 
ATOM   8308  C  CD2   . LEU D 2 187 ? -22.345 29.717  56.333 1.00 11.69 ? 188  LEU C CD2   1 
ATOM   8309  N  N     . THR D 2 188 ? -26.719 31.727  58.418 1.00 11.39 ? 189  THR C N     1 
ATOM   8310  C  CA    . THR D 2 188 ? -27.782 30.995  59.101 1.00 12.03 ? 189  THR C CA    1 
ATOM   8311  C  C     . THR D 2 188 ? -29.134 31.327  58.466 1.00 11.09 ? 189  THR C C     1 
ATOM   8312  O  O     . THR D 2 188 ? -29.938 30.434  58.198 1.00 10.96 ? 189  THR C O     1 
ATOM   8313  C  CB    . THR D 2 188 ? -27.791 31.311  60.620 1.00 13.27 ? 189  THR C CB    1 
ATOM   8314  O  OG1   . THR D 2 188 ? -26.455 31.213  61.140 1.00 14.95 ? 189  THR C OG1   1 
ATOM   8315  C  CG2   . THR D 2 188 ? -28.694 30.345  61.381 1.00 14.05 ? 189  THR C CG2   1 
ATOM   8316  N  N     . GLU D 2 189 ? -29.353 32.614  58.201 1.00 10.94 ? 190  GLU C N     1 
ATOM   8317  C  CA    . GLU D 2 189 ? -30.582 33.119  57.584 1.00 10.10 ? 190  GLU C CA    1 
ATOM   8318  C  C     . GLU D 2 189 ? -30.750 32.625  56.140 1.00 9.11  ? 190  GLU C C     1 
ATOM   8319  O  O     . GLU D 2 189 ? -31.843 32.226  55.745 1.00 8.88  ? 190  GLU C O     1 
ATOM   8320  C  CB    . GLU D 2 189 ? -30.615 34.657  57.639 1.00 10.77 ? 190  GLU C CB    1 
ATOM   8321  C  CG    . GLU D 2 189 ? -30.597 35.237  59.077 1.00 12.21 ? 190  GLU C CG    1 
ATOM   8322  C  CD    . GLU D 2 189 ? -30.696 36.771  59.143 1.00 12.80 ? 190  GLU C CD    1 
ATOM   8323  O  OE1   . GLU D 2 189 ? -31.161 37.405  58.174 1.00 14.76 ? 190  GLU C OE1   1 
ATOM   8324  O  OE2   . GLU D 2 189 ? -30.313 37.352  60.171 1.00 13.26 ? 190  GLU C OE2   1 
ATOM   8325  N  N     . LEU D 2 190 ? -29.665 32.645  55.366 1.00 8.58  ? 191  LEU C N     1 
ATOM   8326  C  CA    . LEU D 2 190 ? -29.700 32.206  53.965 1.00 8.10  ? 191  LEU C CA    1 
ATOM   8327  C  C     . LEU D 2 190 ? -30.082 30.749  53.816 1.00 8.37  ? 191  LEU C C     1 
ATOM   8328  O  O     . LEU D 2 190 ? -30.971 30.411  53.031 1.00 7.48  ? 191  LEU C O     1 
ATOM   8329  C  CB    . LEU D 2 190 ? -28.360 32.442  53.271 1.00 7.89  ? 191  LEU C CB    1 
ATOM   8330  C  CG    . LEU D 2 190 ? -27.887 33.862  52.991 1.00 7.51  ? 191  LEU C CG    1 
ATOM   8331  C  CD1   . LEU D 2 190 ? -26.556 33.779  52.239 1.00 7.49  ? 191  LEU C CD1   1 
ATOM   8332  C  CD2   . LEU D 2 190 ? -28.926 34.639  52.169 1.00 7.63  ? 191  LEU C CD2   1 
ATOM   8333  N  N     . ILE D 2 191 ? -29.395 29.892  54.573 1.00 9.02  ? 192  ILE C N     1 
ATOM   8334  C  CA    . ILE D 2 191 ? -29.661 28.453  54.544 1.00 9.88  ? 192  ILE C CA    1 
ATOM   8335  C  C     . ILE D 2 191 ? -31.100 28.153  54.982 1.00 10.13 ? 192  ILE C C     1 
ATOM   8336  O  O     . ILE D 2 191 ? -31.771 27.328  54.346 1.00 11.55 ? 192  ILE C O     1 
ATOM   8337  C  CB    . ILE D 2 191 ? -28.593 27.645  55.342 1.00 10.22 ? 192  ILE C CB    1 
ATOM   8338  C  CG1   . ILE D 2 191 ? -27.250 27.696  54.587 1.00 10.10 ? 192  ILE C CG1   1 
ATOM   8339  C  CG2   . ILE D 2 191 ? -29.048 26.181  55.564 1.00 9.92  ? 192  ILE C CG2   1 
ATOM   8340  C  CD1   . ILE D 2 191 ? -26.055 27.117  55.335 1.00 9.88  ? 192  ILE C CD1   1 
ATOM   8341  N  N     . ASN D 2 192 ? -31.570 28.830  56.036 1.00 9.42  ? 193  ASN C N     1 
ATOM   8342  C  CA    . ASN D 2 192 ? -32.952 28.682  56.489 1.00 9.38  ? 193  ASN C CA    1 
ATOM   8343  C  C     . ASN D 2 192 ? -33.920 29.061  55.381 1.00 9.72  ? 193  ASN C C     1 
ATOM   8344  O  O     . ASN D 2 192 ? -34.930 28.372  55.153 1.00 9.22  ? 193  ASN C O     1 
ATOM   8345  C  CB    . ASN D 2 192 ? -33.234 29.540  57.727 1.00 9.42  ? 193  ASN C CB    1 
ATOM   8346  C  CG    . ASN D 2 192 ? -32.673 28.934  58.999 1.00 9.60  ? 193  ASN C CG    1 
ATOM   8347  O  OD1   . ASN D 2 192 ? -32.350 27.740  59.056 1.00 10.12 ? 193  ASN C OD1   1 
ATOM   8348  N  ND2   . ASN D 2 192 ? -32.568 29.746  60.030 1.00 9.23  ? 193  ASN C ND2   1 
ATOM   8349  N  N     . GLY D 2 193 ? -33.593 30.159  54.691 1.00 9.71  ? 194  GLY C N     1 
ATOM   8350  C  CA    . GLY D 2 193 ? -34.383 30.649  53.568 1.00 10.08 ? 194  GLY C CA    1 
ATOM   8351  C  C     . GLY D 2 193 ? -34.434 29.602  52.471 1.00 10.98 ? 194  GLY C C     1 
ATOM   8352  O  O     . GLY D 2 193 ? -35.500 29.340  51.908 1.00 11.34 ? 194  GLY C O     1 
ATOM   8353  N  N     . VAL D 2 194 ? -33.279 28.993  52.189 1.00 11.41 ? 195  VAL C N     1 
ATOM   8354  C  CA    . VAL D 2 194 ? -33.165 27.953  51.173 1.00 11.68 ? 195  VAL C CA    1 
ATOM   8355  C  C     . VAL D 2 194 ? -34.010 26.733  51.574 1.00 12.31 ? 195  VAL C C     1 
ATOM   8356  O  O     . VAL D 2 194 ? -34.672 26.126  50.727 1.00 12.12 ? 195  VAL C O     1 
ATOM   8357  C  CB    . VAL D 2 194 ? -31.677 27.558  50.882 1.00 11.78 ? 195  VAL C CB    1 
ATOM   8358  C  CG1   . VAL D 2 194 ? -31.593 26.449  49.842 1.00 12.29 ? 195  VAL C CG1   1 
ATOM   8359  C  CG2   . VAL D 2 194 ? -30.880 28.745  50.402 1.00 11.13 ? 195  VAL C CG2   1 
ATOM   8360  N  N     . LEU D 2 195 ? -34.014 26.404  52.866 1.00 12.66 ? 196  LEU C N     1 
ATOM   8361  C  CA    . LEU D 2 195 ? -34.787 25.254  53.356 1.00 12.98 ? 196  LEU C CA    1 
ATOM   8362  C  C     . LEU D 2 195 ? -36.292 25.437  53.156 1.00 14.22 ? 196  LEU C C     1 
ATOM   8363  O  O     . LEU D 2 195 ? -36.995 24.486  52.803 1.00 16.72 ? 196  LEU C O     1 
ATOM   8364  C  CB    . LEU D 2 195 ? -34.448 24.919  54.813 1.00 11.83 ? 196  LEU C CB    1 
ATOM   8365  C  CG    . LEU D 2 195 ? -33.059 24.323  55.078 1.00 11.35 ? 196  LEU C CG    1 
ATOM   8366  C  CD1   . LEU D 2 195 ? -32.858 24.084  56.560 1.00 11.60 ? 196  LEU C CD1   1 
ATOM   8367  C  CD2   . LEU D 2 195 ? -32.851 23.024  54.307 1.00 11.32 ? 196  LEU C CD2   1 
ATOM   8368  N  N     . SER D 2 196 ? -36.769 26.659  53.370 1.00 13.48 ? 197  SER C N     1 
ATOM   8369  C  CA    . SER D 2 196 ? -38.167 27.011  53.146 1.00 13.19 ? 197  SER C CA    1 
ATOM   8370  C  C     . SER D 2 196 ? -38.549 26.886  51.671 1.00 13.13 ? 197  SER C C     1 
ATOM   8371  O  O     . SER D 2 196 ? -39.587 26.316  51.342 1.00 15.29 ? 197  SER C O     1 
ATOM   8372  C  CB    . SER D 2 196 ? -38.435 28.435  53.638 1.00 12.16 ? 197  SER C CB    1 
ATOM   8373  O  OG    . SER D 2 196 ? -38.145 28.529  55.017 1.00 11.38 ? 197  SER C OG    1 
ATOM   8374  N  N     . LEU D 2 197 ? -37.702 27.418  50.796 1.00 13.33 ? 198  LEU C N     1 
ATOM   8375  C  CA    . LEU D 2 197 ? -37.912 27.357  49.345 1.00 13.73 ? 198  LEU C CA    1 
ATOM   8376  C  C     . LEU D 2 197 ? -38.049 25.922  48.828 1.00 13.73 ? 198  LEU C C     1 
ATOM   8377  O  O     . LEU D 2 197 ? -38.876 25.653  47.959 1.00 14.10 ? 198  LEU C O     1 
ATOM   8378  C  CB    . LEU D 2 197 ? -36.767 28.074  48.601 1.00 13.38 ? 198  LEU C CB    1 
ATOM   8379  C  CG    . LEU D 2 197 ? -36.822 28.095  47.067 1.00 13.54 ? 198  LEU C CG    1 
ATOM   8380  C  CD1   . LEU D 2 197 ? -38.016 28.902  46.552 1.00 13.07 ? 198  LEU C CD1   1 
ATOM   8381  C  CD2   . LEU D 2 197 ? -35.532 28.621  46.466 1.00 14.78 ? 198  LEU C CD2   1 
ATOM   8382  N  N     . SER D 2 198 ? -37.229 25.020  49.370 1.00 14.64 ? 199  SER C N     1 
ATOM   8383  C  CA    . SER D 2 198 ? -37.224 23.610  48.969 1.00 16.42 ? 199  SER C CA    1 
ATOM   8384  C  C     . SER D 2 198 ? -38.502 22.884  49.380 1.00 17.22 ? 199  SER C C     1 
ATOM   8385  O  O     . SER D 2 198 ? -38.839 21.839  48.806 1.00 20.04 ? 199  SER C O     1 
ATOM   8386  C  CB    . SER D 2 198 ? -36.001 22.886  49.555 1.00 16.59 ? 199  SER C CB    1 
ATOM   8387  O  OG    . SER D 2 198 ? -36.050 22.850  50.979 1.00 17.48 ? 199  SER C OG    1 
ATOM   8388  N  N     . LYS D 2 199 ? -39.199 23.431  50.377 1.00 16.66 ? 200  LYS C N     1 
ATOM   8389  C  CA    . LYS D 2 199 ? -40.452 22.858  50.861 1.00 17.58 ? 200  LYS C CA    1 
ATOM   8390  C  C     . LYS D 2 199 ? -41.672 23.549  50.263 1.00 18.74 ? 200  LYS C C     1 
ATOM   8391  O  O     . LYS D 2 199 ? -42.805 23.091  50.442 1.00 18.65 ? 200  LYS C O     1 
ATOM   8392  C  CB    . LYS D 2 199 ? -40.507 22.912  52.383 1.00 18.14 ? 200  LYS C CB    1 
ATOM   8393  C  CG    . LYS D 2 199 ? -39.524 21.982  53.060 1.00 18.89 ? 200  LYS C CG    1 
ATOM   8394  C  CD    . LYS D 2 199 ? -39.475 22.250  54.537 1.00 19.70 ? 200  LYS C CD    1 
ATOM   8395  C  CE    . LYS D 2 199 ? -38.378 21.407  55.170 1.00 22.09 ? 200  LYS C CE    1 
ATOM   8396  N  NZ    . LYS D 2 199 ? -38.157 21.821  56.590 1.00 24.95 ? 200  LYS C NZ    1 
ATOM   8397  N  N     . ASN D 2 200 ? -41.401 24.669  49.578 1.00 18.92 ? 201  ASN C N     1 
ATOM   8398  C  CA    . ASN D 2 200 ? -42.385 25.545  48.925 1.00 18.98 ? 201  ASN C CA    1 
ATOM   8399  C  C     . ASN D 2 200 ? -41.854 26.349  47.724 1.00 19.72 ? 201  ASN C C     1 
ATOM   8400  O  O     . ASN D 2 200 ? -41.290 27.440  47.871 1.00 21.30 ? 201  ASN C O     1 
ATOM   8401  C  CB    . ASN D 2 200 ? -43.048 26.476  49.942 1.00 18.64 ? 201  ASN C CB    1 
ATOM   8402  C  CG    . ASN D 2 200 ? -44.244 27.206  49.362 1.00 19.09 ? 201  ASN C CG    1 
ATOM   8403  O  OD1   . ASN D 2 200 ? -44.704 26.901  48.265 1.00 20.30 ? 201  ASN C OD1   1 
ATOM   8404  N  ND2   . ASN D 2 200 ? -44.751 28.177  50.095 1.00 17.22 ? 201  ASN C ND2   1 
ATOM   8405  N  N     . PRO D 2 201 ? -42.069 25.728  46.491 1.00 19.53 ? 202  PRO C N     1 
ATOM   8406  C  CA    . PRO D 2 201 ? -41.594 26.426  45.292 1.00 19.57 ? 202  PRO C CA    1 
ATOM   8407  C  C     . PRO D 2 201 ? -42.307 27.752  45.061 1.00 19.94 ? 202  PRO C C     1 
ATOM   8408  O  O     . PRO D 2 201 ? -41.754 28.647  44.416 1.00 18.38 ? 202  PRO C O     1 
ATOM   8409  C  CB    . PRO D 2 201 ? -41.940 25.454  44.145 1.00 18.25 ? 202  PRO C CB    1 
ATOM   8410  C  CG    . PRO D 2 201 ? -42.000 24.127  44.797 1.00 19.36 ? 202  PRO C CG    1 
ATOM   8411  C  CD    . PRO D 2 201 ? -42.635 24.408  46.135 1.00 19.97 ? 202  PRO C CD    1 
ATOM   8412  N  N     . ASP D 2 202 ? -43.515 27.882  45.592 1.00 19.86 ? 203  ASP C N     1 
ATOM   8413  C  CA    . ASP D 2 202 ? -44.289 29.095  45.416 1.00 20.58 ? 203  ASP C CA    1 
ATOM   8414  C  C     . ASP D 2 202 ? -44.202 30.073  46.591 1.00 20.42 ? 203  ASP C C     1 
ATOM   8415  O  O     . ASP D 2 202 ? -45.096 30.883  46.766 1.00 20.53 ? 203  ASP C O     1 
ATOM   8416  C  CB    . ASP D 2 202 ? -45.751 28.752  45.141 1.00 21.36 ? 203  ASP C CB    1 
ATOM   8417  C  CG    . ASP D 2 202 ? -45.918 27.711  44.066 1.00 22.27 ? 203  ASP C CG    1 
ATOM   8418  O  OD1   . ASP D 2 202 ? -45.501 27.948  42.911 1.00 23.75 ? 203  ASP C OD1   1 
ATOM   8419  O  OD2   . ASP D 2 202 ? -46.492 26.651  44.378 1.00 24.85 ? 203  ASP C OD2   1 
ATOM   8420  N  N     . ILE D 2 203 ? -43.128 30.006  47.370 1.00 19.23 ? 204  ILE C N     1 
ATOM   8421  C  CA    . ILE D 2 203 ? -42.956 30.910  48.499 1.00 17.73 ? 204  ILE C CA    1 
ATOM   8422  C  C     . ILE D 2 203 ? -42.758 32.349  48.016 1.00 17.49 ? 204  ILE C C     1 
ATOM   8423  O  O     . ILE D 2 203 ? -42.166 32.580  46.970 1.00 18.53 ? 204  ILE C O     1 
ATOM   8424  C  CB    . ILE D 2 203 ? -41.761 30.487  49.384 1.00 18.21 ? 204  ILE C CB    1 
ATOM   8425  C  CG1   . ILE D 2 203 ? -41.763 31.259  50.698 1.00 17.57 ? 204  ILE C CG1   1 
ATOM   8426  C  CG2   . ILE D 2 203 ? -40.442 30.700  48.651 1.00 17.55 ? 204  ILE C CG2   1 
ATOM   8427  C  CD1   . ILE D 2 203 ? -40.872 30.668  51.752 1.00 17.57 ? 204  ILE C CD1   1 
ATOM   8428  N  N     . SER D 2 204 ? -43.260 33.310  48.770 1.00 14.75 ? 205  SER C N     1 
ATOM   8429  C  CA    . SER D 2 204 ? -43.143 34.711  48.386 1.00 13.88 ? 205  SER C CA    1 
ATOM   8430  C  C     . SER D 2 204 ? -41.900 35.393  48.958 1.00 13.78 ? 205  SER C C     1 
ATOM   8431  O  O     . SER D 2 204 ? -41.235 34.850  49.826 1.00 13.68 ? 205  SER C O     1 
ATOM   8432  C  CB    . SER D 2 204 ? -44.385 35.492  48.812 1.00 13.52 ? 205  SER C CB    1 
ATOM   8433  O  OG    . SER D 2 204 ? -44.537 35.509  50.228 1.00 12.86 ? 205  SER C OG    1 
ATOM   8434  N  N     . ILE D 2 205 ? -41.609 36.590  48.463 1.00 13.25 ? 206  ILE C N     1 
ATOM   8435  C  CA    . ILE D 2 205 ? -40.484 37.370  48.962 1.00 14.00 ? 206  ILE C CA    1 
ATOM   8436  C  C     . ILE D 2 205 ? -40.738 37.661  50.447 1.00 13.01 ? 206  ILE C C     1 
ATOM   8437  O  O     . ILE D 2 205 ? -39.872 37.431  51.292 1.00 12.88 ? 206  ILE C O     1 
ATOM   8438  C  CB    . ILE D 2 205 ? -40.290 38.717  48.203 1.00 14.89 ? 206  ILE C CB    1 
ATOM   8439  C  CG1   . ILE D 2 205 ? -40.018 38.496  46.704 1.00 15.41 ? 206  ILE C CG1   1 
ATOM   8440  C  CG2   . ILE D 2 205 ? -39.196 39.565  48.844 1.00 14.27 ? 206  ILE C CG2   1 
ATOM   8441  C  CD1   . ILE D 2 205 ? -38.748 37.743  46.380 1.00 16.10 ? 206  ILE C CD1   1 
ATOM   8442  N  N     . ALA D 2 206 ? -41.940 38.141  50.746 1.00 12.99 ? 207  ALA C N     1 
ATOM   8443  C  CA    . ALA D 2 206 ? -42.349 38.451  52.117 1.00 13.83 ? 207  ALA C CA    1 
ATOM   8444  C  C     . ALA D 2 206 ? -42.101 37.293  53.068 1.00 14.91 ? 207  ALA C C     1 
ATOM   8445  O  O     . ALA D 2 206 ? -41.626 37.497  54.187 1.00 15.89 ? 207  ALA C O     1 
ATOM   8446  C  CB    . ALA D 2 206 ? -43.822 38.874  52.174 1.00 12.48 ? 207  ALA C CB    1 
ATOM   8447  N  N     . GLU D 2 207 ? -42.416 36.082  52.618 1.00 16.58 ? 208  GLU C N     1 
ATOM   8448  C  CA    . GLU D 2 207 ? -42.221 34.910  53.447 1.00 18.87 ? 208  GLU C CA    1 
ATOM   8449  C  C     . GLU D 2 207 ? -40.749 34.562  53.582 1.00 19.44 ? 208  GLU C C     1 
ATOM   8450  O  O     . GLU D 2 207 ? -40.301 34.221  54.664 1.00 22.24 ? 208  GLU C O     1 
ATOM   8451  C  CB    . GLU D 2 207 ? -43.028 33.726  52.937 1.00 21.73 ? 208  GLU C CB    1 
ATOM   8452  C  CG    . GLU D 2 207 ? -43.159 32.628  53.972 1.00 25.74 ? 208  GLU C CG    1 
ATOM   8453  C  CD    . GLU D 2 207 ? -43.889 31.415  53.455 1.00 30.52 ? 208  GLU C CD    1 
ATOM   8454  O  OE1   . GLU D 2 207 ? -44.661 31.557  52.449 1.00 31.01 ? 208  GLU C OE1   1 
ATOM   8455  O  OE2   . GLU D 2 207 ? -43.676 30.334  54.051 1.00 29.33 ? 208  GLU C OE2   1 
ATOM   8456  N  N     . LEU D 2 208 ? -40.001 34.656  52.489 1.00 17.04 ? 209  LEU C N     1 
ATOM   8457  C  CA    . LEU D 2 208 ? -38.563 34.395  52.522 1.00 16.50 ? 209  LEU C CA    1 
ATOM   8458  C  C     . LEU D 2 208 ? -37.870 35.376  53.479 1.00 16.66 ? 209  LEU C C     1 
ATOM   8459  O  O     . LEU D 2 208 ? -36.870 35.037  54.128 1.00 16.62 ? 209  LEU C O     1 
ATOM   8460  C  CB    . LEU D 2 208 ? -37.945 34.490  51.121 1.00 15.73 ? 209  LEU C CB    1 
ATOM   8461  C  CG    . LEU D 2 208 ? -38.165 33.355  50.114 1.00 15.25 ? 209  LEU C CG    1 
ATOM   8462  C  CD1   . LEU D 2 208 ? -37.742 33.767  48.712 1.00 14.82 ? 209  LEU C CD1   1 
ATOM   8463  C  CD2   . LEU D 2 208 ? -37.426 32.080  50.550 1.00 15.01 ? 209  LEU C CD2   1 
ATOM   8464  N  N     . MET D 2 209 ? -38.417 36.587  53.565 1.00 16.57 ? 210  MET C N     1 
ATOM   8465  C  CA    . MET D 2 209 ? -37.892 37.626  54.453 1.00 17.26 ? 210  MET C CA    1 
ATOM   8466  C  C     . MET D 2 209 ? -38.142 37.376  55.953 1.00 17.52 ? 210  MET C C     1 
ATOM   8467  O  O     . MET D 2 209 ? -37.678 38.149  56.796 1.00 18.12 ? 210  MET C O     1 
ATOM   8468  C  CB    . MET D 2 209 ? -38.379 39.015  54.036 1.00 16.70 ? 210  MET C CB    1 
ATOM   8469  C  CG    . MET D 2 209 ? -37.709 39.543  52.780 1.00 17.56 ? 210  MET C CG    1 
ATOM   8470  S  SD    . MET D 2 209 ? -38.196 41.234  52.348 1.00 20.01 ? 210  MET C SD    1 
ATOM   8471  C  CE    . MET D 2 209 ? -37.754 42.117  53.859 1.00 17.88 ? 210  MET C CE    1 
ATOM   8472  N  N     . GLU D 2 210 ? -38.872 36.308  56.273 1.00 18.21 ? 211  GLU C N     1 
ATOM   8473  C  CA    . GLU D 2 210 ? -39.076 35.893  57.665 1.00 18.56 ? 211  GLU C CA    1 
ATOM   8474  C  C     . GLU D 2 210 ? -37.794 35.205  58.139 1.00 17.85 ? 211  GLU C C     1 
ATOM   8475  O  O     . GLU D 2 210 ? -37.452 35.257  59.316 1.00 16.74 ? 211  GLU C O     1 
ATOM   8476  C  CB    . GLU D 2 210 ? -40.275 34.949  57.796 1.00 20.20 ? 211  GLU C CB    1 
ATOM   8477  C  CG    . GLU D 2 210 ? -41.624 35.594  57.488 1.00 22.93 ? 211  GLU C CG    1 
ATOM   8478  C  CD    . GLU D 2 210 ? -42.780 34.593  57.435 1.00 25.19 ? 211  GLU C CD    1 
ATOM   8479  O  OE1   . GLU D 2 210 ? -43.864 34.952  56.916 1.00 26.10 ? 211  GLU C OE1   1 
ATOM   8480  O  OE2   . GLU D 2 210 ? -42.629 33.457  57.900 1.00 25.89 ? 211  GLU C OE2   1 
ATOM   8481  N  N     . ASP D 2 211 ? -37.107 34.557  57.197 1.00 17.41 ? 212  ASP C N     1 
ATOM   8482  C  CA    . ASP D 2 211 ? -35.812 33.909  57.427 1.00 17.21 ? 212  ASP C CA    1 
ATOM   8483  C  C     . ASP D 2 211 ? -34.648 34.888  57.218 1.00 16.91 ? 212  ASP C C     1 
ATOM   8484  O  O     . ASP D 2 211 ? -33.800 35.039  58.087 1.00 18.69 ? 212  ASP C O     1 
ATOM   8485  C  CB    . ASP D 2 211 ? -35.640 32.709  56.488 1.00 15.80 ? 212  ASP C CB    1 
ATOM   8486  C  CG    . ASP D 2 211 ? -36.505 31.520  56.876 1.00 14.16 ? 212  ASP C CG    1 
ATOM   8487  O  OD1   . ASP D 2 211 ? -36.525 31.177  58.100 1.00 14.55 ? 212  ASP C OD1   1 
ATOM   8488  O  OD2   . ASP D 2 211 ? -37.125 30.914  55.973 1.00 12.39 ? 212  ASP C OD2   1 
ATOM   8489  N  N     . ILE D 2 212 ? -34.627 35.540  56.056 1.00 17.07 ? 213  ILE C N     1 
ATOM   8490  C  CA    . ILE D 2 212 ? -33.591 36.505  55.672 1.00 15.51 ? 213  ILE C CA    1 
ATOM   8491  C  C     . ILE D 2 212 ? -34.110 37.912  55.972 1.00 17.38 ? 213  ILE C C     1 
ATOM   8492  O  O     . ILE D 2 212 ? -34.916 38.470  55.217 1.00 16.61 ? 213  ILE C O     1 
ATOM   8493  C  CB    . ILE D 2 212 ? -33.246 36.364  54.164 1.00 14.79 ? 213  ILE C CB    1 
ATOM   8494  C  CG1   . ILE D 2 212 ? -32.914 34.900  53.832 1.00 15.36 ? 213  ILE C CG1   1 
ATOM   8495  C  CG2   . ILE D 2 212 ? -32.115 37.302  53.768 1.00 15.09 ? 213  ILE C CG2   1 
ATOM   8496  C  CD1   . ILE D 2 212 ? -32.891 34.559  52.348 1.00 15.28 ? 213  ILE C CD1   1 
ATOM   8497  N  N     . GLU D 2 213 ? -33.642 38.486  57.076 1.00 18.62 ? 214  GLU C N     1 
ATOM   8498  C  CA    . GLU D 2 213 ? -34.119 39.794  57.532 1.00 18.70 ? 214  GLU C CA    1 
ATOM   8499  C  C     . GLU D 2 213 ? -33.541 40.981  56.744 1.00 18.07 ? 214  GLU C C     1 
ATOM   8500  O  O     . GLU D 2 213 ? -34.148 42.058  56.668 1.00 15.93 ? 214  GLU C O     1 
ATOM   8501  C  CB    . GLU D 2 213 ? -33.863 39.934  59.033 1.00 21.31 ? 214  GLU C CB    1 
ATOM   8502  C  CG    . GLU D 2 213 ? -34.367 41.226  59.652 1.00 26.52 ? 214  GLU C CG    1 
ATOM   8503  C  CD    . GLU D 2 213 ? -34.231 41.191  61.179 1.00 30.85 ? 214  GLU C CD    1 
ATOM   8504  O  OE1   . GLU D 2 213 ? -34.701 40.214  61.821 1.00 32.19 ? 214  GLU C OE1   1 
ATOM   8505  O  OE2   . GLU D 2 213 ? -33.659 42.153  61.757 1.00 32.45 ? 214  GLU C OE2   1 
ATOM   8506  N  N     . GLY D 2 214 ? -32.371 40.767  56.150 1.00 17.59 ? 215  GLY C N     1 
ATOM   8507  C  CA    . GLY D 2 214 ? -31.694 41.802  55.381 1.00 15.12 ? 215  GLY C CA    1 
ATOM   8508  C  C     . GLY D 2 214 ? -30.208 41.516  55.338 1.00 14.47 ? 215  GLY C C     1 
ATOM   8509  O  O     . GLY D 2 214 ? -29.762 40.491  55.853 1.00 15.52 ? 215  GLY C O     1 
ATOM   8510  N  N     . PRO D 2 215 ? -29.429 42.418  54.713 1.00 13.05 ? 216  PRO C N     1 
ATOM   8511  C  CA    . PRO D 2 215 ? -27.984 42.271  54.621 1.00 12.66 ? 216  PRO C CA    1 
ATOM   8512  C  C     . PRO D 2 215 ? -27.308 42.152  55.983 1.00 12.48 ? 216  PRO C C     1 
ATOM   8513  O  O     . PRO D 2 215 ? -27.846 42.635  56.976 1.00 13.84 ? 216  PRO C O     1 
ATOM   8514  C  CB    . PRO D 2 215 ? -27.544 43.575  53.952 1.00 11.78 ? 216  PRO C CB    1 
ATOM   8515  C  CG    . PRO D 2 215 ? -28.720 44.010  53.193 1.00 11.63 ? 216  PRO C CG    1 
ATOM   8516  C  CD    . PRO D 2 215 ? -29.899 43.633  54.026 1.00 12.53 ? 216  PRO C CD    1 
ATOM   8517  N  N     . ASP D 2 216 ? -26.151 41.495  56.017 1.00 11.84 ? 217  ASP C N     1 
ATOM   8518  C  CA    . ASP D 2 216 ? -25.360 41.359  57.233 1.00 12.01 ? 217  ASP C CA    1 
ATOM   8519  C  C     . ASP D 2 216 ? -23.907 41.621  56.833 1.00 12.47 ? 217  ASP C C     1 
ATOM   8520  O  O     . ASP D 2 216 ? -23.262 40.783  56.193 1.00 12.01 ? 217  ASP C O     1 
ATOM   8521  C  CB    . ASP D 2 216 ? -25.534 39.962  57.836 1.00 12.90 ? 217  ASP C CB    1 
ATOM   8522  C  CG    . ASP D 2 216 ? -25.000 39.853  59.257 1.00 14.20 ? 217  ASP C CG    1 
ATOM   8523  O  OD1   . ASP D 2 216 ? -24.811 40.892  59.933 1.00 14.73 ? 217  ASP C OD1   1 
ATOM   8524  O  OD2   . ASP D 2 216 ? -24.786 38.711  59.709 1.00 14.14 ? 217  ASP C OD2   1 
ATOM   8525  N  N     . PHE D 2 217 ? -23.409 42.802  57.184 1.00 12.15 ? 218  PHE C N     1 
ATOM   8526  C  CA    . PHE D 2 217 ? -22.055 43.208  56.810 1.00 11.12 ? 218  PHE C CA    1 
ATOM   8527  C  C     . PHE D 2 217 ? -21.005 42.732  57.817 1.00 10.99 ? 218  PHE C C     1 
ATOM   8528  O  O     . PHE D 2 217 ? -21.277 42.711  59.021 1.00 10.61 ? 218  PHE C O     1 
ATOM   8529  C  CB    . PHE D 2 217 ? -21.975 44.730  56.654 1.00 10.75 ? 218  PHE C CB    1 
ATOM   8530  C  CG    . PHE D 2 217 ? -23.021 45.302  55.735 1.00 10.85 ? 218  PHE C CG    1 
ATOM   8531  C  CD1   . PHE D 2 217 ? -22.912 45.163  54.357 1.00 10.76 ? 218  PHE C CD1   1 
ATOM   8532  C  CD2   . PHE D 2 217 ? -24.109 45.997  56.250 1.00 10.58 ? 218  PHE C CD2   1 
ATOM   8533  C  CE1   . PHE D 2 217 ? -23.875 45.698  53.508 1.00 10.13 ? 218  PHE C CE1   1 
ATOM   8534  C  CE2   . PHE D 2 217 ? -25.067 46.538  55.407 1.00 10.54 ? 218  PHE C CE2   1 
ATOM   8535  C  CZ    . PHE D 2 217 ? -24.948 46.383  54.023 1.00 9.99  ? 218  PHE C CZ    1 
ATOM   8536  N  N     . PRO D 2 218 ? -19.799 42.365  57.326 1.00 11.07 ? 219  PRO C N     1 
ATOM   8537  C  CA    . PRO D 2 218 ? -18.694 41.938  58.204 1.00 10.72 ? 219  PRO C CA    1 
ATOM   8538  C  C     . PRO D 2 218 ? -18.335 43.020  59.221 1.00 10.98 ? 219  PRO C C     1 
ATOM   8539  O  O     . PRO D 2 218 ? -17.909 42.715  60.338 1.00 12.60 ? 219  PRO C O     1 
ATOM   8540  C  CB    . PRO D 2 218 ? -17.527 41.718  57.226 1.00 10.31 ? 219  PRO C CB    1 
ATOM   8541  C  CG    . PRO D 2 218 ? -17.919 42.447  55.969 1.00 10.33 ? 219  PRO C CG    1 
ATOM   8542  C  CD    . PRO D 2 218 ? -19.404 42.336  55.902 1.00 10.54 ? 219  PRO C CD    1 
ATOM   8543  N  N     . THR D 2 219 ? -18.536 44.275  58.840 1.00 10.23 ? 220  THR C N     1 
ATOM   8544  C  CA    . THR D 2 219 ? -18.251 45.425  59.695 1.00 10.32 ? 220  THR C CA    1 
ATOM   8545  C  C     . THR D 2 219 ? -19.414 45.837  60.623 1.00 10.37 ? 220  THR C C     1 
ATOM   8546  O  O     . THR D 2 219 ? -19.402 46.931  61.181 1.00 10.81 ? 220  THR C O     1 
ATOM   8547  C  CB    . THR D 2 219 ? -17.830 46.620  58.828 1.00 10.09 ? 220  THR C CB    1 
ATOM   8548  O  OG1   . THR D 2 219 ? -18.766 46.748  57.755 1.00 10.02 ? 220  THR C OG1   1 
ATOM   8549  C  CG2   . THR D 2 219 ? -16.435 46.389  58.229 1.00 9.82  ? 220  THR C CG2   1 
ATOM   8550  N  N     . ALA D 2 220 ? -20.398 44.954  60.785 1.00 10.16 ? 221  ALA C N     1 
ATOM   8551  C  CA    . ALA D 2 220 ? -21.576 45.171  61.646 1.00 9.93  ? 221  ALA C CA    1 
ATOM   8552  C  C     . ALA D 2 220 ? -22.358 46.466  61.340 1.00 10.08 ? 221  ALA C C     1 
ATOM   8553  O  O     . ALA D 2 220 ? -22.823 46.661  60.223 1.00 10.67 ? 221  ALA C O     1 
ATOM   8554  C  CB    . ALA D 2 220 ? -21.196 45.066  63.131 1.00 9.41  ? 221  ALA C CB    1 
ATOM   8555  N  N     . GLY D 2 221 ? -22.515 47.339  62.332 1.00 10.22 ? 222  GLY C N     1 
ATOM   8556  C  CA    . GLY D 2 221 ? -23.234 48.588  62.131 1.00 10.13 ? 222  GLY C CA    1 
ATOM   8557  C  C     . GLY D 2 221 ? -24.749 48.485  62.170 1.00 10.05 ? 222  GLY C C     1 
ATOM   8558  O  O     . GLY D 2 221 ? -25.311 47.496  62.631 1.00 9.27  ? 222  GLY C O     1 
ATOM   8559  N  N     . LEU D 2 222 ? -25.408 49.530  61.680 1.00 11.05 ? 223  LEU C N     1 
ATOM   8560  C  CA    . LEU D 2 222 ? -26.867 49.598  61.683 1.00 12.23 ? 223  LEU C CA    1 
ATOM   8561  C  C     . LEU D 2 222 ? -27.462 49.869  60.307 1.00 13.12 ? 223  LEU C C     1 
ATOM   8562  O  O     . LEU D 2 222 ? -26.840 50.504  59.449 1.00 12.91 ? 223  LEU C O     1 
ATOM   8563  C  CB    . LEU D 2 222 ? -27.366 50.683  62.653 1.00 11.86 ? 223  LEU C CB    1 
ATOM   8564  C  CG    . LEU D 2 222 ? -27.262 50.549  64.183 1.00 11.98 ? 223  LEU C CG    1 
ATOM   8565  C  CD1   . LEU D 2 222 ? -25.834 50.430  64.714 1.00 11.51 ? 223  LEU C CD1   1 
ATOM   8566  C  CD2   . LEU D 2 222 ? -27.936 51.778  64.818 1.00 12.23 ? 223  LEU C CD2   1 
ATOM   8567  N  N     . ILE D 2 223 ? -28.679 49.370  60.117 1.00 14.06 ? 224  ILE C N     1 
ATOM   8568  C  CA    . ILE D 2 223 ? -29.459 49.646  58.919 1.00 14.65 ? 224  ILE C CA    1 
ATOM   8569  C  C     . ILE D 2 223 ? -30.740 50.329  59.375 1.00 14.95 ? 224  ILE C C     1 
ATOM   8570  O  O     . ILE D 2 223 ? -31.358 49.909  60.359 1.00 15.16 ? 224  ILE C O     1 
ATOM   8571  C  CB    . ILE D 2 223 ? -29.764 48.363  58.103 1.00 14.61 ? 224  ILE C CB    1 
ATOM   8572  C  CG1   . ILE D 2 223 ? -28.488 47.832  57.452 1.00 14.63 ? 224  ILE C CG1   1 
ATOM   8573  C  CG2   . ILE D 2 223 ? -30.805 48.660  57.012 1.00 14.04 ? 224  ILE C CG2   1 
ATOM   8574  C  CD1   . ILE D 2 223 ? -28.652 46.485  56.744 1.00 15.66 ? 224  ILE C CD1   1 
ATOM   8575  N  N     . LEU D 2 224 ? -31.127 51.387  58.667 1.00 15.51 ? 225  LEU C N     1 
ATOM   8576  C  CA    . LEU D 2 224 ? -32.337 52.144  59.000 1.00 16.39 ? 225  LEU C CA    1 
ATOM   8577  C  C     . LEU D 2 224 ? -33.543 51.733  58.160 1.00 15.71 ? 225  LEU C C     1 
ATOM   8578  O  O     . LEU D 2 224 ? -33.561 51.946  56.951 1.00 14.77 ? 225  LEU C O     1 
ATOM   8579  C  CB    . LEU D 2 224 ? -32.085 53.640  58.799 1.00 18.17 ? 225  LEU C CB    1 
ATOM   8580  C  CG    . LEU D 2 224 ? -30.860 54.300  59.431 1.00 19.44 ? 225  LEU C CG    1 
ATOM   8581  C  CD1   . LEU D 2 224 ? -30.821 55.775  59.017 1.00 21.42 ? 225  LEU C CD1   1 
ATOM   8582  C  CD2   . LEU D 2 224 ? -30.864 54.158  60.943 1.00 18.70 ? 225  LEU C CD2   1 
ATOM   8583  N  N     . GLY D 2 225 ? -34.552 51.155  58.805 1.00 16.08 ? 226  GLY C N     1 
ATOM   8584  C  CA    . GLY D 2 225 ? -35.797 50.776  58.126 1.00 15.74 ? 226  GLY C CA    1 
ATOM   8585  C  C     . GLY D 2 225 ? -35.741 49.514  57.273 1.00 17.21 ? 226  GLY C C     1 
ATOM   8586  O  O     . GLY D 2 225 ? -34.667 49.027  56.907 1.00 15.95 ? 226  GLY C O     1 
ATOM   8587  N  N     . LYS D 2 226 ? -36.924 48.997  56.950 1.00 18.40 ? 227  LYS C N     1 
ATOM   8588  C  CA    . LYS D 2 226 ? -37.084 47.805  56.128 1.00 19.72 ? 227  LYS C CA    1 
ATOM   8589  C  C     . LYS D 2 226 ? -37.575 48.069  54.706 1.00 21.67 ? 227  LYS C C     1 
ATOM   8590  O  O     . LYS D 2 226 ? -37.691 47.127  53.918 1.00 23.73 ? 227  LYS C O     1 
ATOM   8591  C  CB    . LYS D 2 226 ? -38.035 46.810  56.806 1.00 19.96 ? 227  LYS C CB    1 
ATOM   8592  C  CG    . LYS D 2 226 ? -37.379 45.925  57.856 1.00 21.27 ? 227  LYS C CG    1 
ATOM   8593  N  N     . SER D 2 227 ? -37.803 49.321  54.352 1.00 21.70 ? 228  SER C N     1 
ATOM   8594  C  CA    . SER D 2 227 ? -38.270 49.652  53.010 1.00 21.11 ? 228  SER C CA    1 
ATOM   8595  C  C     . SER D 2 227 ? -37.269 49.454  51.894 1.00 17.85 ? 228  SER C C     1 
ATOM   8596  O  O     . SER D 2 227 ? -37.618 49.004  50.825 1.00 18.09 ? 228  SER C O     1 
ATOM   8597  C  CB    . SER D 2 227 ? -38.928 51.035  52.965 1.00 20.84 ? 228  SER C CB    1 
ATOM   8598  O  OG    . SER D 2 227 ? -38.041 52.070  53.311 1.00 24.77 ? 228  SER C OG    1 
ATOM   8599  N  N     . GLY D 2 228 ? -36.034 49.823  52.169 1.00 15.32 ? 229  GLY C N     1 
ATOM   8600  C  CA    . GLY D 2 228 ? -34.918 49.699  51.234 1.00 14.05 ? 229  GLY C CA    1 
ATOM   8601  C  C     . GLY D 2 228 ? -34.535 48.288  50.944 1.00 13.87 ? 229  GLY C C     1 
ATOM   8602  O  O     . GLY D 2 228 ? -34.143 48.007  49.853 1.00 14.29 ? 229  GLY C O     1 
ATOM   8603  N  N     . ILE D 2 229 ? -34.589 47.442  51.963 1.00 13.44 ? 230  ILE C N     1 
ATOM   8604  C  CA    . ILE D 2 229 ? -34.312 46.027  51.884 1.00 13.16 ? 230  ILE C CA    1 
ATOM   8605  C  C     . ILE D 2 229 ? -35.390 45.305  51.091 1.00 13.90 ? 230  ILE C C     1 
ATOM   8606  O  O     . ILE D 2 229 ? -35.103 44.485  50.267 1.00 14.31 ? 230  ILE C O     1 
ATOM   8607  C  CB    . ILE D 2 229 ? -34.167 45.393  53.289 1.00 12.24 ? 230  ILE C CB    1 
ATOM   8608  C  CG1   . ILE D 2 229 ? -33.111 46.129  54.121 1.00 11.36 ? 230  ILE C CG1   1 
ATOM   8609  C  CG2   . ILE D 2 229 ? -33.823 43.925  53.185 1.00 11.34 ? 230  ILE C CG2   1 
ATOM   8610  C  CD1   . ILE D 2 229 ? -33.131 45.821  55.595 1.00 9.82  ? 230  ILE C CD1   1 
ATOM   8611  N  N     . ARG D 2 230 ? -36.631 45.660  51.365 1.00 14.33 ? 231  ARG C N     1 
ATOM   8612  C  CA    . ARG D 2 230 ? -37.789 45.101  50.723 1.00 15.86 ? 231  ARG C CA    1 
ATOM   8613  C  C     . ARG D 2 230 ? -37.844 45.420  49.234 1.00 16.28 ? 231  ARG C C     1 
ATOM   8614  O  O     . ARG D 2 230 ? -38.205 44.590  48.435 1.00 16.02 ? 231  ARG C O     1 
ATOM   8615  C  CB    . ARG D 2 230 ? -39.053 45.540  51.459 1.00 16.44 ? 231  ARG C CB    1 
ATOM   8616  C  CG    . ARG D 2 230 ? -40.330 44.941  50.946 1.00 18.77 ? 231  ARG C CG    1 
ATOM   8617  C  CD    . ARG D 2 230 ? -40.277 43.434  51.079 1.00 23.95 ? 231  ARG C CD    1 
ATOM   8618  N  NE    . ARG D 2 230 ? -41.487 42.806  50.606 1.00 27.14 ? 231  ARG C NE    1 
ATOM   8619  C  CZ    . ARG D 2 230 ? -42.445 42.376  51.392 1.00 28.04 ? 231  ARG C CZ    1 
ATOM   8620  N  NH1   . ARG D 2 230 ? -42.313 42.481  52.720 1.00 26.01 ? 231  ARG C NH1   1 
ATOM   8621  N  NH2   . ARG D 2 230 ? -43.523 41.850  50.852 1.00 28.90 ? 231  ARG C NH2   1 
ATOM   8622  N  N     . ARG D 2 231 ? -37.482 46.645  48.897 1.00 17.27 ? 232  ARG C N     1 
ATOM   8623  C  CA    . ARG D 2 231 ? -37.429 47.113  47.536 1.00 19.81 ? 232  ARG C CA    1 
ATOM   8624  C  C     . ARG D 2 231 ? -36.343 46.337  46.780 1.00 20.34 ? 232  ARG C C     1 
ATOM   8625  O  O     . ARG D 2 231 ? -36.553 45.900  45.680 1.00 20.55 ? 232  ARG C O     1 
ATOM   8626  C  CB    . ARG D 2 231 ? -37.171 48.616  47.549 1.00 21.98 ? 232  ARG C CB    1 
ATOM   8627  C  CG    . ARG D 2 231 ? -37.587 49.405  46.324 1.00 24.15 ? 232  ARG C CG    1 
ATOM   8628  C  CD    . ARG D 2 231 ? -38.152 50.807  46.626 1.00 25.63 ? 232  ARG C CD    1 
ATOM   8629  N  NE    . ARG D 2 231 ? -37.478 51.598  47.661 1.00 28.96 ? 232  ARG C NE    1 
ATOM   8630  C  CZ    . ARG D 2 231 ? -38.065 51.974  48.795 1.00 31.45 ? 232  ARG C CZ    1 
ATOM   8631  N  NH1   . ARG D 2 231 ? -39.314 51.612  49.017 1.00 32.48 ? 232  ARG C NH1   1 
ATOM   8632  N  NH2   . ARG D 2 231 ? -37.423 52.686  49.717 1.00 29.64 ? 232  ARG C NH2   1 
ATOM   8633  N  N     . ALA D 2 232 ? -35.193 46.167  47.407 1.00 18.39 ? 233  ALA C N     1 
ATOM   8634  C  CA    . ALA D 2 232 ? -34.083 45.445  46.833 1.00 17.03 ? 233  ALA C CA    1 
ATOM   8635  C  C     . ALA D 2 232 ? -34.371 43.951  46.613 1.00 16.48 ? 233  ALA C C     1 
ATOM   8636  O  O     . ALA D 2 232 ? -34.016 43.395  45.598 1.00 15.16 ? 233  ALA C O     1 
ATOM   8637  C  CB    . ALA D 2 232 ? -32.852 45.639  47.701 1.00 16.63 ? 233  ALA C CB    1 
ATOM   8638  N  N     . TYR D 2 233 ? -35.018 43.320  47.589 1.00 14.51 ? 234  TYR C N     1 
ATOM   8639  C  CA    . TYR D 2 233 ? -35.391 41.927  47.524 1.00 13.25 ? 234  TYR C CA    1 
ATOM   8640  C  C     . TYR D 2 233 ? -36.463 41.620  46.477 1.00 14.40 ? 234  TYR C C     1 
ATOM   8641  O  O     . TYR D 2 233 ? -36.502 40.572  45.882 1.00 14.44 ? 234  TYR C O     1 
ATOM   8642  C  CB    . TYR D 2 233 ? -35.742 41.397  48.915 1.00 12.81 ? 234  TYR C CB    1 
ATOM   8643  C  CG    . TYR D 2 233 ? -34.550 41.240  49.815 1.00 11.73 ? 234  TYR C CG    1 
ATOM   8644  C  CD1   . TYR D 2 233 ? -33.274 41.268  49.307 1.00 11.29 ? 234  TYR C CD1   1 
ATOM   8645  C  CD2   . TYR D 2 233 ? -34.696 41.032  51.153 1.00 10.99 ? 234  TYR C CD2   1 
ATOM   8646  C  CE1   . TYR D 2 233 ? -32.192 41.134  50.105 1.00 10.56 ? 234  TYR C CE1   1 
ATOM   8647  C  CE2   . TYR D 2 233 ? -33.610 40.866  51.968 1.00 10.40 ? 234  TYR C CE2   1 
ATOM   8648  C  CZ    . TYR D 2 233 ? -32.355 40.919  51.426 1.00 10.71 ? 234  TYR C CZ    1 
ATOM   8649  O  OH    . TYR D 2 233 ? -31.263 40.773  52.199 1.00 9.70  ? 234  TYR C OH    1 
ATOM   8650  N  N     . GLU D 2 234 ? -37.388 42.538  46.342 1.00 15.56 ? 235  GLU C N     1 
ATOM   8651  C  CA    . GLU D 2 234 ? -38.434 42.470  45.359 1.00 16.06 ? 235  GLU C CA    1 
ATOM   8652  C  C     . GLU D 2 234 ? -38.053 42.745  43.929 1.00 16.63 ? 235  GLU C C     1 
ATOM   8653  O  O     . GLU D 2 234 ? -38.525 42.100  43.039 1.00 16.28 ? 235  GLU C O     1 
ATOM   8654  C  CB    . GLU D 2 234 ? -39.612 43.314  45.776 1.00 19.52 ? 235  GLU C CB    1 
ATOM   8655  C  CG    . GLU D 2 234 ? -40.630 42.490  46.503 1.00 23.87 ? 235  GLU C CG    1 
ATOM   8656  C  CD    . GLU D 2 234 ? -41.439 43.294  47.448 1.00 30.16 ? 235  GLU C CD    1 
ATOM   8657  O  OE1   . GLU D 2 234 ? -42.140 42.665  48.231 1.00 35.08 ? 235  GLU C OE1   1 
ATOM   8658  O  OE2   . GLU D 2 234 ? -41.379 44.529  47.421 1.00 31.41 ? 235  GLU C OE2   1 
ATOM   8659  N  N     . THR D 2 235 ? -37.205 43.736  43.724 1.00 16.52 ? 236  THR C N     1 
ATOM   8660  C  CA    . THR D 2 235 ? -36.835 44.142  42.388 1.00 15.93 ? 236  THR C CA    1 
ATOM   8661  C  C     . THR D 2 235 ? -35.400 43.903  41.926 1.00 16.75 ? 236  THR C C     1 
ATOM   8662  O  O     . THR D 2 235 ? -35.162 43.776  40.754 1.00 16.38 ? 236  THR C O     1 
ATOM   8663  C  CB    . THR D 2 235 ? -37.134 45.642  42.190 1.00 15.58 ? 236  THR C CB    1 
ATOM   8664  O  OG1   . THR D 2 235 ? -36.289 46.432  43.015 1.00 14.08 ? 236  THR C OG1   1 
ATOM   8665  C  CG2   . THR D 2 235 ? -38.551 45.957  42.510 1.00 15.35 ? 236  THR C CG2   1 
ATOM   8666  N  N     . GLY D 2 236 ? -34.472 43.822  42.856 1.00 16.76 ? 237  GLY C N     1 
ATOM   8667  C  CA    . GLY D 2 236 ? -33.068 43.711  42.570 1.00 16.24 ? 237  GLY C CA    1 
ATOM   8668  C  C     . GLY D 2 236 ? -32.365 45.055  42.709 1.00 17.06 ? 237  GLY C C     1 
ATOM   8669  O  O     . GLY D 2 236 ? -31.169 45.135  42.637 1.00 16.27 ? 237  GLY C O     1 
ATOM   8670  N  N     . ARG D 2 237 ? -33.139 46.104  42.936 1.00 15.92 ? 238  ARG C N     1 
ATOM   8671  C  CA    . ARG D 2 237 ? -32.632 47.443  43.113 1.00 16.29 ? 238  ARG C CA    1 
ATOM   8672  C  C     . ARG D 2 237 ? -33.286 48.136  44.314 1.00 17.52 ? 238  ARG C C     1 
ATOM   8673  O  O     . ARG D 2 237 ? -34.461 48.012  44.567 1.00 16.63 ? 238  ARG C O     1 
ATOM   8674  C  CB    . ARG D 2 237 ? -32.794 48.292  41.868 1.00 15.99 ? 238  ARG C CB    1 
ATOM   8675  C  CG    . ARG D 2 237 ? -31.860 47.926  40.743 1.00 18.54 ? 238  ARG C CG    1 
ATOM   8676  C  CD    . ARG D 2 237 ? -32.057 48.783  39.501 1.00 18.77 ? 238  ARG C CD    1 
ATOM   8677  N  NE    . ARG D 2 237 ? -32.105 50.199  39.865 1.00 19.72 ? 238  ARG C NE    1 
ATOM   8678  C  CZ    . ARG D 2 237 ? -31.030 50.955  40.029 1.00 20.39 ? 238  ARG C CZ    1 
ATOM   8679  N  NH1   . ARG D 2 237 ? -29.820 50.457  39.854 1.00 22.82 ? 238  ARG C NH1   1 
ATOM   8680  N  NH2   . ARG D 2 237 ? -31.165 52.188  40.414 1.00 19.86 ? 238  ARG C NH2   1 
ATOM   8681  N  N     . GLY D 2 238 ? -32.488 48.895  45.042 1.00 17.33 ? 239  GLY C N     1 
ATOM   8682  C  CA    . GLY D 2 238 ? -32.953 49.607  46.212 1.00 18.64 ? 239  GLY C CA    1 
ATOM   8683  C  C     . GLY D 2 238 ? -31.830 50.277  46.972 1.00 18.25 ? 239  GLY C C     1 
ATOM   8684  O  O     . GLY D 2 238 ? -30.674 49.851  46.885 1.00 17.77 ? 239  GLY C O     1 
ATOM   8685  N  N     . SER D 2 239 ? -32.173 51.334  47.714 1.00 18.23 ? 240  SER C N     1 
ATOM   8686  C  CA    . SER D 2 239 ? -31.207 52.068  48.527 1.00 17.42 ? 240  SER C CA    1 
ATOM   8687  C  C     . SER D 2 239 ? -31.346 51.655  49.988 1.00 16.29 ? 240  SER C C     1 
ATOM   8688  O  O     . SER D 2 239 ? -32.439 51.703  50.552 1.00 15.48 ? 240  SER C O     1 
ATOM   8689  C  CB    . SER D 2 239 ? -31.435 53.573  48.354 1.00 17.98 ? 240  SER C CB    1 
ATOM   8690  O  OG    . SER D 2 239 ? -30.511 54.331  49.122 1.00 20.21 ? 240  SER C OG    1 
ATOM   8691  N  N     . ILE D 2 240 ? -30.239 51.224  50.587 1.00 17.44 ? 241  ILE C N     1 
ATOM   8692  C  CA    . ILE D 2 240 ? -30.209 50.799  51.989 1.00 18.62 ? 241  ILE C CA    1 
ATOM   8693  C  C     . ILE D 2 240 ? -29.300 51.746  52.765 1.00 18.24 ? 241  ILE C C     1 
ATOM   8694  O  O     . ILE D 2 240 ? -28.108 51.845  52.468 1.00 18.02 ? 241  ILE C O     1 
ATOM   8695  C  CB    . ILE D 2 240 ? -29.724 49.340  52.139 1.00 19.05 ? 241  ILE C CB    1 
ATOM   8696  C  CG1   . ILE D 2 240 ? -30.706 48.381  51.453 1.00 21.64 ? 241  ILE C CG1   1 
ATOM   8697  C  CG2   . ILE D 2 240 ? -29.566 48.968  53.609 1.00 19.98 ? 241  ILE C CG2   1 
ATOM   8698  C  CD1   . ILE D 2 240 ? -30.291 46.900  51.477 1.00 23.26 ? 241  ILE C CD1   1 
ATOM   8699  N  N     . GLN D 2 241 ? -29.861 52.439  53.754 1.00 18.86 ? 242  GLN C N     1 
ATOM   8700  C  CA    . GLN D 2 241 ? -29.076 53.400  54.534 1.00 19.87 ? 242  GLN C CA    1 
ATOM   8701  C  C     . GLN D 2 241 ? -28.325 52.733  55.685 1.00 18.33 ? 242  GLN C C     1 
ATOM   8702  O  O     . GLN D 2 241 ? -28.936 52.187  56.598 1.00 17.34 ? 242  GLN C O     1 
ATOM   8703  C  CB    . GLN D 2 241 ? -29.957 54.548  55.054 1.00 20.59 ? 242  GLN C CB    1 
ATOM   8704  C  CG    . GLN D 2 241 ? -30.720 55.316  53.979 1.00 24.39 ? 242  GLN C CG    1 
ATOM   8705  C  CD    . GLN D 2 241 ? -29.798 56.046  52.977 1.00 28.54 ? 242  GLN C CD    1 
ATOM   8706  O  OE1   . GLN D 2 241 ? -28.736 56.573  53.348 1.00 28.76 ? 242  GLN C OE1   1 
ATOM   8707  N  NE2   . GLN D 2 241 ? -30.225 56.106  51.716 1.00 30.71 ? 242  GLN C NE2   1 
ATOM   8708  N  N     . MET D 2 242 ? -26.999 52.782  55.616 1.00 18.59 ? 243  MET C N     1 
ATOM   8709  C  CA    . MET D 2 242 ? -26.131 52.215  56.650 1.00 19.02 ? 243  MET C CA    1 
ATOM   8710  C  C     . MET D 2 242 ? -25.748 53.320  57.632 1.00 19.91 ? 243  MET C C     1 
ATOM   8711  O  O     . MET D 2 242 ? -25.717 54.502  57.274 1.00 20.22 ? 243  MET C O     1 
ATOM   8712  C  CB    . MET D 2 242 ? -24.865 51.613  56.035 1.00 17.83 ? 243  MET C CB    1 
ATOM   8713  C  CG    . MET D 2 242 ? -25.096 50.470  55.034 1.00 18.25 ? 243  MET C CG    1 
ATOM   8714  S  SD    . MET D 2 242 ? -23.551 49.884  54.287 1.00 18.39 ? 243  MET C SD    1 
ATOM   8715  C  CE    . MET D 2 242 ? -23.030 51.321  53.337 1.00 17.67 ? 243  MET C CE    1 
ATOM   8716  N  N     . ARG D 2 243 ? -25.448 52.937  58.867 1.00 19.63 ? 244  ARG C N     1 
ATOM   8717  C  CA    . ARG D 2 243 ? -25.095 53.912  59.882 1.00 18.53 ? 244  ARG C CA    1 
ATOM   8718  C  C     . ARG D 2 243 ? -24.090 53.284  60.824 1.00 16.59 ? 244  ARG C C     1 
ATOM   8719  O  O     . ARG D 2 243 ? -24.136 52.082  61.085 1.00 16.93 ? 244  ARG C O     1 
ATOM   8720  C  CB    . ARG D 2 243 ? -26.347 54.329  60.647 1.00 18.29 ? 244  ARG C CB    1 
ATOM   8721  C  CG    . ARG D 2 243 ? -26.457 55.822  60.854 1.00 19.52 ? 244  ARG C CG    1 
ATOM   8722  C  CD    . ARG D 2 243 ? -27.770 56.198  61.521 1.00 20.23 ? 244  ARG C CD    1 
ATOM   8723  N  NE    . ARG D 2 243 ? -28.187 57.554  61.167 1.00 20.13 ? 244  ARG C NE    1 
ATOM   8724  C  CZ    . ARG D 2 243 ? -29.145 58.246  61.797 1.00 21.46 ? 244  ARG C CZ    1 
ATOM   8725  N  NH1   . ARG D 2 243 ? -29.774 57.744  62.858 1.00 20.70 ? 244  ARG C NH1   1 
ATOM   8726  N  NH2   . ARG D 2 243 ? -29.458 59.461  61.379 1.00 21.12 ? 244  ARG C NH2   1 
ATOM   8727  N  N     . SER D 2 244 ? -23.180 54.103  61.326 1.00 16.03 ? 245  SER C N     1 
ATOM   8728  C  CA    . SER D 2 244 ? -22.159 53.656  62.260 1.00 15.69 ? 245  SER C CA    1 
ATOM   8729  C  C     . SER D 2 244 ? -22.764 53.372  63.631 1.00 14.04 ? 245  SER C C     1 
ATOM   8730  O  O     . SER D 2 244 ? -23.843 53.879  63.954 1.00 14.12 ? 245  SER C O     1 
ATOM   8731  C  CB    . SER D 2 244 ? -21.097 54.736  62.407 1.00 16.67 ? 245  SER C CB    1 
ATOM   8732  O  OG    . SER D 2 244 ? -20.483 54.987  61.164 1.00 19.98 ? 245  SER C OG    1 
ATOM   8733  N  N     . ARG D 2 245 ? -22.097 52.542  64.425 1.00 12.18 ? 246  ARG C N     1 
ATOM   8734  C  CA    . ARG D 2 245 ? -22.574 52.327  65.782 1.00 10.35 ? 246  ARG C CA    1 
ATOM   8735  C  C     . ARG D 2 245 ? -21.887 53.403  66.607 1.00 9.61  ? 246  ARG C C     1 
ATOM   8736  O  O     . ARG D 2 245 ? -20.652 53.400  66.749 1.00 9.19  ? 246  ARG C O     1 
ATOM   8737  C  CB    . ARG D 2 245 ? -22.286 50.921  66.310 1.00 9.80  ? 246  ARG C CB    1 
ATOM   8738  C  CG    . ARG D 2 245 ? -22.766 50.716  67.751 1.00 8.99  ? 246  ARG C CG    1 
ATOM   8739  C  CD    . ARG D 2 245 ? -22.746 49.241  68.207 1.00 8.45  ? 246  ARG C CD    1 
ATOM   8740  N  NE    . ARG D 2 245 ? -23.678 48.420  67.436 1.00 7.91  ? 246  ARG C NE    1 
ATOM   8741  C  CZ    . ARG D 2 245 ? -24.987 48.381  67.655 1.00 7.65  ? 246  ARG C CZ    1 
ATOM   8742  N  NH1   . ARG D 2 245 ? -25.527 49.110  68.616 1.00 7.93  ? 246  ARG C NH1   1 
ATOM   8743  N  NH2   . ARG D 2 245 ? -25.761 47.625  66.904 1.00 7.46  ? 246  ARG C NH2   1 
ATOM   8744  N  N     . ALA D 2 246 ? -22.697 54.336  67.111 1.00 8.78  ? 247  ALA C N     1 
ATOM   8745  C  CA    . ALA D 2 246 ? -22.192 55.460  67.889 1.00 8.40  ? 247  ALA C CA    1 
ATOM   8746  C  C     . ALA D 2 246 ? -22.961 55.702  69.185 1.00 8.21  ? 247  ALA C C     1 
ATOM   8747  O  O     . ALA D 2 246 ? -24.180 55.601  69.234 1.00 8.00  ? 247  ALA C O     1 
ATOM   8748  C  CB    . ALA D 2 246 ? -22.171 56.726  67.031 1.00 7.97  ? 247  ALA C CB    1 
ATOM   8749  N  N     . VAL D 2 247 ? -22.224 56.012  70.240 1.00 8.54  ? 248  VAL C N     1 
ATOM   8750  C  CA    . VAL D 2 247 ? -22.826 56.314  71.535 1.00 8.81  ? 248  VAL C CA    1 
ATOM   8751  C  C     . VAL D 2 247 ? -22.232 57.626  72.053 1.00 9.23  ? 248  VAL C C     1 
ATOM   8752  O  O     . VAL D 2 247 ? -21.142 58.027  71.639 1.00 9.59  ? 248  VAL C O     1 
ATOM   8753  C  CB    . VAL D 2 247 ? -22.657 55.143  72.581 1.00 8.77  ? 248  VAL C CB    1 
ATOM   8754  C  CG1   . VAL D 2 247 ? -23.264 53.834  72.049 1.00 8.42  ? 248  VAL C CG1   1 
ATOM   8755  C  CG2   . VAL D 2 247 ? -21.205 54.915  72.957 1.00 8.19  ? 248  VAL C CG2   1 
ATOM   8756  N  N     . ILE D 2 248 ? -22.977 58.296  72.925 1.00 9.94  ? 249  ILE C N     1 
ATOM   8757  C  CA    . ILE D 2 248 ? -22.544 59.527  73.578 1.00 10.35 ? 249  ILE C CA    1 
ATOM   8758  C  C     . ILE D 2 248 ? -22.311 59.187  75.044 1.00 10.89 ? 249  ILE C C     1 
ATOM   8759  O  O     . ILE D 2 248 ? -23.157 58.558  75.687 1.00 10.56 ? 249  ILE C O     1 
ATOM   8760  C  CB    . ILE D 2 248 ? -23.608 60.642  73.442 1.00 10.86 ? 249  ILE C CB    1 
ATOM   8761  C  CG1   . ILE D 2 248 ? -23.747 61.047  71.968 1.00 11.11 ? 249  ILE C CG1   1 
ATOM   8762  C  CG2   . ILE D 2 248 ? -23.259 61.862  74.322 1.00 10.50 ? 249  ILE C CG2   1 
ATOM   8763  C  CD1   . ILE D 2 248 ? -24.931 61.936  71.698 1.00 11.61 ? 249  ILE C CD1   1 
ATOM   8764  N  N     . GLU D 2 249 ? -21.151 59.575  75.561 1.00 11.92 ? 250  GLU C N     1 
ATOM   8765  C  CA    . GLU D 2 249 ? -20.798 59.289  76.949 1.00 12.69 ? 250  GLU C CA    1 
ATOM   8766  C  C     . GLU D 2 249 ? -20.094 60.470  77.614 1.00 14.19 ? 250  GLU C C     1 
ATOM   8767  O  O     . GLU D 2 249 ? -19.538 61.335  76.937 1.00 14.07 ? 250  GLU C O     1 
ATOM   8768  C  CB    . GLU D 2 249 ? -19.927 58.033  77.045 1.00 11.76 ? 250  GLU C CB    1 
ATOM   8769  C  CG    . GLU D 2 249 ? -18.576 58.143  76.357 1.00 11.74 ? 250  GLU C CG    1 
ATOM   8770  C  CD    . GLU D 2 249 ? -17.673 56.924  76.567 1.00 11.66 ? 250  GLU C CD    1 
ATOM   8771  O  OE1   . GLU D 2 249 ? -18.167 55.798  76.830 1.00 10.93 ? 250  GLU C OE1   1 
ATOM   8772  O  OE2   . GLU D 2 249 ? -16.439 57.112  76.545 1.00 11.68 ? 250  GLU C OE2   1 
ATOM   8773  N  N     . GLU D 2 250 ? -20.128 60.491  78.942 1.00 15.82 ? 251  GLU C N     1 
ATOM   8774  C  CA    . GLU D 2 250 ? -19.440 61.517  79.711 1.00 19.31 ? 251  GLU C CA    1 
ATOM   8775  C  C     . GLU D 2 250 ? -17.943 61.218  79.742 1.00 21.40 ? 251  GLU C C     1 
ATOM   8776  O  O     . GLU D 2 250 ? -17.529 60.071  79.551 1.00 23.33 ? 251  GLU C O     1 
ATOM   8777  C  CB    . GLU D 2 250 ? -19.990 61.584  81.134 1.00 20.30 ? 251  GLU C CB    1 
ATOM   8778  C  CG    . GLU D 2 250 ? -20.001 60.236  81.849 1.00 21.62 ? 251  GLU C CG    1 
ATOM   8779  C  CD    . GLU D 2 250 ? -20.652 60.308  83.206 1.00 25.09 ? 251  GLU C CD    1 
ATOM   8780  O  OE1   . GLU D 2 250 ? -21.684 59.627  83.433 1.00 26.57 ? 251  GLU C OE1   1 
ATOM   8781  O  OE2   . GLU D 2 250 ? -20.119 61.067  84.046 1.00 27.60 ? 251  GLU C OE2   1 
ATOM   8782  N  N     . ARG D 2 251 ? -17.140 62.256  79.955 1.00 23.26 ? 252  ARG C N     1 
ATOM   8783  C  CA    . ARG D 2 251 ? -15.694 62.096  80.072 1.00 24.34 ? 252  ARG C CA    1 
ATOM   8784  C  C     . ARG D 2 251 ? -15.151 63.003  81.167 1.00 26.39 ? 252  ARG C C     1 
ATOM   8785  O  O     . ARG D 2 251 ? -13.938 63.125  81.336 1.00 25.39 ? 252  ARG C O     1 
ATOM   8786  C  CB    . ARG D 2 251 ? -14.983 62.363  78.738 1.00 23.12 ? 252  ARG C CB    1 
ATOM   8787  C  CG    . ARG D 2 251 ? -15.145 63.765  78.197 1.00 22.46 ? 252  ARG C CG    1 
ATOM   8788  C  CD    . ARG D 2 251 ? -14.368 63.923  76.919 1.00 23.26 ? 252  ARG C CD    1 
ATOM   8789  N  NE    . ARG D 2 251 ? -14.630 65.208  76.268 1.00 24.66 ? 252  ARG C NE    1 
ATOM   8790  C  CZ    . ARG D 2 251 ? -13.956 66.328  76.511 1.00 23.91 ? 252  ARG C CZ    1 
ATOM   8791  N  NH1   . ARG D 2 251 ? -12.985 66.349  77.410 1.00 22.51 ? 252  ARG C NH1   1 
ATOM   8792  N  NH2   . ARG D 2 251 ? -14.277 67.437  75.856 1.00 24.39 ? 252  ARG C NH2   1 
ATOM   8793  N  N     . GLY D 2 252 ? -16.068 63.639  81.902 1.00 30.99 ? 253  GLY C N     1 
ATOM   8794  C  CA    . GLY D 2 252 ? -15.734 64.535  83.008 1.00 34.75 ? 253  GLY C CA    1 
ATOM   8795  C  C     . GLY D 2 252 ? -15.059 65.831  82.597 1.00 36.39 ? 253  GLY C C     1 
ATOM   8796  O  O     . GLY D 2 252 ? -14.231 65.843  81.690 1.00 42.16 ? 253  GLY C O     1 
ATOM   8797  N  N     . GLY D 2 253 ? -15.420 66.945  83.236 1.00 39.94 ? 254  GLY C N     1 
ATOM   8798  C  CA    . GLY D 2 253 ? -16.465 67.021  84.251 1.00 32.28 ? 254  GLY C CA    1 
ATOM   8799  C  C     . GLY D 2 253 ? -17.491 67.945  83.630 1.00 29.97 ? 254  GLY C C     1 
ATOM   8800  O  O     . GLY D 2 253 ? -17.291 69.164  83.568 1.00 30.02 ? 254  GLY C O     1 
ATOM   8801  N  N     . GLY D 2 254 ? -18.577 67.356  83.132 1.00 28.36 ? 255  GLY C N     1 
ATOM   8802  C  CA    . GLY D 2 254 ? -19.609 68.109  82.441 1.00 25.05 ? 255  GLY C CA    1 
ATOM   8803  C  C     . GLY D 2 254 ? -19.440 68.007  80.936 1.00 23.34 ? 255  GLY C C     1 
ATOM   8804  O  O     . GLY D 2 254 ? -20.343 68.376  80.185 1.00 21.81 ? 255  GLY C O     1 
ATOM   8805  N  N     . ARG D 2 255 ? -18.283 67.512  80.497 1.00 22.94 ? 256  ARG C N     1 
ATOM   8806  C  CA    . ARG D 2 255 ? -17.987 67.332  79.073 1.00 23.66 ? 256  ARG C CA    1 
ATOM   8807  C  C     . ARG D 2 255 ? -18.373 65.938  78.572 1.00 23.19 ? 256  ARG C C     1 
ATOM   8808  O  O     . ARG D 2 255 ? -18.381 64.961  79.334 1.00 23.87 ? 256  ARG C O     1 
ATOM   8809  C  CB    . ARG D 2 255 ? -16.514 67.612  78.772 1.00 26.68 ? 256  ARG C CB    1 
ATOM   8810  C  CG    . ARG D 2 255 ? -16.148 69.085  78.757 1.00 32.13 ? 256  ARG C CG    1 
ATOM   8811  C  CD    . ARG D 2 255 ? -14.642 69.299  78.707 1.00 35.29 ? 256  ARG C CD    1 
ATOM   8812  N  NE    . ARG D 2 255 ? -14.020 68.910  79.970 1.00 45.14 ? 256  ARG C NE    1 
ATOM   8813  C  CZ    . ARG D 2 255 ? -13.739 69.750  80.968 1.00 51.48 ? 256  ARG C CZ    1 
ATOM   8814  N  NH1   . ARG D 2 255 ? -14.007 71.058  80.854 1.00 52.48 ? 256  ARG C NH1   1 
ATOM   8815  N  NH2   . ARG D 2 255 ? -13.176 69.287  82.079 1.00 54.19 ? 256  ARG C NH2   1 
ATOM   8816  N  N     . GLN D 2 256 ? -18.685 65.855  77.279 1.00 22.19 ? 257  GLN C N     1 
ATOM   8817  C  CA    . GLN D 2 256 ? -19.073 64.590  76.658 1.00 21.78 ? 257  GLN C CA    1 
ATOM   8818  C  C     . GLN D 2 256 ? -18.254 64.257  75.418 1.00 21.10 ? 257  GLN C C     1 
ATOM   8819  O  O     . GLN D 2 256 ? -17.517 65.103  74.903 1.00 23.88 ? 257  GLN C O     1 
ATOM   8820  C  CB    . GLN D 2 256 ? -20.560 64.629  76.290 1.00 21.00 ? 257  GLN C CB    1 
ATOM   8821  C  CG    . GLN D 2 256 ? -21.495 64.582  77.478 1.00 21.13 ? 257  GLN C CG    1 
ATOM   8822  C  CD    . GLN D 2 256 ? -22.935 64.776  77.087 1.00 21.61 ? 257  GLN C CD    1 
ATOM   8823  O  OE1   . GLN D 2 256 ? -23.248 65.598  76.219 1.00 22.60 ? 257  GLN C OE1   1 
ATOM   8824  N  NE2   . GLN D 2 256 ? -23.832 64.026  77.738 1.00 20.82 ? 257  GLN C NE2   1 
ATOM   8825  N  N     . ARG D 2 257 ? -18.389 63.021  74.946 1.00 18.03 ? 258  ARG C N     1 
ATOM   8826  C  CA    . ARG D 2 257 ? -17.724 62.578  73.725 1.00 18.49 ? 258  ARG C CA    1 
ATOM   8827  C  C     . ARG D 2 257 ? -18.576 61.571  72.960 1.00 19.21 ? 258  ARG C C     1 
ATOM   8828  O  O     . ARG D 2 257 ? -19.432 60.897  73.540 1.00 18.45 ? 258  ARG C O     1 
ATOM   8829  C  CB    . ARG D 2 257 ? -16.329 62.012  74.025 1.00 19.12 ? 258  ARG C CB    1 
ATOM   8830  C  CG    . ARG D 2 257 ? -16.299 60.750  74.881 1.00 19.07 ? 258  ARG C CG    1 
ATOM   8831  C  CD    . ARG D 2 257 ? -14.881 60.445  75.352 1.00 19.56 ? 258  ARG C CD    1 
ATOM   8832  N  NE    . ARG D 2 257 ? -14.872 59.302  76.262 1.00 19.61 ? 258  ARG C NE    1 
ATOM   8833  C  CZ    . ARG D 2 257 ? -13.852 58.965  77.058 1.00 19.08 ? 258  ARG C CZ    1 
ATOM   8834  N  NH1   . ARG D 2 257 ? -12.742 59.689  77.094 1.00 16.02 ? 258  ARG C NH1   1 
ATOM   8835  N  NH2   . ARG D 2 257 ? -13.966 57.901  77.842 1.00 19.18 ? 258  ARG C NH2   1 
ATOM   8836  N  N     . ILE D 2 258 ? -18.341 61.495  71.652 1.00 19.42 ? 259  ILE C N     1 
ATOM   8837  C  CA    . ILE D 2 258 ? -19.033 60.539  70.786 1.00 19.05 ? 259  ILE C CA    1 
ATOM   8838  C  C     . ILE D 2 258 ? -18.055 59.403  70.509 1.00 18.25 ? 259  ILE C C     1 
ATOM   8839  O  O     . ILE D 2 258 ? -16.932 59.644  70.061 1.00 21.00 ? 259  ILE C O     1 
ATOM   8840  C  CB    . ILE D 2 258 ? -19.524 61.189  69.449 1.00 18.70 ? 259  ILE C CB    1 
ATOM   8841  C  CG1   . ILE D 2 258 ? -20.518 62.323  69.729 1.00 18.41 ? 259  ILE C CG1   1 
ATOM   8842  C  CG2   . ILE D 2 258 ? -20.141 60.126  68.514 1.00 18.99 ? 259  ILE C CG2   1 
ATOM   8843  C  CD1   . ILE D 2 258 ? -20.978 63.109  68.504 1.00 18.35 ? 259  ILE C CD1   1 
ATOM   8844  N  N     . VAL D 2 259 ? -18.470 58.172  70.786 1.00 15.40 ? 260  VAL C N     1 
ATOM   8845  C  CA    . VAL D 2 259 ? -17.608 57.008  70.564 1.00 13.76 ? 260  VAL C CA    1 
ATOM   8846  C  C     . VAL D 2 259 ? -18.180 56.109  69.464 1.00 13.22 ? 260  VAL C C     1 
ATOM   8847  O  O     . VAL D 2 259 ? -19.326 55.647  69.554 1.00 12.66 ? 260  VAL C O     1 
ATOM   8848  C  CB    . VAL D 2 259 ? -17.372 56.195  71.868 1.00 13.28 ? 260  VAL C CB    1 
ATOM   8849  C  CG1   . VAL D 2 259 ? -16.484 54.981  71.605 1.00 12.37 ? 260  VAL C CG1   1 
ATOM   8850  C  CG2   . VAL D 2 259 ? -16.766 57.084  72.953 1.00 12.65 ? 260  VAL C CG2   1 
ATOM   8851  N  N     . VAL D 2 260 ? -17.374 55.873  68.432 1.00 11.75 ? 261  VAL C N     1 
ATOM   8852  C  CA    . VAL D 2 260 ? -17.769 55.025  67.312 1.00 11.78 ? 261  VAL C CA    1 
ATOM   8853  C  C     . VAL D 2 260 ? -17.005 53.702  67.366 1.00 12.39 ? 261  VAL C C     1 
ATOM   8854  O  O     . VAL D 2 260 ? -15.768 53.694  67.409 1.00 12.17 ? 261  VAL C O     1 
ATOM   8855  C  CB    . VAL D 2 260 ? -17.542 55.747  65.947 1.00 11.27 ? 261  VAL C CB    1 
ATOM   8856  C  CG1   . VAL D 2 260 ? -17.857 54.819  64.764 1.00 10.57 ? 261  VAL C CG1   1 
ATOM   8857  C  CG2   . VAL D 2 260 ? -18.381 57.008  65.869 1.00 10.31 ? 261  VAL C CG2   1 
ATOM   8858  N  N     . THR D 2 261 ? -17.740 52.591  67.372 1.00 13.48 ? 262  THR C N     1 
ATOM   8859  C  CA    . THR D 2 261 ? -17.129 51.253  67.450 1.00 14.37 ? 262  THR C CA    1 
ATOM   8860  C  C     . THR D 2 261 ? -17.370 50.382  66.219 1.00 15.41 ? 262  THR C C     1 
ATOM   8861  O  O     . THR D 2 261 ? -16.790 49.300  66.094 1.00 19.00 ? 262  THR C O     1 
ATOM   8862  C  CB    . THR D 2 261 ? -17.563 50.473  68.720 1.00 13.80 ? 262  THR C CB    1 
ATOM   8863  O  OG1   . THR D 2 261 ? -18.990 50.400  68.775 1.00 14.32 ? 262  THR C OG1   1 
ATOM   8864  C  CG2   . THR D 2 261 ? -17.032 51.147  69.982 1.00 12.13 ? 262  THR C CG2   1 
ATOM   8865  N  N     . GLU D 2 262 ? -18.220 50.850  65.316 1.00 15.54 ? 263  GLU C N     1 
ATOM   8866  C  CA    . GLU D 2 262 ? -18.523 50.133  64.084 1.00 15.50 ? 263  GLU C CA    1 
ATOM   8867  C  C     . GLU D 2 262 ? -18.779 51.165  63.008 1.00 16.87 ? 263  GLU C C     1 
ATOM   8868  O  O     . GLU D 2 262 ? -19.469 52.157  63.250 1.00 16.29 ? 263  GLU C O     1 
ATOM   8869  C  CB    . GLU D 2 262 ? -19.765 49.251  64.262 1.00 15.16 ? 263  GLU C CB    1 
ATOM   8870  C  CG    . GLU D 2 262 ? -19.663 48.193  65.366 1.00 13.62 ? 263  GLU C CG    1 
ATOM   8871  C  CD    . GLU D 2 262 ? -20.995 47.556  65.712 1.00 14.32 ? 263  GLU C CD    1 
ATOM   8872  O  OE1   . GLU D 2 262 ? -21.035 46.772  66.683 1.00 15.11 ? 263  GLU C OE1   1 
ATOM   8873  O  OE2   . GLU D 2 262 ? -22.016 47.830  65.035 1.00 15.27 ? 263  GLU C OE2   1 
ATOM   8874  N  N     . ILE D 2 263 ? -18.211 50.939  61.819 1.00 18.13 ? 264  ILE C N     1 
ATOM   8875  C  CA    . ILE D 2 263 ? -18.386 51.879  60.696 1.00 18.83 ? 264  ILE C CA    1 
ATOM   8876  C  C     . ILE D 2 263 ? -19.136 51.201  59.536 1.00 18.41 ? 264  ILE C C     1 
ATOM   8877  O  O     . ILE D 2 263 ? -19.242 49.972  59.512 1.00 19.56 ? 264  ILE C O     1 
ATOM   8878  C  CB    . ILE D 2 263 ? -17.028 52.510  60.224 1.00 19.30 ? 264  ILE C CB    1 
ATOM   8879  C  CG1   . ILE D 2 263 ? -16.095 51.458  59.614 1.00 19.46 ? 264  ILE C CG1   1 
ATOM   8880  C  CG2   . ILE D 2 263 ? -16.338 53.258  61.375 1.00 19.83 ? 264  ILE C CG2   1 
ATOM   8881  C  CD1   . ILE D 2 263 ? -14.830 52.042  59.007 1.00 20.49 ? 264  ILE C CD1   1 
ATOM   8882  N  N     . PRO D 2 264 ? -19.683 51.995  58.586 1.00 17.93 ? 265  PRO C N     1 
ATOM   8883  C  CA    . PRO D 2 264 ? -20.397 51.411  57.445 1.00 16.95 ? 265  PRO C CA    1 
ATOM   8884  C  C     . PRO D 2 264 ? -19.512 50.556  56.541 1.00 16.23 ? 265  PRO C C     1 
ATOM   8885  O  O     . PRO D 2 264 ? -18.311 50.801  56.448 1.00 16.50 ? 265  PRO C O     1 
ATOM   8886  C  CB    . PRO D 2 264 ? -20.922 52.636  56.687 1.00 16.10 ? 265  PRO C CB    1 
ATOM   8887  C  CG    . PRO D 2 264 ? -20.899 53.746  57.687 1.00 16.53 ? 265  PRO C CG    1 
ATOM   8888  C  CD    . PRO D 2 264 ? -19.704 53.468  58.528 1.00 17.01 ? 265  PRO C CD    1 
ATOM   8889  N  N     . PHE D 2 265 ? -20.126 49.565  55.889 1.00 15.61 ? 266  PHE C N     1 
ATOM   8890  C  CA    . PHE D 2 265 ? -19.439 48.630  54.990 1.00 14.77 ? 266  PHE C CA    1 
ATOM   8891  C  C     . PHE D 2 265 ? -18.745 49.337  53.834 1.00 14.31 ? 266  PHE C C     1 
ATOM   8892  O  O     . PHE D 2 265 ? -19.312 50.234  53.225 1.00 15.60 ? 266  PHE C O     1 
ATOM   8893  C  CB    . PHE D 2 265 ? -20.441 47.583  54.482 1.00 14.69 ? 266  PHE C CB    1 
ATOM   8894  C  CG    . PHE D 2 265 ? -19.859 46.564  53.523 1.00 14.46 ? 266  PHE C CG    1 
ATOM   8895  C  CD1   . PHE D 2 265 ? -18.918 45.632  53.943 1.00 13.81 ? 266  PHE C CD1   1 
ATOM   8896  C  CD2   . PHE D 2 265 ? -20.311 46.506  52.201 1.00 14.43 ? 266  PHE C CD2   1 
ATOM   8897  C  CE1   . PHE D 2 265 ? -18.393 44.684  53.060 1.00 13.93 ? 266  PHE C CE1   1 
ATOM   8898  C  CE2   . PHE D 2 265 ? -19.802 45.555  51.312 1.00 14.82 ? 266  PHE C CE2   1 
ATOM   8899  C  CZ    . PHE D 2 265 ? -18.844 44.638  51.742 1.00 14.00 ? 266  PHE C CZ    1 
ATOM   8900  N  N     . GLN D 2 266 ? -17.512 48.930  53.566 1.00 14.73 ? 267  GLN C N     1 
ATOM   8901  C  CA    . GLN D 2 266 ? -16.680 49.480  52.494 1.00 15.23 ? 267  GLN C CA    1 
ATOM   8902  C  C     . GLN D 2 266 ? -16.152 50.902  52.703 1.00 16.10 ? 267  GLN C C     1 
ATOM   8903  O  O     . GLN D 2 266 ? -15.521 51.454  51.822 1.00 17.74 ? 267  GLN C O     1 
ATOM   8904  C  CB    . GLN D 2 266 ? -17.371 49.336  51.147 1.00 14.49 ? 267  GLN C CB    1 
ATOM   8905  C  CG    . GLN D 2 266 ? -17.292 47.932  50.591 1.00 15.03 ? 267  GLN C CG    1 
ATOM   8906  C  CD    . GLN D 2 266 ? -18.182 47.733  49.380 1.00 15.09 ? 267  GLN C CD    1 
ATOM   8907  O  OE1   . GLN D 2 266 ? -19.301 48.264  49.323 1.00 14.54 ? 267  GLN C OE1   1 
ATOM   8908  N  NE2   . GLN D 2 266 ? -17.696 46.961  48.422 1.00 14.39 ? 267  GLN C NE2   1 
ATOM   8909  N  N     . VAL D 2 267 ? -16.402 51.480  53.870 1.00 16.75 ? 268  VAL C N     1 
ATOM   8910  C  CA    . VAL D 2 267 ? -15.930 52.825  54.198 1.00 17.27 ? 268  VAL C CA    1 
ATOM   8911  C  C     . VAL D 2 267 ? -14.515 52.783  54.779 1.00 18.37 ? 268  VAL C C     1 
ATOM   8912  O  O     . VAL D 2 267 ? -14.210 51.981  55.654 1.00 20.51 ? 268  VAL C O     1 
ATOM   8913  C  CB    . VAL D 2 267 ? -16.895 53.562  55.173 1.00 17.29 ? 268  VAL C CB    1 
ATOM   8914  C  CG1   . VAL D 2 267 ? -16.250 54.825  55.760 1.00 17.05 ? 268  VAL C CG1   1 
ATOM   8915  C  CG2   . VAL D 2 267 ? -18.204 53.909  54.473 1.00 16.08 ? 268  VAL C CG2   1 
ATOM   8916  N  N     . ASN D 2 268 ? -13.638 53.624  54.271 1.00 18.54 ? 269  ASN C N     1 
ATOM   8917  C  CA    . ASN D 2 268 ? -12.285 53.705  54.754 1.00 17.69 ? 269  ASN C CA    1 
ATOM   8918  C  C     . ASN D 2 268 ? -12.256 54.522  56.045 1.00 17.40 ? 269  ASN C C     1 
ATOM   8919  O  O     . ASN D 2 268 ? -12.602 55.661  56.039 1.00 18.45 ? 269  ASN C O     1 
ATOM   8920  C  CB    . ASN D 2 268 ? -11.458 54.343  53.669 1.00 16.78 ? 269  ASN C CB    1 
ATOM   8921  C  CG    . ASN D 2 268 ? -10.005 54.365  53.993 1.00 17.04 ? 269  ASN C CG    1 
ATOM   8922  O  OD1   . ASN D 2 268 ? -9.612  54.724  55.067 1.00 15.96 ? 269  ASN C OD1   1 
ATOM   8923  N  ND2   . ASN D 2 268 ? -9.208  54.030  53.038 1.00 15.78 ? 269  ASN C ND2   1 
ATOM   8924  N  N     . LYS D 2 269 ? -11.846 53.917  57.144 1.00 17.86 ? 270  LYS C N     1 
ATOM   8925  C  CA    . LYS D 2 269 ? -11.843 54.574  58.453 1.00 18.08 ? 270  LYS C CA    1 
ATOM   8926  C  C     . LYS D 2 269 ? -10.965 55.825  58.552 1.00 19.12 ? 270  LYS C C     1 
ATOM   8927  O  O     . LYS D 2 269 ? -11.386 56.830  59.058 1.00 18.79 ? 270  LYS C O     1 
ATOM   8928  C  CB    . LYS D 2 269 ? -11.473 53.557  59.533 1.00 16.36 ? 270  LYS C CB    1 
ATOM   8929  C  CG    . LYS D 2 269 ? -11.467 54.087  60.941 1.00 15.77 ? 270  LYS C CG    1 
ATOM   8930  C  CD    . LYS D 2 269 ? -11.544 52.985  61.972 1.00 15.85 ? 270  LYS C CD    1 
ATOM   8931  C  CE    . LYS D 2 269 ? -10.321 52.121  62.052 1.00 15.84 ? 270  LYS C CE    1 
ATOM   8932  N  NZ    . LYS D 2 269 ? -9.105  52.893  62.302 1.00 17.02 ? 270  LYS C NZ    1 
ATOM   8933  N  N     . ALA D 2 270 ? -9.763  55.741  58.029 1.00 20.12 ? 271  ALA C N     1 
ATOM   8934  C  CA    . ALA D 2 270 ? -8.834  56.834  57.993 1.00 22.09 ? 271  ALA C CA    1 
ATOM   8935  C  C     . ALA D 2 270 ? -9.375  57.957  57.123 1.00 23.74 ? 271  ALA C C     1 
ATOM   8936  O  O     . ALA D 2 270 ? -9.239  59.103  57.444 1.00 25.42 ? 271  ALA C O     1 
ATOM   8937  C  CB    . ALA D 2 270 ? -7.507  56.344  57.475 1.00 21.87 ? 271  ALA C CB    1 
ATOM   8938  N  N     . ARG D 2 271 ? -9.984  57.599  56.011 1.00 25.84 ? 272  ARG C N     1 
ATOM   8939  C  CA    . ARG D 2 271 ? -10.587 58.577  55.128 1.00 28.11 ? 272  ARG C CA    1 
ATOM   8940  C  C     . ARG D 2 271 ? -11.769 59.284  55.769 1.00 27.18 ? 272  ARG C C     1 
ATOM   8941  O  O     . ARG D 2 271 ? -11.964 60.460  55.575 1.00 26.25 ? 272  ARG C O     1 
ATOM   8942  C  CB    . ARG D 2 271 ? -10.970 58.006  53.767 1.00 29.14 ? 272  ARG C CB    1 
ATOM   8943  C  CG    . ARG D 2 271 ? -9.888  58.159  52.727 1.00 36.08 ? 272  ARG C CG    1 
ATOM   8944  C  CD    . ARG D 2 271 ? -10.456 58.252  51.310 1.00 43.85 ? 272  ARG C CD    1 
ATOM   8945  N  NE    . ARG D 2 271 ? -9.576  57.545  50.385 1.00 46.38 ? 272  ARG C NE    1 
ATOM   8946  C  CZ    . ARG D 2 271 ? -9.830  56.316  49.942 1.00 50.19 ? 272  ARG C CZ    1 
ATOM   8947  N  NH1   . ARG D 2 271 ? -10.969 55.707  50.310 1.00 48.56 ? 272  ARG C NH1   1 
ATOM   8948  N  NH2   . ARG D 2 271 ? -8.972  55.732  49.132 1.00 49.80 ? 272  ARG C NH2   1 
ATOM   8949  N  N     . MET D 2 272 ? -12.559 58.534  56.517 1.00 22.89 ? 273  MET C N     1 
ATOM   8950  C  CA    . MET D 2 272 ? -13.719 59.063  57.198 1.00 21.32 ? 273  MET C CA    1 
ATOM   8951  C  C     . MET D 2 272 ? -13.310 60.099  58.239 1.00 19.17 ? 273  MET C C     1 
ATOM   8952  O  O     . MET D 2 272 ? -13.938 61.106  58.368 1.00 18.40 ? 273  MET C O     1 
ATOM   8953  C  CB    . MET D 2 272 ? -14.487 57.930  57.852 1.00 21.84 ? 273  MET C CB    1 
ATOM   8954  C  CG    . MET D 2 272 ? -15.915 58.254  58.222 1.00 22.94 ? 273  MET C CG    1 
ATOM   8955  S  SD    . MET D 2 272 ? -16.618 57.055  59.357 1.00 27.15 ? 273  MET C SD    1 
ATOM   8956  C  CE    . MET D 2 272 ? -15.916 57.624  60.899 1.00 24.19 ? 273  MET C CE    1 
ATOM   8957  N  N     . ILE D 2 273 ? -12.245 59.809  58.963 1.00 17.94 ? 274  ILE C N     1 
ATOM   8958  C  CA    . ILE D 2 273 ? -11.708 60.664  59.992 1.00 17.54 ? 274  ILE C CA    1 
ATOM   8959  C  C     . ILE D 2 273 ? -11.172 61.984  59.466 1.00 20.89 ? 274  ILE C C     1 
ATOM   8960  O  O     . ILE D 2 273 ? -11.416 63.020  60.043 1.00 21.73 ? 274  ILE C O     1 
ATOM   8961  C  CB    . ILE D 2 273 ? -10.644 59.914  60.821 1.00 16.33 ? 274  ILE C CB    1 
ATOM   8962  C  CG1   . ILE D 2 273 ? -11.289 58.681  61.464 1.00 14.74 ? 274  ILE C CG1   1 
ATOM   8963  C  CG2   . ILE D 2 273 ? -10.021 60.834  61.838 1.00 14.61 ? 274  ILE C CG2   1 
ATOM   8964  C  CD1   . ILE D 2 273 ? -10.394 57.826  62.321 1.00 12.95 ? 274  ILE C CD1   1 
ATOM   8965  N  N     . GLU D 2 274 ? -10.458 61.932  58.355 1.00 22.70 ? 275  GLU C N     1 
ATOM   8966  C  CA    . GLU D 2 274 ? -9.913  63.115  57.738 1.00 24.06 ? 275  GLU C CA    1 
ATOM   8967  C  C     . GLU D 2 274 ? -11.046 64.022  57.273 1.00 24.29 ? 275  GLU C C     1 
ATOM   8968  O  O     . GLU D 2 274 ? -10.970 65.213  57.398 1.00 23.87 ? 275  GLU C O     1 
ATOM   8969  C  CB    . GLU D 2 274 ? -8.948  62.726  56.618 1.00 24.67 ? 275  GLU C CB    1 
ATOM   8970  C  CG    . GLU D 2 274 ? -8.401  63.843  55.756 1.00 28.45 ? 275  GLU C CG    1 
ATOM   8971  C  CD    . GLU D 2 274 ? -7.947  65.084  56.530 1.00 31.58 ? 275  GLU C CD    1 
ATOM   8972  O  OE1   . GLU D 2 274 ? -7.091  64.998  57.461 1.00 28.75 ? 275  GLU C OE1   1 
ATOM   8973  O  OE2   . GLU D 2 274 ? -8.443  66.165  56.170 1.00 32.30 ? 275  GLU C OE2   1 
ATOM   8974  N  N     . LYS D 2 275 ? -12.098 63.427  56.744 1.00 22.66 ? 276  LYS C N     1 
ATOM   8975  C  CA    . LYS D 2 275 ? -13.269 64.143  56.290 1.00 23.61 ? 276  LYS C CA    1 
ATOM   8976  C  C     . LYS D 2 275 ? -13.917 64.941  57.417 1.00 22.04 ? 276  LYS C C     1 
ATOM   8977  O  O     . LYS D 2 275 ? -14.430 66.011  57.211 1.00 20.96 ? 276  LYS C O     1 
ATOM   8978  C  CB    . LYS D 2 275 ? -14.258 63.150  55.704 1.00 23.06 ? 276  LYS C CB    1 
ATOM   8979  C  CG    . LYS D 2 275 ? -15.597 63.742  55.367 1.00 27.74 ? 276  LYS C CG    1 
ATOM   8980  C  CD    . LYS D 2 275 ? -15.435 64.861  54.350 1.00 28.87 ? 276  LYS C CD    1 
ATOM   8981  C  CE    . LYS D 2 275 ? -16.745 65.568  54.133 1.00 29.98 ? 276  LYS C CE    1 
ATOM   8982  N  NZ    . LYS D 2 275 ? -16.540 66.463  52.953 1.00 32.79 ? 276  LYS C NZ    1 
ATOM   8983  N  N     . ILE D 2 276 ? -13.878 64.386  58.613 1.00 21.54 ? 277  ILE C N     1 
ATOM   8984  C  CA    . ILE D 2 276 ? -14.403 65.039  59.816 1.00 20.77 ? 277  ILE C CA    1 
ATOM   8985  C  C     . ILE D 2 276 ? -13.485 66.200  60.204 1.00 20.51 ? 277  ILE C C     1 
ATOM   8986  O  O     . ILE D 2 276 ? -13.960 67.282  60.526 1.00 20.15 ? 277  ILE C O     1 
ATOM   8987  C  CB    . ILE D 2 276 ? -14.553 64.037  60.995 1.00 20.39 ? 277  ILE C CB    1 
ATOM   8988  C  CG1   . ILE D 2 276 ? -15.497 62.889  60.607 1.00 20.08 ? 277  ILE C CG1   1 
ATOM   8989  C  CG2   . ILE D 2 276 ? -15.071 64.745  62.247 1.00 20.23 ? 277  ILE C CG2   1 
ATOM   8990  C  CD1   . ILE D 2 276 ? -15.542 61.740  61.603 1.00 21.28 ? 277  ILE C CD1   1 
ATOM   8991  N  N     . ALA D 2 277 ? -12.182 65.968  60.132 1.00 21.62 ? 278  ALA C N     1 
ATOM   8992  C  CA    . ALA D 2 277 ? -11.186 66.976  60.454 1.00 23.45 ? 278  ALA C CA    1 
ATOM   8993  C  C     . ALA D 2 277 ? -11.258 68.150  59.488 1.00 26.09 ? 278  ALA C C     1 
ATOM   8994  O  O     . ALA D 2 277 ? -11.122 69.298  59.887 1.00 25.48 ? 278  ALA C O     1 
ATOM   8995  C  CB    . ALA D 2 277 ? -9.795  66.364  60.441 1.00 21.29 ? 278  ALA C CB    1 
ATOM   8996  N  N     . GLU D 2 278 ? -11.473 67.841  58.216 1.00 27.77 ? 279  GLU C N     1 
ATOM   8997  C  CA    . GLU D 2 278 ? -11.581 68.851  57.169 1.00 29.60 ? 279  GLU C CA    1 
ATOM   8998  C  C     . GLU D 2 278 ? -12.726 69.812  57.490 1.00 30.02 ? 279  GLU C C     1 
ATOM   8999  O  O     . GLU D 2 278 ? -12.554 71.029  57.408 1.00 32.59 ? 279  GLU C O     1 
ATOM   9000  C  CB    . GLU D 2 278 ? -11.788 68.191  55.797 1.00 32.12 ? 279  GLU C CB    1 
ATOM   9001  C  CG    . GLU D 2 278 ? -11.928 69.173  54.629 1.00 41.41 ? 279  GLU C CG    1 
ATOM   9002  C  CD    . GLU D 2 278 ? -12.351 68.484  53.326 1.00 47.86 ? 279  GLU C CD    1 
ATOM   9003  O  OE1   . GLU D 2 278 ? -12.946 69.165  52.454 1.00 47.24 ? 279  GLU C OE1   1 
ATOM   9004  O  OE2   . GLU D 2 278 ? -12.102 67.255  53.177 1.00 52.03 ? 279  GLU C OE2   1 
ATOM   9005  N  N     . LEU D 2 279 ? -13.867 69.255  57.885 1.00 26.89 ? 280  LEU C N     1 
ATOM   9006  C  CA    . LEU D 2 279 ? -15.055 70.022  58.239 1.00 26.71 ? 280  LEU C CA    1 
ATOM   9007  C  C     . LEU D 2 279 ? -14.879 70.870  59.493 1.00 29.32 ? 280  LEU C C     1 
ATOM   9008  O  O     . LEU D 2 279 ? -15.449 71.937  59.593 1.00 28.10 ? 280  LEU C O     1 
ATOM   9009  C  CB    . LEU D 2 279 ? -16.272 69.114  58.402 1.00 25.68 ? 280  LEU C CB    1 
ATOM   9010  C  CG    . LEU D 2 279 ? -16.812 68.344  57.199 1.00 25.44 ? 280  LEU C CG    1 
ATOM   9011  C  CD1   . LEU D 2 279 ? -17.951 67.451  57.613 1.00 23.39 ? 280  LEU C CD1   1 
ATOM   9012  C  CD2   . LEU D 2 279 ? -17.278 69.286  56.101 1.00 23.71 ? 280  LEU C CD2   1 
ATOM   9013  N  N     . VAL D 2 280 ? -14.059 70.396  60.424 1.00 28.34 ? 281  VAL C N     1 
ATOM   9014  C  CA    . VAL D 2 280 ? -13.797 71.123  61.651 1.00 30.21 ? 281  VAL C CA    1 
ATOM   9015  C  C     . VAL D 2 280 ? -12.944 72.354  61.375 1.00 32.69 ? 281  VAL C C     1 
ATOM   9016  O  O     . VAL D 2 280 ? -13.208 73.430  61.893 1.00 37.03 ? 281  VAL C O     1 
ATOM   9017  C  CB    . VAL D 2 280 ? -13.090 70.230  62.692 1.00 29.11 ? 281  VAL C CB    1 
ATOM   9018  C  CG1   . VAL D 2 280 ? -12.664 71.043  63.897 1.00 27.06 ? 281  VAL C CG1   1 
ATOM   9019  C  CG2   . VAL D 2 280 ? -13.996 69.090  63.118 1.00 29.44 ? 281  VAL C CG2   1 
ATOM   9020  N  N     . ARG D 2 281 ? -11.912 72.160  60.568 1.00 31.52 ? 282  ARG C N     1 
ATOM   9021  C  CA    . ARG D 2 281 ? -10.991 73.204  60.151 1.00 32.66 ? 282  ARG C CA    1 
ATOM   9022  C  C     . ARG D 2 281 ? -11.674 74.271  59.287 1.00 33.53 ? 282  ARG C C     1 
ATOM   9023  O  O     . ARG D 2 281 ? -11.466 75.461  59.471 1.00 36.55 ? 282  ARG C O     1 
ATOM   9024  C  CB    . ARG D 2 281 ? -9.811  72.539  59.437 1.00 34.85 ? 282  ARG C CB    1 
ATOM   9025  C  CG    . ARG D 2 281 ? -9.203  73.284  58.271 1.00 38.95 ? 282  ARG C CG    1 
ATOM   9026  C  CD    . ARG D 2 281 ? -8.023  72.510  57.715 1.00 40.35 ? 282  ARG C CD    1 
ATOM   9027  N  NE    . ARG D 2 281 ? -8.412  71.352  56.920 1.00 41.82 ? 282  ARG C NE    1 
ATOM   9028  C  CZ    . ARG D 2 281 ? -8.345  70.095  57.342 1.00 42.05 ? 282  ARG C CZ    1 
ATOM   9029  N  NH1   . ARG D 2 281 ? -8.713  69.109  56.542 1.00 38.93 ? 282  ARG C NH1   1 
ATOM   9030  N  NH2   . ARG D 2 281 ? -7.910  69.821  58.562 1.00 42.10 ? 282  ARG C NH2   1 
ATOM   9031  N  N     . ASP D 2 282 ? -12.505 73.822  58.360 1.00 33.72 ? 283  ASP C N     1 
ATOM   9032  C  CA    . ASP D 2 282 ? -13.252 74.688  57.477 1.00 31.90 ? 283  ASP C CA    1 
ATOM   9033  C  C     . ASP D 2 282 ? -14.417 75.325  58.191 1.00 30.87 ? 283  ASP C C     1 
ATOM   9034  O  O     . ASP D 2 282 ? -15.171 76.072  57.601 1.00 26.92 ? 283  ASP C O     1 
ATOM   9035  C  CB    . ASP D 2 282 ? -13.747 73.913  56.264 1.00 32.63 ? 283  ASP C CB    1 
ATOM   9036  C  CG    . ASP D 2 282 ? -12.627 73.450  55.385 1.00 34.69 ? 283  ASP C CG    1 
ATOM   9037  O  OD1   . ASP D 2 282 ? -11.465 73.770  55.672 1.00 34.16 ? 283  ASP C OD1   1 
ATOM   9038  O  OD2   . ASP D 2 282 ? -12.908 72.744  54.405 1.00 40.91 ? 283  ASP C OD2   1 
ATOM   9039  N  N     . LYS D 2 283 ? -14.559 74.999  59.467 1.00 31.25 ? 284  LYS C N     1 
ATOM   9040  C  CA    . LYS D 2 283 ? -15.607 75.545  60.314 1.00 31.26 ? 284  LYS C CA    1 
ATOM   9041  C  C     . LYS D 2 283 ? -16.993 75.278  59.756 1.00 31.40 ? 284  LYS C C     1 
ATOM   9042  O  O     . LYS D 2 283 ? -17.908 76.070  59.921 1.00 30.15 ? 284  LYS C O     1 
ATOM   9043  C  CB    . LYS D 2 283 ? -15.396 77.033  60.537 1.00 31.51 ? 284  LYS C CB    1 
ATOM   9044  C  CG    . LYS D 2 283 ? -14.167 77.374  61.359 1.00 34.08 ? 284  LYS C CG    1 
ATOM   9045  C  CD    . LYS D 2 283 ? -13.896 78.867  61.301 1.00 36.30 ? 284  LYS C CD    1 
ATOM   9046  C  CE    . LYS D 2 283 ? -12.984 79.311  62.435 1.00 38.14 ? 284  LYS C CE    1 
ATOM   9047  N  NZ    . LYS D 2 283 ? -13.103 80.771  62.729 1.00 37.38 ? 284  LYS C NZ    1 
ATOM   9048  N  N     . LYS D 2 284 ? -17.137 74.142  59.093 1.00 32.36 ? 285  LYS C N     1 
ATOM   9049  C  CA    . LYS D 2 284 ? -18.406 73.750  58.521 1.00 34.04 ? 285  LYS C CA    1 
ATOM   9050  C  C     . LYS D 2 284 ? -19.234 72.997  59.538 1.00 33.18 ? 285  LYS C C     1 
ATOM   9051  O  O     . LYS D 2 284 ? -20.408 72.738  59.322 1.00 31.41 ? 285  LYS C O     1 
ATOM   9052  C  CB    . LYS D 2 284 ? -18.187 72.903  57.283 1.00 36.61 ? 285  LYS C CB    1 
ATOM   9053  C  CG    . LYS D 2 284 ? -17.429 73.644  56.192 1.00 43.00 ? 285  LYS C CG    1 
ATOM   9054  C  CD    . LYS D 2 284 ? -17.507 72.910  54.867 1.00 49.09 ? 285  LYS C CD    1 
ATOM   9055  C  CE    . LYS D 2 284 ? -16.923 73.759  53.753 1.00 51.67 ? 285  LYS C CE    1 
ATOM   9056  N  NZ    . LYS D 2 284 ? -16.947 73.016  52.462 1.00 56.56 ? 285  LYS C NZ    1 
ATOM   9057  N  N     . ILE D 2 285 ? -18.610 72.657  60.659 1.00 30.89 ? 286  ILE C N     1 
ATOM   9058  C  CA    . ILE D 2 285 ? -19.299 71.970  61.729 1.00 27.64 ? 286  ILE C CA    1 
ATOM   9059  C  C     . ILE D 2 285 ? -18.799 72.521  63.040 1.00 28.50 ? 286  ILE C C     1 
ATOM   9060  O  O     . ILE D 2 285 ? -17.620 72.767  63.213 1.00 25.27 ? 286  ILE C O     1 
ATOM   9061  C  CB    . ILE D 2 285 ? -19.164 70.428  61.633 1.00 28.10 ? 286  ILE C CB    1 
ATOM   9062  C  CG1   . ILE D 2 285 ? -20.266 69.764  62.445 1.00 25.20 ? 286  ILE C CG1   1 
ATOM   9063  C  CG2   . ILE D 2 285 ? -17.774 69.955  62.064 1.00 27.99 ? 286  ILE C CG2   1 
ATOM   9064  C  CD1   . ILE D 2 285 ? -20.488 68.314  62.095 1.00 24.10 ? 286  ILE C CD1   1 
ATOM   9065  N  N     A ASP D 2 286 ? -19.730 72.748  63.954 0.50 29.39 ? 287  ASP C N     1 
ATOM   9066  N  N     B ASP D 2 286 ? -19.698 72.598  64.007 0.50 29.59 ? 287  ASP C N     1 
ATOM   9067  C  CA    A ASP D 2 286 ? -19.439 73.336  65.259 0.50 28.79 ? 287  ASP C CA    1 
ATOM   9068  C  CA    B ASP D 2 286 ? -19.422 73.270  65.264 0.50 28.73 ? 287  ASP C CA    1 
ATOM   9069  C  C     A ASP D 2 286 ? -19.470 72.314  66.402 0.50 30.17 ? 287  ASP C C     1 
ATOM   9070  C  C     B ASP D 2 286 ? -19.583 72.365  66.487 0.50 30.14 ? 287  ASP C C     1 
ATOM   9071  O  O     A ASP D 2 286 ? -20.164 71.294  66.330 0.50 29.71 ? 287  ASP C O     1 
ATOM   9072  O  O     B ASP D 2 286 ? -20.135 71.293  66.374 0.50 29.75 ? 287  ASP C O     1 
ATOM   9073  C  CB    A ASP D 2 286 ? -20.457 74.451  65.520 0.50 28.16 ? 287  ASP C CB    1 
ATOM   9074  C  CB    B ASP D 2 286 ? -20.243 74.546  65.372 0.50 28.13 ? 287  ASP C CB    1 
ATOM   9075  C  CG    A ASP D 2 286 ? -20.305 75.098  66.900 0.50 28.03 ? 287  ASP C CG    1 
ATOM   9076  C  CG    B ASP D 2 286 ? -19.575 75.714  64.660 0.50 27.56 ? 287  ASP C CG    1 
ATOM   9077  O  OD1   A ASP D 2 286 ? -19.187 75.098  67.469 0.50 26.61 ? 287  ASP C OD1   1 
ATOM   9078  O  OD1   B ASP D 2 286 ? -19.772 75.895  63.438 0.50 26.56 ? 287  ASP C OD1   1 
ATOM   9079  O  OD2   A ASP D 2 286 ? -21.318 75.624  67.411 0.50 26.77 ? 287  ASP C OD2   1 
ATOM   9080  O  OD2   B ASP D 2 286 ? -18.827 76.451  65.337 0.50 26.49 ? 287  ASP C OD2   1 
ATOM   9081  N  N     . GLY D 2 287 ? -18.695 72.597  67.449 1.00 29.26 ? 288  GLY C N     1 
ATOM   9082  C  CA    . GLY D 2 287 ? -18.683 71.802  68.670 1.00 27.02 ? 288  GLY C CA    1 
ATOM   9083  C  C     . GLY D 2 287 ? -17.621 70.746  68.903 1.00 28.44 ? 288  GLY C C     1 
ATOM   9084  O  O     . GLY D 2 287 ? -17.563 70.178  69.992 1.00 34.89 ? 288  GLY C O     1 
ATOM   9085  N  N     . ILE D 2 288 ? -16.782 70.474  67.909 1.00 23.53 ? 289  ILE C N     1 
ATOM   9086  C  CA    . ILE D 2 288 ? -15.752 69.444  68.056 1.00 21.31 ? 289  ILE C CA    1 
ATOM   9087  C  C     . ILE D 2 288 ? -14.397 70.021  68.486 1.00 22.63 ? 289  ILE C C     1 
ATOM   9088  O  O     . ILE D 2 288 ? -13.787 70.811  67.758 1.00 25.03 ? 289  ILE C O     1 
ATOM   9089  C  CB    . ILE D 2 288 ? -15.619 68.573  66.769 1.00 19.84 ? 289  ILE C CB    1 
ATOM   9090  C  CG1   . ILE D 2 288 ? -16.985 67.965  66.398 1.00 18.97 ? 289  ILE C CG1   1 
ATOM   9091  C  CG2   . ILE D 2 288 ? -14.542 67.488  66.943 1.00 19.06 ? 289  ILE C CG2   1 
ATOM   9092  C  CD1   . ILE D 2 288 ? -17.002 67.137  65.120 1.00 19.75 ? 289  ILE C CD1   1 
ATOM   9093  N  N     . THR D 2 289 ? -13.934 69.611  69.668 1.00 23.18 ? 290  THR C N     1 
ATOM   9094  C  CA    . THR D 2 289 ? -12.659 70.084  70.219 1.00 23.50 ? 290  THR C CA    1 
ATOM   9095  C  C     . THR D 2 289 ? -11.481 69.140  70.003 1.00 23.42 ? 290  THR C C     1 
ATOM   9096  O  O     . THR D 2 289 ? -10.327 69.563  70.134 1.00 23.24 ? 290  THR C O     1 
ATOM   9097  C  CB    . THR D 2 289 ? -12.752 70.405  71.732 1.00 25.13 ? 290  THR C CB    1 
ATOM   9098  O  OG1   . THR D 2 289 ? -13.181 69.238  72.450 1.00 27.12 ? 290  THR C OG1   1 
ATOM   9099  C  CG2   . THR D 2 289 ? -13.726 71.544  71.982 1.00 24.49 ? 290  THR C CG2   1 
ATOM   9100  N  N     . ASP D 2 290 ? -11.760 67.871  69.700 1.00 23.30 ? 291  ASP C N     1 
ATOM   9101  C  CA    . ASP D 2 290 ? -10.705 66.876  69.463 1.00 21.19 ? 291  ASP C CA    1 
ATOM   9102  C  C     . ASP D 2 290 ? -11.221 65.642  68.705 1.00 22.14 ? 291  ASP C C     1 
ATOM   9103  O  O     . ASP D 2 290 ? -12.384 65.245  68.842 1.00 22.67 ? 291  ASP C O     1 
ATOM   9104  C  CB    . ASP D 2 290 ? -10.026 66.463  70.775 1.00 22.50 ? 291  ASP C CB    1 
ATOM   9105  C  CG    . ASP D 2 290 ? -8.739  65.680  70.557 1.00 24.68 ? 291  ASP C CG    1 
ATOM   9106  O  OD1   . ASP D 2 290 ? -8.147  65.779  69.472 1.00 28.24 ? 291  ASP C OD1   1 
ATOM   9107  O  OD2   . ASP D 2 290 ? -8.318  64.950  71.474 1.00 28.09 ? 291  ASP C OD2   1 
ATOM   9108  N  N     . LEU D 2 291 ? -10.336 65.045  67.912 1.00 20.49 ? 292  LEU C N     1 
ATOM   9109  C  CA    . LEU D 2 291 ? -10.649 63.892  67.086 1.00 20.19 ? 292  LEU C CA    1 
ATOM   9110  C  C     . LEU D 2 291 ? -9.476  62.906  67.148 1.00 19.37 ? 292  LEU C C     1 
ATOM   9111  O  O     . LEU D 2 291 ? -8.358  63.226  66.727 1.00 18.17 ? 292  LEU C O     1 
ATOM   9112  C  CB    . LEU D 2 291 ? -10.915 64.363  65.651 1.00 20.40 ? 292  LEU C CB    1 
ATOM   9113  C  CG    . LEU D 2 291 ? -11.259 63.389  64.523 1.00 21.18 ? 292  LEU C CG    1 
ATOM   9114  C  CD1   . LEU D 2 291 ? -12.555 62.633  64.780 1.00 20.03 ? 292  LEU C CD1   1 
ATOM   9115  C  CD2   . LEU D 2 291 ? -11.340 64.170  63.226 1.00 22.20 ? 292  LEU C CD2   1 
ATOM   9116  N  N     . ARG D 2 292 ? -9.731  61.716  67.692 1.00 18.76 ? 293  ARG C N     1 
ATOM   9117  C  CA    . ARG D 2 292 ? -8.681  60.706  67.874 1.00 18.78 ? 293  ARG C CA    1 
ATOM   9118  C  C     . ARG D 2 292 ? -9.103  59.309  67.439 1.00 19.06 ? 293  ARG C C     1 
ATOM   9119  O  O     . ARG D 2 292 ? -10.195 58.854  67.780 1.00 18.78 ? 293  ARG C O     1 
ATOM   9120  C  CB    . ARG D 2 292 ? -8.258  60.615  69.343 1.00 18.05 ? 293  ARG C CB    1 
ATOM   9121  C  CG    . ARG D 2 292 ? -7.852  61.921  70.001 1.00 20.56 ? 293  ARG C CG    1 
ATOM   9122  C  CD    . ARG D 2 292 ? -7.340  61.705  71.423 1.00 20.01 ? 293  ARG C CD    1 
ATOM   9123  N  NE    . ARG D 2 292 ? -8.255  60.909  72.232 1.00 21.61 ? 293  ARG C NE    1 
ATOM   9124  C  CZ    . ARG D 2 292 ? -9.277  61.397  72.929 1.00 23.76 ? 293  ARG C CZ    1 
ATOM   9125  N  NH1   . ARG D 2 292 ? -9.547  62.699  72.912 1.00 24.81 ? 293  ARG C NH1   1 
ATOM   9126  N  NH2   . ARG D 2 292 ? -10.044 60.576  73.638 1.00 24.13 ? 293  ARG C NH2   1 
ATOM   9127  N  N     . ASP D 2 293 ? -8.230  58.630  66.699 1.00 18.22 ? 294  ASP C N     1 
ATOM   9128  C  CA    . ASP D 2 293 ? -8.473  57.244  66.345 1.00 17.46 ? 294  ASP C CA    1 
ATOM   9129  C  C     . ASP D 2 293 ? -7.779  56.401  67.412 1.00 18.77 ? 294  ASP C C     1 
ATOM   9130  O  O     . ASP D 2 293 ? -6.555  56.257  67.394 1.00 19.98 ? 294  ASP C O     1 
ATOM   9131  C  CB    . ASP D 2 293 ? -7.908  56.908  64.962 1.00 17.01 ? 294  ASP C CB    1 
ATOM   9132  C  CG    . ASP D 2 293 ? -8.276  55.495  64.505 1.00 17.42 ? 294  ASP C CG    1 
ATOM   9133  O  OD1   . ASP D 2 293 ? -9.081  54.833  65.176 1.00 17.66 ? 294  ASP C OD1   1 
ATOM   9134  O  OD2   . ASP D 2 293 ? -7.771  55.046  63.461 1.00 19.20 ? 294  ASP C OD2   1 
ATOM   9135  N  N     . GLU D 2 294 ? -8.554  55.870  68.355 1.00 17.66 ? 295  GLU C N     1 
ATOM   9136  C  CA    . GLU D 2 294 ? -7.995  55.033  69.422 1.00 17.65 ? 295  GLU C CA    1 
ATOM   9137  C  C     . GLU D 2 294 ? -8.023  53.537  69.085 1.00 17.37 ? 295  GLU C C     1 
ATOM   9138  O  O     . GLU D 2 294 ? -7.688  52.695  69.928 1.00 17.56 ? 295  GLU C O     1 
ATOM   9139  C  CB    . GLU D 2 294 ? -8.680  55.317  70.767 1.00 17.37 ? 295  GLU C CB    1 
ATOM   9140  C  CG    . GLU D 2 294 ? -8.426  56.725  71.287 1.00 18.36 ? 295  GLU C CG    1 
ATOM   9141  C  CD    . GLU D 2 294 ? -9.105  57.025  72.613 1.00 20.60 ? 295  GLU C CD    1 
ATOM   9142  O  OE1   . GLU D 2 294 ? -9.815  56.132  73.168 1.00 21.19 ? 295  GLU C OE1   1 
ATOM   9143  O  OE2   . GLU D 2 294 ? -8.936  58.165  73.103 1.00 20.60 ? 295  GLU C OE2   1 
ATOM   9144  N  N     . THR D 2 295 ? -8.398  53.219  67.843 1.00 16.76 ? 296  THR C N     1 
ATOM   9145  C  CA    . THR D 2 295 ? -8.463  51.831  67.372 1.00 15.58 ? 296  THR C CA    1 
ATOM   9146  C  C     . THR D 2 295 ? -7.214  51.043  67.752 1.00 16.29 ? 296  THR C C     1 
ATOM   9147  O  O     . THR D 2 295 ? -6.089  51.512  67.593 1.00 15.41 ? 296  THR C O     1 
ATOM   9148  C  CB    . THR D 2 295 ? -8.722  51.732  65.837 1.00 14.96 ? 296  THR C CB    1 
ATOM   9149  O  OG1   . THR D 2 295 ? -10.035 52.226  65.533 1.00 13.14 ? 296  THR C OG1   1 
ATOM   9150  C  CG2   . THR D 2 295 ? -8.627  50.281  65.352 1.00 14.46 ? 296  THR C CG2   1 
ATOM   9151  N  N     . SER D 2 296 ? -7.442  49.841  68.256 1.00 17.68 ? 297  SER C N     1 
ATOM   9152  C  CA    . SER D 2 296 ? -6.375  48.959  68.675 1.00 18.23 ? 297  SER C CA    1 
ATOM   9153  C  C     . SER D 2 296 ? -6.715  47.539  68.278 1.00 19.98 ? 297  SER C C     1 
ATOM   9154  O  O     . SER D 2 296 ? -7.874  47.177  68.187 1.00 19.60 ? 297  SER C O     1 
ATOM   9155  C  CB    . SER D 2 296 ? -6.205  49.032  70.182 1.00 18.24 ? 297  SER C CB    1 
ATOM   9156  O  OG    . SER D 2 296 ? -5.104  48.266  70.591 1.00 18.83 ? 297  SER C OG    1 
ATOM   9157  N  N     . LEU D 2 297 ? -5.692  46.737  68.033 1.00 21.14 ? 298  LEU C N     1 
ATOM   9158  C  CA    . LEU D 2 297 ? -5.905  45.361  67.669 1.00 24.48 ? 298  LEU C CA    1 
ATOM   9159  C  C     . LEU D 2 297 ? -6.572  44.703  68.863 1.00 28.40 ? 298  LEU C C     1 
ATOM   9160  O  O     . LEU D 2 297 ? -7.524  43.943  68.734 1.00 30.55 ? 298  LEU C O     1 
ATOM   9161  C  CB    . LEU D 2 297 ? -4.564  44.702  67.391 1.00 25.08 ? 298  LEU C CB    1 
ATOM   9162  C  CG    . LEU D 2 297 ? -4.481  43.321  66.757 1.00 25.49 ? 298  LEU C CG    1 
ATOM   9163  C  CD1   . LEU D 2 297 ? -5.382  43.222  65.534 1.00 23.66 ? 298  LEU C CD1   1 
ATOM   9164  C  CD2   . LEU D 2 297 ? -3.040  43.040  66.391 1.00 27.26 ? 298  LEU C CD2   1 
ATOM   9165  N  N     . ARG D 2 298 ? -6.042  45.013  70.035 1.00 28.83 ? 299  ARG C N     1 
ATOM   9166  C  CA    . ARG D 2 298 ? -6.551  44.506  71.292 1.00 27.96 ? 299  ARG C CA    1 
ATOM   9167  C  C     . ARG D 2 298 ? -7.910  45.041  71.744 1.00 27.86 ? 299  ARG C C     1 
ATOM   9168  O  O     . ARG D 2 298 ? -8.720  44.303  72.295 1.00 28.26 ? 299  ARG C O     1 
ATOM   9169  C  CB    . ARG D 2 298 ? -5.479  44.634  72.370 1.00 27.45 ? 299  ARG C CB    1 
ATOM   9170  C  CG    . ARG D 2 298 ? -4.334  43.660  72.089 1.00 28.65 ? 299  ARG C CG    1 
ATOM   9171  C  CD    . ARG D 2 298 ? -2.994  44.126  72.608 1.00 28.30 ? 299  ARG C CD    1 
ATOM   9172  N  NE    . ARG D 2 298 ? -2.609  45.436  72.078 1.00 28.93 ? 299  ARG C NE    1 
ATOM   9173  C  CZ    . ARG D 2 298 ? -2.093  45.634  70.877 1.00 28.18 ? 299  ARG C CZ    1 
ATOM   9174  N  NH1   . ARG D 2 298 ? -1.900  44.629  70.043 1.00 26.49 ? 299  ARG C NH1   1 
ATOM   9175  N  NH2   . ARG D 2 298 ? -1.757  46.877  70.547 1.00 27.10 ? 299  ARG C NH2   1 
ATOM   9176  N  N     . THR D 2 299 ? -8.161  46.323  71.527 1.00 28.37 ? 300  THR C N     1 
ATOM   9177  C  CA    . THR D 2 299 ? -9.419  46.932  71.938 1.00 25.71 ? 300  THR C CA    1 
ATOM   9178  C  C     . THR D 2 299 ? -10.500 47.109  70.871 1.00 24.57 ? 300  THR C C     1 
ATOM   9179  O  O     . THR D 2 299 ? -11.607 47.528  71.190 1.00 24.15 ? 300  THR C O     1 
ATOM   9180  C  CB    . THR D 2 299 ? -9.177  48.291  72.601 1.00 26.88 ? 300  THR C CB    1 
ATOM   9181  O  OG1   . THR D 2 299 ? -8.690  49.213  71.626 1.00 30.48 ? 300  THR C OG1   1 
ATOM   9182  C  CG2   . THR D 2 299 ? -8.167  48.153  73.705 1.00 28.22 ? 300  THR C CG2   1 
ATOM   9183  N  N     . GLY D 2 300 ? -10.193 46.789  69.623 1.00 23.56 ? 301  GLY C N     1 
ATOM   9184  C  CA    . GLY D 2 300 ? -11.156 46.935  68.542 1.00 19.54 ? 301  GLY C CA    1 
ATOM   9185  C  C     . GLY D 2 300 ? -11.280 48.339  67.974 1.00 17.87 ? 301  GLY C C     1 
ATOM   9186  O  O     . GLY D 2 300 ? -10.545 49.243  68.354 1.00 18.61 ? 301  GLY C O     1 
ATOM   9187  N  N     . VAL D 2 301 ? -12.211 48.527  67.053 1.00 15.79 ? 302  VAL C N     1 
ATOM   9188  C  CA    . VAL D 2 301 ? -12.444 49.837  66.448 1.00 14.95 ? 302  VAL C CA    1 
ATOM   9189  C  C     . VAL D 2 301 ? -13.002 50.808  67.484 1.00 14.92 ? 302  VAL C C     1 
ATOM   9190  O  O     . VAL D 2 301 ? -14.006 50.515  68.132 1.00 14.87 ? 302  VAL C O     1 
ATOM   9191  C  CB    . VAL D 2 301 ? -13.436 49.762  65.257 1.00 15.21 ? 302  VAL C CB    1 
ATOM   9192  C  CG1   . VAL D 2 301 ? -13.715 51.156  64.670 1.00 14.07 ? 302  VAL C CG1   1 
ATOM   9193  C  CG2   . VAL D 2 301 ? -12.939 48.792  64.184 1.00 13.97 ? 302  VAL C CG2   1 
ATOM   9194  N  N     . ARG D 2 302 ? -12.339 51.952  67.640 1.00 14.58 ? 303  ARG C N     1 
ATOM   9195  C  CA    . ARG D 2 302 ? -12.764 52.983  68.577 1.00 13.48 ? 303  ARG C CA    1 
ATOM   9196  C  C     . ARG D 2 302 ? -12.350 54.354  68.062 1.00 13.52 ? 303  ARG C C     1 
ATOM   9197  O  O     . ARG D 2 302 ? -11.168 54.694  68.073 1.00 13.56 ? 303  ARG C O     1 
ATOM   9198  C  CB    . ARG D 2 302 ? -12.181 52.725  69.975 1.00 13.75 ? 303  ARG C CB    1 
ATOM   9199  C  CG    . ARG D 2 302 ? -12.552 53.776  71.022 1.00 13.86 ? 303  ARG C CG    1 
ATOM   9200  C  CD    . ARG D 2 302 ? -12.001 53.427  72.393 1.00 13.57 ? 303  ARG C CD    1 
ATOM   9201  N  NE    . ARG D 2 302 ? -12.422 54.414  73.392 1.00 15.30 ? 303  ARG C NE    1 
ATOM   9202  C  CZ    . ARG D 2 302 ? -13.569 54.394  74.073 1.00 14.23 ? 303  ARG C CZ    1 
ATOM   9203  N  NH1   . ARG D 2 302 ? -14.436 53.426  73.899 1.00 14.96 ? 303  ARG C NH1   1 
ATOM   9204  N  NH2   . ARG D 2 302 ? -13.839 55.334  74.941 1.00 14.19 ? 303  ARG C NH2   1 
ATOM   9205  N  N     . VAL D 2 303 ? -13.323 55.126  67.583 1.00 14.57 ? 304  VAL C N     1 
ATOM   9206  C  CA    . VAL D 2 303 ? -13.073 56.476  67.079 1.00 14.02 ? 304  VAL C CA    1 
ATOM   9207  C  C     . VAL D 2 303 ? -13.705 57.448  68.062 1.00 15.30 ? 304  VAL C C     1 
ATOM   9208  O  O     . VAL D 2 303 ? -14.914 57.394  68.306 1.00 15.37 ? 304  VAL C O     1 
ATOM   9209  C  CB    . VAL D 2 303 ? -13.614 56.671  65.636 1.00 14.09 ? 304  VAL C CB    1 
ATOM   9210  C  CG1   . VAL D 2 303 ? -13.332 58.080  65.135 1.00 13.45 ? 304  VAL C CG1   1 
ATOM   9211  C  CG2   . VAL D 2 303 ? -12.978 55.661  64.679 1.00 13.89 ? 304  VAL C CG2   1 
ATOM   9212  N  N     . VAL D 2 304 ? -12.887 58.325  68.641 1.00 17.18 ? 305  VAL C N     1 
ATOM   9213  C  CA    . VAL D 2 304 ? -13.359 59.262  69.673 1.00 17.89 ? 305  VAL C CA    1 
ATOM   9214  C  C     . VAL D 2 304 ? -13.478 60.689  69.130 1.00 18.83 ? 305  VAL C C     1 
ATOM   9215  O  O     . VAL D 2 304 ? -12.556 61.211  68.501 1.00 19.18 ? 305  VAL C O     1 
ATOM   9216  C  CB    . VAL D 2 304 ? -12.462 59.220  70.928 1.00 18.29 ? 305  VAL C CB    1 
ATOM   9217  C  CG1   . VAL D 2 304 ? -12.981 60.160  72.007 1.00 18.33 ? 305  VAL C CG1   1 
ATOM   9218  C  CG2   . VAL D 2 304 ? -12.378 57.798  71.462 1.00 18.58 ? 305  VAL C CG2   1 
ATOM   9219  N  N     . ILE D 2 305 ? -14.630 61.303  69.392 1.00 18.06 ? 306  ILE C N     1 
ATOM   9220  C  CA    . ILE D 2 305 ? -14.931 62.653  68.943 1.00 19.65 ? 306  ILE C CA    1 
ATOM   9221  C  C     . ILE D 2 305 ? -15.342 63.521  70.143 1.00 21.49 ? 306  ILE C C     1 
ATOM   9222  O  O     . ILE D 2 305 ? -16.507 63.496  70.571 1.00 24.77 ? 306  ILE C O     1 
ATOM   9223  C  CB    . ILE D 2 305 ? -16.063 62.640  67.877 1.00 18.39 ? 306  ILE C CB    1 
ATOM   9224  C  CG1   . ILE D 2 305 ? -15.797 61.562  66.817 1.00 18.25 ? 306  ILE C CG1   1 
ATOM   9225  C  CG2   . ILE D 2 305 ? -16.225 64.025  67.252 1.00 18.08 ? 306  ILE C CG2   1 
ATOM   9226  C  CD1   . ILE D 2 305 ? -16.972 61.239  65.900 1.00 17.66 ? 306  ILE C CD1   1 
ATOM   9227  N  N     . ASP D 2 306 ? -14.380 64.267  70.688 1.00 23.28 ? 307  ASP C N     1 
ATOM   9228  C  CA    . ASP D 2 306 ? -14.626 65.145  71.843 1.00 25.01 ? 307  ASP C CA    1 
ATOM   9229  C  C     . ASP D 2 306 ? -15.557 66.318  71.516 1.00 26.01 ? 307  ASP C C     1 
ATOM   9230  O  O     . ASP D 2 306 ? -15.409 66.982  70.485 1.00 25.85 ? 307  ASP C O     1 
ATOM   9231  C  CB    . ASP D 2 306 ? -13.305 65.662  72.444 1.00 26.27 ? 307  ASP C CB    1 
ATOM   9232  C  CG    . ASP D 2 306 ? -12.573 64.612  73.277 1.00 28.34 ? 307  ASP C CG    1 
ATOM   9233  O  OD1   . ASP D 2 306 ? -13.189 63.606  73.686 1.00 30.82 ? 307  ASP C OD1   1 
ATOM   9234  O  OD2   . ASP D 2 306 ? -11.372 64.805  73.554 1.00 29.19 ? 307  ASP C OD2   1 
ATOM   9235  N  N     . VAL D 2 307 ? -16.508 66.567  72.410 1.00 27.24 ? 308  VAL C N     1 
ATOM   9236  C  CA    . VAL D 2 307 ? -17.480 67.651  72.243 1.00 26.27 ? 308  VAL C CA    1 
ATOM   9237  C  C     . VAL D 2 307 ? -17.178 68.805  73.204 1.00 28.56 ? 308  VAL C C     1 
ATOM   9238  O  O     . VAL D 2 307 ? -16.743 68.579  74.337 1.00 29.40 ? 308  VAL C O     1 
ATOM   9239  C  CB    . VAL D 2 307 ? -18.929 67.134  72.435 1.00 25.20 ? 308  VAL C CB    1 
ATOM   9240  C  CG1   . VAL D 2 307 ? -19.934 68.272  72.424 1.00 25.66 ? 308  VAL C CG1   1 
ATOM   9241  C  CG2   . VAL D 2 307 ? -19.281 66.119  71.354 1.00 23.99 ? 308  VAL C CG2   1 
ATOM   9242  N  N     . ARG D 2 308 ? -17.391 70.034  72.734 1.00 30.65 ? 309  ARG C N     1 
ATOM   9243  C  CA    . ARG D 2 308 ? -17.188 71.240  73.545 1.00 32.88 ? 309  ARG C CA    1 
ATOM   9244  C  C     . ARG D 2 308 ? -18.181 71.259  74.703 1.00 32.62 ? 309  ARG C C     1 
ATOM   9245  O  O     . ARG D 2 308 ? -19.332 70.841  74.549 1.00 30.21 ? 309  ARG C O     1 
ATOM   9246  C  CB    . ARG D 2 308 ? -17.313 72.502  72.674 1.00 35.60 ? 309  ARG C CB    1 
ATOM   9247  C  CG    . ARG D 2 308 ? -17.329 73.846  73.424 1.00 36.58 ? 309  ARG C CG    1 
ATOM   9248  C  CD    . ARG D 2 308 ? -17.334 75.060  72.476 1.00 37.01 ? 309  ARG C CD    1 
ATOM   9249  N  NE    . ARG D 2 308 ? -18.285 74.927  71.366 1.00 36.84 ? 309  ARG C NE    1 
ATOM   9250  C  CZ    . ARG D 2 308 ? -19.585 75.243  71.433 1.00 36.10 ? 309  ARG C CZ    1 
ATOM   9251  N  NH1   . ARG D 2 308 ? -20.114 75.723  72.567 1.00 36.96 ? 309  ARG C NH1   1 
ATOM   9252  N  NH2   . ARG D 2 308 ? -20.357 75.079  70.371 1.00 29.62 ? 309  ARG C NH2   1 
ATOM   9253  N  N     . LYS D 2 309 ? -17.722 71.736  75.861 1.00 34.41 ? 310  LYS C N     1 
ATOM   9254  C  CA    . LYS D 2 309 ? -18.554 71.789  77.062 1.00 36.55 ? 310  LYS C CA    1 
ATOM   9255  C  C     . LYS D 2 309 ? -19.867 72.537  76.811 1.00 35.94 ? 310  LYS C C     1 
ATOM   9256  O  O     . LYS D 2 309 ? -19.873 73.622  76.215 1.00 36.01 ? 310  LYS C O     1 
ATOM   9257  C  CB    . LYS D 2 309 ? -17.779 72.418  78.224 1.00 37.03 ? 310  LYS C CB    1 
ATOM   9258  C  CG    . LYS D 2 309 ? -18.335 72.075  79.603 1.00 38.84 ? 310  LYS C CG    1 
ATOM   9259  C  CD    . LYS D 2 309 ? -17.552 72.765  80.710 1.00 38.00 ? 310  LYS C CD    1 
ATOM   9260  C  CE    . LYS D 2 309 ? -17.909 72.204  82.085 1.00 38.72 ? 310  LYS C CE    1 
ATOM   9261  N  NZ    . LYS D 2 309 ? -19.361 72.246  82.385 1.00 37.43 ? 310  LYS C NZ    1 
ATOM   9262  N  N     . ASP D 2 310 ? -20.966 71.913  77.239 1.00 39.34 ? 311  ASP C N     1 
ATOM   9263  C  CA    . ASP D 2 310 ? -22.341 72.461  77.126 1.00 41.31 ? 311  ASP C CA    1 
ATOM   9264  C  C     . ASP D 2 310 ? -23.010 72.377  75.742 1.00 38.62 ? 311  ASP C C     1 
ATOM   9265  O  O     . ASP D 2 310 ? -24.205 72.648  75.620 1.00 39.32 ? 311  ASP C O     1 
ATOM   9266  C  CB    . ASP D 2 310 ? -22.439 73.879  77.728 1.00 41.44 ? 311  ASP C CB    1 
ATOM   9267  C  CG    . ASP D 2 310 ? -22.096 73.906  79.215 1.00 44.61 ? 311  ASP C CG    1 
ATOM   9268  O  OD1   . ASP D 2 310 ? -21.733 72.843  79.779 1.00 42.23 ? 311  ASP C OD1   1 
ATOM   9269  O  OD2   . ASP D 2 310 ? -22.167 74.997  79.821 1.00 47.61 ? 311  ASP C OD2   1 
ATOM   9270  N  N     . ALA D 2 311 ? -22.248 71.994  74.720 1.00 38.05 ? 312  ALA C N     1 
ATOM   9271  C  CA    . ALA D 2 311 ? -22.795 71.810  73.368 1.00 34.55 ? 312  ALA C CA    1 
ATOM   9272  C  C     . ALA D 2 311 ? -23.550 70.483  73.305 1.00 31.96 ? 312  ALA C C     1 
ATOM   9273  O  O     . ALA D 2 311 ? -23.162 69.515  73.959 1.00 31.35 ? 312  ALA C O     1 
ATOM   9274  C  CB    . ALA D 2 311 ? -21.682 71.846  72.328 1.00 31.05 ? 312  ALA C CB    1 
ATOM   9275  N  N     . ASN D 2 312 ? -24.623 70.444  72.523 1.00 32.27 ? 313  ASN C N     1 
ATOM   9276  C  CA    . ASN D 2 312 ? -25.434 69.230  72.399 1.00 28.61 ? 313  ASN C CA    1 
ATOM   9277  C  C     . ASN D 2 312 ? -24.802 68.199  71.448 1.00 28.68 ? 313  ASN C C     1 
ATOM   9278  O  O     . ASN D 2 312 ? -24.825 68.359  70.226 1.00 29.09 ? 313  ASN C O     1 
ATOM   9279  C  CB    . ASN D 2 312 ? -26.869 69.573  71.992 1.00 27.92 ? 313  ASN C CB    1 
ATOM   9280  C  CG    . ASN D 2 312 ? -27.801 68.386  72.051 1.00 30.52 ? 313  ASN C CG    1 
ATOM   9281  O  OD1   . ASN D 2 312 ? -27.371 67.227  72.025 1.00 35.23 ? 313  ASN C OD1   1 
ATOM   9282  N  ND2   . ASN D 2 312 ? -29.099 68.667  72.123 1.00 29.21 ? 313  ASN C ND2   1 
ATOM   9283  N  N     . ALA D 2 313 ? -24.256 67.138  72.044 1.00 27.03 ? 314  ALA C N     1 
ATOM   9284  C  CA    . ALA D 2 313 ? -23.577 66.058  71.332 1.00 24.28 ? 314  ALA C CA    1 
ATOM   9285  C  C     . ALA D 2 313 ? -24.491 65.259  70.394 1.00 23.00 ? 314  ALA C C     1 
ATOM   9286  O  O     . ALA D 2 313 ? -24.016 64.666  69.418 1.00 21.26 ? 314  ALA C O     1 
ATOM   9287  C  CB    . ALA D 2 313 ? -22.876 65.136  72.321 1.00 24.29 ? 314  ALA C CB    1 
ATOM   9288  N  N     . SER D 2 314 ? -25.787 65.230  70.700 1.00 21.14 ? 315  SER C N     1 
ATOM   9289  C  CA    . SER D 2 314 ? -26.765 64.547  69.852 1.00 20.65 ? 315  SER C CA    1 
ATOM   9290  C  C     . SER D 2 314 ? -26.983 65.304  68.547 1.00 20.58 ? 315  SER C C     1 
ATOM   9291  O  O     . SER D 2 314 ? -27.227 64.694  67.507 1.00 22.24 ? 315  SER C O     1 
ATOM   9292  C  CB    . SER D 2 314 ? -28.097 64.356  70.581 1.00 20.76 ? 315  SER C CB    1 
ATOM   9293  O  OG    . SER D 2 314 ? -27.977 63.415  71.630 1.00 19.92 ? 315  SER C OG    1 
ATOM   9294  N  N     . VAL D 2 315 ? -26.895 66.632  68.614 1.00 19.68 ? 316  VAL C N     1 
ATOM   9295  C  CA    . VAL D 2 315 ? -27.050 67.488  67.436 1.00 17.86 ? 316  VAL C CA    1 
ATOM   9296  C  C     . VAL D 2 315 ? -25.811 67.359  66.545 1.00 17.23 ? 316  VAL C C     1 
ATOM   9297  O  O     . VAL D 2 315 ? -25.921 67.326  65.316 1.00 16.02 ? 316  VAL C O     1 
ATOM   9298  C  CB    . VAL D 2 315 ? -27.308 68.973  67.840 1.00 18.24 ? 316  VAL C CB    1 
ATOM   9299  C  CG1   . VAL D 2 315 ? -27.287 69.913  66.629 1.00 17.18 ? 316  VAL C CG1   1 
ATOM   9300  C  CG2   . VAL D 2 315 ? -28.625 69.094  68.597 1.00 18.26 ? 316  VAL C CG2   1 
ATOM   9301  N  N     . ILE D 2 316 ? -24.642 67.280  67.185 1.00 16.98 ? 317  ILE C N     1 
ATOM   9302  C  CA    . ILE D 2 316 ? -23.361 67.136  66.487 1.00 17.06 ? 317  ILE C CA    1 
ATOM   9303  C  C     . ILE D 2 316 ? -23.310 65.816  65.716 1.00 17.30 ? 317  ILE C C     1 
ATOM   9304  O  O     . ILE D 2 316 ? -22.882 65.779  64.560 1.00 17.08 ? 317  ILE C O     1 
ATOM   9305  C  CB    . ILE D 2 316 ? -22.169 67.283  67.465 1.00 17.60 ? 317  ILE C CB    1 
ATOM   9306  C  CG1   . ILE D 2 316 ? -22.145 68.711  68.027 1.00 18.06 ? 317  ILE C CG1   1 
ATOM   9307  C  CG2   . ILE D 2 316 ? -20.838 66.983  66.784 1.00 18.11 ? 317  ILE C CG2   1 
ATOM   9308  C  CD1   . ILE D 2 316 ? -21.102 68.954  69.093 1.00 16.92 ? 317  ILE C CD1   1 
ATOM   9309  N  N     . LEU D 2 317 ? -23.782 64.748  66.358 1.00 17.71 ? 318  LEU C N     1 
ATOM   9310  C  CA    . LEU D 2 317 ? -23.835 63.409  65.774 1.00 17.22 ? 318  LEU C CA    1 
ATOM   9311  C  C     . LEU D 2 317 ? -24.709 63.395  64.517 1.00 17.66 ? 318  LEU C C     1 
ATOM   9312  O  O     . LEU D 2 317 ? -24.266 62.950  63.453 1.00 17.94 ? 318  LEU C O     1 
ATOM   9313  C  CB    . LEU D 2 317 ? -24.338 62.398  66.818 1.00 16.46 ? 318  LEU C CB    1 
ATOM   9314  C  CG    . LEU D 2 317 ? -24.450 60.904  66.489 1.00 16.14 ? 318  LEU C CG    1 
ATOM   9315  C  CD1   . LEU D 2 317 ? -23.124 60.307  66.073 1.00 16.30 ? 318  LEU C CD1   1 
ATOM   9316  C  CD2   . LEU D 2 317 ? -25.070 60.147  67.663 1.00 16.36 ? 318  LEU C CD2   1 
ATOM   9317  N  N     . ASN D 2 318 ? -25.939 63.892  64.646 1.00 17.91 ? 319  ASN C N     1 
ATOM   9318  C  CA    . ASN D 2 318 ? -26.885 63.982  63.529 1.00 18.34 ? 319  ASN C CA    1 
ATOM   9319  C  C     . ASN D 2 318 ? -26.288 64.742  62.347 1.00 17.75 ? 319  ASN C C     1 
ATOM   9320  O  O     . ASN D 2 318 ? -26.508 64.371  61.195 1.00 16.74 ? 319  ASN C O     1 
ATOM   9321  C  CB    . ASN D 2 318 ? -28.189 64.647  63.980 1.00 19.27 ? 319  ASN C CB    1 
ATOM   9322  C  CG    . ASN D 2 318 ? -28.953 63.816  64.997 1.00 23.18 ? 319  ASN C CG    1 
ATOM   9323  O  OD1   . ASN D 2 318 ? -28.769 62.587  65.099 1.00 25.24 ? 319  ASN C OD1   1 
ATOM   9324  N  ND2   . ASN D 2 318 ? -29.824 64.474  65.754 1.00 24.34 ? 319  ASN C ND2   1 
ATOM   9325  N  N     . ASN D 2 319 ? -25.538 65.803  62.649 1.00 17.01 ? 320  ASN C N     1 
ATOM   9326  C  CA    . ASN D 2 319 ? -24.840 66.571  61.627 1.00 19.23 ? 320  ASN C CA    1 
ATOM   9327  C  C     . ASN D 2 319 ? -23.745 65.741  60.942 1.00 20.96 ? 320  ASN C C     1 
ATOM   9328  O  O     . ASN D 2 319 ? -23.560 65.832  59.725 1.00 23.24 ? 320  ASN C O     1 
ATOM   9329  C  CB    . ASN D 2 319 ? -24.259 67.874  62.212 1.00 19.76 ? 320  ASN C CB    1 
ATOM   9330  C  CG    . ASN D 2 319 ? -25.333 68.918  62.559 1.00 20.64 ? 320  ASN C CG    1 
ATOM   9331  O  OD1   . ASN D 2 319 ? -26.514 68.780  62.185 1.00 22.81 ? 320  ASN C OD1   1 
ATOM   9332  N  ND2   . ASN D 2 319 ? -24.932 69.966  63.258 1.00 18.67 ? 320  ASN C ND2   1 
ATOM   9333  N  N     . LEU D 2 320 ? -23.026 64.930  61.720 1.00 21.40 ? 321  LEU C N     1 
ATOM   9334  C  CA    . LEU D 2 320 ? -21.975 64.062  61.174 1.00 21.63 ? 321  LEU C CA    1 
ATOM   9335  C  C     . LEU D 2 320 ? -22.552 63.007  60.218 1.00 21.91 ? 321  LEU C C     1 
ATOM   9336  O  O     . LEU D 2 320 ? -21.893 62.614  59.254 1.00 21.36 ? 321  LEU C O     1 
ATOM   9337  C  CB    . LEU D 2 320 ? -21.168 63.393  62.286 1.00 21.21 ? 321  LEU C CB    1 
ATOM   9338  C  CG    . LEU D 2 320 ? -20.233 64.234  63.161 1.00 20.95 ? 321  LEU C CG    1 
ATOM   9339  C  CD1   . LEU D 2 320 ? -19.767 63.419  64.366 1.00 19.92 ? 321  LEU C CD1   1 
ATOM   9340  C  CD2   . LEU D 2 320 ? -19.040 64.775  62.373 1.00 19.77 ? 321  LEU C CD2   1 
ATOM   9341  N  N     . TYR D 2 321 ? -23.778 62.558  60.496 1.00 21.58 ? 322  TYR C N     1 
ATOM   9342  C  CA    . TYR D 2 321 ? -24.456 61.590  59.639 1.00 21.14 ? 322  TYR C CA    1 
ATOM   9343  C  C     . TYR D 2 321 ? -24.783 62.191  58.285 1.00 23.19 ? 322  TYR C C     1 
ATOM   9344  O  O     . TYR D 2 321 ? -24.680 61.519  57.258 1.00 27.03 ? 322  TYR C O     1 
ATOM   9345  C  CB    . TYR D 2 321 ? -25.742 61.064  60.279 1.00 18.50 ? 322  TYR C CB    1 
ATOM   9346  C  CG    . TYR D 2 321 ? -25.531 60.112  61.427 1.00 18.81 ? 322  TYR C CG    1 
ATOM   9347  C  CD1   . TYR D 2 321 ? -24.645 59.038  61.311 1.00 18.45 ? 322  TYR C CD1   1 
ATOM   9348  C  CD2   . TYR D 2 321 ? -26.274 60.226  62.604 1.00 19.88 ? 322  TYR C CD2   1 
ATOM   9349  C  CE1   . TYR D 2 321 ? -24.454 58.142  62.352 1.00 18.99 ? 322  TYR C CE1   1 
ATOM   9350  C  CE2   . TYR D 2 321 ? -26.101 59.321  63.657 1.00 20.55 ? 322  TYR C CE2   1 
ATOM   9351  C  CZ    . TYR D 2 321 ? -25.184 58.280  63.516 1.00 20.48 ? 322  TYR C CZ    1 
ATOM   9352  O  OH    . TYR D 2 321 ? -24.987 57.375  64.528 1.00 21.31 ? 322  TYR C OH    1 
ATOM   9353  N  N     . LYS D 2 322 ? -25.167 63.465  58.296 1.00 22.71 ? 323  LYS C N     1 
ATOM   9354  C  CA    . LYS D 2 322 ? -25.522 64.196  57.086 1.00 22.66 ? 323  LYS C CA    1 
ATOM   9355  C  C     . LYS D 2 322 ? -24.318 64.603  56.230 1.00 22.61 ? 323  LYS C C     1 
ATOM   9356  O  O     . LYS D 2 322 ? -24.413 64.630  54.999 1.00 26.05 ? 323  LYS C O     1 
ATOM   9357  C  CB    . LYS D 2 322 ? -26.282 65.476  57.453 1.00 22.87 ? 323  LYS C CB    1 
ATOM   9358  C  CG    . LYS D 2 322 ? -27.605 65.286  58.172 1.00 24.81 ? 323  LYS C CG    1 
ATOM   9359  C  CD    . LYS D 2 322 ? -28.097 66.672  58.630 1.00 25.83 ? 323  LYS C CD    1 
ATOM   9360  C  CE    . LYS D 2 322 ? -29.423 66.579  59.356 1.00 26.34 ? 323  LYS C CE    1 
ATOM   9361  N  NZ    . LYS D 2 322 ? -29.873 67.943  59.749 1.00 26.15 ? 323  LYS C NZ    1 
ATOM   9362  N  N     . GLN D 2 323 ? -23.207 64.960  56.868 1.00 20.28 ? 324  GLN C N     1 
ATOM   9363  C  CA    . GLN D 2 323 ? -22.028 65.454  56.155 1.00 19.35 ? 324  GLN C CA    1 
ATOM   9364  C  C     . GLN D 2 323 ? -20.806 64.561  56.013 1.00 17.12 ? 324  GLN C C     1 
ATOM   9365  O  O     . GLN D 2 323 ? -19.897 64.893  55.288 1.00 17.58 ? 324  GLN C O     1 
ATOM   9366  C  CB    . GLN D 2 323 ? -21.578 66.796  56.746 1.00 20.89 ? 324  GLN C CB    1 
ATOM   9367  C  CG    . GLN D 2 323 ? -22.715 67.730  57.142 1.00 23.04 ? 324  GLN C CG    1 
ATOM   9368  C  CD    . GLN D 2 323 ? -22.244 68.962  57.883 1.00 23.65 ? 324  GLN C CD    1 
ATOM   9369  O  OE1   . GLN D 2 323 ? -21.407 69.714  57.390 1.00 22.64 ? 324  GLN C OE1   1 
ATOM   9370  N  NE2   . GLN D 2 323 ? -22.768 69.168  59.065 1.00 21.40 ? 324  GLN C NE2   1 
ATOM   9371  N  N     . THR D 2 324 ? -20.760 63.453  56.716 1.00 15.90 ? 325  THR C N     1 
ATOM   9372  C  CA    . THR D 2 324 ? -19.620 62.544  56.626 1.00 14.40 ? 325  THR C CA    1 
ATOM   9373  C  C     . THR D 2 324 ? -20.080 61.119  56.313 1.00 13.54 ? 325  THR C C     1 
ATOM   9374  O  O     . THR D 2 324 ? -21.246 60.794  56.522 1.00 13.26 ? 325  THR C O     1 
ATOM   9375  C  CB    . THR D 2 324 ? -18.796 62.521  57.940 1.00 14.32 ? 325  THR C CB    1 
ATOM   9376  O  OG1   . THR D 2 324 ? -19.511 61.808  58.953 1.00 12.75 ? 325  THR C OG1   1 
ATOM   9377  C  CG2   . THR D 2 324 ? -18.470 63.929  58.422 1.00 13.42 ? 325  THR C CG2   1 
ATOM   9378  N  N     . PRO D 2 325 ? -19.171 60.264  55.803 1.00 14.17 ? 326  PRO C N     1 
ATOM   9379  C  CA    . PRO D 2 325 ? -19.521 58.864  55.531 1.00 15.46 ? 326  PRO C CA    1 
ATOM   9380  C  C     . PRO D 2 325 ? -19.949 58.050  56.772 1.00 16.27 ? 326  PRO C C     1 
ATOM   9381  O  O     . PRO D 2 325 ? -20.123 56.831  56.672 1.00 16.48 ? 326  PRO C O     1 
ATOM   9382  C  CB    . PRO D 2 325 ? -18.237 58.292  54.915 1.00 14.48 ? 326  PRO C CB    1 
ATOM   9383  C  CG    . PRO D 2 325 ? -17.521 59.483  54.367 1.00 14.10 ? 326  PRO C CG    1 
ATOM   9384  C  CD    . PRO D 2 325 ? -17.784 60.556  55.389 1.00 14.29 ? 326  PRO C CD    1 
ATOM   9385  N  N     . LEU D 2 326 ? -20.134 58.722  57.911 1.00 16.01 ? 327  LEU C N     1 
ATOM   9386  C  CA    . LEU D 2 326 ? -20.588 58.093  59.158 1.00 16.98 ? 327  LEU C CA    1 
ATOM   9387  C  C     . LEU D 2 326 ? -21.940 57.417  58.914 1.00 15.88 ? 327  LEU C C     1 
ATOM   9388  O  O     . LEU D 2 326 ? -22.361 56.507  59.633 1.00 13.44 ? 327  LEU C O     1 
ATOM   9389  C  CB    . LEU D 2 326 ? -20.717 59.144  60.254 1.00 19.55 ? 327  LEU C CB    1 
ATOM   9390  C  CG    . LEU D 2 326 ? -20.745 58.681  61.699 1.00 23.81 ? 327  LEU C CG    1 
ATOM   9391  C  CD1   . LEU D 2 326 ? -19.395 58.085  62.104 1.00 25.04 ? 327  LEU C CD1   1 
ATOM   9392  C  CD2   . LEU D 2 326 ? -21.066 59.885  62.560 1.00 28.96 ? 327  LEU C CD2   1 
ATOM   9393  N  N     . GLN D 2 327 ? -22.623 57.927  57.897 1.00 16.20 ? 328  GLN C N     1 
ATOM   9394  C  CA    . GLN D 2 327 ? -23.845 57.355  57.378 1.00 16.04 ? 328  GLN C CA    1 
ATOM   9395  C  C     . GLN D 2 327 ? -23.575 57.277  55.887 1.00 16.07 ? 328  GLN C C     1 
ATOM   9396  O  O     . GLN D 2 327 ? -23.233 58.279  55.260 1.00 17.89 ? 328  GLN C O     1 
ATOM   9397  C  CB    . GLN D 2 327 ? -25.063 58.239  57.691 1.00 15.58 ? 328  GLN C CB    1 
ATOM   9398  C  CG    . GLN D 2 327 ? -26.376 57.744  57.057 1.00 14.99 ? 328  GLN C CG    1 
ATOM   9399  C  CD    . GLN D 2 327 ? -27.614 58.441  57.590 1.00 15.44 ? 328  GLN C CD    1 
ATOM   9400  O  OE1   . GLN D 2 327 ? -27.624 58.931  58.723 1.00 18.59 ? 328  GLN C OE1   1 
ATOM   9401  N  NE2   . GLN D 2 327 ? -28.679 58.452  56.806 1.00 14.27 ? 328  GLN C NE2   1 
ATOM   9402  N  N     . THR D 2 328 ? -23.656 56.078  55.330 1.00 16.43 ? 329  THR C N     1 
ATOM   9403  C  CA    . THR D 2 328 ? -23.434 55.898  53.896 1.00 17.84 ? 329  THR C CA    1 
ATOM   9404  C  C     . THR D 2 328 ? -24.525 54.962  53.401 1.00 18.69 ? 329  THR C C     1 
ATOM   9405  O  O     . THR D 2 328 ? -24.955 54.064  54.131 1.00 20.21 ? 329  THR C O     1 
ATOM   9406  C  CB    . THR D 2 328 ? -22.044 55.314  53.596 1.00 19.19 ? 329  THR C CB    1 
ATOM   9407  O  OG1   . THR D 2 328 ? -21.040 56.123  54.211 1.00 22.46 ? 329  THR C OG1   1 
ATOM   9408  C  CG2   . THR D 2 328 ? -21.768 55.274  52.091 1.00 20.42 ? 329  THR C CG2   1 
ATOM   9409  N  N     . SER D 2 329 ? -24.991 55.183  52.176 1.00 16.59 ? 330  SER C N     1 
ATOM   9410  C  CA    . SER D 2 329 ? -25.999 54.303  51.615 1.00 17.91 ? 330  SER C CA    1 
ATOM   9411  C  C     . SER D 2 329 ? -25.385 53.230  50.722 1.00 17.67 ? 330  SER C C     1 
ATOM   9412  O  O     . SER D 2 329 ? -24.380 53.467  50.052 1.00 17.41 ? 330  SER C O     1 
ATOM   9413  C  CB    . SER D 2 329 ? -27.072 55.099  50.859 1.00 19.49 ? 330  SER C CB    1 
ATOM   9414  O  OG    . SER D 2 329 ? -26.492 55.958  49.896 1.00 24.25 ? 330  SER C OG    1 
ATOM   9415  N  N     . PHE D 2 330 ? -25.973 52.039  50.759 1.00 17.54 ? 331  PHE C N     1 
ATOM   9416  C  CA    . PHE D 2 330 ? -25.543 50.931  49.916 1.00 16.35 ? 331  PHE C CA    1 
ATOM   9417  C  C     . PHE D 2 330 ? -26.613 50.757  48.836 1.00 15.64 ? 331  PHE C C     1 
ATOM   9418  O  O     . PHE D 2 330 ? -27.729 50.343  49.125 1.00 14.39 ? 331  PHE C O     1 
ATOM   9419  C  CB    . PHE D 2 330 ? -25.384 49.641  50.730 1.00 18.17 ? 331  PHE C CB    1 
ATOM   9420  C  CG    . PHE D 2 330 ? -24.842 48.480  49.926 1.00 18.97 ? 331  PHE C CG    1 
ATOM   9421  C  CD1   . PHE D 2 330 ? -25.693 47.709  49.123 1.00 18.94 ? 331  PHE C CD1   1 
ATOM   9422  C  CD2   . PHE D 2 330 ? -23.493 48.160  49.966 1.00 18.52 ? 331  PHE C CD2   1 
ATOM   9423  C  CE1   . PHE D 2 330 ? -25.200 46.640  48.373 1.00 20.11 ? 331  PHE C CE1   1 
ATOM   9424  C  CE2   . PHE D 2 330 ? -22.983 47.094  49.221 1.00 19.25 ? 331  PHE C CE2   1 
ATOM   9425  C  CZ    . PHE D 2 330 ? -23.838 46.326  48.423 1.00 21.15 ? 331  PHE C CZ    1 
ATOM   9426  N  N     . GLY D 2 331 ? -26.268 51.099  47.597 1.00 15.46 ? 332  GLY C N     1 
ATOM   9427  C  CA    . GLY D 2 331 ? -27.191 50.989  46.476 1.00 14.14 ? 332  GLY C CA    1 
ATOM   9428  C  C     . GLY D 2 331 ? -27.180 49.615  45.835 1.00 13.80 ? 332  GLY C C     1 
ATOM   9429  O  O     . GLY D 2 331 ? -26.317 49.324  45.003 1.00 14.86 ? 332  GLY C O     1 
ATOM   9430  N  N     . VAL D 2 332 ? -28.145 48.783  46.220 1.00 12.08 ? 333  VAL C N     1 
ATOM   9431  C  CA    . VAL D 2 332 ? -28.273 47.427  45.703 1.00 11.25 ? 333  VAL C CA    1 
ATOM   9432  C  C     . VAL D 2 332 ? -28.616 47.404  44.215 1.00 11.25 ? 333  VAL C C     1 
ATOM   9433  O  O     . VAL D 2 332 ? -29.489 48.141  43.749 1.00 12.04 ? 333  VAL C O     1 
ATOM   9434  C  CB    . VAL D 2 332 ? -29.342 46.619  46.491 1.00 11.18 ? 333  VAL C CB    1 
ATOM   9435  C  CG1   . VAL D 2 332 ? -29.498 45.228  45.908 1.00 10.93 ? 333  VAL C CG1   1 
ATOM   9436  C  CG2   . VAL D 2 332 ? -28.981 46.530  47.959 1.00 10.55 ? 333  VAL C CG2   1 
ATOM   9437  N  N     . ASN D 2 333 ? -27.904 46.554  43.485 1.00 11.24 ? 334  ASN C N     1 
ATOM   9438  C  CA    . ASN D 2 333 ? -28.081 46.360  42.054 1.00 10.90 ? 334  ASN C CA    1 
ATOM   9439  C  C     . ASN D 2 333 ? -27.638 44.921  41.784 1.00 11.03 ? 334  ASN C C     1 
ATOM   9440  O  O     . ASN D 2 333 ? -26.486 44.665  41.429 1.00 10.89 ? 334  ASN C O     1 
ATOM   9441  C  CB    . ASN D 2 333 ? -27.240 47.375  41.266 1.00 10.49 ? 334  ASN C CB    1 
ATOM   9442  C  CG    . ASN D 2 333 ? -27.511 47.331  39.774 1.00 10.53 ? 334  ASN C CG    1 
ATOM   9443  O  OD1   . ASN D 2 333 ? -26.690 47.767  38.965 1.00 9.86  ? 334  ASN C OD1   1 
ATOM   9444  N  ND2   . ASN D 2 333 ? -28.673 46.809  39.393 1.00 11.18 ? 334  ASN C ND2   1 
ATOM   9445  N  N     . MET D 2 334 ? -28.572 43.989  41.981 1.00 11.11 ? 335  MET C N     1 
ATOM   9446  C  CA    . MET D 2 334 ? -28.280 42.560  41.874 1.00 10.91 ? 335  MET C CA    1 
ATOM   9447  C  C     . MET D 2 334 ? -28.250 41.976  40.472 1.00 10.67 ? 335  MET C C     1 
ATOM   9448  O  O     . MET D 2 334 ? -29.223 41.362  40.006 1.00 10.77 ? 335  MET C O     1 
ATOM   9449  C  CB    . MET D 2 334 ? -29.190 41.728  42.793 1.00 11.72 ? 335  MET C CB    1 
ATOM   9450  C  CG    . MET D 2 334 ? -28.977 42.011  44.288 1.00 13.35 ? 335  MET C CG    1 
ATOM   9451  S  SD    . MET D 2 334 ? -29.685 40.748  45.385 1.00 16.03 ? 335  MET C SD    1 
ATOM   9452  C  CE    . MET D 2 334 ? -31.437 40.929  45.033 1.00 15.16 ? 335  MET C CE    1 
ATOM   9453  N  N     . ILE D 2 335 ? -27.111 42.167  39.811 1.00 10.24 ? 336  ILE C N     1 
ATOM   9454  C  CA    . ILE D 2 335 ? -26.864 41.600  38.492 1.00 10.06 ? 336  ILE C CA    1 
ATOM   9455  C  C     . ILE D 2 335 ? -25.842 40.475  38.602 1.00 9.83  ? 336  ILE C C     1 
ATOM   9456  O  O     . ILE D 2 335 ? -24.760 40.651  39.167 1.00 10.38 ? 336  ILE C O     1 
ATOM   9457  C  CB    . ILE D 2 335 ? -26.414 42.665  37.465 1.00 9.94  ? 336  ILE C CB    1 
ATOM   9458  C  CG1   . ILE D 2 335 ? -27.582 43.625  37.151 1.00 9.96  ? 336  ILE C CG1   1 
ATOM   9459  C  CG2   . ILE D 2 335 ? -25.912 41.979  36.189 1.00 10.20 ? 336  ILE C CG2   1 
ATOM   9460  C  CD1   . ILE D 2 335 ? -27.273 44.750  36.160 1.00 9.72  ? 336  ILE C CD1   1 
ATOM   9461  N  N     . ALA D 2 336 ? -26.208 39.308  38.082 1.00 9.77  ? 337  ALA C N     1 
ATOM   9462  C  CA    . ALA D 2 336 ? -25.339 38.131  38.099 1.00 9.33  ? 337  ALA C CA    1 
ATOM   9463  C  C     . ALA D 2 336 ? -25.470 37.378  36.783 1.00 9.58  ? 337  ALA C C     1 
ATOM   9464  O  O     . ALA D 2 336 ? -26.376 37.648  35.977 1.00 9.57  ? 337  ALA C O     1 
ATOM   9465  C  CB    . ALA D 2 336 ? -25.701 37.232  39.250 1.00 9.35  ? 337  ALA C CB    1 
ATOM   9466  N  N     . LEU D 2 337 ? -24.574 36.454  36.539 1.00 9.45  ? 338  LEU C N     1 
ATOM   9467  C  CA    . LEU D 2 337 ? -24.631 35.701  35.325 1.00 9.77  ? 338  LEU C CA    1 
ATOM   9468  C  C     . LEU D 2 337 ? -25.540 34.518  35.544 1.00 10.03 ? 338  LEU C C     1 
ATOM   9469  O  O     . LEU D 2 337 ? -25.295 33.704  36.379 1.00 8.91  ? 338  LEU C O     1 
ATOM   9470  C  CB    . LEU D 2 337 ? -23.249 35.275  34.892 1.00 9.24  ? 338  LEU C CB    1 
ATOM   9471  C  CG    . LEU D 2 337 ? -22.325 36.435  34.554 1.00 8.87  ? 338  LEU C CG    1 
ATOM   9472  C  CD1   . LEU D 2 337 ? -20.917 35.919  34.391 1.00 8.40  ? 338  LEU C CD1   1 
ATOM   9473  C  CD2   . LEU D 2 337 ? -22.768 37.196  33.333 1.00 8.64  ? 338  LEU C CD2   1 
ATOM   9474  N  N     . VAL D 2 338 ? -26.624 34.467  34.787 1.00 10.96 ? 339  VAL C N     1 
ATOM   9475  C  CA    . VAL D 2 338 ? -27.548 33.376  34.885 1.00 13.15 ? 339  VAL C CA    1 
ATOM   9476  C  C     . VAL D 2 338 ? -27.542 32.691  33.547 1.00 14.51 ? 339  VAL C C     1 
ATOM   9477  O  O     . VAL D 2 338 ? -27.866 33.301  32.563 1.00 16.15 ? 339  VAL C O     1 
ATOM   9478  C  CB    . VAL D 2 338 ? -28.969 33.842  35.190 1.00 12.97 ? 339  VAL C CB    1 
ATOM   9479  C  CG1   . VAL D 2 338 ? -29.882 32.644  35.294 1.00 13.60 ? 339  VAL C CG1   1 
ATOM   9480  C  CG2   . VAL D 2 338 ? -29.013 34.612  36.483 1.00 12.19 ? 339  VAL C CG2   1 
ATOM   9481  N  N     A ASN D 2 339 ? -27.177 31.430  33.509 0.50 15.12 ? 340  ASN C N     1 
ATOM   9482  N  N     B ASN D 2 339 ? -27.223 31.410  33.421 0.50 14.70 ? 340  ASN C N     1 
ATOM   9483  C  CA    A ASN D 2 339 ? -27.094 30.726  32.258 0.50 16.61 ? 340  ASN C CA    1 
ATOM   9484  C  CA    B ASN D 2 339 ? -27.087 30.772  32.120 0.50 15.74 ? 340  ASN C CA    1 
ATOM   9485  C  C     A ASN D 2 339 ? -26.177 31.542  31.321 0.50 17.38 ? 340  ASN C C     1 
ATOM   9486  C  C     B ASN D 2 339 ? -26.138 31.578  31.250 0.50 16.81 ? 340  ASN C C     1 
ATOM   9487  O  O     A ASN D 2 339 ? -26.424 31.702  30.150 0.50 18.40 ? 340  ASN C O     1 
ATOM   9488  O  O     B ASN D 2 339 ? -26.345 31.794  30.085 0.50 17.76 ? 340  ASN C O     1 
ATOM   9489  C  CB    A ASN D 2 339 ? -28.473 30.472  31.635 0.50 16.77 ? 340  ASN C CB    1 
ATOM   9490  C  CB    B ASN D 2 339 ? -28.406 30.507  31.392 0.50 15.00 ? 340  ASN C CB    1 
ATOM   9491  C  CG    A ASN D 2 339 ? -28.404 29.662  30.341 0.50 16.54 ? 340  ASN C CG    1 
ATOM   9492  C  CG    B ASN D 2 339 ? -29.218 29.380  32.030 0.50 14.29 ? 340  ASN C CG    1 
ATOM   9493  O  OD1   A ASN D 2 339 ? -27.785 28.601  30.276 0.50 16.03 ? 340  ASN C OD1   1 
ATOM   9494  O  OD1   B ASN D 2 339 ? -28.732 28.623  32.876 0.50 13.76 ? 340  ASN C OD1   1 
ATOM   9495  N  ND2   A ASN D 2 339 ? -29.078 30.154  29.311 0.50 17.94 ? 340  ASN C ND2   1 
ATOM   9496  N  ND2   B ASN D 2 339 ? -30.455 29.256  31.605 0.50 14.38 ? 340  ASN C ND2   1 
ATOM   9497  N  N     . GLY D 2 340 ? -25.123 32.057  31.882 1.00 17.25 ? 341  GLY C N     1 
ATOM   9498  C  CA    . GLY D 2 340 ? -24.164 32.800  31.166 1.00 16.97 ? 341  GLY C CA    1 
ATOM   9499  C  C     . GLY D 2 340 ? -24.578 34.226  30.871 1.00 18.63 ? 341  GLY C C     1 
ATOM   9500  O  O     . GLY D 2 340 ? -24.007 34.871  30.063 1.00 18.04 ? 341  GLY C O     1 
ATOM   9501  N  N     A ARG D 2 341 ? -25.591 34.713  30.993 0.50 18.33 ? 342  ARG C N     1 
ATOM   9502  N  N     B ARG D 2 341 ? -25.576 34.720  31.016 0.50 18.20 ? 342  ARG C N     1 
ATOM   9503  C  CA    A ARG D 2 341 ? -25.930 36.020  30.624 0.50 17.89 ? 342  ARG C CA    1 
ATOM   9504  C  CA    B ARG D 2 341 ? -25.929 36.014  30.632 0.50 17.70 ? 342  ARG C CA    1 
ATOM   9505  C  C     A ARG D 2 341 ? -26.207 36.915  31.829 0.50 17.25 ? 342  ARG C C     1 
ATOM   9506  C  C     B ARG D 2 341 ? -26.218 36.917  31.829 0.50 17.14 ? 342  ARG C C     1 
ATOM   9507  O  O     A ARG D 2 341 ? -26.702 36.431  32.846 0.50 17.60 ? 342  ARG C O     1 
ATOM   9508  O  O     B ARG D 2 341 ? -26.729 36.441  32.842 0.50 17.48 ? 342  ARG C O     1 
ATOM   9509  C  CB    A ARG D 2 341 ? -27.183 35.939  29.757 0.50 18.78 ? 342  ARG C CB    1 
ATOM   9510  C  CB    B ARG D 2 341 ? -27.172 35.880  29.763 0.50 18.37 ? 342  ARG C CB    1 
ATOM   9511  C  CG    A ARG D 2 341 ? -26.996 35.185  28.456 0.50 19.45 ? 342  ARG C CG    1 
ATOM   9512  C  CG    B ARG D 2 341 ? -26.919 35.123  28.478 0.50 18.83 ? 342  ARG C CG    1 
ATOM   9513  C  CD    A ARG D 2 341 ? -28.327 35.040  27.734 0.50 20.21 ? 342  ARG C CD    1 
ATOM   9514  C  CD    B ARG D 2 341 ? -28.174 34.556  27.836 0.50 19.34 ? 342  ARG C CD    1 
ATOM   9515  N  NE    A ARG D 2 341 ? -28.834 36.347  27.317 0.50 21.19 ? 342  ARG C NE    1 
ATOM   9516  N  NE    B ARG D 2 341 ? -27.781 33.896  26.595 0.50 20.01 ? 342  ARG C NE    1 
ATOM   9517  C  CZ    A ARG D 2 341 ? -29.626 36.535  26.274 0.50 20.79 ? 342  ARG C CZ    1 
ATOM   9518  C  CZ    B ARG D 2 341 ? -28.612 33.462  25.670 0.50 20.75 ? 342  ARG C CZ    1 
ATOM   9519  N  NH1   A ARG D 2 341 ? -29.995 35.498  25.536 0.50 20.96 ? 342  ARG C NH1   1 
ATOM   9520  N  NH1   B ARG D 2 341 ? -29.918 33.598  25.827 0.50 21.61 ? 342  ARG C NH1   1 
ATOM   9521  N  NH2   A ARG D 2 341 ? -30.038 37.756  25.968 0.50 20.93 ? 342  ARG C NH2   1 
ATOM   9522  N  NH2   B ARG D 2 341 ? -28.123 32.877  24.590 0.50 21.85 ? 342  ARG C NH2   1 
ATOM   9523  N  N     . PRO D 2 342 ? -25.885 38.251  31.715 1.00 17.11 ? 343  PRO C N     1 
ATOM   9524  C  CA    . PRO D 2 342 ? -26.143 39.201  32.797 1.00 16.05 ? 343  PRO C CA    1 
ATOM   9525  C  C     . PRO D 2 342 ? -27.645 39.390  33.004 1.00 16.11 ? 343  PRO C C     1 
ATOM   9526  O  O     . PRO D 2 342 ? -28.393 39.521  32.036 1.00 16.20 ? 343  PRO C O     1 
ATOM   9527  C  CB    . PRO D 2 342 ? -25.523 40.484  32.259 1.00 16.60 ? 343  PRO C CB    1 
ATOM   9528  C  CG    . PRO D 2 342 ? -25.549 40.324  30.780 1.00 16.37 ? 343  PRO C CG    1 
ATOM   9529  C  CD    . PRO D 2 342 ? -25.269 38.881  30.549 1.00 16.83 ? 343  PRO C CD    1 
ATOM   9530  N  N     . LYS D 2 343 ? -28.081 39.394  34.256 1.00 15.28 ? 344  LYS C N     1 
ATOM   9531  C  CA    . LYS D 2 343 ? -29.505 39.507  34.537 1.00 15.21 ? 344  LYS C CA    1 
ATOM   9532  C  C     . LYS D 2 343 ? -29.747 40.133  35.898 1.00 14.65 ? 344  LYS C C     1 
ATOM   9533  O  O     . LYS D 2 343 ? -29.001 39.878  36.847 1.00 14.42 ? 344  LYS C O     1 
ATOM   9534  C  CB    . LYS D 2 343 ? -30.156 38.122  34.480 1.00 15.11 ? 344  LYS C CB    1 
ATOM   9535  C  CG    . LYS D 2 343 ? -31.676 38.156  34.351 1.00 16.55 ? 344  LYS C CG    1 
ATOM   9536  C  CD    . LYS D 2 343 ? -32.306 36.778  34.535 1.00 17.31 ? 344  LYS C CD    1 
ATOM   9537  C  CE    . LYS D 2 343 ? -33.788 36.805  34.117 1.00 18.11 ? 344  LYS C CE    1 
ATOM   9538  N  NZ    . LYS D 2 343 ? -34.565 37.517  35.163 1.00 18.90 ? 344  LYS C NZ    1 
ATOM   9539  N  N     . LEU D 2 344 ? -30.783 40.965  35.968 1.00 14.52 ? 345  LEU C N     1 
ATOM   9540  C  CA    . LEU D 2 344 ? -31.192 41.600  37.216 1.00 15.21 ? 345  LEU C CA    1 
ATOM   9541  C  C     . LEU D 2 344 ? -32.118 40.604  37.918 1.00 14.17 ? 345  LEU C C     1 
ATOM   9542  O  O     . LEU D 2 344 ? -33.208 40.290  37.425 1.00 14.96 ? 345  LEU C O     1 
ATOM   9543  C  CB    . LEU D 2 344 ? -31.897 42.938  36.945 1.00 15.58 ? 345  LEU C CB    1 
ATOM   9544  C  CG    . LEU D 2 344 ? -32.321 43.826  38.144 1.00 17.36 ? 345  LEU C CG    1 
ATOM   9545  C  CD1   . LEU D 2 344 ? -31.131 44.210  39.029 1.00 16.77 ? 345  LEU C CD1   1 
ATOM   9546  C  CD2   . LEU D 2 344 ? -33.036 45.082  37.663 1.00 15.28 ? 345  LEU C CD2   1 
ATOM   9547  N  N     . ILE D 2 345 ? -31.665 40.100  39.061 1.00 13.03 ? 346  ILE C N     1 
ATOM   9548  C  CA    . ILE D 2 345 ? -32.413 39.097  39.815 1.00 12.10 ? 346  ILE C CA    1 
ATOM   9549  C  C     . ILE D 2 345 ? -32.876 39.602  41.185 1.00 11.44 ? 346  ILE C C     1 
ATOM   9550  O  O     . ILE D 2 345 ? -32.238 40.465  41.785 1.00 10.67 ? 346  ILE C O     1 
ATOM   9551  C  CB    . ILE D 2 345 ? -31.590 37.784  39.995 1.00 12.07 ? 346  ILE C CB    1 
ATOM   9552  C  CG1   . ILE D 2 345 ? -30.268 38.063  40.717 1.00 11.24 ? 346  ILE C CG1   1 
ATOM   9553  C  CG2   . ILE D 2 345 ? -31.353 37.106  38.647 1.00 11.71 ? 346  ILE C CG2   1 
ATOM   9554  C  CD1   . ILE D 2 345 ? -29.475 36.829  41.076 1.00 11.61 ? 346  ILE C CD1   1 
ATOM   9555  N  N     . ASN D 2 346 ? -33.997 39.055  41.656 1.00 11.18 ? 347  ASN C N     1 
ATOM   9556  C  CA    . ASN D 2 346 ? -34.523 39.374  42.975 1.00 11.38 ? 347  ASN C CA    1 
ATOM   9557  C  C     . ASN D 2 346 ? -34.097 38.283  43.949 1.00 11.78 ? 347  ASN C C     1 
ATOM   9558  O  O     . ASN D 2 346 ? -33.573 37.240  43.529 1.00 11.87 ? 347  ASN C O     1 
ATOM   9559  C  CB    . ASN D 2 346 ? -36.052 39.554  42.944 1.00 12.18 ? 347  ASN C CB    1 
ATOM   9560  C  CG    . ASN D 2 346 ? -36.792 38.285  42.555 1.00 12.36 ? 347  ASN C CG    1 
ATOM   9561  O  OD1   . ASN D 2 346 ? -36.652 37.233  43.192 1.00 12.31 ? 347  ASN C OD1   1 
ATOM   9562  N  ND2   . ASN D 2 346 ? -37.614 38.387  41.526 1.00 12.12 ? 347  ASN C ND2   1 
ATOM   9563  N  N     . LEU D 2 347 ? -34.308 38.513  45.242 1.00 11.40 ? 348  LEU C N     1 
ATOM   9564  C  CA    . LEU D 2 347 ? -33.920 37.537  46.258 1.00 12.05 ? 348  LEU C CA    1 
ATOM   9565  C  C     . LEU D 2 347 ? -34.340 36.105  45.909 1.00 12.43 ? 348  LEU C C     1 
ATOM   9566  O  O     . LEU D 2 347 ? -33.515 35.188  45.996 1.00 12.79 ? 348  LEU C O     1 
ATOM   9567  C  CB    . LEU D 2 347 ? -34.445 37.938  47.647 1.00 12.03 ? 348  LEU C CB    1 
ATOM   9568  C  CG    . LEU D 2 347 ? -34.157 37.003  48.827 1.00 12.36 ? 348  LEU C CG    1 
ATOM   9569  C  CD1   . LEU D 2 347 ? -32.664 36.849  49.071 1.00 13.04 ? 348  LEU C CD1   1 
ATOM   9570  C  CD2   . LEU D 2 347 ? -34.846 37.501  50.089 1.00 13.17 ? 348  LEU C CD2   1 
ATOM   9571  N  N     . LYS D 2 348 ? -35.603 35.915  45.506 1.00 12.54 ? 349  LYS C N     1 
ATOM   9572  C  CA    . LYS D 2 348 ? -36.110 34.576  45.173 1.00 12.82 ? 349  LYS C CA    1 
ATOM   9573  C  C     . LYS D 2 348 ? -35.404 33.942  43.966 1.00 12.88 ? 349  LYS C C     1 
ATOM   9574  O  O     . LYS D 2 348 ? -34.986 32.787  44.052 1.00 14.20 ? 349  LYS C O     1 
ATOM   9575  C  CB    . LYS D 2 348 ? -37.634 34.551  44.984 1.00 12.73 ? 349  LYS C CB    1 
ATOM   9576  C  CG    . LYS D 2 348 ? -38.188 33.141  44.790 1.00 12.56 ? 349  LYS C CG    1 
ATOM   9577  C  CD    . LYS D 2 348 ? -39.691 33.110  44.623 1.00 11.74 ? 349  LYS C CD    1 
ATOM   9578  C  CE    . LYS D 2 348 ? -40.163 31.660  44.513 1.00 11.16 ? 349  LYS C CE    1 
ATOM   9579  N  NZ    . LYS D 2 348 ? -41.651 31.556  44.447 1.00 10.77 ? 349  LYS C NZ    1 
ATOM   9580  N  N     . GLU D 2 349 ? -35.269 34.683  42.864 1.00 12.02 ? 350  GLU C N     1 
ATOM   9581  C  CA    . GLU D 2 349 ? -34.561 34.170  41.685 1.00 12.60 ? 350  GLU C CA    1 
ATOM   9582  C  C     . GLU D 2 349 ? -33.174 33.655  42.071 1.00 12.35 ? 350  GLU C C     1 
ATOM   9583  O  O     . GLU D 2 349 ? -32.799 32.550  41.685 1.00 12.66 ? 350  GLU C O     1 
ATOM   9584  C  CB    . GLU D 2 349 ? -34.411 35.229  40.587 1.00 13.49 ? 350  GLU C CB    1 
ATOM   9585  C  CG    . GLU D 2 349 ? -35.705 35.837  40.079 1.00 15.29 ? 350  GLU C CG    1 
ATOM   9586  C  CD    . GLU D 2 349 ? -35.467 36.881  38.997 1.00 16.27 ? 350  GLU C CD    1 
ATOM   9587  O  OE1   . GLU D 2 349 ? -34.906 36.521  37.929 1.00 17.62 ? 350  GLU C OE1   1 
ATOM   9588  O  OE2   . GLU D 2 349 ? -35.859 38.056  39.205 1.00 14.73 ? 350  GLU C OE2   1 
ATOM   9589  N  N     . ALA D 2 350 ? -32.429 34.456  42.831 1.00 11.73 ? 351  ALA C N     1 
ATOM   9590  C  CA    . ALA D 2 350 ? -31.081 34.089  43.292 1.00 11.80 ? 351  ALA C CA    1 
ATOM   9591  C  C     . ALA D 2 350 ? -31.094 32.803  44.100 1.00 11.58 ? 351  ALA C C     1 
ATOM   9592  O  O     . ALA D 2 350 ? -30.235 31.938  43.915 1.00 12.24 ? 351  ALA C O     1 
ATOM   9593  C  CB    . ALA D 2 350 ? -30.449 35.222  44.109 1.00 11.02 ? 351  ALA C CB    1 
ATOM   9594  N  N     . LEU D 2 351 ? -32.074 32.678  44.994 1.00 12.14 ? 352  LEU C N     1 
ATOM   9595  C  CA    . LEU D 2 351 ? -32.223 31.472  45.807 1.00 11.82 ? 352  LEU C CA    1 
ATOM   9596  C  C     . LEU D 2 351 ? -32.641 30.275  44.960 1.00 12.12 ? 352  LEU C C     1 
ATOM   9597  O  O     . LEU D 2 351 ? -32.193 29.157  45.205 1.00 14.46 ? 352  LEU C O     1 
ATOM   9598  C  CB    . LEU D 2 351 ? -33.212 31.700  46.950 1.00 11.55 ? 352  LEU C CB    1 
ATOM   9599  C  CG    . LEU D 2 351 ? -32.811 32.703  48.049 1.00 11.18 ? 352  LEU C CG    1 
ATOM   9600  C  CD1   . LEU D 2 351 ? -33.974 32.861  49.022 1.00 11.02 ? 352  LEU C CD1   1 
ATOM   9601  C  CD2   . LEU D 2 351 ? -31.545 32.274  48.789 1.00 10.52 ? 352  LEU C CD2   1 
ATOM   9602  N  N     . VAL D 2 352 ? -33.478 30.511  43.951 1.00 11.47 ? 353  VAL C N     1 
ATOM   9603  C  CA    . VAL D 2 352 ? -33.938 29.434  43.071 1.00 11.76 ? 353  VAL C CA    1 
ATOM   9604  C  C     . VAL D 2 352 ? -32.783 28.842  42.267 1.00 11.99 ? 353  VAL C C     1 
ATOM   9605  O  O     . VAL D 2 352 ? -32.567 27.627  42.299 1.00 12.31 ? 353  VAL C O     1 
ATOM   9606  C  CB    . VAL D 2 352 ? -35.146 29.862  42.181 1.00 11.22 ? 353  VAL C CB    1 
ATOM   9607  C  CG1   . VAL D 2 352 ? -35.419 28.832  41.079 1.00 10.13 ? 353  VAL C CG1   1 
ATOM   9608  C  CG2   . VAL D 2 352 ? -36.389 30.049  43.046 1.00 11.09 ? 353  VAL C CG2   1 
ATOM   9609  N  N     . HIS D 2 353 ? -32.032 29.695  41.577 1.00 12.11 ? 354  HIS C N     1 
ATOM   9610  C  CA    . HIS D 2 353 ? -30.880 29.237  40.797 1.00 12.60 ? 354  HIS C CA    1 
ATOM   9611  C  C     . HIS D 2 353 ? -29.857 28.503  41.664 1.00 12.87 ? 354  HIS C C     1 
ATOM   9612  O  O     . HIS D 2 353 ? -29.316 27.489  41.233 1.00 14.71 ? 354  HIS C O     1 
ATOM   9613  C  CB    . HIS D 2 353 ? -30.220 30.376  40.017 1.00 13.08 ? 354  HIS C CB    1 
ATOM   9614  C  CG    . HIS D 2 353 ? -31.102 30.978  38.974 1.00 14.14 ? 354  HIS C CG    1 
ATOM   9615  N  ND1   . HIS D 2 353 ? -31.515 30.286  37.855 1.00 14.61 ? 354  HIS C ND1   1 
ATOM   9616  C  CD2   . HIS D 2 353 ? -31.644 32.215  38.872 1.00 14.89 ? 354  HIS C CD2   1 
ATOM   9617  C  CE1   . HIS D 2 353 ? -32.288 31.064  37.117 1.00 15.56 ? 354  HIS C CE1   1 
ATOM   9618  N  NE2   . HIS D 2 353 ? -32.373 32.245  37.702 1.00 15.24 ? 354  HIS C NE2   1 
ATOM   9619  N  N     . TYR D 2 354 ? -29.607 28.993  42.878 1.00 11.97 ? 355  TYR C N     1 
ATOM   9620  C  CA    . TYR D 2 354 ? -28.687 28.291  43.772 1.00 11.38 ? 355  TYR C CA    1 
ATOM   9621  C  C     . TYR D 2 354 ? -29.222 26.910  44.192 1.00 11.72 ? 355  TYR C C     1 
ATOM   9622  O  O     . TYR D 2 354 ? -28.472 25.932  44.210 1.00 11.10 ? 355  TYR C O     1 
ATOM   9623  C  CB    . TYR D 2 354 ? -28.280 29.123  44.994 1.00 10.44 ? 355  TYR C CB    1 
ATOM   9624  C  CG    . TYR D 2 354 ? -27.442 28.319  45.962 1.00 10.39 ? 355  TYR C CG    1 
ATOM   9625  C  CD1   . TYR D 2 354 ? -26.096 28.064  45.709 1.00 10.32 ? 355  TYR C CD1   1 
ATOM   9626  C  CD2   . TYR D 2 354 ? -28.015 27.746  47.102 1.00 10.52 ? 355  TYR C CD2   1 
ATOM   9627  C  CE1   . TYR D 2 354 ? -25.336 27.299  46.585 1.00 10.03 ? 355  TYR C CE1   1 
ATOM   9628  C  CE2   . TYR D 2 354 ? -27.264 26.983  47.983 1.00 10.10 ? 355  TYR C CE2   1 
ATOM   9629  C  CZ    . TYR D 2 354 ? -25.927 26.763  47.720 1.00 10.42 ? 355  TYR C CZ    1 
ATOM   9630  O  OH    . TYR D 2 354 ? -25.185 25.993  48.598 1.00 9.94  ? 355  TYR C OH    1 
ATOM   9631  N  N     . LEU D 2 355 ? -30.514 26.826  44.519 1.00 12.33 ? 356  LEU C N     1 
ATOM   9632  C  CA    . LEU D 2 355 ? -31.102 25.544  44.921 1.00 12.37 ? 356  LEU C CA    1 
ATOM   9633  C  C     . LEU D 2 355 ? -31.020 24.533  43.786 1.00 13.42 ? 356  LEU C C     1 
ATOM   9634  O  O     . LEU D 2 355 ? -30.591 23.397  43.991 1.00 15.32 ? 356  LEU C O     1 
ATOM   9635  C  CB    . LEU D 2 355 ? -32.549 25.705  45.408 1.00 11.87 ? 356  LEU C CB    1 
ATOM   9636  C  CG    . LEU D 2 355 ? -33.272 24.414  45.862 1.00 10.73 ? 356  LEU C CG    1 
ATOM   9637  C  CD1   . LEU D 2 355 ? -32.540 23.694  46.989 1.00 9.99  ? 356  LEU C CD1   1 
ATOM   9638  C  CD2   . LEU D 2 355 ? -34.710 24.717  46.251 1.00 10.18 ? 356  LEU C CD2   1 
ATOM   9639  N  N     . GLU D 2 356 ? -31.398 24.956  42.589 1.00 14.66 ? 357  GLU C N     1 
ATOM   9640  C  CA    . GLU D 2 356 ? -31.349 24.080  41.422 1.00 17.08 ? 357  GLU C CA    1 
ATOM   9641  C  C     . GLU D 2 356 ? -29.912 23.601  41.130 1.00 16.84 ? 357  GLU C C     1 
ATOM   9642  O  O     . GLU D 2 356 ? -29.709 22.468  40.690 1.00 19.47 ? 357  GLU C O     1 
ATOM   9643  C  CB    . GLU D 2 356 ? -32.006 24.749  40.206 1.00 18.12 ? 357  GLU C CB    1 
ATOM   9644  C  CG    . GLU D 2 356 ? -32.131 23.847  38.987 1.00 24.31 ? 357  GLU C CG    1 
ATOM   9645  C  CD    . GLU D 2 356 ? -32.831 22.517  39.277 1.00 28.74 ? 357  GLU C CD    1 
ATOM   9646  O  OE1   . GLU D 2 356 ? -33.827 22.495  40.056 1.00 29.89 ? 357  GLU C OE1   1 
ATOM   9647  O  OE2   . GLU D 2 356 ? -32.386 21.487  38.712 1.00 30.51 ? 357  GLU C OE2   1 
ATOM   9648  N  N     . HIS D 2 357 ? -28.930 24.458  41.393 1.00 15.40 ? 358  HIS C N     1 
ATOM   9649  C  CA    . HIS D 2 357 ? -27.520 24.104  41.205 1.00 15.63 ? 358  HIS C CA    1 
ATOM   9650  C  C     . HIS D 2 357 ? -27.097 23.050  42.240 1.00 15.26 ? 358  HIS C C     1 
ATOM   9651  O  O     . HIS D 2 357 ? -26.299 22.163  41.939 1.00 13.95 ? 358  HIS C O     1 
ATOM   9652  C  CB    . HIS D 2 357 ? -26.626 25.351  41.262 1.00 14.96 ? 358  HIS C CB    1 
ATOM   9653  C  CG    . HIS D 2 357 ? -25.157 25.056  41.311 1.00 15.37 ? 358  HIS C CG    1 
ATOM   9654  N  ND1   . HIS D 2 357 ? -24.457 24.556  40.229 1.00 15.00 ? 358  HIS C ND1   1 
ATOM   9655  C  CD2   . HIS D 2 357 ? -24.246 25.225  42.301 1.00 14.62 ? 358  HIS C CD2   1 
ATOM   9656  C  CE1   . HIS D 2 357 ? -23.183 24.410  40.560 1.00 13.39 ? 358  HIS C CE1   1 
ATOM   9657  N  NE2   . HIS D 2 357 ? -23.028 24.809  41.809 1.00 14.11 ? 358  HIS C NE2   1 
ATOM   9658  N  N     . GLN D 2 358 ? -27.662 23.138  43.442 1.00 14.37 ? 359  GLN C N     1 
ATOM   9659  C  CA    . GLN D 2 358 ? -27.352 22.169  44.494 1.00 15.00 ? 359  GLN C CA    1 
ATOM   9660  C  C     . GLN D 2 358 ? -27.920 20.783  44.206 1.00 15.11 ? 359  GLN C C     1 
ATOM   9661  O  O     . GLN D 2 358 ? -27.313 19.784  44.582 1.00 13.76 ? 359  GLN C O     1 
ATOM   9662  C  CB    . GLN D 2 358 ? -27.789 22.666  45.875 1.00 14.39 ? 359  GLN C CB    1 
ATOM   9663  C  CG    . GLN D 2 358 ? -26.970 23.844  46.343 1.00 14.61 ? 359  GLN C CG    1 
ATOM   9664  C  CD    . GLN D 2 358 ? -25.482 23.550  46.314 1.00 14.66 ? 359  GLN C CD    1 
ATOM   9665  O  OE1   . GLN D 2 358 ? -24.989 22.704  47.068 1.00 15.36 ? 359  GLN C OE1   1 
ATOM   9666  N  NE2   . GLN D 2 358 ? -24.754 24.247  45.439 1.00 13.78 ? 359  GLN C NE2   1 
ATOM   9667  N  N     . LYS D 2 359 ? -29.071 20.731  43.531 1.00 15.33 ? 360  LYS C N     1 
ATOM   9668  C  CA    . LYS D 2 359 ? -29.705 19.458  43.173 1.00 15.56 ? 360  LYS C CA    1 
ATOM   9669  C  C     . LYS D 2 359 ? -28.874 18.704  42.135 1.00 15.28 ? 360  LYS C C     1 
ATOM   9670  O  O     . LYS D 2 359 ? -28.633 17.510  42.281 1.00 14.64 ? 360  LYS C O     1 
ATOM   9671  C  CB    . LYS D 2 359 ? -31.125 19.670  42.643 1.00 16.33 ? 360  LYS C CB    1 
ATOM   9672  C  CG    . LYS D 2 359 ? -32.118 20.226  43.648 1.00 17.71 ? 360  LYS C CG    1 
ATOM   9673  C  CD    . LYS D 2 359 ? -33.468 20.427  42.953 1.00 20.46 ? 360  LYS C CD    1 
ATOM   9674  C  CE    . LYS D 2 359 ? -34.420 21.207  43.877 1.00 24.65 ? 360  LYS C CE    1 
ATOM   9675  N  NZ    . LYS D 2 359 ? -35.621 21.743  43.181 1.00 26.41 ? 360  LYS C NZ    1 
ATOM   9676  N  N     . THR D 2 360 ? -28.441 19.418  41.095 1.00 15.82 ? 361  THR C N     1 
ATOM   9677  C  CA    . THR D 2 360 ? -27.625 18.838  40.028 1.00 16.35 ? 361  THR C CA    1 
ATOM   9678  C  C     . THR D 2 360 ? -26.291 18.320  40.567 1.00 16.03 ? 361  THR C C     1 
ATOM   9679  O  O     . THR D 2 360 ? -25.862 17.236  40.204 1.00 17.23 ? 361  THR C O     1 
ATOM   9680  C  CB    . THR D 2 360 ? -27.375 19.858  38.888 1.00 18.32 ? 361  THR C CB    1 
ATOM   9681  O  OG1   . THR D 2 360 ? -28.619 20.418  38.457 1.00 18.42 ? 361  THR C OG1   1 
ATOM   9682  C  CG2   . THR D 2 360 ? -26.689 19.185  37.695 1.00 18.67 ? 361  THR C CG2   1 
ATOM   9683  N  N     . VAL D 2 361 ? -25.659 19.095  41.449 1.00 15.59 ? 362  VAL C N     1 
ATOM   9684  C  CA    . VAL D 2 361 ? -24.364 18.735  42.060 1.00 15.46 ? 362  VAL C CA    1 
ATOM   9685  C  C     . VAL D 2 361 ? -24.440 17.437  42.874 1.00 16.19 ? 362  VAL C C     1 
ATOM   9686  O  O     . VAL D 2 361 ? -23.569 16.578  42.761 1.00 17.77 ? 362  VAL C O     1 
ATOM   9687  C  CB    . VAL D 2 361 ? -23.793 19.905  42.927 1.00 14.85 ? 362  VAL C CB    1 
ATOM   9688  C  CG1   . VAL D 2 361 ? -22.613 19.453  43.785 1.00 14.29 ? 362  VAL C CG1   1 
ATOM   9689  C  CG2   . VAL D 2 361 ? -23.392 21.079  42.057 1.00 13.45 ? 362  VAL C CG2   1 
ATOM   9690  N  N     . VAL D 2 362 ? -25.483 17.297  43.689 1.00 15.93 ? 363  VAL C N     1 
ATOM   9691  C  CA    . VAL D 2 362 ? -25.648 16.108  44.521 1.00 15.35 ? 363  VAL C CA    1 
ATOM   9692  C  C     . VAL D 2 362 ? -26.026 14.881  43.671 1.00 16.17 ? 363  VAL C C     1 
ATOM   9693  O  O     . VAL D 2 362 ? -25.553 13.773  43.949 1.00 16.87 ? 363  VAL C O     1 
ATOM   9694  C  CB    . VAL D 2 362 ? -26.639 16.347  45.694 1.00 15.67 ? 363  VAL C CB    1 
ATOM   9695  C  CG1   . VAL D 2 362 ? -26.879 15.064  46.492 1.00 15.82 ? 363  VAL C CG1   1 
ATOM   9696  C  CG2   . VAL D 2 362 ? -26.112 17.435  46.621 1.00 14.38 ? 363  VAL C CG2   1 
ATOM   9697  N  N     . ARG D 2 363 ? -26.842 15.082  42.636 1.00 14.77 ? 364  ARG C N     1 
ATOM   9698  C  CA    . ARG D 2 363 ? -27.235 13.982  41.762 1.00 15.26 ? 364  ARG C CA    1 
ATOM   9699  C  C     . ARG D 2 363 ? -26.041 13.465  40.957 1.00 15.04 ? 364  ARG C C     1 
ATOM   9700  O  O     . ARG D 2 363 ? -25.849 12.256  40.820 1.00 15.07 ? 364  ARG C O     1 
ATOM   9701  C  CB    . ARG D 2 363 ? -28.395 14.383  40.837 1.00 16.72 ? 364  ARG C CB    1 
ATOM   9702  C  CG    . ARG D 2 363 ? -28.935 13.215  39.996 1.00 18.53 ? 364  ARG C CG    1 
ATOM   9703  C  CD    . ARG D 2 363 ? -30.165 13.562  39.163 1.00 21.30 ? 364  ARG C CD    1 
ATOM   9704  N  NE    . ARG D 2 363 ? -29.927 14.630  38.195 1.00 24.30 ? 364  ARG C NE    1 
ATOM   9705  C  CZ    . ARG D 2 363 ? -30.335 15.898  38.367 1.00 24.59 ? 364  ARG C CZ    1 
ATOM   9706  N  NH1   . ARG D 2 363 ? -30.996 16.268  39.480 1.00 21.75 ? 364  ARG C NH1   1 
ATOM   9707  N  NH2   . ARG D 2 363 ? -30.051 16.813  37.434 1.00 23.57 ? 364  ARG C NH2   1 
ATOM   9708  N  N     . ARG D 2 364 ? -25.241 14.396  40.438 1.00 15.38 ? 365  ARG C N     1 
ATOM   9709  C  CA    . ARG D 2 364 ? -24.043 14.071  39.668 1.00 14.22 ? 365  ARG C CA    1 
ATOM   9710  C  C     . ARG D 2 364 ? -22.991 13.358  40.528 1.00 14.99 ? 365  ARG C C     1 
ATOM   9711  O  O     . ARG D 2 364 ? -22.294 12.464  40.039 1.00 15.29 ? 365  ARG C O     1 
ATOM   9712  C  CB    . ARG D 2 364 ? -23.472 15.320  39.003 1.00 13.14 ? 365  ARG C CB    1 
ATOM   9713  C  CG    . ARG D 2 364 ? -24.349 15.833  37.853 1.00 12.92 ? 365  ARG C CG    1 
ATOM   9714  C  CD    . ARG D 2 364 ? -23.759 17.054  37.144 1.00 11.63 ? 365  ARG C CD    1 
ATOM   9715  N  NE    . ARG D 2 364 ? -22.375 16.836  36.748 1.00 10.22 ? 365  ARG C NE    1 
ATOM   9716  C  CZ    . ARG D 2 364 ? -21.731 17.533  35.815 1.00 9.87  ? 365  ARG C CZ    1 
ATOM   9717  N  NH1   . ARG D 2 364 ? -22.342 18.493  35.131 1.00 9.09  ? 365  ARG C NH1   1 
ATOM   9718  N  NH2   . ARG D 2 364 ? -20.461 17.240  35.539 1.00 9.48  ? 365  ARG C NH2   1 
ATOM   9719  N  N     . ARG D 2 365 ? -22.901 13.743  41.805 1.00 14.65 ? 366  ARG C N     1 
ATOM   9720  C  CA    . ARG D 2 365 ? -21.960 13.119  42.724 1.00 14.69 ? 366  ARG C CA    1 
ATOM   9721  C  C     . ARG D 2 365 ? -22.370 11.675  42.986 1.00 15.45 ? 366  ARG C C     1 
ATOM   9722  O  O     . ARG D 2 365 ? -21.524 10.771  42.974 1.00 17.26 ? 366  ARG C O     1 
ATOM   9723  C  CB    . ARG D 2 365 ? -21.889 13.870  44.053 1.00 13.26 ? 366  ARG C CB    1 
ATOM   9724  C  CG    . ARG D 2 365 ? -20.810 13.341  45.000 1.00 10.83 ? 366  ARG C CG    1 
ATOM   9725  C  CD    . ARG D 2 365 ? -20.973 13.928  46.378 1.00 10.41 ? 366  ARG C CD    1 
ATOM   9726  N  NE    . ARG D 2 365 ? -22.198 13.460  47.015 1.00 10.04 ? 366  ARG C NE    1 
ATOM   9727  C  CZ    . ARG D 2 365 ? -22.809 14.079  48.022 1.00 10.11 ? 366  ARG C CZ    1 
ATOM   9728  N  NH1   . ARG D 2 365 ? -22.331 15.223  48.497 1.00 10.57 ? 366  ARG C NH1   1 
ATOM   9729  N  NH2   . ARG D 2 365 ? -23.927 13.568  48.534 1.00 9.86  ? 366  ARG C NH2   1 
ATOM   9730  N  N     . THR D 2 366 ? -23.665 11.472  43.223 1.00 15.27 ? 367  THR C N     1 
ATOM   9731  C  CA    . THR D 2 366 ? -24.218 10.147  43.485 1.00 15.03 ? 367  THR C CA    1 
ATOM   9732  C  C     . THR D 2 366 ? -23.982 9.225   42.275 1.00 16.47 ? 367  THR C C     1 
ATOM   9733  O  O     . THR D 2 366 ? -23.541 8.080   42.426 1.00 15.71 ? 367  THR C O     1 
ATOM   9734  C  CB    . THR D 2 366 ? -25.717 10.226  43.833 1.00 14.68 ? 367  THR C CB    1 
ATOM   9735  O  OG1   . THR D 2 366 ? -25.924 11.176  44.888 1.00 14.08 ? 367  THR C OG1   1 
ATOM   9736  C  CG2   . THR D 2 366 ? -26.242 8.866   44.270 1.00 15.49 ? 367  THR C CG2   1 
ATOM   9737  N  N     . GLN D 2 367 ? -24.249 9.739   41.080 1.00 16.39 ? 368  GLN C N     1 
ATOM   9738  C  CA    . GLN D 2 367 ? -24.031 8.982   39.854 1.00 17.76 ? 368  GLN C CA    1 
ATOM   9739  C  C     . GLN D 2 367 ? -22.554 8.623   39.659 1.00 18.67 ? 368  GLN C C     1 
ATOM   9740  O  O     . GLN D 2 367 ? -22.236 7.557   39.125 1.00 21.51 ? 368  GLN C O     1 
ATOM   9741  C  CB    . GLN D 2 367 ? -24.595 9.746   38.647 1.00 17.93 ? 368  GLN C CB    1 
ATOM   9742  C  CG    . GLN D 2 367 ? -26.122 9.850   38.656 1.00 17.37 ? 368  GLN C CG    1 
ATOM   9743  C  CD    . GLN D 2 367 ? -26.676 10.830  37.647 1.00 18.86 ? 368  GLN C CD    1 
ATOM   9744  O  OE1   . GLN D 2 367 ? -27.750 10.613  37.078 1.00 18.94 ? 368  GLN C OE1   1 
ATOM   9745  N  NE2   . GLN D 2 367 ? -25.945 11.919  37.408 1.00 19.31 ? 368  GLN C NE2   1 
ATOM   9746  N  N     . TYR D 2 368 ? -21.659 9.506   40.106 1.00 18.81 ? 369  TYR C N     1 
ATOM   9747  C  CA    . TYR D 2 368 ? -20.217 9.260   40.004 1.00 18.20 ? 369  TYR C CA    1 
ATOM   9748  C  C     . TYR D 2 368 ? -19.772 8.199   41.006 1.00 18.29 ? 369  TYR C C     1 
ATOM   9749  O  O     . TYR D 2 368 ? -19.062 7.266   40.636 1.00 20.91 ? 369  TYR C O     1 
ATOM   9750  C  CB    . TYR D 2 368 ? -19.403 10.552  40.175 1.00 17.32 ? 369  TYR C CB    1 
ATOM   9751  C  CG    . TYR D 2 368 ? -17.913 10.322  40.385 1.00 16.45 ? 369  TYR C CG    1 
ATOM   9752  C  CD1   . TYR D 2 368 ? -17.395 10.113  41.666 1.00 16.32 ? 369  TYR C CD1   1 
ATOM   9753  C  CD2   . TYR D 2 368 ? -17.022 10.313  39.303 1.00 16.46 ? 369  TYR C CD2   1 
ATOM   9754  C  CE1   . TYR D 2 368 ? -16.038 9.893   41.873 1.00 16.14 ? 369  TYR C CE1   1 
ATOM   9755  C  CE2   . TYR D 2 368 ? -15.657 10.099  39.495 1.00 15.71 ? 369  TYR C CE2   1 
ATOM   9756  C  CZ    . TYR D 2 368 ? -15.171 9.883   40.784 1.00 16.22 ? 369  TYR C CZ    1 
ATOM   9757  O  OH    . TYR D 2 368 ? -13.825 9.667   41.003 1.00 15.63 ? 369  TYR C OH    1 
ATOM   9758  N  N     . ASN D 2 369 ? -20.207 8.332   42.251 1.00 17.31 ? 370  ASN C N     1 
ATOM   9759  C  CA    . ASN D 2 369 ? -19.858 7.384   43.291 1.00 18.14 ? 370  ASN C CA    1 
ATOM   9760  C  C     . ASN D 2 369 ? -20.328 5.980   42.934 1.00 18.64 ? 370  ASN C C     1 
ATOM   9761  O  O     . ASN D 2 369 ? -19.679 4.998   43.262 1.00 19.25 ? 370  ASN C O     1 
ATOM   9762  C  CB    . ASN D 2 369 ? -20.453 7.819   44.634 1.00 17.48 ? 370  ASN C CB    1 
ATOM   9763  C  CG    . ASN D 2 369 ? -19.778 9.048   45.198 1.00 16.77 ? 370  ASN C CG    1 
ATOM   9764  O  OD1   . ASN D 2 369 ? -18.588 9.253   45.010 1.00 17.68 ? 370  ASN C OD1   1 
ATOM   9765  N  ND2   . ASN D 2 369 ? -20.526 9.865   45.899 1.00 15.06 ? 370  ASN C ND2   1 
ATOM   9766  N  N     . LEU D 2 370 ? -21.465 5.911   42.260 1.00 18.29 ? 371  LEU C N     1 
ATOM   9767  C  CA    . LEU D 2 370 ? -22.053 4.654   41.814 1.00 18.20 ? 371  LEU C CA    1 
ATOM   9768  C  C     . LEU D 2 370 ? -21.153 3.967   40.785 1.00 18.89 ? 371  LEU C C     1 
ATOM   9769  O  O     . LEU D 2 370 ? -20.757 2.810   40.979 1.00 19.09 ? 371  LEU C O     1 
ATOM   9770  C  CB    . LEU D 2 370 ? -23.459 4.889   41.239 1.00 16.12 ? 371  LEU C CB    1 
ATOM   9771  C  CG    . LEU D 2 370 ? -24.326 3.670   40.914 1.00 15.49 ? 371  LEU C CG    1 
ATOM   9772  C  CD1   . LEU D 2 370 ? -24.682 2.884   42.158 1.00 16.11 ? 371  LEU C CD1   1 
ATOM   9773  C  CD2   . LEU D 2 370 ? -25.601 4.078   40.211 1.00 15.31 ? 371  LEU C CD2   1 
ATOM   9774  N  N     . ARG D 2 371 ? -20.818 4.690   39.711 1.00 19.57 ? 372  ARG C N     1 
ATOM   9775  C  CA    . ARG D 2 371 ? -19.950 4.163   38.651 1.00 19.59 ? 372  ARG C CA    1 
ATOM   9776  C  C     . ARG D 2 371 ? -18.633 3.633   39.202 1.00 19.06 ? 372  ARG C C     1 
ATOM   9777  O  O     . ARG D 2 371 ? -18.213 2.533   38.849 1.00 19.05 ? 372  ARG C O     1 
ATOM   9778  C  CB    . ARG D 2 371 ? -19.667 5.209   37.561 1.00 20.93 ? 372  ARG C CB    1 
ATOM   9779  C  CG    . ARG D 2 371 ? -20.882 5.748   36.827 1.00 21.75 ? 372  ARG C CG    1 
ATOM   9780  C  CD    . ARG D 2 371 ? -20.491 6.479   35.532 1.00 24.67 ? 372  ARG C CD    1 
ATOM   9781  N  NE    . ARG D 2 371 ? -19.690 7.692   35.751 1.00 27.64 ? 372  ARG C NE    1 
ATOM   9782  C  CZ    . ARG D 2 371 ? -20.189 8.932   35.822 1.00 26.90 ? 372  ARG C CZ    1 
ATOM   9783  N  NH1   . ARG D 2 371 ? -21.487 9.159   35.693 1.00 25.40 ? 372  ARG C NH1   1 
ATOM   9784  N  NH2   . ARG D 2 371 ? -19.373 9.958   36.019 1.00 26.68 ? 372  ARG C NH2   1 
ATOM   9785  N  N     . LYS D 2 372 ? -17.994 4.407   40.066 1.00 19.06 ? 373  LYS C N     1 
ATOM   9786  C  CA    . LYS D 2 372 ? -16.721 4.016   40.655 1.00 19.70 ? 373  LYS C CA    1 
ATOM   9787  C  C     . LYS D 2 372 ? -16.844 2.831   41.585 1.00 20.25 ? 373  LYS C C     1 
ATOM   9788  O  O     . LYS D 2 372 ? -15.949 2.006   41.664 1.00 20.25 ? 373  LYS C O     1 
ATOM   9789  C  CB    . LYS D 2 372 ? -16.094 5.190   41.396 1.00 21.84 ? 373  LYS C CB    1 
ATOM   9790  C  CG    . LYS D 2 372 ? -15.782 6.367   40.501 1.00 26.25 ? 373  LYS C CG    1 
ATOM   9791  C  CD    . LYS D 2 372 ? -14.931 5.933   39.320 1.00 28.74 ? 373  LYS C CD    1 
ATOM   9792  C  CE    . LYS D 2 372 ? -14.965 6.966   38.224 1.00 29.07 ? 373  LYS C CE    1 
ATOM   9793  N  NZ    . LYS D 2 372 ? -13.996 6.646   37.153 1.00 35.70 ? 373  LYS C NZ    1 
ATOM   9794  N  N     . ALA D 2 373 ? -17.964 2.755   42.295 1.00 21.02 ? 374  ALA C N     1 
ATOM   9795  C  CA    . ALA D 2 373 ? -18.208 1.668   43.209 1.00 19.26 ? 374  ALA C CA    1 
ATOM   9796  C  C     . ALA D 2 373 ? -18.373 0.382   42.421 1.00 20.77 ? 374  ALA C C     1 
ATOM   9797  O  O     . ALA D 2 373 ? -17.830 -0.649  42.787 1.00 25.48 ? 374  ALA C O     1 
ATOM   9798  C  CB    . ALA D 2 373 ? -19.435 1.956   44.047 1.00 19.59 ? 374  ALA C CB    1 
ATOM   9799  N  N     . LYS D 2 374 ? -19.124 0.455   41.330 1.00 20.60 ? 375  LYS C N     1 
ATOM   9800  C  CA    . LYS D 2 374 ? -19.346 -0.689  40.449 1.00 19.92 ? 375  LYS C CA    1 
ATOM   9801  C  C     . LYS D 2 374 ? -18.048 -1.177  39.811 1.00 19.44 ? 375  LYS C C     1 
ATOM   9802  O  O     . LYS D 2 374 ? -17.793 -2.381  39.765 1.00 17.40 ? 375  LYS C O     1 
ATOM   9803  C  CB    . LYS D 2 374 ? -20.393 -0.370  39.375 1.00 20.24 ? 375  LYS C CB    1 
ATOM   9804  C  CG    . LYS D 2 374 ? -21.811 -0.188  39.907 1.00 21.05 ? 375  LYS C CG    1 
ATOM   9805  C  CD    . LYS D 2 374 ? -22.801 0.033   38.774 1.00 21.65 ? 375  LYS C CD    1 
ATOM   9806  C  CE    . LYS D 2 374 ? -24.211 0.189   39.273 1.00 22.52 ? 375  LYS C CE    1 
ATOM   9807  N  NZ    . LYS D 2 374 ? -25.193 0.449   38.166 1.00 26.49 ? 375  LYS C NZ    1 
ATOM   9808  N  N     . ASP D 2 375 ? -17.217 -0.242  39.364 1.00 20.12 ? 376  ASP C N     1 
ATOM   9809  C  CA    . ASP D 2 375 ? -15.937 -0.579  38.767 1.00 18.30 ? 376  ASP C CA    1 
ATOM   9810  C  C     . ASP D 2 375 ? -15.025 -1.266  39.780 1.00 17.41 ? 376  ASP C C     1 
ATOM   9811  O  O     . ASP D 2 375 ? -14.308 -2.192  39.435 1.00 18.13 ? 376  ASP C O     1 
ATOM   9812  C  CB    . ASP D 2 375 ? -15.244 0.662   38.215 1.00 20.53 ? 376  ASP C CB    1 
ATOM   9813  C  CG    . ASP D 2 375 ? -15.952 1.257   37.022 1.00 22.34 ? 376  ASP C CG    1 
ATOM   9814  O  OD1   . ASP D 2 375 ? -16.932 0.663   36.537 1.00 25.30 ? 376  ASP C OD1   1 
ATOM   9815  O  OD2   . ASP D 2 375 ? -15.533 2.330   36.564 1.00 23.78 ? 376  ASP C OD2   1 
ATOM   9816  N  N     . ARG D 2 376 ? -15.054 -0.812  41.024 1.00 15.68 ? 377  ARG C N     1 
ATOM   9817  C  CA    . ARG D 2 376 ? -14.217 -1.398  42.063 1.00 14.77 ? 377  ARG C CA    1 
ATOM   9818  C  C     . ARG D 2 376 ? -14.743 -2.781  42.426 1.00 14.89 ? 377  ARG C C     1 
ATOM   9819  O  O     . ARG D 2 376 ? -13.976 -3.719  42.578 1.00 14.76 ? 377  ARG C O     1 
ATOM   9820  C  CB    . ARG D 2 376 ? -14.142 -0.496  43.291 1.00 13.13 ? 377  ARG C CB    1 
ATOM   9821  C  CG    . ARG D 2 376 ? -13.273 -1.041  44.408 1.00 13.21 ? 377  ARG C CG    1 
ATOM   9822  C  CD    . ARG D 2 376 ? -11.804 -0.905  44.088 1.00 13.66 ? 377  ARG C CD    1 
ATOM   9823  N  NE    . ARG D 2 376 ? -10.949 -1.362  45.172 1.00 13.81 ? 377  ARG C NE    1 
ATOM   9824  C  CZ    . ARG D 2 376 ? -10.004 -2.288  45.031 1.00 14.85 ? 377  ARG C CZ    1 
ATOM   9825  N  NH1   . ARG D 2 376 ? -9.790  -2.839  43.847 1.00 15.57 ? 377  ARG C NH1   1 
ATOM   9826  N  NH2   . ARG D 2 376 ? -9.271  -2.653  46.063 1.00 12.75 ? 377  ARG C NH2   1 
ATOM   9827  N  N     . ALA D 2 377 ? -16.062 -2.888  42.565 1.00 14.18 ? 378  ALA C N     1 
ATOM   9828  C  CA    . ALA D 2 377 ? -16.710 -4.170  42.855 1.00 13.77 ? 378  ALA C CA    1 
ATOM   9829  C  C     . ALA D 2 377 ? -16.307 -5.226  41.817 1.00 13.93 ? 378  ALA C C     1 
ATOM   9830  O  O     . ALA D 2 377 ? -15.921 -6.344  42.177 1.00 15.46 ? 378  ALA C O     1 
ATOM   9831  C  CB    . ALA D 2 377 ? -18.231 -4.017  42.917 1.00 12.47 ? 378  ALA C CB    1 
ATOM   9832  N  N     . HIS D 2 378 ? -16.352 -4.842  40.547 1.00 13.26 ? 379  HIS C N     1 
ATOM   9833  C  CA    . HIS D 2 378 ? -15.975 -5.714  39.445 1.00 13.76 ? 379  HIS C CA    1 
ATOM   9834  C  C     . HIS D 2 378 ? -14.528 -6.191  39.591 1.00 14.76 ? 379  HIS C C     1 
ATOM   9835  O  O     . HIS D 2 378 ? -14.241 -7.359  39.355 1.00 15.32 ? 379  HIS C O     1 
ATOM   9836  C  CB    . HIS D 2 378 ? -16.167 -4.997  38.108 1.00 14.28 ? 379  HIS C CB    1 
ATOM   9837  C  CG    . HIS D 2 378 ? -15.764 -5.802  36.917 1.00 14.86 ? 379  HIS C CG    1 
ATOM   9838  N  ND1   . HIS D 2 378 ? -16.592 -6.744  36.340 1.00 15.25 ? 379  HIS C ND1   1 
ATOM   9839  C  CD2   . HIS D 2 378 ? -14.628 -5.793  36.177 1.00 14.99 ? 379  HIS C CD2   1 
ATOM   9840  C  CE1   . HIS D 2 378 ? -15.973 -7.286  35.299 1.00 14.71 ? 379  HIS C CE1   1 
ATOM   9841  N  NE2   . HIS D 2 378 ? -14.783 -6.730  35.182 1.00 15.13 ? 379  HIS C NE2   1 
ATOM   9842  N  N     . ILE D 2 379 ? -13.639 -5.285  39.992 1.00 13.43 ? 380  ILE C N     1 
ATOM   9843  C  CA    . ILE D 2 379 ? -12.238 -5.611  40.192 1.00 12.49 ? 380  ILE C CA    1 
ATOM   9844  C  C     . ILE D 2 379 ? -12.083 -6.527  41.404 1.00 12.97 ? 380  ILE C C     1 
ATOM   9845  O  O     . ILE D 2 379 ? -11.281 -7.447  41.380 1.00 13.82 ? 380  ILE C O     1 
ATOM   9846  C  CB    . ILE D 2 379 ? -11.359 -4.351  40.394 1.00 12.15 ? 380  ILE C CB    1 
ATOM   9847  C  CG1   . ILE D 2 379 ? -11.383 -3.461  39.157 1.00 11.43 ? 380  ILE C CG1   1 
ATOM   9848  C  CG2   . ILE D 2 379 ? -9.933  -4.737  40.735 1.00 11.39 ? 380  ILE C CG2   1 
ATOM   9849  C  CD1   . ILE D 2 379 ? -10.887 -4.132  37.900 1.00 11.39 ? 380  ILE C CD1   1 
ATOM   9850  N  N     . LEU D 2 380 ? -12.856 -6.267  42.454 1.00 12.77 ? 381  LEU C N     1 
ATOM   9851  C  CA    . LEU D 2 380 ? -12.825 -7.100  43.670 1.00 13.31 ? 381  LEU C CA    1 
ATOM   9852  C  C     . LEU D 2 380 ? -13.331 -8.522  43.421 1.00 13.56 ? 381  LEU C C     1 
ATOM   9853  O  O     . LEU D 2 380 ? -12.797 -9.477  43.981 1.00 12.79 ? 381  LEU C O     1 
ATOM   9854  C  CB    . LEU D 2 380 ? -13.591 -6.439  44.829 1.00 13.24 ? 381  LEU C CB    1 
ATOM   9855  C  CG    . LEU D 2 380 ? -12.909 -5.231  45.488 1.00 13.57 ? 381  LEU C CG    1 
ATOM   9856  C  CD1   . LEU D 2 380 ? -13.877 -4.446  46.359 1.00 13.15 ? 381  LEU C CD1   1 
ATOM   9857  C  CD2   . LEU D 2 380 ? -11.678 -5.654  46.291 1.00 13.70 ? 381  LEU C CD2   1 
ATOM   9858  N  N     . GLU D 2 381 ? -14.353 -8.649  42.574 1.00 13.93 ? 382  GLU C N     1 
ATOM   9859  C  CA    . GLU D 2 381 ? -14.885 -9.949  42.173 1.00 13.72 ? 382  GLU C CA    1 
ATOM   9860  C  C     . GLU D 2 381 ? -13.816 -10.770 41.444 1.00 13.73 ? 382  GLU C C     1 
ATOM   9861  O  O     . GLU D 2 381 ? -13.829 -12.003 41.504 1.00 14.10 ? 382  GLU C O     1 
ATOM   9862  C  CB    . GLU D 2 381 ? -16.136 -9.774  41.291 1.00 14.11 ? 382  GLU C CB    1 
ATOM   9863  C  CG    . GLU D 2 381 ? -17.399 -9.369  42.050 1.00 14.11 ? 382  GLU C CG    1 
ATOM   9864  C  CD    . GLU D 2 381 ? -18.449 -8.678  41.184 1.00 15.10 ? 382  GLU C CD    1 
ATOM   9865  O  OE1   . GLU D 2 381 ? -18.226 -8.480  39.983 1.00 15.56 ? 382  GLU C OE1   1 
ATOM   9866  O  OE2   . GLU D 2 381 ? -19.514 -8.294  41.723 1.00 16.22 ? 382  GLU C OE2   1 
ATOM   9867  N  N     . GLY D 2 382 ? -12.888 -10.082 40.772 1.00 13.17 ? 383  GLY C N     1 
ATOM   9868  C  CA    . GLY D 2 382 ? -11.795 -10.734 40.047 1.00 12.53 ? 383  GLY C CA    1 
ATOM   9869  C  C     . GLY D 2 382 ? -10.766 -11.302 41.011 1.00 14.16 ? 383  GLY C C     1 
ATOM   9870  O  O     . GLY D 2 382 ? -10.340 -12.457 40.875 1.00 14.71 ? 383  GLY C O     1 
ATOM   9871  N  N     . LEU D 2 383 ? -10.392 -10.497 42.000 1.00 13.40 ? 384  LEU C N     1 
ATOM   9872  C  CA    . LEU D 2 383 ? -9.430  -10.891 43.011 1.00 13.05 ? 384  LEU C CA    1 
ATOM   9873  C  C     . LEU D 2 383 ? -10.002 -12.001 43.906 1.00 13.70 ? 384  LEU C C     1 
ATOM   9874  O  O     . LEU D 2 383 ? -9.285  -12.918 44.288 1.00 14.42 ? 384  LEU C O     1 
ATOM   9875  C  CB    . LEU D 2 383 ? -8.994  -9.676  43.838 1.00 13.02 ? 384  LEU C CB    1 
ATOM   9876  C  CG    . LEU D 2 383 ? -8.581  -8.413  43.073 1.00 12.68 ? 384  LEU C CG    1 
ATOM   9877  C  CD1   . LEU D 2 383 ? -8.349  -7.240  43.980 1.00 11.38 ? 384  LEU C CD1   1 
ATOM   9878  C  CD2   . LEU D 2 383 ? -7.352  -8.653  42.206 1.00 11.54 ? 384  LEU C CD2   1 
ATOM   9879  N  N     . ARG D 2 384 ? -11.291 -11.910 44.223 1.00 13.05 ? 385  ARG C N     1 
ATOM   9880  C  CA    . ARG D 2 384 ? -11.982 -12.940 45.017 1.00 13.09 ? 385  ARG C CA    1 
ATOM   9881  C  C     . ARG D 2 384 ? -11.944 -14.303 44.317 1.00 13.25 ? 385  ARG C C     1 
ATOM   9882  O  O     . ARG D 2 384 ? -11.700 -15.314 44.965 1.00 13.46 ? 385  ARG C O     1 
ATOM   9883  C  CB    . ARG D 2 384 ? -13.418 -12.517 45.366 1.00 12.76 ? 385  ARG C CB    1 
ATOM   9884  C  CG    . ARG D 2 384 ? -13.450 -11.420 46.409 1.00 12.94 ? 385  ARG C CG    1 
ATOM   9885  C  CD    . ARG D 2 384 ? -14.795 -10.717 46.561 1.00 11.95 ? 385  ARG C CD    1 
ATOM   9886  N  NE    . ARG D 2 384 ? -15.858 -11.505 47.186 1.00 11.47 ? 385  ARG C NE    1 
ATOM   9887  C  CZ    . ARG D 2 384 ? -16.874 -12.065 46.526 1.00 10.76 ? 385  ARG C CZ    1 
ATOM   9888  N  NH1   . ARG D 2 384 ? -16.979 -11.940 45.210 1.00 10.09 ? 385  ARG C NH1   1 
ATOM   9889  N  NH2   . ARG D 2 384 ? -17.791 -12.749 47.192 1.00 10.64 ? 385  ARG C NH2   1 
ATOM   9890  N  N     . ILE D 2 385 ? -12.174 -14.318 42.999 1.00 14.16 ? 386  ILE C N     1 
ATOM   9891  C  CA    . ILE D 2 385 ? -12.068 -15.546 42.200 1.00 14.56 ? 386  ILE C CA    1 
ATOM   9892  C  C     . ILE D 2 385 ? -10.630 -16.060 42.280 1.00 15.14 ? 386  ILE C C     1 
ATOM   9893  O  O     . ILE D 2 385 ? -10.392 -17.249 42.481 1.00 16.48 ? 386  ILE C O     1 
ATOM   9894  C  CB    . ILE D 2 385 ? -12.454 -15.320 40.709 1.00 14.99 ? 386  ILE C CB    1 
ATOM   9895  C  CG1   . ILE D 2 385 ? -13.961 -15.049 40.564 1.00 14.84 ? 386  ILE C CG1   1 
ATOM   9896  C  CG2   . ILE D 2 385 ? -12.073 -16.541 39.850 1.00 14.69 ? 386  ILE C CG2   1 
ATOM   9897  C  CD1   . ILE D 2 385 ? -14.388 -14.624 39.147 1.00 15.75 ? 386  ILE C CD1   1 
ATOM   9898  N  N     . ALA D 2 386 ? -9.682  -15.147 42.136 1.00 14.96 ? 387  ALA C N     1 
ATOM   9899  C  CA    . ALA D 2 386 ? -8.268  -15.487 42.191 1.00 15.38 ? 387  ALA C CA    1 
ATOM   9900  C  C     . ALA D 2 386 ? -7.887  -16.147 43.520 1.00 16.13 ? 387  ALA C C     1 
ATOM   9901  O  O     . ALA D 2 386 ? -7.207  -17.174 43.523 1.00 15.80 ? 387  ALA C O     1 
ATOM   9902  C  CB    . ALA D 2 386 ? -7.400  -14.247 41.918 1.00 14.45 ? 387  ALA C CB    1 
ATOM   9903  N  N     . LEU D 2 387 ? -8.337  -15.572 44.639 1.00 15.43 ? 388  LEU C N     1 
ATOM   9904  C  CA    . LEU D 2 387 ? -8.044  -16.144 45.962 1.00 14.75 ? 388  LEU C CA    1 
ATOM   9905  C  C     . LEU D 2 387 ? -8.648  -17.539 46.157 1.00 16.61 ? 388  LEU C C     1 
ATOM   9906  O  O     . LEU D 2 387 ? -8.025  -18.404 46.790 1.00 18.02 ? 388  LEU C O     1 
ATOM   9907  C  CB    . LEU D 2 387 ? -8.480  -15.203 47.083 1.00 14.16 ? 388  LEU C CB    1 
ATOM   9908  C  CG    . LEU D 2 387 ? -7.809  -13.818 47.086 1.00 13.50 ? 388  LEU C CG    1 
ATOM   9909  C  CD1   . LEU D 2 387 ? -8.394  -12.930 48.191 1.00 13.05 ? 388  LEU C CD1   1 
ATOM   9910  C  CD2   . LEU D 2 387 ? -6.298  -13.911 47.193 1.00 12.70 ? 388  LEU C CD2   1 
ATOM   9911  N  N     . ASP D 2 388 ? -9.844  -17.758 45.601 1.00 17.06 ? 389  ASP C N     1 
ATOM   9912  C  CA    . ASP D 2 388 ? -10.538 -19.051 45.675 1.00 17.48 ? 389  ASP C CA    1 
ATOM   9913  C  C     . ASP D 2 388 ? -9.821  -20.170 44.909 1.00 17.80 ? 389  ASP C C     1 
ATOM   9914  O  O     . ASP D 2 388 ? -9.933  -21.342 45.274 1.00 18.82 ? 389  ASP C O     1 
ATOM   9915  C  CB    . ASP D 2 388 ? -11.978 -18.927 45.145 1.00 19.34 ? 389  ASP C CB    1 
ATOM   9916  C  CG    . ASP D 2 388 ? -12.879 -18.103 46.059 1.00 20.63 ? 389  ASP C CG    1 
ATOM   9917  O  OD1   . ASP D 2 388 ? -12.535 -17.913 47.243 1.00 21.65 ? 389  ASP C OD1   1 
ATOM   9918  O  OD2   . ASP D 2 388 ? -13.947 -17.647 45.613 1.00 20.25 ? 389  ASP C OD2   1 
ATOM   9919  N  N     . HIS D 2 389 ? -9.100  -19.809 43.851 1.00 17.64 ? 390  HIS C N     1 
ATOM   9920  C  CA    . HIS D 2 389 ? -8.417  -20.784 43.005 1.00 18.80 ? 390  HIS C CA    1 
ATOM   9921  C  C     . HIS D 2 389 ? -6.965  -20.391 42.777 1.00 20.04 ? 390  HIS C C     1 
ATOM   9922  O  O     . HIS D 2 389 ? -6.404  -20.623 41.701 1.00 20.65 ? 390  HIS C O     1 
ATOM   9923  C  CB    . HIS D 2 389 ? -9.144  -20.909 41.662 1.00 20.87 ? 390  HIS C CB    1 
ATOM   9924  C  CG    . HIS D 2 389 ? -10.588 -21.289 41.797 1.00 22.69 ? 390  HIS C CG    1 
ATOM   9925  N  ND1   . HIS D 2 389 ? -11.004 -22.599 41.917 1.00 21.59 ? 390  HIS C ND1   1 
ATOM   9926  C  CD2   . HIS D 2 389 ? -11.707 -20.526 41.851 1.00 22.29 ? 390  HIS C CD2   1 
ATOM   9927  C  CE1   . HIS D 2 389 ? -12.320 -22.623 42.042 1.00 23.54 ? 390  HIS C CE1   1 
ATOM   9928  N  NE2   . HIS D 2 389 ? -12.771 -21.380 41.990 1.00 23.53 ? 390  HIS C NE2   1 
ATOM   9929  N  N     . ILE D 2 390 ? -6.362  -19.814 43.813 1.00 20.06 ? 391  ILE C N     1 
ATOM   9930  C  CA    . ILE D 2 390 ? -4.992  -19.318 43.767 1.00 20.66 ? 391  ILE C CA    1 
ATOM   9931  C  C     . ILE D 2 390 ? -3.981  -20.314 43.164 1.00 21.29 ? 391  ILE C C     1 
ATOM   9932  O  O     . ILE D 2 390 ? -3.108  -19.917 42.392 1.00 20.04 ? 391  ILE C O     1 
ATOM   9933  C  CB    . ILE D 2 390 ? -4.557  -18.738 45.159 1.00 21.43 ? 391  ILE C CB    1 
ATOM   9934  C  CG1   . ILE D 2 390 ? -3.229  -17.978 45.071 1.00 21.16 ? 391  ILE C CG1   1 
ATOM   9935  C  CG2   . ILE D 2 390 ? -4.533  -19.814 46.227 1.00 21.75 ? 391  ILE C CG2   1 
ATOM   9936  C  CD1   . ILE D 2 390 ? -3.277  -16.725 44.221 1.00 20.91 ? 391  ILE C CD1   1 
ATOM   9937  N  N     . ASP D 2 391 ? -4.116  -21.595 43.498 1.00 22.81 ? 392  ASP C N     1 
ATOM   9938  C  CA    . ASP D 2 391 ? -3.237  -22.630 42.950 1.00 23.62 ? 392  ASP C CA    1 
ATOM   9939  C  C     . ASP D 2 391 ? -3.329  -22.675 41.432 1.00 22.22 ? 392  ASP C C     1 
ATOM   9940  O  O     . ASP D 2 391 ? -2.309  -22.641 40.743 1.00 21.83 ? 392  ASP C O     1 
ATOM   9941  C  CB    . ASP D 2 391 ? -3.559  -24.004 43.535 1.00 25.04 ? 392  ASP C CB    1 
ATOM   9942  C  CG    . ASP D 2 391 ? -3.128  -24.156 44.970 1.00 27.31 ? 392  ASP C CG    1 
ATOM   9943  O  OD1   . ASP D 2 391 ? -2.087  -23.544 45.340 1.00 26.41 ? 392  ASP C OD1   1 
ATOM   9944  O  OD2   . ASP D 2 391 ? -3.825  -24.915 45.713 1.00 28.13 ? 392  ASP C OD2   1 
ATOM   9945  N  N     . GLU D 2 392 ? -4.558  -22.730 40.941 1.00 23.44 ? 393  GLU C N     1 
ATOM   9946  C  CA    . GLU D 2 392 ? -4.861  -22.749 39.529 1.00 24.91 ? 393  GLU C CA    1 
ATOM   9947  C  C     . GLU D 2 392 ? -4.372  -21.465 38.875 1.00 24.03 ? 393  GLU C C     1 
ATOM   9948  O  O     . GLU D 2 392 ? -3.906  -21.479 37.752 1.00 23.96 ? 393  GLU C O     1 
ATOM   9949  C  CB    . GLU D 2 392 ? -6.372  -22.878 39.312 1.00 31.82 ? 393  GLU C CB    1 
ATOM   9950  C  CG    . GLU D 2 392 ? -6.884  -24.289 39.104 1.00 37.96 ? 393  GLU C CG    1 
ATOM   9951  C  CD    . GLU D 2 392 ? -8.189  -24.329 38.303 1.00 45.50 ? 393  GLU C CD    1 
ATOM   9952  O  OE1   . GLU D 2 392 ? -9.188  -23.692 38.735 1.00 46.38 ? 393  GLU C OE1   1 
ATOM   9953  O  OE2   . GLU D 2 392 ? -8.193  -25.046 37.263 1.00 45.03 ? 393  GLU C OE2   1 
ATOM   9954  N  N     . ILE D 2 393 ? -4.507  -20.362 39.598 1.00 21.31 ? 394  ILE C N     1 
ATOM   9955  C  CA    . ILE D 2 393 ? -4.090  -19.041 39.137 1.00 20.42 ? 394  ILE C CA    1 
ATOM   9956  C  C     . ILE D 2 393 ? -2.574  -19.019 38.893 1.00 19.72 ? 394  ILE C C     1 
ATOM   9957  O  O     . ILE D 2 393 ? -2.107  -18.485 37.882 1.00 19.75 ? 394  ILE C O     1 
ATOM   9958  C  CB    . ILE D 2 393 ? -4.509  -17.911 40.133 1.00 19.52 ? 394  ILE C CB    1 
ATOM   9959  C  CG1   . ILE D 2 393 ? -6.046  -17.786 40.240 1.00 18.57 ? 394  ILE C CG1   1 
ATOM   9960  C  CG2   . ILE D 2 393 ? -3.865  -16.561 39.763 1.00 21.04 ? 394  ILE C CG2   1 
ATOM   9961  C  CD1   . ILE D 2 393 ? -6.772  -17.284 38.994 1.00 16.64 ? 394  ILE C CD1   1 
ATOM   9962  N  N     . ILE D 2 394 ? -1.809  -19.607 39.809 1.00 19.08 ? 395  ILE C N     1 
ATOM   9963  C  CA    . ILE D 2 394 ? -0.350  -19.644 39.672 1.00 20.76 ? 395  ILE C CA    1 
ATOM   9964  C  C     . ILE D 2 394 ? 0.068   -20.473 38.451 1.00 20.31 ? 395  ILE C C     1 
ATOM   9965  O  O     . ILE D 2 394 ? 0.872   -20.018 37.634 1.00 18.21 ? 395  ILE C O     1 
ATOM   9966  C  CB    . ILE D 2 394 ? 0.356   -20.174 40.953 1.00 22.26 ? 395  ILE C CB    1 
ATOM   9967  C  CG1   . ILE D 2 394 ? -0.058  -19.362 42.202 1.00 23.90 ? 395  ILE C CG1   1 
ATOM   9968  C  CG2   . ILE D 2 394 ? 1.880   -20.186 40.781 1.00 21.64 ? 395  ILE C CG2   1 
ATOM   9969  C  CD1   . ILE D 2 394 ? 0.196   -17.858 42.132 1.00 26.24 ? 395  ILE C CD1   1 
ATOM   9970  N  N     . SER D 2 395 ? -0.504  -21.672 38.326 1.00 20.78 ? 396  SER C N     1 
ATOM   9971  C  CA    . SER D 2 395 ? -0.187  -22.595 37.228 1.00 21.84 ? 396  SER C CA    1 
ATOM   9972  C  C     . SER D 2 395 ? -0.420  -21.975 35.855 1.00 21.48 ? 396  SER C C     1 
ATOM   9973  O  O     . SER D 2 395 ? 0.363   -22.197 34.920 1.00 21.77 ? 396  SER C O     1 
ATOM   9974  C  CB    . SER D 2 395 ? -0.999  -23.881 37.359 1.00 22.01 ? 396  SER C CB    1 
ATOM   9975  O  OG    . SER D 2 395 ? -0.782  -24.478 38.624 1.00 25.37 ? 396  SER C OG    1 
ATOM   9976  N  N     . THR D 2 396 ? -1.495  -21.202 35.742 1.00 19.38 ? 397  THR C N     1 
ATOM   9977  C  CA    . THR D 2 396 ? -1.828  -20.531 34.493 1.00 20.04 ? 397  THR C CA    1 
ATOM   9978  C  C     . THR D 2 396 ? -0.754  -19.499 34.140 1.00 19.53 ? 397  THR C C     1 
ATOM   9979  O  O     . THR D 2 396 ? -0.307  -19.429 32.995 1.00 21.25 ? 397  THR C O     1 
ATOM   9980  C  CB    . THR D 2 396 ? -3.231  -19.894 34.554 1.00 20.01 ? 397  THR C CB    1 
ATOM   9981  O  OG1   . THR D 2 396 ? -4.191  -20.898 34.904 1.00 21.90 ? 397  THR C OG1   1 
ATOM   9982  C  CG2   . THR D 2 396 ? -3.613  -19.298 33.217 1.00 20.57 ? 397  THR C CG2   1 
ATOM   9983  N  N     . ILE D 2 397 ? -0.321  -18.730 35.133 1.00 19.92 ? 398  ILE C N     1 
ATOM   9984  C  CA    . ILE D 2 397 ? 0.706   -17.702 34.934 1.00 19.92 ? 398  ILE C CA    1 
ATOM   9985  C  C     . ILE D 2 397 ? 2.101   -18.306 34.696 1.00 21.60 ? 398  ILE C C     1 
ATOM   9986  O  O     . ILE D 2 397 ? 2.839   -17.847 33.819 1.00 20.35 ? 398  ILE C O     1 
ATOM   9987  C  CB    . ILE D 2 397 ? 0.722   -16.694 36.107 1.00 18.71 ? 398  ILE C CB    1 
ATOM   9988  C  CG1   . ILE D 2 397 ? -0.675  -16.081 36.292 1.00 17.82 ? 398  ILE C CG1   1 
ATOM   9989  C  CG2   . ILE D 2 397 ? 1.770   -15.610 35.868 1.00 17.70 ? 398  ILE C CG2   1 
ATOM   9990  C  CD1   . ILE D 2 397 ? -0.867  -15.257 37.566 1.00 16.42 ? 398  ILE C CD1   1 
ATOM   9991  N  N     . ARG D 2 398 ? 2.435   -19.335 35.465 1.00 22.93 ? 399  ARG C N     1 
ATOM   9992  C  CA    . ARG D 2 398 ? 3.722   -20.019 35.383 1.00 24.60 ? 399  ARG C CA    1 
ATOM   9993  C  C     . ARG D 2 398 ? 4.033   -20.638 34.017 1.00 26.87 ? 399  ARG C C     1 
ATOM   9994  O  O     . ARG D 2 398 ? 5.166   -20.575 33.553 1.00 28.13 ? 399  ARG C O     1 
ATOM   9995  C  CB    . ARG D 2 398 ? 3.796   -21.092 36.459 1.00 25.23 ? 399  ARG C CB    1 
ATOM   9996  C  CG    . ARG D 2 398 ? 4.035   -20.552 37.854 1.00 26.54 ? 399  ARG C CG    1 
ATOM   9997  C  CD    . ARG D 2 398 ? 5.489   -20.676 38.245 1.00 29.34 ? 399  ARG C CD    1 
ATOM   9998  N  NE    . ARG D 2 398 ? 5.843   -22.041 38.621 1.00 31.98 ? 399  ARG C NE    1 
ATOM   9999  C  CZ    . ARG D 2 398 ? 7.092   -22.442 38.845 1.00 36.65 ? 399  ARG C CZ    1 
ATOM   10000 N  NH1   . ARG D 2 398 ? 8.108   -21.591 38.733 1.00 40.53 ? 399  ARG C NH1   1 
ATOM   10001 N  NH2   . ARG D 2 398 ? 7.336   -23.698 39.175 1.00 36.81 ? 399  ARG C NH2   1 
ATOM   10002 N  N     . GLU D 2 399 ? 3.024   -21.232 33.392 1.00 28.42 ? 400  GLU C N     1 
ATOM   10003 C  CA    . GLU D 2 399 ? 3.155   -21.879 32.091 1.00 26.83 ? 400  GLU C CA    1 
ATOM   10004 C  C     . GLU D 2 399 ? 3.120   -20.889 30.916 1.00 26.89 ? 400  GLU C C     1 
ATOM   10005 O  O     . GLU D 2 399 ? 3.245   -21.295 29.758 1.00 26.98 ? 400  GLU C O     1 
ATOM   10006 C  CB    . GLU D 2 399 ? 2.045   -22.924 31.917 1.00 29.77 ? 400  GLU C CB    1 
ATOM   10007 C  CG    . GLU D 2 399 ? 0.644   -22.332 31.754 1.00 34.76 ? 400  GLU C CG    1 
ATOM   10008 C  CD    . GLU D 2 399 ? -0.471  -23.379 31.785 1.00 39.41 ? 400  GLU C CD    1 
ATOM   10009 O  OE1   . GLU D 2 399 ? -0.196  -24.553 32.188 1.00 32.31 ? 400  GLU C OE1   1 
ATOM   10010 O  OE2   . GLU D 2 399 ? -1.626  -23.021 31.425 1.00 37.37 ? 400  GLU C OE2   1 
ATOM   10011 N  N     . SER D 2 400 ? 2.946   -19.602 31.216 1.00 26.50 ? 401  SER C N     1 
ATOM   10012 C  CA    . SER D 2 400 ? 2.874   -18.564 30.185 1.00 27.00 ? 401  SER C CA    1 
ATOM   10013 C  C     . SER D 2 400 ? 4.204   -17.825 30.015 1.00 28.72 ? 401  SER C C     1 
ATOM   10014 O  O     . SER D 2 400 ? 4.770   -17.308 30.993 1.00 24.14 ? 401  SER C O     1 
ATOM   10015 C  CB    . SER D 2 400 ? 1.767   -17.565 30.516 1.00 27.07 ? 401  SER C CB    1 
ATOM   10016 O  OG    . SER D 2 400 ? 0.523   -18.214 30.695 1.00 24.20 ? 401  SER C OG    1 
ATOM   10017 N  N     . ASP D 2 401 ? 4.685   -17.765 28.769 1.00 29.06 ? 402  ASP C N     1 
ATOM   10018 C  CA    . ASP D 2 401 ? 5.957   -17.104 28.444 1.00 29.45 ? 402  ASP C CA    1 
ATOM   10019 C  C     . ASP D 2 401 ? 5.895   -15.580 28.536 1.00 29.37 ? 402  ASP C C     1 
ATOM   10020 O  O     . ASP D 2 401 ? 6.863   -14.941 28.945 1.00 30.22 ? 402  ASP C O     1 
ATOM   10021 C  CB    . ASP D 2 401 ? 6.420   -17.501 27.035 1.00 33.86 ? 402  ASP C CB    1 
ATOM   10022 C  CG    . ASP D 2 401 ? 6.717   -18.986 26.904 1.00 39.35 ? 402  ASP C CG    1 
ATOM   10023 O  OD1   . ASP D 2 401 ? 6.668   -19.731 27.921 1.00 39.55 ? 402  ASP C OD1   1 
ATOM   10024 O  OD2   . ASP D 2 401 ? 7.010   -19.399 25.760 1.00 43.78 ? 402  ASP C OD2   1 
ATOM   10025 N  N     . THR D 2 402 ? 4.762   -15.011 28.139 1.00 28.48 ? 403  THR C N     1 
ATOM   10026 C  CA    . THR D 2 402 ? 4.569   -13.562 28.137 1.00 28.20 ? 403  THR C CA    1 
ATOM   10027 C  C     . THR D 2 402 ? 3.352   -13.163 28.981 1.00 31.12 ? 403  THR C C     1 
ATOM   10028 O  O     . THR D 2 402 ? 2.544   -14.022 29.367 1.00 36.01 ? 403  THR C O     1 
ATOM   10029 C  CB    . THR D 2 402 ? 4.373   -13.007 26.708 1.00 28.27 ? 403  THR C CB    1 
ATOM   10030 O  OG1   . THR D 2 402 ? 3.153   -13.506 26.149 1.00 27.24 ? 403  THR C OG1   1 
ATOM   10031 C  CG2   . THR D 2 402 ? 5.548   -13.383 25.793 1.00 28.90 ? 403  THR C CG2   1 
ATOM   10032 N  N     . ASP D 2 403 ? 3.225   -11.869 29.263 1.00 29.86 ? 404  ASP C N     1 
ATOM   10033 C  CA    . ASP D 2 403 ? 2.086   -11.332 29.994 1.00 28.95 ? 404  ASP C CA    1 
ATOM   10034 C  C     . ASP D 2 403 ? 0.818   -11.418 29.154 1.00 29.12 ? 404  ASP C C     1 
ATOM   10035 O  O     . ASP D 2 403 ? -0.252  -11.739 29.670 1.00 28.90 ? 404  ASP C O     1 
ATOM   10036 C  CB    . ASP D 2 403 ? 2.325   -9.867  30.400 1.00 29.74 ? 404  ASP C CB    1 
ATOM   10037 C  CG    . ASP D 2 403 ? 3.336   -9.718  31.526 1.00 30.95 ? 404  ASP C CG    1 
ATOM   10038 O  OD1   . ASP D 2 403 ? 3.881   -10.750 32.013 1.00 28.07 ? 404  ASP C OD1   1 
ATOM   10039 O  OD2   . ASP D 2 403 ? 3.579   -8.555  31.915 1.00 30.95 ? 404  ASP C OD2   1 
ATOM   10040 N  N     . LYS D 2 404 ? 0.951   -11.125 27.859 1.00 28.21 ? 405  LYS C N     1 
ATOM   10041 C  CA    . LYS D 2 404 ? -0.169  -11.175 26.917 1.00 26.26 ? 405  LYS C CA    1 
ATOM   10042 C  C     . LYS D 2 404 ? -0.834  -12.562 26.904 1.00 26.27 ? 405  LYS C C     1 
ATOM   10043 O  O     . LYS D 2 404 ? -2.059  -12.667 26.919 1.00 27.61 ? 405  LYS C O     1 
ATOM   10044 C  CB    . LYS D 2 404 ? 0.308   -10.775 25.516 1.00 26.78 ? 405  LYS C CB    1 
ATOM   10045 C  CG    . LYS D 2 404 ? -0.756  -10.809 24.427 1.00 27.85 ? 405  LYS C CG    1 
ATOM   10046 C  CD    . LYS D 2 404 ? -0.149  -10.485 23.058 1.00 29.48 ? 405  LYS C CD    1 
ATOM   10047 C  CE    . LYS D 2 404 ? -1.165  -10.684 21.925 1.00 31.53 ? 405  LYS C CE    1 
ATOM   10048 N  NZ    . LYS D 2 404 ? -1.557  -12.119 21.769 1.00 29.97 ? 405  LYS C NZ    1 
ATOM   10049 N  N     . VAL D 2 405 ? -0.016  -13.613 26.889 1.00 27.39 ? 406  VAL C N     1 
ATOM   10050 C  CA    . VAL D 2 405 ? -0.506  -14.988 26.891 1.00 28.90 ? 406  VAL C CA    1 
ATOM   10051 C  C     . VAL D 2 405 ? -1.127  -15.329 28.246 1.00 27.64 ? 406  VAL C C     1 
ATOM   10052 O  O     . VAL D 2 405 ? -2.141  -16.027 28.311 1.00 24.86 ? 406  VAL C O     1 
ATOM   10053 C  CB    . VAL D 2 405 ? 0.609   -16.002 26.506 1.00 29.79 ? 406  VAL C CB    1 
ATOM   10054 C  CG1   . VAL D 2 405 ? 0.119   -17.445 26.653 1.00 28.91 ? 406  VAL C CG1   1 
ATOM   10055 C  CG2   . VAL D 2 405 ? 1.090   -15.749 25.087 1.00 26.83 ? 406  VAL C CG2   1 
ATOM   10056 N  N     . ALA D 2 406 ? -0.516  -14.829 29.319 1.00 28.97 ? 407  ALA C N     1 
ATOM   10057 C  CA    . ALA D 2 406 ? -1.034  -15.033 30.673 1.00 28.86 ? 407  ALA C CA    1 
ATOM   10058 C  C     . ALA D 2 406 ? -2.440  -14.427 30.790 1.00 28.66 ? 407  ALA C C     1 
ATOM   10059 O  O     . ALA D 2 406 ? -3.361  -15.071 31.295 1.00 29.99 ? 407  ALA C O     1 
ATOM   10060 C  CB    . ALA D 2 406 ? -0.090  -14.429 31.704 1.00 25.30 ? 407  ALA C CB    1 
ATOM   10061 N  N     . MET D 2 407 ? -2.587  -13.206 30.297 1.00 26.22 ? 408  MET C N     1 
ATOM   10062 C  CA    . MET D 2 407 ? -3.852  -12.508 30.305 1.00 27.16 ? 408  MET C CA    1 
ATOM   10063 C  C     . MET D 2 407 ? -4.933  -13.332 29.650 1.00 27.78 ? 408  MET C C     1 
ATOM   10064 O  O     . MET D 2 407 ? -5.931  -13.657 30.271 1.00 28.20 ? 408  MET C O     1 
ATOM   10065 C  CB    . MET D 2 407 ? -3.714  -11.208 29.525 1.00 30.93 ? 408  MET C CB    1 
ATOM   10066 C  CG    . MET D 2 407 ? -3.043  -10.095 30.291 1.00 36.85 ? 408  MET C CG    1 
ATOM   10067 S  SD    . MET D 2 407 ? -4.221  -9.324  31.395 1.00 42.51 ? 408  MET C SD    1 
ATOM   10068 C  CE    . MET D 2 407 ? -5.315  -8.565  30.197 1.00 42.03 ? 408  MET C CE    1 
ATOM   10069 N  N     . GLU D 2 408 ? -4.718  -13.647 28.376 1.00 28.28 ? 409  GLU C N     1 
ATOM   10070 C  CA    . GLU D 2 408 ? -5.654  -14.424 27.569 1.00 27.37 ? 409  GLU C CA    1 
ATOM   10071 C  C     . GLU D 2 408 ? -6.053  -15.754 28.202 1.00 24.61 ? 409  GLU C C     1 
ATOM   10072 O  O     . GLU D 2 408 ? -7.210  -16.153 28.097 1.00 22.32 ? 409  GLU C O     1 
ATOM   10073 C  CB    . GLU D 2 408 ? -5.091  -14.612 26.155 1.00 27.98 ? 409  GLU C CB    1 
ATOM   10074 C  CG    . GLU D 2 408 ? -4.953  -13.287 25.406 1.00 31.19 ? 409  GLU C CG    1 
ATOM   10075 C  CD    . GLU D 2 408 ? -4.183  -13.411 24.096 1.00 34.13 ? 409  GLU C CD    1 
ATOM   10076 O  OE1   . GLU D 2 408 ? -4.150  -12.409 23.349 1.00 33.64 ? 409  GLU C OE1   1 
ATOM   10077 O  OE2   . GLU D 2 408 ? -3.609  -14.497 23.821 1.00 33.55 ? 409  GLU C OE2   1 
ATOM   10078 N  N     . SER D 2 409 ? -5.101  -16.424 28.853 1.00 22.33 ? 410  SER C N     1 
ATOM   10079 C  CA    . SER D 2 409 ? -5.372  -17.695 29.533 1.00 20.82 ? 410  SER C CA    1 
ATOM   10080 C  C     . SER D 2 409 ? -6.222  -17.485 30.781 1.00 20.32 ? 410  SER C C     1 
ATOM   10081 O  O     . SER D 2 409 ? -7.133  -18.267 31.040 1.00 21.72 ? 410  SER C O     1 
ATOM   10082 C  CB    . SER D 2 409 ? -4.077  -18.432 29.891 1.00 21.77 ? 410  SER C CB    1 
ATOM   10083 O  OG    . SER D 2 409 ? -3.424  -18.933 28.745 1.00 22.01 ? 410  SER C OG    1 
ATOM   10084 N  N     . LEU D 2 410 ? -5.922  -16.431 31.544 1.00 19.65 ? 411  LEU C N     1 
ATOM   10085 C  CA    . LEU D 2 410 ? -6.691  -16.079 32.745 1.00 17.31 ? 411  LEU C CA    1 
ATOM   10086 C  C     . LEU D 2 410 ? -8.148  -15.751 32.414 1.00 17.97 ? 411  LEU C C     1 
ATOM   10087 O  O     . LEU D 2 410 ? -9.059  -16.159 33.137 1.00 16.23 ? 411  LEU C O     1 
ATOM   10088 C  CB    . LEU D 2 410 ? -6.042  -14.917 33.498 1.00 16.32 ? 411  LEU C CB    1 
ATOM   10089 C  CG    . LEU D 2 410 ? -4.757  -15.161 34.292 1.00 16.58 ? 411  LEU C CG    1 
ATOM   10090 C  CD1   . LEU D 2 410 ? -4.090  -13.838 34.651 1.00 17.76 ? 411  LEU C CD1   1 
ATOM   10091 C  CD2   . LEU D 2 410 ? -5.011  -15.992 35.548 1.00 16.19 ? 411  LEU C CD2   1 
ATOM   10092 N  N     . GLN D 2 411 ? -8.356  -15.022 31.315 1.00 18.47 ? 412  GLN C N     1 
ATOM   10093 C  CA    . GLN D 2 411 ? -9.705  -14.664 30.860 1.00 19.68 ? 412  GLN C CA    1 
ATOM   10094 C  C     . GLN D 2 411 ? -10.435 -15.904 30.381 1.00 20.39 ? 412  GLN C C     1 
ATOM   10095 O  O     . GLN D 2 411 ? -11.609 -16.097 30.686 1.00 20.38 ? 412  GLN C O     1 
ATOM   10096 C  CB    . GLN D 2 411 ? -9.655  -13.652 29.717 1.00 19.41 ? 412  GLN C CB    1 
ATOM   10097 C  CG    . GLN D 2 411 ? -8.926  -12.363 30.030 1.00 17.86 ? 412  GLN C CG    1 
ATOM   10098 C  CD    . GLN D 2 411 ? -8.797  -11.487 28.813 1.00 18.81 ? 412  GLN C CD    1 
ATOM   10099 O  OE1   . GLN D 2 411 ? -9.794  -11.027 28.257 1.00 18.71 ? 412  GLN C OE1   1 
ATOM   10100 N  NE2   . GLN D 2 411 ? -7.559  -11.234 28.390 1.00 19.95 ? 412  GLN C NE2   1 
ATOM   10101 N  N     . GLN D 2 412 ? -9.725  -16.748 29.634 1.00 22.49 ? 413  GLN C N     1 
ATOM   10102 C  CA    . GLN D 2 412 ? -10.292 -17.977 29.087 1.00 23.99 ? 413  GLN C CA    1 
ATOM   10103 C  C     . GLN D 2 412 ? -10.679 -18.984 30.170 1.00 23.18 ? 413  GLN C C     1 
ATOM   10104 O  O     . GLN D 2 412 ? -11.816 -19.444 30.222 1.00 22.23 ? 413  GLN C O     1 
ATOM   10105 C  CB    . GLN D 2 412 ? -9.316  -18.619 28.106 1.00 24.43 ? 413  GLN C CB    1 
ATOM   10106 C  CG    . GLN D 2 412 ? -9.769  -19.975 27.566 1.00 26.64 ? 413  GLN C CG    1 
ATOM   10107 C  CD    . GLN D 2 412 ? -8.711  -20.616 26.665 1.00 29.58 ? 413  GLN C CD    1 
ATOM   10108 O  OE1   . GLN D 2 412 ? -7.855  -19.907 26.076 1.00 33.16 ? 413  GLN C OE1   1 
ATOM   10109 N  NE2   . GLN D 2 412 ? -8.767  -21.943 26.532 1.00 25.68 ? 413  GLN C NE2   1 
ATOM   10110 N  N     . ARG D 2 413 ? -9.721  -19.306 31.032 1.00 22.29 ? 414  ARG C N     1 
ATOM   10111 C  CA    . ARG D 2 413 ? -9.917  -20.303 32.073 1.00 21.53 ? 414  ARG C CA    1 
ATOM   10112 C  C     . ARG D 2 413 ? -10.862 -19.873 33.202 1.00 21.44 ? 414  ARG C C     1 
ATOM   10113 O  O     . ARG D 2 413 ? -11.705 -20.656 33.638 1.00 23.05 ? 414  ARG C O     1 
ATOM   10114 C  CB    . ARG D 2 413 ? -8.563  -20.756 32.625 1.00 22.22 ? 414  ARG C CB    1 
ATOM   10115 C  CG    . ARG D 2 413 ? -8.615  -21.998 33.503 1.00 26.48 ? 414  ARG C CG    1 
ATOM   10116 C  CD    . ARG D 2 413 ? -7.227  -22.604 33.703 1.00 28.15 ? 414  ARG C CD    1 
ATOM   10117 N  NE    . ARG D 2 413 ? -7.291  -23.899 34.378 1.00 38.58 ? 414  ARG C NE    1 
ATOM   10118 C  CZ    . ARG D 2 413 ? -7.523  -25.069 33.769 1.00 44.21 ? 414  ARG C CZ    1 
ATOM   10119 N  NH1   . ARG D 2 413 ? -7.717  -25.125 32.450 1.00 46.90 ? 414  ARG C NH1   1 
ATOM   10120 N  NH2   . ARG D 2 413 ? -7.567  -26.185 34.478 1.00 45.19 ? 414  ARG C NH2   1 
ATOM   10121 N  N     . PHE D 2 414 ? -10.752 -18.632 33.654 1.00 19.96 ? 415  PHE C N     1 
ATOM   10122 C  CA    . PHE D 2 414 ? -11.564 -18.179 34.783 1.00 20.44 ? 415  PHE C CA    1 
ATOM   10123 C  C     . PHE D 2 414 ? -12.705 -17.224 34.407 1.00 21.27 ? 415  PHE C C     1 
ATOM   10124 O  O     . PHE D 2 414 ? -13.301 -16.584 35.282 1.00 21.83 ? 415  PHE C O     1 
ATOM   10125 C  CB    . PHE D 2 414 ? -10.656 -17.608 35.876 1.00 18.99 ? 415  PHE C CB    1 
ATOM   10126 C  CG    . PHE D 2 414 ? -9.560  -18.554 36.298 1.00 19.63 ? 415  PHE C CG    1 
ATOM   10127 C  CD1   . PHE D 2 414 ? -9.776  -19.492 37.307 1.00 19.42 ? 415  PHE C CD1   1 
ATOM   10128 C  CD2   . PHE D 2 414 ? -8.315  -18.524 35.671 1.00 20.05 ? 415  PHE C CD2   1 
ATOM   10129 C  CE1   . PHE D 2 414 ? -8.772  -20.375 37.692 1.00 21.45 ? 415  PHE C CE1   1 
ATOM   10130 C  CE2   . PHE D 2 414 ? -7.299  -19.405 36.048 1.00 21.19 ? 415  PHE C CE2   1 
ATOM   10131 C  CZ    . PHE D 2 414 ? -7.533  -20.335 37.061 1.00 21.70 ? 415  PHE C CZ    1 
ATOM   10132 N  N     . LYS D 2 415 ? -13.013 -17.165 33.112 1.00 22.98 ? 416  LYS C N     1 
ATOM   10133 C  CA    . LYS D 2 415 ? -14.073 -16.305 32.560 1.00 24.04 ? 416  LYS C CA    1 
ATOM   10134 C  C     . LYS D 2 415 ? -13.996 -14.874 33.108 1.00 23.88 ? 416  LYS C C     1 
ATOM   10135 O  O     . LYS D 2 415 ? -14.973 -14.319 33.608 1.00 24.24 ? 416  LYS C O     1 
ATOM   10136 C  CB    . LYS D 2 415 ? -15.466 -16.933 32.747 1.00 27.50 ? 416  LYS C CB    1 
ATOM   10137 C  CG    . LYS D 2 415 ? -15.645 -18.230 31.932 1.00 34.43 ? 416  LYS C CG    1 
ATOM   10138 C  CD    . LYS D 2 415 ? -17.044 -18.810 31.995 1.00 41.13 ? 416  LYS C CD    1 
ATOM   10139 C  CE    . LYS D 2 415 ? -18.100 -17.871 31.406 1.00 43.12 ? 416  LYS C CE    1 
ATOM   10140 N  NZ    . LYS D 2 415 ? -19.499 -18.374 31.630 1.00 43.74 ? 416  LYS C NZ    1 
ATOM   10141 N  N     . LEU D 2 416 ? -12.810 -14.297 32.996 1.00 24.46 ? 417  LEU C N     1 
ATOM   10142 C  CA    . LEU D 2 416 ? -12.528 -12.957 33.484 1.00 25.13 ? 417  LEU C CA    1 
ATOM   10143 C  C     . LEU D 2 416 ? -12.531 -11.941 32.350 1.00 24.55 ? 417  LEU C C     1 
ATOM   10144 O  O     . LEU D 2 416 ? -12.343 -12.302 31.180 1.00 27.46 ? 417  LEU C O     1 
ATOM   10145 C  CB    . LEU D 2 416 ? -11.151 -12.938 34.162 1.00 23.50 ? 417  LEU C CB    1 
ATOM   10146 C  CG    . LEU D 2 416 ? -10.874 -13.948 35.284 1.00 22.33 ? 417  LEU C CG    1 
ATOM   10147 C  CD1   . LEU D 2 416 ? -9.387  -14.031 35.576 1.00 20.01 ? 417  LEU C CD1   1 
ATOM   10148 C  CD2   . LEU D 2 416 ? -11.679 -13.656 36.555 1.00 22.13 ? 417  LEU C CD2   1 
ATOM   10149 N  N     . SER D 2 417 ? -12.751 -10.677 32.703 1.00 22.44 ? 418  SER C N     1 
ATOM   10150 C  CA    . SER D 2 417 ? -12.697 -9.578  31.745 1.00 22.17 ? 418  SER C CA    1 
ATOM   10151 C  C     . SER D 2 417 ? -11.233 -9.205  31.573 1.00 23.72 ? 418  SER C C     1 
ATOM   10152 O  O     . SER D 2 417 ? -10.360 -9.800  32.208 1.00 23.52 ? 418  SER C O     1 
ATOM   10153 C  CB    . SER D 2 417 ? -13.506 -8.370  32.246 1.00 21.25 ? 418  SER C CB    1 
ATOM   10154 O  OG    . SER D 2 417 ? -12.964 -7.835  33.447 1.00 21.25 ? 418  SER C OG    1 
ATOM   10155 N  N     . GLU D 2 418 ? -10.946 -8.235  30.724 1.00 26.04 ? 419  GLU C N     1 
ATOM   10156 C  CA    . GLU D 2 418 ? -9.566  -7.831  30.521 1.00 26.81 ? 419  GLU C CA    1 
ATOM   10157 C  C     . GLU D 2 418 ? -9.080  -7.109  31.762 1.00 25.87 ? 419  GLU C C     1 
ATOM   10158 O  O     . GLU D 2 418 ? -7.948  -7.296  32.192 1.00 26.65 ? 419  GLU C O     1 
ATOM   10159 C  CB    . GLU D 2 418 ? -9.442  -6.925  29.299 1.00 30.64 ? 419  GLU C CB    1 
ATOM   10160 C  CG    . GLU D 2 418 ? -8.064  -6.967  28.666 1.00 36.77 ? 419  GLU C CG    1 
ATOM   10161 C  CD    . GLU D 2 418 ? -7.806  -5.819  27.717 1.00 38.59 ? 419  GLU C CD    1 
ATOM   10162 O  OE1   . GLU D 2 418 ? -8.702  -5.478  26.920 1.00 38.08 ? 419  GLU C OE1   1 
ATOM   10163 O  OE2   . GLU D 2 418 ? -6.701  -5.245  27.786 1.00 41.42 ? 419  GLU C OE2   1 
ATOM   10164 N  N     . LYS D 2 419 ? -9.950  -6.281  32.329 1.00 23.93 ? 420  LYS C N     1 
ATOM   10165 C  CA    . LYS D 2 419 ? -9.627  -5.525  33.527 1.00 22.32 ? 420  LYS C CA    1 
ATOM   10166 C  C     . LYS D 2 419 ? -9.369  -6.410  34.736 1.00 20.86 ? 420  LYS C C     1 
ATOM   10167 O  O     . LYS D 2 419 ? -8.450  -6.157  35.499 1.00 21.41 ? 420  LYS C O     1 
ATOM   10168 C  CB    . LYS D 2 419 ? -10.731 -4.515  33.835 1.00 21.84 ? 420  LYS C CB    1 
ATOM   10169 C  CG    . LYS D 2 419 ? -10.736 -3.312  32.897 1.00 23.14 ? 420  LYS C CG    1 
ATOM   10170 C  CD    . LYS D 2 419 ? -12.001 -2.484  33.114 1.00 23.65 ? 420  LYS C CD    1 
ATOM   10171 C  CE    . LYS D 2 419 ? -12.021 -1.280  32.201 1.00 25.00 ? 420  LYS C CE    1 
ATOM   10172 N  NZ    . LYS D 2 419 ? -13.198 -0.388  32.544 1.00 26.82 ? 420  LYS C NZ    1 
ATOM   10173 N  N     . GLN D 2 420 ? -10.184 -7.442  34.907 1.00 19.54 ? 421  GLN C N     1 
ATOM   10174 C  CA    . GLN D 2 420 ? -10.022 -8.359  36.026 1.00 19.14 ? 421  GLN C CA    1 
ATOM   10175 C  C     . GLN D 2 420 ? -8.702  -9.122  35.941 1.00 17.58 ? 421  GLN C C     1 
ATOM   10176 O  O     . GLN D 2 420 ? -8.013  -9.283  36.935 1.00 18.48 ? 421  GLN C O     1 
ATOM   10177 C  CB    . GLN D 2 420 ? -11.210 -9.319  36.120 1.00 18.97 ? 421  GLN C CB    1 
ATOM   10178 C  CG    . GLN D 2 420 ? -12.411 -8.736  36.843 1.00 18.27 ? 421  GLN C CG    1 
ATOM   10179 C  CD    . GLN D 2 420 ? -13.660 -9.593  36.687 1.00 18.46 ? 421  GLN C CD    1 
ATOM   10180 O  OE1   . GLN D 2 420 ? -13.754 -10.399 35.775 1.00 18.20 ? 421  GLN C OE1   1 
ATOM   10181 N  NE2   . GLN D 2 420 ? -14.620 -9.412  37.574 1.00 16.96 ? 421  GLN C NE2   1 
ATOM   10182 N  N     . ALA D 2 421 ? -8.355  -9.570  34.744 1.00 15.88 ? 422  ALA C N     1 
ATOM   10183 C  CA    . ALA D 2 421 ? -7.120  -10.301 34.526 1.00 16.40 ? 422  ALA C CA    1 
ATOM   10184 C  C     . ALA D 2 421 ? -5.888  -9.445  34.813 1.00 17.38 ? 422  ALA C C     1 
ATOM   10185 O  O     . ALA D 2 421 ? -4.913  -9.924  35.376 1.00 16.37 ? 422  ALA C O     1 
ATOM   10186 C  CB    . ALA D 2 421 ? -7.066  -10.866 33.114 1.00 16.15 ? 422  ALA C CB    1 
ATOM   10187 N  N     . GLN D 2 422 ? -5.942  -8.181  34.417 1.00 17.85 ? 423  GLN C N     1 
ATOM   10188 C  CA    . GLN D 2 422 ? -4.843  -7.263  34.658 1.00 18.63 ? 423  GLN C CA    1 
ATOM   10189 C  C     . GLN D 2 422 ? -4.621  -7.031  36.148 1.00 18.86 ? 423  GLN C C     1 
ATOM   10190 O  O     . GLN D 2 422 ? -3.489  -6.985  36.613 1.00 17.85 ? 423  GLN C O     1 
ATOM   10191 C  CB    . GLN D 2 422 ? -5.090  -5.929  33.954 1.00 19.43 ? 423  GLN C CB    1 
ATOM   10192 C  CG    . GLN D 2 422 ? -4.904  -5.965  32.450 1.00 20.91 ? 423  GLN C CG    1 
ATOM   10193 C  CD    . GLN D 2 422 ? -3.448  -6.062  32.033 1.00 23.71 ? 423  GLN C CD    1 
ATOM   10194 O  OE1   . GLN D 2 422 ? -2.576  -6.441  32.821 1.00 21.80 ? 423  GLN C OE1   1 
ATOM   10195 N  NE2   . GLN D 2 422 ? -3.178  -5.722  30.783 1.00 25.51 ? 423  GLN C NE2   1 
ATOM   10196 N  N     . ALA D 2 423 ? -5.720  -6.897  36.886 1.00 17.86 ? 424  ALA C N     1 
ATOM   10197 C  CA    . ALA D 2 423 ? -5.679  -6.664  38.319 1.00 17.81 ? 424  ALA C CA    1 
ATOM   10198 C  C     . ALA D 2 423 ? -5.031  -7.812  39.083 1.00 20.41 ? 424  ALA C C     1 
ATOM   10199 O  O     . ALA D 2 423 ? -4.291  -7.583  40.033 1.00 22.42 ? 424  ALA C O     1 
ATOM   10200 C  CB    . ALA D 2 423 ? -7.070  -6.387  38.847 1.00 18.57 ? 424  ALA C CB    1 
ATOM   10201 N  N     . ILE D 2 424 ? -5.328  -9.043  38.674 1.00 20.13 ? 425  ILE C N     1 
ATOM   10202 C  CA    . ILE D 2 424 ? -4.751  -10.223 39.297 1.00 18.72 ? 425  ILE C CA    1 
ATOM   10203 C  C     . ILE D 2 424 ? -3.239  -10.271 39.077 1.00 19.87 ? 425  ILE C C     1 
ATOM   10204 O  O     . ILE D 2 424 ? -2.476  -10.585 39.983 1.00 20.46 ? 425  ILE C O     1 
ATOM   10205 C  CB    . ILE D 2 424 ? -5.430  -11.504 38.782 1.00 20.07 ? 425  ILE C CB    1 
ATOM   10206 C  CG1   . ILE D 2 424 ? -6.881  -11.545 39.266 1.00 19.44 ? 425  ILE C CG1   1 
ATOM   10207 C  CG2   . ILE D 2 424 ? -4.686  -12.740 39.250 1.00 19.35 ? 425  ILE C CG2   1 
ATOM   10208 C  CD1   . ILE D 2 424 ? -7.754  -12.523 38.519 1.00 19.48 ? 425  ILE C CD1   1 
ATOM   10209 N  N     . LEU D 2 425 ? -2.823  -9.950  37.856 1.00 20.64 ? 426  LEU C N     1 
ATOM   10210 C  CA    . LEU D 2 425 ? -1.412  -9.901  37.482 1.00 19.06 ? 426  LEU C CA    1 
ATOM   10211 C  C     . LEU D 2 425 ? -0.659  -8.796  38.229 1.00 20.40 ? 426  LEU C C     1 
ATOM   10212 O  O     . LEU D 2 425 ? 0.503   -8.950  38.567 1.00 20.43 ? 426  LEU C O     1 
ATOM   10213 C  CB    . LEU D 2 425 ? -1.246  -9.751  35.970 1.00 19.52 ? 426  LEU C CB    1 
ATOM   10214 C  CG    . LEU D 2 425 ? -1.524  -10.957 35.082 1.00 20.24 ? 426  LEU C CG    1 
ATOM   10215 C  CD1   . LEU D 2 425 ? -1.558  -10.567 33.617 1.00 18.46 ? 426  LEU C CD1   1 
ATOM   10216 C  CD2   . LEU D 2 425 ? -0.507  -12.062 35.320 1.00 20.45 ? 426  LEU C CD2   1 
ATOM   10217 N  N     . ASP D 2 426 ? -1.324  -7.669  38.451 1.00 19.63 ? 427  ASP C N     1 
ATOM   10218 C  CA    . ASP D 2 426 ? -0.709  -6.545  39.146 1.00 19.99 ? 427  ASP C CA    1 
ATOM   10219 C  C     . ASP D 2 426 ? -0.619  -6.782  40.641 1.00 19.97 ? 427  ASP C C     1 
ATOM   10220 O  O     . ASP D 2 426 ? 0.163   -6.153  41.335 1.00 21.34 ? 427  ASP C O     1 
ATOM   10221 C  CB    . ASP D 2 426 ? -1.446  -5.242  38.832 1.00 19.65 ? 427  ASP C CB    1 
ATOM   10222 C  CG    . ASP D 2 426 ? -1.130  -4.721  37.460 1.00 21.75 ? 427  ASP C CG    1 
ATOM   10223 O  OD1   . ASP D 2 426 ? -0.064  -5.095  36.916 1.00 20.51 ? 427  ASP C OD1   1 
ATOM   10224 O  OD2   . ASP D 2 426 ? -1.955  -3.940  36.936 1.00 24.83 ? 427  ASP C OD2   1 
ATOM   10225 N  N     . MET D 2 427 ? -1.434  -7.703  41.118 1.00 20.33 ? 428  MET C N     1 
ATOM   10226 C  CA    . MET D 2 427 ? -1.457  -8.100  42.519 1.00 20.67 ? 428  MET C CA    1 
ATOM   10227 C  C     . MET D 2 427 ? -0.092  -8.547  43.041 1.00 20.14 ? 428  MET C C     1 
ATOM   10228 O  O     . MET D 2 427 ? 0.543   -9.424  42.478 1.00 20.00 ? 428  MET C O     1 
ATOM   10229 C  CB    . MET D 2 427 ? -2.488  -9.211  42.698 1.00 23.25 ? 428  MET C CB    1 
ATOM   10230 C  CG    . MET D 2 427 ? -2.833  -9.565  44.129 1.00 26.20 ? 428  MET C CG    1 
ATOM   10231 S  SD    . MET D 2 427 ? -4.293  -10.631 44.259 1.00 26.92 ? 428  MET C SD    1 
ATOM   10232 C  CE    . MET D 2 427 ? -3.817  -12.024 43.285 1.00 26.70 ? 428  MET C CE    1 
ATOM   10233 N  N     . ARG D 2 428 ? 0.345   -7.967  44.152 1.00 20.70 ? 429  ARG C N     1 
ATOM   10234 C  CA    . ARG D 2 428 ? 1.620   -8.337  44.759 1.00 20.74 ? 429  ARG C CA    1 
ATOM   10235 C  C     . ARG D 2 428 ? 1.469   -9.579  45.618 1.00 20.90 ? 429  ARG C C     1 
ATOM   10236 O  O     . ARG D 2 428 ? 0.357   -9.962  45.986 1.00 24.11 ? 429  ARG C O     1 
ATOM   10237 C  CB    . ARG D 2 428 ? 2.171   -7.193  45.618 1.00 22.99 ? 429  ARG C CB    1 
ATOM   10238 C  CG    . ARG D 2 428 ? 2.337   -5.863  44.889 1.00 24.22 ? 429  ARG C CG    1 
ATOM   10239 C  CD    . ARG D 2 428 ? 2.934   -4.832  45.827 1.00 27.37 ? 429  ARG C CD    1 
ATOM   10240 N  NE    . ARG D 2 428 ? 2.932   -3.481  45.296 1.00 29.60 ? 429  ARG C NE    1 
ATOM   10241 C  CZ    . ARG D 2 428 ? 3.966   -2.940  44.657 1.00 30.81 ? 429  ARG C CZ    1 
ATOM   10242 N  NH1   . ARG D 2 428 ? 5.080   -3.630  44.443 1.00 29.08 ? 429  ARG C NH1   1 
ATOM   10243 N  NH2   . ARG D 2 428 ? 3.904   -1.681  44.235 1.00 30.72 ? 429  ARG C NH2   1 
ATOM   10244 N  N     . LEU D 2 429 ? 2.584   -10.219 45.933 1.00 18.38 ? 430  LEU C N     1 
ATOM   10245 C  CA    . LEU D 2 429 ? 2.590   -11.439 46.745 1.00 18.39 ? 430  LEU C CA    1 
ATOM   10246 C  C     . LEU D 2 429 ? 2.068   -11.230 48.161 1.00 18.79 ? 430  LEU C C     1 
ATOM   10247 O  O     . LEU D 2 429 ? 1.449   -12.113 48.731 1.00 17.25 ? 430  LEU C O     1 
ATOM   10248 C  CB    . LEU D 2 429 ? 3.979   -12.072 46.763 1.00 18.24 ? 430  LEU C CB    1 
ATOM   10249 C  CG    . LEU D 2 429 ? 4.387   -12.757 45.456 1.00 17.68 ? 430  LEU C CG    1 
ATOM   10250 C  CD1   . LEU D 2 429 ? 5.662   -13.549 45.614 1.00 16.99 ? 430  LEU C CD1   1 
ATOM   10251 C  CD2   . LEU D 2 429 ? 3.287   -13.656 44.962 1.00 18.85 ? 430  LEU C CD2   1 
ATOM   10252 N  N     . ARG D 2 430 ? 2.335   -10.045 48.713 1.00 20.19 ? 431  ARG C N     1 
ATOM   10253 C  CA    . ARG D 2 430 ? 1.928   -9.694  50.066 1.00 20.79 ? 431  ARG C CA    1 
ATOM   10254 C  C     . ARG D 2 430 ? 0.408   -9.688  50.247 1.00 22.28 ? 431  ARG C C     1 
ATOM   10255 O  O     . ARG D 2 430 ? -0.075  -9.793  51.361 1.00 23.79 ? 431  ARG C O     1 
ATOM   10256 C  CB    . ARG D 2 430 ? 2.563   -8.378  50.510 1.00 20.22 ? 431  ARG C CB    1 
ATOM   10257 C  CG    . ARG D 2 430 ? 2.174   -7.165  49.690 1.00 21.80 ? 431  ARG C CG    1 
ATOM   10258 N  N     . ARG D 2 431 ? -0.329  -9.563  49.151 1.00 23.48 ? 432  ARG C N     1 
ATOM   10259 C  CA    . ARG D 2 431 ? -1.785  -9.579  49.179 1.00 24.19 ? 432  ARG C CA    1 
ATOM   10260 C  C     . ARG D 2 431 ? -2.295  -10.944 49.664 1.00 23.20 ? 432  ARG C C     1 
ATOM   10261 O  O     . ARG D 2 431 ? -3.427  -11.075 50.099 1.00 25.53 ? 432  ARG C O     1 
ATOM   10262 C  CB    . ARG D 2 431 ? -2.385  -9.266  47.806 1.00 26.72 ? 432  ARG C CB    1 
ATOM   10263 C  CG    . ARG D 2 431 ? -1.987  -7.930  47.198 1.00 29.89 ? 432  ARG C CG    1 
ATOM   10264 C  CD    . ARG D 2 431 ? -2.491  -6.744  47.999 1.00 32.90 ? 432  ARG C CD    1 
ATOM   10265 N  NE    . ARG D 2 431 ? -3.910  -6.476  47.819 1.00 37.68 ? 432  ARG C NE    1 
ATOM   10266 C  CZ    . ARG D 2 431 ? -4.432  -5.852  46.762 1.00 38.50 ? 432  ARG C CZ    1 
ATOM   10267 N  NH1   . ARG D 2 431 ? -3.660  -5.441  45.766 1.00 36.50 ? 432  ARG C NH1   1 
ATOM   10268 N  NH2   . ARG D 2 431 ? -5.739  -5.642  46.706 1.00 39.37 ? 432  ARG C NH2   1 
ATOM   10269 N  N     . LEU D 2 432 ? -1.457  -11.962 49.545 1.00 22.11 ? 433  LEU C N     1 
ATOM   10270 C  CA    . LEU D 2 432 ? -1.796  -13.321 49.959 1.00 21.61 ? 433  LEU C CA    1 
ATOM   10271 C  C     . LEU D 2 432 ? -1.833  -13.638 51.473 1.00 22.81 ? 433  LEU C C     1 
ATOM   10272 O  O     . LEU D 2 432 ? -2.314  -14.698 51.856 1.00 22.42 ? 433  LEU C O     1 
ATOM   10273 C  CB    . LEU D 2 432 ? -0.935  -14.335 49.207 1.00 21.70 ? 433  LEU C CB    1 
ATOM   10274 C  CG    . LEU D 2 432 ? -1.085  -14.246 47.693 1.00 21.78 ? 433  LEU C CG    1 
ATOM   10275 C  CD1   . LEU D 2 432 ? -0.139  -15.198 46.981 1.00 21.99 ? 433  LEU C CD1   1 
ATOM   10276 C  CD2   . LEU D 2 432 ? -2.520  -14.498 47.277 1.00 21.97 ? 433  LEU C CD2   1 
ATOM   10277 N  N     . THR D 2 433 ? -1.317  -12.747 52.316 1.00 23.94 ? 434  THR C N     1 
ATOM   10278 C  CA    . THR D 2 433 ? -1.323  -12.974 53.767 1.00 24.70 ? 434  THR C CA    1 
ATOM   10279 C  C     . THR D 2 433 ? -2.736  -12.971 54.378 1.00 26.34 ? 434  THR C C     1 
ATOM   10280 O  O     . THR D 2 433 ? -3.661  -12.432 53.793 1.00 28.64 ? 434  THR C O     1 
ATOM   10281 C  CB    . THR D 2 433 ? -0.437  -11.958 54.521 1.00 24.54 ? 434  THR C CB    1 
ATOM   10282 O  OG1   . THR D 2 433 ? -0.973  -10.637 54.382 1.00 25.81 ? 434  THR C OG1   1 
ATOM   10283 C  CG2   . THR D 2 433 ? 0.965   -11.981 53.997 1.00 22.52 ? 434  THR C CG2   1 
ATOM   10284 N  N     . GLY D 2 434 ? -2.885  -13.576 55.557 1.00 27.28 ? 435  GLY C N     1 
ATOM   10285 C  CA    . GLY D 2 434 ? -4.173  -13.659 56.237 1.00 27.09 ? 435  GLY C CA    1 
ATOM   10286 C  C     . GLY D 2 434 ? -4.964  -12.362 56.257 1.00 28.30 ? 435  GLY C C     1 
ATOM   10287 O  O     . GLY D 2 434 ? -6.090  -12.310 55.754 1.00 30.58 ? 435  GLY C O     1 
ATOM   10288 N  N     . LEU D 2 435 ? -4.370  -11.313 56.820 1.00 29.27 ? 436  LEU C N     1 
ATOM   10289 C  CA    . LEU D 2 435 ? -5.040  -10.013 56.918 1.00 33.11 ? 436  LEU C CA    1 
ATOM   10290 C  C     . LEU D 2 435 ? -5.392  -9.368  55.581 1.00 33.57 ? 436  LEU C C     1 
ATOM   10291 O  O     . LEU D 2 435 ? -6.429  -8.710  55.474 1.00 37.00 ? 436  LEU C O     1 
ATOM   10292 C  CB    . LEU D 2 435 ? -4.219  -9.031  57.777 1.00 35.28 ? 436  LEU C CB    1 
ATOM   10293 C  CG    . LEU D 2 435 ? -4.337  -9.039  59.309 1.00 38.02 ? 436  LEU C CG    1 
ATOM   10294 C  CD1   . LEU D 2 435 ? -4.150  -10.412 59.963 1.00 39.13 ? 436  LEU C CD1   1 
ATOM   10295 C  CD2   . LEU D 2 435 ? -3.334  -8.031  59.889 1.00 39.93 ? 436  LEU C CD2   1 
ATOM   10296 N  N     . GLU D 2 436 ? -4.537  -9.544  54.575 1.00 31.43 ? 437  GLU C N     1 
ATOM   10297 C  CA    . GLU D 2 436 ? -4.746  -8.966  53.243 1.00 28.78 ? 437  GLU C CA    1 
ATOM   10298 C  C     . GLU D 2 436 ? -5.886  -9.620  52.482 1.00 28.29 ? 437  GLU C C     1 
ATOM   10299 O  O     . GLU D 2 436 ? -6.633  -8.955  51.774 1.00 31.31 ? 437  GLU C O     1 
ATOM   10300 C  CB    . GLU D 2 436 ? -3.464  -9.028  52.409 1.00 28.38 ? 437  GLU C CB    1 
ATOM   10301 C  CG    . GLU D 2 436 ? -2.395  -8.034  52.823 1.00 27.48 ? 437  GLU C CG    1 
ATOM   10302 C  CD    . GLU D 2 436 ? -2.942  -6.639  53.037 1.00 26.48 ? 437  GLU C CD    1 
ATOM   10303 O  OE1   . GLU D 2 436 ? -2.697  -6.074  54.117 1.00 27.10 ? 437  GLU C OE1   1 
ATOM   10304 O  OE2   . GLU D 2 436 ? -3.616  -6.108  52.137 1.00 24.70 ? 437  GLU C OE2   1 
ATOM   10305 N  N     . ARG D 2 437 ? -6.004  -10.929 52.624 1.00 28.70 ? 438  ARG C N     1 
ATOM   10306 C  CA    . ARG D 2 437 ? -7.080  -11.702 52.002 1.00 28.26 ? 438  ARG C CA    1 
ATOM   10307 C  C     . ARG D 2 437 ? -8.424  -11.314 52.596 1.00 26.74 ? 438  ARG C C     1 
ATOM   10308 O  O     . ARG D 2 437 ? -9.444  -11.329 51.903 1.00 27.24 ? 438  ARG C O     1 
ATOM   10309 C  CB    . ARG D 2 437 ? -6.833  -13.193 52.212 1.00 29.32 ? 438  ARG C CB    1 
ATOM   10310 C  CG    . ARG D 2 437 ? -5.887  -13.817 51.205 1.00 31.26 ? 438  ARG C CG    1 
ATOM   10311 C  CD    . ARG D 2 437 ? -5.135  -14.986 51.808 1.00 30.86 ? 438  ARG C CD    1 
ATOM   10312 N  NE    . ARG D 2 437 ? -5.990  -15.957 52.488 1.00 30.02 ? 438  ARG C NE    1 
ATOM   10313 C  CZ    . ARG D 2 437 ? -5.548  -16.823 53.403 1.00 32.65 ? 438  ARG C CZ    1 
ATOM   10314 N  NH1   . ARG D 2 437 ? -6.371  -17.662 53.991 1.00 37.35 ? 438  ARG C NH1   1 
ATOM   10315 N  NH2   . ARG D 2 437 ? -4.271  -16.845 53.739 1.00 34.02 ? 438  ARG C NH2   1 
ATOM   10316 N  N     . ASP D 2 438 ? -8.411  -10.965 53.883 1.00 26.25 ? 439  ASP C N     1 
ATOM   10317 C  CA    . ASP D 2 438 ? -9.612  -10.567 54.615 1.00 27.41 ? 439  ASP C CA    1 
ATOM   10318 C  C     . ASP D 2 438 ? -10.026 -9.140  54.282 1.00 26.96 ? 439  ASP C C     1 
ATOM   10319 O  O     . ASP D 2 438 ? -11.193 -8.778  54.442 1.00 28.64 ? 439  ASP C O     1 
ATOM   10320 C  CB    . ASP D 2 438 ? -9.408  -10.728 56.125 1.00 30.57 ? 439  ASP C CB    1 
ATOM   10321 C  CG    . ASP D 2 438 ? -9.191  -12.183 56.543 1.00 31.22 ? 439  ASP C CG    1 
ATOM   10322 O  OD1   . ASP D 2 438 ? -9.727  -13.100 55.876 1.00 31.70 ? 439  ASP C OD1   1 
ATOM   10323 O  OD2   . ASP D 2 438 ? -8.494  -12.399 57.559 1.00 32.54 ? 439  ASP C OD2   1 
ATOM   10324 N  N     . LYS D 2 439 ? -9.067  -8.338  53.817 1.00 26.37 ? 440  LYS C N     1 
ATOM   10325 C  CA    . LYS D 2 439 ? -9.337  -6.951  53.425 1.00 24.51 ? 440  LYS C CA    1 
ATOM   10326 C  C     . LYS D 2 439 ? -10.100 -6.893  52.105 1.00 22.93 ? 440  LYS C C     1 
ATOM   10327 O  O     . LYS D 2 439 ? -11.016 -6.092  51.955 1.00 21.10 ? 440  LYS C O     1 
ATOM   10328 C  CB    . LYS D 2 439 ? -8.045  -6.135  53.339 1.00 27.21 ? 440  LYS C CB    1 
ATOM   10329 C  CG    . LYS D 2 439 ? -7.462  -5.779  54.706 1.00 30.25 ? 440  LYS C CG    1 
ATOM   10330 C  CD    . LYS D 2 439 ? -6.063  -5.160  54.605 1.00 31.85 ? 440  LYS C CD    1 
ATOM   10331 C  CE    . LYS D 2 439 ? -6.056  -3.833  53.871 1.00 32.48 ? 440  LYS C CE    1 
ATOM   10332 N  NZ    . LYS D 2 439 ? -4.658  -3.343  53.661 1.00 32.41 ? 440  LYS C NZ    1 
ATOM   10333 N  N     . ILE D 2 440 ? -9.724  -7.755  51.164 1.00 21.95 ? 441  ILE C N     1 
ATOM   10334 C  CA    . ILE D 2 440 ? -10.375 -7.818  49.856 1.00 21.66 ? 441  ILE C CA    1 
ATOM   10335 C  C     . ILE D 2 440 ? -11.854 -8.191  50.000 1.00 22.72 ? 441  ILE C C     1 
ATOM   10336 O  O     . ILE D 2 440 ? -12.709 -7.635  49.308 1.00 23.73 ? 441  ILE C O     1 
ATOM   10337 C  CB    . ILE D 2 440 ? -9.629  -8.770  48.885 1.00 19.75 ? 441  ILE C CB    1 
ATOM   10338 C  CG1   . ILE D 2 440 ? -8.231  -8.212  48.593 1.00 19.22 ? 441  ILE C CG1   1 
ATOM   10339 C  CG2   . ILE D 2 440 ? -10.413 -8.958  47.582 1.00 21.03 ? 441  ILE C CG2   1 
ATOM   10340 C  CD1   . ILE D 2 440 ? -7.330  -9.111  47.745 1.00 17.96 ? 441  ILE C CD1   1 
ATOM   10341 N  N     . GLU D 2 441 ? -12.133 -9.121  50.909 1.00 23.13 ? 442  GLU C N     1 
ATOM   10342 C  CA    . GLU D 2 441 ? -13.494 -9.567  51.203 1.00 22.05 ? 442  GLU C CA    1 
ATOM   10343 C  C     . GLU D 2 441 ? -14.268 -8.487  51.958 1.00 22.53 ? 442  GLU C C     1 
ATOM   10344 O  O     . GLU D 2 441 ? -15.402 -8.164  51.589 1.00 22.72 ? 442  GLU C O     1 
ATOM   10345 C  CB    . GLU D 2 441 ? -13.468 -10.887 51.997 1.00 23.54 ? 442  GLU C CB    1 
ATOM   10346 C  CG    . GLU D 2 441 ? -14.824 -11.384 52.528 1.00 25.71 ? 442  GLU C CG    1 
ATOM   10347 C  CD    . GLU D 2 441 ? -15.833 -11.790 51.448 1.00 25.66 ? 442  GLU C CD    1 
ATOM   10348 O  OE1   . GLU D 2 441 ? -15.456 -11.977 50.277 1.00 25.94 ? 442  GLU C OE1   1 
ATOM   10349 O  OE2   . GLU D 2 441 ? -17.026 -11.934 51.771 1.00 24.55 ? 442  GLU C OE2   1 
ATOM   10350 N  N     . ALA D 2 442 ? -13.650 -7.930  53.006 1.00 20.11 ? 443  ALA C N     1 
ATOM   10351 C  CA    . ALA D 2 442 ? -14.270 -6.880  53.822 1.00 20.10 ? 443  ALA C CA    1 
ATOM   10352 C  C     . ALA D 2 442 ? -14.680 -5.669  52.982 1.00 20.93 ? 443  ALA C C     1 
ATOM   10353 O  O     . ALA D 2 442 ? -15.790 -5.151  53.136 1.00 23.11 ? 443  ALA C O     1 
ATOM   10354 C  CB    . ALA D 2 442 ? -13.349 -6.455  54.968 1.00 19.04 ? 443  ALA C CB    1 
ATOM   10355 N  N     . GLU D 2 443 ? -13.796 -5.236  52.084 1.00 20.44 ? 444  GLU C N     1 
ATOM   10356 C  CA    . GLU D 2 443 ? -14.067 -4.092  51.219 1.00 20.21 ? 444  GLU C CA    1 
ATOM   10357 C  C     . GLU D 2 443 ? -15.254 -4.365  50.281 1.00 21.75 ? 444  GLU C C     1 
ATOM   10358 O  O     . GLU D 2 443 ? -16.125 -3.499  50.101 1.00 21.56 ? 444  GLU C O     1 
ATOM   10359 C  CB    . GLU D 2 443 ? -12.815 -3.682  50.434 1.00 18.23 ? 444  GLU C CB    1 
ATOM   10360 C  CG    . GLU D 2 443 ? -13.010 -2.457  49.534 1.00 20.77 ? 444  GLU C CG    1 
ATOM   10361 C  CD    . GLU D 2 443 ? -11.799 -2.117  48.670 1.00 21.46 ? 444  GLU C CD    1 
ATOM   10362 O  OE1   . GLU D 2 443 ? -11.937 -1.252  47.785 1.00 20.75 ? 444  GLU C OE1   1 
ATOM   10363 O  OE2   . GLU D 2 443 ? -10.711 -2.714  48.868 1.00 21.69 ? 444  GLU C OE2   1 
ATOM   10364 N  N     . TYR D 2 444 ? -15.296 -5.572  49.708 1.00 19.67 ? 445  TYR C N     1 
ATOM   10365 C  CA    . TYR D 2 44