data_5IXG
# 
_entry.id   5IXG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5IXG         
WWPDB D_1000219573 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          5IXH 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5IXG 
_pdbx_database_status.recvd_initial_deposition_date   2016-03-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Loutet, S.A.'   1 ? 
'Murphy, M.E.P.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            MBio 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2150-7511 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            8 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Antibiotic Capture by Bacterial Lipocalins Uncovers an Extracellular Mechanism of Intrinsic Antibiotic Resistance.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1128/mBio.00225-17 
_citation.pdbx_database_id_PubMed   28292982 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'El-Halfawy, O.M.'      1 ? 
primary 'Klett, J.'             2 ? 
primary 'Ingram, R.J.'          3 ? 
primary 'Loutet, S.A.'          4 ? 
primary 'Murphy, M.E.'          5 ? 
primary 'Martin-Santamaria, S.' 6 ? 
primary 'Valvano, M.A.'         7 ? 
# 
_cell.entry_id           5IXG 
_cell.length_a           51.160 
_cell.length_b           101.170 
_cell.length_c           63.490 
_cell.angle_alpha        90.00 
_cell.angle_beta         97.20 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5IXG 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man YceI 18557.992 4   ? ? ? ? 
2 non-polymer syn 
'(2E,6E,10E,14E,18E,22E,26E)-3,7,11,15,19,23,27,31-OCTAMETHYLDOTRIACONTA-2,6,10,14,18,22,26,30-OCTAENYL TRIHYDROGEN DIPHOSPHATE' 
722.911   4   ? ? ? ? 
3 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120   1   ? ? ? ? 
4 water       nat water 18.015    482 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SATYQFDPSHTYPSFEADHFGGLSVWRGKFDKSSGTVTLDRAAKTGTVDVTTDIASIHTGSAKLDEHLQTAEFFDAAKFP
QANYKGTIKFDGDKPVSVVGNLTLHGVTKPLTLKIDSFKCMPHPMLKREVCGVDAVGEFSRDDFGLDYGKQYGFKMKTKL
LITAEAVKQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SATYQFDPSHTYPSFEADHFGGLSVWRGKFDKSSGTVTLDRAAKTGTVDVTTDIASIHTGSAKLDEHLQTAEFFDAAKFP
QANYKGTIKFDGDKPVSVVGNLTLHGVTKPLTLKIDSFKCMPHPMLKREVCGVDAVGEFSRDDFGLDYGKQYGFKMKTKL
LITAEAVKQ
;
_entity_poly.pdbx_strand_id                 B,C,A,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ALA n 
1 3   THR n 
1 4   TYR n 
1 5   GLN n 
1 6   PHE n 
1 7   ASP n 
1 8   PRO n 
1 9   SER n 
1 10  HIS n 
1 11  THR n 
1 12  TYR n 
1 13  PRO n 
1 14  SER n 
1 15  PHE n 
1 16  GLU n 
1 17  ALA n 
1 18  ASP n 
1 19  HIS n 
1 20  PHE n 
1 21  GLY n 
1 22  GLY n 
1 23  LEU n 
1 24  SER n 
1 25  VAL n 
1 26  TRP n 
1 27  ARG n 
1 28  GLY n 
1 29  LYS n 
1 30  PHE n 
1 31  ASP n 
1 32  LYS n 
1 33  SER n 
1 34  SER n 
1 35  GLY n 
1 36  THR n 
1 37  VAL n 
1 38  THR n 
1 39  LEU n 
1 40  ASP n 
1 41  ARG n 
1 42  ALA n 
1 43  ALA n 
1 44  LYS n 
1 45  THR n 
1 46  GLY n 
1 47  THR n 
1 48  VAL n 
1 49  ASP n 
1 50  VAL n 
1 51  THR n 
1 52  THR n 
1 53  ASP n 
1 54  ILE n 
1 55  ALA n 
1 56  SER n 
1 57  ILE n 
1 58  HIS n 
1 59  THR n 
1 60  GLY n 
1 61  SER n 
1 62  ALA n 
1 63  LYS n 
1 64  LEU n 
1 65  ASP n 
1 66  GLU n 
1 67  HIS n 
1 68  LEU n 
1 69  GLN n 
1 70  THR n 
1 71  ALA n 
1 72  GLU n 
1 73  PHE n 
1 74  PHE n 
1 75  ASP n 
1 76  ALA n 
1 77  ALA n 
1 78  LYS n 
1 79  PHE n 
1 80  PRO n 
1 81  GLN n 
1 82  ALA n 
1 83  ASN n 
1 84  TYR n 
1 85  LYS n 
1 86  GLY n 
1 87  THR n 
1 88  ILE n 
1 89  LYS n 
1 90  PHE n 
1 91  ASP n 
1 92  GLY n 
1 93  ASP n 
1 94  LYS n 
1 95  PRO n 
1 96  VAL n 
1 97  SER n 
1 98  VAL n 
1 99  VAL n 
1 100 GLY n 
1 101 ASN n 
1 102 LEU n 
1 103 THR n 
1 104 LEU n 
1 105 HIS n 
1 106 GLY n 
1 107 VAL n 
1 108 THR n 
1 109 LYS n 
1 110 PRO n 
1 111 LEU n 
1 112 THR n 
1 113 LEU n 
1 114 LYS n 
1 115 ILE n 
1 116 ASP n 
1 117 SER n 
1 118 PHE n 
1 119 LYS n 
1 120 CYS n 
1 121 MET n 
1 122 PRO n 
1 123 HIS n 
1 124 PRO n 
1 125 MET n 
1 126 LEU n 
1 127 LYS n 
1 128 ARG n 
1 129 GLU n 
1 130 VAL n 
1 131 CYS n 
1 132 GLY n 
1 133 VAL n 
1 134 ASP n 
1 135 ALA n 
1 136 VAL n 
1 137 GLY n 
1 138 GLU n 
1 139 PHE n 
1 140 SER n 
1 141 ARG n 
1 142 ASP n 
1 143 ASP n 
1 144 PHE n 
1 145 GLY n 
1 146 LEU n 
1 147 ASP n 
1 148 TYR n 
1 149 GLY n 
1 150 LYS n 
1 151 GLN n 
1 152 TYR n 
1 153 GLY n 
1 154 PHE n 
1 155 LYS n 
1 156 MET n 
1 157 LYS n 
1 158 THR n 
1 159 LYS n 
1 160 LEU n 
1 161 LEU n 
1 162 ILE n 
1 163 THR n 
1 164 ALA n 
1 165 GLU n 
1 166 ALA n 
1 167 VAL n 
1 168 LYS n 
1 169 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   169 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 BCPG_01022 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Burkholderia cenocepacia PC184' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     350702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    A2VST2_9BURK 
_struct_ref.pdbx_db_accession          A2VST2 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SATYQFDPSHTYPSFEADHFGGLSVWRGKFDKSSGTVTLDRAAKTGTVDVTTDIASIHTGSAKLDEHLQTAEFFDAAKFP
QANYKGTIKFDGDKPVSVVGNLTLHGVTKPLTLKIDSFKCMPHPMLKREVCGVDAVGEFSRDDFGLDYGKQYGFKMKTKL
LITAEAVKQ
;
_struct_ref.pdbx_align_begin           24 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5IXG A 1 ? 169 ? A2VST2 24 ? 192 ? 6 174 
2 1 5IXG B 1 ? 169 ? A2VST2 24 ? 192 ? 6 174 
3 1 5IXG C 1 ? 169 ? A2VST2 24 ? 192 ? 6 174 
4 1 5IXG D 1 ? 169 ? A2VST2 24 ? 192 ? 6 174 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                          'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ?                          'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                          'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                          'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE ?                          'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                          'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                          'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ?                          'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ?                          'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ?                          'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                          'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ?                          'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ?                          'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ?                          'C5 H11 N O2 S'  149.211 
OTP non-polymer         . 
'(2E,6E,10E,14E,18E,22E,26E)-3,7,11,15,19,23,27,31-OCTAMETHYLDOTRIACONTA-2,6,10,14,18,22,26,30-OCTAENYL TRIHYDROGEN DIPHOSPHATE' 
'OCTAPRENYL PYROPHOSPHATE' 'C40 H68 O7 P2'  722.911 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER' ?                          'C4 H10 O3'      106.120 
PHE 'L-peptide linking' y PHENYLALANINE ?                          'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ?                          'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ?                          'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ?                          'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                          'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ?                          'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ?                          'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5IXG 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.20 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         43.99 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'HEPES, PEG 6000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300HE' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-06-11 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97949 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97949 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
_diffrn_source.pdbx_synchrotron_site       CLSI 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5IXG 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.600 
_reflns.d_resolution_low                 37.33 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       82019 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.300 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.800 
_reflns.pdbx_Rmerge_I_obs                0.061 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.300 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.997 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.600 1.630  ? ? ? ? ? 3495 ? 78.700 ? ? ? ? 0.298 ? ? ? ? ? ? ? ? 3.100 ? ? ? ? ? ? ? 1 1 ? ? 
8.470 37.300 ? ? ? ? ? ?    ? 70.200 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 3.200 ? ? ? ? ? ? ? 2 1 ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5IXG 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     77882 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             37.33 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    97.21 
_refine.ls_R_factor_obs                          0.16189 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16017 
_refine.ls_R_factor_R_free                       0.19448 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4090 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.967 
_refine.correlation_coeff_Fo_to_Fc_free          0.952 
_refine.B_iso_mean                               22.251 
_refine.aniso_B[1][1]                            -1.19 
_refine.aniso_B[2][2]                            0.65 
_refine.aniso_B[3][3]                            0.52 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.07 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1WUB 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.087 
_refine.pdbx_overall_ESU_R_Free                  0.088 
_refine.overall_SU_ML                            0.053 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.263 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        5218 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         203 
_refine_hist.number_atoms_solvent             482 
_refine_hist.number_atoms_total               5903 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        37.33 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.024  0.019  ? 5623  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 5376  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.391  1.984  ? 7594  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.950  3.002  ? 12429 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.471  5.000  ? 689   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       31.021 24.254 ? 228   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.027 15.000 ? 923   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       14.176 15.000 ? 17    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.143  0.200  ? 805   'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.012  0.021  ? 6284  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1263  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.860  1.354  ? 2735  'X-RAY DIFFRACTION' ? 
r_mcbond_other               1.860  1.353  ? 2734  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.812  2.025  ? 3425  'X-RAY DIFFRACTION' ? 
r_mcangle_other              2.812  2.026  ? 3426  'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.465  1.906  ? 2888  'X-RAY DIFFRACTION' ? 
r_scbond_other               3.465  1.907  ? 2889  'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              5.227  2.678  ? 4164  'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       7.044  13.034 ? 6346  'X-RAY DIFFRACTION' ? 
r_long_range_B_other         7.032  12.980 ? 6319  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.600 
_refine_ls_shell.d_res_low                        1.642 
_refine_ls_shell.number_reflns_R_work             4728 
_refine_ls_shell.R_factor_R_work                  0.187 
_refine_ls_shell.percent_reflns_obs               80.39 
_refine_ls_shell.R_factor_R_free                  0.244 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             252 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     5IXG 
_struct.title                        'Crystal Structure of Burkholderia cenocepacia BcnB' 
_struct.pdbx_descriptor              YceI 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5IXG 
_struct_keywords.text            'beta barrel lipocalin, UNKNOWN FUNCTION' 
_struct_keywords.pdbx_keywords   'UNKNOWN FUNCTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 8   ? THR A 11  ? PRO B 13  THR B 16  5 ? 4  
HELX_P HELX_P2  AA2 SER A 61  ? GLN A 69  ? SER B 66  GLN B 74  1 ? 9  
HELX_P HELX_P3  AA3 ASP A 142 ? GLY A 145 ? ASP B 147 GLY B 150 5 ? 4  
HELX_P HELX_P4  AA4 GLY A 149 ? GLY A 153 ? GLY B 154 GLY B 158 5 ? 5  
HELX_P HELX_P5  AA5 PRO B 8   ? THR B 11  ? PRO C 13  THR C 16  5 ? 4  
HELX_P HELX_P6  AA6 SER B 61  ? THR B 70  ? SER C 66  THR C 75  1 ? 10 
HELX_P HELX_P7  AA7 ASP B 142 ? GLY B 145 ? ASP C 147 GLY C 150 5 ? 4  
HELX_P HELX_P8  AA8 GLY B 149 ? GLY B 153 ? GLY C 154 GLY C 158 5 ? 5  
HELX_P HELX_P9  AA9 PRO C 8   ? THR C 11  ? PRO A 13  THR A 16  5 ? 4  
HELX_P HELX_P10 AB1 SER C 61  ? THR C 70  ? SER A 66  THR A 75  1 ? 10 
HELX_P HELX_P11 AB2 ASP C 142 ? GLY C 145 ? ASP A 147 GLY A 150 5 ? 4  
HELX_P HELX_P12 AB3 GLY C 149 ? GLY C 153 ? GLY A 154 GLY A 158 5 ? 5  
HELX_P HELX_P13 AB4 PRO D 8   ? THR D 11  ? PRO D 13  THR D 16  5 ? 4  
HELX_P HELX_P14 AB5 SER D 61  ? LEU D 68  ? SER D 66  LEU D 73  1 ? 8  
HELX_P HELX_P15 AB6 ASP D 142 ? GLY D 145 ? ASP D 147 GLY D 150 5 ? 4  
HELX_P HELX_P16 AB7 GLY D 149 ? GLY D 153 ? GLY D 154 GLY D 158 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 120 SG ? ? ? 1_555 A CYS 131 SG ? ? B CYS 125 B CYS 136 1_555 ? ? ? ? ? ? ? 2.162 ? 
disulf2 disulf ? ? B CYS 120 SG ? ? ? 1_555 B CYS 131 SG B ? C CYS 125 C CYS 136 1_555 ? ? ? ? ? ? ? 2.126 ? 
disulf3 disulf ? ? B CYS 120 SG ? ? ? 1_555 B CYS 131 SG A ? C CYS 125 C CYS 136 1_555 ? ? ? ? ? ? ? 2.072 ? 
disulf4 disulf ? ? C CYS 120 SG ? ? ? 1_555 C CYS 131 SG ? ? A CYS 125 A CYS 136 1_555 ? ? ? ? ? ? ? 2.129 ? 
disulf5 disulf ? ? D CYS 120 SG ? ? ? 1_555 D CYS 131 SG A ? D CYS 125 D CYS 136 1_555 ? ? ? ? ? ? ? 2.068 ? 
disulf6 disulf ? ? D CYS 120 SG ? ? ? 1_555 D CYS 131 SG B ? D CYS 125 D CYS 136 1_555 ? ? ? ? ? ? ? 2.059 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 12 ? 
AA2 ? 12 ? 
AA3 ? 12 ? 
AA4 ? 12 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA1 3  4  ? anti-parallel 
AA1 4  5  ? anti-parallel 
AA1 5  6  ? anti-parallel 
AA1 6  7  ? anti-parallel 
AA1 7  8  ? anti-parallel 
AA1 8  9  ? anti-parallel 
AA1 9  10 ? anti-parallel 
AA1 10 11 ? anti-parallel 
AA1 11 12 ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? anti-parallel 
AA2 5  6  ? anti-parallel 
AA2 6  7  ? anti-parallel 
AA2 7  8  ? anti-parallel 
AA2 8  9  ? anti-parallel 
AA2 9  10 ? anti-parallel 
AA2 10 11 ? anti-parallel 
AA2 11 12 ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA3 2  3  ? anti-parallel 
AA3 3  4  ? anti-parallel 
AA3 4  5  ? anti-parallel 
AA3 5  6  ? anti-parallel 
AA3 6  7  ? anti-parallel 
AA3 7  8  ? anti-parallel 
AA3 8  9  ? anti-parallel 
AA3 9  10 ? anti-parallel 
AA3 10 11 ? anti-parallel 
AA3 11 12 ? anti-parallel 
AA4 1  2  ? anti-parallel 
AA4 2  3  ? anti-parallel 
AA4 3  4  ? anti-parallel 
AA4 4  5  ? anti-parallel 
AA4 5  6  ? anti-parallel 
AA4 6  7  ? anti-parallel 
AA4 7  8  ? anti-parallel 
AA4 8  9  ? anti-parallel 
AA4 9  10 ? anti-parallel 
AA4 10 11 ? anti-parallel 
AA4 11 12 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  ILE A 57  ? HIS A 58  ? ILE B 62  HIS B 63  
AA1 2  SER A 24  ? PHE A 30  ? SER B 29  PHE B 35  
AA1 3  TYR A 12  ? HIS A 19  ? TYR B 17  HIS B 24  
AA1 4  LYS A 157 ? LYS A 168 ? LYS B 162 LYS B 173 
AA1 5  GLU A 129 ? SER A 140 ? GLU B 134 SER B 145 
AA1 6  VAL A 107 ? PRO A 122 ? VAL B 112 PRO B 127 
AA1 7  LYS A 94  ? LEU A 104 ? LYS B 99  LEU B 109 
AA1 8  GLN A 81  ? ASP A 91  ? GLN B 86  ASP B 96  
AA1 9  THR A 45  ? ASP A 53  ? THR B 50  ASP B 58  
AA1 10 SER A 33  ? ASP A 40  ? SER B 38  ASP B 45  
AA1 11 ALA A 2   ? PHE A 6   ? ALA B 7   PHE B 11  
AA1 12 LYS A 157 ? LYS A 168 ? LYS B 162 LYS B 173 
AA2 1  ILE B 57  ? HIS B 58  ? ILE C 62  HIS C 63  
AA2 2  SER B 24  ? PHE B 30  ? SER C 29  PHE C 35  
AA2 3  TYR B 12  ? HIS B 19  ? TYR C 17  HIS C 24  
AA2 4  LYS B 157 ? LYS B 168 ? LYS C 162 LYS C 173 
AA2 5  GLU B 129 ? SER B 140 ? GLU C 134 SER C 145 
AA2 6  VAL B 107 ? PRO B 122 ? VAL C 112 PRO C 127 
AA2 7  LYS B 94  ? LEU B 104 ? LYS C 99  LEU C 109 
AA2 8  GLN B 81  ? ASP B 91  ? GLN C 86  ASP C 96  
AA2 9  THR B 45  ? ASP B 53  ? THR C 50  ASP C 58  
AA2 10 SER B 33  ? ASP B 40  ? SER C 38  ASP C 45  
AA2 11 ALA B 2   ? PHE B 6   ? ALA C 7   PHE C 11  
AA2 12 LYS B 157 ? LYS B 168 ? LYS C 162 LYS C 173 
AA3 1  ILE C 57  ? HIS C 58  ? ILE A 62  HIS A 63  
AA3 2  SER C 24  ? PHE C 30  ? SER A 29  PHE A 35  
AA3 3  TYR C 12  ? HIS C 19  ? TYR A 17  HIS A 24  
AA3 4  LYS C 157 ? LYS C 168 ? LYS A 162 LYS A 173 
AA3 5  GLU C 129 ? SER C 140 ? GLU A 134 SER A 145 
AA3 6  VAL C 107 ? PRO C 122 ? VAL A 112 PRO A 127 
AA3 7  LYS C 94  ? LEU C 104 ? LYS A 99  LEU A 109 
AA3 8  GLN C 81  ? ASP C 91  ? GLN A 86  ASP A 96  
AA3 9  THR C 45  ? ASP C 53  ? THR A 50  ASP A 58  
AA3 10 SER C 33  ? ASP C 40  ? SER A 38  ASP A 45  
AA3 11 THR C 3   ? PHE C 6   ? THR A 8   PHE A 11  
AA3 12 LYS C 157 ? LYS C 168 ? LYS A 162 LYS A 173 
AA4 1  ILE D 57  ? HIS D 58  ? ILE D 62  HIS D 63  
AA4 2  SER D 24  ? PHE D 30  ? SER D 29  PHE D 35  
AA4 3  TYR D 12  ? HIS D 19  ? TYR D 17  HIS D 24  
AA4 4  LYS D 157 ? LYS D 168 ? LYS D 162 LYS D 173 
AA4 5  GLU D 129 ? SER D 140 ? GLU D 134 SER D 145 
AA4 6  VAL D 107 ? PRO D 122 ? VAL D 112 PRO D 127 
AA4 7  LYS D 94  ? LEU D 104 ? LYS D 99  LEU D 109 
AA4 8  GLN D 81  ? ASP D 91  ? GLN D 86  ASP D 96  
AA4 9  THR D 45  ? ASP D 53  ? THR D 50  ASP D 58  
AA4 10 SER D 33  ? ASP D 40  ? SER D 38  ASP D 45  
AA4 11 ALA D 2   ? PHE D 6   ? ALA D 7   PHE D 11  
AA4 12 LYS D 157 ? LYS D 168 ? LYS D 162 LYS D 173 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  O HIS A 58  ? O HIS B 63  N LYS A 29  ? N LYS B 34  
AA1 2  3  O GLY A 28  ? O GLY B 33  N PHE A 15  ? N PHE B 20  
AA1 3  4  N SER A 14  ? N SER B 19  O LEU A 161 ? O LEU B 166 
AA1 4  5  O LYS A 168 ? O LYS B 173 N GLU A 129 ? N GLU B 134 
AA1 5  6  O GLY A 132 ? O GLY B 137 N LYS A 119 ? N LYS B 124 
AA1 6  7  O LYS A 109 ? O LYS B 114 N LEU A 102 ? N LEU B 107 
AA1 7  8  O THR A 103 ? O THR B 108 N ASN A 83  ? N ASN B 88  
AA1 8  9  O TYR A 84  ? O TYR B 89  N VAL A 50  ? N VAL B 55  
AA1 9  10 O THR A 45  ? O THR B 50  N ASP A 40  ? N ASP B 45  
AA1 10 11 O VAL A 37  ? O VAL B 42  N TYR A 4   ? N TYR B 9   
AA1 11 12 N GLN A 5   ? N GLN B 10  O VAL A 167 ? O VAL B 172 
AA2 1  2  O HIS B 58  ? O HIS C 63  N LYS B 29  ? N LYS C 34  
AA2 2  3  O TRP B 26  ? O TRP C 31  N ALA B 17  ? N ALA C 22  
AA2 3  4  N SER B 14  ? N SER C 19  O LEU B 161 ? O LEU C 166 
AA2 4  5  O ILE B 162 ? O ILE C 167 N ALA B 135 ? N ALA C 140 
AA2 5  6  O GLY B 132 ? O GLY C 137 N LYS B 119 ? N LYS C 124 
AA2 6  7  O LEU B 113 ? O LEU C 118 N VAL B 98  ? N VAL C 103 
AA2 7  8  O VAL B 96  ? O VAL C 101 N LYS B 89  ? N LYS C 94  
AA2 8  9  O GLY B 86  ? O GLY C 91  N VAL B 48  ? N VAL C 53  
AA2 9  10 O THR B 45  ? O THR C 50  N ASP B 40  ? N ASP C 45  
AA2 10 11 O VAL B 37  ? O VAL C 42  N TYR B 4   ? N TYR C 9   
AA2 11 12 N GLN B 5   ? N GLN C 10  O VAL B 167 ? O VAL C 172 
AA3 1  2  O HIS C 58  ? O HIS A 63  N LYS C 29  ? N LYS A 34  
AA3 2  3  O TRP C 26  ? O TRP A 31  N ALA C 17  ? N ALA A 22  
AA3 3  4  N SER C 14  ? N SER A 19  O LEU C 161 ? O LEU A 166 
AA3 4  5  O LEU C 160 ? O LEU A 165 N GLY C 137 ? N GLY A 142 
AA3 5  6  O VAL C 136 ? O VAL A 141 N LYS C 114 ? N LYS A 119 
AA3 6  7  O LEU C 113 ? O LEU A 118 N VAL C 98  ? N VAL A 103 
AA3 7  8  O THR C 103 ? O THR A 108 N ASN C 83  ? N ASN A 88  
AA3 8  9  O TYR C 84  ? O TYR A 89  N VAL C 50  ? N VAL A 55  
AA3 9  10 O THR C 45  ? O THR A 50  N ASP C 40  ? N ASP A 45  
AA3 10 11 O VAL C 37  ? O VAL A 42  N TYR C 4   ? N TYR A 9   
AA3 11 12 N GLN C 5   ? N GLN A 10  O VAL C 167 ? O VAL A 172 
AA4 1  2  O HIS D 58  ? O HIS D 63  N LYS D 29  ? N LYS D 34  
AA4 2  3  O TRP D 26  ? O TRP D 31  N ALA D 17  ? N ALA D 22  
AA4 3  4  N SER D 14  ? N SER D 19  O LEU D 161 ? O LEU D 166 
AA4 4  5  O LYS D 168 ? O LYS D 173 N GLU D 129 ? N GLU D 134 
AA4 5  6  O GLY D 132 ? O GLY D 137 N LYS D 119 ? N LYS D 124 
AA4 6  7  O LYS D 109 ? O LYS D 114 N LEU D 102 ? N LEU D 107 
AA4 7  8  O VAL D 96  ? O VAL D 101 N LYS D 89  ? N LYS D 94  
AA4 8  9  O TYR D 84  ? O TYR D 89  N VAL D 50  ? N VAL D 55  
AA4 9  10 O THR D 45  ? O THR D 50  N ASP D 40  ? N ASP D 45  
AA4 10 11 O VAL D 37  ? O VAL D 42  N TYR D 4   ? N TYR D 9   
AA4 11 12 N GLN D 5   ? N GLN D 10  O VAL D 167 ? O VAL D 172 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B OTP 201 ? 12 'binding site for residue OTP B 201' 
AC2 Software B PEG 202 ? 10 'binding site for residue PEG B 202' 
AC3 Software C OTP 201 ? 15 'binding site for residue OTP C 201' 
AC4 Software A OTP 201 ? 14 'binding site for residue OTP A 201' 
AC5 Software D OTP 201 ? 13 'binding site for residue OTP D 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 HIS C 10  ? HIS A 15  . ? 1_555 ? 
2  AC1 12 HIS A 19  ? HIS B 24  . ? 1_555 ? 
3  AC1 12 PHE A 20  ? PHE B 25  . ? 1_555 ? 
4  AC1 12 PHE A 30  ? PHE B 35  . ? 1_555 ? 
5  AC1 12 THR A 52  ? THR B 57  . ? 1_555 ? 
6  AC1 12 CYS A 131 ? CYS B 136 . ? 1_555 ? 
7  AC1 12 TYR A 148 ? TYR B 153 . ? 1_555 ? 
8  AC1 12 PHE A 154 ? PHE B 159 . ? 1_555 ? 
9  AC1 12 ILE A 162 ? ILE B 167 . ? 1_555 ? 
10 AC1 12 HOH J .   ? HOH B 301 . ? 1_555 ? 
11 AC1 12 HOH J .   ? HOH B 314 . ? 1_555 ? 
12 AC1 12 HOH J .   ? HOH B 379 . ? 1_555 ? 
13 AC2 10 ALA A 71  ? ALA B 76  . ? 1_555 ? 
14 AC2 10 GLU A 72  ? GLU B 77  . ? 1_555 ? 
15 AC2 10 PHE A 73  ? PHE B 78  . ? 1_555 ? 
16 AC2 10 ASP A 75  ? ASP B 80  . ? 1_555 ? 
17 AC2 10 HIS A 105 ? HIS B 110 . ? 1_555 ? 
18 AC2 10 GLY A 145 ? GLY B 150 . ? 1_555 ? 
19 AC2 10 LEU A 146 ? LEU B 151 . ? 1_555 ? 
20 AC2 10 ASP A 147 ? ASP B 152 . ? 1_555 ? 
21 AC2 10 TYR A 148 ? TYR B 153 . ? 1_555 ? 
22 AC2 10 HOH J .   ? HOH B 400 . ? 1_555 ? 
23 AC3 15 ALA B 17  ? ALA C 22  . ? 1_555 ? 
24 AC3 15 HIS B 19  ? HIS C 24  . ? 1_555 ? 
25 AC3 15 TRP B 26  ? TRP C 31  . ? 1_555 ? 
26 AC3 15 PHE B 30  ? PHE C 35  . ? 1_555 ? 
27 AC3 15 VAL B 50  ? VAL C 55  . ? 1_555 ? 
28 AC3 15 THR B 52  ? THR C 57  . ? 1_555 ? 
29 AC3 15 LEU B 64  ? LEU C 69  . ? 1_555 ? 
30 AC3 15 PHE B 118 ? PHE C 123 . ? 1_555 ? 
31 AC3 15 CYS B 131 ? CYS C 136 . ? 1_555 ? 
32 AC3 15 VAL B 133 ? VAL C 138 . ? 1_555 ? 
33 AC3 15 ALA B 135 ? ALA C 140 . ? 1_555 ? 
34 AC3 15 ARG B 141 ? ARG C 146 . ? 1_555 ? 
35 AC3 15 TYR B 148 ? TYR C 153 . ? 1_555 ? 
36 AC3 15 ILE B 162 ? ILE C 167 . ? 1_555 ? 
37 AC3 15 HIS D 10  ? HIS D 15  . ? 1_555 ? 
38 AC4 14 ALA C 17  ? ALA A 22  . ? 1_555 ? 
39 AC4 14 HIS C 19  ? HIS A 24  . ? 1_555 ? 
40 AC4 14 TRP C 26  ? TRP A 31  . ? 1_555 ? 
41 AC4 14 PHE C 30  ? PHE A 35  . ? 1_555 ? 
42 AC4 14 VAL C 50  ? VAL A 55  . ? 1_555 ? 
43 AC4 14 THR C 52  ? THR A 57  . ? 1_555 ? 
44 AC4 14 LYS C 63  ? LYS A 68  . ? 1_555 ? 
45 AC4 14 LEU C 64  ? LEU A 69  . ? 1_555 ? 
46 AC4 14 CYS C 131 ? CYS A 136 . ? 1_555 ? 
47 AC4 14 TYR C 148 ? TYR A 153 . ? 1_555 ? 
48 AC4 14 ILE C 162 ? ILE A 167 . ? 1_555 ? 
49 AC4 14 HOH L .   ? HOH A 309 . ? 1_555 ? 
50 AC4 14 HOH L .   ? HOH A 401 . ? 1_555 ? 
51 AC4 14 HIS A 10  ? HIS B 15  . ? 1_555 ? 
52 AC5 13 ALA C 71  ? ALA A 76  . ? 1_556 ? 
53 AC5 13 HIS B 10  ? HIS C 15  . ? 1_555 ? 
54 AC5 13 ALA D 17  ? ALA D 22  . ? 1_555 ? 
55 AC5 13 HIS D 19  ? HIS D 24  . ? 1_555 ? 
56 AC5 13 TRP D 26  ? TRP D 31  . ? 1_555 ? 
57 AC5 13 PHE D 30  ? PHE D 35  . ? 1_555 ? 
58 AC5 13 VAL D 50  ? VAL D 55  . ? 1_555 ? 
59 AC5 13 THR D 52  ? THR D 57  . ? 1_555 ? 
60 AC5 13 LEU D 64  ? LEU D 69  . ? 1_555 ? 
61 AC5 13 CYS D 131 ? CYS D 136 . ? 1_555 ? 
62 AC5 13 ARG D 141 ? ARG D 146 . ? 1_555 ? 
63 AC5 13 TYR D 148 ? TYR D 153 . ? 1_555 ? 
64 AC5 13 HOH M .   ? HOH D 343 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5IXG 
_atom_sites.fract_transf_matrix[1][1]   0.019547 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002469 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009884 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015876 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? 34.486 49.033 -0.496  1.00 35.05 ? 6   SER B N   1 
ATOM   2    C CA  . SER A 1 1   ? 34.538 47.526 -0.735  1.00 35.72 ? 6   SER B CA  1 
ATOM   3    C C   . SER A 1 1   ? 35.123 47.095 -2.100  1.00 33.79 ? 6   SER B C   1 
ATOM   4    O O   . SER A 1 1   ? 34.752 47.656 -3.166  1.00 32.86 ? 6   SER B O   1 
ATOM   5    C CB  . SER A 1 1   ? 33.147 46.928 -0.602  1.00 39.40 ? 6   SER B CB  1 
ATOM   6    O OG  . SER A 1 1   ? 33.265 45.513 -0.653  1.00 40.37 ? 6   SER B OG  1 
ATOM   7    N N   . ALA A 1 2   ? 35.945 46.024 -2.098  1.00 20.16 ? 7   ALA B N   1 
ATOM   8    C CA  . ALA A 1 2   ? 36.708 45.653 -3.225  1.00 18.66 ? 7   ALA B CA  1 
ATOM   9    C C   . ALA A 1 2   ? 36.867 44.105 -3.259  1.00 16.85 ? 7   ALA B C   1 
ATOM   10   O O   . ALA A 1 2   ? 36.885 43.454 -2.234  1.00 18.01 ? 7   ALA B O   1 
ATOM   11   C CB  . ALA A 1 2   ? 38.053 46.300 -3.160  1.00 21.72 ? 7   ALA B CB  1 
ATOM   12   N N   . THR A 1 3   ? 36.993 43.587 -4.445  1.00 16.09 ? 8   THR B N   1 
ATOM   13   C CA  . THR A 1 3   ? 37.209 42.150 -4.642  1.00 13.78 ? 8   THR B CA  1 
ATOM   14   C C   . THR A 1 3   ? 38.504 41.924 -5.373  1.00 13.09 ? 8   THR B C   1 
ATOM   15   O O   . THR A 1 3   ? 38.835 42.683 -6.281  1.00 13.97 ? 8   THR B O   1 
ATOM   16   C CB  . THR A 1 3   ? 36.093 41.565 -5.519  1.00 15.27 ? 8   THR B CB  1 
ATOM   17   O OG1 . THR A 1 3   ? 34.878 41.856 -4.825  1.00 18.31 ? 8   THR B OG1 1 
ATOM   18   C CG2 . THR A 1 3   ? 36.281 40.100 -5.715  1.00 17.80 ? 8   THR B CG2 1 
ATOM   19   N N   . TYR A 1 4   ? 39.344 41.013 -4.861  1.00 12.28 ? 9   TYR B N   1 
ATOM   20   C CA  . TYR A 1 4   ? 40.638 40.763 -5.424  1.00 11.41 ? 9   TYR B CA  1 
ATOM   21   C C   . TYR A 1 4   ? 40.793 39.268 -5.734  1.00 12.45 ? 9   TYR B C   1 
ATOM   22   O O   . TYR A 1 4   ? 40.252 38.406 -4.954  1.00 13.00 ? 9   TYR B O   1 
ATOM   23   C CB  . TYR A 1 4   ? 41.709 41.117 -4.336  1.00 11.46 ? 9   TYR B CB  1 
ATOM   24   C CG  . TYR A 1 4   ? 41.706 42.515 -3.753  1.00 12.37 ? 9   TYR B CG  1 
ATOM   25   C CD1 . TYR A 1 4   ? 40.760 42.930 -2.856  1.00 13.70 ? 9   TYR B CD1 1 
ATOM   26   C CD2 . TYR A 1 4   ? 42.669 43.426 -4.171  1.00 12.78 ? 9   TYR B CD2 1 
ATOM   27   C CE1 . TYR A 1 4   ? 40.724 44.213 -2.396  1.00 16.32 ? 9   TYR B CE1 1 
ATOM   28   C CE2 . TYR A 1 4   ? 42.656 44.694 -3.695  1.00 14.47 ? 9   TYR B CE2 1 
ATOM   29   C CZ  . TYR A 1 4   ? 41.687 45.085 -2.822  1.00 15.52 ? 9   TYR B CZ  1 
ATOM   30   O OH  . TYR A 1 4   ? 41.639 46.354 -2.264  1.00 18.29 ? 9   TYR B OH  1 
ATOM   31   N N   . GLN A 1 5   ? 41.577 38.907 -6.680  1.00 10.97 ? 10  GLN B N   1 
ATOM   32   C CA  . GLN A 1 5   ? 41.815 37.490 -7.031  1.00 12.00 ? 10  GLN B CA  1 
ATOM   33   C C   . GLN A 1 5   ? 43.281 37.145 -6.693  1.00 11.03 ? 10  GLN B C   1 
ATOM   34   O O   . GLN A 1 5   ? 44.199 37.894 -7.052  1.00 10.72 ? 10  GLN B O   1 
ATOM   35   C CB  . GLN A 1 5   ? 41.548 37.187 -8.458  1.00 14.05 ? 10  GLN B CB  1 
ATOM   36   C CG  . GLN A 1 5   ? 40.174 37.491 -8.933  1.00 16.48 ? 10  GLN B CG  1 
ATOM   37   C CD  . GLN A 1 5   ? 39.076 36.824 -8.171  1.00 19.48 ? 10  GLN B CD  1 
ATOM   38   O OE1 . GLN A 1 5   ? 39.266 35.707 -7.617  1.00 20.88 ? 10  GLN B OE1 1 
ATOM   39   N NE2 . GLN A 1 5   ? 37.857 37.429 -8.253  1.00 22.08 ? 10  GLN B NE2 1 
ATOM   40   N N   . PHE A 1 6   ? 43.550 36.027 -6.016  1.00 10.56 ? 11  PHE B N   1 
ATOM   41   C CA  . PHE A 1 6   ? 44.916 35.738 -5.658  1.00 10.61 ? 11  PHE B CA  1 
ATOM   42   C C   . PHE A 1 6   ? 45.686 35.505 -6.924  1.00 10.75 ? 11  PHE B C   1 
ATOM   43   O O   . PHE A 1 6   ? 45.192 34.897 -7.916  1.00 11.54 ? 11  PHE B O   1 
ATOM   44   C CB  . PHE A 1 6   ? 45.004 34.466 -4.832  1.00 10.81 ? 11  PHE B CB  1 
ATOM   45   C CG  . PHE A 1 6   ? 44.538 34.637 -3.438  1.00 10.61 ? 11  PHE B CG  1 
ATOM   46   C CD1 . PHE A 1 6   ? 45.218 35.483 -2.529  1.00 11.72 ? 11  PHE B CD1 1 
ATOM   47   C CD2 . PHE A 1 6   ? 43.487 33.977 -2.943  1.00 11.46 ? 11  PHE B CD2 1 
ATOM   48   C CE1 . PHE A 1 6   ? 44.834 35.601 -1.261  1.00 12.80 ? 11  PHE B CE1 1 
ATOM   49   C CE2 . PHE A 1 6   ? 43.032 34.157 -1.661  1.00 12.48 ? 11  PHE B CE2 1 
ATOM   50   C CZ  . PHE A 1 6   ? 43.759 34.911 -0.755  1.00 12.78 ? 11  PHE B CZ  1 
ATOM   51   N N   . ASP A 1 7   ? 46.911 36.033 -6.903  1.00 10.43 ? 12  ASP B N   1 
ATOM   52   C CA  . ASP A 1 7   ? 47.898 35.747 -7.947  1.00 11.47 ? 12  ASP B CA  1 
ATOM   53   C C   . ASP A 1 7   ? 48.590 34.443 -7.591  1.00 11.04 ? 12  ASP B C   1 
ATOM   54   O O   . ASP A 1 7   ? 49.380 34.447 -6.625  1.00 10.17 ? 12  ASP B O   1 
ATOM   55   C CB  . ASP A 1 7   ? 48.899 36.919 -7.977  1.00 13.40 ? 12  ASP B CB  1 
ATOM   56   C CG  . ASP A 1 7   ? 50.097 36.621 -8.882  1.00 14.98 ? 12  ASP B CG  1 
ATOM   57   O OD1 . ASP A 1 7   ? 50.086 35.582 -9.619  1.00 16.59 ? 12  ASP B OD1 1 
ATOM   58   O OD2 . ASP A 1 7   ? 51.112 37.377 -8.749  1.00 18.83 ? 12  ASP B OD2 1 
ATOM   59   N N   . PRO A 1 8   ? 48.344 33.334 -8.280  1.00 11.44 ? 13  PRO B N   1 
ATOM   60   C CA  . PRO A 1 8   ? 48.945 32.115 -7.905  1.00 13.05 ? 13  PRO B CA  1 
ATOM   61   C C   . PRO A 1 8   ? 50.484 32.116 -7.789  1.00 12.37 ? 13  PRO B C   1 
ATOM   62   O O   . PRO A 1 8   ? 51.013 31.440 -6.917  1.00 13.74 ? 13  PRO B O   1 
ATOM   63   C CB  . PRO A 1 8   ? 48.411 31.099 -8.881  1.00 13.86 ? 13  PRO B CB  1 
ATOM   64   C CG  . PRO A 1 8   ? 47.157 31.659 -9.304  1.00 13.76 ? 13  PRO B CG  1 
ATOM   65   C CD  . PRO A 1 8   ? 47.437 33.117 -9.418  1.00 12.87 ? 13  PRO B CD  1 
ATOM   66   N N   . SER A 1 9   ? 51.150 32.900 -8.640  1.00 12.96 ? 14  SER B N   1 
ATOM   67   C CA  . SER A 1 9   ? 52.602 32.901 -8.668  1.00 14.38 ? 14  SER B CA  1 
ATOM   68   C C   . SER A 1 9   ? 53.188 33.548 -7.445  1.00 14.55 ? 14  SER B C   1 
ATOM   69   O O   . SER A 1 9   ? 54.368 33.394 -7.165  1.00 14.68 ? 14  SER B O   1 
ATOM   70   C CB  . SER A 1 9   ? 53.108 33.628 -9.963  1.00 16.10 ? 14  SER B CB  1 
ATOM   71   O OG  . SER A 1 9   ? 52.716 34.987 -10.002 1.00 20.33 ? 14  SER B OG  1 
ATOM   72   N N   . HIS A 1 10  ? 52.359 34.314 -6.631  1.00 12.70 ? 15  HIS B N   1 
ATOM   73   C CA  . HIS A 1 10  ? 52.813 34.828 -5.338  1.00 11.90 ? 15  HIS B CA  1 
ATOM   74   C C   . HIS A 1 10  ? 51.864 34.502 -4.139  1.00 11.66 ? 15  HIS B C   1 
ATOM   75   O O   . HIS A 1 10  ? 51.719 35.236 -3.159  1.00 12.51 ? 15  HIS B O   1 
ATOM   76   C CB  . HIS A 1 10  ? 52.979 36.323 -5.370  1.00 14.34 ? 15  HIS B CB  1 
ATOM   77   C CG  . HIS A 1 10  ? 54.038 36.736 -6.350  1.00 14.46 ? 15  HIS B CG  1 
ATOM   78   N ND1 . HIS A 1 10  ? 53.797 36.901 -7.701  1.00 16.45 ? 15  HIS B ND1 1 
ATOM   79   C CD2 . HIS A 1 10  ? 55.359 36.889 -6.162  1.00 16.08 ? 15  HIS B CD2 1 
ATOM   80   C CE1 . HIS A 1 10  ? 54.948 37.179 -8.313  1.00 16.98 ? 15  HIS B CE1 1 
ATOM   81   N NE2 . HIS A 1 10  ? 55.892 37.217 -7.376  1.00 15.63 ? 15  HIS B NE2 1 
ATOM   82   N N   . THR A 1 11  ? 51.238 33.340 -4.232  1.00 9.84  ? 16  THR B N   1 
ATOM   83   C CA  . THR A 1 11  ? 50.330 32.835 -3.169  1.00 9.30  ? 16  THR B CA  1 
ATOM   84   C C   . THR A 1 11  ? 50.658 31.402 -2.899  1.00 9.89  ? 16  THR B C   1 
ATOM   85   O O   . THR A 1 11  ? 50.445 30.522 -3.735  1.00 9.31  ? 16  THR B O   1 
ATOM   86   C CB  . THR A 1 11  ? 48.833 32.971 -3.602  1.00 9.26  ? 16  THR B CB  1 
ATOM   87   O OG1 . THR A 1 11  ? 48.614 34.350 -3.925  1.00 9.70  ? 16  THR B OG1 1 
ATOM   88   C CG2 . THR A 1 11  ? 47.887 32.498 -2.534  1.00 9.47  ? 16  THR B CG2 1 
ATOM   89   N N   . TYR A 1 12  ? 51.231 31.144 -1.708  1.00 10.27 ? 17  TYR B N   1 
ATOM   90   C CA  . TYR A 1 12  ? 51.642 29.819 -1.314  1.00 10.05 ? 17  TYR B CA  1 
ATOM   91   C C   . TYR A 1 12  ? 51.509 29.635 0.186   1.00 10.05 ? 17  TYR B C   1 
ATOM   92   O O   . TYR A 1 12  ? 52.043 30.503 0.961   1.00 10.06 ? 17  TYR B O   1 
ATOM   93   C CB  . TYR A 1 12  ? 53.105 29.551 -1.684  1.00 10.92 ? 17  TYR B CB  1 
ATOM   94   C CG  . TYR A 1 12  ? 53.559 29.870 -3.060  1.00 10.44 ? 17  TYR B CG  1 
ATOM   95   C CD1 . TYR A 1 12  ? 53.468 28.905 -4.084  1.00 11.01 ? 17  TYR B CD1 1 
ATOM   96   C CD2 . TYR A 1 12  ? 53.945 31.089 -3.401  1.00 10.90 ? 17  TYR B CD2 1 
ATOM   97   C CE1 . TYR A 1 12  ? 53.894 29.131 -5.357  1.00 11.37 ? 17  TYR B CE1 1 
ATOM   98   C CE2 . TYR A 1 12  ? 54.396 31.325 -4.673  1.00 12.14 ? 17  TYR B CE2 1 
ATOM   99   C CZ  . TYR A 1 12  ? 54.292 30.406 -5.674  1.00 12.12 ? 17  TYR B CZ  1 
ATOM   100  O OH  . TYR A 1 12  ? 54.734 30.700 -6.933  1.00 14.24 ? 17  TYR B OH  1 
ATOM   101  N N   . PRO A 1 13  ? 50.952 28.551 0.646   1.00 9.50  ? 18  PRO B N   1 
ATOM   102  C CA  . PRO A 1 13  ? 51.109 28.136 2.016   1.00 9.41  ? 18  PRO B CA  1 
ATOM   103  C C   . PRO A 1 13  ? 52.350 27.321 2.156   1.00 8.83  ? 18  PRO B C   1 
ATOM   104  O O   . PRO A 1 13  ? 52.491 26.224 1.591   1.00 8.60  ? 18  PRO B O   1 
ATOM   105  C CB  . PRO A 1 13  ? 49.871 27.320 2.328   1.00 10.80 ? 18  PRO B CB  1 
ATOM   106  C CG  . PRO A 1 13  ? 49.424 26.803 0.959   1.00 10.74 ? 18  PRO B CG  1 
ATOM   107  C CD  . PRO A 1 13  ? 50.081 27.625 -0.120  1.00 10.14 ? 18  PRO B CD  1 
ATOM   108  N N   . SER A 1 14  ? 53.258 27.772 2.989   1.00 9.21  ? 19  SER B N   1 
ATOM   109  C CA  . SER A 1 14  ? 54.404 27.033 3.431   1.00 9.39  ? 19  SER B CA  1 
ATOM   110  C C   . SER A 1 14  ? 54.130 26.436 4.783   1.00 9.35  ? 19  SER B C   1 
ATOM   111  O O   . SER A 1 14  ? 53.204 26.926 5.519   1.00 9.16  ? 19  SER B O   1 
ATOM   112  C CB  . SER A 1 14  ? 55.647 27.927 3.529   1.00 9.69  ? 19  SER B CB  1 
ATOM   113  O OG  . SER A 1 14  ? 56.046 28.502 2.263   1.00 10.82 ? 19  SER B OG  1 
ATOM   114  N N   . PHE A 1 15  ? 54.871 25.441 5.207   1.00 9.72  ? 20  PHE B N   1 
ATOM   115  C CA  . PHE A 1 15  ? 54.643 24.794 6.457   1.00 9.38  ? 20  PHE B CA  1 
ATOM   116  C C   . PHE A 1 15  ? 55.949 24.472 7.209   1.00 10.16 ? 20  PHE B C   1 
ATOM   117  O O   . PHE A 1 15  ? 57.015 24.372 6.581   1.00 9.10  ? 20  PHE B O   1 
ATOM   118  C CB  . PHE A 1 15  ? 53.799 23.516 6.336   1.00 10.53 ? 20  PHE B CB  1 
ATOM   119  C CG  . PHE A 1 15  ? 54.322 22.547 5.338   1.00 10.67 ? 20  PHE B CG  1 
ATOM   120  C CD1 . PHE A 1 15  ? 55.253 21.681 5.672   1.00 12.22 ? 20  PHE B CD1 1 
ATOM   121  C CD2 . PHE A 1 15  ? 53.816 22.584 4.015   1.00 12.73 ? 20  PHE B CD2 1 
ATOM   122  C CE1 . PHE A 1 15  ? 55.830 20.837 4.679   1.00 14.63 ? 20  PHE B CE1 1 
ATOM   123  C CE2 . PHE A 1 15  ? 54.349 21.742 3.053   1.00 13.72 ? 20  PHE B CE2 1 
ATOM   124  C CZ  . PHE A 1 15  ? 55.305 20.862 3.406   1.00 13.47 ? 20  PHE B CZ  1 
ATOM   125  N N   . GLU A 1 16  ? 55.787 24.171 8.479   1.00 9.70  ? 21  GLU B N   1 
ATOM   126  C CA  . GLU A 1 16  ? 56.798 23.583 9.328   1.00 10.41 ? 21  GLU B CA  1 
ATOM   127  C C   . GLU A 1 16  ? 56.205 22.432 10.077  1.00 11.10 ? 21  GLU B C   1 
ATOM   128  O O   . GLU A 1 16  ? 55.129 22.586 10.654  1.00 12.37 ? 21  GLU B O   1 
ATOM   129  C CB  . GLU A 1 16  ? 57.410 24.516 10.379  1.00 11.91 ? 21  GLU B CB  1 
ATOM   130  C CG  . GLU A 1 16  ? 58.019 25.752 9.796   1.00 12.55 ? 21  GLU B CG  1 
ATOM   131  C CD  . GLU A 1 16  ? 58.628 26.728 10.868  1.00 17.19 ? 21  GLU B CD  1 
ATOM   132  O OE1 . GLU A 1 16  ? 58.437 26.471 12.070  1.00 20.65 ? 21  GLU B OE1 1 
ATOM   133  O OE2 . GLU A 1 16  ? 59.279 27.738 10.447  1.00 19.17 ? 21  GLU B OE2 1 
ATOM   134  N N   . ALA A 1 17  ? 56.843 21.273 10.018  1.00 10.74 ? 22  ALA B N   1 
ATOM   135  C CA  . ALA A 1 17  ? 56.337 20.088 10.759  1.00 12.02 ? 22  ALA B CA  1 
ATOM   136  C C   . ALA A 1 17  ? 57.548 19.436 11.472  1.00 14.10 ? 22  ALA B C   1 
ATOM   137  O O   . ALA A 1 17  ? 58.683 19.523 11.114  1.00 13.98 ? 22  ALA B O   1 
ATOM   138  C CB  . ALA A 1 17  ? 55.802 19.138 9.792   1.00 12.78 ? 22  ALA B CB  1 
ATOM   139  N N   . ASP A 1 18  ? 57.281 18.638 12.476  1.00 13.55 ? 23  ASP B N   1 
ATOM   140  C CA  . ASP A 1 18  ? 58.324 18.032 13.319  1.00 14.91 ? 23  ASP B CA  1 
ATOM   141  C C   . ASP A 1 18  ? 58.862 16.787 12.662  1.00 15.21 ? 23  ASP B C   1 
ATOM   142  O O   . ASP A 1 18  ? 58.162 16.097 11.881  1.00 17.66 ? 23  ASP B O   1 
ATOM   143  C CB  . ASP A 1 18  ? 57.660 17.519 14.602  1.00 16.18 ? 23  ASP B CB  1 
ATOM   144  C CG  . ASP A 1 18  ? 58.660 16.832 15.505  1.00 18.64 ? 23  ASP B CG  1 
ATOM   145  O OD1 . ASP A 1 18  ? 59.668 17.506 15.846  1.00 20.94 ? 23  ASP B OD1 1 
ATOM   146  O OD2 . ASP A 1 18  ? 58.474 15.652 15.824  1.00 21.34 ? 23  ASP B OD2 1 
ATOM   147  N N   . HIS A 1 19  ? 60.150 16.551 12.880  1.00 14.17 ? 24  HIS B N   1 
ATOM   148  C CA  . HIS A 1 19  ? 60.774 15.290 12.562  1.00 14.87 ? 24  HIS B CA  1 
ATOM   149  C C   . HIS A 1 19  ? 61.435 14.685 13.851  1.00 15.36 ? 24  HIS B C   1 
ATOM   150  O O   . HIS A 1 19  ? 62.306 15.236 14.483  1.00 15.58 ? 24  HIS B O   1 
ATOM   151  C CB  . HIS A 1 19  ? 61.920 15.458 11.544  1.00 14.59 ? 24  HIS B CB  1 
ATOM   152  C CG  . HIS A 1 19  ? 62.425 14.138 11.031  1.00 16.59 ? 24  HIS B CG  1 
ATOM   153  N ND1 . HIS A 1 19  ? 63.760 13.793 11.031  1.00 18.98 ? 24  HIS B ND1 1 
ATOM   154  C CD2 . HIS A 1 19  ? 61.775 13.098 10.474  1.00 19.78 ? 24  HIS B CD2 1 
ATOM   155  C CE1 . HIS A 1 19  ? 63.914 12.605 10.475  1.00 19.28 ? 24  HIS B CE1 1 
ATOM   156  N NE2 . HIS A 1 19  ? 62.720 12.136 10.171  1.00 20.09 ? 24  HIS B NE2 1 
ATOM   157  N N   . PHE A 1 20  ? 60.951 13.515 14.218  1.00 19.61 ? 25  PHE B N   1 
ATOM   158  C CA  . PHE A 1 20  ? 61.533 12.687 15.341  1.00 20.45 ? 25  PHE B CA  1 
ATOM   159  C C   . PHE A 1 20  ? 61.593 13.386 16.660  1.00 20.12 ? 25  PHE B C   1 
ATOM   160  O O   . PHE A 1 20  ? 62.624 13.433 17.353  1.00 21.35 ? 25  PHE B O   1 
ATOM   161  C CB  . PHE A 1 20  ? 62.936 12.154 15.038  1.00 23.22 ? 25  PHE B CB  1 
ATOM   162  C CG  . PHE A 1 20  ? 63.010 11.066 13.999  1.00 29.67 ? 25  PHE B CG  1 
ATOM   163  C CD1 . PHE A 1 20  ? 61.950 10.309 13.642  1.00 34.70 ? 25  PHE B CD1 1 
ATOM   164  C CD2 . PHE A 1 20  ? 64.266 10.779 13.428  1.00 36.34 ? 25  PHE B CD2 1 
ATOM   165  C CE1 . PHE A 1 20  ? 62.095 9.302  12.678  1.00 37.25 ? 25  PHE B CE1 1 
ATOM   166  C CE2 . PHE A 1 20  ? 64.416 9.785  12.468  1.00 35.99 ? 25  PHE B CE2 1 
ATOM   167  C CZ  . PHE A 1 20  ? 63.331 9.043  12.110  1.00 35.25 ? 25  PHE B CZ  1 
ATOM   168  N N   . GLY A 1 21  ? 60.493 14.046 16.982  1.00 19.50 ? 26  GLY B N   1 
ATOM   169  C CA  . GLY A 1 21  ? 60.406 14.657 18.300  1.00 20.64 ? 26  GLY B CA  1 
ATOM   170  C C   . GLY A 1 21  ? 61.448 15.700 18.556  1.00 21.33 ? 26  GLY B C   1 
ATOM   171  O O   . GLY A 1 21  ? 62.126 15.703 19.570  1.00 24.13 ? 26  GLY B O   1 
ATOM   172  N N   . GLY A 1 22  ? 61.532 16.665 17.653  1.00 17.41 ? 27  GLY B N   1 
ATOM   173  C CA  . GLY A 1 22  ? 62.382 17.797 17.802  1.00 17.91 ? 27  GLY B CA  1 
ATOM   174  C C   . GLY A 1 22  ? 63.791 17.661 17.247  1.00 16.42 ? 27  GLY B C   1 
ATOM   175  O O   . GLY A 1 22  ? 64.639 18.456 17.568  1.00 18.05 ? 27  GLY B O   1 
ATOM   176  N N   . LEU A 1 23  ? 64.054 16.607 16.507  1.00 15.39 ? 28  LEU B N   1 
ATOM   177  C CA  . LEU A 1 23  ? 65.362 16.440 15.915  1.00 15.08 ? 28  LEU B CA  1 
ATOM   178  C C   . LEU A 1 23  ? 65.633 17.527 14.885  1.00 14.31 ? 28  LEU B C   1 
ATOM   179  O O   . LEU A 1 23  ? 66.710 18.059 14.790  1.00 14.60 ? 28  LEU B O   1 
ATOM   180  C CB  . LEU A 1 23  ? 65.459 15.077 15.304  1.00 15.71 ? 28  LEU B CB  1 
ATOM   181  C CG  . LEU A 1 23  ? 66.794 14.731 14.737  1.00 16.27 ? 28  LEU B CG  1 
ATOM   182  C CD1 . LEU A 1 23  ? 67.853 14.719 15.841  1.00 16.57 ? 28  LEU B CD1 1 
ATOM   183  C CD2 . LEU A 1 23  ? 66.709 13.381 14.073  1.00 19.27 ? 28  LEU B CD2 1 
ATOM   184  N N   . SER A 1 24  ? 64.616 17.764 14.068  1.00 12.86 ? 29  SER B N   1 
ATOM   185  C CA  . SER A 1 24  ? 64.710 18.837 13.115  1.00 13.56 ? 29  SER B CA  1 
ATOM   186  C C   . SER A 1 24  ? 63.326 19.215 12.662  1.00 13.58 ? 29  SER B C   1 
ATOM   187  O O   . SER A 1 24  ? 62.312 18.631 13.107  1.00 13.85 ? 29  SER B O   1 
ATOM   188  C CB  . SER A 1 24  ? 65.608 18.468 11.932  1.00 13.98 ? 29  SER B CB  1 
ATOM   189  O OG  . SER A 1 24  ? 64.987 17.517 11.159  1.00 15.66 ? 29  SER B OG  1 
ATOM   190  N N   . VAL A 1 25  ? 63.301 20.227 11.788  1.00 12.87 ? 30  VAL B N   1 
ATOM   191  C CA  . VAL A 1 25  ? 62.011 20.770 11.284  1.00 12.75 ? 30  VAL B CA  1 
ATOM   192  C C   . VAL A 1 25  ? 61.876 20.502 9.802   1.00 12.60 ? 30  VAL B C   1 
ATOM   193  O O   . VAL A 1 25  ? 62.713 21.069 9.006   1.00 13.33 ? 30  VAL B O   1 
ATOM   194  C CB  . VAL A 1 25  ? 61.918 22.262 11.581  1.00 13.49 ? 30  VAL B CB  1 
ATOM   195  C CG1 . VAL A 1 25  ? 60.616 22.872 11.017  1.00 13.60 ? 30  VAL B CG1 1 
ATOM   196  C CG2 . VAL A 1 25  ? 62.105 22.566 13.011  1.00 14.61 ? 30  VAL B CG2 1 
ATOM   197  N N   . TRP A 1 26  ? 60.849 19.786 9.346   1.00 12.05 ? 31  TRP B N   1 
ATOM   198  C CA  . TRP A 1 26  ? 60.482 19.700 7.938   1.00 11.74 ? 31  TRP B CA  1 
ATOM   199  C C   . TRP A 1 26  ? 59.905 20.990 7.472   1.00 12.24 ? 31  TRP B C   1 
ATOM   200  O O   . TRP A 1 26  ? 58.976 21.520 8.153   1.00 14.06 ? 31  TRP B O   1 
ATOM   201  C CB  . TRP A 1 26  ? 59.439 18.637 7.668   1.00 13.46 ? 31  TRP B CB  1 
ATOM   202  C CG  . TRP A 1 26  ? 59.922 17.298 7.314   1.00 14.02 ? 31  TRP B CG  1 
ATOM   203  C CD1 . TRP A 1 26  ? 59.924 16.209 8.112   1.00 16.04 ? 31  TRP B CD1 1 
ATOM   204  C CD2 . TRP A 1 26  ? 60.614 16.926 6.104   1.00 15.82 ? 31  TRP B CD2 1 
ATOM   205  N NE1 . TRP A 1 26  ? 60.575 15.177 7.503   1.00 18.49 ? 31  TRP B NE1 1 
ATOM   206  C CE2 . TRP A 1 26  ? 60.994 15.579 6.242   1.00 17.21 ? 31  TRP B CE2 1 
ATOM   207  C CE3 . TRP A 1 26  ? 60.967 17.609 4.967   1.00 18.07 ? 31  TRP B CE3 1 
ATOM   208  C CZ2 . TRP A 1 26  ? 61.716 14.916 5.278   1.00 18.36 ? 31  TRP B CZ2 1 
ATOM   209  C CZ3 . TRP A 1 26  ? 61.645 16.941 3.950   1.00 17.88 ? 31  TRP B CZ3 1 
ATOM   210  C CH2 . TRP A 1 26  ? 62.028 15.596 4.129   1.00 17.47 ? 31  TRP B CH2 1 
ATOM   211  N N   . ARG A 1 27  ? 60.438 21.588 6.420   1.00 11.22 ? 32  ARG B N   1 
ATOM   212  C CA  . ARG A 1 27  ? 59.855 22.770 5.849   1.00 11.57 ? 32  ARG B CA  1 
ATOM   213  C C   . ARG A 1 27  ? 59.497 22.459 4.401   1.00 11.99 ? 32  ARG B C   1 
ATOM   214  O O   . ARG A 1 27  ? 60.230 21.746 3.661   1.00 14.68 ? 32  ARG B O   1 
ATOM   215  C CB  . ARG A 1 27  ? 60.756 23.981 5.922   1.00 13.09 ? 32  ARG B CB  1 
ATOM   216  C CG  . ARG A 1 27  ? 61.025 24.464 7.262   1.00 13.18 ? 32  ARG B CG  1 
ATOM   217  C CD  . ARG A 1 27  ? 61.828 25.802 7.264   1.00 14.94 ? 32  ARG B CD  1 
ATOM   218  N NE  . ARG A 1 27  ? 61.861 26.290 8.625   1.00 15.84 ? 32  ARG B NE  1 
ATOM   219  C CZ  . ARG A 1 27  ? 62.706 25.945 9.589   1.00 16.34 ? 32  ARG B CZ  1 
ATOM   220  N NH1 . ARG A 1 27  ? 63.657 25.143 9.361   1.00 16.94 ? 32  ARG B NH1 1 
ATOM   221  N NH2 . ARG A 1 27  ? 62.490 26.414 10.797  1.00 19.26 ? 32  ARG B NH2 1 
ATOM   222  N N   . GLY A 1 28  ? 58.453 23.067 3.908   1.00 11.44 ? 33  GLY B N   1 
ATOM   223  C CA  . GLY A 1 28  ? 58.070 22.914 2.504   1.00 11.21 ? 33  GLY B CA  1 
ATOM   224  C C   . GLY A 1 28  ? 56.898 23.779 2.168   1.00 10.29 ? 33  GLY B C   1 
ATOM   225  O O   . GLY A 1 28  ? 56.463 24.706 2.969   1.00 10.09 ? 33  GLY B O   1 
ATOM   226  N N   . LYS A 1 29  ? 56.273 23.566 0.989   1.00 9.57  ? 34  LYS B N   1 
ATOM   227  C CA  . LYS A 1 29  ? 55.157 24.437 0.616   1.00 9.32  ? 34  LYS B CA  1 
ATOM   228  C C   . LYS A 1 29  ? 54.303 23.683 -0.371  1.00 9.31  ? 34  LYS B C   1 
ATOM   229  O O   . LYS A 1 29  ? 54.655 22.588 -0.862  1.00 11.49 ? 34  LYS B O   1 
ATOM   230  C CB  . LYS A 1 29  ? 55.553 25.800 0.054   1.00 10.13 ? 34  LYS B CB  1 
ATOM   231  C CG  . LYS A 1 29  ? 56.277 25.614 -1.263  1.00 10.67 ? 34  LYS B CG  1 
ATOM   232  C CD  . LYS A 1 29  ? 56.952 26.874 -1.860  1.00 14.07 ? 34  LYS B CD  1 
ATOM   233  C CE  . LYS A 1 29  ? 56.380 28.187 -1.530  1.00 13.37 ? 34  LYS B CE  1 
ATOM   234  N NZ  . LYS A 1 29  ? 56.940 29.414 -2.151  1.00 13.94 ? 34  LYS B NZ  1 
ATOM   235  N N   . PHE A 1 30  ? 53.148 24.238 -0.664  1.00 8.78  ? 35  PHE B N   1 
ATOM   236  C CA  . PHE A 1 30  ? 52.254 23.732 -1.765  1.00 8.61  ? 35  PHE B CA  1 
ATOM   237  C C   . PHE A 1 30  ? 52.367 24.765 -2.855  1.00 9.49  ? 35  PHE B C   1 
ATOM   238  O O   . PHE A 1 30  ? 52.197 25.956 -2.625  1.00 9.62  ? 35  PHE B O   1 
ATOM   239  C CB  . PHE A 1 30  ? 50.847 23.651 -1.271  1.00 8.31  ? 35  PHE B CB  1 
ATOM   240  C CG  . PHE A 1 30  ? 50.638 22.572 -0.236  1.00 8.36  ? 35  PHE B CG  1 
ATOM   241  C CD1 . PHE A 1 30  ? 50.956 22.809 1.118   1.00 9.10  ? 35  PHE B CD1 1 
ATOM   242  C CD2 . PHE A 1 30  ? 50.214 21.254 -0.605  1.00 8.68  ? 35  PHE B CD2 1 
ATOM   243  C CE1 . PHE A 1 30  ? 50.736 21.766 2.026   1.00 9.74  ? 35  PHE B CE1 1 
ATOM   244  C CE2 . PHE A 1 30  ? 50.071 20.265 0.263   1.00 10.07 ? 35  PHE B CE2 1 
ATOM   245  C CZ  . PHE A 1 30  ? 50.384 20.473 1.602   1.00 9.88  ? 35  PHE B CZ  1 
ATOM   246  N N   . ASP A 1 31  ? 52.668 24.300 -4.063  1.00 9.98  ? 36  ASP B N   1 
ATOM   247  C CA  . ASP A 1 31  ? 52.930 25.209 -5.200  1.00 10.54 ? 36  ASP B CA  1 
ATOM   248  C C   . ASP A 1 31  ? 51.683 25.779 -5.880  1.00 10.98 ? 36  ASP B C   1 
ATOM   249  O O   . ASP A 1 31  ? 51.836 26.781 -6.629  1.00 12.20 ? 36  ASP B O   1 
ATOM   250  C CB  . ASP A 1 31  ? 53.779 24.524 -6.232  1.00 12.18 ? 36  ASP B CB  1 
ATOM   251  C CG  . ASP A 1 31  ? 55.178 24.128 -5.821  1.00 16.43 ? 36  ASP B CG  1 
ATOM   252  O OD1 . ASP A 1 31  ? 55.692 24.488 -4.791  1.00 16.89 ? 36  ASP B OD1 1 
ATOM   253  O OD2 . ASP A 1 31  ? 55.850 23.413 -6.673  1.00 19.05 ? 36  ASP B OD2 1 
ATOM   254  N N   . LYS A 1 32  ? 50.501 25.190 -5.700  1.00 10.23 ? 37  LYS B N   1 
ATOM   255  C CA  . LYS A 1 32  ? 49.310 25.595 -6.528  1.00 11.46 ? 37  LYS B CA  1 
ATOM   256  C C   . LYS A 1 32  ? 48.100 25.947 -5.624  1.00 10.70 ? 37  LYS B C   1 
ATOM   257  O O   . LYS A 1 32  ? 47.647 25.094 -4.861  1.00 10.70 ? 37  LYS B O   1 
ATOM   258  C CB  . LYS A 1 32  ? 48.905 24.501 -7.494  1.00 14.16 ? 37  LYS B CB  1 
ATOM   259  C CG  . LYS A 1 32  ? 49.839 24.283 -8.664  1.00 19.65 ? 37  LYS B CG  1 
ATOM   260  C CD  . LYS A 1 32  ? 49.929 25.481 -9.572  1.00 27.40 ? 37  LYS B CD  1 
ATOM   261  C CE  . LYS A 1 32  ? 48.661 26.369 -9.701  1.00 35.34 ? 37  LYS B CE  1 
ATOM   262  N NZ  . LYS A 1 32  ? 48.945 27.686 -10.395 1.00 33.20 ? 37  LYS B NZ  1 
ATOM   263  N N   . SER A 1 33  ? 47.781 27.241 -5.642  1.00 10.43 ? 38  SER B N   1 
ATOM   264  C CA  . SER A 1 33  ? 46.641 27.816 -4.882  1.00 10.44 ? 38  SER B CA  1 
ATOM   265  C C   . SER A 1 33  ? 45.863 28.814 -5.794  1.00 10.88 ? 38  SER B C   1 
ATOM   266  O O   . SER A 1 33  ? 46.389 29.383 -6.685  1.00 11.73 ? 38  SER B O   1 
ATOM   267  C CB  . SER A 1 33  ? 47.096 28.509 -3.604  1.00 11.72 ? 38  SER B CB  1 
ATOM   268  O OG  . SER A 1 33  ? 47.722 27.607 -2.723  1.00 12.42 ? 38  SER B OG  1 
ATOM   269  N N   . SER A 1 34  ? 44.641 29.040 -5.423  1.00 10.54 ? 39  SER B N   1 
ATOM   270  C CA  . SER A 1 34  ? 43.819 30.024 -6.083  1.00 10.45 ? 39  SER B CA  1 
ATOM   271  C C   . SER A 1 34  ? 42.714 30.487 -5.125  1.00 10.89 ? 39  SER B C   1 
ATOM   272  O O   . SER A 1 34  ? 42.382 29.804 -4.162  1.00 11.41 ? 39  SER B O   1 
ATOM   273  C CB  . SER A 1 34  ? 43.162 29.442 -7.349  1.00 13.19 ? 39  SER B CB  1 
ATOM   274  O OG  . SER A 1 34  ? 42.288 28.394 -7.076  1.00 14.93 ? 39  SER B OG  1 
ATOM   275  N N   . GLY A 1 35  ? 42.099 31.626 -5.435  1.00 9.17  ? 40  GLY B N   1 
ATOM   276  C CA  . GLY A 1 35  ? 40.927 32.090 -4.719  1.00 9.07  ? 40  GLY B CA  1 
ATOM   277  C C   . GLY A 1 35  ? 40.722 33.570 -4.748  1.00 9.07  ? 40  GLY B C   1 
ATOM   278  O O   . GLY A 1 35  ? 41.313 34.257 -5.597  1.00 9.54  ? 40  GLY B O   1 
ATOM   279  N N   . THR A 1 36  ? 39.911 34.062 -3.848  1.00 9.54  ? 41  THR B N   1 
ATOM   280  C CA  . THR A 1 36  ? 39.349 35.379 -3.854  1.00 10.81 ? 41  THR B CA  1 
ATOM   281  C C   . THR A 1 36  ? 39.366 35.997 -2.476  1.00 11.20 ? 41  THR B C   1 
ATOM   282  O O   . THR A 1 36  ? 39.104 35.323 -1.461  1.00 10.45 ? 41  THR B O   1 
ATOM   283  C CB  . THR A 1 36  ? 37.870 35.337 -4.374  1.00 12.73 ? 41  THR B CB  1 
ATOM   284  O OG1 . THR A 1 36  ? 37.788 34.612 -5.591  1.00 15.98 ? 41  THR B OG1 1 
ATOM   285  C CG2 . THR A 1 36  ? 37.312 36.658 -4.586  1.00 13.14 ? 41  THR B CG2 1 
ATOM   286  N N   . VAL A 1 37  ? 39.669 37.298 -2.394  1.00 11.45 ? 42  VAL B N   1 
ATOM   287  C CA  . VAL A 1 37  ? 39.564 38.088 -1.186  1.00 12.28 ? 42  VAL B CA  1 
ATOM   288  C C   . VAL A 1 37  ? 38.543 39.199 -1.428  1.00 12.47 ? 42  VAL B C   1 
ATOM   289  O O   . VAL A 1 37  ? 38.549 39.803 -2.498  1.00 13.61 ? 42  VAL B O   1 
ATOM   290  C CB  . VAL A 1 37  ? 40.922 38.743 -0.812  1.00 14.25 ? 42  VAL B CB  1 
ATOM   291  C CG1 . VAL A 1 37  ? 40.842 39.762 0.333   1.00 14.35 ? 42  VAL B CG1 1 
ATOM   292  C CG2 . VAL A 1 37  ? 41.969 37.653 -0.557  1.00 15.53 ? 42  VAL B CG2 1 
ATOM   293  N N   . THR A 1 38  ? 37.737 39.479 -0.406  1.00 11.50 ? 43  THR B N   1 
ATOM   294  C CA  . THR A 1 38  ? 36.993 40.714 -0.415  1.00 12.90 ? 43  THR B CA  1 
ATOM   295  C C   . THR A 1 38  ? 37.417 41.538 0.758   1.00 12.36 ? 43  THR B C   1 
ATOM   296  O O   . THR A 1 38  ? 37.765 41.050 1.818   1.00 13.25 ? 43  THR B O   1 
ATOM   297  C CB  . THR A 1 38  ? 35.467 40.486 -0.322  1.00 13.91 ? 43  THR B CB  1 
ATOM   298  O OG1 . THR A 1 38  ? 35.103 39.965 0.931   1.00 14.63 ? 43  THR B OG1 1 
ATOM   299  C CG2 . THR A 1 38  ? 34.916 39.584 -1.378  1.00 14.48 ? 43  THR B CG2 1 
ATOM   300  N N   . LEU A 1 39  ? 37.525 42.893 0.567   1.00 14.03 ? 44  LEU B N   1 
ATOM   301  C CA  . LEU A 1 39  ? 37.994 43.719 1.639   1.00 15.91 ? 44  LEU B CA  1 
ATOM   302  C C   . LEU A 1 39  ? 37.234 45.074 1.584   1.00 19.18 ? 44  LEU B C   1 
ATOM   303  O O   . LEU A 1 39  ? 37.076 45.640 0.462   1.00 21.22 ? 44  LEU B O   1 
ATOM   304  C CB  . LEU A 1 39  ? 39.498 43.997 1.424   1.00 19.55 ? 44  LEU B CB  1 
ATOM   305  C CG  . LEU A 1 39  ? 40.324 44.441 2.652   1.00 23.43 ? 44  LEU B CG  1 
ATOM   306  C CD1 . LEU A 1 39  ? 40.351 43.458 3.791   1.00 24.54 ? 44  LEU B CD1 1 
ATOM   307  C CD2 . LEU A 1 39  ? 41.719 44.723 2.145   1.00 25.06 ? 44  LEU B CD2 1 
ATOM   308  N N   . ASP A 1 40  ? 36.710 45.464 2.727   1.00 19.03 ? 45  ASP B N   1 
ATOM   309  C CA  . ASP A 1 40  ? 36.016 46.793 2.895   1.00 24.74 ? 45  ASP B CA  1 
ATOM   310  C C   . ASP A 1 40  ? 36.707 47.443 4.098   1.00 23.58 ? 45  ASP B C   1 
ATOM   311  O O   . ASP A 1 40  ? 36.276 47.231 5.245   1.00 25.42 ? 45  ASP B O   1 
ATOM   312  C CB  . ASP A 1 40  ? 34.555 46.596 3.112   1.00 29.05 ? 45  ASP B CB  1 
ATOM   313  C CG  . ASP A 1 40  ? 33.799 47.955 3.128   1.00 34.08 ? 45  ASP B CG  1 
ATOM   314  O OD1 . ASP A 1 40  ? 34.500 48.969 3.284   1.00 36.59 ? 45  ASP B OD1 1 
ATOM   315  O OD2 . ASP A 1 40  ? 32.580 47.930 2.986   1.00 39.08 ? 45  ASP B OD2 1 
ATOM   316  N N   . ARG A 1 41  ? 37.777 48.186 3.783   1.00 28.31 ? 46  ARG B N   1 
ATOM   317  C CA  . ARG A 1 41  ? 38.666 48.832 4.795   1.00 28.96 ? 46  ARG B CA  1 
ATOM   318  C C   . ARG A 1 41  ? 37.835 49.788 5.695   1.00 31.72 ? 46  ARG B C   1 
ATOM   319  O O   . ARG A 1 41  ? 37.942 49.740 6.898   1.00 33.21 ? 46  ARG B O   1 
ATOM   320  C CB  . ARG A 1 41  ? 39.961 49.401 4.153   1.00 30.53 ? 46  ARG B CB  1 
ATOM   321  C CG  . ARG A 1 41  ? 40.930 48.354 3.519   1.00 32.66 ? 46  ARG B CG  1 
ATOM   322  C CD  . ARG A 1 41  ? 42.098 48.893 2.653   1.00 34.56 ? 46  ARG B CD  1 
ATOM   323  N NE  . ARG A 1 41  ? 43.190 49.441 3.490   1.00 37.86 ? 46  ARG B NE  1 
ATOM   324  C CZ  . ARG A 1 41  ? 44.383 49.847 3.034   1.00 41.55 ? 46  ARG B CZ  1 
ATOM   325  N NH1 . ARG A 1 41  ? 44.694 49.744 1.750   1.00 43.42 ? 46  ARG B NH1 1 
ATOM   326  N NH2 . ARG A 1 41  ? 45.285 50.353 3.868   1.00 44.52 ? 46  ARG B NH2 1 
ATOM   327  N N   . ALA A 1 42  ? 36.865 50.505 5.136   1.00 35.77 ? 47  ALA B N   1 
ATOM   328  C CA  . ALA A 1 42  ? 36.072 51.480 5.922   1.00 36.31 ? 47  ALA B CA  1 
ATOM   329  C C   . ALA A 1 42  ? 35.082 50.797 6.836   1.00 35.63 ? 47  ALA B C   1 
ATOM   330  O O   . ALA A 1 42  ? 34.885 51.230 7.969   1.00 33.29 ? 47  ALA B O   1 
ATOM   331  C CB  . ALA A 1 42  ? 35.349 52.439 4.993   1.00 40.53 ? 47  ALA B CB  1 
ATOM   332  N N   . ALA A 1 43  ? 34.540 49.652 6.414   1.00 27.20 ? 48  ALA B N   1 
ATOM   333  C CA  . ALA A 1 43  ? 33.677 48.878 7.278   1.00 25.52 ? 48  ALA B CA  1 
ATOM   334  C C   . ALA A 1 43  ? 34.431 47.887 8.162   1.00 23.33 ? 48  ALA B C   1 
ATOM   335  O O   . ALA A 1 43  ? 33.866 47.235 8.981   1.00 25.22 ? 48  ALA B O   1 
ATOM   336  C CB  . ALA A 1 43  ? 32.643 48.168 6.433   1.00 26.63 ? 48  ALA B CB  1 
ATOM   337  N N   . LYS A 1 44  ? 35.727 47.815 7.993   1.00 23.45 ? 49  LYS B N   1 
ATOM   338  C CA  . LYS A 1 44  ? 36.605 46.966 8.800   1.00 22.65 ? 49  LYS B CA  1 
ATOM   339  C C   . LYS A 1 44  ? 36.144 45.516 8.680   1.00 19.06 ? 49  LYS B C   1 
ATOM   340  O O   . LYS A 1 44  ? 35.918 44.834 9.664   1.00 20.39 ? 49  LYS B O   1 
ATOM   341  C CB  . LYS A 1 44  ? 36.703 47.435 10.250  1.00 27.52 ? 49  LYS B CB  1 
ATOM   342  C CG  . LYS A 1 44  ? 37.539 48.726 10.427  1.00 30.28 ? 49  LYS B CG  1 
ATOM   343  C CD  . LYS A 1 44  ? 37.397 49.133 11.886  1.00 37.14 ? 49  LYS B CD  1 
ATOM   344  C CE  . LYS A 1 44  ? 38.561 49.956 12.408  1.00 42.45 ? 49  LYS B CE  1 
ATOM   345  N NZ  . LYS A 1 44  ? 38.958 50.956 11.404  1.00 40.90 ? 49  LYS B NZ  1 
ATOM   346  N N   . THR A 1 45  ? 35.962 45.065 7.435   1.00 19.46 ? 50  THR B N   1 
ATOM   347  C CA  . THR A 1 45  ? 35.617 43.636 7.253   1.00 17.82 ? 50  THR B CA  1 
ATOM   348  C C   . THR A 1 45  ? 36.187 43.185 5.925   1.00 15.33 ? 50  THR B C   1 
ATOM   349  O O   . THR A 1 45  ? 36.716 43.956 5.121   1.00 15.39 ? 50  THR B O   1 
ATOM   350  C CB  . THR A 1 45  ? 34.128 43.309 7.396   1.00 19.78 ? 50  THR B CB  1 
ATOM   351  O OG1 . THR A 1 45  ? 33.918 41.864 7.511   1.00 21.78 ? 50  THR B OG1 1 
ATOM   352  C CG2 . THR A 1 45  ? 33.383 43.910 6.215   1.00 21.84 ? 50  THR B CG2 1 
ATOM   353  N N   . GLY A 1 46  ? 36.136 41.864 5.756   1.00 12.59 ? 51  GLY B N   1 
ATOM   354  C CA  . GLY A 1 46  ? 36.552 41.263 4.530   1.00 11.05 ? 51  GLY B CA  1 
ATOM   355  C C   . GLY A 1 46  ? 36.473 39.762 4.644   1.00 10.06 ? 51  GLY B C   1 
ATOM   356  O O   . GLY A 1 46  ? 36.125 39.260 5.762   1.00 9.78  ? 51  GLY B O   1 
ATOM   357  N N   . THR A 1 47  ? 36.776 39.022 3.572   1.00 9.56  ? 52  THR B N   1 
ATOM   358  C CA  . THR A 1 47  ? 36.703 37.557 3.599   1.00 9.14  ? 52  THR B CA  1 
ATOM   359  C C   . THR A 1 47  ? 37.772 36.958 2.709   1.00 9.18  ? 52  THR B C   1 
ATOM   360  O O   . THR A 1 47  ? 38.284 37.635 1.830   1.00 10.87 ? 52  THR B O   1 
ATOM   361  C CB  . THR A 1 47  ? 35.352 36.961 3.142   1.00 10.06 ? 52  THR B CB  1 
ATOM   362  O OG1 . THR A 1 47  ? 35.145 37.286 1.793   1.00 11.76 ? 52  THR B OG1 1 
ATOM   363  C CG2 . THR A 1 47  ? 34.248 37.353 3.987   1.00 10.11 ? 52  THR B CG2 1 
ATOM   364  N N   . VAL A 1 48  ? 38.127 35.728 2.929   1.00 8.78  ? 53  VAL B N   1 
ATOM   365  C CA  . VAL A 1 48  ? 39.025 34.948 2.152   1.00 9.78  ? 53  VAL B CA  1 
ATOM   366  C C   . VAL A 1 48  ? 38.356 33.623 1.769   1.00 10.43 ? 53  VAL B C   1 
ATOM   367  O O   . VAL A 1 48  ? 37.665 33.035 2.605   1.00 10.06 ? 53  VAL B O   1 
ATOM   368  C CB  . VAL A 1 48  ? 40.317 34.644 2.950   1.00 10.88 ? 53  VAL B CB  1 
ATOM   369  C CG1 . VAL A 1 48  ? 41.233 33.692 2.198   1.00 13.57 ? 53  VAL B CG1 1 
ATOM   370  C CG2 . VAL A 1 48  ? 40.981 35.963 3.358   1.00 12.42 ? 53  VAL B CG2 1 
ATOM   371  N N   . ASP A 1 49  ? 38.552 33.190 0.531   1.00 10.30 ? 54  ASP B N   1 
ATOM   372  C CA  . ASP A 1 49  ? 38.192 31.852 0.051   1.00 10.62 ? 54  ASP B CA  1 
ATOM   373  C C   . ASP A 1 49  ? 39.327 31.384 -0.745  1.00 11.14 ? 54  ASP B C   1 
ATOM   374  O O   . ASP A 1 49  ? 39.613 31.982 -1.823  1.00 11.08 ? 54  ASP B O   1 
ATOM   375  C CB  . ASP A 1 49  ? 36.898 31.991 -0.803  1.00 12.50 ? 54  ASP B CB  1 
ATOM   376  C CG  . ASP A 1 49  ? 36.526 30.774 -1.493  1.00 19.53 ? 54  ASP B CG  1 
ATOM   377  O OD1 . ASP A 1 49  ? 36.887 29.689 -1.023  1.00 21.81 ? 54  ASP B OD1 1 
ATOM   378  O OD2 . ASP A 1 49  ? 35.769 30.923 -2.495  1.00 24.63 ? 54  ASP B OD2 1 
ATOM   379  N N   . VAL A 1 50  ? 40.050 30.380 -0.278  1.00 9.44  ? 55  VAL B N   1 
ATOM   380  C CA  . VAL A 1 50  ? 41.277 29.927 -1.009  1.00 9.82  ? 55  VAL B CA  1 
ATOM   381  C C   . VAL A 1 50  ? 41.340 28.421 -1.042  1.00 9.44  ? 55  VAL B C   1 
ATOM   382  O O   . VAL A 1 50  ? 40.892 27.705 -0.108  1.00 10.10 ? 55  VAL B O   1 
ATOM   383  C CB  . VAL A 1 50  ? 42.483 30.547 -0.304  1.00 11.94 ? 55  VAL B CB  1 
ATOM   384  C CG1 . VAL A 1 50  ? 42.562 30.167 1.135   1.00 13.41 ? 55  VAL B CG1 1 
ATOM   385  C CG2 . VAL A 1 50  ? 43.770 30.251 -1.057  1.00 13.17 ? 55  VAL B CG2 1 
ATOM   386  N N   . THR A 1 51  ? 41.836 27.869 -2.136  1.00 9.13  ? 56  THR B N   1 
ATOM   387  C CA  . THR A 1 51  ? 41.946 26.474 -2.347  1.00 9.76  ? 56  THR B CA  1 
ATOM   388  C C   . THR A 1 51  ? 43.381 26.120 -2.740  1.00 10.39 ? 56  THR B C   1 
ATOM   389  O O   . THR A 1 51  ? 43.957 26.836 -3.562  1.00 11.97 ? 56  THR B O   1 
ATOM   390  C CB  . THR A 1 51  ? 40.965 26.054 -3.463  1.00 12.32 ? 56  THR B CB  1 
ATOM   391  O OG1 . THR A 1 51  ? 39.630 26.342 -2.967  1.00 14.74 ? 56  THR B OG1 1 
ATOM   392  C CG2 . THR A 1 51  ? 40.945 24.605 -3.597  1.00 14.86 ? 56  THR B CG2 1 
ATOM   393  N N   . THR A 1 52  ? 43.933 25.038 -2.184  1.00 9.59  ? 57  THR B N   1 
ATOM   394  C CA  . THR A 1 52  ? 45.283 24.581 -2.444  1.00 10.02 ? 57  THR B CA  1 
ATOM   395  C C   . THR A 1 52  ? 45.236 23.144 -2.955  1.00 9.92  ? 57  THR B C   1 
ATOM   396  O O   . THR A 1 52  ? 44.476 22.310 -2.397  1.00 10.37 ? 57  THR B O   1 
ATOM   397  C CB  . THR A 1 52  ? 46.132 24.735 -1.173  1.00 11.31 ? 57  THR B CB  1 
ATOM   398  O OG1 . THR A 1 52  ? 46.202 26.127 -0.826  1.00 12.10 ? 57  THR B OG1 1 
ATOM   399  C CG2 . THR A 1 52  ? 47.502 24.249 -1.390  1.00 12.74 ? 57  THR B CG2 1 
ATOM   400  N N   . ASP A 1 53  ? 46.058 22.822 -3.948  1.00 10.05 ? 58  ASP B N   1 
ATOM   401  C CA  . ASP A 1 53  ? 46.019 21.420 -4.553  1.00 11.39 ? 58  ASP B CA  1 
ATOM   402  C C   . ASP A 1 53  ? 47.023 20.633 -3.718  1.00 10.83 ? 58  ASP B C   1 
ATOM   403  O O   . ASP A 1 53  ? 48.214 20.941 -3.681  1.00 11.45 ? 58  ASP B O   1 
ATOM   404  C CB  . ASP A 1 53  ? 46.507 21.493 -5.999  1.00 14.66 ? 58  ASP B CB  1 
ATOM   405  C CG  . ASP A 1 53  ? 45.454 22.049 -6.976  1.00 20.30 ? 58  ASP B CG  1 
ATOM   406  O OD1 . ASP A 1 53  ? 44.293 22.277 -6.567  1.00 23.98 ? 58  ASP B OD1 1 
ATOM   407  O OD2 . ASP A 1 53  ? 45.839 22.229 -8.162  1.00 30.05 ? 58  ASP B OD2 1 
ATOM   408  N N   . ILE A 1 54  ? 46.611 19.524 -3.170  1.00 10.04 ? 59  ILE B N   1 
ATOM   409  C CA  . ILE A 1 54  ? 47.489 18.706 -2.357  1.00 10.07 ? 59  ILE B CA  1 
ATOM   410  C C   . ILE A 1 54  ? 48.614 18.082 -3.180  1.00 10.19 ? 59  ILE B C   1 
ATOM   411  O O   . ILE A 1 54  ? 49.733 17.896 -2.707  1.00 11.36 ? 59  ILE B O   1 
ATOM   412  C CB  . ILE A 1 54  ? 46.672 17.566 -1.698  1.00 10.93 ? 59  ILE B CB  1 
ATOM   413  C CG1 . ILE A 1 54  ? 45.695 18.155 -0.713  1.00 10.12 ? 59  ILE B CG1 1 
ATOM   414  C CG2 . ILE A 1 54  ? 47.529 16.525 -1.039  1.00 12.15 ? 59  ILE B CG2 1 
ATOM   415  C CD1 . ILE A 1 54  ? 46.309 18.934 0.495   1.00 10.82 ? 59  ILE B CD1 1 
ATOM   416  N N   . ALA A 1 55  ? 48.355 17.753 -4.425  1.00 10.52 ? 60  ALA B N   1 
ATOM   417  C CA  . ALA A 1 55  ? 49.367 17.215 -5.320  1.00 11.94 ? 60  ALA B CA  1 
ATOM   418  C C   . ALA A 1 55  ? 50.516 18.139 -5.600  1.00 11.31 ? 60  ALA B C   1 
ATOM   419  O O   . ALA A 1 55  ? 51.545 17.679 -6.149  1.00 13.57 ? 60  ALA B O   1 
ATOM   420  C CB  . ALA A 1 55  ? 48.742 16.788 -6.630  1.00 13.65 ? 60  ALA B CB  1 
ATOM   421  N N   . SER A 1 56  ? 50.401 19.430 -5.302  1.00 10.47 ? 61  SER B N   1 
ATOM   422  C CA  . SER A 1 56  ? 51.435 20.392 -5.501  1.00 9.94  ? 61  SER B CA  1 
ATOM   423  C C   . SER A 1 56  ? 52.423 20.496 -4.353  1.00 9.84  ? 61  SER B C   1 
ATOM   424  O O   . SER A 1 56  ? 53.277 21.433 -4.379  1.00 10.13 ? 61  SER B O   1 
ATOM   425  C CB  . SER A 1 56  ? 50.864 21.707 -5.845  1.00 10.34 ? 61  SER B CB  1 
ATOM   426  O OG  . SER A 1 56  ? 50.291 22.399 -4.705  1.00 9.62  ? 61  SER B OG  1 
ATOM   427  N N   . ILE A 1 57  ? 52.320 19.649 -3.374  1.00 9.58  ? 62  ILE B N   1 
ATOM   428  C CA  . ILE A 1 57  ? 53.301 19.680 -2.259  1.00 9.71  ? 62  ILE B CA  1 
ATOM   429  C C   . ILE A 1 57  ? 54.740 19.584 -2.752  1.00 10.75 ? 62  ILE B C   1 
ATOM   430  O O   . ILE A 1 57  ? 55.017 18.753 -3.623  1.00 12.31 ? 62  ILE B O   1 
ATOM   431  C CB  . ILE A 1 57  ? 52.982 18.702 -1.141  1.00 11.21 ? 62  ILE B CB  1 
ATOM   432  C CG1 . ILE A 1 57  ? 53.639 19.139 0.191   1.00 11.58 ? 62  ILE B CG1 1 
ATOM   433  C CG2 . ILE A 1 57  ? 53.264 17.281 -1.591  1.00 10.77 ? 62  ILE B CG2 1 
ATOM   434  C CD1 . ILE A 1 57  ? 53.186 18.331 1.363   1.00 11.97 ? 62  ILE B CD1 1 
ATOM   435  N N   . HIS A 1 58  ? 55.635 20.332 -2.087  1.00 10.86 ? 63  HIS B N   1 
ATOM   436  C CA  . HIS A 1 58  ? 57.035 20.116 -2.273  1.00 12.66 ? 63  HIS B CA  1 
ATOM   437  C C   . HIS A 1 58  ? 57.709 20.137 -0.893  1.00 12.30 ? 63  HIS B C   1 
ATOM   438  O O   . HIS A 1 58  ? 57.737 21.175 -0.256  1.00 13.70 ? 63  HIS B O   1 
ATOM   439  C CB  . HIS A 1 58  ? 57.620 21.275 -3.079  1.00 15.16 ? 63  HIS B CB  1 
ATOM   440  C CG  . HIS A 1 58  ? 59.094 21.132 -3.410  1.00 18.91 ? 63  HIS B CG  1 
ATOM   441  N ND1 . HIS A 1 58  ? 59.535 20.508 -4.561  1.00 20.70 ? 63  HIS B ND1 1 
ATOM   442  C CD2 . HIS A 1 58  ? 60.221 21.513 -2.728  1.00 22.09 ? 63  HIS B CD2 1 
ATOM   443  C CE1 . HIS A 1 58  ? 60.884 20.456 -4.543  1.00 20.24 ? 63  HIS B CE1 1 
ATOM   444  N NE2 . HIS A 1 58  ? 61.307 21.105 -3.460  1.00 23.08 ? 63  HIS B NE2 1 
ATOM   445  N N   . THR A 1 59  ? 58.328 19.030 -0.514  1.00 13.58 ? 64  THR B N   1 
ATOM   446  C CA  . THR A 1 59  ? 59.076 18.944 0.687   1.00 14.67 ? 64  THR B CA  1 
ATOM   447  C C   . THR A 1 59  ? 60.573 19.033 0.581   1.00 17.02 ? 64  THR B C   1 
ATOM   448  O O   . THR A 1 59  ? 61.275 19.112 1.616   1.00 18.12 ? 64  THR B O   1 
ATOM   449  C CB  . THR A 1 59  ? 58.794 17.631 1.408   1.00 15.92 ? 64  THR B CB  1 
ATOM   450  O OG1 . THR A 1 59  ? 59.249 16.544 0.604   1.00 16.67 ? 64  THR B OG1 1 
ATOM   451  C CG2 . THR A 1 59  ? 57.297 17.411 1.700   1.00 17.63 ? 64  THR B CG2 1 
ATOM   452  N N   . GLY A 1 60  ? 61.082 18.865 -0.600  1.00 16.28 ? 65  GLY B N   1 
ATOM   453  C CA  . GLY A 1 60  ? 62.526 18.693 -0.843  1.00 17.58 ? 65  GLY B CA  1 
ATOM   454  C C   . GLY A 1 60  ? 62.856 17.282 -1.156  1.00 18.92 ? 65  GLY B C   1 
ATOM   455  O O   . GLY A 1 60  ? 63.891 16.982 -1.715  1.00 17.21 ? 65  GLY B O   1 
ATOM   456  N N   . SER A 1 61  ? 61.970 16.351 -0.768  1.00 17.66 ? 66  SER B N   1 
ATOM   457  C CA  . SER A 1 61  ? 62.108 14.963 -1.127  1.00 20.41 ? 66  SER B CA  1 
ATOM   458  C C   . SER A 1 61  ? 60.963 14.523 -2.057  1.00 21.61 ? 66  SER B C   1 
ATOM   459  O O   . SER A 1 61  ? 59.777 14.433 -1.642  1.00 19.14 ? 66  SER B O   1 
ATOM   460  C CB  . SER A 1 61  ? 62.065 14.220 0.148   1.00 19.75 ? 66  SER B CB  1 
ATOM   461  O OG  . SER A 1 61  ? 61.969 12.857 -0.088  1.00 21.55 ? 66  SER B OG  1 
ATOM   462  N N   . ALA A 1 62  ? 61.294 14.204 -3.293  1.00 22.73 ? 67  ALA B N   1 
ATOM   463  C CA  . ALA A 1 62  ? 60.266 13.755 -4.233  1.00 23.20 ? 67  ALA B CA  1 
ATOM   464  C C   . ALA A 1 62  ? 59.575 12.491 -3.722  1.00 24.12 ? 67  ALA B C   1 
ATOM   465  O O   . ALA A 1 62  ? 58.348 12.336 -3.955  1.00 22.22 ? 67  ALA B O   1 
ATOM   466  C CB  . ALA A 1 62  ? 60.828 13.515 -5.616  1.00 26.81 ? 67  ALA B CB  1 
ATOM   467  N N   . LYS A 1 63  ? 60.315 11.626 -3.053  1.00 22.19 ? 68  LYS B N   1 
ATOM   468  C CA  . LYS A 1 63  ? 59.757 10.425 -2.521  1.00 24.49 ? 68  LYS B CA  1 
ATOM   469  C C   . LYS A 1 63  ? 58.738 10.728 -1.412  1.00 21.18 ? 68  LYS B C   1 
ATOM   470  O O   . LYS A 1 63  ? 57.747 10.027 -1.374  1.00 22.41 ? 68  LYS B O   1 
ATOM   471  C CB  . LYS A 1 63  ? 60.811 9.406  -2.009  1.00 28.91 ? 68  LYS B CB  1 
ATOM   472  C CG  . LYS A 1 63  ? 61.675 8.821  -3.121  1.00 33.97 ? 68  LYS B CG  1 
ATOM   473  C CD  . LYS A 1 63  ? 60.857 8.142  -4.219  1.00 39.19 ? 68  LYS B CD  1 
ATOM   474  C CE  . LYS A 1 63  ? 61.672 7.080  -4.965  1.00 43.95 ? 68  LYS B CE  1 
ATOM   475  N NZ  . LYS A 1 63  ? 60.866 5.841  -5.091  1.00 44.40 ? 68  LYS B NZ  1 
ATOM   476  N N   . LEU A 1 64  ? 59.061 11.630 -0.469  1.00 20.65 ? 69  LEU B N   1 
ATOM   477  C CA  . LEU A 1 64  ? 58.116 12.007 0.580   1.00 17.65 ? 69  LEU B CA  1 
ATOM   478  C C   . LEU A 1 64  ? 56.862 12.623 -0.068  1.00 19.36 ? 69  LEU B C   1 
ATOM   479  O O   . LEU A 1 64  ? 55.726 12.255 0.258   1.00 18.42 ? 69  LEU B O   1 
ATOM   480  C CB  . LEU A 1 64  ? 58.743 12.896 1.606   1.00 18.08 ? 69  LEU B CB  1 
ATOM   481  C CG  . LEU A 1 64  ? 57.901 13.388 2.694   1.00 17.97 ? 69  LEU B CG  1 
ATOM   482  C CD1 . LEU A 1 64  ? 57.357 12.201 3.507   1.00 19.03 ? 69  LEU B CD1 1 
ATOM   483  C CD2 . LEU A 1 64  ? 58.609 14.375 3.597   1.00 18.17 ? 69  LEU B CD2 1 
ATOM   484  N N   . ASP A 1 65  ? 57.065 13.531 -1.011  1.00 16.15 ? 70  ASP B N   1 
ATOM   485  C CA  . ASP A 1 65  ? 55.943 14.190 -1.703  1.00 17.57 ? 70  ASP B CA  1 
ATOM   486  C C   . ASP A 1 65  ? 54.936 13.142 -2.192  1.00 17.65 ? 70  ASP B C   1 
ATOM   487  O O   . ASP A 1 65  ? 53.689 13.279 -2.039  1.00 17.42 ? 70  ASP B O   1 
ATOM   488  C CB  . ASP A 1 65  ? 56.295 15.107 -2.904  1.00 18.61 ? 70  ASP B CB  1 
ATOM   489  C CG  . ASP A 1 65  ? 57.211 16.207 -2.624  1.00 20.94 ? 70  ASP B CG  1 
ATOM   490  O OD1 . ASP A 1 65  ? 57.356 16.546 -1.445  1.00 21.81 ? 70  ASP B OD1 1 
ATOM   491  O OD2 . ASP A 1 65  ? 57.813 16.780 -3.637  1.00 25.59 ? 70  ASP B OD2 1 
ATOM   492  N N   . GLU A 1 66  ? 55.475 12.106 -2.891  1.00 18.68 ? 71  GLU B N   1 
ATOM   493  C CA  . GLU A 1 66  ? 54.606 11.081 -3.506  1.00 20.81 ? 71  GLU B CA  1 
ATOM   494  C C   . GLU A 1 66  ? 53.921 10.224 -2.422  1.00 18.24 ? 71  GLU B C   1 
ATOM   495  O O   . GLU A 1 66  ? 52.679 9.952  -2.475  1.00 18.86 ? 71  GLU B O   1 
ATOM   496  C CB  . GLU A 1 66  ? 55.459 10.270 -4.519  1.00 25.45 ? 71  GLU B CB  1 
ATOM   497  C CG  . GLU A 1 66  ? 54.792 9.040  -5.115  1.00 30.78 ? 71  GLU B CG  1 
ATOM   498  C CD  . GLU A 1 66  ? 55.761 8.338  -6.103  1.00 40.43 ? 71  GLU B CD  1 
ATOM   499  O OE1 . GLU A 1 66  ? 56.991 8.248  -5.784  1.00 44.78 ? 71  GLU B OE1 1 
ATOM   500  O OE2 . GLU A 1 66  ? 55.291 7.923  -7.193  1.00 48.23 ? 71  GLU B OE2 1 
ATOM   501  N N   . HIS A 1 67  ? 54.666 9.884  -1.385  1.00 17.79 ? 72  HIS B N   1 
ATOM   502  C CA  . HIS A 1 67  ? 54.138 9.119  -0.292  1.00 19.39 ? 72  HIS B CA  1 
ATOM   503  C C   . HIS A 1 67  ? 53.002 9.824  0.438   1.00 18.80 ? 72  HIS B C   1 
ATOM   504  O O   . HIS A 1 67  ? 52.001 9.201  0.837   1.00 19.48 ? 72  HIS B O   1 
ATOM   505  C CB  . HIS A 1 67  ? 55.244 8.854  0.687   1.00 22.27 ? 72  HIS B CB  1 
ATOM   506  C CG  . HIS A 1 67  ? 54.798 8.211  1.938   1.00 23.81 ? 72  HIS B CG  1 
ATOM   507  N ND1 . HIS A 1 67  ? 54.305 6.926  1.952   1.00 31.07 ? 72  HIS B ND1 1 
ATOM   508  C CD2 . HIS A 1 67  ? 54.781 8.641  3.209   1.00 28.68 ? 72  HIS B CD2 1 
ATOM   509  C CE1 . HIS A 1 67  ? 53.983 6.607  3.188   1.00 28.95 ? 72  HIS B CE1 1 
ATOM   510  N NE2 . HIS A 1 67  ? 54.274 7.628  3.969   1.00 33.14 ? 72  HIS B NE2 1 
ATOM   511  N N   . LEU A 1 68  ? 53.142 11.144 0.649   1.00 14.94 ? 73  LEU B N   1 
ATOM   512  C CA  . LEU A 1 68  ? 52.120 11.878 1.354   1.00 14.69 ? 73  LEU B CA  1 
ATOM   513  C C   . LEU A 1 68  ? 50.807 11.929 0.598   1.00 13.76 ? 73  LEU B C   1 
ATOM   514  O O   . LEU A 1 68  ? 49.756 12.267 1.218   1.00 13.95 ? 73  LEU B O   1 
ATOM   515  C CB  . LEU A 1 68  ? 52.606 13.301 1.660   1.00 15.24 ? 73  LEU B CB  1 
ATOM   516  C CG  . LEU A 1 68  ? 53.773 13.399 2.664   1.00 16.03 ? 73  LEU B CG  1 
ATOM   517  C CD1 . LEU A 1 68  ? 54.216 14.822 2.905   1.00 16.78 ? 73  LEU B CD1 1 
ATOM   518  C CD2 . LEU A 1 68  ? 53.489 12.659 3.991   1.00 19.19 ? 73  LEU B CD2 1 
ATOM   519  N N   . GLN A 1 69  ? 50.820 11.691 -0.688  1.00 14.32 ? 74  GLN B N   1 
ATOM   520  C CA  . GLN A 1 69  ? 49.560 11.707 -1.446  1.00 13.71 ? 74  GLN B CA  1 
ATOM   521  C C   . GLN A 1 69  ? 48.681 10.453 -1.143  1.00 14.82 ? 74  GLN B C   1 
ATOM   522  O O   . GLN A 1 69  ? 47.502 10.458 -1.465  1.00 14.44 ? 74  GLN B O   1 
ATOM   523  C CB  . GLN A 1 69  ? 49.824 11.667 -2.927  1.00 15.22 ? 74  GLN B CB  1 
ATOM   524  C CG  . GLN A 1 69  ? 50.684 12.724 -3.446  1.00 15.30 ? 74  GLN B CG  1 
ATOM   525  C CD  . GLN A 1 69  ? 50.135 14.078 -3.212  1.00 14.05 ? 74  GLN B CD  1 
ATOM   526  O OE1 . GLN A 1 69  ? 48.994 14.396 -3.629  1.00 15.34 ? 74  GLN B OE1 1 
ATOM   527  N NE2 . GLN A 1 69  ? 50.910 14.931 -2.528  1.00 15.23 ? 74  GLN B NE2 1 
ATOM   528  N N   . THR A 1 70  ? 49.329 9.416  -0.614  1.00 15.46 ? 75  THR B N   1 
ATOM   529  C CA  . THR A 1 70  ? 48.618 8.148  -0.433  1.00 16.95 ? 75  THR B CA  1 
ATOM   530  C C   . THR A 1 70  ? 47.652 8.176  0.744   1.00 16.25 ? 75  THR B C   1 
ATOM   531  O O   . THR A 1 70  ? 47.563 9.133  1.495   1.00 15.27 ? 75  THR B O   1 
ATOM   532  C CB  . THR A 1 70  ? 49.585 7.022  -0.212  1.00 17.22 ? 75  THR B CB  1 
ATOM   533  O OG1 . THR A 1 70  ? 50.179 7.125  1.067   1.00 20.32 ? 75  THR B OG1 1 
ATOM   534  C CG2 . THR A 1 70  ? 50.633 6.983  -1.233  1.00 19.08 ? 75  THR B CG2 1 
ATOM   535  N N   . ALA A 1 71  ? 46.872 7.120  0.894   1.00 16.63 ? 76  ALA B N   1 
ATOM   536  C CA  . ALA A 1 71  ? 45.913 7.006  1.976   1.00 19.34 ? 76  ALA B CA  1 
ATOM   537  C C   . ALA A 1 71  ? 46.535 6.952  3.335   1.00 18.67 ? 76  ALA B C   1 
ATOM   538  O O   . ALA A 1 71  ? 45.801 7.176  4.286   1.00 21.43 ? 76  ALA B O   1 
ATOM   539  C CB  . ALA A 1 71  ? 45.029 5.786  1.763   1.00 21.17 ? 76  ALA B CB  1 
ATOM   540  N N   . GLU A 1 72  ? 47.832 6.711  3.473   1.00 17.69 ? 77  GLU B N   1 
ATOM   541  C CA  . GLU A 1 72  ? 48.502 6.798  4.738   1.00 19.25 ? 77  GLU B CA  1 
ATOM   542  C C   . GLU A 1 72  ? 48.555 8.229  5.259   1.00 19.65 ? 77  GLU B C   1 
ATOM   543  O O   . GLU A 1 72  ? 48.821 8.433  6.443   1.00 22.75 ? 77  GLU B O   1 
ATOM   544  C CB  . GLU A 1 72  ? 49.893 6.246  4.698   1.00 21.59 ? 77  GLU B CB  1 
ATOM   545  C CG  . GLU A 1 72  ? 49.995 4.783  4.461   1.00 25.66 ? 77  GLU B CG  1 
ATOM   546  C CD  . GLU A 1 72  ? 51.385 4.199  4.639   1.00 28.46 ? 77  GLU B CD  1 
ATOM   547  O OE1 . GLU A 1 72  ? 52.046 4.377  5.719   1.00 33.93 ? 77  GLU B OE1 1 
ATOM   548  O OE2 . GLU A 1 72  ? 51.792 3.518  3.675   1.00 33.35 ? 77  GLU B OE2 1 
ATOM   549  N N   . PHE A 1 73  ? 48.392 9.190  4.364   1.00 16.39 ? 78  PHE B N   1 
ATOM   550  C CA  . PHE A 1 73  ? 48.468 10.582 4.823   1.00 14.18 ? 78  PHE B CA  1 
ATOM   551  C C   . PHE A 1 73  ? 47.286 11.394 4.144   1.00 13.33 ? 78  PHE B C   1 
ATOM   552  O O   . PHE A 1 73  ? 46.150 11.255 4.577   1.00 13.42 ? 78  PHE B O   1 
ATOM   553  C CB  . PHE A 1 73  ? 49.856 11.146 4.623   1.00 15.22 ? 78  PHE B CB  1 
ATOM   554  C CG  . PHE A 1 73  ? 50.202 12.285 5.576   1.00 15.89 ? 78  PHE B CG  1 
ATOM   555  C CD1 . PHE A 1 73  ? 50.705 12.061 6.798   1.00 20.03 ? 78  PHE B CD1 1 
ATOM   556  C CD2 . PHE A 1 73  ? 50.053 13.589 5.180   1.00 14.68 ? 78  PHE B CD2 1 
ATOM   557  C CE1 . PHE A 1 73  ? 50.914 13.164 7.666   1.00 18.86 ? 78  PHE B CE1 1 
ATOM   558  C CE2 . PHE A 1 73  ? 50.268 14.672 6.054   1.00 15.10 ? 78  PHE B CE2 1 
ATOM   559  C CZ  . PHE A 1 73  ? 50.734 14.411 7.265   1.00 16.11 ? 78  PHE B CZ  1 
ATOM   560  N N   . PHE A 1 74  ? 47.529 12.203 3.134   1.00 12.32 ? 79  PHE B N   1 
ATOM   561  C CA  . PHE A 1 74  ? 46.520 13.092 2.610   1.00 12.08 ? 79  PHE B CA  1 
ATOM   562  C C   . PHE A 1 74  ? 45.330 12.395 1.895   1.00 12.25 ? 79  PHE B C   1 
ATOM   563  O O   . PHE A 1 74  ? 44.304 12.963 1.804   1.00 12.70 ? 79  PHE B O   1 
ATOM   564  C CB  . PHE A 1 74  ? 47.118 14.104 1.675   1.00 12.36 ? 79  PHE B CB  1 
ATOM   565  C CG  . PHE A 1 74  ? 48.000 15.171 2.337   1.00 12.34 ? 79  PHE B CG  1 
ATOM   566  C CD1 . PHE A 1 74  ? 47.495 16.018 3.276   1.00 12.86 ? 79  PHE B CD1 1 
ATOM   567  C CD2 . PHE A 1 74  ? 49.290 15.376 1.876   1.00 13.38 ? 79  PHE B CD2 1 
ATOM   568  C CE1 . PHE A 1 74  ? 48.332 17.006 3.866   1.00 12.32 ? 79  PHE B CE1 1 
ATOM   569  C CE2 . PHE A 1 74  ? 50.126 16.312 2.500   1.00 14.28 ? 79  PHE B CE2 1 
ATOM   570  C CZ  . PHE A 1 74  ? 49.595 17.178 3.431   1.00 12.88 ? 79  PHE B CZ  1 
ATOM   571  N N   . ASP A 1 75  ? 45.582 11.220 1.365   1.00 13.86 ? 80  ASP B N   1 
ATOM   572  C CA  . ASP A 1 75  ? 44.548 10.564 0.497   1.00 14.47 ? 80  ASP B CA  1 
ATOM   573  C C   . ASP A 1 75  ? 44.020 11.506 -0.535  1.00 14.09 ? 80  ASP B C   1 
ATOM   574  O O   . ASP A 1 75  ? 42.866 11.793 -0.704  1.00 15.13 ? 80  ASP B O   1 
ATOM   575  C CB  . ASP A 1 75  ? 43.450 9.984  1.371   1.00 17.19 ? 80  ASP B CB  1 
ATOM   576  C CG  . ASP A 1 75  ? 42.756 8.794  0.726   1.00 21.10 ? 80  ASP B CG  1 
ATOM   577  O OD1 . ASP A 1 75  ? 43.089 8.487  -0.431  1.00 25.66 ? 80  ASP B OD1 1 
ATOM   578  O OD2 . ASP A 1 75  ? 41.853 8.263  1.414   1.00 25.49 ? 80  ASP B OD2 1 
ATOM   579  N N   . ALA A 1 76  ? 44.947 12.004 -1.324  1.00 14.39 ? 81  ALA B N   1 
ATOM   580  C CA  . ALA A 1 76  ? 44.672 12.976 -2.359  1.00 16.20 ? 81  ALA B CA  1 
ATOM   581  C C   . ALA A 1 76  ? 43.753 12.485 -3.426  1.00 17.01 ? 81  ALA B C   1 
ATOM   582  O O   . ALA A 1 76  ? 43.095 13.303 -4.096  1.00 18.78 ? 81  ALA B O   1 
ATOM   583  C CB  . ALA A 1 76  ? 45.968 13.481 -2.944  1.00 17.64 ? 81  ALA B CB  1 
ATOM   584  N N   . ALA A 1 77  ? 43.698 11.166 -3.604  1.00 17.85 ? 82  ALA B N   1 
ATOM   585  C CA  . ALA A 1 77  ? 42.708 10.633 -4.563  1.00 20.41 ? 82  ALA B CA  1 
ATOM   586  C C   . ALA A 1 77  ? 41.288 11.005 -4.182  1.00 19.51 ? 82  ALA B C   1 
ATOM   587  O O   . ALA A 1 77  ? 40.503 11.421 -5.076  1.00 24.08 ? 82  ALA B O   1 
ATOM   588  C CB  . ALA A 1 77  ? 42.890 9.111  -4.665  1.00 23.93 ? 82  ALA B CB  1 
ATOM   589  N N   . LYS A 1 78  ? 40.959 10.909 -2.893  1.00 17.17 ? 83  LYS B N   1 
ATOM   590  C CA  . LYS A 1 78  ? 39.653 11.239 -2.340  1.00 15.67 ? 83  LYS B CA  1 
ATOM   591  C C   . LYS A 1 78  ? 39.492 12.730 -2.076  1.00 14.38 ? 83  LYS B C   1 
ATOM   592  O O   . LYS A 1 78  ? 38.508 13.320 -2.347  1.00 13.81 ? 83  LYS B O   1 
ATOM   593  C CB  . LYS A 1 78  ? 39.311 10.532 -1.012  1.00 18.58 ? 83  LYS B CB  1 
ATOM   594  C CG  . LYS A 1 78  ? 39.198 9.019  -1.042  1.00 25.49 ? 83  LYS B CG  1 
ATOM   595  C CD  . LYS A 1 78  ? 38.648 8.652  0.309   1.00 28.39 ? 83  LYS B CD  1 
ATOM   596  C CE  . LYS A 1 78  ? 38.517 7.168  0.451   1.00 37.72 ? 83  LYS B CE  1 
ATOM   597  N NZ  . LYS A 1 78  ? 37.916 6.842  1.757   1.00 42.35 ? 83  LYS B NZ  1 
ATOM   598  N N   . PHE A 1 79  ? 40.603 13.339 -1.599  1.00 12.74 ? 84  PHE B N   1 
ATOM   599  C CA  . PHE A 1 79  ? 40.575 14.740 -1.169  1.00 12.85 ? 84  PHE B CA  1 
ATOM   600  C C   . PHE A 1 79  ? 41.704 15.551 -1.880  1.00 12.91 ? 84  PHE B C   1 
ATOM   601  O O   . PHE A 1 79  ? 42.765 15.776 -1.227  1.00 11.62 ? 84  PHE B O   1 
ATOM   602  C CB  . PHE A 1 79  ? 40.707 14.799 0.337   1.00 14.09 ? 84  PHE B CB  1 
ATOM   603  C CG  . PHE A 1 79  ? 39.781 13.922 1.104   1.00 14.70 ? 84  PHE B CG  1 
ATOM   604  C CD1 . PHE A 1 79  ? 38.441 14.129 1.034   1.00 15.22 ? 84  PHE B CD1 1 
ATOM   605  C CD2 . PHE A 1 79  ? 40.297 12.909 1.899   1.00 15.16 ? 84  PHE B CD2 1 
ATOM   606  C CE1 . PHE A 1 79  ? 37.602 13.234 1.770   1.00 15.24 ? 84  PHE B CE1 1 
ATOM   607  C CE2 . PHE A 1 79  ? 39.446 12.071 2.624   1.00 17.42 ? 84  PHE B CE2 1 
ATOM   608  C CZ  . PHE A 1 79  ? 38.125 12.249 2.475   1.00 15.51 ? 84  PHE B CZ  1 
ATOM   609  N N   . PRO A 1 80  ? 41.552 15.903 -3.133  1.00 11.95 ? 85  PRO B N   1 
ATOM   610  C CA  . PRO A 1 80  ? 42.658 16.538 -3.912  1.00 11.62 ? 85  PRO B CA  1 
ATOM   611  C C   . PRO A 1 80  ? 42.982 17.938 -3.435  1.00 10.58 ? 85  PRO B C   1 
ATOM   612  O O   . PRO A 1 80  ? 43.969 18.462 -3.861  1.00 10.03 ? 85  PRO B O   1 
ATOM   613  C CB  . PRO A 1 80  ? 42.151 16.542 -5.338  1.00 13.41 ? 85  PRO B CB  1 
ATOM   614  C CG  . PRO A 1 80  ? 40.717 16.271 -5.265  1.00 14.47 ? 85  PRO B CG  1 
ATOM   615  C CD  . PRO A 1 80  ? 40.442 15.523 -4.041  1.00 12.84 ? 85  PRO B CD  1 
ATOM   616  N N   . GLN A 1 81  ? 42.065 18.583 -2.709  1.00 11.09 ? 86  GLN B N   1 
ATOM   617  C CA  . GLN A 1 81  ? 42.238 20.007 -2.382  1.00 11.19 ? 86  GLN B CA  1 
ATOM   618  C C   . GLN A 1 81  ? 42.028 20.203 -0.897  1.00 11.39 ? 86  GLN B C   1 
ATOM   619  O O   . GLN A 1 81  ? 41.394 19.367 -0.223  1.00 13.34 ? 86  GLN B O   1 
ATOM   620  C CB  . GLN A 1 81  ? 41.253 20.836 -3.210  1.00 14.87 ? 86  GLN B CB  1 
ATOM   621  C CG  . GLN A 1 81  ? 41.616 20.834 -4.691  1.00 17.85 ? 86  GLN B CG  1 
ATOM   622  C CD  . GLN A 1 81  ? 40.644 21.630 -5.497  1.00 23.69 ? 86  GLN B CD  1 
ATOM   623  O OE1 . GLN A 1 81  ? 39.453 21.555 -5.290  1.00 27.74 ? 86  GLN B OE1 1 
ATOM   624  N NE2 . GLN A 1 81  ? 41.175 22.443 -6.420  1.00 28.57 ? 86  GLN B NE2 1 
ATOM   625  N N   . ALA A 1 82  ? 42.595 21.298 -0.381  1.00 9.61  ? 87  ALA B N   1 
ATOM   626  C CA  . ALA A 1 82  ? 42.293 21.855 0.891   1.00 9.79  ? 87  ALA B CA  1 
ATOM   627  C C   . ALA A 1 82  ? 41.658 23.207 0.637   1.00 9.26  ? 87  ALA B C   1 
ATOM   628  O O   . ALA A 1 82  ? 42.090 23.913 -0.268  1.00 11.04 ? 87  ALA B O   1 
ATOM   629  C CB  . ALA A 1 82  ? 43.523 22.028 1.796   1.00 10.54 ? 87  ALA B CB  1 
ATOM   630  N N   . ASN A 1 83  ? 40.724 23.606 1.467   1.00 8.70  ? 88  ASN B N   1 
ATOM   631  C CA  . ASN A 1 83  ? 39.963 24.860 1.247   1.00 9.31  ? 88  ASN B CA  1 
ATOM   632  C C   . ASN A 1 83  ? 39.860 25.611 2.509   1.00 10.06 ? 88  ASN B C   1 
ATOM   633  O O   . ASN A 1 83  ? 39.503 24.994 3.576   1.00 10.68 ? 88  ASN B O   1 
ATOM   634  C CB  . ASN A 1 83  ? 38.530 24.664 0.624   1.00 10.70 ? 88  ASN B CB  1 
ATOM   635  C CG  . ASN A 1 83  ? 37.731 25.977 0.579   1.00 13.74 ? 88  ASN B CG  1 
ATOM   636  O OD1 . ASN A 1 83  ? 36.873 26.179 1.467   1.00 19.29 ? 88  ASN B OD1 1 
ATOM   637  N ND2 . ASN A 1 83  ? 38.005 26.862 -0.358  1.00 14.79 ? 88  ASN B ND2 1 
ATOM   638  N N   . TYR A 1 84  ? 40.102 26.903 2.498   1.00 8.51  ? 89  TYR B N   1 
ATOM   639  C CA  . TYR A 1 84  ? 40.004 27.718 3.683   1.00 9.26  ? 89  TYR B CA  1 
ATOM   640  C C   . TYR A 1 84  ? 39.066 28.880 3.333   1.00 9.18  ? 89  TYR B C   1 
ATOM   641  O O   . TYR A 1 84  ? 39.215 29.552 2.363   1.00 9.21  ? 89  TYR B O   1 
ATOM   642  C CB  . TYR A 1 84  ? 41.355 28.248 4.127   1.00 9.38  ? 89  TYR B CB  1 
ATOM   643  C CG  . TYR A 1 84  ? 41.285 29.189 5.348   1.00 9.57  ? 89  TYR B CG  1 
ATOM   644  C CD1 . TYR A 1 84  ? 41.186 28.663 6.638   1.00 10.40 ? 89  TYR B CD1 1 
ATOM   645  C CD2 . TYR A 1 84  ? 41.316 30.551 5.207   1.00 10.59 ? 89  TYR B CD2 1 
ATOM   646  C CE1 . TYR A 1 84  ? 41.049 29.505 7.726   1.00 10.07 ? 89  TYR B CE1 1 
ATOM   647  C CE2 . TYR A 1 84  ? 41.176 31.389 6.307   1.00 11.44 ? 89  TYR B CE2 1 
ATOM   648  C CZ  . TYR A 1 84  ? 41.099 30.831 7.575   1.00 11.52 ? 89  TYR B CZ  1 
ATOM   649  O OH  . TYR A 1 84  ? 41.021 31.683 8.682   1.00 11.93 ? 89  TYR B OH  1 
ATOM   650  N N   . LYS A 1 85  ? 38.109 29.122 4.223   1.00 8.87  ? 90  LYS B N   1 
ATOM   651  C CA  . LYS A 1 85  ? 37.244 30.273 4.176   1.00 9.41  ? 90  LYS B CA  1 
ATOM   652  C C   . LYS A 1 85  ? 37.222 30.972 5.500   1.00 8.51  ? 90  LYS B C   1 
ATOM   653  O O   . LYS A 1 85  ? 37.202 30.307 6.521   1.00 9.39  ? 90  LYS B O   1 
ATOM   654  C CB  . LYS A 1 85  ? 35.758 29.932 3.779   1.00 11.41 ? 90  LYS B CB  1 
ATOM   655  C CG  . LYS A 1 85  ? 35.612 29.322 2.465   1.00 14.52 ? 90  LYS B CG  1 
ATOM   656  C CD  . LYS A 1 85  ? 34.145 29.138 2.093   1.00 18.90 ? 90  LYS B CD  1 
ATOM   657  C CE  . LYS A 1 85  ? 34.012 28.589 0.651   1.00 21.09 ? 90  LYS B CE  1 
ATOM   658  N NZ  . LYS A 1 85  ? 34.618 27.263 0.529   1.00 31.55 ? 90  LYS B NZ  1 
ATOM   659  N N   . GLY A 1 86  ? 37.257 32.317 5.520   1.00 7.88  ? 91  GLY B N   1 
ATOM   660  C CA  . GLY A 1 86  ? 37.257 32.988 6.801   1.00 8.37  ? 91  GLY B CA  1 
ATOM   661  C C   . GLY A 1 86  ? 37.022 34.457 6.644   1.00 8.48  ? 91  GLY B C   1 
ATOM   662  O O   . GLY A 1 86  ? 36.908 35.005 5.537   1.00 8.34  ? 91  GLY B O   1 
ATOM   663  N N   . THR A 1 87  ? 36.755 35.092 7.778   1.00 8.21  ? 92  THR B N   1 
ATOM   664  C CA  . THR A 1 87  ? 36.406 36.530 7.875   1.00 8.91  ? 92  THR B CA  1 
ATOM   665  C C   . THR A 1 87  ? 37.598 37.296 8.409   1.00 9.11  ? 92  THR B C   1 
ATOM   666  O O   . THR A 1 87  ? 38.240 36.896 9.394   1.00 8.98  ? 92  THR B O   1 
ATOM   667  C CB  . THR A 1 87  ? 35.182 36.701 8.825   1.00 10.04 ? 92  THR B CB  1 
ATOM   668  O OG1 . THR A 1 87  ? 34.111 35.904 8.218   1.00 11.36 ? 92  THR B OG1 1 
ATOM   669  C CG2 . THR A 1 87  ? 34.810 38.132 8.981   1.00 10.82 ? 92  THR B CG2 1 
ATOM   670  N N   . ILE A 1 88  ? 37.898 38.388 7.715   1.00 9.65  ? 93  ILE B N   1 
ATOM   671  C CA  . ILE A 1 88  ? 39.042 39.224 8.102   1.00 10.50 ? 93  ILE B CA  1 
ATOM   672  C C   . ILE A 1 88  ? 38.615 40.162 9.220   1.00 11.75 ? 93  ILE B C   1 
ATOM   673  O O   . ILE A 1 88  ? 37.566 40.862 9.144   1.00 11.98 ? 93  ILE B O   1 
ATOM   674  C CB  . ILE A 1 88  ? 39.527 39.963 6.860   1.00 11.34 ? 93  ILE B CB  1 
ATOM   675  C CG1 . ILE A 1 88  ? 39.932 39.011 5.767   1.00 10.74 ? 93  ILE B CG1 1 
ATOM   676  C CG2 . ILE A 1 88  ? 40.709 40.919 7.264   1.00 11.80 ? 93  ILE B CG2 1 
ATOM   677  C CD1 . ILE A 1 88  ? 40.435 39.616 4.491   1.00 10.77 ? 93  ILE B CD1 1 
ATOM   678  N N   . LYS A 1 89  ? 39.455 40.217 10.267  1.00 11.73 ? 94  LYS B N   1 
ATOM   679  C CA  . LYS A 1 89  ? 39.280 41.087 11.402  1.00 12.47 ? 94  LYS B CA  1 
ATOM   680  C C   . LYS A 1 89  ? 40.321 42.183 11.377  1.00 11.71 ? 94  LYS B C   1 
ATOM   681  O O   . LYS A 1 89  ? 41.434 41.900 10.938  1.00 11.93 ? 94  LYS B O   1 
ATOM   682  C CB  . LYS A 1 89  ? 39.460 40.280 12.682  1.00 15.30 ? 94  LYS B CB  1 
ATOM   683  C CG  . LYS A 1 89  ? 38.574 39.095 12.830  1.00 19.01 ? 94  LYS B CG  1 
ATOM   684  C CD  . LYS A 1 89  ? 37.143 39.356 12.661  1.00 22.15 ? 94  LYS B CD  1 
ATOM   685  C CE  . LYS A 1 89  ? 36.266 38.053 12.634  1.00 26.59 ? 94  LYS B CE  1 
ATOM   686  N NZ  . LYS A 1 89  ? 34.945 38.712 13.034  1.00 32.02 ? 94  LYS B NZ  1 
ATOM   687  N N   . PHE A 1 90  ? 39.972 43.351 11.892  1.00 13.92 ? 95  PHE B N   1 
ATOM   688  C CA  . PHE A 1 90  ? 40.881 44.491 11.879  1.00 15.37 ? 95  PHE B CA  1 
ATOM   689  C C   . PHE A 1 90  ? 41.220 44.917 13.326  1.00 17.83 ? 95  PHE B C   1 
ATOM   690  O O   . PHE A 1 90  ? 40.500 44.605 14.282  1.00 19.04 ? 95  PHE B O   1 
ATOM   691  C CB  . PHE A 1 90  ? 40.197 45.662 11.183  1.00 17.62 ? 95  PHE B CB  1 
ATOM   692  C CG  . PHE A 1 90  ? 40.146 45.623 9.696   1.00 17.75 ? 95  PHE B CG  1 
ATOM   693  C CD1 . PHE A 1 90  ? 39.440 44.642 8.999   1.00 17.57 ? 95  PHE B CD1 1 
ATOM   694  C CD2 . PHE A 1 90  ? 40.784 46.621 8.997   1.00 19.54 ? 95  PHE B CD2 1 
ATOM   695  C CE1 . PHE A 1 90  ? 39.383 44.660 7.565   1.00 17.82 ? 95  PHE B CE1 1 
ATOM   696  C CE2 . PHE A 1 90  ? 40.701 46.677 7.572   1.00 21.40 ? 95  PHE B CE2 1 
ATOM   697  C CZ  . PHE A 1 90  ? 40.040 45.687 6.883   1.00 19.25 ? 95  PHE B CZ  1 
ATOM   698  N N   . ASP A 1 91  ? 42.391 45.501 13.519  1.00 17.20 ? 96  ASP B N   1 
ATOM   699  C CA  . ASP A 1 91  ? 42.785 45.989 14.878  1.00 16.46 ? 96  ASP B CA  1 
ATOM   700  C C   . ASP A 1 91  ? 43.497 47.259 14.513  1.00 21.89 ? 96  ASP B C   1 
ATOM   701  O O   . ASP A 1 91  ? 44.514 47.282 13.769  1.00 23.55 ? 96  ASP B O   1 
ATOM   702  C CB  . ASP A 1 91  ? 43.668 44.980 15.653  1.00 18.44 ? 96  ASP B CB  1 
ATOM   703  C CG  . ASP A 1 91  ? 43.943 45.431 17.069  1.00 20.90 ? 96  ASP B CG  1 
ATOM   704  O OD1 . ASP A 1 91  ? 43.259 46.375 17.573  1.00 20.15 ? 96  ASP B OD1 1 
ATOM   705  O OD2 . ASP A 1 91  ? 44.969 44.822 17.590  1.00 22.88 ? 96  ASP B OD2 1 
ATOM   706  N N   . GLY A 1 92  ? 42.914 48.377 14.917  1.00 27.40 ? 97  GLY B N   1 
ATOM   707  C CA  . GLY A 1 92  ? 43.296 49.681 14.327  1.00 29.25 ? 97  GLY B CA  1 
ATOM   708  C C   . GLY A 1 92  ? 42.803 49.722 12.884  1.00 31.20 ? 97  GLY B C   1 
ATOM   709  O O   . GLY A 1 92  ? 41.756 49.181 12.527  1.00 32.31 ? 97  GLY B O   1 
ATOM   710  N N   . ASP A 1 93  ? 43.592 50.314 12.007  1.00 30.88 ? 98  ASP B N   1 
ATOM   711  C CA  . ASP A 1 93  ? 43.068 50.508 10.655  1.00 33.86 ? 98  ASP B CA  1 
ATOM   712  C C   . ASP A 1 93  ? 43.503 49.361 9.733   1.00 28.38 ? 98  ASP B C   1 
ATOM   713  O O   . ASP A 1 93  ? 43.216 49.406 8.545   1.00 32.01 ? 98  ASP B O   1 
ATOM   714  C CB  . ASP A 1 93  ? 43.449 51.874 10.046  1.00 39.85 ? 98  ASP B CB  1 
ATOM   715  C CG  . ASP A 1 93  ? 44.903 52.194 10.139  1.00 43.95 ? 98  ASP B CG  1 
ATOM   716  O OD1 . ASP A 1 93  ? 45.695 51.301 10.528  1.00 44.15 ? 98  ASP B OD1 1 
ATOM   717  O OD2 . ASP A 1 93  ? 45.260 53.390 9.864   1.00 50.87 ? 98  ASP B OD2 1 
ATOM   718  N N   . LYS A 1 94  ? 44.154 48.327 10.255  1.00 26.55 ? 99  LYS B N   1 
ATOM   719  C CA  . LYS A 1 94  ? 44.707 47.323 9.363   1.00 24.26 ? 99  LYS B CA  1 
ATOM   720  C C   . LYS A 1 94  ? 44.150 45.938 9.709   1.00 18.40 ? 99  LYS B C   1 
ATOM   721  O O   . LYS A 1 94  ? 43.775 45.679 10.851  1.00 17.91 ? 99  LYS B O   1 
ATOM   722  C CB  . LYS A 1 94  ? 46.238 47.235 9.440   1.00 28.53 ? 99  LYS B CB  1 
ATOM   723  C CG  . LYS A 1 94  ? 46.973 48.384 8.711   1.00 40.64 ? 99  LYS B CG  1 
ATOM   724  C CD  . LYS A 1 94  ? 46.574 48.449 7.227   1.00 47.89 ? 99  LYS B CD  1 
ATOM   725  C CE  . LYS A 1 94  ? 47.320 49.515 6.402   1.00 54.98 ? 99  LYS B CE  1 
ATOM   726  N NZ  . LYS A 1 94  ? 46.823 50.933 6.563   1.00 58.93 ? 99  LYS B NZ  1 
ATOM   727  N N   . PRO A 1 95  ? 43.988 45.136 8.686   1.00 16.88 ? 100 PRO B N   1 
ATOM   728  C CA  . PRO A 1 95  ? 43.657 43.731 8.968   1.00 14.96 ? 100 PRO B CA  1 
ATOM   729  C C   . PRO A 1 95  ? 44.672 43.095 9.823   1.00 14.38 ? 100 PRO B C   1 
ATOM   730  O O   . PRO A 1 95  ? 45.874 43.260 9.570   1.00 15.05 ? 100 PRO B O   1 
ATOM   731  C CB  . PRO A 1 95  ? 43.735 43.059 7.608   1.00 17.25 ? 100 PRO B CB  1 
ATOM   732  C CG  . PRO A 1 95  ? 43.644 44.175 6.631   1.00 20.27 ? 100 PRO B CG  1 
ATOM   733  C CD  . PRO A 1 95  ? 44.219 45.346 7.245   1.00 19.23 ? 100 PRO B CD  1 
ATOM   734  N N   . VAL A 1 96  ? 44.237 42.248 10.783  1.00 12.23 ? 101 VAL B N   1 
ATOM   735  C CA  . VAL A 1 96  ? 45.101 41.588 11.669  1.00 12.66 ? 101 VAL B CA  1 
ATOM   736  C C   . VAL A 1 96  ? 44.988 40.098 11.789  1.00 11.50 ? 101 VAL B C   1 
ATOM   737  O O   . VAL A 1 96  ? 45.866 39.437 12.334  1.00 12.66 ? 101 VAL B O   1 
ATOM   738  C CB  . VAL A 1 96  ? 45.110 42.200 13.033  1.00 14.79 ? 101 VAL B CB  1 
ATOM   739  C CG1 . VAL A 1 96  ? 45.624 43.647 12.884  1.00 17.62 ? 101 VAL B CG1 1 
ATOM   740  C CG2 . VAL A 1 96  ? 43.829 42.056 13.694  1.00 14.77 ? 101 VAL B CG2 1 
ATOM   741  N N   . SER A 1 97  ? 43.811 39.573 11.348  1.00 11.24 ? 102 SER B N   1 
ATOM   742  C CA  . SER A 1 97  ? 43.589 38.127 11.457  1.00 11.25 ? 102 SER B CA  1 
ATOM   743  C C   . SER A 1 97  ? 42.481 37.744 10.511  1.00 10.61 ? 102 SER B C   1 
ATOM   744  O O   . SER A 1 97  ? 41.754 38.553 9.988   1.00 10.96 ? 102 SER B O   1 
ATOM   745  C CB  . SER A 1 97  ? 43.206 37.641 12.799  1.00 14.09 ? 102 SER B CB  1 
ATOM   746  O OG  . SER A 1 97  ? 42.040 38.169 13.214  1.00 19.17 ? 102 SER B OG  1 
ATOM   747  N N   . VAL A 1 98  ? 42.406 36.436 10.318  1.00 9.86  ? 103 VAL B N   1 
ATOM   748  C CA  . VAL A 1 98  ? 41.313 35.845 9.546   1.00 9.50  ? 103 VAL B CA  1 
ATOM   749  C C   . VAL A 1 98  ? 40.835 34.703 10.438  1.00 9.79  ? 103 VAL B C   1 
ATOM   750  O O   . VAL A 1 98  ? 41.614 33.832 10.853  1.00 10.87 ? 103 VAL B O   1 
ATOM   751  C CB  . VAL A 1 98  ? 41.774 35.272 8.188   1.00 9.58  ? 103 VAL B CB  1 
ATOM   752  C CG1 . VAL A 1 98  ? 40.542 34.954 7.389   1.00 10.10 ? 103 VAL B CG1 1 
ATOM   753  C CG2 . VAL A 1 98  ? 42.629 36.240 7.408   1.00 10.76 ? 103 VAL B CG2 1 
ATOM   754  N N   . VAL A 1 99  ? 39.542 34.684 10.716  1.00 9.21  ? 104 VAL B N   1 
ATOM   755  C CA  . VAL A 1 99  ? 38.934 33.630 11.551  1.00 9.80  ? 104 VAL B CA  1 
ATOM   756  C C   . VAL A 1 99  ? 37.996 32.811 10.693  1.00 9.74  ? 104 VAL B C   1 
ATOM   757  O O   . VAL A 1 99  ? 37.062 33.347 10.075  1.00 9.85  ? 104 VAL B O   1 
ATOM   758  C CB  . VAL A 1 99  ? 38.146 34.270 12.671  1.00 10.96 ? 104 VAL B CB  1 
ATOM   759  C CG1 . VAL A 1 99  ? 37.488 33.203 13.512  1.00 12.87 ? 104 VAL B CG1 1 
ATOM   760  C CG2 . VAL A 1 99  ? 39.106 35.118 13.521  1.00 13.05 ? 104 VAL B CG2 1 
ATOM   761  N N   . GLY A 1 100 ? 38.251 31.514 10.581  1.00 9.55  ? 105 GLY B N   1 
ATOM   762  C CA  . GLY A 1 100 ? 37.480 30.730 9.688   1.00 11.01 ? 105 GLY B CA  1 
ATOM   763  C C   . GLY A 1 100 ? 37.687 29.267 9.897   1.00 9.62  ? 105 GLY B C   1 
ATOM   764  O O   . GLY A 1 100 ? 37.797 28.788 11.048  1.00 9.78  ? 105 GLY B O   1 
ATOM   765  N N   . ASN A 1 101 ? 37.596 28.567 8.814   1.00 8.86  ? 106 ASN B N   1 
ATOM   766  C CA  . ASN A 1 101 ? 37.564 27.101 8.803   1.00 9.19  ? 106 ASN B CA  1 
ATOM   767  C C   . ASN A 1 101 ? 38.373 26.537 7.663   1.00 9.23  ? 106 ASN B C   1 
ATOM   768  O O   . ASN A 1 101 ? 38.246 26.995 6.520   1.00 9.67  ? 106 ASN B O   1 
ATOM   769  C CB  . ASN A 1 101 ? 36.114 26.588 8.727   1.00 10.74 ? 106 ASN B CB  1 
ATOM   770  C CG  . ASN A 1 101 ? 35.300 27.017 9.932   1.00 12.95 ? 106 ASN B CG  1 
ATOM   771  O OD1 . ASN A 1 101 ? 34.642 28.060 9.837   1.00 15.18 ? 106 ASN B OD1 1 
ATOM   772  N ND2 . ASN A 1 101 ? 35.348 26.274 10.976  1.00 12.92 ? 106 ASN B ND2 1 
ATOM   773  N N   . LEU A 1 102 ? 39.165 25.555 7.970   1.00 8.29  ? 107 LEU B N   1 
ATOM   774  C CA  . LEU A 1 102 ? 39.991 24.824 7.008   1.00 8.56  ? 107 LEU B CA  1 
ATOM   775  C C   . LEU A 1 102 ? 39.411 23.459 6.807   1.00 8.91  ? 107 LEU B C   1 
ATOM   776  O O   . LEU A 1 102 ? 39.061 22.754 7.770   1.00 8.70  ? 107 LEU B O   1 
ATOM   777  C CB  . LEU A 1 102 ? 41.390 24.622 7.491   1.00 9.21  ? 107 LEU B CB  1 
ATOM   778  C CG  . LEU A 1 102 ? 42.354 23.756 6.662   1.00 9.47  ? 107 LEU B CG  1 
ATOM   779  C CD1 . LEU A 1 102 ? 42.505 24.406 5.306   1.00 11.22 ? 107 LEU B CD1 1 
ATOM   780  C CD2 . LEU A 1 102 ? 43.660 23.576 7.365   1.00 9.62  ? 107 LEU B CD2 1 
ATOM   781  N N   . THR A 1 103 ? 39.211 23.072 5.558   1.00 8.68  ? 108 THR B N   1 
ATOM   782  C CA  . THR A 1 103 ? 38.858 21.698 5.176   1.00 9.02  ? 108 THR B CA  1 
ATOM   783  C C   . THR A 1 103 ? 40.034 21.035 4.513   1.00 8.90  ? 108 THR B C   1 
ATOM   784  O O   . THR A 1 103 ? 40.535 21.499 3.520   1.00 10.36 ? 108 THR B O   1 
ATOM   785  C CB  . THR A 1 103 ? 37.655 21.707 4.186   1.00 9.63  ? 108 THR B CB  1 
ATOM   786  O OG1 . THR A 1 103 ? 36.579 22.446 4.721   1.00 10.98 ? 108 THR B OG1 1 
ATOM   787  C CG2 . THR A 1 103 ? 37.224 20.254 3.850   1.00 10.24 ? 108 THR B CG2 1 
ATOM   788  N N   . LEU A 1 104 ? 40.547 20.022 5.188   1.00 8.80  ? 109 LEU B N   1 
ATOM   789  C CA  . LEU A 1 104 ? 41.822 19.339 4.839   1.00 8.49  ? 109 LEU B CA  1 
ATOM   790  C C   . LEU A 1 104 ? 41.544 17.862 5.121   1.00 8.92  ? 109 LEU B C   1 
ATOM   791  O O   . LEU A 1 104 ? 40.999 17.523 6.179   1.00 9.78  ? 109 LEU B O   1 
ATOM   792  C CB  . LEU A 1 104 ? 42.919 19.897 5.754   1.00 9.14  ? 109 LEU B CB  1 
ATOM   793  C CG  . LEU A 1 104 ? 44.255 19.193 5.750   1.00 9.62  ? 109 LEU B CG  1 
ATOM   794  C CD1 . LEU A 1 104 ? 44.881 19.244 4.372   1.00 10.06 ? 109 LEU B CD1 1 
ATOM   795  C CD2 . LEU A 1 104 ? 45.216 19.736 6.838   1.00 10.03 ? 109 LEU B CD2 1 
ATOM   796  N N   . HIS A 1 105 ? 41.899 17.004 4.195   1.00 9.59  ? 110 HIS B N   1 
ATOM   797  C CA  . HIS A 1 105 ? 41.701 15.583 4.359   1.00 9.83  ? 110 HIS B CA  1 
ATOM   798  C C   . HIS A 1 105 ? 40.220 15.285 4.610   1.00 10.03 ? 110 HIS B C   1 
ATOM   799  O O   . HIS A 1 105 ? 39.879 14.353 5.315   1.00 12.15 ? 110 HIS B O   1 
ATOM   800  C CB  . HIS A 1 105 ? 42.618 15.055 5.454   1.00 10.53 ? 110 HIS B CB  1 
ATOM   801  C CG  . HIS A 1 105 ? 42.680 13.557 5.576   1.00 12.17 ? 110 HIS B CG  1 
ATOM   802  N ND1 . HIS A 1 105 ? 42.393 12.922 6.760   1.00 14.77 ? 110 HIS B ND1 1 
ATOM   803  C CD2 . HIS A 1 105 ? 42.910 12.592 4.673   1.00 13.68 ? 110 HIS B CD2 1 
ATOM   804  C CE1 . HIS A 1 105 ? 42.487 11.593 6.599   1.00 15.75 ? 110 HIS B CE1 1 
ATOM   805  N NE2 . HIS A 1 105 ? 42.847 11.371 5.354   1.00 15.82 ? 110 HIS B NE2 1 
ATOM   806  N N   . GLY A 1 106 ? 39.372 16.064 3.951   1.00 10.78 ? 111 GLY B N   1 
ATOM   807  C CA  . GLY A 1 106 ? 37.970 15.925 4.124   1.00 12.21 ? 111 GLY B CA  1 
ATOM   808  C C   . GLY A 1 106 ? 37.313 16.394 5.364   1.00 13.30 ? 111 GLY B C   1 
ATOM   809  O O   . GLY A 1 106 ? 36.057 16.349 5.445   1.00 15.57 ? 111 GLY B O   1 
ATOM   810  N N   . VAL A 1 107 ? 38.109 16.884 6.314   1.00 10.16 ? 112 VAL B N   1 
ATOM   811  C CA  . VAL A 1 107 ? 37.622 17.268 7.620   1.00 9.19  ? 112 VAL B CA  1 
ATOM   812  C C   . VAL A 1 107 ? 37.681 18.773 7.753   1.00 8.61  ? 112 VAL B C   1 
ATOM   813  O O   . VAL A 1 107 ? 38.695 19.397 7.435   1.00 8.31  ? 112 VAL B O   1 
ATOM   814  C CB  . VAL A 1 107 ? 38.510 16.605 8.709   1.00 9.21  ? 112 VAL B CB  1 
ATOM   815  C CG1 . VAL A 1 107 ? 38.108 17.049 10.090  1.00 9.69  ? 112 VAL B CG1 1 
ATOM   816  C CG2 . VAL A 1 107 ? 38.539 15.067 8.600   1.00 10.04 ? 112 VAL B CG2 1 
ATOM   817  N N   . THR A 1 108 ? 36.649 19.338 8.359   1.00 8.31  ? 113 THR B N   1 
ATOM   818  C CA  . THR A 1 108 ? 36.557 20.787 8.483   1.00 8.66  ? 113 THR B CA  1 
ATOM   819  C C   . THR A 1 108 ? 36.787 21.130 9.941   1.00 9.03  ? 113 THR B C   1 
ATOM   820  O O   . THR A 1 108 ? 36.055 20.604 10.823  1.00 10.02 ? 113 THR B O   1 
ATOM   821  C CB  . THR A 1 108 ? 35.243 21.393 7.956   1.00 9.78  ? 113 THR B CB  1 
ATOM   822  O OG1 . THR A 1 108 ? 35.131 21.116 6.583   1.00 11.61 ? 113 THR B OG1 1 
ATOM   823  C CG2 . THR A 1 108 ? 35.166 22.914 8.194   1.00 11.08 ? 113 THR B CG2 1 
ATOM   824  N N   . LYS A 1 109 ? 37.737 22.003 10.294  1.00 9.46  ? 114 LYS B N   1 
ATOM   825  C CA  . LYS A 1 109 ? 38.007 22.467 11.618  1.00 9.51  ? 114 LYS B CA  1 
ATOM   826  C C   . LYS A 1 109 ? 38.251 23.941 11.670  1.00 10.14 ? 114 LYS B C   1 
ATOM   827  O O   . LYS A 1 109 ? 38.677 24.529 10.663  1.00 10.63 ? 114 LYS B O   1 
ATOM   828  C CB  . LYS A 1 109 ? 39.208 21.756 12.255  1.00 10.46 ? 114 LYS B CB  1 
ATOM   829  C CG  . LYS A 1 109 ? 38.994 20.263 12.422  1.00 12.10 ? 114 LYS B CG  1 
ATOM   830  C CD  . LYS A 1 109 ? 37.998 19.938 13.527  1.00 14.75 ? 114 LYS B CD  1 
ATOM   831  C CE  . LYS A 1 109 ? 37.341 18.515 13.391  1.00 18.85 ? 114 LYS B CE  1 
ATOM   832  N NZ  . LYS A 1 109 ? 38.159 17.506 14.087  1.00 23.60 ? 114 LYS B NZ  1 
ATOM   833  N N   . PRO A 1 110 ? 38.021 24.602 12.804  1.00 9.68  ? 115 PRO B N   1 
ATOM   834  C CA  . PRO A 1 110 ? 38.362 26.024 12.902  1.00 10.44 ? 115 PRO B CA  1 
ATOM   835  C C   . PRO A 1 110 ? 39.839 26.299 12.731  1.00 10.43 ? 115 PRO B C   1 
ATOM   836  O O   . PRO A 1 110 ? 40.707 25.535 13.209  1.00 12.07 ? 115 PRO B O   1 
ATOM   837  C CB  . PRO A 1 110 ? 37.844 26.463 14.281  1.00 11.15 ? 115 PRO B CB  1 
ATOM   838  C CG  . PRO A 1 110 ? 37.141 25.308 14.798  1.00 13.56 ? 115 PRO B CG  1 
ATOM   839  C CD  . PRO A 1 110 ? 37.557 24.097 14.106  1.00 11.24 ? 115 PRO B CD  1 
ATOM   840  N N   . LEU A 1 111 ? 40.121 27.427 12.068  1.00 9.42  ? 116 LEU B N   1 
ATOM   841  C CA  . LEU A 1 111 ? 41.516 27.872 11.948  1.00 10.45 ? 116 LEU B CA  1 
ATOM   842  C C   . LEU A 1 111 ? 41.536 29.367 11.841  1.00 11.40 ? 116 LEU B C   1 
ATOM   843  O O   . LEU A 1 111 ? 40.821 29.958 11.018  1.00 9.78  ? 116 LEU B O   1 
ATOM   844  C CB  . LEU A 1 111 ? 42.230 27.250 10.747  1.00 10.82 ? 116 LEU B CB  1 
ATOM   845  C CG  . LEU A 1 111 ? 43.616 27.735 10.385  1.00 12.35 ? 116 LEU B CG  1 
ATOM   846  C CD1 . LEU A 1 111 ? 44.578 27.397 11.527  1.00 14.81 ? 116 LEU B CD1 1 
ATOM   847  C CD2 . LEU A 1 111 ? 44.061 27.112 9.044   1.00 13.21 ? 116 LEU B CD2 1 
ATOM   848  N N   . THR A 1 112 ? 42.404 30.015 12.674  1.00 10.57 ? 117 THR B N   1 
ATOM   849  C CA  . THR A 1 112 ? 42.635 31.437 12.628  1.00 11.80 ? 117 THR B CA  1 
ATOM   850  C C   . THR A 1 112 ? 44.044 31.674 12.096  1.00 12.43 ? 117 THR B C   1 
ATOM   851  O O   . THR A 1 112 ? 45.015 30.992 12.456  1.00 13.97 ? 117 THR B O   1 
ATOM   852  C CB  . THR A 1 112 ? 42.492 32.017 14.048  1.00 13.38 ? 117 THR B CB  1 
ATOM   853  O OG1 . THR A 1 112 ? 41.158 31.871 14.496  1.00 16.12 ? 117 THR B OG1 1 
ATOM   854  C CG2 . THR A 1 112 ? 42.895 33.452 14.096  1.00 14.27 ? 117 THR B CG2 1 
ATOM   855  N N   . LEU A 1 113 ? 44.185 32.601 11.194  1.00 11.99 ? 118 LEU B N   1 
ATOM   856  C CA  . LEU A 1 113 ? 45.475 33.023 10.625  1.00 11.92 ? 118 LEU B CA  1 
ATOM   857  C C   . LEU A 1 113 ? 45.733 34.428 11.149  1.00 13.93 ? 118 LEU B C   1 
ATOM   858  O O   . LEU A 1 113 ? 44.822 35.264 11.111  1.00 15.42 ? 118 LEU B O   1 
ATOM   859  C CB  . LEU A 1 113 ? 45.392 33.062 9.112   1.00 14.38 ? 118 LEU B CB  1 
ATOM   860  C CG  . LEU A 1 113 ? 45.001 31.727 8.500   1.00 17.12 ? 118 LEU B CG  1 
ATOM   861  C CD1 . LEU A 1 113 ? 44.813 31.759 6.962   1.00 19.20 ? 118 LEU B CD1 1 
ATOM   862  C CD2 . LEU A 1 113 ? 45.956 30.685 8.863   1.00 17.19 ? 118 LEU B CD2 1 
ATOM   863  N N   . LYS A 1 114 ? 46.924 34.669 11.688  1.00 11.72 ? 119 LYS B N   1 
ATOM   864  C CA  . LYS A 1 114 ? 47.292 36.014 12.113  1.00 12.48 ? 119 LYS B CA  1 
ATOM   865  C C   . LYS A 1 114 ? 48.040 36.707 11.007  1.00 11.96 ? 119 LYS B C   1 
ATOM   866  O O   . LYS A 1 114 ? 48.937 36.099 10.399  1.00 12.48 ? 119 LYS B O   1 
ATOM   867  C CB  . LYS A 1 114 ? 48.205 35.811 13.321  1.00 15.82 ? 119 LYS B CB  1 
ATOM   868  C CG  . LYS A 1 114 ? 48.884 37.047 13.771  1.00 22.91 ? 119 LYS B CG  1 
ATOM   869  C CD  . LYS A 1 114 ? 49.094 36.861 15.310  1.00 30.03 ? 119 LYS B CD  1 
ATOM   870  C CE  . LYS A 1 114 ? 50.495 37.126 15.744  1.00 36.63 ? 119 LYS B CE  1 
ATOM   871  N NZ  . LYS A 1 114 ? 51.442 36.551 14.754  1.00 36.88 ? 119 LYS B NZ  1 
ATOM   872  N N   . ILE A 1 115 ? 47.730 37.940 10.715  1.00 11.72 ? 120 ILE B N   1 
ATOM   873  C CA  . ILE A 1 115 ? 48.318 38.681 9.562   1.00 12.03 ? 120 ILE B CA  1 
ATOM   874  C C   . ILE A 1 115 ? 49.454 39.513 10.220  1.00 14.33 ? 120 ILE B C   1 
ATOM   875  O O   . ILE A 1 115 ? 49.191 40.377 11.070  1.00 15.00 ? 120 ILE B O   1 
ATOM   876  C CB  . ILE A 1 115 ? 47.316 39.598 8.960   1.00 12.82 ? 120 ILE B CB  1 
ATOM   877  C CG1 . ILE A 1 115 ? 46.237 38.753 8.223   1.00 13.61 ? 120 ILE B CG1 1 
ATOM   878  C CG2 . ILE A 1 115 ? 47.969 40.549 7.931   1.00 14.82 ? 120 ILE B CG2 1 
ATOM   879  C CD1 . ILE A 1 115 ? 45.049 39.490 7.672   1.00 15.02 ? 120 ILE B CD1 1 
ATOM   880  N N   . ASP A 1 116 ? 50.679 39.228 9.816   1.00 13.79 ? 121 ASP B N   1 
ATOM   881  C CA  . ASP A 1 116 ? 51.868 39.847 10.389  1.00 15.80 ? 121 ASP B CA  1 
ATOM   882  C C   . ASP A 1 116 ? 52.200 41.084 9.584   1.00 16.43 ? 121 ASP B C   1 
ATOM   883  O O   . ASP A 1 116 ? 52.777 42.074 10.129  1.00 19.53 ? 121 ASP B O   1 
ATOM   884  C CB  . ASP A 1 116 ? 53.000 38.872 10.392  1.00 18.20 ? 121 ASP B CB  1 
ATOM   885  C CG  . ASP A 1 116 ? 52.914 37.880 11.587  1.00 24.99 ? 121 ASP B CG  1 
ATOM   886  O OD1 . ASP A 1 116 ? 52.222 38.139 12.616  1.00 30.65 ? 121 ASP B OD1 1 
ATOM   887  O OD2 . ASP A 1 116 ? 53.535 36.836 11.416  1.00 30.45 ? 121 ASP B OD2 1 
ATOM   888  N N   . SER A 1 117 ? 51.850 41.112 8.318   1.00 14.03 ? 122 SER B N   1 
ATOM   889  C CA  . SER A 1 117 ? 52.113 42.274 7.468   1.00 15.49 ? 122 SER B CA  1 
ATOM   890  C C   . SER A 1 117 ? 51.006 42.370 6.420   1.00 14.34 ? 122 SER B C   1 
ATOM   891  O O   . SER A 1 117 ? 50.517 41.330 5.915   1.00 13.96 ? 122 SER B O   1 
ATOM   892  C CB  . SER A 1 117 ? 53.460 42.245 6.816   1.00 19.95 ? 122 SER B CB  1 
ATOM   893  O OG  . SER A 1 117 ? 53.621 41.279 5.852   1.00 22.74 ? 122 SER B OG  1 
ATOM   894  N N   . PHE A 1 118 ? 50.715 43.577 6.050   1.00 15.13 ? 123 PHE B N   1 
ATOM   895  C CA  . PHE A 1 118 ? 49.699 43.884 5.040   1.00 14.54 ? 123 PHE B CA  1 
ATOM   896  C C   . PHE A 1 118 ? 50.172 45.133 4.330   1.00 15.32 ? 123 PHE B C   1 
ATOM   897  O O   . PHE A 1 118 ? 50.477 46.118 4.997   1.00 17.36 ? 123 PHE B O   1 
ATOM   898  C CB  . PHE A 1 118 ? 48.286 44.077 5.675   1.00 15.21 ? 123 PHE B CB  1 
ATOM   899  C CG  . PHE A 1 118 ? 47.262 44.615 4.751   1.00 16.65 ? 123 PHE B CG  1 
ATOM   900  C CD1 . PHE A 1 118 ? 46.542 43.779 3.923   1.00 18.84 ? 123 PHE B CD1 1 
ATOM   901  C CD2 . PHE A 1 118 ? 46.971 45.953 4.766   1.00 20.55 ? 123 PHE B CD2 1 
ATOM   902  C CE1 . PHE A 1 118 ? 45.597 44.311 3.051   1.00 18.44 ? 123 PHE B CE1 1 
ATOM   903  C CE2 . PHE A 1 118 ? 46.027 46.481 3.913   1.00 20.38 ? 123 PHE B CE2 1 
ATOM   904  C CZ  . PHE A 1 118 ? 45.320 45.643 3.064   1.00 20.88 ? 123 PHE B CZ  1 
ATOM   905  N N   . LYS A 1 119 ? 50.150 45.113 2.990   1.00 13.81 ? 124 LYS B N   1 
ATOM   906  C CA  . LYS A 1 119 ? 50.549 46.209 2.138   1.00 14.83 ? 124 LYS B CA  1 
ATOM   907  C C   . LYS A 1 119 ? 49.725 46.205 0.881   1.00 15.26 ? 124 LYS B C   1 
ATOM   908  O O   . LYS A 1 119 ? 49.518 45.130 0.272   1.00 14.87 ? 124 LYS B O   1 
ATOM   909  C CB  . LYS A 1 119 ? 52.001 46.102 1.724   1.00 16.45 ? 124 LYS B CB  1 
ATOM   910  C CG  . LYS A 1 119 ? 52.503 47.235 0.877   1.00 16.90 ? 124 LYS B CG  1 
ATOM   911  C CD  . LYS A 1 119 ? 53.944 47.052 0.411   1.00 20.51 ? 124 LYS B CD  1 
ATOM   912  C CE  . LYS A 1 119 ? 54.414 48.237 -0.388  1.00 22.85 ? 124 LYS B CE  1 
ATOM   913  N NZ  . LYS A 1 119 ? 55.774 48.095 -0.905  1.00 24.74 ? 124 LYS B NZ  1 
ATOM   914  N N   . CYS A 1 120 ? 49.311 47.401 0.436   1.00 15.62 ? 125 CYS B N   1 
ATOM   915  C CA  . CYS A 1 120 ? 48.740 47.498 -0.859  1.00 16.73 ? 125 CYS B CA  1 
ATOM   916  C C   . CYS A 1 120 ? 49.473 48.520 -1.710  1.00 17.02 ? 125 CYS B C   1 
ATOM   917  O O   . CYS A 1 120 ? 50.011 49.494 -1.203  1.00 17.78 ? 125 CYS B O   1 
ATOM   918  C CB  . CYS A 1 120 ? 47.275 47.883 -0.825  1.00 20.77 ? 125 CYS B CB  1 
ATOM   919  S SG  . CYS A 1 120 ? 46.165 46.830 0.156   1.00 25.92 ? 125 CYS B SG  1 
ATOM   920  N N   . MET A 1 121 ? 49.524 48.299 -3.012  1.00 15.71 ? 126 MET B N   1 
ATOM   921  C CA  . MET A 1 121 ? 50.289 49.169 -3.906  1.00 16.04 ? 126 MET B CA  1 
ATOM   922  C C   . MET A 1 121 ? 49.745 48.959 -5.313  1.00 16.05 ? 126 MET B C   1 
ATOM   923  O O   . MET A 1 121 ? 49.167 47.918 -5.589  1.00 14.67 ? 126 MET B O   1 
ATOM   924  C CB  . MET A 1 121 ? 51.807 48.877 -3.814  1.00 18.02 ? 126 MET B CB  1 
ATOM   925  C CG  . MET A 1 121 ? 52.123 47.500 -4.351  1.00 17.95 ? 126 MET B CG  1 
ATOM   926  S SD  . MET A 1 121 ? 53.846 47.018 -4.101  1.00 23.00 ? 126 MET B SD  1 
ATOM   927  C CE  . MET A 1 121 ? 54.725 47.956 -5.282  1.00 26.53 ? 126 MET B CE  1 
ATOM   928  N N   . PRO A 1 122 ? 50.028 49.868 -6.225  1.00 14.80 ? 127 PRO B N   1 
ATOM   929  C CA  . PRO A 1 122 ? 49.661 49.603 -7.564  1.00 15.60 ? 127 PRO B CA  1 
ATOM   930  C C   . PRO A 1 122 ? 50.585 48.488 -8.127  1.00 16.85 ? 127 PRO B C   1 
ATOM   931  O O   . PRO A 1 122 ? 51.785 48.503 -7.879  1.00 17.80 ? 127 PRO B O   1 
ATOM   932  C CB  . PRO A 1 122 ? 49.943 50.956 -8.311  1.00 17.31 ? 127 PRO B CB  1 
ATOM   933  C CG  . PRO A 1 122 ? 50.174 51.898 -7.238  1.00 18.11 ? 127 PRO B CG  1 
ATOM   934  C CD  . PRO A 1 122 ? 50.508 51.235 -5.980  1.00 16.90 ? 127 PRO B CD  1 
ATOM   935  N N   . HIS A 1 123 ? 49.999 47.472 -8.773  1.00 16.76 ? 128 HIS B N   1 
ATOM   936  C CA  . HIS A 1 123 ? 50.807 46.369 -9.264  1.00 19.91 ? 128 HIS B CA  1 
ATOM   937  C C   . HIS A 1 123 ? 51.788 46.876 -10.330 1.00 22.67 ? 128 HIS B C   1 
ATOM   938  O O   . HIS A 1 123 ? 51.345 47.540 -11.230 1.00 21.30 ? 128 HIS B O   1 
ATOM   939  C CB  . HIS A 1 123 ? 49.891 45.281 -9.802  1.00 22.48 ? 128 HIS B CB  1 
ATOM   940  C CG  . HIS A 1 123 ? 50.617 44.001 -9.984  1.00 26.67 ? 128 HIS B CG  1 
ATOM   941  N ND1 . HIS A 1 123 ? 51.611 43.841 -10.932 1.00 30.18 ? 128 HIS B ND1 1 
ATOM   942  C CD2 . HIS A 1 123 ? 50.613 42.858 -9.243  1.00 25.35 ? 128 HIS B CD2 1 
ATOM   943  C CE1 . HIS A 1 123 ? 52.168 42.644 -10.784 1.00 31.09 ? 128 HIS B CE1 1 
ATOM   944  N NE2 . HIS A 1 123 ? 51.540 42.010 -9.803  1.00 29.67 ? 128 HIS B NE2 1 
ATOM   945  N N   . PRO A 1 124 ? 53.077 46.669 -10.168 1.00 25.23 ? 129 PRO B N   1 
ATOM   946  C CA  . PRO A 1 124 ? 54.049 47.211 -11.121 1.00 29.00 ? 129 PRO B CA  1 
ATOM   947  C C   . PRO A 1 124 ? 53.761 46.863 -12.621 1.00 32.11 ? 129 PRO B C   1 
ATOM   948  O O   . PRO A 1 124 ? 54.097 47.646 -13.495 1.00 34.42 ? 129 PRO B O   1 
ATOM   949  C CB  . PRO A 1 124 ? 55.324 46.534 -10.658 1.00 29.89 ? 129 PRO B CB  1 
ATOM   950  C CG  . PRO A 1 124 ? 55.157 46.442 -9.157  1.00 31.31 ? 129 PRO B CG  1 
ATOM   951  C CD  . PRO A 1 124 ? 53.742 46.019 -9.020  1.00 29.03 ? 129 PRO B CD  1 
ATOM   952  N N   . MET A 1 125 ? 53.123 45.731 -12.907 1.00 30.24 ? 130 MET B N   1 
ATOM   953  C CA  . MET A 1 125 ? 52.655 45.360 -14.275 1.00 31.95 ? 130 MET B CA  1 
ATOM   954  C C   . MET A 1 125 ? 51.179 45.461 -14.687 1.00 32.42 ? 130 MET B C   1 
ATOM   955  O O   . MET A 1 125 ? 50.858 45.908 -15.780 1.00 34.66 ? 130 MET B O   1 
ATOM   956  C CB  . MET A 1 125 ? 53.121 43.936 -14.574 1.00 35.66 ? 130 MET B CB  1 
ATOM   957  C CG  . MET A 1 125 ? 53.156 43.691 -16.058 1.00 40.40 ? 130 MET B CG  1 
ATOM   958  S SD  . MET A 1 125 ? 52.795 42.004 -16.451 1.00 40.31 ? 130 MET B SD  1 
ATOM   959  C CE  . MET A 1 125 ? 54.412 41.405 -15.952 1.00 46.51 ? 130 MET B CE  1 
ATOM   960  N N   . LEU A 1 126 ? 50.239 45.041 -13.839 1.00 25.00 ? 131 LEU B N   1 
ATOM   961  C CA  . LEU A 1 126 ? 48.838 45.025 -14.146 1.00 27.31 ? 131 LEU B CA  1 
ATOM   962  C C   . LEU A 1 126 ? 48.149 46.343 -13.828 1.00 28.55 ? 131 LEU B C   1 
ATOM   963  O O   . LEU A 1 126 ? 46.985 46.596 -14.183 1.00 28.41 ? 131 LEU B O   1 
ATOM   964  C CB  . LEU A 1 126 ? 48.258 43.878 -13.282 1.00 28.14 ? 131 LEU B CB  1 
ATOM   965  C CG  . LEU A 1 126 ? 48.898 42.508 -13.537 1.00 31.49 ? 131 LEU B CG  1 
ATOM   966  C CD1 . LEU A 1 126 ? 48.359 41.433 -12.583 1.00 30.44 ? 131 LEU B CD1 1 
ATOM   967  C CD2 . LEU A 1 126 ? 48.556 42.046 -14.930 1.00 32.19 ? 131 LEU B CD2 1 
ATOM   968  N N   . LYS A 1 127 ? 48.880 47.195 -13.094 1.00 29.46 ? 132 LYS B N   1 
ATOM   969  C CA  . LYS A 1 127 ? 48.392 48.522 -12.660 1.00 27.45 ? 132 LYS B CA  1 
ATOM   970  C C   . LYS A 1 127 ? 47.362 48.625 -11.494 1.00 29.08 ? 132 LYS B C   1 
ATOM   971  O O   . LYS A 1 127 ? 47.475 49.520 -10.596 1.00 28.81 ? 132 LYS B O   1 
ATOM   972  C CB  . LYS A 1 127 ? 47.972 49.329 -13.871 1.00 33.30 ? 132 LYS B CB  1 
ATOM   973  C CG  . LYS A 1 127 ? 49.114 49.313 -14.912 1.00 30.95 ? 132 LYS B CG  1 
ATOM   974  C CD  . LYS A 1 127 ? 50.424 49.733 -14.282 1.00 32.41 ? 132 LYS B CD  1 
ATOM   975  C CE  . LYS A 1 127 ? 51.405 50.427 -15.197 1.00 40.22 ? 132 LYS B CE  1 
ATOM   976  N NZ  . LYS A 1 127 ? 52.491 49.511 -15.567 1.00 42.85 ? 132 LYS B NZ  1 
ATOM   977  N N   . ARG A 1 128 ? 46.419 47.699 -11.479 1.00 21.15 ? 133 ARG B N   1 
ATOM   978  C CA  . ARG A 1 128 ? 45.406 47.618 -10.509 1.00 20.92 ? 133 ARG B CA  1 
ATOM   979  C C   . ARG A 1 128 ? 46.089 47.357 -9.161  1.00 16.43 ? 133 ARG B C   1 
ATOM   980  O O   . ARG A 1 128 ? 47.220 46.930 -9.099  1.00 18.93 ? 133 ARG B O   1 
ATOM   981  C CB  . ARG A 1 128 ? 44.418 46.446 -10.849 1.00 22.60 ? 133 ARG B CB  1 
ATOM   982  C CG  . ARG A 1 128 ? 43.811 46.673 -12.213 1.00 23.64 ? 133 ARG B CG  1 
ATOM   983  C CD  . ARG A 1 128 ? 42.585 45.863 -12.490 1.00 24.79 ? 133 ARG B CD  1 
ATOM   984  N NE  . ARG A 1 128 ? 42.823 44.443 -12.297 1.00 25.03 ? 133 ARG B NE  1 
ATOM   985  C CZ  . ARG A 1 128 ? 43.474 43.588 -13.058 1.00 25.04 ? 133 ARG B CZ  1 
ATOM   986  N NH1 . ARG A 1 128 ? 43.996 43.932 -14.190 1.00 30.68 ? 133 ARG B NH1 1 
ATOM   987  N NH2 . ARG A 1 128 ? 43.528 42.335 -12.677 1.00 30.40 ? 133 ARG B NH2 1 
ATOM   988  N N   . GLU A 1 129 ? 45.332 47.640 -8.122  1.00 18.22 ? 134 GLU B N   1 
ATOM   989  C CA  . GLU A 1 129 ? 45.840 47.497 -6.793  1.00 16.38 ? 134 GLU B CA  1 
ATOM   990  C C   . GLU A 1 129 ? 46.127 46.035 -6.526  1.00 15.66 ? 134 GLU B C   1 
ATOM   991  O O   . GLU A 1 129 ? 45.358 45.193 -6.873  1.00 16.66 ? 134 GLU B O   1 
ATOM   992  C CB  . GLU A 1 129 ? 44.839 47.995 -5.820  1.00 18.69 ? 134 GLU B CB  1 
ATOM   993  C CG  . GLU A 1 129 ? 45.355 47.917 -4.412  1.00 18.95 ? 134 GLU B CG  1 
ATOM   994  C CD  . GLU A 1 129 ? 44.504 48.622 -3.401  1.00 23.76 ? 134 GLU B CD  1 
ATOM   995  O OE1 . GLU A 1 129 ? 43.331 48.276 -3.222  1.00 27.07 ? 134 GLU B OE1 1 
ATOM   996  O OE2 . GLU A 1 129 ? 44.965 49.643 -2.896  1.00 30.54 ? 134 GLU B OE2 1 
ATOM   997  N N   . VAL A 1 130 ? 47.291 45.802 -5.944  1.00 12.94 ? 135 VAL B N   1 
ATOM   998  C CA  . VAL A 1 130 ? 47.634 44.482 -5.362  1.00 12.91 ? 135 VAL B CA  1 
ATOM   999  C C   . VAL A 1 130 ? 47.848 44.602 -3.886  1.00 13.86 ? 135 VAL B C   1 
ATOM   1000 O O   . VAL A 1 130 ? 48.472 45.564 -3.353  1.00 14.05 ? 135 VAL B O   1 
ATOM   1001 C CB  . VAL A 1 130 ? 48.878 43.877 -6.025  1.00 13.85 ? 135 VAL B CB  1 
ATOM   1002 C CG1 . VAL A 1 130 ? 50.128 44.729 -5.884  1.00 14.58 ? 135 VAL B CG1 1 
ATOM   1003 C CG2 . VAL A 1 130 ? 49.129 42.496 -5.471  1.00 14.45 ? 135 VAL B CG2 1 
ATOM   1004 N N   . CYS A 1 131 ? 47.182 43.699 -3.148  1.00 13.53 ? 136 CYS B N   1 
ATOM   1005 C CA  . CYS A 1 131 ? 47.372 43.659 -1.697  1.00 14.38 ? 136 CYS B CA  1 
ATOM   1006 C C   . CYS A 1 131 ? 48.134 42.379 -1.405  1.00 13.00 ? 136 CYS B C   1 
ATOM   1007 O O   . CYS A 1 131 ? 47.895 41.341 -1.951  1.00 13.37 ? 136 CYS B O   1 
ATOM   1008 C CB  . CYS A 1 131 ? 46.113 43.696 -0.818  1.00 17.92 ? 136 CYS B CB  1 
ATOM   1009 S SG  . CYS A 1 131 ? 45.194 45.349 -1.085  1.00 26.23 ? 136 CYS B SG  1 
ATOM   1010 N N   . GLY A 1 132 ? 49.060 42.528 -0.495  1.00 12.38 ? 137 GLY B N   1 
ATOM   1011 C CA  . GLY A 1 132 ? 49.893 41.398 -0.071  1.00 12.56 ? 137 GLY B CA  1 
ATOM   1012 C C   . GLY A 1 132 ? 50.007 41.224 1.391   1.00 11.81 ? 137 GLY B C   1 
ATOM   1013 O O   . GLY A 1 132 ? 50.005 42.205 2.189   1.00 11.72 ? 137 GLY B O   1 
ATOM   1014 N N   . VAL A 1 133 ? 50.117 39.961 1.826   1.00 11.34 ? 138 VAL B N   1 
ATOM   1015 C CA  . VAL A 1 133 ? 50.189 39.677 3.251   1.00 12.48 ? 138 VAL B CA  1 
ATOM   1016 C C   . VAL A 1 133 ? 51.209 38.613 3.513   1.00 11.45 ? 138 VAL B C   1 
ATOM   1017 O O   . VAL A 1 133 ? 51.598 37.808 2.647   1.00 11.86 ? 138 VAL B O   1 
ATOM   1018 C CB  . VAL A 1 133 ? 48.855 39.165 3.837   1.00 15.66 ? 138 VAL B CB  1 
ATOM   1019 C CG1 . VAL A 1 133 ? 47.774 40.183 3.782   1.00 16.63 ? 138 VAL B CG1 1 
ATOM   1020 C CG2 . VAL A 1 133 ? 48.507 37.834 3.164   1.00 17.82 ? 138 VAL B CG2 1 
ATOM   1021 N N   . ASP A 1 134 ? 51.740 38.633 4.736   1.00 10.97 ? 139 ASP B N   1 
ATOM   1022 C CA  . ASP A 1 134 ? 52.397 37.506 5.360   1.00 11.14 ? 139 ASP B CA  1 
ATOM   1023 C C   . ASP A 1 134 ? 51.602 37.106 6.535   1.00 10.77 ? 139 ASP B C   1 
ATOM   1024 O O   . ASP A 1 134 ? 51.210 37.996 7.348   1.00 11.79 ? 139 ASP B O   1 
ATOM   1025 C CB  . ASP A 1 134 ? 53.853 37.789 5.789   1.00 13.13 ? 139 ASP B CB  1 
ATOM   1026 C CG  . ASP A 1 134 ? 54.739 36.506 5.842   1.00 15.80 ? 139 ASP B CG  1 
ATOM   1027 O OD1 . ASP A 1 134 ? 54.829 35.685 4.837   1.00 16.95 ? 139 ASP B OD1 1 
ATOM   1028 O OD2 . ASP A 1 134 ? 55.438 36.355 6.879   1.00 24.52 ? 139 ASP B OD2 1 
ATOM   1029 N N   . ALA A 1 135 ? 51.284 35.841 6.668   1.00 10.04 ? 140 ALA B N   1 
ATOM   1030 C CA  . ALA A 1 135 ? 50.384 35.407 7.765   1.00 10.56 ? 140 ALA B CA  1 
ATOM   1031 C C   . ALA A 1 135 ? 50.909 34.098 8.328   1.00 9.97  ? 140 ALA B C   1 
ATOM   1032 O O   . ALA A 1 135 ? 51.734 33.413 7.747   1.00 12.05 ? 140 ALA B O   1 
ATOM   1033 C CB  . ALA A 1 135 ? 48.963 35.233 7.263   1.00 10.27 ? 140 ALA B CB  1 
ATOM   1034 N N   . VAL A 1 136 ? 50.438 33.795 9.538   1.00 9.76  ? 141 VAL B N   1 
ATOM   1035 C CA  . VAL A 1 136 ? 50.838 32.616 10.248  1.00 10.95 ? 141 VAL B CA  1 
ATOM   1036 C C   . VAL A 1 136 ? 49.714 31.946 10.933  1.00 11.90 ? 141 VAL B C   1 
ATOM   1037 O O   . VAL A 1 136 ? 48.733 32.598 11.319  1.00 12.58 ? 141 VAL B O   1 
ATOM   1038 C CB  . VAL A 1 136 ? 51.940 32.903 11.350  1.00 13.64 ? 141 VAL B CB  1 
ATOM   1039 C CG1 . VAL A 1 136 ? 53.108 33.544 10.765  1.00 15.91 ? 141 VAL B CG1 1 
ATOM   1040 C CG2 . VAL A 1 136 ? 51.424 33.797 12.425  1.00 15.40 ? 141 VAL B CG2 1 
ATOM   1041 N N   . GLY A 1 137 ? 49.746 30.635 10.987  1.00 11.22 ? 142 GLY B N   1 
ATOM   1042 C CA  . GLY A 1 137 ? 48.736 29.848 11.685  1.00 12.64 ? 142 GLY B CA  1 
ATOM   1043 C C   . GLY A 1 137 ? 49.366 28.590 12.204  1.00 11.64 ? 142 GLY B C   1 
ATOM   1044 O O   . GLY A 1 137 ? 50.495 28.249 11.879  1.00 12.53 ? 142 GLY B O   1 
ATOM   1045 N N   . GLU A 1 138 ? 48.659 27.907 13.075  1.00 11.53 ? 143 GLU B N   1 
ATOM   1046 C CA  . GLU A 1 138 ? 49.162 26.606 13.511  1.00 12.96 ? 143 GLU B CA  1 
ATOM   1047 C C   . GLU A 1 138 ? 47.947 25.754 13.775  1.00 11.91 ? 143 GLU B C   1 
ATOM   1048 O O   . GLU A 1 138 ? 46.879 26.287 14.250  1.00 12.81 ? 143 GLU B O   1 
ATOM   1049 C CB  . GLU A 1 138 ? 49.978 26.782 14.815  1.00 18.41 ? 143 GLU B CB  1 
ATOM   1050 C CG  . GLU A 1 138 ? 51.130 27.835 14.835  1.00 27.68 ? 143 GLU B CG  1 
ATOM   1051 C CD  . GLU A 1 138 ? 51.947 27.835 16.172  1.00 34.23 ? 143 GLU B CD  1 
ATOM   1052 O OE1 . GLU A 1 138 ? 51.430 27.209 17.189  1.00 39.98 ? 143 GLU B OE1 1 
ATOM   1053 O OE2 . GLU A 1 138 ? 53.083 28.478 16.168  1.00 35.07 ? 143 GLU B OE2 1 
ATOM   1054 N N   . PHE A 1 139 ? 48.118 24.431 13.612  1.00 10.47 ? 144 PHE B N   1 
ATOM   1055 C CA  . PHE A 1 139 ? 47.066 23.487 13.909  1.00 10.68 ? 144 PHE B CA  1 
ATOM   1056 C C   . PHE A 1 139 ? 47.704 22.167 14.314  1.00 11.14 ? 144 PHE B C   1 
ATOM   1057 O O   . PHE A 1 139 ? 48.862 21.961 14.050  1.00 11.54 ? 144 PHE B O   1 
ATOM   1058 C CB  . PHE A 1 139 ? 46.109 23.322 12.769  1.00 10.28 ? 144 PHE B CB  1 
ATOM   1059 C CG  . PHE A 1 139 ? 46.706 22.754 11.495  1.00 11.51 ? 144 PHE B CG  1 
ATOM   1060 C CD1 . PHE A 1 139 ? 47.228 23.546 10.558  1.00 14.57 ? 144 PHE B CD1 1 
ATOM   1061 C CD2 . PHE A 1 139 ? 46.708 21.388 11.203  1.00 11.63 ? 144 PHE B CD2 1 
ATOM   1062 C CE1 . PHE A 1 139 ? 47.813 23.051 9.428   1.00 16.68 ? 144 PHE B CE1 1 
ATOM   1063 C CE2 . PHE A 1 139 ? 47.290 20.899 10.052  1.00 13.28 ? 144 PHE B CE2 1 
ATOM   1064 C CZ  . PHE A 1 139 ? 47.814 21.710 9.141   1.00 15.13 ? 144 PHE B CZ  1 
ATOM   1065 N N   . SER A 1 140 ? 46.912 21.289 14.911  1.00 12.05 ? 145 SER B N   1 
ATOM   1066 C CA  . SER A 1 140 ? 47.340 19.969 15.258  1.00 11.30 ? 145 SER B CA  1 
ATOM   1067 C C   . SER A 1 140 ? 46.841 19.040 14.171  1.00 10.65 ? 145 SER B C   1 
ATOM   1068 O O   . SER A 1 140 ? 45.649 18.895 13.989  1.00 11.24 ? 145 SER B O   1 
ATOM   1069 C CB  . SER A 1 140 ? 46.651 19.608 16.576  1.00 13.81 ? 145 SER B CB  1 
ATOM   1070 O OG  . SER A 1 140 ? 47.456 18.618 17.230  1.00 18.59 ? 145 SER B OG  1 
ATOM   1071 N N   . ARG A 1 141 ? 47.737 18.437 13.387  1.00 10.77 ? 146 ARG B N   1 
ATOM   1072 C CA  . ARG A 1 141 ? 47.266 17.698 12.215  1.00 10.85 ? 146 ARG B CA  1 
ATOM   1073 C C   . ARG A 1 141 ? 46.430 16.473 12.468  1.00 11.31 ? 146 ARG B C   1 
ATOM   1074 O O   . ARG A 1 141 ? 45.597 16.087 11.604  1.00 11.24 ? 146 ARG B O   1 
ATOM   1075 C CB  . ARG A 1 141 ? 48.403 17.343 11.302  1.00 11.45 ? 146 ARG B CB  1 
ATOM   1076 C CG  . ARG A 1 141 ? 49.560 16.506 11.884  1.00 11.77 ? 146 ARG B CG  1 
ATOM   1077 C CD  . ARG A 1 141 ? 50.503 16.205 10.721  1.00 14.79 ? 146 ARG B CD  1 
ATOM   1078 N NE  . ARG A 1 141 ? 51.780 15.628 11.172  1.00 16.20 ? 146 ARG B NE  1 
ATOM   1079 C CZ  . ARG A 1 141 ? 51.969 14.323 11.387  1.00 18.81 ? 146 ARG B CZ  1 
ATOM   1080 N NH1 . ARG A 1 141 ? 51.060 13.436 11.238  1.00 17.72 ? 146 ARG B NH1 1 
ATOM   1081 N NH2 . ARG A 1 141 ? 53.247 13.925 11.692  1.00 19.89 ? 146 ARG B NH2 1 
ATOM   1082 N N   . ASP A 1 142 ? 46.567 15.891 13.644  1.00 12.67 ? 147 ASP B N   1 
ATOM   1083 C CA  . ASP A 1 142 ? 45.656 14.836 14.048  1.00 14.84 ? 147 ASP B CA  1 
ATOM   1084 C C   . ASP A 1 142 ? 44.155 15.271 14.130  1.00 13.74 ? 147 ASP B C   1 
ATOM   1085 O O   . ASP A 1 142 ? 43.305 14.428 13.978  1.00 15.57 ? 147 ASP B O   1 
ATOM   1086 C CB  . ASP A 1 142 ? 46.075 14.161 15.352  1.00 15.91 ? 147 ASP B CB  1 
ATOM   1087 C CG  . ASP A 1 142 ? 46.256 15.104 16.522  1.00 20.10 ? 147 ASP B CG  1 
ATOM   1088 O OD1 . ASP A 1 142 ? 46.432 16.296 16.327  1.00 17.08 ? 147 ASP B OD1 1 
ATOM   1089 O OD2 . ASP A 1 142 ? 46.388 14.640 17.701  1.00 22.97 ? 147 ASP B OD2 1 
ATOM   1090 N N   . ASP A 1 143 ? 43.827 16.556 14.273  1.00 13.01 ? 148 ASP B N   1 
ATOM   1091 C CA  . ASP A 1 143 ? 42.493 17.051 14.240  1.00 14.05 ? 148 ASP B CA  1 
ATOM   1092 C C   . ASP A 1 143 ? 41.861 16.914 12.899  1.00 12.98 ? 148 ASP B C   1 
ATOM   1093 O O   . ASP A 1 143 ? 40.627 16.947 12.754  1.00 15.16 ? 148 ASP B O   1 
ATOM   1094 C CB  . ASP A 1 143 ? 42.486 18.516 14.612  1.00 14.52 ? 148 ASP B CB  1 
ATOM   1095 C CG  . ASP A 1 143 ? 42.754 18.765 16.067  1.00 19.59 ? 148 ASP B CG  1 
ATOM   1096 O OD1 . ASP A 1 143 ? 42.886 17.795 16.867  1.00 22.90 ? 148 ASP B OD1 1 
ATOM   1097 O OD2 . ASP A 1 143 ? 42.796 19.990 16.397  1.00 21.29 ? 148 ASP B OD2 1 
ATOM   1098 N N   . PHE A 1 144 ? 42.692 16.702 11.858  1.00 12.19 ? 149 PHE B N   1 
ATOM   1099 C CA  . PHE A 1 144 ? 42.168 16.512 10.470  1.00 11.31 ? 149 PHE B CA  1 
ATOM   1100 C C   . PHE A 1 144 ? 42.282 15.085 10.072  1.00 12.12 ? 149 PHE B C   1 
ATOM   1101 O O   . PHE A 1 144 ? 42.153 14.738 8.911   1.00 14.70 ? 149 PHE B O   1 
ATOM   1102 C CB  . PHE A 1 144 ? 42.922 17.397 9.502   1.00 10.19 ? 149 PHE B CB  1 
ATOM   1103 C CG  . PHE A 1 144 ? 42.688 18.849 9.745   1.00 10.23 ? 149 PHE B CG  1 
ATOM   1104 C CD1 . PHE A 1 144 ? 41.633 19.493 9.149   1.00 9.49  ? 149 PHE B CD1 1 
ATOM   1105 C CD2 . PHE A 1 144 ? 43.477 19.582 10.592  1.00 10.49 ? 149 PHE B CD2 1 
ATOM   1106 C CE1 . PHE A 1 144 ? 41.351 20.819 9.384   1.00 9.66  ? 149 PHE B CE1 1 
ATOM   1107 C CE2 . PHE A 1 144 ? 43.225 20.947 10.781  1.00 9.74  ? 149 PHE B CE2 1 
ATOM   1108 C CZ  . PHE A 1 144 ? 42.116 21.551 10.216  1.00 9.82  ? 149 PHE B CZ  1 
ATOM   1109 N N   . GLY A 1 145 ? 42.588 14.194 11.028  1.00 14.37 ? 150 GLY B N   1 
ATOM   1110 C CA  . GLY A 1 145 ? 42.725 12.739 10.670  1.00 14.96 ? 150 GLY B CA  1 
ATOM   1111 C C   . GLY A 1 145 ? 44.118 12.384 10.146  1.00 18.00 ? 150 GLY B C   1 
ATOM   1112 O O   . GLY A 1 145 ? 44.310 11.281 9.592   1.00 20.92 ? 150 GLY B O   1 
ATOM   1113 N N   . LEU A 1 146 ? 45.090 13.291 10.205  1.00 14.03 ? 151 LEU B N   1 
ATOM   1114 C CA  . LEU A 1 146 ? 46.421 13.147 9.714   1.00 14.37 ? 151 LEU B CA  1 
ATOM   1115 C C   . LEU A 1 146 ? 47.389 12.861 10.929  1.00 15.23 ? 151 LEU B C   1 
ATOM   1116 O O   . LEU A 1 146 ? 48.184 13.700 11.286  1.00 19.45 ? 151 LEU B O   1 
ATOM   1117 C CB  . LEU A 1 146 ? 46.874 14.393 8.938   1.00 13.27 ? 151 LEU B CB  1 
ATOM   1118 C CG  . LEU A 1 146 ? 46.034 14.756 7.700   1.00 13.34 ? 151 LEU B CG  1 
ATOM   1119 C CD1 . LEU A 1 146 ? 46.504 16.074 7.249   1.00 12.44 ? 151 LEU B CD1 1 
ATOM   1120 C CD2 . LEU A 1 146 ? 46.201 13.694 6.625   1.00 13.71 ? 151 LEU B CD2 1 
ATOM   1121 N N   . ASP A 1 147 ? 47.335 11.650 11.410  1.00 21.48 ? 152 ASP B N   1 
ATOM   1122 C CA  . ASP A 1 147 ? 48.131 11.348 12.609  1.00 24.39 ? 152 ASP B CA  1 
ATOM   1123 C C   . ASP A 1 147 ? 49.365 10.474 12.390  1.00 27.05 ? 152 ASP B C   1 
ATOM   1124 O O   . ASP A 1 147 ? 50.057 9.993  13.381  1.00 27.15 ? 152 ASP B O   1 
ATOM   1125 C CB  . ASP A 1 147 ? 47.165 10.774 13.620  1.00 27.93 ? 152 ASP B CB  1 
ATOM   1126 C CG  . ASP A 1 147 ? 46.600 9.427  13.196  1.00 35.15 ? 152 ASP B CG  1 
ATOM   1127 O OD1 . ASP A 1 147 ? 46.910 8.923  12.071  1.00 37.69 ? 152 ASP B OD1 1 
ATOM   1128 O OD2 . ASP A 1 147 ? 45.879 8.827  13.999  1.00 39.09 ? 152 ASP B OD2 1 
ATOM   1129 N N   . TYR A 1 148 ? 49.739 10.312 11.138  1.00 25.98 ? 153 TYR B N   1 
ATOM   1130 C CA  . TYR A 1 148 ? 50.938 9.484  10.885  1.00 27.88 ? 153 TYR B CA  1 
ATOM   1131 C C   . TYR A 1 148 ? 52.162 9.948  11.761  1.00 27.26 ? 153 TYR B C   1 
ATOM   1132 O O   . TYR A 1 148 ? 52.525 11.128 11.803  1.00 25.39 ? 153 TYR B O   1 
ATOM   1133 C CB  . TYR A 1 148 ? 51.302 9.623  9.438   1.00 30.26 ? 153 TYR B CB  1 
ATOM   1134 C CG  . TYR A 1 148 ? 52.476 8.781  8.956   1.00 43.21 ? 153 TYR B CG  1 
ATOM   1135 C CD1 . TYR A 1 148 ? 53.802 9.021  9.380   1.00 48.27 ? 153 TYR B CD1 1 
ATOM   1136 C CD2 . TYR A 1 148 ? 52.265 7.770  8.024   1.00 53.66 ? 153 TYR B CD2 1 
ATOM   1137 C CE1 . TYR A 1 148 ? 54.856 8.239  8.892   1.00 55.71 ? 153 TYR B CE1 1 
ATOM   1138 C CE2 . TYR A 1 148 ? 53.305 7.013  7.531   1.00 54.44 ? 153 TYR B CE2 1 
ATOM   1139 C CZ  . TYR A 1 148 ? 54.580 7.239  7.956   1.00 57.95 ? 153 TYR B CZ  1 
ATOM   1140 O OH  . TYR A 1 148 ? 55.545 6.425  7.409   1.00 66.65 ? 153 TYR B OH  1 
ATOM   1141 N N   . GLY A 1 149 ? 52.918 8.987  12.324  1.00 26.97 ? 154 GLY B N   1 
ATOM   1142 C CA  . GLY A 1 149 ? 54.138 9.309  13.073  1.00 25.99 ? 154 GLY B CA  1 
ATOM   1143 C C   . GLY A 1 149 ? 53.927 9.468  14.550  1.00 31.61 ? 154 GLY B C   1 
ATOM   1144 O O   . GLY A 1 149 ? 54.935 9.504  15.340  1.00 27.31 ? 154 GLY B O   1 
ATOM   1145 N N   . LYS A 1 150 ? 52.642 9.516  14.952  1.00 32.45 ? 155 LYS B N   1 
ATOM   1146 C CA  . LYS A 1 150 ? 52.263 9.854  16.313  1.00 37.29 ? 155 LYS B CA  1 
ATOM   1147 C C   . LYS A 1 150 ? 52.785 8.809  17.228  1.00 36.10 ? 155 LYS B C   1 
ATOM   1148 O O   . LYS A 1 150 ? 53.342 9.081  18.365  1.00 34.07 ? 155 LYS B O   1 
ATOM   1149 C CB  . LYS A 1 150 ? 50.725 9.915  16.441  1.00 33.47 ? 155 LYS B CB  1 
ATOM   1150 C CG  . LYS A 1 150 ? 50.258 10.457 17.751  1.00 39.47 ? 155 LYS B CG  1 
ATOM   1151 C CD  . LYS A 1 150 ? 48.861 10.982 17.571  1.00 35.76 ? 155 LYS B CD  1 
ATOM   1152 C CE  . LYS A 1 150 ? 48.376 11.662 18.808  1.00 39.33 ? 155 LYS B CE  1 
ATOM   1153 N NZ  . LYS A 1 150 ? 46.984 12.025 18.541  1.00 34.79 ? 155 LYS B NZ  1 
ATOM   1154 N N   . GLN A 1 151 ? 52.642 7.577  16.766  1.00 39.32 ? 156 GLN B N   1 
ATOM   1155 C CA  . GLN A 1 151 ? 53.132 6.434  17.557  1.00 41.07 ? 156 GLN B CA  1 
ATOM   1156 C C   . GLN A 1 151 ? 54.654 6.309  17.669  1.00 43.38 ? 156 GLN B C   1 
ATOM   1157 O O   . GLN A 1 151 ? 55.129 5.479  18.405  1.00 53.42 ? 156 GLN B O   1 
ATOM   1158 C CB  . GLN A 1 151 ? 52.549 5.141  16.973  1.00 46.86 ? 156 GLN B CB  1 
ATOM   1159 C CG  . GLN A 1 151 ? 51.162 4.869  17.521  1.00 52.14 ? 156 GLN B CG  1 
ATOM   1160 C CD  . GLN A 1 151 ? 50.976 5.647  18.812  1.00 53.35 ? 156 GLN B CD  1 
ATOM   1161 O OE1 . GLN A 1 151 ? 51.521 5.286  19.887  1.00 51.88 ? 156 GLN B OE1 1 
ATOM   1162 N NE2 . GLN A 1 151 ? 50.268 6.751  18.709  1.00 50.61 ? 156 GLN B NE2 1 
ATOM   1163 N N   . TYR A 1 152 ? 55.402 7.162  16.967  1.00 46.29 ? 157 TYR B N   1 
ATOM   1164 C CA  . TYR A 1 152 ? 56.888 7.125  16.856  1.00 44.32 ? 157 TYR B CA  1 
ATOM   1165 C C   . TYR A 1 152 ? 57.561 8.400  17.421  1.00 38.50 ? 157 TYR B C   1 
ATOM   1166 O O   . TYR A 1 152 ? 58.721 8.706  17.140  1.00 42.82 ? 157 TYR B O   1 
ATOM   1167 C CB  . TYR A 1 152 ? 57.269 6.927  15.381  1.00 49.56 ? 157 TYR B CB  1 
ATOM   1168 C CG  . TYR A 1 152 ? 57.115 5.484  14.913  1.00 60.40 ? 157 TYR B CG  1 
ATOM   1169 C CD1 . TYR A 1 152 ? 55.860 4.829  14.953  1.00 62.26 ? 157 TYR B CD1 1 
ATOM   1170 C CD2 . TYR A 1 152 ? 58.231 4.759  14.437  1.00 60.50 ? 157 TYR B CD2 1 
ATOM   1171 C CE1 . TYR A 1 152 ? 55.732 3.501  14.543  1.00 66.13 ? 157 TYR B CE1 1 
ATOM   1172 C CE2 . TYR A 1 152 ? 58.108 3.440  14.020  1.00 65.48 ? 157 TYR B CE2 1 
ATOM   1173 C CZ  . TYR A 1 152 ? 56.861 2.812  14.076  1.00 68.26 ? 157 TYR B CZ  1 
ATOM   1174 O OH  . TYR A 1 152 ? 56.739 1.498  13.665  1.00 68.08 ? 157 TYR B OH  1 
ATOM   1175 N N   . GLY A 1 153 ? 56.801 9.153  18.208  1.00 34.88 ? 158 GLY B N   1 
ATOM   1176 C CA  . GLY A 1 153 ? 57.306 10.368 18.828  1.00 32.85 ? 158 GLY B CA  1 
ATOM   1177 C C   . GLY A 1 153 ? 57.125 11.672 18.064  1.00 28.06 ? 158 GLY B C   1 
ATOM   1178 O O   . GLY A 1 153 ? 57.545 12.739 18.600  1.00 28.43 ? 158 GLY B O   1 
ATOM   1179 N N   . PHE A 1 154 ? 56.419 11.664 16.901  1.00 24.16 ? 159 PHE B N   1 
ATOM   1180 C CA  . PHE A 1 154 ? 56.342 12.889 16.055  1.00 21.71 ? 159 PHE B CA  1 
ATOM   1181 C C   . PHE A 1 154 ? 55.221 13.760 16.735  1.00 19.23 ? 159 PHE B C   1 
ATOM   1182 O O   . PHE A 1 154 ? 54.282 13.252 17.301  1.00 22.23 ? 159 PHE B O   1 
ATOM   1183 C CB  . PHE A 1 154 ? 55.890 12.601 14.623  1.00 22.01 ? 159 PHE B CB  1 
ATOM   1184 C CG  . PHE A 1 154 ? 56.944 12.116 13.684  1.00 23.31 ? 159 PHE B CG  1 
ATOM   1185 C CD1 . PHE A 1 154 ? 57.535 10.854 13.838  1.00 25.46 ? 159 PHE B CD1 1 
ATOM   1186 C CD2 . PHE A 1 154 ? 57.291 12.875 12.564  1.00 24.62 ? 159 PHE B CD2 1 
ATOM   1187 C CE1 . PHE A 1 154 ? 58.467 10.404 12.897  1.00 25.70 ? 159 PHE B CE1 1 
ATOM   1188 C CE2 . PHE A 1 154 ? 58.216 12.420 11.653  1.00 25.24 ? 159 PHE B CE2 1 
ATOM   1189 C CZ  . PHE A 1 154 ? 58.831 11.206 11.837  1.00 28.06 ? 159 PHE B CZ  1 
ATOM   1190 N N   . LYS A 1 155 ? 55.516 15.023 16.753  1.00 20.01 ? 160 LYS B N   1 
ATOM   1191 C CA  . LYS A 1 155 ? 54.620 16.038 17.277  1.00 17.68 ? 160 LYS B CA  1 
ATOM   1192 C C   . LYS A 1 155 ? 53.637 16.368 16.157  1.00 15.28 ? 160 LYS B C   1 
ATOM   1193 O O   . LYS A 1 155 ? 54.005 16.379 14.988  1.00 15.29 ? 160 LYS B O   1 
ATOM   1194 C CB  . LYS A 1 155 ? 55.372 17.204 17.730  1.00 18.11 ? 160 LYS B CB  1 
ATOM   1195 C CG  . LYS A 1 155 ? 56.416 16.881 18.792  1.00 22.68 ? 160 LYS B CG  1 
ATOM   1196 C CD  . LYS A 1 155 ? 55.804 16.171 19.967  1.00 28.22 ? 160 LYS B CD  1 
ATOM   1197 C CE  . LYS A 1 155 ? 56.664 16.236 21.250  1.00 35.89 ? 160 LYS B CE  1 
ATOM   1198 N NZ  . LYS A 1 155 ? 58.097 16.401 20.889  1.00 40.43 ? 160 LYS B NZ  1 
ATOM   1199 N N   . MET A 1 156 ? 52.402 16.627 16.551  1.00 13.68 ? 161 MET B N   1 
ATOM   1200 C CA  . MET A 1 156 ? 51.296 16.891 15.596  1.00 13.53 ? 161 MET B CA  1 
ATOM   1201 C C   . MET A 1 156 ? 51.213 18.363 15.258  1.00 12.40 ? 161 MET B C   1 
ATOM   1202 O O   . MET A 1 156 ? 50.532 18.779 14.287  1.00 11.78 ? 161 MET B O   1 
ATOM   1203 C CB  . MET A 1 156 ? 49.999 16.459 16.218  1.00 13.65 ? 161 MET B CB  1 
ATOM   1204 C CG  . MET A 1 156 ? 49.740 14.989 16.401  1.00 16.52 ? 161 MET B CG  1 
ATOM   1205 S SD  . MET A 1 156 ? 49.940 13.970 14.901  1.00 18.25 ? 161 MET B SD  1 
ATOM   1206 C CE  . MET A 1 156 ? 51.588 13.420 15.037  1.00 22.14 ? 161 MET B CE  1 
ATOM   1207 N N   . LYS A 1 157 ? 51.828 19.257 16.014  1.00 12.60 ? 162 LYS B N   1 
ATOM   1208 C CA  . LYS A 1 157 ? 51.776 20.699 15.756  1.00 13.60 ? 162 LYS B CA  1 
ATOM   1209 C C   . LYS A 1 157 ? 52.418 21.019 14.455  1.00 12.01 ? 162 LYS B C   1 
ATOM   1210 O O   . LYS A 1 157 ? 53.513 20.542 14.123  1.00 14.56 ? 162 LYS B O   1 
ATOM   1211 C CB  . LYS A 1 157 ? 52.504 21.501 16.860  1.00 17.59 ? 162 LYS B CB  1 
ATOM   1212 C CG  . LYS A 1 157 ? 52.423 23.011 16.717  1.00 25.36 ? 162 LYS B CG  1 
ATOM   1213 C CD  . LYS A 1 157 ? 53.286 23.674 17.797  1.00 30.12 ? 162 LYS B CD  1 
ATOM   1214 C CE  . LYS A 1 157 ? 54.665 23.954 17.280  1.00 36.23 ? 162 LYS B CE  1 
ATOM   1215 N NZ  . LYS A 1 157 ? 55.361 24.932 18.175  1.00 41.84 ? 162 LYS B NZ  1 
ATOM   1216 N N   . THR A 1 158 ? 51.641 21.712 13.598  1.00 9.96  ? 163 THR B N   1 
ATOM   1217 C CA  . THR A 1 158 ? 52.044 22.033 12.232  1.00 9.92  ? 163 THR B CA  1 
ATOM   1218 C C   . THR A 1 158 ? 51.911 23.503 12.140  1.00 10.49 ? 163 THR B C   1 
ATOM   1219 O O   . THR A 1 158 ? 50.826 24.077 12.376  1.00 11.52 ? 163 THR B O   1 
ATOM   1220 C CB  . THR A 1 158 ? 51.158 21.270 11.229  1.00 10.93 ? 163 THR B CB  1 
ATOM   1221 O OG1 . THR A 1 158 ? 51.191 19.840 11.533  1.00 12.95 ? 163 THR B OG1 1 
ATOM   1222 C CG2 . THR A 1 158 ? 51.650 21.461 9.793   1.00 12.59 ? 163 THR B CG2 1 
ATOM   1223 N N   . LYS A 1 159 ? 52.899 24.203 11.630  1.00 11.23 ? 164 LYS B N   1 
ATOM   1224 C CA  . LYS A 1 159 ? 52.835 25.616 11.482  1.00 11.91 ? 164 LYS B CA  1 
ATOM   1225 C C   . LYS A 1 159 ? 52.610 25.961 10.046  1.00 11.33 ? 164 LYS B C   1 
ATOM   1226 O O   . LYS A 1 159 ? 53.178 25.280 9.180   1.00 10.84 ? 164 LYS B O   1 
ATOM   1227 C CB  . LYS A 1 159 ? 54.107 26.309 11.974  1.00 15.30 ? 164 LYS B CB  1 
ATOM   1228 C CG  . LYS A 1 159 ? 54.233 26.194 13.461  1.00 19.82 ? 164 LYS B CG  1 
ATOM   1229 C CD  . LYS A 1 159 ? 55.574 26.581 13.996  1.00 25.71 ? 164 LYS B CD  1 
ATOM   1230 C CE  . LYS A 1 159 ? 55.808 28.042 13.851  1.00 27.81 ? 164 LYS B CE  1 
ATOM   1231 N NZ  . LYS A 1 159 ? 55.578 28.664 12.539  1.00 34.21 ? 164 LYS B NZ  1 
ATOM   1232 N N   . LEU A 1 160 ? 51.846 26.996 9.800   1.00 10.72 ? 165 LEU B N   1 
ATOM   1233 C CA  . LEU A 1 160 ? 51.667 27.524 8.456   1.00 11.43 ? 165 LEU B CA  1 
ATOM   1234 C C   . LEU A 1 160 ? 52.235 28.929 8.356   1.00 12.11 ? 165 LEU B C   1 
ATOM   1235 O O   . LEU A 1 160 ? 52.114 29.757 9.258   1.00 13.35 ? 165 LEU B O   1 
ATOM   1236 C CB  . LEU A 1 160 ? 50.193 27.636 8.067   1.00 13.44 ? 165 LEU B CB  1 
ATOM   1237 C CG  . LEU A 1 160 ? 49.379 26.368 8.001   1.00 14.93 ? 165 LEU B CG  1 
ATOM   1238 C CD1 . LEU A 1 160 ? 47.820 26.650 7.874   1.00 16.20 ? 165 LEU B CD1 1 
ATOM   1239 C CD2 . LEU A 1 160 ? 49.950 25.390 6.973   1.00 15.82 ? 165 LEU B CD2 1 
ATOM   1240 N N   . LEU A 1 161 ? 52.947 29.167 7.256   1.00 10.22 ? 166 LEU B N   1 
ATOM   1241 C CA  . LEU A 1 161 ? 53.577 30.436 6.950   1.00 11.25 ? 166 LEU B CA  1 
ATOM   1242 C C   . LEU A 1 161 ? 53.027 30.772 5.557   1.00 11.04 ? 166 LEU B C   1 
ATOM   1243 O O   . LEU A 1 161 ? 53.469 30.169 4.572   1.00 11.06 ? 166 LEU B O   1 
ATOM   1244 C CB  . LEU A 1 161 ? 55.105 30.390 6.971   1.00 12.05 ? 166 LEU B CB  1 
ATOM   1245 C CG  . LEU A 1 161 ? 55.721 30.140 8.356   1.00 13.86 ? 166 LEU B CG  1 
ATOM   1246 C CD1 . LEU A 1 161 ? 55.814 28.659 8.616   1.00 14.48 ? 166 LEU B CD1 1 
ATOM   1247 C CD2 . LEU A 1 161 ? 57.073 30.701 8.524   1.00 17.05 ? 166 LEU B CD2 1 
ATOM   1248 N N   . ILE A 1 162 ? 52.218 31.787 5.453   1.00 9.72  ? 167 ILE B N   1 
ATOM   1249 C CA  . ILE A 1 162 ? 51.431 32.053 4.283   1.00 10.72 ? 167 ILE B CA  1 
ATOM   1250 C C   . ILE A 1 162 ? 51.893 33.278 3.559   1.00 10.26 ? 167 ILE B C   1 
ATOM   1251 O O   . ILE A 1 162 ? 52.018 34.371 4.194   1.00 11.39 ? 167 ILE B O   1 
ATOM   1252 C CB  . ILE A 1 162 ? 49.973 32.154 4.655   1.00 12.92 ? 167 ILE B CB  1 
ATOM   1253 C CG1 . ILE A 1 162 ? 49.466 30.727 5.070   1.00 15.74 ? 167 ILE B CG1 1 
ATOM   1254 C CG2 . ILE A 1 162 ? 49.217 32.641 3.474   1.00 15.29 ? 167 ILE B CG2 1 
ATOM   1255 C CD1 . ILE A 1 162 ? 48.309 30.903 5.983   1.00 17.89 ? 167 ILE B CD1 1 
ATOM   1256 N N   . THR A 1 163 ? 52.233 33.160 2.274   1.00 10.56 ? 168 THR B N   1 
ATOM   1257 C CA  . THR A 1 163 ? 52.483 34.261 1.432   1.00 10.03 ? 168 THR B CA  1 
ATOM   1258 C C   . THR A 1 163 ? 51.259 34.416 0.548   1.00 9.61  ? 168 THR B C   1 
ATOM   1259 O O   . THR A 1 163 ? 50.818 33.448 -0.024  1.00 9.86  ? 168 THR B O   1 
ATOM   1260 C CB  . THR A 1 163 ? 53.632 33.849 0.443   1.00 12.97 ? 168 THR B CB  1 
ATOM   1261 O OG1 . THR A 1 163 ? 54.831 33.494 1.204   1.00 17.38 ? 168 THR B OG1 1 
ATOM   1262 C CG2 . THR A 1 163 ? 53.950 34.931 -0.537  1.00 15.60 ? 168 THR B CG2 1 
ATOM   1263 N N   . ALA A 1 164 ? 50.750 35.634 0.397   1.00 9.35  ? 169 ALA B N   1 
ATOM   1264 C CA  . ALA A 1 164 ? 49.603 35.818 -0.536  1.00 9.45  ? 169 ALA B CA  1 
ATOM   1265 C C   . ALA A 1 164 ? 49.648 37.196 -1.156  1.00 10.12 ? 169 ALA B C   1 
ATOM   1266 O O   . ALA A 1 164 ? 49.945 38.187 -0.440  1.00 11.68 ? 169 ALA B O   1 
ATOM   1267 C CB  . ALA A 1 164 ? 48.279 35.582 0.152   1.00 10.07 ? 169 ALA B CB  1 
ATOM   1268 N N   . GLU A 1 165 ? 49.312 37.260 -2.414  1.00 9.81  ? 170 GLU B N   1 
ATOM   1269 C CA  . GLU A 1 165 ? 49.115 38.548 -3.119  1.00 9.75  ? 170 GLU B CA  1 
ATOM   1270 C C   . GLU A 1 165 ? 47.818 38.423 -3.904  1.00 10.68 ? 170 GLU B C   1 
ATOM   1271 O O   . GLU A 1 165 ? 47.630 37.350 -4.559  1.00 11.88 ? 170 GLU B O   1 
ATOM   1272 C CB  . GLU A 1 165 ? 50.269 38.948 -4.070  1.00 10.88 ? 170 GLU B CB  1 
ATOM   1273 C CG  . GLU A 1 165 ? 51.613 39.130 -3.341  1.00 12.04 ? 170 GLU B CG  1 
ATOM   1274 C CD  . GLU A 1 165 ? 52.761 39.611 -4.184  1.00 14.18 ? 170 GLU B CD  1 
ATOM   1275 O OE1 . GLU A 1 165 ? 52.695 39.871 -5.413  1.00 18.52 ? 170 GLU B OE1 1 
ATOM   1276 O OE2 . GLU A 1 165 ? 53.862 39.785 -3.550  1.00 16.29 ? 170 GLU B OE2 1 
ATOM   1277 N N   . ALA A 1 166 ? 46.991 39.453 -3.849  1.00 11.38 ? 171 ALA B N   1 
ATOM   1278 C CA  . ALA A 1 166 ? 45.729 39.395 -4.585  1.00 11.08 ? 171 ALA B CA  1 
ATOM   1279 C C   . ALA A 1 166 ? 45.509 40.713 -5.322  1.00 11.61 ? 171 ALA B C   1 
ATOM   1280 O O   . ALA A 1 166 ? 45.774 41.780 -4.784  1.00 11.51 ? 171 ALA B O   1 
ATOM   1281 C CB  . ALA A 1 166 ? 44.657 39.081 -3.612  1.00 13.02 ? 171 ALA B CB  1 
ATOM   1282 N N   . VAL A 1 167 ? 45.086 40.614 -6.570  1.00 10.69 ? 172 VAL B N   1 
ATOM   1283 C CA  . VAL A 1 167 ? 44.991 41.774 -7.459  1.00 12.15 ? 172 VAL B CA  1 
ATOM   1284 C C   . VAL A 1 167 ? 43.542 42.143 -7.613  1.00 12.64 ? 172 VAL B C   1 
ATOM   1285 O O   . VAL A 1 167 ? 42.733 41.268 -7.878  1.00 12.74 ? 172 VAL B O   1 
ATOM   1286 C CB  . VAL A 1 167 ? 45.628 41.460 -8.787  1.00 13.08 ? 172 VAL B CB  1 
ATOM   1287 C CG1 . VAL A 1 167 ? 45.606 42.685 -9.698  1.00 14.48 ? 172 VAL B CG1 1 
ATOM   1288 C CG2 . VAL A 1 167 ? 47.076 41.015 -8.611  1.00 14.57 ? 172 VAL B CG2 1 
ATOM   1289 N N   . LYS A 1 168 ? 43.256 43.424 -7.426  1.00 13.45 ? 173 LYS B N   1 
ATOM   1290 C CA  . LYS A 1 168 ? 41.850 43.940 -7.522  1.00 14.67 ? 173 LYS B CA  1 
ATOM   1291 C C   . LYS A 1 168 ? 41.273 43.616 -8.899  1.00 16.86 ? 173 LYS B C   1 
ATOM   1292 O O   . LYS A 1 168 ? 41.962 43.762 -9.972  1.00 17.36 ? 173 LYS B O   1 
ATOM   1293 C CB  . LYS A 1 168 ? 41.851 45.457 -7.215  1.00 16.43 ? 173 LYS B CB  1 
ATOM   1294 C CG  . LYS A 1 168 ? 40.463 45.970 -6.983  1.00 19.82 ? 173 LYS B CG  1 
ATOM   1295 C CD  . LYS A 1 168 ? 40.588 47.432 -6.543  1.00 23.81 ? 173 LYS B CD  1 
ATOM   1296 C CE  . LYS A 1 168 ? 39.272 48.084 -6.354  1.00 27.93 ? 173 LYS B CE  1 
ATOM   1297 N NZ  . LYS A 1 168 ? 39.561 49.438 -5.742  1.00 32.84 ? 173 LYS B NZ  1 
ATOM   1298 N N   . GLN A 1 169 ? 40.026 43.174 -8.950  1.00 17.35 ? 174 GLN B N   1 
ATOM   1299 C CA  . GLN A 1 169 ? 39.423 42.849 -10.315 1.00 21.32 ? 174 GLN B CA  1 
ATOM   1300 C C   . GLN A 1 169 ? 39.161 44.125 -11.096 1.00 24.99 ? 174 GLN B C   1 
ATOM   1301 O O   . GLN A 1 169 ? 39.038 45.158 -10.439 1.00 25.38 ? 174 GLN B O   1 
ATOM   1302 C CB  . GLN A 1 169 ? 38.203 41.920 -10.269 1.00 27.30 ? 174 GLN B CB  1 
ATOM   1303 C CG  . GLN A 1 169 ? 37.155 42.285 -9.307  1.00 31.35 ? 174 GLN B CG  1 
ATOM   1304 C CD  . GLN A 1 169 ? 35.973 41.251 -9.296  1.00 32.85 ? 174 GLN B CD  1 
ATOM   1305 O OE1 . GLN A 1 169 ? 34.852 41.643 -9.352  1.00 41.49 ? 174 GLN B OE1 1 
ATOM   1306 N NE2 . GLN A 1 169 ? 36.275 39.962 -9.249  1.00 35.52 ? 174 GLN B NE2 1 
ATOM   1307 N N   . SER B 1 1   ? 53.649 12.305 39.029  1.00 49.60 ? 6   SER C N   1 
ATOM   1308 C CA  . SER B 1 1   ? 52.632 13.424 39.098  1.00 48.89 ? 6   SER C CA  1 
ATOM   1309 C C   . SER B 1 1   ? 52.689 14.088 40.468  1.00 43.56 ? 6   SER C C   1 
ATOM   1310 O O   . SER B 1 1   ? 53.109 13.467 41.440  1.00 41.45 ? 6   SER C O   1 
ATOM   1311 C CB  . SER B 1 1   ? 51.219 12.904 38.794  1.00 50.64 ? 6   SER C CB  1 
ATOM   1312 O OG  . SER B 1 1   ? 51.241 12.023 37.680  1.00 51.96 ? 6   SER C OG  1 
ATOM   1313 N N   . ALA B 1 2   ? 52.300 15.361 40.567  1.00 36.62 ? 7   ALA C N   1 
ATOM   1314 C CA  . ALA B 1 2   ? 52.544 16.079 41.771  1.00 35.71 ? 7   ALA C CA  1 
ATOM   1315 C C   . ALA B 1 2   ? 51.853 17.413 41.612  1.00 29.08 ? 7   ALA C C   1 
ATOM   1316 O O   . ALA B 1 2   ? 51.468 17.781 40.497  1.00 25.42 ? 7   ALA C O   1 
ATOM   1317 C CB  . ALA B 1 2   ? 54.053 16.320 41.926  1.00 40.02 ? 7   ALA C CB  1 
ATOM   1318 N N   . THR B 1 3   ? 51.668 18.032 42.756  1.00 29.28 ? 8   THR C N   1 
ATOM   1319 C CA  . THR B 1 3   ? 51.308 19.456 42.832  1.00 27.31 ? 8   THR C CA  1 
ATOM   1320 C C   . THR B 1 3   ? 52.613 20.255 43.062  1.00 23.86 ? 8   THR C C   1 
ATOM   1321 O O   . THR B 1 3   ? 53.565 19.853 43.783  1.00 24.30 ? 8   THR C O   1 
ATOM   1322 C CB  . THR B 1 3   ? 50.299 19.702 43.981  1.00 30.42 ? 8   THR C CB  1 
ATOM   1323 O OG1 . THR B 1 3   ? 49.140 18.899 43.758  1.00 33.55 ? 8   THR C OG1 1 
ATOM   1324 C CG2 . THR B 1 3   ? 49.856 21.113 44.053  1.00 30.83 ? 8   THR C CG2 1 
ATOM   1325 N N   . TYR B 1 4   ? 52.634 21.425 42.423  1.00 20.60 ? 9   TYR C N   1 
ATOM   1326 C CA  . TYR B 1 4   ? 53.747 22.366 42.505  1.00 20.57 ? 9   TYR C CA  1 
ATOM   1327 C C   . TYR B 1 4   ? 53.241 23.735 42.819  1.00 19.07 ? 9   TYR C C   1 
ATOM   1328 O O   . TYR B 1 4   ? 52.172 24.136 42.348  1.00 20.73 ? 9   TYR C O   1 
ATOM   1329 C CB  . TYR B 1 4   ? 54.474 22.466 41.178  1.00 20.35 ? 9   TYR C CB  1 
ATOM   1330 C CG  . TYR B 1 4   ? 55.032 21.159 40.607  1.00 20.43 ? 9   TYR C CG  1 
ATOM   1331 C CD1 . TYR B 1 4   ? 54.188 20.261 40.061  1.00 22.30 ? 9   TYR C CD1 1 
ATOM   1332 C CD2 . TYR B 1 4   ? 56.400 20.892 40.604  1.00 21.01 ? 9   TYR C CD2 1 
ATOM   1333 C CE1 . TYR B 1 4   ? 54.666 19.041 39.585  1.00 24.64 ? 9   TYR C CE1 1 
ATOM   1334 C CE2 . TYR B 1 4   ? 56.898 19.716 40.064  1.00 24.16 ? 9   TYR C CE2 1 
ATOM   1335 C CZ  . TYR B 1 4   ? 55.996 18.793 39.578  1.00 24.48 ? 9   TYR C CZ  1 
ATOM   1336 O OH  . TYR B 1 4   ? 56.426 17.583 39.031  1.00 26.95 ? 9   TYR C OH  1 
ATOM   1337 N N   . GLN B 1 5   ? 53.964 24.445 43.656  1.00 15.18 ? 10  GLN C N   1 
ATOM   1338 C CA  . GLN B 1 5   ? 53.611 25.814 44.011  1.00 14.92 ? 10  GLN C CA  1 
ATOM   1339 C C   . GLN B 1 5   ? 54.524 26.775 43.232  1.00 14.66 ? 10  GLN C C   1 
ATOM   1340 O O   . GLN B 1 5   ? 55.722 26.641 43.256  1.00 14.79 ? 10  GLN C O   1 
ATOM   1341 C CB  . GLN B 1 5   ? 53.828 26.037 45.505  1.00 16.81 ? 10  GLN C CB  1 
ATOM   1342 C CG  . GLN B 1 5   ? 53.373 27.335 46.104  1.00 17.91 ? 10  GLN C CG  1 
ATOM   1343 C CD  . GLN B 1 5   ? 51.843 27.444 46.177  1.00 17.50 ? 10  GLN C CD  1 
ATOM   1344 O OE1 . GLN B 1 5   ? 51.153 26.416 46.476  1.00 21.17 ? 10  GLN C OE1 1 
ATOM   1345 N NE2 . GLN B 1 5   ? 51.336 28.645 45.996  1.00 15.90 ? 10  GLN C NE2 1 
ATOM   1346 N N   . PHE B 1 6   ? 53.908 27.754 42.531  1.00 12.96 ? 11  PHE C N   1 
ATOM   1347 C CA  . PHE B 1 6   ? 54.770 28.669 41.782  1.00 13.32 ? 11  PHE C CA  1 
ATOM   1348 C C   . PHE B 1 6   ? 55.750 29.384 42.752  1.00 13.18 ? 11  PHE C C   1 
ATOM   1349 O O   . PHE B 1 6   ? 55.389 29.854 43.801  1.00 12.40 ? 11  PHE C O   1 
ATOM   1350 C CB  . PHE B 1 6   ? 53.977 29.686 40.995  1.00 12.86 ? 11  PHE C CB  1 
ATOM   1351 C CG  . PHE B 1 6   ? 53.282 29.122 39.829  1.00 14.72 ? 11  PHE C CG  1 
ATOM   1352 C CD1 . PHE B 1 6   ? 53.985 28.643 38.739  1.00 16.18 ? 11  PHE C CD1 1 
ATOM   1353 C CD2 . PHE B 1 6   ? 51.948 29.099 39.771  1.00 16.75 ? 11  PHE C CD2 1 
ATOM   1354 C CE1 . PHE B 1 6   ? 53.355 28.082 37.640  1.00 17.52 ? 11  PHE C CE1 1 
ATOM   1355 C CE2 . PHE B 1 6   ? 51.265 28.527 38.637  1.00 17.96 ? 11  PHE C CE2 1 
ATOM   1356 C CZ  . PHE B 1 6   ? 51.998 28.011 37.611  1.00 19.11 ? 11  PHE C CZ  1 
ATOM   1357 N N   . ASP B 1 7   ? 56.979 29.540 42.273  1.00 12.91 ? 12  ASP C N   1 
ATOM   1358 C CA  . ASP B 1 7   ? 57.948 30.326 42.921  1.00 12.88 ? 12  ASP C CA  1 
ATOM   1359 C C   . ASP B 1 7   ? 57.770 31.731 42.506  1.00 12.52 ? 12  ASP C C   1 
ATOM   1360 O O   . ASP B 1 7   ? 58.026 32.084 41.321  1.00 12.18 ? 12  ASP C O   1 
ATOM   1361 C CB  . ASP B 1 7   ? 59.318 29.842 42.420  1.00 13.94 ? 12  ASP C CB  1 
ATOM   1362 C CG  . ASP B 1 7   ? 60.466 30.751 42.862  1.00 14.68 ? 12  ASP C CG  1 
ATOM   1363 O OD1 . ASP B 1 7   ? 60.304 31.777 43.539  1.00 14.47 ? 12  ASP C OD1 1 
ATOM   1364 O OD2 . ASP B 1 7   ? 61.646 30.439 42.446  1.00 18.28 ? 12  ASP C OD2 1 
ATOM   1365 N N   . PRO B 1 8   ? 57.298 32.610 43.370  1.00 12.07 ? 13  PRO C N   1 
ATOM   1366 C CA  . PRO B 1 8   ? 56.946 33.942 42.974  1.00 12.76 ? 13  PRO C CA  1 
ATOM   1367 C C   . PRO B 1 8   ? 58.081 34.750 42.464  1.00 13.64 ? 13  PRO C C   1 
ATOM   1368 O O   . PRO B 1 8   ? 57.911 35.665 41.680  1.00 15.73 ? 13  PRO C O   1 
ATOM   1369 C CB  . PRO B 1 8   ? 56.197 34.449 44.212  1.00 12.80 ? 13  PRO C CB  1 
ATOM   1370 C CG  . PRO B 1 8   ? 56.979 33.741 45.315  1.00 12.09 ? 13  PRO C CG  1 
ATOM   1371 C CD  . PRO B 1 8   ? 57.175 32.404 44.845  1.00 11.74 ? 13  PRO C CD  1 
ATOM   1372 N N   . SER B 1 9   ? 59.298 34.436 42.845  1.00 12.16 ? 14  SER C N   1 
ATOM   1373 C CA  . SER B 1 9   ? 60.474 35.120 42.339  1.00 13.35 ? 14  SER C CA  1 
ATOM   1374 C C   . SER B 1 9   ? 60.940 34.695 40.993  1.00 12.78 ? 14  SER C C   1 
ATOM   1375 O O   . SER B 1 9   ? 61.782 35.433 40.427  1.00 14.78 ? 14  SER C O   1 
ATOM   1376 C CB  . SER B 1 9   ? 61.653 34.939 43.346  1.00 14.14 ? 14  SER C CB  1 
ATOM   1377 O OG  . SER B 1 9   ? 62.183 33.641 43.384  1.00 14.86 ? 14  SER C OG  1 
ATOM   1378 N N   . HIS B 1 10  ? 60.323 33.687 40.374  1.00 12.38 ? 15  HIS C N   1 
ATOM   1379 C CA  . HIS B 1 10  ? 60.625 33.305 39.024  1.00 12.53 ? 15  HIS C CA  1 
ATOM   1380 C C   . HIS B 1 10  ? 59.345 33.093 38.225  1.00 12.25 ? 15  HIS C C   1 
ATOM   1381 O O   . HIS B 1 10  ? 59.303 32.226 37.305  1.00 13.64 ? 15  HIS C O   1 
ATOM   1382 C CB  . HIS B 1 10  ? 61.451 32.077 38.973  1.00 14.37 ? 15  HIS C CB  1 
ATOM   1383 C CG  . HIS B 1 10  ? 62.855 32.302 39.493  1.00 15.39 ? 15  HIS C CG  1 
ATOM   1384 N ND1 . HIS B 1 10  ? 63.214 32.033 40.772  1.00 17.33 ? 15  HIS C ND1 1 
ATOM   1385 C CD2 . HIS B 1 10  ? 63.956 32.816 38.891  1.00 16.41 ? 15  HIS C CD2 1 
ATOM   1386 C CE1 . HIS B 1 10  ? 64.476 32.380 40.987  1.00 17.16 ? 15  HIS C CE1 1 
ATOM   1387 N NE2 . HIS B 1 10  ? 64.949 32.889 39.858  1.00 17.58 ? 15  HIS C NE2 1 
ATOM   1388 N N   . THR B 1 11  ? 58.298 33.718 38.679  1.00 11.60 ? 16  THR C N   1 
ATOM   1389 C CA  . THR B 1 11  ? 57.001 33.583 37.973  1.00 10.98 ? 16  THR C CA  1 
ATOM   1390 C C   . THR B 1 11  ? 56.420 34.949 37.725  1.00 11.07 ? 16  THR C C   1 
ATOM   1391 O O   . THR B 1 11  ? 56.069 35.702 38.658  1.00 10.41 ? 16  THR C O   1 
ATOM   1392 C CB  . THR B 1 11  ? 56.018 32.747 38.830  1.00 11.34 ? 16  THR C CB  1 
ATOM   1393 O OG1 . THR B 1 11  ? 56.573 31.459 39.013  1.00 11.64 ? 16  THR C OG1 1 
ATOM   1394 C CG2 . THR B 1 11  ? 54.683 32.636 38.074  1.00 11.96 ? 16  THR C CG2 1 
ATOM   1395 N N   . TYR B 1 12  ? 56.307 35.402 36.417  1.00 11.21 ? 17  TYR C N   1 
ATOM   1396 C CA  . TYR B 1 12  ? 55.929 36.714 36.060  1.00 10.79 ? 17  TYR C CA  1 
ATOM   1397 C C   . TYR B 1 12  ? 55.179 36.653 34.723  1.00 11.47 ? 17  TYR C C   1 
ATOM   1398 O O   . TYR B 1 12  ? 55.762 36.117 33.801  1.00 11.69 ? 17  TYR C O   1 
ATOM   1399 C CB  . TYR B 1 12  ? 57.070 37.676 35.943  1.00 11.31 ? 17  TYR C CB  1 
ATOM   1400 C CG  . TYR B 1 12  ? 57.966 37.782 37.130  1.00 11.02 ? 17  TYR C CG  1 
ATOM   1401 C CD1 . TYR B 1 12  ? 59.013 36.968 37.229  1.00 11.01 ? 17  TYR C CD1 1 
ATOM   1402 C CD2 . TYR B 1 12  ? 57.650 38.677 38.180  1.00 10.98 ? 17  TYR C CD2 1 
ATOM   1403 C CE1 . TYR B 1 12  ? 59.902 37.064 38.305  1.00 11.39 ? 17  TYR C CE1 1 
ATOM   1404 C CE2 . TYR B 1 12  ? 58.533 38.739 39.304  1.00 11.55 ? 17  TYR C CE2 1 
ATOM   1405 C CZ  . TYR B 1 12  ? 59.633 37.917 39.305  1.00 11.26 ? 17  TYR C CZ  1 
ATOM   1406 O OH  . TYR B 1 12  ? 60.465 37.986 40.454  1.00 14.73 ? 17  TYR C OH  1 
ATOM   1407 N N   . PRO B 1 13  ? 54.086 37.376 34.598  1.00 11.59 ? 18  PRO C N   1 
ATOM   1408 C CA  . PRO B 1 13  ? 53.515 37.632 33.256  1.00 11.88 ? 18  PRO C CA  1 
ATOM   1409 C C   . PRO B 1 13  ? 54.037 38.952 32.774  1.00 10.89 ? 18  PRO C C   1 
ATOM   1410 O O   . PRO B 1 13  ? 53.856 40.008 33.417  1.00 11.21 ? 18  PRO C O   1 
ATOM   1411 C CB  . PRO B 1 13  ? 52.049 37.624 33.500  1.00 12.53 ? 18  PRO C CB  1 
ATOM   1412 C CG  . PRO B 1 13  ? 51.870 38.105 34.842  1.00 13.15 ? 18  PRO C CG  1 
ATOM   1413 C CD  . PRO B 1 13  ? 53.154 37.858 35.646  1.00 11.78 ? 18  PRO C CD  1 
ATOM   1414 N N   . SER B 1 14  ? 54.746 38.926 31.654  1.00 11.47 ? 19  SER C N   1 
ATOM   1415 C CA  . SER B 1 14  ? 55.196 40.091 30.974  1.00 10.23 ? 19  SER C CA  1 
ATOM   1416 C C   . SER B 1 14  ? 54.227 40.330 29.787  1.00 10.91 ? 19  SER C C   1 
ATOM   1417 O O   . SER B 1 14  ? 53.511 39.430 29.378  1.00 12.35 ? 19  SER C O   1 
ATOM   1418 C CB  . SER B 1 14  ? 56.592 39.935 30.397  1.00 10.95 ? 19  SER C CB  1 
ATOM   1419 O OG  . SER B 1 14  ? 57.578 39.712 31.472  1.00 11.67 ? 19  SER C OG  1 
ATOM   1420 N N   . PHE B 1 15  ? 54.257 41.559 29.297  1.00 10.96 ? 20  PHE C N   1 
ATOM   1421 C CA  . PHE B 1 15  ? 53.291 41.907 28.213  1.00 12.03 ? 20  PHE C CA  1 
ATOM   1422 C C   . PHE B 1 15  ? 53.957 42.780 27.189  1.00 12.65 ? 20  PHE C C   1 
ATOM   1423 O O   . PHE B 1 15  ? 54.982 43.486 27.445  1.00 12.71 ? 20  PHE C O   1 
ATOM   1424 C CB  . PHE B 1 15  ? 52.041 42.554 28.763  1.00 13.04 ? 20  PHE C CB  1 
ATOM   1425 C CG  . PHE B 1 15  ? 52.286 43.778 29.597  1.00 13.95 ? 20  PHE C CG  1 
ATOM   1426 C CD1 . PHE B 1 15  ? 52.604 45.012 29.056  1.00 15.99 ? 20  PHE C CD1 1 
ATOM   1427 C CD2 . PHE B 1 15  ? 52.321 43.633 30.978  1.00 16.35 ? 20  PHE C CD2 1 
ATOM   1428 C CE1 . PHE B 1 15  ? 52.870 46.124 29.867  1.00 18.63 ? 20  PHE C CE1 1 
ATOM   1429 C CE2 . PHE B 1 15  ? 52.631 44.716 31.756  1.00 16.37 ? 20  PHE C CE2 1 
ATOM   1430 C CZ  . PHE B 1 15  ? 52.872 45.923 31.206  1.00 18.11 ? 20  PHE C CZ  1 
ATOM   1431 N N   . GLU B 1 16  ? 53.292 42.844 25.995  1.00 12.15 ? 21  GLU C N   1 
ATOM   1432 C CA  . GLU B 1 16  ? 53.600 43.800 24.952  1.00 13.79 ? 21  GLU C CA  1 
ATOM   1433 C C   . GLU B 1 16  ? 52.290 44.416 24.484  1.00 14.41 ? 21  GLU C C   1 
ATOM   1434 O O   . GLU B 1 16  ? 51.326 43.688 24.228  1.00 15.63 ? 21  GLU C O   1 
ATOM   1435 C CB  . GLU B 1 16  ? 54.217 43.097 23.739  1.00 15.91 ? 21  GLU C CB  1 
ATOM   1436 C CG  . GLU B 1 16  ? 55.547 42.457 23.974  1.00 16.97 ? 21  GLU C CG  1 
ATOM   1437 C CD  . GLU B 1 16  ? 56.204 41.819 22.774  1.00 22.03 ? 21  GLU C CD  1 
ATOM   1438 O OE1 . GLU B 1 16  ? 55.540 41.803 21.726  1.00 26.38 ? 21  GLU C OE1 1 
ATOM   1439 O OE2 . GLU B 1 16  ? 57.427 41.441 22.861  1.00 25.12 ? 21  GLU C OE2 1 
ATOM   1440 N N   . ALA B 1 17  ? 52.297 45.720 24.371  1.00 13.67 ? 22  ALA C N   1 
ATOM   1441 C CA  . ALA B 1 17  ? 51.096 46.476 24.022  1.00 13.80 ? 22  ALA C CA  1 
ATOM   1442 C C   . ALA B 1 17  ? 51.513 47.588 23.114  1.00 14.64 ? 22  ALA C C   1 
ATOM   1443 O O   . ALA B 1 17  ? 52.539 48.194 23.194  1.00 16.15 ? 22  ALA C O   1 
ATOM   1444 C CB  . ALA B 1 17  ? 50.512 47.054 25.267  1.00 15.88 ? 22  ALA C CB  1 
ATOM   1445 N N   . ASP B 1 18  ? 50.631 47.882 22.132  1.00 15.47 ? 23  ASP C N   1 
ATOM   1446 C CA  . ASP B 1 18  ? 50.881 48.894 21.177  1.00 15.93 ? 23  ASP C CA  1 
ATOM   1447 C C   . ASP B 1 18  ? 50.807 50.287 21.731  1.00 15.98 ? 23  ASP C C   1 
ATOM   1448 O O   . ASP B 1 18  ? 50.002 50.623 22.549  1.00 18.05 ? 23  ASP C O   1 
ATOM   1449 C CB  . ASP B 1 18  ? 49.743 48.809 20.139  1.00 18.50 ? 23  ASP C CB  1 
ATOM   1450 C CG  . ASP B 1 18  ? 49.874 49.873 19.050  1.00 19.06 ? 23  ASP C CG  1 
ATOM   1451 O OD1 . ASP B 1 18  ? 50.946 49.850 18.400  1.00 21.10 ? 23  ASP C OD1 1 
ATOM   1452 O OD2 . ASP B 1 18  ? 48.909 50.667 18.966  1.00 22.19 ? 23  ASP C OD2 1 
ATOM   1453 N N   . HIS B 1 19  ? 51.622 51.181 21.198  1.00 15.30 ? 24  HIS C N   1 
ATOM   1454 C CA  . HIS B 1 19  ? 51.485 52.621 21.390  1.00 18.01 ? 24  HIS C CA  1 
ATOM   1455 C C   . HIS B 1 19  ? 51.263 53.294 19.977  1.00 19.15 ? 24  HIS C C   1 
ATOM   1456 O O   . HIS B 1 19  ? 52.125 53.156 19.090  1.00 19.10 ? 24  HIS C O   1 
ATOM   1457 C CB  . HIS B 1 19  ? 52.797 53.176 21.939  1.00 17.92 ? 24  HIS C CB  1 
ATOM   1458 C CG  . HIS B 1 19  ? 52.704 54.609 22.354  1.00 20.88 ? 24  HIS C CG  1 
ATOM   1459 N ND1 . HIS B 1 19  ? 53.672 55.547 22.058  1.00 24.02 ? 24  HIS C ND1 1 
ATOM   1460 C CD2 . HIS B 1 19  ? 51.761 55.257 23.070  1.00 23.33 ? 24  HIS C CD2 1 
ATOM   1461 C CE1 . HIS B 1 19  ? 53.318 56.725 22.549  1.00 24.90 ? 24  HIS C CE1 1 
ATOM   1462 N NE2 . HIS B 1 19  ? 52.177 56.561 23.212  1.00 27.14 ? 24  HIS C NE2 1 
ATOM   1463 N N   . PHE B 1 20  ? 50.105 53.899 19.798  1.00 21.85 ? 25  PHE C N   1 
ATOM   1464 C CA  . PHE B 1 20  ? 49.867 54.737 18.608  1.00 23.68 ? 25  PHE C CA  1 
ATOM   1465 C C   . PHE B 1 20  ? 49.901 54.061 17.265  1.00 25.35 ? 25  PHE C C   1 
ATOM   1466 O O   . PHE B 1 20  ? 50.383 54.618 16.211  1.00 27.40 ? 25  PHE C O   1 
ATOM   1467 C CB  . PHE B 1 20  ? 50.863 55.919 18.595  1.00 27.35 ? 25  PHE C CB  1 
ATOM   1468 C CG  . PHE B 1 20  ? 50.285 57.097 19.238  1.00 31.26 ? 25  PHE C CG  1 
ATOM   1469 C CD1 . PHE B 1 20  ? 49.182 57.691 18.645  1.00 35.61 ? 25  PHE C CD1 1 
ATOM   1470 C CD2 . PHE B 1 20  ? 50.721 57.557 20.457  1.00 32.37 ? 25  PHE C CD2 1 
ATOM   1471 C CE1 . PHE B 1 20  ? 48.557 58.769 19.250  1.00 39.89 ? 25  PHE C CE1 1 
ATOM   1472 C CE2 . PHE B 1 20  ? 50.083 58.613 21.092  1.00 36.03 ? 25  PHE C CE2 1 
ATOM   1473 C CZ  . PHE B 1 20  ? 49.004 59.218 20.492  1.00 37.89 ? 25  PHE C CZ  1 
ATOM   1474 N N   . GLY B 1 21  ? 49.314 52.907 17.242  1.00 24.31 ? 26  GLY C N   1 
ATOM   1475 C CA  . GLY B 1 21  ? 49.129 52.131 16.014  1.00 25.80 ? 26  GLY C CA  1 
ATOM   1476 C C   . GLY B 1 21  ? 50.429 51.805 15.326  1.00 25.83 ? 26  GLY C C   1 
ATOM   1477 O O   . GLY B 1 21  ? 50.639 52.128 14.151  1.00 30.19 ? 26  GLY C O   1 
ATOM   1478 N N   . GLY B 1 22  ? 51.362 51.204 16.048  1.00 23.63 ? 27  GLY C N   1 
ATOM   1479 C CA  . GLY B 1 22  ? 52.596 50.809 15.424  1.00 23.92 ? 27  GLY C CA  1 
ATOM   1480 C C   . GLY B 1 22  ? 53.793 51.727 15.614  1.00 20.87 ? 27  GLY C C   1 
ATOM   1481 O O   . GLY B 1 22  ? 54.849 51.499 15.053  1.00 24.35 ? 27  GLY C O   1 
ATOM   1482 N N   . LEU B 1 23  ? 53.644 52.738 16.452  1.00 19.35 ? 28  LEU C N   1 
ATOM   1483 C CA  . LEU B 1 23  ? 54.730 53.649 16.695  1.00 20.10 ? 28  LEU C CA  1 
ATOM   1484 C C   . LEU B 1 23  ? 55.814 53.001 17.522  1.00 18.15 ? 28  LEU C C   1 
ATOM   1485 O O   . LEU B 1 23  ? 56.987 53.093 17.221  1.00 18.43 ? 28  LEU C O   1 
ATOM   1486 C CB  . LEU B 1 23  ? 54.232 54.952 17.342  1.00 21.40 ? 28  LEU C CB  1 
ATOM   1487 C CG  . LEU B 1 23  ? 55.313 56.026 17.514  1.00 22.29 ? 28  LEU C CG  1 
ATOM   1488 C CD1 . LEU B 1 23  ? 55.849 56.549 16.168  1.00 22.81 ? 28  LEU C CD1 1 
ATOM   1489 C CD2 . LEU B 1 23  ? 54.769 57.176 18.321  1.00 23.29 ? 28  LEU C CD2 1 
ATOM   1490 N N   . SER B 1 24  ? 55.407 52.326 18.584  1.00 17.53 ? 29  SER C N   1 
ATOM   1491 C CA  . SER B 1 24  ? 56.324 51.577 19.394  1.00 17.21 ? 29  SER C CA  1 
ATOM   1492 C C   . SER B 1 24  ? 55.548 50.569 20.226  1.00 16.07 ? 29  SER C C   1 
ATOM   1493 O O   . SER B 1 24  ? 54.330 50.500 20.140  1.00 16.99 ? 29  SER C O   1 
ATOM   1494 C CB  . SER B 1 24  ? 57.244 52.445 20.286  1.00 19.22 ? 29  SER C CB  1 
ATOM   1495 O OG  . SER B 1 24  ? 56.522 53.031 21.342  1.00 21.71 ? 29  SER C OG  1 
ATOM   1496 N N   . VAL B 1 25  ? 56.311 49.735 21.002  1.00 15.55 ? 30  VAL C N   1 
ATOM   1497 C CA  . VAL B 1 25  ? 55.728 48.636 21.763  1.00 16.16 ? 30  VAL C CA  1 
ATOM   1498 C C   . VAL B 1 25  ? 56.049 48.908 23.211  1.00 15.19 ? 30  VAL C C   1 
ATOM   1499 O O   . VAL B 1 25  ? 57.265 48.901 23.573  1.00 17.87 ? 30  VAL C O   1 
ATOM   1500 C CB  . VAL B 1 25  ? 56.308 47.335 21.376  1.00 16.85 ? 30  VAL C CB  1 
ATOM   1501 C CG1 . VAL B 1 25  ? 55.710 46.191 22.210  1.00 17.82 ? 30  VAL C CG1 1 
ATOM   1502 C CG2 . VAL B 1 25  ? 56.130 47.056 19.884  1.00 20.08 ? 30  VAL C CG2 1 
ATOM   1503 N N   . TRP B 1 26  ? 54.999 49.065 24.059  1.00 15.44 ? 31  TRP C N   1 
ATOM   1504 C CA  . TRP B 1 26  ? 55.137 49.084 25.489  1.00 14.89 ? 31  TRP C CA  1 
ATOM   1505 C C   . TRP B 1 26  ? 55.410 47.656 25.977  1.00 15.12 ? 31  TRP C C   1 
ATOM   1506 O O   . TRP B 1 26  ? 54.639 46.783 25.689  1.00 16.25 ? 31  TRP C O   1 
ATOM   1507 C CB  . TRP B 1 26  ? 53.849 49.531 26.161  1.00 16.25 ? 31  TRP C CB  1 
ATOM   1508 C CG  . TRP B 1 26  ? 53.698 50.944 26.392  1.00 17.61 ? 31  TRP C CG  1 
ATOM   1509 C CD1 . TRP B 1 26  ? 52.822 51.803 25.769  1.00 20.20 ? 31  TRP C CD1 1 
ATOM   1510 C CD2 . TRP B 1 26  ? 54.431 51.732 27.329  1.00 18.77 ? 31  TRP C CD2 1 
ATOM   1511 N NE1 . TRP B 1 26  ? 53.044 53.082 26.207  1.00 21.69 ? 31  TRP C NE1 1 
ATOM   1512 C CE2 . TRP B 1 26  ? 53.978 53.038 27.226  1.00 20.28 ? 31  TRP C CE2 1 
ATOM   1513 C CE3 . TRP B 1 26  ? 55.415 51.427 28.282  1.00 20.92 ? 31  TRP C CE3 1 
ATOM   1514 C CZ2 . TRP B 1 26  ? 54.523 54.073 28.016  1.00 20.11 ? 31  TRP C CZ2 1 
ATOM   1515 C CZ3 . TRP B 1 26  ? 55.904 52.444 29.074  1.00 21.14 ? 31  TRP C CZ3 1 
ATOM   1516 C CH2 . TRP B 1 26  ? 55.467 53.715 28.952  1.00 19.35 ? 31  TRP C CH2 1 
ATOM   1517 N N   . ARG B 1 27  ? 56.477 47.470 26.728  1.00 13.08 ? 32  ARG C N   1 
ATOM   1518 C CA  . ARG B 1 27  ? 56.754 46.215 27.382  1.00 14.31 ? 32  ARG C CA  1 
ATOM   1519 C C   . ARG B 1 27  ? 56.783 46.449 28.926  1.00 14.75 ? 32  ARG C C   1 
ATOM   1520 O O   . ARG B 1 27  ? 57.150 47.557 29.404  1.00 16.90 ? 32  ARG C O   1 
ATOM   1521 C CB  . ARG B 1 27  ? 58.098 45.680 26.927  1.00 14.75 ? 32  ARG C CB  1 
ATOM   1522 C CG  . ARG B 1 27  ? 58.096 45.176 25.481  1.00 17.47 ? 32  ARG C CG  1 
ATOM   1523 C CD  . ARG B 1 27  ? 59.430 44.527 25.049  1.00 19.46 ? 32  ARG C CD  1 
ATOM   1524 N NE  . ARG B 1 27  ? 59.250 43.958 23.742  1.00 18.61 ? 32  ARG C NE  1 
ATOM   1525 C CZ  . ARG B 1 27  ? 59.432 44.659 22.609  1.00 20.28 ? 32  ARG C CZ  1 
ATOM   1526 N NH1 . ARG B 1 27  ? 59.950 45.836 22.607  1.00 20.25 ? 32  ARG C NH1 1 
ATOM   1527 N NH2 . ARG B 1 27  ? 59.159 44.094 21.457  1.00 22.88 ? 32  ARG C NH2 1 
ATOM   1528 N N   . GLY B 1 28  ? 56.316 45.483 29.672  1.00 13.76 ? 33  GLY C N   1 
ATOM   1529 C CA  . GLY B 1 28  ? 56.406 45.554 31.144  1.00 14.03 ? 33  GLY C CA  1 
ATOM   1530 C C   . GLY B 1 28  ? 55.993 44.216 31.685  1.00 11.89 ? 33  GLY C C   1 
ATOM   1531 O O   . GLY B 1 28  ? 55.881 43.222 30.941  1.00 11.99 ? 33  GLY C O   1 
ATOM   1532 N N   . LYS B 1 29  ? 55.765 44.190 33.002  1.00 11.61 ? 34  LYS C N   1 
ATOM   1533 C CA  . LYS B 1 29  ? 55.411 42.970 33.666  1.00 10.95 ? 34  LYS C CA  1 
ATOM   1534 C C   . LYS B 1 29  ? 54.608 43.305 34.878  1.00 11.32 ? 34  LYS C C   1 
ATOM   1535 O O   . LYS B 1 29  ? 54.526 44.423 35.259  1.00 14.77 ? 34  LYS C O   1 
ATOM   1536 C CB  . LYS B 1 29  ? 56.612 42.017 34.042  1.00 12.69 ? 34  LYS C CB  1 
ATOM   1537 C CG  . LYS B 1 29  ? 57.556 42.617 35.051  1.00 13.75 ? 34  LYS C CG  1 
ATOM   1538 C CD  . LYS B 1 29  ? 58.868 41.888 35.173  1.00 16.82 ? 34  LYS C CD  1 
ATOM   1539 C CE  . LYS B 1 29  ? 58.913 40.443 35.086  1.00 16.55 ? 34  LYS C CE  1 
ATOM   1540 N NZ  . LYS B 1 29  ? 60.219 39.763 35.268  1.00 16.15 ? 34  LYS C NZ  1 
ATOM   1541 N N   . PHE B 1 30  ? 54.033 42.279 35.527  1.00 11.83 ? 35  PHE C N   1 
ATOM   1542 C CA  . PHE B 1 30  ? 53.438 42.336 36.867  1.00 11.49 ? 35  PHE C CA  1 
ATOM   1543 C C   . PHE B 1 30  ? 54.401 41.615 37.811  1.00 12.23 ? 35  PHE C C   1 
ATOM   1544 O O   . PHE B 1 30  ? 54.763 40.487 37.552  1.00 12.44 ? 35  PHE C O   1 
ATOM   1545 C CB  . PHE B 1 30  ? 52.066 41.683 36.874  1.00 12.71 ? 35  PHE C CB  1 
ATOM   1546 C CG  . PHE B 1 30  ? 51.044 42.450 36.048  1.00 12.56 ? 35  PHE C CG  1 
ATOM   1547 C CD1 . PHE B 1 30  ? 50.979 42.264 34.667  1.00 13.79 ? 35  PHE C CD1 1 
ATOM   1548 C CD2 . PHE B 1 30  ? 50.220 43.382 36.680  1.00 13.23 ? 35  PHE C CD2 1 
ATOM   1549 C CE1 . PHE B 1 30  ? 50.042 43.006 33.898  1.00 16.00 ? 35  PHE C CE1 1 
ATOM   1550 C CE2 . PHE B 1 30  ? 49.350 44.145 35.923  1.00 14.61 ? 35  PHE C CE2 1 
ATOM   1551 C CZ  . PHE B 1 30  ? 49.214 43.912 34.544  1.00 14.95 ? 35  PHE C CZ  1 
ATOM   1552 N N   . ASP B 1 31  ? 54.827 42.284 38.855  1.00 11.36 ? 36  ASP C N   1 
ATOM   1553 C CA  . ASP B 1 31  ? 55.831 41.732 39.764  1.00 12.64 ? 36  ASP C CA  1 
ATOM   1554 C C   . ASP B 1 31  ? 55.294 40.685 40.744  1.00 12.37 ? 36  ASP C C   1 
ATOM   1555 O O   . ASP B 1 31  ? 56.141 40.038 41.393  1.00 14.12 ? 36  ASP C O   1 
ATOM   1556 C CB  . ASP B 1 31  ? 56.438 42.860 40.576  1.00 13.30 ? 36  ASP C CB  1 
ATOM   1557 C CG  . ASP B 1 31  ? 57.247 43.875 39.790  1.00 16.76 ? 36  ASP C CG  1 
ATOM   1558 O OD1 . ASP B 1 31  ? 57.546 43.704 38.605  1.00 16.58 ? 36  ASP C OD1 1 
ATOM   1559 O OD2 . ASP B 1 31  ? 57.642 44.889 40.483  1.00 23.40 ? 36  ASP C OD2 1 
ATOM   1560 N N   . LYS B 1 32  ? 53.954 40.624 41.026  1.00 11.42 ? 37  LYS C N   1 
ATOM   1561 C CA  . LYS B 1 32  ? 53.488 39.759 42.095  1.00 13.39 ? 37  LYS C CA  1 
ATOM   1562 C C   . LYS B 1 32  ? 52.429 38.801 41.645  1.00 12.52 ? 37  LYS C C   1 
ATOM   1563 O O   . LYS B 1 32  ? 51.347 39.184 41.197  1.00 13.66 ? 37  LYS C O   1 
ATOM   1564 C CB  . LYS B 1 32  ? 52.971 40.604 43.204  1.00 16.01 ? 37  LYS C CB  1 
ATOM   1565 C CG  . LYS B 1 32  ? 53.999 41.438 43.849  1.00 22.74 ? 37  LYS C CG  1 
ATOM   1566 C CD  . LYS B 1 32  ? 53.517 41.970 45.191  1.00 32.34 ? 37  LYS C CD  1 
ATOM   1567 C CE  . LYS B 1 32  ? 53.378 40.867 46.224  1.00 37.90 ? 37  LYS C CE  1 
ATOM   1568 N NZ  . LYS B 1 32  ? 52.829 41.523 47.456  1.00 44.44 ? 37  LYS C NZ  1 
ATOM   1569 N N   . SER B 1 33  ? 52.773 37.523 41.651  1.00 12.16 ? 38  SER C N   1 
ATOM   1570 C CA  . SER B 1 33  ? 51.904 36.430 41.269  1.00 12.22 ? 38  SER C CA  1 
ATOM   1571 C C   . SER B 1 33  ? 52.106 35.261 42.231  1.00 13.22 ? 38  SER C C   1 
ATOM   1572 O O   . SER B 1 33  ? 53.155 35.137 42.894  1.00 15.57 ? 38  SER C O   1 
ATOM   1573 C CB  . SER B 1 33  ? 52.186 35.891 39.873  1.00 13.43 ? 38  SER C CB  1 
ATOM   1574 O OG  . SER B 1 33  ? 52.002 36.878 38.878  1.00 14.71 ? 38  SER C OG  1 
ATOM   1575 N N   . SER B 1 34  ? 51.098 34.423 42.335  1.00 12.55 ? 39  SER C N   1 
ATOM   1576 C CA  . SER B 1 34  ? 51.187 33.154 43.076  1.00 12.69 ? 39  SER C CA  1 
ATOM   1577 C C   . SER B 1 34  ? 50.252 32.178 42.512  1.00 12.74 ? 39  SER C C   1 
ATOM   1578 O O   . SER B 1 34  ? 49.325 32.548 41.766  1.00 12.77 ? 39  SER C O   1 
ATOM   1579 C CB  . SER B 1 34  ? 50.835 33.365 44.566  1.00 14.87 ? 39  SER C CB  1 
ATOM   1580 O OG  . SER B 1 34  ? 49.481 33.889 44.698  1.00 17.75 ? 39  SER C OG  1 
ATOM   1581 N N   . GLY B 1 35  ? 50.420 30.943 42.891  1.00 11.63 ? 40  GLY C N   1 
ATOM   1582 C CA  . GLY B 1 35  ? 49.492 29.911 42.423  1.00 12.64 ? 40  GLY C CA  1 
ATOM   1583 C C   . GLY B 1 35  ? 50.115 28.558 42.391  1.00 12.37 ? 40  GLY C C   1 
ATOM   1584 O O   . GLY B 1 35  ? 51.169 28.277 42.967  1.00 12.17 ? 40  GLY C O   1 
ATOM   1585 N N   . THR B 1 36  ? 49.377 27.634 41.765  1.00 13.56 ? 41  THR C N   1 
ATOM   1586 C CA  . THR B 1 36  ? 49.717 26.253 41.793  1.00 15.99 ? 41  THR C CA  1 
ATOM   1587 C C   . THR B 1 36  ? 49.533 25.627 40.411  1.00 16.06 ? 41  THR C C   1 
ATOM   1588 O O   . THR B 1 36  ? 48.712 26.088 39.595  1.00 15.77 ? 41  THR C O   1 
ATOM   1589 C CB  . THR B 1 36  ? 48.795 25.430 42.761  1.00 19.67 ? 41  THR C CB  1 
ATOM   1590 O OG1 . THR B 1 36  ? 47.436 25.531 42.336  1.00 23.39 ? 41  THR C OG1 1 
ATOM   1591 C CG2 . THR B 1 36  ? 48.908 25.867 44.150  1.00 19.25 ? 41  THR C CG2 1 
ATOM   1592 N N   . VAL B 1 37  ? 50.278 24.569 40.188  1.00 16.48 ? 42  VAL C N   1 
ATOM   1593 C CA  . VAL B 1 37  ? 50.050 23.738 39.009  1.00 20.09 ? 42  VAL C CA  1 
ATOM   1594 C C   . VAL B 1 37  ? 50.123 22.294 39.423  1.00 19.56 ? 42  VAL C C   1 
ATOM   1595 O O   . VAL B 1 37  ? 50.965 21.901 40.243  1.00 20.91 ? 42  VAL C O   1 
ATOM   1596 C CB  . VAL B 1 37  ? 51.025 24.053 37.850  1.00 22.89 ? 42  VAL C CB  1 
ATOM   1597 C CG1 . VAL B 1 37  ? 52.443 24.089 38.298  1.00 24.13 ? 42  VAL C CG1 1 
ATOM   1598 C CG2 . VAL B 1 37  ? 50.904 23.026 36.738  1.00 24.37 ? 42  VAL C CG2 1 
ATOM   1599 N N   . THR B 1 38  ? 49.211 21.483 38.882  1.00 19.90 ? 43  THR C N   1 
ATOM   1600 C CA  . THR B 1 38  ? 49.196 20.060 39.142  1.00 27.00 ? 43  THR C CA  1 
ATOM   1601 C C   . THR B 1 38  ? 49.524 19.454 37.824  1.00 25.80 ? 43  THR C C   1 
ATOM   1602 O O   . THR B 1 38  ? 49.006 19.902 36.733  1.00 26.95 ? 43  THR C O   1 
ATOM   1603 C CB  . THR B 1 38  ? 47.812 19.595 39.555  1.00 32.47 ? 43  THR C CB  1 
ATOM   1604 O OG1 . THR B 1 38  ? 47.480 20.126 40.849  1.00 34.89 ? 43  THR C OG1 1 
ATOM   1605 C CG2 . THR B 1 38  ? 47.736 18.097 39.655  1.00 41.07 ? 43  THR C CG2 1 
ATOM   1606 N N   . LEU B 1 39  ? 50.423 18.499 37.850  1.00 23.69 ? 44  LEU C N   1 
ATOM   1607 C CA  . LEU B 1 39  ? 50.792 17.827 36.637  1.00 30.40 ? 44  LEU C CA  1 
ATOM   1608 C C   . LEU B 1 39  ? 50.538 16.342 36.827  1.00 34.21 ? 44  LEU C C   1 
ATOM   1609 O O   . LEU B 1 39  ? 50.909 15.788 37.879  1.00 37.07 ? 44  LEU C O   1 
ATOM   1610 C CB  . LEU B 1 39  ? 52.256 18.021 36.369  1.00 31.88 ? 44  LEU C CB  1 
ATOM   1611 C CG  . LEU B 1 39  ? 52.814 19.261 35.771  1.00 37.58 ? 44  LEU C CG  1 
ATOM   1612 C CD1 . LEU B 1 39  ? 54.208 18.902 35.266  1.00 40.68 ? 44  LEU C CD1 1 
ATOM   1613 C CD2 . LEU B 1 39  ? 51.888 19.712 34.665  1.00 39.73 ? 44  LEU C CD2 1 
ATOM   1614 N N   . ASP B 1 40  ? 49.805 15.783 35.849  1.00 37.70 ? 45  ASP C N   1 
ATOM   1615 C CA  . ASP B 1 40  ? 49.584 14.299 35.708  1.00 44.14 ? 45  ASP C CA  1 
ATOM   1616 C C   . ASP B 1 40  ? 50.140 13.862 34.368  1.00 42.27 ? 45  ASP C C   1 
ATOM   1617 O O   . ASP B 1 40  ? 49.364 13.728 33.402  1.00 41.05 ? 45  ASP C O   1 
ATOM   1618 C CB  . ASP B 1 40  ? 48.087 13.978 35.772  1.00 44.96 ? 45  ASP C CB  1 
ATOM   1619 C CG  . ASP B 1 40  ? 47.788 12.463 35.940  1.00 53.11 ? 45  ASP C CG  1 
ATOM   1620 O OD1 . ASP B 1 40  ? 48.729 11.615 35.913  1.00 50.27 ? 45  ASP C OD1 1 
ATOM   1621 O OD2 . ASP B 1 40  ? 46.573 12.160 36.090  1.00 54.24 ? 45  ASP C OD2 1 
ATOM   1622 N N   . ARG B 1 41  ? 51.462 13.711 34.281  1.00 42.47 ? 46  ARG C N   1 
ATOM   1623 C CA  . ARG B 1 41  ? 52.055 13.267 33.022  1.00 51.66 ? 46  ARG C CA  1 
ATOM   1624 C C   . ARG B 1 41  ? 52.058 11.742 32.871  1.00 58.78 ? 46  ARG C C   1 
ATOM   1625 O O   . ARG B 1 41  ? 53.112 11.101 32.739  1.00 64.18 ? 46  ARG C O   1 
ATOM   1626 C CB  . ARG B 1 41  ? 53.416 13.922 32.709  1.00 47.35 ? 46  ARG C CB  1 
ATOM   1627 C CG  . ARG B 1 41  ? 54.430 14.150 33.797  1.00 48.25 ? 46  ARG C CG  1 
ATOM   1628 C CD  . ARG B 1 41  ? 55.213 15.406 33.395  1.00 49.57 ? 46  ARG C CD  1 
ATOM   1629 N NE  . ARG B 1 41  ? 56.534 15.487 34.000  1.00 48.32 ? 46  ARG C NE  1 
ATOM   1630 C CZ  . ARG B 1 41  ? 57.687 15.523 33.343  1.00 50.00 ? 46  ARG C CZ  1 
ATOM   1631 N NH1 . ARG B 1 41  ? 57.711 15.481 32.017  1.00 50.06 ? 46  ARG C NH1 1 
ATOM   1632 N NH2 . ARG B 1 41  ? 58.842 15.588 34.022  1.00 50.26 ? 46  ARG C NH2 1 
ATOM   1633 N N   . ALA B 1 42  ? 50.837 11.186 32.941  1.00 55.53 ? 47  ALA C N   1 
ATOM   1634 C CA  . ALA B 1 42  ? 50.519 9.835  32.570  1.00 54.19 ? 47  ALA C CA  1 
ATOM   1635 C C   . ALA B 1 42  ? 49.166 9.894  31.879  1.00 54.33 ? 47  ALA C C   1 
ATOM   1636 O O   . ALA B 1 42  ? 49.007 9.369  30.785  1.00 58.32 ? 47  ALA C O   1 
ATOM   1637 C CB  . ALA B 1 42  ? 50.440 8.948  33.801  1.00 59.51 ? 47  ALA C CB  1 
ATOM   1638 N N   . ALA B 1 43  ? 48.181 10.541 32.514  1.00 52.38 ? 48  ALA C N   1 
ATOM   1639 C CA  . ALA B 1 43  ? 46.930 10.937 31.816  1.00 49.87 ? 48  ALA C CA  1 
ATOM   1640 C C   . ALA B 1 43  ? 47.138 12.135 30.908  1.00 45.37 ? 48  ALA C C   1 
ATOM   1641 O O   . ALA B 1 43  ? 46.166 12.626 30.305  1.00 46.96 ? 48  ALA C O   1 
ATOM   1642 C CB  . ALA B 1 43  ? 45.812 11.237 32.811  1.00 52.84 ? 48  ALA C CB  1 
ATOM   1643 N N   . LYS B 1 44  ? 48.388 12.613 30.822  1.00 43.78 ? 49  LYS C N   1 
ATOM   1644 C CA  . LYS B 1 44  ? 48.743 13.763 29.997  1.00 41.05 ? 49  LYS C CA  1 
ATOM   1645 C C   . LYS B 1 44  ? 47.778 14.874 30.264  1.00 38.13 ? 49  LYS C C   1 
ATOM   1646 O O   . LYS B 1 44  ? 47.057 15.315 29.358  1.00 38.21 ? 49  LYS C O   1 
ATOM   1647 C CB  . LYS B 1 44  ? 48.655 13.391 28.507  1.00 45.80 ? 49  LYS C CB  1 
ATOM   1648 C CG  . LYS B 1 44  ? 49.515 12.210 28.134  1.00 44.25 ? 49  LYS C CG  1 
ATOM   1649 C CD  . LYS B 1 44  ? 50.977 12.586 28.134  1.00 44.55 ? 49  LYS C CD  1 
ATOM   1650 C CE  . LYS B 1 44  ? 51.899 11.364 28.123  1.00 51.67 ? 49  LYS C CE  1 
ATOM   1651 N NZ  . LYS B 1 44  ? 52.249 10.988 26.715  1.00 53.48 ? 49  LYS C NZ  1 
ATOM   1652 N N   . THR B 1 45  ? 47.790 15.362 31.508  1.00 35.12 ? 50  THR C N   1 
ATOM   1653 C CA  . THR B 1 45  ? 46.996 16.526 31.806  1.00 35.28 ? 50  THR C CA  1 
ATOM   1654 C C   . THR B 1 45  ? 47.554 17.235 33.043  1.00 29.68 ? 50  THR C C   1 
ATOM   1655 O O   . THR B 1 45  ? 48.560 16.814 33.607  1.00 32.68 ? 50  THR C O   1 
ATOM   1656 C CB  . THR B 1 45  ? 45.503 16.168 31.964  1.00 36.30 ? 50  THR C CB  1 
ATOM   1657 O OG1 . THR B 1 45  ? 44.704 17.341 31.888  1.00 38.35 ? 50  THR C OG1 1 
ATOM   1658 C CG2 . THR B 1 45  ? 45.245 15.415 33.273  1.00 38.65 ? 50  THR C CG2 1 
ATOM   1659 N N   . GLY B 1 46  ? 46.833 18.256 33.471  1.00 31.01 ? 51  GLY C N   1 
ATOM   1660 C CA  . GLY B 1 46  ? 47.314 19.128 34.548  1.00 27.99 ? 51  GLY C CA  1 
ATOM   1661 C C   . GLY B 1 46  ? 46.379 20.313 34.580  1.00 26.15 ? 51  GLY C C   1 
ATOM   1662 O O   . GLY B 1 46  ? 45.638 20.534 33.630  1.00 23.86 ? 51  GLY C O   1 
ATOM   1663 N N   . THR B 1 47  ? 46.486 21.093 35.653  1.00 24.07 ? 52  THR C N   1 
ATOM   1664 C CA  . THR B 1 47  ? 45.653 22.241 35.894  1.00 23.57 ? 52  THR C CA  1 
ATOM   1665 C C   . THR B 1 47  ? 46.598 23.333 36.398  1.00 23.37 ? 52  THR C C   1 
ATOM   1666 O O   . THR B 1 47  ? 47.595 23.071 37.077  1.00 24.03 ? 52  THR C O   1 
ATOM   1667 C CB  . THR B 1 47  ? 44.577 21.882 36.974  1.00 28.80 ? 52  THR C CB  1 
ATOM   1668 O OG1 . THR B 1 47  ? 43.668 22.955 37.217  1.00 35.53 ? 52  THR C OG1 1 
ATOM   1669 C CG2 . THR B 1 47  ? 45.171 21.599 38.263  1.00 30.15 ? 52  THR C CG2 1 
ATOM   1670 N N   . VAL B 1 48  ? 46.261 24.540 36.052  1.00 18.87 ? 53  VAL C N   1 
ATOM   1671 C CA  . VAL B 1 48  ? 46.975 25.724 36.512  1.00 18.14 ? 53  VAL C CA  1 
ATOM   1672 C C   . VAL B 1 48  ? 45.999 26.643 37.136  1.00 17.14 ? 53  VAL C C   1 
ATOM   1673 O O   . VAL B 1 48  ? 44.876 26.776 36.661  1.00 17.57 ? 53  VAL C O   1 
ATOM   1674 C CB  . VAL B 1 48  ? 47.557 26.459 35.301  1.00 19.49 ? 53  VAL C CB  1 
ATOM   1675 C CG1 . VAL B 1 48  ? 48.110 27.842 35.718  1.00 22.28 ? 53  VAL C CG1 1 
ATOM   1676 C CG2 . VAL B 1 48  ? 48.568 25.597 34.630  1.00 20.29 ? 53  VAL C CG2 1 
ATOM   1677 N N   . ASP B 1 49  ? 46.402 27.286 38.270  1.00 16.03 ? 54  ASP C N   1 
ATOM   1678 C CA  . ASP B 1 49  ? 45.588 28.311 38.955  1.00 17.19 ? 54  ASP C CA  1 
ATOM   1679 C C   . ASP B 1 49  ? 46.553 29.375 39.383  1.00 17.49 ? 54  ASP C C   1 
ATOM   1680 O O   . ASP B 1 49  ? 47.431 29.102 40.232  1.00 20.15 ? 54  ASP C O   1 
ATOM   1681 C CB  . ASP B 1 49  ? 44.841 27.683 40.111  1.00 19.98 ? 54  ASP C CB  1 
ATOM   1682 C CG  . ASP B 1 49  ? 43.922 28.657 40.845  1.00 26.63 ? 54  ASP C CG  1 
ATOM   1683 O OD1 . ASP B 1 49  ? 43.845 29.816 40.502  1.00 31.20 ? 54  ASP C OD1 1 
ATOM   1684 O OD2 . ASP B 1 49  ? 43.159 28.216 41.777  1.00 38.43 ? 54  ASP C OD2 1 
ATOM   1685 N N   A VAL B 1 50  ? 46.523 30.548 38.779  0.50 15.27 ? 55  VAL C N   1 
ATOM   1686 N N   B VAL B 1 50  ? 46.401 30.584 38.845  0.50 15.52 ? 55  VAL C N   1 
ATOM   1687 C CA  A VAL B 1 50  ? 47.476 31.585 39.138  0.50 14.42 ? 55  VAL C CA  1 
ATOM   1688 C CA  B VAL B 1 50  ? 47.329 31.678 39.086  0.50 14.59 ? 55  VAL C CA  1 
ATOM   1689 C C   A VAL B 1 50  ? 46.663 32.854 39.372  0.50 13.64 ? 55  VAL C C   1 
ATOM   1690 C C   B VAL B 1 50  ? 46.682 33.020 39.276  0.50 13.79 ? 55  VAL C C   1 
ATOM   1691 O O   A VAL B 1 50  ? 45.569 32.983 38.745  0.50 13.72 ? 55  VAL C O   1 
ATOM   1692 O O   B VAL B 1 50  ? 45.862 33.465 38.473  0.50 12.40 ? 55  VAL C O   1 
ATOM   1693 C CB  A VAL B 1 50  ? 48.610 31.686 38.043  0.50 13.62 ? 55  VAL C CB  1 
ATOM   1694 C CB  B VAL B 1 50  ? 48.310 31.827 37.885  0.50 14.64 ? 55  VAL C CB  1 
ATOM   1695 C CG1 A VAL B 1 50  ? 47.960 31.818 36.660  0.50 14.32 ? 55  VAL C CG1 1 
ATOM   1696 C CG1 B VAL B 1 50  ? 49.119 33.102 37.938  0.50 15.50 ? 55  VAL C CG1 1 
ATOM   1697 C CG2 A VAL B 1 50  ? 49.712 32.734 38.374  0.50 14.55 ? 55  VAL C CG2 1 
ATOM   1698 C CG2 B VAL B 1 50  ? 49.094 30.568 37.735  0.50 15.13 ? 55  VAL C CG2 1 
ATOM   1699 N N   . THR B 1 51  ? 47.170 33.771 40.231  1.00 12.97 ? 56  THR C N   1 
ATOM   1700 C CA  . THR B 1 51  ? 46.571 35.080 40.522  1.00 14.15 ? 56  THR C CA  1 
ATOM   1701 C C   . THR B 1 51  ? 47.705 36.095 40.514  1.00 15.20 ? 56  THR C C   1 
ATOM   1702 O O   . THR B 1 51  ? 48.812 35.863 41.096  1.00 15.18 ? 56  THR C O   1 
ATOM   1703 C CB  . THR B 1 51  ? 45.870 35.082 41.855  1.00 17.40 ? 56  THR C CB  1 
ATOM   1704 O OG1 . THR B 1 51  ? 44.860 34.060 41.877  1.00 19.71 ? 56  THR C OG1 1 
ATOM   1705 C CG2 . THR B 1 51  ? 45.218 36.406 42.163  1.00 20.07 ? 56  THR C CG2 1 
ATOM   1706 N N   . THR B 1 52  ? 47.486 37.240 39.898  1.00 14.17 ? 57  THR C N   1 
ATOM   1707 C CA  . THR B 1 52  ? 48.412 38.293 39.737  1.00 14.38 ? 57  THR C CA  1 
ATOM   1708 C C   . THR B 1 52  ? 47.823 39.581 40.276  1.00 15.56 ? 57  THR C C   1 
ATOM   1709 O O   . THR B 1 52  ? 46.653 39.840 40.030  1.00 15.18 ? 57  THR C O   1 
ATOM   1710 C CB  . THR B 1 52  ? 48.773 38.443 38.263  1.00 16.51 ? 57  THR C CB  1 
ATOM   1711 O OG1 . THR B 1 52  ? 49.455 37.308 37.726  1.00 17.65 ? 57  THR C OG1 1 
ATOM   1712 C CG2 . THR B 1 52  ? 49.546 39.667 37.980  1.00 17.95 ? 57  THR C CG2 1 
ATOM   1713 N N   . ASP B 1 53  ? 48.595 40.341 41.065  1.00 12.77 ? 58  ASP C N   1 
ATOM   1714 C CA  . ASP B 1 53  ? 48.181 41.625 41.615  1.00 13.59 ? 58  ASP C CA  1 
ATOM   1715 C C   . ASP B 1 53  ? 48.344 42.776 40.651  1.00 13.69 ? 58  ASP C C   1 
ATOM   1716 O O   . ASP B 1 53  ? 49.468 43.108 40.193  1.00 14.17 ? 58  ASP C O   1 
ATOM   1717 C CB  . ASP B 1 53  ? 49.004 41.924 42.888  1.00 17.08 ? 58  ASP C CB  1 
ATOM   1718 C CG  . ASP B 1 53  ? 48.612 41.019 44.084  1.00 23.82 ? 58  ASP C CG  1 
ATOM   1719 O OD1 . ASP B 1 53  ? 47.815 40.090 43.933  1.00 23.99 ? 58  ASP C OD1 1 
ATOM   1720 O OD2 . ASP B 1 53  ? 49.238 41.228 45.154  1.00 31.44 ? 58  ASP C OD2 1 
ATOM   1721 N N   . ILE B 1 54  ? 47.227 43.408 40.243  1.00 13.35 ? 59  ILE C N   1 
ATOM   1722 C CA  . ILE B 1 54  ? 47.285 44.545 39.374  1.00 14.01 ? 59  ILE C CA  1 
ATOM   1723 C C   . ILE B 1 54  ? 48.121 45.666 39.805  1.00 13.79 ? 59  ILE C C   1 
ATOM   1724 O O   . ILE B 1 54  ? 48.893 46.285 38.996  1.00 14.71 ? 59  ILE C O   1 
ATOM   1725 C CB  . ILE B 1 54  ? 45.825 45.023 39.056  1.00 15.18 ? 59  ILE C CB  1 
ATOM   1726 C CG1 . ILE B 1 54  ? 45.008 43.920 38.418  1.00 16.15 ? 59  ILE C CG1 1 
ATOM   1727 C CG2 . ILE B 1 54  ? 45.874 46.341 38.260  1.00 16.61 ? 59  ILE C CG2 1 
ATOM   1728 C CD1 . ILE B 1 54  ? 45.448 43.408 37.016  1.00 18.27 ? 59  ILE C CD1 1 
ATOM   1729 N N   . ALA B 1 55  ? 48.192 45.945 41.075  1.00 14.54 ? 60  ALA C N   1 
ATOM   1730 C CA  . ALA B 1 55  ? 49.017 46.992 41.617  1.00 15.25 ? 60  ALA C CA  1 
ATOM   1731 C C   . ALA B 1 55  ? 50.519 46.789 41.497  1.00 14.72 ? 60  ALA C C   1 
ATOM   1732 O O   . ALA B 1 55  ? 51.283 47.675 41.718  1.00 17.38 ? 60  ALA C O   1 
ATOM   1733 C CB  . ALA B 1 55  ? 48.651 47.211 43.097  1.00 17.55 ? 60  ALA C CB  1 
ATOM   1734 N N   . SER B 1 56  ? 50.895 45.560 41.066  1.00 13.84 ? 61  SER C N   1 
ATOM   1735 C CA  . SER B 1 56  ? 52.297 45.226 40.889  1.00 13.28 ? 61  SER C CA  1 
ATOM   1736 C C   . SER B 1 56  ? 52.797 45.451 39.496  1.00 13.57 ? 61  SER C C   1 
ATOM   1737 O O   . SER B 1 56  ? 53.943 45.145 39.193  1.00 12.58 ? 61  SER C O   1 
ATOM   1738 C CB  . SER B 1 56  ? 52.525 43.779 41.249  1.00 13.00 ? 61  SER C CB  1 
ATOM   1739 O OG  . SER B 1 56  ? 52.029 42.793 40.363  1.00 13.31 ? 61  SER C OG  1 
ATOM   1740 N N   . ILE B 1 57  ? 51.977 46.120 38.670  1.00 12.95 ? 62  ILE C N   1 
ATOM   1741 C CA  . ILE B 1 57  ? 52.431 46.425 37.337  1.00 14.14 ? 62  ILE C CA  1 
ATOM   1742 C C   . ILE B 1 57  ? 53.617 47.314 37.282  1.00 14.43 ? 62  ILE C C   1 
ATOM   1743 O O   . ILE B 1 57  ? 53.761 48.218 38.083  1.00 15.33 ? 62  ILE C O   1 
ATOM   1744 C CB  . ILE B 1 57  ? 51.262 47.017 36.447  1.00 14.99 ? 62  ILE C CB  1 
ATOM   1745 C CG1 . ILE B 1 57  ? 51.618 46.866 34.945  1.00 16.70 ? 62  ILE C CG1 1 
ATOM   1746 C CG2 . ILE B 1 57  ? 50.953 48.460 36.811  1.00 17.12 ? 62  ILE C CG2 1 
ATOM   1747 C CD1 . ILE B 1 57  ? 50.485 47.210 33.996  1.00 19.39 ? 62  ILE C CD1 1 
ATOM   1748 N N   . HIS B 1 58  ? 54.518 47.047 36.299  1.00 13.37 ? 63  HIS C N   1 
ATOM   1749 C CA  . HIS B 1 58  ? 55.673 47.869 36.089  1.00 15.72 ? 63  HIS C CA  1 
ATOM   1750 C C   . HIS B 1 58  ? 55.862 48.082 34.615  1.00 14.62 ? 63  HIS C C   1 
ATOM   1751 O O   . HIS B 1 58  ? 56.126 47.133 33.885  1.00 15.41 ? 63  HIS C O   1 
ATOM   1752 C CB  . HIS B 1 58  ? 56.952 47.263 36.654  1.00 18.25 ? 63  HIS C CB  1 
ATOM   1753 C CG  . HIS B 1 58  ? 58.140 48.191 36.605  1.00 22.47 ? 63  HIS C CG  1 
ATOM   1754 N ND1 . HIS B 1 58  ? 59.046 48.218 35.559  1.00 28.35 ? 63  HIS C ND1 1 
ATOM   1755 C CD2 . HIS B 1 58  ? 58.586 49.095 37.513  1.00 23.86 ? 63  HIS C CD2 1 
ATOM   1756 C CE1 . HIS B 1 58  ? 59.956 49.149 35.778  1.00 22.79 ? 63  HIS C CE1 1 
ATOM   1757 N NE2 . HIS B 1 58  ? 59.717 49.697 36.975  1.00 26.42 ? 63  HIS C NE2 1 
ATOM   1758 N N   . THR B 1 59  ? 55.722 49.288 34.155  1.00 16.21 ? 64  THR C N   1 
ATOM   1759 C CA  . THR B 1 59  ? 55.844 49.575 32.724  1.00 17.28 ? 64  THR C CA  1 
ATOM   1760 C C   . THR B 1 59  ? 57.155 50.276 32.390  1.00 18.71 ? 64  THR C C   1 
ATOM   1761 O O   . THR B 1 59  ? 57.483 50.438 31.196  1.00 19.57 ? 64  THR C O   1 
ATOM   1762 C CB  . THR B 1 59  ? 54.708 50.567 32.264  1.00 18.27 ? 64  THR C CB  1 
ATOM   1763 O OG1 . THR B 1 59  ? 54.855 51.780 32.984  1.00 19.15 ? 64  THR C OG1 1 
ATOM   1764 C CG2 . THR B 1 59  ? 53.281 50.000 32.601  1.00 18.97 ? 64  THR C CG2 1 
ATOM   1765 N N   . GLY B 1 60  ? 57.880 50.749 33.413  1.00 16.21 ? 65  GLY C N   1 
ATOM   1766 C CA  . GLY B 1 60  ? 58.987 51.630 33.178  1.00 16.79 ? 65  GLY C CA  1 
ATOM   1767 C C   . GLY B 1 60  ? 58.745 53.095 33.425  1.00 18.48 ? 65  GLY C C   1 
ATOM   1768 O O   . GLY B 1 60  ? 59.676 53.807 33.759  1.00 19.35 ? 65  GLY C O   1 
ATOM   1769 N N   . SER B 1 61  ? 57.460 53.447 33.415  1.00 19.46 ? 66  SER C N   1 
ATOM   1770 C CA  . SER B 1 61  ? 56.951 54.771 33.803  1.00 20.15 ? 66  SER C CA  1 
ATOM   1771 C C   . SER B 1 61  ? 56.144 54.658 35.077  1.00 22.41 ? 66  SER C C   1 
ATOM   1772 O O   . SER B 1 61  ? 55.047 54.129 35.069  1.00 21.93 ? 66  SER C O   1 
ATOM   1773 C CB  . SER B 1 61  ? 56.136 55.350 32.651  1.00 20.03 ? 66  SER C CB  1 
ATOM   1774 O OG  . SER B 1 61  ? 55.486 56.511 33.122  1.00 20.81 ? 66  SER C OG  1 
ATOM   1775 N N   . ALA B 1 62  ? 56.699 55.162 36.171  1.00 23.35 ? 67  ALA C N   1 
ATOM   1776 C CA  . ALA B 1 62  ? 55.973 55.184 37.416  1.00 24.53 ? 67  ALA C CA  1 
ATOM   1777 C C   . ALA B 1 62  ? 54.660 55.975 37.259  1.00 26.21 ? 67  ALA C C   1 
ATOM   1778 O O   . ALA B 1 62  ? 53.632 55.617 37.899  1.00 25.72 ? 67  ALA C O   1 
ATOM   1779 C CB  . ALA B 1 62  ? 56.810 55.760 38.513  1.00 28.03 ? 67  ALA C CB  1 
ATOM   1780 N N   . LYS B 1 63  ? 54.667 57.049 36.453  1.00 27.38 ? 68  LYS C N   1 
ATOM   1781 C CA  . LYS B 1 63  ? 53.434 57.823 36.247  1.00 29.21 ? 68  LYS C CA  1 
ATOM   1782 C C   . LYS B 1 63  ? 52.351 56.976 35.573  1.00 25.03 ? 68  LYS C C   1 
ATOM   1783 O O   . LYS B 1 63  ? 51.167 57.000 35.991  1.00 23.79 ? 68  LYS C O   1 
ATOM   1784 C CB  . LYS B 1 63  ? 53.710 59.088 35.410  1.00 34.97 ? 68  LYS C CB  1 
ATOM   1785 C CG  . LYS B 1 63  ? 52.477 59.959 35.097  1.00 44.41 ? 68  LYS C CG  1 
ATOM   1786 C CD  . LYS B 1 63  ? 52.804 61.003 34.014  1.00 47.51 ? 68  LYS C CD  1 
ATOM   1787 C CE  . LYS B 1 63  ? 51.563 61.528 33.303  1.00 52.94 ? 68  LYS C CE  1 
ATOM   1788 N NZ  . LYS B 1 63  ? 50.712 62.413 34.167  1.00 56.92 ? 68  LYS C NZ  1 
ATOM   1789 N N   . LEU B 1 64  ? 52.746 56.242 34.536  1.00 21.55 ? 69  LEU C N   1 
ATOM   1790 C CA  . LEU B 1 64  ? 51.848 55.372 33.835  1.00 21.26 ? 69  LEU C CA  1 
ATOM   1791 C C   . LEU B 1 64  ? 51.343 54.242 34.762  1.00 19.24 ? 69  LEU C C   1 
ATOM   1792 O O   . LEU B 1 64  ? 50.165 53.903 34.734  1.00 21.55 ? 69  LEU C O   1 
ATOM   1793 C CB  . LEU B 1 64  ? 52.504 54.767 32.606  1.00 22.44 ? 69  LEU C CB  1 
ATOM   1794 C CG  . LEU B 1 64  ? 51.674 53.822 31.724  1.00 22.33 ? 69  LEU C CG  1 
ATOM   1795 C CD1 . LEU B 1 64  ? 50.376 54.581 31.336  1.00 22.97 ? 69  LEU C CD1 1 
ATOM   1796 C CD2 . LEU B 1 64  ? 52.423 53.308 30.532  1.00 24.15 ? 69  LEU C CD2 1 
ATOM   1797 N N   . ASP B 1 65  ? 52.230 53.686 35.601  1.00 17.73 ? 70  ASP C N   1 
ATOM   1798 C CA  . ASP B 1 65  ? 51.867 52.590 36.437  1.00 18.93 ? 70  ASP C CA  1 
ATOM   1799 C C   . ASP B 1 65  ? 50.686 53.020 37.355  1.00 21.27 ? 70  ASP C C   1 
ATOM   1800 O O   . ASP B 1 65  ? 49.712 52.275 37.577  1.00 20.33 ? 70  ASP C O   1 
ATOM   1801 C CB  . ASP B 1 65  ? 53.006 52.104 37.367  1.00 20.28 ? 70  ASP C CB  1 
ATOM   1802 C CG  . ASP B 1 65  ? 54.158 51.429 36.659  1.00 20.49 ? 70  ASP C CG  1 
ATOM   1803 O OD1 . ASP B 1 65  ? 53.990 51.057 35.487  1.00 22.23 ? 70  ASP C OD1 1 
ATOM   1804 O OD2 . ASP B 1 65  ? 55.252 51.337 37.291  1.00 25.86 ? 70  ASP C OD2 1 
ATOM   1805 N N   . GLU B 1 66  ? 50.841 54.232 37.924  1.00 22.11 ? 71  GLU C N   1 
ATOM   1806 C CA  . GLU B 1 66  ? 49.837 54.789 38.868  1.00 26.12 ? 71  GLU C CA  1 
ATOM   1807 C C   . GLU B 1 66  ? 48.574 55.075 38.108  1.00 23.41 ? 71  GLU C C   1 
ATOM   1808 O O   . GLU B 1 66  ? 47.458 54.758 38.555  1.00 23.96 ? 71  GLU C O   1 
ATOM   1809 C CB  . GLU B 1 66  ? 50.422 56.058 39.504  1.00 29.69 ? 71  GLU C CB  1 
ATOM   1810 C CG  . GLU B 1 66  ? 49.550 56.780 40.540  1.00 38.66 ? 71  GLU C CG  1 
ATOM   1811 C CD  . GLU B 1 66  ? 50.221 58.079 41.055  1.00 48.07 ? 71  GLU C CD  1 
ATOM   1812 O OE1 . GLU B 1 66  ? 50.678 58.891 40.212  1.00 57.01 ? 71  GLU C OE1 1 
ATOM   1813 O OE2 . GLU B 1 66  ? 50.319 58.288 42.297  1.00 51.29 ? 71  GLU C OE2 1 
ATOM   1814 N N   . HIS B 1 67  ? 48.698 55.684 36.955  1.00 23.87 ? 72  HIS C N   1 
ATOM   1815 C CA  . HIS B 1 67  ? 47.558 55.964 36.130  1.00 24.53 ? 72  HIS C CA  1 
ATOM   1816 C C   . HIS B 1 67  ? 46.724 54.748 35.782  1.00 25.98 ? 72  HIS C C   1 
ATOM   1817 O O   . HIS B 1 67  ? 45.488 54.720 35.910  1.00 23.21 ? 72  HIS C O   1 
ATOM   1818 C CB  . HIS B 1 67  ? 47.995 56.735 34.874  1.00 29.23 ? 72  HIS C CB  1 
ATOM   1819 C CG  . HIS B 1 67  ? 46.933 56.860 33.842  1.00 37.87 ? 72  HIS C CG  1 
ATOM   1820 N ND1 . HIS B 1 67  ? 45.906 57.776 33.940  1.00 45.59 ? 72  HIS C ND1 1 
ATOM   1821 C CD2 . HIS B 1 67  ? 46.681 56.127 32.726  1.00 42.47 ? 72  HIS C CD2 1 
ATOM   1822 C CE1 . HIS B 1 67  ? 45.082 57.619 32.911  1.00 46.01 ? 72  HIS C CE1 1 
ATOM   1823 N NE2 . HIS B 1 67  ? 45.524 56.621 32.164  1.00 46.74 ? 72  HIS C NE2 1 
ATOM   1824 N N   . LEU B 1 68  ? 47.395 53.655 35.404  1.00 18.93 ? 73  LEU C N   1 
ATOM   1825 C CA  . LEU B 1 68  ? 46.695 52.448 34.991  1.00 18.72 ? 73  LEU C CA  1 
ATOM   1826 C C   . LEU B 1 68  ? 45.878 51.811 36.125  1.00 18.21 ? 73  LEU C C   1 
ATOM   1827 O O   . LEU B 1 68  ? 44.963 51.027 35.811  1.00 20.08 ? 73  LEU C O   1 
ATOM   1828 C CB  . LEU B 1 68  ? 47.700 51.410 34.407  1.00 19.58 ? 73  LEU C CB  1 
ATOM   1829 C CG  . LEU B 1 68  ? 48.344 51.828 33.084  1.00 21.00 ? 73  LEU C CG  1 
ATOM   1830 C CD1 . LEU B 1 68  ? 49.365 50.802 32.664  1.00 21.73 ? 73  LEU C CD1 1 
ATOM   1831 C CD2 . LEU B 1 68  ? 47.256 52.093 31.997  1.00 23.77 ? 73  LEU C CD2 1 
ATOM   1832 N N   . GLN B 1 69  ? 46.220 52.084 37.391  1.00 19.29 ? 74  GLN C N   1 
ATOM   1833 C CA  . GLN B 1 69  ? 45.489 51.585 38.564  1.00 19.48 ? 74  GLN C CA  1 
ATOM   1834 C C   . GLN B 1 69  ? 44.197 52.344 38.870  1.00 22.62 ? 74  GLN C C   1 
ATOM   1835 O O   . GLN B 1 69  ? 43.323 51.849 39.604  1.00 21.23 ? 74  GLN C O   1 
ATOM   1836 C CB  . GLN B 1 69  ? 46.265 51.810 39.853  1.00 21.77 ? 74  GLN C CB  1 
ATOM   1837 C CG  . GLN B 1 69  ? 47.651 51.303 39.900  1.00 22.69 ? 74  GLN C CG  1 
ATOM   1838 C CD  . GLN B 1 69  ? 47.664 49.900 39.641  1.00 24.71 ? 74  GLN C CD  1 
ATOM   1839 O OE1 . GLN B 1 69  ? 46.982 49.143 40.331  1.00 28.70 ? 74  GLN C OE1 1 
ATOM   1840 N NE2 . GLN B 1 69  ? 48.396 49.467 38.568  1.00 25.16 ? 74  GLN C NE2 1 
ATOM   1841 N N   . THR B 1 70  ? 44.083 53.508 38.276  1.00 23.28 ? 75  THR C N   1 
ATOM   1842 C CA  . THR B 1 70  ? 42.899 54.340 38.618  1.00 26.02 ? 75  THR C CA  1 
ATOM   1843 C C   . THR B 1 70  ? 41.652 53.801 37.967  1.00 26.11 ? 75  THR C C   1 
ATOM   1844 O O   . THR B 1 70  ? 41.700 52.963 37.087  1.00 23.24 ? 75  THR C O   1 
ATOM   1845 C CB  . THR B 1 70  ? 43.045 55.809 38.148  1.00 25.43 ? 75  THR C CB  1 
ATOM   1846 O OG1 . THR B 1 70  ? 43.153 55.873 36.725  1.00 25.46 ? 75  THR C OG1 1 
ATOM   1847 C CG2 . THR B 1 70  ? 44.299 56.514 38.827  1.00 28.24 ? 75  THR C CG2 1 
ATOM   1848 N N   . ALA B 1 71  ? 40.512 54.328 38.439  1.00 28.95 ? 76  ALA C N   1 
ATOM   1849 C CA  . ALA B 1 71  ? 39.213 53.956 37.915  1.00 33.63 ? 76  ALA C CA  1 
ATOM   1850 C C   . ALA B 1 71  ? 39.110 53.942 36.400  1.00 32.96 ? 76  ALA C C   1 
ATOM   1851 O O   . ALA B 1 71  ? 38.351 53.150 35.858  1.00 37.62 ? 76  ALA C O   1 
ATOM   1852 C CB  . ALA B 1 71  ? 38.152 54.877 38.499  1.00 36.72 ? 76  ALA C CB  1 
ATOM   1853 N N   . GLU B 1 72  ? 39.821 54.833 35.721  1.00 35.15 ? 77  GLU C N   1 
ATOM   1854 C CA  . GLU B 1 72  ? 39.854 54.925 34.249  1.00 39.70 ? 77  GLU C CA  1 
ATOM   1855 C C   . GLU B 1 72  ? 40.441 53.784 33.449  1.00 39.76 ? 77  GLU C C   1 
ATOM   1856 O O   . GLU B 1 72  ? 40.221 53.702 32.216  1.00 38.37 ? 77  GLU C O   1 
ATOM   1857 C CB  . GLU B 1 72  ? 40.683 56.142 33.810  1.00 45.32 ? 77  GLU C CB  1 
ATOM   1858 C CG  . GLU B 1 72  ? 40.036 57.480 34.065  1.00 49.73 ? 77  GLU C CG  1 
ATOM   1859 C CD  . GLU B 1 72  ? 40.352 58.453 32.938  1.00 57.24 ? 77  GLU C CD  1 
ATOM   1860 O OE1 . GLU B 1 72  ? 41.368 59.200 33.066  1.00 57.97 ? 77  GLU C OE1 1 
ATOM   1861 O OE2 . GLU B 1 72  ? 39.591 58.447 31.918  1.00 59.09 ? 77  GLU C OE2 1 
ATOM   1862 N N   . PHE B 1 73  ? 41.309 52.973 34.065  1.00 30.61 ? 78  PHE C N   1 
ATOM   1863 C CA  . PHE B 1 73  ? 41.855 51.851 33.335  1.00 25.06 ? 78  PHE C CA  1 
ATOM   1864 C C   . PHE B 1 73  ? 41.583 50.576 34.152  1.00 21.33 ? 78  PHE C C   1 
ATOM   1865 O O   . PHE B 1 73  ? 40.484 50.078 34.057  1.00 22.59 ? 78  PHE C O   1 
ATOM   1866 C CB  . PHE B 1 73  ? 43.371 51.928 32.974  1.00 26.19 ? 78  PHE C CB  1 
ATOM   1867 C CG  . PHE B 1 73  ? 43.772 50.963 31.848  1.00 28.39 ? 78  PHE C CG  1 
ATOM   1868 C CD1 . PHE B 1 73  ? 43.464 51.239 30.531  1.00 31.17 ? 78  PHE C CD1 1 
ATOM   1869 C CD2 . PHE B 1 73  ? 44.507 49.779 32.090  1.00 26.34 ? 78  PHE C CD2 1 
ATOM   1870 C CE1 . PHE B 1 73  ? 43.827 50.389 29.522  1.00 27.29 ? 78  PHE C CE1 1 
ATOM   1871 C CE2 . PHE B 1 73  ? 44.878 48.947 31.069  1.00 24.19 ? 78  PHE C CE2 1 
ATOM   1872 C CZ  . PHE B 1 73  ? 44.568 49.275 29.773  1.00 31.17 ? 78  PHE C CZ  1 
ATOM   1873 N N   . PHE B 1 74  ? 42.526 50.027 34.925  1.00 19.22 ? 79  PHE C N   1 
ATOM   1874 C CA  . PHE B 1 74  ? 42.300 48.755 35.536  1.00 17.07 ? 79  PHE C CA  1 
ATOM   1875 C C   . PHE B 1 74  ? 41.307 48.861 36.717  1.00 19.18 ? 79  PHE C C   1 
ATOM   1876 O O   . PHE B 1 74  ? 40.756 47.860 37.180  1.00 19.72 ? 79  PHE C O   1 
ATOM   1877 C CB  . PHE B 1 74  ? 43.584 48.123 36.100  1.00 15.78 ? 79  PHE C CB  1 
ATOM   1878 C CG  . PHE B 1 74  ? 44.545 47.530 35.030  1.00 16.02 ? 79  PHE C CG  1 
ATOM   1879 C CD1 . PHE B 1 74  ? 44.235 46.418 34.327  1.00 15.90 ? 79  PHE C CD1 1 
ATOM   1880 C CD2 . PHE B 1 74  ? 45.816 47.990 34.980  1.00 17.58 ? 79  PHE C CD2 1 
ATOM   1881 C CE1 . PHE B 1 74  ? 45.123 45.890 33.422  1.00 15.96 ? 79  PHE C CE1 1 
ATOM   1882 C CE2 . PHE B 1 74  ? 46.742 47.497 34.053  1.00 17.13 ? 79  PHE C CE2 1 
ATOM   1883 C CZ  . PHE B 1 74  ? 46.400 46.417 33.301  1.00 16.72 ? 79  PHE C CZ  1 
ATOM   1884 N N   . ASP B 1 75  ? 41.232 50.042 37.299  1.00 21.70 ? 80  ASP C N   1 
ATOM   1885 C CA  . ASP B 1 75  ? 40.499 50.195 38.575  1.00 23.05 ? 80  ASP C CA  1 
ATOM   1886 C C   . ASP B 1 75  ? 40.932 49.148 39.578  1.00 20.48 ? 80  ASP C C   1 
ATOM   1887 O O   . ASP B 1 75  ? 40.096 48.417 40.073  1.00 24.52 ? 80  ASP C O   1 
ATOM   1888 C CB  . ASP B 1 75  ? 38.999 50.183 38.384  1.00 26.25 ? 80  ASP C CB  1 
ATOM   1889 C CG  . ASP B 1 75  ? 38.230 50.788 39.616  1.00 27.15 ? 80  ASP C CG  1 
ATOM   1890 O OD1 . ASP B 1 75  ? 38.803 50.860 40.766  1.00 27.16 ? 80  ASP C OD1 1 
ATOM   1891 O OD2 . ASP B 1 75  ? 37.056 51.138 39.453  1.00 28.93 ? 80  ASP C OD2 1 
ATOM   1892 N N   . ALA B 1 76  ? 42.137 49.289 40.078  1.00 21.36 ? 81  ALA C N   1 
ATOM   1893 C CA  . ALA B 1 76  ? 42.693 48.332 40.987  1.00 22.69 ? 81  ALA C CA  1 
ATOM   1894 C C   . ALA B 1 76  ? 42.051 48.291 42.397  1.00 23.24 ? 81  ALA C C   1 
ATOM   1895 O O   . ALA B 1 76  ? 42.077 47.273 43.099  1.00 24.38 ? 81  ALA C O   1 
ATOM   1896 C CB  . ALA B 1 76  ? 44.151 48.623 41.181  1.00 24.53 ? 81  ALA C CB  1 
ATOM   1897 N N   . ALA B 1 77  ? 41.460 49.400 42.806  1.00 23.52 ? 82  ALA C N   1 
ATOM   1898 C CA  . ALA B 1 77  ? 40.749 49.412 44.071  1.00 24.09 ? 82  ALA C CA  1 
ATOM   1899 C C   . ALA B 1 77  ? 39.579 48.492 44.061  1.00 27.76 ? 82  ALA C C   1 
ATOM   1900 O O   . ALA B 1 77  ? 39.308 47.801 45.066  1.00 32.99 ? 82  ALA C O   1 
ATOM   1901 C CB  . ALA B 1 77  ? 40.353 50.856 44.384  1.00 26.12 ? 82  ALA C CB  1 
ATOM   1902 N N   . LYS B 1 78  ? 38.894 48.399 42.928  1.00 23.86 ? 83  LYS C N   1 
ATOM   1903 C CA  . LYS B 1 78  ? 37.807 47.503 42.751  1.00 25.96 ? 83  LYS C CA  1 
ATOM   1904 C C   . LYS B 1 78  ? 38.106 46.081 42.257  1.00 23.91 ? 83  LYS C C   1 
ATOM   1905 O O   . LYS B 1 78  ? 37.453 45.067 42.634  1.00 22.75 ? 83  LYS C O   1 
ATOM   1906 C CB  . LYS B 1 78  ? 36.941 48.159 41.681  1.00 30.48 ? 83  LYS C CB  1 
ATOM   1907 C CG  . LYS B 1 78  ? 35.727 47.411 41.269  1.00 37.37 ? 83  LYS C CG  1 
ATOM   1908 C CD  . LYS B 1 78  ? 34.537 47.909 42.097  1.00 40.30 ? 83  LYS C CD  1 
ATOM   1909 C CE  . LYS B 1 78  ? 33.332 47.055 41.793  1.00 39.96 ? 83  LYS C CE  1 
ATOM   1910 N NZ  . LYS B 1 78  ? 32.410 47.001 42.990  1.00 43.53 ? 83  LYS C NZ  1 
ATOM   1911 N N   . PHE B 1 79  ? 39.113 45.973 41.387  1.00 20.83 ? 84  PHE C N   1 
ATOM   1912 C CA  . PHE B 1 79  ? 39.463 44.683 40.795  1.00 22.25 ? 84  PHE C CA  1 
ATOM   1913 C C   . PHE B 1 79  ? 40.983 44.487 40.988  1.00 21.22 ? 84  PHE C C   1 
ATOM   1914 O O   . PHE B 1 79  ? 41.824 44.804 40.055  1.00 19.44 ? 84  PHE C O   1 
ATOM   1915 C CB  . PHE B 1 79  ? 39.186 44.571 39.314  1.00 21.38 ? 84  PHE C CB  1 
ATOM   1916 C CG  . PHE B 1 79  ? 37.795 44.990 38.895  1.00 23.64 ? 84  PHE C CG  1 
ATOM   1917 C CD1 . PHE B 1 79  ? 36.756 44.210 39.234  1.00 26.35 ? 84  PHE C CD1 1 
ATOM   1918 C CD2 . PHE B 1 79  ? 37.625 46.109 38.120  1.00 23.10 ? 84  PHE C CD2 1 
ATOM   1919 C CE1 . PHE B 1 79  ? 35.481 44.584 38.833  1.00 26.52 ? 84  PHE C CE1 1 
ATOM   1920 C CE2 . PHE B 1 79  ? 36.395 46.482 37.653  1.00 28.52 ? 84  PHE C CE2 1 
ATOM   1921 C CZ  . PHE B 1 79  ? 35.305 45.728 38.052  1.00 29.03 ? 84  PHE C CZ  1 
ATOM   1922 N N   . PRO B 1 80  ? 41.362 44.097 42.184  1.00 19.35 ? 85  PRO C N   1 
ATOM   1923 C CA  . PRO B 1 80  ? 42.744 44.208 42.516  1.00 19.67 ? 85  PRO C CA  1 
ATOM   1924 C C   . PRO B 1 80  ? 43.628 43.114 41.913  1.00 19.65 ? 85  PRO C C   1 
ATOM   1925 O O   . PRO B 1 80  ? 44.836 43.261 41.943  1.00 17.39 ? 85  PRO C O   1 
ATOM   1926 C CB  . PRO B 1 80  ? 42.815 44.173 44.038  1.00 21.22 ? 85  PRO C CB  1 
ATOM   1927 C CG  . PRO B 1 80  ? 41.500 43.685 44.508  1.00 21.43 ? 85  PRO C CG  1 
ATOM   1928 C CD  . PRO B 1 80  ? 40.497 43.897 43.397  1.00 20.07 ? 85  PRO C CD  1 
ATOM   1929 N N   . GLN B 1 81  ? 43.007 42.050 41.435  1.00 18.57 ? 86  GLN C N   1 
ATOM   1930 C CA  . GLN B 1 81  ? 43.760 40.886 40.943  1.00 16.96 ? 86  GLN C CA  1 
ATOM   1931 C C   . GLN B 1 81  ? 43.212 40.446 39.623  1.00 16.34 ? 86  GLN C C   1 
ATOM   1932 O O   . GLN B 1 81  ? 42.056 40.726 39.205  1.00 21.10 ? 86  GLN C O   1 
ATOM   1933 C CB  . GLN B 1 81  ? 43.695 39.735 41.964  1.00 18.35 ? 86  GLN C CB  1 
ATOM   1934 C CG  . GLN B 1 81  ? 44.439 40.102 43.246  1.00 20.46 ? 86  GLN C CG  1 
ATOM   1935 C CD  . GLN B 1 81  ? 44.348 39.043 44.252  1.00 22.23 ? 86  GLN C CD  1 
ATOM   1936 O OE1 . GLN B 1 81  ? 43.257 38.505 44.472  1.00 23.44 ? 86  GLN C OE1 1 
ATOM   1937 N NE2 . GLN B 1 81  ? 45.473 38.699 44.866  1.00 24.91 ? 86  GLN C NE2 1 
ATOM   1938 N N   . ALA B 1 82  ? 44.010 39.742 38.858  1.00 14.17 ? 87  ALA C N   1 
ATOM   1939 C CA  . ALA B 1 82  ? 43.633 38.982 37.727  1.00 14.90 ? 87  ALA C CA  1 
ATOM   1940 C C   . ALA B 1 82  ? 43.919 37.534 37.968  1.00 15.82 ? 87  ALA C C   1 
ATOM   1941 O O   . ALA B 1 82  ? 44.833 37.257 38.708  1.00 16.71 ? 87  ALA C O   1 
ATOM   1942 C CB  . ALA B 1 82  ? 44.412 39.415 36.533  1.00 16.00 ? 87  ALA C CB  1 
ATOM   1943 N N   . ASN B 1 83  ? 43.173 36.606 37.352  1.00 15.47 ? 88  ASN C N   1 
ATOM   1944 C CA  . ASN B 1 83  ? 43.249 35.175 37.675  1.00 17.40 ? 88  ASN C CA  1 
ATOM   1945 C C   . ASN B 1 83  ? 43.228 34.433 36.382  1.00 17.89 ? 88  ASN C C   1 
ATOM   1946 O O   . ASN B 1 83  ? 42.489 34.821 35.442  1.00 17.01 ? 88  ASN C O   1 
ATOM   1947 C CB  . ASN B 1 83  ? 42.090 34.709 38.560  1.00 21.61 ? 88  ASN C CB  1 
ATOM   1948 C CG  . ASN B 1 83  ? 42.066 33.206 38.746  1.00 29.70 ? 88  ASN C CG  1 
ATOM   1949 O OD1 . ASN B 1 83  ? 41.302 32.556 38.071  1.00 32.97 ? 88  ASN C OD1 1 
ATOM   1950 N ND2 . ASN B 1 83  ? 42.954 32.622 39.627  1.00 26.81 ? 88  ASN C ND2 1 
ATOM   1951 N N   . TYR B 1 84  ? 43.990 33.371 36.283  1.00 14.96 ? 89  TYR C N   1 
ATOM   1952 C CA  . TYR B 1 84  ? 44.011 32.476 35.132  1.00 16.04 ? 89  TYR C CA  1 
ATOM   1953 C C   . TYR B 1 84  ? 43.894 31.075 35.663  1.00 16.91 ? 89  TYR C C   1 
ATOM   1954 O O   . TYR B 1 84  ? 44.663 30.631 36.568  1.00 16.03 ? 89  TYR C O   1 
ATOM   1955 C CB  . TYR B 1 84  ? 45.275 32.620 34.299  1.00 15.16 ? 89  TYR C CB  1 
ATOM   1956 C CG  . TYR B 1 84  ? 45.287 31.698 33.148  1.00 16.11 ? 89  TYR C CG  1 
ATOM   1957 C CD1 . TYR B 1 84  ? 44.567 32.015 32.016  1.00 16.33 ? 89  TYR C CD1 1 
ATOM   1958 C CD2 . TYR B 1 84  ? 45.905 30.524 33.167  1.00 17.04 ? 89  TYR C CD2 1 
ATOM   1959 C CE1 . TYR B 1 84  ? 44.526 31.131 30.942  1.00 17.57 ? 89  TYR C CE1 1 
ATOM   1960 C CE2 . TYR B 1 84  ? 45.897 29.693 32.030  1.00 17.51 ? 89  TYR C CE2 1 
ATOM   1961 C CZ  . TYR B 1 84  ? 45.173 30.032 30.944  1.00 17.58 ? 89  TYR C CZ  1 
ATOM   1962 O OH  . TYR B 1 84  ? 45.153 29.183 29.838  1.00 21.28 ? 89  TYR C OH  1 
ATOM   1963 N N   . LYS B 1 85  ? 42.925 30.346 35.128  1.00 17.19 ? 90  LYS C N   1 
ATOM   1964 C CA  . LYS B 1 85  ? 42.783 28.965 35.453  1.00 18.60 ? 90  LYS C CA  1 
ATOM   1965 C C   . LYS B 1 85  ? 42.710 28.162 34.181  1.00 17.62 ? 90  LYS C C   1 
ATOM   1966 O O   . LYS B 1 85  ? 41.968 28.609 33.270  1.00 18.51 ? 90  LYS C O   1 
ATOM   1967 C CB  . LYS B 1 85  ? 41.463 28.689 36.246  1.00 21.06 ? 90  LYS C CB  1 
ATOM   1968 C CG  . LYS B 1 85  ? 41.221 29.450 37.514  1.00 25.32 ? 90  LYS C CG  1 
ATOM   1969 C CD  . LYS B 1 85  ? 40.035 28.857 38.264  1.00 30.72 ? 90  LYS C CD  1 
ATOM   1970 C CE  . LYS B 1 85  ? 40.162 29.176 39.735  1.00 37.14 ? 90  LYS C CE  1 
ATOM   1971 N NZ  . LYS B 1 85  ? 40.198 30.672 39.885  1.00 41.27 ? 90  LYS C NZ  1 
ATOM   1972 N N   . GLY B 1 86  ? 43.345 27.022 34.092  1.00 15.96 ? 91  GLY C N   1 
ATOM   1973 C CA  . GLY B 1 86  ? 43.232 26.226 32.847  1.00 17.79 ? 91  GLY C CA  1 
ATOM   1974 C C   . GLY B 1 86  ? 43.802 24.890 32.958  1.00 17.39 ? 91  GLY C C   1 
ATOM   1975 O O   . GLY B 1 86  ? 44.313 24.452 34.030  1.00 19.32 ? 91  GLY C O   1 
ATOM   1976 N N   . THR B 1 87  ? 43.586 24.148 31.898  1.00 19.35 ? 92  THR C N   1 
ATOM   1977 C CA  . THR B 1 87  ? 43.977 22.769 31.780  1.00 21.20 ? 92  THR C CA  1 
ATOM   1978 C C   . THR B 1 87  ? 45.138 22.629 30.812  1.00 19.88 ? 92  THR C C   1 
ATOM   1979 O O   . THR B 1 87  ? 45.094 23.185 29.767  1.00 19.86 ? 92  THR C O   1 
ATOM   1980 C CB  . THR B 1 87  ? 42.752 21.961 31.274  1.00 23.94 ? 92  THR C CB  1 
ATOM   1981 O OG1 . THR B 1 87  ? 41.709 22.069 32.263  1.00 29.11 ? 92  THR C OG1 1 
ATOM   1982 C CG2 . THR B 1 87  ? 43.112 20.461 31.121  1.00 25.17 ? 92  THR C CG2 1 
ATOM   1983 N N   . ILE B 1 88  ? 46.121 21.820 31.166  1.00 19.80 ? 93  ILE C N   1 
ATOM   1984 C CA  . ILE B 1 88  ? 47.341 21.599 30.382  1.00 19.88 ? 93  ILE C CA  1 
ATOM   1985 C C   . ILE B 1 88  ? 47.103 20.517 29.344  1.00 19.69 ? 93  ILE C C   1 
ATOM   1986 O O   . ILE B 1 88  ? 46.652 19.461 29.711  1.00 21.33 ? 93  ILE C O   1 
ATOM   1987 C CB  . ILE B 1 88  ? 48.576 21.228 31.238  1.00 23.06 ? 93  ILE C CB  1 
ATOM   1988 C CG1 . ILE B 1 88  ? 48.970 22.383 32.189  1.00 21.89 ? 93  ILE C CG1 1 
ATOM   1989 C CG2 . ILE B 1 88  ? 49.786 20.954 30.367  1.00 21.71 ? 93  ILE C CG2 1 
ATOM   1990 C CD1 . ILE B 1 88  ? 49.896 21.974 33.315  1.00 23.56 ? 93  ILE C CD1 1 
ATOM   1991 N N   . LYS B 1 89  ? 47.339 20.834 28.061  1.00 19.30 ? 94  LYS C N   1 
ATOM   1992 C CA  . LYS B 1 89  ? 47.242 19.887 26.943  1.00 20.08 ? 94  LYS C CA  1 
ATOM   1993 C C   . LYS B 1 89  ? 48.637 19.430 26.539  1.00 19.94 ? 94  LYS C C   1 
ATOM   1994 O O   . LYS B 1 89  ? 49.583 20.213 26.452  1.00 19.62 ? 94  LYS C O   1 
ATOM   1995 C CB  . LYS B 1 89  ? 46.663 20.619 25.751  1.00 21.86 ? 94  LYS C CB  1 
ATOM   1996 C CG  . LYS B 1 89  ? 45.370 21.347 26.034  1.00 28.44 ? 94  LYS C CG  1 
ATOM   1997 C CD  . LYS B 1 89  ? 44.298 20.445 26.629  1.00 34.25 ? 94  LYS C CD  1 
ATOM   1998 C CE  . LYS B 1 89  ? 43.330 21.227 27.553  1.00 37.64 ? 94  LYS C CE  1 
ATOM   1999 N NZ  . LYS B 1 89  ? 41.869 20.881 27.410  1.00 45.42 ? 94  LYS C NZ  1 
ATOM   2000 N N   . PHE B 1 90  ? 48.758 18.150 26.141  1.00 20.01 ? 95  PHE C N   1 
ATOM   2001 C CA  . PHE B 1 90  ? 50.043 17.596 25.728  1.00 21.53 ? 95  PHE C CA  1 
ATOM   2002 C C   . PHE B 1 90  ? 50.073 17.242 24.236  1.00 25.63 ? 95  PHE C C   1 
ATOM   2003 O O   . PHE B 1 90  ? 49.011 16.962 23.730  1.00 28.88 ? 95  PHE C O   1 
ATOM   2004 C CB  . PHE B 1 90  ? 50.330 16.327 26.511  1.00 21.97 ? 95  PHE C CB  1 
ATOM   2005 C CG  . PHE B 1 90  ? 50.713 16.530 27.990  1.00 23.80 ? 95  PHE C CG  1 
ATOM   2006 C CD1 . PHE B 1 90  ? 49.793 16.965 28.917  1.00 23.46 ? 95  PHE C CD1 1 
ATOM   2007 C CD2 . PHE B 1 90  ? 51.968 16.161 28.424  1.00 25.47 ? 95  PHE C CD2 1 
ATOM   2008 C CE1 . PHE B 1 90  ? 50.140 17.138 30.265  1.00 25.24 ? 95  PHE C CE1 1 
ATOM   2009 C CE2 . PHE B 1 90  ? 52.314 16.288 29.775  1.00 24.87 ? 95  PHE C CE2 1 
ATOM   2010 C CZ  . PHE B 1 90  ? 51.411 16.787 30.670  1.00 27.04 ? 95  PHE C CZ  1 
ATOM   2011 N N   . ASP B 1 91  ? 51.248 17.302 23.600  1.00 28.13 ? 96  ASP C N   1 
ATOM   2012 C CA  . ASP B 1 91  ? 51.560 16.944 22.109  1.00 30.43 ? 96  ASP C CA  1 
ATOM   2013 C C   . ASP B 1 91  ? 52.597 15.844 22.419  1.00 40.25 ? 96  ASP C C   1 
ATOM   2014 O O   . ASP B 1 91  ? 53.800 16.112 22.596  1.00 42.24 ? 96  ASP C O   1 
ATOM   2015 C CB  . ASP B 1 91  ? 52.134 18.138 21.250  1.00 29.06 ? 96  ASP C CB  1 
ATOM   2016 C CG  . ASP B 1 91  ? 52.149 17.889 19.678  1.00 26.83 ? 96  ASP C CG  1 
ATOM   2017 O OD1 . ASP B 1 91  ? 51.821 16.687 19.317  1.00 21.37 ? 96  ASP C OD1 1 
ATOM   2018 O OD2 . ASP B 1 91  ? 52.530 18.932 18.922  1.00 19.72 ? 96  ASP C OD2 1 
ATOM   2019 N N   . GLY B 1 92  ? 52.087 14.630 22.567  1.00 43.47 ? 97  GLY C N   1 
ATOM   2020 C CA  . GLY B 1 92  ? 52.883 13.464 22.889  1.00 49.37 ? 97  GLY C CA  1 
ATOM   2021 C C   . GLY B 1 92  ? 53.102 13.457 24.383  1.00 50.23 ? 97  GLY C C   1 
ATOM   2022 O O   . GLY B 1 92  ? 52.120 13.472 25.160  1.00 51.30 ? 97  GLY C O   1 
ATOM   2023 N N   . ASP B 1 93  ? 54.376 13.451 24.790  1.00 44.17 ? 98  ASP C N   1 
ATOM   2024 C CA  . ASP B 1 93  ? 54.733 13.422 26.219  1.00 44.33 ? 98  ASP C CA  1 
ATOM   2025 C C   . ASP B 1 93  ? 55.024 14.826 26.715  1.00 39.77 ? 98  ASP C C   1 
ATOM   2026 O O   . ASP B 1 93  ? 55.396 14.992 27.844  1.00 37.82 ? 98  ASP C O   1 
ATOM   2027 C CB  . ASP B 1 93  ? 55.961 12.515 26.484  1.00 46.67 ? 98  ASP C CB  1 
ATOM   2028 C CG  . ASP B 1 93  ? 57.114 12.788 25.530  1.00 50.11 ? 98  ASP C CG  1 
ATOM   2029 O OD1 . ASP B 1 93  ? 57.127 13.855 24.845  1.00 58.28 ? 98  ASP C OD1 1 
ATOM   2030 O OD2 . ASP B 1 93  ? 57.983 11.901 25.408  1.00 59.48 ? 98  ASP C OD2 1 
ATOM   2031 N N   . LYS B 1 94  ? 54.787 15.836 25.886  1.00 35.84 ? 99  LYS C N   1 
ATOM   2032 C CA  . LYS B 1 94  ? 55.238 17.180 26.161  1.00 34.83 ? 99  LYS C CA  1 
ATOM   2033 C C   . LYS B 1 94  ? 54.039 18.105 26.338  1.00 28.53 ? 99  LYS C C   1 
ATOM   2034 O O   . LYS B 1 94  ? 53.178 18.145 25.459  1.00 28.89 ? 99  LYS C O   1 
ATOM   2035 C CB  . LYS B 1 94  ? 56.100 17.656 24.977  1.00 40.90 ? 99  LYS C CB  1 
ATOM   2036 C CG  . LYS B 1 94  ? 56.867 18.934 25.269  1.00 46.86 ? 99  LYS C CG  1 
ATOM   2037 C CD  . LYS B 1 94  ? 57.783 18.801 26.495  1.00 50.51 ? 99  LYS C CD  1 
ATOM   2038 C CE  . LYS B 1 94  ? 58.770 19.969 26.597  1.00 53.08 ? 99  LYS C CE  1 
ATOM   2039 N NZ  . LYS B 1 94  ? 60.177 19.600 26.299  1.00 54.57 ? 99  LYS C NZ  1 
ATOM   2040 N N   . PRO B 1 95  ? 53.967 18.855 27.432  1.00 25.24 ? 100 PRO C N   1 
ATOM   2041 C CA  . PRO B 1 95  ? 52.980 19.932 27.527  1.00 25.41 ? 100 PRO C CA  1 
ATOM   2042 C C   . PRO B 1 95  ? 53.112 20.912 26.378  1.00 21.92 ? 100 PRO C C   1 
ATOM   2043 O O   . PRO B 1 95  ? 54.216 21.355 26.079  1.00 23.06 ? 100 PRO C O   1 
ATOM   2044 C CB  . PRO B 1 95  ? 53.331 20.606 28.860  1.00 24.12 ? 100 PRO C CB  1 
ATOM   2045 C CG  . PRO B 1 95  ? 53.887 19.503 29.643  1.00 26.25 ? 100 PRO C CG  1 
ATOM   2046 C CD  . PRO B 1 95  ? 54.792 18.818 28.682  1.00 26.96 ? 100 PRO C CD  1 
ATOM   2047 N N   . VAL B 1 96  ? 52.021 21.236 25.673  1.00 19.92 ? 101 VAL C N   1 
ATOM   2048 C CA  . VAL B 1 96  ? 52.087 22.163 24.544  1.00 19.16 ? 101 VAL C CA  1 
ATOM   2049 C C   . VAL B 1 96  ? 51.278 23.433 24.709  1.00 17.55 ? 101 VAL C C   1 
ATOM   2050 O O   . VAL B 1 96  ? 51.519 24.398 24.018  1.00 16.71 ? 101 VAL C O   1 
ATOM   2051 C CB  . VAL B 1 96  ? 51.705 21.470 23.192  1.00 22.23 ? 101 VAL C CB  1 
ATOM   2052 C CG1 . VAL B 1 96  ? 52.776 20.470 22.871  1.00 26.67 ? 101 VAL C CG1 1 
ATOM   2053 C CG2 . VAL B 1 96  ? 50.324 20.864 23.201  1.00 23.65 ? 101 VAL C CG2 1 
ATOM   2054 N N   . SER B 1 97  ? 50.245 23.390 25.549  1.00 16.67 ? 102 SER C N   1 
ATOM   2055 C CA  . SER B 1 97  ? 49.393 24.545 25.735  1.00 17.08 ? 102 SER C CA  1 
ATOM   2056 C C   . SER B 1 97  ? 48.631 24.427 27.053  1.00 17.47 ? 102 SER C C   1 
ATOM   2057 O O   . SER B 1 97  ? 48.606 23.385 27.674  1.00 17.10 ? 102 SER C O   1 
ATOM   2058 C CB  . SER B 1 97  ? 48.433 24.717 24.604  1.00 18.56 ? 102 SER C CB  1 
ATOM   2059 O OG  . SER B 1 97  ? 47.507 23.693 24.550  1.00 20.85 ? 102 SER C OG  1 
ATOM   2060 N N   . VAL B 1 98  ? 48.078 25.545 27.460  1.00 18.28 ? 103 VAL C N   1 
ATOM   2061 C CA  . VAL B 1 98  ? 47.134 25.625 28.564  1.00 16.48 ? 103 VAL C CA  1 
ATOM   2062 C C   . VAL B 1 98  ? 45.874 26.267 28.014  1.00 17.85 ? 103 VAL C C   1 
ATOM   2063 O O   . VAL B 1 98  ? 45.916 27.364 27.445  1.00 16.77 ? 103 VAL C O   1 
ATOM   2064 C CB  . VAL B 1 98  ? 47.636 26.457 29.767  1.00 16.91 ? 103 VAL C CB  1 
ATOM   2065 C CG1 . VAL B 1 98  ? 46.676 26.288 30.929  1.00 18.10 ? 103 VAL C CG1 1 
ATOM   2066 C CG2 . VAL B 1 98  ? 49.023 26.043 30.141  1.00 17.83 ? 103 VAL C CG2 1 
ATOM   2067 N N   . VAL B 1 99  ? 44.772 25.519 28.098  1.00 19.31 ? 104 VAL C N   1 
ATOM   2068 C CA  . VAL B 1 99  ? 43.457 25.984 27.697  1.00 20.15 ? 104 VAL C CA  1 
ATOM   2069 C C   . VAL B 1 99  ? 42.622 26.379 28.908  1.00 20.07 ? 104 VAL C C   1 
ATOM   2070 O O   . VAL B 1 99  ? 42.369 25.562 29.769  1.00 19.35 ? 104 VAL C O   1 
ATOM   2071 C CB  . VAL B 1 99  ? 42.747 24.935 26.810  1.00 22.26 ? 104 VAL C CB  1 
ATOM   2072 C CG1 . VAL B 1 99  ? 41.415 25.427 26.317  1.00 24.21 ? 104 VAL C CG1 1 
ATOM   2073 C CG2 . VAL B 1 99  ? 43.667 24.576 25.663  1.00 24.61 ? 104 VAL C CG2 1 
ATOM   2074 N N   . GLY B 1 100 ? 42.234 27.637 28.991  1.00 20.49 ? 105 GLY C N   1 
ATOM   2075 C CA  . GLY B 1 100 ? 41.627 28.182 30.166  1.00 21.64 ? 105 GLY C CA  1 
ATOM   2076 C C   . GLY B 1 100 ? 40.906 29.496 30.047  1.00 21.75 ? 105 GLY C C   1 
ATOM   2077 O O   . GLY B 1 100 ? 40.396 29.797 28.983  1.00 19.87 ? 105 GLY C O   1 
ATOM   2078 N N   . ASN B 1 101 ? 40.776 30.204 31.174  1.00 19.61 ? 106 ASN C N   1 
ATOM   2079 C CA  . ASN B 1 101 ? 40.015 31.431 31.240  1.00 20.42 ? 106 ASN C CA  1 
ATOM   2080 C C   . ASN B 1 101 ? 40.782 32.463 32.057  1.00 16.98 ? 106 ASN C C   1 
ATOM   2081 O O   . ASN B 1 101 ? 41.278 32.106 33.136  1.00 18.37 ? 106 ASN C O   1 
ATOM   2082 C CB  . ASN B 1 101 ? 38.695 31.149 31.898  1.00 21.85 ? 106 ASN C CB  1 
ATOM   2083 C CG  . ASN B 1 101 ? 37.775 30.369 30.978  1.00 25.76 ? 106 ASN C CG  1 
ATOM   2084 O OD1 . ASN B 1 101 ? 37.239 30.913 30.038  1.00 28.10 ? 106 ASN C OD1 1 
ATOM   2085 N ND2 . ASN B 1 101 ? 37.618 29.104 31.255  1.00 28.40 ? 106 ASN C ND2 1 
ATOM   2086 N N   . LEU B 1 102 ? 40.782 33.675 31.577  1.00 16.87 ? 107 LEU C N   1 
ATOM   2087 C CA  . LEU B 1 102 ? 41.395 34.816 32.202  1.00 16.41 ? 107 LEU C CA  1 
ATOM   2088 C C   . LEU B 1 102 ? 40.280 35.616 32.767  1.00 17.12 ? 107 LEU C C   1 
ATOM   2089 O O   . LEU B 1 102 ? 39.332 35.951 32.022  1.00 17.54 ? 107 LEU C O   1 
ATOM   2090 C CB  . LEU B 1 102 ? 42.179 35.666 31.234  1.00 16.26 ? 107 LEU C CB  1 
ATOM   2091 C CG  . LEU B 1 102 ? 42.874 36.906 31.741  1.00 17.00 ? 107 LEU C CG  1 
ATOM   2092 C CD1 . LEU B 1 102 ? 43.871 36.553 32.825  1.00 19.33 ? 107 LEU C CD1 1 
ATOM   2093 C CD2 . LEU B 1 102 ? 43.519 37.652 30.633  1.00 18.46 ? 107 LEU C CD2 1 
ATOM   2094 N N   . THR B 1 103 ? 40.381 35.935 34.041  1.00 17.78 ? 108 THR C N   1 
ATOM   2095 C CA  . THR B 1 103 ? 39.536 36.951 34.681  1.00 17.61 ? 108 THR C CA  1 
ATOM   2096 C C   . THR B 1 103 ? 40.359 38.199 34.883  1.00 17.94 ? 108 THR C C   1 
ATOM   2097 O O   . THR B 1 103 ? 41.392 38.186 35.573  1.00 16.56 ? 108 THR C O   1 
ATOM   2098 C CB  . THR B 1 103 ? 39.013 36.407 36.014  1.00 18.57 ? 108 THR C CB  1 
ATOM   2099 O OG1 . THR B 1 103 ? 38.295 35.192 35.761  1.00 20.71 ? 108 THR C OG1 1 
ATOM   2100 C CG2 . THR B 1 103 ? 38.082 37.449 36.732  1.00 20.70 ? 108 THR C CG2 1 
ATOM   2101 N N   . LEU B 1 104 ? 39.919 39.308 34.306  1.00 16.26 ? 109 LEU C N   1 
ATOM   2102 C CA  . LEU B 1 104 ? 40.610 40.541 34.322  1.00 16.29 ? 109 LEU C CA  1 
ATOM   2103 C C   . LEU B 1 104 ? 39.646 41.689 34.264  1.00 17.00 ? 109 LEU C C   1 
ATOM   2104 O O   . LEU B 1 104 ? 38.760 41.656 33.370  1.00 17.53 ? 109 LEU C O   1 
ATOM   2105 C CB  . LEU B 1 104 ? 41.516 40.620 33.111  1.00 16.09 ? 109 LEU C CB  1 
ATOM   2106 C CG  . LEU B 1 104 ? 42.217 41.902 32.819  1.00 16.81 ? 109 LEU C CG  1 
ATOM   2107 C CD1 . LEU B 1 104 ? 43.240 42.245 33.934  1.00 18.06 ? 109 LEU C CD1 1 
ATOM   2108 C CD2 . LEU B 1 104 ? 42.943 41.796 31.469  1.00 17.56 ? 109 LEU C CD2 1 
ATOM   2109 N N   . HIS B 1 105 ? 39.707 42.630 35.207  1.00 19.14 ? 110 HIS C N   1 
ATOM   2110 C CA  . HIS B 1 105 ? 38.800 43.814 35.146  1.00 19.21 ? 110 HIS C CA  1 
ATOM   2111 C C   . HIS B 1 105 ? 37.293 43.437 35.206  1.00 20.52 ? 110 HIS C C   1 
ATOM   2112 O O   . HIS B 1 105 ? 36.474 44.060 34.520  1.00 21.14 ? 110 HIS C O   1 
ATOM   2113 C CB  . HIS B 1 105 ? 39.060 44.661 33.886  1.00 20.89 ? 110 HIS C CB  1 
ATOM   2114 C CG  . HIS B 1 105 ? 38.415 45.995 33.896  1.00 18.55 ? 110 HIS C CG  1 
ATOM   2115 N ND1 . HIS B 1 105 ? 37.544 46.361 32.906  1.00 21.12 ? 110 HIS C ND1 1 
ATOM   2116 C CD2 . HIS B 1 105 ? 38.598 47.092 34.664  1.00 19.39 ? 110 HIS C CD2 1 
ATOM   2117 C CE1 . HIS B 1 105 ? 37.085 47.574 33.148  1.00 20.90 ? 110 HIS C CE1 1 
ATOM   2118 N NE2 . HIS B 1 105 ? 37.746 48.061 34.187  1.00 22.81 ? 110 HIS C NE2 1 
ATOM   2119 N N   . GLY B 1 106 ? 36.962 42.424 36.013  1.00 22.98 ? 111 GLY C N   1 
ATOM   2120 C CA  . GLY B 1 106 ? 35.578 41.984 36.170  1.00 24.32 ? 111 GLY C CA  1 
ATOM   2121 C C   . GLY B 1 106 ? 35.046 41.139 35.041  1.00 24.23 ? 111 GLY C C   1 
ATOM   2122 O O   . GLY B 1 106 ? 33.808 40.841 34.981  1.00 25.50 ? 111 GLY C O   1 
ATOM   2123 N N   . VAL B 1 107 ? 35.895 40.737 34.095  1.00 19.95 ? 112 VAL C N   1 
ATOM   2124 C CA  . VAL B 1 107 ? 35.447 40.033 32.913  1.00 20.00 ? 112 VAL C CA  1 
ATOM   2125 C C   . VAL B 1 107 ? 36.202 38.743 32.806  1.00 20.31 ? 112 VAL C C   1 
ATOM   2126 O O   . VAL B 1 107 ? 37.424 38.778 32.903  1.00 17.88 ? 112 VAL C O   1 
ATOM   2127 C CB  . VAL B 1 107 ? 35.653 40.825 31.635  1.00 21.36 ? 112 VAL C CB  1 
ATOM   2128 C CG1 . VAL B 1 107 ? 35.266 40.005 30.399  1.00 20.37 ? 112 VAL C CG1 1 
ATOM   2129 C CG2 . VAL B 1 107 ? 34.886 42.163 31.744  1.00 22.64 ? 112 VAL C CG2 1 
ATOM   2130 N N   . THR B 1 108 ? 35.473 37.641 32.587  1.00 19.86 ? 113 THR C N   1 
ATOM   2131 C CA  . THR B 1 108 ? 36.105 36.288 32.469  1.00 19.72 ? 113 THR C CA  1 
ATOM   2132 C C   . THR B 1 108 ? 35.930 35.843 31.058  1.00 21.24 ? 113 THR C C   1 
ATOM   2133 O O   . THR B 1 108 ? 34.747 35.713 30.551  1.00 23.39 ? 113 THR C O   1 
ATOM   2134 C CB  . THR B 1 108 ? 35.608 35.241 33.442  1.00 21.11 ? 113 THR C CB  1 
ATOM   2135 O OG1 . THR B 1 108 ? 35.937 35.673 34.734  1.00 22.95 ? 113 THR C OG1 1 
ATOM   2136 C CG2 . THR B 1 108 ? 36.245 33.838 33.174  1.00 23.57 ? 113 THR C CG2 1 
ATOM   2137 N N   . LYS B 1 109 ? 37.017 35.568 30.354  1.00 21.02 ? 114 LYS C N   1 
ATOM   2138 C CA  . LYS B 1 109 ? 36.980 35.125 28.939  1.00 20.12 ? 114 LYS C CA  1 
ATOM   2139 C C   . LYS B 1 109 ? 37.991 34.061 28.647  1.00 20.23 ? 114 LYS C C   1 
ATOM   2140 O O   . LYS B 1 109 ? 39.087 34.003 29.306  1.00 17.79 ? 114 LYS C O   1 
ATOM   2141 C CB  . LYS B 1 109 ? 37.163 36.320 28.010  1.00 22.98 ? 114 LYS C CB  1 
ATOM   2142 C CG  . LYS B 1 109 ? 35.886 37.195 28.046  1.00 26.80 ? 114 LYS C CG  1 
ATOM   2143 C CD  . LYS B 1 109 ? 35.702 38.146 26.905  1.00 27.80 ? 114 LYS C CD  1 
ATOM   2144 C CE  . LYS B 1 109 ? 34.372 38.974 26.939  1.00 26.99 ? 114 LYS C CE  1 
ATOM   2145 N NZ  . LYS B 1 109 ? 34.251 40.188 26.026  1.00 23.72 ? 114 LYS C NZ  1 
ATOM   2146 N N   . PRO B 1 110 ? 37.756 33.206 27.697  1.00 18.77 ? 115 PRO C N   1 
ATOM   2147 C CA  . PRO B 1 110 ? 38.720 32.194 27.264  1.00 18.52 ? 115 PRO C CA  1 
ATOM   2148 C C   . PRO B 1 110 ? 40.064 32.701 26.789  1.00 18.08 ? 115 PRO C C   1 
ATOM   2149 O O   . PRO B 1 110 ? 40.162 33.762 26.170  1.00 18.24 ? 115 PRO C O   1 
ATOM   2150 C CB  . PRO B 1 110 ? 38.015 31.480 26.112  1.00 22.10 ? 115 PRO C CB  1 
ATOM   2151 C CG  . PRO B 1 110 ? 36.610 31.781 26.310  1.00 23.75 ? 115 PRO C CG  1 
ATOM   2152 C CD  . PRO B 1 110 ? 36.562 33.179 26.792  1.00 22.02 ? 115 PRO C CD  1 
ATOM   2153 N N   . LEU B 1 111 ? 41.132 32.050 27.301  1.00 17.86 ? 116 LEU C N   1 
ATOM   2154 C CA  . LEU B 1 111 ? 42.540 32.336 26.881  1.00 17.39 ? 116 LEU C CA  1 
ATOM   2155 C C   . LEU B 1 111 ? 43.370 31.110 26.843  1.00 19.71 ? 116 LEU C C   1 
ATOM   2156 O O   . LEU B 1 111 ? 43.385 30.320 27.816  1.00 19.73 ? 116 LEU C O   1 
ATOM   2157 C CB  . LEU B 1 111 ? 43.194 33.378 27.821  1.00 17.79 ? 116 LEU C CB  1 
ATOM   2158 C CG  . LEU B 1 111 ? 44.686 33.631 27.559  1.00 19.09 ? 116 LEU C CG  1 
ATOM   2159 C CD1 . LEU B 1 111 ? 44.994 34.305 26.227  1.00 20.92 ? 116 LEU C CD1 1 
ATOM   2160 C CD2 . LEU B 1 111 ? 45.148 34.510 28.713  1.00 19.25 ? 116 LEU C CD2 1 
ATOM   2161 N N   . THR B 1 112 ? 44.063 30.900 25.699  1.00 17.85 ? 117 THR C N   1 
ATOM   2162 C CA  . THR B 1 112 ? 44.895 29.737 25.537  1.00 18.20 ? 117 THR C CA  1 
ATOM   2163 C C   . THR B 1 112 ? 46.329 30.227 25.571  1.00 18.84 ? 117 THR C C   1 
ATOM   2164 O O   . THR B 1 112 ? 46.631 31.283 24.994  1.00 22.40 ? 117 THR C O   1 
ATOM   2165 C CB  . THR B 1 112 ? 44.532 28.983 24.225  1.00 21.79 ? 117 THR C CB  1 
ATOM   2166 O OG1 . THR B 1 112 ? 43.295 28.309 24.437  1.00 22.49 ? 117 THR C OG1 1 
ATOM   2167 C CG2 . THR B 1 112 ? 45.575 27.970 23.865  1.00 21.30 ? 117 THR C CG2 1 
ATOM   2168 N N   . LEU B 1 113 ? 47.173 29.584 26.399  1.00 18.87 ? 118 LEU C N   1 
ATOM   2169 C CA  . LEU B 1 113 ? 48.631 29.887 26.382  1.00 17.80 ? 118 LEU C CA  1 
ATOM   2170 C C   . LEU B 1 113 ? 49.370 28.796 25.684  1.00 19.97 ? 118 LEU C C   1 
ATOM   2171 O O   . LEU B 1 113 ? 49.161 27.635 26.053  1.00 23.94 ? 118 LEU C O   1 
ATOM   2172 C CB  . LEU B 1 113 ? 49.213 30.058 27.787  1.00 18.31 ? 118 LEU C CB  1 
ATOM   2173 C CG  . LEU B 1 113 ? 48.454 31.060 28.690  1.00 19.88 ? 118 LEU C CG  1 
ATOM   2174 C CD1 . LEU B 1 113 ? 49.048 30.961 30.080  1.00 21.57 ? 118 LEU C CD1 1 
ATOM   2175 C CD2 . LEU B 1 113 ? 48.583 32.434 28.191  1.00 20.53 ? 118 LEU C CD2 1 
ATOM   2176 N N   . LYS B 1 114 ? 50.266 29.144 24.749  1.00 18.23 ? 119 LYS C N   1 
ATOM   2177 C CA  . LYS B 1 114 ? 51.125 28.179 24.075  1.00 18.50 ? 119 LYS C CA  1 
ATOM   2178 C C   . LYS B 1 114 ? 52.400 27.963 24.875  1.00 17.54 ? 119 LYS C C   1 
ATOM   2179 O O   . LYS B 1 114 ? 53.050 28.938 25.243  1.00 17.61 ? 119 LYS C O   1 
ATOM   2180 C CB  . LYS B 1 114 ? 51.466 28.681 22.660  1.00 20.67 ? 119 LYS C CB  1 
ATOM   2181 C CG  . LYS B 1 114 ? 50.266 28.508 21.708  1.00 29.06 ? 119 LYS C CG  1 
ATOM   2182 C CD  . LYS B 1 114 ? 50.009 27.018 21.435  1.00 35.48 ? 119 LYS C CD  1 
ATOM   2183 C CE  . LYS B 1 114 ? 48.891 26.767 20.418  1.00 41.54 ? 119 LYS C CE  1 
ATOM   2184 N NZ  . LYS B 1 114 ? 47.631 26.390 21.118  1.00 40.95 ? 119 LYS C NZ  1 
ATOM   2185 N N   . ILE B 1 115 ? 52.775 26.743 25.142  1.00 16.72 ? 120 ILE C N   1 
ATOM   2186 C CA  . ILE B 1 115 ? 53.981 26.482 25.913  1.00 17.79 ? 120 ILE C CA  1 
ATOM   2187 C C   . ILE B 1 115 ? 55.109 26.351 24.910  1.00 19.02 ? 120 ILE C C   1 
ATOM   2188 O O   . ILE B 1 115 ? 55.126 25.400 24.070  1.00 21.89 ? 120 ILE C O   1 
ATOM   2189 C CB  . ILE B 1 115 ? 53.858 25.226 26.727  1.00 17.95 ? 120 ILE C CB  1 
ATOM   2190 C CG1 . ILE B 1 115 ? 52.838 25.485 27.828  1.00 17.73 ? 120 ILE C CG1 1 
ATOM   2191 C CG2 . ILE B 1 115 ? 55.213 24.813 27.310  1.00 19.66 ? 120 ILE C CG2 1 
ATOM   2192 C CD1 . ILE B 1 115 ? 52.343 24.328 28.600  1.00 21.32 ? 120 ILE C CD1 1 
ATOM   2193 N N   . ASP B 1 116 ? 56.040 27.297 24.930  1.00 18.30 ? 121 ASP C N   1 
ATOM   2194 C CA  . ASP B 1 116 ? 57.205 27.265 24.033  1.00 22.21 ? 121 ASP C CA  1 
ATOM   2195 C C   . ASP B 1 116 ? 58.354 26.446 24.557  1.00 23.91 ? 121 ASP C C   1 
ATOM   2196 O O   . ASP B 1 116 ? 59.163 25.870 23.781  1.00 24.30 ? 121 ASP C O   1 
ATOM   2197 C CB  . ASP B 1 116 ? 57.673 28.654 23.705  1.00 23.93 ? 121 ASP C CB  1 
ATOM   2198 C CG  . ASP B 1 116 ? 56.711 29.370 22.723  1.00 30.36 ? 121 ASP C CG  1 
ATOM   2199 O OD1 . ASP B 1 116 ? 55.807 28.721 22.148  1.00 34.89 ? 121 ASP C OD1 1 
ATOM   2200 O OD2 . ASP B 1 116 ? 56.825 30.589 22.560  1.00 38.03 ? 121 ASP C OD2 1 
ATOM   2201 N N   . SER B 1 117 ? 58.516 26.408 25.857  1.00 19.26 ? 122 SER C N   1 
ATOM   2202 C CA  . SER B 1 117 ? 59.534 25.515 26.498  1.00 21.94 ? 122 SER C CA  1 
ATOM   2203 C C   . SER B 1 117 ? 59.015 25.020 27.859  1.00 20.04 ? 122 SER C C   1 
ATOM   2204 O O   . SER B 1 117 ? 58.175 25.651 28.512  1.00 17.71 ? 122 SER C O   1 
ATOM   2205 C CB  . SER B 1 117 ? 60.840 26.218 26.671  1.00 24.89 ? 122 SER C CB  1 
ATOM   2206 O OG  . SER B 1 117 ? 60.713 27.245 27.606  1.00 28.04 ? 122 SER C OG  1 
ATOM   2207 N N   . PHE B 1 118 ? 59.376 23.799 28.168  1.00 21.32 ? 123 PHE C N   1 
ATOM   2208 C CA  . PHE B 1 118 ? 59.013 23.115 29.371  1.00 20.90 ? 123 PHE C CA  1 
ATOM   2209 C C   . PHE B 1 118 ? 60.158 22.241 29.789  1.00 20.31 ? 123 PHE C C   1 
ATOM   2210 O O   . PHE B 1 118 ? 60.724 21.464 28.975  1.00 21.93 ? 123 PHE C O   1 
ATOM   2211 C CB  . PHE B 1 118 ? 57.745 22.294 29.155  1.00 22.11 ? 123 PHE C CB  1 
ATOM   2212 C CG  . PHE B 1 118 ? 57.395 21.414 30.273  1.00 25.15 ? 123 PHE C CG  1 
ATOM   2213 C CD1 . PHE B 1 118 ? 57.983 20.160 30.363  1.00 27.92 ? 123 PHE C CD1 1 
ATOM   2214 C CD2 . PHE B 1 118 ? 56.456 21.813 31.224  1.00 28.88 ? 123 PHE C CD2 1 
ATOM   2215 C CE1 . PHE B 1 118 ? 57.682 19.321 31.452  1.00 32.11 ? 123 PHE C CE1 1 
ATOM   2216 C CE2 . PHE B 1 118 ? 56.146 20.966 32.320  1.00 29.16 ? 123 PHE C CE2 1 
ATOM   2217 C CZ  . PHE B 1 118 ? 56.730 19.707 32.392  1.00 29.70 ? 123 PHE C CZ  1 
ATOM   2218 N N   . LYS B 1 119 ? 60.545 22.341 31.072  1.00 20.34 ? 124 LYS C N   1 
ATOM   2219 C CA  . LYS B 1 119 ? 61.673 21.602 31.588  1.00 21.53 ? 124 LYS C CA  1 
ATOM   2220 C C   . LYS B 1 119 ? 61.386 21.292 33.020  1.00 20.69 ? 124 LYS C C   1 
ATOM   2221 O O   . LYS B 1 119 ? 60.920 22.190 33.795  1.00 21.03 ? 124 LYS C O   1 
ATOM   2222 C CB  . LYS B 1 119 ? 62.980 22.426 31.437  1.00 22.81 ? 124 LYS C CB  1 
ATOM   2223 C CG  . LYS B 1 119 ? 64.218 21.789 31.977  1.00 24.59 ? 124 LYS C CG  1 
ATOM   2224 C CD  . LYS B 1 119 ? 65.417 22.693 32.027  1.00 27.41 ? 124 LYS C CD  1 
ATOM   2225 C CE  . LYS B 1 119 ? 66.729 21.943 32.115  1.00 29.90 ? 124 LYS C CE  1 
ATOM   2226 N NZ  . LYS B 1 119 ? 67.930 22.822 32.332  1.00 32.36 ? 124 LYS C NZ  1 
ATOM   2227 N N   . CYS B 1 120 ? 61.618 20.054 33.436  1.00 21.12 ? 125 CYS C N   1 
ATOM   2228 C CA  . CYS B 1 120 ? 61.576 19.725 34.839  1.00 23.45 ? 125 CYS C CA  1 
ATOM   2229 C C   . CYS B 1 120 ? 62.955 19.157 35.235  1.00 21.73 ? 125 CYS C C   1 
ATOM   2230 O O   . CYS B 1 120 ? 63.573 18.479 34.426  1.00 23.77 ? 125 CYS C O   1 
ATOM   2231 C CB  . CYS B 1 120 ? 60.464 18.747 35.202  1.00 26.32 ? 125 CYS C CB  1 
ATOM   2232 S SG  . CYS B 1 120 ? 58.707 19.214 35.040  1.00 34.20 ? 125 CYS C SG  1 
ATOM   2233 N N   . MET B 1 121 ? 63.467 19.526 36.395  1.00 22.17 ? 126 MET C N   1 
ATOM   2234 C CA  . MET B 1 121 ? 64.808 19.145 36.788  1.00 22.78 ? 126 MET C CA  1 
ATOM   2235 C C   . MET B 1 121 ? 64.889 19.143 38.303  1.00 22.74 ? 126 MET C C   1 
ATOM   2236 O O   . MET B 1 121 ? 64.083 19.818 38.998  1.00 20.25 ? 126 MET C O   1 
ATOM   2237 C CB  . MET B 1 121 ? 65.842 20.082 36.161  1.00 24.40 ? 126 MET C CB  1 
ATOM   2238 C CG  . MET B 1 121 ? 65.784 21.528 36.716  1.00 27.20 ? 126 MET C CG  1 
ATOM   2239 S SD  . MET B 1 121 ? 66.939 22.768 35.985  1.00 30.78 ? 126 MET C SD  1 
ATOM   2240 C CE  . MET B 1 121 ? 68.496 22.089 36.551  1.00 34.92 ? 126 MET C CE  1 
ATOM   2241 N N   . PRO B 1 122 ? 65.773 18.319 38.858  1.00 23.40 ? 127 PRO C N   1 
ATOM   2242 C CA  . PRO B 1 122 ? 66.133 18.549 40.241  1.00 24.45 ? 127 PRO C CA  1 
ATOM   2243 C C   . PRO B 1 122 ? 66.909 19.873 40.328  1.00 24.95 ? 127 PRO C C   1 
ATOM   2244 O O   . PRO B 1 122 ? 67.854 20.101 39.630  1.00 29.04 ? 127 PRO C O   1 
ATOM   2245 C CB  . PRO B 1 122 ? 67.045 17.374 40.562  1.00 26.39 ? 127 PRO C CB  1 
ATOM   2246 C CG  . PRO B 1 122 ? 67.090 16.516 39.319  1.00 26.93 ? 127 PRO C CG  1 
ATOM   2247 C CD  . PRO B 1 122 ? 66.664 17.351 38.176  1.00 26.66 ? 127 PRO C CD  1 
ATOM   2248 N N   . HIS B 1 123 ? 66.475 20.752 41.209  1.00 24.20 ? 128 HIS C N   1 
ATOM   2249 C CA  . HIS B 1 123 ? 67.097 22.011 41.371  1.00 23.25 ? 128 HIS C CA  1 
ATOM   2250 C C   . HIS B 1 123 ? 68.408 21.776 42.130  1.00 27.29 ? 128 HIS C C   1 
ATOM   2251 O O   . HIS B 1 123 ? 68.414 21.081 43.129  1.00 25.02 ? 128 HIS C O   1 
ATOM   2252 C CB  . HIS B 1 123 ? 66.148 22.895 42.170  1.00 24.12 ? 128 HIS C CB  1 
ATOM   2253 C CG  . HIS B 1 123 ? 66.568 24.317 42.188  1.00 24.43 ? 128 HIS C CG  1 
ATOM   2254 N ND1 . HIS B 1 123 ? 67.719 24.726 42.805  1.00 25.12 ? 128 HIS C ND1 1 
ATOM   2255 C CD2 . HIS B 1 123 ? 66.010 25.434 41.656  1.00 28.00 ? 128 HIS C CD2 1 
ATOM   2256 C CE1 . HIS B 1 123 ? 67.880 26.030 42.629  1.00 26.10 ? 128 HIS C CE1 1 
ATOM   2257 N NE2 . HIS B 1 123 ? 66.838 26.489 41.970  1.00 26.48 ? 128 HIS C NE2 1 
ATOM   2258 N N   . PRO B 1 124 ? 69.546 22.259 41.609  1.00 29.98 ? 129 PRO C N   1 
ATOM   2259 C CA  . PRO B 1 124 ? 70.771 21.818 42.308  1.00 33.76 ? 129 PRO C CA  1 
ATOM   2260 C C   . PRO B 1 124 ? 70.997 22.330 43.749  1.00 33.58 ? 129 PRO C C   1 
ATOM   2261 O O   . PRO B 1 124 ? 71.748 21.733 44.561  1.00 33.67 ? 129 PRO C O   1 
ATOM   2262 C CB  . PRO B 1 124 ? 71.910 22.302 41.372  1.00 35.65 ? 129 PRO C CB  1 
ATOM   2263 C CG  . PRO B 1 124 ? 71.281 23.316 40.475  1.00 33.28 ? 129 PRO C CG  1 
ATOM   2264 C CD  . PRO B 1 124 ? 69.834 22.944 40.328  1.00 32.70 ? 129 PRO C CD  1 
ATOM   2265 N N   . MET B 1 125 ? 70.317 23.427 44.076  1.00 29.79 ? 130 MET C N   1 
ATOM   2266 C CA  . MET B 1 125 ? 70.530 24.047 45.360  1.00 30.08 ? 130 MET C CA  1 
ATOM   2267 C C   . MET B 1 125 ? 69.337 23.758 46.262  1.00 26.11 ? 130 MET C C   1 
ATOM   2268 O O   . MET B 1 125 ? 69.517 23.544 47.440  1.00 28.14 ? 130 MET C O   1 
ATOM   2269 C CB  . MET B 1 125 ? 70.692 25.540 45.147  1.00 33.26 ? 130 MET C CB  1 
ATOM   2270 C CG  . MET B 1 125 ? 71.764 25.809 44.076  1.00 41.18 ? 130 MET C CG  1 
ATOM   2271 S SD  . MET B 1 125 ? 71.916 27.551 43.750  1.00 56.45 ? 130 MET C SD  1 
ATOM   2272 C CE  . MET B 1 125 ? 73.017 27.354 42.357  1.00 51.23 ? 130 MET C CE  1 
ATOM   2273 N N   . LEU B 1 126 ? 68.119 23.720 45.702  1.00 25.17 ? 131 LEU C N   1 
ATOM   2274 C CA  . LEU B 1 126 ? 66.931 23.403 46.524  1.00 24.03 ? 131 LEU C CA  1 
ATOM   2275 C C   . LEU B 1 126 ? 66.802 21.923 46.793  1.00 26.88 ? 131 LEU C C   1 
ATOM   2276 O O   . LEU B 1 126 ? 66.133 21.546 47.724  1.00 27.33 ? 131 LEU C O   1 
ATOM   2277 C CB  . LEU B 1 126 ? 65.634 23.968 45.891  1.00 24.08 ? 131 LEU C CB  1 
ATOM   2278 C CG  . LEU B 1 126 ? 65.616 25.472 45.716  1.00 23.07 ? 131 LEU C CG  1 
ATOM   2279 C CD1 . LEU B 1 126 ? 64.405 25.787 44.874  1.00 23.83 ? 131 LEU C CD1 1 
ATOM   2280 C CD2 . LEU B 1 126 ? 65.564 26.210 47.096  1.00 21.81 ? 131 LEU C CD2 1 
ATOM   2281 N N   . LYS B 1 127 ? 67.441 21.086 45.995  1.00 28.01 ? 132 LYS C N   1 
ATOM   2282 C CA  . LYS B 1 127 ? 67.365 19.628 46.184  1.00 30.80 ? 132 LYS C CA  1 
ATOM   2283 C C   . LYS B 1 127 ? 65.877 19.205 46.183  1.00 33.56 ? 132 LYS C C   1 
ATOM   2284 O O   . LYS B 1 127 ? 65.422 18.381 46.988  1.00 36.21 ? 132 LYS C O   1 
ATOM   2285 C CB  . LYS B 1 127 ? 68.137 19.196 47.444  1.00 35.41 ? 132 LYS C CB  1 
ATOM   2286 C CG  . LYS B 1 127 ? 69.662 19.420 47.381  1.00 43.43 ? 132 LYS C CG  1 
ATOM   2287 C CD  . LYS B 1 127 ? 70.393 18.625 48.466  1.00 48.47 ? 132 LYS C CD  1 
ATOM   2288 C CE  . LYS B 1 127 ? 71.911 18.666 48.343  1.00 54.05 ? 132 LYS C CE  1 
ATOM   2289 N NZ  . LYS B 1 127 ? 72.496 19.888 48.970  1.00 53.51 ? 132 LYS C NZ  1 
ATOM   2290 N N   . ARG B 1 128 ? 65.118 19.782 45.238  1.00 30.48 ? 133 ARG C N   1 
ATOM   2291 C CA  . ARG B 1 128 ? 63.713 19.552 45.079  1.00 27.71 ? 133 ARG C CA  1 
ATOM   2292 C C   . ARG B 1 128 ? 63.401 19.704 43.590  1.00 24.49 ? 133 ARG C C   1 
ATOM   2293 O O   . ARG B 1 128 ? 64.156 20.432 42.915  1.00 25.77 ? 133 ARG C O   1 
ATOM   2294 C CB  . ARG B 1 128 ? 62.931 20.641 45.779  1.00 32.97 ? 133 ARG C CB  1 
ATOM   2295 C CG  . ARG B 1 128 ? 62.872 20.445 47.269  1.00 37.47 ? 133 ARG C CG  1 
ATOM   2296 C CD  . ARG B 1 128 ? 61.529 20.851 47.789  1.00 39.83 ? 133 ARG C CD  1 
ATOM   2297 N NE  . ARG B 1 128 ? 61.460 22.201 48.278  1.00 36.00 ? 133 ARG C NE  1 
ATOM   2298 C CZ  . ARG B 1 128 ? 60.312 22.845 48.520  1.00 38.61 ? 133 ARG C CZ  1 
ATOM   2299 N NH1 . ARG B 1 128 ? 59.116 22.328 48.255  1.00 39.97 ? 133 ARG C NH1 1 
ATOM   2300 N NH2 . ARG B 1 128 ? 60.362 24.038 49.030  1.00 39.68 ? 133 ARG C NH2 1 
ATOM   2301 N N   . GLU B 1 129 ? 62.352 19.038 43.103  1.00 24.00 ? 134 GLU C N   1 
ATOM   2302 C CA  . GLU B 1 129 ? 62.037 19.107 41.644  1.00 23.21 ? 134 GLU C CA  1 
ATOM   2303 C C   . GLU B 1 129 ? 61.422 20.460 41.387  1.00 19.89 ? 134 GLU C C   1 
ATOM   2304 O O   . GLU B 1 129 ? 60.567 20.924 42.159  1.00 19.64 ? 134 GLU C O   1 
ATOM   2305 C CB  . GLU B 1 129 ? 61.020 18.060 41.150  1.00 26.97 ? 134 GLU C CB  1 
ATOM   2306 C CG  . GLU B 1 129 ? 60.926 18.118 39.650  1.00 33.39 ? 134 GLU C CG  1 
ATOM   2307 C CD  . GLU B 1 129 ? 60.124 17.008 39.024  1.00 42.19 ? 134 GLU C CD  1 
ATOM   2308 O OE1 . GLU B 1 129 ? 58.928 16.798 39.385  1.00 43.78 ? 134 GLU C OE1 1 
ATOM   2309 O OE2 . GLU B 1 129 ? 60.716 16.378 38.127  1.00 46.51 ? 134 GLU C OE2 1 
ATOM   2310 N N   . VAL B 1 130 ? 61.853 21.032 40.301  1.00 19.51 ? 135 VAL C N   1 
ATOM   2311 C CA  . VAL B 1 130 ? 61.285 22.354 39.847  1.00 19.19 ? 135 VAL C CA  1 
ATOM   2312 C C   . VAL B 1 130 ? 60.919 22.187 38.395  1.00 20.85 ? 135 VAL C C   1 
ATOM   2313 O O   . VAL B 1 130 ? 61.710 21.568 37.632  1.00 19.99 ? 135 VAL C O   1 
ATOM   2314 C CB  . VAL B 1 130 ? 62.304 23.474 39.999  1.00 20.12 ? 135 VAL C CB  1 
ATOM   2315 C CG1 . VAL B 1 130 ? 63.571 23.221 39.187  1.00 22.06 ? 135 VAL C CG1 1 
ATOM   2316 C CG2 . VAL B 1 130 ? 61.746 24.821 39.586  1.00 20.57 ? 135 VAL C CG2 1 
ATOM   2317 N N   . CYS B 1 131 ? 59.734 22.636 38.011  1.00 18.66 ? 136 CYS C N   1 
ATOM   2318 C CA  A CYS B 1 131 ? 59.358 22.666 36.615  0.50 19.37 ? 136 CYS C CA  1 
ATOM   2319 C CA  B CYS B 1 131 ? 59.334 22.657 36.604  0.50 19.59 ? 136 CYS C CA  1 
ATOM   2320 C C   . CYS B 1 131 ? 59.273 24.103 36.151  1.00 17.96 ? 136 CYS C C   1 
ATOM   2321 O O   . CYS B 1 131 ? 58.775 24.936 36.877  1.00 17.45 ? 136 CYS C O   1 
ATOM   2322 C CB  A CYS B 1 131 ? 58.057 21.948 36.377  0.50 22.68 ? 136 CYS C CB  1 
ATOM   2323 C CB  B CYS B 1 131 ? 57.970 22.041 36.334  0.50 23.06 ? 136 CYS C CB  1 
ATOM   2324 S SG  A CYS B 1 131 ? 58.315 20.207 36.816  0.50 29.83 ? 136 CYS C SG  1 
ATOM   2325 S SG  B CYS B 1 131 ? 57.833 20.271 36.664  0.50 31.53 ? 136 CYS C SG  1 
ATOM   2326 N N   . GLY B 1 132 ? 59.807 24.363 34.954  1.00 16.30 ? 137 GLY C N   1 
ATOM   2327 C CA  . GLY B 1 132 ? 59.840 25.701 34.359  1.00 14.87 ? 137 GLY C CA  1 
ATOM   2328 C C   . GLY B 1 132 ? 59.250 25.775 32.984  1.00 14.71 ? 137 GLY C C   1 
ATOM   2329 O O   . GLY B 1 132 ? 59.415 24.843 32.190  1.00 14.76 ? 137 GLY C O   1 
ATOM   2330 N N   . VAL B 1 133 ? 58.602 26.895 32.662  1.00 14.38 ? 138 VAL C N   1 
ATOM   2331 C CA  . VAL B 1 133 ? 57.962 27.109 31.376  1.00 16.10 ? 138 VAL C CA  1 
ATOM   2332 C C   . VAL B 1 133 ? 58.264 28.459 30.830  1.00 15.71 ? 138 VAL C C   1 
ATOM   2333 O O   . VAL B 1 133 ? 58.348 29.420 31.593  1.00 14.35 ? 138 VAL C O   1 
ATOM   2334 C CB  . VAL B 1 133 ? 56.491 26.835 31.411  1.00 19.99 ? 138 VAL C CB  1 
ATOM   2335 C CG1 . VAL B 1 133 ? 56.252 25.315 31.713  1.00 20.89 ? 138 VAL C CG1 1 
ATOM   2336 C CG2 . VAL B 1 133 ? 55.757 27.827 32.314  1.00 22.01 ? 138 VAL C CG2 1 
ATOM   2337 N N   . ASP B 1 134 ? 58.322 28.593 29.490  1.00 15.44 ? 139 ASP C N   1 
ATOM   2338 C CA  . ASP B 1 134 ? 58.114 29.862 28.861  1.00 15.93 ? 139 ASP C CA  1 
ATOM   2339 C C   . ASP B 1 134 ? 56.862 29.693 27.985  1.00 15.77 ? 139 ASP C C   1 
ATOM   2340 O O   . ASP B 1 134 ? 56.773 28.687 27.240  1.00 15.29 ? 139 ASP C O   1 
ATOM   2341 C CB  . ASP B 1 134 ? 59.295 30.287 28.013  1.00 18.99 ? 139 ASP C CB  1 
ATOM   2342 C CG  . ASP B 1 134 ? 59.273 31.787 27.747  1.00 22.98 ? 139 ASP C CG  1 
ATOM   2343 O OD1 . ASP B 1 134 ? 59.095 32.646 28.728  1.00 23.14 ? 139 ASP C OD1 1 
ATOM   2344 O OD2 . ASP B 1 134 ? 59.409 32.142 26.568  1.00 29.94 ? 139 ASP C OD2 1 
ATOM   2345 N N   . ALA B 1 135 ? 55.938 30.603 28.119  1.00 14.24 ? 140 ALA C N   1 
ATOM   2346 C CA  . ALA B 1 135 ? 54.660 30.479 27.413  1.00 14.73 ? 140 ALA C CA  1 
ATOM   2347 C C   . ALA B 1 135 ? 54.294 31.785 26.838  1.00 14.73 ? 140 ALA C C   1 
ATOM   2348 O O   . ALA B 1 135 ? 54.787 32.869 27.213  1.00 15.54 ? 140 ALA C O   1 
ATOM   2349 C CB  . ALA B 1 135 ? 53.565 29.980 28.324  1.00 15.86 ? 140 ALA C CB  1 
ATOM   2350 N N   . VAL B 1 136 ? 53.406 31.696 25.832  1.00 13.95 ? 141 VAL C N   1 
ATOM   2351 C CA  . VAL B 1 136 ? 52.964 32.927 25.138  1.00 15.52 ? 141 VAL C CA  1 
ATOM   2352 C C   . VAL B 1 136 ? 51.478 32.889 24.844  1.00 16.98 ? 141 VAL C C   1 
ATOM   2353 O O   . VAL B 1 136 ? 50.895 31.786 24.612  1.00 17.91 ? 141 VAL C O   1 
ATOM   2354 C CB  . VAL B 1 136 ? 53.747 33.152 23.816  1.00 18.43 ? 141 VAL C CB  1 
ATOM   2355 C CG1 . VAL B 1 136 ? 55.246 33.430 24.120  1.00 20.96 ? 141 VAL C CG1 1 
ATOM   2356 C CG2 . VAL B 1 136 ? 53.522 32.011 22.816  1.00 19.25 ? 141 VAL C CG2 1 
ATOM   2357 N N   . GLY B 1 137 ? 50.852 34.040 24.904  1.00 16.82 ? 142 GLY C N   1 
ATOM   2358 C CA  . GLY B 1 137 ? 49.435 34.094 24.505  1.00 18.46 ? 142 GLY C CA  1 
ATOM   2359 C C   . GLY B 1 137 ? 49.133 35.451 24.081  1.00 17.27 ? 142 GLY C C   1 
ATOM   2360 O O   . GLY B 1 137 ? 49.995 36.325 24.088  1.00 16.49 ? 142 GLY C O   1 
ATOM   2361 N N   . GLU B 1 138 ? 47.890 35.661 23.577  1.00 17.44 ? 143 GLU C N   1 
ATOM   2362 C CA  . GLU B 1 138 ? 47.499 37.007 23.055  1.00 21.02 ? 143 GLU C CA  1 
ATOM   2363 C C   . GLU B 1 138 ? 46.020 37.186 23.283  1.00 18.68 ? 143 GLU C C   1 
ATOM   2364 O O   . GLU B 1 138 ? 45.234 36.195 23.243  1.00 20.29 ? 143 GLU C O   1 
ATOM   2365 C CB  . GLU B 1 138 ? 47.650 37.230 21.523  1.00 26.68 ? 143 GLU C CB  1 
ATOM   2366 C CG  . GLU B 1 138 ? 49.004 37.041 20.940  1.00 37.90 ? 143 GLU C CG  1 
ATOM   2367 C CD  . GLU B 1 138 ? 48.983 37.207 19.449  1.00 45.39 ? 143 GLU C CD  1 
ATOM   2368 O OE1 . GLU B 1 138 ? 47.952 37.703 18.899  1.00 50.11 ? 143 GLU C OE1 1 
ATOM   2369 O OE2 . GLU B 1 138 ? 50.005 36.815 18.873  1.00 51.23 ? 143 GLU C OE2 1 
ATOM   2370 N N   . PHE B 1 139 ? 45.629 38.399 23.595  1.00 16.63 ? 144 PHE C N   1 
ATOM   2371 C CA  . PHE B 1 139 ? 44.189 38.722 23.778  1.00 17.17 ? 144 PHE C CA  1 
ATOM   2372 C C   . PHE B 1 139 ? 43.946 40.180 23.424  1.00 16.96 ? 144 PHE C C   1 
ATOM   2373 O O   . PHE B 1 139 ? 44.845 40.944 23.285  1.00 16.86 ? 144 PHE C O   1 
ATOM   2374 C CB  . PHE B 1 139 ? 43.695 38.412 25.169  1.00 17.92 ? 144 PHE C CB  1 
ATOM   2375 C CG  . PHE B 1 139 ? 44.244 39.337 26.219  1.00 19.70 ? 144 PHE C CG  1 
ATOM   2376 C CD1 . PHE B 1 139 ? 43.584 40.474 26.562  1.00 18.75 ? 144 PHE C CD1 1 
ATOM   2377 C CD2 . PHE B 1 139 ? 45.418 39.010 26.897  1.00 20.96 ? 144 PHE C CD2 1 
ATOM   2378 C CE1 . PHE B 1 139 ? 44.065 41.345 27.503  1.00 21.38 ? 144 PHE C CE1 1 
ATOM   2379 C CE2 . PHE B 1 139 ? 45.918 39.869 27.793  1.00 21.40 ? 144 PHE C CE2 1 
ATOM   2380 C CZ  . PHE B 1 139 ? 45.278 41.054 28.109  1.00 20.64 ? 144 PHE C CZ  1 
ATOM   2381 N N   . SER B 1 140 ? 42.693 40.512 23.084  1.00 18.32 ? 145 SER C N   1 
ATOM   2382 C CA  . SER B 1 140 ? 42.311 41.845 22.800  1.00 17.08 ? 145 SER C CA  1 
ATOM   2383 C C   . SER B 1 140 ? 41.782 42.524 24.066  1.00 16.19 ? 145 SER C C   1 
ATOM   2384 O O   . SER B 1 140 ? 40.842 42.115 24.652  1.00 17.91 ? 145 SER C O   1 
ATOM   2385 C CB  . SER B 1 140 ? 41.260 41.815 21.603  1.00 20.33 ? 145 SER C CB  1 
ATOM   2386 O OG  . SER B 1 140 ? 41.098 43.097 20.985  1.00 27.67 ? 145 SER C OG  1 
ATOM   2387 N N   . ARG B 1 141 ? 42.466 43.580 24.504  1.00 14.57 ? 146 ARG C N   1 
ATOM   2388 C CA  . ARG B 1 141 ? 42.172 44.083 25.825  1.00 15.73 ? 146 ARG C CA  1 
ATOM   2389 C C   . ARG B 1 141 ? 40.794 44.711 25.873  1.00 15.63 ? 146 ARG C C   1 
ATOM   2390 O O   . ARG B 1 141 ? 40.222 44.816 26.945  1.00 16.50 ? 146 ARG C O   1 
ATOM   2391 C CB  . ARG B 1 141 ? 43.231 45.022 26.295  1.00 16.55 ? 146 ARG C CB  1 
ATOM   2392 C CG  . ARG B 1 141 ? 43.594 46.203 25.362  1.00 15.86 ? 146 ARG C CG  1 
ATOM   2393 C CD  . ARG B 1 141 ? 44.581 47.081 26.151  1.00 16.56 ? 146 ARG C CD  1 
ATOM   2394 N NE  . ARG B 1 141 ? 45.136 48.114 25.329  1.00 17.47 ? 146 ARG C NE  1 
ATOM   2395 C CZ  . ARG B 1 141 ? 44.681 49.333 25.221  1.00 17.90 ? 146 ARG C CZ  1 
ATOM   2396 N NH1 . ARG B 1 141 ? 43.508 49.674 25.775  1.00 19.28 ? 146 ARG C NH1 1 
ATOM   2397 N NH2 . ARG B 1 141 ? 45.378 50.177 24.516  1.00 18.71 ? 146 ARG C NH2 1 
ATOM   2398 N N   . ASP B 1 142 ? 40.245 45.196 24.727  1.00 17.85 ? 147 ASP C N   1 
ATOM   2399 C CA  . ASP B 1 142 ? 38.909 45.680 24.729  1.00 19.02 ? 147 ASP C CA  1 
ATOM   2400 C C   . ASP B 1 142 ? 37.890 44.631 25.123  1.00 18.85 ? 147 ASP C C   1 
ATOM   2401 O O   . ASP B 1 142 ? 36.817 44.996 25.679  1.00 20.95 ? 147 ASP C O   1 
ATOM   2402 C CB  . ASP B 1 142 ? 38.544 46.294 23.383  1.00 19.63 ? 147 ASP C CB  1 
ATOM   2403 C CG  . ASP B 1 142 ? 38.813 45.419 22.215  1.00 22.63 ? 147 ASP C CG  1 
ATOM   2404 O OD1 . ASP B 1 142 ? 39.546 44.431 22.218  1.00 23.72 ? 147 ASP C OD1 1 
ATOM   2405 O OD2 . ASP B 1 142 ? 38.151 45.700 21.137  1.00 26.28 ? 147 ASP C OD2 1 
ATOM   2406 N N   . ASP B 1 143 ? 38.224 43.357 24.899  1.00 17.91 ? 148 ASP C N   1 
ATOM   2407 C CA  . ASP B 1 143 ? 37.337 42.264 25.336  1.00 18.42 ? 148 ASP C CA  1 
ATOM   2408 C C   . ASP B 1 143 ? 37.115 42.245 26.831  1.00 18.32 ? 148 ASP C C   1 
ATOM   2409 O O   . ASP B 1 143 ? 36.137 41.668 27.321  1.00 17.39 ? 148 ASP C O   1 
ATOM   2410 C CB  . ASP B 1 143 ? 37.809 40.909 24.886  1.00 20.37 ? 148 ASP C CB  1 
ATOM   2411 C CG  . ASP B 1 143 ? 37.750 40.686 23.411  1.00 27.50 ? 148 ASP C CG  1 
ATOM   2412 O OD1 . ASP B 1 143 ? 37.072 41.444 22.656  1.00 31.72 ? 148 ASP C OD1 1 
ATOM   2413 O OD2 . ASP B 1 143 ? 38.375 39.670 22.990  1.00 31.03 ? 148 ASP C OD2 1 
ATOM   2414 N N   . PHE B 1 144 ? 37.980 42.903 27.640  1.00 17.29 ? 149 PHE C N   1 
ATOM   2415 C CA  . PHE B 1 144 ? 37.876 42.942 29.062  1.00 15.93 ? 149 PHE C CA  1 
ATOM   2416 C C   . PHE B 1 144 ? 37.528 44.297 29.574  1.00 16.90 ? 149 PHE C C   1 
ATOM   2417 O O   . PHE B 1 144 ? 37.707 44.612 30.787  1.00 20.58 ? 149 PHE C O   1 
ATOM   2418 C CB  . PHE B 1 144 ? 39.280 42.470 29.657  1.00 16.26 ? 149 PHE C CB  1 
ATOM   2419 C CG  . PHE B 1 144 ? 39.559 41.059 29.390  1.00 15.65 ? 149 PHE C CG  1 
ATOM   2420 C CD1 . PHE B 1 144 ? 40.143 40.712 28.185  1.00 16.18 ? 149 PHE C CD1 1 
ATOM   2421 C CD2 . PHE B 1 144 ? 39.245 40.043 30.279  1.00 15.96 ? 149 PHE C CD2 1 
ATOM   2422 C CE1 . PHE B 1 144 ? 40.424 39.384 27.880  1.00 17.75 ? 149 PHE C CE1 1 
ATOM   2423 C CE2 . PHE B 1 144 ? 39.509 38.711 30.007  1.00 18.05 ? 149 PHE C CE2 1 
ATOM   2424 C CZ  . PHE B 1 144 ? 40.115 38.392 28.828  1.00 17.54 ? 149 PHE C CZ  1 
ATOM   2425 N N   . GLY B 1 145 ? 37.046 45.180 28.674  1.00 18.56 ? 150 GLY C N   1 
ATOM   2426 C CA  . GLY B 1 145 ? 36.665 46.523 29.043  1.00 19.75 ? 150 GLY C CA  1 
ATOM   2427 C C   . GLY B 1 145 ? 37.801 47.514 29.203  1.00 19.51 ? 150 GLY C C   1 
ATOM   2428 O O   . GLY B 1 145 ? 37.655 48.513 29.966  1.00 21.20 ? 150 GLY C O   1 
ATOM   2429 N N   . LEU B 1 146 ? 38.977 47.193 28.622  1.00 20.40 ? 151 LEU C N   1 
ATOM   2430 C CA  . LEU B 1 146 ? 40.174 48.005 28.696  1.00 18.61 ? 151 LEU C CA  1 
ATOM   2431 C C   . LEU B 1 146 ? 40.454 48.483 27.340  1.00 20.59 ? 151 LEU C C   1 
ATOM   2432 O O   . LEU B 1 146 ? 41.369 48.028 26.674  1.00 19.23 ? 151 LEU C O   1 
ATOM   2433 C CB  . LEU B 1 146 ? 41.329 47.150 29.269  1.00 19.39 ? 151 LEU C CB  1 
ATOM   2434 C CG  . LEU B 1 146 ? 41.110 46.483 30.594  1.00 19.01 ? 151 LEU C CG  1 
ATOM   2435 C CD1 . LEU B 1 146 ? 42.248 45.530 30.869  1.00 21.59 ? 151 LEU C CD1 1 
ATOM   2436 C CD2 . LEU B 1 146 ? 41.059 47.534 31.734  1.00 20.62 ? 151 LEU C CD2 1 
ATOM   2437 N N   . ASP B 1 147 ? 39.632 49.415 26.862  1.00 22.74 ? 152 ASP C N   1 
ATOM   2438 C CA  . ASP B 1 147 ? 39.781 49.799 25.463  1.00 24.14 ? 152 ASP C CA  1 
ATOM   2439 C C   . ASP B 1 147 ? 40.369 51.187 25.237  1.00 24.59 ? 152 ASP C C   1 
ATOM   2440 O O   . ASP B 1 147 ? 40.248 51.728 24.121  1.00 25.50 ? 152 ASP C O   1 
ATOM   2441 C CB  . ASP B 1 147 ? 38.414 49.635 24.703  1.00 28.55 ? 152 ASP C CB  1 
ATOM   2442 C CG  . ASP B 1 147 ? 37.355 50.523 25.212  1.00 37.66 ? 152 ASP C CG  1 
ATOM   2443 O OD1 . ASP B 1 147 ? 37.606 51.137 26.295  1.00 34.29 ? 152 ASP C OD1 1 
ATOM   2444 O OD2 . ASP B 1 147 ? 36.249 50.587 24.530  1.00 44.39 ? 152 ASP C OD2 1 
ATOM   2445 N N   . TYR B 1 148 ? 40.936 51.818 26.259  1.00 22.97 ? 153 TYR C N   1 
ATOM   2446 C CA  . TYR B 1 148 ? 41.557 53.122 26.102  1.00 24.68 ? 153 TYR C CA  1 
ATOM   2447 C C   . TYR B 1 148 ? 42.438 53.186 24.832  1.00 25.36 ? 153 TYR C C   1 
ATOM   2448 O O   . TYR B 1 148 ? 43.214 52.315 24.563  1.00 24.07 ? 153 TYR C O   1 
ATOM   2449 C CB  . TYR B 1 148 ? 42.462 53.493 27.306  1.00 31.82 ? 153 TYR C CB  1 
ATOM   2450 C CG  . TYR B 1 148 ? 43.170 54.832 27.095  1.00 35.68 ? 153 TYR C CG  1 
ATOM   2451 C CD1 . TYR B 1 148 ? 42.497 56.042 27.299  1.00 40.89 ? 153 TYR C CD1 1 
ATOM   2452 C CD2 . TYR B 1 148 ? 44.454 54.874 26.556  1.00 41.80 ? 153 TYR C CD2 1 
ATOM   2453 C CE1 . TYR B 1 148 ? 43.120 57.258 27.013  1.00 44.01 ? 153 TYR C CE1 1 
ATOM   2454 C CE2 . TYR B 1 148 ? 45.097 56.077 26.278  1.00 43.33 ? 153 TYR C CE2 1 
ATOM   2455 C CZ  . TYR B 1 148 ? 44.437 57.253 26.518  1.00 45.04 ? 153 TYR C CZ  1 
ATOM   2456 O OH  . TYR B 1 148 ? 45.111 58.436 26.246  1.00 54.57 ? 153 TYR C OH  1 
ATOM   2457 N N   . GLY B 1 149 ? 42.295 54.242 24.055  1.00 23.97 ? 154 GLY C N   1 
ATOM   2458 C CA  . GLY B 1 149 ? 43.136 54.430 22.882  1.00 26.59 ? 154 GLY C CA  1 
ATOM   2459 C C   . GLY B 1 149 ? 42.547 54.022 21.556  1.00 25.10 ? 154 GLY C C   1 
ATOM   2460 O O   . GLY B 1 149 ? 43.149 54.279 20.543  1.00 26.30 ? 154 GLY C O   1 
ATOM   2461 N N   . LYS B 1 150 ? 41.509 53.214 21.609  1.00 25.10 ? 155 LYS C N   1 
ATOM   2462 C CA  . LYS B 1 150 ? 40.929 52.648 20.414  1.00 30.43 ? 155 LYS C CA  1 
ATOM   2463 C C   . LYS B 1 150 ? 40.531 53.819 19.487  1.00 34.29 ? 155 LYS C C   1 
ATOM   2464 O O   . LYS B 1 150 ? 40.864 53.863 18.298  1.00 34.32 ? 155 LYS C O   1 
ATOM   2465 C CB  . LYS B 1 150 ? 39.766 51.750 20.819  1.00 29.67 ? 155 LYS C CB  1 
ATOM   2466 C CG  . LYS B 1 150 ? 39.473 50.637 19.854  1.00 31.22 ? 155 LYS C CG  1 
ATOM   2467 C CD  . LYS B 1 150 ? 38.315 49.858 20.442  1.00 30.94 ? 155 LYS C CD  1 
ATOM   2468 C CE  . LYS B 1 150 ? 37.962 48.666 19.582  1.00 31.28 ? 155 LYS C CE  1 
ATOM   2469 N NZ  . LYS B 1 150 ? 36.813 48.007 20.204  1.00 32.33 ? 155 LYS C NZ  1 
ATOM   2470 N N   . GLN B 1 151 ? 39.915 54.831 20.112  1.00 41.13 ? 156 GLN C N   1 
ATOM   2471 C CA  . GLN B 1 151 ? 39.467 56.055 19.450  1.00 49.24 ? 156 GLN C CA  1 
ATOM   2472 C C   . GLN B 1 151 ? 40.573 56.699 18.648  1.00 46.41 ? 156 GLN C C   1 
ATOM   2473 O O   . GLN B 1 151 ? 40.289 57.356 17.641  1.00 55.80 ? 156 GLN C O   1 
ATOM   2474 C CB  . GLN B 1 151 ? 38.926 57.085 20.484  1.00 54.65 ? 156 GLN C CB  1 
ATOM   2475 C CG  . GLN B 1 151 ? 38.100 56.535 21.659  1.00 57.04 ? 156 GLN C CG  1 
ATOM   2476 C CD  . GLN B 1 151 ? 38.914 55.817 22.766  1.00 55.74 ? 156 GLN C CD  1 
ATOM   2477 O OE1 . GLN B 1 151 ? 39.965 56.289 23.221  1.00 60.49 ? 156 GLN C OE1 1 
ATOM   2478 N NE2 . GLN B 1 151 ? 38.410 54.671 23.207  1.00 54.32 ? 156 GLN C NE2 1 
ATOM   2479 N N   . TYR B 1 152 ? 41.815 56.525 19.105  1.00 44.30 ? 157 TYR C N   1 
ATOM   2480 C CA  . TYR B 1 152 ? 43.050 57.017 18.480  1.00 40.16 ? 157 TYR C CA  1 
ATOM   2481 C C   . TYR B 1 152 ? 43.870 56.061 17.602  1.00 35.99 ? 157 TYR C C   1 
ATOM   2482 O O   . TYR B 1 152 ? 45.027 56.364 17.329  1.00 40.08 ? 157 TYR C O   1 
ATOM   2483 C CB  . TYR B 1 152 ? 44.045 57.443 19.572  1.00 48.62 ? 157 TYR C CB  1 
ATOM   2484 C CG  . TYR B 1 152 ? 43.723 58.726 20.242  1.00 58.02 ? 157 TYR C CG  1 
ATOM   2485 C CD1 . TYR B 1 152 ? 42.526 58.892 20.975  1.00 65.50 ? 157 TYR C CD1 1 
ATOM   2486 C CD2 . TYR B 1 152 ? 44.618 59.793 20.156  1.00 64.42 ? 157 TYR C CD2 1 
ATOM   2487 C CE1 . TYR B 1 152 ? 42.235 60.096 21.588  1.00 65.40 ? 157 TYR C CE1 1 
ATOM   2488 C CE2 . TYR B 1 152 ? 44.341 60.995 20.759  1.00 66.96 ? 157 TYR C CE2 1 
ATOM   2489 C CZ  . TYR B 1 152 ? 43.164 61.135 21.464  1.00 70.42 ? 157 TYR C CZ  1 
ATOM   2490 O OH  . TYR B 1 152 ? 42.966 62.343 22.034  1.00 78.73 ? 157 TYR C OH  1 
ATOM   2491 N N   . GLY B 1 153 ? 43.320 54.914 17.212  1.00 33.88 ? 158 GLY C N   1 
ATOM   2492 C CA  . GLY B 1 153 ? 43.997 53.929 16.379  1.00 30.16 ? 158 GLY C CA  1 
ATOM   2493 C C   . GLY B 1 153 ? 44.940 52.920 17.090  1.00 27.38 ? 158 GLY C C   1 
ATOM   2494 O O   . GLY B 1 153 ? 45.625 52.100 16.449  1.00 25.34 ? 158 GLY C O   1 
ATOM   2495 N N   . PHE B 1 154 ? 44.982 52.976 18.427  1.00 25.54 ? 159 PHE C N   1 
ATOM   2496 C CA  . PHE B 1 154 ? 45.841 52.063 19.221  1.00 22.52 ? 159 PHE C CA  1 
ATOM   2497 C C   . PHE B 1 154 ? 45.275 50.690 18.944  1.00 21.26 ? 159 PHE C C   1 
ATOM   2498 O O   . PHE B 1 154 ? 44.046 50.477 18.917  1.00 22.34 ? 159 PHE C O   1 
ATOM   2499 C CB  . PHE B 1 154 ? 45.721 52.255 20.754  1.00 21.92 ? 159 PHE C CB  1 
ATOM   2500 C CG  . PHE B 1 154 ? 46.536 53.340 21.333  1.00 22.64 ? 159 PHE C CG  1 
ATOM   2501 C CD1 . PHE B 1 154 ? 46.495 54.642 20.819  1.00 27.73 ? 159 PHE C CD1 1 
ATOM   2502 C CD2 . PHE B 1 154 ? 47.376 53.080 22.370  1.00 24.25 ? 159 PHE C CD2 1 
ATOM   2503 C CE1 . PHE B 1 154 ? 47.260 55.642 21.417  1.00 29.17 ? 159 PHE C CE1 1 
ATOM   2504 C CE2 . PHE B 1 154 ? 48.150 54.071 22.972  1.00 24.81 ? 159 PHE C CE2 1 
ATOM   2505 C CZ  . PHE B 1 154 ? 48.119 55.334 22.479  1.00 28.97 ? 159 PHE C CZ  1 
ATOM   2506 N N   . LYS B 1 155 ? 46.159 49.736 18.811  1.00 19.17 ? 160 LYS C N   1 
ATOM   2507 C CA  . LYS B 1 155 ? 45.796 48.380 18.626  1.00 19.45 ? 160 LYS C CA  1 
ATOM   2508 C C   . LYS B 1 155 ? 45.493 47.729 19.962  1.00 18.93 ? 160 LYS C C   1 
ATOM   2509 O O   . LYS B 1 155 ? 46.189 48.002 21.011  1.00 19.74 ? 160 LYS C O   1 
ATOM   2510 C CB  . LYS B 1 155 ? 46.894 47.632 17.949  1.00 22.59 ? 160 LYS C CB  1 
ATOM   2511 C CG  . LYS B 1 155 ? 47.330 48.191 16.633  1.00 30.25 ? 160 LYS C CG  1 
ATOM   2512 C CD  . LYS B 1 155 ? 48.053 47.078 15.875  1.00 36.75 ? 160 LYS C CD  1 
ATOM   2513 C CE  . LYS B 1 155 ? 49.094 47.672 14.972  1.00 46.36 ? 160 LYS C CE  1 
ATOM   2514 N NZ  . LYS B 1 155 ? 48.468 48.759 14.175  1.00 50.92 ? 160 LYS C NZ  1 
ATOM   2515 N N   . MET B 1 156 ? 44.465 46.911 20.016  1.00 17.65 ? 161 MET C N   1 
ATOM   2516 C CA  . MET B 1 156 ? 44.049 46.233 21.224  1.00 16.63 ? 161 MET C CA  1 
ATOM   2517 C C   . MET B 1 156 ? 44.722 44.921 21.511  1.00 16.94 ? 161 MET C C   1 
ATOM   2518 O O   . MET B 1 156 ? 44.692 44.414 22.629  1.00 17.45 ? 161 MET C O   1 
ATOM   2519 C CB  . MET B 1 156 ? 42.525 45.993 21.205  1.00 17.81 ? 161 MET C CB  1 
ATOM   2520 C CG  . MET B 1 156 ? 41.707 47.239 21.071  1.00 17.80 ? 161 MET C CG  1 
ATOM   2521 S SD  . MET B 1 156 ? 41.782 48.314 22.497  1.00 19.27 ? 161 MET C SD  1 
ATOM   2522 C CE  . MET B 1 156 ? 42.875 49.601 21.973  1.00 19.87 ? 161 MET C CE  1 
ATOM   2523 N N   . LYS B 1 157 ? 45.406 44.398 20.526  1.00 17.54 ? 162 LYS C N   1 
ATOM   2524 C CA  . LYS B 1 157 ? 46.038 43.091 20.671  1.00 19.79 ? 162 LYS C CA  1 
ATOM   2525 C C   . LYS B 1 157 ? 47.204 43.210 21.690  1.00 18.04 ? 162 LYS C C   1 
ATOM   2526 O O   . LYS B 1 157 ? 48.033 44.085 21.603  1.00 20.14 ? 162 LYS C O   1 
ATOM   2527 C CB  . LYS B 1 157 ? 46.611 42.564 19.374  1.00 23.95 ? 162 LYS C CB  1 
ATOM   2528 C CG  . LYS B 1 157 ? 47.183 41.152 19.579  1.00 30.70 ? 162 LYS C CG  1 
ATOM   2529 C CD  . LYS B 1 157 ? 48.160 40.781 18.482  1.00 38.07 ? 162 LYS C CD  1 
ATOM   2530 C CE  . LYS B 1 157 ? 49.421 41.624 18.504  1.00 41.26 ? 162 LYS C CE  1 
ATOM   2531 N NZ  . LYS B 1 157 ? 50.344 41.133 17.435  1.00 48.13 ? 162 LYS C NZ  1 
ATOM   2532 N N   . THR B 1 158 ? 47.093 42.406 22.718  1.00 16.38 ? 163 THR C N   1 
ATOM   2533 C CA  . THR B 1 158 ? 48.075 42.506 23.839  1.00 14.95 ? 163 THR C CA  1 
ATOM   2534 C C   . THR B 1 158 ? 48.742 41.154 23.908  1.00 14.83 ? 163 THR C C   1 
ATOM   2535 O O   . THR B 1 158 ? 48.067 40.120 24.069  1.00 15.94 ? 163 THR C O   1 
ATOM   2536 C CB  . THR B 1 158 ? 47.310 42.772 25.124  1.00 15.58 ? 163 THR C CB  1 
ATOM   2537 O OG1 . THR B 1 158 ? 46.607 44.032 24.957  1.00 16.29 ? 163 THR C OG1 1 
ATOM   2538 C CG2 . THR B 1 158 ? 48.265 42.907 26.276  1.00 15.87 ? 163 THR C CG2 1 
ATOM   2539 N N   . LYS B 1 159 ? 50.073 41.106 23.899  1.00 14.66 ? 164 LYS C N   1 
ATOM   2540 C CA  . LYS B 1 159 ? 50.795 39.834 23.918  1.00 15.74 ? 164 LYS C CA  1 
ATOM   2541 C C   . LYS B 1 159 ? 51.219 39.528 25.384  1.00 14.13 ? 164 LYS C C   1 
ATOM   2542 O O   . LYS B 1 159 ? 51.569 40.471 26.096  1.00 13.65 ? 164 LYS C O   1 
ATOM   2543 C CB  . LYS B 1 159 ? 52.060 39.850 23.037  1.00 17.73 ? 164 LYS C CB  1 
ATOM   2544 C CG  . LYS B 1 159 ? 52.731 38.498 22.811  1.00 22.52 ? 164 LYS C CG  1 
ATOM   2545 C CD  . LYS B 1 159 ? 54.058 38.584 22.071  1.00 26.78 ? 164 LYS C CD  1 
ATOM   2546 C CE  . LYS B 1 159 ? 54.724 37.217 21.963  1.00 34.66 ? 164 LYS C CE  1 
ATOM   2547 N NZ  . LYS B 1 159 ? 55.877 37.271 21.014  1.00 42.65 ? 164 LYS C NZ  1 
ATOM   2548 N N   . LEU B 1 160 ? 51.050 38.279 25.816  1.00 13.92 ? 165 LEU C N   1 
ATOM   2549 C CA  . LEU B 1 160 ? 51.578 37.829 27.108  1.00 14.66 ? 165 LEU C CA  1 
ATOM   2550 C C   . LEU B 1 160 ? 52.746 36.926 26.878  1.00 14.86 ? 165 LEU C C   1 
ATOM   2551 O O   . LEU B 1 160 ? 52.756 35.988 26.031  1.00 16.86 ? 165 LEU C O   1 
ATOM   2552 C CB  . LEU B 1 160 ? 50.500 37.069 27.945  1.00 15.49 ? 165 LEU C CB  1 
ATOM   2553 C CG  . LEU B 1 160 ? 49.273 37.882 28.252  1.00 18.69 ? 165 LEU C CG  1 
ATOM   2554 C CD1 . LEU B 1 160 ? 48.210 37.003 28.944  1.00 22.40 ? 165 LEU C CD1 1 
ATOM   2555 C CD2 . LEU B 1 160 ? 49.662 39.000 29.204  1.00 21.31 ? 165 LEU C CD2 1 
ATOM   2556 N N   . LEU B 1 161 ? 53.830 37.188 27.671  1.00 14.09 ? 166 LEU C N   1 
ATOM   2557 C CA  . LEU B 1 161 ? 55.068 36.414 27.652  1.00 13.96 ? 166 LEU C CA  1 
ATOM   2558 C C   . LEU B 1 161 ? 55.270 35.929 29.064  1.00 15.83 ? 166 LEU C C   1 
ATOM   2559 O O   . LEU B 1 161 ? 55.530 36.812 29.922  1.00 14.79 ? 166 LEU C O   1 
ATOM   2560 C CB  . LEU B 1 161 ? 56.272 37.156 27.077  1.00 16.65 ? 166 LEU C CB  1 
ATOM   2561 C CG  . LEU B 1 161 ? 56.083 37.600 25.613  1.00 16.43 ? 166 LEU C CG  1 
ATOM   2562 C CD1 . LEU B 1 161 ? 55.411 38.951 25.625  1.00 19.08 ? 166 LEU C CD1 1 
ATOM   2563 C CD2 . LEU B 1 161 ? 57.405 37.707 24.925  1.00 21.45 ? 166 LEU C CD2 1 
ATOM   2564 N N   . ILE B 1 162 ? 55.031 34.649 29.304  1.00 13.58 ? 167 ILE C N   1 
ATOM   2565 C CA  . ILE B 1 162 ? 54.887 34.160 30.668  1.00 14.43 ? 167 ILE C CA  1 
ATOM   2566 C C   . ILE B 1 162 ? 56.152 33.389 31.020  1.00 12.74 ? 167 ILE C C   1 
ATOM   2567 O O   . ILE B 1 162 ? 56.583 32.411 30.338  1.00 13.02 ? 167 ILE C O   1 
ATOM   2568 C CB  . ILE B 1 162 ? 53.720 33.176 30.721  1.00 18.17 ? 167 ILE C CB  1 
ATOM   2569 C CG1 . ILE B 1 162 ? 52.358 33.758 30.282  1.00 24.50 ? 167 ILE C CG1 1 
ATOM   2570 C CG2 . ILE B 1 162 ? 53.680 32.538 32.081  1.00 19.31 ? 167 ILE C CG2 1 
ATOM   2571 C CD1 . ILE B 1 162 ? 52.060 34.992 30.969  1.00 25.48 ? 167 ILE C CD1 1 
ATOM   2572 N N   . THR B 1 163 ? 56.808 33.758 32.117  1.00 12.36 ? 168 THR C N   1 
ATOM   2573 C CA  . THR B 1 163 ? 57.852 33.034 32.789  1.00 12.97 ? 168 THR C CA  1 
ATOM   2574 C C   . THR B 1 163 ? 57.238 32.341 34.026  1.00 11.27 ? 168 THR C C   1 
ATOM   2575 O O   . THR B 1 163 ? 56.538 32.996 34.775  1.00 11.52 ? 168 THR C O   1 
ATOM   2576 C CB  . THR B 1 163 ? 58.855 34.036 33.439  1.00 14.23 ? 168 THR C CB  1 
ATOM   2577 O OG1 . THR B 1 163 ? 59.401 34.941 32.438  1.00 19.73 ? 168 THR C OG1 1 
ATOM   2578 C CG2 . THR B 1 163 ? 60.030 33.346 34.144  1.00 15.78 ? 168 THR C CG2 1 
ATOM   2579 N N   . ALA B 1 164 ? 57.465 31.095 34.227  1.00 12.25 ? 169 ALA C N   1 
ATOM   2580 C CA  . ALA B 1 164 ? 56.950 30.452 35.435  1.00 13.84 ? 169 ALA C CA  1 
ATOM   2581 C C   . ALA B 1 164 ? 57.826 29.349 35.919  1.00 14.38 ? 169 ALA C C   1 
ATOM   2582 O O   . ALA B 1 164 ? 58.335 28.545 35.064  1.00 14.20 ? 169 ALA C O   1 
ATOM   2583 C CB  . ALA B 1 164 ? 55.512 29.988 35.172  1.00 15.40 ? 169 ALA C CB  1 
ATOM   2584 N N   . GLU B 1 165 ? 58.045 29.229 37.214  1.00 13.23 ? 170 GLU C N   1 
ATOM   2585 C CA  . GLU B 1 165 ? 58.810 28.115 37.756  1.00 13.19 ? 170 GLU C CA  1 
ATOM   2586 C C   . GLU B 1 165 ? 58.029 27.657 38.971  1.00 13.67 ? 170 GLU C C   1 
ATOM   2587 O O   . GLU B 1 165 ? 57.544 28.510 39.684  1.00 13.07 ? 170 GLU C O   1 
ATOM   2588 C CB  . GLU B 1 165 ? 60.221 28.437 38.156  1.00 14.24 ? 170 GLU C CB  1 
ATOM   2589 C CG  . GLU B 1 165 ? 61.110 28.901 37.008  1.00 15.50 ? 170 GLU C CG  1 
ATOM   2590 C CD  . GLU B 1 165 ? 62.568 29.032 37.344  1.00 17.80 ? 170 GLU C CD  1 
ATOM   2591 O OE1 . GLU B 1 165 ? 62.963 28.903 38.531  1.00 19.42 ? 170 GLU C OE1 1 
ATOM   2592 O OE2 . GLU B 1 165 ? 63.320 29.312 36.339  1.00 22.37 ? 170 GLU C OE2 1 
ATOM   2593 N N   . ALA B 1 166 ? 57.889 26.381 39.154  1.00 14.11 ? 171 ALA C N   1 
ATOM   2594 C CA  . ALA B 1 166 ? 57.055 25.864 40.276  1.00 14.64 ? 171 ALA C CA  1 
ATOM   2595 C C   . ALA B 1 166 ? 57.837 24.740 40.943  1.00 15.91 ? 171 ALA C C   1 
ATOM   2596 O O   . ALA B 1 166 ? 58.498 23.948 40.261  1.00 16.43 ? 171 ALA C O   1 
ATOM   2597 C CB  . ALA B 1 166 ? 55.752 25.359 39.774  1.00 17.16 ? 171 ALA C CB  1 
ATOM   2598 N N   . VAL B 1 167 ? 57.671 24.668 42.272  1.00 15.91 ? 172 VAL C N   1 
ATOM   2599 C CA  . VAL B 1 167 ? 58.485 23.744 43.113  1.00 18.05 ? 172 VAL C CA  1 
ATOM   2600 C C   . VAL B 1 167 ? 57.572 22.700 43.673  1.00 18.08 ? 172 VAL C C   1 
ATOM   2601 O O   . VAL B 1 167 ? 56.485 23.043 44.176  1.00 18.04 ? 172 VAL C O   1 
ATOM   2602 C CB  . VAL B 1 167 ? 59.212 24.492 44.265  1.00 20.12 ? 172 VAL C CB  1 
ATOM   2603 C CG1 . VAL B 1 167 ? 60.103 23.562 45.051  1.00 21.13 ? 172 VAL C CG1 1 
ATOM   2604 C CG2 . VAL B 1 167 ? 60.072 25.649 43.676  1.00 21.69 ? 172 VAL C CG2 1 
ATOM   2605 N N   . LYS B 1 168 ? 58.013 21.428 43.559  1.00 20.28 ? 173 LYS C N   1 
ATOM   2606 C CA  . LYS B 1 168 ? 57.172 20.296 43.948  1.00 25.45 ? 173 LYS C CA  1 
ATOM   2607 C C   . LYS B 1 168 ? 56.921 20.328 45.416  1.00 29.19 ? 173 LYS C C   1 
ATOM   2608 O O   . LYS B 1 168 ? 57.829 20.574 46.214  1.00 28.12 ? 173 LYS C O   1 
ATOM   2609 C CB  . LYS B 1 168 ? 57.814 18.962 43.596  1.00 29.54 ? 173 LYS C CB  1 
ATOM   2610 C CG  . LYS B 1 168 ? 56.998 17.793 44.147  1.00 36.19 ? 173 LYS C CG  1 
ATOM   2611 C CD  . LYS B 1 168 ? 57.660 16.464 43.864  1.00 42.64 ? 173 LYS C CD  1 
ATOM   2612 C CE  . LYS B 1 168 ? 57.662 16.159 42.376  1.00 42.35 ? 173 LYS C CE  1 
ATOM   2613 N NZ  . LYS B 1 168 ? 57.759 14.684 42.171  1.00 46.73 ? 173 LYS C NZ  1 
ATOM   2614 N N   . GLN B 1 169 ? 55.653 20.198 45.754  1.00 31.22 ? 174 GLN C N   1 
ATOM   2615 C CA  . GLN B 1 169 ? 55.243 20.263 47.154  1.00 36.44 ? 174 GLN C CA  1 
ATOM   2616 C C   . GLN B 1 169 ? 55.411 18.905 47.749  1.00 31.14 ? 174 GLN C C   1 
ATOM   2617 O O   . GLN B 1 169 ? 56.162 18.773 48.716  1.00 39.05 ? 174 GLN C O   1 
ATOM   2618 C CB  . GLN B 1 169 ? 53.800 20.764 47.271  1.00 39.77 ? 174 GLN C CB  1 
ATOM   2619 C CG  . GLN B 1 169 ? 53.648 22.180 46.789  1.00 44.86 ? 174 GLN C CG  1 
ATOM   2620 C CD  . GLN B 1 169 ? 54.658 23.131 47.440  1.00 45.48 ? 174 GLN C CD  1 
ATOM   2621 O OE1 . GLN B 1 169 ? 55.829 23.350 46.956  1.00 38.34 ? 174 GLN C OE1 1 
ATOM   2622 N NE2 . GLN B 1 169 ? 54.219 23.725 48.530  1.00 43.21 ? 174 GLN C NE2 1 
ATOM   2623 N N   . ALA C 1 2   ? 84.073 13.547 17.302  1.00 18.49 ? 7   ALA A N   1 
ATOM   2624 C CA  . ALA C 1 2   ? 83.230 12.697 16.526  1.00 17.02 ? 7   ALA A CA  1 
ATOM   2625 C C   . ALA C 1 2   ? 82.956 13.334 15.162  1.00 16.19 ? 7   ALA A C   1 
ATOM   2626 O O   . ALA C 1 2   ? 82.909 14.560 15.074  1.00 17.28 ? 7   ALA A O   1 
ATOM   2627 C CB  . ALA C 1 2   ? 81.965 12.494 17.242  1.00 19.65 ? 7   ALA A CB  1 
ATOM   2628 N N   . THR C 1 3   ? 82.790 12.512 14.160  1.00 16.02 ? 8   THR A N   1 
ATOM   2629 C CA  . THR C 1 3   ? 82.523 12.964 12.781  1.00 15.22 ? 8   THR A CA  1 
ATOM   2630 C C   . THR C 1 3   ? 81.172 12.430 12.307  1.00 15.66 ? 8   THR A C   1 
ATOM   2631 O O   . THR C 1 3   ? 80.846 11.291 12.498  1.00 15.12 ? 8   THR A O   1 
ATOM   2632 C CB  . THR C 1 3   ? 83.641 12.455 11.860  1.00 18.24 ? 8   THR A CB  1 
ATOM   2633 O OG1 . THR C 1 3   ? 84.903 12.946 12.433  1.00 20.25 ? 8   THR A OG1 1 
ATOM   2634 C CG2 . THR C 1 3   ? 83.443 12.846 10.442  1.00 18.30 ? 8   THR A CG2 1 
ATOM   2635 N N   . TYR C 1 4   ? 80.398 13.297 11.679  1.00 13.12 ? 9   TYR A N   1 
ATOM   2636 C CA  . TYR C 1 4   ? 79.003 12.997 11.236  1.00 13.10 ? 9   TYR A CA  1 
ATOM   2637 C C   . TYR C 1 4   ? 78.846 13.481 9.821   1.00 13.70 ? 9   TYR A C   1 
ATOM   2638 O O   . TYR C 1 4   ? 79.448 14.512 9.420   1.00 14.63 ? 9   TYR A O   1 
ATOM   2639 C CB  . TYR C 1 4   ? 78.016 13.813 12.092  1.00 12.80 ? 9   TYR A CB  1 
ATOM   2640 C CG  . TYR C 1 4   ? 78.029 13.644 13.588  1.00 14.54 ? 9   TYR A CG  1 
ATOM   2641 C CD1 . TYR C 1 4   ? 79.021 14.189 14.332  1.00 16.20 ? 9   TYR A CD1 1 
ATOM   2642 C CD2 . TYR C 1 4   ? 77.096 12.829 14.202  1.00 14.92 ? 9   TYR A CD2 1 
ATOM   2643 C CE1 . TYR C 1 4   ? 79.040 14.071 15.713  1.00 18.16 ? 9   TYR A CE1 1 
ATOM   2644 C CE2 . TYR C 1 4   ? 77.146 12.654 15.605  1.00 17.75 ? 9   TYR A CE2 1 
ATOM   2645 C CZ  . TYR C 1 4   ? 78.156 13.247 16.341  1.00 18.95 ? 9   TYR A CZ  1 
ATOM   2646 O OH  . TYR C 1 4   ? 78.216 13.120 17.744  1.00 21.41 ? 9   TYR A OH  1 
ATOM   2647 N N   . GLN C 1 5   ? 78.150 12.745 9.000   1.00 12.14 ? 10  GLN A N   1 
ATOM   2648 C CA  . GLN C 1 5   ? 77.838 13.120 7.636   1.00 12.28 ? 10  GLN A CA  1 
ATOM   2649 C C   . GLN C 1 5   ? 76.451 13.553 7.532   1.00 11.12 ? 10  GLN A C   1 
ATOM   2650 O O   . GLN C 1 5   ? 75.540 12.898 8.024   1.00 11.43 ? 10  GLN A O   1 
ATOM   2651 C CB  . GLN C 1 5   ? 78.104 11.979 6.660   1.00 14.38 ? 10  GLN A CB  1 
ATOM   2652 C CG  . GLN C 1 5   ? 79.553 11.432 6.846   1.00 16.86 ? 10  GLN A CG  1 
ATOM   2653 C CD  . GLN C 1 5   ? 80.653 12.423 6.478   1.00 19.07 ? 10  GLN A CD  1 
ATOM   2654 O OE1 . GLN C 1 5   ? 80.432 13.439 5.813   1.00 18.98 ? 10  GLN A OE1 1 
ATOM   2655 N NE2 . GLN C 1 5   ? 81.877 12.107 6.907   1.00 21.92 ? 10  GLN A NE2 1 
ATOM   2656 N N   . PHE C 1 6   ? 76.223 14.727 6.883   1.00 9.90  ? 11  PHE A N   1 
ATOM   2657 C CA  . PHE C 1 6   ? 74.839 15.143 6.697   1.00 10.48 ? 11  PHE A CA  1 
ATOM   2658 C C   . PHE C 1 6   ? 74.010 14.148 5.932   1.00 10.64 ? 11  PHE A C   1 
ATOM   2659 O O   . PHE C 1 6   ? 74.482 13.561 4.962   1.00 10.88 ? 11  PHE A O   1 
ATOM   2660 C CB  . PHE C 1 6   ? 74.714 16.480 5.983   1.00 10.12 ? 11  PHE A CB  1 
ATOM   2661 C CG  . PHE C 1 6   ? 75.176 17.662 6.816   1.00 10.20 ? 11  PHE A CG  1 
ATOM   2662 C CD1 . PHE C 1 6   ? 74.471 18.014 7.944   1.00 11.40 ? 11  PHE A CD1 1 
ATOM   2663 C CD2 . PHE C 1 6   ? 76.266 18.450 6.415   1.00 11.36 ? 11  PHE A CD2 1 
ATOM   2664 C CE1 . PHE C 1 6   ? 74.940 19.099 8.731   1.00 11.54 ? 11  PHE A CE1 1 
ATOM   2665 C CE2 . PHE C 1 6   ? 76.745 19.502 7.174   1.00 11.72 ? 11  PHE A CE2 1 
ATOM   2666 C CZ  . PHE C 1 6   ? 76.029 19.865 8.313   1.00 12.44 ? 11  PHE A CZ  1 
ATOM   2667 N N   . ASP C 1 7   ? 72.792 13.863 6.431   1.00 11.64 ? 12  ASP A N   1 
ATOM   2668 C CA  . ASP C 1 7   ? 71.789 13.064 5.700   1.00 13.01 ? 12  ASP A CA  1 
ATOM   2669 C C   . ASP C 1 7   ? 71.076 14.023 4.731   1.00 12.89 ? 12  ASP A C   1 
ATOM   2670 O O   . ASP C 1 7   ? 70.319 14.877 5.195   1.00 12.33 ? 12  ASP A O   1 
ATOM   2671 C CB  . ASP C 1 7   ? 70.750 12.525 6.706   1.00 14.78 ? 12  ASP A CB  1 
ATOM   2672 C CG  . ASP C 1 7   ? 69.563 11.931 6.041   1.00 18.71 ? 12  ASP A CG  1 
ATOM   2673 O OD1 . ASP C 1 7   ? 69.552 11.823 4.827   1.00 17.52 ? 12  ASP A OD1 1 
ATOM   2674 O OD2 . ASP C 1 7   ? 68.597 11.695 6.815   1.00 20.89 ? 12  ASP A OD2 1 
ATOM   2675 N N   . PRO C 1 8   ? 71.352 13.957 3.410   1.00 12.84 ? 13  PRO A N   1 
ATOM   2676 C CA  . PRO C 1 8   ? 70.759 14.944 2.446   1.00 12.93 ? 13  PRO A CA  1 
ATOM   2677 C C   . PRO C 1 8   ? 69.216 14.992 2.531   1.00 14.33 ? 13  PRO A C   1 
ATOM   2678 O O   . PRO C 1 8   ? 68.629 16.048 2.380   1.00 14.53 ? 13  PRO A O   1 
ATOM   2679 C CB  . PRO C 1 8   ? 71.250 14.459 1.117   1.00 14.09 ? 13  PRO A CB  1 
ATOM   2680 C CG  . PRO C 1 8   ? 72.538 13.774 1.439   1.00 14.46 ? 13  PRO A CG  1 
ATOM   2681 C CD  . PRO C 1 8   ? 72.236 13.009 2.679   1.00 13.54 ? 13  PRO A CD  1 
ATOM   2682 N N   A SER C 1 9   ? 68.594 13.870 2.847   0.50 14.25 ? 14  SER A N   1 
ATOM   2683 N N   B SER C 1 9   ? 68.582 13.867 2.867   0.50 15.24 ? 14  SER A N   1 
ATOM   2684 C CA  A SER C 1 9   ? 67.133 13.871 2.887   0.50 14.44 ? 14  SER A CA  1 
ATOM   2685 C CA  B SER C 1 9   ? 67.098 13.836 2.983   0.50 16.07 ? 14  SER A CA  1 
ATOM   2686 C C   A SER C 1 9   ? 66.518 14.591 4.056   0.50 14.01 ? 14  SER A C   1 
ATOM   2687 C C   B SER C 1 9   ? 66.525 14.730 4.023   0.50 14.86 ? 14  SER A C   1 
ATOM   2688 O O   A SER C 1 9   ? 65.295 14.692 4.114   0.50 14.76 ? 14  SER A O   1 
ATOM   2689 O O   B SER C 1 9   ? 65.353 15.123 3.957   0.50 15.70 ? 14  SER A O   1 
ATOM   2690 C CB  A SER C 1 9   ? 66.627 12.445 2.823   0.50 14.56 ? 14  SER A CB  1 
ATOM   2691 C CB  B SER C 1 9   ? 66.622 12.424 3.253   0.50 17.50 ? 14  SER A CB  1 
ATOM   2692 O OG  A SER C 1 9   ? 66.998 11.740 4.012   0.50 14.65 ? 14  SER A OG  1 
ATOM   2693 O OG  B SER C 1 9   ? 67.057 11.595 2.199   0.50 20.05 ? 14  SER A OG  1 
ATOM   2694 N N   . HIS C 1 10  ? 67.333 15.047 5.039   1.00 14.01 ? 15  HIS A N   1 
ATOM   2695 C CA  . HIS C 1 10  ? 66.869 15.905 6.147   1.00 13.79 ? 15  HIS A CA  1 
ATOM   2696 C C   . HIS C 1 10  ? 67.814 17.080 6.363   1.00 13.48 ? 15  HIS A C   1 
ATOM   2697 O O   . HIS C 1 10  ? 68.003 17.567 7.476   1.00 15.12 ? 15  HIS A O   1 
ATOM   2698 C CB  . HIS C 1 10  ? 66.718 15.107 7.435   1.00 15.38 ? 15  HIS A CB  1 
ATOM   2699 C CG  . HIS C 1 10  ? 65.653 14.052 7.334   1.00 16.86 ? 15  HIS A CG  1 
ATOM   2700 N ND1 . HIS C 1 10  ? 65.889 12.814 6.809   1.00 18.50 ? 15  HIS A ND1 1 
ATOM   2701 C CD2 . HIS C 1 10  ? 64.320 14.175 7.463   1.00 19.18 ? 15  HIS A CD2 1 
ATOM   2702 C CE1 . HIS C 1 10  ? 64.739 12.135 6.752   1.00 20.60 ? 15  HIS A CE1 1 
ATOM   2703 N NE2 . HIS C 1 10  ? 63.782 12.939 7.182   1.00 18.81 ? 15  HIS A NE2 1 
ATOM   2704 N N   . THR C 1 11  ? 68.507 17.518 5.265   1.00 11.94 ? 16  THR A N   1 
ATOM   2705 C CA  . THR C 1 11  ? 69.359 18.677 5.367   1.00 11.51 ? 16  THR A CA  1 
ATOM   2706 C C   . THR C 1 11  ? 68.992 19.615 4.210   1.00 12.03 ? 16  THR A C   1 
ATOM   2707 O O   . THR C 1 11  ? 69.248 19.264 3.041   1.00 11.11 ? 16  THR A O   1 
ATOM   2708 C CB  . THR C 1 11  ? 70.843 18.223 5.295   1.00 12.15 ? 16  THR A CB  1 
ATOM   2709 O OG1 . THR C 1 11  ? 71.086 17.343 6.401   1.00 11.67 ? 16  THR A OG1 1 
ATOM   2710 C CG2 . THR C 1 11  ? 71.797 19.443 5.370   1.00 12.56 ? 16  THR A CG2 1 
ATOM   2711 N N   . TYR C 1 12  ? 68.518 20.817 4.579   1.00 10.65 ? 17  TYR A N   1 
ATOM   2712 C CA  . TYR C 1 12  ? 68.045 21.787 3.604   1.00 10.96 ? 17  TYR A CA  1 
ATOM   2713 C C   . TYR C 1 12  ? 68.208 23.164 4.132   1.00 10.53 ? 17  TYR A C   1 
ATOM   2714 O O   . TYR C 1 12  ? 67.740 23.445 5.237   1.00 12.43 ? 17  TYR A O   1 
ATOM   2715 C CB  . TYR C 1 12  ? 66.581 21.555 3.217   1.00 12.36 ? 17  TYR A CB  1 
ATOM   2716 C CG  . TYR C 1 12  ? 66.105 20.167 2.819   1.00 11.89 ? 17  TYR A CG  1 
ATOM   2717 C CD1 . TYR C 1 12  ? 66.157 19.745 1.451   1.00 12.65 ? 17  TYR A CD1 1 
ATOM   2718 C CD2 . TYR C 1 12  ? 65.616 19.265 3.741   1.00 12.31 ? 17  TYR A CD2 1 
ATOM   2719 C CE1 . TYR C 1 12  ? 65.818 18.501 1.066   1.00 11.96 ? 17  TYR A CE1 1 
ATOM   2720 C CE2 . TYR C 1 12  ? 65.227 17.997 3.340   1.00 12.19 ? 17  TYR A CE2 1 
ATOM   2721 C CZ  . TYR C 1 12  ? 65.296 17.575 2.028   1.00 13.72 ? 17  TYR A CZ  1 
ATOM   2722 O OH  . TYR C 1 12  ? 64.905 16.309 1.654   1.00 15.53 ? 17  TYR A OH  1 
ATOM   2723 N N   . PRO C 1 13  ? 68.780 24.118 3.379   1.00 9.81  ? 18  PRO A N   1 
ATOM   2724 C CA  . PRO C 1 13  ? 68.629 25.516 3.630   1.00 9.91  ? 18  PRO A CA  1 
ATOM   2725 C C   . PRO C 1 13  ? 67.370 26.024 2.967   1.00 9.75  ? 18  PRO A C   1 
ATOM   2726 O O   . PRO C 1 13  ? 67.217 25.944 1.753   1.00 10.30 ? 18  PRO A O   1 
ATOM   2727 C CB  . PRO C 1 13  ? 69.843 26.169 2.996   1.00 10.25 ? 18  PRO A CB  1 
ATOM   2728 C CG  . PRO C 1 13  ? 70.306 25.242 1.944   1.00 10.89 ? 18  PRO A CG  1 
ATOM   2729 C CD  . PRO C 1 13  ? 69.693 23.880 2.235   1.00 10.27 ? 18  PRO A CD  1 
ATOM   2730 N N   . SER C 1 14  ? 66.454 26.534 3.802   1.00 8.97  ? 19  SER A N   1 
ATOM   2731 C CA  . SER C 1 14  ? 65.308 27.262 3.315   1.00 8.25  ? 19  SER A CA  1 
ATOM   2732 C C   . SER C 1 14  ? 65.594 28.738 3.486   1.00 8.54  ? 19  SER A C   1 
ATOM   2733 O O   . SER C 1 14  ? 66.503 29.169 4.213   1.00 8.59  ? 19  SER A O   1 
ATOM   2734 C CB  . SER C 1 14  ? 64.019 26.904 4.099   1.00 9.56  ? 19  SER A CB  1 
ATOM   2735 O OG  . SER C 1 14  ? 63.742 25.481 4.062   1.00 10.14 ? 19  SER A OG  1 
ATOM   2736 N N   . PHE C 1 15  ? 64.823 29.555 2.782   1.00 8.20  ? 20  PHE A N   1 
ATOM   2737 C CA  . PHE C 1 15  ? 65.065 31.012 2.797   1.00 8.65  ? 20  PHE A CA  1 
ATOM   2738 C C   . PHE C 1 15  ? 63.766 31.799 2.837   1.00 9.31  ? 20  PHE A C   1 
ATOM   2739 O O   . PHE C 1 15  ? 62.694 31.309 2.428   1.00 9.13  ? 20  PHE A O   1 
ATOM   2740 C CB  . PHE C 1 15  ? 65.942 31.413 1.591   1.00 9.39  ? 20  PHE A CB  1 
ATOM   2741 C CG  . PHE C 1 15  ? 65.418 30.904 0.269   1.00 10.53 ? 20  PHE A CG  1 
ATOM   2742 C CD1 . PHE C 1 15  ? 64.437 31.615 -0.319  1.00 12.27 ? 20  PHE A CD1 1 
ATOM   2743 C CD2 . PHE C 1 15  ? 65.913 29.751 -0.339  1.00 10.36 ? 20  PHE A CD2 1 
ATOM   2744 C CE1 . PHE C 1 15  ? 63.853 31.178 -1.501  1.00 13.21 ? 20  PHE A CE1 1 
ATOM   2745 C CE2 . PHE C 1 15  ? 65.292 29.326 -1.521  1.00 12.71 ? 20  PHE A CE2 1 
ATOM   2746 C CZ  . PHE C 1 15  ? 64.328 30.040 -2.111  1.00 13.44 ? 20  PHE A CZ  1 
ATOM   2747 N N   . GLU C 1 16  ? 63.888 33.042 3.207   1.00 9.95  ? 21  GLU A N   1 
ATOM   2748 C CA  . GLU C 1 16  ? 62.884 34.070 3.004   1.00 11.44 ? 21  GLU A CA  1 
ATOM   2749 C C   . GLU C 1 16  ? 63.510 35.267 2.354   1.00 10.66 ? 21  GLU A C   1 
ATOM   2750 O O   . GLU C 1 16  ? 64.580 35.729 2.757   1.00 11.43 ? 21  GLU A O   1 
ATOM   2751 C CB  . GLU C 1 16  ? 62.287 34.524 4.303   1.00 13.14 ? 21  GLU A CB  1 
ATOM   2752 C CG  . GLU C 1 16  ? 61.643 33.444 5.157   1.00 14.10 ? 21  GLU A CG  1 
ATOM   2753 C CD  . GLU C 1 16  ? 61.025 33.931 6.475   1.00 19.35 ? 21  GLU A CD  1 
ATOM   2754 O OE1 . GLU C 1 16  ? 61.257 35.109 6.776   1.00 22.13 ? 21  GLU A OE1 1 
ATOM   2755 O OE2 . GLU C 1 16  ? 60.318 33.144 7.200   1.00 21.63 ? 21  GLU A OE2 1 
ATOM   2756 N N   . ALA C 1 17  ? 62.863 35.809 1.364   1.00 10.73 ? 22  ALA A N   1 
ATOM   2757 C CA  . ALA C 1 17  ? 63.277 36.940 0.626   1.00 11.85 ? 22  ALA A CA  1 
ATOM   2758 C C   . ALA C 1 17  ? 62.150 37.850 0.323   1.00 12.66 ? 22  ALA A C   1 
ATOM   2759 O O   . ALA C 1 17  ? 61.003 37.463 0.210   1.00 12.28 ? 22  ALA A O   1 
ATOM   2760 C CB  . ALA C 1 17  ? 63.927 36.490 -0.641  1.00 12.60 ? 22  ALA A CB  1 
ATOM   2761 N N   . ASP C 1 18  ? 62.428 39.166 0.148   1.00 13.14 ? 23  ASP A N   1 
ATOM   2762 C CA  . ASP C 1 18  ? 61.392 40.142 -0.115  1.00 14.16 ? 23  ASP A CA  1 
ATOM   2763 C C   . ASP C 1 18  ? 60.888 40.113 -1.485  1.00 14.21 ? 23  ASP A C   1 
ATOM   2764 O O   . ASP C 1 18  ? 61.604 39.851 -2.441  1.00 15.50 ? 23  ASP A O   1 
ATOM   2765 C CB  . ASP C 1 18  ? 62.028 41.535 0.148   1.00 15.97 ? 23  ASP A CB  1 
ATOM   2766 C CG  . ASP C 1 18  ? 61.050 42.641 -0.067  1.00 17.54 ? 23  ASP A CG  1 
ATOM   2767 O OD1 . ASP C 1 18  ? 60.062 42.665 0.703   1.00 18.18 ? 23  ASP A OD1 1 
ATOM   2768 O OD2 . ASP C 1 18  ? 61.381 43.474 -0.979  1.00 20.76 ? 23  ASP A OD2 1 
ATOM   2769 N N   . HIS C 1 19  ? 59.613 40.483 -1.637  1.00 13.05 ? 24  HIS A N   1 
ATOM   2770 C CA  . HIS C 1 19  ? 59.020 40.816 -2.906  1.00 13.66 ? 24  HIS A CA  1 
ATOM   2771 C C   . HIS C 1 19  ? 58.408 42.229 -2.836  1.00 15.54 ? 24  HIS A C   1 
ATOM   2772 O O   . HIS C 1 19  ? 57.531 42.519 -2.026  1.00 14.61 ? 24  HIS A O   1 
ATOM   2773 C CB  . HIS C 1 19  ? 57.895 39.850 -3.272  1.00 15.08 ? 24  HIS A CB  1 
ATOM   2774 C CG  . HIS C 1 19  ? 57.354 40.020 -4.659  1.00 16.21 ? 24  HIS A CG  1 
ATOM   2775 N ND1 . HIS C 1 19  ? 56.012 40.138 -4.923  1.00 17.24 ? 24  HIS A ND1 1 
ATOM   2776 C CD2 . HIS C 1 19  ? 57.973 40.002 -5.882  1.00 16.85 ? 24  HIS A CD2 1 
ATOM   2777 C CE1 . HIS C 1 19  ? 55.827 40.207 -6.242  1.00 17.26 ? 24  HIS A CE1 1 
ATOM   2778 N NE2 . HIS C 1 19  ? 57.009 40.082 -6.840  1.00 18.80 ? 24  HIS A NE2 1 
ATOM   2779 N N   . PHE C 1 20  ? 58.885 43.080 -3.712  1.00 18.69 ? 25  PHE A N   1 
ATOM   2780 C CA  . PHE C 1 20  ? 58.348 44.460 -3.834  1.00 21.11 ? 25  PHE A CA  1 
ATOM   2781 C C   . PHE C 1 20  ? 58.288 45.291 -2.600  1.00 20.89 ? 25  PHE A C   1 
ATOM   2782 O O   . PHE C 1 20  ? 57.238 45.955 -2.319  1.00 23.79 ? 25  PHE A O   1 
ATOM   2783 C CB  . PHE C 1 20  ? 57.013 44.425 -4.523  1.00 22.60 ? 25  PHE A CB  1 
ATOM   2784 C CG  . PHE C 1 20  ? 57.207 44.413 -5.968  1.00 27.82 ? 25  PHE A CG  1 
ATOM   2785 C CD1 . PHE C 1 20  ? 57.876 45.499 -6.563  1.00 35.10 ? 25  PHE A CD1 1 
ATOM   2786 C CD2 . PHE C 1 20  ? 56.947 43.328 -6.702  1.00 28.03 ? 25  PHE A CD2 1 
ATOM   2787 C CE1 . PHE C 1 20  ? 58.154 45.518 -7.920  1.00 39.74 ? 25  PHE A CE1 1 
ATOM   2788 C CE2 . PHE C 1 20  ? 57.206 43.312 -8.080  1.00 35.96 ? 25  PHE A CE2 1 
ATOM   2789 C CZ  . PHE C 1 20  ? 57.826 44.392 -8.682  1.00 38.10 ? 25  PHE A CZ  1 
ATOM   2790 N N   . GLY C 1 21  ? 59.350 45.223 -1.826  1.00 22.11 ? 26  GLY A N   1 
ATOM   2791 C CA  . GLY C 1 21  ? 59.471 46.108 -0.713  1.00 23.51 ? 26  GLY A CA  1 
ATOM   2792 C C   . GLY C 1 21  ? 58.425 45.907 0.329   1.00 22.03 ? 26  GLY A C   1 
ATOM   2793 O O   . GLY C 1 21  ? 57.760 46.881 0.806   1.00 24.34 ? 26  GLY A O   1 
ATOM   2794 N N   . GLY C 1 22  ? 58.236 44.650 0.720   1.00 17.73 ? 27  GLY A N   1 
ATOM   2795 C CA  . GLY C 1 22  ? 57.359 44.362 1.827   1.00 16.67 ? 27  GLY A CA  1 
ATOM   2796 C C   . GLY C 1 22  ? 55.983 43.893 1.419   1.00 15.52 ? 27  GLY A C   1 
ATOM   2797 O O   . GLY C 1 22  ? 55.140 43.712 2.257   1.00 16.88 ? 27  GLY A O   1 
ATOM   2798 N N   . LEU C 1 23  ? 55.783 43.681 0.103   1.00 15.61 ? 28  LEU A N   1 
ATOM   2799 C CA  . LEU C 1 23  ? 54.494 43.254 -0.341  1.00 14.73 ? 28  LEU A CA  1 
ATOM   2800 C C   . LEU C 1 23  ? 54.178 41.873 0.105   1.00 13.48 ? 28  LEU A C   1 
ATOM   2801 O O   . LEU C 1 23  ? 53.098 41.551 0.611   1.00 13.88 ? 28  LEU A O   1 
ATOM   2802 C CB  . LEU C 1 23  ? 54.393 43.413 -1.844  1.00 15.24 ? 28  LEU A CB  1 
ATOM   2803 C CG  . LEU C 1 23  ? 53.011 43.058 -2.391  1.00 15.72 ? 28  LEU A CG  1 
ATOM   2804 C CD1 . LEU C 1 23  ? 51.924 44.024 -1.911  1.00 17.21 ? 28  LEU A CD1 1 
ATOM   2805 C CD2 . LEU C 1 23  ? 53.066 43.069 -3.890  1.00 18.52 ? 28  LEU A CD2 1 
ATOM   2806 N N   . SER C 1 24  ? 55.188 41.012 -0.054  1.00 12.72 ? 29  SER A N   1 
ATOM   2807 C CA  . SER C 1 24  ? 55.041 39.669 0.465   1.00 12.92 ? 29  SER A CA  1 
ATOM   2808 C C   . SER C 1 24  ? 56.458 39.071 0.622   1.00 11.95 ? 29  SER A C   1 
ATOM   2809 O O   . SER C 1 24  ? 57.449 39.664 0.266   1.00 12.13 ? 29  SER A O   1 
ATOM   2810 C CB  . SER C 1 24  ? 54.155 38.788 -0.455  1.00 13.30 ? 29  SER A CB  1 
ATOM   2811 O OG  . SER C 1 24  ? 54.835 38.481 -1.647  1.00 15.17 ? 29  SER A OG  1 
ATOM   2812 N N   . VAL C 1 25  ? 56.535 37.821 1.090   1.00 11.33 ? 30  VAL A N   1 
ATOM   2813 C CA  . VAL C 1 25  ? 57.784 37.102 1.429   1.00 11.56 ? 30  VAL A CA  1 
ATOM   2814 C C   . VAL C 1 25  ? 57.831 35.873 0.487   1.00 11.08 ? 30  VAL A C   1 
ATOM   2815 O O   . VAL C 1 25  ? 57.058 34.930 0.635   1.00 13.25 ? 30  VAL A O   1 
ATOM   2816 C CB  . VAL C 1 25  ? 57.823 36.690 2.852   1.00 11.95 ? 30  VAL A CB  1 
ATOM   2817 C CG1 . VAL C 1 25  ? 59.132 35.955 3.172   1.00 12.21 ? 30  VAL A CG1 1 
ATOM   2818 C CG2 . VAL C 1 25  ? 57.595 37.848 3.830   1.00 12.84 ? 30  VAL A CG2 1 
ATOM   2819 N N   . TRP C 1 26  ? 58.832 35.817 -0.397  1.00 11.28 ? 31  TRP A N   1 
ATOM   2820 C CA  . TRP C 1 26  ? 59.208 34.605 -1.093  1.00 10.66 ? 31  TRP A CA  1 
ATOM   2821 C C   . TRP C 1 26  ? 59.832 33.599 -0.143  1.00 11.18 ? 31  TRP A C   1 
ATOM   2822 O O   . TRP C 1 26  ? 60.794 33.961 0.545   1.00 10.98 ? 31  TRP A O   1 
ATOM   2823 C CB  . TRP C 1 26  ? 60.274 34.902 -2.182  1.00 11.37 ? 31  TRP A CB  1 
ATOM   2824 C CG  . TRP C 1 26  ? 59.713 35.226 -3.556  1.00 11.94 ? 31  TRP A CG  1 
ATOM   2825 C CD1 . TRP C 1 26  ? 59.736 36.413 -4.221  1.00 12.89 ? 31  TRP A CD1 1 
ATOM   2826 C CD2 . TRP C 1 26  ? 58.991 34.316 -4.385  1.00 11.49 ? 31  TRP A CD2 1 
ATOM   2827 N NE1 . TRP C 1 26  ? 59.030 36.318 -5.377  1.00 13.07 ? 31  TRP A NE1 1 
ATOM   2828 C CE2 . TRP C 1 26  ? 58.580 35.021 -5.508  1.00 12.25 ? 31  TRP A CE2 1 
ATOM   2829 C CE3 . TRP C 1 26  ? 58.663 32.953 -4.291  1.00 12.34 ? 31  TRP A CE3 1 
ATOM   2830 C CZ2 . TRP C 1 26  ? 57.856 34.416 -6.545  1.00 13.58 ? 31  TRP A CZ2 1 
ATOM   2831 C CZ3 . TRP C 1 26  ? 57.920 32.395 -5.321  1.00 12.25 ? 31  TRP A CZ3 1 
ATOM   2832 C CH2 . TRP C 1 26  ? 57.510 33.112 -6.391  1.00 13.71 ? 31  TRP A CH2 1 
ATOM   2833 N N   . ARG C 1 27  ? 59.377 32.372 -0.110  1.00 10.48 ? 32  ARG A N   1 
ATOM   2834 C CA  . ARG C 1 27  ? 59.896 31.326 0.672   1.00 9.69  ? 32  ARG A CA  1 
ATOM   2835 C C   . ARG C 1 27  ? 60.248 30.181 -0.254  1.00 11.86 ? 32  ARG A C   1 
ATOM   2836 O O   . ARG C 1 27  ? 59.557 29.891 -1.294  1.00 13.94 ? 32  ARG A O   1 
ATOM   2837 C CB  . ARG C 1 27  ? 58.932 30.872 1.741   1.00 11.99 ? 32  ARG A CB  1 
ATOM   2838 C CG  . ARG C 1 27  ? 58.717 31.809 2.852   1.00 12.40 ? 32  ARG A CG  1 
ATOM   2839 C CD  . ARG C 1 27  ? 57.889 31.186 4.028   1.00 13.40 ? 32  ARG A CD  1 
ATOM   2840 N NE  . ARG C 1 27  ? 57.848 32.121 5.090   1.00 14.74 ? 32  ARG A NE  1 
ATOM   2841 C CZ  . ARG C 1 27  ? 57.008 33.155 5.148   1.00 16.33 ? 32  ARG A CZ  1 
ATOM   2842 N NH1 . ARG C 1 27  ? 56.005 33.302 4.336   1.00 17.38 ? 32  ARG A NH1 1 
ATOM   2843 N NH2 . ARG C 1 27  ? 57.150 33.958 6.171   1.00 21.65 ? 32  ARG A NH2 1 
ATOM   2844 N N   . GLY C 1 28  ? 61.293 29.482 0.065   1.00 9.75  ? 33  GLY A N   1 
ATOM   2845 C CA  . GLY C 1 28  ? 61.649 28.303 -0.723  1.00 10.14 ? 33  GLY A CA  1 
ATOM   2846 C C   . GLY C 1 28  ? 62.806 27.571 -0.066  1.00 9.70  ? 33  GLY A C   1 
ATOM   2847 O O   . GLY C 1 28  ? 63.227 27.922 0.996   1.00 9.56  ? 33  GLY A O   1 
ATOM   2848 N N   . LYS C 1 29  ? 63.432 26.623 -0.805  1.00 9.24  ? 34  LYS A N   1 
ATOM   2849 C CA  . LYS C 1 29  ? 64.569 25.916 -0.252  1.00 9.09  ? 34  LYS A CA  1 
ATOM   2850 C C   . LYS C 1 29  ? 65.442 25.396 -1.419  1.00 9.68  ? 34  LYS A C   1 
ATOM   2851 O O   . LYS C 1 29  ? 64.998 25.435 -2.556  1.00 11.29 ? 34  LYS A O   1 
ATOM   2852 C CB  . LYS C 1 29  ? 64.103 24.753 0.665   1.00 10.61 ? 34  LYS A CB  1 
ATOM   2853 C CG  . LYS C 1 29  ? 63.401 23.646 -0.064  1.00 12.05 ? 34  LYS A CG  1 
ATOM   2854 C CD  . LYS C 1 29  ? 62.806 22.498 0.755   1.00 17.14 ? 34  LYS A CD  1 
ATOM   2855 C CE  . LYS C 1 29  ? 63.313 22.334 2.096   1.00 16.25 ? 34  LYS A CE  1 
ATOM   2856 N NZ  . LYS C 1 29  ? 62.703 21.166 2.777   1.00 16.22 ? 34  LYS A NZ  1 
ATOM   2857 N N   . PHE C 1 30  ? 66.617 24.917 -1.098  1.00 8.73  ? 35  PHE A N   1 
ATOM   2858 C CA  . PHE C 1 30  ? 67.455 24.148 -2.001  1.00 9.30  ? 35  PHE A CA  1 
ATOM   2859 C C   . PHE C 1 30  ? 67.337 22.719 -1.645  1.00 9.80  ? 35  PHE A C   1 
ATOM   2860 O O   . PHE C 1 30  ? 67.508 22.349 -0.468  1.00 10.38 ? 35  PHE A O   1 
ATOM   2861 C CB  . PHE C 1 30  ? 68.889 24.646 -1.921  1.00 9.62  ? 35  PHE A CB  1 
ATOM   2862 C CG  . PHE C 1 30  ? 69.056 26.061 -2.377  1.00 10.09 ? 35  PHE A CG  1 
ATOM   2863 C CD1 . PHE C 1 30  ? 68.783 27.119 -1.524  1.00 10.75 ? 35  PHE A CD1 1 
ATOM   2864 C CD2 . PHE C 1 30  ? 69.470 26.305 -3.651  1.00 9.73  ? 35  PHE A CD2 1 
ATOM   2865 C CE1 . PHE C 1 30  ? 68.971 28.399 -1.967  1.00 11.61 ? 35  PHE A CE1 1 
ATOM   2866 C CE2 . PHE C 1 30  ? 69.692 27.590 -4.085  1.00 11.04 ? 35  PHE A CE2 1 
ATOM   2867 C CZ  . PHE C 1 30  ? 69.380 28.647 -3.270  1.00 11.83 ? 35  PHE A CZ  1 
ATOM   2868 N N   . ASP C 1 31  ? 67.061 21.874 -2.597  1.00 9.92  ? 36  ASP A N   1 
ATOM   2869 C CA  . ASP C 1 31  ? 66.753 20.493 -2.333  1.00 11.27 ? 36  ASP A CA  1 
ATOM   2870 C C   . ASP C 1 31  ? 67.997 19.603 -2.142  1.00 11.40 ? 36  ASP A C   1 
ATOM   2871 O O   . ASP C 1 31  ? 67.881 18.472 -1.653  1.00 11.98 ? 36  ASP A O   1 
ATOM   2872 C CB  . ASP C 1 31  ? 65.895 19.847 -3.414  1.00 12.74 ? 36  ASP A CB  1 
ATOM   2873 C CG  . ASP C 1 31  ? 64.471 20.381 -3.542  1.00 16.31 ? 36  ASP A CG  1 
ATOM   2874 O OD1 . ASP C 1 31  ? 63.985 21.141 -2.677  1.00 17.54 ? 36  ASP A OD1 1 
ATOM   2875 O OD2 . ASP C 1 31  ? 63.801 19.866 -4.543  1.00 21.50 ? 36  ASP A OD2 1 
ATOM   2876 N N   . LYS C 1 32  ? 69.183 20.008 -2.611  1.00 10.27 ? 37  LYS A N   1 
ATOM   2877 C CA  . LYS C 1 32  ? 70.349 19.127 -2.562  1.00 12.02 ? 37  LYS A CA  1 
ATOM   2878 C C   . LYS C 1 32  ? 71.529 19.803 -1.831  1.00 10.30 ? 37  LYS A C   1 
ATOM   2879 O O   . LYS C 1 32  ? 72.085 20.828 -2.330  1.00 11.03 ? 37  LYS A O   1 
ATOM   2880 C CB  . LYS C 1 32  ? 70.761 18.834 -4.013  1.00 14.67 ? 37  LYS A CB  1 
ATOM   2881 C CG  . LYS C 1 32  ? 69.781 17.939 -4.801  1.00 19.90 ? 37  LYS A CG  1 
ATOM   2882 C CD  . LYS C 1 32  ? 70.511 17.461 -6.066  1.00 27.70 ? 37  LYS A CD  1 
ATOM   2883 C CE  . LYS C 1 32  ? 71.918 16.992 -5.720  1.00 32.98 ? 37  LYS A CE  1 
ATOM   2884 N NZ  . LYS C 1 32  ? 72.790 16.241 -6.703  1.00 42.31 ? 37  LYS A NZ  1 
ATOM   2885 N N   . SER C 1 33  ? 71.914 19.190 -0.739  1.00 10.03 ? 38  SER A N   1 
ATOM   2886 C CA  . SER C 1 33  ? 73.073 19.571 0.052   1.00 10.07 ? 38  SER A CA  1 
ATOM   2887 C C   . SER C 1 33  ? 73.834 18.319 0.520   1.00 11.39 ? 38  SER A C   1 
ATOM   2888 O O   . SER C 1 33  ? 73.333 17.204 0.575   1.00 12.03 ? 38  SER A O   1 
ATOM   2889 C CB  . SER C 1 33  ? 72.609 20.375 1.284   1.00 11.13 ? 38  SER A CB  1 
ATOM   2890 O OG  . SER C 1 33  ? 71.968 21.576 0.919   1.00 12.38 ? 38  SER A OG  1 
ATOM   2891 N N   . SER C 1 34  ? 75.103 18.584 0.850   1.00 10.19 ? 39  SER A N   1 
ATOM   2892 C CA  . SER C 1 34  ? 75.899 17.521 1.442   1.00 11.34 ? 39  SER A CA  1 
ATOM   2893 C C   . SER C 1 34  ? 77.018 18.090 2.294   1.00 10.66 ? 39  SER A C   1 
ATOM   2894 O O   . SER C 1 34  ? 77.356 19.265 2.144   1.00 10.86 ? 39  SER A O   1 
ATOM   2895 C CB  . SER C 1 34  ? 76.511 16.649 0.368   1.00 14.26 ? 39  SER A CB  1 
ATOM   2896 O OG  . SER C 1 34  ? 77.386 17.378 -0.409  1.00 17.53 ? 39  SER A OG  1 
ATOM   2897 N N   . GLY C 1 35  ? 77.599 17.289 3.123   1.00 9.62  ? 40  GLY A N   1 
ATOM   2898 C CA  . GLY C 1 35  ? 78.758 17.737 3.934   1.00 10.30 ? 40  GLY A CA  1 
ATOM   2899 C C   . GLY C 1 35  ? 78.965 17.040 5.199   1.00 9.54  ? 40  GLY A C   1 
ATOM   2900 O O   . GLY C 1 35  ? 78.411 15.938 5.406   1.00 10.13 ? 40  GLY A O   1 
ATOM   2901 N N   . THR C 1 36  ? 79.754 17.615 6.100   1.00 10.31 ? 41  THR A N   1 
ATOM   2902 C CA  . THR C 1 36  ? 80.307 16.948 7.219   1.00 11.21 ? 41  THR A CA  1 
ATOM   2903 C C   . THR C 1 36  ? 80.312 17.863 8.475   1.00 10.78 ? 41  THR A C   1 
ATOM   2904 O O   . THR C 1 36  ? 80.601 19.078 8.331   1.00 10.58 ? 41  THR A O   1 
ATOM   2905 C CB  . THR C 1 36  ? 81.769 16.593 6.915   1.00 12.57 ? 41  THR A CB  1 
ATOM   2906 O OG1 . THR C 1 36  ? 81.811 15.816 5.675   1.00 15.25 ? 41  THR A OG1 1 
ATOM   2907 C CG2 . THR C 1 36  ? 82.437 15.806 8.098   1.00 13.97 ? 41  THR A CG2 1 
ATOM   2908 N N   . VAL C 1 37  ? 80.047 17.303 9.646   1.00 11.00 ? 42  VAL A N   1 
ATOM   2909 C CA  . VAL C 1 37  ? 80.151 18.006 10.885  1.00 11.20 ? 42  VAL A CA  1 
ATOM   2910 C C   . VAL C 1 37  ? 81.152 17.267 11.771  1.00 12.15 ? 42  VAL A C   1 
ATOM   2911 O O   . VAL C 1 37  ? 81.190 16.022 11.775  1.00 12.48 ? 42  VAL A O   1 
ATOM   2912 C CB  . VAL C 1 37  ? 78.801 17.956 11.626  1.00 13.24 ? 42  VAL A CB  1 
ATOM   2913 C CG1 . VAL C 1 37  ? 78.963 18.469 13.064  1.00 13.75 ? 42  VAL A CG1 1 
ATOM   2914 C CG2 . VAL C 1 37  ? 77.785 18.700 10.813  1.00 15.90 ? 42  VAL A CG2 1 
ATOM   2915 N N   . THR C 1 38  ? 81.950 18.012 12.460  1.00 11.44 ? 43  THR A N   1 
ATOM   2916 C CA  . THR C 1 38  ? 82.797 17.456 13.554  1.00 12.41 ? 43  THR A CA  1 
ATOM   2917 C C   . THR C 1 38  ? 82.351 18.071 14.857  1.00 12.82 ? 43  THR A C   1 
ATOM   2918 O O   . THR C 1 38  ? 81.993 19.235 14.915  1.00 11.58 ? 43  THR A O   1 
ATOM   2919 C CB  . THR C 1 38  ? 84.295 17.632 13.356  1.00 14.36 ? 43  THR A CB  1 
ATOM   2920 O OG1 . THR C 1 38  ? 84.692 19.000 13.559  1.00 15.53 ? 43  THR A OG1 1 
ATOM   2921 C CG2 . THR C 1 38  ? 84.763 17.113 12.044  1.00 14.79 ? 43  THR A CG2 1 
ATOM   2922 N N   . LEU C 1 39  ? 82.280 17.252 15.955  1.00 14.85 ? 44  LEU A N   1 
ATOM   2923 C CA  . LEU C 1 39  ? 81.842 17.807 17.238  1.00 17.47 ? 44  LEU A CA  1 
ATOM   2924 C C   . LEU C 1 39  ? 82.693 17.159 18.312  1.00 20.57 ? 44  LEU A C   1 
ATOM   2925 O O   . LEU C 1 39  ? 82.754 15.937 18.325  1.00 22.62 ? 44  LEU A O   1 
ATOM   2926 C CB  . LEU C 1 39  ? 80.420 17.387 17.497  1.00 20.32 ? 44  LEU A CB  1 
ATOM   2927 C CG  . LEU C 1 39  ? 79.211 18.221 17.277  1.00 25.58 ? 44  LEU A CG  1 
ATOM   2928 C CD1 . LEU C 1 39  ? 78.027 17.638 18.071  1.00 25.42 ? 44  LEU A CD1 1 
ATOM   2929 C CD2 . LEU C 1 39  ? 79.392 19.676 17.719  1.00 22.40 ? 44  LEU A CD2 1 
ATOM   2930 N N   . ASP C 1 40  ? 83.339 17.998 19.121  1.00 21.32 ? 45  ASP A N   1 
ATOM   2931 C CA  . ASP C 1 40  ? 84.062 17.520 20.355  1.00 26.08 ? 45  ASP A CA  1 
ATOM   2932 C C   . ASP C 1 40  ? 83.389 18.221 21.536  1.00 26.79 ? 45  ASP A C   1 
ATOM   2933 O O   . ASP C 1 40  ? 83.764 19.301 21.913  1.00 27.03 ? 45  ASP A O   1 
ATOM   2934 C CB  . ASP C 1 40  ? 85.515 17.856 20.269  1.00 27.60 ? 45  ASP A CB  1 
ATOM   2935 C CG  . ASP C 1 40  ? 86.293 17.288 21.542  1.00 36.16 ? 45  ASP A CG  1 
ATOM   2936 O OD1 . ASP C 1 40  ? 85.607 16.851 22.519  1.00 37.68 ? 45  ASP A OD1 1 
ATOM   2937 O OD2 . ASP C 1 40  ? 87.536 17.247 21.476  1.00 46.04 ? 45  ASP A OD2 1 
ATOM   2938 N N   A ARG C 1 41  ? 82.363 17.567 22.067  0.50 29.95 ? 46  ARG A N   1 
ATOM   2939 N N   B ARG C 1 41  ? 82.342 17.614 22.063  0.50 30.18 ? 46  ARG A N   1 
ATOM   2940 C CA  A ARG C 1 41  ? 81.478 18.153 23.070  0.50 33.73 ? 46  ARG A CA  1 
ATOM   2941 C CA  B ARG C 1 41  ? 81.573 18.190 23.164  0.50 33.91 ? 46  ARG A CA  1 
ATOM   2942 C C   A ARG C 1 41  ? 82.184 18.365 24.454  0.50 39.06 ? 46  ARG A C   1 
ATOM   2943 C C   B ARG C 1 41  ? 82.461 18.580 24.336  0.50 37.73 ? 46  ARG A C   1 
ATOM   2944 O O   A ARG C 1 41  ? 81.731 19.229 25.235  0.50 38.12 ? 46  ARG A O   1 
ATOM   2945 O O   B ARG C 1 41  ? 82.428 19.708 24.876  0.50 30.23 ? 46  ARG A O   1 
ATOM   2946 C CB  A ARG C 1 41  ? 80.150 17.340 23.171  0.50 34.15 ? 46  ARG A CB  1 
ATOM   2947 C CB  B ARG C 1 41  ? 80.600 17.147 23.676  0.50 36.65 ? 46  ARG A CB  1 
ATOM   2948 C CG  A ARG C 1 41  ? 79.201 17.376 21.937  0.50 34.04 ? 46  ARG A CG  1 
ATOM   2949 C CG  B ARG C 1 41  ? 79.330 17.014 22.880  0.50 35.48 ? 46  ARG A CG  1 
ATOM   2950 C CD  A ARG C 1 41  ? 77.884 16.576 22.070  0.50 32.31 ? 46  ARG A CD  1 
ATOM   2951 C CD  B ARG C 1 41  ? 79.008 15.547 22.706  0.50 32.88 ? 46  ARG A CD  1 
ATOM   2952 N NE  A ARG C 1 41  ? 76.923 17.205 22.974  0.50 31.97 ? 46  ARG A NE  1 
ATOM   2953 N NE  B ARG C 1 41  ? 77.828 15.387 21.868  0.50 33.09 ? 46  ARG A NE  1 
ATOM   2954 C CZ  A ARG C 1 41  ? 75.761 16.703 23.346  0.50 28.99 ? 46  ARG A CZ  1 
ATOM   2955 C CZ  B ARG C 1 41  ? 77.813 14.823 20.673  0.50 29.86 ? 46  ARG A CZ  1 
ATOM   2956 N NH1 A ARG C 1 41  ? 75.338 15.523 22.902  0.50 30.37 ? 46  ARG A NH1 1 
ATOM   2957 N NH1 B ARG C 1 41  ? 78.923 14.338 20.115  0.50 26.16 ? 46  ARG A NH1 1 
ATOM   2958 N NH2 A ARG C 1 41  ? 75.004 17.417 24.163  0.50 30.17 ? 46  ARG A NH2 1 
ATOM   2959 N NH2 B ARG C 1 41  ? 76.655 14.722 20.065  0.50 29.80 ? 46  ARG A NH2 1 
ATOM   2960 N N   . ALA C 1 42  ? 83.274 17.627 24.733  1.00 43.49 ? 47  ALA A N   1 
ATOM   2961 C CA  . ALA C 1 42  ? 84.116 17.828 25.931  1.00 45.90 ? 47  ALA A CA  1 
ATOM   2962 C C   . ALA C 1 42  ? 84.905 19.127 25.813  1.00 44.69 ? 47  ALA A C   1 
ATOM   2963 O O   . ALA C 1 42  ? 84.850 19.987 26.714  1.00 43.50 ? 47  ALA A O   1 
ATOM   2964 C CB  . ALA C 1 42  ? 85.063 16.657 26.110  1.00 44.83 ? 47  ALA A CB  1 
ATOM   2965 N N   . ALA C 1 43  ? 85.583 19.282 24.668  1.00 36.37 ? 48  ALA A N   1 
ATOM   2966 C CA  . ALA C 1 43  ? 86.353 20.460 24.338  1.00 29.05 ? 48  ALA A CA  1 
ATOM   2967 C C   . ALA C 1 43  ? 85.524 21.661 23.904  1.00 27.65 ? 48  ALA A C   1 
ATOM   2968 O O   . ALA C 1 43  ? 86.072 22.699 23.610  1.00 29.15 ? 48  ALA A O   1 
ATOM   2969 C CB  . ALA C 1 43  ? 87.347 20.135 23.277  1.00 31.74 ? 48  ALA A CB  1 
ATOM   2970 N N   . LYS C 1 44  ? 84.229 21.444 23.764  1.00 26.30 ? 49  LYS A N   1 
ATOM   2971 C CA  . LYS C 1 44  ? 83.288 22.452 23.389  1.00 25.73 ? 49  LYS A CA  1 
ATOM   2972 C C   . LYS C 1 44  ? 83.716 23.088 22.064  1.00 21.66 ? 49  LYS A C   1 
ATOM   2973 O O   . LYS C 1 44  ? 83.860 24.279 21.944  1.00 19.26 ? 49  LYS A O   1 
ATOM   2974 C CB  . LYS C 1 44  ? 83.103 23.516 24.512  1.00 28.64 ? 49  LYS A CB  1 
ATOM   2975 C CG  . LYS C 1 44  ? 82.310 22.983 25.714  1.00 36.28 ? 49  LYS A CG  1 
ATOM   2976 C CD  . LYS C 1 44  ? 82.760 23.520 27.085  1.00 45.87 ? 49  LYS A CD  1 
ATOM   2977 C CE  . LYS C 1 44  ? 83.096 24.997 27.117  1.00 47.62 ? 49  LYS A CE  1 
ATOM   2978 N NZ  . LYS C 1 44  ? 82.078 25.852 26.437  1.00 49.86 ? 49  LYS A NZ  1 
ATOM   2979 N N   . THR C 1 45  ? 83.945 22.251 21.054  1.00 20.24 ? 50  THR A N   1 
ATOM   2980 C CA  . THR C 1 45  ? 84.190 22.830 19.726  1.00 19.46 ? 50  THR A CA  1 
ATOM   2981 C C   . THR C 1 45  ? 83.617 21.857 18.695  1.00 17.47 ? 50  THR A C   1 
ATOM   2982 O O   . THR C 1 45  ? 83.181 20.766 18.939  1.00 17.24 ? 50  THR A O   1 
ATOM   2983 C CB  . THR C 1 45  ? 85.697 23.105 19.509  1.00 23.35 ? 50  THR A CB  1 
ATOM   2984 O OG1 . THR C 1 45  ? 85.967 23.868 18.276  1.00 25.45 ? 50  THR A OG1 1 
ATOM   2985 C CG2 . THR C 1 45  ? 86.430 21.782 19.590  1.00 24.99 ? 50  THR A CG2 1 
ATOM   2986 N N   . GLY C 1 46  ? 83.567 22.374 17.498  1.00 14.31 ? 51  GLY A N   1 
ATOM   2987 C CA  . GLY C 1 46  ? 83.170 21.587 16.384  1.00 13.09 ? 51  GLY A CA  1 
ATOM   2988 C C   . GLY C 1 46  ? 83.246 22.397 15.096  1.00 11.06 ? 51  GLY A C   1 
ATOM   2989 O O   . GLY C 1 46  ? 83.600 23.572 15.149  1.00 9.94  ? 51  GLY A O   1 
ATOM   2990 N N   . THR C 1 47  ? 83.009 21.775 13.928  1.00 10.53 ? 52  THR A N   1 
ATOM   2991 C CA  . THR C 1 47  ? 83.049 22.469 12.659  1.00 9.99  ? 52  THR A CA  1 
ATOM   2992 C C   . THR C 1 47  ? 81.914 21.944 11.748  1.00 10.27 ? 52  THR A C   1 
ATOM   2993 O O   . THR C 1 47  ? 81.479 20.838 11.907  1.00 10.34 ? 52  THR A O   1 
ATOM   2994 C CB  . THR C 1 47  ? 84.375 22.365 11.876  1.00 11.16 ? 52  THR A CB  1 
ATOM   2995 O OG1 . THR C 1 47  ? 84.579 20.962 11.554  1.00 12.18 ? 52  THR A OG1 1 
ATOM   2996 C CG2 . THR C 1 47  ? 85.526 22.870 12.684  1.00 12.05 ? 52  THR A CG2 1 
ATOM   2997 N N   . VAL C 1 48  ? 81.661 22.707 10.740  1.00 9.50  ? 53  VAL A N   1 
ATOM   2998 C CA  . VAL C 1 48  ? 80.720 22.400 9.660   1.00 10.02 ? 53  VAL A CA  1 
ATOM   2999 C C   . VAL C 1 48  ? 81.404 22.699 8.353   1.00 10.08 ? 53  VAL A C   1 
ATOM   3000 O O   . VAL C 1 48  ? 82.051 23.758 8.211   1.00 10.08 ? 53  VAL A O   1 
ATOM   3001 C CB  . VAL C 1 48  ? 79.476 23.278 9.742   1.00 11.57 ? 53  VAL A CB  1 
ATOM   3002 C CG1 . VAL C 1 48  ? 78.479 23.047 8.574   1.00 13.89 ? 53  VAL A CG1 1 
ATOM   3003 C CG2 . VAL C 1 48  ? 78.719 22.992 11.008  1.00 13.51 ? 53  VAL A CG2 1 
ATOM   3004 N N   . ASP C 1 49  ? 81.150 21.805 7.374   1.00 9.72  ? 54  ASP A N   1 
ATOM   3005 C CA  . ASP C 1 49  ? 81.558 22.055 5.985   1.00 10.98 ? 54  ASP A CA  1 
ATOM   3006 C C   . ASP C 1 49  ? 80.402 21.527 5.118   1.00 10.29 ? 54  ASP A C   1 
ATOM   3007 O O   . ASP C 1 49  ? 80.066 20.341 5.218   1.00 12.08 ? 54  ASP A O   1 
ATOM   3008 C CB  . ASP C 1 49  ? 82.799 21.275 5.602   1.00 14.84 ? 54  ASP A CB  1 
ATOM   3009 C CG  . ASP C 1 49  ? 83.174 21.506 4.152   1.00 24.23 ? 54  ASP A CG  1 
ATOM   3010 O OD1 . ASP C 1 49  ? 83.090 22.695 3.700   1.00 27.60 ? 54  ASP A OD1 1 
ATOM   3011 O OD2 . ASP C 1 49  ? 83.792 20.566 3.571   1.00 32.95 ? 54  ASP A OD2 1 
ATOM   3012 N N   . VAL C 1 50  ? 79.712 22.408 4.446   1.00 8.88  ? 55  VAL A N   1 
ATOM   3013 C CA  . VAL C 1 50  ? 78.464 22.022 3.715   1.00 10.27 ? 55  VAL A CA  1 
ATOM   3014 C C   . VAL C 1 50  ? 78.447 22.694 2.332   1.00 10.57 ? 55  VAL A C   1 
ATOM   3015 O O   . VAL C 1 50  ? 78.893 23.858 2.178   1.00 10.00 ? 55  VAL A O   1 
ATOM   3016 C CB  . VAL C 1 50  ? 77.260 22.354 4.572   1.00 11.84 ? 55  VAL A CB  1 
ATOM   3017 C CG1 . VAL C 1 50  ? 77.131 23.793 4.939   1.00 12.16 ? 55  VAL A CG1 1 
ATOM   3018 C CG2 . VAL C 1 50  ? 75.996 21.805 4.013   1.00 13.01 ? 55  VAL A CG2 1 
ATOM   3019 N N   . THR C 1 51  ? 77.881 21.986 1.347   1.00 10.30 ? 56  THR A N   1 
ATOM   3020 C CA  . THR C 1 51  ? 77.815 22.463 -0.000  1.00 10.58 ? 56  THR A CA  1 
ATOM   3021 C C   . THR C 1 51  ? 76.385 22.264 -0.493  1.00 10.53 ? 56  THR A C   1 
ATOM   3022 O O   . THR C 1 51  ? 75.785 21.187 -0.210  1.00 12.24 ? 56  THR A O   1 
ATOM   3023 C CB  . THR C 1 51  ? 78.799 21.665 -0.894  1.00 12.69 ? 56  THR A CB  1 
ATOM   3024 O OG1 . THR C 1 51  ? 80.157 21.939 -0.351  1.00 14.40 ? 56  THR A OG1 1 
ATOM   3025 C CG2 . THR C 1 51  ? 78.707 22.150 -2.281  1.00 16.24 ? 56  THR A CG2 1 
ATOM   3026 N N   . THR C 1 52  ? 75.789 23.230 -1.137  1.00 10.32 ? 57  THR A N   1 
ATOM   3027 C CA  . THR C 1 52  ? 74.436 23.151 -1.672  1.00 11.00 ? 57  THR A CA  1 
ATOM   3028 C C   . THR C 1 52  ? 74.444 23.445 -3.177  1.00 10.98 ? 57  THR A C   1 
ATOM   3029 O O   . THR C 1 52  ? 75.227 24.306 -3.652  1.00 10.78 ? 57  THR A O   1 
ATOM   3030 C CB  . THR C 1 52  ? 73.573 24.253 -0.927  1.00 12.90 ? 57  THR A CB  1 
ATOM   3031 O OG1 . THR C 1 52  ? 73.515 23.947 0.482   1.00 13.41 ? 57  THR A OG1 1 
ATOM   3032 C CG2 . THR C 1 52  ? 72.184 24.394 -1.422  1.00 14.33 ? 57  THR A CG2 1 
ATOM   3033 N N   . ASP C 1 53  ? 73.648 22.677 -3.944  1.00 10.40 ? 58  ASP A N   1 
ATOM   3034 C CA  . ASP C 1 53  ? 73.543 22.864 -5.351  1.00 11.68 ? 58  ASP A CA  1 
ATOM   3035 C C   . ASP C 1 53  ? 72.550 23.925 -5.747  1.00 11.04 ? 58  ASP A C   1 
ATOM   3036 O O   . ASP C 1 53  ? 71.394 23.878 -5.444  1.00 10.79 ? 58  ASP A O   1 
ATOM   3037 C CB  . ASP C 1 53  ? 73.188 21.538 -5.970  1.00 14.23 ? 58  ASP A CB  1 
ATOM   3038 C CG  . ASP C 1 53  ? 74.313 20.534 -5.897  1.00 21.63 ? 58  ASP A CG  1 
ATOM   3039 O OD1 . ASP C 1 53  ? 75.461 20.806 -5.417  1.00 26.47 ? 58  ASP A OD1 1 
ATOM   3040 O OD2 . ASP C 1 53  ? 74.042 19.402 -6.400  1.00 29.84 ? 58  ASP A OD2 1 
ATOM   3041 N N   . ILE C 1 54  ? 73.020 24.946 -6.434  1.00 10.63 ? 59  ILE A N   1 
ATOM   3042 C CA  . ILE C 1 54  ? 72.190 26.029 -6.829  1.00 10.57 ? 59  ILE A CA  1 
ATOM   3043 C C   . ILE C 1 54  ? 71.014 25.634 -7.740  1.00 11.28 ? 59  ILE A C   1 
ATOM   3044 O O   . ILE C 1 54  ? 69.895 26.168 -7.656  1.00 11.19 ? 59  ILE A O   1 
ATOM   3045 C CB  . ILE C 1 54  ? 73.014 27.166 -7.538  1.00 11.11 ? 59  ILE A CB  1 
ATOM   3046 C CG1 . ILE C 1 54  ? 74.009 27.747 -6.510  1.00 11.12 ? 59  ILE A CG1 1 
ATOM   3047 C CG2 . ILE C 1 54  ? 72.130 28.249 -8.172  1.00 12.03 ? 59  ILE A CG2 1 
ATOM   3048 C CD1 . ILE C 1 54  ? 73.373 28.528 -5.349  1.00 12.17 ? 59  ILE A CD1 1 
ATOM   3049 N N   . ALA C 1 55  ? 71.257 24.647 -8.577  1.00 10.67 ? 60  ALA A N   1 
ATOM   3050 C CA  . ALA C 1 55  ? 70.241 24.182 -9.489  1.00 11.34 ? 60  ALA A CA  1 
ATOM   3051 C C   . ALA C 1 55  ? 69.075 23.445 -8.799  1.00 11.41 ? 60  ALA A C   1 
ATOM   3052 O O   . ALA C 1 55  ? 68.045 23.247 -9.447  1.00 13.07 ? 60  ALA A O   1 
ATOM   3053 C CB  . ALA C 1 55  ? 70.840 23.230 -10.485 1.00 12.50 ? 60  ALA A CB  1 
ATOM   3054 N N   . SER C 1 56  ? 69.264 23.171 -7.496  1.00 9.74  ? 61  SER A N   1 
ATOM   3055 C CA  . SER C 1 56  ? 68.229 22.527 -6.701  1.00 9.65  ? 61  SER A CA  1 
ATOM   3056 C C   . SER C 1 56  ? 67.230 23.431 -6.062  1.00 9.21  ? 61  SER A C   1 
ATOM   3057 O O   . SER C 1 56  ? 66.393 22.960 -5.283  1.00 9.97  ? 61  SER A O   1 
ATOM   3058 C CB  . SER C 1 56  ? 68.866 21.596 -5.638  1.00 10.07 ? 61  SER A CB  1 
ATOM   3059 O OG  . SER C 1 56  ? 69.481 22.246 -4.512  1.00 10.18 ? 61  SER A OG  1 
ATOM   3060 N N   . ILE C 1 57  ? 67.279 24.693 -6.370  1.00 9.99  ? 62  ILE A N   1 
ATOM   3061 C CA  . ILE C 1 57  ? 66.364 25.678 -5.769  1.00 11.20 ? 62  ILE A CA  1 
ATOM   3062 C C   . ILE C 1 57  ? 64.934 25.386 -6.171  1.00 12.14 ? 62  ILE A C   1 
ATOM   3063 O O   . ILE C 1 57  ? 64.650 24.950 -7.288  1.00 13.01 ? 62  ILE A O   1 
ATOM   3064 C CB  . ILE C 1 57  ? 66.713 27.127 -6.111  1.00 12.77 ? 62  ILE A CB  1 
ATOM   3065 C CG1 . ILE C 1 57  ? 66.078 28.074 -5.116  1.00 12.95 ? 62  ILE A CG1 1 
ATOM   3066 C CG2 . ILE C 1 57  ? 66.312 27.495 -7.504  1.00 13.68 ? 62  ILE A CG2 1 
ATOM   3067 C CD1 . ILE C 1 57  ? 66.467 29.528 -5.287  1.00 12.61 ? 62  ILE A CD1 1 
ATOM   3068 N N   A HIS C 1 58  ? 64.027 25.515 -5.171  0.50 11.12 ? 63  HIS A N   1 
ATOM   3069 N N   B HIS C 1 58  ? 63.992 25.606 -5.242  0.50 11.40 ? 63  HIS A N   1 
ATOM   3070 C CA  A HIS C 1 58  ? 62.553 25.422 -5.365  0.50 11.56 ? 63  HIS A CA  1 
ATOM   3071 C CA  B HIS C 1 58  ? 62.572 25.455 -5.579  0.50 11.86 ? 63  HIS A CA  1 
ATOM   3072 C C   A HIS C 1 58  ? 61.914 26.665 -4.736  0.50 11.21 ? 63  HIS A C   1 
ATOM   3073 C C   B HIS C 1 58  ? 61.815 26.509 -4.775  0.50 11.41 ? 63  HIS A C   1 
ATOM   3074 O O   A HIS C 1 58  ? 62.111 26.934 -3.616  0.50 11.25 ? 63  HIS A O   1 
ATOM   3075 O O   B HIS C 1 58  ? 61.794 26.414 -3.576  0.50 10.97 ? 63  HIS A O   1 
ATOM   3076 C CB  A HIS C 1 58  ? 61.934 24.207 -4.657  0.50 11.80 ? 63  HIS A CB  1 
ATOM   3077 C CB  B HIS C 1 58  ? 62.056 24.043 -5.248  0.50 12.62 ? 63  HIS A CB  1 
ATOM   3078 C CG  A HIS C 1 58  ? 60.483 23.936 -5.049  0.50 12.95 ? 63  HIS A CG  1 
ATOM   3079 C CG  B HIS C 1 58  ? 62.618 22.999 -6.154  0.50 14.25 ? 63  HIS A CG  1 
ATOM   3080 N ND1 A HIS C 1 58  ? 59.383 24.312 -4.287  0.50 15.36 ? 63  HIS A ND1 1 
ATOM   3081 N ND1 B HIS C 1 58  ? 62.006 22.586 -7.336  0.50 16.84 ? 63  HIS A ND1 1 
ATOM   3082 C CD2 A HIS C 1 58  ? 59.987 23.343 -6.153  0.50 14.50 ? 63  HIS A CD2 1 
ATOM   3083 C CD2 B HIS C 1 58  ? 63.786 22.326 -6.076  0.50 14.62 ? 63  HIS A CD2 1 
ATOM   3084 C CE1 A HIS C 1 58  ? 58.283 24.006 -4.931  0.50 13.20 ? 63  HIS A CE1 1 
ATOM   3085 C CE1 B HIS C 1 58  ? 62.800 21.704 -7.931  0.50 16.73 ? 63  HIS A CE1 1 
ATOM   3086 N NE2 A HIS C 1 58  ? 58.617 23.386 -6.064  0.50 14.22 ? 63  HIS A NE2 1 
ATOM   3087 N NE2 B HIS C 1 58  ? 63.908 21.567 -7.194  0.50 15.95 ? 63  HIS A NE2 1 
ATOM   3088 N N   . THR C 1 59  ? 61.192 27.449 -5.512  1.00 11.38 ? 64  THR A N   1 
ATOM   3089 C CA  . THR C 1 59  ? 60.497 28.576 -4.948  1.00 12.32 ? 64  THR A CA  1 
ATOM   3090 C C   . THR C 1 59  ? 58.968 28.380 -5.070  1.00 13.08 ? 64  THR A C   1 
ATOM   3091 O O   . THR C 1 59  ? 58.272 29.225 -4.485  1.00 16.01 ? 64  THR A O   1 
ATOM   3092 C CB  . THR C 1 59  ? 60.826 29.843 -5.718  1.00 12.88 ? 64  THR A CB  1 
ATOM   3093 O OG1 . THR C 1 59  ? 60.407 29.692 -7.088  1.00 13.20 ? 64  THR A OG1 1 
ATOM   3094 C CG2 . THR C 1 59  ? 62.310 30.161 -5.748  1.00 14.03 ? 64  THR A CG2 1 
ATOM   3095 N N   . GLY C 1 60  ? 58.508 27.359 -5.779  1.00 13.44 ? 65  GLY A N   1 
ATOM   3096 C CA  . GLY C 1 60  ? 57.086 27.206 -6.153  1.00 13.64 ? 65  GLY A CA  1 
ATOM   3097 C C   . GLY C 1 60  ? 56.725 27.732 -7.481  1.00 13.90 ? 65  GLY A C   1 
ATOM   3098 O O   . GLY C 1 60  ? 55.700 27.449 -8.043  1.00 13.11 ? 65  GLY A O   1 
ATOM   3099 N N   . SER C 1 61  ? 57.659 28.467 -8.087  1.00 13.85 ? 66  SER A N   1 
ATOM   3100 C CA  . SER C 1 61  ? 57.523 29.030 -9.395  1.00 13.77 ? 66  SER A CA  1 
ATOM   3101 C C   . SER C 1 61  ? 58.666 28.581 -10.335 1.00 14.60 ? 66  SER A C   1 
ATOM   3102 O O   . SER C 1 61  ? 59.804 28.957 -10.078 1.00 14.08 ? 66  SER A O   1 
ATOM   3103 C CB  . SER C 1 61  ? 57.512 30.531 -9.353  1.00 13.87 ? 66  SER A CB  1 
ATOM   3104 O OG  . SER C 1 61  ? 57.600 31.143 -10.633 1.00 16.31 ? 66  SER A OG  1 
ATOM   3105 N N   . ALA C 1 62  ? 58.346 27.723 -11.277 1.00 15.84 ? 67  ALA A N   1 
ATOM   3106 C CA  . ALA C 1 62  ? 59.399 27.240 -12.154 1.00 14.95 ? 67  ALA A CA  1 
ATOM   3107 C C   . ALA C 1 62  ? 60.036 28.333 -12.909 1.00 14.68 ? 67  ALA A C   1 
ATOM   3108 O O   . ALA C 1 62  ? 61.261 28.254 -13.220 1.00 13.73 ? 67  ALA A O   1 
ATOM   3109 C CB  . ALA C 1 62  ? 58.821 26.186 -13.156 1.00 17.74 ? 67  ALA A CB  1 
ATOM   3110 N N   . LYS C 1 63  ? 59.268 29.344 -13.319 1.00 14.97 ? 68  LYS A N   1 
ATOM   3111 C CA  . LYS C 1 63  ? 59.792 30.436 -14.044 1.00 15.43 ? 68  LYS A CA  1 
ATOM   3112 C C   . LYS C 1 63  ? 60.833 31.195 -13.218 1.00 14.21 ? 68  LYS A C   1 
ATOM   3113 O O   . LYS C 1 63  ? 61.865 31.602 -13.735 1.00 13.25 ? 68  LYS A O   1 
ATOM   3114 C CB  . LYS C 1 63  ? 58.702 31.345 -14.663 1.00 19.99 ? 68  LYS A CB  1 
ATOM   3115 C CG  . LYS C 1 63  ? 58.248 32.517 -13.914 1.00 25.61 ? 68  LYS A CG  1 
ATOM   3116 C CD  . LYS C 1 63  ? 57.268 33.374 -14.746 1.00 26.90 ? 68  LYS A CD  1 
ATOM   3117 C CE  . LYS C 1 63  ? 56.691 34.526 -13.878 1.00 32.34 ? 68  LYS A CE  1 
ATOM   3118 N NZ  . LYS C 1 63  ? 57.730 35.571 -13.552 1.00 34.94 ? 68  LYS A NZ  1 
ATOM   3119 N N   . LEU C 1 64  ? 60.562 31.366 -11.913 1.00 12.27 ? 69  LEU A N   1 
ATOM   3120 C CA  . LEU C 1 64  ? 61.509 32.032 -11.071 1.00 11.78 ? 69  LEU A CA  1 
ATOM   3121 C C   . LEU C 1 64  ? 62.704 31.188 -10.813 1.00 11.56 ? 69  LEU A C   1 
ATOM   3122 O O   . LEU C 1 64  ? 63.856 31.689 -10.861 1.00 12.18 ? 69  LEU A O   1 
ATOM   3123 C CB  . LEU C 1 64  ? 60.884 32.462 -9.732  1.00 11.19 ? 69  LEU A CB  1 
ATOM   3124 C CG  . LEU C 1 64  ? 61.854 33.077 -8.761  1.00 10.81 ? 69  LEU A CG  1 
ATOM   3125 C CD1 . LEU C 1 64  ? 62.435 34.339 -9.229  1.00 12.79 ? 69  LEU A CD1 1 
ATOM   3126 C CD2 . LEU C 1 64  ? 61.051 33.436 -7.480  1.00 12.05 ? 69  LEU A CD2 1 
ATOM   3127 N N   . ASP C 1 65  ? 62.538 29.897 -10.544 1.00 11.32 ? 70  ASP A N   1 
ATOM   3128 C CA  . ASP C 1 65  ? 63.661 29.010 -10.343 1.00 11.85 ? 70  ASP A CA  1 
ATOM   3129 C C   . ASP C 1 65  ? 64.651 29.123 -11.538 1.00 11.72 ? 70  ASP A C   1 
ATOM   3130 O O   . ASP C 1 65  ? 65.839 29.141 -11.303 1.00 12.82 ? 70  ASP A O   1 
ATOM   3131 C CB  . ASP C 1 65  ? 63.244 27.595 -10.239 1.00 12.58 ? 70  ASP A CB  1 
ATOM   3132 C CG  . ASP C 1 65  ? 62.368 27.248 -9.064  1.00 16.07 ? 70  ASP A CG  1 
ATOM   3133 O OD1 . ASP C 1 65  ? 62.286 28.016 -8.106  1.00 17.65 ? 70  ASP A OD1 1 
ATOM   3134 O OD2 . ASP C 1 65  ? 61.794 26.067 -9.186  1.00 19.72 ? 70  ASP A OD2 1 
ATOM   3135 N N   . GLU C 1 66  ? 64.129 29.187 -12.771 1.00 11.15 ? 71  GLU A N   1 
ATOM   3136 C CA  . GLU C 1 66  ? 65.059 29.201 -13.900 1.00 12.02 ? 71  GLU A CA  1 
ATOM   3137 C C   . GLU C 1 66  ? 65.654 30.556 -14.047 1.00 12.47 ? 71  GLU A C   1 
ATOM   3138 O O   . GLU C 1 66  ? 66.884 30.652 -14.353 1.00 13.77 ? 71  GLU A O   1 
ATOM   3139 C CB  . GLU C 1 66  ? 64.295 28.738 -15.144 1.00 14.40 ? 71  GLU A CB  1 
ATOM   3140 C CG  . GLU C 1 66  ? 65.120 28.812 -16.415 1.00 17.35 ? 71  GLU A CG  1 
ATOM   3141 C CD  . GLU C 1 66  ? 66.567 28.368 -16.401 1.00 23.01 ? 71  GLU A CD  1 
ATOM   3142 O OE1 . GLU C 1 66  ? 66.818 27.250 -15.776 1.00 24.39 ? 71  GLU A OE1 1 
ATOM   3143 O OE2 . GLU C 1 66  ? 67.475 29.065 -17.054 1.00 23.69 ? 71  GLU A OE2 1 
ATOM   3144 N N   . HIS C 1 67  ? 64.893 31.672 -13.806 1.00 12.56 ? 72  HIS A N   1 
ATOM   3145 C CA  . HIS C 1 67  ? 65.455 32.945 -13.900 1.00 13.96 ? 72  HIS A CA  1 
ATOM   3146 C C   . HIS C 1 67  ? 66.623 33.090 -12.892 1.00 12.47 ? 72  HIS A C   1 
ATOM   3147 O O   . HIS C 1 67  ? 67.646 33.686 -13.162 1.00 13.49 ? 72  HIS A O   1 
ATOM   3148 C CB  . HIS C 1 67  ? 64.393 33.994 -13.561 1.00 16.26 ? 72  HIS A CB  1 
ATOM   3149 C CG  . HIS C 1 67  ? 64.986 35.343 -13.374 1.00 19.90 ? 72  HIS A CG  1 
ATOM   3150 N ND1 . HIS C 1 67  ? 65.325 36.159 -14.428 1.00 25.60 ? 72  HIS A ND1 1 
ATOM   3151 C CD2 . HIS C 1 67  ? 65.434 35.975 -12.256 1.00 25.14 ? 72  HIS A CD2 1 
ATOM   3152 C CE1 . HIS C 1 67  ? 65.827 37.286 -13.973 1.00 25.16 ? 72  HIS A CE1 1 
ATOM   3153 N NE2 . HIS C 1 67  ? 65.950 37.182 -12.663 1.00 28.86 ? 72  HIS A NE2 1 
ATOM   3154 N N   . LEU C 1 68  ? 66.481 32.513 -11.737 1.00 11.32 ? 73  LEU A N   1 
ATOM   3155 C CA  . LEU C 1 68  ? 67.536 32.643 -10.683 1.00 11.37 ? 73  LEU A CA  1 
ATOM   3156 C C   . LEU C 1 68  ? 68.848 31.980 -11.062 1.00 11.33 ? 73  LEU A C   1 
ATOM   3157 O O   . LEU C 1 68  ? 69.899 32.315 -10.509 1.00 11.47 ? 73  LEU A O   1 
ATOM   3158 C CB  . LEU C 1 68  ? 67.049 32.190 -9.318  1.00 11.64 ? 73  LEU A CB  1 
ATOM   3159 C CG  . LEU C 1 68  ? 65.973 33.063 -8.722  1.00 13.69 ? 73  LEU A CG  1 
ATOM   3160 C CD1 . LEU C 1 68  ? 65.376 32.354 -7.498  1.00 14.42 ? 73  LEU A CD1 1 
ATOM   3161 C CD2 . LEU C 1 68  ? 66.364 34.464 -8.463  1.00 15.27 ? 73  LEU A CD2 1 
ATOM   3162 N N   A GLN C 1 69  ? 68.765 30.973 -11.935 0.50 10.04 ? 74  GLN A N   1 
ATOM   3163 N N   B GLN C 1 69  ? 68.781 30.974 -11.941 0.50 11.96 ? 74  GLN A N   1 
ATOM   3164 C CA  A GLN C 1 69  ? 69.981 30.281 -12.432 0.50 9.86  ? 74  GLN A CA  1 
ATOM   3165 C CA  B GLN C 1 69  ? 70.030 30.305 -12.371 0.50 13.34 ? 74  GLN A CA  1 
ATOM   3166 C C   A GLN C 1 69  ? 70.840 31.143 -13.350 0.50 10.65 ? 74  GLN A C   1 
ATOM   3167 C C   B GLN C 1 69  ? 70.824 31.103 -13.379 0.50 12.63 ? 74  GLN A C   1 
ATOM   3168 O O   A GLN C 1 69  ? 72.067 30.887 -13.511 0.50 10.69 ? 74  GLN A O   1 
ATOM   3169 O O   B GLN C 1 69  ? 71.990 30.737 -13.637 0.50 12.75 ? 74  GLN A O   1 
ATOM   3170 C CB  A GLN C 1 69  ? 69.522 29.110 -13.204 0.50 9.23  ? 74  GLN A CB  1 
ATOM   3171 C CB  B GLN C 1 69  ? 69.752 28.998 -13.016 0.50 15.23 ? 74  GLN A CB  1 
ATOM   3172 C CG  A GLN C 1 69  ? 68.768 28.076 -12.449 0.50 8.49  ? 74  GLN A CG  1 
ATOM   3173 C CG  B GLN C 1 69  ? 68.519 28.252 -12.625 0.50 17.49 ? 74  GLN A CG  1 
ATOM   3174 C CD  A GLN C 1 69  ? 69.417 27.659 -11.213 0.50 7.60  ? 74  GLN A CD  1 
ATOM   3175 C CD  B GLN C 1 69  ? 68.884 26.975 -11.934 0.50 19.47 ? 74  GLN A CD  1 
ATOM   3176 O OE1 A GLN C 1 69  ? 70.559 27.065 -11.174 0.50 7.21  ? 74  GLN A OE1 1 
ATOM   3177 O OE1 B GLN C 1 69  ? 70.030 26.830 -11.476 0.50 20.50 ? 74  GLN A OE1 1 
ATOM   3178 N NE2 A GLN C 1 69  ? 68.657 27.794 -10.147 0.50 7.08  ? 74  GLN A NE2 1 
ATOM   3179 N NE2 B GLN C 1 69  ? 67.925 26.026 -11.853 0.50 26.31 ? 74  GLN A NE2 1 
ATOM   3180 N N   . THR C 1 70  ? 70.221 32.116 -13.994 1.00 12.26 ? 75  THR A N   1 
ATOM   3181 C CA  . THR C 1 70  ? 70.886 32.865 -15.056 1.00 13.18 ? 75  THR A CA  1 
ATOM   3182 C C   . THR C 1 70  ? 71.937 33.808 -14.542 1.00 14.43 ? 75  THR A C   1 
ATOM   3183 O O   . THR C 1 70  ? 72.078 34.017 -13.315 1.00 13.62 ? 75  THR A O   1 
ATOM   3184 C CB  . THR C 1 70  ? 69.871 33.673 -15.870 1.00 13.48 ? 75  THR A CB  1 
ATOM   3185 O OG1 . THR C 1 70  ? 69.448 34.810 -15.117 1.00 14.50 ? 75  THR A OG1 1 
ATOM   3186 C CG2 . THR C 1 70  ? 68.711 32.911 -16.385 1.00 14.34 ? 75  THR A CG2 1 
ATOM   3187 N N   . ALA C 1 71  ? 72.739 34.401 -15.480 1.00 15.83 ? 76  ALA A N   1 
ATOM   3188 C CA  . ALA C 1 71  ? 73.709 35.417 -15.072 1.00 17.57 ? 76  ALA A CA  1 
ATOM   3189 C C   . ALA C 1 71  ? 73.154 36.675 -14.443 1.00 17.55 ? 76  ALA A C   1 
ATOM   3190 O O   . ALA C 1 71  ? 73.906 37.435 -13.773 1.00 20.22 ? 76  ALA A O   1 
ATOM   3191 C CB  . ALA C 1 71  ? 74.592 35.793 -16.230 1.00 17.60 ? 76  ALA A CB  1 
ATOM   3192 N N   . GLU C 1 72  ? 71.842 36.854 -14.543 1.00 18.20 ? 77  GLU A N   1 
ATOM   3193 C CA  . GLU C 1 72  ? 71.150 37.945 -13.864 1.00 20.02 ? 77  GLU A CA  1 
ATOM   3194 C C   . GLU C 1 72  ? 71.077 37.702 -12.337 1.00 17.67 ? 77  GLU A C   1 
ATOM   3195 O O   . GLU C 1 72  ? 70.725 38.589 -11.556 1.00 19.26 ? 77  GLU A O   1 
ATOM   3196 C CB  . GLU C 1 72  ? 69.755 38.147 -14.491 1.00 23.99 ? 77  GLU A CB  1 
ATOM   3197 C CG  . GLU C 1 72  ? 69.861 38.674 -15.909 1.00 33.03 ? 77  GLU A CG  1 
ATOM   3198 C CD  . GLU C 1 72  ? 69.915 40.207 -15.932 1.00 42.80 ? 77  GLU A CD  1 
ATOM   3199 O OE1 . GLU C 1 72  ? 69.165 40.805 -15.122 1.00 51.30 ? 77  GLU A OE1 1 
ATOM   3200 O OE2 . GLU C 1 72  ? 70.655 40.849 -16.752 1.00 46.66 ? 77  GLU A OE2 1 
ATOM   3201 N N   . PHE C 1 73  ? 71.381 36.487 -11.918 1.00 15.14 ? 78  PHE A N   1 
ATOM   3202 C CA  . PHE C 1 73  ? 71.273 36.163 -10.505 1.00 13.81 ? 78  PHE A CA  1 
ATOM   3203 C C   . PHE C 1 73  ? 72.320 35.240 -10.066 1.00 12.35 ? 78  PHE A C   1 
ATOM   3204 O O   . PHE C 1 73  ? 73.514 35.664 -10.030 1.00 12.74 ? 78  PHE A O   1 
ATOM   3205 C CB  . PHE C 1 73  ? 69.834 35.779 -10.107 1.00 13.47 ? 78  PHE A CB  1 
ATOM   3206 C CG  . PHE C 1 73  ? 69.478 36.077 -8.648  1.00 14.08 ? 78  PHE A CG  1 
ATOM   3207 C CD1 . PHE C 1 73  ? 69.724 35.214 -7.630  1.00 13.77 ? 78  PHE A CD1 1 
ATOM   3208 C CD2 . PHE C 1 73  ? 68.838 37.248 -8.317  1.00 16.67 ? 78  PHE A CD2 1 
ATOM   3209 C CE1 . PHE C 1 73  ? 69.378 35.465 -6.324  1.00 14.31 ? 78  PHE A CE1 1 
ATOM   3210 C CE2 . PHE C 1 73  ? 68.533 37.549 -6.992  1.00 17.77 ? 78  PHE A CE2 1 
ATOM   3211 C CZ  . PHE C 1 73  ? 68.826 36.669 -5.976  1.00 14.52 ? 78  PHE A CZ  1 
ATOM   3212 N N   . PHE C 1 74  ? 72.078 33.968 -9.753  1.00 11.62 ? 79  PHE A N   1 
ATOM   3213 C CA  . PHE C 1 74  ? 73.158 33.135 -9.244  1.00 11.12 ? 79  PHE A CA  1 
ATOM   3214 C C   . PHE C 1 74  ? 74.297 32.816 -10.243 1.00 12.05 ? 79  PHE A C   1 
ATOM   3215 O O   . PHE C 1 74  ? 75.377 32.456 -9.830  1.00 12.69 ? 79  PHE A O   1 
ATOM   3216 C CB  . PHE C 1 74  ? 72.618 31.833 -8.750  1.00 10.94 ? 79  PHE A CB  1 
ATOM   3217 C CG  . PHE C 1 74  ? 71.737 31.946 -7.521  1.00 10.58 ? 79  PHE A CG  1 
ATOM   3218 C CD1 . PHE C 1 74  ? 72.243 32.415 -6.333  1.00 11.81 ? 79  PHE A CD1 1 
ATOM   3219 C CD2 . PHE C 1 74  ? 70.473 31.466 -7.546  1.00 11.46 ? 79  PHE A CD2 1 
ATOM   3220 C CE1 . PHE C 1 74  ? 71.424 32.527 -5.211  1.00 11.84 ? 79  PHE A CE1 1 
ATOM   3221 C CE2 . PHE C 1 74  ? 69.647 31.516 -6.363  1.00 11.21 ? 79  PHE A CE2 1 
ATOM   3222 C CZ  . PHE C 1 74  ? 70.138 32.102 -5.229  1.00 11.21 ? 79  PHE A CZ  1 
ATOM   3223 N N   . ASP C 1 75  ? 73.974 32.806 -11.509 1.00 13.07 ? 80  ASP A N   1 
ATOM   3224 C CA  . ASP C 1 75  ? 74.969 32.427 -12.583 1.00 13.96 ? 80  ASP A CA  1 
ATOM   3225 C C   . ASP C 1 75  ? 75.469 30.991 -12.318 1.00 14.40 ? 80  ASP A C   1 
ATOM   3226 O O   . ASP C 1 75  ? 76.683 30.743 -12.130 1.00 14.76 ? 80  ASP A O   1 
ATOM   3227 C CB  . ASP C 1 75  ? 76.050 33.434 -12.709 1.00 16.20 ? 80  ASP A CB  1 
ATOM   3228 C CG  . ASP C 1 75  ? 76.791 33.348 -14.034 1.00 20.41 ? 80  ASP A CG  1 
ATOM   3229 O OD1 . ASP C 1 75  ? 76.431 32.454 -14.900 1.00 24.16 ? 80  ASP A OD1 1 
ATOM   3230 O OD2 . ASP C 1 75  ? 77.688 34.177 -14.199 1.00 22.93 ? 80  ASP A OD2 1 
ATOM   3231 N N   . ALA C 1 76  ? 74.547 30.024 -12.248 1.00 14.01 ? 81  ALA A N   1 
ATOM   3232 C CA  . ALA C 1 76  ? 74.851 28.667 -11.921 1.00 13.54 ? 81  ALA A CA  1 
ATOM   3233 C C   . ALA C 1 76  ? 75.799 28.059 -12.939 1.00 14.47 ? 81  ALA A C   1 
ATOM   3234 O O   . ALA C 1 76  ? 76.483 27.098 -12.564 1.00 15.33 ? 81  ALA A O   1 
ATOM   3235 C CB  . ALA C 1 76  ? 73.595 27.814 -11.874 1.00 15.98 ? 81  ALA A CB  1 
ATOM   3236 N N   . ALA C 1 77  ? 75.816 28.514 -14.185 1.00 15.15 ? 82  ALA A N   1 
ATOM   3237 C CA  . ALA C 1 77  ? 76.836 27.951 -15.133 1.00 16.85 ? 82  ALA A CA  1 
ATOM   3238 C C   . ALA C 1 77  ? 78.270 28.225 -14.626 1.00 17.93 ? 82  ALA A C   1 
ATOM   3239 O O   . ALA C 1 77  ? 79.161 27.408 -14.833 1.00 21.38 ? 82  ALA A O   1 
ATOM   3240 C CB  . ALA C 1 77  ? 76.580 28.471 -16.543 1.00 17.13 ? 82  ALA A CB  1 
ATOM   3241 N N   . LYS C 1 78  ? 78.481 29.348 -13.973 1.00 15.50 ? 83  LYS A N   1 
ATOM   3242 C CA  . LYS C 1 78  ? 79.762 29.735 -13.476 1.00 16.83 ? 83  LYS A CA  1 
ATOM   3243 C C   . LYS C 1 78  ? 80.027 29.225 -12.121 1.00 15.86 ? 83  LYS A C   1 
ATOM   3244 O O   . LYS C 1 78  ? 81.166 28.841 -11.705 1.00 16.30 ? 83  LYS A O   1 
ATOM   3245 C CB  . LYS C 1 78  ? 79.902 31.242 -13.490 1.00 22.39 ? 83  LYS A CB  1 
ATOM   3246 C CG  . LYS C 1 78  ? 80.477 31.874 -14.767 1.00 32.67 ? 83  LYS A CG  1 
ATOM   3247 C CD  . LYS C 1 78  ? 81.138 33.184 -14.358 1.00 38.77 ? 83  LYS A CD  1 
ATOM   3248 C CE  . LYS C 1 78  ? 80.990 34.234 -15.433 1.00 45.13 ? 83  LYS A CE  1 
ATOM   3249 N NZ  . LYS C 1 78  ? 81.740 33.996 -16.700 1.00 49.99 ? 83  LYS A NZ  1 
ATOM   3250 N N   . PHE C 1 79  ? 78.965 29.299 -11.255 1.00 13.88 ? 84  PHE A N   1 
ATOM   3251 C CA  . PHE C 1 79  ? 79.078 29.001 -9.852  1.00 13.86 ? 84  PHE A CA  1 
ATOM   3252 C C   . PHE C 1 79  ? 77.939 28.018 -9.499  1.00 13.40 ? 84  PHE A C   1 
ATOM   3253 O O   . PHE C 1 79  ? 76.907 28.407 -8.896  1.00 13.07 ? 84  PHE A O   1 
ATOM   3254 C CB  . PHE C 1 79  ? 78.907 30.296 -9.035  1.00 15.62 ? 84  PHE A CB  1 
ATOM   3255 C CG  . PHE C 1 79  ? 79.842 31.398 -9.441  1.00 16.91 ? 84  PHE A CG  1 
ATOM   3256 C CD1 . PHE C 1 79  ? 81.169 31.284 -9.145  1.00 18.12 ? 84  PHE A CD1 1 
ATOM   3257 C CD2 . PHE C 1 79  ? 79.349 32.550 -10.016 1.00 19.43 ? 84  PHE A CD2 1 
ATOM   3258 C CE1 . PHE C 1 79  ? 82.037 32.354 -9.559  1.00 18.37 ? 84  PHE A CE1 1 
ATOM   3259 C CE2 . PHE C 1 79  ? 80.190 33.566 -10.390 1.00 22.58 ? 84  PHE A CE2 1 
ATOM   3260 C CZ  . PHE C 1 79  ? 81.511 33.452 -10.121 1.00 19.76 ? 84  PHE A CZ  1 
ATOM   3261 N N   . PRO C 1 80  ? 78.092 26.745 -9.743  1.00 12.50 ? 85  PRO A N   1 
ATOM   3262 C CA  . PRO C 1 80  ? 77.018 25.724 -9.476  1.00 13.07 ? 85  PRO A CA  1 
ATOM   3263 C C   . PRO C 1 80  ? 76.704 25.508 -8.037  1.00 11.56 ? 85  PRO A C   1 
ATOM   3264 O O   . PRO C 1 80  ? 75.653 24.908 -7.779  1.00 12.77 ? 85  PRO A O   1 
ATOM   3265 C CB  . PRO C 1 80  ? 77.577 24.449 -10.054 1.00 14.82 ? 85  PRO A CB  1 
ATOM   3266 C CG  . PRO C 1 80  ? 78.949 24.789 -10.553 1.00 15.31 ? 85  PRO A CG  1 
ATOM   3267 C CD  . PRO C 1 80  ? 79.231 26.237 -10.544 1.00 15.00 ? 85  PRO A CD  1 
ATOM   3268 N N   . GLN C 1 81  ? 77.642 25.833 -7.134  1.00 12.14 ? 86  GLN A N   1 
ATOM   3269 C CA  . GLN C 1 81  ? 77.465 25.463 -5.707  1.00 13.15 ? 86  GLN A CA  1 
ATOM   3270 C C   . GLN C 1 81  ? 77.674 26.639 -4.839  1.00 11.84 ? 86  GLN A C   1 
ATOM   3271 O O   . GLN C 1 81  ? 78.240 27.683 -5.278  1.00 11.85 ? 86  GLN A O   1 
ATOM   3272 C CB  . GLN C 1 81  ? 78.418 24.370 -5.303  1.00 16.63 ? 86  GLN A CB  1 
ATOM   3273 C CG  . GLN C 1 81  ? 78.060 23.072 -6.016  1.00 18.11 ? 86  GLN A CG  1 
ATOM   3274 C CD  . GLN C 1 81  ? 78.987 21.966 -5.655  1.00 25.96 ? 86  GLN A CD  1 
ATOM   3275 O OE1 . GLN C 1 81  ? 80.192 22.118 -5.689  1.00 27.27 ? 86  GLN A OE1 1 
ATOM   3276 N NE2 . GLN C 1 81  ? 78.422 20.790 -5.386  1.00 29.42 ? 86  GLN A NE2 1 
ATOM   3277 N N   . ALA C 1 82  ? 77.077 26.574 -3.651  1.00 9.90  ? 87  ALA A N   1 
ATOM   3278 C CA  . ALA C 1 82  ? 77.374 27.481 -2.535  1.00 10.12 ? 87  ALA A CA  1 
ATOM   3279 C C   . ALA C 1 82  ? 77.986 26.624 -1.446  1.00 10.10 ? 87  ALA A C   1 
ATOM   3280 O O   . ALA C 1 82  ? 77.638 25.408 -1.313  1.00 10.42 ? 87  ALA A O   1 
ATOM   3281 C CB  . ALA C 1 82  ? 76.204 28.171 -2.012  1.00 10.08 ? 87  ALA A CB  1 
ATOM   3282 N N   . ASN C 1 83  ? 78.943 27.180 -0.701  1.00 10.24 ? 88  ASN A N   1 
ATOM   3283 C CA  . ASN C 1 83  ? 79.692 26.385 0.258   1.00 10.45 ? 88  ASN A CA  1 
ATOM   3284 C C   . ASN C 1 83  ? 79.832 27.198 1.561   1.00 11.34 ? 88  ASN A C   1 
ATOM   3285 O O   . ASN C 1 83  ? 80.158 28.403 1.499   1.00 13.63 ? 88  ASN A O   1 
ATOM   3286 C CB  . ASN C 1 83  ? 81.105 25.972 -0.182  1.00 13.25 ? 88  ASN A CB  1 
ATOM   3287 C CG  . ASN C 1 83  ? 81.993 25.342 0.992   1.00 16.97 ? 88  ASN A CG  1 
ATOM   3288 O OD1 . ASN C 1 83  ? 82.920 26.045 1.517   1.00 21.94 ? 88  ASN A OD1 1 
ATOM   3289 N ND2 . ASN C 1 83  ? 81.760 24.026 1.408   1.00 16.40 ? 88  ASN A ND2 1 
ATOM   3290 N N   . TYR C 1 84  ? 79.591 26.553 2.694   1.00 9.28  ? 89  TYR A N   1 
ATOM   3291 C CA  . TYR C 1 84  ? 79.723 27.235 3.954   1.00 8.75  ? 89  TYR A CA  1 
ATOM   3292 C C   . TYR C 1 84  ? 80.678 26.396 4.835   1.00 8.83  ? 89  TYR A C   1 
ATOM   3293 O O   . TYR C 1 84  ? 80.529 25.139 4.936   1.00 9.32  ? 89  TYR A O   1 
ATOM   3294 C CB  . TYR C 1 84  ? 78.362 27.317 4.675   1.00 9.71  ? 89  TYR A CB  1 
ATOM   3295 C CG  . TYR C 1 84  ? 78.461 27.925 6.033   1.00 9.63  ? 89  TYR A CG  1 
ATOM   3296 C CD1 . TYR C 1 84  ? 78.544 29.273 6.173   1.00 10.25 ? 89  TYR A CD1 1 
ATOM   3297 C CD2 . TYR C 1 84  ? 78.460 27.204 7.211   1.00 10.88 ? 89  TYR A CD2 1 
ATOM   3298 C CE1 . TYR C 1 84  ? 78.651 29.875 7.433   1.00 10.70 ? 89  TYR A CE1 1 
ATOM   3299 C CE2 . TYR C 1 84  ? 78.617 27.804 8.456   1.00 12.05 ? 89  TYR A CE2 1 
ATOM   3300 C CZ  . TYR C 1 84  ? 78.688 29.127 8.563   1.00 11.83 ? 89  TYR A CZ  1 
ATOM   3301 O OH  . TYR C 1 84  ? 78.808 29.729 9.849   1.00 13.53 ? 89  TYR A OH  1 
ATOM   3302 N N   A LYS C 1 85  ? 81.590 27.061 5.495   0.50 9.19  ? 90  LYS A N   1 
ATOM   3303 N N   B LYS C 1 85  ? 81.572 27.084 5.513   0.50 9.21  ? 90  LYS A N   1 
ATOM   3304 C CA  A LYS C 1 85  ? 82.428 26.381 6.499   0.50 9.41  ? 90  LYS A CA  1 
ATOM   3305 C CA  B LYS C 1 85  ? 82.571 26.454 6.419   0.50 9.46  ? 90  LYS A CA  1 
ATOM   3306 C C   A LYS C 1 85  ? 82.382 27.255 7.720   0.50 8.85  ? 90  LYS A C   1 
ATOM   3307 C C   B LYS C 1 85  ? 82.509 27.284 7.690   0.50 8.89  ? 90  LYS A C   1 
ATOM   3308 O O   A LYS C 1 85  ? 82.363 28.462 7.664   0.50 8.14  ? 90  LYS A O   1 
ATOM   3309 O O   B LYS C 1 85  ? 82.639 28.520 7.608   0.50 8.07  ? 90  LYS A O   1 
ATOM   3310 C CB  A LYS C 1 85  ? 83.917 26.134 6.069   0.50 11.51 ? 90  LYS A CB  1 
ATOM   3311 C CB  B LYS C 1 85  ? 84.064 26.481 5.822   0.50 11.48 ? 90  LYS A CB  1 
ATOM   3312 C CG  A LYS C 1 85  ? 84.032 25.169 4.969   0.50 13.66 ? 90  LYS A CG  1 
ATOM   3313 C CG  B LYS C 1 85  ? 84.234 25.715 4.550   0.50 14.13 ? 90  LYS A CG  1 
ATOM   3314 C CD  A LYS C 1 85  ? 85.488 24.741 4.791   0.50 15.37 ? 90  LYS A CD  1 
ATOM   3315 C CD  B LYS C 1 85  ? 85.711 25.502 4.158   0.50 15.68 ? 90  LYS A CD  1 
ATOM   3316 C CE  A LYS C 1 85  ? 86.505 25.855 4.845   0.50 16.38 ? 90  LYS A CE  1 
ATOM   3317 C CE  B LYS C 1 85  ? 85.783 24.248 3.295   0.50 17.40 ? 90  LYS A CE  1 
ATOM   3318 N NZ  A LYS C 1 85  ? 87.878 25.346 4.376   0.50 18.26 ? 90  LYS A NZ  1 
ATOM   3319 N NZ  B LYS C 1 85  ? 86.940 24.038 2.453   0.50 19.78 ? 90  LYS A NZ  1 
ATOM   3320 N N   . GLY C 1 86  ? 82.457 26.614 8.859   1.00 8.49  ? 91  GLY A N   1 
ATOM   3321 C CA  . GLY C 1 86  ? 82.489 27.391 10.084  1.00 8.08  ? 91  GLY A CA  1 
ATOM   3322 C C   . GLY C 1 86  ? 82.736 26.575 11.332  1.00 8.16  ? 91  GLY A C   1 
ATOM   3323 O O   . GLY C 1 86  ? 82.794 25.345 11.315  1.00 8.86  ? 91  GLY A O   1 
ATOM   3324 N N   . THR C 1 87  ? 83.021 27.300 12.373  1.00 8.94  ? 92  THR A N   1 
ATOM   3325 C CA  . THR C 1 87  ? 83.336 26.758 13.690  1.00 9.71  ? 92  THR A CA  1 
ATOM   3326 C C   . THR C 1 87  ? 82.161 26.836 14.668  1.00 10.06 ? 92  THR A C   1 
ATOM   3327 O O   . THR C 1 87  ? 81.546 27.921 14.815  1.00 10.67 ? 92  THR A O   1 
ATOM   3328 C CB  . THR C 1 87  ? 84.541 27.538 14.300  1.00 10.73 ? 92  THR A CB  1 
ATOM   3329 O OG1 . THR C 1 87  ? 85.656 27.395 13.359  1.00 12.80 ? 92  THR A OG1 1 
ATOM   3330 C CG2 . THR C 1 87  ? 84.944 26.951 15.618  1.00 11.24 ? 92  THR A CG2 1 
ATOM   3331 N N   . ILE C 1 88  ? 81.868 25.716 15.268  1.00 9.87  ? 93  ILE A N   1 
ATOM   3332 C CA  . ILE C 1 88  ? 80.718 25.606 16.198  1.00 10.86 ? 93  ILE A CA  1 
ATOM   3333 C C   . ILE C 1 88  ? 81.195 26.146 17.500  1.00 11.27 ? 93  ILE A C   1 
ATOM   3334 O O   . ILE C 1 88  ? 82.220 25.751 18.095  1.00 12.15 ? 93  ILE A O   1 
ATOM   3335 C CB  . ILE C 1 88  ? 80.239 24.171 16.279  1.00 10.91 ? 93  ILE A CB  1 
ATOM   3336 C CG1 . ILE C 1 88  ? 79.734 23.680 14.944  1.00 11.33 ? 93  ILE A CG1 1 
ATOM   3337 C CG2 . ILE C 1 88  ? 79.096 24.114 17.262  1.00 11.20 ? 93  ILE A CG2 1 
ATOM   3338 C CD1 . ILE C 1 88  ? 79.342 22.199 14.845  1.00 12.05 ? 93  ILE A CD1 1 
ATOM   3339 N N   . LYS C 1 89  ? 80.382 27.123 18.030  1.00 10.88 ? 94  LYS A N   1 
ATOM   3340 C CA  . LYS C 1 89  ? 80.532 27.686 19.379  1.00 13.82 ? 94  LYS A CA  1 
ATOM   3341 C C   . LYS C 1 89  ? 79.500 27.106 20.323  1.00 13.84 ? 94  LYS A C   1 
ATOM   3342 O O   . LYS C 1 89  ? 78.381 26.880 19.962  1.00 14.13 ? 94  LYS A O   1 
ATOM   3343 C CB  . LYS C 1 89  ? 80.359 29.196 19.331  1.00 15.43 ? 94  LYS A CB  1 
ATOM   3344 C CG  . LYS C 1 89  ? 81.225 29.875 18.351  1.00 21.19 ? 94  LYS A CG  1 
ATOM   3345 C CD  . LYS C 1 89  ? 82.678 29.673 18.545  1.00 24.30 ? 94  LYS A CD  1 
ATOM   3346 C CE  . LYS C 1 89  ? 83.464 30.328 17.399  1.00 29.35 ? 94  LYS A CE  1 
ATOM   3347 N NZ  . LYS C 1 89  ? 84.866 30.307 17.878  1.00 35.12 ? 94  LYS A NZ  1 
ATOM   3348 N N   . PHE C 1 90  ? 79.910 26.870 21.541  1.00 18.07 ? 95  PHE A N   1 
ATOM   3349 C CA  . PHE C 1 90  ? 79.052 26.316 22.622  1.00 19.84 ? 95  PHE A CA  1 
ATOM   3350 C C   . PHE C 1 90  ? 78.637 27.398 23.672  1.00 24.04 ? 95  PHE A C   1 
ATOM   3351 O O   . PHE C 1 90  ? 79.431 28.298 23.880  1.00 25.76 ? 95  PHE A O   1 
ATOM   3352 C CB  . PHE C 1 90  ? 79.790 25.192 23.297  1.00 23.45 ? 95  PHE A CB  1 
ATOM   3353 C CG  . PHE C 1 90  ? 79.801 23.896 22.535  1.00 21.68 ? 95  PHE A CG  1 
ATOM   3354 C CD1 . PHE C 1 90  ? 80.540 23.736 21.358  1.00 21.52 ? 95  PHE A CD1 1 
ATOM   3355 C CD2 . PHE C 1 90  ? 79.134 22.759 23.081  1.00 25.33 ? 95  PHE A CD2 1 
ATOM   3356 C CE1 . PHE C 1 90  ? 80.499 22.539 20.651  1.00 21.06 ? 95  PHE A CE1 1 
ATOM   3357 C CE2 . PHE C 1 90  ? 79.162 21.562 22.383  1.00 21.97 ? 95  PHE A CE2 1 
ATOM   3358 C CZ  . PHE C 1 90  ? 79.853 21.454 21.196  1.00 21.92 ? 95  PHE A CZ  1 
ATOM   3359 N N   . ASP C 1 91  ? 77.395 27.376 24.172  1.00 27.86 ? 96  ASP A N   1 
ATOM   3360 C CA  . ASP C 1 91  ? 76.879 28.310 25.307  1.00 28.56 ? 96  ASP A CA  1 
ATOM   3361 C C   . ASP C 1 91  ? 76.689 27.188 26.363  1.00 43.20 ? 96  ASP A C   1 
ATOM   3362 O O   . ASP C 1 91  ? 75.583 26.678 26.547  1.00 48.89 ? 96  ASP A O   1 
ATOM   3363 C CB  . ASP C 1 91  ? 75.653 29.147 24.883  1.00 27.31 ? 96  ASP A CB  1 
ATOM   3364 C CG  . ASP C 1 91  ? 75.260 30.268 25.858  1.00 28.45 ? 96  ASP A CG  1 
ATOM   3365 O OD1 . ASP C 1 91  ? 75.925 30.277 26.976  1.00 24.34 ? 96  ASP A OD1 1 
ATOM   3366 O OD2 . ASP C 1 91  ? 74.285 31.068 25.436  1.00 21.89 ? 96  ASP A OD2 1 
ATOM   3367 N N   . GLY C 1 92  ? 77.868 26.752 26.843  1.00 44.57 ? 97  GLY A N   1 
ATOM   3368 C CA  . GLY C 1 92  ? 78.146 25.773 27.900  1.00 50.56 ? 97  GLY A CA  1 
ATOM   3369 C C   . GLY C 1 92  ? 78.295 24.356 27.396  1.00 47.66 ? 97  GLY A C   1 
ATOM   3370 O O   . GLY C 1 92  ? 79.316 23.964 26.779  1.00 42.43 ? 97  GLY A O   1 
ATOM   3371 N N   . ASP C 1 93  ? 77.226 23.616 27.617  1.00 49.42 ? 98  ASP A N   1 
ATOM   3372 C CA  . ASP C 1 93  ? 77.092 22.209 27.234  1.00 50.53 ? 98  ASP A CA  1 
ATOM   3373 C C   . ASP C 1 93  ? 76.524 22.066 25.780  1.00 41.73 ? 98  ASP A C   1 
ATOM   3374 O O   . ASP C 1 93  ? 76.631 21.029 25.105  1.00 40.37 ? 98  ASP A O   1 
ATOM   3375 C CB  . ASP C 1 93  ? 76.110 21.576 28.241  1.00 60.74 ? 98  ASP A CB  1 
ATOM   3376 C CG  . ASP C 1 93  ? 76.355 20.116 28.467  1.00 68.32 ? 98  ASP A CG  1 
ATOM   3377 O OD1 . ASP C 1 93  ? 77.344 19.580 27.911  1.00 74.09 ? 98  ASP A OD1 1 
ATOM   3378 O OD2 . ASP C 1 93  ? 75.552 19.504 29.214  1.00 70.02 ? 98  ASP A OD2 1 
ATOM   3379 N N   . LYS C 1 94  ? 75.934 23.132 25.280  1.00 32.69 ? 99  LYS A N   1 
ATOM   3380 C CA  . LYS C 1 94  ? 75.184 23.009 24.084  1.00 30.56 ? 99  LYS A CA  1 
ATOM   3381 C C   . LYS C 1 94  ? 75.780 23.897 22.928  1.00 23.36 ? 99  LYS A C   1 
ATOM   3382 O O   . LYS C 1 94  ? 76.202 24.996 23.180  1.00 22.19 ? 99  LYS A O   1 
ATOM   3383 C CB  . LYS C 1 94  ? 73.794 23.464 24.360  1.00 36.79 ? 99  LYS A CB  1 
ATOM   3384 C CG  . LYS C 1 94  ? 72.867 22.879 23.353  1.00 38.60 ? 99  LYS A CG  1 
ATOM   3385 C CD  . LYS C 1 94  ? 72.020 21.720 23.923  1.00 41.60 ? 99  LYS A CD  1 
ATOM   3386 C CE  . LYS C 1 94  ? 70.659 21.840 23.249  1.00 40.74 ? 99  LYS A CE  1 
ATOM   3387 N NZ  . LYS C 1 94  ? 69.709 20.757 23.634  1.00 41.13 ? 99  LYS A NZ  1 
ATOM   3388 N N   . PRO C 1 95  ? 75.799 23.355 21.710  1.00 19.97 ? 100 PRO A N   1 
ATOM   3389 C CA  . PRO C 1 95  ? 76.115 24.280 20.609  1.00 18.20 ? 100 PRO A CA  1 
ATOM   3390 C C   . PRO C 1 95  ? 75.106 25.430 20.495  1.00 17.32 ? 100 PRO A C   1 
ATOM   3391 O O   . PRO C 1 95  ? 73.902 25.163 20.498  1.00 18.33 ? 100 PRO A O   1 
ATOM   3392 C CB  . PRO C 1 95  ? 76.027 23.404 19.366  1.00 19.09 ? 100 PRO A CB  1 
ATOM   3393 C CG  . PRO C 1 95  ? 76.176 22.030 19.807  1.00 22.45 ? 100 PRO A CG  1 
ATOM   3394 C CD  . PRO C 1 95  ? 75.635 21.961 21.186  1.00 21.94 ? 100 PRO A CD  1 
ATOM   3395 N N   . VAL C 1 96  ? 75.595 26.639 20.257  1.00 14.89 ? 101 VAL A N   1 
ATOM   3396 C CA  . VAL C 1 96  ? 74.737 27.796 20.161  1.00 15.61 ? 101 VAL A CA  1 
ATOM   3397 C C   . VAL C 1 96  ? 74.870 28.551 18.840  1.00 13.38 ? 101 VAL A C   1 
ATOM   3398 O O   . VAL C 1 96  ? 73.959 29.260 18.443  1.00 13.97 ? 101 VAL A O   1 
ATOM   3399 C CB  . VAL C 1 96  ? 74.956 28.793 21.306  1.00 16.95 ? 101 VAL A CB  1 
ATOM   3400 C CG1 . VAL C 1 96  ? 74.489 28.105 22.558  1.00 24.71 ? 101 VAL A CG1 1 
ATOM   3401 C CG2 . VAL C 1 96  ? 76.360 29.380 21.327  1.00 17.97 ? 101 VAL A CG2 1 
ATOM   3402 N N   . SER C 1 97  ? 76.002 28.410 18.116  1.00 12.36 ? 102 SER A N   1 
ATOM   3403 C CA  . SER C 1 97  ? 76.155 29.158 16.891  1.00 12.57 ? 102 SER A CA  1 
ATOM   3404 C C   . SER C 1 97  ? 77.248 28.489 16.072  1.00 11.85 ? 102 SER A C   1 
ATOM   3405 O O   . SER C 1 97  ? 77.986 27.674 16.558  1.00 12.10 ? 102 SER A O   1 
ATOM   3406 C CB  . SER C 1 97  ? 76.462 30.589 17.005  1.00 15.39 ? 102 SER A CB  1 
ATOM   3407 O OG  . SER C 1 97  ? 77.685 30.750 17.671  1.00 17.88 ? 102 SER A OG  1 
ATOM   3408 N N   . VAL C 1 98  ? 77.309 28.899 14.819  1.00 10.25 ? 103 VAL A N   1 
ATOM   3409 C CA  . VAL C 1 98  ? 78.429 28.531 13.893  1.00 10.06 ? 103 VAL A CA  1 
ATOM   3410 C C   . VAL C 1 98  ? 78.913 29.823 13.360  1.00 9.96  ? 103 VAL A C   1 
ATOM   3411 O O   . VAL C 1 98  ? 78.179 30.610 12.766  1.00 10.60 ? 103 VAL A O   1 
ATOM   3412 C CB  . VAL C 1 98  ? 77.995 27.580 12.777  1.00 11.52 ? 103 VAL A CB  1 
ATOM   3413 C CG1 . VAL C 1 98  ? 79.215 26.988 12.023  1.00 12.29 ? 103 VAL A CG1 1 
ATOM   3414 C CG2 . VAL C 1 98  ? 77.131 26.441 13.399  1.00 11.73 ? 103 VAL A CG2 1 
ATOM   3415 N N   . VAL C 1 99  ? 80.224 30.081 13.437  1.00 9.03  ? 104 VAL A N   1 
ATOM   3416 C CA  . VAL C 1 99  ? 80.839 31.296 12.970  1.00 9.70  ? 104 VAL A CA  1 
ATOM   3417 C C   . VAL C 1 99  ? 81.802 30.936 11.823  1.00 10.12 ? 104 VAL A C   1 
ATOM   3418 O O   . VAL C 1 99  ? 82.710 30.145 12.006  1.00 9.90  ? 104 VAL A O   1 
ATOM   3419 C CB  . VAL C 1 99  ? 81.606 32.003 14.079  1.00 11.68 ? 104 VAL A CB  1 
ATOM   3420 C CG1 . VAL C 1 99  ? 82.212 33.240 13.505  1.00 13.74 ? 104 VAL A CG1 1 
ATOM   3421 C CG2 . VAL C 1 99  ? 80.622 32.324 15.221  1.00 13.77 ? 104 VAL A CG2 1 
ATOM   3422 N N   . GLY C 1 100 ? 81.498 31.474 10.657  1.00 9.08  ? 105 GLY A N   1 
ATOM   3423 C CA  . GLY C 1 100 ? 82.206 31.046 9.450   1.00 9.51  ? 105 GLY A CA  1 
ATOM   3424 C C   . GLY C 1 100 ? 82.074 31.936 8.281   1.00 9.01  ? 105 GLY A C   1 
ATOM   3425 O O   . GLY C 1 100 ? 81.957 33.156 8.424   1.00 9.20  ? 105 GLY A O   1 
ATOM   3426 N N   . ASN C 1 101 ? 82.113 31.297 7.135   1.00 9.07  ? 106 ASN A N   1 
ATOM   3427 C CA  . ASN C 1 101 ? 82.149 32.002 5.876   1.00 8.78  ? 106 ASN A CA  1 
ATOM   3428 C C   . ASN C 1 101 ? 81.297 31.238 4.825   1.00 8.96  ? 106 ASN A C   1 
ATOM   3429 O O   . ASN C 1 101 ? 81.439 30.042 4.697   1.00 9.18  ? 106 ASN A O   1 
ATOM   3430 C CB  . ASN C 1 101 ? 83.586 32.128 5.349   1.00 9.91  ? 106 ASN A CB  1 
ATOM   3431 C CG  . ASN C 1 101 ? 84.470 32.921 6.276   1.00 11.80 ? 106 ASN A CG  1 
ATOM   3432 O OD1 . ASN C 1 101 ? 85.112 32.347 7.182   1.00 14.14 ? 106 ASN A OD1 1 
ATOM   3433 N ND2 . ASN C 1 101 ? 84.427 34.213 6.123   1.00 12.34 ? 106 ASN A ND2 1 
ATOM   3434 N N   . LEU C 1 102 ? 80.518 32.014 4.084   1.00 8.81  ? 107 LEU A N   1 
ATOM   3435 C CA  . LEU C 1 102 ? 79.683 31.524 3.010   1.00 8.73  ? 107 LEU A CA  1 
ATOM   3436 C C   . LEU C 1 102 ? 80.319 31.978 1.733   1.00 8.62  ? 107 LEU A C   1 
ATOM   3437 O O   . LEU C 1 102 ? 80.619 33.126 1.578   1.00 9.05  ? 107 LEU A O   1 
ATOM   3438 C CB  . LEU C 1 102 ? 78.281 32.049 3.066   1.00 9.85  ? 107 LEU A CB  1 
ATOM   3439 C CG  . LEU C 1 102 ? 77.327 31.669 1.907   1.00 10.59 ? 107 LEU A CG  1 
ATOM   3440 C CD1 . LEU C 1 102 ? 77.119 30.181 1.920   1.00 12.24 ? 107 LEU A CD1 1 
ATOM   3441 C CD2 . LEU C 1 102 ? 76.058 32.440 2.064   1.00 11.68 ? 107 LEU A CD2 1 
ATOM   3442 N N   . THR C 1 103 ? 80.409 31.046 0.787   1.00 8.80  ? 108 THR A N   1 
ATOM   3443 C CA  . THR C 1 103 ? 80.778 31.340 -0.595  1.00 8.73  ? 108 THR A CA  1 
ATOM   3444 C C   . THR C 1 103 ? 79.574 31.140 -1.478  1.00 9.00  ? 108 THR A C   1 
ATOM   3445 O O   . THR C 1 103 ? 79.054 29.999 -1.601  1.00 10.53 ? 108 THR A O   1 
ATOM   3446 C CB  . THR C 1 103 ? 81.950 30.503 -1.111  1.00 9.86  ? 108 THR A CB  1 
ATOM   3447 O OG1 . THR C 1 103 ? 83.056 30.593 -0.135  1.00 11.17 ? 108 THR A OG1 1 
ATOM   3448 C CG2 . THR C 1 103 ? 82.398 30.890 -2.468  1.00 10.77 ? 108 THR A CG2 1 
ATOM   3449 N N   . LEU C 1 104 ? 79.097 32.244 -2.010  1.00 8.46  ? 109 LEU A N   1 
ATOM   3450 C CA  . LEU C 1 104 ? 77.834 32.240 -2.767  1.00 9.30  ? 109 LEU A CA  1 
ATOM   3451 C C   . LEU C 1 104 ? 78.111 33.125 -4.007  1.00 10.05 ? 109 LEU A C   1 
ATOM   3452 O O   . LEU C 1 104 ? 78.631 34.274 -3.884  1.00 10.12 ? 109 LEU A O   1 
ATOM   3453 C CB  . LEU C 1 104 ? 76.703 32.809 -1.878  1.00 10.10 ? 109 LEU A CB  1 
ATOM   3454 C CG  . LEU C 1 104 ? 75.372 33.079 -2.584  1.00 10.81 ? 109 LEU A CG  1 
ATOM   3455 C CD1 . LEU C 1 104 ? 74.776 31.837 -3.207  1.00 12.19 ? 109 LEU A CD1 1 
ATOM   3456 C CD2 . LEU C 1 104 ? 74.422 33.787 -1.637  1.00 10.74 ? 109 LEU A CD2 1 
ATOM   3457 N N   . HIS C 1 105 ? 77.765 32.656 -5.194  1.00 10.57 ? 110 HIS A N   1 
ATOM   3458 C CA  . HIS C 1 105 ? 77.978 33.437 -6.431  1.00 11.43 ? 110 HIS A CA  1 
ATOM   3459 C C   . HIS C 1 105 ? 79.479 33.837 -6.584  1.00 11.72 ? 110 HIS A C   1 
ATOM   3460 O O   . HIS C 1 105 ? 79.794 34.954 -7.020  1.00 12.72 ? 110 HIS A O   1 
ATOM   3461 C CB  . HIS C 1 105 ? 77.082 34.698 -6.401  1.00 11.73 ? 110 HIS A CB  1 
ATOM   3462 C CG  . HIS C 1 105 ? 77.076 35.478 -7.653  1.00 12.92 ? 110 HIS A CG  1 
ATOM   3463 N ND1 . HIS C 1 105 ? 77.339 36.814 -7.666  1.00 14.87 ? 110 HIS A ND1 1 
ATOM   3464 C CD2 . HIS C 1 105 ? 76.780 35.124 -8.919  1.00 13.53 ? 110 HIS A CD2 1 
ATOM   3465 C CE1 . HIS C 1 105 ? 77.296 37.256 -8.928  1.00 16.21 ? 110 HIS A CE1 1 
ATOM   3466 N NE2 . HIS C 1 105 ? 76.940 36.266 -9.704  1.00 15.30 ? 110 HIS A NE2 1 
ATOM   3467 N N   . GLY C 1 106 ? 80.324 32.914 -6.130  1.00 12.56 ? 111 GLY A N   1 
ATOM   3468 C CA  . GLY C 1 106 ? 81.773 33.093 -6.167  1.00 12.13 ? 111 GLY A CA  1 
ATOM   3469 C C   . GLY C 1 106 ? 82.388 34.020 -5.165  1.00 12.93 ? 111 GLY A C   1 
ATOM   3470 O O   . GLY C 1 106 ? 83.600 34.158 -5.191  1.00 17.86 ? 111 GLY A O   1 
ATOM   3471 N N   . VAL C 1 107 ? 81.600 34.615 -4.291  1.00 10.40 ? 112 VAL A N   1 
ATOM   3472 C CA  . VAL C 1 107 ? 82.037 35.577 -3.349  1.00 10.16 ? 112 VAL A CA  1 
ATOM   3473 C C   . VAL C 1 107 ? 81.979 34.983 -1.944  1.00 9.55  ? 112 VAL A C   1 
ATOM   3474 O O   . VAL C 1 107 ? 80.980 34.481 -1.525  1.00 9.56  ? 112 VAL A O   1 
ATOM   3475 C CB  . VAL C 1 107 ? 81.166 36.900 -3.442  1.00 10.04 ? 112 VAL A CB  1 
ATOM   3476 C CG1 . VAL C 1 107 ? 81.569 37.884 -2.368  1.00 10.22 ? 112 VAL A CG1 1 
ATOM   3477 C CG2 . VAL C 1 107 ? 81.134 37.474 -4.867  1.00 11.16 ? 112 VAL A CG2 1 
ATOM   3478 N N   . THR C 1 108 ? 83.065 35.145 -1.128  1.00 9.10  ? 113 THR A N   1 
ATOM   3479 C CA  . THR C 1 108 ? 83.110 34.674 0.203   1.00 9.50  ? 113 THR A CA  1 
ATOM   3480 C C   . THR C 1 108 ? 82.926 35.800 1.189   1.00 10.63 ? 113 THR A C   1 
ATOM   3481 O O   . THR C 1 108 ? 83.617 36.820 1.083   1.00 10.32 ? 113 THR A O   1 
ATOM   3482 C CB  . THR C 1 108 ? 84.478 33.973 0.462   1.00 10.50 ? 113 THR A CB  1 
ATOM   3483 O OG1 . THR C 1 108 ? 84.573 32.892 -0.472  1.00 10.92 ? 113 THR A OG1 1 
ATOM   3484 C CG2 . THR C 1 108 ? 84.580 33.473 1.879   1.00 11.74 ? 113 THR A CG2 1 
ATOM   3485 N N   . LYS C 1 109 ? 81.991 35.673 2.093   1.00 9.36  ? 114 LYS A N   1 
ATOM   3486 C CA  . LYS C 1 109 ? 81.725 36.645 3.150   1.00 10.13 ? 114 LYS A CA  1 
ATOM   3487 C C   . LYS C 1 109 ? 81.477 35.983 4.481   1.00 9.80  ? 114 LYS A C   1 
ATOM   3488 O O   . LYS C 1 109 ? 81.127 34.803 4.562   1.00 10.00 ? 114 LYS A O   1 
ATOM   3489 C CB  . LYS C 1 109 ? 80.474 37.474 2.785   1.00 11.58 ? 114 LYS A CB  1 
ATOM   3490 C CG  . LYS C 1 109 ? 80.707 38.363 1.587   1.00 12.56 ? 114 LYS A CG  1 
ATOM   3491 C CD  . LYS C 1 109 ? 81.649 39.551 1.799   1.00 15.57 ? 114 LYS A CD  1 
ATOM   3492 C CE  . LYS C 1 109 ? 82.288 40.042 0.506   1.00 18.63 ? 114 LYS A CE  1 
ATOM   3493 N NZ  . LYS C 1 109 ? 81.471 41.054 -0.084  1.00 23.61 ? 114 LYS A NZ  1 
ATOM   3494 N N   . PRO C 1 110 ? 81.736 36.707 5.550   1.00 10.42 ? 115 PRO A N   1 
ATOM   3495 C CA  . PRO C 1 110 ? 81.413 36.142 6.820   1.00 10.15 ? 115 PRO A CA  1 
ATOM   3496 C C   . PRO C 1 110 ? 79.921 35.874 7.035   1.00 10.80 ? 115 PRO A C   1 
ATOM   3497 O O   . PRO C 1 110 ? 79.044 36.654 6.626   1.00 12.16 ? 115 PRO A O   1 
ATOM   3498 C CB  . PRO C 1 110 ? 81.818 37.245 7.813   1.00 10.90 ? 115 PRO A CB  1 
ATOM   3499 C CG  . PRO C 1 110 ? 82.693 38.144 7.106   1.00 11.49 ? 115 PRO A CG  1 
ATOM   3500 C CD  . PRO C 1 110 ? 82.198 38.098 5.706   1.00 10.25 ? 115 PRO A CD  1 
ATOM   3501 N N   . LEU C 1 111 ? 79.634 34.780 7.709   1.00 10.12 ? 116 LEU A N   1 
ATOM   3502 C CA  . LEU C 1 111 ? 78.228 34.397 8.062   1.00 11.14 ? 116 LEU A CA  1 
ATOM   3503 C C   . LEU C 1 111 ? 78.211 33.558 9.290   1.00 10.81 ? 116 LEU A C   1 
ATOM   3504 O O   . LEU C 1 111 ? 78.942 32.588 9.470   1.00 10.55 ? 116 LEU A O   1 
ATOM   3505 C CB  . LEU C 1 111 ? 77.518 33.662 6.887   1.00 10.94 ? 116 LEU A CB  1 
ATOM   3506 C CG  . LEU C 1 111 ? 76.095 33.188 7.192   1.00 12.06 ? 116 LEU A CG  1 
ATOM   3507 C CD1 . LEU C 1 111 ? 75.141 34.332 7.383   1.00 14.42 ? 116 LEU A CD1 1 
ATOM   3508 C CD2 . LEU C 1 111 ? 75.589 32.224 6.133   1.00 12.90 ? 116 LEU A CD2 1 
ATOM   3509 N N   . THR C 1 112 ? 77.400 34.019 10.280  1.00 11.52 ? 117 THR A N   1 
ATOM   3510 C CA  . THR C 1 112 ? 77.130 33.335 11.547  1.00 11.77 ? 117 THR A CA  1 
ATOM   3511 C C   . THR C 1 112 ? 75.728 32.728 11.536  1.00 12.06 ? 117 THR A C   1 
ATOM   3512 O O   . THR C 1 112 ? 74.742 33.371 11.047  1.00 13.50 ? 117 THR A O   1 
ATOM   3513 C CB  . THR C 1 112 ? 77.266 34.313 12.701  1.00 13.64 ? 117 THR A CB  1 
ATOM   3514 O OG1 . THR C 1 112 ? 78.641 34.674 12.796  1.00 16.25 ? 117 THR A OG1 1 
ATOM   3515 C CG2 . THR C 1 112 ? 76.837 33.664 13.969  1.00 16.34 ? 117 THR A CG2 1 
ATOM   3516 N N   . LEU C 1 113 ? 75.619 31.482 11.864  1.00 12.20 ? 118 LEU A N   1 
ATOM   3517 C CA  . LEU C 1 113 ? 74.360 30.763 11.973  1.00 13.14 ? 118 LEU A CA  1 
ATOM   3518 C C   . LEU C 1 113 ? 74.046 30.579 13.455  1.00 14.69 ? 118 LEU A C   1 
ATOM   3519 O O   . LEU C 1 113 ? 74.887 30.088 14.173  1.00 17.21 ? 118 LEU A O   1 
ATOM   3520 C CB  . LEU C 1 113 ? 74.391 29.417 11.298  1.00 14.93 ? 118 LEU A CB  1 
ATOM   3521 C CG  . LEU C 1 113 ? 74.776 29.451 9.827   1.00 16.43 ? 118 LEU A CG  1 
ATOM   3522 C CD1 . LEU C 1 113 ? 74.880 28.068 9.182   1.00 18.12 ? 118 LEU A CD1 1 
ATOM   3523 C CD2 . LEU C 1 113 ? 73.812 30.390 9.164   1.00 16.97 ? 118 LEU A CD2 1 
ATOM   3524 N N   . LYS C 1 114 ? 72.869 30.964 13.935  1.00 12.21 ? 119 LYS A N   1 
ATOM   3525 C CA  . LYS C 1 114 ? 72.431 30.774 15.298  1.00 13.60 ? 119 LYS A CA  1 
ATOM   3526 C C   . LYS C 1 114 ? 71.752 29.453 15.397  1.00 13.12 ? 119 LYS A C   1 
ATOM   3527 O O   . LYS C 1 114 ? 70.875 29.177 14.591  1.00 13.13 ? 119 LYS A O   1 
ATOM   3528 C CB  . LYS C 1 114 ? 71.458 31.884 15.670  1.00 16.77 ? 119 LYS A CB  1 
ATOM   3529 C CG  . LYS C 1 114 ? 71.005 31.957 17.077  1.00 26.01 ? 119 LYS A CG  1 
ATOM   3530 C CD  . LYS C 1 114 ? 70.115 30.878 17.604  1.00 32.86 ? 119 LYS A CD  1 
ATOM   3531 C CE  . LYS C 1 114 ? 69.388 31.413 18.873  1.00 38.11 ? 119 LYS A CE  1 
ATOM   3532 N NZ  . LYS C 1 114 ? 68.762 30.416 19.812  1.00 39.59 ? 119 LYS A NZ  1 
ATOM   3533 N N   . ILE C 1 115 ? 72.102 28.629 16.344  1.00 11.83 ? 120 ILE A N   1 
ATOM   3534 C CA  . ILE C 1 115 ? 71.474 27.291 16.488  1.00 12.40 ? 120 ILE A CA  1 
ATOM   3535 C C   . ILE C 1 115 ? 70.307 27.433 17.520  1.00 14.01 ? 120 ILE A C   1 
ATOM   3536 O O   . ILE C 1 115 ? 70.563 27.729 18.707  1.00 16.98 ? 120 ILE A O   1 
ATOM   3537 C CB  . ILE C 1 115 ? 72.476 26.247 16.961  1.00 13.54 ? 120 ILE A CB  1 
ATOM   3538 C CG1 . ILE C 1 115 ? 73.544 26.000 15.848  1.00 14.50 ? 120 ILE A CG1 1 
ATOM   3539 C CG2 . ILE C 1 115 ? 71.801 24.959 17.383  1.00 13.93 ? 120 ILE A CG2 1 
ATOM   3540 C CD1 . ILE C 1 115 ? 74.712 25.163 16.351  1.00 15.97 ? 120 ILE A CD1 1 
ATOM   3541 N N   . ASP C 1 116 ? 69.097 27.247 17.065  1.00 13.75 ? 121 ASP A N   1 
ATOM   3542 C CA  . ASP C 1 116 ? 67.881 27.446 17.899  1.00 15.42 ? 121 ASP A CA  1 
ATOM   3543 C C   . ASP C 1 116 ? 67.572 26.167 18.615  1.00 16.99 ? 121 ASP A C   1 
ATOM   3544 O O   . ASP C 1 116 ? 67.035 26.204 19.708  1.00 19.86 ? 121 ASP A O   1 
ATOM   3545 C CB  . ASP C 1 116 ? 66.742 27.887 17.089  1.00 19.09 ? 121 ASP A CB  1 
ATOM   3546 C CG  . ASP C 1 116 ? 66.826 29.330 16.700  1.00 23.09 ? 121 ASP A CG  1 
ATOM   3547 O OD1 . ASP C 1 116 ? 67.616 30.090 17.375  1.00 30.29 ? 121 ASP A OD1 1 
ATOM   3548 O OD2 . ASP C 1 116 ? 66.077 29.677 15.710  1.00 32.25 ? 121 ASP A OD2 1 
ATOM   3549 N N   . SER C 1 117 ? 67.865 25.024 18.012  1.00 16.70 ? 122 SER A N   1 
ATOM   3550 C CA  . SER C 1 117 ? 67.700 23.761 18.682  1.00 18.69 ? 122 SER A CA  1 
ATOM   3551 C C   . SER C 1 117 ? 68.773 22.774 18.251  1.00 16.42 ? 122 SER A C   1 
ATOM   3552 O O   . SER C 1 117 ? 69.313 22.836 17.126  1.00 14.40 ? 122 SER A O   1 
ATOM   3553 C CB  . SER C 1 117 ? 66.361 23.140 18.350  1.00 22.00 ? 122 SER A CB  1 
ATOM   3554 O OG  . SER C 1 117 ? 66.178 22.696 17.016  1.00 23.24 ? 122 SER A OG  1 
ATOM   3555 N N   . PHE C 1 118 ? 69.104 21.855 19.151  1.00 16.02 ? 123 PHE A N   1 
ATOM   3556 C CA  . PHE C 1 118 ? 70.117 20.836 18.885  1.00 15.42 ? 123 PHE A CA  1 
ATOM   3557 C C   . PHE C 1 118 ? 69.697 19.600 19.697  1.00 17.14 ? 123 PHE A C   1 
ATOM   3558 O O   . PHE C 1 118 ? 69.294 19.756 20.890  1.00 18.03 ? 123 PHE A O   1 
ATOM   3559 C CB  . PHE C 1 118 ? 71.480 21.306 19.415  1.00 16.71 ? 123 PHE A CB  1 
ATOM   3560 C CG  . PHE C 1 118 ? 72.522 20.243 19.449  1.00 17.69 ? 123 PHE A CG  1 
ATOM   3561 C CD1 . PHE C 1 118 ? 73.266 19.926 18.313  1.00 19.92 ? 123 PHE A CD1 1 
ATOM   3562 C CD2 . PHE C 1 118 ? 72.802 19.503 20.643  1.00 19.50 ? 123 PHE A CD2 1 
ATOM   3563 C CE1 . PHE C 1 118 ? 74.259 18.922 18.331  1.00 21.12 ? 123 PHE A CE1 1 
ATOM   3564 C CE2 . PHE C 1 118 ? 73.790 18.559 20.637  1.00 19.62 ? 123 PHE A CE2 1 
ATOM   3565 C CZ  . PHE C 1 118 ? 74.505 18.248 19.473  1.00 20.71 ? 123 PHE A CZ  1 
ATOM   3566 N N   . LYS C 1 119 ? 69.706 18.450 19.068  1.00 14.98 ? 124 LYS A N   1 
ATOM   3567 C CA  . LYS C 1 119 ? 69.309 17.204 19.753  1.00 18.30 ? 124 LYS A CA  1 
ATOM   3568 C C   . LYS C 1 119 ? 70.110 16.098 19.148  1.00 18.70 ? 124 LYS A C   1 
ATOM   3569 O O   . LYS C 1 119 ? 70.415 16.091 17.929  1.00 17.63 ? 124 LYS A O   1 
ATOM   3570 C CB  . LYS C 1 119 ? 67.831 16.945 19.525  1.00 19.79 ? 124 LYS A CB  1 
ATOM   3571 C CG  . LYS C 1 119 ? 67.283 15.659 20.102  1.00 21.40 ? 124 LYS A CG  1 
ATOM   3572 C CD  . LYS C 1 119 ? 65.809 15.439 19.758  1.00 20.84 ? 124 LYS A CD  1 
ATOM   3573 C CE  . LYS C 1 119 ? 65.310 14.209 20.506  1.00 22.92 ? 124 LYS A CE  1 
ATOM   3574 N NZ  . LYS C 1 119 ? 64.133 13.578 19.833  1.00 24.37 ? 124 LYS A NZ  1 
ATOM   3575 N N   . CYS C 1 120 ? 70.588 15.176 19.986  1.00 17.40 ? 125 CYS A N   1 
ATOM   3576 C CA  . CYS C 1 120 ? 71.204 13.983 19.442  1.00 19.96 ? 125 CYS A CA  1 
ATOM   3577 C C   . CYS C 1 120 ? 70.452 12.821 19.955  1.00 19.07 ? 125 CYS A C   1 
ATOM   3578 O O   . CYS C 1 120 ? 69.956 12.868 21.100  1.00 21.42 ? 125 CYS A O   1 
ATOM   3579 C CB  . CYS C 1 120 ? 72.680 13.813 19.835  1.00 22.67 ? 125 CYS A CB  1 
ATOM   3580 S SG  . CYS C 1 120 ? 73.800 15.116 19.232  1.00 28.67 ? 125 CYS A SG  1 
ATOM   3581 N N   . MET C 1 121 ? 70.345 11.759 19.176  1.00 18.19 ? 126 MET A N   1 
ATOM   3582 C CA  . MET C 1 121 ? 69.563 10.548 19.622  1.00 19.71 ? 126 MET A CA  1 
ATOM   3583 C C   . MET C 1 121 ? 70.030 9.405  18.760  1.00 19.36 ? 126 MET A C   1 
ATOM   3584 O O   . MET C 1 121 ? 70.615 9.591  17.683  1.00 18.03 ? 126 MET A O   1 
ATOM   3585 C CB  . MET C 1 121 ? 68.069 10.755 19.380  1.00 20.72 ? 126 MET A CB  1 
ATOM   3586 C CG  . MET C 1 121 ? 67.677 11.049 17.959  1.00 22.30 ? 126 MET A CG  1 
ATOM   3587 S SD  . MET C 1 121 ? 65.978 11.569 17.633  1.00 25.94 ? 126 MET A SD  1 
ATOM   3588 C CE  . MET C 1 121 ? 65.140 10.084 18.086  1.00 27.16 ? 126 MET A CE  1 
ATOM   3589 N N   . PRO C 1 122 ? 69.772 8.173  19.148  1.00 18.87 ? 127 PRO A N   1 
ATOM   3590 C CA  . PRO C 1 122 ? 70.037 7.093  18.284  1.00 20.79 ? 127 PRO A CA  1 
ATOM   3591 C C   . PRO C 1 122 ? 69.146 7.104  17.064  1.00 21.87 ? 127 PRO A C   1 
ATOM   3592 O O   . PRO C 1 122 ? 67.980 7.445  17.184  1.00 26.61 ? 127 PRO A O   1 
ATOM   3593 C CB  . PRO C 1 122 ? 69.672 5.860  19.190  1.00 22.20 ? 127 PRO A CB  1 
ATOM   3594 C CG  . PRO C 1 122 ? 69.680 6.394  20.515  1.00 21.90 ? 127 PRO A CG  1 
ATOM   3595 C CD  . PRO C 1 122 ? 69.180 7.762  20.423  1.00 21.79 ? 127 PRO A CD  1 
ATOM   3596 N N   . HIS C 1 123 ? 69.669 6.876  15.867  1.00 23.77 ? 128 HIS A N   1 
ATOM   3597 C CA  . HIS C 1 123 ? 68.841 6.897  14.699  1.00 27.32 ? 128 HIS A CA  1 
ATOM   3598 C C   . HIS C 1 123 ? 67.975 5.615  14.663  1.00 34.22 ? 128 HIS A C   1 
ATOM   3599 O O   . HIS C 1 123 ? 68.544 4.542  14.766  1.00 33.31 ? 128 HIS A O   1 
ATOM   3600 C CB  . HIS C 1 123 ? 69.685 6.952  13.452  1.00 29.48 ? 128 HIS A CB  1 
ATOM   3601 C CG  . HIS C 1 123 ? 68.933 7.403  12.260  1.00 33.85 ? 128 HIS A CG  1 
ATOM   3602 N ND1 . HIS C 1 123 ? 67.984 6.614  11.663  1.00 36.21 ? 128 HIS A ND1 1 
ATOM   3603 C CD2 . HIS C 1 123 ? 68.997 8.552  11.527  1.00 34.90 ? 128 HIS A CD2 1 
ATOM   3604 C CE1 . HIS C 1 123 ? 67.465 7.260  10.626  1.00 39.71 ? 128 HIS A CE1 1 
ATOM   3605 N NE2 . HIS C 1 123 ? 68.075 8.431  10.509  1.00 41.52 ? 128 HIS A NE2 1 
ATOM   3606 N N   . PRO C 1 124 ? 66.639 5.750  14.530  1.00 41.80 ? 129 PRO A N   1 
ATOM   3607 C CA  . PRO C 1 124 ? 65.767 4.568  14.425  1.00 45.68 ? 129 PRO A CA  1 
ATOM   3608 C C   . PRO C 1 124 ? 66.277 3.496  13.455  1.00 43.76 ? 129 PRO A C   1 
ATOM   3609 O O   . PRO C 1 124 ? 66.493 2.368  13.875  1.00 48.68 ? 129 PRO A O   1 
ATOM   3610 C CB  . PRO C 1 124 ? 64.450 5.173  13.929  1.00 46.21 ? 129 PRO A CB  1 
ATOM   3611 C CG  . PRO C 1 124 ? 64.404 6.514  14.585  1.00 42.89 ? 129 PRO A CG  1 
ATOM   3612 C CD  . PRO C 1 124 ? 65.847 7.003  14.551  1.00 42.45 ? 129 PRO A CD  1 
ATOM   3613 N N   . MET C 1 125 ? 66.479 3.827  12.186  1.00 46.24 ? 130 MET A N   1 
ATOM   3614 C CA  . MET C 1 125 ? 66.882 2.821  11.193  1.00 48.89 ? 130 MET A CA  1 
ATOM   3615 C C   . MET C 1 125 ? 68.368 2.536  11.165  1.00 44.56 ? 130 MET A C   1 
ATOM   3616 O O   . MET C 1 125 ? 68.758 1.388  11.011  1.00 42.33 ? 130 MET A O   1 
ATOM   3617 C CB  . MET C 1 125 ? 66.410 3.203  9.780   1.00 57.06 ? 130 MET A CB  1 
ATOM   3618 C CG  . MET C 1 125 ? 64.887 3.318  9.630   1.00 66.63 ? 130 MET A CG  1 
ATOM   3619 S SD  . MET C 1 125 ? 63.964 1.744  9.566   1.00 79.43 ? 130 MET A SD  1 
ATOM   3620 C CE  . MET C 1 125 ? 63.828 1.249  11.296  1.00 71.16 ? 130 MET A CE  1 
ATOM   3621 N N   . LEU C 1 126 ? 69.220 3.561  11.312  1.00 36.95 ? 131 LEU A N   1 
ATOM   3622 C CA  . LEU C 1 126 ? 70.652 3.371  11.054  1.00 35.16 ? 131 LEU A CA  1 
ATOM   3623 C C   . LEU C 1 126 ? 71.434 2.854  12.266  1.00 30.15 ? 131 LEU A C   1 
ATOM   3624 O O   . LEU C 1 126 ? 72.560 2.412  12.151  1.00 33.61 ? 131 LEU A O   1 
ATOM   3625 C CB  . LEU C 1 126 ? 71.259 4.707  10.548  1.00 35.06 ? 131 LEU A CB  1 
ATOM   3626 C CG  . LEU C 1 126 ? 70.693 5.235  9.211   1.00 39.31 ? 131 LEU A CG  1 
ATOM   3627 C CD1 . LEU C 1 126 ? 71.102 6.701  8.954   1.00 40.46 ? 131 LEU A CD1 1 
ATOM   3628 C CD2 . LEU C 1 126 ? 71.130 4.378  8.051   1.00 39.52 ? 131 LEU A CD2 1 
ATOM   3629 N N   . LYS C 1 127 ? 70.855 2.997  13.442  1.00 30.72 ? 132 LYS A N   1 
ATOM   3630 C CA  . LYS C 1 127 ? 71.499 2.518  14.669  1.00 31.30 ? 132 LYS A CA  1 
ATOM   3631 C C   . LYS C 1 127 ? 72.909 3.057  14.890  1.00 29.81 ? 132 LYS A C   1 
ATOM   3632 O O   . LYS C 1 127 ? 73.823 2.319  15.268  1.00 30.85 ? 132 LYS A O   1 
ATOM   3633 C CB  . LYS C 1 127 ? 71.530 0.975  14.662  1.00 33.70 ? 132 LYS A CB  1 
ATOM   3634 C CG  . LYS C 1 127 ? 70.200 0.368  14.316  1.00 37.89 ? 132 LYS A CG  1 
ATOM   3635 C CD  . LYS C 1 127 ? 70.377 -1.112 14.148  1.00 42.89 ? 132 LYS A CD  1 
ATOM   3636 C CE  . LYS C 1 127 ? 69.375 -1.856 14.995  1.00 48.20 ? 132 LYS A CE  1 
ATOM   3637 N NZ  . LYS C 1 127 ? 69.763 -3.295 15.086  1.00 51.82 ? 132 LYS A NZ  1 
ATOM   3638 N N   . ARG C 1 128 ? 73.063 4.349  14.558  1.00 23.61 ? 133 ARG A N   1 
ATOM   3639 C CA  . ARG C 1 128 ? 74.174 5.180  14.894  1.00 23.18 ? 133 ARG A CA  1 
ATOM   3640 C C   . ARG C 1 128 ? 73.576 6.514  15.327  1.00 19.64 ? 133 ARG A C   1 
ATOM   3641 O O   . ARG C 1 128 ? 72.412 6.804  15.074  1.00 19.53 ? 133 ARG A O   1 
ATOM   3642 C CB  . ARG C 1 128 ? 75.077 5.434  13.657  1.00 25.57 ? 133 ARG A CB  1 
ATOM   3643 C CG  . ARG C 1 128 ? 75.654 4.127  13.136  1.00 29.47 ? 133 ARG A CG  1 
ATOM   3644 C CD  . ARG C 1 128 ? 76.873 4.252  12.257  1.00 33.34 ? 133 ARG A CD  1 
ATOM   3645 N NE  . ARG C 1 128 ? 76.726 5.160  11.119  1.00 35.34 ? 133 ARG A NE  1 
ATOM   3646 C CZ  . ARG C 1 128 ? 76.229 4.846  9.926   1.00 37.50 ? 133 ARG A CZ  1 
ATOM   3647 N NH1 . ARG C 1 128 ? 75.826 3.620  9.663   1.00 39.88 ? 133 ARG A NH1 1 
ATOM   3648 N NH2 . ARG C 1 128 ? 76.131 5.766  8.989   1.00 38.15 ? 133 ARG A NH2 1 
ATOM   3649 N N   . GLU C 1 129 ? 74.349 7.253  16.096  1.00 18.99 ? 134 GLU A N   1 
ATOM   3650 C CA  . GLU C 1 129 ? 73.921 8.555  16.614  1.00 16.96 ? 134 GLU A CA  1 
ATOM   3651 C C   . GLU C 1 129 ? 73.586 9.493  15.432  1.00 16.51 ? 134 GLU A C   1 
ATOM   3652 O O   . GLU C 1 129 ? 74.362 9.605  14.488  1.00 16.83 ? 134 GLU A O   1 
ATOM   3653 C CB  . GLU C 1 129 ? 75.003 9.186  17.478  1.00 18.67 ? 134 GLU A CB  1 
ATOM   3654 C CG  . GLU C 1 129 ? 74.547 10.457 18.160  1.00 22.45 ? 134 GLU A CG  1 
ATOM   3655 C CD  . GLU C 1 129 ? 75.554 11.042 19.123  1.00 27.06 ? 134 GLU A CD  1 
ATOM   3656 O OE1 . GLU C 1 129 ? 76.768 11.284 18.746  1.00 27.41 ? 134 GLU A OE1 1 
ATOM   3657 O OE2 . GLU C 1 129 ? 75.120 11.219 20.297  1.00 34.46 ? 134 GLU A OE2 1 
ATOM   3658 N N   . VAL C 1 130 ? 72.504 10.215 15.593  1.00 16.41 ? 135 VAL A N   1 
ATOM   3659 C CA  . VAL C 1 130 ? 72.136 11.314 14.687  1.00 14.31 ? 135 VAL A CA  1 
ATOM   3660 C C   . VAL C 1 130 ? 72.024 12.554 15.484  1.00 14.94 ? 135 VAL A C   1 
ATOM   3661 O O   . VAL C 1 130 ? 71.382 12.570 16.571  1.00 15.81 ? 135 VAL A O   1 
ATOM   3662 C CB  . VAL C 1 130 ? 70.867 11.020 13.838  1.00 14.63 ? 135 VAL A CB  1 
ATOM   3663 C CG1 . VAL C 1 130 ? 69.580 10.747 14.676  1.00 14.99 ? 135 VAL A CG1 1 
ATOM   3664 C CG2 . VAL C 1 130 ? 70.569 12.146 12.869  1.00 15.30 ? 135 VAL A CG2 1 
ATOM   3665 N N   . CYS C 1 131 ? 72.559 13.651 14.956  1.00 14.40 ? 136 CYS A N   1 
ATOM   3666 C CA  . CYS C 1 131 ? 72.412 14.948 15.612  1.00 16.24 ? 136 CYS A CA  1 
ATOM   3667 C C   . CYS C 1 131 ? 71.634 15.818 14.624  1.00 14.38 ? 136 CYS A C   1 
ATOM   3668 O O   . CYS C 1 131 ? 71.867 15.781 13.442  1.00 15.19 ? 136 CYS A O   1 
ATOM   3669 C CB  . CYS C 1 131 ? 73.671 15.625 16.022  1.00 19.07 ? 136 CYS A CB  1 
ATOM   3670 S SG  . CYS C 1 131 ? 74.615 14.650 17.321  1.00 28.39 ? 136 CYS A SG  1 
ATOM   3671 N N   . GLY C 1 132 ? 70.745 16.602 15.166  1.00 14.24 ? 137 GLY A N   1 
ATOM   3672 C CA  . GLY C 1 132 ? 69.929 17.446 14.345  1.00 13.58 ? 137 GLY A CA  1 
ATOM   3673 C C   . GLY C 1 132 ? 69.812 18.850 14.889  1.00 13.66 ? 137 GLY A C   1 
ATOM   3674 O O   . GLY C 1 132 ? 69.805 19.067 16.141  1.00 14.72 ? 137 GLY A O   1 
ATOM   3675 N N   . VAL C 1 133 ? 69.709 19.809 13.979  1.00 12.70 ? 138 VAL A N   1 
ATOM   3676 C CA  . VAL C 1 133 ? 69.628 21.221 14.389  1.00 13.03 ? 138 VAL A CA  1 
ATOM   3677 C C   . VAL C 1 133 ? 68.555 21.944 13.600  1.00 13.45 ? 138 VAL A C   1 
ATOM   3678 O O   . VAL C 1 133 ? 68.184 21.511 12.532  1.00 13.42 ? 138 VAL A O   1 
ATOM   3679 C CB  . VAL C 1 133 ? 70.948 22.002 14.199  1.00 16.56 ? 138 VAL A CB  1 
ATOM   3680 C CG1 . VAL C 1 133 ? 72.049 21.569 15.149  1.00 16.27 ? 138 VAL A CG1 1 
ATOM   3681 C CG2 . VAL C 1 133 ? 71.295 21.947 12.750  1.00 18.58 ? 138 VAL A CG2 1 
ATOM   3682 N N   . ASP C 1 134 ? 68.028 22.990 14.205  1.00 13.05 ? 139 ASP A N   1 
ATOM   3683 C CA  . ASP C 1 134 ? 67.364 24.061 13.492  1.00 13.49 ? 139 ASP A CA  1 
ATOM   3684 C C   . ASP C 1 134 ? 68.154 25.293 13.721  1.00 13.30 ? 139 ASP A C   1 
ATOM   3685 O O   . ASP C 1 134 ? 68.599 25.587 14.890  1.00 14.06 ? 139 ASP A O   1 
ATOM   3686 C CB  . ASP C 1 134 ? 65.959 24.317 13.996  1.00 15.16 ? 139 ASP A CB  1 
ATOM   3687 C CG  . ASP C 1 134 ? 64.984 24.927 12.827  1.00 19.50 ? 139 ASP A CG  1 
ATOM   3688 O OD1 . ASP C 1 134 ? 64.981 24.480 11.651  1.00 16.82 ? 139 ASP A OD1 1 
ATOM   3689 O OD2 . ASP C 1 134 ? 64.233 25.864 13.122  1.00 24.59 ? 139 ASP A OD2 1 
ATOM   3690 N N   . ALA C 1 135 ? 68.483 25.992 12.669  1.00 11.91 ? 140 ALA A N   1 
ATOM   3691 C CA  . ALA C 1 135 ? 69.387 27.151 12.757  1.00 11.23 ? 140 ALA A CA  1 
ATOM   3692 C C   . ALA C 1 135 ? 68.899 28.269 11.856  1.00 10.25 ? 140 ALA A C   1 
ATOM   3693 O O   . ALA C 1 135 ? 68.023 28.035 10.996  1.00 12.08 ? 140 ALA A O   1 
ATOM   3694 C CB  . ALA C 1 135 ? 70.825 26.769 12.322  1.00 11.46 ? 140 ALA A CB  1 
ATOM   3695 N N   . VAL C 1 136 ? 69.331 29.448 12.137  1.00 10.21 ? 141 VAL A N   1 
ATOM   3696 C CA  . VAL C 1 136 ? 68.893 30.619 11.418  1.00 11.46 ? 141 VAL A CA  1 
ATOM   3697 C C   . VAL C 1 136 ? 70.072 31.485 11.087  1.00 11.56 ? 141 VAL A C   1 
ATOM   3698 O O   . VAL C 1 136 ? 71.033 31.627 11.888  1.00 12.78 ? 141 VAL A O   1 
ATOM   3699 C CB  . VAL C 1 136 ? 67.840 31.490 12.200  1.00 14.35 ? 141 VAL A CB  1 
ATOM   3700 C CG1 . VAL C 1 136 ? 66.610 30.663 12.430  1.00 15.51 ? 141 VAL A CG1 1 
ATOM   3701 C CG2 . VAL C 1 136 ? 68.362 32.015 13.525  1.00 17.65 ? 141 VAL A CG2 1 
ATOM   3702 N N   . GLY C 1 137 ? 69.931 32.271 10.069  1.00 11.97 ? 142 GLY A N   1 
ATOM   3703 C CA  . GLY C 1 137 ? 70.944 33.304 9.742   1.00 12.02 ? 142 GLY A CA  1 
ATOM   3704 C C   . GLY C 1 137 ? 70.385 34.316 8.845   1.00 11.83 ? 142 GLY A C   1 
ATOM   3705 O O   . GLY C 1 137 ? 69.244 34.151 8.330   1.00 12.23 ? 142 GLY A O   1 
ATOM   3706 N N   . GLU C 1 138 ? 71.101 35.412 8.582   1.00 11.68 ? 143 GLU A N   1 
ATOM   3707 C CA  . GLU C 1 138 ? 70.583 36.431 7.727   1.00 12.46 ? 143 GLU A CA  1 
ATOM   3708 C C   . GLU C 1 138 ? 71.802 37.073 7.062   1.00 11.30 ? 143 GLU A C   1 
ATOM   3709 O O   . GLU C 1 138 ? 72.896 37.199 7.663   1.00 11.79 ? 143 GLU A O   1 
ATOM   3710 C CB  . GLU C 1 138 ? 69.887 37.534 8.511   1.00 16.33 ? 143 GLU A CB  1 
ATOM   3711 C CG  . GLU C 1 138 ? 68.880 37.166 9.520   1.00 25.99 ? 143 GLU A CG  1 
ATOM   3712 C CD  . GLU C 1 138 ? 68.028 38.354 10.017  1.00 33.32 ? 143 GLU A CD  1 
ATOM   3713 O OE1 . GLU C 1 138 ? 68.492 39.539 9.988   1.00 42.88 ? 143 GLU A OE1 1 
ATOM   3714 O OE2 . GLU C 1 138 ? 66.865 38.063 10.409  1.00 41.02 ? 143 GLU A OE2 1 
ATOM   3715 N N   . PHE C 1 139 ? 71.617 37.488 5.843   1.00 11.30 ? 144 PHE A N   1 
ATOM   3716 C CA  . PHE C 1 139 ? 72.606 38.245 5.077   1.00 10.65 ? 144 PHE A CA  1 
ATOM   3717 C C   . PHE C 1 139 ? 71.991 39.192 4.091   1.00 11.94 ? 144 PHE A C   1 
ATOM   3718 O O   . PHE C 1 139 ? 70.807 39.035 3.739   1.00 13.10 ? 144 PHE A O   1 
ATOM   3719 C CB  . PHE C 1 139 ? 73.606 37.299 4.386   1.00 11.40 ? 144 PHE A CB  1 
ATOM   3720 C CG  . PHE C 1 139 ? 73.028 36.437 3.261   1.00 12.72 ? 144 PHE A CG  1 
ATOM   3721 C CD1 . PHE C 1 139 ? 72.496 35.177 3.596   1.00 14.81 ? 144 PHE A CD1 1 
ATOM   3722 C CD2 . PHE C 1 139 ? 72.988 36.832 2.000   1.00 12.18 ? 144 PHE A CD2 1 
ATOM   3723 C CE1 . PHE C 1 139 ? 71.955 34.378 2.637   1.00 16.77 ? 144 PHE A CE1 1 
ATOM   3724 C CE2 . PHE C 1 139 ? 72.502 35.975 0.986   1.00 12.85 ? 144 PHE A CE2 1 
ATOM   3725 C CZ  . PHE C 1 139 ? 71.962 34.761 1.339   1.00 13.65 ? 144 PHE A CZ  1 
ATOM   3726 N N   . SER C 1 140 ? 72.797 40.126 3.548   1.00 12.50 ? 145 SER A N   1 
ATOM   3727 C CA  . SER C 1 140 ? 72.326 41.024 2.534   1.00 12.57 ? 145 SER A CA  1 
ATOM   3728 C C   . SER C 1 140 ? 72.884 40.530 1.201   1.00 12.23 ? 145 SER A C   1 
ATOM   3729 O O   . SER C 1 140 ? 74.063 40.434 0.999   1.00 12.65 ? 145 SER A O   1 
ATOM   3730 C CB  . SER C 1 140 ? 72.837 42.418 2.945   1.00 15.80 ? 145 SER A CB  1 
ATOM   3731 O OG  . SER C 1 140 ? 72.203 43.392 2.189   1.00 19.66 ? 145 SER A OG  1 
ATOM   3732 N N   . ARG C 1 141 ? 72.035 40.109 0.277   1.00 10.19 ? 146 ARG A N   1 
ATOM   3733 C CA  . ARG C 1 141 ? 72.441 39.428 -0.910  1.00 10.26 ? 146 ARG A CA  1 
ATOM   3734 C C   . ARG C 1 141 ? 73.300 40.227 -1.801  1.00 10.20 ? 146 ARG A C   1 
ATOM   3735 O O   . ARG C 1 141 ? 74.083 39.677 -2.580  1.00 10.15 ? 146 ARG A O   1 
ATOM   3736 C CB  . ARG C 1 141 ? 71.258 38.746 -1.611  1.00 10.47 ? 146 ARG A CB  1 
ATOM   3737 C CG  . ARG C 1 141 ? 70.122 39.670 -2.063  1.00 11.93 ? 146 ARG A CG  1 
ATOM   3738 C CD  . ARG C 1 141 ? 69.241 38.836 -2.976  1.00 13.51 ? 146 ARG A CD  1 
ATOM   3739 N NE  . ARG C 1 141 ? 67.962 39.430 -3.308  1.00 15.01 ? 146 ARG A NE  1 
ATOM   3740 C CZ  . ARG C 1 141 ? 67.722 40.269 -4.298  1.00 17.20 ? 146 ARG A CZ  1 
ATOM   3741 N NH1 . ARG C 1 141 ? 68.681 40.676 -5.095  1.00 16.01 ? 146 ARG A NH1 1 
ATOM   3742 N NH2 . ARG C 1 141 ? 66.435 40.701 -4.488  1.00 18.78 ? 146 ARG A NH2 1 
ATOM   3743 N N   . ASP C 1 142 ? 73.195 41.555 -1.706  1.00 11.56 ? 147 ASP A N   1 
ATOM   3744 C CA  . ASP C 1 142 ? 74.050 42.372 -2.514  1.00 13.13 ? 147 ASP A CA  1 
ATOM   3745 C C   . ASP C 1 142 ? 75.529 42.277 -2.115  1.00 13.66 ? 147 ASP A C   1 
ATOM   3746 O O   . ASP C 1 142 ? 76.387 42.534 -2.984  1.00 14.59 ? 147 ASP A O   1 
ATOM   3747 C CB  . ASP C 1 142 ? 73.588 43.850 -2.512  1.00 14.93 ? 147 ASP A CB  1 
ATOM   3748 C CG  . ASP C 1 142 ? 73.317 44.399 -1.149  1.00 18.53 ? 147 ASP A CG  1 
ATOM   3749 O OD1 . ASP C 1 142 ? 73.221 43.681 -0.150  1.00 19.13 ? 147 ASP A OD1 1 
ATOM   3750 O OD2 . ASP C 1 142 ? 73.225 45.673 -1.053  1.00 23.77 ? 147 ASP A OD2 1 
ATOM   3751 N N   . ASP C 1 143 ? 75.798 41.814 -0.894  1.00 11.92 ? 148 ASP A N   1 
ATOM   3752 C CA  . ASP C 1 143 ? 77.167 41.559 -0.418  1.00 13.58 ? 148 ASP A CA  1 
ATOM   3753 C C   . ASP C 1 143 ? 77.838 40.453 -1.240  1.00 15.05 ? 148 ASP A C   1 
ATOM   3754 O O   . ASP C 1 143 ? 79.074 40.316 -1.220  1.00 16.88 ? 148 ASP A O   1 
ATOM   3755 C CB  . ASP C 1 143 ? 77.244 41.175 1.027   1.00 14.60 ? 148 ASP A CB  1 
ATOM   3756 C CG  . ASP C 1 143 ? 76.965 42.332 1.943   1.00 19.44 ? 148 ASP A CG  1 
ATOM   3757 O OD1 . ASP C 1 143 ? 76.920 43.507 1.389   1.00 22.86 ? 148 ASP A OD1 1 
ATOM   3758 O OD2 . ASP C 1 143 ? 76.810 42.082 3.177   1.00 22.86 ? 148 ASP A OD2 1 
ATOM   3759 N N   . PHE C 1 144 ? 77.026 39.610 -1.898  1.00 11.93 ? 149 PHE A N   1 
ATOM   3760 C CA  . PHE C 1 144 ? 77.483 38.527 -2.786  1.00 12.74 ? 149 PHE A CA  1 
ATOM   3761 C C   . PHE C 1 144 ? 77.301 38.821 -4.255  1.00 13.80 ? 149 PHE A C   1 
ATOM   3762 O O   . PHE C 1 144 ? 77.450 37.904 -5.086  1.00 13.44 ? 149 PHE A O   1 
ATOM   3763 C CB  . PHE C 1 144 ? 76.742 37.220 -2.390  1.00 11.85 ? 149 PHE A CB  1 
ATOM   3764 C CG  . PHE C 1 144 ? 77.015 36.760 -1.042  1.00 10.69 ? 149 PHE A CG  1 
ATOM   3765 C CD1 . PHE C 1 144 ? 78.103 35.996 -0.805  1.00 10.75 ? 149 PHE A CD1 1 
ATOM   3766 C CD2 . PHE C 1 144 ? 76.204 37.180 0.069   1.00 10.82 ? 149 PHE A CD2 1 
ATOM   3767 C CE1 . PHE C 1 144 ? 78.373 35.525 0.462   1.00 10.07 ? 149 PHE A CE1 1 
ATOM   3768 C CE2 . PHE C 1 144 ? 76.465 36.734 1.326   1.00 11.54 ? 149 PHE A CE2 1 
ATOM   3769 C CZ  . PHE C 1 144 ? 77.567 35.919 1.560   1.00 10.63 ? 149 PHE A CZ  1 
ATOM   3770 N N   . GLY C 1 145 ? 77.072 40.096 -4.585  1.00 14.94 ? 150 GLY A N   1 
ATOM   3771 C CA  . GLY C 1 145 ? 76.910 40.458 -5.925  1.00 15.61 ? 150 GLY A CA  1 
ATOM   3772 C C   . GLY C 1 145 ? 75.544 40.214 -6.477  1.00 16.99 ? 150 GLY A C   1 
ATOM   3773 O O   . GLY C 1 145 ? 75.303 40.356 -7.706  1.00 20.28 ? 150 GLY A O   1 
ATOM   3774 N N   . LEU C 1 146 ? 74.572 39.896 -5.623  1.00 15.03 ? 151 LEU A N   1 
ATOM   3775 C CA  . LEU C 1 146 ? 73.250 39.511 -6.105  1.00 15.18 ? 151 LEU A CA  1 
ATOM   3776 C C   . LEU C 1 146 ? 72.293 40.659 -5.803  1.00 16.51 ? 151 LEU A C   1 
ATOM   3777 O O   . LEU C 1 146 ? 71.555 40.630 -4.794  1.00 18.01 ? 151 LEU A O   1 
ATOM   3778 C CB  . LEU C 1 146 ? 72.827 38.254 -5.400  1.00 14.45 ? 151 LEU A CB  1 
ATOM   3779 C CG  . LEU C 1 146 ? 73.644 36.998 -5.603  1.00 13.83 ? 151 LEU A CG  1 
ATOM   3780 C CD1 . LEU C 1 146 ? 73.253 35.942 -4.612  1.00 14.82 ? 151 LEU A CD1 1 
ATOM   3781 C CD2 . LEU C 1 146 ? 73.545 36.442 -7.005  1.00 14.15 ? 151 LEU A CD2 1 
ATOM   3782 N N   . ASP C 1 147 ? 72.383 41.692 -6.640  1.00 20.57 ? 152 ASP A N   1 
ATOM   3783 C CA  . ASP C 1 147 ? 71.624 42.896 -6.365  1.00 22.35 ? 152 ASP A CA  1 
ATOM   3784 C C   . ASP C 1 147 ? 70.353 43.103 -7.253  1.00 21.67 ? 152 ASP A C   1 
ATOM   3785 O O   . ASP C 1 147 ? 69.852 44.281 -7.281  1.00 23.41 ? 152 ASP A O   1 
ATOM   3786 C CB  . ASP C 1 147 ? 72.546 44.112 -6.537  1.00 26.11 ? 152 ASP A CB  1 
ATOM   3787 C CG  . ASP C 1 147 ? 73.193 44.186 -7.933  1.00 31.78 ? 152 ASP A CG  1 
ATOM   3788 O OD1 . ASP C 1 147 ? 72.830 43.451 -8.877  1.00 30.93 ? 152 ASP A OD1 1 
ATOM   3789 O OD2 . ASP C 1 147 ? 74.078 45.058 -8.102  1.00 40.32 ? 152 ASP A OD2 1 
ATOM   3790 N N   . TYR C 1 148 ? 69.862 42.065 -7.957  1.00 21.31 ? 153 TYR A N   1 
ATOM   3791 C CA  . TYR C 1 148 ? 68.678 42.181 -8.802  1.00 22.61 ? 153 TYR A CA  1 
ATOM   3792 C C   . TYR C 1 148 ? 67.558 42.816 -7.975  1.00 24.17 ? 153 TYR A C   1 
ATOM   3793 O O   . TYR C 1 148 ? 67.306 42.533 -6.765  1.00 22.05 ? 153 TYR A O   1 
ATOM   3794 C CB  . TYR C 1 148 ? 68.287 40.799 -9.350  1.00 25.89 ? 153 TYR A CB  1 
ATOM   3795 C CG  . TYR C 1 148 ? 67.340 40.796 -10.576 1.00 30.92 ? 153 TYR A CG  1 
ATOM   3796 C CD1 . TYR C 1 148 ? 67.834 40.805 -11.871 1.00 37.47 ? 153 TYR A CD1 1 
ATOM   3797 C CD2 . TYR C 1 148 ? 66.009 40.769 -10.386 1.00 35.70 ? 153 TYR A CD2 1 
ATOM   3798 C CE1 . TYR C 1 148 ? 66.957 40.818 -12.971 1.00 42.20 ? 153 TYR A CE1 1 
ATOM   3799 C CE2 . TYR C 1 148 ? 65.112 40.794 -11.446 1.00 36.85 ? 153 TYR A CE2 1 
ATOM   3800 C CZ  . TYR C 1 148 ? 65.598 40.812 -12.739 1.00 44.67 ? 153 TYR A CZ  1 
ATOM   3801 O OH  . TYR C 1 148 ? 64.753 40.792 -13.838 1.00 48.83 ? 153 TYR A OH  1 
ATOM   3802 N N   . GLY C 1 149 ? 66.818 43.743 -8.580  1.00 23.91 ? 154 GLY A N   1 
ATOM   3803 C CA  . GLY C 1 149 ? 65.686 44.274 -7.901  1.00 24.52 ? 154 GLY A CA  1 
ATOM   3804 C C   . GLY C 1 149 ? 65.948 45.494 -7.064  1.00 25.65 ? 154 GLY A C   1 
ATOM   3805 O O   . GLY C 1 149 ? 65.033 46.170 -6.685  1.00 24.24 ? 154 GLY A O   1 
ATOM   3806 N N   . LYS C 1 150 ? 67.209 45.753 -6.730  1.00 27.92 ? 155 LYS A N   1 
ATOM   3807 C CA  . LYS C 1 150 ? 67.557 46.799 -5.804  1.00 32.75 ? 155 LYS A CA  1 
ATOM   3808 C C   . LYS C 1 150 ? 67.104 48.126 -6.355  1.00 36.19 ? 155 LYS A C   1 
ATOM   3809 O O   . LYS C 1 150 ? 66.631 48.981 -5.602  1.00 39.14 ? 155 LYS A O   1 
ATOM   3810 C CB  . LYS C 1 150 ? 69.058 46.818 -5.569  1.00 32.09 ? 155 LYS A CB  1 
ATOM   3811 C CG  . LYS C 1 150 ? 69.518 47.567 -4.303  1.00 31.03 ? 155 LYS A CG  1 
ATOM   3812 C CD  . LYS C 1 150 ? 71.003 47.350 -4.114  1.00 32.93 ? 155 LYS A CD  1 
ATOM   3813 C CE  . LYS C 1 150 ? 71.541 48.091 -2.919  1.00 35.14 ? 155 LYS A CE  1 
ATOM   3814 N NZ  . LYS C 1 150 ? 73.000 47.909 -2.733  1.00 32.35 ? 155 LYS A NZ  1 
ATOM   3815 N N   . GLN C 1 151 ? 67.209 48.264 -7.671  1.00 43.77 ? 156 GLN A N   1 
ATOM   3816 C CA  . GLN C 1 151 ? 66.774 49.492 -8.399  1.00 47.80 ? 156 GLN A CA  1 
ATOM   3817 C C   . GLN C 1 151 ? 65.288 49.788 -8.305  1.00 44.78 ? 156 GLN A C   1 
ATOM   3818 O O   . GLN C 1 151 ? 64.861 50.876 -8.606  1.00 47.57 ? 156 GLN A O   1 
ATOM   3819 C CB  . GLN C 1 151 ? 67.133 49.378 -9.900  1.00 57.02 ? 156 GLN A CB  1 
ATOM   3820 C CG  . GLN C 1 151 ? 68.620 49.375 -10.183 1.00 60.11 ? 156 GLN A CG  1 
ATOM   3821 C CD  . GLN C 1 151 ? 69.293 50.560 -9.529  1.00 62.77 ? 156 GLN A CD  1 
ATOM   3822 O OE1 . GLN C 1 151 ? 69.793 50.476 -8.400  1.00 64.03 ? 156 GLN A OE1 1 
ATOM   3823 N NE2 . GLN C 1 151 ? 69.258 51.689 -10.212 1.00 67.15 ? 156 GLN A NE2 1 
ATOM   3824 N N   . TYR C 1 152 ? 64.526 48.786 -7.921  1.00 40.00 ? 157 TYR A N   1 
ATOM   3825 C CA  . TYR C 1 152 ? 63.088 48.773 -7.940  1.00 40.92 ? 157 TYR A CA  1 
ATOM   3826 C C   . TYR C 1 152 ? 62.480 48.631 -6.527  1.00 36.55 ? 157 TYR A C   1 
ATOM   3827 O O   . TYR C 1 152 ? 61.319 48.285 -6.399  1.00 40.21 ? 157 TYR A O   1 
ATOM   3828 C CB  . TYR C 1 152 ? 62.603 47.608 -8.843  1.00 46.72 ? 157 TYR A CB  1 
ATOM   3829 C CG  . TYR C 1 152 ? 62.946 47.733 -10.341 1.00 56.29 ? 157 TYR A CG  1 
ATOM   3830 C CD1 . TYR C 1 152 ? 64.278 47.626 -10.803 1.00 56.74 ? 157 TYR A CD1 1 
ATOM   3831 C CD2 . TYR C 1 152 ? 61.934 47.951 -11.304 1.00 63.76 ? 157 TYR A CD2 1 
ATOM   3832 C CE1 . TYR C 1 152 ? 64.590 47.739 -12.153 1.00 61.38 ? 157 TYR A CE1 1 
ATOM   3833 C CE2 . TYR C 1 152 ? 62.251 48.069 -12.662 1.00 65.96 ? 157 TYR A CE2 1 
ATOM   3834 C CZ  . TYR C 1 152 ? 63.575 47.964 -13.067 1.00 61.99 ? 157 TYR A CZ  1 
ATOM   3835 O OH  . TYR C 1 152 ? 63.876 48.078 -14.387 1.00 74.05 ? 157 TYR A OH  1 
ATOM   3836 N N   . GLY C 1 153 ? 63.262 48.865 -5.475  1.00 32.84 ? 158 GLY A N   1 
ATOM   3837 C CA  . GLY C 1 153 ? 62.755 48.857 -4.084  1.00 31.01 ? 158 GLY A CA  1 
ATOM   3838 C C   . GLY C 1 153 ? 62.781 47.518 -3.310  1.00 29.16 ? 158 GLY A C   1 
ATOM   3839 O O   . GLY C 1 153 ? 62.289 47.476 -2.126  1.00 24.48 ? 158 GLY A O   1 
ATOM   3840 N N   . PHE C 1 154 ? 63.339 46.456 -3.959  1.00 24.31 ? 159 PHE A N   1 
ATOM   3841 C CA  . PHE C 1 154 ? 63.464 45.127 -3.328  1.00 21.14 ? 159 PHE A CA  1 
ATOM   3842 C C   . PHE C 1 154 ? 64.536 45.257 -2.235  1.00 19.04 ? 159 PHE A C   1 
ATOM   3843 O O   . PHE C 1 154 ? 65.471 45.975 -2.378  1.00 20.74 ? 159 PHE A O   1 
ATOM   3844 C CB  . PHE C 1 154 ? 63.937 44.002 -4.262  1.00 21.06 ? 159 PHE A CB  1 
ATOM   3845 C CG  . PHE C 1 154 ? 62.876 43.394 -5.164  1.00 22.91 ? 159 PHE A CG  1 
ATOM   3846 C CD1 . PHE C 1 154 ? 62.121 44.203 -6.033  1.00 26.86 ? 159 PHE A CD1 1 
ATOM   3847 C CD2 . PHE C 1 154 ? 62.567 42.062 -5.054  1.00 23.04 ? 159 PHE A CD2 1 
ATOM   3848 C CE1 . PHE C 1 154 ? 61.201 43.628 -6.900  1.00 29.71 ? 159 PHE A CE1 1 
ATOM   3849 C CE2 . PHE C 1 154 ? 61.639 41.468 -5.906  1.00 26.01 ? 159 PHE A CE2 1 
ATOM   3850 C CZ  . PHE C 1 154 ? 60.945 42.233 -6.807  1.00 28.63 ? 159 PHE A CZ  1 
ATOM   3851 N N   . LYS C 1 155 ? 64.181 44.693 -1.127  1.00 18.86 ? 160 LYS A N   1 
ATOM   3852 C CA  . LYS C 1 155 ? 65.043 44.618 0.019   1.00 17.00 ? 160 LYS A CA  1 
ATOM   3853 C C   . LYS C 1 155 ? 66.040 43.478 -0.205  1.00 15.41 ? 160 LYS A C   1 
ATOM   3854 O O   . LYS C 1 155 ? 65.718 42.385 -0.774  1.00 15.00 ? 160 LYS A O   1 
ATOM   3855 C CB  . LYS C 1 155 ? 64.273 44.356 1.279   1.00 22.15 ? 160 LYS A CB  1 
ATOM   3856 C CG  . LYS C 1 155 ? 63.181 45.407 1.584   1.00 26.13 ? 160 LYS A CG  1 
ATOM   3857 C CD  . LYS C 1 155 ? 62.641 45.088 3.002   1.00 35.96 ? 160 LYS A CD  1 
ATOM   3858 C CE  . LYS C 1 155 ? 61.129 44.868 3.201   1.00 38.97 ? 160 LYS A CE  1 
ATOM   3859 N NZ  . LYS C 1 155 ? 60.489 46.012 3.928   1.00 42.30 ? 160 LYS A NZ  1 
ATOM   3860 N N   . MET C 1 156 ? 67.270 43.713 0.290   1.00 13.25 ? 161 MET A N   1 
ATOM   3861 C CA  . MET C 1 156 ? 68.372 42.753 0.072   1.00 13.78 ? 161 MET A CA  1 
ATOM   3862 C C   . MET C 1 156 ? 68.523 41.762 1.230   1.00 12.84 ? 161 MET A C   1 
ATOM   3863 O O   . MET C 1 156 ? 69.122 40.695 1.051   1.00 11.86 ? 161 MET A O   1 
ATOM   3864 C CB  . MET C 1 156 ? 69.697 43.429 -0.121  1.00 14.80 ? 161 MET A CB  1 
ATOM   3865 C CG  . MET C 1 156 ? 69.742 44.369 -1.298  1.00 16.03 ? 161 MET A CG  1 
ATOM   3866 S SD  . MET C 1 156 ? 69.665 43.516 -2.893  1.00 17.46 ? 161 MET A SD  1 
ATOM   3867 C CE  . MET C 1 156 ? 67.983 43.838 -3.384  1.00 17.95 ? 161 MET A CE  1 
ATOM   3868 N N   . LYS C 1 157 ? 67.872 41.994 2.357   1.00 13.23 ? 162 LYS A N   1 
ATOM   3869 C CA  . LYS C 1 157 ? 67.972 41.126 3.502   1.00 14.54 ? 162 LYS A CA  1 
ATOM   3870 C C   . LYS C 1 157 ? 67.334 39.810 3.197   1.00 13.60 ? 162 LYS A C   1 
ATOM   3871 O O   . LYS C 1 157 ? 66.181 39.729 2.699   1.00 14.36 ? 162 LYS A O   1 
ATOM   3872 C CB  . LYS C 1 157 ? 67.275 41.705 4.703   1.00 18.41 ? 162 LYS A CB  1 
ATOM   3873 C CG  . LYS C 1 157 ? 67.238 40.822 5.956   1.00 22.68 ? 162 LYS A CG  1 
ATOM   3874 C CD  . LYS C 1 157 ? 66.042 41.281 6.830   1.00 30.19 ? 162 LYS A CD  1 
ATOM   3875 C CE  . LYS C 1 157 ? 65.876 40.492 8.116   1.00 38.48 ? 162 LYS A CE  1 
ATOM   3876 N NZ  . LYS C 1 157 ? 64.690 40.999 8.891   1.00 45.28 ? 162 LYS A NZ  1 
ATOM   3877 N N   . THR C 1 158 ? 68.108 38.762 3.354   1.00 10.64 ? 163 THR A N   1 
ATOM   3878 C CA  . THR C 1 158 ? 67.676 37.402 3.032   1.00 10.70 ? 163 THR A CA  1 
ATOM   3879 C C   . THR C 1 158 ? 67.863 36.546 4.275   1.00 11.50 ? 163 THR A C   1 
ATOM   3880 O O   . THR C 1 158 ? 68.955 36.571 4.895   1.00 11.48 ? 163 THR A O   1 
ATOM   3881 C CB  . THR C 1 158 ? 68.542 36.851 1.891   1.00 10.66 ? 163 THR A CB  1 
ATOM   3882 O OG1 . THR C 1 158 ? 68.521 37.735 0.787   1.00 11.96 ? 163 THR A OG1 1 
ATOM   3883 C CG2 . THR C 1 158 ? 68.087 35.441 1.426   1.00 12.57 ? 163 THR A CG2 1 
ATOM   3884 N N   . LYS C 1 159 ? 66.812 35.857 4.698   1.00 10.95 ? 164 LYS A N   1 
ATOM   3885 C CA  . LYS C 1 159 ? 66.862 35.006 5.867   1.00 10.82 ? 164 LYS A CA  1 
ATOM   3886 C C   . LYS C 1 159 ? 67.076 33.567 5.492   1.00 10.57 ? 164 LYS A C   1 
ATOM   3887 O O   . LYS C 1 159 ? 66.518 33.113 4.522   1.00 10.20 ? 164 LYS A O   1 
ATOM   3888 C CB  . LYS C 1 159 ? 65.610 35.147 6.716   1.00 13.50 ? 164 LYS A CB  1 
ATOM   3889 C CG  . LYS C 1 159 ? 65.381 36.519 7.387   1.00 18.13 ? 164 LYS A CG  1 
ATOM   3890 C CD  . LYS C 1 159 ? 63.987 36.577 8.068   1.00 25.57 ? 164 LYS A CD  1 
ATOM   3891 C CE  . LYS C 1 159 ? 63.743 37.967 8.681   1.00 33.17 ? 164 LYS A CE  1 
ATOM   3892 N NZ  . LYS C 1 159 ? 62.755 37.850 9.825   1.00 40.93 ? 164 LYS A NZ  1 
ATOM   3893 N N   . LEU C 1 160 ? 67.855 32.848 6.309   1.00 10.58 ? 165 LEU A N   1 
ATOM   3894 C CA  . LEU C 1 160 ? 68.116 31.436 6.100   1.00 10.38 ? 165 LEU A CA  1 
ATOM   3895 C C   . LEU C 1 160 ? 67.513 30.740 7.287   1.00 11.20 ? 165 LEU A C   1 
ATOM   3896 O O   . LEU C 1 160 ? 67.679 31.139 8.452   1.00 12.21 ? 165 LEU A O   1 
ATOM   3897 C CB  . LEU C 1 160 ? 69.572 31.097 6.102   1.00 12.33 ? 165 LEU A CB  1 
ATOM   3898 C CG  . LEU C 1 160 ? 70.328 31.608 4.871   1.00 14.53 ? 165 LEU A CG  1 
ATOM   3899 C CD1 . LEU C 1 160 ? 71.835 31.435 5.061   1.00 17.91 ? 165 LEU A CD1 1 
ATOM   3900 C CD2 . LEU C 1 160 ? 69.745 31.066 3.557   1.00 17.71 ? 165 LEU A CD2 1 
ATOM   3901 N N   . LEU C 1 161 ? 66.800 29.656 6.979   1.00 10.02 ? 166 LEU A N   1 
ATOM   3902 C CA  . LEU C 1 161 ? 66.184 28.757 7.986   1.00 10.33 ? 166 LEU A CA  1 
ATOM   3903 C C   . LEU C 1 161 ? 66.676 27.384 7.655   1.00 10.38 ? 166 LEU A C   1 
ATOM   3904 O O   . LEU C 1 161 ? 66.263 26.804 6.653   1.00 11.03 ? 166 LEU A O   1 
ATOM   3905 C CB  . LEU C 1 161 ? 64.654 28.855 7.977   1.00 12.01 ? 166 LEU A CB  1 
ATOM   3906 C CG  . LEU C 1 161 ? 64.074 30.224 8.376   1.00 13.05 ? 166 LEU A CG  1 
ATOM   3907 C CD1 . LEU C 1 161 ? 63.936 31.112 7.228   1.00 16.48 ? 166 LEU A CD1 1 
ATOM   3908 C CD2 . LEU C 1 161 ? 62.736 30.034 9.034   1.00 15.92 ? 166 LEU A CD2 1 
ATOM   3909 N N   . ILE C 1 162 ? 67.531 26.839 8.513   1.00 10.20 ? 167 ILE A N   1 
ATOM   3910 C CA  . ILE C 1 162 ? 68.263 25.639 8.159   1.00 11.03 ? 167 ILE A CA  1 
ATOM   3911 C C   . ILE C 1 162 ? 67.836 24.460 8.959   1.00 11.10 ? 167 ILE A C   1 
ATOM   3912 O O   . ILE C 1 162 ? 67.706 24.500 10.159  1.00 11.58 ? 167 ILE A O   1 
ATOM   3913 C CB  . ILE C 1 162 ? 69.717 25.896 8.412   1.00 13.57 ? 167 ILE A CB  1 
ATOM   3914 C CG1 . ILE C 1 162 ? 70.264 26.905 7.302   1.00 17.06 ? 167 ILE A CG1 1 
ATOM   3915 C CG2 . ILE C 1 162 ? 70.559 24.649 8.245   1.00 15.07 ? 167 ILE A CG2 1 
ATOM   3916 C CD1 . ILE C 1 162 ? 71.421 27.569 7.835   1.00 20.25 ? 167 ILE A CD1 1 
ATOM   3917 N N   . THR C 1 163 ? 67.551 23.395 8.235   1.00 10.97 ? 168 THR A N   1 
ATOM   3918 C CA  . THR C 1 163 ? 67.257 22.106 8.796   1.00 11.62 ? 168 THR A CA  1 
ATOM   3919 C C   . THR C 1 163 ? 68.468 21.263 8.552   1.00 10.86 ? 168 THR A C   1 
ATOM   3920 O O   . THR C 1 163 ? 68.935 21.225 7.411   1.00 10.31 ? 168 THR A O   1 
ATOM   3921 C CB  . THR C 1 163 ? 66.126 21.425 7.909   1.00 13.63 ? 168 THR A CB  1 
ATOM   3922 O OG1 . THR C 1 163 ? 64.918 22.267 7.886   1.00 19.43 ? 168 THR A OG1 1 
ATOM   3923 C CG2 . THR C 1 163 ? 65.836 19.999 8.379   1.00 15.71 ? 168 THR A CG2 1 
ATOM   3924 N N   . ALA C 1 164 ? 69.001 20.539 9.543   1.00 10.74 ? 169 ALA A N   1 
ATOM   3925 C CA  . ALA C 1 164 ? 70.144 19.620 9.205   1.00 11.55 ? 169 ALA A CA  1 
ATOM   3926 C C   . ALA C 1 164 ? 70.124 18.464 10.178  1.00 11.71 ? 169 ALA A C   1 
ATOM   3927 O O   . ALA C 1 164 ? 69.870 18.649 11.415  1.00 12.40 ? 169 ALA A O   1 
ATOM   3928 C CB  . ALA C 1 164 ? 71.483 20.405 9.296   1.00 12.71 ? 169 ALA A CB  1 
ATOM   3929 N N   . GLU C 1 165 ? 70.441 17.300 9.636   1.00 11.05 ? 170 GLU A N   1 
ATOM   3930 C CA  . GLU C 1 165 ? 70.609 16.091 10.445  1.00 12.70 ? 170 GLU A CA  1 
ATOM   3931 C C   . GLU C 1 165 ? 71.861 15.420 9.951   1.00 11.89 ? 170 GLU A C   1 
ATOM   3932 O O   . GLU C 1 165 ? 72.085 15.328 8.773   1.00 12.24 ? 170 GLU A O   1 
ATOM   3933 C CB  . GLU C 1 165 ? 69.462 15.110 10.290  1.00 13.99 ? 170 GLU A CB  1 
ATOM   3934 C CG  . GLU C 1 165 ? 68.169 15.700 10.854  1.00 14.80 ? 170 GLU A CG  1 
ATOM   3935 C CD  . GLU C 1 165 ? 67.036 14.743 10.976  1.00 17.17 ? 170 GLU A CD  1 
ATOM   3936 O OE1 . GLU C 1 165 ? 67.135 13.569 10.558  1.00 17.99 ? 170 GLU A OE1 1 
ATOM   3937 O OE2 . GLU C 1 165 ? 65.998 15.247 11.456  1.00 18.52 ? 170 GLU A OE2 1 
ATOM   3938 N N   . ALA C 1 166 ? 72.721 15.066 10.866  1.00 12.21 ? 171 ALA A N   1 
ATOM   3939 C CA  . ALA C 1 166 ? 74.002 14.415 10.504  1.00 12.24 ? 171 ALA A CA  1 
ATOM   3940 C C   . ALA C 1 166 ? 74.182 13.106 11.280  1.00 12.69 ? 171 ALA A C   1 
ATOM   3941 O O   . ALA C 1 166 ? 73.922 13.094 12.448  1.00 13.19 ? 171 ALA A O   1 
ATOM   3942 C CB  . ALA C 1 166 ? 75.119 15.325 10.727  1.00 12.58 ? 171 ALA A CB  1 
ATOM   3943 N N   . VAL C 1 167 ? 74.588 12.072 10.592  1.00 11.65 ? 172 VAL A N   1 
ATOM   3944 C CA  . VAL C 1 167 ? 74.720 10.719 11.175  1.00 13.71 ? 172 VAL A CA  1 
ATOM   3945 C C   . VAL C 1 167 ? 76.166 10.383 11.425  1.00 13.32 ? 172 VAL A C   1 
ATOM   3946 O O   . VAL C 1 167 ? 77.029 10.566 10.538  1.00 12.77 ? 172 VAL A O   1 
ATOM   3947 C CB  . VAL C 1 167 ? 74.064 9.660  10.272  1.00 15.72 ? 172 VAL A CB  1 
ATOM   3948 C CG1 . VAL C 1 167 ? 74.187 8.222  10.890  1.00 17.34 ? 172 VAL A CG1 1 
ATOM   3949 C CG2 . VAL C 1 167 ? 72.674 10.032 9.956   1.00 17.84 ? 172 VAL A CG2 1 
ATOM   3950 N N   . LYS C 1 168 ? 76.461 9.869  12.590  1.00 15.39 ? 173 LYS A N   1 
ATOM   3951 C CA  . LYS C 1 168 ? 77.818 9.643  13.071  1.00 16.08 ? 173 LYS A CA  1 
ATOM   3952 C C   . LYS C 1 168 ? 78.394 8.591  12.222  1.00 18.73 ? 173 LYS A C   1 
ATOM   3953 O O   . LYS C 1 168 ? 77.737 7.609  11.905  1.00 20.55 ? 173 LYS A O   1 
ATOM   3954 C CB  . LYS C 1 168 ? 77.902 9.240  14.552  1.00 17.95 ? 173 LYS A CB  1 
ATOM   3955 C CG  . LYS C 1 168 ? 79.277 9.250  15.125  1.00 20.49 ? 173 LYS A CG  1 
ATOM   3956 C CD  . LYS C 1 168 ? 79.142 9.220  16.622  1.00 25.00 ? 173 LYS A CD  1 
ATOM   3957 C CE  . LYS C 1 168 ? 80.370 8.734  17.318  1.00 30.20 ? 173 LYS A CE  1 
ATOM   3958 N NZ  . LYS C 1 168 ? 80.152 8.942  18.764  1.00 37.68 ? 173 LYS A NZ  1 
ATOM   3959 N N   . GLN C 1 169 ? 79.645 8.736  11.830  1.00 20.73 ? 174 GLN A N   1 
ATOM   3960 C CA  . GLN C 1 169 ? 80.201 7.668  10.942  1.00 23.72 ? 174 GLN A CA  1 
ATOM   3961 C C   . GLN C 1 169 ? 80.782 6.419  11.670  1.00 27.15 ? 174 GLN A C   1 
ATOM   3962 O O   . GLN C 1 169 ? 80.696 6.376  12.864  1.00 30.10 ? 174 GLN A O   1 
ATOM   3963 C CB  . GLN C 1 169 ? 81.123 8.238  9.898   1.00 30.59 ? 174 GLN A CB  1 
ATOM   3964 C CG  . GLN C 1 169 ? 82.377 8.667  10.454  1.00 31.53 ? 174 GLN A CG  1 
ATOM   3965 C CD  . GLN C 1 169 ? 83.274 9.301  9.385   1.00 32.04 ? 174 GLN A CD  1 
ATOM   3966 O OE1 . GLN C 1 169 ? 82.887 9.675  8.211   1.00 32.51 ? 174 GLN A OE1 1 
ATOM   3967 N NE2 . GLN C 1 169 ? 84.434 9.455  9.801   1.00 29.68 ? 174 GLN A NE2 1 
ATOM   3968 N N   . SER D 1 1   ? 68.110 66.421 6.316   1.00 32.47 ? 6   SER D N   1 
ATOM   3969 C CA  . SER D 1 1   ? 68.569 65.814 7.606   1.00 33.98 ? 6   SER D CA  1 
ATOM   3970 C C   . SER D 1 1   ? 67.876 66.408 8.856   1.00 33.99 ? 6   SER D C   1 
ATOM   3971 O O   . SER D 1 1   ? 67.586 67.618 8.918   1.00 38.65 ? 6   SER D O   1 
ATOM   3972 C CB  . SER D 1 1   ? 70.066 66.045 7.817   1.00 35.69 ? 6   SER D CB  1 
ATOM   3973 O OG  . SER D 1 1   ? 70.453 65.364 9.036   1.00 36.57 ? 6   SER D OG  1 
ATOM   3974 N N   . ALA D 1 2   ? 67.686 65.561 9.881   1.00 31.36 ? 7   ALA D N   1 
ATOM   3975 C CA  . ALA D 1 2   ? 67.020 65.998 11.107  1.00 34.51 ? 7   ALA D CA  1 
ATOM   3976 C C   . ALA D 1 2   ? 67.570 65.317 12.362  1.00 28.53 ? 7   ALA D C   1 
ATOM   3977 O O   . ALA D 1 2   ? 67.995 64.148 12.296  1.00 26.45 ? 7   ALA D O   1 
ATOM   3978 C CB  . ALA D 1 2   ? 65.520 65.704 11.001  1.00 36.72 ? 7   ALA D CB  1 
ATOM   3979 N N   . THR D 1 3   ? 67.527 66.041 13.489  1.00 26.18 ? 8   THR D N   1 
ATOM   3980 C CA  . THR D 1 3   ? 67.934 65.513 14.763  1.00 25.49 ? 8   THR D CA  1 
ATOM   3981 C C   . THR D 1 3   ? 66.701 65.339 15.666  1.00 24.45 ? 8   THR D C   1 
ATOM   3982 O O   . THR D 1 3   ? 65.857 66.247 15.785  1.00 24.31 ? 8   THR D O   1 
ATOM   3983 C CB  . THR D 1 3   ? 68.899 66.402 15.503  1.00 31.42 ? 8   THR D CB  1 
ATOM   3984 O OG1 . THR D 1 3   ? 70.031 66.680 14.675  1.00 36.09 ? 8   THR D OG1 1 
ATOM   3985 C CG2 . THR D 1 3   ? 69.351 65.735 16.800  1.00 33.17 ? 8   THR D CG2 1 
ATOM   3986 N N   . TYR D 1 4   ? 66.681 64.200 16.374  1.00 21.85 ? 9   TYR D N   1 
ATOM   3987 C CA  . TYR D 1 4   ? 65.575 63.838 17.235  1.00 23.43 ? 9   TYR D CA  1 
ATOM   3988 C C   . TYR D 1 4   ? 66.092 63.490 18.626  1.00 21.14 ? 9   TYR D C   1 
ATOM   3989 O O   . TYR D 1 4   ? 67.162 62.844 18.787  1.00 23.05 ? 9   TYR D O   1 
ATOM   3990 C CB  . TYR D 1 4   ? 64.855 62.612 16.698  1.00 22.91 ? 9   TYR D CB  1 
ATOM   3991 C CG  . TYR D 1 4   ? 64.335 62.668 15.269  1.00 24.20 ? 9   TYR D CG  1 
ATOM   3992 C CD1 . TYR D 1 4   ? 65.214 62.700 14.177  1.00 25.32 ? 9   TYR D CD1 1 
ATOM   3993 C CD2 . TYR D 1 4   ? 62.960 62.686 15.011  1.00 23.47 ? 9   TYR D CD2 1 
ATOM   3994 C CE1 . TYR D 1 4   ? 64.741 62.784 12.866  1.00 29.17 ? 9   TYR D CE1 1 
ATOM   3995 C CE2 . TYR D 1 4   ? 62.501 62.690 13.726  1.00 26.09 ? 9   TYR D CE2 1 
ATOM   3996 C CZ  . TYR D 1 4   ? 63.367 62.826 12.667  1.00 28.39 ? 9   TYR D CZ  1 
ATOM   3997 O OH  . TYR D 1 4   ? 62.855 62.837 11.386  1.00 32.24 ? 9   TYR D OH  1 
ATOM   3998 N N   A GLN D 1 5   ? 65.312 63.858 19.630  0.50 20.80 ? 10  GLN D N   1 
ATOM   3999 N N   B GLN D 1 5   ? 65.370 63.928 19.639  0.50 19.91 ? 10  GLN D N   1 
ATOM   4000 C CA  A GLN D 1 5   ? 65.670 63.616 21.015  0.50 20.14 ? 10  GLN D CA  1 
ATOM   4001 C CA  B GLN D 1 5   ? 65.710 63.626 21.011  0.50 18.71 ? 10  GLN D CA  1 
ATOM   4002 C C   A GLN D 1 5   ? 64.796 62.491 21.643  0.50 19.42 ? 10  GLN D C   1 
ATOM   4003 C C   B GLN D 1 5   ? 64.835 62.426 21.407  0.50 18.66 ? 10  GLN D C   1 
ATOM   4004 O O   A GLN D 1 5   ? 63.572 62.574 21.757  0.50 17.88 ? 10  GLN D O   1 
ATOM   4005 O O   B GLN D 1 5   ? 63.620 62.429 21.084  0.50 17.73 ? 10  GLN D O   1 
ATOM   4006 C CB  A GLN D 1 5   ? 65.572 64.892 21.823  0.50 22.82 ? 10  GLN D CB  1 
ATOM   4007 C CB  B GLN D 1 5   ? 65.416 64.797 21.922  0.50 19.87 ? 10  GLN D CB  1 
ATOM   4008 C CG  A GLN D 1 5   ? 66.442 66.033 21.296  0.50 23.78 ? 10  GLN D CG  1 
ATOM   4009 C CG  B GLN D 1 5   ? 65.884 64.610 23.362  0.50 19.52 ? 10  GLN D CG  1 
ATOM   4010 C CD  A GLN D 1 5   ? 67.941 65.742 21.394  0.50 25.96 ? 10  GLN D CD  1 
ATOM   4011 C CD  B GLN D 1 5   ? 67.367 64.832 23.523  0.50 19.87 ? 10  GLN D CD  1 
ATOM   4012 O OE1 A GLN D 1 5   ? 68.357 64.845 22.128  0.50 28.38 ? 10  GLN D OE1 1 
ATOM   4013 O OE1 B GLN D 1 5   ? 67.934 65.749 22.885  0.50 20.97 ? 10  GLN D OE1 1 
ATOM   4014 N NE2 A GLN D 1 5   ? 68.740 66.480 20.649  0.50 27.60 ? 10  GLN D NE2 1 
ATOM   4015 N NE2 B GLN D 1 5   ? 68.022 64.017 24.371  0.50 18.02 ? 10  GLN D NE2 1 
ATOM   4016 N N   . PHE D 1 6   ? 65.430 61.434 22.099  1.00 19.56 ? 11  PHE D N   1 
ATOM   4017 C CA  . PHE D 1 6   ? 64.643 60.318 22.650  1.00 18.94 ? 11  PHE D CA  1 
ATOM   4018 C C   . PHE D 1 6   ? 63.744 60.821 23.754  1.00 18.83 ? 11  PHE D C   1 
ATOM   4019 O O   . PHE D 1 6   ? 64.186 61.552 24.655  1.00 19.30 ? 11  PHE D O   1 
ATOM   4020 C CB  . PHE D 1 6   ? 65.526 59.207 23.254  1.00 18.69 ? 11  PHE D CB  1 
ATOM   4021 C CG  . PHE D 1 6   ? 66.191 58.369 22.198  1.00 19.44 ? 11  PHE D CG  1 
ATOM   4022 C CD1 . PHE D 1 6   ? 65.434 57.691 21.206  1.00 19.25 ? 11  PHE D CD1 1 
ATOM   4023 C CD2 . PHE D 1 6   ? 67.559 58.278 22.224  1.00 19.69 ? 11  PHE D CD2 1 
ATOM   4024 C CE1 . PHE D 1 6   ? 66.019 56.940 20.236  1.00 21.50 ? 11  PHE D CE1 1 
ATOM   4025 C CE2 . PHE D 1 6   ? 68.180 57.517 21.251  1.00 21.96 ? 11  PHE D CE2 1 
ATOM   4026 C CZ  . PHE D 1 6   ? 67.426 56.898 20.253  1.00 21.84 ? 11  PHE D CZ  1 
ATOM   4027 N N   . ASP D 1 7   ? 62.457 60.407 23.720  1.00 19.15 ? 12  ASP D N   1 
ATOM   4028 C CA  . ASP D 1 7   ? 61.532 60.600 24.812  1.00 19.68 ? 12  ASP D CA  1 
ATOM   4029 C C   . ASP D 1 7   ? 61.721 59.502 25.843  1.00 18.96 ? 12  ASP D C   1 
ATOM   4030 O O   . ASP D 1 7   ? 61.405 58.343 25.552  1.00 18.75 ? 12  ASP D O   1 
ATOM   4031 C CB  . ASP D 1 7   ? 60.102 60.545 24.212  1.00 20.64 ? 12  ASP D CB  1 
ATOM   4032 C CG  . ASP D 1 7   ? 59.058 60.537 25.245  1.00 24.76 ? 12  ASP D CG  1 
ATOM   4033 O OD1 . ASP D 1 7   ? 59.369 60.749 26.434  1.00 26.84 ? 12  ASP D OD1 1 
ATOM   4034 O OD2 . ASP D 1 7   ? 57.913 60.160 24.837  1.00 31.52 ? 12  ASP D OD2 1 
ATOM   4035 N N   . PRO D 1 8   ? 62.317 59.800 26.969  1.00 20.05 ? 13  PRO D N   1 
ATOM   4036 C CA  . PRO D 1 8   ? 62.574 58.725 27.936  1.00 20.67 ? 13  PRO D CA  1 
ATOM   4037 C C   . PRO D 1 8   ? 61.372 57.932 28.370  1.00 21.26 ? 13  PRO D C   1 
ATOM   4038 O O   . PRO D 1 8   ? 61.495 56.730 28.694  1.00 20.67 ? 13  PRO D O   1 
ATOM   4039 C CB  . PRO D 1 8   ? 63.254 59.444 29.118  1.00 22.00 ? 13  PRO D CB  1 
ATOM   4040 C CG  . PRO D 1 8   ? 63.747 60.678 28.591  1.00 21.91 ? 13  PRO D CG  1 
ATOM   4041 C CD  . PRO D 1 8   ? 62.811 61.104 27.475  1.00 22.07 ? 13  PRO D CD  1 
ATOM   4042 N N   . SER D 1 9   ? 60.210 58.558 28.364  1.00 21.90 ? 14  SER D N   1 
ATOM   4043 C CA  . SER D 1 9   ? 58.993 57.881 28.750  1.00 22.26 ? 14  SER D CA  1 
ATOM   4044 C C   . SER D 1 9   ? 58.563 56.786 27.773  1.00 21.95 ? 14  SER D C   1 
ATOM   4045 O O   . SER D 1 9   ? 57.754 55.940 28.152  1.00 21.72 ? 14  SER D O   1 
ATOM   4046 C CB  . SER D 1 9   ? 57.850 58.914 29.024  1.00 27.11 ? 14  SER D CB  1 
ATOM   4047 O OG  . SER D 1 9   ? 57.297 59.389 27.797  1.00 30.83 ? 14  SER D OG  1 
ATOM   4048 N N   . HIS D 1 10  ? 59.132 56.708 26.554  1.00 19.89 ? 15  HIS D N   1 
ATOM   4049 C CA  . HIS D 1 10  ? 58.815 55.691 25.576  1.00 18.23 ? 15  HIS D CA  1 
ATOM   4050 C C   . HIS D 1 10  ? 60.107 55.134 25.004  1.00 16.89 ? 15  HIS D C   1 
ATOM   4051 O O   . HIS D 1 10  ? 60.131 54.676 23.895  1.00 19.72 ? 15  HIS D O   1 
ATOM   4052 C CB  . HIS D 1 10  ? 57.961 56.289 24.449  1.00 19.98 ? 15  HIS D CB  1 
ATOM   4053 C CG  . HIS D 1 10  ? 56.575 56.591 24.882  1.00 22.28 ? 15  HIS D CG  1 
ATOM   4054 N ND1 . HIS D 1 10  ? 56.197 57.820 25.384  1.00 26.30 ? 15  HIS D ND1 1 
ATOM   4055 C CD2 . HIS D 1 10  ? 55.512 55.772 25.019  1.00 23.61 ? 15  HIS D CD2 1 
ATOM   4056 C CE1 . HIS D 1 10  ? 54.936 57.759 25.773  1.00 24.50 ? 15  HIS D CE1 1 
ATOM   4057 N NE2 . HIS D 1 10  ? 54.498 56.530 25.553  1.00 24.82 ? 15  HIS D NE2 1 
ATOM   4058 N N   . THR D 1 11  ? 61.207 55.203 25.797  1.00 16.29 ? 16  THR D N   1 
ATOM   4059 C CA  . THR D 1 11  ? 62.484 54.676 25.314  1.00 14.90 ? 16  THR D CA  1 
ATOM   4060 C C   . THR D 1 11  ? 63.029 53.747 26.396  1.00 14.27 ? 16  THR D C   1 
ATOM   4061 O O   . THR D 1 11  ? 63.453 54.217 27.487  1.00 15.11 ? 16  THR D O   1 
ATOM   4062 C CB  . THR D 1 11  ? 63.459 55.821 24.955  1.00 15.67 ? 16  THR D CB  1 
ATOM   4063 O OG1 . THR D 1 11  ? 62.848 56.550 23.892  1.00 15.65 ? 16  THR D OG1 1 
ATOM   4064 C CG2 . THR D 1 11  ? 64.806 55.282 24.365  1.00 15.73 ? 16  THR D CG2 1 
ATOM   4065 N N   . TYR D 1 12  ? 63.069 52.421 26.090  1.00 14.14 ? 17  TYR D N   1 
ATOM   4066 C CA  . TYR D 1 12  ? 63.524 51.471 27.084  1.00 14.09 ? 17  TYR D CA  1 
ATOM   4067 C C   . TYR D 1 12  ? 64.160 50.294 26.408  1.00 14.38 ? 17  TYR D C   1 
ATOM   4068 O O   . TYR D 1 12  ? 63.559 49.713 25.498  1.00 14.68 ? 17  TYR D O   1 
ATOM   4069 C CB  . TYR D 1 12  ? 62.387 50.920 27.944  1.00 14.07 ? 17  TYR D CB  1 
ATOM   4070 C CG  . TYR D 1 12  ? 61.443 51.910 28.622  1.00 14.91 ? 17  TYR D CG  1 
ATOM   4071 C CD1 . TYR D 1 12  ? 61.760 52.465 29.843  1.00 15.64 ? 17  TYR D CD1 1 
ATOM   4072 C CD2 . TYR D 1 12  ? 60.349 52.353 27.956  1.00 16.18 ? 17  TYR D CD2 1 
ATOM   4073 C CE1 . TYR D 1 12  ? 60.868 53.358 30.465  1.00 16.49 ? 17  TYR D CE1 1 
ATOM   4074 C CE2 . TYR D 1 12  ? 59.466 53.240 28.560  1.00 17.40 ? 17  TYR D CE2 1 
ATOM   4075 C CZ  . TYR D 1 12  ? 59.758 53.762 29.732  1.00 18.05 ? 17  TYR D CZ  1 
ATOM   4076 O OH  . TYR D 1 12  ? 58.921 54.669 30.341  1.00 18.41 ? 17  TYR D OH  1 
ATOM   4077 N N   . PRO D 1 13  ? 65.320 49.852 26.885  1.00 13.43 ? 18  PRO D N   1 
ATOM   4078 C CA  . PRO D 1 13  ? 65.771 48.514 26.499  1.00 13.57 ? 18  PRO D CA  1 
ATOM   4079 C C   . PRO D 1 13  ? 65.259 47.444 27.490  1.00 11.47 ? 18  PRO D C   1 
ATOM   4080 O O   . PRO D 1 13  ? 65.492 47.536 28.723  1.00 12.20 ? 18  PRO D O   1 
ATOM   4081 C CB  . PRO D 1 13  ? 67.287 48.589 26.587  1.00 13.88 ? 18  PRO D CB  1 
ATOM   4082 C CG  . PRO D 1 13  ? 67.489 49.561 27.721  1.00 14.12 ? 18  PRO D CG  1 
ATOM   4083 C CD  . PRO D 1 13  ? 66.230 50.450 27.866  1.00 14.13 ? 18  PRO D CD  1 
ATOM   4084 N N   . SER D 1 14  ? 64.593 46.462 26.918  1.00 11.60 ? 19  SER D N   1 
ATOM   4085 C CA  . SER D 1 14  ? 64.171 45.282 27.612  1.00 11.17 ? 19  SER D CA  1 
ATOM   4086 C C   . SER D 1 14  ? 65.110 44.152 27.258  1.00 11.34 ? 19  SER D C   1 
ATOM   4087 O O   . SER D 1 14  ? 65.800 44.209 26.221  1.00 12.35 ? 19  SER D O   1 
ATOM   4088 C CB  . SER D 1 14  ? 62.718 44.926 27.284  1.00 12.69 ? 19  SER D CB  1 
ATOM   4089 O OG  . SER D 1 14  ? 61.777 45.999 27.612  1.00 12.80 ? 19  SER D OG  1 
ATOM   4090 N N   . PHE D 1 15  ? 65.118 43.123 28.072  1.00 12.16 ? 20  PHE D N   1 
ATOM   4091 C CA  . PHE D 1 15  ? 65.982 41.995 27.908  1.00 12.88 ? 20  PHE D CA  1 
ATOM   4092 C C   . PHE D 1 15  ? 65.332 40.712 28.229  1.00 12.67 ? 20  PHE D C   1 
ATOM   4093 O O   . PHE D 1 15  ? 64.295 40.639 28.944  1.00 12.57 ? 20  PHE D O   1 
ATOM   4094 C CB  . PHE D 1 15  ? 67.276 42.204 28.760  1.00 13.34 ? 20  PHE D CB  1 
ATOM   4095 C CG  . PHE D 1 15  ? 67.027 42.301 30.214  1.00 14.62 ? 20  PHE D CG  1 
ATOM   4096 C CD1 . PHE D 1 15  ? 66.790 41.212 30.991  1.00 15.60 ? 20  PHE D CD1 1 
ATOM   4097 C CD2 . PHE D 1 15  ? 67.034 43.566 30.787  1.00 16.11 ? 20  PHE D CD2 1 
ATOM   4098 C CE1 . PHE D 1 15  ? 66.468 41.391 32.369  1.00 18.36 ? 20  PHE D CE1 1 
ATOM   4099 C CE2 . PHE D 1 15  ? 66.716 43.727 32.118  1.00 17.32 ? 20  PHE D CE2 1 
ATOM   4100 C CZ  . PHE D 1 15  ? 66.519 42.678 32.863  1.00 16.14 ? 20  PHE D CZ  1 
ATOM   4101 N N   . GLU D 1 16  ? 65.942 39.647 27.675  1.00 12.79 ? 21  GLU D N   1 
ATOM   4102 C CA  . GLU D 1 16  ? 65.591 38.301 28.075  1.00 13.86 ? 21  GLU D CA  1 
ATOM   4103 C C   . GLU D 1 16  ? 66.886 37.609 28.425  1.00 13.35 ? 21  GLU D C   1 
ATOM   4104 O O   . GLU D 1 16  ? 67.865 37.691 27.609  1.00 15.38 ? 21  GLU D O   1 
ATOM   4105 C CB  . GLU D 1 16  ? 64.994 37.542 26.913  1.00 15.77 ? 21  GLU D CB  1 
ATOM   4106 C CG  . GLU D 1 16  ? 63.615 38.000 26.464  1.00 17.39 ? 21  GLU D CG  1 
ATOM   4107 C CD  . GLU D 1 16  ? 62.968 37.181 25.340  1.00 23.74 ? 21  GLU D CD  1 
ATOM   4108 O OE1 . GLU D 1 16  ? 63.600 36.241 24.832  1.00 24.71 ? 21  GLU D OE1 1 
ATOM   4109 O OE2 . GLU D 1 16  ? 61.816 37.533 24.899  1.00 26.87 ? 21  GLU D OE2 1 
ATOM   4110 N N   . ALA D 1 17  ? 66.891 36.823 29.495  1.00 13.59 ? 22  ALA D N   1 
ATOM   4111 C CA  . ALA D 1 17  ? 68.099 36.127 29.880  1.00 14.30 ? 22  ALA D CA  1 
ATOM   4112 C C   . ALA D 1 17  ? 67.720 34.765 30.444  1.00 15.14 ? 22  ALA D C   1 
ATOM   4113 O O   . ALA D 1 17  ? 66.634 34.526 30.940  1.00 16.00 ? 22  ALA D O   1 
ATOM   4114 C CB  . ALA D 1 17  ? 68.824 36.911 30.932  1.00 17.30 ? 22  ALA D CB  1 
ATOM   4115 N N   . ASP D 1 18  ? 68.606 33.814 30.311  1.00 15.46 ? 23  ASP D N   1 
ATOM   4116 C CA  . ASP D 1 18  ? 68.330 32.458 30.773  1.00 16.65 ? 23  ASP D CA  1 
ATOM   4117 C C   . ASP D 1 18  ? 68.433 32.246 32.283  1.00 17.26 ? 23  ASP D C   1 
ATOM   4118 O O   . ASP D 1 18  ? 69.183 32.914 33.021  1.00 18.78 ? 23  ASP D O   1 
ATOM   4119 C CB  . ASP D 1 18  ? 69.396 31.515 30.076  1.00 16.64 ? 23  ASP D CB  1 
ATOM   4120 C CG  . ASP D 1 18  ? 69.304 30.115 30.513  1.00 17.03 ? 23  ASP D CG  1 
ATOM   4121 O OD1 . ASP D 1 18  ? 68.234 29.545 30.139  1.00 20.44 ? 23  ASP D OD1 1 
ATOM   4122 O OD2 . ASP D 1 18  ? 70.219 29.599 31.241  1.00 18.40 ? 23  ASP D OD2 1 
ATOM   4123 N N   . HIS D 1 19  ? 67.625 31.317 32.787  1.00 16.08 ? 24  HIS D N   1 
ATOM   4124 C CA  . HIS D 1 19  ? 67.717 30.787 34.129  1.00 17.77 ? 24  HIS D CA  1 
ATOM   4125 C C   . HIS D 1 19  ? 67.869 29.279 34.064  1.00 17.51 ? 24  HIS D C   1 
ATOM   4126 O O   . HIS D 1 19  ? 67.028 28.587 33.525  1.00 17.31 ? 24  HIS D O   1 
ATOM   4127 C CB  . HIS D 1 19  ? 66.453 31.151 34.895  1.00 17.17 ? 24  HIS D CB  1 
ATOM   4128 C CG  . HIS D 1 19  ? 66.532 30.901 36.352  1.00 20.07 ? 24  HIS D CG  1 
ATOM   4129 N ND1 . HIS D 1 19  ? 65.624 30.167 37.066  1.00 22.32 ? 24  HIS D ND1 1 
ATOM   4130 C CD2 . HIS D 1 19  ? 67.463 31.321 37.245  1.00 22.72 ? 24  HIS D CD2 1 
ATOM   4131 C CE1 . HIS D 1 19  ? 66.001 30.110 38.327  1.00 20.45 ? 24  HIS D CE1 1 
ATOM   4132 N NE2 . HIS D 1 19  ? 67.115 30.815 38.459  1.00 22.91 ? 24  HIS D NE2 1 
ATOM   4133 N N   . PHE D 1 20  ? 69.005 28.803 34.582  1.00 18.74 ? 25  PHE D N   1 
ATOM   4134 C CA  . PHE D 1 20  ? 69.268 27.384 34.795  1.00 21.36 ? 25  PHE D CA  1 
ATOM   4135 C C   . PHE D 1 20  ? 69.208 26.600 33.530  1.00 23.79 ? 25  PHE D C   1 
ATOM   4136 O O   . PHE D 1 20  ? 68.717 25.488 33.516  1.00 28.29 ? 25  PHE D O   1 
ATOM   4137 C CB  . PHE D 1 20  ? 68.368 26.756 35.871  1.00 22.44 ? 25  PHE D CB  1 
ATOM   4138 C CG  . PHE D 1 20  ? 68.922 26.911 37.244  1.00 25.46 ? 25  PHE D CG  1 
ATOM   4139 C CD1 . PHE D 1 20  ? 70.068 26.231 37.566  1.00 28.29 ? 25  PHE D CD1 1 
ATOM   4140 C CD2 . PHE D 1 20  ? 68.326 27.716 38.191  1.00 28.35 ? 25  PHE D CD2 1 
ATOM   4141 C CE1 . PHE D 1 20  ? 70.639 26.334 38.827  1.00 31.72 ? 25  PHE D CE1 1 
ATOM   4142 C CE2 . PHE D 1 20  ? 68.922 27.898 39.425  1.00 33.29 ? 25  PHE D CE2 1 
ATOM   4143 C CZ  . PHE D 1 20  ? 70.078 27.189 39.750  1.00 32.40 ? 25  PHE D CZ  1 
ATOM   4144 N N   . GLY D 1 21  ? 69.721 27.119 32.443  1.00 22.08 ? 26  GLY D N   1 
ATOM   4145 C CA  . GLY D 1 21  ? 69.815 26.301 31.222  1.00 24.41 ? 26  GLY D CA  1 
ATOM   4146 C C   . GLY D 1 21  ? 68.508 25.893 30.591  1.00 25.93 ? 26  GLY D C   1 
ATOM   4147 O O   . GLY D 1 21  ? 68.290 24.722 30.299  1.00 26.21 ? 26  GLY D O   1 
ATOM   4148 N N   . GLY D 1 22  ? 67.626 26.847 30.391  1.00 23.10 ? 27  GLY D N   1 
ATOM   4149 C CA  . GLY D 1 22  ? 66.368 26.576 29.725  1.00 22.37 ? 27  GLY D CA  1 
ATOM   4150 C C   . GLY D 1 22  ? 65.218 26.351 30.709  1.00 20.59 ? 27  GLY D C   1 
ATOM   4151 O O   . GLY D 1 22  ? 64.120 25.926 30.300  1.00 22.18 ? 27  GLY D O   1 
ATOM   4152 N N   . LEU D 1 23  ? 65.430 26.559 32.024  1.00 18.44 ? 28  LEU D N   1 
ATOM   4153 C CA  . LEU D 1 23  ? 64.367 26.330 32.959  1.00 17.70 ? 28  LEU D CA  1 
ATOM   4154 C C   . LEU D 1 23  ? 63.308 27.411 32.796  1.00 17.98 ? 28  LEU D C   1 
ATOM   4155 O O   . LEU D 1 23  ? 62.146 27.108 32.737  1.00 17.86 ? 28  LEU D O   1 
ATOM   4156 C CB  . LEU D 1 23  ? 64.883 26.215 34.386  1.00 18.14 ? 28  LEU D CB  1 
ATOM   4157 C CG  . LEU D 1 23  ? 63.885 25.898 35.440  1.00 18.02 ? 28  LEU D CG  1 
ATOM   4158 C CD1 . LEU D 1 23  ? 63.282 24.500 35.220  1.00 17.97 ? 28  LEU D CD1 1 
ATOM   4159 C CD2 . LEU D 1 23  ? 64.663 26.044 36.757  1.00 17.94 ? 28  LEU D CD2 1 
ATOM   4160 N N   . SER D 1 24  ? 63.736 28.641 32.632  1.00 15.76 ? 29  SER D N   1 
ATOM   4161 C CA  . SER D 1 24  ? 62.821 29.716 32.337  1.00 15.96 ? 29  SER D CA  1 
ATOM   4162 C C   . SER D 1 24  ? 63.609 30.897 31.818  1.00 17.03 ? 29  SER D C   1 
ATOM   4163 O O   . SER D 1 24  ? 64.843 30.813 31.660  1.00 16.98 ? 29  SER D O   1 
ATOM   4164 C CB  . SER D 1 24  ? 61.951 30.143 33.494  1.00 17.04 ? 29  SER D CB  1 
ATOM   4165 O OG  . SER D 1 24  ? 62.734 30.784 34.505  1.00 18.12 ? 29  SER D OG  1 
ATOM   4166 N N   . VAL D 1 25  ? 62.863 31.987 31.491  1.00 15.59 ? 30  VAL D N   1 
ATOM   4167 C CA  . VAL D 1 25  ? 63.405 33.177 30.829  1.00 15.03 ? 30  VAL D CA  1 
ATOM   4168 C C   . VAL D 1 25  ? 63.204 34.345 31.710  1.00 14.93 ? 30  VAL D C   1 
ATOM   4169 O O   . VAL D 1 25  ? 62.022 34.690 31.990  1.00 16.64 ? 30  VAL D O   1 
ATOM   4170 C CB  . VAL D 1 25  ? 62.809 33.444 29.431  1.00 15.57 ? 30  VAL D CB  1 
ATOM   4171 C CG1 . VAL D 1 25  ? 63.445 34.634 28.743  1.00 17.46 ? 30  VAL D CG1 1 
ATOM   4172 C CG2 . VAL D 1 25  ? 63.008 32.247 28.559  1.00 17.10 ? 30  VAL D CG2 1 
ATOM   4173 N N   . TRP D 1 26  ? 64.295 34.936 32.254  1.00 15.24 ? 31  TRP D N   1 
ATOM   4174 C CA  . TRP D 1 26  ? 64.193 36.194 32.954  1.00 13.97 ? 31  TRP D CA  1 
ATOM   4175 C C   . TRP D 1 26  ? 63.937 37.306 31.967  1.00 13.76 ? 31  TRP D C   1 
ATOM   4176 O O   . TRP D 1 26  ? 64.662 37.468 30.974  1.00 15.39 ? 31  TRP D O   1 
ATOM   4177 C CB  . TRP D 1 26  ? 65.516 36.632 33.610  1.00 15.70 ? 31  TRP D CB  1 
ATOM   4178 C CG  . TRP D 1 26  ? 65.713 36.183 35.018  1.00 18.15 ? 31  TRP D CG  1 
ATOM   4179 C CD1 . TRP D 1 26  ? 66.538 35.199 35.522  1.00 21.23 ? 31  TRP D CD1 1 
ATOM   4180 C CD2 . TRP D 1 26  ? 64.969 36.673 36.149  1.00 17.55 ? 31  TRP D CD2 1 
ATOM   4181 N NE1 . TRP D 1 26  ? 66.360 35.037 36.877  1.00 21.49 ? 31  TRP D NE1 1 
ATOM   4182 C CE2 . TRP D 1 26  ? 65.406 35.959 37.293  1.00 18.73 ? 31  TRP D CE2 1 
ATOM   4183 C CE3 . TRP D 1 26  ? 64.031 37.687 36.308  1.00 17.78 ? 31  TRP D CE3 1 
ATOM   4184 C CZ2 . TRP D 1 26  ? 64.900 36.241 38.561  1.00 17.81 ? 31  TRP D CZ2 1 
ATOM   4185 C CZ3 . TRP D 1 26  ? 63.519 37.912 37.521  1.00 17.71 ? 31  TRP D CZ3 1 
ATOM   4186 C CH2 . TRP D 1 26  ? 63.935 37.228 38.644  1.00 18.29 ? 31  TRP D CH2 1 
ATOM   4187 N N   . ARG D 1 27  ? 62.899 38.136 32.281  1.00 12.56 ? 32  ARG D N   1 
ATOM   4188 C CA  . ARG D 1 27  ? 62.591 39.310 31.463  1.00 12.08 ? 32  ARG D CA  1 
ATOM   4189 C C   . ARG D 1 27  ? 62.562 40.523 32.333  1.00 13.70 ? 32  ARG D C   1 
ATOM   4190 O O   . ARG D 1 27  ? 62.183 40.452 33.540  1.00 16.81 ? 32  ARG D O   1 
ATOM   4191 C CB  . ARG D 1 27  ? 61.237 39.239 30.727  1.00 12.93 ? 32  ARG D CB  1 
ATOM   4192 C CG  . ARG D 1 27  ? 61.148 38.085 29.780  1.00 14.90 ? 32  ARG D CG  1 
ATOM   4193 C CD  . ARG D 1 27  ? 59.895 38.166 28.889  1.00 15.69 ? 32  ARG D CD  1 
ATOM   4194 N NE  . ARG D 1 27  ? 59.974 37.201 27.831  1.00 18.00 ? 32  ARG D NE  1 
ATOM   4195 C CZ  . ARG D 1 27  ? 59.743 35.896 27.964  1.00 18.46 ? 32  ARG D CZ  1 
ATOM   4196 N NH1 . ARG D 1 27  ? 59.233 35.387 29.015  1.00 19.88 ? 32  ARG D NH1 1 
ATOM   4197 N NH2 . ARG D 1 27  ? 59.923 35.115 26.892  1.00 23.17 ? 32  ARG D NH2 1 
ATOM   4198 N N   . GLY D 1 28  ? 63.049 41.630 31.824  1.00 12.14 ? 33  GLY D N   1 
ATOM   4199 C CA  . GLY D 1 28  ? 63.030 42.833 32.553  1.00 12.57 ? 33  GLY D CA  1 
ATOM   4200 C C   . GLY D 1 28  ? 63.407 43.999 31.662  1.00 11.89 ? 33  GLY D C   1 
ATOM   4201 O O   . GLY D 1 28  ? 63.529 43.865 30.459  1.00 10.58 ? 33  GLY D O   1 
ATOM   4202 N N   . LYS D 1 29  ? 63.659 45.155 32.233  1.00 11.75 ? 34  LYS D N   1 
ATOM   4203 C CA  . LYS D 1 29  ? 64.045 46.324 31.452  1.00 12.23 ? 34  LYS D CA  1 
ATOM   4204 C C   . LYS D 1 29  ? 64.821 47.312 32.285  1.00 12.95 ? 34  LYS D C   1 
ATOM   4205 O O   . LYS D 1 29  ? 64.881 47.147 33.518  1.00 14.76 ? 34  LYS D O   1 
ATOM   4206 C CB  . LYS D 1 29  ? 62.847 47.044 30.831  1.00 13.68 ? 34  LYS D CB  1 
ATOM   4207 C CG  . LYS D 1 29  ? 61.882 47.666 31.862  1.00 14.62 ? 34  LYS D CG  1 
ATOM   4208 C CD  . LYS D 1 29  ? 60.507 48.082 31.292  1.00 18.07 ? 34  LYS D CD  1 
ATOM   4209 C CE  . LYS D 1 29  ? 60.508 48.806 30.074  1.00 17.52 ? 34  LYS D CE  1 
ATOM   4210 N NZ  . LYS D 1 29  ? 59.185 49.341 29.591  1.00 17.19 ? 34  LYS D NZ  1 
ATOM   4211 N N   . PHE D 1 30  ? 65.361 48.373 31.657  1.00 13.19 ? 35  PHE D N   1 
ATOM   4212 C CA  . PHE D 1 30  ? 65.996 49.442 32.403  1.00 14.12 ? 35  PHE D CA  1 
ATOM   4213 C C   . PHE D 1 30  ? 65.074 50.643 32.213  1.00 14.12 ? 35  PHE D C   1 
ATOM   4214 O O   . PHE D 1 30  ? 64.637 50.947 31.097  1.00 14.10 ? 35  PHE D O   1 
ATOM   4215 C CB  . PHE D 1 30  ? 67.398 49.750 31.842  1.00 15.37 ? 35  PHE D CB  1 
ATOM   4216 C CG  . PHE D 1 30  ? 68.376 48.640 32.073  1.00 15.38 ? 35  PHE D CG  1 
ATOM   4217 C CD1 . PHE D 1 30  ? 68.398 47.482 31.210  1.00 16.15 ? 35  PHE D CD1 1 
ATOM   4218 C CD2 . PHE D 1 30  ? 69.246 48.672 33.161  1.00 15.96 ? 35  PHE D CD2 1 
ATOM   4219 C CE1 . PHE D 1 30  ? 69.256 46.426 31.458  1.00 16.75 ? 35  PHE D CE1 1 
ATOM   4220 C CE2 . PHE D 1 30  ? 70.101 47.664 33.374  1.00 16.67 ? 35  PHE D CE2 1 
ATOM   4221 C CZ  . PHE D 1 30  ? 70.159 46.550 32.564  1.00 15.76 ? 35  PHE D CZ  1 
ATOM   4222 N N   . ASP D 1 31  ? 64.688 51.242 33.326  1.00 15.14 ? 36  ASP D N   1 
ATOM   4223 C CA  . ASP D 1 31  ? 63.711 52.353 33.303  1.00 16.37 ? 36  ASP D CA  1 
ATOM   4224 C C   . ASP D 1 31  ? 64.190 53.703 32.830  1.00 18.01 ? 36  ASP D C   1 
ATOM   4225 O O   . ASP D 1 31  ? 63.374 54.519 32.430  1.00 19.05 ? 36  ASP D O   1 
ATOM   4226 C CB  . ASP D 1 31  ? 63.166 52.508 34.687  1.00 17.94 ? 36  ASP D CB  1 
ATOM   4227 C CG  . ASP D 1 31  ? 62.290 51.368 35.166  1.00 22.51 ? 36  ASP D CG  1 
ATOM   4228 O OD1 . ASP D 1 31  ? 61.992 50.386 34.481  1.00 21.55 ? 36  ASP D OD1 1 
ATOM   4229 O OD2 . ASP D 1 31  ? 61.873 51.501 36.343  1.00 23.64 ? 36  ASP D OD2 1 
ATOM   4230 N N   . LYS D 1 32  ? 65.508 53.956 32.867  1.00 15.80 ? 37  LYS D N   1 
ATOM   4231 C CA  . LYS D 1 32  ? 65.992 55.251 32.530  1.00 18.77 ? 37  LYS D CA  1 
ATOM   4232 C C   . LYS D 1 32  ? 67.066 55.246 31.412  1.00 17.71 ? 37  LYS D C   1 
ATOM   4233 O O   . LYS D 1 32  ? 68.165 54.728 31.569  1.00 19.28 ? 37  LYS D O   1 
ATOM   4234 C CB  . LYS D 1 32  ? 66.623 55.927 33.726  1.00 21.61 ? 37  LYS D CB  1 
ATOM   4235 C CG  . LYS D 1 32  ? 66.925 57.419 33.456  1.00 27.54 ? 37  LYS D CG  1 
ATOM   4236 C CD  . LYS D 1 32  ? 67.178 58.213 34.740  1.00 35.32 ? 37  LYS D CD  1 
ATOM   4237 C CE  . LYS D 1 32  ? 67.759 59.615 34.447  1.00 38.59 ? 37  LYS D CE  1 
ATOM   4238 N NZ  . LYS D 1 32  ? 67.819 60.538 35.617  1.00 44.07 ? 37  LYS D NZ  1 
ATOM   4239 N N   . SER D 1 33  ? 66.728 55.904 30.323  1.00 17.94 ? 38  SER D N   1 
ATOM   4240 C CA  . SER D 1 33  ? 67.594 56.091 29.156  1.00 16.87 ? 38  SER D CA  1 
ATOM   4241 C C   . SER D 1 33  ? 67.436 57.516 28.584  1.00 20.02 ? 38  SER D C   1 
ATOM   4242 O O   . SER D 1 33  ? 66.424 58.200 28.830  1.00 20.42 ? 38  SER D O   1 
ATOM   4243 C CB  . SER D 1 33  ? 67.198 55.112 28.031  1.00 17.33 ? 38  SER D CB  1 
ATOM   4244 O OG  . SER D 1 33  ? 67.417 53.765 28.487  1.00 19.12 ? 38  SER D OG  1 
ATOM   4245 N N   . SER D 1 34  ? 68.436 57.948 27.839  1.00 17.24 ? 39  SER D N   1 
ATOM   4246 C CA  . SER D 1 34  ? 68.340 59.183 27.109  1.00 17.34 ? 39  SER D CA  1 
ATOM   4247 C C   . SER D 1 34  ? 69.251 59.185 25.920  1.00 19.28 ? 39  SER D C   1 
ATOM   4248 O O   . SER D 1 34  ? 70.167 58.377 25.857  1.00 18.99 ? 39  SER D O   1 
ATOM   4249 C CB  . SER D 1 34  ? 68.681 60.333 28.063  1.00 19.55 ? 39  SER D CB  1 
ATOM   4250 O OG  . SER D 1 34  ? 70.029 60.238 28.408  1.00 23.33 ? 39  SER D OG  1 
ATOM   4251 N N   . GLY D 1 35  ? 69.123 60.193 25.034  1.00 18.29 ? 40  GLY D N   1 
ATOM   4252 C CA  . GLY D 1 35  ? 70.030 60.333 23.902  1.00 19.51 ? 40  GLY D CA  1 
ATOM   4253 C C   . GLY D 1 35  ? 69.387 60.959 22.689  1.00 20.65 ? 40  GLY D C   1 
ATOM   4254 O O   . GLY D 1 35  ? 68.315 61.533 22.749  1.00 19.46 ? 40  GLY D O   1 
ATOM   4255 N N   . THR D 1 36  ? 70.028 60.772 21.547  1.00 19.25 ? 41  THR D N   1 
ATOM   4256 C CA  . THR D 1 36  ? 69.656 61.476 20.331  1.00 21.87 ? 41  THR D CA  1 
ATOM   4257 C C   . THR D 1 36  ? 69.817 60.566 19.107  1.00 21.65 ? 41  THR D C   1 
ATOM   4258 O O   . THR D 1 36  ? 70.639 59.604 19.124  1.00 21.03 ? 41  THR D O   1 
ATOM   4259 C CB  . THR D 1 36  ? 70.600 62.698 20.193  1.00 26.34 ? 41  THR D CB  1 
ATOM   4260 O OG1 . THR D 1 36  ? 71.899 62.201 20.054  1.00 32.93 ? 41  THR D OG1 1 
ATOM   4261 C CG2 . THR D 1 36  ? 70.596 63.552 21.425  1.00 29.77 ? 41  THR D CG2 1 
ATOM   4262 N N   . VAL D 1 37  ? 69.052 60.843 18.049  1.00 20.70 ? 42  VAL D N   1 
ATOM   4263 C CA  . VAL D 1 37  ? 69.195 60.187 16.768  1.00 20.88 ? 42  VAL D CA  1 
ATOM   4264 C C   . VAL D 1 37  ? 69.237 61.294 15.756  1.00 21.91 ? 42  VAL D C   1 
ATOM   4265 O O   . VAL D 1 37  ? 68.565 62.314 15.916  1.00 23.44 ? 42  VAL D O   1 
ATOM   4266 C CB  . VAL D 1 37  ? 68.006 59.279 16.421  1.00 24.39 ? 42  VAL D CB  1 
ATOM   4267 C CG1 . VAL D 1 37  ? 68.174 58.601 15.106  1.00 25.76 ? 42  VAL D CG1 1 
ATOM   4268 C CG2 . VAL D 1 37  ? 67.801 58.253 17.492  1.00 26.93 ? 42  VAL D CG2 1 
ATOM   4269 N N   . THR D 1 38  ? 70.128 61.136 14.791  1.00 21.72 ? 43  THR D N   1 
ATOM   4270 C CA  . THR D 1 38  ? 70.109 61.954 13.572  1.00 23.20 ? 43  THR D CA  1 
ATOM   4271 C C   . THR D 1 38  ? 69.743 61.025 12.406  1.00 23.13 ? 43  THR D C   1 
ATOM   4272 O O   . THR D 1 38  ? 70.210 59.866 12.285  1.00 23.48 ? 43  THR D O   1 
ATOM   4273 C CB  . THR D 1 38  ? 71.462 62.601 13.310  1.00 26.65 ? 43  THR D CB  1 
ATOM   4274 O OG1 . THR D 1 38  ? 72.417 61.540 13.060  1.00 29.12 ? 43  THR D OG1 1 
ATOM   4275 C CG2 . THR D 1 38  ? 71.867 63.440 14.505  1.00 27.25 ? 43  THR D CG2 1 
ATOM   4276 N N   . LEU D 1 39  ? 68.929 61.536 11.479  1.00 22.88 ? 44  LEU D N   1 
ATOM   4277 C CA  . LEU D 1 39  ? 68.481 60.754 10.396  1.00 23.58 ? 44  LEU D CA  1 
ATOM   4278 C C   . LEU D 1 39  ? 68.395 61.596 9.135   1.00 23.70 ? 44  LEU D C   1 
ATOM   4279 O O   . LEU D 1 39  ? 67.904 62.709 9.170   1.00 25.16 ? 44  LEU D O   1 
ATOM   4280 C CB  . LEU D 1 39  ? 67.072 60.270 10.739  1.00 26.99 ? 44  LEU D CB  1 
ATOM   4281 C CG  . LEU D 1 39  ? 66.366 59.250 9.880   1.00 32.43 ? 44  LEU D CG  1 
ATOM   4282 C CD1 . LEU D 1 39  ? 67.140 57.925 9.789   1.00 31.80 ? 44  LEU D CD1 1 
ATOM   4283 C CD2 . LEU D 1 39  ? 64.977 59.050 10.524  1.00 34.60 ? 44  LEU D CD2 1 
ATOM   4284 N N   . ASP D 1 40  ? 68.864 61.033 8.034   1.00 22.69 ? 45  ASP D N   1 
ATOM   4285 C CA  . ASP D 1 40  ? 68.700 61.677 6.685   1.00 24.63 ? 45  ASP D CA  1 
ATOM   4286 C C   . ASP D 1 40  ? 68.281 60.614 5.722   1.00 25.60 ? 45  ASP D C   1 
ATOM   4287 O O   . ASP D 1 40  ? 69.126 59.942 5.160   1.00 25.18 ? 45  ASP D O   1 
ATOM   4288 C CB  . ASP D 1 40  ? 69.972 62.319 6.262   1.00 29.43 ? 45  ASP D CB  1 
ATOM   4289 C CG  . ASP D 1 40  ? 69.828 63.061 4.904   1.00 34.42 ? 45  ASP D CG  1 
ATOM   4290 O OD1 . ASP D 1 40  ? 68.935 62.747 4.086   1.00 37.35 ? 45  ASP D OD1 1 
ATOM   4291 O OD2 . ASP D 1 40  ? 70.603 63.971 4.666   1.00 39.29 ? 45  ASP D OD2 1 
ATOM   4292 N N   . ARG D 1 41  ? 66.961 60.438 5.553   1.00 23.90 ? 46  ARG D N   1 
ATOM   4293 C CA  . ARG D 1 41  ? 66.424 59.333 4.743   1.00 26.74 ? 46  ARG D CA  1 
ATOM   4294 C C   . ARG D 1 41  ? 66.761 59.467 3.278   1.00 25.75 ? 46  ARG D C   1 
ATOM   4295 O O   . ARG D 1 41  ? 67.019 58.466 2.577   1.00 26.77 ? 46  ARG D O   1 
ATOM   4296 C CB  . ARG D 1 41  ? 64.908 59.188 5.010   1.00 27.99 ? 46  ARG D CB  1 
ATOM   4297 C CG  . ARG D 1 41  ? 64.595 58.451 6.288   1.00 31.71 ? 46  ARG D CG  1 
ATOM   4298 C CD  . ARG D 1 41  ? 63.099 58.282 6.607   1.00 33.73 ? 46  ARG D CD  1 
ATOM   4299 N NE  . ARG D 1 41  ? 62.697 59.493 7.258   1.00 32.18 ? 46  ARG D NE  1 
ATOM   4300 C CZ  . ARG D 1 41  ? 61.524 59.662 7.854   1.00 39.53 ? 46  ARG D CZ  1 
ATOM   4301 N NH1 . ARG D 1 41  ? 60.644 58.655 7.885   1.00 39.86 ? 46  ARG D NH1 1 
ATOM   4302 N NH2 . ARG D 1 41  ? 61.229 60.872 8.364   1.00 39.40 ? 46  ARG D NH2 1 
ATOM   4303 N N   . ALA D 1 42  ? 66.824 60.718 2.780   1.00 24.36 ? 47  ALA D N   1 
ATOM   4304 C CA  . ALA D 1 42  ? 67.201 60.956 1.382   1.00 25.93 ? 47  ALA D CA  1 
ATOM   4305 C C   . ALA D 1 42  ? 68.628 60.493 1.110   1.00 26.05 ? 47  ALA D C   1 
ATOM   4306 O O   . ALA D 1 42  ? 68.891 59.793 0.112   1.00 27.37 ? 47  ALA D O   1 
ATOM   4307 C CB  . ALA D 1 42  ? 67.038 62.440 1.028   1.00 25.66 ? 47  ALA D CB  1 
ATOM   4308 N N   . ALA D 1 43  ? 69.535 60.751 2.080   1.00 24.89 ? 48  ALA D N   1 
ATOM   4309 C CA  . ALA D 1 43  ? 70.933 60.307 1.946   1.00 24.98 ? 48  ALA D CA  1 
ATOM   4310 C C   . ALA D 1 43  ? 71.222 58.873 2.450   1.00 28.83 ? 48  ALA D C   1 
ATOM   4311 O O   . ALA D 1 43  ? 72.325 58.344 2.283   1.00 29.82 ? 48  ALA D O   1 
ATOM   4312 C CB  . ALA D 1 43  ? 71.763 61.249 2.797   1.00 25.22 ? 48  ALA D CB  1 
ATOM   4313 N N   . LYS D 1 44  ? 70.233 58.288 3.108   1.00 26.80 ? 49  LYS D N   1 
ATOM   4314 C CA  . LYS D 1 44  ? 70.274 56.934 3.633   1.00 28.33 ? 49  LYS D CA  1 
ATOM   4315 C C   . LYS D 1 44  ? 71.364 56.814 4.693   1.00 27.47 ? 49  LYS D C   1 
ATOM   4316 O O   . LYS D 1 44  ? 72.144 55.876 4.662   1.00 27.58 ? 49  LYS D O   1 
ATOM   4317 C CB  . LYS D 1 44  ? 70.455 55.867 2.566   1.00 32.23 ? 49  LYS D CB  1 
ATOM   4318 C CG  . LYS D 1 44  ? 69.340 55.846 1.499   1.00 37.62 ? 49  LYS D CG  1 
ATOM   4319 C CD  . LYS D 1 44  ? 69.685 54.881 0.363   1.00 44.21 ? 49  LYS D CD  1 
ATOM   4320 C CE  . LYS D 1 44  ? 68.516 53.979 0.017   1.00 50.65 ? 49  LYS D CE  1 
ATOM   4321 N NZ  . LYS D 1 44  ? 67.343 54.737 -0.478  1.00 56.03 ? 49  LYS D NZ  1 
ATOM   4322 N N   . THR D 1 45  ? 71.387 57.774 5.596   1.00 27.30 ? 50  THR D N   1 
ATOM   4323 C CA  . THR D 1 45  ? 72.352 57.763 6.688   1.00 28.52 ? 50  THR D CA  1 
ATOM   4324 C C   . THR D 1 45  ? 71.649 58.139 7.989   1.00 25.64 ? 50  THR D C   1 
ATOM   4325 O O   . THR D 1 45  ? 70.523 58.665 7.996   1.00 24.32 ? 50  THR D O   1 
ATOM   4326 C CB  . THR D 1 45  ? 73.509 58.772 6.483   1.00 29.45 ? 50  THR D CB  1 
ATOM   4327 O OG1 . THR D 1 45  ? 73.007 60.102 6.494   1.00 34.77 ? 50  THR D OG1 1 
ATOM   4328 C CG2 . THR D 1 45  ? 74.253 58.570 5.183   1.00 33.73 ? 50  THR D CG2 1 
ATOM   4329 N N   . GLY D 1 46  ? 72.330 57.867 9.106   1.00 21.27 ? 51  GLY D N   1 
ATOM   4330 C CA  . GLY D 1 46  ? 71.932 58.361 10.352  1.00 19.86 ? 51  GLY D CA  1 
ATOM   4331 C C   . GLY D 1 46  ? 72.781 57.786 11.497  1.00 19.84 ? 51  GLY D C   1 
ATOM   4332 O O   . GLY D 1 46  ? 73.640 56.949 11.288  1.00 19.21 ? 51  GLY D O   1 
ATOM   4333 N N   . THR D 1 47  ? 72.577 58.306 12.674  1.00 19.63 ? 52  THR D N   1 
ATOM   4334 C CA  . THR D 1 47  ? 73.390 57.941 13.858  1.00 20.49 ? 52  THR D CA  1 
ATOM   4335 C C   . THR D 1 47  ? 72.525 57.867 15.075  1.00 20.56 ? 52  THR D C   1 
ATOM   4336 O O   . THR D 1 47  ? 71.488 58.521 15.162  1.00 22.40 ? 52  THR D O   1 
ATOM   4337 C CB  . THR D 1 47  ? 74.523 58.939 14.138  1.00 24.43 ? 52  THR D CB  1 
ATOM   4338 O OG1 . THR D 1 47  ? 73.970 60.193 14.501  1.00 29.24 ? 52  THR D OG1 1 
ATOM   4339 C CG2 . THR D 1 47  ? 75.381 59.118 12.950  1.00 25.43 ? 52  THR D CG2 1 
ATOM   4340 N N   . VAL D 1 48  ? 72.896 57.009 16.014  1.00 18.21 ? 53  VAL D N   1 
ATOM   4341 C CA  . VAL D 1 48  ? 72.218 56.867 17.292  1.00 18.41 ? 53  VAL D CA  1 
ATOM   4342 C C   . VAL D 1 48  ? 73.252 57.071 18.404  1.00 19.03 ? 53  VAL D C   1 
ATOM   4343 O O   . VAL D 1 48  ? 74.345 56.541 18.284  1.00 18.83 ? 53  VAL D O   1 
ATOM   4344 C CB  . VAL D 1 48  ? 71.592 55.450 17.452  1.00 19.84 ? 53  VAL D CB  1 
ATOM   4345 C CG1 . VAL D 1 48  ? 70.968 55.231 18.810  1.00 21.86 ? 53  VAL D CG1 1 
ATOM   4346 C CG2 . VAL D 1 48  ? 70.492 55.225 16.394  1.00 20.78 ? 53  VAL D CG2 1 
ATOM   4347 N N   . ASP D 1 49  ? 72.911 57.791 19.502  1.00 17.37 ? 54  ASP D N   1 
ATOM   4348 C CA  . ASP D 1 49  ? 73.714 57.827 20.692  1.00 19.33 ? 54  ASP D CA  1 
ATOM   4349 C C   . ASP D 1 49  ? 72.814 57.707 21.899  1.00 19.38 ? 54  ASP D C   1 
ATOM   4350 O O   . ASP D 1 49  ? 71.974 58.589 22.104  1.00 21.41 ? 54  ASP D O   1 
ATOM   4351 C CB  . ASP D 1 49  ? 74.503 59.161 20.714  1.00 23.26 ? 54  ASP D CB  1 
ATOM   4352 C CG  . ASP D 1 49  ? 75.459 59.306 21.935  1.00 28.66 ? 54  ASP D CG  1 
ATOM   4353 O OD1 . ASP D 1 49  ? 75.491 58.474 22.856  1.00 37.58 ? 54  ASP D OD1 1 
ATOM   4354 O OD2 . ASP D 1 49  ? 76.200 60.285 21.970  1.00 37.68 ? 54  ASP D OD2 1 
ATOM   4355 N N   . VAL D 1 50  ? 72.895 56.618 22.658  1.00 16.81 ? 55  VAL D N   1 
ATOM   4356 C CA  . VAL D 1 50  ? 72.028 56.451 23.800  1.00 18.41 ? 55  VAL D CA  1 
ATOM   4357 C C   . VAL D 1 50  ? 72.769 56.004 25.044  1.00 19.25 ? 55  VAL D C   1 
ATOM   4358 O O   . VAL D 1 50  ? 73.775 55.321 24.950  1.00 21.32 ? 55  VAL D O   1 
ATOM   4359 C CB  . VAL D 1 50  ? 70.899 55.425 23.425  1.00 20.39 ? 55  VAL D CB  1 
ATOM   4360 C CG1 . VAL D 1 50  ? 71.465 54.165 22.936  1.00 23.56 ? 55  VAL D CG1 1 
ATOM   4361 C CG2 . VAL D 1 50  ? 69.956 55.130 24.559  1.00 22.64 ? 55  VAL D CG2 1 
ATOM   4362 N N   . THR D 1 51  ? 72.259 56.353 26.208  1.00 17.40 ? 56  THR D N   1 
ATOM   4363 C CA  . THR D 1 51  ? 72.843 55.935 27.465  1.00 17.87 ? 56  THR D CA  1 
ATOM   4364 C C   . THR D 1 51  ? 71.745 55.448 28.353  1.00 18.23 ? 56  THR D C   1 
ATOM   4365 O O   . THR D 1 51  ? 70.690 56.053 28.353  1.00 19.56 ? 56  THR D O   1 
ATOM   4366 C CB  . THR D 1 51  ? 73.584 57.110 28.153  1.00 21.22 ? 56  THR D CB  1 
ATOM   4367 O OG1 . THR D 1 51  ? 74.567 57.629 27.246  1.00 25.83 ? 56  THR D OG1 1 
ATOM   4368 C CG2 . THR D 1 51  ? 74.304 56.678 29.401  1.00 22.21 ? 56  THR D CG2 1 
ATOM   4369 N N   . THR D 1 52  ? 71.978 54.412 29.131  1.00 16.24 ? 57  THR D N   1 
ATOM   4370 C CA  . THR D 1 52  ? 71.000 53.795 30.020  1.00 17.23 ? 57  THR D CA  1 
ATOM   4371 C C   . THR D 1 52  ? 71.633 53.651 31.402  1.00 17.95 ? 57  THR D C   1 
ATOM   4372 O O   . THR D 1 52  ? 72.792 53.264 31.588  1.00 18.44 ? 57  THR D O   1 
ATOM   4373 C CB  . THR D 1 52  ? 70.643 52.363 29.444  1.00 19.33 ? 57  THR D CB  1 
ATOM   4374 O OG1 . THR D 1 52  ? 69.984 52.533 28.188  1.00 18.04 ? 57  THR D OG1 1 
ATOM   4375 C CG2 . THR D 1 52  ? 69.689 51.638 30.307  1.00 20.31 ? 57  THR D CG2 1 
ATOM   4376 N N   . ASP D 1 53  ? 70.874 53.973 32.433  1.00 18.95 ? 58  ASP D N   1 
ATOM   4377 C CA  . ASP D 1 53  ? 71.338 53.870 33.828  1.00 19.62 ? 58  ASP D CA  1 
ATOM   4378 C C   . ASP D 1 53  ? 71.176 52.444 34.370  1.00 17.52 ? 58  ASP D C   1 
ATOM   4379 O O   . ASP D 1 53  ? 70.053 51.923 34.519  1.00 18.46 ? 58  ASP D O   1 
ATOM   4380 C CB  . ASP D 1 53  ? 70.457 54.805 34.705  1.00 22.27 ? 58  ASP D CB  1 
ATOM   4381 C CG  . ASP D 1 53  ? 70.742 56.271 34.471  1.00 29.55 ? 58  ASP D CG  1 
ATOM   4382 O OD1 . ASP D 1 53  ? 71.675 56.608 33.703  1.00 32.28 ? 58  ASP D OD1 1 
ATOM   4383 O OD2 . ASP D 1 53  ? 70.005 57.080 35.063  1.00 33.55 ? 58  ASP D OD2 1 
ATOM   4384 N N   . ILE D 1 54  ? 72.243 51.787 34.768  1.00 16.83 ? 59  ILE D N   1 
ATOM   4385 C CA  . ILE D 1 54  ? 72.194 50.453 35.258  1.00 17.01 ? 59  ILE D CA  1 
ATOM   4386 C C   . ILE D 1 54  ? 71.342 50.323 36.507  1.00 17.51 ? 59  ILE D C   1 
ATOM   4387 O O   . ILE D 1 54  ? 70.699 49.317 36.753  1.00 17.28 ? 59  ILE D O   1 
ATOM   4388 C CB  . ILE D 1 54  ? 73.648 49.949 35.540  1.00 18.42 ? 59  ILE D CB  1 
ATOM   4389 C CG1 . ILE D 1 54  ? 74.435 49.883 34.244  1.00 20.27 ? 59  ILE D CG1 1 
ATOM   4390 C CG2 . ILE D 1 54  ? 73.634 48.653 36.284  1.00 20.32 ? 59  ILE D CG2 1 
ATOM   4391 C CD1 . ILE D 1 54  ? 73.909 48.986 33.143  1.00 20.46 ? 59  ILE D CD1 1 
ATOM   4392 N N   . ALA D 1 55  ? 71.442 51.333 37.421  1.00 17.41 ? 60  ALA D N   1 
ATOM   4393 C CA  . ALA D 1 55  ? 70.640 51.311 38.614  1.00 19.40 ? 60  ALA D CA  1 
ATOM   4394 C C   . ALA D 1 55  ? 69.141 51.360 38.414  1.00 18.50 ? 60  ALA D C   1 
ATOM   4395 O O   . ALA D 1 55  ? 68.403 51.143 39.379  1.00 18.65 ? 60  ALA D O   1 
ATOM   4396 C CB  . ALA D 1 55  ? 71.010 52.476 39.547  1.00 19.83 ? 60  ALA D CB  1 
ATOM   4397 N N   . SER D 1 56  ? 68.694 51.562 37.179  1.00 17.43 ? 61  SER D N   1 
ATOM   4398 C CA  . SER D 1 56  ? 67.264 51.631 36.859  1.00 16.22 ? 61  SER D CA  1 
ATOM   4399 C C   . SER D 1 56  ? 66.738 50.289 36.369  1.00 15.32 ? 61  SER D C   1 
ATOM   4400 O O   . SER D 1 56  ? 65.575 50.201 35.913  1.00 14.81 ? 61  SER D O   1 
ATOM   4401 C CB  . SER D 1 56  ? 67.039 52.725 35.780  1.00 15.61 ? 61  SER D CB  1 
ATOM   4402 O OG  . SER D 1 56  ? 67.386 52.341 34.485  1.00 16.01 ? 61  SER D OG  1 
ATOM   4403 N N   . ILE D 1 57  ? 67.560 49.263 36.519  1.00 16.80 ? 62  ILE D N   1 
ATOM   4404 C CA  . ILE D 1 57  ? 67.092 47.925 36.162  1.00 16.11 ? 62  ILE D CA  1 
ATOM   4405 C C   . ILE D 1 57  ? 65.871 47.576 36.983  1.00 16.66 ? 62  ILE D C   1 
ATOM   4406 O O   . ILE D 1 57  ? 65.733 47.894 38.171  1.00 15.67 ? 62  ILE D O   1 
ATOM   4407 C CB  . ILE D 1 57  ? 68.186 46.837 36.221  1.00 19.60 ? 62  ILE D CB  1 
ATOM   4408 C CG1 . ILE D 1 57  ? 67.766 45.593 35.412  1.00 20.04 ? 62  ILE D CG1 1 
ATOM   4409 C CG2 . ILE D 1 57  ? 68.517 46.530 37.658  1.00 18.95 ? 62  ILE D CG2 1 
ATOM   4410 C CD1 . ILE D 1 57  ? 68.821 44.513 35.276  1.00 21.78 ? 62  ILE D CD1 1 
ATOM   4411 N N   . HIS D 1 58  ? 64.940 46.847 36.311  1.00 14.44 ? 63  HIS D N   1 
ATOM   4412 C CA  . HIS D 1 58  ? 63.784 46.278 36.941  1.00 14.84 ? 63  HIS D CA  1 
ATOM   4413 C C   . HIS D 1 58  ? 63.593 44.832 36.430  1.00 14.88 ? 63  HIS D C   1 
ATOM   4414 O O   . HIS D 1 58  ? 63.257 44.672 35.261  1.00 15.86 ? 63  HIS D O   1 
ATOM   4415 C CB  . HIS D 1 58  ? 62.530 47.101 36.612  1.00 16.20 ? 63  HIS D CB  1 
ATOM   4416 C CG  . HIS D 1 58  ? 61.320 46.658 37.395  1.00 20.26 ? 63  HIS D CG  1 
ATOM   4417 N ND1 . HIS D 1 58  ? 60.494 45.608 36.997  1.00 24.75 ? 63  HIS D ND1 1 
ATOM   4418 C CD2 . HIS D 1 58  ? 60.855 47.072 38.581  1.00 22.35 ? 63  HIS D CD2 1 
ATOM   4419 C CE1 . HIS D 1 58  ? 59.540 45.436 37.880  1.00 21.16 ? 63  HIS D CE1 1 
ATOM   4420 N NE2 . HIS D 1 58  ? 59.721 46.332 38.852  1.00 25.27 ? 63  HIS D NE2 1 
ATOM   4421 N N   . THR D 1 59  ? 63.733 43.859 37.304  1.00 14.90 ? 64  THR D N   1 
ATOM   4422 C CA  . THR D 1 59  ? 63.553 42.431 37.031  1.00 17.06 ? 64  THR D CA  1 
ATOM   4423 C C   . THR D 1 59  ? 62.238 41.827 37.526  1.00 17.10 ? 64  THR D C   1 
ATOM   4424 O O   . THR D 1 59  ? 61.883 40.752 37.092  1.00 19.15 ? 64  THR D O   1 
ATOM   4425 C CB  . THR D 1 59  ? 64.664 41.592 37.682  1.00 17.41 ? 64  THR D CB  1 
ATOM   4426 O OG1 . THR D 1 59  ? 64.555 41.727 39.070  1.00 17.68 ? 64  THR D OG1 1 
ATOM   4427 C CG2 . THR D 1 59  ? 66.020 41.975 37.153  1.00 20.04 ? 64  THR D CG2 1 
ATOM   4428 N N   . GLY D 1 60  ? 61.540 42.538 38.371  1.00 16.89 ? 65  GLY D N   1 
ATOM   4429 C CA  . GLY D 1 60  ? 60.423 42.006 39.072  1.00 17.18 ? 65  GLY D CA  1 
ATOM   4430 C C   . GLY D 1 60  ? 60.724 41.655 40.486  1.00 17.39 ? 65  GLY D C   1 
ATOM   4431 O O   . GLY D 1 60  ? 59.800 41.487 41.303  1.00 18.50 ? 65  GLY D O   1 
ATOM   4432 N N   . SER D 1 61  ? 62.002 41.448 40.782  1.00 19.06 ? 66  SER D N   1 
ATOM   4433 C CA  . SER D 1 61  ? 62.482 41.131 42.147  1.00 22.21 ? 66  SER D CA  1 
ATOM   4434 C C   . SER D 1 61  ? 63.376 42.252 42.624  1.00 21.67 ? 66  SER D C   1 
ATOM   4435 O O   . SER D 1 61  ? 64.421 42.462 42.040  1.00 21.03 ? 66  SER D O   1 
ATOM   4436 C CB  . SER D 1 61  ? 63.331 39.891 42.111  1.00 21.88 ? 66  SER D CB  1 
ATOM   4437 O OG  . SER D 1 61  ? 63.956 39.681 43.401  1.00 27.71 ? 66  SER D OG  1 
ATOM   4438 N N   . ALA D 1 62  ? 62.907 43.025 43.586  1.00 23.29 ? 67  ALA D N   1 
ATOM   4439 C CA  . ALA D 1 62  ? 63.694 44.176 44.091  1.00 24.91 ? 67  ALA D CA  1 
ATOM   4440 C C   . ALA D 1 62  ? 65.025 43.709 44.736  1.00 24.80 ? 67  ALA D C   1 
ATOM   4441 O O   . ALA D 1 62  ? 66.076 44.334 44.559  1.00 22.30 ? 67  ALA D O   1 
ATOM   4442 C CB  . ALA D 1 62  ? 62.905 44.956 45.115  1.00 27.79 ? 67  ALA D CB  1 
ATOM   4443 N N   . LYS D 1 63  ? 65.010 42.521 45.327  1.00 24.40 ? 68  LYS D N   1 
ATOM   4444 C CA  . LYS D 1 63  ? 66.236 41.928 45.822  1.00 26.62 ? 68  LYS D CA  1 
ATOM   4445 C C   . LYS D 1 63  ? 67.222 41.538 44.714  1.00 25.37 ? 68  LYS D C   1 
ATOM   4446 O O   . LYS D 1 63  ? 68.473 41.727 44.871  1.00 23.29 ? 68  LYS D O   1 
ATOM   4447 C CB  . LYS D 1 63  ? 65.905 40.702 46.736  1.00 31.45 ? 68  LYS D CB  1 
ATOM   4448 C CG  . LYS D 1 63  ? 66.492 40.805 48.087  1.00 40.86 ? 68  LYS D CG  1 
ATOM   4449 C CD  . LYS D 1 63  ? 65.827 41.895 48.896  1.00 44.92 ? 68  LYS D CD  1 
ATOM   4450 C CE  . LYS D 1 63  ? 66.271 41.722 50.339  1.00 48.04 ? 68  LYS D CE  1 
ATOM   4451 N NZ  . LYS D 1 63  ? 65.769 42.730 51.323  1.00 49.62 ? 68  LYS D NZ  1 
ATOM   4452 N N   . LEU D 1 64  ? 66.738 41.026 43.584  1.00 23.07 ? 69  LEU D N   1 
ATOM   4453 C CA  . LEU D 1 64  ? 67.604 40.708 42.516  1.00 22.64 ? 69  LEU D CA  1 
ATOM   4454 C C   . LEU D 1 64  ? 68.160 42.002 41.910  1.00 23.88 ? 69  LEU D C   1 
ATOM   4455 O O   . LEU D 1 64  ? 69.334 42.077 41.540  1.00 24.41 ? 69  LEU D O   1 
ATOM   4456 C CB  . LEU D 1 64  ? 66.950 39.839 41.463  1.00 22.61 ? 69  LEU D CB  1 
ATOM   4457 C CG  . LEU D 1 64  ? 67.750 39.610 40.184  1.00 24.28 ? 69  LEU D CG  1 
ATOM   4458 C CD1 . LEU D 1 64  ? 69.053 38.840 40.458  1.00 25.13 ? 69  LEU D CD1 1 
ATOM   4459 C CD2 . LEU D 1 64  ? 66.957 38.819 39.122  1.00 25.90 ? 69  LEU D CD2 1 
ATOM   4460 N N   . ASP D 1 65  ? 67.301 43.032 41.748  1.00 22.34 ? 70  ASP D N   1 
ATOM   4461 C CA  . ASP D 1 65  ? 67.770 44.289 41.144  1.00 21.85 ? 70  ASP D CA  1 
ATOM   4462 C C   . ASP D 1 65  ? 69.001 44.800 41.957  1.00 21.03 ? 70  ASP D C   1 
ATOM   4463 O O   . ASP D 1 65  ? 69.917 45.358 41.334  1.00 19.70 ? 70  ASP D O   1 
ATOM   4464 C CB  . ASP D 1 65  ? 66.727 45.406 41.213  1.00 22.23 ? 70  ASP D CB  1 
ATOM   4465 C CG  . ASP D 1 65  ? 65.450 45.139 40.386  1.00 24.63 ? 70  ASP D CG  1 
ATOM   4466 O OD1 . ASP D 1 65  ? 65.505 44.261 39.496  1.00 24.80 ? 70  ASP D OD1 1 
ATOM   4467 O OD2 . ASP D 1 65  ? 64.360 45.809 40.650  1.00 23.18 ? 70  ASP D OD2 1 
ATOM   4468 N N   . GLU D 1 66  ? 68.845 44.745 43.277  1.00 21.80 ? 71  GLU D N   1 
ATOM   4469 C CA  . GLU D 1 66  ? 69.939 45.160 44.267  1.00 24.25 ? 71  GLU D CA  1 
ATOM   4470 C C   . GLU D 1 66  ? 71.170 44.302 44.100  1.00 24.14 ? 71  GLU D C   1 
ATOM   4471 O O   . GLU D 1 66  ? 72.247 44.803 43.901  1.00 23.71 ? 71  GLU D O   1 
ATOM   4472 C CB  . GLU D 1 66  ? 69.390 45.050 45.693  1.00 27.67 ? 71  GLU D CB  1 
ATOM   4473 C CG  . GLU D 1 66  ? 68.368 46.097 46.055  1.00 33.42 ? 71  GLU D CG  1 
ATOM   4474 C CD  . GLU D 1 66  ? 67.823 45.922 47.478  1.00 42.58 ? 71  GLU D CD  1 
ATOM   4475 O OE1 . GLU D 1 66  ? 66.625 46.253 47.716  1.00 53.00 ? 71  GLU D OE1 1 
ATOM   4476 O OE2 . GLU D 1 66  ? 68.580 45.419 48.361  1.00 51.24 ? 71  GLU D OE2 1 
ATOM   4477 N N   . HIS D 1 67  ? 70.990 42.979 44.138  1.00 22.94 ? 72  HIS D N   1 
ATOM   4478 C CA  . HIS D 1 67  ? 72.112 42.071 43.933  1.00 26.52 ? 72  HIS D CA  1 
ATOM   4479 C C   . HIS D 1 67  ? 72.855 42.246 42.639  1.00 25.04 ? 72  HIS D C   1 
ATOM   4480 O O   . HIS D 1 67  ? 74.100 42.175 42.545  1.00 28.89 ? 72  HIS D O   1 
ATOM   4481 C CB  . HIS D 1 67  ? 71.629 40.635 44.048  1.00 29.09 ? 72  HIS D CB  1 
ATOM   4482 C CG  . HIS D 1 67  ? 72.714 39.633 43.811  1.00 39.99 ? 72  HIS D CG  1 
ATOM   4483 N ND1 . HIS D 1 67  ? 73.791 39.510 44.669  1.00 43.87 ? 72  HIS D ND1 1 
ATOM   4484 C CD2 . HIS D 1 67  ? 72.916 38.730 42.816  1.00 43.29 ? 72  HIS D CD2 1 
ATOM   4485 C CE1 . HIS D 1 67  ? 74.596 38.557 44.227  1.00 47.87 ? 72  HIS D CE1 1 
ATOM   4486 N NE2 . HIS D 1 67  ? 74.091 38.067 43.107  1.00 50.48 ? 72  HIS D NE2 1 
ATOM   4487 N N   . LEU D 1 68  ? 72.137 42.524 41.529  1.00 21.27 ? 73  LEU D N   1 
ATOM   4488 C CA  . LEU D 1 68  ? 72.779 42.724 40.292  1.00 20.77 ? 73  LEU D CA  1 
ATOM   4489 C C   . LEU D 1 68  ? 73.631 44.004 40.183  1.00 22.13 ? 73  LEU D C   1 
ATOM   4490 O O   . LEU D 1 68  ? 74.461 44.136 39.329  1.00 20.94 ? 73  LEU D O   1 
ATOM   4491 C CB  . LEU D 1 68  ? 71.728 42.724 39.127  1.00 20.84 ? 73  LEU D CB  1 
ATOM   4492 C CG  . LEU D 1 68  ? 71.031 41.397 38.932  1.00 23.78 ? 73  LEU D CG  1 
ATOM   4493 C CD1 . LEU D 1 68  ? 70.027 41.572 37.816  1.00 21.85 ? 73  LEU D CD1 1 
ATOM   4494 C CD2 . LEU D 1 68  ? 72.053 40.407 38.446  1.00 26.94 ? 73  LEU D CD2 1 
ATOM   4495 N N   . GLN D 1 69  ? 73.411 44.965 41.065  1.00 22.59 ? 74  GLN D N   1 
ATOM   4496 C CA  . GLN D 1 69  ? 74.245 46.161 41.000  1.00 23.45 ? 74  GLN D CA  1 
ATOM   4497 C C   . GLN D 1 69  ? 75.666 45.905 41.642  1.00 25.16 ? 74  GLN D C   1 
ATOM   4498 O O   . GLN D 1 69  ? 76.609 46.651 41.439  1.00 26.76 ? 74  GLN D O   1 
ATOM   4499 C CB  . GLN D 1 69  ? 73.610 47.248 41.836  1.00 22.89 ? 74  GLN D CB  1 
ATOM   4500 C CG  . GLN D 1 69  ? 72.186 47.632 41.505  1.00 25.62 ? 74  GLN D CG  1 
ATOM   4501 C CD  . GLN D 1 69  ? 72.058 48.178 40.153  1.00 26.71 ? 74  GLN D CD  1 
ATOM   4502 O OE1 . GLN D 1 69  ? 72.773 49.145 39.769  1.00 24.76 ? 74  GLN D OE1 1 
ATOM   4503 N NE2 . GLN D 1 69  ? 71.225 47.537 39.349  1.00 27.02 ? 74  GLN D NE2 1 
ATOM   4504 N N   . THR D 1 70  ? 75.771 44.817 42.335  1.00 25.93 ? 75  THR D N   1 
ATOM   4505 C CA  . THR D 1 70  ? 77.093 44.529 43.041  1.00 27.18 ? 75  THR D CA  1 
ATOM   4506 C C   . THR D 1 70  ? 78.160 44.066 42.072  1.00 29.03 ? 75  THR D C   1 
ATOM   4507 O O   . THR D 1 70  ? 77.915 43.800 40.882  1.00 27.75 ? 75  THR D O   1 
ATOM   4508 C CB  . THR D 1 70  ? 76.856 43.467 44.128  1.00 25.68 ? 75  THR D CB  1 
ATOM   4509 O OG1 . THR D 1 70  ? 76.672 42.184 43.559  1.00 29.08 ? 75  THR D OG1 1 
ATOM   4510 C CG2 . THR D 1 70  ? 75.742 43.757 45.037  1.00 26.58 ? 75  THR D CG2 1 
ATOM   4511 N N   . ALA D 1 71  ? 79.421 43.969 42.578  1.00 31.06 ? 76  ALA D N   1 
ATOM   4512 C CA  . ALA D 1 71  ? 80.554 43.646 41.752  1.00 32.69 ? 76  ALA D CA  1 
ATOM   4513 C C   . ALA D 1 71  ? 80.466 42.211 41.286  1.00 32.81 ? 76  ALA D C   1 
ATOM   4514 O O   . ALA D 1 71  ? 81.166 41.828 40.391  1.00 37.03 ? 76  ALA D O   1 
ATOM   4515 C CB  . ALA D 1 71  ? 81.809 43.840 42.568  1.00 35.65 ? 76  ALA D CB  1 
ATOM   4516 N N   . GLU D 1 72  ? 79.586 41.414 41.865  1.00 32.89 ? 77  GLU D N   1 
ATOM   4517 C CA  . GLU D 1 72  ? 79.330 40.077 41.295  1.00 37.67 ? 77  GLU D CA  1 
ATOM   4518 C C   . GLU D 1 72  ? 78.617 40.122 39.956  1.00 36.81 ? 77  GLU D C   1 
ATOM   4519 O O   . GLU D 1 72  ? 78.473 39.066 39.284  1.00 39.31 ? 77  GLU D O   1 
ATOM   4520 C CB  . GLU D 1 72  ? 78.467 39.256 42.236  1.00 40.69 ? 77  GLU D CB  1 
ATOM   4521 C CG  . GLU D 1 72  ? 79.060 39.145 43.640  1.00 46.79 ? 77  GLU D CG  1 
ATOM   4522 C CD  . GLU D 1 72  ? 78.484 37.989 44.432  1.00 52.00 ? 77  GLU D CD  1 
ATOM   4523 O OE1 . GLU D 1 72  ? 77.319 37.608 44.215  1.00 50.12 ? 77  GLU D OE1 1 
ATOM   4524 O OE2 . GLU D 1 72  ? 79.216 37.441 45.281  1.00 64.49 ? 77  GLU D OE2 1 
ATOM   4525 N N   . PHE D 1 73  ? 78.112 41.293 39.570  1.00 32.25 ? 78  PHE D N   1 
ATOM   4526 C CA  . PHE D 1 73  ? 77.517 41.383 38.239  1.00 31.05 ? 78  PHE D CA  1 
ATOM   4527 C C   . PHE D 1 73  ? 77.824 42.718 37.596  1.00 31.94 ? 78  PHE D C   1 
ATOM   4528 O O   . PHE D 1 73  ? 78.901 42.897 37.106  1.00 28.75 ? 78  PHE D O   1 
ATOM   4529 C CB  . PHE D 1 73  ? 76.015 41.020 38.323  1.00 30.57 ? 78  PHE D CB  1 
ATOM   4530 C CG  . PHE D 1 73  ? 75.426 40.539 37.029  1.00 28.20 ? 78  PHE D CG  1 
ATOM   4531 C CD1 . PHE D 1 73  ? 75.509 39.223 36.675  1.00 31.75 ? 78  PHE D CD1 1 
ATOM   4532 C CD2 . PHE D 1 73  ? 74.759 41.413 36.178  1.00 26.96 ? 78  PHE D CD2 1 
ATOM   4533 C CE1 . PHE D 1 73  ? 74.956 38.742 35.466  1.00 35.54 ? 78  PHE D CE1 1 
ATOM   4534 C CE2 . PHE D 1 73  ? 74.216 40.961 34.986  1.00 27.01 ? 78  PHE D CE2 1 
ATOM   4535 C CZ  . PHE D 1 73  ? 74.289 39.637 34.614  1.00 30.65 ? 78  PHE D CZ  1 
ATOM   4536 N N   . PHE D 1 74  ? 76.913 43.704 37.611  1.00 27.39 ? 79  PHE D N   1 
ATOM   4537 C CA  . PHE D 1 74  ? 77.139 44.903 36.855  1.00 28.55 ? 79  PHE D CA  1 
ATOM   4538 C C   . PHE D 1 74  ? 78.275 45.755 37.426  1.00 28.95 ? 79  PHE D C   1 
ATOM   4539 O O   . PHE D 1 74  ? 78.816 46.503 36.705  1.00 28.85 ? 79  PHE D O   1 
ATOM   4540 C CB  . PHE D 1 74  ? 75.870 45.794 36.707  1.00 24.29 ? 79  PHE D CB  1 
ATOM   4541 C CG  . PHE D 1 74  ? 74.814 45.192 35.814  1.00 22.94 ? 79  PHE D CG  1 
ATOM   4542 C CD1 . PHE D 1 74  ? 75.077 44.974 34.483  1.00 22.79 ? 79  PHE D CD1 1 
ATOM   4543 C CD2 . PHE D 1 74  ? 73.533 44.907 36.289  1.00 24.29 ? 79  PHE D CD2 1 
ATOM   4544 C CE1 . PHE D 1 74  ? 74.105 44.442 33.610  1.00 22.30 ? 79  PHE D CE1 1 
ATOM   4545 C CE2 . PHE D 1 74  ? 72.589 44.376 35.413  1.00 23.21 ? 79  PHE D CE2 1 
ATOM   4546 C CZ  . PHE D 1 74  ? 72.877 44.143 34.122  1.00 22.71 ? 79  PHE D CZ  1 
ATOM   4547 N N   . ASP D 1 75  ? 78.552 45.639 38.712  1.00 34.19 ? 80  ASP D N   1 
ATOM   4548 C CA  . ASP D 1 75  ? 79.569 46.494 39.400  1.00 35.12 ? 80  ASP D CA  1 
ATOM   4549 C C   . ASP D 1 75  ? 79.199 47.961 39.123  1.00 33.57 ? 80  ASP D C   1 
ATOM   4550 O O   . ASP D 1 75  ? 79.993 48.686 38.536  1.00 31.02 ? 80  ASP D O   1 
ATOM   4551 C CB  . ASP D 1 75  ? 80.993 46.152 38.859  1.00 38.48 ? 80  ASP D CB  1 
ATOM   4552 C CG  . ASP D 1 75  ? 82.086 46.378 39.888  1.00 45.00 ? 80  ASP D CG  1 
ATOM   4553 O OD1 . ASP D 1 75  ? 81.763 46.979 40.970  1.00 46.67 ? 80  ASP D OD1 1 
ATOM   4554 O OD2 . ASP D 1 75  ? 83.259 45.950 39.625  1.00 41.56 ? 80  ASP D OD2 1 
ATOM   4555 N N   . ALA D 1 76  ? 77.959 48.353 39.464  1.00 29.21 ? 81  ALA D N   1 
ATOM   4556 C CA  . ALA D 1 76  ? 77.395 49.661 39.045  1.00 30.82 ? 81  ALA D CA  1 
ATOM   4557 C C   . ALA D 1 76  ? 78.124 50.803 39.693  1.00 33.65 ? 81  ALA D C   1 
ATOM   4558 O O   . ALA D 1 76  ? 78.155 51.938 39.176  1.00 33.11 ? 81  ALA D O   1 
ATOM   4559 C CB  . ALA D 1 76  ? 75.881 49.756 39.349  1.00 31.02 ? 81  ALA D CB  1 
ATOM   4560 N N   . ALA D 1 77  ? 78.713 50.527 40.852  1.00 32.39 ? 82  ALA D N   1 
ATOM   4561 C CA  . ALA D 1 77  ? 79.534 51.545 41.507  1.00 31.95 ? 82  ALA D CA  1 
ATOM   4562 C C   . ALA D 1 77  ? 80.603 52.007 40.528  1.00 31.72 ? 82  ALA D C   1 
ATOM   4563 O O   . ALA D 1 77  ? 80.808 53.196 40.248  1.00 34.05 ? 82  ALA D O   1 
ATOM   4564 C CB  . ALA D 1 77  ? 80.108 50.965 42.827  1.00 31.25 ? 82  ALA D CB  1 
ATOM   4565 N N   . LYS D 1 78  ? 81.276 51.046 39.898  1.00 32.03 ? 83  LYS D N   1 
ATOM   4566 C CA  . LYS D 1 78  ? 82.341 51.259 38.949  1.00 34.71 ? 83  LYS D CA  1 
ATOM   4567 C C   . LYS D 1 78  ? 81.814 51.637 37.562  1.00 31.77 ? 83  LYS D C   1 
ATOM   4568 O O   . LYS D 1 78  ? 82.319 52.512 36.920  1.00 29.48 ? 83  LYS D O   1 
ATOM   4569 C CB  . LYS D 1 78  ? 83.162 49.931 38.964  1.00 39.00 ? 83  LYS D CB  1 
ATOM   4570 C CG  . LYS D 1 78  ? 84.177 49.712 37.908  1.00 40.22 ? 83  LYS D CG  1 
ATOM   4571 C CD  . LYS D 1 78  ? 85.363 50.583 38.131  1.00 41.91 ? 83  LYS D CD  1 
ATOM   4572 C CE  . LYS D 1 78  ? 86.393 50.379 37.022  1.00 40.17 ? 83  LYS D CE  1 
ATOM   4573 N NZ  . LYS D 1 78  ? 87.163 51.621 37.005  1.00 41.34 ? 83  LYS D NZ  1 
ATOM   4574 N N   . PHE D 1 79  ? 80.703 51.012 37.171  1.00 31.29 ? 84  PHE D N   1 
ATOM   4575 C CA  . PHE D 1 79  ? 80.148 51.173 35.819  1.00 28.72 ? 84  PHE D CA  1 
ATOM   4576 C C   . PHE D 1 79  ? 78.640 51.489 35.870  1.00 29.06 ? 84  PHE D C   1 
ATOM   4577 O O   . PHE D 1 79  ? 77.743 50.582 35.714  1.00 25.26 ? 84  PHE D O   1 
ATOM   4578 C CB  . PHE D 1 79  ? 80.373 49.910 34.984  1.00 31.69 ? 84  PHE D CB  1 
ATOM   4579 C CG  . PHE D 1 79  ? 81.814 49.436 34.920  1.00 32.61 ? 84  PHE D CG  1 
ATOM   4580 C CD1 . PHE D 1 79  ? 82.755 50.124 34.195  1.00 36.57 ? 84  PHE D CD1 1 
ATOM   4581 C CD2 . PHE D 1 79  ? 82.179 48.231 35.524  1.00 31.83 ? 84  PHE D CD2 1 
ATOM   4582 C CE1 . PHE D 1 79  ? 84.061 49.641 34.115  1.00 36.20 ? 84  PHE D CE1 1 
ATOM   4583 C CE2 . PHE D 1 79  ? 83.469 47.728 35.428  1.00 33.72 ? 84  PHE D CE2 1 
ATOM   4584 C CZ  . PHE D 1 79  ? 84.407 48.448 34.739  1.00 32.78 ? 84  PHE D CZ  1 
ATOM   4585 N N   . PRO D 1 80  ? 78.342 52.770 36.041  1.00 24.21 ? 85  PRO D N   1 
ATOM   4586 C CA  . PRO D 1 80  ? 76.940 53.081 36.257  1.00 25.25 ? 85  PRO D CA  1 
ATOM   4587 C C   . PRO D 1 80  ? 76.057 53.180 35.042  1.00 22.68 ? 85  PRO D C   1 
ATOM   4588 O O   . PRO D 1 80  ? 74.826 53.161 35.230  1.00 23.02 ? 85  PRO D O   1 
ATOM   4589 C CB  . PRO D 1 80  ? 76.964 54.449 36.945  1.00 25.26 ? 85  PRO D CB  1 
ATOM   4590 C CG  . PRO D 1 80  ? 78.266 55.036 36.595  1.00 25.56 ? 85  PRO D CG  1 
ATOM   4591 C CD  . PRO D 1 80  ? 79.240 53.875 36.458  1.00 27.66 ? 85  PRO D CD  1 
ATOM   4592 N N   . GLN D 1 81  ? 76.629 53.393 33.890  1.00 23.02 ? 86  GLN D N   1 
ATOM   4593 C CA  . GLN D 1 81  ? 75.907 53.525 32.608  1.00 23.12 ? 86  GLN D CA  1 
ATOM   4594 C C   . GLN D 1 81  ? 76.333 52.429 31.672  1.00 23.99 ? 86  GLN D C   1 
ATOM   4595 O O   . GLN D 1 81  ? 77.412 51.847 31.751  1.00 23.18 ? 86  GLN D O   1 
ATOM   4596 C CB  . GLN D 1 81  ? 76.294 54.804 31.925  1.00 27.29 ? 86  GLN D CB  1 
ATOM   4597 C CG  . GLN D 1 81  ? 76.243 55.999 32.824  1.00 36.94 ? 86  GLN D CG  1 
ATOM   4598 C CD  . GLN D 1 81  ? 74.908 56.628 32.766  1.00 42.98 ? 86  GLN D CD  1 
ATOM   4599 O OE1 . GLN D 1 81  ? 73.906 55.939 32.762  1.00 49.48 ? 86  GLN D OE1 1 
ATOM   4600 N NE2 . GLN D 1 81  ? 74.881 57.955 32.639  1.00 49.70 ? 86  GLN D NE2 1 
ATOM   4601 N N   . ALA D 1 82  ? 75.420 52.117 30.776  1.00 18.79 ? 87  ALA D N   1 
ATOM   4602 C CA  . ALA D 1 82  ? 75.723 51.459 29.528  1.00 18.16 ? 87  ALA D CA  1 
ATOM   4603 C C   . ALA D 1 82  ? 75.447 52.422 28.423  1.00 18.45 ? 87  ALA D C   1 
ATOM   4604 O O   . ALA D 1 82  ? 74.583 53.244 28.514  1.00 18.67 ? 87  ALA D O   1 
ATOM   4605 C CB  . ALA D 1 82  ? 74.897 50.218 29.380  1.00 19.16 ? 87  ALA D CB  1 
ATOM   4606 N N   . ASN D 1 83  ? 76.274 52.370 27.378  1.00 17.36 ? 88  ASN D N   1 
ATOM   4607 C CA  . ASN D 1 83  ? 76.208 53.372 26.282  1.00 21.58 ? 88  ASN D CA  1 
ATOM   4608 C C   . ASN D 1 83  ? 76.154 52.630 24.936  1.00 19.97 ? 88  ASN D C   1 
ATOM   4609 O O   . ASN D 1 83  ? 76.791 51.584 24.754  1.00 21.03 ? 88  ASN D O   1 
ATOM   4610 C CB  . ASN D 1 83  ? 77.420 54.242 26.228  1.00 25.11 ? 88  ASN D CB  1 
ATOM   4611 C CG  . ASN D 1 83  ? 77.722 54.986 27.504  1.00 33.02 ? 88  ASN D CG  1 
ATOM   4612 O OD1 . ASN D 1 83  ? 78.840 54.874 28.049  1.00 43.52 ? 88  ASN D OD1 1 
ATOM   4613 N ND2 . ASN D 1 83  ? 76.793 55.780 27.960  1.00 32.38 ? 88  ASN D ND2 1 
ATOM   4614 N N   . TYR D 1 84  ? 75.324 53.074 23.978  1.00 17.61 ? 89  TYR D N   1 
ATOM   4615 C CA  . TYR D 1 84  ? 75.297 52.540 22.666  1.00 17.64 ? 89  TYR D CA  1 
ATOM   4616 C C   . TYR D 1 84  ? 75.410 53.666 21.636  1.00 18.09 ? 89  TYR D C   1 
ATOM   4617 O O   . TYR D 1 84  ? 74.697 54.653 21.703  1.00 18.53 ? 89  TYR D O   1 
ATOM   4618 C CB  . TYR D 1 84  ? 74.040 51.691 22.424  1.00 16.71 ? 89  TYR D CB  1 
ATOM   4619 C CG  . TYR D 1 84  ? 73.993 51.090 21.110  1.00 17.20 ? 89  TYR D CG  1 
ATOM   4620 C CD1 . TYR D 1 84  ? 74.730 49.978 20.826  1.00 17.10 ? 89  TYR D CD1 1 
ATOM   4621 C CD2 . TYR D 1 84  ? 73.273 51.645 20.047  1.00 16.94 ? 89  TYR D CD2 1 
ATOM   4622 C CE1 . TYR D 1 84  ? 74.690 49.379 19.608  1.00 15.74 ? 89  TYR D CE1 1 
ATOM   4623 C CE2 . TYR D 1 84  ? 73.286 51.096 18.793  1.00 20.20 ? 89  TYR D CE2 1 
ATOM   4624 C CZ  . TYR D 1 84  ? 74.008 49.952 18.515  1.00 17.86 ? 89  TYR D CZ  1 
ATOM   4625 O OH  . TYR D 1 84  ? 73.999 49.370 17.258  1.00 19.77 ? 89  TYR D OH  1 
ATOM   4626 N N   . LYS D 1 85  ? 76.316 53.513 20.674  1.00 17.87 ? 90  LYS D N   1 
ATOM   4627 C CA  . LYS D 1 85  ? 76.502 54.488 19.646  1.00 17.60 ? 90  LYS D CA  1 
ATOM   4628 C C   . LYS D 1 85  ? 76.607 53.695 18.354  1.00 19.05 ? 90  LYS D C   1 
ATOM   4629 O O   . LYS D 1 85  ? 77.271 52.628 18.315  1.00 18.47 ? 90  LYS D O   1 
ATOM   4630 C CB  . LYS D 1 85  ? 77.797 55.301 19.837  1.00 23.21 ? 90  LYS D CB  1 
ATOM   4631 C CG  . LYS D 1 85  ? 77.787 56.289 20.969  1.00 27.85 ? 90  LYS D CG  1 
ATOM   4632 C CD  . LYS D 1 85  ? 79.033 57.169 20.837  1.00 34.77 ? 90  LYS D CD  1 
ATOM   4633 C CE  . LYS D 1 85  ? 79.067 58.204 21.953  1.00 41.61 ? 90  LYS D CE  1 
ATOM   4634 N NZ  . LYS D 1 85  ? 79.449 57.560 23.235  1.00 45.42 ? 90  LYS D NZ  1 
ATOM   4635 N N   . GLY D 1 86  ? 75.901 54.136 17.303  1.00 16.94 ? 91  GLY D N   1 
ATOM   4636 C CA  . GLY D 1 86  ? 76.004 53.479 16.040  1.00 17.06 ? 91  GLY D CA  1 
ATOM   4637 C C   . GLY D 1 86  ? 75.439 54.222 14.849  1.00 15.76 ? 91  GLY D C   1 
ATOM   4638 O O   . GLY D 1 86  ? 74.963 55.343 15.009  1.00 19.59 ? 91  GLY D O   1 
ATOM   4639 N N   . THR D 1 87  ? 75.665 53.656 13.681  1.00 17.90 ? 92  THR D N   1 
ATOM   4640 C CA  . THR D 1 87  ? 75.208 54.215 12.439  1.00 18.74 ? 92  THR D CA  1 
ATOM   4641 C C   . THR D 1 87  ? 73.985 53.423 11.944  1.00 18.82 ? 92  THR D C   1 
ATOM   4642 O O   . THR D 1 87  ? 73.937 52.193 12.040  1.00 17.40 ? 92  THR D O   1 
ATOM   4643 C CB  . THR D 1 87  ? 76.387 54.083 11.428  1.00 24.66 ? 92  THR D CB  1 
ATOM   4644 O OG1 . THR D 1 87  ? 77.391 55.009 11.875  1.00 28.98 ? 92  THR D OG1 1 
ATOM   4645 C CG2 . THR D 1 87  ? 76.001 54.432 10.072  1.00 26.85 ? 92  THR D CG2 1 
ATOM   4646 N N   . ILE D 1 88  ? 73.011 54.169 11.380  1.00 17.50 ? 93  ILE D N   1 
ATOM   4647 C CA  . ILE D 1 88  ? 71.765 53.587 10.820  1.00 18.26 ? 93  ILE D CA  1 
ATOM   4648 C C   . ILE D 1 88  ? 72.005 53.139 9.354   1.00 17.76 ? 93  ILE D C   1 
ATOM   4649 O O   . ILE D 1 88  ? 72.536 53.918 8.531   1.00 19.87 ? 93  ILE D O   1 
ATOM   4650 C CB  . ILE D 1 88  ? 70.651 54.620 10.872  1.00 17.84 ? 93  ILE D CB  1 
ATOM   4651 C CG1 . ILE D 1 88  ? 70.324 54.955 12.330  1.00 18.34 ? 93  ILE D CG1 1 
ATOM   4652 C CG2 . ILE D 1 88  ? 69.381 54.019 10.238  1.00 18.69 ? 93  ILE D CG2 1 
ATOM   4653 C CD1 . ILE D 1 88  ? 69.400 56.090 12.644  1.00 20.13 ? 93  ILE D CD1 1 
ATOM   4654 N N   . LYS D 1 89  ? 71.685 51.905 9.056   1.00 17.81 ? 94  LYS D N   1 
ATOM   4655 C CA  . LYS D 1 89  ? 71.762 51.320 7.716   1.00 19.49 ? 94  LYS D CA  1 
ATOM   4656 C C   . LYS D 1 89  ? 70.381 51.123 7.123   1.00 18.96 ? 94  LYS D C   1 
ATOM   4657 O O   . LYS D 1 89  ? 69.446 50.886 7.889   1.00 18.93 ? 94  LYS D O   1 
ATOM   4658 C CB  . LYS D 1 89  ? 72.442 49.960 7.761   1.00 23.04 ? 94  LYS D CB  1 
ATOM   4659 C CG  . LYS D 1 89  ? 73.704 49.983 8.553   1.00 27.95 ? 94  LYS D CG  1 
ATOM   4660 C CD  . LYS D 1 89  ? 74.787 50.695 7.768   1.00 33.94 ? 94  LYS D CD  1 
ATOM   4661 C CE  . LYS D 1 89  ? 76.095 50.801 8.572   1.00 36.84 ? 94  LYS D CE  1 
ATOM   4662 N NZ  . LYS D 1 89  ? 76.895 49.562 8.265   1.00 42.56 ? 94  LYS D NZ  1 
ATOM   4663 N N   . PHE D 1 90  ? 70.247 51.263 5.793   1.00 20.86 ? 95  PHE D N   1 
ATOM   4664 C CA  . PHE D 1 90  ? 68.936 51.235 5.107   1.00 21.43 ? 95  PHE D CA  1 
ATOM   4665 C C   . PHE D 1 90  ? 68.857 50.045 4.191   1.00 22.21 ? 95  PHE D C   1 
ATOM   4666 O O   . PHE D 1 90  ? 69.927 49.550 3.719   1.00 26.70 ? 95  PHE D O   1 
ATOM   4667 C CB  . PHE D 1 90  ? 68.781 52.518 4.258   1.00 19.93 ? 95  PHE D CB  1 
ATOM   4668 C CG  . PHE D 1 90  ? 68.406 53.754 5.056   1.00 22.30 ? 95  PHE D CG  1 
ATOM   4669 C CD1 . PHE D 1 90  ? 69.274 54.306 5.955   1.00 22.35 ? 95  PHE D CD1 1 
ATOM   4670 C CD2 . PHE D 1 90  ? 67.171 54.339 4.872   1.00 23.77 ? 95  PHE D CD2 1 
ATOM   4671 C CE1 . PHE D 1 90  ? 68.926 55.396 6.732   1.00 25.24 ? 95  PHE D CE1 1 
ATOM   4672 C CE2 . PHE D 1 90  ? 66.821 55.483 5.602   1.00 24.86 ? 95  PHE D CE2 1 
ATOM   4673 C CZ  . PHE D 1 90  ? 67.675 55.978 6.553   1.00 22.77 ? 95  PHE D CZ  1 
ATOM   4674 N N   . ASP D 1 91  ? 67.655 49.503 3.945   1.00 22.84 ? 96  ASP D N   1 
ATOM   4675 C CA  . ASP D 1 91  ? 67.481 48.446 2.919   1.00 21.47 ? 96  ASP D CA  1 
ATOM   4676 C C   . ASP D 1 91  ? 66.139 48.800 2.299   1.00 26.96 ? 96  ASP D C   1 
ATOM   4677 O O   . ASP D 1 91  ? 65.089 48.693 2.959   1.00 28.61 ? 96  ASP D O   1 
ATOM   4678 C CB  . ASP D 1 91  ? 67.400 47.073 3.597   1.00 21.83 ? 96  ASP D CB  1 
ATOM   4679 C CG  . ASP D 1 91  ? 67.464 45.888 2.631   1.00 21.59 ? 96  ASP D CG  1 
ATOM   4680 O OD1 . ASP D 1 91  ? 67.746 46.110 1.465   1.00 21.18 ? 96  ASP D OD1 1 
ATOM   4681 O OD2 . ASP D 1 91  ? 67.201 44.737 3.208   1.00 21.89 ? 96  ASP D OD2 1 
ATOM   4682 N N   . GLY D 1 92  ? 66.176 49.168 1.035   1.00 34.34 ? 97  GLY D N   1 
ATOM   4683 C CA  . GLY D 1 92  ? 65.004 49.768 0.380   1.00 37.72 ? 97  GLY D CA  1 
ATOM   4684 C C   . GLY D 1 92  ? 64.985 51.190 0.923   1.00 42.70 ? 97  GLY D C   1 
ATOM   4685 O O   . GLY D 1 92  ? 66.053 51.828 1.075   1.00 47.28 ? 97  GLY D O   1 
ATOM   4686 N N   . ASP D 1 93  ? 63.783 51.676 1.248   1.00 46.97 ? 98  ASP D N   1 
ATOM   4687 C CA  . ASP D 1 93  ? 63.589 53.072 1.690   1.00 46.88 ? 98  ASP D CA  1 
ATOM   4688 C C   . ASP D 1 93  ? 63.959 53.247 3.137   1.00 45.65 ? 98  ASP D C   1 
ATOM   4689 O O   . ASP D 1 93  ? 64.176 54.371 3.599   1.00 43.35 ? 98  ASP D O   1 
ATOM   4690 C CB  . ASP D 1 93  ? 62.095 53.453 1.568   1.00 53.11 ? 98  ASP D CB  1 
ATOM   4691 C CG  . ASP D 1 93  ? 61.771 54.238 0.299   1.00 57.25 ? 98  ASP D CG  1 
ATOM   4692 O OD1 . ASP D 1 93  ? 62.696 54.766 -0.375  1.00 65.26 ? 98  ASP D OD1 1 
ATOM   4693 O OD2 . ASP D 1 93  ? 60.561 54.335 -0.001  1.00 56.13 ? 98  ASP D OD2 1 
ATOM   4694 N N   . LYS D 1 94  ? 64.011 52.131 3.859   1.00 35.30 ? 99  LYS D N   1 
ATOM   4695 C CA  . LYS D 1 94  ? 63.701 52.124 5.233   1.00 35.53 ? 99  LYS D CA  1 
ATOM   4696 C C   . LYS D 1 94  ? 64.971 51.824 5.999   1.00 27.83 ? 99  LYS D C   1 
ATOM   4697 O O   . LYS D 1 94  ? 65.739 51.006 5.561   1.00 24.57 ? 99  LYS D O   1 
ATOM   4698 C CB  . LYS D 1 94  ? 62.722 50.992 5.545   1.00 43.83 ? 99  LYS D CB  1 
ATOM   4699 C CG  . LYS D 1 94  ? 61.558 51.423 6.419   1.00 50.26 ? 99  LYS D CG  1 
ATOM   4700 C CD  . LYS D 1 94  ? 60.494 52.157 5.575   1.00 58.43 ? 99  LYS D CD  1 
ATOM   4701 C CE  . LYS D 1 94  ? 59.387 52.775 6.428   1.00 60.80 ? 99  LYS D CE  1 
ATOM   4702 N NZ  . LYS D 1 94  ? 58.860 51.782 7.409   1.00 62.19 ? 99  LYS D NZ  1 
ATOM   4703 N N   . PRO D 1 95  ? 65.127 52.424 7.184   1.00 23.47 ? 100 PRO D N   1 
ATOM   4704 C CA  . PRO D 1 95  ? 66.150 51.968 8.127   1.00 22.16 ? 100 PRO D CA  1 
ATOM   4705 C C   . PRO D 1 95  ? 65.905 50.527 8.473   1.00 23.11 ? 100 PRO D C   1 
ATOM   4706 O O   . PRO D 1 95  ? 64.755 50.158 8.781   1.00 25.38 ? 100 PRO D O   1 
ATOM   4707 C CB  . PRO D 1 95  ? 65.941 52.850 9.379   1.00 23.24 ? 100 PRO D CB  1 
ATOM   4708 C CG  . PRO D 1 95  ? 65.193 53.985 8.845   1.00 24.36 ? 100 PRO D CG  1 
ATOM   4709 C CD  . PRO D 1 95  ? 64.383 53.577 7.703   1.00 25.38 ? 100 PRO D CD  1 
ATOM   4710 N N   . VAL D 1 96  ? 66.960 49.725 8.513   1.00 21.36 ? 101 VAL D N   1 
ATOM   4711 C CA  . VAL D 1 96  ? 66.797 48.321 8.861   1.00 21.53 ? 101 VAL D CA  1 
ATOM   4712 C C   . VAL D 1 96  ? 67.697 47.806 9.965   1.00 18.72 ? 101 VAL D C   1 
ATOM   4713 O O   . VAL D 1 96  ? 67.428 46.769 10.521  1.00 18.85 ? 101 VAL D O   1 
ATOM   4714 C CB  . VAL D 1 96  ? 66.923 47.434 7.678   1.00 24.72 ? 101 VAL D CB  1 
ATOM   4715 C CG1 . VAL D 1 96  ? 65.745 47.790 6.721   1.00 27.45 ? 101 VAL D CG1 1 
ATOM   4716 C CG2 . VAL D 1 96  ? 68.303 47.527 7.090   1.00 21.43 ? 101 VAL D CG2 1 
ATOM   4717 N N   . SER D 1 97  ? 68.741 48.584 10.260  1.00 17.93 ? 102 SER D N   1 
ATOM   4718 C CA  . SER D 1 97  ? 69.601 48.271 11.378  1.00 18.34 ? 102 SER D CA  1 
ATOM   4719 C C   . SER D 1 97  ? 70.394 49.434 11.868  1.00 17.68 ? 102 SER D C   1 
ATOM   4720 O O   . SER D 1 97  ? 70.472 50.452 11.294  1.00 18.21 ? 102 SER D O   1 
ATOM   4721 C CB  . SER D 1 97  ? 70.513 47.093 11.056  1.00 19.48 ? 102 SER D CB  1 
ATOM   4722 O OG  . SER D 1 97  ? 71.498 47.518 10.143  1.00 22.49 ? 102 SER D OG  1 
ATOM   4723 N N   . VAL D 1 98  ? 70.945 49.245 13.067  1.00 17.34 ? 103 VAL D N   1 
ATOM   4724 C CA  . VAL D 1 98  ? 71.934 50.115 13.608  1.00 17.40 ? 103 VAL D CA  1 
ATOM   4725 C C   . VAL D 1 98  ? 73.172 49.262 13.900  1.00 17.87 ? 103 VAL D C   1 
ATOM   4726 O O   . VAL D 1 98  ? 73.099 48.216 14.540  1.00 17.59 ? 103 VAL D O   1 
ATOM   4727 C CB  . VAL D 1 98  ? 71.466 50.731 14.874  1.00 17.14 ? 103 VAL D CB  1 
ATOM   4728 C CG1 . VAL D 1 98  ? 72.431 51.861 15.222  1.00 17.32 ? 103 VAL D CG1 1 
ATOM   4729 C CG2 . VAL D 1 98  ? 70.064 51.252 14.735  1.00 18.59 ? 103 VAL D CG2 1 
ATOM   4730 N N   . VAL D 1 99  ? 74.272 49.661 13.270  1.00 17.16 ? 104 VAL D N   1 
ATOM   4731 C CA  . VAL D 1 99  ? 75.578 48.975 13.394  1.00 19.09 ? 104 VAL D CA  1 
ATOM   4732 C C   . VAL D 1 99  ? 76.469 49.842 14.281  1.00 17.34 ? 104 VAL D C   1 
ATOM   4733 O O   . VAL D 1 99  ? 76.761 51.013 13.979  1.00 17.03 ? 104 VAL D O   1 
ATOM   4734 C CB  . VAL D 1 99  ? 76.199 48.761 12.020  1.00 21.19 ? 104 VAL D CB  1 
ATOM   4735 C CG1 . VAL D 1 99  ? 77.519 48.057 12.152  1.00 23.89 ? 104 VAL D CG1 1 
ATOM   4736 C CG2 . VAL D 1 99  ? 75.271 47.919 11.149  1.00 22.30 ? 104 VAL D CG2 1 
ATOM   4737 N N   . GLY D 1 100 ? 76.790 49.316 15.418  1.00 17.13 ? 105 GLY D N   1 
ATOM   4738 C CA  . GLY D 1 100 ? 77.509 50.124 16.431  1.00 18.32 ? 105 GLY D CA  1 
ATOM   4739 C C   . GLY D 1 100 ? 78.201 49.314 17.456  1.00 17.96 ? 105 GLY D C   1 
ATOM   4740 O O   . GLY D 1 100 ? 78.617 48.192 17.187  1.00 17.67 ? 105 GLY D O   1 
ATOM   4741 N N   . ASN D 1 101 ? 78.393 49.956 18.598  1.00 16.66 ? 106 ASN D N   1 
ATOM   4742 C CA  . ASN D 1 101 ? 79.159 49.462 19.736  1.00 17.67 ? 106 ASN D CA  1 
ATOM   4743 C C   . ASN D 1 101 ? 78.416 49.729 21.048  1.00 16.36 ? 106 ASN D C   1 
ATOM   4744 O O   . ASN D 1 101 ? 78.033 50.896 21.316  1.00 18.02 ? 106 ASN D O   1 
ATOM   4745 C CB  . ASN D 1 101 ? 80.532 50.138 19.800  1.00 19.85 ? 106 ASN D CB  1 
ATOM   4746 C CG  . ASN D 1 101 ? 81.402 49.781 18.591  1.00 21.15 ? 106 ASN D CG  1 
ATOM   4747 O OD1 . ASN D 1 101 ? 81.849 48.666 18.506  1.00 24.09 ? 106 ASN D OD1 1 
ATOM   4748 N ND2 . ASN D 1 101 ? 81.457 50.631 17.620  1.00 24.41 ? 106 ASN D ND2 1 
ATOM   4749 N N   . LEU D 1 102 ? 78.364 48.659 21.857  1.00 16.69 ? 107 LEU D N   1 
ATOM   4750 C CA  . LEU D 1 102 ? 77.767 48.687 23.148  1.00 16.79 ? 107 LEU D CA  1 
ATOM   4751 C C   . LEU D 1 102 ? 78.911 48.719 24.158  1.00 18.84 ? 107 LEU D C   1 
ATOM   4752 O O   . LEU D 1 102 ? 79.789 47.870 24.095  1.00 17.59 ? 107 LEU D O   1 
ATOM   4753 C CB  . LEU D 1 102 ? 76.931 47.496 23.389  1.00 16.94 ? 107 LEU D CB  1 
ATOM   4754 C CG  . LEU D 1 102 ? 76.340 47.318 24.808  1.00 18.12 ? 107 LEU D CG  1 
ATOM   4755 C CD1 . LEU D 1 102 ? 75.354 48.461 25.151  1.00 20.57 ? 107 LEU D CD1 1 
ATOM   4756 C CD2 . LEU D 1 102 ? 75.648 46.038 24.980  1.00 18.68 ? 107 LEU D CD2 1 
ATOM   4757 N N   . THR D 1 103 ? 78.817 49.658 25.065  1.00 17.79 ? 108 THR D N   1 
ATOM   4758 C CA  . THR D 1 103 ? 79.679 49.711 26.260  1.00 18.05 ? 108 THR D CA  1 
ATOM   4759 C C   . THR D 1 103 ? 78.905 49.237 27.442  1.00 20.46 ? 108 THR D C   1 
ATOM   4760 O O   . THR D 1 103 ? 77.926 49.907 27.858  1.00 20.64 ? 108 THR D O   1 
ATOM   4761 C CB  . THR D 1 103 ? 80.283 51.111 26.459  1.00 19.75 ? 108 THR D CB  1 
ATOM   4762 O OG1 . THR D 1 103 ? 80.989 51.568 25.297  1.00 20.63 ? 108 THR D OG1 1 
ATOM   4763 C CG2 . THR D 1 103 ? 81.312 51.132 27.650  1.00 24.86 ? 108 THR D CG2 1 
ATOM   4764 N N   . LEU D 1 104 ? 79.320 48.107 28.078  1.00 18.85 ? 109 LEU D N   1 
ATOM   4765 C CA  . LEU D 1 104 ? 78.524 47.513 29.163  1.00 20.28 ? 109 LEU D CA  1 
ATOM   4766 C C   . LEU D 1 104 ? 79.608 46.977 30.144  1.00 19.80 ? 109 LEU D C   1 
ATOM   4767 O O   . LEU D 1 104 ? 80.469 46.237 29.667  1.00 20.19 ? 109 LEU D O   1 
ATOM   4768 C CB  . LEU D 1 104 ? 77.649 46.395 28.595  1.00 20.55 ? 109 LEU D CB  1 
ATOM   4769 C CG  . LEU D 1 104 ? 76.852 45.513 29.555  1.00 20.89 ? 109 LEU D CG  1 
ATOM   4770 C CD1 . LEU D 1 104 ? 75.964 46.336 30.518  1.00 21.15 ? 109 LEU D CD1 1 
ATOM   4771 C CD2 . LEU D 1 104 ? 76.041 44.450 28.870  1.00 21.94 ? 109 LEU D CD2 1 
ATOM   4772 N N   . HIS D 1 105 ? 79.515 47.248 31.428  1.00 19.79 ? 110 HIS D N   1 
ATOM   4773 C CA  . HIS D 1 105 ? 80.446 46.648 32.397  1.00 19.23 ? 110 HIS D CA  1 
ATOM   4774 C C   . HIS D 1 105 ? 81.905 46.954 31.942  1.00 21.75 ? 110 HIS D C   1 
ATOM   4775 O O   . HIS D 1 105 ? 82.818 46.106 32.126  1.00 21.79 ? 110 HIS D O   1 
ATOM   4776 C CB  . HIS D 1 105 ? 80.182 45.128 32.531  1.00 19.78 ? 110 HIS D CB  1 
ATOM   4777 C CG  . HIS D 1 105 ? 80.967 44.468 33.629  1.00 21.66 ? 110 HIS D CG  1 
ATOM   4778 N ND1 . HIS D 1 105 ? 81.844 43.449 33.374  1.00 23.89 ? 110 HIS D ND1 1 
ATOM   4779 C CD2 . HIS D 1 105 ? 81.049 44.696 34.938  1.00 24.73 ? 110 HIS D CD2 1 
ATOM   4780 C CE1 . HIS D 1 105 ? 82.486 43.105 34.467  1.00 23.01 ? 110 HIS D CE1 1 
ATOM   4781 N NE2 . HIS D 1 105 ? 82.004 43.826 35.455  1.00 24.02 ? 110 HIS D NE2 1 
ATOM   4782 N N   . GLY D 1 106 ? 82.098 48.141 31.379  1.00 20.37 ? 111 GLY D N   1 
ATOM   4783 C CA  . GLY D 1 106 ? 83.433 48.639 30.987  1.00 22.36 ? 111 GLY D CA  1 
ATOM   4784 C C   . GLY D 1 106 ? 83.987 48.072 29.721  1.00 21.27 ? 111 GLY D C   1 
ATOM   4785 O O   . GLY D 1 106 ? 85.042 48.452 29.280  1.00 25.69 ? 111 GLY D O   1 
ATOM   4786 N N   . VAL D 1 107 ? 83.281 47.183 29.060  1.00 19.78 ? 112 VAL D N   1 
ATOM   4787 C CA  . VAL D 1 107 ? 83.787 46.545 27.839  1.00 17.89 ? 112 VAL D CA  1 
ATOM   4788 C C   . VAL D 1 107 ? 82.954 47.038 26.695  1.00 18.93 ? 112 VAL D C   1 
ATOM   4789 O O   . VAL D 1 107 ? 81.710 47.049 26.781  1.00 18.06 ? 112 VAL D O   1 
ATOM   4790 C CB  . VAL D 1 107 ? 83.632 45.036 27.926  1.00 17.95 ? 112 VAL D CB  1 
ATOM   4791 C CG1 . VAL D 1 107 ? 84.094 44.306 26.677  1.00 18.80 ? 112 VAL D CG1 1 
ATOM   4792 C CG2 . VAL D 1 107 ? 84.357 44.531 29.159  1.00 19.76 ? 112 VAL D CG2 1 
ATOM   4793 N N   . THR D 1 108 ? 83.627 47.479 25.670  1.00 20.25 ? 113 THR D N   1 
ATOM   4794 C CA  . THR D 1 108 ? 82.968 47.921 24.427  1.00 20.29 ? 113 THR D CA  1 
ATOM   4795 C C   . THR D 1 108 ? 83.114 46.873 23.352  1.00 22.24 ? 113 THR D C   1 
ATOM   4796 O O   . THR D 1 108 ? 84.304 46.527 22.954  1.00 22.46 ? 113 THR D O   1 
ATOM   4797 C CB  . THR D 1 108 ? 83.522 49.308 24.006  1.00 22.03 ? 113 THR D CB  1 
ATOM   4798 O OG1 . THR D 1 108 ? 83.324 50.224 25.067  1.00 22.29 ? 113 THR D OG1 1 
ATOM   4799 C CG2 . THR D 1 108 ? 82.875 49.824 22.723  1.00 24.41 ? 113 THR D CG2 1 
ATOM   4800 N N   . LYS D 1 109 ? 82.026 46.417 22.734  1.00 19.66 ? 114 LYS D N   1 
ATOM   4801 C CA  . LYS D 1 109 ? 82.032 45.419 21.728  1.00 21.19 ? 114 LYS D CA  1 
ATOM   4802 C C   . LYS D 1 109 ? 81.048 45.819 20.666  1.00 21.20 ? 114 LYS D C   1 
ATOM   4803 O O   . LYS D 1 109 ? 80.024 46.466 20.982  1.00 19.39 ? 114 LYS D O   1 
ATOM   4804 C CB  . LYS D 1 109 ? 81.576 44.051 22.269  1.00 22.81 ? 114 LYS D CB  1 
ATOM   4805 C CG  . LYS D 1 109 ? 82.445 43.501 23.325  1.00 29.00 ? 114 LYS D CG  1 
ATOM   4806 C CD  . LYS D 1 109 ? 83.782 43.139 22.746  1.00 35.38 ? 114 LYS D CD  1 
ATOM   4807 C CE  . LYS D 1 109 ? 84.243 41.797 23.259  1.00 37.00 ? 114 LYS D CE  1 
ATOM   4808 N NZ  . LYS D 1 109 ? 85.415 41.434 22.457  1.00 40.14 ? 114 LYS D NZ  1 
ATOM   4809 N N   . PRO D 1 110 ? 81.279 45.421 19.430  1.00 20.25 ? 115 PRO D N   1 
ATOM   4810 C CA  . PRO D 1 110 ? 80.284 45.603 18.374  1.00 20.04 ? 115 PRO D CA  1 
ATOM   4811 C C   . PRO D 1 110 ? 78.929 45.004 18.743  1.00 19.97 ? 115 PRO D C   1 
ATOM   4812 O O   . PRO D 1 110 ? 78.852 43.888 19.229  1.00 18.96 ? 115 PRO D O   1 
ATOM   4813 C CB  . PRO D 1 110 ? 80.883 44.855 17.164  1.00 20.81 ? 115 PRO D CB  1 
ATOM   4814 C CG  . PRO D 1 110 ? 82.288 44.649 17.516  1.00 25.05 ? 115 PRO D CG  1 
ATOM   4815 C CD  . PRO D 1 110 ? 82.431 44.634 18.973  1.00 21.95 ? 115 PRO D CD  1 
ATOM   4816 N N   . LEU D 1 111 ? 77.832 45.671 18.303  1.00 19.29 ? 116 LEU D N   1 
ATOM   4817 C CA  . LEU D 1 111 ? 76.492 45.155 18.504  1.00 18.64 ? 116 LEU D CA  1 
ATOM   4818 C C   . LEU D 1 111 ? 75.643 45.802 17.404  1.00 17.05 ? 116 LEU D C   1 
ATOM   4819 O O   . LEU D 1 111 ? 75.633 47.023 17.303  1.00 17.03 ? 116 LEU D O   1 
ATOM   4820 C CB  . LEU D 1 111 ? 75.937 45.554 19.874  1.00 19.16 ? 116 LEU D CB  1 
ATOM   4821 C CG  . LEU D 1 111 ? 74.430 45.249 20.119  1.00 19.34 ? 116 LEU D CG  1 
ATOM   4822 C CD1 . LEU D 1 111 ? 74.176 43.770 20.087  1.00 21.23 ? 116 LEU D CD1 1 
ATOM   4823 C CD2 . LEU D 1 111 ? 73.893 45.990 21.345  1.00 22.09 ? 116 LEU D CD2 1 
ATOM   4824 N N   . THR D 1 112 ? 74.937 44.994 16.660  1.00 17.75 ? 117 THR D N   1 
ATOM   4825 C CA  . THR D 1 112 ? 73.986 45.417 15.658  1.00 17.86 ? 117 THR D CA  1 
ATOM   4826 C C   . THR D 1 112 ? 72.545 45.226 16.178  1.00 18.42 ? 117 THR D C   1 
ATOM   4827 O O   . THR D 1 112 ? 72.221 44.226 16.852  1.00 19.57 ? 117 THR D O   1 
ATOM   4828 C CB  . THR D 1 112 ? 74.196 44.558 14.384  1.00 20.81 ? 117 THR D CB  1 
ATOM   4829 O OG1 . THR D 1 112 ? 75.482 44.839 13.839  1.00 24.15 ? 117 THR D OG1 1 
ATOM   4830 C CG2 . THR D 1 112 ? 73.061 44.828 13.366  1.00 21.33 ? 117 THR D CG2 1 
ATOM   4831 N N   . LEU D 1 113 ? 71.711 46.242 16.047  1.00 17.30 ? 118 LEU D N   1 
ATOM   4832 C CA  . LEU D 1 113 ? 70.314 46.189 16.440  1.00 17.89 ? 118 LEU D CA  1 
ATOM   4833 C C   . LEU D 1 113 ? 69.547 46.145 15.122  1.00 19.05 ? 118 LEU D C   1 
ATOM   4834 O O   . LEU D 1 113 ? 69.755 47.052 14.305  1.00 21.18 ? 118 LEU D O   1 
ATOM   4835 C CB  . LEU D 1 113 ? 69.928 47.444 17.244  1.00 17.57 ? 118 LEU D CB  1 
ATOM   4836 C CG  . LEU D 1 113 ? 70.788 47.602 18.489  1.00 19.34 ? 118 LEU D CG  1 
ATOM   4837 C CD1 . LEU D 1 113 ? 70.431 48.890 19.216  1.00 20.73 ? 118 LEU D CD1 1 
ATOM   4838 C CD2 . LEU D 1 113 ? 70.665 46.456 19.401  1.00 21.05 ? 118 LEU D CD2 1 
ATOM   4839 N N   . LYS D 1 114 ? 68.753 45.120 14.927  1.00 15.27 ? 119 LYS D N   1 
ATOM   4840 C CA  . LYS D 1 114 ? 67.912 44.986 13.794  1.00 17.77 ? 119 LYS D CA  1 
ATOM   4841 C C   . LYS D 1 114 ? 66.644 45.771 14.053  1.00 18.09 ? 119 LYS D C   1 
ATOM   4842 O O   . LYS D 1 114 ? 66.009 45.571 15.044  1.00 18.11 ? 119 LYS D O   1 
ATOM   4843 C CB  . LYS D 1 114 ? 67.599 43.544 13.575  1.00 19.97 ? 119 LYS D CB  1 
ATOM   4844 C CG  . LYS D 1 114 ? 66.572 43.278 12.463  1.00 25.67 ? 119 LYS D CG  1 
ATOM   4845 C CD  . LYS D 1 114 ? 66.371 41.777 12.168  1.00 32.57 ? 119 LYS D CD  1 
ATOM   4846 C CE  . LYS D 1 114 ? 65.428 41.068 13.128  1.00 34.80 ? 119 LYS D CE  1 
ATOM   4847 N NZ  . LYS D 1 114 ? 65.438 39.599 12.849  1.00 43.48 ? 119 LYS D NZ  1 
ATOM   4848 N N   . ILE D 1 115 ? 66.216 46.566 13.071  1.00 18.30 ? 120 ILE D N   1 
ATOM   4849 C CA  . ILE D 1 115 ? 65.003 47.352 13.191  1.00 19.01 ? 120 ILE D CA  1 
ATOM   4850 C C   . ILE D 1 115 ? 63.835 46.594 12.649  1.00 21.12 ? 120 ILE D C   1 
ATOM   4851 O O   . ILE D 1 115 ? 63.771 46.361 11.466  1.00 21.45 ? 120 ILE D O   1 
ATOM   4852 C CB  . ILE D 1 115 ? 65.134 48.748 12.531  1.00 19.38 ? 120 ILE D CB  1 
ATOM   4853 C CG1 . ILE D 1 115 ? 66.268 49.560 13.235  1.00 18.62 ? 120 ILE D CG1 1 
ATOM   4854 C CG2 . ILE D 1 115 ? 63.763 49.422 12.554  1.00 20.50 ? 120 ILE D CG2 1 
ATOM   4855 C CD1 . ILE D 1 115 ? 66.689 50.810 12.519  1.00 19.43 ? 120 ILE D CD1 1 
ATOM   4856 N N   . ASP D 1 116 ? 62.915 46.162 13.534  1.00 19.67 ? 121 ASP D N   1 
ATOM   4857 C CA  . ASP D 1 116 ? 61.772 45.382 13.038  1.00 23.69 ? 121 ASP D CA  1 
ATOM   4858 C C   . ASP D 1 116 ? 60.627 46.253 12.609  1.00 21.80 ? 121 ASP D C   1 
ATOM   4859 O O   . ASP D 1 116 ? 59.805 45.838 11.750  1.00 25.98 ? 121 ASP D O   1 
ATOM   4860 C CB  . ASP D 1 116 ? 61.303 44.420 14.124  1.00 26.72 ? 121 ASP D CB  1 
ATOM   4861 C CG  . ASP D 1 116 ? 62.211 43.211 14.278  1.00 32.42 ? 121 ASP D CG  1 
ATOM   4862 O OD1 . ASP D 1 116 ? 63.106 42.998 13.424  1.00 33.75 ? 121 ASP D OD1 1 
ATOM   4863 O OD2 . ASP D 1 116 ? 61.978 42.453 15.245  1.00 36.51 ? 121 ASP D OD2 1 
ATOM   4864 N N   . SER D 1 117 ? 60.512 47.434 13.195  1.00 21.83 ? 122 SER D N   1 
ATOM   4865 C CA  . SER D 1 117 ? 59.475 48.403 12.740  1.00 23.02 ? 122 SER D CA  1 
ATOM   4866 C C   . SER D 1 117 ? 59.978 49.800 12.942  1.00 21.24 ? 122 SER D C   1 
ATOM   4867 O O   . SER D 1 117 ? 60.787 50.071 13.798  1.00 18.55 ? 122 SER D O   1 
ATOM   4868 C CB  . SER D 1 117 ? 58.189 48.251 13.527  1.00 24.57 ? 122 SER D CB  1 
ATOM   4869 O OG  . SER D 1 117 ? 58.310 48.693 14.891  1.00 27.88 ? 122 SER D OG  1 
ATOM   4870 N N   . PHE D 1 118 ? 59.530 50.691 12.074  1.00 20.40 ? 123 PHE D N   1 
ATOM   4871 C CA  . PHE D 1 118 ? 59.913 52.041 12.050  1.00 21.88 ? 123 PHE D CA  1 
ATOM   4872 C C   . PHE D 1 118 ? 58.695 52.791 11.570  1.00 22.92 ? 123 PHE D C   1 
ATOM   4873 O O   . PHE D 1 118 ? 58.202 52.455 10.491  1.00 25.40 ? 123 PHE D O   1 
ATOM   4874 C CB  . PHE D 1 118 ? 61.118 52.223 11.082  1.00 22.23 ? 123 PHE D CB  1 
ATOM   4875 C CG  . PHE D 1 118 ? 61.525 53.626 10.899  1.00 25.30 ? 123 PHE D CG  1 
ATOM   4876 C CD1 . PHE D 1 118 ? 62.363 54.253 11.783  1.00 25.68 ? 123 PHE D CD1 1 
ATOM   4877 C CD2 . PHE D 1 118 ? 61.032 54.350 9.828   1.00 26.75 ? 123 PHE D CD2 1 
ATOM   4878 C CE1 . PHE D 1 118 ? 62.715 55.601 11.618  1.00 29.80 ? 123 PHE D CE1 1 
ATOM   4879 C CE2 . PHE D 1 118 ? 61.358 55.658 9.672   1.00 29.62 ? 123 PHE D CE2 1 
ATOM   4880 C CZ  . PHE D 1 118 ? 62.220 56.274 10.566  1.00 27.15 ? 123 PHE D CZ  1 
ATOM   4881 N N   . LYS D 1 119 ? 58.304 53.813 12.326  1.00 22.00 ? 124 LYS D N   1 
ATOM   4882 C CA  . LYS D 1 119 ? 57.138 54.637 11.953  1.00 22.96 ? 124 LYS D CA  1 
ATOM   4883 C C   . LYS D 1 119 ? 57.446 56.063 12.369  1.00 22.98 ? 124 LYS D C   1 
ATOM   4884 O O   . LYS D 1 119 ? 58.055 56.299 13.398  1.00 21.70 ? 124 LYS D O   1 
ATOM   4885 C CB  . LYS D 1 119 ? 55.876 54.132 12.697  1.00 23.72 ? 124 LYS D CB  1 
ATOM   4886 C CG  . LYS D 1 119 ? 54.691 55.045 12.421  1.00 25.87 ? 124 LYS D CG  1 
ATOM   4887 C CD  . LYS D 1 119 ? 53.470 54.521 13.127  1.00 29.68 ? 124 LYS D CD  1 
ATOM   4888 C CE  . LYS D 1 119 ? 52.245 55.275 12.578  1.00 32.49 ? 124 LYS D CE  1 
ATOM   4889 N NZ  . LYS D 1 119 ? 51.056 55.038 13.427  1.00 32.81 ? 124 LYS D NZ  1 
ATOM   4890 N N   . CYS D 1 120 ? 57.053 57.071 11.527  1.00 22.49 ? 125 CYS D N   1 
ATOM   4891 C CA  . CYS D 1 120 ? 57.066 58.473 11.943  1.00 27.81 ? 125 CYS D CA  1 
ATOM   4892 C C   . CYS D 1 120 ? 55.680 59.017 11.676  1.00 27.98 ? 125 CYS D C   1 
ATOM   4893 O O   . CYS D 1 120 ? 54.939 58.509 10.796  1.00 27.90 ? 125 CYS D O   1 
ATOM   4894 C CB  . CYS D 1 120 ? 58.087 59.381 11.216  1.00 31.27 ? 125 CYS D CB  1 
ATOM   4895 S SG  . CYS D 1 120 ? 59.766 58.698 11.209  1.00 34.28 ? 125 CYS D SG  1 
ATOM   4896 N N   . MET D 1 121 ? 55.289 59.911 12.550  1.00 28.77 ? 126 MET D N   1 
ATOM   4897 C CA  . MET D 1 121 ? 53.957 60.548 12.488  1.00 27.29 ? 126 MET D CA  1 
ATOM   4898 C C   . MET D 1 121 ? 54.033 61.849 13.209  1.00 27.81 ? 126 MET D C   1 
ATOM   4899 O O   . MET D 1 121 ? 54.920 62.103 14.000  1.00 26.46 ? 126 MET D O   1 
ATOM   4900 C CB  . MET D 1 121 ? 52.903 59.669 13.195  1.00 28.12 ? 126 MET D CB  1 
ATOM   4901 C CG  . MET D 1 121 ? 53.223 59.402 14.670  1.00 28.24 ? 126 MET D CG  1 
ATOM   4902 S SD  . MET D 1 121 ? 52.089 58.201 15.404  1.00 33.03 ? 126 MET D SD  1 
ATOM   4903 C CE  . MET D 1 121 ? 50.827 59.305 15.939  1.00 32.79 ? 126 MET D CE  1 
ATOM   4904 N N   . PRO D 1 122 ? 53.055 62.772 12.927  1.00 27.74 ? 127 PRO D N   1 
ATOM   4905 C CA  . PRO D 1 122 ? 52.995 63.916 13.801  1.00 28.58 ? 127 PRO D CA  1 
ATOM   4906 C C   . PRO D 1 122 ? 52.534 63.564 15.149  1.00 29.79 ? 127 PRO D C   1 
ATOM   4907 O O   . PRO D 1 122 ? 51.576 62.826 15.270  1.00 35.17 ? 127 PRO D O   1 
ATOM   4908 C CB  . PRO D 1 122 ? 51.936 64.831 13.109  1.00 30.54 ? 127 PRO D CB  1 
ATOM   4909 C CG  . PRO D 1 122 ? 51.662 64.203 11.743  1.00 31.18 ? 127 PRO D CG  1 
ATOM   4910 C CD  . PRO D 1 122 ? 52.025 62.758 11.873  1.00 30.80 ? 127 PRO D CD  1 
ATOM   4911 N N   . HIS D 1 123 ? 53.151 64.097 16.179  1.00 31.12 ? 128 HIS D N   1 
ATOM   4912 C CA  . HIS D 1 123 ? 52.706 63.844 17.557  1.00 37.27 ? 128 HIS D CA  1 
ATOM   4913 C C   . HIS D 1 123 ? 51.411 64.672 17.845  1.00 39.73 ? 128 HIS D C   1 
ATOM   4914 O O   . HIS D 1 123 ? 51.447 65.888 17.693  1.00 37.81 ? 128 HIS D O   1 
ATOM   4915 C CB  . HIS D 1 123 ? 53.862 64.247 18.512  1.00 42.04 ? 128 HIS D CB  1 
ATOM   4916 C CG  . HIS D 1 123 ? 53.597 64.033 19.981  1.00 51.00 ? 128 HIS D CG  1 
ATOM   4917 N ND1 . HIS D 1 123 ? 52.479 63.393 20.479  1.00 52.22 ? 128 HIS D ND1 1 
ATOM   4918 C CD2 . HIS D 1 123 ? 54.329 64.391 21.062  1.00 55.74 ? 128 HIS D CD2 1 
ATOM   4919 C CE1 . HIS D 1 123 ? 52.543 63.355 21.799  1.00 58.00 ? 128 HIS D CE1 1 
ATOM   4920 N NE2 . HIS D 1 123 ? 53.652 63.963 22.176  1.00 60.59 ? 128 HIS D NE2 1 
ATOM   4921 N N   . PRO D 1 124 ? 50.296 64.018 18.247  1.00 42.19 ? 129 PRO D N   1 
ATOM   4922 C CA  . PRO D 1 124 ? 49.066 64.799 18.596  1.00 46.50 ? 129 PRO D CA  1 
ATOM   4923 C C   . PRO D 1 124 ? 49.205 65.853 19.716  1.00 50.25 ? 129 PRO D C   1 
ATOM   4924 O O   . PRO D 1 124 ? 48.433 66.807 19.718  1.00 48.01 ? 129 PRO D O   1 
ATOM   4925 C CB  . PRO D 1 124 ? 48.067 63.713 19.027  1.00 48.34 ? 129 PRO D CB  1 
ATOM   4926 C CG  . PRO D 1 124 ? 48.922 62.565 19.446  1.00 48.02 ? 129 PRO D CG  1 
ATOM   4927 C CD  . PRO D 1 124 ? 50.071 62.570 18.466  1.00 46.91 ? 129 PRO D CD  1 
ATOM   4928 N N   . MET D 1 125 ? 50.177 65.718 20.628  1.00 52.60 ? 130 MET D N   1 
ATOM   4929 C CA  . MET D 1 125 ? 50.302 66.649 21.776  1.00 55.30 ? 130 MET D CA  1 
ATOM   4930 C C   . MET D 1 125 ? 51.454 67.671 21.696  1.00 55.59 ? 130 MET D C   1 
ATOM   4931 O O   . MET D 1 125 ? 51.282 68.823 22.123  1.00 53.14 ? 130 MET D O   1 
ATOM   4932 C CB  . MET D 1 125 ? 50.361 65.840 23.088  1.00 59.22 ? 130 MET D CB  1 
ATOM   4933 C CG  . MET D 1 125 ? 49.210 64.826 23.268  1.00 61.83 ? 130 MET D CG  1 
ATOM   4934 S SD  . MET D 1 125 ? 47.600 65.519 23.806  1.00 72.40 ? 130 MET D SD  1 
ATOM   4935 C CE  . MET D 1 125 ? 46.632 65.673 22.291  1.00 67.30 ? 130 MET D CE  1 
ATOM   4936 N N   . LEU D 1 126 ? 52.617 67.282 21.153  1.00 50.27 ? 131 LEU D N   1 
ATOM   4937 C CA  . LEU D 1 126 ? 53.761 68.235 20.985  1.00 52.12 ? 131 LEU D CA  1 
ATOM   4938 C C   . LEU D 1 126 ? 53.779 68.892 19.613  1.00 46.42 ? 131 LEU D C   1 
ATOM   4939 O O   . LEU D 1 126 ? 54.566 69.795 19.357  1.00 46.98 ? 131 LEU D O   1 
ATOM   4940 C CB  . LEU D 1 126 ? 55.133 67.580 21.239  1.00 53.59 ? 131 LEU D CB  1 
ATOM   4941 C CG  . LEU D 1 126 ? 55.527 67.023 22.626  1.00 56.60 ? 131 LEU D CG  1 
ATOM   4942 C CD1 . LEU D 1 126 ? 56.986 66.566 22.585  1.00 55.88 ? 131 LEU D CD1 1 
ATOM   4943 C CD2 . LEU D 1 126 ? 55.338 68.025 23.754  1.00 56.59 ? 131 LEU D CD2 1 
ATOM   4944 N N   . LYS D 1 127 ? 52.926 68.419 18.717  1.00 47.20 ? 132 LYS D N   1 
ATOM   4945 C CA  . LYS D 1 127 ? 52.800 69.000 17.388  1.00 48.69 ? 132 LYS D CA  1 
ATOM   4946 C C   . LYS D 1 127 ? 54.156 69.117 16.637  1.00 46.91 ? 132 LYS D C   1 
ATOM   4947 O O   . LYS D 1 127 ? 54.389 70.046 15.853  1.00 43.28 ? 132 LYS D O   1 
ATOM   4948 C CB  . LYS D 1 127 ? 52.049 70.349 17.506  1.00 53.72 ? 132 LYS D CB  1 
ATOM   4949 C CG  . LYS D 1 127 ? 51.788 71.101 16.193  1.00 59.67 ? 132 LYS D CG  1 
ATOM   4950 C CD  . LYS D 1 127 ? 50.682 72.160 16.334  1.00 64.24 ? 132 LYS D CD  1 
ATOM   4951 C CE  . LYS D 1 127 ? 51.035 73.317 17.283  1.00 66.00 ? 132 LYS D CE  1 
ATOM   4952 N NZ  . LYS D 1 127 ? 52.259 74.070 16.889  1.00 61.84 ? 132 LYS D NZ  1 
ATOM   4953 N N   . ARG D 1 128 ? 55.044 68.148 16.875  1.00 42.05 ? 133 ARG D N   1 
ATOM   4954 C CA  . ARG D 1 128 ? 56.258 67.945 16.058  1.00 41.56 ? 133 ARG D CA  1 
ATOM   4955 C C   . ARG D 1 128 ? 56.336 66.421 15.803  1.00 34.51 ? 133 ARG D C   1 
ATOM   4956 O O   . ARG D 1 128 ? 55.635 65.642 16.469  1.00 32.68 ? 133 ARG D O   1 
ATOM   4957 C CB  . ARG D 1 128 ? 57.529 68.380 16.795  1.00 44.96 ? 133 ARG D CB  1 
ATOM   4958 C CG  . ARG D 1 128 ? 58.026 69.805 16.515  1.00 48.98 ? 133 ARG D CG  1 
ATOM   4959 C CD  . ARG D 1 128 ? 59.191 70.160 17.439  1.00 52.41 ? 133 ARG D CD  1 
ATOM   4960 N NE  . ARG D 1 128 ? 58.904 69.830 18.840  1.00 57.25 ? 133 ARG D NE  1 
ATOM   4961 C CZ  . ARG D 1 128 ? 59.799 69.449 19.755  1.00 59.33 ? 133 ARG D CZ  1 
ATOM   4962 N NH1 . ARG D 1 128 ? 61.081 69.342 19.453  1.00 62.04 ? 133 ARG D NH1 1 
ATOM   4963 N NH2 . ARG D 1 128 ? 59.406 69.173 20.995  1.00 59.08 ? 133 ARG D NH2 1 
ATOM   4964 N N   . GLU D 1 129 ? 57.157 66.056 14.824  1.00 31.47 ? 134 GLU D N   1 
ATOM   4965 C CA  . GLU D 1 129 ? 57.289 64.679 14.313  1.00 29.52 ? 134 GLU D CA  1 
ATOM   4966 C C   . GLU D 1 129 ? 57.984 63.792 15.360  1.00 27.59 ? 134 GLU D C   1 
ATOM   4967 O O   . GLU D 1 129 ? 58.892 64.218 16.103  1.00 25.32 ? 134 GLU D O   1 
ATOM   4968 C CB  . GLU D 1 129 ? 58.088 64.608 12.989  1.00 32.80 ? 134 GLU D CB  1 
ATOM   4969 C CG  . GLU D 1 129 ? 58.323 63.185 12.425  1.00 36.60 ? 134 GLU D CG  1 
ATOM   4970 C CD  . GLU D 1 129 ? 59.143 63.043 11.128  1.00 39.37 ? 134 GLU D CD  1 
ATOM   4971 O OE1 . GLU D 1 129 ? 60.390 63.184 11.090  1.00 38.11 ? 134 GLU D OE1 1 
ATOM   4972 O OE2 . GLU D 1 129 ? 58.535 62.712 10.101  1.00 48.83 ? 134 GLU D OE2 1 
ATOM   4973 N N   . VAL D 1 130 ? 57.410 62.615 15.485  1.00 24.89 ? 135 VAL D N   1 
ATOM   4974 C CA  . VAL D 1 130 ? 57.935 61.593 16.386  1.00 23.34 ? 135 VAL D CA  1 
ATOM   4975 C C   . VAL D 1 130 ? 58.164 60.387 15.531  1.00 22.95 ? 135 VAL D C   1 
ATOM   4976 O O   . VAL D 1 130 ? 57.346 60.009 14.696  1.00 22.67 ? 135 VAL D O   1 
ATOM   4977 C CB  . VAL D 1 130 ? 57.048 61.334 17.628  1.00 23.94 ? 135 VAL D CB  1 
ATOM   4978 C CG1 . VAL D 1 130 ? 55.630 60.909 17.232  1.00 25.76 ? 135 VAL D CG1 1 
ATOM   4979 C CG2 . VAL D 1 130 ? 57.688 60.278 18.548  1.00 24.09 ? 135 VAL D CG2 1 
ATOM   4980 N N   . CYS D 1 131 ? 59.328 59.736 15.730  1.00 23.36 ? 136 CYS D N   1 
ATOM   4981 C CA  A CYS D 1 131 ? 59.650 58.496 15.016  0.50 22.79 ? 136 CYS D CA  1 
ATOM   4982 C CA  B CYS D 1 131 ? 59.632 58.491 15.026  0.50 22.99 ? 136 CYS D CA  1 
ATOM   4983 C C   . CYS D 1 131 ? 59.846 57.438 16.086  1.00 20.63 ? 136 CYS D C   1 
ATOM   4984 O O   . CYS D 1 131 ? 60.400 57.716 17.140  1.00 22.39 ? 136 CYS D O   1 
ATOM   4985 C CB  A CYS D 1 131 ? 60.931 58.598 14.184  0.50 25.94 ? 136 CYS D CB  1 
ATOM   4986 C CB  B CYS D 1 131 ? 60.888 58.589 14.173  0.50 26.42 ? 136 CYS D CB  1 
ATOM   4987 S SG  A CYS D 1 131 ? 60.893 59.657 12.654  0.50 32.22 ? 136 CYS D SG  1 
ATOM   4988 S SG  B CYS D 1 131 ? 60.778 59.698 12.698  0.50 33.63 ? 136 CYS D SG  1 
ATOM   4989 N N   . GLY D 1 132 ? 59.315 56.306 15.835  1.00 18.84 ? 137 GLY D N   1 
ATOM   4990 C CA  . GLY D 1 132 ? 59.338 55.199 16.789  1.00 15.81 ? 137 GLY D CA  1 
ATOM   4991 C C   . GLY D 1 132 ? 59.841 53.939 16.115  1.00 16.44 ? 137 GLY D C   1 
ATOM   4992 O O   . GLY D 1 132 ? 59.555 53.626 14.965  1.00 17.77 ? 137 GLY D O   1 
ATOM   4993 N N   . VAL D 1 133 ? 60.565 53.143 16.909  1.00 16.08 ? 138 VAL D N   1 
ATOM   4994 C CA  . VAL D 1 133 ? 61.070 51.864 16.439  1.00 16.68 ? 138 VAL D CA  1 
ATOM   4995 C C   . VAL D 1 133 ? 60.854 50.755 17.428  1.00 16.95 ? 138 VAL D C   1 
ATOM   4996 O O   . VAL D 1 133 ? 60.809 50.976 18.667  1.00 16.78 ? 138 VAL D O   1 
ATOM   4997 C CB  . VAL D 1 133 ? 62.606 51.919 16.188  1.00 19.02 ? 138 VAL D CB  1 
ATOM   4998 C CG1 . VAL D 1 133 ? 62.949 52.881 15.106  1.00 21.64 ? 138 VAL D CG1 1 
ATOM   4999 C CG2 . VAL D 1 133 ? 63.397 52.078 17.467  1.00 21.39 ? 138 VAL D CG2 1 
ATOM   5000 N N   . ASP D 1 134 ? 60.845 49.565 16.868  1.00 15.35 ? 139 ASP D N   1 
ATOM   5001 C CA  . ASP D 1 134 ? 60.980 48.351 17.609  1.00 16.26 ? 139 ASP D CA  1 
ATOM   5002 C C   . ASP D 1 134 ? 62.217 47.677 17.051  1.00 16.25 ? 139 ASP D C   1 
ATOM   5003 O O   . ASP D 1 134 ? 62.297 47.465 15.889  1.00 17.56 ? 139 ASP D O   1 
ATOM   5004 C CB  . ASP D 1 134 ? 59.808 47.413 17.633  1.00 18.75 ? 139 ASP D CB  1 
ATOM   5005 C CG  . ASP D 1 134 ? 59.815 46.459 18.930  1.00 21.80 ? 139 ASP D CG  1 
ATOM   5006 O OD1 . ASP D 1 134 ? 59.935 46.941 20.098  1.00 20.49 ? 139 ASP D OD1 1 
ATOM   5007 O OD2 . ASP D 1 134 ? 59.587 45.248 18.773  1.00 28.46 ? 139 ASP D OD2 1 
ATOM   5008 N N   . ALA D 1 135 ? 63.170 47.346 17.947  1.00 14.33 ? 140 ALA D N   1 
ATOM   5009 C CA  . ALA D 1 135 ? 64.435 46.741 17.522  1.00 15.12 ? 140 ALA D CA  1 
ATOM   5010 C C   . ALA D 1 135 ? 64.856 45.610 18.381  1.00 15.17 ? 140 ALA D C   1 
ATOM   5011 O O   . ALA D 1 135 ? 64.400 45.439 19.510  1.00 15.04 ? 140 ALA D O   1 
ATOM   5012 C CB  . ALA D 1 135 ? 65.516 47.778 17.459  1.00 16.45 ? 140 ALA D CB  1 
ATOM   5013 N N   . VAL D 1 136 ? 65.716 44.753 17.813  1.00 14.47 ? 141 VAL D N   1 
ATOM   5014 C CA  . VAL D 1 136 ? 66.157 43.579 18.564  1.00 15.56 ? 141 VAL D CA  1 
ATOM   5015 C C   . VAL D 1 136 ? 67.652 43.418 18.402  1.00 16.23 ? 141 VAL D C   1 
ATOM   5016 O O   . VAL D 1 136 ? 68.225 43.750 17.353  1.00 16.90 ? 141 VAL D O   1 
ATOM   5017 C CB  . VAL D 1 136 ? 65.490 42.287 18.063  1.00 17.89 ? 141 VAL D CB  1 
ATOM   5018 C CG1 . VAL D 1 136 ? 64.030 42.336 18.290  1.00 20.47 ? 141 VAL D CG1 1 
ATOM   5019 C CG2 . VAL D 1 136 ? 65.722 41.932 16.598  1.00 20.82 ? 141 VAL D CG2 1 
ATOM   5020 N N   . GLY D 1 137 ? 68.303 42.870 19.413  1.00 17.96 ? 142 GLY D N   1 
ATOM   5021 C CA  . GLY D 1 137 ? 69.713 42.472 19.255  1.00 17.33 ? 142 GLY D CA  1 
ATOM   5022 C C   . GLY D 1 137 ? 69.978 41.364 20.200  1.00 17.08 ? 142 GLY D C   1 
ATOM   5023 O O   . GLY D 1 137 ? 69.139 41.044 21.034  1.00 15.58 ? 142 GLY D O   1 
ATOM   5024 N N   . GLU D 1 138 ? 71.168 40.756 20.109  1.00 17.13 ? 143 GLU D N   1 
ATOM   5025 C CA  . GLU D 1 138 ? 71.558 39.726 21.016  1.00 18.73 ? 143 GLU D CA  1 
ATOM   5026 C C   . GLU D 1 138 ? 73.031 39.798 21.237  1.00 17.59 ? 143 GLU D C   1 
ATOM   5027 O O   . GLU D 1 138 ? 73.798 40.078 20.314  1.00 17.39 ? 143 GLU D O   1 
ATOM   5028 C CB  . GLU D 1 138 ? 71.270 38.358 20.412  1.00 24.04 ? 143 GLU D CB  1 
ATOM   5029 C CG  . GLU D 1 138 ? 69.841 38.144 20.036  1.00 32.00 ? 143 GLU D CG  1 
ATOM   5030 C CD  . GLU D 1 138 ? 69.489 36.672 19.741  1.00 37.35 ? 143 GLU D CD  1 
ATOM   5031 O OE1 . GLU D 1 138 ? 70.401 35.783 19.679  1.00 43.85 ? 143 GLU D OE1 1 
ATOM   5032 O OE2 . GLU D 1 138 ? 68.263 36.470 19.529  1.00 44.15 ? 143 GLU D OE2 1 
ATOM   5033 N N   . PHE D 1 139 ? 73.431 39.409 22.423  1.00 16.23 ? 144 PHE D N   1 
ATOM   5034 C CA  . PHE D 1 139 ? 74.873 39.238 22.703  1.00 16.54 ? 144 PHE D CA  1 
ATOM   5035 C C   . PHE D 1 139 ? 75.076 38.160 23.702  1.00 18.45 ? 144 PHE D C   1 
ATOM   5036 O O   . PHE D 1 139 ? 74.183 37.796 24.507  1.00 18.12 ? 144 PHE D O   1 
ATOM   5037 C CB  . PHE D 1 139 ? 75.437 40.599 23.184  1.00 18.11 ? 144 PHE D CB  1 
ATOM   5038 C CG  . PHE D 1 139 ? 74.819 41.164 24.424  1.00 19.80 ? 144 PHE D CG  1 
ATOM   5039 C CD1 . PHE D 1 139 ? 73.671 41.971 24.391  1.00 22.63 ? 144 PHE D CD1 1 
ATOM   5040 C CD2 . PHE D 1 139 ? 75.426 41.014 25.646  1.00 19.28 ? 144 PHE D CD2 1 
ATOM   5041 C CE1 . PHE D 1 139 ? 73.175 42.423 25.584  1.00 22.34 ? 144 PHE D CE1 1 
ATOM   5042 C CE2 . PHE D 1 139 ? 74.897 41.481 26.817  1.00 21.78 ? 144 PHE D CE2 1 
ATOM   5043 C CZ  . PHE D 1 139 ? 73.822 42.210 26.788  1.00 22.66 ? 144 PHE D CZ  1 
ATOM   5044 N N   . SER D 1 140 ? 76.298 37.714 23.831  1.00 18.72 ? 145 SER D N   1 
ATOM   5045 C CA  . SER D 1 140 ? 76.641 36.745 24.861  1.00 19.23 ? 145 SER D CA  1 
ATOM   5046 C C   . SER D 1 140 ? 77.201 37.588 26.045  1.00 17.73 ? 145 SER D C   1 
ATOM   5047 O O   . SER D 1 140 ? 78.168 38.286 25.939  1.00 19.81 ? 145 SER D O   1 
ATOM   5048 C CB  . SER D 1 140 ? 77.694 35.786 24.308  1.00 21.86 ? 145 SER D CB  1 
ATOM   5049 O OG  . SER D 1 140 ? 77.870 34.714 25.205  1.00 26.23 ? 145 SER D OG  1 
ATOM   5050 N N   . ARG D 1 141 ? 76.547 37.582 27.196  1.00 15.80 ? 146 ARG D N   1 
ATOM   5051 C CA  . ARG D 1 141 ? 76.937 38.493 28.250  1.00 15.62 ? 146 ARG D CA  1 
ATOM   5052 C C   . ARG D 1 141 ? 78.343 38.292 28.897  1.00 19.45 ? 146 ARG D C   1 
ATOM   5053 O O   . ARG D 1 141 ? 78.873 39.188 29.525  1.00 18.58 ? 146 ARG D O   1 
ATOM   5054 C CB  . ARG D 1 141 ? 75.832 38.591 29.341  1.00 16.61 ? 146 ARG D CB  1 
ATOM   5055 C CG  . ARG D 1 141 ? 75.563 37.306 30.048  1.00 16.15 ? 146 ARG D CG  1 
ATOM   5056 C CD  . ARG D 1 141 ? 74.638 37.534 31.261  1.00 17.56 ? 146 ARG D CD  1 
ATOM   5057 N NE  . ARG D 1 141 ? 74.047 36.360 31.821  1.00 17.21 ? 146 ARG D NE  1 
ATOM   5058 C CZ  . ARG D 1 141 ? 74.559 35.651 32.821  1.00 19.16 ? 146 ARG D CZ  1 
ATOM   5059 N NH1 . ARG D 1 141 ? 75.741 35.963 33.353  1.00 20.90 ? 146 ARG D NH1 1 
ATOM   5060 N NH2 . ARG D 1 141 ? 73.848 34.663 33.361  1.00 19.74 ? 146 ARG D NH2 1 
ATOM   5061 N N   . ASP D 1 142 ? 78.876 37.081 28.790  1.00 19.25 ? 147 ASP D N   1 
ATOM   5062 C CA  . ASP D 1 142 ? 80.269 36.874 29.215  1.00 21.44 ? 147 ASP D CA  1 
ATOM   5063 C C   . ASP D 1 142 ? 81.232 37.645 28.360  1.00 20.98 ? 147 ASP D C   1 
ATOM   5064 O O   . ASP D 1 142 ? 82.327 37.963 28.882  1.00 22.25 ? 147 ASP D O   1 
ATOM   5065 C CB  . ASP D 1 142 ? 80.595 35.421 29.276  1.00 22.49 ? 147 ASP D CB  1 
ATOM   5066 C CG  . ASP D 1 142 ? 80.342 34.674 28.011  1.00 24.49 ? 147 ASP D CG  1 
ATOM   5067 O OD1 . ASP D 1 142 ? 79.634 35.117 27.038  1.00 23.90 ? 147 ASP D OD1 1 
ATOM   5068 O OD2 . ASP D 1 142 ? 80.840 33.484 28.038  1.00 28.15 ? 147 ASP D OD2 1 
ATOM   5069 N N   . ASP D 1 143 ? 80.833 38.044 27.161  1.00 20.22 ? 148 ASP D N   1 
ATOM   5070 C CA  . ASP D 1 143 ? 81.685 38.922 26.348  1.00 23.14 ? 148 ASP D CA  1 
ATOM   5071 C C   . ASP D 1 143 ? 81.958 40.217 27.016  1.00 19.86 ? 148 ASP D C   1 
ATOM   5072 O O   . ASP D 1 143 ? 82.907 40.937 26.646  1.00 23.20 ? 148 ASP D O   1 
ATOM   5073 C CB  . ASP D 1 143 ? 81.159 39.214 24.990  1.00 23.83 ? 148 ASP D CB  1 
ATOM   5074 C CG  . ASP D 1 143 ? 81.324 38.091 24.083  1.00 34.90 ? 148 ASP D CG  1 
ATOM   5075 O OD1 . ASP D 1 143 ? 81.988 37.076 24.481  1.00 40.24 ? 148 ASP D OD1 1 
ATOM   5076 O OD2 . ASP D 1 143 ? 80.796 38.193 22.957  1.00 44.61 ? 148 ASP D OD2 1 
ATOM   5077 N N   . PHE D 1 144 ? 81.053 40.632 27.866  1.00 20.37 ? 149 PHE D N   1 
ATOM   5078 C CA  . PHE D 1 144 ? 81.217 41.836 28.676  1.00 19.24 ? 149 PHE D CA  1 
ATOM   5079 C C   . PHE D 1 144 ? 81.674 41.652 30.067  1.00 22.54 ? 149 PHE D C   1 
ATOM   5080 O O   . PHE D 1 144 ? 81.608 42.535 30.932  1.00 22.15 ? 149 PHE D O   1 
ATOM   5081 C CB  . PHE D 1 144 ? 79.881 42.696 28.627  1.00 18.37 ? 149 PHE D CB  1 
ATOM   5082 C CG  . PHE D 1 144 ? 79.504 43.072 27.288  1.00 17.08 ? 149 PHE D CG  1 
ATOM   5083 C CD1 . PHE D 1 144 ? 78.791 42.229 26.458  1.00 17.98 ? 149 PHE D CD1 1 
ATOM   5084 C CD2 . PHE D 1 144 ? 79.919 44.295 26.759  1.00 16.99 ? 149 PHE D CD2 1 
ATOM   5085 C CE1 . PHE D 1 144 ? 78.450 42.606 25.176  1.00 18.32 ? 149 PHE D CE1 1 
ATOM   5086 C CE2 . PHE D 1 144 ? 79.554 44.690 25.504  1.00 17.13 ? 149 PHE D CE2 1 
ATOM   5087 C CZ  . PHE D 1 144 ? 78.883 43.807 24.679  1.00 18.56 ? 149 PHE D CZ  1 
ATOM   5088 N N   . GLY D 1 145 ? 82.123 40.435 30.338  1.00 22.69 ? 150 GLY D N   1 
ATOM   5089 C CA  . GLY D 1 145 ? 82.577 40.085 31.690  1.00 24.64 ? 150 GLY D CA  1 
ATOM   5090 C C   . GLY D 1 145 ? 81.447 39.823 32.724  1.00 25.24 ? 150 GLY D C   1 
ATOM   5091 O O   . GLY D 1 145 ? 81.614 39.821 33.943  1.00 26.34 ? 150 GLY D O   1 
ATOM   5092 N N   . LEU D 1 146 ? 80.230 39.642 32.223  1.00 21.79 ? 151 LEU D N   1 
ATOM   5093 C CA  . LEU D 1 146 ? 79.080 39.303 33.054  1.00 22.09 ? 151 LEU D CA  1 
ATOM   5094 C C   . LEU D 1 146 ? 78.847 37.783 32.952  1.00 25.33 ? 151 LEU D C   1 
ATOM   5095 O O   . LEU D 1 146 ? 77.985 37.325 32.168  1.00 23.01 ? 151 LEU D O   1 
ATOM   5096 C CB  . LEU D 1 146 ? 77.865 40.075 32.505  1.00 20.84 ? 151 LEU D CB  1 
ATOM   5097 C CG  . LEU D 1 146 ? 78.044 41.587 32.586  1.00 20.98 ? 151 LEU D CG  1 
ATOM   5098 C CD1 . LEU D 1 146 ? 76.880 42.245 31.816  1.00 23.13 ? 151 LEU D CD1 1 
ATOM   5099 C CD2 . LEU D 1 146 ? 78.081 42.056 33.980  1.00 21.81 ? 151 LEU D CD2 1 
ATOM   5100 N N   . ASP D 1 147 ? 79.637 36.988 33.672  1.00 24.87 ? 152 ASP D N   1 
ATOM   5101 C CA  . ASP D 1 147 ? 79.632 35.509 33.458  1.00 25.86 ? 152 ASP D CA  1 
ATOM   5102 C C   . ASP D 1 147 ? 79.002 34.730 34.623  1.00 25.11 ? 152 ASP D C   1 
ATOM   5103 O O   . ASP D 1 147 ? 79.105 33.485 34.687  1.00 25.15 ? 152 ASP D O   1 
ATOM   5104 C CB  . ASP D 1 147 ? 81.038 35.001 33.091  1.00 28.77 ? 152 ASP D CB  1 
ATOM   5105 C CG  . ASP D 1 147 ? 82.042 35.236 34.190  1.00 30.87 ? 152 ASP D CG  1 
ATOM   5106 O OD1 . ASP D 1 147 ? 81.649 35.841 35.209  1.00 31.42 ? 152 ASP D OD1 1 
ATOM   5107 O OD2 . ASP D 1 147 ? 83.161 34.699 34.068  1.00 30.71 ? 152 ASP D OD2 1 
ATOM   5108 N N   . TYR D 1 148 ? 78.340 35.428 35.527  1.00 24.23 ? 153 TYR D N   1 
ATOM   5109 C CA  . TYR D 1 148 ? 77.708 34.790 36.611  1.00 28.45 ? 153 TYR D CA  1 
ATOM   5110 C C   . TYR D 1 148 ? 76.799 33.634 36.169  1.00 26.68 ? 153 TYR D C   1 
ATOM   5111 O O   . TYR D 1 148 ? 76.011 33.719 35.226  1.00 23.41 ? 153 TYR D O   1 
ATOM   5112 C CB  . TYR D 1 148 ? 76.901 35.786 37.455  1.00 30.53 ? 153 TYR D CB  1 
ATOM   5113 C CG  . TYR D 1 148 ? 76.455 35.109 38.740  1.00 41.18 ? 153 TYR D CG  1 
ATOM   5114 C CD1 . TYR D 1 148 ? 75.351 34.279 38.764  1.00 47.79 ? 153 TYR D CD1 1 
ATOM   5115 C CD2 . TYR D 1 148 ? 77.223 35.227 39.889  1.00 50.79 ? 153 TYR D CD2 1 
ATOM   5116 C CE1 . TYR D 1 148 ? 74.982 33.615 39.921  1.00 55.28 ? 153 TYR D CE1 1 
ATOM   5117 C CE2 . TYR D 1 148 ? 76.865 34.582 41.057  1.00 55.52 ? 153 TYR D CE2 1 
ATOM   5118 C CZ  . TYR D 1 148 ? 75.755 33.773 41.065  1.00 58.23 ? 153 TYR D CZ  1 
ATOM   5119 O OH  . TYR D 1 148 ? 75.417 33.136 42.233  1.00 70.17 ? 153 TYR D OH  1 
ATOM   5120 N N   . GLY D 1 149 ? 76.908 32.521 36.862  1.00 25.10 ? 154 GLY D N   1 
ATOM   5121 C CA  . GLY D 1 149 ? 76.031 31.385 36.594  1.00 24.20 ? 154 GLY D CA  1 
ATOM   5122 C C   . GLY D 1 149 ? 76.558 30.341 35.656  1.00 24.60 ? 154 GLY D C   1 
ATOM   5123 O O   . GLY D 1 149 ? 75.960 29.294 35.567  1.00 23.96 ? 154 GLY D O   1 
ATOM   5124 N N   . LYS D 1 150 ? 77.675 30.545 34.966  1.00 27.03 ? 155 LYS D N   1 
ATOM   5125 C CA  . LYS D 1 150 ? 78.222 29.399 34.178  1.00 31.47 ? 155 LYS D CA  1 
ATOM   5126 C C   . LYS D 1 150 ? 78.401 28.097 34.869  1.00 35.70 ? 155 LYS D C   1 
ATOM   5127 O O   . LYS D 1 150 ? 78.153 27.042 34.285  1.00 39.26 ? 155 LYS D O   1 
ATOM   5128 C CB  . LYS D 1 150 ? 79.537 29.717 33.582  1.00 33.31 ? 155 LYS D CB  1 
ATOM   5129 C CG  . LYS D 1 150 ? 79.399 30.708 32.480  1.00 33.29 ? 155 LYS D CG  1 
ATOM   5130 C CD  . LYS D 1 150 ? 80.751 30.930 31.880  1.00 31.70 ? 155 LYS D CD  1 
ATOM   5131 C CE  . LYS D 1 150 ? 80.645 31.557 30.531  1.00 30.51 ? 155 LYS D CE  1 
ATOM   5132 N NZ  . LYS D 1 150 ? 81.974 31.842 29.936  1.00 29.78 ? 155 LYS D NZ  1 
ATOM   5133 N N   . GLN D 1 151 ? 78.858 28.142 36.118  1.00 39.47 ? 156 GLN D N   1 
ATOM   5134 C CA  . GLN D 1 151 ? 78.995 26.956 36.939  1.00 41.65 ? 156 GLN D CA  1 
ATOM   5135 C C   . GLN D 1 151 ? 77.700 26.122 37.072  1.00 43.08 ? 156 GLN D C   1 
ATOM   5136 O O   . GLN D 1 151 ? 77.785 24.914 37.201  1.00 46.31 ? 156 GLN D O   1 
ATOM   5137 C CB  . GLN D 1 151 ? 79.644 27.329 38.328  1.00 43.76 ? 156 GLN D CB  1 
ATOM   5138 C CG  . GLN D 1 151 ? 79.139 28.609 39.060  1.00 46.81 ? 156 GLN D CG  1 
ATOM   5139 C CD  . GLN D 1 151 ? 79.547 29.961 38.410  1.00 49.02 ? 156 GLN D CD  1 
ATOM   5140 O OE1 . GLN D 1 151 ? 80.389 29.984 37.514  1.00 59.97 ? 156 GLN D OE1 1 
ATOM   5141 N NE2 . GLN D 1 151 ? 78.926 31.079 38.837  1.00 44.07 ? 156 GLN D NE2 1 
ATOM   5142 N N   . TYR D 1 152 ? 76.508 26.755 37.036  1.00 35.78 ? 157 TYR D N   1 
ATOM   5143 C CA  . TYR D 1 152 ? 75.223 26.080 37.143  1.00 37.69 ? 157 TYR D CA  1 
ATOM   5144 C C   . TYR D 1 152 ? 74.561 25.879 35.798  1.00 33.67 ? 157 TYR D C   1 
ATOM   5145 O O   . TYR D 1 152 ? 73.361 25.587 35.753  1.00 36.22 ? 157 TYR D O   1 
ATOM   5146 C CB  . TYR D 1 152 ? 74.290 26.907 38.047  1.00 37.82 ? 157 TYR D CB  1 
ATOM   5147 C CG  . TYR D 1 152 ? 74.964 27.255 39.347  1.00 47.21 ? 157 TYR D CG  1 
ATOM   5148 C CD1 . TYR D 1 152 ? 75.092 26.307 40.363  1.00 54.05 ? 157 TYR D CD1 1 
ATOM   5149 C CD2 . TYR D 1 152 ? 75.575 28.496 39.522  1.00 54.19 ? 157 TYR D CD2 1 
ATOM   5150 C CE1 . TYR D 1 152 ? 75.771 26.609 41.542  1.00 58.68 ? 157 TYR D CE1 1 
ATOM   5151 C CE2 . TYR D 1 152 ? 76.248 28.807 40.696  1.00 60.97 ? 157 TYR D CE2 1 
ATOM   5152 C CZ  . TYR D 1 152 ? 76.341 27.864 41.701  1.00 60.77 ? 157 TYR D CZ  1 
ATOM   5153 O OH  . TYR D 1 152 ? 77.016 28.188 42.867  1.00 71.88 ? 157 TYR D OH  1 
ATOM   5154 N N   . GLY D 1 153 ? 75.329 26.080 34.735  1.00 33.14 ? 158 GLY D N   1 
ATOM   5155 C CA  . GLY D 1 153 ? 74.861 25.904 33.378  1.00 30.62 ? 158 GLY D CA  1 
ATOM   5156 C C   . GLY D 1 153 ? 73.932 26.989 32.869  1.00 28.72 ? 158 GLY D C   1 
ATOM   5157 O O   . GLY D 1 153 ? 73.149 26.718 31.961  1.00 25.96 ? 158 GLY D O   1 
ATOM   5158 N N   . PHE D 1 154 ? 74.028 28.203 33.422  1.00 24.24 ? 159 PHE D N   1 
ATOM   5159 C CA  . PHE D 1 154 ? 73.242 29.314 32.894  1.00 21.91 ? 159 PHE D CA  1 
ATOM   5160 C C   . PHE D 1 154 ? 73.812 29.607 31.541  1.00 20.34 ? 159 PHE D C   1 
ATOM   5161 O O   . PHE D 1 154 ? 75.058 29.616 31.311  1.00 21.79 ? 159 PHE D O   1 
ATOM   5162 C CB  . PHE D 1 154 ? 73.347 30.584 33.752  1.00 20.86 ? 159 PHE D CB  1 
ATOM   5163 C CG  . PHE D 1 154 ? 72.499 30.641 34.968  1.00 21.44 ? 159 PHE D CG  1 
ATOM   5164 C CD1 . PHE D 1 154 ? 72.401 29.573 35.836  1.00 23.83 ? 159 PHE D CD1 1 
ATOM   5165 C CD2 . PHE D 1 154 ? 71.841 31.792 35.274  1.00 23.20 ? 159 PHE D CD2 1 
ATOM   5166 C CE1 . PHE D 1 154 ? 71.675 29.679 37.028  1.00 24.77 ? 159 PHE D CE1 1 
ATOM   5167 C CE2 . PHE D 1 154 ? 71.110 31.904 36.436  1.00 25.97 ? 159 PHE D CE2 1 
ATOM   5168 C CZ  . PHE D 1 154 ? 71.057 30.857 37.301  1.00 24.90 ? 159 PHE D CZ  1 
ATOM   5169 N N   . LYS D 1 155 ? 72.941 29.912 30.570  1.00 17.92 ? 160 LYS D N   1 
ATOM   5170 C CA  . LYS D 1 155 ? 73.393 30.286 29.262  1.00 18.61 ? 160 LYS D CA  1 
ATOM   5171 C C   . LYS D 1 155 ? 73.645 31.764 29.200  1.00 17.51 ? 160 LYS D C   1 
ATOM   5172 O O   . LYS D 1 155 ? 72.966 32.560 29.849  1.00 19.06 ? 160 LYS D O   1 
ATOM   5173 C CB  . LYS D 1 155 ? 72.342 29.947 28.233  1.00 20.37 ? 160 LYS D CB  1 
ATOM   5174 C CG  . LYS D 1 155 ? 71.945 28.458 28.209  1.00 25.62 ? 160 LYS D CG  1 
ATOM   5175 C CD  . LYS D 1 155 ? 70.580 28.314 27.470  1.00 30.64 ? 160 LYS D CD  1 
ATOM   5176 C CE  . LYS D 1 155 ? 70.449 28.905 26.065  1.00 34.64 ? 160 LYS D CE  1 
ATOM   5177 N NZ  . LYS D 1 155 ? 69.746 30.262 25.910  1.00 30.42 ? 160 LYS D NZ  1 
ATOM   5178 N N   . MET D 1 156 ? 74.600 32.183 28.427  1.00 16.85 ? 161 MET D N   1 
ATOM   5179 C CA  . MET D 1 156 ? 75.041 33.584 28.291  1.00 15.86 ? 161 MET D CA  1 
ATOM   5180 C C   . MET D 1 156 ? 74.265 34.451 27.262  1.00 15.50 ? 161 MET D C   1 
ATOM   5181 O O   . MET D 1 156 ? 74.338 35.678 27.264  1.00 14.35 ? 161 MET D O   1 
ATOM   5182 C CB  . MET D 1 156 ? 76.544 33.657 27.992  1.00 17.03 ? 161 MET D CB  1 
ATOM   5183 C CG  . MET D 1 156 ? 77.381 33.025 29.122  1.00 18.83 ? 161 MET D CG  1 
ATOM   5184 S SD  . MET D 1 156 ? 77.335 33.796 30.749  1.00 21.31 ? 161 MET D SD  1 
ATOM   5185 C CE  . MET D 1 156 ? 76.361 32.605 31.667  1.00 20.70 ? 161 MET D CE  1 
ATOM   5186 N N   . LYS D 1 157 ? 73.571 33.785 26.359  1.00 16.70 ? 162 LYS D N   1 
ATOM   5187 C CA  . LYS D 1 157 ? 72.847 34.503 25.326  1.00 18.24 ? 162 LYS D CA  1 
ATOM   5188 C C   . LYS D 1 157 ? 71.826 35.408 25.958  1.00 16.20 ? 162 LYS D C   1 
ATOM   5189 O O   . LYS D 1 157 ? 70.964 34.945 26.730  1.00 17.27 ? 162 LYS D O   1 
ATOM   5190 C CB  . LYS D 1 157 ? 72.083 33.523 24.456  1.00 22.35 ? 162 LYS D CB  1 
ATOM   5191 C CG  . LYS D 1 157 ? 71.308 34.262 23.346  1.00 26.52 ? 162 LYS D CG  1 
ATOM   5192 C CD  . LYS D 1 157 ? 70.948 33.287 22.246  1.00 34.53 ? 162 LYS D CD  1 
ATOM   5193 C CE  . LYS D 1 157 ? 69.713 32.490 22.645  1.00 39.79 ? 162 LYS D CE  1 
ATOM   5194 N NZ  . LYS D 1 157 ? 68.603 33.023 21.806  1.00 43.22 ? 162 LYS D NZ  1 
ATOM   5195 N N   . THR D 1 158 ? 71.909 36.677 25.625  1.00 15.38 ? 163 THR D N   1 
ATOM   5196 C CA  . THR D 1 158 ? 71.015 37.692 26.167  1.00 14.67 ? 163 THR D CA  1 
ATOM   5197 C C   . THR D 1 158 ? 70.388 38.432 25.009  1.00 15.43 ? 163 THR D C   1 
ATOM   5198 O O   . THR D 1 158 ? 71.092 38.940 24.105  1.00 16.06 ? 163 THR D O   1 
ATOM   5199 C CB  . THR D 1 158 ? 71.791 38.686 26.992  1.00 14.69 ? 163 THR D CB  1 
ATOM   5200 O OG1 . THR D 1 158 ? 72.584 37.986 27.973  1.00 15.95 ? 163 THR D OG1 1 
ATOM   5201 C CG2 . THR D 1 158 ? 70.920 39.740 27.740  1.00 15.49 ? 163 THR D CG2 1 
ATOM   5202 N N   . LYS D 1 159 ? 69.042 38.532 25.040  1.00 13.64 ? 164 LYS D N   1 
ATOM   5203 C CA  . LYS D 1 159 ? 68.335 39.225 23.982  1.00 14.36 ? 164 LYS D CA  1 
ATOM   5204 C C   . LYS D 1 159 ? 67.966 40.596 24.416  1.00 13.25 ? 164 LYS D C   1 
ATOM   5205 O O   . LYS D 1 159 ? 67.619 40.812 25.588  1.00 12.91 ? 164 LYS D O   1 
ATOM   5206 C CB  . LYS D 1 159 ? 67.161 38.401 23.630  1.00 17.18 ? 164 LYS D CB  1 
ATOM   5207 C CG  . LYS D 1 159 ? 67.523 36.979 23.153  1.00 24.28 ? 164 LYS D CG  1 
ATOM   5208 C CD  . LYS D 1 159 ? 66.319 36.130 22.774  1.00 31.88 ? 164 LYS D CD  1 
ATOM   5209 C CE  . LYS D 1 159 ? 65.306 36.808 21.867  1.00 35.30 ? 164 LYS D CE  1 
ATOM   5210 N NZ  . LYS D 1 159 ? 64.174 35.811 21.763  1.00 39.16 ? 164 LYS D NZ  1 
ATOM   5211 N N   . LEU D 1 160 ? 68.085 41.548 23.547  1.00 13.37 ? 165 LEU D N   1 
ATOM   5212 C CA  . LEU D 1 160 ? 67.605 42.894 23.742  1.00 14.70 ? 165 LEU D CA  1 
ATOM   5213 C C   . LEU D 1 160 ? 66.395 43.143 22.860  1.00 15.38 ? 165 LEU D C   1 
ATOM   5214 O O   . LEU D 1 160 ? 66.346 42.779 21.705  1.00 16.90 ? 165 LEU D O   1 
ATOM   5215 C CB  . LEU D 1 160 ? 68.677 43.929 23.365  1.00 17.57 ? 165 LEU D CB  1 
ATOM   5216 C CG  . LEU D 1 160 ? 69.963 43.894 24.213  1.00 18.83 ? 165 LEU D CG  1 
ATOM   5217 C CD1 . LEU D 1 160 ? 70.909 44.873 23.629  1.00 22.51 ? 165 LEU D CD1 1 
ATOM   5218 C CD2 . LEU D 1 160 ? 69.694 44.194 25.665  1.00 24.86 ? 165 LEU D CD2 1 
ATOM   5219 N N   . LEU D 1 161 ? 65.371 43.767 23.482  1.00 14.68 ? 166 LEU D N   1 
ATOM   5220 C CA  . LEU D 1 161 ? 64.141 44.130 22.798  1.00 14.51 ? 166 LEU D CA  1 
ATOM   5221 C C   . LEU D 1 161 ? 64.044 45.596 23.115  1.00 14.53 ? 166 LEU D C   1 
ATOM   5222 O O   . LEU D 1 161 ? 63.731 45.927 24.276  1.00 15.02 ? 166 LEU D O   1 
ATOM   5223 C CB  . LEU D 1 161 ? 62.894 43.334 23.276  1.00 16.65 ? 166 LEU D CB  1 
ATOM   5224 C CG  . LEU D 1 161 ? 63.011 41.857 23.008  1.00 18.21 ? 166 LEU D CG  1 
ATOM   5225 C CD1 . LEU D 1 161 ? 63.741 41.150 24.121  1.00 20.83 ? 166 LEU D CD1 1 
ATOM   5226 C CD2 . LEU D 1 161 ? 61.640 41.202 22.898  1.00 23.22 ? 166 LEU D CD2 1 
ATOM   5227 N N   . ILE D 1 162 ? 64.128 46.438 22.095  1.00 13.76 ? 167 ILE D N   1 
ATOM   5228 C CA  . ILE D 1 162 ? 64.277 47.844 22.299  1.00 15.50 ? 167 ILE D CA  1 
ATOM   5229 C C   . ILE D 1 162 ? 63.033 48.594 21.843  1.00 15.63 ? 167 ILE D C   1 
ATOM   5230 O O   . ILE D 1 162 ? 62.596 48.397 20.721  1.00 16.66 ? 167 ILE D O   1 
ATOM   5231 C CB  . ILE D 1 162 ? 65.434 48.405 21.465  1.00 17.78 ? 167 ILE D CB  1 
ATOM   5232 C CG1 . ILE D 1 162 ? 66.778 47.681 21.803  1.00 20.59 ? 167 ILE D CG1 1 
ATOM   5233 C CG2 . ILE D 1 162 ? 65.429 49.908 21.469  1.00 19.01 ? 167 ILE D CG2 1 
ATOM   5234 C CD1 . ILE D 1 162 ? 67.067 47.573 23.166  1.00 21.91 ? 167 ILE D CD1 1 
ATOM   5235 N N   . THR D 1 163 ? 62.528 49.465 22.688  1.00 15.39 ? 168 THR D N   1 
ATOM   5236 C CA  . THR D 1 163 ? 61.391 50.383 22.345  1.00 16.89 ? 168 THR D CA  1 
ATOM   5237 C C   . THR D 1 163 ? 62.060 51.738 22.338  1.00 15.37 ? 168 THR D C   1 
ATOM   5238 O O   . THR D 1 163 ? 62.766 52.077 23.291  1.00 14.90 ? 168 THR D O   1 
ATOM   5239 C CB  . THR D 1 163 ? 60.383 50.407 23.508  1.00 18.93 ? 168 THR D CB  1 
ATOM   5240 O OG1 . THR D 1 163 ? 59.855 49.079 23.762  1.00 22.44 ? 168 THR D OG1 1 
ATOM   5241 C CG2 . THR D 1 163 ? 59.270 51.408 23.373  1.00 20.68 ? 168 THR D CG2 1 
ATOM   5242 N N   . ALA D 1 164 ? 61.817 52.560 21.328  1.00 16.69 ? 169 ALA D N   1 
ATOM   5243 C CA  . ALA D 1 164 ? 62.353 53.893 21.345  1.00 16.79 ? 169 ALA D CA  1 
ATOM   5244 C C   . ALA D 1 164 ? 61.435 54.813 20.540  1.00 16.10 ? 169 ALA D C   1 
ATOM   5245 O O   . ALA D 1 164 ? 60.933 54.403 19.491  1.00 17.65 ? 169 ALA D O   1 
ATOM   5246 C CB  . ALA D 1 164 ? 63.731 53.871 20.719  1.00 17.54 ? 169 ALA D CB  1 
ATOM   5247 N N   . GLU D 1 165 ? 61.282 56.017 21.059  1.00 16.30 ? 170 GLU D N   1 
ATOM   5248 C CA  . GLU D 1 165 ? 60.521 57.064 20.396  1.00 17.59 ? 170 GLU D CA  1 
ATOM   5249 C C   . GLU D 1 165 ? 61.373 58.325 20.527  1.00 17.26 ? 170 GLU D C   1 
ATOM   5250 O O   . GLU D 1 165 ? 61.880 58.594 21.613  1.00 18.06 ? 170 GLU D O   1 
ATOM   5251 C CB  . GLU D 1 165 ? 59.144 57.299 21.015  1.00 19.46 ? 170 GLU D CB  1 
ATOM   5252 C CG  . GLU D 1 165 ? 58.189 56.161 20.689  1.00 21.16 ? 170 GLU D CG  1 
ATOM   5253 C CD  . GLU D 1 165 ? 56.730 56.373 21.085  1.00 24.29 ? 170 GLU D CD  1 
ATOM   5254 O OE1 . GLU D 1 165 ? 56.340 57.518 21.498  1.00 26.11 ? 170 GLU D OE1 1 
ATOM   5255 O OE2 . GLU D 1 165 ? 55.996 55.348 20.976  1.00 24.57 ? 170 GLU D OE2 1 
ATOM   5256 N N   . ALA D 1 166 ? 61.495 59.077 19.424  1.00 18.23 ? 171 ALA D N   1 
ATOM   5257 C CA  . ALA D 1 166 ? 62.293 60.295 19.433  1.00 19.10 ? 171 ALA D CA  1 
ATOM   5258 C C   . ALA D 1 166 ? 61.522 61.401 18.690  1.00 20.06 ? 171 ALA D C   1 
ATOM   5259 O O   . ALA D 1 166 ? 60.947 61.155 17.636  1.00 22.56 ? 171 ALA D O   1 
ATOM   5260 C CB  . ALA D 1 166 ? 63.612 60.043 18.799  1.00 20.22 ? 171 ALA D CB  1 
ATOM   5261 N N   . VAL D 1 167 ? 61.575 62.583 19.290  1.00 22.98 ? 172 VAL D N   1 
ATOM   5262 C CA  . VAL D 1 167 ? 60.784 63.734 18.848  1.00 22.81 ? 172 VAL D CA  1 
ATOM   5263 C C   . VAL D 1 167 ? 61.729 64.692 18.084  1.00 24.48 ? 172 VAL D C   1 
ATOM   5264 O O   . VAL D 1 167 ? 62.764 65.092 18.615  1.00 22.32 ? 172 VAL D O   1 
ATOM   5265 C CB  . VAL D 1 167 ? 60.198 64.459 20.060  1.00 24.66 ? 172 VAL D CB  1 
ATOM   5266 C CG1 . VAL D 1 167 ? 59.385 65.726 19.680  1.00 26.10 ? 172 VAL D CG1 1 
ATOM   5267 C CG2 . VAL D 1 167 ? 59.404 63.539 20.978  1.00 25.33 ? 172 VAL D CG2 1 
ATOM   5268 N N   . LYS D 1 168 ? 61.372 65.017 16.841  1.00 26.36 ? 173 LYS D N   1 
ATOM   5269 C CA  . LYS D 1 168 ? 62.163 65.924 16.030  1.00 30.89 ? 173 LYS D CA  1 
ATOM   5270 C C   . LYS D 1 168 ? 62.366 67.260 16.722  1.00 33.25 ? 173 LYS D C   1 
ATOM   5271 O O   . LYS D 1 168 ? 61.459 67.839 17.354  1.00 32.48 ? 173 LYS D O   1 
ATOM   5272 C CB  . LYS D 1 168 ? 61.584 66.138 14.633  1.00 32.70 ? 173 LYS D CB  1 
ATOM   5273 C CG  . LYS D 1 168 ? 62.560 66.834 13.666  1.00 35.40 ? 173 LYS D CG  1 
ATOM   5274 C CD  . LYS D 1 168 ? 61.883 67.224 12.390  1.00 41.88 ? 173 LYS D CD  1 
ATOM   5275 C CE  . LYS D 1 168 ? 61.508 66.038 11.527  1.00 42.74 ? 173 LYS D CE  1 
ATOM   5276 N NZ  . LYS D 1 168 ? 60.827 66.469 10.273  1.00 54.66 ? 173 LYS D NZ  1 
ATOM   5277 N N   . GLN D 1 169 ? 63.605 67.746 16.626  1.00 34.51 ? 174 GLN D N   1 
ATOM   5278 C CA  . GLN D 1 169 ? 63.959 68.995 17.317  1.00 46.97 ? 174 GLN D CA  1 
ATOM   5279 C C   . GLN D 1 169 ? 63.955 70.113 16.300  1.00 47.24 ? 174 GLN D C   1 
ATOM   5280 O O   . GLN D 1 169 ? 62.962 70.827 16.212  1.00 45.62 ? 174 GLN D O   1 
ATOM   5281 C CB  . GLN D 1 169 ? 65.293 68.894 18.083  1.00 50.66 ? 174 GLN D CB  1 
ATOM   5282 C CG  . GLN D 1 169 ? 66.527 69.133 17.242  1.00 57.74 ? 174 GLN D CG  1 
ATOM   5283 C CD  . GLN D 1 169 ? 67.802 69.096 18.074  1.00 59.19 ? 174 GLN D CD  1 
ATOM   5284 O OE1 . GLN D 1 169 ? 67.876 68.423 19.110  1.00 60.64 ? 174 GLN D OE1 1 
ATOM   5285 N NE2 . GLN D 1 169 ? 68.807 69.836 17.628  1.00 65.21 ? 174 GLN D NE2 1 
HETATM 5286 O O7  . OTP E 2 .   ? 62.886 9.645  8.651   1.00 47.95 ? 201 OTP B O7  1 
HETATM 5287 P P2  . OTP E 2 .   ? 61.479 9.243  8.468   1.00 64.59 ? 201 OTP B P2  1 
HETATM 5288 O O5  . OTP E 2 .   ? 61.279 7.737  8.598   1.00 68.04 ? 201 OTP B O5  1 
HETATM 5289 O O6  . OTP E 2 .   ? 60.508 10.045 9.295   1.00 67.46 ? 201 OTP B O6  1 
HETATM 5290 O O4  . OTP E 2 .   ? 61.145 9.510  6.897   1.00 68.46 ? 201 OTP B O4  1 
HETATM 5291 P P1  . OTP E 2 .   ? 60.058 10.424 6.086   1.00 77.84 ? 201 OTP B P1  1 
HETATM 5292 O O2  . OTP E 2 .   ? 60.958 10.984 4.983   1.00 61.18 ? 201 OTP B O2  1 
HETATM 5293 O O3  . OTP E 2 .   ? 58.836 9.582  5.701   1.00 68.75 ? 201 OTP B O3  1 
HETATM 5294 O O1  . OTP E 2 .   ? 59.491 11.630 7.032   1.00 66.91 ? 201 OTP B O1  1 
HETATM 5295 C C40 . OTP E 2 .   ? 58.469 11.514 8.053   1.00 55.55 ? 201 OTP B C40 1 
HETATM 5296 C C39 . OTP E 2 .   ? 57.415 12.609 8.011   1.00 50.23 ? 201 OTP B C39 1 
HETATM 5297 C C37 . OTP E 2 .   ? 56.151 12.393 7.545   1.00 50.36 ? 201 OTP B C37 1 
HETATM 5298 C C38 . OTP E 2 .   ? 55.746 11.054 6.962   1.00 44.41 ? 201 OTP B C38 1 
HETATM 5299 C C36 . OTP E 2 .   ? 55.083 13.484 7.502   1.00 44.83 ? 201 OTP B C36 1 
HETATM 5300 C C35 . OTP E 2 .   ? 55.557 14.813 8.054   1.00 40.20 ? 201 OTP B C35 1 
HETATM 5301 C C34 . OTP E 2 .   ? 54.578 15.945 7.848   1.00 30.43 ? 201 OTP B C34 1 
HETATM 5302 C C32 . OTP E 2 .   ? 54.795 16.908 6.895   1.00 25.94 ? 201 OTP B C32 1 
HETATM 5303 C C33 . OTP E 2 .   ? 55.956 16.961 5.972   1.00 23.25 ? 201 OTP B C33 1 
HETATM 5304 C C31 . OTP E 2 .   ? 53.812 18.034 6.830   1.00 21.07 ? 201 OTP B C31 1 
HETATM 5305 C C30 . OTP E 2 .   ? 52.883 17.935 5.646   1.00 19.64 ? 201 OTP B C30 1 
HETATM 5306 C C29 . OTP E 2 .   ? 52.093 19.205 5.641   1.00 18.33 ? 201 OTP B C29 1 
HETATM 5307 C C27 . OTP E 2 .   ? 50.892 19.480 6.281   1.00 15.15 ? 201 OTP B C27 1 
HETATM 5308 C C28 . OTP E 2 .   ? 50.118 18.644 7.170   1.00 17.30 ? 201 OTP B C28 1 
HETATM 5309 C C26 . OTP E 2 .   ? 50.230 20.798 6.050   1.00 14.61 ? 201 OTP B C26 1 
HETATM 5310 C C25 . OTP E 2 .   ? 48.927 20.730 5.297   1.00 13.54 ? 201 OTP B C25 1 
HETATM 5311 C C24 . OTP E 2 .   ? 48.465 22.124 5.016   1.00 15.00 ? 201 OTP B C24 1 
HETATM 5312 C C22 . OTP E 2 .   ? 47.826 22.620 3.917   1.00 16.18 ? 201 OTP B C22 1 
HETATM 5313 C C23 . OTP E 2 .   ? 47.406 21.773 2.749   1.00 17.34 ? 201 OTP B C23 1 
HETATM 5314 C C21 . OTP E 2 .   ? 47.625 24.123 3.749   1.00 21.33 ? 201 OTP B C21 1 
HETATM 5315 C C20 . OTP E 2 .   ? 46.258 24.399 4.227   1.00 22.13 ? 201 OTP B C20 1 
HETATM 5316 C C19 . OTP E 2 .   ? 46.079 25.931 4.096   1.00 25.17 ? 201 OTP B C19 1 
HETATM 5317 C C17 . OTP E 2 .   ? 45.343 26.588 3.210   1.00 19.84 ? 201 OTP B C17 1 
HETATM 5318 C C18 . OTP E 2 .   ? 44.459 25.943 2.200   1.00 22.27 ? 201 OTP B C18 1 
HETATM 5319 C C16 . OTP E 2 .   ? 45.219 28.069 3.396   1.00 20.44 ? 201 OTP B C16 1 
HETATM 5320 C C15 . OTP E 2 .   ? 46.292 28.880 2.790   1.00 20.49 ? 201 OTP B C15 1 
HETATM 5321 C C14 . OTP E 2 .   ? 45.935 30.297 2.753   1.00 17.31 ? 201 OTP B C14 1 
HETATM 5322 C C12 . OTP E 2 .   ? 46.338 31.157 1.834   1.00 17.73 ? 201 OTP B C12 1 
HETATM 5323 C C13 . OTP E 2 .   ? 47.235 30.758 0.722   1.00 17.24 ? 201 OTP B C13 1 
HETATM 5324 C C11 . OTP E 2 .   ? 45.960 32.595 1.916   1.00 16.41 ? 201 OTP B C11 1 
HETATM 5325 C C10 . OTP E 2 .   ? 45.224 33.068 3.160   1.00 16.27 ? 201 OTP B C10 1 
HETATM 5326 C C9  . OTP E 2 .   ? 44.957 34.548 3.102   1.00 17.63 ? 201 OTP B C9  1 
HETATM 5327 C C7  . OTP E 2 .   ? 45.170 35.513 4.016   1.00 17.97 ? 201 OTP B C7  1 
HETATM 5328 C C8  . OTP E 2 .   ? 45.774 35.272 5.376   1.00 18.17 ? 201 OTP B C8  1 
HETATM 5329 C C6  . OTP E 2 .   ? 44.730 36.936 3.844   1.00 17.90 ? 201 OTP B C6  1 
HETATM 5330 C C5  . OTP E 2 .   ? 44.563 37.289 2.409   1.00 20.01 ? 201 OTP B C5  1 
HETATM 5331 C C4  . OTP E 2 .   ? 44.340 38.766 2.246   1.00 21.03 ? 201 OTP B C4  1 
HETATM 5332 C C2  . OTP E 2 .   ? 45.008 39.543 1.337   1.00 19.51 ? 201 OTP B C2  1 
HETATM 5333 C C3  . OTP E 2 .   ? 44.526 40.967 1.514   1.00 22.44 ? 201 OTP B C3  1 
HETATM 5334 C C1  . OTP E 2 .   ? 46.197 39.262 0.391   1.00 19.49 ? 201 OTP B C1  1 
HETATM 5335 C C1  . PEG F 3 .   ? 43.605 8.769  4.559   1.00 26.58 ? 202 PEG B C1  1 
HETATM 5336 O O1  . PEG F 3 .   ? 42.178 8.825  4.323   1.00 30.32 ? 202 PEG B O1  1 
HETATM 5337 C C2  . PEG F 3 .   ? 44.121 8.864  5.973   1.00 32.89 ? 202 PEG B C2  1 
HETATM 5338 O O2  . PEG F 3 .   ? 45.506 9.223  6.169   1.00 31.92 ? 202 PEG B O2  1 
HETATM 5339 C C3  . PEG F 3 .   ? 45.829 10.111 7.247   1.00 26.70 ? 202 PEG B C3  1 
HETATM 5340 C C4  . PEG F 3 .   ? 46.669 9.550  8.404   1.00 34.94 ? 202 PEG B C4  1 
HETATM 5341 O O4  . PEG F 3 .   ? 47.984 10.106 8.655   1.00 27.97 ? 202 PEG B O4  1 
HETATM 5342 O O7  . OTP G 2 .   ? 49.492 57.978 30.583  1.00 83.84 ? 201 OTP C O7  1 
HETATM 5343 P P2  . OTP G 2 .   ? 49.088 57.544 29.177  1.00 90.56 ? 201 OTP C P2  1 
HETATM 5344 O O5  . OTP G 2 .   ? 48.100 56.375 29.148  1.00 80.18 ? 201 OTP C O5  1 
HETATM 5345 O O6  . OTP G 2 .   ? 48.564 58.729 28.391  1.00 99.58 ? 201 OTP C O6  1 
HETATM 5346 O O4  . OTP G 2 .   ? 50.506 57.108 28.419  1.00 79.01 ? 201 OTP C O4  1 
HETATM 5347 P P1  . OTP G 2 .   ? 50.830 56.705 26.847  1.00 75.94 ? 201 OTP C P1  1 
HETATM 5348 O O2  . OTP G 2 .   ? 50.711 57.941 25.909  1.00 67.58 ? 201 OTP C O2  1 
HETATM 5349 O O3  . OTP G 2 .   ? 52.120 55.951 26.715  1.00 48.40 ? 201 OTP C O3  1 
HETATM 5350 O O1  . OTP G 2 .   ? 49.757 55.508 26.506  1.00 67.37 ? 201 OTP C O1  1 
HETATM 5351 C C40 . OTP G 2 .   ? 49.718 54.377 27.378  1.00 66.97 ? 201 OTP C C40 1 
HETATM 5352 C C39 . OTP G 2 .   ? 49.481 53.048 26.718  1.00 63.72 ? 201 OTP C C39 1 
HETATM 5353 C C37 . OTP G 2 .   ? 48.342 52.366 26.906  1.00 65.56 ? 201 OTP C C37 1 
HETATM 5354 C C38 . OTP G 2 .   ? 47.208 52.908 27.747  1.00 65.50 ? 201 OTP C C38 1 
HETATM 5355 C C36 . OTP G 2 .   ? 48.193 51.013 26.235  1.00 60.25 ? 201 OTP C C36 1 
HETATM 5356 C C35 . OTP G 2 .   ? 47.813 49.901 27.242  1.00 54.24 ? 201 OTP C C35 1 
HETATM 5357 C C34 . OTP G 2 .   ? 49.043 49.817 28.061  1.00 46.51 ? 201 OTP C C34 1 
HETATM 5358 C C32 . OTP G 2 .   ? 49.663 48.793 28.626  1.00 35.84 ? 201 OTP C C32 1 
HETATM 5359 C C33 . OTP G 2 .   ? 50.936 49.288 29.274  1.00 35.54 ? 201 OTP C C33 1 
HETATM 5360 C C31 . OTP G 2 .   ? 49.308 47.330 28.654  1.00 29.85 ? 201 OTP C C31 1 
HETATM 5361 C C30 . OTP G 2 .   ? 48.736 46.963 30.030  1.00 27.96 ? 201 OTP C C30 1 
HETATM 5362 C C29 . OTP G 2 .   ? 48.792 45.488 30.245  1.00 23.70 ? 201 OTP C C29 1 
HETATM 5363 C C27 . OTP G 2 .   ? 47.807 44.596 30.046  1.00 23.40 ? 201 OTP C C27 1 
HETATM 5364 C C28 . OTP G 2 .   ? 46.420 44.980 29.585  1.00 24.12 ? 201 OTP C C28 1 
HETATM 5365 C C26 . OTP G 2 .   ? 47.969 43.143 30.382  1.00 20.65 ? 201 OTP C C26 1 
HETATM 5366 C C25 . OTP G 2 .   ? 47.049 42.658 31.496  1.00 21.42 ? 201 OTP C C25 1 
HETATM 5367 C C24 . OTP G 2 .   ? 47.510 41.270 31.736  1.00 24.14 ? 201 OTP C C24 1 
HETATM 5368 C C22 . OTP G 2 .   ? 47.538 40.621 32.902  1.00 24.90 ? 201 OTP C C22 1 
HETATM 5369 C C23 . OTP G 2 .   ? 47.000 41.213 34.199  1.00 23.48 ? 201 OTP C C23 1 
HETATM 5370 C C21 . OTP G 2 .   ? 48.248 39.298 32.916  1.00 29.15 ? 201 OTP C C21 1 
HETATM 5371 C C20 . OTP G 2 .   ? 47.468 38.328 33.629  1.00 31.91 ? 201 OTP C C20 1 
HETATM 5372 C C19 . OTP G 2 .   ? 47.986 36.965 33.241  1.00 30.17 ? 201 OTP C C19 1 
HETATM 5373 C C17 . OTP G 2 .   ? 47.818 35.950 34.055  1.00 26.66 ? 201 OTP C C17 1 
HETATM 5374 C C18 . OTP G 2 .   ? 47.111 36.131 35.394  1.00 27.81 ? 201 OTP C C18 1 
HETATM 5375 C C16 . OTP G 2 .   ? 48.324 34.631 33.527  1.00 26.51 ? 201 OTP C C16 1 
HETATM 5376 C C15 . OTP G 2 .   ? 49.742 34.448 33.932  1.00 26.50 ? 201 OTP C C15 1 
HETATM 5377 C C14 . OTP G 2 .   ? 50.128 33.012 33.946  1.00 22.92 ? 201 OTP C C14 1 
HETATM 5378 C C12 . OTP G 2 .   ? 51.198 32.604 34.698  1.00 22.82 ? 201 OTP C C12 1 
HETATM 5379 C C13 . OTP G 2 .   ? 52.063 33.550 35.448  1.00 23.81 ? 201 OTP C C13 1 
HETATM 5380 C C11 . OTP G 2 .   ? 51.618 31.200 34.681  1.00 20.53 ? 201 OTP C C11 1 
HETATM 5381 C C10 . OTP G 2 .   ? 50.914 30.304 33.707  1.00 21.39 ? 201 OTP C C10 1 
HETATM 5382 C C9  . OTP G 2 .   ? 51.413 28.893 33.754  1.00 24.02 ? 201 OTP C C9  1 
HETATM 5383 C C7  . OTP G 2 .   ? 51.792 28.155 32.683  1.00 24.30 ? 201 OTP C C7  1 
HETATM 5384 C C8  . OTP G 2 .   ? 51.867 28.677 31.251  1.00 24.40 ? 201 OTP C C8  1 
HETATM 5385 C C6  . OTP G 2 .   ? 52.176 26.704 32.839  1.00 27.91 ? 201 OTP C C6  1 
HETATM 5386 C C5  . OTP G 2 .   ? 52.803 26.454 34.207  1.00 26.88 ? 201 OTP C C5  1 
HETATM 5387 C C4  . OTP G 2 .   ? 53.413 25.110 34.275  1.00 30.39 ? 201 OTP C C4  1 
HETATM 5388 C C2  . OTP G 2 .   ? 54.592 24.801 34.872  1.00 30.50 ? 201 OTP C C2  1 
HETATM 5389 C C3  . OTP G 2 .   ? 54.916 23.358 34.729  1.00 37.43 ? 201 OTP C C3  1 
HETATM 5390 C C1  . OTP G 2 .   ? 55.562 25.738 35.601  1.00 29.35 ? 201 OTP C C1  1 
HETATM 5391 O O7  . OTP H 2 .   ? 56.729 39.724 -9.511  1.00 37.60 ? 201 OTP A O7  1 
HETATM 5392 P P2  . OTP H 2 .   ? 57.675 39.295 -10.642 1.00 36.04 ? 201 OTP A P2  1 
HETATM 5393 O O5  . OTP H 2 .   ? 56.946 38.186 -11.470 1.00 41.57 ? 201 OTP A O5  1 
HETATM 5394 O O6  . OTP H 2 .   ? 58.060 40.364 -11.670 1.00 36.82 ? 201 OTP A O6  1 
HETATM 5395 O O4  . OTP H 2 .   ? 58.953 38.386 -10.248 1.00 32.00 ? 201 OTP A O4  1 
HETATM 5396 P P1  . OTP H 2 .   ? 59.170 37.215 -9.186  1.00 25.85 ? 201 OTP A P1  1 
HETATM 5397 O O2  . OTP H 2 .   ? 58.504 37.557 -7.890  1.00 21.54 ? 201 OTP A O2  1 
HETATM 5398 O O3  . OTP H 2 .   ? 58.834 35.894 -9.973  1.00 28.06 ? 201 OTP A O3  1 
HETATM 5399 O O1  . OTP H 2 .   ? 60.793 37.463 -9.181  1.00 28.94 ? 201 OTP A O1  1 
HETATM 5400 C C40 . OTP H 2 .   ? 61.330 38.420 -8.255  1.00 27.84 ? 201 OTP A C40 1 
HETATM 5401 C C39 . OTP H 2 .   ? 62.277 37.861 -7.187  1.00 27.78 ? 201 OTP A C39 1 
HETATM 5402 C C37 . OTP H 2 .   ? 63.615 37.884 -7.338  1.00 31.84 ? 201 OTP A C37 1 
HETATM 5403 C C38 . OTP H 2 .   ? 64.285 38.389 -8.586  1.00 34.34 ? 201 OTP A C38 1 
HETATM 5404 C C36 . OTP H 2 .   ? 64.612 37.402 -6.327  1.00 34.16 ? 201 OTP A C36 1 
HETATM 5405 C C35 . OTP H 2 .   ? 63.886 37.015 -5.081  1.00 30.25 ? 201 OTP A C35 1 
HETATM 5406 C C34 . OTP H 2 .   ? 64.901 36.357 -4.173  1.00 25.57 ? 201 OTP A C34 1 
HETATM 5407 C C32 . OTP H 2 .   ? 64.883 35.040 -3.937  1.00 20.89 ? 201 OTP A C32 1 
HETATM 5408 C C33 . OTP H 2 .   ? 63.866 34.000 -4.346  1.00 23.08 ? 201 OTP A C33 1 
HETATM 5409 C C31 . OTP H 2 .   ? 65.866 34.540 -2.966  1.00 19.90 ? 201 OTP A C31 1 
HETATM 5410 C C30 . OTP H 2 .   ? 66.765 33.513 -3.515  1.00 17.94 ? 201 OTP A C30 1 
HETATM 5411 C C29 . OTP H 2 .   ? 67.609 32.864 -2.470  1.00 17.07 ? 201 OTP A C29 1 
HETATM 5412 C C27 . OTP H 2 .   ? 68.786 33.239 -1.878  1.00 14.37 ? 201 OTP A C27 1 
HETATM 5413 C C28 . OTP H 2 .   ? 69.443 34.518 -2.209  1.00 15.10 ? 201 OTP A C28 1 
HETATM 5414 C C26 . OTP H 2 .   ? 69.449 32.430 -0.839  1.00 14.10 ? 201 OTP A C26 1 
HETATM 5415 C C25 . OTP H 2 .   ? 70.797 31.857 -1.266  1.00 13.54 ? 201 OTP A C25 1 
HETATM 5416 C C24 . OTP H 2 .   ? 71.269 30.983 -0.157  1.00 15.62 ? 201 OTP A C24 1 
HETATM 5417 C C22 . OTP H 2 .   ? 71.866 29.799 -0.273  1.00 19.56 ? 201 OTP A C22 1 
HETATM 5418 C C23 . OTP H 2 .   ? 72.314 29.257 -1.610  1.00 16.93 ? 201 OTP A C23 1 
HETATM 5419 C C21 . OTP H 2 .   ? 72.099 28.906 0.909   1.00 20.56 ? 201 OTP A C21 1 
HETATM 5420 C C20 . OTP H 2 .   ? 73.433 29.075 1.401   1.00 24.37 ? 201 OTP A C20 1 
HETATM 5421 C C19 . OTP H 2 .   ? 73.632 28.287 2.681   1.00 21.73 ? 201 OTP A C19 1 
HETATM 5422 C C17 . OTP H 2 .   ? 74.491 27.241 2.836   1.00 20.44 ? 201 OTP A C17 1 
HETATM 5423 C C18 . OTP H 2 .   ? 75.399 26.776 1.737   1.00 18.53 ? 201 OTP A C18 1 
HETATM 5424 C C16 . OTP H 2 .   ? 74.551 26.844 4.285   1.00 21.18 ? 201 OTP A C16 1 
HETATM 5425 C C15 . OTP H 2 .   ? 73.544 25.789 4.640   1.00 20.64 ? 201 OTP A C15 1 
HETATM 5426 C C14 . OTP H 2 .   ? 73.876 25.128 5.891   1.00 19.06 ? 201 OTP A C14 1 
HETATM 5427 C C12 . OTP H 2 .   ? 73.388 23.931 6.229   1.00 19.09 ? 201 OTP A C12 1 
HETATM 5428 C C13 . OTP H 2 .   ? 72.514 23.158 5.292   1.00 18.96 ? 201 OTP A C13 1 
HETATM 5429 C C11 . OTP H 2 .   ? 73.763 23.295 7.471   1.00 18.30 ? 201 OTP A C11 1 
HETATM 5430 C C10 . OTP H 2 .   ? 74.420 24.145 8.533   1.00 16.73 ? 201 OTP A C10 1 
HETATM 5431 C C9  . OTP H 2 .   ? 74.714 23.365 9.760   1.00 16.59 ? 201 OTP A C9  1 
HETATM 5432 C C7  . OTP H 2 .   ? 74.584 23.761 11.039  1.00 16.33 ? 201 OTP A C7  1 
HETATM 5433 C C8  . OTP H 2 .   ? 74.032 25.110 11.403  1.00 18.83 ? 201 OTP A C8  1 
HETATM 5434 C C6  . OTP H 2 .   ? 74.941 22.978 12.253  1.00 19.25 ? 201 OTP A C6  1 
HETATM 5435 C C5  . OTP H 2 .   ? 75.005 21.485 11.908  1.00 19.92 ? 201 OTP A C5  1 
HETATM 5436 C C4  . OTP H 2 .   ? 75.383 20.737 13.100  1.00 23.31 ? 201 OTP A C4  1 
HETATM 5437 C C2  . OTP H 2 .   ? 74.785 19.553 13.395  1.00 21.33 ? 201 OTP A C2  1 
HETATM 5438 C C3  . OTP H 2 .   ? 75.342 18.948 14.623  1.00 26.19 ? 201 OTP A C3  1 
HETATM 5439 C C1  . OTP H 2 .   ? 73.652 18.869 12.644  1.00 21.55 ? 201 OTP A C1  1 
HETATM 5440 O O7  . OTP I 2 .   ? 67.913 36.276 43.512  1.00 68.72 ? 201 OTP D O7  1 
HETATM 5441 P P2  . OTP I 2 .   ? 67.326 35.066 42.759  1.00 87.17 ? 201 OTP D P2  1 
HETATM 5442 O O5  . OTP I 2 .   ? 67.158 33.741 43.532  1.00 63.94 ? 201 OTP D O5  1 
HETATM 5443 O O6  . OTP I 2 .   ? 66.078 35.433 41.965  1.00 82.51 ? 201 OTP D O6  1 
HETATM 5444 O O4  . OTP I 2 .   ? 68.541 34.792 41.694  1.00 74.45 ? 201 OTP D O4  1 
HETATM 5445 P P1  . OTP I 2 .   ? 68.649 34.083 40.217  1.00 69.25 ? 201 OTP D P1  1 
HETATM 5446 O O2  . OTP I 2 .   ? 69.563 32.863 40.357  1.00 65.84 ? 201 OTP D O2  1 
HETATM 5447 O O3  . OTP I 2 .   ? 67.412 33.922 39.358  1.00 39.22 ? 201 OTP D O3  1 
HETATM 5448 O O1  . OTP I 2 .   ? 69.371 35.339 39.534  1.00 66.67 ? 201 OTP D O1  1 
HETATM 5449 C C40 . OTP I 2 .   ? 70.764 35.390 39.321  1.00 67.28 ? 201 OTP D C40 1 
HETATM 5450 C C39 . OTP I 2 .   ? 70.790 35.600 37.849  1.00 60.63 ? 201 OTP D C39 1 
HETATM 5451 C C37 . OTP I 2 .   ? 71.817 36.190 37.274  1.00 53.92 ? 201 OTP D C37 1 
HETATM 5452 C C38 . OTP I 2 .   ? 72.993 36.701 38.052  1.00 58.82 ? 201 OTP D C38 1 
HETATM 5453 C C36 . OTP I 2 .   ? 71.705 36.369 35.805  1.00 52.60 ? 201 OTP D C36 1 
HETATM 5454 C C35 . OTP I 2 .   ? 70.467 37.235 35.627  1.00 46.10 ? 201 OTP D C35 1 
HETATM 5455 C C34 . OTP I 2 .   ? 70.638 38.008 34.379  1.00 41.91 ? 201 OTP D C34 1 
HETATM 5456 C C32 . OTP I 2 .   ? 69.806 39.007 34.067  1.00 35.84 ? 201 OTP D C32 1 
HETATM 5457 C C33 . OTP I 2 .   ? 68.638 39.441 34.882  1.00 36.18 ? 201 OTP D C33 1 
HETATM 5458 C C31 . OTP I 2 .   ? 70.029 39.708 32.793  1.00 33.40 ? 201 OTP D C31 1 
HETATM 5459 C C30 . OTP I 2 .   ? 70.619 41.040 33.142  1.00 28.98 ? 201 OTP D C30 1 
HETATM 5460 C C29 . OTP I 2 .   ? 70.477 41.929 31.952  1.00 27.69 ? 201 OTP D C29 1 
HETATM 5461 C C27 . OTP I 2 .   ? 71.402 42.141 30.981  1.00 28.11 ? 201 OTP D C27 1 
HETATM 5462 C C28 . OTP I 2 .   ? 72.776 41.511 30.995  1.00 29.68 ? 201 OTP D C28 1 
HETATM 5463 C C26 . OTP I 2 .   ? 71.188 43.118 29.839  1.00 26.27 ? 201 OTP D C26 1 
HETATM 5464 C C25 . OTP I 2 .   ? 72.183 44.284 29.947  1.00 25.09 ? 201 OTP D C25 1 
HETATM 5465 C C24 . OTP I 2 .   ? 71.702 45.245 28.962  1.00 24.02 ? 201 OTP D C24 1 
HETATM 5466 C C22 . OTP I 2 .   ? 71.804 46.537 28.946  1.00 24.71 ? 201 OTP D C22 1 
HETATM 5467 C C23 . OTP I 2 .   ? 72.375 47.314 30.056  1.00 23.67 ? 201 OTP D C23 1 
HETATM 5468 C C21 . OTP I 2 .   ? 71.072 47.289 27.843  1.00 23.99 ? 201 OTP D C21 1 
HETATM 5469 C C20 . OTP I 2 .   ? 72.045 48.015 27.008  1.00 25.95 ? 201 OTP D C20 1 
HETATM 5470 C C19 . OTP I 2 .   ? 71.422 48.536 25.718  1.00 27.67 ? 201 OTP D C19 1 
HETATM 5471 C C17 . OTP I 2 .   ? 71.572 49.843 25.363  1.00 25.97 ? 201 OTP D C17 1 
HETATM 5472 C C18 . OTP I 2 .   ? 72.263 50.841 26.257  1.00 27.24 ? 201 OTP D C18 1 
HETATM 5473 C C16 . OTP I 2 .   ? 71.029 50.225 24.020  1.00 28.14 ? 201 OTP D C16 1 
HETATM 5474 C C15 . OTP I 2 .   ? 69.607 50.655 24.178  1.00 28.57 ? 201 OTP D C15 1 
HETATM 5475 C C14 . OTP I 2 .   ? 69.190 51.314 22.911  1.00 26.93 ? 201 OTP D C14 1 
HETATM 5476 C C12 . OTP I 2 .   ? 68.107 52.132 22.826  1.00 26.12 ? 201 OTP D C12 1 
HETATM 5477 C C13 . OTP I 2 .   ? 67.244 52.377 24.044  1.00 27.33 ? 201 OTP D C13 1 
HETATM 5478 C C11 . OTP I 2 .   ? 67.784 52.813 21.513  1.00 26.01 ? 201 OTP D C11 1 
HETATM 5479 C C10 . OTP I 2 .   ? 68.312 52.210 20.204  1.00 26.54 ? 201 OTP D C10 1 
HETATM 5480 C C9  . OTP I 2 .   ? 67.841 52.998 19.041  1.00 24.99 ? 201 OTP D C9  1 
HETATM 5481 C C7  . OTP I 2 .   ? 67.459 52.502 17.846  1.00 25.52 ? 201 OTP D C7  1 
HETATM 5482 C C8  . OTP I 2 .   ? 67.446 51.008 17.562  1.00 26.66 ? 201 OTP D C8  1 
HETATM 5483 C C6  . OTP I 2 .   ? 67.047 53.359 16.684  1.00 31.32 ? 201 OTP D C6  1 
HETATM 5484 C C5  . OTP I 2 .   ? 66.352 54.612 17.214  1.00 31.51 ? 201 OTP D C5  1 
HETATM 5485 C C4  . OTP I 2 .   ? 65.877 55.400 16.048  1.00 35.09 ? 201 OTP D C4  1 
HETATM 5486 C C2  . OTP I 2 .   ? 64.734 56.107 15.994  1.00 32.07 ? 201 OTP D C2  1 
HETATM 5487 C C3  . OTP I 2 .   ? 64.598 56.856 14.704  1.00 36.67 ? 201 OTP D C3  1 
HETATM 5488 C C1  . OTP I 2 .   ? 63.595 56.168 17.000  1.00 27.52 ? 201 OTP D C1  1 
HETATM 5489 O O   . HOH J 4 .   ? 61.273 12.214 7.422   1.00 29.35 ? 301 HOH B O   1 
HETATM 5490 O O   . HOH J 4 .   ? 31.739 45.892 3.973   1.00 38.15 ? 302 HOH B O   1 
HETATM 5491 O O   . HOH J 4 .   ? 53.595 29.833 11.754  1.00 23.62 ? 303 HOH B O   1 
HETATM 5492 O O   . HOH J 4 .   ? 51.008 28.508 -9.362  1.00 35.85 ? 304 HOH B O   1 
HETATM 5493 O O   . HOH J 4 .   ? 55.788 37.238 9.157   1.00 37.88 ? 305 HOH B O   1 
HETATM 5494 O O   . HOH J 4 .   ? 59.989 17.849 -3.146  1.00 24.06 ? 306 HOH B O   1 
HETATM 5495 O O   . HOH J 4 .   ? 57.766 16.126 -6.036  1.00 39.66 ? 307 HOH B O   1 
HETATM 5496 O O   . HOH J 4 .   ? 44.143 21.932 15.476  1.00 20.19 ? 308 HOH B O   1 
HETATM 5497 O O   . HOH J 4 .   ? 54.414 18.199 13.258  1.00 19.42 ? 309 HOH B O   1 
HETATM 5498 O O   . HOH J 4 .   ? 35.638 41.831 10.540  1.00 32.97 ? 310 HOH B O   1 
HETATM 5499 O O   . HOH J 4 .   ? 53.066 17.853 11.237  1.00 28.51 ? 311 HOH B O   1 
HETATM 5500 O O   . HOH J 4 .   ? 53.740 50.137 -8.282  1.00 35.04 ? 312 HOH B O   1 
HETATM 5501 O O   . HOH J 4 .   ? 52.068 50.983 -0.721  1.00 35.25 ? 313 HOH B O   1 
HETATM 5502 O O   . HOH J 4 .   ? 62.674 12.022 3.328   1.00 39.70 ? 314 HOH B O   1 
HETATM 5503 O O   . HOH J 4 .   ? 41.917 6.442  -1.533  1.00 33.96 ? 315 HOH B O   1 
HETATM 5504 O O   . HOH J 4 .   ? 46.549 51.135 -8.769  1.00 35.85 ? 316 HOH B O   1 
HETATM 5505 O O   . HOH J 4 .   ? 44.021 15.596 1.063   1.00 14.93 ? 317 HOH B O   1 
HETATM 5506 O O   . HOH J 4 .   ? 44.362 25.842 14.852  1.00 19.48 ? 318 HOH B O   1 
HETATM 5507 O O   . HOH J 4 .   ? 54.198 36.912 2.594   1.00 14.74 ? 319 HOH B O   1 
HETATM 5508 O O   . HOH J 4 .   ? 54.565 4.020  6.405   1.00 36.12 ? 320 HOH B O   1 
HETATM 5509 O O   . HOH J 4 .   ? 48.562 6.506  8.238   1.00 30.30 ? 321 HOH B O   1 
HETATM 5510 O O   . HOH J 4 .   ? 60.493 19.930 15.163  1.00 27.91 ? 322 HOH B O   1 
HETATM 5511 O O   . HOH J 4 .   ? 54.030 16.902 -5.247  1.00 27.27 ? 323 HOH B O   1 
HETATM 5512 O O   . HOH J 4 .   ? 46.465 29.565 14.166  1.00 14.80 ? 324 HOH B O   1 
HETATM 5513 O O   . HOH J 4 .   ? 59.562 28.317 7.868   1.00 19.30 ? 325 HOH B O   1 
HETATM 5514 O O   . HOH J 4 .   ? 45.549 9.102  -2.667  1.00 26.73 ? 326 HOH B O   1 
HETATM 5515 O O   . HOH J 4 .   ? 32.819 41.197 9.845   1.00 34.20 ? 327 HOH B O   1 
HETATM 5516 O O   . HOH J 4 .   ? 40.119 29.446 14.880  1.00 23.33 ? 328 HOH B O   1 
HETATM 5517 O O   . HOH J 4 .   ? 51.418 8.718  -4.474  1.00 29.33 ? 329 HOH B O   1 
HETATM 5518 O O   . HOH J 4 .   ? 55.043 30.983 2.078   1.00 20.08 ? 330 HOH B O   1 
HETATM 5519 O O   . HOH J 4 .   ? 52.462 30.194 14.222  1.00 33.04 ? 331 HOH B O   1 
HETATM 5520 O O   . HOH J 4 .   ? 47.957 13.328 -5.844  1.00 19.11 ? 332 HOH B O   1 
HETATM 5521 O O   . HOH J 4 .   ? 36.834 32.142 -5.222  1.00 29.44 ? 333 HOH B O   1 
HETATM 5522 O O   . HOH J 4 .   ? 40.217 33.118 16.667  1.00 27.14 ? 334 HOH B O   1 
HETATM 5523 O O   . HOH J 4 .   ? 64.916 19.654 19.945  1.00 31.88 ? 335 HOH B O   1 
HETATM 5524 O O   . HOH J 4 .   ? 39.736 29.022 -6.441  1.00 31.73 ? 336 HOH B O   1 
HETATM 5525 O O   . HOH J 4 .   ? 40.724 47.315 17.542  1.00 34.30 ? 337 HOH B O   1 
HETATM 5526 O O   . HOH J 4 .   ? 36.658 12.252 -4.010  1.00 26.80 ? 338 HOH B O   1 
HETATM 5527 O O   . HOH J 4 .   ? 32.774 40.197 -4.436  1.00 17.30 ? 339 HOH B O   1 
HETATM 5528 O O   . HOH J 4 .   ? 38.918 12.017 6.290   1.00 20.38 ? 340 HOH B O   1 
HETATM 5529 O O   . HOH J 4 .   ? 42.920 23.971 13.139  1.00 24.00 ? 341 HOH B O   1 
HETATM 5530 O O   . HOH J 4 .   ? 51.295 39.952 -7.733  1.00 27.04 ? 342 HOH B O   1 
HETATM 5531 O O   . HOH J 4 .   ? 55.466 15.808 12.026  1.00 35.36 ? 343 HOH B O   1 
HETATM 5532 O O   . HOH J 4 .   ? 43.435 13.358 -6.792  1.00 30.46 ? 344 HOH B O   1 
HETATM 5533 O O   . HOH J 4 .   ? 54.037 2.186  2.913   1.00 39.02 ? 345 HOH B O   1 
HETATM 5534 O O   . HOH J 4 .   ? 40.624 33.555 -8.599  1.00 19.87 ? 346 HOH B O   1 
HETATM 5535 O O   . HOH J 4 .   ? 43.346 32.888 -7.912  1.00 11.06 ? 347 HOH B O   1 
HETATM 5536 O O   . HOH J 4 .   ? 55.714 20.730 -6.178  1.00 26.24 ? 348 HOH B O   1 
HETATM 5537 O O   . HOH J 4 .   ? 45.696 17.557 -5.776  1.00 14.24 ? 349 HOH B O   1 
HETATM 5538 O O   . HOH J 4 .   ? 50.287 27.684 -3.665  1.00 11.06 ? 350 HOH B O   1 
HETATM 5539 O O   . HOH J 4 .   ? 34.276 18.642 5.793   1.00 14.53 ? 351 HOH B O   1 
HETATM 5540 O O   . HOH J 4 .   ? 50.081 28.883 -6.644  1.00 15.96 ? 352 HOH B O   1 
HETATM 5541 O O   . HOH J 4 .   ? 43.621 11.729 14.298  1.00 29.57 ? 353 HOH B O   1 
HETATM 5542 O O   . HOH J 4 .   ? 46.545 28.032 -9.122  1.00 22.57 ? 354 HOH B O   1 
HETATM 5543 O O   . HOH J 4 .   ? 58.696 24.384 13.826  1.00 30.94 ? 355 HOH B O   1 
HETATM 5544 O O   . HOH J 4 .   ? 33.709 44.240 -5.502  1.00 32.04 ? 356 HOH B O   1 
HETATM 5545 O O   . HOH J 4 .   ? 42.515 15.129 17.383  1.00 42.50 ? 357 HOH B O   1 
HETATM 5546 O O   . HOH J 4 .   ? 32.507 34.692 10.085  1.00 13.48 ? 358 HOH B O   1 
HETATM 5547 O O   . HOH J 4 .   ? 34.333 29.630 7.600   1.00 20.28 ? 359 HOH B O   1 
HETATM 5548 O O   . HOH J 4 .   ? 57.498 19.467 -6.100  1.00 33.74 ? 360 HOH B O   1 
HETATM 5549 O O   . HOH J 4 .   ? 59.044 9.988  -6.425  1.00 50.01 ? 361 HOH B O   1 
HETATM 5550 O O   . HOH J 4 .   ? 48.029 40.049 13.961  1.00 36.52 ? 362 HOH B O   1 
HETATM 5551 O O   . HOH J 4 .   ? 66.346 16.097 -2.663  1.00 41.12 ? 363 HOH B O   1 
HETATM 5552 O O   . HOH J 4 .   ? 36.663 15.245 13.472  1.00 25.62 ? 364 HOH B O   1 
HETATM 5553 O O   . HOH J 4 .   ? 38.306 48.490 1.070   1.00 29.01 ? 365 HOH B O   1 
HETATM 5554 O O   . HOH J 4 .   ? 42.933 17.993 1.643   1.00 13.44 ? 366 HOH B O   1 
HETATM 5555 O O   . HOH J 4 .   ? 58.483 27.473 1.399   1.00 16.15 ? 367 HOH B O   1 
HETATM 5556 O O   . HOH J 4 .   ? 38.945 28.987 -3.535  1.00 21.51 ? 368 HOH B O   1 
HETATM 5557 O O   . HOH J 4 .   ? 34.549 33.488 11.281  1.00 20.08 ? 369 HOH B O   1 
HETATM 5558 O O   . HOH J 4 .   ? 59.503 23.260 -0.868  1.00 37.77 ? 370 HOH B O   1 
HETATM 5559 O O   . HOH J 4 .   ? 56.089 20.686 15.212  1.00 25.94 ? 371 HOH B O   1 
HETATM 5560 O O   . HOH J 4 .   ? 34.479 28.812 -3.808  1.00 30.30 ? 372 HOH B O   1 
HETATM 5561 O O   . HOH J 4 .   ? 50.382 4.552  7.974   1.00 28.35 ? 373 HOH B O   1 
HETATM 5562 O O   . HOH J 4 .   ? 46.731 5.284  -1.232  1.00 25.10 ? 374 HOH B O   1 
HETATM 5563 O O   . HOH J 4 .   ? 57.234 7.485  -2.464  1.00 32.92 ? 375 HOH B O   1 
HETATM 5564 O O   . HOH J 4 .   ? 50.784 4.321  1.167   1.00 41.33 ? 376 HOH B O   1 
HETATM 5565 O O   . HOH J 4 .   ? 57.015 13.455 -6.174  1.00 34.13 ? 377 HOH B O   1 
HETATM 5566 O O   . HOH J 4 .   ? 37.269 43.796 12.577  1.00 26.50 ? 378 HOH B O   1 
HETATM 5567 O O   . HOH J 4 .   ? 65.692 9.683  8.973   1.00 42.91 ? 379 HOH B O   1 
HETATM 5568 O O   . HOH J 4 .   ? 54.589 33.801 7.754   1.00 27.15 ? 380 HOH B O   1 
HETATM 5569 O O   . HOH J 4 .   ? 33.644 41.627 2.707   1.00 21.18 ? 381 HOH B O   1 
HETATM 5570 O O   . HOH J 4 .   ? 53.794 29.571 -9.374  1.00 30.62 ? 382 HOH B O   1 
HETATM 5571 O O   . HOH J 4 .   ? 40.699 47.758 0.037   1.00 35.15 ? 383 HOH B O   1 
HETATM 5572 O O   . HOH J 4 .   ? 63.278 17.366 8.870   1.00 18.90 ? 384 HOH B O   1 
HETATM 5573 O O   . HOH J 4 .   ? 42.286 40.384 -10.566 1.00 25.29 ? 385 HOH B O   1 
HETATM 5574 O O   . HOH J 4 .   ? 39.701 18.166 2.009   1.00 14.11 ? 386 HOH B O   1 
HETATM 5575 O O   . HOH J 4 .   ? 58.253 26.897 5.939   1.00 14.91 ? 387 HOH B O   1 
HETATM 5576 O O   . HOH J 4 .   ? 56.503 32.097 -1.184  1.00 13.09 ? 388 HOH B O   1 
HETATM 5577 O O   . HOH J 4 .   ? 43.499 28.516 14.885  1.00 16.57 ? 389 HOH B O   1 
HETATM 5578 O O   . HOH J 4 .   ? 34.138 17.922 8.533   1.00 14.59 ? 390 HOH B O   1 
HETATM 5579 O O   . HOH J 4 .   ? 36.401 35.995 -0.500  1.00 13.34 ? 391 HOH B O   1 
HETATM 5580 O O   . HOH J 4 .   ? 47.356 50.813 -4.130  1.00 30.34 ? 392 HOH B O   1 
HETATM 5581 O O   . HOH J 4 .   ? 40.647 24.429 15.933  1.00 32.81 ? 393 HOH B O   1 
HETATM 5582 O O   . HOH J 4 .   ? 58.963 19.139 18.193  1.00 33.81 ? 394 HOH B O   1 
HETATM 5583 O O   . HOH J 4 .   ? 63.941 14.997 -4.316  1.00 31.51 ? 395 HOH B O   1 
HETATM 5584 O O   . HOH J 4 .   ? 63.256 11.717 -3.306  1.00 32.85 ? 396 HOH B O   1 
HETATM 5585 O O   . HOH J 4 .   ? 52.130 45.623 7.643   1.00 28.79 ? 397 HOH B O   1 
HETATM 5586 O O   . HOH J 4 .   ? 49.707 49.714 2.253   1.00 24.12 ? 398 HOH B O   1 
HETATM 5587 O O   . HOH J 4 .   ? 54.602 22.515 -9.214  1.00 35.07 ? 399 HOH B O   1 
HETATM 5588 O O   . HOH J 4 .   ? 43.009 8.756  8.702   1.00 47.69 ? 400 HOH B O   1 
HETATM 5589 O O   . HOH J 4 .   ? 36.440 45.505 -6.654  1.00 23.97 ? 401 HOH B O   1 
HETATM 5590 O O   . HOH J 4 .   ? 39.289 17.810 -1.780  1.00 19.01 ? 402 HOH B O   1 
HETATM 5591 O O   . HOH J 4 .   ? 40.365 21.704 15.821  1.00 30.11 ? 403 HOH B O   1 
HETATM 5592 O O   . HOH J 4 .   ? 32.740 40.817 4.921   1.00 19.79 ? 404 HOH B O   1 
HETATM 5593 O O   . HOH J 4 .   ? 43.934 25.707 -6.394  1.00 30.07 ? 405 HOH B O   1 
HETATM 5594 O O   . HOH J 4 .   ? 53.999 5.165  -0.574  1.00 36.21 ? 406 HOH B O   1 
HETATM 5595 O O   . HOH J 4 .   ? 33.127 27.285 -2.221  1.00 36.77 ? 407 HOH B O   1 
HETATM 5596 O O   . HOH J 4 .   ? 39.266 9.564  5.196   1.00 35.91 ? 408 HOH B O   1 
HETATM 5597 O O   . HOH J 4 .   ? 42.752 49.284 -8.825  1.00 34.26 ? 409 HOH B O   1 
HETATM 5598 O O   . HOH J 4 .   ? 43.413 46.651 -15.782 1.00 34.01 ? 410 HOH B O   1 
HETATM 5599 O O   . HOH J 4 .   ? 57.406 24.794 -9.218  1.00 32.33 ? 411 HOH B O   1 
HETATM 5600 O O   . HOH J 4 .   ? 34.485 35.460 13.356  1.00 31.21 ? 412 HOH B O   1 
HETATM 5601 O O   . HOH J 4 .   ? 54.710 22.985 20.768  1.00 35.66 ? 413 HOH B O   1 
HETATM 5602 O O   . HOH J 4 .   ? 48.111 4.051  1.035   1.00 34.54 ? 414 HOH B O   1 
HETATM 5603 O O   . HOH J 4 .   ? 45.201 25.581 -8.634  1.00 36.03 ? 415 HOH B O   1 
HETATM 5604 O O   . HOH J 4 .   ? 58.305 21.623 13.970  1.00 29.35 ? 416 HOH B O   1 
HETATM 5605 O O   . HOH J 4 .   ? 34.998 44.591 -11.298 1.00 58.31 ? 417 HOH B O   1 
HETATM 5606 O O   . HOH J 4 .   ? 45.449 14.832 -6.308  1.00 23.99 ? 418 HOH B O   1 
HETATM 5607 O O   . HOH J 4 .   ? 45.792 23.137 17.790  1.00 42.83 ? 419 HOH B O   1 
HETATM 5608 O O   . HOH J 4 .   ? 48.647 8.443  -4.239  1.00 37.22 ? 420 HOH B O   1 
HETATM 5609 O O   . HOH J 4 .   ? 39.731 11.696 8.879   1.00 22.00 ? 421 HOH B O   1 
HETATM 5610 O O   . HOH J 4 .   ? 40.967 27.706 16.177  1.00 36.76 ? 422 HOH B O   1 
HETATM 5611 O O   . HOH J 4 .   ? 54.526 6.428  -2.670  1.00 34.98 ? 423 HOH B O   1 
HETATM 5612 O O   . HOH J 4 .   ? 40.069 12.675 13.282  1.00 45.28 ? 424 HOH B O   1 
HETATM 5613 O O   . HOH J 4 .   ? 46.897 10.617 -5.438  1.00 31.83 ? 425 HOH B O   1 
HETATM 5614 O O   . HOH J 4 .   ? 50.145 19.968 -8.992  1.00 35.83 ? 426 HOH B O   1 
HETATM 5615 O O   . HOH J 4 .   ? 39.146 31.259 -8.008  1.00 33.29 ? 427 HOH B O   1 
HETATM 5616 O O   . HOH J 4 .   ? 59.830 25.302 0.519   1.00 16.45 ? 428 HOH B O   1 
HETATM 5617 O O   . HOH J 4 .   ? 50.544 31.457 15.266  1.00 37.66 ? 429 HOH B O   1 
HETATM 5618 O O   . HOH J 4 .   ? 43.912 38.548 -11.392 1.00 32.35 ? 430 HOH B O   1 
HETATM 5619 O O   . HOH J 4 .   ? 52.754 6.239  -4.550  1.00 39.17 ? 431 HOH B O   1 
HETATM 5620 O O   . HOH J 4 .   ? 52.617 21.144 -8.455  1.00 39.31 ? 432 HOH B O   1 
HETATM 5621 O O   . HOH J 4 .   ? 55.804 34.023 -3.272  1.00 15.09 ? 433 HOH B O   1 
HETATM 5622 O O   . HOH J 4 .   ? 33.795 37.735 -4.429  1.00 16.91 ? 434 HOH B O   1 
HETATM 5623 O O   . HOH J 4 .   ? 59.867 27.367 3.855   1.00 17.04 ? 435 HOH B O   1 
HETATM 5624 O O   . HOH J 4 .   ? 37.299 17.945 0.620   1.00 32.00 ? 436 HOH B O   1 
HETATM 5625 O O   . HOH J 4 .   ? 31.738 43.457 10.935  1.00 41.06 ? 437 HOH B O   1 
HETATM 5626 O O   . HOH J 4 .   ? 44.838 33.372 -11.986 1.00 33.17 ? 438 HOH B O   1 
HETATM 5627 O O   . HOH J 4 .   ? 43.703 31.592 -10.362 1.00 21.94 ? 439 HOH B O   1 
HETATM 5628 O O   . HOH J 4 .   ? 49.509 13.314 -7.881  1.00 31.96 ? 440 HOH B O   1 
HETATM 5629 O O   . HOH J 4 .   ? 44.773 29.206 -10.884 1.00 33.32 ? 441 HOH B O   1 
HETATM 5630 O O   . HOH J 4 .   ? 56.595 20.659 17.739  1.00 29.14 ? 442 HOH B O   1 
HETATM 5631 O O   . HOH J 4 .   ? 37.442 17.753 -4.058  1.00 34.75 ? 443 HOH B O   1 
HETATM 5632 O O   . HOH J 4 .   ? 37.307 29.839 15.666  1.00 21.15 ? 444 HOH B O   1 
HETATM 5633 O O   . HOH J 4 .   ? 36.859 21.248 0.023   1.00 28.99 ? 445 HOH B O   1 
HETATM 5634 O O   . HOH J 4 .   ? 38.355 21.837 17.089  1.00 30.86 ? 446 HOH B O   1 
HETATM 5635 O O   . HOH J 4 .   ? 36.992 32.275 17.109  1.00 37.73 ? 447 HOH B O   1 
HETATM 5636 O O   . HOH J 4 .   ? 37.213 27.980 17.638  1.00 27.00 ? 448 HOH B O   1 
HETATM 5637 O O   . HOH K 4 .   ? 50.733 15.085 19.993  1.00 38.88 ? 301 HOH C O   1 
HETATM 5638 O O   . HOH K 4 .   ? 48.591 35.791 45.393  1.00 40.14 ? 302 HOH C O   1 
HETATM 5639 O O   . HOH K 4 .   ? 54.591 25.815 49.378  1.00 24.87 ? 303 HOH C O   1 
HETATM 5640 O O   . HOH K 4 .   ? 56.467 31.964 20.695  1.00 43.64 ? 304 HOH C O   1 
HETATM 5641 O O   . HOH K 4 .   ? 35.128 32.085 29.971  1.00 34.14 ? 305 HOH C O   1 
HETATM 5642 O O   . HOH K 4 .   ? 59.469 18.980 47.011  1.00 42.16 ? 306 HOH C O   1 
HETATM 5643 O O   . HOH K 4 .   ? 58.589 41.258 25.033  1.00 21.45 ? 307 HOH C O   1 
HETATM 5644 O O   . HOH K 4 .   ? 57.393 51.376 36.045  1.00 30.00 ? 308 HOH C O   1 
HETATM 5645 O O   . HOH K 4 .   ? 58.970 46.393 33.806  1.00 28.50 ? 309 HOH C O   1 
HETATM 5646 O O   . HOH K 4 .   ? 42.022 45.397 37.579  1.00 24.68 ? 310 HOH C O   1 
HETATM 5647 O O   . HOH K 4 .   ? 52.658 49.366 40.106  1.00 30.78 ? 311 HOH C O   1 
HETATM 5648 O O   . HOH K 4 .   ? 46.400 44.884 43.191  1.00 19.99 ? 312 HOH C O   1 
HETATM 5649 O O   . HOH K 4 .   ? 40.564 38.552 23.764  1.00 28.68 ? 313 HOH C O   1 
HETATM 5650 O O   . HOH K 4 .   ? 47.988 46.567 22.306  1.00 22.85 ? 314 HOH C O   1 
HETATM 5651 O O   . HOH K 4 .   ? 41.916 20.666 34.419  1.00 48.22 ? 315 HOH C O   1 
HETATM 5652 O O   . HOH K 4 .   ? 42.838 35.231 23.462  1.00 29.09 ? 316 HOH C O   1 
HETATM 5653 O O   . HOH K 4 .   ? 41.158 29.788 24.400  1.00 43.84 ? 317 HOH C O   1 
HETATM 5654 O O   . HOH K 4 .   ? 52.851 48.082 18.259  1.00 33.00 ? 318 HOH C O   1 
HETATM 5655 O O   . HOH K 4 .   ? 50.672 23.851 46.794  1.00 33.47 ? 319 HOH C O   1 
HETATM 5656 O O   . HOH K 4 .   ? 64.584 22.713 49.500  1.00 28.38 ? 320 HOH C O   1 
HETATM 5657 O O   . HOH K 4 .   ? 58.083 37.132 31.823  1.00 26.68 ? 321 HOH C O   1 
HETATM 5658 O O   . HOH K 4 .   ? 47.355 46.555 24.983  1.00 23.65 ? 322 HOH C O   1 
HETATM 5659 O O   . HOH K 4 .   ? 34.529 37.502 36.001  1.00 37.68 ? 323 HOH C O   1 
HETATM 5660 O O   . HOH K 4 .   ? 41.897 29.862 43.403  1.00 46.98 ? 324 HOH C O   1 
HETATM 5661 O O   . HOH K 4 .   ? 35.628 49.981 30.828  1.00 33.51 ? 325 HOH C O   1 
HETATM 5662 O O   . HOH K 4 .   ? 46.018 24.013 22.372  1.00 44.08 ? 326 HOH C O   1 
HETATM 5663 O O   . HOH K 4 .   ? 32.460 36.958 31.104  1.00 27.27 ? 327 HOH C O   1 
HETATM 5664 O O   . HOH K 4 .   ? 55.729 37.204 41.742  1.00 18.44 ? 328 HOH C O   1 
HETATM 5665 O O   . HOH K 4 .   ? 46.599 33.164 23.075  1.00 18.62 ? 329 HOH C O   1 
HETATM 5666 O O   . HOH K 4 .   ? 53.662 36.873 44.882  1.00 23.57 ? 330 HOH C O   1 
HETATM 5667 O O   . HOH K 4 .   ? 35.453 47.309 25.522  1.00 22.24 ? 331 HOH C O   1 
HETATM 5668 O O   . HOH K 4 .   ? 41.836 52.214 41.828  1.00 29.76 ? 332 HOH C O   1 
HETATM 5669 O O   . HOH K 4 .   ? 58.418 39.143 21.820  1.00 41.60 ? 333 HOH C O   1 
HETATM 5670 O O   . HOH K 4 .   ? 37.548 50.762 34.839  1.00 31.44 ? 334 HOH C O   1 
HETATM 5671 O O   . HOH K 4 .   ? 56.033 47.046 40.080  1.00 33.27 ? 335 HOH C O   1 
HETATM 5672 O O   . HOH K 4 .   ? 47.582 49.447 23.071  1.00 26.15 ? 336 HOH C O   1 
HETATM 5673 O O   . HOH K 4 .   ? 54.430 38.144 38.978  1.00 13.82 ? 337 HOH C O   1 
HETATM 5674 O O   . HOH K 4 .   ? 54.835 50.115 12.668  1.00 33.67 ? 338 HOH C O   1 
HETATM 5675 O O   . HOH K 4 .   ? 65.663 28.936 41.415  1.00 36.15 ? 339 HOH C O   1 
HETATM 5676 O O   . HOH K 4 .   ? 47.611 31.837 44.978  1.00 27.75 ? 340 HOH C O   1 
HETATM 5677 O O   . HOH K 4 .   ? 46.278 27.759 43.555  1.00 34.96 ? 341 HOH C O   1 
HETATM 5678 O O   . HOH K 4 .   ? 52.887 30.695 44.711  1.00 12.91 ? 342 HOH C O   1 
HETATM 5679 O O   . HOH K 4 .   ? 62.630 28.075 41.326  1.00 31.39 ? 343 HOH C O   1 
HETATM 5680 O O   . HOH K 4 .   ? 48.989 37.478 43.373  1.00 28.20 ? 344 HOH C O   1 
HETATM 5681 O O   . HOH K 4 .   ? 54.758 20.420 19.729  1.00 24.73 ? 345 HOH C O   1 
HETATM 5682 O O   . HOH K 4 .   ? 39.795 32.845 35.467  1.00 22.76 ? 346 HOH C O   1 
HETATM 5683 O O   . HOH K 4 .   ? 35.559 48.639 22.637  1.00 30.70 ? 347 HOH C O   1 
HETATM 5684 O O   . HOH K 4 .   ? 43.421 32.354 23.384  1.00 26.40 ? 348 HOH C O   1 
HETATM 5685 O O   . HOH K 4 .   ? 55.782 52.477 23.996  1.00 24.11 ? 349 HOH C O   1 
HETATM 5686 O O   . HOH K 4 .   ? 59.298 41.947 31.529  1.00 17.72 ? 350 HOH C O   1 
HETATM 5687 O O   . HOH K 4 .   ? 41.757 42.692 37.146  1.00 22.82 ? 351 HOH C O   1 
HETATM 5688 O O   . HOH K 4 .   ? 53.803 43.378 20.154  1.00 43.37 ? 352 HOH C O   1 
HETATM 5689 O O   . HOH K 4 .   ? 59.552 38.877 42.977  1.00 34.77 ? 353 HOH C O   1 
HETATM 5690 O O   . HOH K 4 .   ? 46.521 16.425 26.463  1.00 27.66 ? 354 HOH C O   1 
HETATM 5691 O O   . HOH K 4 .   ? 61.474 56.002 33.969  1.00 42.33 ? 355 HOH C O   1 
HETATM 5692 O O   . HOH K 4 .   ? 42.960 26.490 22.274  1.00 40.04 ? 356 HOH C O   1 
HETATM 5693 O O   . HOH K 4 .   ? 38.912 50.610 31.464  1.00 30.86 ? 357 HOH C O   1 
HETATM 5694 O O   . HOH K 4 .   ? 57.571 58.495 32.708  1.00 42.30 ? 358 HOH C O   1 
HETATM 5695 O O   . HOH K 4 .   ? 46.693 55.254 41.335  1.00 28.06 ? 359 HOH C O   1 
HETATM 5696 O O   . HOH K 4 .   ? 38.416 45.230 46.148  1.00 36.93 ? 360 HOH C O   1 
HETATM 5697 O O   . HOH K 4 .   ? 57.045 58.547 35.622  1.00 30.31 ? 361 HOH C O   1 
HETATM 5698 O O   . HOH K 4 .   ? 60.060 44.780 42.140  1.00 30.26 ? 362 HOH C O   1 
HETATM 5699 O O   . HOH K 4 .   ? 62.313 18.156 31.307  1.00 33.05 ? 363 HOH C O   1 
HETATM 5700 O O   . HOH K 4 .   ? 46.136 49.979 43.022  1.00 30.78 ? 364 HOH C O   1 
HETATM 5701 O O   . HOH K 4 .   ? 57.482 41.934 27.472  1.00 17.78 ? 365 HOH C O   1 
HETATM 5702 O O   . HOH K 4 .   ? 38.969 27.926 33.589  1.00 33.42 ? 366 HOH C O   1 
HETATM 5703 O O   . HOH K 4 .   ? 48.420 26.919 47.466  1.00 36.42 ? 367 HOH C O   1 
HETATM 5704 O O   . HOH K 4 .   ? 60.781 37.106 34.112  1.00 20.77 ? 368 HOH C O   1 
HETATM 5705 O O   . HOH K 4 .   ? 42.483 25.626 37.951  1.00 35.72 ? 369 HOH C O   1 
HETATM 5706 O O   . HOH K 4 .   ? 59.579 55.834 36.155  1.00 33.69 ? 370 HOH C O   1 
HETATM 5707 O O   . HOH K 4 .   ? 61.096 17.122 44.986  1.00 34.29 ? 371 HOH C O   1 
HETATM 5708 O O   . HOH K 4 .   ? 48.492 29.554 46.051  1.00 27.13 ? 372 HOH C O   1 
HETATM 5709 O O   . HOH K 4 .   ? 63.643 30.712 44.653  1.00 38.57 ? 373 HOH C O   1 
HETATM 5710 O O   . HOH K 4 .   ? 39.052 40.883 37.559  1.00 40.06 ? 374 HOH C O   1 
HETATM 5711 O O   . HOH K 4 .   ? 58.563 49.636 26.654  1.00 18.71 ? 375 HOH C O   1 
HETATM 5712 O O   . HOH K 4 .   ? 60.847 22.567 25.845  1.00 34.84 ? 376 HOH C O   1 
HETATM 5713 O O   . HOH K 4 .   ? 40.187 51.499 29.164  1.00 40.49 ? 377 HOH C O   1 
HETATM 5714 O O   . HOH K 4 .   ? 45.963 31.294 42.411  1.00 28.57 ? 378 HOH C O   1 
HETATM 5715 O O   . HOH K 4 .   ? 40.414 24.535 33.476  1.00 46.23 ? 379 HOH C O   1 
HETATM 5716 O O   . HOH K 4 .   ? 53.996 54.003 40.451  1.00 34.36 ? 380 HOH C O   1 
HETATM 5717 O O   . HOH K 4 .   ? 40.132 41.068 41.609  1.00 26.55 ? 381 HOH C O   1 
HETATM 5718 O O   . HOH K 4 .   ? 46.358 23.948 39.964  1.00 27.23 ? 382 HOH C O   1 
HETATM 5719 O O   . HOH K 4 .   ? 32.724 37.716 33.908  1.00 32.56 ? 383 HOH C O   1 
HETATM 5720 O O   . HOH K 4 .   ? 61.798 24.220 23.850  1.00 38.99 ? 384 HOH C O   1 
HETATM 5721 O O   . HOH K 4 .   ? 40.024 57.625 37.260  1.00 42.95 ? 385 HOH C O   1 
HETATM 5722 O O   . HOH K 4 .   ? 40.925 24.587 36.165  1.00 43.19 ? 386 HOH C O   1 
HETATM 5723 O O   . HOH K 4 .   ? 47.576 14.229 25.088  1.00 47.12 ? 387 HOH C O   1 
HETATM 5724 O O   . HOH K 4 .   ? 44.134 51.966 43.384  1.00 40.98 ? 388 HOH C O   1 
HETATM 5725 O O   . HOH K 4 .   ? 61.055 41.491 19.217  1.00 32.24 ? 389 HOH C O   1 
HETATM 5726 O O   . HOH K 4 .   ? 35.370 39.169 38.226  1.00 36.87 ? 390 HOH C O   1 
HETATM 5727 O O   . HOH K 4 .   ? 59.689 44.350 32.211  1.00 25.12 ? 391 HOH C O   1 
HETATM 5728 O O   . HOH K 4 .   ? 57.443 52.220 26.004  1.00 22.86 ? 392 HOH C O   1 
HETATM 5729 O O   . HOH K 4 .   ? 61.968 35.339 36.214  1.00 17.91 ? 393 HOH C O   1 
HETATM 5730 O O   . HOH K 4 .   ? 37.952 30.761 35.492  1.00 33.77 ? 394 HOH C O   1 
HETATM 5731 O O   . HOH K 4 .   ? 42.747 21.857 23.139  1.00 48.50 ? 395 HOH C O   1 
HETATM 5732 O O   . HOH K 4 .   ? 43.159 24.101 21.912  1.00 37.80 ? 396 HOH C O   1 
HETATM 5733 O O   . HOH L 4 .   ? 65.040 25.925 -15.165 1.00 44.92 ? 301 HOH A O   1 
HETATM 5734 O O   . HOH L 4 .   ? 60.103 24.984 -2.168  1.00 25.38 ? 302 HOH A O   1 
HETATM 5735 O O   . HOH L 4 .   ? 69.881 28.561 -17.256 1.00 35.41 ? 303 HOH A O   1 
HETATM 5736 O O   . HOH L 4 .   ? 82.498 16.918 3.565   1.00 35.67 ? 304 HOH A O   1 
HETATM 5737 O O   . HOH L 4 .   ? 76.176 24.806 -13.496 1.00 33.10 ? 305 HOH A O   1 
HETATM 5738 O O   . HOH L 4 .   ? 59.146 41.058 2.397   1.00 29.00 ? 306 HOH A O   1 
HETATM 5739 O O   . HOH L 4 .   ? 71.621 47.106 0.307   1.00 42.56 ? 307 HOH A O   1 
HETATM 5740 O O   . HOH L 4 .   ? 53.525 27.006 -9.290  1.00 36.92 ? 308 HOH A O   1 
HETATM 5741 O O   . HOH L 4 .   ? 57.101 34.054 -10.343 1.00 25.60 ? 309 HOH A O   1 
HETATM 5742 O O   . HOH L 4 .   ? 86.727 26.256 18.792  1.00 29.33 ? 310 HOH A O   1 
HETATM 5743 O O   . HOH L 4 .   ? 64.656 24.265 6.303   1.00 22.83 ? 311 HOH A O   1 
HETATM 5744 O O   . HOH L 4 .   ? 77.367 32.511 -17.289 1.00 32.67 ? 312 HOH A O   1 
HETATM 5745 O O   . HOH L 4 .   ? 75.617 40.177 4.422   1.00 21.68 ? 313 HOH A O   1 
HETATM 5746 O O   . HOH L 4 .   ? 78.637 35.158 -16.403 1.00 41.23 ? 314 HOH A O   1 
HETATM 5747 O O   . HOH L 4 .   ? 65.224 39.988 0.128   1.00 19.08 ? 315 HOH A O   1 
HETATM 5748 O O   . HOH L 4 .   ? 71.176 25.437 -13.365 1.00 22.40 ? 316 HOH A O   1 
HETATM 5749 O O   . HOH L 4 .   ? 65.588 21.939 11.578  1.00 15.84 ? 317 HOH A O   1 
HETATM 5750 O O   . HOH L 4 .   ? 76.866 37.233 5.295   1.00 22.94 ? 318 HOH A O   1 
HETATM 5751 O O   . HOH L 4 .   ? 78.319 33.283 18.000  1.00 32.36 ? 319 HOH A O   1 
HETATM 5752 O O   . HOH L 4 .   ? 69.505 20.713 0.569   1.00 11.75 ? 320 HOH A O   1 
HETATM 5753 O O   . HOH L 4 .   ? 60.112 30.597 6.506   1.00 17.40 ? 321 HOH A O   1 
HETATM 5754 O O   . HOH L 4 .   ? 65.577 24.442 -9.722  1.00 25.62 ? 322 HOH A O   1 
HETATM 5755 O O   . HOH L 4 .   ? 75.677 30.531 -7.866  1.00 13.81 ? 323 HOH A O   1 
HETATM 5756 O O   . HOH L 4 .   ? 79.039 39.318 6.566   1.00 37.25 ? 324 HOH A O   1 
HETATM 5757 O O   . HOH L 4 .   ? 79.522 35.958 14.967  1.00 28.90 ? 325 HOH A O   1 
HETATM 5758 O O   . HOH L 4 .   ? 54.967 45.202 4.490   1.00 37.20 ? 326 HOH A O   1 
HETATM 5759 O O   . HOH L 4 .   ? 59.570 25.607 -7.718  1.00 24.43 ? 327 HOH A O   1 
HETATM 5760 O O   . HOH L 4 .   ? 85.891 11.179 14.226  1.00 31.23 ? 328 HOH A O   1 
HETATM 5761 O O   . HOH L 4 .   ? 79.737 36.211 10.850  1.00 24.41 ? 329 HOH A O   1 
HETATM 5762 O O   . HOH L 4 .   ? 73.295 35.602 10.512  1.00 14.89 ? 330 HOH A O   1 
HETATM 5763 O O   . HOH L 4 .   ? 86.936 14.116 11.069  1.00 19.72 ? 331 HOH A O   1 
HETATM 5764 O O   . HOH L 4 .   ? 61.575 24.350 -11.278 1.00 36.83 ? 332 HOH A O   1 
HETATM 5765 O O   . HOH L 4 .   ? 66.664 38.283 -1.211  1.00 22.76 ? 333 HOH A O   1 
HETATM 5766 O O   . HOH L 4 .   ? 80.744 36.857 -8.717  1.00 20.79 ? 334 HOH A O   1 
HETATM 5767 O O   . HOH L 4 .   ? 73.114 15.724 -1.698  1.00 27.69 ? 335 HOH A O   1 
HETATM 5768 O O   . HOH L 4 .   ? 75.516 37.933 7.576   1.00 20.32 ? 336 HOH A O   1 
HETATM 5769 O O   . HOH L 4 .   ? 56.448 36.585 -2.751  1.00 15.81 ? 337 HOH A O   1 
HETATM 5770 O O   . HOH L 4 .   ? 74.529 37.981 -11.039 1.00 23.91 ? 338 HOH A O   1 
HETATM 5771 O O   . HOH L 4 .   ? 68.441 11.391 9.574   1.00 31.01 ? 339 HOH A O   1 
HETATM 5772 O O   . HOH L 4 .   ? 87.294 29.564 13.173  1.00 14.54 ? 340 HOH A O   1 
HETATM 5773 O O   . HOH L 4 .   ? 77.982 36.232 -12.433 1.00 25.34 ? 341 HOH A O   1 
HETATM 5774 O O   . HOH L 4 .   ? 71.296 25.811 20.979  1.00 35.07 ? 342 HOH A O   1 
HETATM 5775 O O   . HOH L 4 .   ? 84.315 26.863 19.447  1.00 36.86 ? 343 HOH A O   1 
HETATM 5776 O O   . HOH L 4 .   ? 77.549 8.647  8.667   1.00 24.78 ? 344 HOH A O   1 
HETATM 5777 O O   . HOH L 4 .   ? 81.146 25.940 -13.663 1.00 36.47 ? 345 HOH A O   1 
HETATM 5778 O O   . HOH L 4 .   ? 85.442 33.353 -3.022  1.00 14.36 ? 346 HOH A O   1 
HETATM 5779 O O   . HOH L 4 .   ? 80.776 20.273 1.735   1.00 22.79 ? 347 HOH A O   1 
HETATM 5780 O O   . HOH L 4 .   ? 73.744 40.199 -9.955  1.00 31.71 ? 348 HOH A O   1 
HETATM 5781 O O   . HOH L 4 .   ? 86.006 19.710 15.864  1.00 25.84 ? 349 HOH A O   1 
HETATM 5782 O O   . HOH L 4 .   ? 82.294 22.706 -1.907  1.00 34.06 ? 350 HOH A O   1 
HETATM 5783 O O   . HOH L 4 .   ? 82.872 41.719 -2.360  1.00 27.15 ? 351 HOH A O   1 
HETATM 5784 O O   . HOH L 4 .   ? 76.027 43.937 -5.329  1.00 29.11 ? 352 HOH A O   1 
HETATM 5785 O O   . HOH L 4 .   ? 69.650 17.410 0.210   1.00 15.37 ? 353 HOH A O   1 
HETATM 5786 O O   . HOH L 4 .   ? 64.410 40.550 -2.621  1.00 25.76 ? 354 HOH A O   1 
HETATM 5787 O O   . HOH L 4 .   ? 73.888 23.655 -9.491  1.00 15.30 ? 355 HOH A O   1 
HETATM 5788 O O   . HOH L 4 .   ? 65.867 14.891 -0.511  1.00 28.42 ? 356 HOH A O   1 
HETATM 5789 O O   . HOH L 4 .   ? 76.730 30.090 -5.490  1.00 13.41 ? 357 HOH A O   1 
HETATM 5790 O O   . HOH L 4 .   ? 55.918 26.357 -11.220 1.00 26.88 ? 358 HOH A O   1 
HETATM 5791 O O   . HOH L 4 .   ? 62.003 32.368 -16.418 1.00 14.75 ? 359 HOH A O   1 
HETATM 5792 O O   . HOH L 4 .   ? 74.080 30.525 -15.481 1.00 23.04 ? 360 HOH A O   1 
HETATM 5793 O O   . HOH L 4 .   ? 86.352 15.115 17.780  1.00 44.35 ? 361 HOH A O   1 
HETATM 5794 O O   . HOH L 4 .   ? 81.836 15.020 21.003  1.00 34.38 ? 362 HOH A O   1 
HETATM 5795 O O   . HOH L 4 .   ? 82.575 27.197 22.378  1.00 30.30 ? 363 HOH A O   1 
HETATM 5796 O O   . HOH L 4 .   ? 61.248 25.247 2.767   1.00 16.84 ? 364 HOH A O   1 
HETATM 5797 O O   . HOH L 4 .   ? 79.041 13.611 3.366   1.00 18.48 ? 365 HOH A O   1 
HETATM 5798 O O   . HOH L 4 .   ? 74.915 10.774 4.812   1.00 39.73 ? 366 HOH A O   1 
HETATM 5799 O O   . HOH L 4 .   ? 54.950 31.032 -11.611 1.00 28.79 ? 367 HOH A O   1 
HETATM 5800 O O   . HOH L 4 .   ? 80.404 43.119 1.535   1.00 33.54 ? 368 HOH A O   1 
HETATM 5801 O O   . HOH L 4 .   ? 85.291 31.139 12.623  1.00 21.11 ? 369 HOH A O   1 
HETATM 5802 O O   . HOH L 4 .   ? 65.109 27.932 11.393  1.00 23.89 ? 370 HOH A O   1 
HETATM 5803 O O   . HOH L 4 .   ? 82.721 27.620 -9.668  1.00 37.09 ? 371 HOH A O   1 
HETATM 5804 O O   . HOH L 4 .   ? 67.058 19.989 17.108  1.00 19.31 ? 372 HOH A O   1 
HETATM 5805 O O   . HOH L 4 .   ? 71.789 30.430 19.877  1.00 27.18 ? 373 HOH A O   1 
HETATM 5806 O O   . HOH L 4 .   ? 76.410 14.516 3.077   1.00 11.85 ? 374 HOH A O   1 
HETATM 5807 O O   . HOH L 4 .   ? 81.466 23.806 -7.618  1.00 45.93 ? 375 HOH A O   1 
HETATM 5808 O O   . HOH L 4 .   ? 83.599 30.155 -12.445 1.00 43.40 ? 376 HOH A O   1 
HETATM 5809 O O   . HOH L 4 .   ? 83.243 19.602 9.392   1.00 13.41 ? 377 HOH A O   1 
HETATM 5810 O O   . HOH L 4 .   ? 85.553 36.046 -2.273  1.00 14.30 ? 378 HOH A O   1 
HETATM 5811 O O   . HOH L 4 .   ? 87.057 22.205 16.181  1.00 20.78 ? 379 HOH A O   1 
HETATM 5812 O O   . HOH L 4 .   ? 63.230 20.801 5.594   1.00 18.29 ? 380 HOH A O   1 
HETATM 5813 O O   . HOH L 4 .   ? 63.481 40.568 3.352   1.00 37.01 ? 381 HOH A O   1 
HETATM 5814 O O   . HOH L 4 .   ? 52.721 42.566 3.386   1.00 18.10 ? 382 HOH A O   1 
HETATM 5815 O O   . HOH L 4 .   ? 80.091 17.831 0.559   1.00 32.68 ? 383 HOH A O   1 
HETATM 5816 O O   . HOH L 4 .   ? 80.024 30.192 -5.139  1.00 15.28 ? 384 HOH A O   1 
HETATM 5817 O O   . HOH L 4 .   ? 61.499 29.506 4.382   1.00 14.29 ? 385 HOH A O   1 
HETATM 5818 O O   . HOH L 4 .   ? 66.597 24.725 22.182  1.00 45.39 ? 386 HOH A O   1 
HETATM 5819 O O   . HOH L 4 .   ? 56.346 29.065 -13.538 1.00 21.07 ? 387 HOH A O   1 
HETATM 5820 O O   . HOH L 4 .   ? 62.242 17.378 -4.799  1.00 29.87 ? 388 HOH A O   1 
HETATM 5821 O O   . HOH L 4 .   ? 75.242 45.343 2.972   1.00 35.92 ? 389 HOH A O   1 
HETATM 5822 O O   . HOH L 4 .   ? 64.988 32.411 15.487  1.00 41.37 ? 390 HOH A O   1 
HETATM 5823 O O   . HOH L 4 .   ? 76.838 5.915  16.954  1.00 25.16 ? 391 HOH A O   1 
HETATM 5824 O O   . HOH L 4 .   ? 76.225 36.711 9.946   1.00 17.13 ? 392 HOH A O   1 
HETATM 5825 O O   . HOH L 4 .   ? 67.367 44.881 -11.265 1.00 33.23 ? 393 HOH A O   1 
HETATM 5826 O O   . HOH L 4 .   ? 69.702 26.546 -15.649 1.00 29.19 ? 394 HOH A O   1 
HETATM 5827 O O   . HOH L 4 .   ? 71.475 39.732 -8.898  1.00 31.04 ? 395 HOH A O   1 
HETATM 5828 O O   . HOH L 4 .   ? 70.203 44.708 3.982   1.00 35.83 ? 396 HOH A O   1 
HETATM 5829 O O   . HOH L 4 .   ? 83.193 9.585  14.661  1.00 27.10 ? 397 HOH A O   1 
HETATM 5830 O O   . HOH L 4 .   ? 84.701 36.489 -6.729  1.00 33.46 ? 398 HOH A O   1 
HETATM 5831 O O   . HOH L 4 .   ? 66.104 33.384 9.677   1.00 23.91 ? 399 HOH A O   1 
HETATM 5832 O O   . HOH L 4 .   ? 67.711 22.564 21.716  1.00 30.49 ? 400 HOH A O   1 
HETATM 5833 O O   . HOH L 4 .   ? 60.628 35.374 -12.328 1.00 32.12 ? 401 HOH A O   1 
HETATM 5834 O O   . HOH L 4 .   ? 79.180 40.614 4.318   1.00 31.56 ? 402 HOH A O   1 
HETATM 5835 O O   . HOH L 4 .   ? 80.456 26.876 -7.448  1.00 19.39 ? 403 HOH A O   1 
HETATM 5836 O O   . HOH L 4 .   ? 70.455 15.773 22.956  1.00 28.44 ? 404 HOH A O   1 
HETATM 5837 O O   . HOH L 4 .   ? 84.734 13.119 6.725   1.00 35.00 ? 405 HOH A O   1 
HETATM 5838 O O   . HOH L 4 .   ? 75.696 19.298 -2.588  1.00 30.95 ? 406 HOH A O   1 
HETATM 5839 O O   . HOH L 4 .   ? 80.017 41.988 -3.697  1.00 32.92 ? 407 HOH A O   1 
HETATM 5840 O O   . HOH L 4 .   ? 85.248 32.157 15.328  1.00 36.78 ? 408 HOH A O   1 
HETATM 5841 O O   . HOH L 4 .   ? 77.856 6.767  19.288  1.00 39.72 ? 409 HOH A O   1 
HETATM 5842 O O   . HOH L 4 .   ? 63.627 38.202 4.588   1.00 40.68 ? 410 HOH A O   1 
HETATM 5843 O O   . HOH L 4 .   ? 68.788 15.343 -1.278  1.00 37.88 ? 411 HOH A O   1 
HETATM 5844 O O   . HOH L 4 .   ? 74.895 46.576 -5.272  1.00 39.55 ? 412 HOH A O   1 
HETATM 5845 O O   . HOH L 4 .   ? 61.341 39.230 3.404   1.00 31.15 ? 413 HOH A O   1 
HETATM 5846 O O   . HOH L 4 .   ? 79.802 39.382 -7.747  1.00 22.31 ? 414 HOH A O   1 
HETATM 5847 O O   . HOH L 4 .   ? 74.089 24.342 -12.341 1.00 31.72 ? 415 HOH A O   1 
HETATM 5848 O O   . HOH L 4 .   ? 74.592 17.450 -3.347  1.00 40.17 ? 416 HOH A O   1 
HETATM 5849 O O   . HOH L 4 .   ? 86.337 13.864 20.414  1.00 39.45 ? 417 HOH A O   1 
HETATM 5850 O O   . HOH L 4 .   ? 87.526 9.918  11.883  1.00 43.16 ? 418 HOH A O   1 
HETATM 5851 O O   . HOH L 4 .   ? 74.230 21.049 -9.811  1.00 36.78 ? 419 HOH A O   1 
HETATM 5852 O O   . HOH L 4 .   ? 79.201 10.926 3.138   1.00 35.13 ? 420 HOH A O   1 
HETATM 5853 O O   . HOH L 4 .   ? 81.945 28.674 -5.823  1.00 29.15 ? 421 HOH A O   1 
HETATM 5854 O O   . HOH L 4 .   ? 82.728 25.309 -11.301 1.00 39.91 ? 422 HOH A O   1 
HETATM 5855 O O   . HOH L 4 .   ? 78.850 38.162 10.211  1.00 34.00 ? 423 HOH A O   1 
HETATM 5856 O O   . HOH L 4 .   ? 80.649 15.256 1.693   1.00 31.74 ? 424 HOH A O   1 
HETATM 5857 O O   . HOH L 4 .   ? 80.403 36.901 -11.529 1.00 25.18 ? 425 HOH A O   1 
HETATM 5858 O O   . HOH L 4 .   ? 61.604 35.002 -15.897 1.00 26.07 ? 426 HOH A O   1 
HETATM 5859 O O   . HOH L 4 .   ? 75.810 8.825  6.370   1.00 38.71 ? 427 HOH A O   1 
HETATM 5860 O O   . HOH L 4 .   ? 63.789 17.995 6.396   1.00 18.30 ? 428 HOH A O   1 
HETATM 5861 O O   . HOH L 4 .   ? 85.913 15.309 8.950   1.00 19.28 ? 429 HOH A O   1 
HETATM 5862 O O   . HOH L 4 .   ? 84.313 29.962 -6.082  1.00 38.26 ? 430 HOH A O   1 
HETATM 5863 O O   . HOH L 4 .   ? 74.676 13.611 -1.478  1.00 27.08 ? 431 HOH A O   1 
HETATM 5864 O O   . HOH L 4 .   ? 82.307 35.875 -12.816 1.00 41.20 ? 432 HOH A O   1 
HETATM 5865 O O   . HOH L 4 .   ? 74.742 10.649 1.733   1.00 31.28 ? 433 HOH A O   1 
HETATM 5866 O O   . HOH L 4 .   ? 63.039 42.519 4.726   1.00 39.54 ? 434 HOH A O   1 
HETATM 5867 O O   . HOH L 4 .   ? 82.460 36.694 11.643  1.00 21.93 ? 435 HOH A O   1 
HETATM 5868 O O   . HOH L 4 .   ? 76.036 13.071 0.796   1.00 21.79 ? 436 HOH A O   1 
HETATM 5869 O O   . HOH L 4 .   ? 80.303 35.141 17.386  1.00 38.83 ? 437 HOH A O   1 
HETATM 5870 O O   . HOH L 4 .   ? 81.324 41.773 5.164   1.00 25.68 ? 438 HOH A O   1 
HETATM 5871 O O   . HOH L 4 .   ? 63.768 32.870 11.162  1.00 32.38 ? 439 HOH A O   1 
HETATM 5872 O O   . HOH L 4 .   ? 77.401 9.443  4.260   1.00 42.76 ? 440 HOH A O   1 
HETATM 5873 O O   . HOH L 4 .   ? 82.412 40.544 -6.555  1.00 30.85 ? 441 HOH A O   1 
HETATM 5874 O O   . HOH L 4 .   ? 82.756 39.348 10.980  1.00 24.94 ? 442 HOH A O   1 
HETATM 5875 O O   . HOH M 4 .   ? 72.151 64.008 8.725   1.00 40.44 ? 301 HOH D O   1 
HETATM 5876 O O   . HOH M 4 .   ? 58.094 61.559 8.125   1.00 41.34 ? 302 HOH D O   1 
HETATM 5877 O O   . HOH M 4 .   ? 74.049 61.781 11.322  1.00 42.98 ? 303 HOH D O   1 
HETATM 5878 O O   . HOH M 4 .   ? 60.614 44.916 34.674  1.00 37.30 ? 304 HOH D O   1 
HETATM 5879 O O   . HOH M 4 .   ? 58.460 67.181 10.082  1.00 45.64 ? 305 HOH D O   1 
HETATM 5880 O O   . HOH M 4 .   ? 69.037 56.925 37.361  1.00 43.22 ? 306 HOH D O   1 
HETATM 5881 O O   . HOH M 4 .   ? 60.293 36.149 23.462  1.00 45.79 ? 307 HOH D O   1 
HETATM 5882 O O   . HOH M 4 .   ? 73.596 50.896 41.415  1.00 33.15 ? 308 HOH D O   1 
HETATM 5883 O O   . HOH M 4 .   ? 71.784 29.812 24.460  1.00 30.58 ? 309 HOH D O   1 
HETATM 5884 O O   . HOH M 4 .   ? 66.529 49.304 40.138  1.00 34.19 ? 310 HOH D O   1 
HETATM 5885 O O   . HOH M 4 .   ? 62.122 44.783 39.987  1.00 28.42 ? 311 HOH D O   1 
HETATM 5886 O O   . HOH M 4 .   ? 67.243 34.141 19.735  1.00 46.46 ? 312 HOH D O   1 
HETATM 5887 O O   . HOH M 4 .   ? 85.170 50.300 26.834  1.00 37.24 ? 313 HOH D O   1 
HETATM 5888 O O   . HOH M 4 .   ? 56.798 59.897 22.316  1.00 39.42 ? 314 HOH D O   1 
HETATM 5889 O O   . HOH M 4 .   ? 78.945 54.836 40.889  1.00 40.21 ? 315 HOH D O   1 
HETATM 5890 O O   . HOH M 4 .   ? 60.677 39.615 25.900  1.00 22.25 ? 316 HOH D O   1 
HETATM 5891 O O   . HOH M 4 .   ? 66.161 30.363 28.825  1.00 30.59 ? 317 HOH D O   1 
HETATM 5892 O O   . HOH M 4 .   ? 83.996 47.793 19.658  1.00 38.69 ? 318 HOH D O   1 
HETATM 5893 O O   . HOH M 4 .   ? 83.356 44.068 37.651  1.00 39.31 ? 319 HOH D O   1 
HETATM 5894 O O   . HOH M 4 .   ? 63.627 56.135 30.052  1.00 23.96 ? 320 HOH D O   1 
HETATM 5895 O O   . HOH M 4 .   ? 68.495 51.066 0.562   1.00 34.31 ? 321 HOH D O   1 
HETATM 5896 O O   . HOH M 4 .   ? 61.959 63.852 23.373  1.00 37.37 ? 322 HOH D O   1 
HETATM 5897 O O   . HOH M 4 .   ? 58.076 40.880 43.180  1.00 39.14 ? 323 HOH D O   1 
HETATM 5898 O O   . HOH M 4 .   ? 63.956 47.401 42.696  1.00 37.15 ? 324 HOH D O   1 
HETATM 5899 O O   . HOH M 4 .   ? 71.937 36.792 30.322  1.00 28.46 ? 325 HOH D O   1 
HETATM 5900 O O   . HOH M 4 .   ? 76.172 40.860 19.443  1.00 22.92 ? 326 HOH D O   1 
HETATM 5901 O O   . HOH M 4 .   ? 77.605 42.535 21.138  1.00 26.17 ? 327 HOH D O   1 
HETATM 5902 O O   . HOH M 4 .   ? 69.190 32.688 26.824  1.00 35.83 ? 328 HOH D O   1 
HETATM 5903 O O   . HOH M 4 .   ? 65.103 53.292 29.711  1.00 18.73 ? 329 HOH D O   1 
HETATM 5904 O O   . HOH M 4 .   ? 77.542 48.060 34.892  1.00 24.69 ? 330 HOH D O   1 
HETATM 5905 O O   . HOH M 4 .   ? 71.338 34.647 29.452  1.00 21.26 ? 331 HOH D O   1 
HETATM 5906 O O   . HOH M 4 .   ? 73.029 45.392 9.565   1.00 41.09 ? 332 HOH D O   1 
HETATM 5907 O O   . HOH M 4 .   ? 71.587 33.744 32.158  1.00 26.48 ? 333 HOH D O   1 
HETATM 5908 O O   . HOH M 4 .   ? 64.018 24.401 28.090  1.00 35.09 ? 334 HOH D O   1 
HETATM 5909 O O   . HOH M 4 .   ? 72.436 41.638 17.545  1.00 20.33 ? 335 HOH D O   1 
HETATM 5910 O O   . HOH M 4 .   ? 80.796 40.989 36.906  1.00 36.16 ? 336 HOH D O   1 
HETATM 5911 O O   . HOH M 4 .   ? 58.911 49.437 20.231  1.00 19.19 ? 337 HOH D O   1 
HETATM 5912 O O   . HOH M 4 .   ? 75.980 43.895 11.339  1.00 40.35 ? 338 HOH D O   1 
HETATM 5913 O O   . HOH M 4 .   ? 61.408 25.815 30.042  1.00 21.15 ? 339 HOH D O   1 
HETATM 5914 O O   . HOH M 4 .   ? 59.630 56.584 32.163  1.00 36.71 ? 340 HOH D O   1 
HETATM 5915 O O   . HOH M 4 .   ? 61.279 47.236 25.221  1.00 23.18 ? 341 HOH D O   1 
HETATM 5916 O O   . HOH M 4 .   ? 73.257 53.621 37.432  1.00 23.61 ? 342 HOH D O   1 
HETATM 5917 O O   . HOH M 4 .   ? 64.712 33.631 44.774  1.00 18.34 ? 343 HOH D O   1 
HETATM 5918 O O   . HOH M 4 .   ? 63.432 41.306 51.073  1.00 49.02 ? 344 HOH D O   1 
HETATM 5919 O O   . HOH M 4 .   ? 57.705 51.374 14.891  1.00 21.66 ? 345 HOH D O   1 
HETATM 5920 O O   . HOH M 4 .   ? 60.196 31.518 30.989  1.00 18.23 ? 346 HOH D O   1 
HETATM 5921 O O   . HOH M 4 .   ? 56.614 46.915 16.147  1.00 42.33 ? 347 HOH D O   1 
HETATM 5922 O O   . HOH M 4 .   ? 78.942 51.691 12.418  1.00 38.21 ? 348 HOH D O   1 
HETATM 5923 O O   . HOH M 4 .   ? 79.558 52.481 23.110  1.00 24.92 ? 349 HOH D O   1 
HETATM 5924 O O   . HOH M 4 .   ? 63.519 33.340 35.240  1.00 21.03 ? 350 HOH D O   1 
HETATM 5925 O O   . HOH M 4 .   ? 66.733 61.873 25.704  1.00 18.81 ? 351 HOH D O   1 
HETATM 5926 O O   . HOH M 4 .   ? 63.492 50.324 38.287  1.00 33.53 ? 352 HOH D O   1 
HETATM 5927 O O   . HOH M 4 .   ? 77.554 49.053 32.254  1.00 26.73 ? 353 HOH D O   1 
HETATM 5928 O O   . HOH M 4 .   ? 80.373 41.545 19.187  1.00 28.11 ? 354 HOH D O   1 
HETATM 5929 O O   . HOH M 4 .   ? 78.218 38.437 21.890  1.00 26.32 ? 355 HOH D O   1 
HETATM 5930 O O   . HOH M 4 .   ? 65.736 44.598 9.972   1.00 39.68 ? 356 HOH D O   1 
HETATM 5931 O O   . HOH M 4 .   ? 73.493 46.710 45.549  1.00 29.24 ? 357 HOH D O   1 
HETATM 5932 O O   . HOH M 4 .   ? 69.954 42.126 47.238  1.00 35.12 ? 358 HOH D O   1 
HETATM 5933 O O   . HOH M 4 .   ? 61.901 44.062 19.885  1.00 30.72 ? 359 HOH D O   1 
HETATM 5934 O O   . HOH M 4 .   ? 85.626 45.845 32.351  1.00 30.90 ? 360 HOH D O   1 
HETATM 5935 O O   . HOH M 4 .   ? 76.492 57.903 17.043  1.00 35.69 ? 361 HOH D O   1 
HETATM 5936 O O   . HOH M 4 .   ? 74.444 56.011 8.301   1.00 34.99 ? 362 HOH D O   1 
HETATM 5937 O O   . HOH M 4 .   ? 60.066 45.080 29.695  1.00 18.35 ? 363 HOH D O   1 
HETATM 5938 O O   . HOH M 4 .   ? 72.599 52.171 4.459   1.00 31.87 ? 364 HOH D O   1 
HETATM 5939 O O   . HOH M 4 .   ? 64.851 44.625 4.857   1.00 29.70 ? 365 HOH D O   1 
HETATM 5940 O O   . HOH M 4 .   ? 80.064 44.885 45.229  1.00 35.09 ? 366 HOH D O   1 
HETATM 5941 O O   . HOH M 4 .   ? 64.981 62.087 6.872   1.00 34.31 ? 367 HOH D O   1 
HETATM 5942 O O   . HOH M 4 .   ? 73.638 59.241 24.970  1.00 42.06 ? 368 HOH D O   1 
HETATM 5943 O O   . HOH M 4 .   ? 61.794 41.389 27.582  1.00 16.75 ? 369 HOH D O   1 
HETATM 5944 O O   . HOH M 4 .   ? 59.443 53.047 36.962  1.00 38.08 ? 370 HOH D O   1 
HETATM 5945 O O   . HOH M 4 .   ? 75.540 42.120 16.997  1.00 22.75 ? 371 HOH D O   1 
HETATM 5946 O O   . HOH M 4 .   ? 56.132 56.178 8.856   1.00 29.93 ? 372 HOH D O   1 
HETATM 5947 O O   . HOH M 4 .   ? 79.775 31.056 26.648  1.00 38.50 ? 373 HOH D O   1 
HETATM 5948 O O   . HOH M 4 .   ? 80.215 50.439 30.932  1.00 29.49 ? 374 HOH D O   1 
HETATM 5949 O O   . HOH M 4 .   ? 58.110 49.292 9.804   1.00 35.61 ? 375 HOH D O   1 
HETATM 5950 O O   . HOH M 4 .   ? 79.591 53.780 33.318  1.00 26.15 ? 376 HOH D O   1 
HETATM 5951 O O   . HOH M 4 .   ? 72.968 60.614 17.365  1.00 31.14 ? 377 HOH D O   1 
HETATM 5952 O O   . HOH M 4 .   ? 70.172 57.918 30.757  1.00 39.00 ? 378 HOH D O   1 
HETATM 5953 O O   . HOH M 4 .   ? 79.545 40.838 21.906  1.00 34.02 ? 379 HOH D O   1 
HETATM 5954 O O   . HOH M 4 .   ? 74.991 52.217 39.459  1.00 44.19 ? 380 HOH D O   1 
HETATM 5955 O O   . HOH M 4 .   ? 66.786 32.971 27.569  1.00 29.99 ? 381 HOH D O   1 
HETATM 5956 O O   . HOH M 4 .   ? 62.527 48.883 39.550  1.00 42.09 ? 382 HOH D O   1 
HETATM 5957 O O   . HOH M 4 .   ? 82.679 37.004 20.084  1.00 51.93 ? 383 HOH D O   1 
HETATM 5958 O O   . HOH M 4 .   ? 53.606 56.038 8.252   1.00 52.38 ? 384 HOH D O   1 
HETATM 5959 O O   . HOH M 4 .   ? 53.993 60.304 23.322  1.00 41.02 ? 385 HOH D O   1 
HETATM 5960 O O   . HOH M 4 .   ? 71.450 51.291 42.720  1.00 41.92 ? 386 HOH D O   1 
HETATM 5961 O O   . HOH M 4 .   ? 71.094 43.626 10.553  1.00 44.20 ? 387 HOH D O   1 
HETATM 5962 O O   . HOH M 4 .   ? 61.202 47.160 42.812  1.00 42.53 ? 388 HOH D O   1 
HETATM 5963 O O   . HOH M 4 .   ? 66.502 63.043 28.092  1.00 32.01 ? 389 HOH D O   1 
HETATM 5964 O O   . HOH M 4 .   ? 87.117 51.462 32.824  1.00 36.85 ? 390 HOH D O   1 
HETATM 5965 O O   . HOH M 4 .   ? 81.408 53.546 21.329  1.00 38.05 ? 391 HOH D O   1 
HETATM 5966 O O   . HOH M 4 .   ? 59.648 42.459 28.803  1.00 17.18 ? 392 HOH D O   1 
HETATM 5967 O O   . HOH M 4 .   ? 80.208 37.397 18.733  1.00 32.51 ? 393 HOH D O   1 
HETATM 5968 O O   . HOH M 4 .   ? 74.321 54.472 39.800  1.00 34.71 ? 394 HOH D O   1 
HETATM 5969 O O   . HOH M 4 .   ? 72.273 55.442 41.406  1.00 43.67 ? 395 HOH D O   1 
HETATM 5970 O O   . HOH M 4 .   ? 74.900 63.253 0.439   1.00 41.98 ? 396 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 1   ? 0.4529 0.4132 0.4655 0.0181  -0.0393 0.0178  6   SER B N   
2    C CA  . SER A 1   ? 0.4604 0.4258 0.4707 0.0164  -0.0368 0.0172  6   SER B CA  
3    C C   . SER A 1   ? 0.4354 0.4037 0.4446 0.0130  -0.0369 0.0199  6   SER B C   
4    O O   . SER A 1   ? 0.4229 0.3922 0.4333 0.0121  -0.0385 0.0228  6   SER B O   
5    C CB  . SER A 1   ? 0.5054 0.4747 0.5166 0.0183  -0.0356 0.0163  6   SER B CB  
6    O OG  . SER A 1   ? 0.5171 0.4904 0.5261 0.0168  -0.0332 0.0153  6   SER B OG  
7    N N   . ALA A 2   ? 0.2629 0.2332 0.2697 0.0110  -0.0350 0.0190  7   ALA B N   
8    C CA  . ALA A 2   ? 0.2435 0.2162 0.2491 0.0078  -0.0349 0.0209  7   ALA B CA  
9    C C   . ALA A 2   ? 0.2199 0.1965 0.2236 0.0066  -0.0321 0.0194  7   ALA B C   
10   O O   . ALA A 2   ? 0.2349 0.2111 0.2379 0.0079  -0.0305 0.0169  7   ALA B O   
11   C CB  . ALA A 2   ? 0.2837 0.2529 0.2886 0.0064  -0.0361 0.0216  7   ALA B CB  
12   N N   . THR A 3   ? 0.2092 0.1897 0.2122 0.0041  -0.0317 0.0209  8   THR B N   
13   C CA  . THR A 3   ? 0.1793 0.1634 0.1807 0.0026  -0.0292 0.0195  8   THR B CA  
14   C C   . THR A 3   ? 0.1707 0.1557 0.1708 -0.0002 -0.0290 0.0204  8   THR B C   
15   O O   . THR A 3   ? 0.1816 0.1670 0.1820 -0.0019 -0.0308 0.0228  8   THR B O   
16   C CB  . THR A 3   ? 0.1964 0.1853 0.1981 0.0019  -0.0285 0.0201  8   THR B CB  
17   O OG1 . THR A 3   ? 0.2348 0.2230 0.2379 0.0047  -0.0288 0.0194  8   THR B OG1 
18   C CG2 . THR A 3   ? 0.2279 0.2200 0.2281 0.0004  -0.0259 0.0184  8   THR B CG2 
19   N N   . TYR A 4   ? 0.1608 0.1458 0.1596 -0.0006 -0.0271 0.0185  9   TYR B N   
20   C CA  . TYR A 4   ? 0.1500 0.1359 0.1476 -0.0030 -0.0267 0.0190  9   TYR B CA  
21   C C   . TYR A 4   ? 0.1622 0.1517 0.1589 -0.0042 -0.0240 0.0174  9   TYR B C   
22   O O   . TYR A 4   ? 0.1692 0.1587 0.1660 -0.0026 -0.0222 0.0154  9   TYR B O   
23   C CB  . TYR A 4   ? 0.1520 0.1339 0.1493 -0.0021 -0.0269 0.0182  9   TYR B CB  
24   C CG  . TYR A 4   ? 0.1648 0.1422 0.1630 -0.0008 -0.0293 0.0190  9   TYR B CG  
25   C CD1 . TYR A 4   ? 0.1821 0.1571 0.1813 0.0019  -0.0298 0.0179  9   TYR B CD1 
26   C CD2 . TYR A 4   ? 0.1706 0.1464 0.1686 -0.0024 -0.0312 0.0209  9   TYR B CD2 
27   C CE1 . TYR A 4   ? 0.2162 0.1871 0.2164 0.0031  -0.0319 0.0185  9   TYR B CE1 
28   C CE2 . TYR A 4   ? 0.1931 0.1645 0.1920 -0.0013 -0.0333 0.0216  9   TYR B CE2 
29   C CZ  . TYR A 4   ? 0.2068 0.1757 0.2069 0.0014  -0.0337 0.0203  9   TYR B CZ  
30   O OH  . TYR A 4   ? 0.2431 0.2074 0.2444 0.0028  -0.0358 0.0206  9   TYR B OH  
31   N N   . GLN A 5   ? 0.1428 0.1350 0.1387 -0.0068 -0.0235 0.0180  10  GLN B N   
32   C CA  . GLN A 5   ? 0.1550 0.1504 0.1502 -0.0080 -0.0209 0.0163  10  GLN B CA  
33   C C   . GLN A 5   ? 0.1432 0.1377 0.1379 -0.0086 -0.0200 0.0156  10  GLN B C   
34   O O   . GLN A 5   ? 0.1395 0.1336 0.1338 -0.0099 -0.0214 0.0171  10  GLN B O   
35   C CB  . GLN A 5   ? 0.1795 0.1797 0.1744 -0.0106 -0.0206 0.0171  10  GLN B CB  
36   C CG  . GLN A 5   ? 0.2094 0.2115 0.2049 -0.0104 -0.0215 0.0181  10  GLN B CG  
37   C CD  . GLN A 5   ? 0.2475 0.2491 0.2435 -0.0083 -0.0202 0.0163  10  GLN B CD  
38   O OE1 . GLN A 5   ? 0.2654 0.2668 0.2611 -0.0078 -0.0180 0.0141  10  GLN B OE1 
39   N NE2 . GLN A 5   ? 0.2800 0.2821 0.2769 -0.0072 -0.0216 0.0175  10  GLN B NE2 
40   N N   . PHE A 6   ? 0.1375 0.1317 0.1320 -0.0077 -0.0177 0.0134  11  PHE B N   
41   C CA  . PHE A 6   ? 0.1384 0.1319 0.1326 -0.0081 -0.0169 0.0129  11  PHE B CA  
42   C C   . PHE A 6   ? 0.1392 0.1363 0.1329 -0.0108 -0.0165 0.0135  11  PHE B C   
43   O O   . PHE A 6   ? 0.1479 0.1487 0.1415 -0.0123 -0.0156 0.0131  11  PHE B O   
44   C CB  . PHE A 6   ? 0.1410 0.1341 0.1355 -0.0068 -0.0144 0.0108  11  PHE B CB  
45   C CG  . PHE A 6   ? 0.1394 0.1294 0.1344 -0.0042 -0.0147 0.0102  11  PHE B CG  
46   C CD1 . PHE A 6   ? 0.1544 0.1414 0.1493 -0.0031 -0.0160 0.0107  11  PHE B CD1 
47   C CD2 . PHE A 6   ? 0.1499 0.1400 0.1454 -0.0028 -0.0135 0.0090  11  PHE B CD2 
48   C CE1 . PHE A 6   ? 0.1688 0.1534 0.1639 -0.0010 -0.0161 0.0099  11  PHE B CE1 
49   C CE2 . PHE A 6   ? 0.1635 0.1512 0.1593 -0.0005 -0.0138 0.0084  11  PHE B CE2 
50   C CZ  . PHE A 6   ? 0.1682 0.1532 0.1639 0.0004  -0.0149 0.0087  11  PHE B CZ  
51   N N   . ASP A 7   ? 0.1355 0.1320 0.1288 -0.0116 -0.0174 0.0145  12  ASP B N   
52   C CA  . ASP A 7   ? 0.1475 0.1477 0.1404 -0.0142 -0.0168 0.0148  12  ASP B CA  
53   C C   . ASP A 7   ? 0.1418 0.1428 0.1349 -0.0137 -0.0141 0.0126  12  ASP B C   
54   O O   . ASP A 7   ? 0.1314 0.1301 0.1248 -0.0125 -0.0139 0.0123  12  ASP B O   
55   C CB  . ASP A 7   ? 0.1725 0.1715 0.1649 -0.0152 -0.0190 0.0169  12  ASP B CB  
56   C CG  . ASP A 7   ? 0.1914 0.1944 0.1833 -0.0177 -0.0183 0.0171  12  ASP B CG  
57   O OD1 . ASP A 7   ? 0.2105 0.2173 0.2024 -0.0187 -0.0163 0.0157  12  ASP B OD1 
58   O OD2 . ASP A 7   ? 0.2405 0.2427 0.2320 -0.0184 -0.0197 0.0185  12  ASP B OD2 
59   N N   . PRO A 8   ? 0.1457 0.1498 0.1390 -0.0146 -0.0120 0.0110  13  PRO B N   
60   C CA  . PRO A 8   ? 0.1657 0.1701 0.1598 -0.0139 -0.0095 0.0089  13  PRO B CA  
61   C C   . PRO A 8   ? 0.1569 0.1619 0.1511 -0.0143 -0.0092 0.0092  13  PRO B C   
62   O O   . PRO A 8   ? 0.1744 0.1779 0.1694 -0.0128 -0.0078 0.0081  13  PRO B O   
63   C CB  . PRO A 8   ? 0.1748 0.1827 0.1690 -0.0153 -0.0076 0.0073  13  PRO B CB  
64   C CG  . PRO A 8   ? 0.1736 0.1819 0.1673 -0.0157 -0.0089 0.0082  13  PRO B CG  
65   C CD  . PRO A 8   ? 0.1627 0.1703 0.1558 -0.0163 -0.0118 0.0109  13  PRO B CD  
66   N N   . SER A 9   ? 0.1639 0.1712 0.1573 -0.0165 -0.0106 0.0107  14  SER B N   
67   C CA  . SER A 9   ? 0.1813 0.1900 0.1747 -0.0172 -0.0104 0.0110  14  SER B CA  
68   C C   . SER A 9   ? 0.1847 0.1897 0.1781 -0.0156 -0.0116 0.0120  14  SER B C   
69   O O   . SER A 9   ? 0.1861 0.1918 0.1798 -0.0157 -0.0111 0.0120  14  SER B O   
70   C CB  . SER A 9   ? 0.2021 0.2148 0.1946 -0.0202 -0.0117 0.0126  14  SER B CB  
71   O OG  . SER A 9   ? 0.2565 0.2675 0.2482 -0.0208 -0.0146 0.0151  14  SER B OG  
72   N N   . HIS A 10  ? 0.1627 0.1637 0.1559 -0.0142 -0.0132 0.0128  15  HIS B N   
73   C CA  . HIS A 10  ? 0.1538 0.1513 0.1471 -0.0125 -0.0141 0.0133  15  HIS B CA  
74   C C   . HIS A 10  ? 0.1516 0.1458 0.1454 -0.0099 -0.0136 0.0122  15  HIS B C   
75   O O   . HIS A 10  ? 0.1635 0.1545 0.1571 -0.0086 -0.0150 0.0127  15  HIS B O   
76   C CB  . HIS A 10  ? 0.1855 0.1812 0.1780 -0.0134 -0.0170 0.0154  15  HIS B CB  
77   C CG  . HIS A 10  ? 0.1862 0.1850 0.1780 -0.0161 -0.0178 0.0168  15  HIS B CG  
78   N ND1 . HIS A 10  ? 0.2104 0.2127 0.2019 -0.0183 -0.0183 0.0177  15  HIS B ND1 
79   C CD2 . HIS A 10  ? 0.2065 0.2063 0.1982 -0.0168 -0.0179 0.0174  15  HIS B CD2 
80   C CE1 . HIS A 10  ? 0.2163 0.2214 0.2073 -0.0205 -0.0187 0.0188  15  HIS B CE1 
81   N NE2 . HIS A 10  ? 0.1997 0.2032 0.1908 -0.0195 -0.0186 0.0187  15  HIS B NE2 
82   N N   . THR A 11  ? 0.1280 0.1233 0.1226 -0.0092 -0.0115 0.0106  16  THR B N   
83   C CA  . THR A 11  ? 0.1217 0.1146 0.1169 -0.0069 -0.0107 0.0095  16  THR B CA  
84   C C   . THR A 11  ? 0.1285 0.1224 0.1248 -0.0062 -0.0080 0.0079  16  THR B C   
85   O O   . THR A 11  ? 0.1202 0.1163 0.1170 -0.0071 -0.0064 0.0068  16  THR B O   
86   C CB  . THR A 11  ? 0.1214 0.1142 0.1163 -0.0068 -0.0111 0.0093  16  THR B CB  
87   O OG1 . THR A 11  ? 0.1275 0.1194 0.1217 -0.0075 -0.0137 0.0110  16  THR B OG1 
88   C CG2 . THR A 11  ? 0.1244 0.1153 0.1200 -0.0046 -0.0104 0.0082  16  THR B CG2 
89   N N   . TYR A 12  ? 0.1336 0.1259 0.1305 -0.0046 -0.0076 0.0079  17  TYR B N   
90   C CA  . TYR A 12  ? 0.1301 0.1231 0.1284 -0.0037 -0.0052 0.0068  17  TYR B CA  
91   C C   . TYR A 12  ? 0.1306 0.1215 0.1295 -0.0016 -0.0051 0.0069  17  TYR B C   
92   O O   . TYR A 12  ? 0.1314 0.1210 0.1296 -0.0011 -0.0066 0.0079  17  TYR B O   
93   C CB  . TYR A 12  ? 0.1403 0.1354 0.1392 -0.0045 -0.0045 0.0070  17  TYR B CB  
94   C CG  . TYR A 12  ? 0.1335 0.1313 0.1317 -0.0068 -0.0048 0.0072  17  TYR B CG  
95   C CD1 . TYR A 12  ? 0.1396 0.1399 0.1385 -0.0078 -0.0029 0.0057  17  TYR B CD1 
96   C CD2 . TYR A 12  ? 0.1396 0.1377 0.1365 -0.0081 -0.0069 0.0087  17  TYR B CD2 
97   C CE1 . TYR A 12  ? 0.1432 0.1469 0.1416 -0.0100 -0.0030 0.0057  17  TYR B CE1 
98   C CE2 . TYR A 12  ? 0.1545 0.1557 0.1508 -0.0104 -0.0072 0.0090  17  TYR B CE2 
99   C CZ  . TYR A 12  ? 0.1530 0.1572 0.1500 -0.0114 -0.0054 0.0076  17  TYR B CZ  
100  O OH  . TYR A 12  ? 0.1790 0.1868 0.1753 -0.0138 -0.0057 0.0079  17  TYR B OH  
101  N N   . PRO A 13  ? 0.1234 0.1139 0.1235 -0.0004 -0.0033 0.0059  18  PRO B N   
102  C CA  . PRO A 13  ? 0.1223 0.1117 0.1232 0.0013  -0.0028 0.0062  18  PRO B CA  
103  C C   . PRO A 13  ? 0.1141 0.1046 0.1165 0.0015  -0.0014 0.0063  18  PRO B C   
104  O O   . PRO A 13  ? 0.1104 0.1020 0.1143 0.0013  0.0005  0.0054  18  PRO B O   
105  C CB  . PRO A 13  ? 0.1400 0.1287 0.1416 0.0021  -0.0017 0.0053  18  PRO B CB  
106  C CG  . PRO A 13  ? 0.1388 0.1288 0.1404 0.0007  -0.0007 0.0042  18  PRO B CG  
107  C CD  . PRO A 13  ? 0.1311 0.1224 0.1317 -0.0009 -0.0018 0.0046  18  PRO B CD  
108  N N   . SER A 14  ? 0.1189 0.1094 0.1213 0.0020  -0.0022 0.0074  19  SER B N   
109  C CA  . SER A 14  ? 0.1203 0.1120 0.1242 0.0026  -0.0009 0.0079  19  SER B CA  
110  C C   . SER A 14  ? 0.1197 0.1107 0.1248 0.0044  -0.0003 0.0084  19  SER B C   
111  O O   . SER A 14  ? 0.1181 0.1077 0.1221 0.0050  -0.0013 0.0083  19  SER B O   
112  C CB  . SER A 14  ? 0.1241 0.1168 0.1272 0.0019  -0.0023 0.0091  19  SER B CB  
113  O OG  . SER A 14  ? 0.1383 0.1322 0.1405 0.0001  -0.0029 0.0090  19  SER B OG  
114  N N   . PHE A 15  ? 0.1234 0.1153 0.1306 0.0052  0.0011  0.0088  20  PHE B N   
115  C CA  . PHE A 15  ? 0.1188 0.1103 0.1272 0.0067  0.0017  0.0095  20  PHE B CA  
116  C C   . PHE A 15  ? 0.1276 0.1207 0.1375 0.0075  0.0021  0.0110  20  PHE B C   
117  O O   . PHE A 15  ? 0.1135 0.1081 0.1242 0.0070  0.0026  0.0112  20  PHE B O   
118  C CB  . PHE A 15  ? 0.1330 0.1237 0.1432 0.0073  0.0036  0.0087  20  PHE B CB  
119  C CG  . PHE A 15  ? 0.1340 0.1252 0.1461 0.0070  0.0054  0.0079  20  PHE B CG  
120  C CD1 . PHE A 15  ? 0.1526 0.1446 0.1671 0.0079  0.0068  0.0087  20  PHE B CD1 
121  C CD2 . PHE A 15  ? 0.1604 0.1515 0.1716 0.0056  0.0058  0.0063  20  PHE B CD2 
122  C CE1 . PHE A 15  ? 0.1822 0.1749 0.1987 0.0076  0.0085  0.0076  20  PHE B CE1 
123  C CE2 . PHE A 15  ? 0.1721 0.1641 0.1850 0.0052  0.0075  0.0051  20  PHE B CE2 
124  C CZ  . PHE A 15  ? 0.1679 0.1604 0.1834 0.0062  0.0089  0.0057  20  PHE B CZ  
125  N N   . GLU A 16  ? 0.1215 0.1148 0.1322 0.0087  0.0021  0.0121  21  GLU B N   
126  C CA  . GLU A 16  ? 0.1293 0.1243 0.1419 0.0096  0.0028  0.0137  21  GLU B CA  
127  C C   . GLU A 16  ? 0.1374 0.1321 0.1521 0.0108  0.0041  0.0143  21  GLU B C   
128  O O   . GLU A 16  ? 0.1541 0.1480 0.1679 0.0110  0.0036  0.0141  21  GLU B O   
129  C CB  . GLU A 16  ? 0.1482 0.1447 0.1595 0.0096  0.0012  0.0150  21  GLU B CB  
130  C CG  . GLU A 16  ? 0.1570 0.1537 0.1661 0.0082  -0.0003 0.0147  21  GLU B CG  
131  C CD  . GLU A 16  ? 0.2157 0.2138 0.2235 0.0079  -0.0020 0.0157  21  GLU B CD  
132  O OE1 . GLU A 16  ? 0.2591 0.2580 0.2673 0.0088  -0.0020 0.0165  21  GLU B OE1 
133  O OE2 . GLU A 16  ? 0.2413 0.2395 0.2474 0.0067  -0.0033 0.0157  21  GLU B OE2 
134  N N   . ALA A 17  ? 0.1317 0.1270 0.1495 0.0116  0.0058  0.0151  22  ALA B N   
135  C CA  . ALA A 17  ? 0.1472 0.1420 0.1674 0.0128  0.0070  0.0160  22  ALA B CA  
136  C C   . ALA A 17  ? 0.1719 0.1688 0.1950 0.0139  0.0077  0.0182  22  ALA B C   
137  O O   . ALA A 17  ? 0.1696 0.1679 0.1934 0.0139  0.0079  0.0186  22  ALA B O   
138  C CB  . ALA A 17  ? 0.1570 0.1498 0.1787 0.0127  0.0087  0.0145  22  ALA B CB  
139  N N   . ASP A 18  ? 0.1642 0.1614 0.1892 0.0149  0.0082  0.0199  23  ASP B N   
140  C CA  . ASP A 18  ? 0.1797 0.1792 0.2075 0.0160  0.0087  0.0225  23  ASP B CA  
141  C C   . ASP A 18  ? 0.1825 0.1810 0.2141 0.0169  0.0107  0.0226  23  ASP B C   
142  O O   . ASP A 18  ? 0.2142 0.2101 0.2468 0.0168  0.0120  0.0209  23  ASP B O   
143  C CB  . ASP A 18  ? 0.1952 0.1954 0.2240 0.0166  0.0086  0.0244  23  ASP B CB  
144  C CG  . ASP A 18  ? 0.2245 0.2273 0.2564 0.0177  0.0090  0.0275  23  ASP B CG  
145  O OD1 . ASP A 18  ? 0.2529 0.2585 0.2841 0.0176  0.0081  0.0285  23  ASP B OD1 
146  O OD2 . ASP A 18  ? 0.2578 0.2600 0.2930 0.0187  0.0102  0.0289  23  ASP B OD2 
147  N N   . HIS A 19  ? 0.1678 0.1687 0.2017 0.0178  0.0110  0.0243  24  HIS B N   
148  C CA  . HIS A 19  ? 0.1753 0.1758 0.2136 0.0191  0.0130  0.0249  24  HIS B CA  
149  C C   . HIS A 19  ? 0.1798 0.1827 0.2211 0.0205  0.0130  0.0285  24  HIS B C   
150  O O   . HIS A 19  ? 0.1816 0.1878 0.2225 0.0206  0.0120  0.0303  24  HIS B O   
151  C CB  . HIS A 19  ? 0.1712 0.1728 0.2101 0.0191  0.0135  0.0238  24  HIS B CB  
152  C CG  . HIS A 19  ? 0.1953 0.1960 0.2389 0.0205  0.0157  0.0236  24  HIS B CG  
153  N ND1 . HIS A 19  ? 0.2237 0.2269 0.2703 0.0218  0.0164  0.0249  24  HIS B ND1 
154  C CD2 . HIS A 19  ? 0.2360 0.2335 0.2819 0.0209  0.0174  0.0221  24  HIS B CD2 
155  C CE1 . HIS A 19  ? 0.2268 0.2282 0.2774 0.0230  0.0185  0.0241  24  HIS B CE1 
156  N NE2 . HIS A 19  ? 0.2384 0.2361 0.2886 0.0225  0.0191  0.0225  24  HIS B NE2 
157  N N   . PHE A 20  ? 0.2330 0.2342 0.2775 0.0214  0.0141  0.0296  25  PHE B N   
158  C CA  . PHE A 20  ? 0.2418 0.2450 0.2901 0.0229  0.0144  0.0334  25  PHE B CA  
159  C C   . PHE A 20  ? 0.2370 0.2439 0.2834 0.0225  0.0126  0.0358  25  PHE B C   
160  O O   . PHE A 20  ? 0.2509 0.2614 0.2988 0.0231  0.0122  0.0385  25  PHE B O   
161  C CB  . PHE A 20  ? 0.2750 0.2799 0.3272 0.0243  0.0155  0.0345  25  PHE B CB  
162  C CG  . PHE A 20  ? 0.3566 0.3582 0.4124 0.0253  0.0176  0.0328  25  PHE B CG  
163  C CD1 . PHE A 20  ? 0.4214 0.4190 0.4780 0.0252  0.0186  0.0313  25  PHE B CD1 
164  C CD2 . PHE A 20  ? 0.4396 0.4427 0.4982 0.0265  0.0186  0.0327  25  PHE B CD2 
165  C CE1 . PHE A 20  ? 0.4536 0.4482 0.5136 0.0260  0.0207  0.0295  25  PHE B CE1 
166  C CE2 . PHE A 20  ? 0.4349 0.4352 0.4970 0.0275  0.0207  0.0308  25  PHE B CE2 
167  C CZ  . PHE A 20  ? 0.4268 0.4227 0.4896 0.0273  0.0218  0.0292  25  PHE B CZ  
168  N N   . GLY A 21  ? 0.2306 0.2369 0.2734 0.0212  0.0115  0.0348  26  GLY B N   
169  C CA  . GLY A 21  ? 0.2444 0.2543 0.2855 0.0207  0.0100  0.0368  26  GLY B CA  
170  C C   . GLY A 21  ? 0.2525 0.2659 0.2917 0.0203  0.0087  0.0373  26  GLY B C   
171  O O   . GLY A 21  ? 0.2864 0.3037 0.3265 0.0206  0.0081  0.0401  26  GLY B O   
172  N N   . GLY A 22  ? 0.2044 0.2166 0.2405 0.0193  0.0082  0.0345  27  GLY B N   
173  C CA  . GLY A 22  ? 0.2106 0.2255 0.2443 0.0185  0.0068  0.0345  27  GLY B CA  
174  C C   . GLY A 22  ? 0.1904 0.2071 0.2261 0.0190  0.0074  0.0352  27  GLY B C   
175  O O   . GLY A 22  ? 0.2105 0.2303 0.2448 0.0183  0.0063  0.0360  27  GLY B O   
176  N N   . LEU A 23  ? 0.1767 0.1917 0.2160 0.0202  0.0091  0.0351  28  LEU B N   
177  C CA  . LEU A 23  ? 0.1716 0.1884 0.2130 0.0209  0.0098  0.0355  28  LEU B CA  
178  C C   . LEU A 23  ? 0.1630 0.1795 0.2010 0.0194  0.0091  0.0329  28  LEU B C   
179  O O   . LEU A 23  ? 0.1658 0.1853 0.2035 0.0190  0.0086  0.0335  28  LEU B O   
180  C CB  . LEU A 23  ? 0.1786 0.1934 0.2246 0.0225  0.0120  0.0355  28  LEU B CB  
181  C CG  . LEU A 23  ? 0.1841 0.2010 0.2330 0.0235  0.0130  0.0359  28  LEU B CG  
182  C CD1 . LEU A 23  ? 0.1857 0.2074 0.2364 0.0243  0.0123  0.0396  28  LEU B CD1 
183  C CD2 . LEU A 23  ? 0.2215 0.2355 0.2748 0.0252  0.0152  0.0352  28  LEU B CD2 
184  N N   . SER A 24  ? 0.1465 0.1594 0.1824 0.0186  0.0092  0.0301  29  SER B N   
185  C CA  . SER A 24  ? 0.1567 0.1691 0.1893 0.0170  0.0084  0.0278  29  SER B CA  
186  C C   . SER A 24  ? 0.1591 0.1679 0.1889 0.0161  0.0080  0.0255  29  SER B C   
187  O O   . SER A 24  ? 0.1629 0.1698 0.1934 0.0166  0.0084  0.0255  29  SER B O   
188  C CB  . SER A 24  ? 0.1611 0.1742 0.1957 0.0173  0.0097  0.0268  29  SER B CB  
189  O OG  . SER A 24  ? 0.1828 0.1928 0.2192 0.0180  0.0114  0.0251  29  SER B OG  
190  N N   . VAL A 25  ? 0.1513 0.1595 0.1781 0.0146  0.0071  0.0235  30  VAL B N   
191  C CA  . VAL A 25  ? 0.1518 0.1569 0.1757 0.0135  0.0064  0.0213  30  VAL B CA  
192  C C   . VAL A 25  ? 0.1503 0.1539 0.1745 0.0130  0.0075  0.0191  30  VAL B C   
193  O O   . VAL A 25  ? 0.1593 0.1645 0.1827 0.0121  0.0072  0.0186  30  VAL B O   
194  C CB  . VAL A 25  ? 0.1623 0.1678 0.1824 0.0121  0.0042  0.0211  30  VAL B CB  
195  C CG1 . VAL A 25  ? 0.1655 0.1680 0.1829 0.0112  0.0035  0.0190  30  VAL B CG1 
196  C CG2 . VAL A 25  ? 0.1759 0.1834 0.1956 0.0124  0.0031  0.0230  30  VAL B CG2 
197  N N   . TRP A 26  ? 0.1440 0.1449 0.1689 0.0132  0.0087  0.0177  31  TRP B N   
198  C CA  . TRP A 26  ? 0.1407 0.1402 0.1651 0.0123  0.0095  0.0152  31  TRP B CA  
199  C C   . TRP A 26  ? 0.1485 0.1475 0.1691 0.0107  0.0077  0.0141  31  TRP B C   
200  O O   . TRP A 26  ? 0.1726 0.1703 0.1913 0.0105  0.0065  0.0143  31  TRP B O   
201  C CB  . TRP A 26  ? 0.1628 0.1598 0.1888 0.0128  0.0110  0.0140  31  TRP B CB  
202  C CG  . TRP A 26  ? 0.1686 0.1653 0.1986 0.0139  0.0132  0.0137  31  TRP B CG  
203  C CD1 . TRP A 26  ? 0.1934 0.1893 0.2266 0.0155  0.0143  0.0152  31  TRP B CD1 
204  C CD2 . TRP A 26  ? 0.1907 0.1882 0.2220 0.0137  0.0146  0.0120  31  TRP B CD2 
205  N NE1 . TRP A 26  ? 0.2232 0.2190 0.2600 0.0164  0.0163  0.0145  31  TRP B NE1 
206  C CE2 . TRP A 26  ? 0.2071 0.2040 0.2427 0.0153  0.0166  0.0123  31  TRP B CE2 
207  C CE3 . TRP A 26  ? 0.2194 0.2183 0.2488 0.0122  0.0143  0.0103  31  TRP B CE3 
208  C CZ2 . TRP A 26  ? 0.2207 0.2182 0.2587 0.0156  0.0184  0.0107  31  TRP B CZ2 
209  C CZ3 . TRP A 26  ? 0.2159 0.2159 0.2475 0.0123  0.0161  0.0087  31  TRP B CZ3 
210  C CH2 . TRP A 26  ? 0.2094 0.2087 0.2454 0.0141  0.0182  0.0088  31  TRP B CH2 
211  N N   . ARG A 27  ? 0.1356 0.1356 0.1549 0.0094  0.0073  0.0131  32  ARG B N   
212  C CA  . ARG A 27  ? 0.1414 0.1406 0.1573 0.0077  0.0057  0.0122  32  ARG B CA  
213  C C   . ARG A 27  ? 0.1468 0.1458 0.1628 0.0067  0.0067  0.0101  32  ARG B C   
214  O O   . ARG A 27  ? 0.1797 0.1802 0.1976 0.0068  0.0083  0.0094  32  ARG B O   
215  C CB  . ARG A 27  ? 0.1608 0.1618 0.1748 0.0067  0.0038  0.0132  32  ARG B CB  
216  C CG  . ARG A 27  ? 0.1618 0.1633 0.1753 0.0073  0.0026  0.0149  32  ARG B CG  
217  C CD  . ARG A 27  ? 0.1846 0.1874 0.1957 0.0058  0.0006  0.0156  32  ARG B CD  
218  N NE  . ARG A 27  ? 0.1962 0.1992 0.2065 0.0063  -0.0005 0.0168  32  ARG B NE  
219  C CZ  . ARG A 27  ? 0.2012 0.2065 0.2130 0.0071  -0.0002 0.0185  32  ARG B CZ  
220  N NH1 . ARG A 27  ? 0.2072 0.2148 0.2214 0.0077  0.0010  0.0193  32  ARG B NH1 
221  N NH2 . ARG A 27  ? 0.2385 0.2438 0.2492 0.0073  -0.0014 0.0193  32  ARG B NH2 
222  N N   . GLY A 28  ? 0.1411 0.1386 0.1547 0.0056  0.0058  0.0091  33  GLY B N   
223  C CA  . GLY A 28  ? 0.1383 0.1361 0.1515 0.0043  0.0065  0.0072  33  GLY B CA  
224  C C   . GLY A 28  ? 0.1280 0.1244 0.1386 0.0032  0.0050  0.0067  33  GLY B C   
225  O O   . GLY A 28  ? 0.1265 0.1216 0.1353 0.0034  0.0031  0.0077  33  GLY B O   
226  N N   . LYS A 29  ? 0.1190 0.1155 0.1291 0.0020  0.0057  0.0050  34  LYS B N   
227  C CA  . LYS A 29  ? 0.1169 0.1124 0.1246 0.0009  0.0041  0.0048  34  LYS B CA  
228  C C   . LYS A 29  ? 0.1165 0.1122 0.1246 0.0001  0.0055  0.0029  34  LYS B C   
229  O O   . LYS A 29  ? 0.1432 0.1397 0.1533 0.0002  0.0076  0.0016  34  LYS B O   
230  C CB  . LYS A 29  ? 0.1275 0.1242 0.1330 -0.0006 0.0020  0.0056  34  LYS B CB  
231  C CG  . LYS A 29  ? 0.1333 0.1329 0.1391 -0.0021 0.0028  0.0047  34  LYS B CG  
232  C CD  . LYS A 29  ? 0.1765 0.1778 0.1803 -0.0039 0.0009  0.0059  34  LYS B CD  
233  C CE  . LYS A 29  ? 0.1689 0.1684 0.1707 -0.0044 -0.0016 0.0071  34  LYS B CE  
234  N NZ  . LYS A 29  ? 0.1762 0.1770 0.1763 -0.0062 -0.0036 0.0084  34  LYS B NZ  
235  N N   . PHE A 30  ? 0.1108 0.1057 0.1171 -0.0005 0.0045  0.0026  35  PHE B N   
236  C CA  . PHE A 30  ? 0.1084 0.1041 0.1146 -0.0018 0.0055  0.0009  35  PHE B CA  
237  C C   . PHE A 30  ? 0.1195 0.1172 0.1237 -0.0038 0.0040  0.0011  35  PHE B C   
238  O O   . PHE A 30  ? 0.1219 0.1190 0.1245 -0.0040 0.0018  0.0025  35  PHE B O   
239  C CB  . PHE A 30  ? 0.1053 0.0991 0.1110 -0.0013 0.0052  0.0007  35  PHE B CB  
240  C CG  . PHE A 30  ? 0.1060 0.0980 0.1137 0.0003  0.0066  0.0006  35  PHE B CG  
241  C CD1 . PHE A 30  ? 0.1156 0.1064 0.1236 0.0020  0.0059  0.0022  35  PHE B CD1 
242  C CD2 . PHE A 30  ? 0.1095 0.1012 0.1188 0.0002  0.0088  -0.0009 35  PHE B CD2 
243  C CE1 . PHE A 30  ? 0.1235 0.1130 0.1333 0.0034  0.0072  0.0023  35  PHE B CE1 
244  C CE2 . PHE A 30  ? 0.1271 0.1171 0.1383 0.0015  0.0101  -0.0008 35  PHE B CE2 
245  C CZ  . PHE A 30  ? 0.1249 0.1139 0.1366 0.0032  0.0093  0.0010  35  PHE B CZ  
246  N N   . ASP A 31  ? 0.1247 0.1250 0.1293 -0.0054 0.0052  -0.0002 36  ASP B N   
247  C CA  . ASP A 31  ? 0.1315 0.1346 0.1344 -0.0075 0.0040  0.0001  36  ASP B CA  
248  C C   . ASP A 31  ? 0.1374 0.1410 0.1387 -0.0089 0.0028  0.0002  36  ASP B C   
249  O O   . ASP A 31  ? 0.1527 0.1582 0.1525 -0.0106 0.0011  0.0013  36  ASP B O   
250  C CB  . ASP A 31  ? 0.1508 0.1572 0.1547 -0.0088 0.0057  -0.0013 36  ASP B CB  
251  C CG  . ASP A 31  ? 0.2039 0.2109 0.2095 -0.0078 0.0067  -0.0012 36  ASP B CG  
252  O OD1 . ASP A 31  ? 0.2101 0.2155 0.2159 -0.0064 0.0058  0.0003  36  ASP B OD1 
253  O OD2 . ASP A 31  ? 0.2357 0.2456 0.2424 -0.0085 0.0085  -0.0029 36  ASP B OD2 
254  N N   . LYS A 32  ? 0.1282 0.1304 0.1297 -0.0084 0.0035  -0.0007 37  LYS B N   
255  C CA  . LYS A 32  ? 0.1438 0.1473 0.1440 -0.0099 0.0027  -0.0008 37  LYS B CA  
256  C C   . LYS A 32  ? 0.1353 0.1361 0.1350 -0.0085 0.0016  0.0000  37  LYS B C   
257  O O   . LYS A 32  ? 0.1356 0.1346 0.1364 -0.0071 0.0029  -0.0009 37  LYS B O   
258  C CB  . LYS A 32  ? 0.1772 0.1829 0.1779 -0.0113 0.0048  -0.0032 37  LYS B CB  
259  C CG  . LYS A 32  ? 0.2455 0.2549 0.2463 -0.0133 0.0058  -0.0043 37  LYS B CG  
260  C CD  . LYS A 32  ? 0.3432 0.3557 0.3422 -0.0153 0.0037  -0.0027 37  LYS B CD  
261  C CE  . LYS A 32  ? 0.4443 0.4565 0.4418 -0.0158 0.0017  -0.0013 37  LYS B CE  
262  N NZ  . LYS A 32  ? 0.4170 0.4314 0.4130 -0.0175 -0.0006 0.0008  37  LYS B NZ  
263  N N   . SER A 33  ? 0.1324 0.1329 0.1307 -0.0087 -0.0007 0.0016  38  SER B N   
264  C CA  . SER A 33  ? 0.1334 0.1319 0.1313 -0.0074 -0.0021 0.0024  38  SER B CA  
265  C C   . SER A 33  ? 0.1388 0.1389 0.1355 -0.0088 -0.0040 0.0035  38  SER B C   
266  O O   . SER A 33  ? 0.1492 0.1513 0.1451 -0.0105 -0.0048 0.0043  38  SER B O   
267  C CB  . SER A 33  ? 0.1506 0.1461 0.1484 -0.0055 -0.0034 0.0036  38  SER B CB  
268  O OG  . SER A 33  ? 0.1595 0.1538 0.1586 -0.0041 -0.0018 0.0030  38  SER B OG  
269  N N   . SER A 34  ? 0.1349 0.1341 0.1314 -0.0079 -0.0046 0.0037  39  SER B N   
270  C CA  . SER A 34  ? 0.1337 0.1340 0.1293 -0.0087 -0.0065 0.0050  39  SER B CA  
271  C C   . SER A 34  ? 0.1398 0.1380 0.1356 -0.0066 -0.0076 0.0054  39  SER B C   
272  O O   . SER A 34  ? 0.1468 0.1435 0.1432 -0.0051 -0.0064 0.0044  39  SER B O   
273  C CB  . SER A 34  ? 0.1672 0.1713 0.1626 -0.0109 -0.0056 0.0042  39  SER B CB  
274  O OG  . SER A 34  ? 0.1890 0.1931 0.1849 -0.0104 -0.0039 0.0025  39  SER B OG  
275  N N   . GLY A 35  ? 0.1182 0.1165 0.1136 -0.0067 -0.0097 0.0070  40  GLY B N   
276  C CA  . GLY A 35  ? 0.1173 0.1142 0.1130 -0.0048 -0.0107 0.0072  40  GLY B CA  
277  C C   . GLY A 35  ? 0.1178 0.1134 0.1134 -0.0043 -0.0134 0.0091  40  GLY B C   
278  O O   . GLY A 35  ? 0.1235 0.1200 0.1188 -0.0059 -0.0146 0.0105  40  GLY B O   
279  N N   . THR A 36  ? 0.1241 0.1178 0.1202 -0.0021 -0.0142 0.0091  41  THR B N   
280  C CA  . THR A 36  ? 0.1405 0.1330 0.1370 -0.0013 -0.0166 0.0106  41  THR B CA  
281  C C   . THR A 36  ? 0.1466 0.1355 0.1434 0.0012  -0.0174 0.0101  41  THR B C   
282  O O   . THR A 36  ? 0.1372 0.1256 0.1342 0.0027  -0.0161 0.0086  41  THR B O   
283  C CB  . THR A 36  ? 0.1639 0.1590 0.1608 -0.0012 -0.0168 0.0109  41  THR B CB  
284  O OG1 . THR A 36  ? 0.2039 0.2027 0.2003 -0.0036 -0.0158 0.0109  41  THR B OG1 
285  C CG2 . THR A 36  ? 0.1691 0.1633 0.1667 -0.0004 -0.0193 0.0127  41  THR B CG2 
286  N N   . VAL A 37  ? 0.1504 0.1368 0.1475 0.0016  -0.0196 0.0114  42  VAL B N   
287  C CA  . VAL A 37  ? 0.1620 0.1450 0.1595 0.0039  -0.0207 0.0109  42  VAL B CA  
288  C C   . VAL A 37  ? 0.1642 0.1466 0.1628 0.0050  -0.0227 0.0120  42  VAL B C   
289  O O   . VAL A 37  ? 0.1783 0.1614 0.1772 0.0036  -0.0241 0.0139  42  VAL B O   
290  C CB  . VAL A 37  ? 0.1880 0.1682 0.1851 0.0035  -0.0216 0.0113  42  VAL B CB  
291  C CG1 . VAL A 37  ? 0.1903 0.1669 0.1879 0.0056  -0.0231 0.0107  42  VAL B CG1 
292  C CG2 . VAL A 37  ? 0.2042 0.1854 0.2005 0.0026  -0.0197 0.0104  42  VAL B CG2 
293  N N   . THR A 38  ? 0.1521 0.1332 0.1515 0.0075  -0.0229 0.0108  43  THR B N   
294  C CA  . THR A 38  ? 0.1700 0.1493 0.1707 0.0090  -0.0250 0.0116  43  THR B CA  
295  C C   . THR A 38  ? 0.1643 0.1397 0.1653 0.0108  -0.0259 0.0106  43  THR B C   
296  O O   . THR A 38  ? 0.1760 0.1509 0.1764 0.0116  -0.0247 0.0088  43  THR B O   
297  C CB  . THR A 38  ? 0.1817 0.1634 0.1834 0.0107  -0.0246 0.0111  43  THR B CB  
298  O OG1 . THR A 38  ? 0.1909 0.1725 0.1925 0.0125  -0.0233 0.0089  43  THR B OG1 
299  C CG2 . THR A 38  ? 0.1875 0.1735 0.1889 0.0089  -0.0235 0.0118  43  THR B CG2 
300  N N   . LEU A 39  ? 0.1863 0.1585 0.1882 0.0112  -0.0283 0.0118  44  LEU B N   
301  C CA  . LEU A 39  ? 0.2113 0.1796 0.2135 0.0126  -0.0292 0.0106  44  LEU B CA  
302  C C   . LEU A 39  ? 0.2529 0.2185 0.2571 0.0143  -0.0314 0.0112  44  LEU B C   
303  O O   . LEU A 39  ? 0.2785 0.2441 0.2835 0.0132  -0.0330 0.0137  44  LEU B O   
304  C CB  . LEU A 39  ? 0.2585 0.2247 0.2595 0.0105  -0.0298 0.0115  44  LEU B CB  
305  C CG  . LEU A 39  ? 0.3089 0.2719 0.3094 0.0112  -0.0300 0.0099  44  LEU B CG  
306  C CD1 . LEU A 39  ? 0.3226 0.2872 0.3223 0.0123  -0.0279 0.0076  44  LEU B CD1 
307  C CD2 . LEU A 39  ? 0.3302 0.2920 0.3297 0.0087  -0.0308 0.0114  44  LEU B CD2 
308  N N   . ASP A 40  ? 0.2514 0.2152 0.2563 0.0169  -0.0315 0.0091  45  ASP B N   
309  C CA  . ASP A 40  ? 0.3240 0.2847 0.3312 0.0191  -0.0335 0.0091  45  ASP B CA  
310  C C   . ASP A 40  ? 0.3107 0.2673 0.3176 0.0200  -0.0339 0.0070  45  ASP B C   
311  O O   . ASP A 40  ? 0.3338 0.2910 0.3407 0.0220  -0.0329 0.0043  45  ASP B O   
312  C CB  . ASP A 40  ? 0.3773 0.3405 0.3858 0.0214  -0.0329 0.0082  45  ASP B CB  
313  C CG  . ASP A 40  ? 0.4411 0.4013 0.4524 0.0237  -0.0351 0.0085  45  ASP B CG  
314  O OD1 . ASP A 40  ? 0.4743 0.4298 0.4861 0.0236  -0.0367 0.0087  45  ASP B OD1 
315  O OD2 . ASP A 40  ? 0.5031 0.4657 0.5159 0.0255  -0.0350 0.0086  45  ASP B OD2 
316  N N   . ARG A 41  ? 0.3719 0.3251 0.3785 0.0183  -0.0355 0.0082  46  ARG B N   
317  C CA  . ARG A 41  ? 0.3816 0.3309 0.3877 0.0185  -0.0360 0.0064  46  ARG B CA  
318  C C   . ARG A 41  ? 0.4169 0.3633 0.4249 0.0216  -0.0369 0.0042  46  ARG B C   
319  O O   . ARG A 41  ? 0.4361 0.3821 0.4435 0.0228  -0.0361 0.0014  46  ARG B O   
320  C CB  . ARG A 41  ? 0.4026 0.3493 0.4080 0.0158  -0.0375 0.0086  46  ARG B CB  
321  C CG  . ARG A 41  ? 0.4293 0.3792 0.4325 0.0129  -0.0362 0.0100  46  ARG B CG  
322  C CD  . ARG A 41  ? 0.4540 0.4023 0.4567 0.0100  -0.0377 0.0126  46  ARG B CD  
323  N NE  . ARG A 41  ? 0.4973 0.4423 0.4990 0.0094  -0.0383 0.0114  46  ARG B NE  
324  C CZ  . ARG A 41  ? 0.5446 0.4883 0.5455 0.0068  -0.0394 0.0131  46  ARG B CZ  
325  N NH1 . ARG A 41  ? 0.5678 0.5134 0.5685 0.0046  -0.0400 0.0160  46  ARG B NH1 
326  N NH2 . ARG A 41  ? 0.5834 0.5244 0.5836 0.0063  -0.0400 0.0119  46  ARG B NH2 
327  N N   . ALA A 42  ? 0.4678 0.4131 0.4781 0.0231  -0.0383 0.0053  47  ALA B N   
328  C CA  . ALA A 42  ? 0.4748 0.4172 0.4875 0.0261  -0.0392 0.0031  47  ALA B CA  
329  C C   . ALA A 42  ? 0.4649 0.4109 0.4776 0.0286  -0.0373 0.0003  47  ALA B C   
330  O O   . ALA A 42  ? 0.4357 0.3802 0.4489 0.0306  -0.0371 -0.0027 47  ALA B O   
331  C CB  . ALA A 42  ? 0.5280 0.4683 0.5435 0.0271  -0.0413 0.0055  47  ALA B CB  
332  N N   . ALA A 43  ? 0.3567 0.3079 0.3687 0.0281  -0.0357 0.0012  48  ALA B N   
333  C CA  . ALA A 43  ? 0.3342 0.2893 0.3459 0.0300  -0.0338 -0.0011 48  ALA B CA  
334  C C   . ALA A 43  ? 0.3066 0.2637 0.3158 0.0289  -0.0319 -0.0028 48  ALA B C   
335  O O   . ALA A 43  ? 0.3297 0.2900 0.3385 0.0301  -0.0304 -0.0047 48  ALA B O   
336  C CB  . ALA A 43  ? 0.3467 0.3062 0.3589 0.0301  -0.0332 0.0005  48  ALA B CB  
337  N N   . LYS A 44  ? 0.3094 0.2646 0.3169 0.0265  -0.0321 -0.0019 49  LYS B N   
338  C CA  . LYS A 44  ? 0.2994 0.2563 0.3047 0.0253  -0.0305 -0.0031 49  LYS B CA  
339  C C   . LYS A 44  ? 0.2526 0.2146 0.2570 0.0249  -0.0284 -0.0027 49  LYS B C   
340  O O   . LYS A 44  ? 0.2687 0.2333 0.2724 0.0257  -0.0269 -0.0046 49  LYS B O   
341  C CB  . LYS A 44  ? 0.3616 0.3172 0.3668 0.0269  -0.0304 -0.0063 49  LYS B CB  
342  C CG  . LYS A 44  ? 0.3982 0.3485 0.4038 0.0265  -0.0323 -0.0068 49  LYS B CG  
343  C CD  . LYS A 44  ? 0.4852 0.4351 0.4909 0.0283  -0.0319 -0.0104 49  LYS B CD  
344  C CE  . LYS A 44  ? 0.5540 0.4998 0.5588 0.0271  -0.0330 -0.0114 49  LYS B CE  
345  N NZ  . LYS A 44  ? 0.5357 0.4767 0.5416 0.0261  -0.0352 -0.0093 49  LYS B NZ  
346  N N   . THR A 45  ? 0.2571 0.2206 0.2616 0.0235  -0.0283 -0.0003 50  THR B N   
347  C CA  . THR A 45  ? 0.2351 0.2032 0.2387 0.0228  -0.0263 0.0000  50  THR B CA  
348  C C   . THR A 45  ? 0.2036 0.1723 0.2065 0.0202  -0.0263 0.0025  50  THR B C   
349  O O   . THR A 45  ? 0.2051 0.1713 0.2082 0.0190  -0.0279 0.0041  50  THR B O   
350  C CB  . THR A 45  ? 0.2585 0.2297 0.2631 0.0247  -0.0256 -0.0007 50  THR B CB  
351  O OG1 . THR A 45  ? 0.2828 0.2581 0.2863 0.0239  -0.0234 -0.0009 50  THR B OG1 
352  C CG2 . THR A 45  ? 0.2841 0.2552 0.2903 0.0249  -0.0270 0.0011  50  THR B CG2 
353  N N   . GLY A 46  ? 0.1681 0.1402 0.1700 0.0191  -0.0243 0.0026  51  GLY B N   
354  C CA  . GLY A 46  ? 0.1483 0.1219 0.1496 0.0167  -0.0240 0.0045  51  GLY B CA  
355  C C   . GLY A 46  ? 0.1350 0.1119 0.1354 0.0160  -0.0216 0.0040  51  GLY B C   
356  O O   . GLY A 46  ? 0.1310 0.1091 0.1313 0.0173  -0.0205 0.0023  51  GLY B O   
357  N N   . THR A 47  ? 0.1282 0.1070 0.1280 0.0138  -0.0208 0.0053  52  THR B N   
358  C CA  . THR A 47  ? 0.1220 0.1037 0.1213 0.0130  -0.0186 0.0047  52  THR B CA  
359  C C   . THR A 47  ? 0.1227 0.1047 0.1211 0.0105  -0.0179 0.0057  52  THR B C   
360  O O   . THR A 47  ? 0.1445 0.1256 0.1428 0.0093  -0.0192 0.0071  52  THR B O   
361  C CB  . THR A 47  ? 0.1325 0.1174 0.1323 0.0132  -0.0178 0.0047  52  THR B CB  
362  O OG1 . THR A 47  ? 0.1536 0.1394 0.1536 0.0117  -0.0187 0.0063  52  THR B OG1 
363  C CG2 . THR A 47  ? 0.1327 0.1180 0.1333 0.0155  -0.0182 0.0037  52  THR B CG2 
364  N N   . VAL A 48  ? 0.1173 0.1008 0.1153 0.0098  -0.0159 0.0051  53  VAL B N   
365  C CA  . VAL A 48  ? 0.1299 0.1142 0.1273 0.0077  -0.0148 0.0056  53  VAL B CA  
366  C C   . VAL A 48  ? 0.1372 0.1243 0.1348 0.0070  -0.0128 0.0050  53  VAL B C   
367  O O   . VAL A 48  ? 0.1321 0.1200 0.1300 0.0082  -0.0118 0.0040  53  VAL B O   
368  C CB  . VAL A 48  ? 0.1444 0.1274 0.1415 0.0077  -0.0141 0.0052  53  VAL B CB  
369  C CG1 . VAL A 48  ? 0.1781 0.1623 0.1750 0.0058  -0.0127 0.0055  53  VAL B CG1 
370  C CG2 . VAL A 48  ? 0.1649 0.1451 0.1617 0.0082  -0.0161 0.0056  53  VAL B CG2 
371  N N   . ASP A 49  ? 0.1350 0.1239 0.1324 0.0049  -0.0123 0.0055  54  ASP B N   
372  C CA  . ASP A 49  ? 0.1382 0.1294 0.1357 0.0037  -0.0102 0.0047  54  ASP B CA  
373  C C   . ASP A 49  ? 0.1448 0.1364 0.1419 0.0018  -0.0094 0.0049  54  ASP B C   
374  O O   . ASP A 49  ? 0.1439 0.1363 0.1406 0.0003  -0.0105 0.0058  54  ASP B O   
375  C CB  . ASP A 49  ? 0.1612 0.1549 0.1587 0.0032  -0.0107 0.0051  54  ASP B CB  
376  C CG  . ASP A 49  ? 0.2495 0.2457 0.2469 0.0015  -0.0088 0.0043  54  ASP B CG  
377  O OD1 . ASP A 49  ? 0.2784 0.2742 0.2760 0.0014  -0.0070 0.0033  54  ASP B OD1 
378  O OD2 . ASP A 49  ? 0.3132 0.3119 0.3105 0.0003  -0.0093 0.0048  54  ASP B OD2 
379  N N   . VAL A 50  ? 0.1233 0.1144 0.1207 0.0018  -0.0077 0.0040  55  VAL B N   
380  C CA  . VAL A 50  ? 0.1280 0.1196 0.1253 0.0001  -0.0068 0.0040  55  VAL B CA  
381  C C   . VAL A 50  ? 0.1227 0.1152 0.1207 -0.0003 -0.0043 0.0027  55  VAL B C   
382  O O   . VAL A 50  ? 0.1310 0.1229 0.1297 0.0008  -0.0033 0.0021  55  VAL B O   
383  C CB  . VAL A 50  ? 0.1557 0.1452 0.1529 0.0009  -0.0077 0.0047  55  VAL B CB  
384  C CG1 . VAL A 50  ? 0.1746 0.1627 0.1723 0.0027  -0.0070 0.0042  55  VAL B CG1 
385  C CG2 . VAL A 50  ? 0.1709 0.1613 0.1681 -0.0006 -0.0070 0.0048  55  VAL B CG2 
386  N N   . THR A 51  ? 0.1182 0.1123 0.1162 -0.0022 -0.0033 0.0022  56  THR B N   
387  C CA  . THR A 51  ? 0.1257 0.1204 0.1245 -0.0029 -0.0009 0.0008  56  THR B CA  
388  C C   . THR A 51  ? 0.1335 0.1284 0.1328 -0.0037 0.0000  0.0006  56  THR B C   
389  O O   . THR A 51  ? 0.1534 0.1495 0.1519 -0.0049 -0.0010 0.0012  56  THR B O   
390  C CB  . THR A 51  ? 0.1574 0.1547 0.1558 -0.0047 -0.0003 0.0000  56  THR B CB  
391  O OG1 . THR A 51  ? 0.1881 0.1855 0.1864 -0.0037 -0.0011 0.0003  56  THR B OG1 
392  C CG2 . THR A 51  ? 0.1891 0.1867 0.1886 -0.0054 0.0020  -0.0016 56  THR B CG2 
393  N N   . THR A 52  ? 0.1233 0.1171 0.1239 -0.0030 0.0017  -0.0001 57  THR B N   
394  C CA  . THR A 52  ? 0.1284 0.1225 0.1298 -0.0034 0.0028  -0.0005 57  THR B CA  
395  C C   . THR A 52  ? 0.1264 0.1211 0.1292 -0.0042 0.0053  -0.0024 57  THR B C   
396  O O   . THR A 52  ? 0.1322 0.1258 0.1358 -0.0036 0.0064  -0.0029 57  THR B O   
397  C CB  . THR A 52  ? 0.1451 0.1372 0.1472 -0.0016 0.0024  0.0004  57  THR B CB  
398  O OG1 . THR A 52  ? 0.1557 0.1472 0.1565 -0.0011 0.0001  0.0019  57  THR B OG1 
399  C CG2 . THR A 52  ? 0.1628 0.1553 0.1659 -0.0018 0.0036  0.0002  57  THR B CG2 
400  N N   . ASP A 53  ? 0.1274 0.1237 0.1304 -0.0056 0.0063  -0.0033 58  ASP B N   
401  C CA  . ASP A 53  ? 0.1437 0.1406 0.1482 -0.0066 0.0088  -0.0056 58  ASP B CA  
402  C C   . ASP A 53  ? 0.1366 0.1316 0.1432 -0.0049 0.0102  -0.0056 58  ASP B C   
403  O O   . ASP A 53  ? 0.1442 0.1396 0.1512 -0.0045 0.0099  -0.0050 58  ASP B O   
404  C CB  . ASP A 53  ? 0.1842 0.1844 0.1881 -0.0088 0.0093  -0.0068 58  ASP B CB  
405  C CG  . ASP A 53  ? 0.2554 0.2581 0.2575 -0.0108 0.0083  -0.0069 58  ASP B CG  
406  O OD1 . ASP A 53  ? 0.3026 0.3045 0.3040 -0.0103 0.0074  -0.0063 58  ASP B OD1 
407  O OD2 . ASP A 53  ? 0.3782 0.3840 0.3796 -0.0128 0.0084  -0.0076 58  ASP B OD2 
408  N N   . ILE A 54  ? 0.1266 0.1198 0.1349 -0.0041 0.0117  -0.0063 59  ILE B N   
409  C CA  . ILE A 54  ? 0.1268 0.1181 0.1375 -0.0025 0.0130  -0.0061 59  ILE B CA  
410  C C   . ILE A 54  ? 0.1275 0.1199 0.1397 -0.0031 0.0147  -0.0076 59  ILE B C   
411  O O   . ILE A 54  ? 0.1420 0.1339 0.1557 -0.0018 0.0151  -0.0069 59  ILE B O   
412  C CB  . ILE A 54  ? 0.1380 0.1271 0.1502 -0.0019 0.0144  -0.0065 59  ILE B CB  
413  C CG1 . ILE A 54  ? 0.1284 0.1167 0.1394 -0.0010 0.0128  -0.0049 59  ILE B CG1 
414  C CG2 . ILE A 54  ? 0.1530 0.1403 0.1682 -0.0004 0.0159  -0.0063 59  ILE B CG2 
415  C CD1 . ILE A 54  ? 0.1375 0.1252 0.1482 0.0007  0.0112  -0.0026 59  ILE B CD1 
416  N N   . ALA A 55  ? 0.1312 0.1254 0.1430 -0.0050 0.0157  -0.0097 60  ALA B N   
417  C CA  . ALA A 55  ? 0.1482 0.1441 0.1613 -0.0058 0.0173  -0.0116 60  ALA B CA  
418  C C   . ALA A 55  ? 0.1397 0.1379 0.1520 -0.0059 0.0162  -0.0105 60  ALA B C   
419  O O   . ALA A 55  ? 0.1673 0.1670 0.1811 -0.0060 0.0176  -0.0118 60  ALA B O   
420  C CB  . ALA A 55  ? 0.1693 0.1673 0.1818 -0.0081 0.0185  -0.0142 60  ALA B CB  
421  N N   . SER A 56  ? 0.1296 0.1283 0.1398 -0.0059 0.0137  -0.0083 61  SER B N   
422  C CA  . SER A 56  ? 0.1226 0.1232 0.1318 -0.0061 0.0124  -0.0071 61  SER B CA  
423  C C   . SER A 56  ? 0.1214 0.1205 0.1318 -0.0041 0.0120  -0.0053 61  SER B C   
424  O O   . SER A 56  ? 0.1249 0.1254 0.1343 -0.0043 0.0106  -0.0039 61  SER B O   
425  C CB  . SER A 56  ? 0.1282 0.1300 0.1347 -0.0074 0.0100  -0.0057 61  SER B CB  
426  O OG  . SER A 56  ? 0.1201 0.1193 0.1258 -0.0059 0.0083  -0.0037 61  SER B OG  
427  N N   . ILE A 57  ? 0.1184 0.1149 0.1307 -0.0023 0.0131  -0.0051 62  ILE B N   
428  C CA  . ILE A 57  ? 0.1198 0.1154 0.1335 -0.0003 0.0128  -0.0033 62  ILE B CA  
429  C C   . ILE A 57  ? 0.1318 0.1298 0.1467 -0.0004 0.0136  -0.0036 62  ILE B C   
430  O O   . ILE A 57  ? 0.1507 0.1498 0.1670 -0.0010 0.0155  -0.0057 62  ILE B O   
431  C CB  . ILE A 57  ? 0.1390 0.1319 0.1550 0.0014  0.0139  -0.0029 62  ILE B CB  
432  C CG1 . ILE A 57  ? 0.1438 0.1360 0.1601 0.0031  0.0127  -0.0004 62  ILE B CG1 
433  C CG2 . ILE A 57  ? 0.1326 0.1250 0.1515 0.0017  0.0165  -0.0048 62  ILE B CG2 
434  C CD1 . ILE A 57  ? 0.1489 0.1389 0.1670 0.0047  0.0134  0.0004  62  ILE B CD1 
435  N N   . HIS A 58  ? 0.1331 0.1316 0.1476 0.0002  0.0122  -0.0016 63  HIS B N   
436  C CA  . HIS A 58  ? 0.1547 0.1553 0.1708 0.0006  0.0130  -0.0015 63  HIS B CA  
437  C C   . HIS A 58  ? 0.1501 0.1497 0.1674 0.0026  0.0125  0.0007  63  HIS B C   
438  O O   . HIS A 58  ? 0.1685 0.1680 0.1840 0.0025  0.0105  0.0025  63  HIS B O   
439  C CB  . HIS A 58  ? 0.1861 0.1898 0.2000 -0.0011 0.0115  -0.0010 63  HIS B CB  
440  C CG  . HIS A 58  ? 0.2320 0.2388 0.2473 -0.0011 0.0122  -0.0010 63  HIS B CG  
441  N ND1 . HIS A 58  ? 0.2534 0.2629 0.2698 -0.0020 0.0140  -0.0032 63  HIS B ND1 
442  C CD2 . HIS A 58  ? 0.2719 0.2797 0.2877 -0.0002 0.0115  0.0007  63  HIS B CD2 
443  C CE1 . HIS A 58  ? 0.2463 0.2584 0.2641 -0.0014 0.0145  -0.0027 63  HIS B CE1 
444  N NE2 . HIS A 58  ? 0.2827 0.2939 0.3000 -0.0005 0.0129  -0.0001 63  HIS B NE2 
445  N N   . THR A 59  ? 0.1653 0.1647 0.1859 0.0042  0.0144  0.0005  64  THR B N   
446  C CA  . THR A 59  ? 0.1786 0.1778 0.2008 0.0060  0.0141  0.0027  64  THR B CA  
447  C C   . THR A 59  ? 0.2070 0.2092 0.2304 0.0063  0.0143  0.0034  64  THR B C   
448  O O   . THR A 59  ? 0.2204 0.2231 0.2449 0.0076  0.0138  0.0056  64  THR B O   
449  C CB  . THR A 59  ? 0.1942 0.1910 0.2196 0.0078  0.0158  0.0028  64  THR B CB  
450  O OG1 . THR A 59  ? 0.2025 0.1998 0.2308 0.0081  0.0181  0.0008  64  THR B OG1 
451  C CG2 . THR A 59  ? 0.2171 0.2111 0.2416 0.0076  0.0156  0.0023  64  THR B CG2 
452  N N   . GLY A 60  ? 0.1967 0.2012 0.2205 0.0053  0.0154  0.0016  65  GLY B N   
453  C CA  . GLY A 60  ? 0.2114 0.2193 0.2372 0.0058  0.0161  0.0019  65  GLY B CA  
454  C C   . GLY A 60  ? 0.2271 0.2348 0.2568 0.0072  0.0189  0.0001  65  GLY B C   
455  O O   . GLY A 60  ? 0.2038 0.2145 0.2353 0.0075  0.0200  -0.0006 65  GLY B O   
456  N N   . SER A 61  ? 0.2118 0.2159 0.2431 0.0083  0.0200  -0.0004 66  SER B N   
457  C CA  . SER A 61  ? 0.2456 0.2488 0.2808 0.0094  0.0227  -0.0024 66  SER B CA  
458  C C   . SER A 61  ? 0.2617 0.2631 0.2960 0.0080  0.0237  -0.0054 66  SER B C   
459  O O   . SER A 61  ? 0.2318 0.2302 0.2651 0.0077  0.0232  -0.0051 66  SER B O   
460  C CB  . SER A 61  ? 0.2373 0.2377 0.2752 0.0117  0.0230  -0.0003 66  SER B CB  
461  O OG  . SER A 61  ? 0.2595 0.2580 0.3013 0.0129  0.0255  -0.0021 66  SER B OG  
462  N N   . ALA A 62  ? 0.2750 0.2787 0.3099 0.0070  0.0252  -0.0082 67  ALA B N   
463  C CA  . ALA A 62  ? 0.2815 0.2841 0.3156 0.0054  0.0263  -0.0112 67  ALA B CA  
464  C C   . ALA A 62  ? 0.2936 0.2919 0.3307 0.0067  0.0279  -0.0120 67  ALA B C   
465  O O   . ALA A 62  ? 0.2708 0.2669 0.3064 0.0055  0.0279  -0.0131 67  ALA B O   
466  C CB  . ALA A 62  ? 0.3259 0.3321 0.3605 0.0041  0.0279  -0.0144 67  ALA B CB  
467  N N   . LYS A 63  ? 0.2683 0.2653 0.3094 0.0091  0.0292  -0.0111 68  LYS B N   
468  C CA  . LYS A 63  ? 0.2978 0.2905 0.3420 0.0104  0.0306  -0.0114 68  LYS B CA  
469  C C   . LYS A 63  ? 0.2574 0.2473 0.3000 0.0105  0.0289  -0.0088 68  LYS B C   
470  O O   . LYS A 63  ? 0.2738 0.2606 0.3170 0.0102  0.0297  -0.0098 68  LYS B O   
471  C CB  . LYS A 63  ? 0.3523 0.3442 0.4017 0.0132  0.0323  -0.0108 68  LYS B CB  
472  C CG  . LYS A 63  ? 0.4148 0.4089 0.4667 0.0133  0.0345  -0.0141 68  LYS B CG  
473  C CD  . LYS A 63  ? 0.4814 0.4741 0.5333 0.0117  0.0363  -0.0183 68  LYS B CD  
474  C CE  . LYS A 63  ? 0.5401 0.5334 0.5963 0.0128  0.0391  -0.0215 68  LYS B CE  
475  N NZ  . LYS A 63  ? 0.5464 0.5350 0.6053 0.0129  0.0411  -0.0239 68  LYS B NZ  
476  N N   . LEU A 64  ? 0.2508 0.2418 0.2918 0.0111  0.0269  -0.0055 69  LEU B N   
477  C CA  . LEU A 64  ? 0.2141 0.2030 0.2532 0.0112  0.0252  -0.0032 69  LEU B CA  
478  C C   . LEU A 64  ? 0.2372 0.2258 0.2725 0.0089  0.0243  -0.0047 69  LEU B C   
479  O O   . LEU A 64  ? 0.2262 0.2123 0.2612 0.0086  0.0243  -0.0048 69  LEU B O   
480  C CB  . LEU A 64  ? 0.2194 0.2100 0.2574 0.0121  0.0233  0.0000  69  LEU B CB  
481  C CG  . LEU A 64  ? 0.2191 0.2084 0.2553 0.0121  0.0215  0.0022  69  LEU B CG  
482  C CD1 . LEU A 64  ? 0.2325 0.2186 0.2717 0.0134  0.0226  0.0031  69  LEU B CD1 
483  C CD2 . LEU A 64  ? 0.2213 0.2127 0.2561 0.0127  0.0196  0.0050  69  LEU B CD2 
484  N N   . ASP A 65  ? 0.1964 0.1880 0.2290 0.0073  0.0235  -0.0059 70  ASP B N   
485  C CA  . ASP A 65  ? 0.2156 0.2074 0.2445 0.0051  0.0225  -0.0071 70  ASP B CA  
486  C C   . ASP A 65  ? 0.2169 0.2065 0.2470 0.0043  0.0242  -0.0096 70  ASP B C   
487  O O   . ASP A 65  ? 0.2151 0.2033 0.2434 0.0034  0.0235  -0.0095 70  ASP B O   
488  C CB  . ASP A 65  ? 0.2284 0.2239 0.2548 0.0031  0.0218  -0.0084 70  ASP B CB  
489  C CG  . ASP A 65  ? 0.2576 0.2554 0.2826 0.0032  0.0200  -0.0063 70  ASP B CG  
490  O OD1 . ASP A 65  ? 0.2690 0.2656 0.2940 0.0046  0.0188  -0.0037 70  ASP B OD1 
491  O OD2 . ASP A 65  ? 0.3157 0.3169 0.3394 0.0017  0.0198  -0.0072 70  ASP B OD2 
492  N N   . GLU A 66  ? 0.2291 0.2186 0.2620 0.0045  0.0266  -0.0120 71  GLU B N   
493  C CA  . GLU A 66  ? 0.2563 0.2438 0.2904 0.0035  0.0284  -0.0148 71  GLU B CA  
494  C C   . GLU A 66  ? 0.2245 0.2078 0.2607 0.0048  0.0288  -0.0135 71  GLU B C   
495  O O   . GLU A 66  ? 0.2333 0.2149 0.2684 0.0036  0.0289  -0.0143 71  GLU B O   
496  C CB  . GLU A 66  ? 0.3138 0.3026 0.3505 0.0035  0.0308  -0.0180 71  GLU B CB  
497  C CG  . GLU A 66  ? 0.3814 0.3678 0.4201 0.0027  0.0331  -0.0213 71  GLU B CG  
498  C CD  . GLU A 66  ? 0.5021 0.4902 0.5436 0.0028  0.0355  -0.0246 71  GLU B CD  
499  O OE1 . GLU A 66  ? 0.5561 0.5452 0.6001 0.0048  0.0359  -0.0236 71  GLU B OE1 
500  O OE2 . GLU A 66  ? 0.6008 0.5897 0.6418 0.0008  0.0369  -0.0282 71  GLU B OE2 
501  N N   . HIS A 67  ? 0.2182 0.2003 0.2571 0.0071  0.0289  -0.0111 72  HIS B N   
502  C CA  . HIS A 67  ? 0.2389 0.2176 0.2799 0.0083  0.0291  -0.0093 72  HIS B CA  
503  C C   . HIS A 67  ? 0.2326 0.2109 0.2705 0.0076  0.0271  -0.0074 72  HIS B C   
504  O O   . HIS A 67  ? 0.2419 0.2178 0.2804 0.0073  0.0274  -0.0072 72  HIS B O   
505  C CB  . HIS A 67  ? 0.2745 0.2530 0.3186 0.0108  0.0291  -0.0066 72  HIS B CB  
506  C CG  . HIS A 67  ? 0.2942 0.2699 0.3404 0.0121  0.0290  -0.0040 72  HIS B CG  
507  N ND1 . HIS A 67  ? 0.3863 0.3585 0.4356 0.0123  0.0307  -0.0049 72  HIS B ND1 
508  C CD2 . HIS A 67  ? 0.3559 0.3320 0.4016 0.0131  0.0273  -0.0005 72  HIS B CD2 
509  C CE1 . HIS A 67  ? 0.3595 0.3301 0.4101 0.0133  0.0300  -0.0018 72  HIS B CE1 
510  N NE2 . HIS A 67  ? 0.4124 0.3855 0.4609 0.0138  0.0280  0.0007  72  HIS B NE2 
511  N N   . LEU A 68  ? 0.1839 0.1648 0.2186 0.0074  0.0250  -0.0058 73  LEU B N   
512  C CA  . LEU A 68  ? 0.1818 0.1625 0.2137 0.0069  0.0231  -0.0042 73  LEU B CA  
513  C C   . LEU A 68  ? 0.1710 0.1513 0.2005 0.0049  0.0231  -0.0062 73  LEU B C   
514  O O   . LEU A 68  ? 0.1741 0.1539 0.2019 0.0046  0.0219  -0.0050 73  LEU B O   
515  C CB  . LEU A 68  ? 0.1889 0.1721 0.2179 0.0071  0.0209  -0.0024 73  LEU B CB  
516  C CG  . LEU A 68  ? 0.1980 0.1819 0.2288 0.0090  0.0204  0.0001  73  LEU B CG  
517  C CD1 . LEU A 68  ? 0.2079 0.1940 0.2357 0.0088  0.0183  0.0015  73  LEU B CD1 
518  C CD2 . LEU A 68  ? 0.2380 0.2199 0.2710 0.0105  0.0206  0.0023  73  LEU B CD2 
519  N N   . GLN A 69  ? 0.1778 0.1590 0.2071 0.0034  0.0243  -0.0091 74  GLN B N   
520  C CA  . GLN A 69  ? 0.1707 0.1521 0.1980 0.0013  0.0243  -0.0110 74  GLN B CA  
521  C C   . GLN A 69  ? 0.1851 0.1633 0.2144 0.0012  0.0258  -0.0117 74  GLN B C   
522  O O   . GLN A 69  ? 0.1809 0.1592 0.2084 -0.0003 0.0256  -0.0127 74  GLN B O   
523  C CB  . GLN A 69  ? 0.1893 0.1728 0.2160 -0.0004 0.0254  -0.0141 74  GLN B CB  
524  C CG  . GLN A 69  ? 0.1898 0.1765 0.2147 -0.0007 0.0243  -0.0137 74  GLN B CG  
525  C CD  . GLN A 69  ? 0.1747 0.1629 0.1962 -0.0012 0.0218  -0.0119 74  GLN B CD  
526  O OE1 . GLN A 69  ? 0.1916 0.1804 0.2109 -0.0027 0.0211  -0.0125 74  GLN B OE1 
527  N NE2 . GLN A 69  ? 0.1896 0.1785 0.2105 0.0000  0.0202  -0.0095 74  GLN B NE2 
528  N N   . THR A 70  ? 0.1928 0.1686 0.2259 0.0027  0.0272  -0.0113 75  THR B N   
529  C CA  . THR A 70  ? 0.2119 0.1845 0.2474 0.0024  0.0288  -0.0121 75  THR B CA  
530  C C   . THR A 70  ? 0.2037 0.1751 0.2385 0.0028  0.0275  -0.0095 75  THR B C   
531  O O   . THR A 70  ? 0.1914 0.1644 0.2242 0.0035  0.0256  -0.0071 75  THR B O   
532  C CB  . THR A 70  ? 0.2147 0.1849 0.2548 0.0041  0.0306  -0.0122 75  THR B CB  
533  O OG1 . THR A 70  ? 0.2536 0.2233 0.2952 0.0063  0.0297  -0.0087 75  THR B OG1 
534  C CG2 . THR A 70  ? 0.2374 0.2091 0.2785 0.0041  0.0318  -0.0146 75  THR B CG2 
535  N N   . ALA A 71  ? 0.2089 0.1776 0.2454 0.0021  0.0287  -0.0100 76  ALA B N   
536  C CA  . ALA A 71  ? 0.2435 0.2113 0.2797 0.0022  0.0277  -0.0076 76  ALA B CA  
537  C C   . ALA A 71  ? 0.2346 0.2018 0.2727 0.0045  0.0270  -0.0041 76  ALA B C   
538  O O   . ALA A 71  ? 0.2698 0.2375 0.3069 0.0046  0.0258  -0.0019 76  ALA B O   
539  C CB  . ALA A 71  ? 0.2671 0.2321 0.3050 0.0009  0.0292  -0.0090 76  ALA B CB  
540  N N   . GLU A 72  ? 0.2214 0.1882 0.2622 0.0062  0.0277  -0.0034 77  GLU B N   
541  C CA  . GLU A 72  ? 0.2406 0.2078 0.2830 0.0082  0.0268  0.0000  77  GLU B CA  
542  C C   . GLU A 72  ? 0.2457 0.2162 0.2845 0.0085  0.0245  0.0017  77  GLU B C   
543  O O   . GLU A 72  ? 0.2845 0.2558 0.3238 0.0098  0.0235  0.0047  77  GLU B O   
544  C CB  . GLU A 72  ? 0.2693 0.2357 0.3154 0.0099  0.0280  0.0003  77  GLU B CB  
545  C CG  . GLU A 72  ? 0.3206 0.2833 0.3710 0.0102  0.0302  -0.0007 77  GLU B CG  
546  C CD  . GLU A 72  ? 0.3548 0.3168 0.4096 0.0124  0.0312  0.0002  77  GLU B CD  
547  O OE1 . GLU A 72  ? 0.4233 0.3865 0.4794 0.0141  0.0303  0.0037  77  GLU B OE1 
548  O OE2 . GLU A 72  ? 0.4165 0.3769 0.4735 0.0123  0.0331  -0.0027 77  GLU B OE2 
549  N N   . PHE A 73  ? 0.2049 0.1773 0.2405 0.0074  0.0238  -0.0002 78  PHE B N   
550  C CA  . PHE A 73  ? 0.1770 0.1521 0.2094 0.0077  0.0217  0.0012  78  PHE B CA  
551  C C   . PHE A 73  ? 0.1672 0.1435 0.1957 0.0059  0.0207  -0.0003 78  PHE B C   
552  O O   . PHE A 73  ? 0.1687 0.1447 0.1964 0.0053  0.0203  0.0000  78  PHE B O   
553  C CB  . PHE A 73  ? 0.1896 0.1663 0.2222 0.0086  0.0214  0.0015  78  PHE B CB  
554  C CG  . PHE A 73  ? 0.1981 0.1768 0.2287 0.0095  0.0193  0.0039  78  PHE B CG  
555  C CD1 . PHE A 73  ? 0.2498 0.2287 0.2822 0.0110  0.0190  0.0066  78  PHE B CD1 
556  C CD2 . PHE A 73  ? 0.1832 0.1639 0.2104 0.0087  0.0177  0.0033  78  PHE B CD2 
557  C CE1 . PHE A 73  ? 0.2350 0.2162 0.2653 0.0115  0.0170  0.0085  78  PHE B CE1 
558  C CE2 . PHE A 73  ? 0.1887 0.1709 0.2139 0.0093  0.0158  0.0052  78  PHE B CE2 
559  C CZ  . PHE A 73  ? 0.2008 0.1833 0.2277 0.0107  0.0156  0.0077  78  PHE B CZ  
560  N N   . PHE A 74  ? 0.1545 0.1325 0.1809 0.0049  0.0202  -0.0020 79  PHE B N   
561  C CA  . PHE A 74  ? 0.1522 0.1316 0.1752 0.0035  0.0190  -0.0029 79  PHE B CA  
562  C C   . PHE A 74  ? 0.1545 0.1333 0.1773 0.0017  0.0200  -0.0049 79  PHE B C   
563  O O   . PHE A 74  ? 0.1607 0.1406 0.1811 0.0009  0.0190  -0.0050 79  PHE B O   
564  C CB  . PHE A 74  ? 0.1557 0.1372 0.1767 0.0028  0.0182  -0.0038 79  PHE B CB  
565  C CG  . PHE A 74  ? 0.1553 0.1381 0.1754 0.0041  0.0165  -0.0018 79  PHE B CG  
566  C CD1 . PHE A 74  ? 0.1623 0.1455 0.1806 0.0047  0.0147  -0.0001 79  PHE B CD1 
567  C CD2 . PHE A 74  ? 0.1679 0.1516 0.1886 0.0043  0.0168  -0.0020 79  PHE B CD2 
568  C CE1 . PHE A 74  ? 0.1555 0.1397 0.1729 0.0057  0.0132  0.0014  79  PHE B CE1 
569  C CE2 . PHE A 74  ? 0.1793 0.1641 0.1992 0.0053  0.0152  -0.0002 79  PHE B CE2 
570  C CZ  . PHE A 74  ? 0.1621 0.1471 0.1801 0.0058  0.0134  0.0013  79  PHE B CZ  
571  N N   . ASP A 75  ? 0.1748 0.1517 0.2000 0.0013  0.0221  -0.0066 80  ASP B N   
572  C CA  . ASP A 75  ? 0.1827 0.1592 0.2076 -0.0007 0.0232  -0.0090 80  ASP B CA  
573  C C   . ASP A 75  ? 0.1781 0.1574 0.1997 -0.0024 0.0223  -0.0104 80  ASP B C   
574  O O   . ASP A 75  ? 0.1916 0.1720 0.2113 -0.0036 0.0216  -0.0107 80  ASP B O   
575  C CB  . ASP A 75  ? 0.2175 0.1926 0.2429 -0.0008 0.0232  -0.0078 80  ASP B CB  
576  C CG  . ASP A 75  ? 0.2671 0.2404 0.2939 -0.0025 0.0250  -0.0101 80  ASP B CG  
577  O OD1 . ASP A 75  ? 0.3248 0.2982 0.3519 -0.0037 0.0263  -0.0128 80  ASP B OD1 
578  O OD2 . ASP A 75  ? 0.3229 0.2951 0.3502 -0.0028 0.0250  -0.0090 80  ASP B OD2 
579  N N   . ALA A 76  ? 0.1815 0.1624 0.2027 -0.0026 0.0223  -0.0114 81  ALA B N   
580  C CA  . ALA A 76  ? 0.2043 0.1883 0.2226 -0.0042 0.0213  -0.0124 81  ALA B CA  
581  C C   . ALA A 76  ? 0.2146 0.1994 0.2321 -0.0066 0.0223  -0.0149 81  ALA B C   
582  O O   . ALA A 76  ? 0.2370 0.2245 0.2518 -0.0080 0.0212  -0.0152 81  ALA B O   
583  C CB  . ALA A 76  ? 0.2221 0.2076 0.2404 -0.0040 0.0212  -0.0128 81  ALA B CB  
584  N N   . ALA A 77  ? 0.2251 0.2078 0.2450 -0.0071 0.0245  -0.0168 82  ALA B N   
585  C CA  . ALA A 77  ? 0.2576 0.2412 0.2767 -0.0096 0.0255  -0.0194 82  ALA B CA  
586  C C   . ALA A 77  ? 0.2465 0.2309 0.2636 -0.0104 0.0242  -0.0181 82  ALA B C   
587  O O   . ALA A 77  ? 0.3042 0.2915 0.3191 -0.0124 0.0237  -0.0193 82  ALA B O   
588  C CB  . ALA A 77  ? 0.3021 0.2826 0.3245 -0.0099 0.0280  -0.0215 82  ALA B CB  
589  N N   . LYS A 78  ? 0.2173 0.1997 0.2351 -0.0087 0.0235  -0.0158 83  LYS B N   
590  C CA  . LYS A 78  ? 0.1985 0.1818 0.2147 -0.0090 0.0223  -0.0144 83  LYS B CA  
591  C C   . LYS A 78  ? 0.1822 0.1680 0.1959 -0.0082 0.0199  -0.0125 83  LYS B C   
592  O O   . LYS A 78  ? 0.1749 0.1629 0.1865 -0.0091 0.0188  -0.0124 83  LYS B O   
593  C CB  . LYS A 78  ? 0.2357 0.2164 0.2537 -0.0078 0.0224  -0.0126 83  LYS B CB  
594  C CG  . LYS A 78  ? 0.3233 0.3009 0.3440 -0.0086 0.0246  -0.0140 83  LYS B CG  
595  C CD  . LYS A 78  ? 0.3602 0.3364 0.3819 -0.0076 0.0241  -0.0115 83  LYS B CD  
596  C CE  . LYS A 78  ? 0.4785 0.4514 0.5032 -0.0083 0.0260  -0.0122 83  LYS B CE  
597  N NZ  . LYS A 78  ? 0.5372 0.5092 0.5627 -0.0075 0.0254  -0.0095 83  LYS B NZ  
598  N N   . PHE A 79  ? 0.1615 0.1468 0.1755 -0.0063 0.0191  -0.0111 84  PHE B N   
599  C CA  . PHE A 79  ? 0.1631 0.1500 0.1751 -0.0052 0.0168  -0.0092 84  PHE B CA  
600  C C   . PHE A 79  ? 0.1637 0.1518 0.1749 -0.0052 0.0162  -0.0094 84  PHE B C   
601  O O   . PHE A 79  ? 0.1474 0.1344 0.1595 -0.0036 0.0159  -0.0081 84  PHE B O   
602  C CB  . PHE A 79  ? 0.1791 0.1644 0.1919 -0.0031 0.0161  -0.0069 84  PHE B CB  
603  C CG  . PHE A 79  ? 0.1868 0.1710 0.2007 -0.0031 0.0167  -0.0064 84  PHE B CG  
604  C CD1 . PHE A 79  ? 0.1933 0.1792 0.2056 -0.0040 0.0161  -0.0066 84  PHE B CD1 
605  C CD2 . PHE A 79  ? 0.1925 0.1743 0.2090 -0.0021 0.0179  -0.0057 84  PHE B CD2 
606  C CE1 . PHE A 79  ? 0.1935 0.1785 0.2069 -0.0042 0.0168  -0.0060 84  PHE B CE1 
607  C CE2 . PHE A 79  ? 0.2211 0.2019 0.2387 -0.0023 0.0185  -0.0050 84  PHE B CE2 
608  C CZ  . PHE A 79  ? 0.1970 0.1795 0.2129 -0.0035 0.0179  -0.0053 84  PHE B CZ  
609  N N   . PRO A 80  ? 0.1511 0.1416 0.1610 -0.0071 0.0161  -0.0108 85  PRO B N   
610  C CA  . PRO A 80  ? 0.1467 0.1387 0.1560 -0.0075 0.0158  -0.0111 85  PRO B CA  
611  C C   . PRO A 80  ? 0.1339 0.1265 0.1417 -0.0063 0.0134  -0.0089 85  PRO B C   
612  O O   . PRO A 80  ? 0.1266 0.1202 0.1341 -0.0064 0.0130  -0.0087 85  PRO B O   
613  C CB  . PRO A 80  ? 0.1688 0.1638 0.1768 -0.0101 0.0162  -0.0130 85  PRO B CB  
614  C CG  . PRO A 80  ? 0.1824 0.1776 0.1897 -0.0109 0.0161  -0.0133 85  PRO B CG  
615  C CD  . PRO A 80  ? 0.1623 0.1544 0.1712 -0.0094 0.0167  -0.0125 85  PRO B CD  
616  N N   . GLN A 81  ? 0.1407 0.1332 0.1474 -0.0055 0.0119  -0.0074 86  GLN B N   
617  C CA  . GLN A 81  ? 0.1424 0.1354 0.1475 -0.0046 0.0095  -0.0056 86  GLN B CA  
618  C C   . GLN A 81  ? 0.1453 0.1365 0.1508 -0.0024 0.0087  -0.0040 86  GLN B C   
619  O O   . GLN A 81  ? 0.1700 0.1602 0.1765 -0.0019 0.0097  -0.0041 86  GLN B O   
620  C CB  . GLN A 81  ? 0.1887 0.1841 0.1919 -0.0059 0.0082  -0.0055 86  GLN B CB  
621  C CG  . GLN A 81  ? 0.2258 0.2237 0.2285 -0.0082 0.0087  -0.0068 86  GLN B CG  
622  C CD  . GLN A 81  ? 0.2994 0.3001 0.3004 -0.0096 0.0073  -0.0064 86  GLN B CD  
623  O OE1 . GLN A 81  ? 0.3508 0.3518 0.3513 -0.0096 0.0070  -0.0063 86  GLN B OE1 
624  N NE2 . GLN A 81  ? 0.3609 0.3636 0.3608 -0.0108 0.0062  -0.0059 86  GLN B NE2 
625  N N   . ALA A 82  ? 0.1231 0.1140 0.1278 -0.0013 0.0070  -0.0026 87  ALA B N   
626  C CA  . ALA A 82  ? 0.1258 0.1158 0.1303 0.0004  0.0058  -0.0012 87  ALA B CA  
627  C C   . ALA A 82  ? 0.1194 0.1104 0.1220 0.0003  0.0037  -0.0006 87  ALA B C   
628  O O   . ALA A 82  ? 0.1419 0.1337 0.1436 -0.0006 0.0028  -0.0005 87  ALA B O   
629  C CB  . ALA A 82  ? 0.1354 0.1242 0.1406 0.0018  0.0055  -0.0001 87  ALA B CB  
630  N N   . ASN A 83  ? 0.1124 0.1033 0.1146 0.0015  0.0027  -0.0001 88  ASN B N   
631  C CA  . ASN A 83  ? 0.1204 0.1121 0.1212 0.0017  0.0008  0.0003  88  ASN B CA  
632  C C   . ASN A 83  ? 0.1303 0.1210 0.1308 0.0036  -0.0004 0.0011  88  ASN B C   
633  O O   . ASN A 83  ? 0.1379 0.1285 0.1392 0.0047  0.0002  0.0011  88  ASN B O   
634  C CB  . ASN A 83  ? 0.1375 0.1312 0.1379 0.0007  0.0009  -0.0001 88  ASN B CB  
635  C CG  . ASN A 83  ? 0.1760 0.1705 0.1755 0.0014  -0.0011 0.0005  88  ASN B CG  
636  O OD1 . ASN A 83  ? 0.2462 0.2408 0.2457 0.0028  -0.0016 0.0007  88  ASN B OD1 
637  N ND2 . ASN A 83  ? 0.1894 0.1844 0.1881 0.0005  -0.0024 0.0010  88  ASN B ND2 
638  N N   . TYR A 84  ? 0.1110 0.1013 0.1108 0.0041  -0.0023 0.0018  89  TYR B N   
639  C CA  . TYR A 84  ? 0.1210 0.1103 0.1205 0.0059  -0.0036 0.0022  89  TYR B CA  
640  C C   . TYR A 84  ? 0.1200 0.1097 0.1188 0.0063  -0.0054 0.0024  89  TYR B C   
641  O O   . TYR A 84  ? 0.1205 0.1103 0.1188 0.0053  -0.0064 0.0028  89  TYR B O   
642  C CB  . TYR A 84  ? 0.1230 0.1109 0.1224 0.0063  -0.0043 0.0028  89  TYR B CB  
643  C CG  . TYR A 84  ? 0.1259 0.1128 0.1249 0.0080  -0.0057 0.0030  89  TYR B CG  
644  C CD1 . TYR A 84  ? 0.1361 0.1234 0.1356 0.0092  -0.0050 0.0029  89  TYR B CD1 
645  C CD2 . TYR A 84  ? 0.1394 0.1252 0.1376 0.0083  -0.0077 0.0033  89  TYR B CD2 
646  C CE1 . TYR A 84  ? 0.1322 0.1191 0.1312 0.0106  -0.0062 0.0027  89  TYR B CE1 
647  C CE2 . TYR A 84  ? 0.1505 0.1355 0.1485 0.0098  -0.0088 0.0031  89  TYR B CE2 
648  C CZ  . TYR A 84  ? 0.1512 0.1369 0.1496 0.0110  -0.0080 0.0027  89  TYR B CZ  
649  O OH  . TYR A 84  ? 0.1566 0.1418 0.1546 0.0123  -0.0091 0.0022  89  TYR B OH  
650  N N   . LYS A 85  ? 0.1159 0.1060 0.1148 0.0078  -0.0058 0.0021  90  LYS B N   
651  C CA  . LYS A 85  ? 0.1228 0.1131 0.1214 0.0087  -0.0076 0.0022  90  LYS B CA  
652  C C   . LYS A 85  ? 0.1118 0.1011 0.1103 0.0107  -0.0085 0.0019  90  LYS B C   
653  O O   . LYS A 85  ? 0.1226 0.1125 0.1215 0.0114  -0.0075 0.0015  90  LYS B O   
654  C CB  . LYS A 85  ? 0.1473 0.1400 0.1461 0.0086  -0.0072 0.0019  90  LYS B CB  
655  C CG  . LYS A 85  ? 0.1863 0.1804 0.1849 0.0066  -0.0064 0.0020  90  LYS B CG  
656  C CD  . LYS A 85  ? 0.2409 0.2376 0.2396 0.0064  -0.0063 0.0018  90  LYS B CD  
657  C CE  . LYS A 85  ? 0.2680 0.2666 0.2665 0.0040  -0.0056 0.0019  90  LYS B CE  
658  N NZ  . LYS A 85  ? 0.4006 0.3989 0.3993 0.0026  -0.0035 0.0010  90  LYS B NZ  
659  N N   . GLY A 86  ? 0.1044 0.0922 0.1027 0.0116  -0.0104 0.0021  91  GLY B N   
660  C CA  . GLY A 86  ? 0.1108 0.0978 0.1092 0.0134  -0.0112 0.0014  91  GLY B CA  
661  C C   . GLY A 86  ? 0.1128 0.0980 0.1112 0.0143  -0.0133 0.0015  91  GLY B C   
662  O O   . GLY A 86  ? 0.1112 0.0959 0.1097 0.0135  -0.0143 0.0023  91  GLY B O   
663  N N   . THR A 87  ? 0.1095 0.0943 0.1081 0.0161  -0.0139 0.0004  92  THR B N   
664  C CA  . THR A 87  ? 0.1189 0.1017 0.1178 0.0175  -0.0159 0.0000  92  THR B CA  
665  C C   . THR A 87  ? 0.1225 0.1026 0.1210 0.0174  -0.0169 -0.0001 92  THR B C   
666  O O   . THR A 87  ? 0.1209 0.1013 0.1189 0.0175  -0.0161 -0.0007 92  THR B O   
667  C CB  . THR A 87  ? 0.1324 0.1170 0.1320 0.0196  -0.0158 -0.0013 92  THR B CB  
668  O OG1 . THR A 87  ? 0.1480 0.1355 0.1480 0.0193  -0.0149 -0.0009 92  THR B OG1 
669  C CG2 . THR A 87  ? 0.1426 0.1252 0.1430 0.0213  -0.0177 -0.0020 92  THR B CG2 
670  N N   . ILE A 88  ? 0.1302 0.1076 0.1288 0.0171  -0.0186 0.0006  93  ILE B N   
671  C CA  . ILE A 88  ? 0.1421 0.1166 0.1402 0.0168  -0.0198 0.0005  93  ILE B CA  
672  C C   . ILE A 88  ? 0.1582 0.1314 0.1568 0.0188  -0.0207 -0.0012 93  ILE B C   
673  O O   . ILE A 88  ? 0.1608 0.1336 0.1605 0.0204  -0.0217 -0.0018 93  ILE B O   
674  C CB  . ILE A 88  ? 0.1533 0.1257 0.1515 0.0153  -0.0213 0.0022  93  ILE B CB  
675  C CG1 . ILE A 88  ? 0.1453 0.1196 0.1431 0.0132  -0.0202 0.0036  93  ILE B CG1 
676  C CG2 . ILE A 88  ? 0.1605 0.1296 0.1582 0.0148  -0.0227 0.0022  93  ILE B CG2 
677  C CD1 . ILE A 88  ? 0.1461 0.1192 0.1438 0.0115  -0.0215 0.0055  93  ILE B CD1 
678  N N   . LYS A 89  ? 0.1584 0.1310 0.1562 0.0188  -0.0205 -0.0022 94  LYS B N   
679  C CA  . LYS A 89  ? 0.1680 0.1395 0.1660 0.0204  -0.0213 -0.0042 94  LYS B CA  
680  C C   . LYS A 89  ? 0.1598 0.1275 0.1575 0.0196  -0.0230 -0.0041 94  LYS B C   
681  O O   . LYS A 89  ? 0.1630 0.1303 0.1599 0.0177  -0.0229 -0.0027 94  LYS B O   
682  C CB  . LYS A 89  ? 0.2032 0.1776 0.2005 0.0208  -0.0198 -0.0054 94  LYS B CB  
683  C CG  . LYS A 89  ? 0.2488 0.2270 0.2464 0.0213  -0.0181 -0.0053 94  LYS B CG  
684  C CD  . LYS A 89  ? 0.2879 0.2671 0.2865 0.0229  -0.0183 -0.0061 94  LYS B CD  
685  C CE  . LYS A 89  ? 0.3427 0.3259 0.3415 0.0229  -0.0166 -0.0057 94  LYS B CE  
686  N NZ  . LYS A 89  ? 0.4108 0.3951 0.4106 0.0251  -0.0171 -0.0073 94  LYS B NZ  
687  N N   . PHE A 90  ? 0.1884 0.1537 0.1867 0.0210  -0.0243 -0.0057 95  PHE B N   
688  C CA  . PHE A 90  ? 0.2082 0.1694 0.2063 0.0202  -0.0260 -0.0058 95  PHE B CA  
689  C C   . PHE A 90  ? 0.2397 0.2007 0.2372 0.0209  -0.0260 -0.0083 95  PHE B C   
690  O O   . PHE A 90  ? 0.2540 0.2176 0.2516 0.0225  -0.0251 -0.0103 95  PHE B O   
691  C CB  . PHE A 90  ? 0.2372 0.1951 0.2369 0.0212  -0.0279 -0.0055 95  PHE B CB  
692  C CG  . PHE A 90  ? 0.2389 0.1962 0.2391 0.0199  -0.0286 -0.0027 95  PHE B CG  
693  C CD1 . PHE A 90  ? 0.2355 0.1962 0.2358 0.0198  -0.0274 -0.0016 95  PHE B CD1 
694  C CD2 . PHE A 90  ? 0.2627 0.2162 0.2632 0.0187  -0.0305 -0.0013 95  PHE B CD2 
695  C CE1 . PHE A 90  ? 0.2386 0.1992 0.2393 0.0185  -0.0281 0.0009  95  PHE B CE1 
696  C CE2 . PHE A 90  ? 0.2862 0.2396 0.2872 0.0174  -0.0313 0.0013  95  PHE B CE2 
697  C CZ  . PHE A 90  ? 0.2578 0.2148 0.2588 0.0173  -0.0300 0.0024  95  PHE B CZ  
698  N N   . ASP A 91  ? 0.2327 0.1913 0.2293 0.0195  -0.0270 -0.0083 96  ASP B N   
699  C CA  . ASP A 91  ? 0.2236 0.1820 0.2196 0.0198  -0.0271 -0.0108 96  ASP B CA  
700  C C   . ASP A 91  ? 0.2940 0.2475 0.2902 0.0188  -0.0291 -0.0107 96  ASP B C   
701  O O   . ASP A 91  ? 0.3156 0.2678 0.3111 0.0166  -0.0297 -0.0085 96  ASP B O   
702  C CB  . ASP A 91  ? 0.2479 0.2101 0.2424 0.0186  -0.0256 -0.0106 96  ASP B CB  
703  C CG  . ASP A 91  ? 0.2790 0.2420 0.2728 0.0190  -0.0256 -0.0133 96  ASP B CG  
704  O OD1 . ASP A 91  ? 0.2699 0.2310 0.2645 0.0205  -0.0264 -0.0158 96  ASP B OD1 
705  O OD2 . ASP A 91  ? 0.3038 0.2692 0.2963 0.0175  -0.0248 -0.0126 96  ASP B OD2 
706  N N   . GLY A 92  ? 0.3644 0.3148 0.3616 0.0203  -0.0303 -0.0129 97  GLY B N   
707  C CA  . GLY A 92  ? 0.3895 0.3343 0.3875 0.0196  -0.0326 -0.0124 97  GLY B CA  
708  C C   . GLY A 92  ? 0.4142 0.3577 0.4134 0.0196  -0.0333 -0.0096 97  GLY B C   
709  O O   . GLY A 92  ? 0.4272 0.3730 0.4274 0.0210  -0.0325 -0.0092 97  GLY B O   
710  N N   . ASP A 93  ? 0.4112 0.3515 0.4104 0.0176  -0.0349 -0.0074 98  ASP B N   
711  C CA  . ASP A 93  ? 0.4489 0.3880 0.4495 0.0175  -0.0359 -0.0047 98  ASP B CA  
712  C C   . ASP A 93  ? 0.3786 0.3214 0.3780 0.0156  -0.0347 -0.0020 98  ASP B C   
713  O O   . ASP A 93  ? 0.4244 0.3671 0.4247 0.0150  -0.0354 0.0003  98  ASP B O   
714  C CB  . ASP A 93  ? 0.5263 0.4598 0.5280 0.0166  -0.0384 -0.0035 98  ASP B CB  
715  C CG  . ASP A 93  ? 0.5793 0.5111 0.5794 0.0139  -0.0392 -0.0029 98  ASP B CG  
716  O OD1 . ASP A 93  ? 0.5814 0.5166 0.5795 0.0126  -0.0377 -0.0029 98  ASP B OD1 
717  O OD2 . ASP A 93  ? 0.6683 0.5951 0.6692 0.0130  -0.0413 -0.0023 98  ASP B OD2 
718  N N   . LYS A 94  ? 0.3548 0.3011 0.3526 0.0148  -0.0330 -0.0023 99  LYS B N   
719  C CA  . LYS A 94  ? 0.3252 0.2744 0.3221 0.0129  -0.0320 0.0000  99  LYS B CA  
720  C C   . LYS A 94  ? 0.2494 0.2033 0.2460 0.0139  -0.0296 -0.0005 99  LYS B C   
721  O O   . LYS A 94  ? 0.2429 0.1982 0.2393 0.0154  -0.0287 -0.0027 99  LYS B O   
722  C CB  . LYS A 94  ? 0.3798 0.3290 0.3751 0.0105  -0.0321 0.0009  99  LYS B CB  
723  C CG  . LYS A 94  ? 0.5343 0.4797 0.5298 0.0086  -0.0343 0.0026  99  LYS B CG  
724  C CD  . LYS A 94  ? 0.6259 0.5713 0.6223 0.0078  -0.0351 0.0052  99  LYS B CD  
725  C CE  . LYS A 94  ? 0.7168 0.6589 0.7133 0.0057  -0.0374 0.0074  99  LYS B CE  
726  N NZ  . LYS A 94  ? 0.7681 0.7049 0.7661 0.0067  -0.0396 0.0069  99  LYS B NZ  
727  N N   . PRO A 95  ? 0.2295 0.1856 0.2261 0.0131  -0.0288 0.0013  100 PRO B N   
728  C CA  . PRO A 95  ? 0.2038 0.1642 0.2001 0.0135  -0.0265 0.0009  100 PRO B CA  
729  C C   . PRO A 95  ? 0.1964 0.1583 0.1914 0.0128  -0.0254 0.0004  100 PRO B C   
730  O O   . PRO A 95  ? 0.2054 0.1666 0.1997 0.0110  -0.0259 0.0015  100 PRO B O   
731  C CB  . PRO A 95  ? 0.2323 0.1943 0.2285 0.0120  -0.0260 0.0031  100 PRO B CB  
732  C CG  . PRO A 95  ? 0.2713 0.2305 0.2682 0.0113  -0.0282 0.0046  100 PRO B CG  
733  C CD  . PRO A 95  ? 0.2594 0.2149 0.2563 0.0113  -0.0298 0.0039  100 PRO B CD  
734  N N   . VAL A 96  ? 0.1682 0.1330 0.1632 0.0140  -0.0238 -0.0009 101 VAL B N   
735  C CA  . VAL A 96  ? 0.1733 0.1401 0.1674 0.0135  -0.0226 -0.0012 101 VAL B CA  
736  C C   . VAL A 96  ? 0.1573 0.1279 0.1515 0.0136  -0.0205 -0.0007 101 VAL B C   
737  O O   . VAL A 96  ? 0.1717 0.1440 0.1654 0.0129  -0.0195 -0.0003 101 VAL B O   
738  C CB  . VAL A 96  ? 0.2005 0.1669 0.1943 0.0145  -0.0230 -0.0033 101 VAL B CB  
739  C CG1 . VAL A 96  ? 0.2379 0.2001 0.2315 0.0139  -0.0252 -0.0037 101 VAL B CG1 
740  C CG2 . VAL A 96  ? 0.1996 0.1675 0.1940 0.0166  -0.0224 -0.0051 101 VAL B CG2 
741  N N   . SER A 97  ? 0.1533 0.1251 0.1483 0.0145  -0.0197 -0.0007 102 SER B N   
742  C CA  . SER A 97  ? 0.1523 0.1274 0.1475 0.0145  -0.0177 -0.0002 102 SER B CA  
743  C C   . SER A 97  ? 0.1438 0.1196 0.1397 0.0148  -0.0173 0.0000  102 SER B C   
744  O O   . SER A 97  ? 0.1486 0.1229 0.1449 0.0154  -0.0185 0.0000  102 SER B O   
745  C CB  . SER A 97  ? 0.1875 0.1650 0.1827 0.0157  -0.0167 -0.0015 102 SER B CB  
746  O OG  . SER A 97  ? 0.2517 0.2292 0.2472 0.0174  -0.0172 -0.0030 102 SER B OG  
747  N N   . VAL A 98  ? 0.1334 0.1115 0.1295 0.0143  -0.0155 0.0007  103 VAL B N   
748  C CA  . VAL A 98  ? 0.1282 0.1077 0.1248 0.0145  -0.0148 0.0009  103 VAL B CA  
749  C C   . VAL A 98  ? 0.1309 0.1132 0.1279 0.0152  -0.0130 0.0004  103 VAL B C   
750  O O   . VAL A 98  ? 0.1442 0.1275 0.1412 0.0146  -0.0118 0.0009  103 VAL B O   
751  C CB  . VAL A 98  ? 0.1292 0.1088 0.1258 0.0126  -0.0142 0.0022  103 VAL B CB  
752  C CG1 . VAL A 98  ? 0.1351 0.1160 0.1323 0.0127  -0.0139 0.0023  103 VAL B CG1 
753  C CG2 . VAL A 98  ? 0.1450 0.1224 0.1413 0.0115  -0.0158 0.0031  103 VAL B CG2 
754  N N   . VAL A 99  ? 0.1229 0.1065 0.1203 0.0164  -0.0129 -0.0004 104 VAL B N   
755  C CA  . VAL A 99  ? 0.1293 0.1159 0.1270 0.0170  -0.0114 -0.0008 104 VAL B CA  
756  C C   . VAL A 99  ? 0.1279 0.1159 0.1261 0.0165  -0.0104 -0.0003 104 VAL B C   
757  O O   . VAL A 99  ? 0.1292 0.1172 0.1276 0.0169  -0.0112 -0.0006 104 VAL B O   
758  C CB  . VAL A 99  ? 0.1436 0.1313 0.1413 0.0187  -0.0120 -0.0023 104 VAL B CB  
759  C CG1 . VAL A 99  ? 0.1666 0.1576 0.1645 0.0192  -0.0105 -0.0025 104 VAL B CG1 
760  C CG2 . VAL A 99  ? 0.1708 0.1571 0.1679 0.0190  -0.0129 -0.0029 104 VAL B CG2 
761  N N   . GLY A 100 ? 0.1251 0.1142 0.1235 0.0155  -0.0088 0.0003  105 GLY B N   
762  C CA  . GLY A 100 ? 0.1430 0.1333 0.1419 0.0146  -0.0078 0.0006  105 GLY B CA  
763  C C   . GLY A 100 ? 0.1248 0.1163 0.1242 0.0138  -0.0059 0.0011  105 GLY B C   
764  O O   . GLY A 100 ? 0.1264 0.1191 0.1261 0.0144  -0.0053 0.0011  105 GLY B O   
765  N N   . ASN A 101 ? 0.1151 0.1065 0.1148 0.0125  -0.0050 0.0014  106 ASN B N   
766  C CA  . ASN A 101 ? 0.1188 0.1111 0.1193 0.0116  -0.0031 0.0017  106 ASN B CA  
767  C C   . ASN A 101 ? 0.1195 0.1107 0.1203 0.0100  -0.0023 0.0020  106 ASN B C   
768  O O   . ASN A 101 ? 0.1254 0.1163 0.1257 0.0091  -0.0029 0.0018  106 ASN B O   
769  C CB  . ASN A 101 ? 0.1376 0.1321 0.1383 0.0115  -0.0026 0.0013  106 ASN B CB  
770  C CG  . ASN A 101 ? 0.1650 0.1613 0.1655 0.0131  -0.0032 0.0009  106 ASN B CG  
771  O OD1 . ASN A 101 ? 0.1932 0.1899 0.1933 0.0140  -0.0045 0.0003  106 ASN B OD1 
772  N ND2 . ASN A 101 ? 0.1640 0.1616 0.1651 0.0134  -0.0023 0.0013  106 ASN B ND2 
773  N N   . LEU A 102 ? 0.1074 0.0982 0.1091 0.0096  -0.0010 0.0024  107 LEU B N   
774  C CA  . LEU A 102 ? 0.1110 0.1008 0.1134 0.0083  0.0001  0.0025  107 LEU B CA  
775  C C   . LEU A 102 ? 0.1148 0.1052 0.1182 0.0075  0.0019  0.0022  107 LEU B C   
776  O O   . LEU A 102 ? 0.1118 0.1028 0.1160 0.0080  0.0026  0.0026  107 LEU B O   
777  C CB  . LEU A 102 ? 0.1193 0.1082 0.1223 0.0086  0.0004  0.0032  107 LEU B CB  
778  C CG  . LEU A 102 ? 0.1225 0.1106 0.1266 0.0075  0.0018  0.0032  107 LEU B CG  
779  C CD1 . LEU A 102 ? 0.1451 0.1331 0.1482 0.0063  0.0012  0.0026  107 LEU B CD1 
780  C CD2 . LEU A 102 ? 0.1242 0.1119 0.1292 0.0081  0.0021  0.0042  107 LEU B CD2 
781  N N   . THR A 103 ? 0.1119 0.1024 0.1153 0.0060  0.0026  0.0015  108 THR B N   
782  C CA  . THR A 103 ? 0.1158 0.1063 0.1204 0.0049  0.0045  0.0009  108 THR B CA  
783  C C   . THR A 103 ? 0.1144 0.1036 0.1200 0.0040  0.0057  0.0006  108 THR B C   
784  O O   . THR A 103 ? 0.1330 0.1223 0.1380 0.0032  0.0054  0.0001  108 THR B O   
785  C CB  . THR A 103 ? 0.1234 0.1153 0.1271 0.0036  0.0045  0.0000  108 THR B CB  
786  O OG1 . THR A 103 ? 0.1403 0.1337 0.1432 0.0045  0.0032  0.0002  108 THR B OG1 
787  C CG2 . THR A 103 ? 0.1307 0.1226 0.1355 0.0022  0.0064  -0.0007 108 THR B CG2 
788  N N   . LEU A 104 ? 0.1129 0.1011 0.1202 0.0045  0.0070  0.0011  109 LEU B N   
789  C CA  . LEU A 104 ? 0.1088 0.0958 0.1177 0.0043  0.0082  0.0010  109 LEU B CA  
790  C C   . LEU A 104 ? 0.1139 0.0999 0.1248 0.0040  0.0101  0.0009  109 LEU B C   
791  O O   . LEU A 104 ? 0.1246 0.1109 0.1361 0.0047  0.0101  0.0020  109 LEU B O   
792  C CB  . LEU A 104 ? 0.1171 0.1038 0.1261 0.0057  0.0074  0.0024  109 LEU B CB  
793  C CG  . LEU A 104 ? 0.1229 0.1087 0.1339 0.0059  0.0086  0.0028  109 LEU B CG  
794  C CD1 . LEU A 104 ? 0.1285 0.1143 0.1394 0.0047  0.0091  0.0015  109 LEU B CD1 
795  C CD2 . LEU A 104 ? 0.1279 0.1139 0.1390 0.0073  0.0076  0.0044  109 LEU B CD2 
796  N N   . HIS A 105 ? 0.1223 0.1074 0.1345 0.0029  0.0117  -0.0002 110 HIS B N   
797  C CA  . HIS A 105 ? 0.1250 0.1087 0.1394 0.0025  0.0135  -0.0005 110 HIS B CA  
798  C C   . HIS A 105 ? 0.1276 0.1120 0.1413 0.0018  0.0135  -0.0006 110 HIS B C   
799  O O   . HIS A 105 ? 0.1542 0.1378 0.1696 0.0019  0.0143  0.0001  110 HIS B O   
800  C CB  . HIS A 105 ? 0.1336 0.1162 0.1502 0.0041  0.0139  0.0012  110 HIS B CB  
801  C CG  . HIS A 105 ? 0.1540 0.1346 0.1735 0.0038  0.0158  0.0012  110 HIS B CG  
802  N ND1 . HIS A 105 ? 0.1866 0.1668 0.2076 0.0046  0.0160  0.0030  110 HIS B ND1 
803  C CD2 . HIS A 105 ? 0.1732 0.1521 0.1944 0.0029  0.0176  -0.0004 110 HIS B CD2 
804  C CE1 . HIS A 105 ? 0.1988 0.1767 0.2226 0.0042  0.0178  0.0027  110 HIS B CE1 
805  N NE2 . HIS A 105 ? 0.2000 0.1770 0.2240 0.0032  0.0188  0.0005  110 HIS B NE2 
806  N N   . GLY A 106 ? 0.1373 0.1234 0.1488 0.0009  0.0125  -0.0014 111 GLY B N   
807  C CA  . GLY A 106 ? 0.1553 0.1426 0.1661 0.0003  0.0123  -0.0015 111 GLY B CA  
808  C C   . GLY A 106 ? 0.1687 0.1574 0.1789 0.0016  0.0111  0.0000  111 GLY B C   
809  O O   . GLY A 106 ? 0.1973 0.1876 0.2067 0.0010  0.0109  -0.0002 111 GLY B O   
810  N N   . VAL A 107 ? 0.1291 0.1174 0.1395 0.0032  0.0103  0.0012  112 VAL B N   
811  C CA  . VAL A 107 ? 0.1164 0.1063 0.1265 0.0045  0.0093  0.0026  112 VAL B CA  
812  C C   . VAL A 107 ? 0.1094 0.1003 0.1175 0.0056  0.0074  0.0026  112 VAL B C   
813  O O   . VAL A 107 ? 0.1059 0.0960 0.1137 0.0059  0.0069  0.0026  112 VAL B O   
814  C CB  . VAL A 107 ? 0.1163 0.1052 0.1283 0.0055  0.0099  0.0043  112 VAL B CB  
815  C CG1 . VAL A 107 ? 0.1219 0.1129 0.1333 0.0067  0.0088  0.0056  112 VAL B CG1 
816  C CG2 . VAL A 107 ? 0.1266 0.1138 0.1410 0.0046  0.0118  0.0044  112 VAL B CG2 
817  N N   . THR A 108 ? 0.1052 0.0982 0.1123 0.0062  0.0064  0.0028  113 THR B N   
818  C CA  . THR A 108 ? 0.1098 0.1037 0.1153 0.0072  0.0046  0.0026  113 THR B CA  
819  C C   . THR A 108 ? 0.1143 0.1091 0.1198 0.0088  0.0039  0.0035  113 THR B C   
820  O O   . THR A 108 ? 0.1260 0.1225 0.1319 0.0090  0.0043  0.0041  113 THR B O   
821  C CB  . THR A 108 ? 0.1239 0.1196 0.1281 0.0070  0.0038  0.0017  113 THR B CB  
822  O OG1 . THR A 108 ? 0.1473 0.1425 0.1513 0.0054  0.0044  0.0009  113 THR B OG1 
823  C CG2 . THR A 108 ? 0.1405 0.1368 0.1435 0.0083  0.0019  0.0016  113 THR B CG2 
824  N N   . LYS A 109 ? 0.1200 0.1141 0.1250 0.0097  0.0029  0.0038  114 LYS B N   
825  C CA  . LYS A 109 ? 0.1204 0.1157 0.1252 0.0110  0.0021  0.0045  114 LYS B CA  
826  C C   . LYS A 109 ? 0.1289 0.1239 0.1323 0.0119  0.0004  0.0039  114 LYS B C   
827  O O   . LYS A 109 ? 0.1359 0.1292 0.1387 0.0115  0.0000  0.0034  114 LYS B O   
828  C CB  . LYS A 109 ? 0.1321 0.1268 0.1383 0.0111  0.0029  0.0059  114 LYS B CB  
829  C CG  . LYS A 109 ? 0.1522 0.1469 0.1602 0.0104  0.0046  0.0068  114 LYS B CG  
830  C CD  . LYS A 109 ? 0.1849 0.1823 0.1930 0.0107  0.0046  0.0074  114 LYS B CD  
831  C CE  . LYS A 109 ? 0.2364 0.2337 0.2460 0.0096  0.0061  0.0080  114 LYS B CE  
832  N NZ  . LYS A 109 ? 0.2960 0.2929 0.3078 0.0096  0.0070  0.0099  114 LYS B NZ  
833  N N   . PRO A 110 ? 0.1227 0.1193 0.1256 0.0131  -0.0004 0.0038  115 PRO B N   
834  C CA  . PRO A 110 ? 0.1330 0.1289 0.1347 0.0140  -0.0020 0.0031  115 PRO B CA  
835  C C   . PRO A 110 ? 0.1335 0.1275 0.1352 0.0137  -0.0023 0.0036  115 PRO B C   
836  O O   . PRO A 110 ? 0.1539 0.1481 0.1565 0.0134  -0.0014 0.0047  115 PRO B O   
837  C CB  . PRO A 110 ? 0.1413 0.1397 0.1426 0.0152  -0.0026 0.0027  115 PRO B CB  
838  C CG  . PRO A 110 ? 0.1707 0.1714 0.1729 0.0149  -0.0014 0.0034  115 PRO B CG  
839  C CD  . PRO A 110 ? 0.1415 0.1408 0.1448 0.0136  0.0000  0.0044  115 PRO B CD  
840  N N   . LEU A 111 ? 0.1215 0.1138 0.1223 0.0137  -0.0036 0.0030  116 LEU B N   
841  C CA  . LEU A 111 ? 0.1353 0.1260 0.1358 0.0133  -0.0041 0.0035  116 LEU B CA  
842  C C   . LEU A 111 ? 0.1481 0.1376 0.1475 0.0138  -0.0060 0.0027  116 LEU B C   
843  O O   . LEU A 111 ? 0.1280 0.1166 0.1269 0.0137  -0.0067 0.0021  116 LEU B O   
844  C CB  . LEU A 111 ? 0.1401 0.1295 0.1412 0.0120  -0.0032 0.0040  116 LEU B CB  
845  C CG  . LEU A 111 ? 0.1601 0.1481 0.1609 0.0115  -0.0038 0.0045  116 LEU B CG  
846  C CD1 . LEU A 111 ? 0.1908 0.1797 0.1922 0.0119  -0.0034 0.0054  116 LEU B CD1 
847  C CD2 . LEU A 111 ? 0.1710 0.1584 0.1725 0.0102  -0.0028 0.0046  116 LEU B CD2 
848  N N   . THR A 112 ? 0.1378 0.1270 0.1366 0.0141  -0.0068 0.0027  117 THR B N   
849  C CA  . THR A 112 ? 0.1543 0.1418 0.1522 0.0144  -0.0086 0.0020  117 THR B CA  
850  C C   . THR A 112 ? 0.1628 0.1488 0.1605 0.0133  -0.0090 0.0029  117 THR B C   
851  O O   . THR A 112 ? 0.1820 0.1688 0.1801 0.0129  -0.0081 0.0038  117 THR B O   
852  C CB  . THR A 112 ? 0.1740 0.1627 0.1714 0.0155  -0.0093 0.0011  117 THR B CB  
853  O OG1 . THR A 112 ? 0.2081 0.1986 0.2057 0.0166  -0.0090 0.0002  117 THR B OG1 
854  C CG2 . THR A 112 ? 0.1863 0.1729 0.1828 0.0157  -0.0111 0.0002  117 THR B CG2 
855  N N   . LEU A 113 ? 0.1581 0.1420 0.1552 0.0127  -0.0102 0.0028  118 LEU B N   
856  C CA  . LEU A 113 ? 0.1579 0.1404 0.1546 0.0115  -0.0109 0.0036  118 LEU B CA  
857  C C   . LEU A 113 ? 0.1842 0.1651 0.1800 0.0118  -0.0128 0.0030  118 LEU B C   
858  O O   . LEU A 113 ? 0.2035 0.1832 0.1991 0.0126  -0.0139 0.0020  118 LEU B O   
859  C CB  . LEU A 113 ? 0.1893 0.1709 0.1860 0.0104  -0.0110 0.0041  118 LEU B CB  
860  C CG  . LEU A 113 ? 0.2232 0.2063 0.2208 0.0100  -0.0092 0.0043  118 LEU B CG  
861  C CD1 . LEU A 113 ? 0.2497 0.2325 0.2472 0.0087  -0.0092 0.0045  118 LEU B CD1 
862  C CD2 . LEU A 113 ? 0.2234 0.2077 0.2218 0.0097  -0.0077 0.0049  118 LEU B CD2 
863  N N   . LYS A 114 ? 0.1563 0.1372 0.1517 0.0113  -0.0131 0.0034  119 LYS B N   
864  C CA  . LYS A 114 ? 0.1668 0.1458 0.1613 0.0112  -0.0149 0.0027  119 LYS B CA  
865  C C   . LYS A 114 ? 0.1611 0.1381 0.1552 0.0098  -0.0161 0.0036  119 LYS B C   
866  O O   . LYS A 114 ? 0.1673 0.1451 0.1615 0.0086  -0.0154 0.0049  119 LYS B O   
867  C CB  . LYS A 114 ? 0.2087 0.1894 0.2029 0.0112  -0.0146 0.0028  119 LYS B CB  
868  C CG  . LYS A 114 ? 0.2993 0.2784 0.2925 0.0107  -0.0163 0.0022  119 LYS B CG  
869  C CD  . LYS A 114 ? 0.3888 0.3704 0.3816 0.0113  -0.0158 0.0015  119 LYS B CD  
870  C CE  . LYS A 114 ? 0.4723 0.4546 0.4646 0.0100  -0.0163 0.0022  119 LYS B CE  
871  N NZ  . LYS A 114 ? 0.4753 0.4577 0.4680 0.0088  -0.0158 0.0041  119 LYS B NZ  
872  N N   . ILE A 115 ? 0.1591 0.1334 0.1527 0.0097  -0.0179 0.0031  120 ILE B N   
873  C CA  . ILE A 115 ? 0.1638 0.1362 0.1571 0.0082  -0.0192 0.0043  120 ILE B CA  
874  C C   . ILE A 115 ? 0.1935 0.1647 0.1860 0.0073  -0.0204 0.0043  120 ILE B C   
875  O O   . ILE A 115 ? 0.2026 0.1722 0.1948 0.0081  -0.0215 0.0029  120 ILE B O   
876  C CB  . ILE A 115 ? 0.1744 0.1445 0.1680 0.0087  -0.0207 0.0040  120 ILE B CB  
877  C CG1 . ILE A 115 ? 0.1837 0.1554 0.1780 0.0092  -0.0195 0.0042  120 ILE B CG1 
878  C CG2 . ILE A 115 ? 0.2006 0.1685 0.1939 0.0069  -0.0224 0.0054  120 ILE B CG2 
879  C CD1 . ILE A 115 ? 0.2018 0.1721 0.1967 0.0100  -0.0207 0.0040  120 ILE B CD1 
880  N N   . ASP A 116 ? 0.1865 0.1587 0.1787 0.0058  -0.0202 0.0056  121 ASP B N   
881  C CA  . ASP A 116 ? 0.2123 0.1841 0.2037 0.0047  -0.0211 0.0058  121 ASP B CA  
882  C C   . ASP A 116 ? 0.2214 0.1903 0.2123 0.0032  -0.0232 0.0065  121 ASP B C   
883  O O   . ASP A 116 ? 0.2616 0.2286 0.2518 0.0025  -0.0247 0.0061  121 ASP B O   
884  C CB  . ASP A 116 ? 0.2417 0.2165 0.2332 0.0038  -0.0198 0.0070  121 ASP B CB  
885  C CG  . ASP A 116 ? 0.3266 0.3041 0.3186 0.0051  -0.0181 0.0065  121 ASP B CG  
886  O OD1 . ASP A 116 ? 0.3985 0.3758 0.3903 0.0064  -0.0183 0.0051  121 ASP B OD1 
887  O OD2 . ASP A 116 ? 0.3947 0.3747 0.3874 0.0049  -0.0166 0.0076  121 ASP B OD2 
888  N N   . SER A 117 ? 0.1911 0.1594 0.1824 0.0026  -0.0235 0.0075  122 SER B N   
889  C CA  . SER A 117 ? 0.2105 0.1762 0.2015 0.0011  -0.0256 0.0086  122 SER B CA  
890  C C   . SER A 117 ? 0.1961 0.1610 0.1878 0.0015  -0.0260 0.0091  122 SER B C   
891  O O   . SER A 117 ? 0.1902 0.1577 0.1824 0.0019  -0.0243 0.0092  122 SER B O   
892  C CB  . SER A 117 ? 0.2668 0.2339 0.2572 -0.0011 -0.0258 0.0103  122 SER B CB  
893  O OG  . SER A 117 ? 0.3010 0.2710 0.2918 -0.0018 -0.0244 0.0113  122 SER B OG  
894  N N   . PHE A 118 ? 0.2071 0.1689 0.1989 0.0011  -0.0280 0.0095  123 PHE B N   
895  C CA  . PHE A 118 ? 0.1996 0.1605 0.1922 0.0013  -0.0288 0.0103  123 PHE B CA  
896  C C   . PHE A 118 ? 0.2104 0.1686 0.2030 -0.0003 -0.0312 0.0120  123 PHE B C   
897  O O   . PHE A 118 ? 0.2373 0.1923 0.2297 -0.0003 -0.0327 0.0114  123 PHE B O   
898  C CB  . PHE A 118 ? 0.2082 0.1678 0.2017 0.0039  -0.0288 0.0086  123 PHE B CB  
899  C CG  . PHE A 118 ? 0.2264 0.1849 0.2210 0.0042  -0.0299 0.0095  123 PHE B CG  
900  C CD1 . PHE A 118 ? 0.2532 0.2145 0.2482 0.0043  -0.0288 0.0101  123 PHE B CD1 
901  C CD2 . PHE A 118 ? 0.2769 0.2315 0.2722 0.0046  -0.0322 0.0097  123 PHE B CD2 
902  C CE1 . PHE A 118 ? 0.2480 0.2086 0.2440 0.0045  -0.0300 0.0112  123 PHE B CE1 
903  C CE2 . PHE A 118 ? 0.2747 0.2282 0.2712 0.0050  -0.0333 0.0108  123 PHE B CE2 
904  C CZ  . PHE A 118 ? 0.2798 0.2367 0.2767 0.0050  -0.0322 0.0117  123 PHE B CZ  
905  N N   . LYS A 119 ? 0.1908 0.1503 0.1836 -0.0019 -0.0317 0.0140  124 LYS B N   
906  C CA  . LYS A 119 ? 0.2042 0.1618 0.1971 -0.0038 -0.0340 0.0161  124 LYS B CA  
907  C C   . LYS A 119 ? 0.2090 0.1679 0.2027 -0.0043 -0.0344 0.0177  124 LYS B C   
908  O O   . LYS A 119 ? 0.2028 0.1656 0.1964 -0.0045 -0.0327 0.0178  124 LYS B O   
909  C CB  . LYS A 119 ? 0.2245 0.1840 0.2164 -0.0065 -0.0340 0.0175  124 LYS B CB  
910  C CG  . LYS A 119 ? 0.2309 0.1886 0.2227 -0.0088 -0.0365 0.0199  124 LYS B CG  
911  C CD  . LYS A 119 ? 0.2759 0.2364 0.2667 -0.0115 -0.0364 0.0213  124 LYS B CD  
912  C CE  . LYS A 119 ? 0.3062 0.2649 0.2969 -0.0140 -0.0390 0.0239  124 LYS B CE  
913  N NZ  . LYS A 119 ? 0.3294 0.2912 0.3191 -0.0168 -0.0390 0.0254  124 LYS B NZ  
914  N N   . CYS A 120 ? 0.2143 0.1700 0.2089 -0.0045 -0.0368 0.0192  125 CYS B N   
915  C CA  . CYS A 120 ? 0.2276 0.1851 0.2229 -0.0055 -0.0375 0.0213  125 CYS B CA  
916  C C   . CYS A 120 ? 0.2316 0.1879 0.2269 -0.0082 -0.0399 0.0242  125 CYS B C   
917  O O   . CYS A 120 ? 0.2425 0.1949 0.2379 -0.0085 -0.0416 0.0243  125 CYS B O   
918  C CB  . CYS A 120 ? 0.2788 0.2346 0.2757 -0.0033 -0.0381 0.0210  125 CYS B CB  
919  S SG  . CYS A 120 ? 0.3435 0.3007 0.3406 -0.0001 -0.0357 0.0179  125 CYS B SG  
920  N N   . MET A 121 ? 0.2139 0.1737 0.2092 -0.0102 -0.0401 0.0264  126 MET B N   
921  C CA  . MET A 121 ? 0.2181 0.1778 0.2133 -0.0131 -0.0422 0.0294  126 MET B CA  
922  C C   . MET A 121 ? 0.2168 0.1805 0.2124 -0.0146 -0.0425 0.0317  126 MET B C   
923  O O   . MET A 121 ? 0.1982 0.1655 0.1936 -0.0139 -0.0405 0.0306  126 MET B O   
924  C CB  . MET A 121 ? 0.2431 0.2046 0.2367 -0.0153 -0.0417 0.0295  126 MET B CB  
925  C CG  . MET A 121 ? 0.2406 0.2080 0.2333 -0.0161 -0.0391 0.0289  126 MET B CG  
926  S SD  . MET A 121 ? 0.3043 0.2742 0.2954 -0.0180 -0.0380 0.0285  126 MET B SD  
927  C CE  . MET A 121 ? 0.3486 0.3198 0.3393 -0.0218 -0.0404 0.0321  126 MET B CE  
928  N N   . PRO A 122 ? 0.2009 0.1644 0.1970 -0.0169 -0.0448 0.0349  127 PRO B N   
929  C CA  . PRO A 122 ? 0.2094 0.1776 0.2056 -0.0187 -0.0449 0.0371  127 PRO B CA  
930  C C   . PRO A 122 ? 0.2238 0.1980 0.2182 -0.0208 -0.0428 0.0366  127 PRO B C   
931  O O   . PRO A 122 ? 0.2362 0.2104 0.2296 -0.0222 -0.0427 0.0365  127 PRO B O   
932  C CB  . PRO A 122 ? 0.2314 0.1978 0.2285 -0.0210 -0.0482 0.0410  127 PRO B CB  
933  C CG  . PRO A 122 ? 0.2435 0.2033 0.2412 -0.0196 -0.0496 0.0402  127 PRO B CG  
934  C CD  . PRO A 122 ? 0.2289 0.1874 0.2256 -0.0177 -0.0476 0.0365  127 PRO B CD  
935  N N   . HIS A 123 ? 0.2212 0.2002 0.2155 -0.0208 -0.0409 0.0359  128 HIS B N   
936  C CA  . HIS A 123 ? 0.2597 0.2441 0.2526 -0.0225 -0.0387 0.0350  128 HIS B CA  
937  C C   . HIS A 123 ? 0.2937 0.2814 0.2860 -0.0262 -0.0402 0.0379  128 HIS B C   
938  O O   . HIS A 123 ? 0.2758 0.2646 0.2687 -0.0277 -0.0421 0.0406  128 HIS B O   
939  C CB  . HIS A 123 ? 0.2908 0.2793 0.2838 -0.0220 -0.0367 0.0337  128 HIS B CB  
940  C CG  . HIS A 123 ? 0.3428 0.3357 0.3347 -0.0228 -0.0339 0.0317  128 HIS B CG  
941  N ND1 . HIS A 123 ? 0.3860 0.3835 0.3770 -0.0259 -0.0338 0.0328  128 HIS B ND1 
942  C CD2 . HIS A 123 ? 0.3261 0.3191 0.3178 -0.0210 -0.0313 0.0286  128 HIS B CD2 
943  C CE1 . HIS A 123 ? 0.3968 0.3971 0.3873 -0.0256 -0.0311 0.0304  128 HIS B CE1 
944  N NE2 . HIS A 123 ? 0.3796 0.3771 0.3705 -0.0227 -0.0295 0.0279  128 HIS B NE2 
945  N N   . PRO A 124 ? 0.3261 0.3149 0.3173 -0.0276 -0.0396 0.0375  129 PRO B N   
946  C CA  . PRO A 124 ? 0.3731 0.3651 0.3637 -0.0312 -0.0411 0.0403  129 PRO B CA  
947  C C   . PRO A 124 ? 0.4102 0.4089 0.4006 -0.0337 -0.0409 0.0420  129 PRO B C   
948  O O   . PRO A 124 ? 0.4388 0.4395 0.4292 -0.0365 -0.0430 0.0452  129 PRO B O   
949  C CB  . PRO A 124 ? 0.3841 0.3779 0.3736 -0.0316 -0.0393 0.0386  129 PRO B CB  
950  C CG  . PRO A 124 ? 0.4039 0.3922 0.3936 -0.0284 -0.0386 0.0361  129 PRO B CG  
951  C CD  . PRO A 124 ? 0.3750 0.3623 0.3657 -0.0259 -0.0377 0.0347  129 PRO B CD  
952  N N   . MET A 125 ? 0.3855 0.3877 0.3758 -0.0328 -0.0385 0.0398  130 MET B N   
953  C CA  . MET A 125 ? 0.4050 0.4136 0.3952 -0.0349 -0.0382 0.0410  130 MET B CA  
954  C C   . MET A 125 ? 0.4106 0.4194 0.4018 -0.0341 -0.0387 0.0417  130 MET B C   
955  O O   . MET A 125 ? 0.4377 0.4502 0.4291 -0.0363 -0.0402 0.0445  130 MET B O   
956  C CB  . MET A 125 ? 0.4506 0.4645 0.4399 -0.0354 -0.0349 0.0380  130 MET B CB  
957  C CG  . MET A 125 ? 0.5082 0.5295 0.4970 -0.0387 -0.0348 0.0394  130 MET B CG  
958  S SD  . MET A 125 ? 0.5056 0.5320 0.4940 -0.0382 -0.0310 0.0355  130 MET B SD  
959  C CE  . MET A 125 ? 0.5841 0.6112 0.5718 -0.0383 -0.0292 0.0335  130 MET B CE  
960  N N   . LEU A 126 ? 0.3175 0.3229 0.3094 -0.0308 -0.0376 0.0394  131 LEU B N   
961  C CA  . LEU A 126 ? 0.3463 0.3521 0.3391 -0.0298 -0.0378 0.0398  131 LEU B CA  
962  C C   . LEU A 126 ? 0.3632 0.3640 0.3576 -0.0285 -0.0408 0.0423  131 LEU B C   
963  O O   . LEU A 126 ? 0.3609 0.3621 0.3564 -0.0278 -0.0416 0.0435  131 LEU B O   
964  C CB  . LEU A 126 ? 0.3573 0.3619 0.3500 -0.0269 -0.0350 0.0359  131 LEU B CB  
965  C CG  . LEU A 126 ? 0.3986 0.4076 0.3902 -0.0278 -0.0320 0.0332  131 LEU B CG  
966  C CD1 . LEU A 126 ? 0.3859 0.3930 0.3777 -0.0249 -0.0294 0.0296  131 LEU B CD1 
967  C CD2 . LEU A 126 ? 0.4052 0.4211 0.3964 -0.0305 -0.0314 0.0338  131 LEU B CD2 
968  N N   . LYS A 127 ? 0.3764 0.3720 0.3709 -0.0281 -0.0423 0.0429  132 LYS B N   
969  C CA  . LYS A 127 ? 0.3524 0.3421 0.3485 -0.0267 -0.0451 0.0450  132 LYS B CA  
970  C C   . LYS A 127 ? 0.3743 0.3586 0.3717 -0.0227 -0.0448 0.0428  132 LYS B C   
971  O O   . LYS A 127 ? 0.3727 0.3508 0.3710 -0.0211 -0.0463 0.0428  132 LYS B O   
972  C CB  . LYS A 127 ? 0.4252 0.4175 0.4223 -0.0290 -0.0476 0.0492  132 LYS B CB  
973  C CG  . LYS A 127 ? 0.3941 0.3917 0.3899 -0.0331 -0.0480 0.0513  132 LYS B CG  
974  C CD  . LYS A 127 ? 0.4139 0.4083 0.4089 -0.0338 -0.0485 0.0510  132 LYS B CD  
975  C CE  . LYS A 127 ? 0.5120 0.5093 0.5066 -0.0377 -0.0506 0.0546  132 LYS B CE  
976  N NZ  . LYS A 127 ? 0.5441 0.5470 0.5368 -0.0398 -0.0485 0.0532  132 LYS B NZ  
977  N N   . ARG A 128 ? 0.2731 0.2599 0.2706 -0.0212 -0.0429 0.0409  133 ARG B N   
978  C CA  . ARG A 128 ? 0.2710 0.2542 0.2694 -0.0177 -0.0423 0.0388  133 ARG B CA  
979  C C   . ARG A 128 ? 0.2158 0.1950 0.2135 -0.0159 -0.0410 0.0358  133 ARG B C   
980  O O   . ARG A 128 ? 0.2474 0.2278 0.2438 -0.0174 -0.0401 0.0351  133 ARG B O   
981  C CB  . ARG A 128 ? 0.2908 0.2786 0.2891 -0.0170 -0.0400 0.0371  133 ARG B CB  
982  C CG  . ARG A 128 ? 0.3023 0.2948 0.3011 -0.0191 -0.0412 0.0401  133 ARG B CG  
983  C CD  . ARG A 128 ? 0.3155 0.3116 0.3146 -0.0182 -0.0397 0.0390  133 ARG B CD  
984  N NE  . ARG A 128 ? 0.3181 0.3170 0.3157 -0.0183 -0.0365 0.0357  133 ARG B NE  
985  C CZ  . ARG A 128 ? 0.3171 0.3208 0.3132 -0.0208 -0.0349 0.0350  133 ARG B CZ  
986  N NH1 . ARG A 128 ? 0.3875 0.3951 0.3831 -0.0240 -0.0360 0.0375  133 ARG B NH1 
987  N NH2 . ARG A 128 ? 0.3849 0.3899 0.3801 -0.0202 -0.0321 0.0318  133 ARG B NH2 
988  N N   . GLU A 129 ? 0.2395 0.2144 0.2383 -0.0128 -0.0412 0.0342  134 GLU B N   
989  C CA  . GLU A 129 ? 0.2176 0.1887 0.2158 -0.0110 -0.0402 0.0315  134 GLU B CA  
990  C C   . GLU A 129 ? 0.2078 0.1824 0.2046 -0.0109 -0.0371 0.0289  134 GLU B C   
991  O O   . GLU A 129 ? 0.2194 0.1972 0.2162 -0.0105 -0.0356 0.0281  134 GLU B O   
992  C CB  . GLU A 129 ? 0.2477 0.2146 0.2474 -0.0077 -0.0407 0.0301  134 GLU B CB  
993  C CG  . GLU A 129 ? 0.2525 0.2159 0.2516 -0.0060 -0.0399 0.0274  134 GLU B CG  
994  C CD  . GLU A 129 ? 0.3144 0.2732 0.3149 -0.0030 -0.0407 0.0260  134 GLU B CD  
995  O OE1 . GLU A 129 ? 0.3558 0.3155 0.3572 -0.0008 -0.0399 0.0249  134 GLU B OE1 
996  O OE2 . GLU A 129 ? 0.4016 0.3559 0.4026 -0.0028 -0.0424 0.0261  134 GLU B OE2 
997  N N   . VAL A 130 ? 0.1741 0.1478 0.1698 -0.0114 -0.0364 0.0278  135 VAL B N   
998  C CA  . VAL A 130 ? 0.1733 0.1491 0.1680 -0.0107 -0.0335 0.0251  135 VAL B CA  
999  C C   . VAL A 130 ? 0.1866 0.1584 0.1813 -0.0085 -0.0332 0.0231  135 VAL B C   
1000 O O   . VAL A 130 ? 0.1903 0.1585 0.1850 -0.0086 -0.0348 0.0236  135 VAL B O   
1001 C CB  . VAL A 130 ? 0.1844 0.1639 0.1779 -0.0133 -0.0325 0.0256  135 VAL B CB  
1002 C CG1 . VAL A 130 ? 0.1944 0.1721 0.1874 -0.0149 -0.0341 0.0269  135 VAL B CG1 
1003 C CG2 . VAL A 130 ? 0.1914 0.1729 0.1844 -0.0123 -0.0295 0.0229  135 VAL B CG2 
1004 N N   . CYS A 131 ? 0.1822 0.1545 0.1770 -0.0063 -0.0312 0.0207  136 CYS B N   
1005 C CA  . CYS A 131 ? 0.1941 0.1635 0.1888 -0.0043 -0.0306 0.0186  136 CYS B CA  
1006 C C   . CYS A 131 ? 0.1759 0.1481 0.1698 -0.0046 -0.0281 0.0173  136 CYS B C   
1007 O O   . CYS A 131 ? 0.1795 0.1550 0.1733 -0.0050 -0.0264 0.0169  136 CYS B O   
1008 C CB  . CYS A 131 ? 0.2391 0.2067 0.2347 -0.0014 -0.0303 0.0169  136 CYS B CB  
1009 S SG  . CYS A 131 ? 0.3452 0.3089 0.3424 -0.0005 -0.0335 0.0185  136 CYS B SG  
1010 N N   . GLY A 132 ? 0.1688 0.1394 0.1622 -0.0044 -0.0281 0.0166  137 GLY B N   
1011 C CA  . GLY A 132 ? 0.1705 0.1434 0.1633 -0.0045 -0.0259 0.0156  137 GLY B CA  
1012 C C   . GLY A 132 ? 0.1615 0.1328 0.1543 -0.0026 -0.0253 0.0139  137 GLY B C   
1013 O O   . GLY A 132 ? 0.1615 0.1295 0.1542 -0.0019 -0.0268 0.0135  137 GLY B O   
1014 N N   . VAL A 133 ? 0.1548 0.1284 0.1476 -0.0019 -0.0229 0.0127  138 VAL B N   
1015 C CA  . VAL A 133 ? 0.1695 0.1422 0.1624 -0.0001 -0.0221 0.0112  138 VAL B CA  
1016 C C   . VAL A 133 ? 0.1556 0.1308 0.1484 -0.0005 -0.0203 0.0111  138 VAL B C   
1017 O O   . VAL A 133 ? 0.1599 0.1377 0.1529 -0.0016 -0.0190 0.0116  138 VAL B O   
1018 C CB  . VAL A 133 ? 0.2096 0.1823 0.2031 0.0019  -0.0211 0.0098  138 VAL B CB  
1019 C CG1 . VAL A 133 ? 0.2225 0.1927 0.2163 0.0029  -0.0228 0.0096  138 VAL B CG1 
1020 C CG2 . VAL A 133 ? 0.2358 0.2115 0.2298 0.0017  -0.0190 0.0096  138 VAL B CG2 
1021 N N   . ASP A 134 ? 0.1498 0.1245 0.1424 0.0002  -0.0202 0.0105  139 ASP B N   
1022 C CA  . ASP A 134 ? 0.1511 0.1281 0.1441 0.0006  -0.0182 0.0101  139 ASP B CA  
1023 C C   . ASP A 134 ? 0.1463 0.1231 0.1397 0.0027  -0.0174 0.0088  139 ASP B C   
1024 O O   . ASP A 134 ? 0.1601 0.1348 0.1530 0.0035  -0.0187 0.0081  139 ASP B O   
1025 C CB  . ASP A 134 ? 0.1762 0.1538 0.1686 -0.0003 -0.0187 0.0109  139 ASP B CB  
1026 C CG  . ASP A 134 ? 0.2086 0.1895 0.2019 -0.0004 -0.0166 0.0112  139 ASP B CG  
1027 O OD1 . ASP A 134 ? 0.2223 0.2051 0.2163 -0.0010 -0.0152 0.0115  139 ASP B OD1 
1028 O OD2 . ASP A 134 ? 0.3188 0.3005 0.3121 0.0000  -0.0163 0.0113  139 ASP B OD2 
1029 N N   . ALA A 135 ? 0.1361 0.1148 0.1303 0.0035  -0.0154 0.0085  140 ALA B N   
1030 C CA  . ALA A 135 ? 0.1425 0.1213 0.1371 0.0054  -0.0146 0.0074  140 ALA B CA  
1031 C C   . ALA A 135 ? 0.1340 0.1152 0.1296 0.0058  -0.0126 0.0076  140 ALA B C   
1032 O O   . ALA A 135 ? 0.1597 0.1422 0.1558 0.0050  -0.0116 0.0083  140 ALA B O   
1033 C CB  . ALA A 135 ? 0.1388 0.1173 0.1338 0.0061  -0.0144 0.0067  140 ALA B CB  
1034 N N   . VAL A 136 ? 0.1310 0.1127 0.1268 0.0072  -0.0121 0.0070  141 VAL B N   
1035 C CA  . VAL A 136 ? 0.1450 0.1289 0.1418 0.0078  -0.0104 0.0074  141 VAL B CA  
1036 C C   . VAL A 136 ? 0.1566 0.1413 0.1541 0.0091  -0.0095 0.0068  141 VAL B C   
1037 O O   . VAL A 136 ? 0.1657 0.1495 0.1625 0.0099  -0.0104 0.0057  141 VAL B O   
1038 C CB  . VAL A 136 ? 0.1789 0.1639 0.1754 0.0077  -0.0109 0.0080  141 VAL B CB  
1039 C CG1 . VAL A 136 ? 0.2079 0.1925 0.2039 0.0063  -0.0118 0.0087  141 VAL B CG1 
1040 C CG2 . VAL A 136 ? 0.2017 0.1860 0.1972 0.0084  -0.0121 0.0069  141 VAL B CG2 
1041 N N   . GLY A 137 ? 0.1471 0.1332 0.1459 0.0094  -0.0077 0.0073  142 GLY B N   
1042 C CA  . GLY A 137 ? 0.1645 0.1517 0.1640 0.0105  -0.0066 0.0070  142 GLY B CA  
1043 C C   . GLY A 137 ? 0.1507 0.1397 0.1518 0.0107  -0.0050 0.0082  142 GLY B C   
1044 O O   . GLY A 137 ? 0.1616 0.1509 0.1634 0.0102  -0.0045 0.0091  142 GLY B O   
1045 N N   . GLU A 138 ? 0.1487 0.1389 0.1505 0.0116  -0.0042 0.0083  143 GLU B N   
1046 C CA  . GLU A 138 ? 0.1655 0.1573 0.1693 0.0118  -0.0026 0.0097  143 GLU B CA  
1047 C C   . GLU A 138 ? 0.1519 0.1442 0.1564 0.0123  -0.0016 0.0095  143 GLU B C   
1048 O O   . GLU A 138 ? 0.1635 0.1562 0.1669 0.0128  -0.0024 0.0085  143 GLU B O   
1049 C CB  . GLU A 138 ? 0.2339 0.2278 0.2377 0.0122  -0.0031 0.0108  143 GLU B CB  
1050 C CG  . GLU A 138 ? 0.3517 0.3455 0.3543 0.0116  -0.0044 0.0109  143 GLU B CG  
1051 C CD  . GLU A 138 ? 0.4337 0.4303 0.4365 0.0118  -0.0047 0.0121  143 GLU B CD  
1052 O OE1 . GLU A 138 ? 0.5056 0.5043 0.5091 0.0124  -0.0041 0.0127  143 GLU B OE1 
1053 O OE2 . GLU A 138 ? 0.4445 0.4414 0.4466 0.0111  -0.0055 0.0125  143 GLU B OE2 
1054 N N   . PHE A 139 ? 0.1329 0.1254 0.1395 0.0123  0.0000  0.0104  144 PHE B N   
1055 C CA  . PHE A 139 ? 0.1350 0.1281 0.1426 0.0126  0.0010  0.0106  144 PHE B CA  
1056 C C   . PHE A 139 ? 0.1397 0.1335 0.1499 0.0128  0.0024  0.0123  144 PHE B C   
1057 O O   . PHE A 139 ? 0.1445 0.1380 0.1557 0.0128  0.0028  0.0131  144 PHE B O   
1058 C CB  . PHE A 139 ? 0.1305 0.1220 0.1378 0.0120  0.0014  0.0092  144 PHE B CB  
1059 C CG  . PHE A 139 ? 0.1463 0.1362 0.1546 0.0113  0.0025  0.0089  144 PHE B CG  
1060 C CD1 . PHE A 139 ? 0.1857 0.1747 0.1929 0.0106  0.0017  0.0082  144 PHE B CD1 
1061 C CD2 . PHE A 139 ? 0.1474 0.1368 0.1578 0.0111  0.0042  0.0093  144 PHE B CD2 
1062 C CE1 . PHE A 139 ? 0.2125 0.2006 0.2205 0.0098  0.0027  0.0078  144 PHE B CE1 
1063 C CE2 . PHE A 139 ? 0.1683 0.1565 0.1797 0.0104  0.0053  0.0087  144 PHE B CE2 
1064 C CZ  . PHE A 139 ? 0.1922 0.1800 0.2024 0.0097  0.0046  0.0079  144 PHE B CZ  
1065 N N   . SER A 140 ? 0.1506 0.1452 0.1618 0.0131  0.0032  0.0130  145 SER B N   
1066 C CA  . SER A 140 ? 0.1401 0.1350 0.1541 0.0133  0.0046  0.0148  145 SER B CA  
1067 C C   . SER A 140 ? 0.1322 0.1249 0.1475 0.0127  0.0061  0.0140  145 SER B C   
1068 O O   . SER A 140 ? 0.1399 0.1323 0.1545 0.0123  0.0062  0.0131  145 SER B O   
1069 C CB  . SER A 140 ? 0.1709 0.1683 0.1852 0.0136  0.0045  0.0162  145 SER B CB  
1070 O OG  . SER A 140 ? 0.2303 0.2287 0.2472 0.0140  0.0054  0.0186  145 SER B OG  
1071 N N   . ARG A 141 ? 0.1337 0.1248 0.1507 0.0126  0.0071  0.0140  146 ARG B N   
1072 C CA  . ARG A 141 ? 0.1351 0.1239 0.1529 0.0119  0.0084  0.0126  146 ARG B CA  
1073 C C   . ARG A 141 ? 0.1405 0.1288 0.1602 0.0117  0.0097  0.0131  146 ARG B C   
1074 O O   . ARG A 141 ? 0.1402 0.1270 0.1597 0.0108  0.0104  0.0116  146 ARG B O   
1075 C CB  . ARG A 141 ? 0.1426 0.1303 0.1620 0.0118  0.0094  0.0122  146 ARG B CB  
1076 C CG  . ARG A 141 ? 0.1455 0.1335 0.1679 0.0127  0.0103  0.0142  146 ARG B CG  
1077 C CD  . ARG A 141 ? 0.1838 0.1706 0.2075 0.0125  0.0114  0.0131  146 ARG B CD  
1078 N NE  . ARG A 141 ? 0.2005 0.1880 0.2270 0.0136  0.0121  0.0150  146 ARG B NE  
1079 C CZ  . ARG A 141 ? 0.2327 0.2192 0.2627 0.0143  0.0136  0.0160  146 ARG B CZ  
1080 N NH1 . ARG A 141 ? 0.2192 0.2037 0.2503 0.0139  0.0146  0.0155  146 ARG B NH1 
1081 N NH2 . ARG A 141 ? 0.2452 0.2325 0.2778 0.0154  0.0141  0.0177  146 ARG B NH2 
1082 N N   . ASP A 142 ? 0.1568 0.1463 0.1781 0.0123  0.0098  0.0154  147 ASP B N   
1083 C CA  . ASP A 142 ? 0.1839 0.1732 0.2067 0.0120  0.0107  0.0162  147 ASP B CA  
1084 C C   . ASP A 142 ? 0.1704 0.1607 0.1909 0.0113  0.0100  0.0151  147 ASP B C   
1085 O O   . ASP A 142 ? 0.1935 0.1830 0.2149 0.0106  0.0109  0.0150  147 ASP B O   
1086 C CB  . ASP A 142 ? 0.1962 0.1871 0.2212 0.0127  0.0108  0.0192  147 ASP B CB  
1087 C CG  . ASP A 142 ? 0.2486 0.2430 0.2720 0.0132  0.0093  0.0204  147 ASP B CG  
1088 O OD1 . ASP A 142 ? 0.2110 0.2060 0.2319 0.0133  0.0081  0.0190  147 ASP B OD1 
1089 O OD2 . ASP A 142 ? 0.2838 0.2804 0.3085 0.0136  0.0092  0.0229  147 ASP B OD2 
1090 N N   . ASP A 143 ? 0.1615 0.1533 0.1792 0.0115  0.0085  0.0141  148 ASP B N   
1091 C CA  . ASP A 143 ? 0.1751 0.1680 0.1908 0.0111  0.0078  0.0128  148 ASP B CA  
1092 C C   . ASP A 143 ? 0.1623 0.1532 0.1774 0.0101  0.0084  0.0108  148 ASP B C   
1093 O O   . ASP A 143 ? 0.1900 0.1817 0.2041 0.0095  0.0083  0.0100  148 ASP B O   
1094 C CB  . ASP A 143 ? 0.1813 0.1758 0.1945 0.0117  0.0061  0.0121  148 ASP B CB  
1095 C CG  . ASP A 143 ? 0.2445 0.2418 0.2576 0.0125  0.0054  0.0137  148 ASP B CG  
1096 O OD1 . ASP A 143 ? 0.2855 0.2840 0.3005 0.0125  0.0061  0.0157  148 ASP B OD1 
1097 O OD2 . ASP A 143 ? 0.2664 0.2649 0.2775 0.0130  0.0040  0.0128  148 ASP B OD2 
1098 N N   . PHE A 144 ? 0.1528 0.1416 0.1687 0.0097  0.0092  0.0100  149 PHE B N   
1099 C CA  . PHE A 144 ? 0.1423 0.1295 0.1577 0.0085  0.0099  0.0080  149 PHE B CA  
1100 C C   . PHE A 144 ? 0.1523 0.1376 0.1703 0.0079  0.0118  0.0080  149 PHE B C   
1101 O O   . PHE A 144 ? 0.1855 0.1695 0.2036 0.0068  0.0127  0.0063  149 PHE B O   
1102 C CB  . PHE A 144 ? 0.1287 0.1154 0.1429 0.0084  0.0093  0.0068  149 PHE B CB  
1103 C CG  . PHE A 144 ? 0.1296 0.1176 0.1413 0.0089  0.0074  0.0066  149 PHE B CG  
1104 C CD1 . PHE A 144 ? 0.1207 0.1093 0.1306 0.0083  0.0067  0.0053  149 PHE B CD1 
1105 C CD2 . PHE A 144 ? 0.1328 0.1216 0.1440 0.0099  0.0063  0.0076  149 PHE B CD2 
1106 C CE1 . PHE A 144 ? 0.1232 0.1127 0.1311 0.0089  0.0049  0.0051  149 PHE B CE1 
1107 C CE2 . PHE A 144 ? 0.1237 0.1134 0.1328 0.0103  0.0046  0.0071  149 PHE B CE2 
1108 C CZ  . PHE A 144 ? 0.1252 0.1151 0.1327 0.0099  0.0039  0.0059  149 PHE B CZ  
1109 N N   . GLY A 145 ? 0.1801 0.1653 0.2004 0.0084  0.0124  0.0100  150 GLY B N   
1110 C CA  . GLY A 145 ? 0.1874 0.1702 0.2107 0.0079  0.0143  0.0101  150 GLY B CA  
1111 C C   . GLY A 145 ? 0.2258 0.2068 0.2512 0.0085  0.0152  0.0099  150 GLY B C   
1112 O O   . GLY A 145 ? 0.2628 0.2415 0.2906 0.0080  0.0169  0.0093  150 GLY B O   
1113 N N   . LEU A 146 ? 0.1754 0.1575 0.1998 0.0093  0.0143  0.0102  151 LEU B N   
1114 C CA  . LEU A 146 ? 0.1795 0.1608 0.2055 0.0099  0.0150  0.0100  151 LEU B CA  
1115 C C   . LEU A 146 ? 0.1893 0.1715 0.2175 0.0113  0.0148  0.0129  151 LEU B C   
1116 O O   . LEU A 146 ? 0.2426 0.2265 0.2698 0.0120  0.0138  0.0137  151 LEU B O   
1117 C CB  . LEU A 146 ? 0.1661 0.1484 0.1895 0.0096  0.0140  0.0086  151 LEU B CB  
1118 C CG  . LEU A 146 ? 0.1679 0.1498 0.1892 0.0081  0.0140  0.0061  151 LEU B CG  
1119 C CD1 . LEU A 146 ? 0.1568 0.1400 0.1757 0.0080  0.0126  0.0055  151 LEU B CD1 
1120 C CD2 . LEU A 146 ? 0.1724 0.1525 0.1957 0.0073  0.0159  0.0043  151 LEU B CD2 
1121 N N   . ASP A 147 ? 0.2680 0.2489 0.2992 0.0116  0.0160  0.0143  152 ASP B N   
1122 C CA  . ASP A 147 ? 0.3036 0.2859 0.3370 0.0129  0.0157  0.0174  152 ASP B CA  
1123 C C   . ASP A 147 ? 0.3365 0.3173 0.3737 0.0139  0.0171  0.0182  152 ASP B C   
1124 O O   . ASP A 147 ? 0.3365 0.3184 0.3764 0.0151  0.0171  0.0212  152 ASP B O   
1125 C CB  . ASP A 147 ? 0.3480 0.3309 0.3821 0.0127  0.0156  0.0193  152 ASP B CB  
1126 C CG  . ASP A 147 ? 0.4396 0.4195 0.4763 0.0120  0.0172  0.0189  152 ASP B CG  
1127 O OD1 . ASP A 147 ? 0.4722 0.4493 0.5102 0.0117  0.0185  0.0169  152 ASP B OD1 
1128 O OD2 . ASP A 147 ? 0.4891 0.4693 0.5267 0.0116  0.0171  0.0207  152 ASP B OD2 
1129 N N   . TYR A 148 ? 0.3234 0.3024 0.3611 0.0136  0.0182  0.0158  153 TYR B N   
1130 C CA  . TYR A 148 ? 0.3466 0.3244 0.3882 0.0148  0.0196  0.0163  153 TYR B CA  
1131 C C   . TYR A 148 ? 0.3376 0.3181 0.3799 0.0162  0.0187  0.0189  153 TYR B C   
1132 O O   . TYR A 148 ? 0.3141 0.2970 0.3535 0.0161  0.0173  0.0187  153 TYR B O   
1133 C CB  . TYR A 148 ? 0.3772 0.3540 0.4183 0.0142  0.0205  0.0130  153 TYR B CB  
1134 C CG  . TYR A 148 ? 0.5403 0.5159 0.5853 0.0153  0.0222  0.0127  153 TYR B CG  
1135 C CD1 . TYR A 148 ? 0.6033 0.5808 0.6497 0.0168  0.0219  0.0146  153 TYR B CD1 
1136 C CD2 . TYR A 148 ? 0.6730 0.6456 0.7202 0.0149  0.0241  0.0104  153 TYR B CD2 
1137 C CE1 . TYR A 148 ? 0.6966 0.6733 0.7468 0.0180  0.0235  0.0141  153 TYR B CE1 
1138 C CE2 . TYR A 148 ? 0.6820 0.6535 0.7329 0.0160  0.0257  0.0097  153 TYR B CE2 
1139 C CZ  . TYR A 148 ? 0.7252 0.6987 0.7776 0.0176  0.0254  0.0116  153 TYR B CZ  
1140 O OH  . TYR A 148 ? 0.8345 0.8070 0.8909 0.0188  0.0272  0.0106  153 TYR B OH  
1141 N N   . GLY A 149 ? 0.3326 0.3128 0.3791 0.0175  0.0195  0.0213  154 GLY B N   
1142 C CA  . GLY A 149 ? 0.3189 0.3019 0.3665 0.0188  0.0188  0.0239  154 GLY B CA  
1143 C C   . GLY A 149 ? 0.3893 0.3749 0.4366 0.0191  0.0175  0.0272  154 GLY B C   
1144 O O   . GLY A 149 ? 0.3334 0.3217 0.3824 0.0202  0.0171  0.0300  154 GLY B O   
1145 N N   . LYS A 150 ? 0.4007 0.3861 0.4461 0.0181  0.0170  0.0271  155 LYS B N   
1146 C CA  . LYS A 150 ? 0.4612 0.4498 0.5056 0.0180  0.0156  0.0298  155 LYS B CA  
1147 C C   . LYS A 150 ? 0.4445 0.4338 0.4931 0.0190  0.0160  0.0335  155 LYS B C   
1148 O O   . LYS A 150 ? 0.4174 0.4105 0.4663 0.0195  0.0150  0.0365  155 LYS B O   
1149 C CB  . LYS A 150 ? 0.4138 0.4019 0.4558 0.0167  0.0152  0.0288  155 LYS B CB  
1150 C CG  . LYS A 150 ? 0.4892 0.4811 0.5293 0.0164  0.0137  0.0308  155 LYS B CG  
1151 C CD  . LYS A 150 ? 0.4434 0.4352 0.4802 0.0152  0.0131  0.0287  155 LYS B CD  
1152 C CE  . LYS A 150 ? 0.4878 0.4838 0.5225 0.0150  0.0116  0.0301  155 LYS B CE  
1153 N NZ  . LYS A 150 ? 0.4313 0.4270 0.4633 0.0140  0.0113  0.0280  155 LYS B NZ  
1154 N N   . GLN A 151 ? 0.4853 0.4710 0.5375 0.0192  0.0176  0.0335  156 GLN B N   
1155 C CA  . GLN A 151 ? 0.5059 0.4915 0.5629 0.0203  0.0182  0.0372  156 GLN B CA  
1156 C C   . GLN A 151 ? 0.5336 0.5207 0.5936 0.0220  0.0185  0.0390  156 GLN B C   
1157 O O   . GLN A 151 ? 0.6593 0.6470 0.7233 0.0230  0.0188  0.0425  156 GLN B O   
1158 C CB  . GLN A 151 ? 0.5798 0.5607 0.6400 0.0201  0.0199  0.0365  156 GLN B CB  
1159 C CG  . GLN A 151 ? 0.6471 0.6278 0.7061 0.0186  0.0194  0.0372  156 GLN B CG  
1160 C CD  . GLN A 151 ? 0.6615 0.6474 0.7180 0.0183  0.0176  0.0398  156 GLN B CD  
1161 O OE1 . GLN A 151 ? 0.6411 0.6297 0.7001 0.0191  0.0171  0.0437  156 GLN B OE1 
1162 N NE2 . GLN A 151 ? 0.6278 0.6154 0.6795 0.0173  0.0165  0.0375  156 GLN B NE2 
1163 N N   . TYR A 152 ? 0.5709 0.5589 0.6290 0.0223  0.0184  0.0368  157 TYR B N   
1164 C CA  . TYR A 152 ? 0.5446 0.5340 0.6052 0.0238  0.0187  0.0379  157 TYR B CA  
1165 C C   . TYR A 152 ? 0.4704 0.4646 0.5278 0.0236  0.0170  0.0387  157 TYR B C   
1166 O O   . TYR A 152 ? 0.5243 0.5201 0.5825 0.0245  0.0171  0.0388  157 TYR B O   
1167 C CB  . TYR A 152 ? 0.6117 0.5980 0.6731 0.0241  0.0203  0.0343  157 TYR B CB  
1168 C CG  . TYR A 152 ? 0.7489 0.7308 0.8150 0.0248  0.0222  0.0339  157 TYR B CG  
1169 C CD1 . TYR A 152 ? 0.7735 0.7523 0.8398 0.0237  0.0226  0.0335  157 TYR B CD1 
1170 C CD2 . TYR A 152 ? 0.7490 0.7298 0.8196 0.0265  0.0237  0.0340  157 TYR B CD2 
1171 C CE1 . TYR A 152 ? 0.8225 0.7969 0.8932 0.0243  0.0244  0.0332  157 TYR B CE1 
1172 C CE2 . TYR A 152 ? 0.8120 0.7886 0.8872 0.0273  0.0255  0.0335  157 TYR B CE2 
1173 C CZ  . TYR A 152 ? 0.8483 0.8215 0.9236 0.0261  0.0259  0.0331  157 TYR B CZ  
1174 O OH  . TYR A 152 ? 0.8461 0.8146 0.9259 0.0267  0.0277  0.0325  157 TYR B OH  
1175 N N   . GLY A 153 ? 0.4249 0.4214 0.4788 0.0225  0.0155  0.0392  158 GLY B N   
1176 C CA  . GLY A 153 ? 0.3989 0.3997 0.4496 0.0221  0.0139  0.0399  158 GLY B CA  
1177 C C   . GLY A 153 ? 0.3399 0.3404 0.3859 0.0211  0.0130  0.0363  158 GLY B C   
1178 O O   . GLY A 153 ? 0.3443 0.3481 0.3876 0.0207  0.0116  0.0367  158 GLY B O   
1179 N N   . PHE A 154 ? 0.2921 0.2889 0.3369 0.0205  0.0138  0.0330  159 PHE B N   
1180 C CA  . PHE A 154 ? 0.2625 0.2590 0.3032 0.0195  0.0130  0.0299  159 PHE B CA  
1181 C C   . PHE A 154 ? 0.2320 0.2297 0.2688 0.0184  0.0115  0.0294  159 PHE B C   
1182 O O   . PHE A 154 ? 0.2699 0.2674 0.3071 0.0182  0.0116  0.0303  159 PHE B O   
1183 C CB  . PHE A 154 ? 0.2675 0.2604 0.3081 0.0190  0.0142  0.0266  159 PHE B CB  
1184 C CG  . PHE A 154 ? 0.2835 0.2754 0.3267 0.0197  0.0156  0.0258  159 PHE B CG  
1185 C CD1 . PHE A 154 ? 0.3094 0.3004 0.3574 0.0211  0.0171  0.0275  159 PHE B CD1 
1186 C CD2 . PHE A 154 ? 0.3009 0.2927 0.3419 0.0190  0.0155  0.0231  159 PHE B CD2 
1187 C CE1 . PHE A 154 ? 0.3118 0.3021 0.3624 0.0219  0.0185  0.0262  159 PHE B CE1 
1188 C CE2 . PHE A 154 ? 0.3081 0.2994 0.3514 0.0196  0.0168  0.0221  159 PHE B CE2 
1189 C CZ  . PHE A 154 ? 0.3425 0.3331 0.3906 0.0211  0.0184  0.0236  159 PHE B CZ  
1190 N N   . LYS A 155 ? 0.2424 0.2419 0.2760 0.0179  0.0101  0.0285  160 LYS B N   
1191 C CA  . LYS A 155 ? 0.2137 0.2143 0.2436 0.0170  0.0086  0.0276  160 LYS B CA  
1192 C C   . LYS A 155 ? 0.1850 0.1826 0.2128 0.0162  0.0088  0.0244  160 LYS B C   
1193 O O   . LYS A 155 ? 0.1858 0.1814 0.2137 0.0160  0.0094  0.0227  160 LYS B O   
1194 C CB  . LYS A 155 ? 0.2190 0.2223 0.2466 0.0167  0.0071  0.0278  160 LYS B CB  
1195 C CG  . LYS A 155 ? 0.2749 0.2818 0.3047 0.0174  0.0070  0.0310  160 LYS B CG  
1196 C CD  . LYS A 155 ? 0.3440 0.3528 0.3752 0.0177  0.0070  0.0333  160 LYS B CD  
1197 C CE  . LYS A 155 ? 0.4393 0.4528 0.4713 0.0179  0.0063  0.0365  160 LYS B CE  
1198 N NZ  . LYS A 155 ? 0.4961 0.5107 0.5293 0.0183  0.0064  0.0371  160 LYS B NZ  
1199 N N   . MET A 156 ? 0.1653 0.1629 0.1912 0.0157  0.0082  0.0238  161 MET B N   
1200 C CA  . MET A 156 ? 0.1649 0.1600 0.1889 0.0149  0.0082  0.0211  161 MET B CA  
1201 C C   . MET A 156 ? 0.1517 0.1471 0.1721 0.0144  0.0067  0.0192  161 MET B C   
1202 O O   . MET A 156 ? 0.1451 0.1386 0.1638 0.0137  0.0066  0.0170  161 MET B O   
1203 C CB  . MET A 156 ? 0.1664 0.1618 0.1902 0.0147  0.0083  0.0214  161 MET B CB  
1204 C CG  . MET A 156 ? 0.2020 0.1963 0.2291 0.0149  0.0098  0.0229  161 MET B CG  
1205 S SD  . MET A 156 ? 0.2245 0.2148 0.2540 0.0148  0.0117  0.0213  161 MET B SD  
1206 C CE  . MET A 156 ? 0.2725 0.2632 0.3054 0.0159  0.0125  0.0233  161 MET B CE  
1207 N N   . LYS A 157 ? 0.1540 0.1517 0.1730 0.0145  0.0054  0.0199  162 LYS B N   
1208 C CA  . LYS A 157 ? 0.1677 0.1652 0.1835 0.0140  0.0039  0.0183  162 LYS B CA  
1209 C C   . LYS A 157 ? 0.1483 0.1441 0.1638 0.0135  0.0040  0.0170  162 LYS B C   
1210 O O   . LYS A 157 ? 0.1800 0.1760 0.1973 0.0137  0.0048  0.0179  162 LYS B O   
1211 C CB  . LYS A 157 ? 0.2177 0.2181 0.2325 0.0141  0.0025  0.0194  162 LYS B CB  
1212 C CG  . LYS A 157 ? 0.3172 0.3173 0.3288 0.0135  0.0009  0.0176  162 LYS B CG  
1213 C CD  . LYS A 157 ? 0.3769 0.3798 0.3877 0.0134  -0.0002 0.0187  162 LYS B CD  
1214 C CE  . LYS A 157 ? 0.4541 0.4571 0.4652 0.0130  -0.0003 0.0193  162 LYS B CE  
1215 N NZ  . LYS A 157 ? 0.5249 0.5303 0.5344 0.0125  -0.0018 0.0196  162 LYS B NZ  
1216 N N   . THR A 158 ? 0.1235 0.1176 0.1370 0.0128  0.0034  0.0149  163 THR B N   
1217 C CA  . THR A 158 ? 0.1237 0.1163 0.1366 0.0120  0.0035  0.0136  163 THR B CA  
1218 C C   . THR A 158 ? 0.1320 0.1244 0.1420 0.0115  0.0016  0.0127  163 THR B C   
1219 O O   . THR A 158 ? 0.1457 0.1376 0.1542 0.0115  0.0008  0.0118  163 THR B O   
1220 C CB  . THR A 158 ? 0.1369 0.1276 0.1505 0.0116  0.0048  0.0123  163 THR B CB  
1221 O OG1 . THR A 158 ? 0.1615 0.1521 0.1781 0.0122  0.0065  0.0133  163 THR B OG1 
1222 C CG2 . THR A 158 ? 0.1584 0.1482 0.1717 0.0107  0.0051  0.0110  163 THR B CG2 
1223 N N   . LYS A 159 ? 0.1416 0.1341 0.1509 0.0109  0.0009  0.0127  164 LYS B N   
1224 C CA  . LYS A 159 ? 0.1512 0.1432 0.1580 0.0102  -0.0008 0.0119  164 LYS B CA  
1225 C C   . LYS A 159 ? 0.1447 0.1351 0.1506 0.0092  -0.0010 0.0106  164 LYS B C   
1226 O O   . LYS A 159 ? 0.1379 0.1285 0.1451 0.0088  0.0001  0.0106  164 LYS B O   
1227 C CB  . LYS A 159 ? 0.1939 0.1872 0.2001 0.0099  -0.0018 0.0129  164 LYS B CB  
1228 C CG  . LYS A 159 ? 0.2504 0.2456 0.2570 0.0107  -0.0020 0.0140  164 LYS B CG  
1229 C CD  . LYS A 159 ? 0.3243 0.3215 0.3308 0.0104  -0.0027 0.0152  164 LYS B CD  
1230 C CE  . LYS A 159 ? 0.3520 0.3484 0.3560 0.0094  -0.0046 0.0144  164 LYS B CE  
1231 N NZ  . LYS A 159 ? 0.4343 0.4283 0.4372 0.0085  -0.0052 0.0132  164 LYS B NZ  
1232 N N   . LEU A 160 ? 0.1379 0.1272 0.1419 0.0088  -0.0024 0.0097  165 LEU B N   
1233 C CA  . LEU A 160 ? 0.1476 0.1358 0.1506 0.0077  -0.0029 0.0088  165 LEU B CA  
1234 C C   . LEU A 160 ? 0.1570 0.1447 0.1583 0.0069  -0.0049 0.0090  165 LEU B C   
1235 O O   . LEU A 160 ? 0.1732 0.1605 0.1734 0.0073  -0.0062 0.0090  165 LEU B O   
1236 C CB  . LEU A 160 ? 0.1737 0.1609 0.1760 0.0077  -0.0031 0.0077  165 LEU B CB  
1237 C CG  . LEU A 160 ? 0.1920 0.1793 0.1957 0.0081  -0.0013 0.0073  165 LEU B CG  
1238 C CD1 . LEU A 160 ? 0.2086 0.1954 0.2114 0.0083  -0.0018 0.0063  165 LEU B CD1 
1239 C CD2 . LEU A 160 ? 0.2027 0.1904 0.2078 0.0074  0.0002  0.0071  165 LEU B CD2 
1240 N N   . LEU A 161 ? 0.1330 0.1209 0.1341 0.0056  -0.0051 0.0092  166 LEU B N   
1241 C CA  . LEU A 161 ? 0.1468 0.1343 0.1464 0.0045  -0.0069 0.0096  166 LEU B CA  
1242 C C   . LEU A 161 ? 0.1446 0.1314 0.1435 0.0033  -0.0074 0.0090  166 LEU B C   
1243 O O   . LEU A 161 ? 0.1441 0.1323 0.1437 0.0024  -0.0063 0.0090  166 LEU B O   
1244 C CB  . LEU A 161 ? 0.1561 0.1453 0.1561 0.0038  -0.0068 0.0106  166 LEU B CB  
1245 C CG  . LEU A 161 ? 0.1786 0.1688 0.1792 0.0048  -0.0066 0.0114  166 LEU B CG  
1246 C CD1 . LEU A 161 ? 0.1852 0.1768 0.1880 0.0059  -0.0044 0.0117  166 LEU B CD1 
1247 C CD2 . LEU A 161 ? 0.2187 0.2102 0.2188 0.0040  -0.0074 0.0124  166 LEU B CD2 
1248 N N   . ILE A 162 ? 0.1288 0.1140 0.1264 0.0032  -0.0090 0.0088  167 ILE B N   
1249 C CA  . ILE A 162 ? 0.1418 0.1266 0.1389 0.0023  -0.0094 0.0084  167 ILE B CA  
1250 C C   . ILE A 162 ? 0.1365 0.1207 0.1325 0.0008  -0.0114 0.0092  167 ILE B C   
1251 O O   . ILE A 162 ? 0.1517 0.1342 0.1469 0.0010  -0.0131 0.0096  167 ILE B O   
1252 C CB  . ILE A 162 ? 0.1701 0.1537 0.1671 0.0035  -0.0096 0.0076  167 ILE B CB  
1253 C CG1 . ILE A 162 ? 0.2050 0.1897 0.2033 0.0045  -0.0074 0.0070  167 ILE B CG1 
1254 C CG2 . ILE A 162 ? 0.2003 0.1837 0.1968 0.0025  -0.0105 0.0076  167 ILE B CG2 
1255 C CD1 . ILE A 162 ? 0.2325 0.2164 0.2307 0.0059  -0.0078 0.0064  167 ILE B CD1 
1256 N N   . THR A 163 ? 0.1398 0.1255 0.1358 -0.0007 -0.0111 0.0096  168 THR B N   
1257 C CA  . THR A 163 ? 0.1335 0.1190 0.1285 -0.0024 -0.0130 0.0106  168 THR B CA  
1258 C C   . THR A 163 ? 0.1282 0.1136 0.1230 -0.0027 -0.0134 0.0103  168 THR B C   
1259 O O   . THR A 163 ? 0.1307 0.1178 0.1261 -0.0029 -0.0117 0.0096  168 THR B O   
1260 C CB  . THR A 163 ? 0.1697 0.1580 0.1649 -0.0041 -0.0122 0.0111  168 THR B CB  
1261 O OG1 . THR A 163 ? 0.2252 0.2143 0.2208 -0.0037 -0.0115 0.0113  168 THR B OG1 
1262 C CG2 . THR A 163 ? 0.2032 0.1919 0.1973 -0.0062 -0.0141 0.0123  168 THR B CG2 
1263 N N   . ALA A 164 ? 0.1258 0.1093 0.1199 -0.0030 -0.0155 0.0111  169 ALA B N   
1264 C CA  . ALA A 164 ? 0.1270 0.1110 0.1211 -0.0034 -0.0160 0.0112  169 ALA B CA  
1265 C C   . ALA A 164 ? 0.1360 0.1188 0.1295 -0.0047 -0.0185 0.0128  169 ALA B C   
1266 O O   . ALA A 164 ? 0.1568 0.1369 0.1500 -0.0042 -0.0202 0.0133  169 ALA B O   
1267 C CB  . ALA A 164 ? 0.1351 0.1178 0.1296 -0.0015 -0.0156 0.0102  169 ALA B CB  
1268 N N   . GLU A 165 ? 0.1314 0.1163 0.1248 -0.0063 -0.0189 0.0136  170 GLU B N   
1269 C CA  . GLU A 165 ? 0.1311 0.1151 0.1242 -0.0075 -0.0214 0.0155  170 GLU B CA  
1270 C C   . GLU A 165 ? 0.1422 0.1277 0.1357 -0.0076 -0.0214 0.0157  170 GLU B C   
1271 O O   . GLU A 165 ? 0.1563 0.1450 0.1498 -0.0083 -0.0195 0.0148  170 GLU B O   
1272 C CB  . GLU A 165 ? 0.1450 0.1309 0.1375 -0.0102 -0.0222 0.0172  170 GLU B CB  
1273 C CG  . GLU A 165 ? 0.1600 0.1450 0.1521 -0.0103 -0.0223 0.0172  170 GLU B CG  
1274 C CD  . GLU A 165 ? 0.1868 0.1738 0.1783 -0.0130 -0.0233 0.0189  170 GLU B CD  
1275 O OE1 . GLU A 165 ? 0.2409 0.2304 0.2321 -0.0150 -0.0241 0.0203  170 GLU B OE1 
1276 O OE2 . GLU A 165 ? 0.2137 0.2001 0.2049 -0.0131 -0.0235 0.0190  170 GLU B OE2 
1277 N N   . ALA A 166 ? 0.1517 0.1349 0.1455 -0.0068 -0.0234 0.0166  171 ALA B N   
1278 C CA  . ALA A 166 ? 0.1472 0.1321 0.1416 -0.0068 -0.0235 0.0170  171 ALA B CA  
1279 C C   . ALA A 166 ? 0.1541 0.1382 0.1488 -0.0079 -0.0262 0.0195  171 ALA B C   
1280 O O   . ALA A 166 ? 0.1540 0.1345 0.1489 -0.0072 -0.0281 0.0203  171 ALA B O   
1281 C CB  . ALA A 166 ? 0.1721 0.1555 0.1671 -0.0042 -0.0228 0.0154  171 ALA B CB  
1282 N N   . VAL A 167 ? 0.1413 0.1289 0.1359 -0.0097 -0.0264 0.0208  172 VAL B N   
1283 C CA  . VAL A 167 ? 0.1596 0.1474 0.1546 -0.0112 -0.0290 0.0236  172 VAL B CA  
1284 C C   . VAL A 167 ? 0.1654 0.1530 0.1615 -0.0098 -0.0299 0.0243  172 VAL B C   
1285 O O   . VAL A 167 ? 0.1658 0.1564 0.1619 -0.0096 -0.0283 0.0232  172 VAL B O   
1286 C CB  . VAL A 167 ? 0.1699 0.1625 0.1642 -0.0144 -0.0287 0.0249  172 VAL B CB  
1287 C CG1 . VAL A 167 ? 0.1875 0.1804 0.1822 -0.0162 -0.0315 0.0283  172 VAL B CG1 
1288 C CG2 . VAL A 167 ? 0.1890 0.1821 0.1823 -0.0155 -0.0276 0.0241  172 VAL B CG2 
1289 N N   . LYS A 168 ? 0.1765 0.1607 0.1737 -0.0090 -0.0324 0.0260  173 LYS B N   
1290 C CA  . LYS A 168 ? 0.1915 0.1753 0.1902 -0.0074 -0.0335 0.0268  173 LYS B CA  
1291 C C   . LYS A 168 ? 0.2175 0.2067 0.2162 -0.0095 -0.0335 0.0285  173 LYS B C   
1292 O O   . LYS A 168 ? 0.2231 0.2152 0.2212 -0.0124 -0.0342 0.0305  173 LYS B O   
1293 C CB  . LYS A 168 ? 0.2149 0.1940 0.2151 -0.0064 -0.0364 0.0287  173 LYS B CB  
1294 C CG  . LYS A 168 ? 0.2577 0.2355 0.2597 -0.0039 -0.0374 0.0289  173 LYS B CG  
1295 C CD  . LYS A 168 ? 0.3096 0.2818 0.3131 -0.0028 -0.0400 0.0302  173 LYS B CD  
1296 C CE  . LYS A 168 ? 0.3616 0.3323 0.3673 -0.0002 -0.0412 0.0307  173 LYS B CE  
1297 N NZ  . LYS A 168 ? 0.4253 0.3898 0.4325 0.0009  -0.0435 0.0312  173 LYS B NZ  
1298 N N   . GLN A 169 ? 0.2229 0.2141 0.2223 -0.0082 -0.0328 0.0279  174 GLN B N   
1299 C CA  . GLN A 169 ? 0.2712 0.2682 0.2705 -0.0105 -0.0327 0.0295  174 GLN B CA  
1300 C C   . GLN A 169 ? 0.3171 0.3142 0.3178 -0.0113 -0.0357 0.0333  174 GLN B C   
1301 O O   . GLN A 169 ? 0.3233 0.3155 0.3253 -0.0093 -0.0375 0.0341  174 GLN B O   
1302 C CB  . GLN A 169 ? 0.3458 0.3458 0.3453 -0.0095 -0.0310 0.0278  174 GLN B CB  
1303 C CG  . GLN A 169 ? 0.3977 0.3947 0.3986 -0.0061 -0.0314 0.0271  174 GLN B CG  
1304 C CD  . GLN A 169 ? 0.4155 0.4160 0.4163 -0.0055 -0.0295 0.0254  174 GLN B CD  
1305 O OE1 . GLN A 169 ? 0.5242 0.5256 0.5264 -0.0042 -0.0304 0.0263  174 GLN B OE1 
1306 N NE2 . GLN A 169 ? 0.4492 0.4517 0.4486 -0.0065 -0.0269 0.0231  174 GLN B NE2 
1307 N N   . SER B 1   ? 0.7611 0.5634 0.5598 0.0056  -0.0062 0.0252  6   SER C N   
1308 C CA  . SER B 1   ? 0.7428 0.5593 0.5553 -0.0008 -0.0080 0.0250  6   SER C CA  
1309 C C   . SER B 1   ? 0.6680 0.4965 0.4905 0.0008  -0.0078 0.0253  6   SER C C   
1310 O O   . SER B 1   ? 0.6448 0.4685 0.4616 0.0043  -0.0066 0.0261  6   SER C O   
1311 C CB  . SER B 1   ? 0.7690 0.5787 0.5762 -0.0101 -0.0090 0.0253  6   SER C CB  
1312 O OG  . SER B 1   ? 0.7946 0.5902 0.5893 -0.0113 -0.0088 0.0249  6   SER C OG  
1313 N N   . ALA B 2   ? 0.5700 0.4141 0.4072 -0.0013 -0.0089 0.0248  7   ALA C N   
1314 C CA  . ALA B 2   ? 0.5514 0.4071 0.3982 0.0011  -0.0087 0.0247  7   ALA C CA  
1315 C C   . ALA B 2   ? 0.4577 0.3280 0.3190 -0.0028 -0.0099 0.0241  7   ALA C C   
1316 O O   . ALA B 2   ? 0.4102 0.2816 0.2739 -0.0058 -0.0108 0.0239  7   ALA C O   
1317 C CB  . ALA B 2   ? 0.6041 0.4636 0.4526 0.0097  -0.0075 0.0241  7   ALA C CB  
1318 N N   . THR B 3   ? 0.4542 0.3344 0.3239 -0.0028 -0.0099 0.0240  8   THR C N   
1319 C CA  . THR B 3   ? 0.4192 0.3145 0.3038 -0.0044 -0.0106 0.0233  8   THR C CA  
1320 C C   . THR B 3   ? 0.3701 0.2741 0.2622 0.0022  -0.0098 0.0220  8   THR C C   
1321 O O   . THR B 3   ? 0.3774 0.2799 0.2659 0.0075  -0.0088 0.0218  8   THR C O   
1322 C CB  . THR B 3   ? 0.4549 0.3564 0.3444 -0.0085 -0.0110 0.0237  8   THR C CB  
1323 O OG1 . THR B 3   ? 0.4997 0.3934 0.3816 -0.0149 -0.0118 0.0250  8   THR C OG1 
1324 C CG2 . THR B 3   ? 0.4506 0.3664 0.3543 -0.0101 -0.0116 0.0230  8   THR C CG2 
1325 N N   . TYR B 4   ? 0.3222 0.2356 0.2248 0.0017  -0.0102 0.0212  9   TYR C N   
1326 C CA  . TYR B 4   ? 0.3158 0.2385 0.2269 0.0067  -0.0095 0.0199  9   TYR C CA  
1327 C C   . TYR B 4   ? 0.2882 0.2236 0.2128 0.0044  -0.0098 0.0191  9   TYR C C   
1328 O O   . TYR B 4   ? 0.3073 0.2446 0.2356 -0.0004 -0.0106 0.0197  9   TYR C O   
1329 C CB  . TYR B 4   ? 0.3143 0.2347 0.2240 0.0092  -0.0094 0.0197  9   TYR C CB  
1330 C CG  . TYR B 4   ? 0.3243 0.2314 0.2202 0.0120  -0.0090 0.0204  9   TYR C CG  
1331 C CD1 . TYR B 4   ? 0.3547 0.2510 0.2414 0.0078  -0.0096 0.0214  9   TYR C CD1 
1332 C CD2 . TYR B 4   ? 0.3332 0.2393 0.2256 0.0187  -0.0079 0.0201  9   TYR C CD2 
1333 C CE1 . TYR B 4   ? 0.3933 0.2762 0.2665 0.0103  -0.0090 0.0219  9   TYR C CE1 
1334 C CE2 . TYR B 4   ? 0.3815 0.2752 0.2610 0.0218  -0.0074 0.0207  9   TYR C CE2 
1335 C CZ  . TYR B 4   ? 0.3929 0.2744 0.2626 0.0174  -0.0079 0.0216  9   TYR C CZ  
1336 O OH  . TYR B 4   ? 0.4335 0.3010 0.2893 0.0201  -0.0072 0.0221  9   TYR C OH  
1337 N N   . GLN B 5   ? 0.2336 0.1778 0.1654 0.0077  -0.0091 0.0178  10  GLN C N   
1338 C CA  . GLN B 5   ? 0.2221 0.1781 0.1667 0.0060  -0.0090 0.0167  10  GLN C CA  
1339 C C   . GLN B 5   ? 0.2145 0.1763 0.1661 0.0087  -0.0085 0.0157  10  GLN C C   
1340 O O   . GLN B 5   ? 0.2166 0.1788 0.1665 0.0132  -0.0078 0.0149  10  GLN C O   
1341 C CB  . GLN B 5   ? 0.2426 0.2050 0.1909 0.0076  -0.0085 0.0155  10  GLN C CB  
1342 C CG  . GLN B 5   ? 0.2489 0.2224 0.2091 0.0057  -0.0083 0.0142  10  GLN C CG  
1343 C CD  . GLN B 5   ? 0.2430 0.2168 0.2050 0.0003  -0.0091 0.0154  10  GLN C CD  
1344 O OE1 . GLN B 5   ? 0.2943 0.2616 0.2484 -0.0019 -0.0097 0.0168  10  GLN C OE1 
1345 N NE2 . GLN B 5   ? 0.2169 0.1983 0.1887 -0.0014 -0.0090 0.0148  10  GLN C NE2 
1346 N N   . PHE B 6   ? 0.1888 0.1552 0.1482 0.0057  -0.0087 0.0158  11  PHE C N   
1347 C CA  . PHE B 6   ? 0.1895 0.1610 0.1554 0.0081  -0.0081 0.0150  11  PHE C CA  
1348 C C   . PHE B 6   ? 0.1827 0.1627 0.1551 0.0113  -0.0071 0.0129  11  PHE C C   
1349 O O   . PHE B 6   ? 0.1695 0.1549 0.1469 0.0102  -0.0068 0.0119  11  PHE C O   
1350 C CB  . PHE B 6   ? 0.1796 0.1554 0.1533 0.0048  -0.0083 0.0156  11  PHE C CB  
1351 C CG  . PHE B 6   ? 0.2074 0.1765 0.1754 0.0022  -0.0092 0.0174  11  PHE C CG  
1352 C CD1 . PHE B 6   ? 0.2295 0.1933 0.1920 0.0043  -0.0092 0.0179  11  PHE C CD1 
1353 C CD2 . PHE B 6   ? 0.2330 0.2019 0.2014 -0.0022 -0.0100 0.0186  11  PHE C CD2 
1354 C CE1 . PHE B 6   ? 0.2505 0.2081 0.2072 0.0018  -0.0101 0.0194  11  PHE C CE1 
1355 C CE2 . PHE B 6   ? 0.2522 0.2153 0.2148 -0.0050 -0.0109 0.0202  11  PHE C CE2 
1356 C CZ  . PHE B 6   ? 0.2707 0.2279 0.2274 -0.0030 -0.0110 0.0205  11  PHE C CZ  
1357 N N   . ASP B 7   ? 0.1788 0.1603 0.1514 0.0150  -0.0064 0.0123  12  ASP C N   
1358 C CA  . ASP B 7   ? 0.1733 0.1635 0.1526 0.0174  -0.0055 0.0104  12  ASP C CA  
1359 C C   . ASP B 7   ? 0.1629 0.1598 0.1528 0.0153  -0.0049 0.0096  12  ASP C C   
1360 O O   . ASP B 7   ? 0.1584 0.1546 0.1498 0.0154  -0.0048 0.0104  12  ASP C O   
1361 C CB  . ASP B 7   ? 0.1887 0.1777 0.1631 0.0221  -0.0050 0.0104  12  ASP C CB  
1362 C CG  . ASP B 7   ? 0.1922 0.1914 0.1740 0.0245  -0.0040 0.0084  12  ASP C CG  
1363 O OD1 . ASP B 7   ? 0.1841 0.1908 0.1746 0.0225  -0.0035 0.0067  12  ASP C OD1 
1364 O OD2 . ASP B 7   ? 0.2387 0.2386 0.2172 0.0285  -0.0036 0.0084  12  ASP C OD2 
1365 N N   . PRO B 8   ? 0.1525 0.1557 0.1502 0.0133  -0.0045 0.0082  13  PRO C N   
1366 C CA  . PRO B 8   ? 0.1564 0.1645 0.1636 0.0111  -0.0038 0.0078  13  PRO C CA  
1367 C C   . PRO B 8   ? 0.1644 0.1772 0.1766 0.0129  -0.0028 0.0067  13  PRO C C   
1368 O O   . PRO B 8   ? 0.1883 0.2027 0.2063 0.0115  -0.0022 0.0071  13  PRO C O   
1369 C CB  . PRO B 8   ? 0.1539 0.1664 0.1659 0.0091  -0.0036 0.0065  13  PRO C CB  
1370 C CG  . PRO B 8   ? 0.1459 0.1598 0.1536 0.0118  -0.0036 0.0051  13  PRO C CG  
1371 C CD  . PRO B 8   ? 0.1474 0.1536 0.1449 0.0135  -0.0045 0.0069  13  PRO C CD  
1372 N N   . SER B 9   ? 0.1455 0.1609 0.1555 0.0161  -0.0024 0.0055  14  SER C N   
1373 C CA  . SER B 9   ? 0.1575 0.1778 0.1717 0.0177  -0.0015 0.0046  14  SER C CA  
1374 C C   . SER B 9   ? 0.1531 0.1693 0.1630 0.0194  -0.0017 0.0064  14  SER C C   
1375 O O   . SER B 9   ? 0.1754 0.1961 0.1899 0.0201  -0.0009 0.0059  14  SER C O   
1376 C CB  . SER B 9   ? 0.1657 0.1921 0.1792 0.0206  -0.0010 0.0025  14  SER C CB  
1377 O OG  . SER B 9   ? 0.1793 0.2018 0.1834 0.0242  -0.0017 0.0036  14  SER C OG  
1378 N N   . HIS B 10  ? 0.1534 0.1613 0.1555 0.0194  -0.0028 0.0085  15  HIS C N   
1379 C CA  . HIS B 10  ? 0.1582 0.1616 0.1560 0.0207  -0.0031 0.0102  15  HIS C CA  
1380 C C   . HIS B 10  ? 0.1574 0.1546 0.1532 0.0176  -0.0040 0.0122  15  HIS C C   
1381 O O   . HIS B 10  ? 0.1799 0.1703 0.1680 0.0185  -0.0047 0.0138  15  HIS C O   
1382 C CB  . HIS B 10  ? 0.1862 0.1854 0.1743 0.0248  -0.0034 0.0107  15  HIS C CB  
1383 C CG  . HIS B 10  ? 0.1961 0.2026 0.1861 0.0284  -0.0025 0.0092  15  HIS C CG  
1384 N ND1 . HIS B 10  ? 0.2198 0.2298 0.2089 0.0299  -0.0023 0.0078  15  HIS C ND1 
1385 C CD2 . HIS B 10  ? 0.2061 0.2181 0.1993 0.0304  -0.0017 0.0089  15  HIS C CD2 
1386 C CE1 . HIS B 10  ? 0.2141 0.2320 0.2059 0.0327  -0.0015 0.0065  15  HIS C CE1 
1387 N NE2 . HIS B 10  ? 0.2180 0.2374 0.2125 0.0328  -0.0011 0.0072  15  HIS C NE2 
1388 N N   . THR B 11  ? 0.1467 0.1459 0.1479 0.0143  -0.0040 0.0120  16  THR C N   
1389 C CA  . THR B 11  ? 0.1408 0.1357 0.1407 0.0111  -0.0048 0.0140  16  THR C CA  
1390 C C   . THR B 11  ? 0.1368 0.1370 0.1466 0.0087  -0.0040 0.0142  16  THR C C   
1391 O O   . THR B 11  ? 0.1247 0.1297 0.1409 0.0075  -0.0033 0.0129  16  THR C O   
1392 C CB  . THR B 11  ? 0.1484 0.1393 0.1431 0.0091  -0.0058 0.0142  16  THR C CB  
1393 O OG1 . THR B 11  ? 0.1576 0.1422 0.1423 0.0115  -0.0063 0.0143  16  THR C OG1 
1394 C CG2 . THR B 11  ? 0.1577 0.1454 0.1513 0.0054  -0.0066 0.0163  16  THR C CG2 
1395 N N   . TYR B 12  ? 0.1380 0.1379 0.1499 0.0082  -0.0038 0.0158  17  TYR C N   
1396 C CA  . TYR B 12  ? 0.1280 0.1327 0.1490 0.0068  -0.0027 0.0162  17  TYR C CA  
1397 C C   . TYR B 12  ? 0.1380 0.1401 0.1575 0.0054  -0.0033 0.0189  17  TYR C C   
1398 O O   . TYR B 12  ? 0.1434 0.1425 0.1582 0.0069  -0.0037 0.0197  17  TYR C O   
1399 C CB  . TYR B 12  ? 0.1310 0.1405 0.1582 0.0085  -0.0012 0.0150  17  TYR C CB  
1400 C CG  . TYR B 12  ? 0.1255 0.1387 0.1542 0.0099  -0.0006 0.0123  17  TYR C CG  
1401 C CD1 . TYR B 12  ? 0.1276 0.1399 0.1507 0.0126  -0.0010 0.0116  17  TYR C CD1 
1402 C CD2 . TYR B 12  ? 0.1214 0.1389 0.1569 0.0084  0.0003  0.0105  17  TYR C CD2 
1403 C CE1 . TYR B 12  ? 0.1304 0.1473 0.1549 0.0141  -0.0004 0.0092  17  TYR C CE1 
1404 C CE2 . TYR B 12  ? 0.1268 0.1484 0.1634 0.0096  0.0008  0.0078  17  TYR C CE2 
1405 C CZ  . TYR B 12  ? 0.1251 0.1465 0.1561 0.0124  0.0003  0.0073  17  TYR C CZ  
1406 O OH  . TYR B 12  ? 0.1669 0.1935 0.1992 0.0136  0.0008  0.0048  17  TYR C OH  
1407 N N   . PRO B 13  ? 0.1370 0.1416 0.1617 0.0031  -0.0030 0.0201  18  PRO C N   
1408 C CA  . PRO B 13  ? 0.1405 0.1449 0.1660 0.0022  -0.0031 0.0226  18  PRO C CA  
1409 C C   . PRO B 13  ? 0.1238 0.1324 0.1575 0.0033  -0.0013 0.0229  18  PRO C C   
1410 O O   . PRO B 13  ? 0.1240 0.1365 0.1651 0.0029  0.0000  0.0221  18  PRO C O   
1411 C CB  . PRO B 13  ? 0.1482 0.1534 0.1742 -0.0005 -0.0037 0.0239  18  PRO C CB  
1412 C CG  . PRO B 13  ? 0.1536 0.1618 0.1841 -0.0008 -0.0030 0.0221  18  PRO C CG  
1413 C CD  . PRO B 13  ? 0.1369 0.1444 0.1660 0.0013  -0.0027 0.0195  18  PRO C CD  
1414 N N   . SER B 14  ? 0.1318 0.1396 0.1642 0.0048  -0.0012 0.0239  19  SER C N   
1415 C CA  . SER B 14  ? 0.1126 0.1239 0.1520 0.0056  0.0004  0.0247  19  SER C CA  
1416 C C   . SER B 14  ? 0.1209 0.1324 0.1610 0.0045  0.0002  0.0279  19  SER C C   
1417 O O   . SER B 14  ? 0.1421 0.1510 0.1762 0.0033  -0.0013 0.0290  19  SER C O   
1418 C CB  . SER B 14  ? 0.1224 0.1335 0.1600 0.0080  0.0007  0.0243  19  SER C CB  
1419 O OG  . SER B 14  ? 0.1314 0.1435 0.1683 0.0092  0.0009  0.0214  19  SER C OG  
1420 N N   . PHE B 15  ? 0.1179 0.1328 0.1654 0.0049  0.0020  0.0291  20  PHE C N   
1421 C CA  . PHE B 15  ? 0.1306 0.1468 0.1795 0.0042  0.0021  0.0323  20  PHE C CA  
1422 C C   . PHE B 15  ? 0.1364 0.1544 0.1898 0.0056  0.0036  0.0339  20  PHE C C   
1423 O O   . PHE B 15  ? 0.1354 0.1545 0.1930 0.0067  0.0052  0.0325  20  PHE C O   
1424 C CB  . PHE B 15  ? 0.1410 0.1597 0.1945 0.0028  0.0027  0.0332  20  PHE C CB  
1425 C CG  . PHE B 15  ? 0.1493 0.1701 0.2106 0.0033  0.0049  0.0317  20  PHE C CG  
1426 C CD1 . PHE B 15  ? 0.1725 0.1949 0.2402 0.0043  0.0072  0.0329  20  PHE C CD1 
1427 C CD2 . PHE B 15  ? 0.1797 0.2003 0.2411 0.0027  0.0048  0.0289  20  PHE C CD2 
1428 C CE1 . PHE B 15  ? 0.2035 0.2268 0.2776 0.0045  0.0094  0.0312  20  PHE C CE1 
1429 C CE2 . PHE B 15  ? 0.1773 0.1994 0.2451 0.0030  0.0068  0.0272  20  PHE C CE2 
1430 C CZ  . PHE B 15  ? 0.1970 0.2201 0.2708 0.0038  0.0091  0.0283  20  PHE C CZ  
1431 N N   . GLU B 16  ? 0.1298 0.1489 0.1827 0.0055  0.0034  0.0370  21  GLU C N   
1432 C CA  . GLU B 16  ? 0.1482 0.1696 0.2060 0.0068  0.0051  0.0393  21  GLU C CA  
1433 C C   . GLU B 16  ? 0.1539 0.1782 0.2151 0.0062  0.0057  0.0424  21  GLU C C   
1434 O O   . GLU B 16  ? 0.1707 0.1954 0.2276 0.0048  0.0039  0.0435  21  GLU C O   
1435 C CB  . GLU B 16  ? 0.1772 0.1976 0.2297 0.0078  0.0040  0.0405  21  GLU C CB  
1436 C CG  . GLU B 16  ? 0.1926 0.2108 0.2412 0.0091  0.0035  0.0381  21  GLU C CG  
1437 C CD  . GLU B 16  ? 0.2587 0.2759 0.3021 0.0106  0.0027  0.0391  21  GLU C CD  
1438 O OE1 . GLU B 16  ? 0.3139 0.3321 0.3563 0.0103  0.0023  0.0418  21  GLU C OE1 
1439 O OE2 . GLU B 16  ? 0.2990 0.3154 0.3399 0.0123  0.0027  0.0375  21  GLU C OE2 
1440 N N   . ALA B 17  ? 0.1415 0.1679 0.2100 0.0071  0.0081  0.0437  22  ALA C N   
1441 C CA  . ALA B 17  ? 0.1407 0.1702 0.2133 0.0073  0.0092  0.0467  22  ALA C CA  
1442 C C   . ALA B 17  ? 0.1492 0.1799 0.2270 0.0090  0.0116  0.0492  22  ALA C C   
1443 O O   . ALA B 17  ? 0.1678 0.1970 0.2486 0.0097  0.0132  0.0481  22  ALA C O   
1444 C CB  . ALA B 17  ? 0.1657 0.1954 0.2421 0.0068  0.0103  0.0453  22  ALA C CB  
1445 N N   . ASP B 18  ? 0.1583 0.1922 0.2370 0.0097  0.0119  0.0530  23  ASP C N   
1446 C CA  . ASP B 18  ? 0.1622 0.1974 0.2454 0.0115  0.0142  0.0560  23  ASP C CA  
1447 C C   . ASP B 18  ? 0.1608 0.1952 0.2511 0.0126  0.0174  0.0563  23  ASP C C   
1448 O O   . ASP B 18  ? 0.1863 0.2210 0.2786 0.0125  0.0180  0.0559  23  ASP C O   
1449 C CB  . ASP B 18  ? 0.1936 0.2333 0.2758 0.0121  0.0136  0.0601  23  ASP C CB  
1450 C CG  . ASP B 18  ? 0.1985 0.2403 0.2854 0.0144  0.0160  0.0639  23  ASP C CG  
1451 O OD1 . ASP B 18  ? 0.2250 0.2654 0.3112 0.0149  0.0163  0.0639  23  ASP C OD1 
1452 O OD2 . ASP B 18  ? 0.2360 0.2805 0.3266 0.0157  0.0177  0.0667  23  ASP C OD2 
1453 N N   . HIS B 19  ? 0.1512 0.1845 0.2453 0.0137  0.0197  0.0574  24  HIS C N   
1454 C CA  . HIS B 19  ? 0.1839 0.2158 0.2844 0.0149  0.0232  0.0587  24  HIS C CA  
1455 C C   . HIS B 19  ? 0.1969 0.2309 0.2995 0.0171  0.0249  0.0637  24  HIS C C   
1456 O O   . HIS B 19  ? 0.1966 0.2309 0.2983 0.0173  0.0248  0.0646  24  HIS C O   
1457 C CB  . HIS B 19  ? 0.1832 0.2113 0.2863 0.0140  0.0249  0.0557  24  HIS C CB  
1458 C CG  . HIS B 19  ? 0.2197 0.2448 0.3286 0.0147  0.0286  0.0561  24  HIS C CG  
1459 N ND1 . HIS B 19  ? 0.2592 0.2817 0.3716 0.0145  0.0313  0.0563  24  HIS C ND1 
1460 C CD2 . HIS B 19  ? 0.2503 0.2743 0.3617 0.0154  0.0301  0.0562  24  HIS C CD2 
1461 C CE1 . HIS B 19  ? 0.2701 0.2892 0.3867 0.0151  0.0344  0.0565  24  HIS C CE1 
1462 N NE2 . HIS B 19  ? 0.2983 0.3183 0.4144 0.0158  0.0338  0.0563  24  HIS C NE2 
1463 N N   . PHE B 20  ? 0.2296 0.2658 0.3346 0.0188  0.0263  0.0669  25  PHE C N   
1464 C CA  . PHE B 20  ? 0.2512 0.2893 0.3591 0.0213  0.0285  0.0718  25  PHE C CA  
1465 C C   . PHE B 20  ? 0.2720 0.3144 0.3766 0.0217  0.0267  0.0745  25  PHE C C   
1466 O O   . PHE B 20  ? 0.2973 0.3402 0.4036 0.0232  0.0283  0.0776  25  PHE C O   
1467 C CB  . PHE B 20  ? 0.2979 0.3310 0.4102 0.0218  0.0320  0.0717  25  PHE C CB  
1468 C CG  . PHE B 20  ? 0.3469 0.3770 0.4636 0.0232  0.0352  0.0724  25  PHE C CG  
1469 C CD1 . PHE B 20  ? 0.4006 0.4334 0.5190 0.0262  0.0369  0.0770  25  PHE C CD1 
1470 C CD2 . PHE B 20  ? 0.3621 0.3871 0.4807 0.0218  0.0366  0.0684  25  PHE C CD2 
1471 C CE1 . PHE B 20  ? 0.4546 0.4844 0.5765 0.0282  0.0400  0.0778  25  PHE C CE1 
1472 C CE2 . PHE B 20  ? 0.4084 0.4302 0.5303 0.0233  0.0396  0.0688  25  PHE C CE2 
1473 C CZ  . PHE B 20  ? 0.4307 0.4546 0.5542 0.0267  0.0414  0.0736  25  PHE C CZ  
1474 N N   . GLY B 21  ? 0.2593 0.3050 0.3591 0.0205  0.0234  0.0738  26  GLY C N   
1475 C CA  . GLY B 21  ? 0.2781 0.3283 0.3737 0.0205  0.0213  0.0762  26  GLY C CA  
1476 C C   . GLY B 21  ? 0.2798 0.3282 0.3735 0.0203  0.0209  0.0754  26  GLY C C   
1477 O O   . GLY B 21  ? 0.3338 0.3847 0.4283 0.0218  0.0217  0.0787  26  GLY C O   
1478 N N   . GLY B 22  ? 0.2540 0.2985 0.3453 0.0186  0.0196  0.0711  27  GLY C N   
1479 C CA  . GLY B 22  ? 0.2587 0.3023 0.3478 0.0185  0.0190  0.0703  27  GLY C CA  
1480 C C   . GLY B 22  ? 0.2196 0.2603 0.3131 0.0189  0.0216  0.0695  27  GLY C C   
1481 O O   . GLY B 22  ? 0.2641 0.3049 0.3563 0.0190  0.0214  0.0692  27  GLY C O   
1482 N N   . LEU B 23  ? 0.1994 0.2375 0.2980 0.0188  0.0241  0.0690  28  LEU C N   
1483 C CA  . LEU B 23  ? 0.2085 0.2436 0.3113 0.0184  0.0267  0.0680  28  LEU C CA  
1484 C C   . LEU B 23  ? 0.1852 0.2185 0.2857 0.0166  0.0253  0.0632  28  LEU C C   
1485 O O   . LEU B 23  ? 0.1886 0.2220 0.2895 0.0162  0.0258  0.0626  28  LEU C O   
1486 C CB  . LEU B 23  ? 0.2242 0.2563 0.3326 0.0188  0.0300  0.0686  28  LEU C CB  
1487 C CG  . LEU B 23  ? 0.2352 0.2636 0.3480 0.0180  0.0331  0.0678  28  LEU C CG  
1488 C CD1 . LEU B 23  ? 0.2407 0.2706 0.3551 0.0193  0.0348  0.0718  28  LEU C CD1 
1489 C CD2 . LEU B 23  ? 0.2477 0.2720 0.3649 0.0182  0.0362  0.0676  28  LEU C CD2 
1490 N N   . SER B 24  ? 0.1786 0.2108 0.2766 0.0154  0.0235  0.0601  29  SER C N   
1491 C CA  . SER B 24  ? 0.1759 0.2069 0.2709 0.0140  0.0219  0.0558  29  SER C CA  
1492 C C   . SER B 24  ? 0.1630 0.1936 0.2537 0.0132  0.0193  0.0536  29  SER C C   
1493 O O   . SER B 24  ? 0.1745 0.2060 0.2648 0.0135  0.0188  0.0554  29  SER C O   
1494 C CB  . SER B 24  ? 0.2006 0.2294 0.3001 0.0127  0.0242  0.0530  29  SER C CB  
1495 O OG  . SER B 24  ? 0.2318 0.2584 0.3343 0.0120  0.0254  0.0516  29  SER C OG  
1496 N N   . VAL B 25  ? 0.1580 0.1874 0.2452 0.0123  0.0176  0.0498  30  VAL C N   
1497 C CA  . VAL B 25  ? 0.1677 0.1962 0.2498 0.0115  0.0151  0.0476  30  VAL C CA  
1498 C C   . VAL B 25  ? 0.1552 0.1822 0.2395 0.0103  0.0158  0.0439  30  VAL C C   
1499 O O   . VAL B 25  ? 0.1891 0.2160 0.2736 0.0101  0.0161  0.0415  30  VAL C O   
1500 C CB  . VAL B 25  ? 0.1789 0.2071 0.2539 0.0118  0.0126  0.0467  30  VAL C CB  
1501 C CG1 . VAL B 25  ? 0.1938 0.2201 0.2631 0.0108  0.0101  0.0445  30  VAL C CG1 
1502 C CG2 . VAL B 25  ? 0.2202 0.2501 0.2926 0.0130  0.0119  0.0500  30  VAL C CG2 
1503 N N   . TRP B 26  ? 0.1581 0.1845 0.2437 0.0096  0.0158  0.0434  31  TRP C N   
1504 C CA  . TRP B 26  ? 0.1513 0.1765 0.2377 0.0085  0.0159  0.0397  31  TRP C CA  
1505 C C   . TRP B 26  ? 0.1568 0.1813 0.2364 0.0081  0.0130  0.0373  31  TRP C C   
1506 O O   . TRP B 26  ? 0.1727 0.1971 0.2476 0.0079  0.0110  0.0385  31  TRP C O   
1507 C CB  . TRP B 26  ? 0.1677 0.1929 0.2566 0.0082  0.0165  0.0401  31  TRP C CB  
1508 C CG  . TRP B 26  ? 0.1831 0.2075 0.2786 0.0085  0.0196  0.0406  31  TRP C CG  
1509 C CD1 . TRP B 26  ? 0.2145 0.2394 0.3134 0.0098  0.0215  0.0441  31  TRP C CD1 
1510 C CD2 . TRP B 26  ? 0.1970 0.2197 0.2963 0.0076  0.0216  0.0375  31  TRP C CD2 
1511 N NE1 . TRP B 26  ? 0.2324 0.2550 0.3367 0.0099  0.0246  0.0434  31  TRP C NE1 
1512 C CE2 . TRP B 26  ? 0.2149 0.2361 0.3195 0.0083  0.0247  0.0391  31  TRP C CE2 
1513 C CE3 . TRP B 26  ? 0.2246 0.2471 0.3231 0.0063  0.0211  0.0333  31  TRP C CE3 
1514 C CZ2 . TRP B 26  ? 0.2122 0.2308 0.3210 0.0073  0.0273  0.0365  31  TRP C CZ2 
1515 C CZ3 . TRP B 26  ? 0.2264 0.2474 0.3293 0.0052  0.0235  0.0308  31  TRP C CZ3 
1516 C CH2 . TRP B 26  ? 0.2027 0.2216 0.3106 0.0055  0.0265  0.0322  31  TRP C CH2 
1517 N N   . ARG B 27  ? 0.1311 0.1554 0.2102 0.0078  0.0130  0.0341  32  ARG C N   
1518 C CA  . ARG B 27  ? 0.1491 0.1725 0.2220 0.0077  0.0107  0.0317  32  ARG C CA  
1519 C C   . ARG B 27  ? 0.1540 0.1775 0.2290 0.0067  0.0111  0.0283  32  ARG C C   
1520 O O   . ARG B 27  ? 0.1788 0.2033 0.2598 0.0060  0.0133  0.0270  32  ARG C O   
1521 C CB  . ARG B 27  ? 0.1556 0.1795 0.2252 0.0089  0.0101  0.0310  32  ARG C CB  
1522 C CG  . ARG B 27  ? 0.1915 0.2150 0.2573 0.0101  0.0092  0.0339  32  ARG C CG  
1523 C CD  . ARG B 27  ? 0.2178 0.2420 0.2795 0.0118  0.0085  0.0331  32  ARG C CD  
1524 N NE  . ARG B 27  ? 0.2088 0.2322 0.2661 0.0129  0.0075  0.0357  32  ARG C NE  
1525 C CZ  . ARG B 27  ? 0.2281 0.2535 0.2887 0.0135  0.0087  0.0384  32  ARG C CZ  
1526 N NH1 . ARG B 27  ? 0.2246 0.2524 0.2921 0.0131  0.0110  0.0387  32  ARG C NH1 
1527 N NH2 . ARG B 27  ? 0.2627 0.2875 0.3190 0.0144  0.0076  0.0407  32  ARG C NH2 
1528 N N   . GLY B 28  ? 0.1433 0.1657 0.2136 0.0063  0.0092  0.0270  33  GLY C N   
1529 C CA  . GLY B 28  ? 0.1461 0.1690 0.2177 0.0055  0.0094  0.0237  33  GLY C CA  
1530 C C   . GLY B 28  ? 0.1219 0.1431 0.1865 0.0054  0.0070  0.0230  33  GLY C C   
1531 O O   . GLY B 28  ? 0.1260 0.1452 0.1844 0.0059  0.0053  0.0245  33  GLY C O   
1532 N N   . LYS B 29  ? 0.1179 0.1398 0.1832 0.0046  0.0070  0.0205  34  LYS C N   
1533 C CA  . LYS B 29  ? 0.1123 0.1324 0.1712 0.0044  0.0049  0.0197  34  LYS C CA  
1534 C C   . LYS B 29  ? 0.1156 0.1370 0.1773 0.0032  0.0053  0.0183  34  LYS C C   
1535 O O   . LYS B 29  ? 0.1566 0.1800 0.2246 0.0028  0.0071  0.0174  34  LYS C O   
1536 C CB  . LYS B 29  ? 0.1364 0.1558 0.1898 0.0058  0.0039  0.0177  34  LYS C CB  
1537 C CG  . LYS B 29  ? 0.1472 0.1701 0.2048 0.0061  0.0052  0.0146  34  LYS C CG  
1538 C CD  . LYS B 29  ? 0.1873 0.2110 0.2405 0.0080  0.0046  0.0132  34  LYS C CD  
1539 C CE  . LYS B 29  ? 0.1880 0.2082 0.2323 0.0095  0.0026  0.0138  34  LYS C CE  
1540 N NZ  . LYS B 29  ? 0.1840 0.2053 0.2239 0.0120  0.0023  0.0125  34  LYS C NZ  
1541 N N   . PHE B 30  ? 0.1244 0.1444 0.1807 0.0026  0.0035  0.0179  35  PHE C N   
1542 C CA  . PHE B 30  ? 0.1191 0.1406 0.1768 0.0016  0.0036  0.0161  35  PHE C CA  
1543 C C   . PHE B 30  ? 0.1298 0.1512 0.1837 0.0025  0.0029  0.0134  35  PHE C C   
1544 O O   . PHE B 30  ? 0.1357 0.1542 0.1826 0.0033  0.0014  0.0139  35  PHE C O   
1545 C CB  . PHE B 30  ? 0.1361 0.1565 0.1902 0.0001  0.0021  0.0181  35  PHE C CB  
1546 C CG  . PHE B 30  ? 0.1323 0.1543 0.1905 -0.0004 0.0029  0.0208  35  PHE C CG  
1547 C CD1 . PHE B 30  ? 0.1490 0.1696 0.2052 -0.0003 0.0024  0.0235  35  PHE C CD1 
1548 C CD2 . PHE B 30  ? 0.1379 0.1629 0.2018 -0.0008 0.0042  0.0207  35  PHE C CD2 
1549 C CE1 . PHE B 30  ? 0.1749 0.1977 0.2351 -0.0005 0.0033  0.0263  35  PHE C CE1 
1550 C CE2 . PHE B 30  ? 0.1534 0.1802 0.2212 -0.0007 0.0052  0.0234  35  PHE C CE2 
1551 C CZ  . PHE B 30  ? 0.1588 0.1847 0.2245 -0.0007 0.0046  0.0264  35  PHE C CZ  
1552 N N   . ASP B 31  ? 0.1162 0.1408 0.1745 0.0025  0.0041  0.0107  36  ASP C N   
1553 C CA  . ASP B 31  ? 0.1328 0.1588 0.1884 0.0036  0.0036  0.0080  36  ASP C CA  
1554 C C   . ASP B 31  ? 0.1315 0.1564 0.1817 0.0034  0.0021  0.0076  36  ASP C C   
1555 O O   . ASP B 31  ? 0.1547 0.1803 0.2013 0.0047  0.0016  0.0059  36  ASP C O   
1556 C CB  . ASP B 31  ? 0.1376 0.1679 0.1999 0.0032  0.0055  0.0050  36  ASP C CB  
1557 C CG  . ASP B 31  ? 0.1792 0.2108 0.2465 0.0032  0.0072  0.0050  36  ASP C CG  
1558 O OD1 . ASP B 31  ? 0.1781 0.2079 0.2439 0.0040  0.0070  0.0071  36  ASP C OD1 
1559 O OD2 . ASP B 31  ? 0.2605 0.2951 0.3334 0.0023  0.0089  0.0023  36  ASP C OD2 
1560 N N   . LYS B 32  ? 0.1198 0.1440 0.1700 0.0017  0.0017  0.0087  37  LYS C N   
1561 C CA  . LYS B 32  ? 0.1463 0.1702 0.1922 0.0013  0.0005  0.0081  37  LYS C CA  
1562 C C   . LYS B 32  ? 0.1385 0.1584 0.1785 0.0000  -0.0010 0.0107  37  LYS C C   
1563 O O   . LYS B 32  ? 0.1520 0.1725 0.1943 -0.0016 -0.0010 0.0126  37  LYS C O   
1564 C CB  . LYS B 32  ? 0.1761 0.2042 0.2278 0.0004  0.0016  0.0062  37  LYS C CB  
1565 C CG  . LYS B 32  ? 0.2585 0.2904 0.3150 0.0013  0.0030  0.0031  37  LYS C CG  
1566 C CD  . LYS B 32  ? 0.3776 0.4133 0.4379 0.0006  0.0038  0.0008  37  LYS C CD  
1567 C CE  . LYS B 32  ? 0.4497 0.4857 0.5045 0.0008  0.0023  0.0002  37  LYS C CE  
1568 N NZ  . LYS B 32  ? 0.5297 0.5699 0.5888 0.0001  0.0032  -0.0018 37  LYS C NZ  
1569 N N   . SER B 33  ? 0.1381 0.1539 0.1699 0.0005  -0.0024 0.0111  38  SER C N   
1570 C CA  . SER B 33  ? 0.1429 0.1539 0.1675 -0.0010 -0.0040 0.0133  38  SER C CA  
1571 C C   . SER B 33  ? 0.1589 0.1670 0.1763 -0.0005 -0.0049 0.0125  38  SER C C   
1572 O O   . SER B 33  ? 0.1884 0.1976 0.2052 0.0018  -0.0045 0.0106  38  SER C O   
1573 C CB  . SER B 33  ? 0.1614 0.1675 0.1811 -0.0007 -0.0046 0.0152  38  SER C CB  
1574 O OG  . SER B 33  ? 0.1749 0.1834 0.2005 -0.0010 -0.0038 0.0163  38  SER C OG  
1575 N N   . SER B 34  ? 0.1533 0.1581 0.1653 -0.0029 -0.0061 0.0141  39  SER C N   
1576 C CA  . SER B 34  ? 0.1594 0.1596 0.1629 -0.0027 -0.0070 0.0140  39  SER C CA  
1577 C C   . SER B 34  ? 0.1645 0.1588 0.1607 -0.0056 -0.0083 0.0162  39  SER C C   
1578 O O   . SER B 34  ? 0.1636 0.1592 0.1623 -0.0082 -0.0086 0.0178  39  SER C O   
1579 C CB  . SER B 34  ? 0.1844 0.1893 0.1910 -0.0031 -0.0067 0.0126  39  SER C CB  
1580 O OG  . SER B 34  ? 0.2183 0.2268 0.2292 -0.0062 -0.0068 0.0136  39  SER C OG  
1581 N N   . GLY B 35  ? 0.1556 0.1436 0.1427 -0.0054 -0.0090 0.0164  40  GLY C N   
1582 C CA  . GLY B 35  ? 0.1732 0.1546 0.1523 -0.0088 -0.0102 0.0184  40  GLY C CA  
1583 C C   . GLY B 35  ? 0.1767 0.1486 0.1445 -0.0074 -0.0106 0.0186  40  GLY C C   
1584 O O   . GLY B 35  ? 0.1753 0.1461 0.1409 -0.0036 -0.0100 0.0174  40  GLY C O   
1585 N N   . THR B 36  ? 0.1969 0.1616 0.1567 -0.0107 -0.0116 0.0202  41  THR C N   
1586 C CA  . THR B 36  ? 0.2351 0.1893 0.1829 -0.0101 -0.0119 0.0206  41  THR C CA  
1587 C C   . THR B 36  ? 0.2410 0.1874 0.1817 -0.0119 -0.0126 0.0217  41  THR C C   
1588 O O   . THR B 36  ? 0.2351 0.1847 0.1793 -0.0153 -0.0132 0.0226  41  THR C O   
1589 C CB  . THR B 36  ? 0.2846 0.2356 0.2270 -0.0136 -0.0124 0.0214  41  THR C CB  
1590 O OG1 . THR B 36  ? 0.3307 0.2836 0.2743 -0.0192 -0.0134 0.0228  41  THR C OG1 
1591 C CG2 . THR B 36  ? 0.2752 0.2329 0.2231 -0.0120 -0.0118 0.0204  41  THR C CG2 
1592 N N   . VAL B 37  ? 0.2529 0.1896 0.1835 -0.0096 -0.0124 0.0216  42  VAL C N   
1593 C CA  . VAL B 37  ? 0.3049 0.2322 0.2263 -0.0116 -0.0131 0.0225  42  VAL C CA  
1594 C C   . VAL B 37  ? 0.3065 0.2217 0.2148 -0.0118 -0.0130 0.0228  42  VAL C C   
1595 O O   . VAL B 37  ? 0.3255 0.2381 0.2306 -0.0075 -0.0121 0.0223  42  VAL C O   
1596 C CB  . VAL B 37  ? 0.3401 0.2670 0.2623 -0.0079 -0.0127 0.0221  42  VAL C CB  
1597 C CG1 . VAL B 37  ? 0.3556 0.2830 0.2779 -0.0015 -0.0116 0.0210  42  VAL C CG1 
1598 C CG2 . VAL B 37  ? 0.3664 0.2823 0.2773 -0.0095 -0.0132 0.0227  42  VAL C CG2 
1599 N N   . THR B 38  ? 0.3160 0.2235 0.2163 -0.0169 -0.0138 0.0238  43  THR C N   
1600 C CA  . THR B 38  ? 0.4150 0.3091 0.3016 -0.0178 -0.0136 0.0241  43  THR C CA  
1601 C C   . THR B 38  ? 0.4058 0.2906 0.2839 -0.0175 -0.0138 0.0240  43  THR C C   
1602 O O   . THR B 38  ? 0.4181 0.3062 0.2994 -0.0206 -0.0146 0.0242  43  THR C O   
1603 C CB  . THR B 38  ? 0.4859 0.3783 0.3694 -0.0248 -0.0145 0.0252  43  THR C CB  
1604 O OG1 . THR B 38  ? 0.5111 0.4123 0.4022 -0.0249 -0.0143 0.0253  43  THR C OG1 
1605 C CG2 . THR B 38  ? 0.6050 0.4821 0.4734 -0.0265 -0.0142 0.0256  43  THR C CG2 
1606 N N   . LEU B 39  ? 0.3861 0.2599 0.2538 -0.0133 -0.0128 0.0238  44  LEU C N   
1607 C CA  . LEU B 39  ? 0.4777 0.3413 0.3360 -0.0125 -0.0128 0.0235  44  LEU C CA  
1608 C C   . LEU B 39  ? 0.5365 0.3840 0.3793 -0.0146 -0.0124 0.0239  44  LEU C C   
1609 O O   . LEU B 39  ? 0.5757 0.4187 0.4140 -0.0118 -0.0114 0.0242  44  LEU C O   
1610 C CB  . LEU B 39  ? 0.4960 0.3602 0.3549 -0.0047 -0.0117 0.0228  44  LEU C CB  
1611 C CG  . LEU B 39  ? 0.5603 0.4365 0.4309 -0.0018 -0.0118 0.0223  44  LEU C CG  
1612 C CD1 . LEU B 39  ? 0.6030 0.4743 0.4681 0.0051  -0.0107 0.0219  44  LEU C CD1 
1613 C CD2 . LEU B 39  ? 0.5854 0.4647 0.4595 -0.0073 -0.0130 0.0227  44  LEU C CD2 
1614 N N   . ASP B 40  ? 0.5856 0.4256 0.4212 -0.0200 -0.0131 0.0239  45  ASP C N   
1615 C CA  . ASP B 40  ? 0.6786 0.5008 0.4974 -0.0225 -0.0127 0.0240  45  ASP C CA  
1616 C C   . ASP B 40  ? 0.6605 0.4741 0.4714 -0.0206 -0.0124 0.0231  45  ASP C C   
1617 O O   . ASP B 40  ? 0.6467 0.4582 0.4548 -0.0264 -0.0135 0.0228  45  ASP C O   
1618 C CB  . ASP B 40  ? 0.6903 0.5112 0.5068 -0.0320 -0.0138 0.0246  45  ASP C CB  
1619 C CG  . ASP B 40  ? 0.8051 0.6077 0.6048 -0.0353 -0.0131 0.0247  45  ASP C CG  
1620 O OD1 . ASP B 40  ? 0.7772 0.5668 0.5660 -0.0300 -0.0116 0.0244  45  ASP C OD1 
1621 O OD2 . ASP B 40  ? 0.8206 0.6223 0.6180 -0.0435 -0.0140 0.0253  45  ASP C OD2 
1622 N N   . ARG B 41  ? 0.6653 0.4753 0.4732 -0.0124 -0.0112 0.0227  46  ARG C N   
1623 C CA  . ARG B 41  ? 0.7871 0.5887 0.5869 -0.0099 -0.0108 0.0219  46  ARG C CA  
1624 C C   . ARG B 41  ? 0.8901 0.6715 0.6715 -0.0106 -0.0098 0.0216  46  ARG C C   
1625 O O   . ARG B 41  ? 0.9646 0.7365 0.7371 -0.0038 -0.0083 0.0213  46  ARG C O   
1626 C CB  . ARG B 41  ? 0.7281 0.5368 0.5340 -0.0013 -0.0101 0.0215  46  ARG C CB  
1627 C CG  . ARG B 41  ? 0.7367 0.5501 0.5464 0.0058  -0.0088 0.0219  46  ARG C CG  
1628 C CD  . ARG B 41  ? 0.7441 0.5724 0.5669 0.0101  -0.0090 0.0216  46  ARG C CD  
1629 N NE  . ARG B 41  ? 0.7268 0.5582 0.5507 0.0184  -0.0077 0.0217  46  ARG C NE  
1630 C CZ  . ARG B 41  ? 0.7485 0.5803 0.5709 0.0249  -0.0068 0.0214  46  ARG C CZ  
1631 N NH1 . ARG B 41  ? 0.7513 0.5800 0.5707 0.0242  -0.0072 0.0210  46  ARG C NH1 
1632 N NH2 . ARG B 41  ? 0.7500 0.5859 0.5736 0.0322  -0.0056 0.0215  46  ARG C NH2 
1633 N N   . ALA B 42  ? 0.8529 0.6281 0.6288 -0.0190 -0.0105 0.0217  47  ALA C N   
1634 C CA  . ALA B 42  ? 0.8480 0.6043 0.6068 -0.0225 -0.0099 0.0212  47  ALA C CA  
1635 C C   . ALA B 42  ? 0.8488 0.6071 0.6081 -0.0327 -0.0117 0.0208  47  ALA C C   
1636 O O   . ALA B 42  ? 0.9052 0.6548 0.6558 -0.0354 -0.0119 0.0197  47  ALA C O   
1637 C CB  . ALA B 42  ? 0.9216 0.6675 0.6719 -0.0224 -0.0086 0.0222  47  ALA C CB  
1638 N N   . ALA B 43  ? 0.8168 0.5871 0.5863 -0.0383 -0.0129 0.0218  48  ALA C N   
1639 C CA  . ALA B 43  ? 0.7809 0.5589 0.5550 -0.0471 -0.0148 0.0217  48  ALA C CA  
1640 C C   . ALA B 43  ? 0.7148 0.5074 0.5013 -0.0449 -0.0158 0.0215  48  ALA C C   
1641 O O   . ALA B 43  ? 0.7302 0.5316 0.5223 -0.0512 -0.0174 0.0217  48  ALA C O   
1642 C CB  . ALA B 43  ? 0.8134 0.5999 0.5942 -0.0533 -0.0157 0.0229  48  ALA C CB  
1643 N N   . LYS B 44  ? 0.6923 0.4879 0.4832 -0.0361 -0.0149 0.0212  49  LYS C N   
1644 C CA  . LYS B 44  ? 0.6493 0.4582 0.4519 -0.0332 -0.0156 0.0212  49  LYS C CA  
1645 C C   . LYS B 44  ? 0.6021 0.4275 0.4188 -0.0377 -0.0169 0.0222  49  LYS C C   
1646 O O   . LYS B 44  ? 0.5996 0.4317 0.4202 -0.0423 -0.0181 0.0224  49  LYS C O   
1647 C CB  . LYS B 44  ? 0.7139 0.5169 0.5092 -0.0354 -0.0161 0.0202  49  LYS C CB  
1648 C CG  . LYS B 44  ? 0.7055 0.4907 0.4851 -0.0314 -0.0147 0.0190  49  LYS C CG  
1649 C CD  . LYS B 44  ? 0.7074 0.4950 0.4903 -0.0213 -0.0134 0.0190  49  LYS C CD  
1650 C CE  . LYS B 44  ? 0.8087 0.5785 0.5759 -0.0159 -0.0117 0.0182  49  LYS C CE  
1651 N NZ  . LYS B 44  ? 0.8366 0.5994 0.5959 -0.0148 -0.0116 0.0170  49  LYS C NZ  
1652 N N   . THR B 45  ? 0.5590 0.3916 0.3836 -0.0360 -0.0166 0.0230  50  THR C N   
1653 C CA  . THR B 45  ? 0.5509 0.3997 0.3896 -0.0390 -0.0175 0.0239  50  THR C CA  
1654 C C   . THR B 45  ? 0.4742 0.3310 0.3225 -0.0339 -0.0167 0.0242  50  THR C C   
1655 O O   . THR B 45  ? 0.5157 0.3662 0.3596 -0.0282 -0.0155 0.0238  50  THR C O   
1656 C CB  . THR B 45  ? 0.5644 0.4137 0.4008 -0.0482 -0.0187 0.0246  50  THR C CB  
1657 O OG1 . THR B 45  ? 0.5806 0.4461 0.4304 -0.0509 -0.0197 0.0256  50  THR C OG1 
1658 C CG2 . THR B 45  ? 0.5984 0.4409 0.4290 -0.0498 -0.0182 0.0250  50  THR C CG2 
1659 N N   . GLY B 46  ? 0.4823 0.3529 0.3429 -0.0363 -0.0174 0.0250  51  GLY C N   
1660 C CA  . GLY B 46  ? 0.4373 0.3175 0.3085 -0.0318 -0.0167 0.0251  51  GLY C CA  
1661 C C   . GLY B 46  ? 0.4048 0.2997 0.2889 -0.0351 -0.0175 0.0259  51  GLY C C   
1662 O O   . GLY B 46  ? 0.3742 0.2725 0.2596 -0.0392 -0.0185 0.0265  51  GLY C O   
1663 N N   . THR B 47  ? 0.3723 0.2761 0.2658 -0.0328 -0.0170 0.0260  52  THR C N   
1664 C CA  . THR B 47  ? 0.3574 0.2748 0.2631 -0.0350 -0.0175 0.0267  52  THR C CA  
1665 C C   . THR B 47  ? 0.3488 0.2743 0.2649 -0.0289 -0.0164 0.0260  52  THR C C   
1666 O O   . THR B 47  ? 0.3590 0.2809 0.2730 -0.0243 -0.0155 0.0250  52  THR C O   
1667 C CB  . THR B 47  ? 0.4236 0.3423 0.3282 -0.0399 -0.0179 0.0275  52  THR C CB  
1668 O OG1 . THR B 47  ? 0.5007 0.4327 0.4166 -0.0421 -0.0183 0.0284  52  THR C OG1 
1669 C CG2 . THR B 47  ? 0.4420 0.3581 0.3454 -0.0365 -0.0170 0.0269  52  THR C CG2 
1670 N N   . VAL B 48  ? 0.2844 0.2209 0.2115 -0.0290 -0.0165 0.0264  53  VAL C N   
1671 C CA  . VAL B 48  ? 0.2686 0.2138 0.2067 -0.0243 -0.0154 0.0257  53  VAL C CA  
1672 C C   . VAL B 48  ? 0.2493 0.2050 0.1969 -0.0266 -0.0155 0.0263  53  VAL C C   
1673 O O   . VAL B 48  ? 0.2530 0.2125 0.2019 -0.0310 -0.0163 0.0277  53  VAL C O   
1674 C CB  . VAL B 48  ? 0.2832 0.2314 0.2258 -0.0217 -0.0151 0.0257  53  VAL C CB  
1675 C CG1 . VAL B 48  ? 0.3111 0.2692 0.2661 -0.0179 -0.0140 0.0251  53  VAL C CG1 
1676 C CG2 . VAL B 48  ? 0.2996 0.2380 0.2330 -0.0189 -0.0150 0.0251  53  VAL C CG2 
1677 N N   . ASP B 49  ? 0.2312 0.1923 0.1856 -0.0237 -0.0146 0.0253  54  ASP C N   
1678 C CA  . ASP B 49  ? 0.2390 0.2106 0.2033 -0.0250 -0.0143 0.0256  54  ASP C CA  
1679 C C   . ASP B 49  ? 0.2381 0.2152 0.2111 -0.0201 -0.0130 0.0241  54  ASP C C   
1680 O O   . ASP B 49  ? 0.2732 0.2480 0.2445 -0.0171 -0.0124 0.0226  54  ASP C O   
1681 C CB  . ASP B 49  ? 0.2757 0.2466 0.2366 -0.0279 -0.0147 0.0258  54  ASP C CB  
1682 C CG  . ASP B 49  ? 0.3532 0.3349 0.3236 -0.0292 -0.0145 0.0263  54  ASP C CG  
1683 O OD1 . ASP B 49  ? 0.4057 0.3948 0.3850 -0.0278 -0.0138 0.0264  54  ASP C OD1 
1684 O OD2 . ASP B 49  ? 0.5029 0.4857 0.4713 -0.0320 -0.0149 0.0267  54  ASP C OD2 
1685 N N   A VAL B 50  ? 0.2049 0.1887 0.1866 -0.0191 -0.0123 0.0244  55  VAL C N   
1686 N N   B VAL B 50  ? 0.2076 0.1920 0.1897 -0.0194 -0.0124 0.0245  55  VAL C N   
1687 C CA  A VAL B 50  ? 0.1898 0.1783 0.1795 -0.0150 -0.0109 0.0228  55  VAL C CA  
1688 C CA  B VAL B 50  ? 0.1916 0.1808 0.1819 -0.0153 -0.0110 0.0230  55  VAL C CA  
1689 C C   A VAL B 50  ? 0.1735 0.1711 0.1733 -0.0158 -0.0102 0.0233  55  VAL C C   
1690 C C   B VAL B 50  ? 0.1748 0.1732 0.1758 -0.0156 -0.0101 0.0233  55  VAL C C   
1691 O O   A VAL B 50  ? 0.1734 0.1736 0.1741 -0.0188 -0.0108 0.0252  55  VAL C O   
1692 O O   B VAL B 50  ? 0.1551 0.1568 0.1590 -0.0175 -0.0102 0.0251  55  VAL C O   
1693 C CB  A VAL B 50  ? 0.1810 0.1664 0.1697 -0.0119 -0.0105 0.0225  55  VAL C CB  
1694 C CB  B VAL B 50  ? 0.1932 0.1798 0.1830 -0.0127 -0.0106 0.0230  55  VAL C CB  
1695 C CG1 A VAL B 50  ? 0.1899 0.1755 0.1785 -0.0141 -0.0111 0.0245  55  VAL C CG1 
1696 C CG1 B VAL B 50  ? 0.1991 0.1915 0.1982 -0.0094 -0.0091 0.0218  55  VAL C CG1 
1697 C CG2 A VAL B 50  ? 0.1886 0.1788 0.1851 -0.0080 -0.0090 0.0208  55  VAL C CG2 
1698 C CG2 B VAL B 50  ? 0.2059 0.1834 0.1853 -0.0115 -0.0112 0.0225  55  VAL C CG2 
1699 N N   . THR B 51  ? 0.1610 0.1636 0.1681 -0.0133 -0.0089 0.0215  56  THR C N   
1700 C CA  . THR B 51  ? 0.1701 0.1805 0.1869 -0.0132 -0.0078 0.0215  56  THR C CA  
1701 C C   . THR B 51  ? 0.1806 0.1931 0.2038 -0.0098 -0.0062 0.0197  56  THR C C   
1702 O O   . THR B 51  ? 0.1814 0.1922 0.2032 -0.0075 -0.0059 0.0176  56  THR C O   
1703 C CB  . THR B 51  ? 0.2095 0.2236 0.2278 -0.0144 -0.0078 0.0209  56  THR C CB  
1704 O OG1 . THR B 51  ? 0.2416 0.2536 0.2533 -0.0180 -0.0093 0.0226  56  THR C OG1 
1705 C CG2 . THR B 51  ? 0.2377 0.2594 0.2653 -0.0140 -0.0065 0.0209  56  THR C CG2 
1706 N N   . THR B 52  ? 0.1638 0.1803 0.1942 -0.0092 -0.0051 0.0205  57  THR C N   
1707 C CA  . THR B 52  ? 0.1638 0.1821 0.2004 -0.0067 -0.0034 0.0191  57  THR C CA  
1708 C C   . THR B 52  ? 0.1739 0.1979 0.2190 -0.0065 -0.0018 0.0187  57  THR C C   
1709 O O   . THR B 52  ? 0.1677 0.1944 0.2145 -0.0079 -0.0019 0.0208  57  THR C O   
1710 C CB  . THR B 52  ? 0.1915 0.2079 0.2278 -0.0061 -0.0033 0.0208  57  THR C CB  
1711 O OG1 . THR B 52  ? 0.2104 0.2212 0.2387 -0.0057 -0.0046 0.0209  57  THR C OG1 
1712 C CG2 . THR B 52  ? 0.2065 0.2253 0.2500 -0.0040 -0.0014 0.0200  57  THR C CG2 
1713 N N   . ASP B 53  ? 0.1364 0.1623 0.1863 -0.0048 -0.0003 0.0161  58  ASP C N   
1714 C CA  . ASP B 53  ? 0.1427 0.1730 0.2004 -0.0043 0.0014  0.0152  58  ASP C CA  
1715 C C   . ASP B 53  ? 0.1420 0.1728 0.2053 -0.0033 0.0032  0.0162  58  ASP C C   
1716 O O   . ASP B 53  ? 0.1482 0.1773 0.2128 -0.0021 0.0039  0.0152  58  ASP C O   
1717 C CB  . ASP B 53  ? 0.1858 0.2176 0.2456 -0.0033 0.0023  0.0115  58  ASP C CB  
1718 C CG  . ASP B 53  ? 0.2722 0.3048 0.3278 -0.0042 0.0010  0.0106  58  ASP C CG  
1719 O OD1 . ASP B 53  ? 0.2765 0.3078 0.3270 -0.0058 -0.0005 0.0126  58  ASP C OD1 
1720 O OD2 . ASP B 53  ? 0.3676 0.4022 0.4248 -0.0034 0.0016  0.0076  58  ASP C OD2 
1721 N N   . ILE B 54  ? 0.1357 0.1689 0.2024 -0.0035 0.0039  0.0185  59  ILE C N   
1722 C CA  . ILE B 54  ? 0.1422 0.1758 0.2143 -0.0022 0.0058  0.0198  59  ILE C CA  
1723 C C   . ILE B 54  ? 0.1377 0.1710 0.2153 -0.0009 0.0080  0.0173  59  ILE C C   
1724 O O   . ILE B 54  ? 0.1490 0.1807 0.2291 -0.0001 0.0093  0.0175  59  ILE C O   
1725 C CB  . ILE B 54  ? 0.1549 0.1921 0.2296 -0.0023 0.0062  0.0228  59  ILE C CB  
1726 C CG1 . ILE B 54  ? 0.1689 0.2067 0.2379 -0.0042 0.0039  0.0256  59  ILE C CG1 
1727 C CG2 . ILE B 54  ? 0.1710 0.2083 0.2516 -0.0005 0.0087  0.0243  59  ILE C CG2 
1728 C CD1 . ILE B 54  ? 0.1979 0.2329 0.2634 -0.0045 0.0029  0.0276  59  ILE C CD1 
1729 N N   . ALA B 55  ? 0.1460 0.1808 0.2255 -0.0009 0.0087  0.0144  60  ALA C N   
1730 C CA  . ALA B 55  ? 0.1535 0.1881 0.2378 -0.0002 0.0109  0.0113  60  ALA C CA  
1731 C C   . ALA B 55  ? 0.1477 0.1807 0.2309 -0.0002 0.0108  0.0092  60  ALA C C   
1732 O O   . ALA B 55  ? 0.1800 0.2129 0.2671 0.0000  0.0126  0.0069  60  ALA C O   
1733 C CB  . ALA B 55  ? 0.1812 0.2184 0.2671 -0.0004 0.0114  0.0085  60  ALA C CB  
1734 N N   . SER B 56  ? 0.1389 0.1707 0.2161 -0.0004 0.0086  0.0102  61  SER C N   
1735 C CA  . SER B 56  ? 0.1328 0.1635 0.2081 0.0000  0.0083  0.0086  61  SER C CA  
1736 C C   . SER B 56  ? 0.1370 0.1659 0.2127 0.0005  0.0087  0.0107  61  SER C C   
1737 O O   . SER B 56  ? 0.1251 0.1536 0.1991 0.0010  0.0084  0.0098  61  SER C O   
1738 C CB  . SER B 56  ? 0.1320 0.1619 0.2000 0.0000  0.0059  0.0083  61  SER C CB  
1739 O OG  . SER B 56  ? 0.1386 0.1658 0.2011 -0.0002 0.0042  0.0113  61  SER C OG  
1740 N N   . ILE B 57  ? 0.1282 0.1567 0.2070 0.0005  0.0096  0.0134  62  ILE C N   
1741 C CA  . ILE B 57  ? 0.1435 0.1705 0.2230 0.0012  0.0102  0.0155  62  ILE C CA  
1742 C C   . ILE B 57  ? 0.1458 0.1729 0.2295 0.0014  0.0122  0.0136  62  ILE C C   
1743 O O   . ILE B 57  ? 0.1554 0.1833 0.2435 0.0009  0.0140  0.0112  62  ILE C O   
1744 C CB  . ILE B 57  ? 0.1534 0.1805 0.2355 0.0014  0.0111  0.0192  62  ILE C CB  
1745 C CG1 . ILE B 57  ? 0.1760 0.2018 0.2567 0.0020  0.0108  0.0220  62  ILE C CG1 
1746 C CG2 . ILE B 57  ? 0.1780 0.2055 0.2668 0.0019  0.0139  0.0186  62  ILE C CG2 
1747 C CD1 . ILE B 57  ? 0.2093 0.2360 0.2913 0.0024  0.0111  0.0259  62  ILE C CD1 
1748 N N   . HIS B 58  ? 0.1332 0.1595 0.2151 0.0019  0.0118  0.0146  63  HIS C N   
1749 C CA  . HIS B 58  ? 0.1616 0.1885 0.2473 0.0018  0.0136  0.0133  63  HIS C CA  
1750 C C   . HIS B 58  ? 0.1478 0.1736 0.2339 0.0025  0.0141  0.0165  63  HIS C C   
1751 O O   . HIS B 58  ? 0.1597 0.1850 0.2409 0.0033  0.0123  0.0179  63  HIS C O   
1752 C CB  . HIS B 58  ? 0.1938 0.2226 0.2769 0.0019  0.0127  0.0104  63  HIS C CB  
1753 C CG  . HIS B 58  ? 0.2453 0.2758 0.3326 0.0012  0.0147  0.0086  63  HIS C CG  
1754 N ND1 . HIS B 58  ? 0.3197 0.3507 0.4068 0.0017  0.0150  0.0099  63  HIS C ND1 
1755 C CD2 . HIS B 58  ? 0.2608 0.2930 0.3526 -0.0002 0.0165  0.0054  63  HIS C CD2 
1756 C CE1 . HIS B 58  ? 0.2471 0.2801 0.3387 0.0004  0.0169  0.0079  63  HIS C CE1 
1757 N NE2 . HIS B 58  ? 0.2919 0.3255 0.3863 -0.0009 0.0179  0.0049  63  HIS C NE2 
1758 N N   . THR B 59  ? 0.1665 0.1914 0.2578 0.0024  0.0164  0.0176  64  THR C N   
1759 C CA  . THR B 59  ? 0.1800 0.2042 0.2721 0.0032  0.0171  0.0210  64  THR C CA  
1760 C C   . THR B 59  ? 0.1970 0.2216 0.2921 0.0027  0.0188  0.0199  64  THR C C   
1761 O O   . THR B 59  ? 0.2079 0.2324 0.3033 0.0033  0.0192  0.0226  64  THR C O   
1762 C CB  . THR B 59  ? 0.1916 0.2145 0.2879 0.0037  0.0190  0.0238  64  THR C CB  
1763 O OG1 . THR B 59  ? 0.2015 0.2232 0.3029 0.0030  0.0217  0.0218  64  THR C OG1 
1764 C CG2 . THR B 59  ? 0.2011 0.2246 0.2950 0.0040  0.0175  0.0251  64  THR C CG2 
1765 N N   . GLY B 60  ? 0.1642 0.1899 0.2618 0.0013  0.0199  0.0162  65  GLY C N   
1766 C CA  . GLY B 60  ? 0.1701 0.1964 0.2714 0.0002  0.0219  0.0152  65  GLY C CA  
1767 C C   . GLY B 60  ? 0.1905 0.2141 0.2975 -0.0010 0.0252  0.0146  65  GLY C C   
1768 O O   . GLY B 60  ? 0.2003 0.2245 0.3102 -0.0029 0.0269  0.0122  65  GLY C O   
1769 N N   . SER B 61  ? 0.2033 0.2244 0.3115 -0.0001 0.0258  0.0165  66  SER C N   
1770 C CA  . SER B 61  ? 0.2117 0.2293 0.3245 -0.0006 0.0289  0.0160  66  SER C CA  
1771 C C   . SER B 61  ? 0.2403 0.2581 0.3528 -0.0006 0.0285  0.0135  66  SER C C   
1772 O O   . SER B 61  ? 0.2347 0.2530 0.3453 0.0008  0.0271  0.0155  66  SER C O   
1773 C CB  . SER B 61  ? 0.2105 0.2255 0.3249 0.0011  0.0304  0.0206  66  SER C CB  
1774 O OG  . SER B 61  ? 0.2203 0.2317 0.3384 0.0013  0.0333  0.0203  66  SER C OG  
1775 N N   . ALA B 62  ? 0.2517 0.2694 0.3660 -0.0025 0.0297  0.0093  67  ALA C N   
1776 C CA  . ALA B 62  ? 0.2665 0.2844 0.3809 -0.0025 0.0296  0.0068  67  ALA C CA  
1777 C C   . ALA B 62  ? 0.2882 0.3027 0.4049 -0.0007 0.0316  0.0092  67  ALA C C   
1778 O O   . ALA B 62  ? 0.2820 0.2977 0.3975 0.0003  0.0306  0.0093  67  ALA C O   
1779 C CB  . ALA B 62  ? 0.3100 0.3283 0.4264 -0.0049 0.0310  0.0018  67  ALA C CB  
1780 N N   . LYS B 63  ? 0.3034 0.3138 0.4231 -0.0003 0.0344  0.0114  68  LYS C N   
1781 C CA  . LYS B 63  ? 0.3269 0.3342 0.4485 0.0019  0.0365  0.0141  68  LYS C CA  
1782 C C   . LYS B 63  ? 0.2738 0.2842 0.3930 0.0043  0.0343  0.0184  68  LYS C C   
1783 O O   . LYS B 63  ? 0.2578 0.2689 0.3769 0.0059  0.0343  0.0193  68  LYS C O   
1784 C CB  . LYS B 63  ? 0.4006 0.4026 0.5254 0.0021  0.0401  0.0160  68  LYS C CB  
1785 C CG  . LYS B 63  ? 0.5207 0.5192 0.6472 0.0051  0.0427  0.0194  68  LYS C CG  
1786 C CD  . LYS B 63  ? 0.5608 0.5543 0.6897 0.0056  0.0459  0.0223  68  LYS C CD  
1787 C CE  . LYS B 63  ? 0.6298 0.6218 0.7596 0.0096  0.0476  0.0273  68  LYS C CE  
1788 N NZ  . LYS B 63  ? 0.6811 0.6692 0.8122 0.0113  0.0504  0.0262  68  LYS C NZ  
1789 N N   . LEU B 64  ? 0.2298 0.2421 0.3468 0.0043  0.0324  0.0208  69  LEU C N   
1790 C CA  . LEU B 64  ? 0.2260 0.2413 0.3402 0.0059  0.0301  0.0246  69  LEU C CA  
1791 C C   . LEU B 64  ? 0.2006 0.2193 0.3112 0.0054  0.0271  0.0228  69  LEU C C   
1792 O O   . LEU B 64  ? 0.2294 0.2502 0.3389 0.0066  0.0262  0.0250  69  LEU C O   
1793 C CB  . LEU B 64  ? 0.2413 0.2577 0.3534 0.0058  0.0286  0.0269  69  LEU C CB  
1794 C CG  . LEU B 64  ? 0.2401 0.2595 0.3488 0.0070  0.0262  0.0307  69  LEU C CG  
1795 C CD1 . LEU B 64  ? 0.2473 0.2668 0.3584 0.0092  0.0280  0.0343  69  LEU C CD1 
1796 C CD2 . LEU B 64  ? 0.2637 0.2837 0.3702 0.0070  0.0250  0.0326  69  LEU C CD2 
1797 N N   . ASP B 65  ? 0.1817 0.2013 0.2907 0.0036  0.0258  0.0189  70  ASP C N   
1798 C CA  . ASP B 65  ? 0.1971 0.2194 0.3024 0.0031  0.0231  0.0173  70  ASP C CA  
1799 C C   . ASP B 65  ? 0.2261 0.2490 0.3330 0.0039  0.0240  0.0169  70  ASP C C   
1800 O O   . ASP B 65  ? 0.2141 0.2396 0.3185 0.0042  0.0222  0.0182  70  ASP C O   
1801 C CB  . ASP B 65  ? 0.2145 0.2379 0.3182 0.0015  0.0221  0.0130  70  ASP C CB  
1802 C CG  . ASP B 65  ? 0.2177 0.2417 0.3188 0.0011  0.0207  0.0132  70  ASP C CG  
1803 O OD1 . ASP B 65  ? 0.2405 0.2641 0.3398 0.0020  0.0199  0.0166  70  ASP C OD1 
1804 O OD2 . ASP B 65  ? 0.2855 0.3107 0.3864 0.0000  0.0206  0.0098  70  ASP C OD2 
1805 N N   . GLU B 66  ? 0.2362 0.2566 0.3473 0.0039  0.0270  0.0147  71  GLU C N   
1806 C CA  . GLU B 66  ? 0.2864 0.3069 0.3992 0.0049  0.0283  0.0138  71  GLU C CA  
1807 C C   . GLU B 66  ? 0.2515 0.2726 0.3651 0.0073  0.0290  0.0184  71  GLU C C   
1808 O O   . GLU B 66  ? 0.2578 0.2820 0.3705 0.0083  0.0282  0.0194  71  GLU C O   
1809 C CB  . GLU B 66  ? 0.3316 0.3482 0.4482 0.0043  0.0316  0.0104  71  GLU C CB  
1810 C CG  . GLU B 66  ? 0.4448 0.4606 0.5632 0.0054  0.0335  0.0088  71  GLU C CG  
1811 C CD  . GLU B 66  ? 0.5648 0.5754 0.6863 0.0044  0.0370  0.0052  71  GLU C CD  
1812 O OE1 . GLU B 66  ? 0.6787 0.6850 0.8022 0.0044  0.0393  0.0066  71  GLU C OE1 
1813 O OE2 . GLU B 66  ? 0.6054 0.6163 0.7272 0.0035  0.0375  0.0010  71  GLU C OE2 
1814 N N   . HIS B 67  ? 0.2575 0.2763 0.3728 0.0084  0.0307  0.0214  72  HIS C N   
1815 C CA  . HIS B 67  ? 0.2653 0.2853 0.3813 0.0109  0.0314  0.0262  72  HIS C CA  
1816 C C   . HIS B 67  ? 0.2831 0.3085 0.3955 0.0108  0.0281  0.0288  72  HIS C C   
1817 O O   . HIS B 67  ? 0.2468 0.2756 0.3592 0.0123  0.0279  0.0310  72  HIS C O   
1818 C CB  . HIS B 67  ? 0.3252 0.3420 0.4434 0.0119  0.0335  0.0291  72  HIS C CB  
1819 C CG  . HIS B 67  ? 0.4337 0.4528 0.5521 0.0145  0.0339  0.0344  72  HIS C CG  
1820 N ND1 . HIS B 67  ? 0.5308 0.5496 0.6516 0.0175  0.0365  0.0365  72  HIS C ND1 
1821 C CD2 . HIS B 67  ? 0.4916 0.5142 0.6078 0.0147  0.0318  0.0380  72  HIS C CD2 
1822 C CE1 . HIS B 67  ? 0.5351 0.5577 0.6554 0.0195  0.0360  0.0414  72  HIS C CE1 
1823 N NE2 . HIS B 67  ? 0.5443 0.5694 0.6619 0.0176  0.0331  0.0423  72  HIS C NE2 
1824 N N   . LEU B 68  ? 0.1947 0.2211 0.3035 0.0089  0.0253  0.0284  73  LEU C N   
1825 C CA  . LEU B 68  ? 0.1921 0.2225 0.2967 0.0084  0.0222  0.0307  73  LEU C CA  
1826 C C   . LEU B 68  ? 0.1852 0.2188 0.2878 0.0076  0.0206  0.0293  73  LEU C C   
1827 O O   . LEU B 68  ? 0.2086 0.2460 0.3083 0.0072  0.0186  0.0318  73  LEU C O   
1828 C CB  . LEU B 68  ? 0.2046 0.2341 0.3051 0.0067  0.0198  0.0302  73  LEU C CB  
1829 C CG  . LEU B 68  ? 0.2227 0.2505 0.3244 0.0074  0.0208  0.0325  73  LEU C CG  
1830 C CD1 . LEU B 68  ? 0.2336 0.2607 0.3311 0.0060  0.0186  0.0315  73  LEU C CD1 
1831 C CD2 . LEU B 68  ? 0.2567 0.2871 0.3592 0.0091  0.0213  0.0374  73  LEU C CD2 
1832 N N   . GLN B 69  ? 0.1988 0.2313 0.3026 0.0071  0.0213  0.0254  74  GLN C N   
1833 C CA  . GLN B 69  ? 0.2007 0.2363 0.3031 0.0065  0.0201  0.0238  74  GLN C CA  
1834 C C   . GLN B 69  ? 0.2385 0.2769 0.3438 0.0086  0.0219  0.0256  74  GLN C C   
1835 O O   . GLN B 69  ? 0.2201 0.2624 0.3239 0.0083  0.0206  0.0256  74  GLN C O   
1836 C CB  . GLN B 69  ? 0.2299 0.2638 0.3333 0.0057  0.0208  0.0189  74  GLN C CB  
1837 C CG  . GLN B 69  ? 0.2429 0.2747 0.3443 0.0041  0.0198  0.0162  74  GLN C CG  
1838 C CD  . GLN B 69  ? 0.2698 0.3031 0.3659 0.0028  0.0166  0.0172  74  GLN C CD  
1839 O OE1 . GLN B 69  ? 0.3204 0.3563 0.4138 0.0022  0.0149  0.0171  74  GLN C OE1 
1840 N NE2 . GLN B 69  ? 0.2768 0.3084 0.3708 0.0025  0.0157  0.0186  74  GLN C NE2 
1841 N N   . THR B 70  ? 0.2463 0.2825 0.3553 0.0109  0.0248  0.0274  75  THR C N   
1842 C CA  . THR B 70  ? 0.2795 0.3179 0.3912 0.0136  0.0269  0.0290  75  THR C CA  
1843 C C   . THR B 70  ? 0.2790 0.3237 0.3892 0.0143  0.0254  0.0335  75  THR C C   
1844 O O   . THR B 70  ? 0.2431 0.2895 0.3504 0.0129  0.0231  0.0357  75  THR C O   
1845 C CB  . THR B 70  ? 0.2722 0.3059 0.3880 0.0164  0.0309  0.0300  75  THR C CB  
1846 O OG1 . THR B 70  ? 0.2726 0.3059 0.3885 0.0171  0.0310  0.0339  75  THR C OG1 
1847 C CG2 . THR B 70  ? 0.3093 0.3365 0.4269 0.0152  0.0329  0.0252  75  THR C CG2 
1848 N N   . ALA B 71  ? 0.3131 0.3615 0.4251 0.0167  0.0267  0.0349  76  ALA C N   
1849 C CA  . ALA B 71  ? 0.3703 0.4261 0.4813 0.0176  0.0256  0.0393  76  ALA C CA  
1850 C C   . ALA B 71  ? 0.3615 0.4184 0.4723 0.0182  0.0254  0.0436  76  ALA C C   
1851 O O   . ALA B 71  ? 0.4194 0.4824 0.5277 0.0171  0.0232  0.0465  76  ALA C O   
1852 C CB  . ALA B 71  ? 0.4074 0.4662 0.5213 0.0212  0.0282  0.0404  76  ALA C CB  
1853 N N   . GLU B 72  ? 0.3902 0.4417 0.5035 0.0200  0.0279  0.0441  77  GLU C N   
1854 C CA  . GLU B 72  ? 0.4477 0.4997 0.5610 0.0209  0.0281  0.0481  77  GLU C CA  
1855 C C   . GLU B 72  ? 0.4495 0.5020 0.5591 0.0177  0.0249  0.0484  77  GLU C C   
1856 O O   . GLU B 72  ? 0.4313 0.4862 0.5404 0.0183  0.0246  0.0522  77  GLU C O   
1857 C CB  . GLU B 72  ? 0.5201 0.5649 0.6367 0.0230  0.0316  0.0480  77  GLU C CB  
1858 C CG  . GLU B 72  ? 0.5751 0.6187 0.6954 0.0273  0.0355  0.0495  77  GLU C CG  
1859 C CD  . GLU B 72  ? 0.6709 0.7104 0.7934 0.0299  0.0384  0.0526  77  GLU C CD  
1860 O OE1 . GLU B 72  ? 0.6823 0.7137 0.8064 0.0296  0.0408  0.0502  77  GLU C OE1 
1861 O OE2 . GLU B 72  ? 0.6925 0.7373 0.8150 0.0320  0.0384  0.0576  77  GLU C OE2 
1862 N N   . PHE B 73  ? 0.3356 0.3850 0.4424 0.0145  0.0229  0.0445  78  PHE C N   
1863 C CA  . PHE B 73  ? 0.2668 0.3160 0.3694 0.0119  0.0200  0.0447  78  PHE C CA  
1864 C C   . PHE B 73  ? 0.2203 0.2717 0.3184 0.0088  0.0168  0.0426  78  PHE C C   
1865 O O   . PHE B 73  ? 0.2349 0.2921 0.3312 0.0081  0.0154  0.0449  78  PHE C O   
1866 C CB  . PHE B 73  ? 0.2832 0.3261 0.3857 0.0111  0.0204  0.0425  78  PHE C CB  
1867 C CG  . PHE B 73  ? 0.3122 0.3555 0.4107 0.0095  0.0179  0.0440  78  PHE C CG  
1868 C CD1 . PHE B 73  ? 0.3466 0.3919 0.4457 0.0109  0.0185  0.0481  78  PHE C CD1 
1869 C CD2 . PHE B 73  ? 0.2887 0.3299 0.3822 0.0069  0.0153  0.0414  78  PHE C CD2 
1870 C CE1 . PHE B 73  ? 0.2987 0.3442 0.3939 0.0095  0.0164  0.0493  78  PHE C CE1 
1871 C CE2 . PHE B 73  ? 0.2628 0.3037 0.3523 0.0057  0.0133  0.0427  78  PHE C CE2 
1872 C CZ  . PHE B 73  ? 0.3503 0.3932 0.4407 0.0070  0.0139  0.0465  78  PHE C CZ  
1873 N N   . PHE B 74  ? 0.1956 0.2431 0.2916 0.0069  0.0157  0.0386  79  PHE C N   
1874 C CA  . PHE B 74  ? 0.1695 0.2185 0.2605 0.0042  0.0128  0.0372  79  PHE C CA  
1875 C C   . PHE B 74  ? 0.1945 0.2476 0.2866 0.0043  0.0130  0.0366  79  PHE C C   
1876 O O   . PHE B 74  ? 0.2016 0.2575 0.2898 0.0020  0.0107  0.0365  79  PHE C O   
1877 C CB  . PHE B 74  ? 0.1557 0.1998 0.2439 0.0026  0.0117  0.0333  79  PHE C CB  
1878 C CG  . PHE B 74  ? 0.1609 0.2017 0.2459 0.0018  0.0105  0.0338  79  PHE C CG  
1879 C CD1 . PHE B 74  ? 0.1611 0.2025 0.2406 0.0001  0.0080  0.0355  79  PHE C CD1 
1880 C CD2 . PHE B 74  ? 0.1814 0.2182 0.2682 0.0026  0.0118  0.0316  79  PHE C CD2 
1881 C CE1 . PHE B 74  ? 0.1639 0.2021 0.2401 -0.0002 0.0071  0.0357  79  PHE C CE1 
1882 C CE2 . PHE B 74  ? 0.1776 0.2117 0.2615 0.0023  0.0108  0.0320  79  PHE C CE2 
1883 C CZ  . PHE B 74  ? 0.1740 0.2087 0.2525 0.0010  0.0085  0.0339  79  PHE C CZ  
1884 N N   . ASP B 75  ? 0.2249 0.2775 0.3219 0.0068  0.0158  0.0356  80  ASP C N   
1885 C CA  . ASP B 75  ? 0.2406 0.2963 0.3387 0.0072  0.0162  0.0341  80  ASP C CA  
1886 C C   . ASP B 75  ? 0.2096 0.2645 0.3039 0.0044  0.0139  0.0308  80  ASP C C   
1887 O O   . ASP B 75  ? 0.2602 0.3194 0.3519 0.0029  0.0122  0.0315  80  ASP C O   
1888 C CB  . ASP B 75  ? 0.2786 0.3417 0.3770 0.0079  0.0160  0.0379  80  ASP C CB  
1889 C CG  . ASP B 75  ? 0.2879 0.3544 0.3890 0.0097  0.0175  0.0367  80  ASP C CG  
1890 O OD1 . ASP B 75  ? 0.2889 0.3524 0.3904 0.0093  0.0179  0.0327  80  ASP C OD1 
1891 O OD2 . ASP B 75  ? 0.3079 0.3804 0.4105 0.0115  0.0182  0.0399  80  ASP C OD2 
1892 N N   . ALA B 76  ? 0.2223 0.2723 0.3170 0.0042  0.0145  0.0271  81  ALA C N   
1893 C CA  . ALA B 76  ? 0.2406 0.2896 0.3316 0.0021  0.0125  0.0240  81  ALA C CA  
1894 C C   . ALA B 76  ? 0.2463 0.2987 0.3377 0.0019  0.0125  0.0222  81  ALA C C   
1895 O O   . ALA B 76  ? 0.2618 0.3151 0.3493 0.0000  0.0105  0.0209  81  ALA C O   
1896 C CB  . ALA B 76  ? 0.2652 0.3094 0.3572 0.0022  0.0134  0.0206  81  ALA C CB  
1897 N N   . ALA B 77  ? 0.2478 0.3021 0.3438 0.0042  0.0150  0.0222  82  ALA C N   
1898 C CA  . ALA B 77  ? 0.2535 0.3117 0.3500 0.0044  0.0151  0.0208  82  ALA C CA  
1899 C C   . ALA B 77  ? 0.2991 0.3631 0.3924 0.0029  0.0129  0.0236  82  ALA C C   
1900 O O   . ALA B 77  ? 0.3653 0.4318 0.4562 0.0014  0.0114  0.0223  82  ALA C O   
1901 C CB  . ALA B 77  ? 0.2774 0.3358 0.3792 0.0076  0.0184  0.0203  82  ALA C CB  
1902 N N   . LYS B 78  ? 0.2491 0.3154 0.3419 0.0029  0.0124  0.0277  83  LYS C N   
1903 C CA  . LYS B 78  ? 0.2749 0.3470 0.3644 0.0009  0.0102  0.0306  83  LYS C CA  
1904 C C   . LYS B 78  ? 0.2517 0.3218 0.3349 -0.0028 0.0072  0.0312  83  LYS C C   
1905 O O   . LYS B 78  ? 0.2373 0.3106 0.3164 -0.0056 0.0050  0.0320  83  LYS C O   
1906 C CB  . LYS B 78  ? 0.3299 0.4060 0.4220 0.0028  0.0114  0.0348  83  LYS C CB  
1907 C CG  . LYS B 78  ? 0.4157 0.4990 0.5051 0.0007  0.0094  0.0384  83  LYS C CG  
1908 C CD  . LYS B 78  ? 0.4493 0.5403 0.5414 0.0025  0.0105  0.0395  83  LYS C CD  
1909 C CE  . LYS B 78  ? 0.4433 0.5426 0.5324 -0.0003 0.0083  0.0429  83  LYS C CE  
1910 N NZ  . LYS B 78  ? 0.4861 0.5921 0.5757 -0.0003 0.0083  0.0426  83  LYS C NZ  
1911 N N   . PHE B 79  ? 0.2149 0.2794 0.2970 -0.0029 0.0070  0.0308  84  PHE C N   
1912 C CA  . PHE B 79  ? 0.2360 0.2975 0.3117 -0.0059 0.0044  0.0314  84  PHE C CA  
1913 C C   . PHE B 79  ? 0.2257 0.2803 0.3000 -0.0056 0.0044  0.0280  84  PHE C C   
1914 O O   . PHE B 79  ? 0.2042 0.2550 0.2794 -0.0046 0.0050  0.0282  84  PHE C O   
1915 C CB  . PHE B 79  ? 0.2251 0.2873 0.2997 -0.0064 0.0038  0.0348  84  PHE C CB  
1916 C CG  . PHE B 79  ? 0.2505 0.3203 0.3274 -0.0059 0.0042  0.0385  84  PHE C CG  
1917 C CD1 . PHE B 79  ? 0.2841 0.3592 0.3579 -0.0087 0.0025  0.0398  84  PHE C CD1 
1918 C CD2 . PHE B 79  ? 0.2414 0.3130 0.3232 -0.0028 0.0064  0.0406  84  PHE C CD2 
1919 C CE1 . PHE B 79  ? 0.2827 0.3661 0.3586 -0.0083 0.0028  0.0434  84  PHE C CE1 
1920 C CE2 . PHE B 79  ? 0.3069 0.3860 0.3906 -0.0020 0.0068  0.0443  84  PHE C CE2 
1921 C CZ  . PHE B 79  ? 0.3121 0.3977 0.3931 -0.0047 0.0050  0.0456  84  PHE C CZ  
1922 N N   . PRO B 80  ? 0.2028 0.2565 0.2757 -0.0062 0.0039  0.0251  85  PRO C N   
1923 C CA  . PRO B 80  ? 0.2083 0.2573 0.2815 -0.0052 0.0045  0.0218  85  PRO C CA  
1924 C C   . PRO B 80  ? 0.2117 0.2557 0.2789 -0.0065 0.0027  0.0216  85  PRO C C   
1925 O O   . PRO B 80  ? 0.1841 0.2248 0.2516 -0.0054 0.0032  0.0194  85  PRO C O   
1926 C CB  . PRO B 80  ? 0.2273 0.2778 0.3009 -0.0052 0.0047  0.0187  85  PRO C CB  
1927 C CG  . PRO B 80  ? 0.2290 0.2843 0.3009 -0.0067 0.0036  0.0206  85  PRO C CG  
1928 C CD  . PRO B 80  ? 0.2104 0.2686 0.2832 -0.0069 0.0036  0.0245  85  PRO C CD  
1929 N N   . GLN B 81  ? 0.2001 0.2439 0.2616 -0.0088 0.0006  0.0239  86  GLN C N   
1930 C CA  . GLN B 81  ? 0.1838 0.2221 0.2384 -0.0100 -0.0011 0.0237  86  GLN C CA  
1931 C C   . GLN B 81  ? 0.1771 0.2149 0.2285 -0.0116 -0.0022 0.0268  86  GLN C C   
1932 O O   . GLN B 81  ? 0.2353 0.2778 0.2884 -0.0125 -0.0022 0.0294  86  GLN C O   
1933 C CB  . GLN B 81  ? 0.2039 0.2407 0.2525 -0.0118 -0.0027 0.0224  86  GLN C CB  
1934 C CG  . GLN B 81  ? 0.2295 0.2669 0.2808 -0.0101 -0.0016 0.0191  86  GLN C CG  
1935 C CD  . GLN B 81  ? 0.2541 0.2904 0.2999 -0.0114 -0.0030 0.0182  86  GLN C CD  
1936 O OE1 . GLN B 81  ? 0.2697 0.3080 0.3129 -0.0138 -0.0040 0.0199  86  GLN C OE1 
1937 N NE2 . GLN B 81  ? 0.2896 0.3232 0.3334 -0.0101 -0.0030 0.0156  86  GLN C NE2 
1938 N N   . ALA B 82  ? 0.1531 0.1857 0.1996 -0.0118 -0.0031 0.0268  87  ALA C N   
1939 C CA  . ALA B 82  ? 0.1646 0.1954 0.2058 -0.0138 -0.0046 0.0291  87  ALA C CA  
1940 C C   . ALA B 82  ? 0.1813 0.2063 0.2134 -0.0157 -0.0065 0.0283  87  ALA C C   
1941 O O   . ALA B 82  ? 0.1942 0.2159 0.2248 -0.0144 -0.0063 0.0259  87  ALA C O   
1942 C CB  . ALA B 82  ? 0.1787 0.2075 0.2214 -0.0119 -0.0039 0.0297  87  ALA C CB  
1943 N N   . ASN B 83  ? 0.1794 0.2030 0.2053 -0.0189 -0.0082 0.0302  88  ASN C N   
1944 C CA  . ASN B 83  ? 0.2091 0.2265 0.2255 -0.0213 -0.0098 0.0295  88  ASN C CA  
1945 C C   . ASN B 83  ? 0.2188 0.2318 0.2288 -0.0231 -0.0110 0.0310  88  ASN C C   
1946 O O   . ASN B 83  ? 0.2056 0.2229 0.2178 -0.0244 -0.0112 0.0332  88  ASN C O   
1947 C CB  . ASN B 83  ? 0.2619 0.2823 0.2766 -0.0246 -0.0107 0.0302  88  ASN C CB  
1948 C CG  . ASN B 83  ? 0.3703 0.3835 0.3745 -0.0277 -0.0123 0.0300  88  ASN C CG  
1949 O OD1 . ASN B 83  ? 0.4136 0.4259 0.4128 -0.0313 -0.0135 0.0317  88  ASN C OD1 
1950 N ND2 . ASN B 83  ? 0.3368 0.3445 0.3371 -0.0260 -0.0122 0.0279  88  ASN C ND2 
1951 N N   . TYR B 84  ? 0.1872 0.1920 0.1890 -0.0231 -0.0118 0.0298  89  TYR C N   
1952 C CA  . TYR B 84  ? 0.2054 0.2045 0.1994 -0.0250 -0.0130 0.0308  89  TYR C CA  
1953 C C   . TYR B 84  ? 0.2223 0.2139 0.2061 -0.0277 -0.0142 0.0301  89  TYR C C   
1954 O O   . TYR B 84  ? 0.2137 0.2007 0.1946 -0.0257 -0.0139 0.0284  89  TYR C O   
1955 C CB  . TYR B 84  ? 0.1957 0.1909 0.1892 -0.0214 -0.0124 0.0300  89  TYR C CB  
1956 C CG  . TYR B 84  ? 0.2125 0.2018 0.1976 -0.0232 -0.0136 0.0308  89  TYR C CG  
1957 C CD1 . TYR B 84  ? 0.2134 0.2067 0.2001 -0.0251 -0.0140 0.0329  89  TYR C CD1 
1958 C CD2 . TYR B 84  ? 0.2306 0.2106 0.2061 -0.0231 -0.0142 0.0297  89  TYR C CD2 
1959 C CE1 . TYR B 84  ? 0.2337 0.2215 0.2121 -0.0271 -0.0151 0.0334  89  TYR C CE1 
1960 C CE2 . TYR B 84  ? 0.2413 0.2152 0.2085 -0.0247 -0.0152 0.0303  89  TYR C CE2 
1961 C CZ  . TYR B 84  ? 0.2401 0.2185 0.2092 -0.0270 -0.0157 0.0320  89  TYR C CZ  
1962 O OH  . TYR B 84  ? 0.2918 0.2643 0.2524 -0.0288 -0.0167 0.0324  89  TYR C OH  
1963 N N   . LYS B 85  ? 0.2283 0.2186 0.2063 -0.0323 -0.0156 0.0316  90  LYS C N   
1964 C CA  . LYS B 85  ? 0.2525 0.2343 0.2198 -0.0354 -0.0166 0.0311  90  LYS C CA  
1965 C C   . LYS B 85  ? 0.2449 0.2205 0.2039 -0.0379 -0.0176 0.0318  90  LYS C C   
1966 O O   . LYS B 85  ? 0.2531 0.2348 0.2152 -0.0400 -0.0181 0.0334  90  LYS C O   
1967 C CB  . LYS B 85  ? 0.2824 0.2685 0.2492 -0.0402 -0.0174 0.0322  90  LYS C CB  
1968 C CG  . LYS B 85  ? 0.3313 0.3246 0.3060 -0.0387 -0.0165 0.0318  90  LYS C CG  
1969 C CD  . LYS B 85  ? 0.4000 0.3954 0.3716 -0.0436 -0.0174 0.0328  90  LYS C CD  
1970 C CE  . LYS B 85  ? 0.4789 0.4773 0.4546 -0.0415 -0.0166 0.0318  90  LYS C CE  
1971 N NZ  . LYS B 85  ? 0.5241 0.5321 0.5117 -0.0379 -0.0153 0.0316  90  LYS C NZ  
1972 N N   . GLY B 86  ? 0.2310 0.1956 0.1797 -0.0378 -0.0180 0.0307  91  GLY C N   
1973 C CA  . GLY B 86  ? 0.2592 0.2172 0.1993 -0.0405 -0.0189 0.0311  91  GLY C CA  
1974 C C   . GLY B 86  ? 0.2628 0.2075 0.1905 -0.0407 -0.0191 0.0298  91  GLY C C   
1975 O O   . GLY B 86  ? 0.2897 0.2296 0.2146 -0.0387 -0.0186 0.0288  91  GLY C O   
1976 N N   . THR B 87  ? 0.2924 0.2310 0.2118 -0.0437 -0.0200 0.0300  92  THR C N   
1977 C CA  . THR B 87  ? 0.3251 0.2496 0.2309 -0.0447 -0.0201 0.0289  92  THR C CA  
1978 C C   . THR B 87  ? 0.3116 0.2300 0.2137 -0.0400 -0.0196 0.0280  92  THR C C   
1979 O O   . THR B 87  ? 0.3083 0.2318 0.2142 -0.0398 -0.0199 0.0286  92  THR C O   
1980 C CB  . THR B 87  ? 0.3633 0.2848 0.2613 -0.0525 -0.0215 0.0296  92  THR C CB  
1981 O OG1 . THR B 87  ? 0.4257 0.3533 0.3271 -0.0566 -0.0219 0.0306  92  THR C OG1 
1982 C CG2 . THR B 87  ? 0.3896 0.2946 0.2721 -0.0540 -0.0215 0.0284  92  THR C CG2 
1983 N N   . ILE B 88  ? 0.3169 0.2245 0.2109 -0.0364 -0.0189 0.0268  93  ILE C N   
1984 C CA  . ILE B 88  ? 0.3214 0.2228 0.2110 -0.0312 -0.0182 0.0259  93  ILE C CA  
1985 C C   . ILE B 88  ? 0.3268 0.2175 0.2039 -0.0345 -0.0189 0.0255  93  ILE C C   
1986 O O   . ILE B 88  ? 0.3541 0.2351 0.2211 -0.0382 -0.0191 0.0252  93  ILE C O   
1987 C CB  . ILE B 88  ? 0.3648 0.2601 0.2511 -0.0251 -0.0170 0.0248  93  ILE C CB  
1988 C CG1 . ILE B 88  ? 0.3419 0.2485 0.2410 -0.0214 -0.0162 0.0249  93  ILE C CG1 
1989 C CG2 . ILE B 88  ? 0.3514 0.2408 0.2327 -0.0197 -0.0163 0.0241  93  ILE C CG2 
1990 C CD1 . ILE B 88  ? 0.3655 0.2678 0.2617 -0.0168 -0.0152 0.0240  93  ILE C CD1 
1991 N N   . LYS B 89  ? 0.3209 0.2136 0.1988 -0.0336 -0.0191 0.0256  94  LYS C N   
1992 C CA  . LYS B 89  ? 0.3379 0.2208 0.2042 -0.0361 -0.0197 0.0249  94  LYS C CA  
1993 C C   . LYS B 89  ? 0.3413 0.2153 0.2009 -0.0295 -0.0186 0.0238  94  LYS C C   
1994 O O   . LYS B 89  ? 0.3327 0.2129 0.1998 -0.0235 -0.0178 0.0239  94  LYS C O   
1995 C CB  . LYS B 89  ? 0.3553 0.2477 0.2275 -0.0386 -0.0206 0.0259  94  LYS C CB  
1996 C CG  . LYS B 89  ? 0.4316 0.3361 0.3129 -0.0438 -0.0215 0.0274  94  LYS C CG  
1997 C CD  . LYS B 89  ? 0.5094 0.4087 0.3832 -0.0508 -0.0223 0.0273  94  LYS C CD  
1998 C CE  . LYS B 89  ? 0.5448 0.4561 0.4289 -0.0536 -0.0226 0.0287  94  LYS C CE  
1999 N NZ  . LYS B 89  ? 0.6432 0.5578 0.5247 -0.0619 -0.0240 0.0296  94  LYS C NZ  
2000 N N   . PHE B 90  ? 0.3518 0.2113 0.1968 -0.0306 -0.0185 0.0227  95  PHE C N   
2001 C CA  . PHE B 90  ? 0.3770 0.2270 0.2141 -0.0241 -0.0174 0.0216  95  PHE C CA  
2002 C C   . PHE B 90  ? 0.4326 0.2782 0.2629 -0.0252 -0.0179 0.0210  95  PHE C C   
2003 O O   . PHE B 90  ? 0.4751 0.3200 0.3021 -0.0320 -0.0190 0.0209  95  PHE C O   
2004 C CB  . PHE B 90  ? 0.3919 0.2268 0.2160 -0.0233 -0.0165 0.0208  95  PHE C CB  
2005 C CG  . PHE B 90  ? 0.4126 0.2501 0.2415 -0.0199 -0.0156 0.0212  95  PHE C CG  
2006 C CD1 . PHE B 90  ? 0.4034 0.2483 0.2396 -0.0243 -0.0163 0.0220  95  PHE C CD1 
2007 C CD2 . PHE B 90  ? 0.4371 0.2688 0.2617 -0.0124 -0.0142 0.0208  95  PHE C CD2 
2008 C CE1 . PHE B 90  ? 0.4237 0.2711 0.2640 -0.0212 -0.0155 0.0223  95  PHE C CE1 
2009 C CE2 . PHE B 90  ? 0.4274 0.2616 0.2557 -0.0094 -0.0134 0.0212  95  PHE C CE2 
2010 C CZ  . PHE B 90  ? 0.4497 0.2917 0.2859 -0.0139 -0.0141 0.0219  95  PHE C CZ  
2011 N N   . ASP B 91  ? 0.4653 0.3092 0.2942 -0.0185 -0.0170 0.0205  96  ASP C N   
2012 C CA  . ASP B 91  ? 0.4983 0.3375 0.3201 -0.0177 -0.0171 0.0198  96  ASP C CA  
2013 C C   . ASP B 91  ? 0.6320 0.4562 0.4409 -0.0122 -0.0157 0.0186  96  ASP C C   
2014 O O   . ASP B 91  ? 0.6557 0.4818 0.4672 -0.0046 -0.0145 0.0187  96  ASP C O   
2015 C CB  . ASP B 91  ? 0.4728 0.3252 0.3060 -0.0137 -0.0171 0.0207  96  ASP C CB  
2016 C CG  . ASP B 91  ? 0.4473 0.2973 0.2747 -0.0145 -0.0176 0.0202  96  ASP C CG  
2017 O OD1 . ASP B 91  ? 0.3875 0.2239 0.2005 -0.0177 -0.0179 0.0187  96  ASP C OD1 
2018 O OD2 . ASP B 91  ? 0.3500 0.2118 0.1874 -0.0116 -0.0177 0.0213  96  ASP C OD2 
2019 N N   . GLY B 92  ? 0.6821 0.4918 0.4774 -0.0162 -0.0157 0.0175  97  GLY C N   
2020 C CA  . GLY B 92  ? 0.7669 0.5604 0.5482 -0.0117 -0.0141 0.0165  97  GLY C CA  
2021 C C   . GLY B 92  ? 0.7769 0.5706 0.5610 -0.0093 -0.0133 0.0172  97  GLY C C   
2022 O O   . GLY B 92  ? 0.7890 0.5844 0.5756 -0.0152 -0.0140 0.0177  97  GLY C O   
2023 N N   . ASP B 93  ? 0.7005 0.4933 0.4843 -0.0007 -0.0118 0.0174  98  ASP C N   
2024 C CA  . ASP B 93  ? 0.7015 0.4949 0.4876 0.0024  -0.0109 0.0181  98  ASP C CA  
2025 C C   . ASP B 93  ? 0.6319 0.4436 0.4355 0.0047  -0.0113 0.0191  98  ASP C C   
2026 O O   . ASP B 93  ? 0.6048 0.4197 0.4123 0.0077  -0.0106 0.0196  98  ASP C O   
2027 C CB  . ASP B 93  ? 0.7390 0.5205 0.5137 0.0107  -0.0090 0.0178  98  ASP C CB  
2028 C CG  . ASP B 93  ? 0.7813 0.5659 0.5566 0.0177  -0.0083 0.0176  98  ASP C CG  
2029 O OD1 . ASP B 93  ? 0.8764 0.6744 0.6632 0.0172  -0.0093 0.0178  98  ASP C OD1 
2030 O OD2 . ASP B 93  ? 0.9078 0.6809 0.6712 0.0238  -0.0068 0.0172  98  ASP C OD2 
2031 N N   . LYS B 94  ? 0.5747 0.3983 0.3887 0.0029  -0.0123 0.0194  99  LYS C N   
2032 C CA  . LYS B 94  ? 0.5513 0.3910 0.3809 0.0059  -0.0123 0.0202  99  LYS C CA  
2033 C C   . LYS B 94  ? 0.4639 0.3148 0.3050 -0.0006 -0.0136 0.0209  99  LYS C C   
2034 O O   . LYS B 94  ? 0.4685 0.3201 0.3090 -0.0059 -0.0147 0.0210  99  LYS C O   
2035 C CB  . LYS B 94  ? 0.6258 0.4702 0.4579 0.0104  -0.0120 0.0202  99  LYS C CB  
2036 C CG  . LYS B 94  ? 0.6915 0.5508 0.5380 0.0147  -0.0116 0.0209  99  LYS C CG  
2037 C CD  . LYS B 94  ? 0.7377 0.5970 0.5843 0.0202  -0.0104 0.0207  99  LYS C CD  
2038 C CE  . LYS B 94  ? 0.7615 0.6346 0.6205 0.0250  -0.0097 0.0211  99  LYS C CE  
2039 N NZ  . LYS B 94  ? 0.7829 0.6538 0.6366 0.0327  -0.0085 0.0209  99  LYS C NZ  
2040 N N   . PRO B 95  ? 0.4158 0.2760 0.2672 -0.0003 -0.0135 0.0215  100 PRO C N   
2041 C CA  . PRO B 95  ? 0.4097 0.2822 0.2734 -0.0053 -0.0145 0.0223  100 PRO C CA  
2042 C C   . PRO B 95  ? 0.3596 0.2415 0.2316 -0.0046 -0.0148 0.0229  100 PRO C C   
2043 O O   . PRO B 95  ? 0.3717 0.2572 0.2471 0.0010  -0.0140 0.0228  100 PRO C O   
2044 C CB  . PRO B 95  ? 0.3877 0.2680 0.2606 -0.0026 -0.0138 0.0224  100 PRO C CB  
2045 C CG  . PRO B 95  ? 0.4220 0.2912 0.2842 0.0003  -0.0130 0.0218  100 PRO C CG  
2046 C CD  . PRO B 95  ? 0.4370 0.2976 0.2897 0.0047  -0.0123 0.0213  100 PRO C CD  
2047 N N   . VAL B 96  ? 0.3319 0.2181 0.2068 -0.0103 -0.0159 0.0236  101 VAL C N   
2048 C CA  . VAL B 96  ? 0.3167 0.2120 0.1993 -0.0097 -0.0162 0.0245  101 VAL C CA  
2049 C C   . VAL B 96  ? 0.2872 0.1961 0.1834 -0.0126 -0.0166 0.0259  101 VAL C C   
2050 O O   . VAL B 96  ? 0.2709 0.1883 0.1754 -0.0108 -0.0163 0.0268  101 VAL C O   
2051 C CB  . VAL B 96  ? 0.3608 0.2497 0.2341 -0.0126 -0.0170 0.0242  101 VAL C CB  
2052 C CG1 . VAL B 96  ? 0.4250 0.3019 0.2864 -0.0079 -0.0162 0.0229  101 VAL C CG1 
2053 C CG2 . VAL B 96  ? 0.3817 0.2670 0.2495 -0.0203 -0.0183 0.0242  101 VAL C CG2 
2054 N N   . SER B 97  ? 0.2750 0.1853 0.1728 -0.0172 -0.0172 0.0261  102 SER C N   
2055 C CA  . SER B 97  ? 0.2720 0.1948 0.1820 -0.0198 -0.0174 0.0275  102 SER C CA  
2056 C C   . SER B 97  ? 0.2762 0.1998 0.1876 -0.0230 -0.0177 0.0275  102 SER C C   
2057 O O   . SER B 97  ? 0.2778 0.1920 0.1799 -0.0241 -0.0178 0.0266  102 SER C O   
2058 C CB  . SER B 97  ? 0.2892 0.2162 0.1997 -0.0243 -0.0185 0.0287  102 SER C CB  
2059 O OG  . SER B 97  ? 0.3236 0.2439 0.2245 -0.0300 -0.0196 0.0284  102 SER C OG  
2060 N N   . VAL B 98  ? 0.2789 0.2137 0.2018 -0.0238 -0.0175 0.0286  103 VAL C N   
2061 C CA  . VAL B 98  ? 0.2540 0.1922 0.1799 -0.0273 -0.0178 0.0289  103 VAL C CA  
2062 C C   . VAL B 98  ? 0.2663 0.2139 0.1981 -0.0318 -0.0186 0.0307  103 VAL C C   
2063 O O   . VAL B 98  ? 0.2465 0.2029 0.1875 -0.0299 -0.0181 0.0318  103 VAL C O   
2064 C CB  . VAL B 98  ? 0.2544 0.1984 0.1894 -0.0237 -0.0167 0.0284  103 VAL C CB  
2065 C CG1 . VAL B 98  ? 0.2686 0.2144 0.2044 -0.0273 -0.0171 0.0286  103 VAL C CG1 
2066 C CG2 . VAL B 98  ? 0.2697 0.2072 0.2006 -0.0183 -0.0158 0.0269  103 VAL C CG2 
2067 N N   . VAL B 99  ? 0.2875 0.2328 0.2132 -0.0377 -0.0198 0.0311  104 VAL C N   
2068 C CA  . VAL B 99  ? 0.2934 0.2481 0.2238 -0.0425 -0.0206 0.0329  104 VAL C CA  
2069 C C   . VAL B 99  ? 0.2883 0.2497 0.2246 -0.0445 -0.0206 0.0335  104 VAL C C   
2070 O O   . VAL B 99  ? 0.2830 0.2387 0.2133 -0.0471 -0.0210 0.0328  104 VAL C O   
2071 C CB  . VAL B 99  ? 0.3255 0.2748 0.2453 -0.0483 -0.0221 0.0329  104 VAL C CB  
2072 C CG1 . VAL B 99  ? 0.3449 0.3053 0.2695 -0.0531 -0.0230 0.0349  104 VAL C CG1 
2073 C CG2 . VAL B 99  ? 0.3595 0.3020 0.2734 -0.0455 -0.0219 0.0320  104 VAL C CG2 
2074 N N   . GLY B 100 ? 0.2857 0.2589 0.2336 -0.0431 -0.0200 0.0349  105 GLY C N   
2075 C CA  . GLY B 100 ? 0.2958 0.2758 0.2505 -0.0437 -0.0197 0.0354  105 GLY C CA  
2076 C C   . GLY B 100 ? 0.2891 0.2821 0.2552 -0.0430 -0.0191 0.0373  105 GLY C C   
2077 O O   . GLY B 100 ? 0.2630 0.2613 0.2306 -0.0444 -0.0195 0.0390  105 GLY C O   
2078 N N   . ASN B 101 ? 0.2577 0.2560 0.2312 -0.0412 -0.0182 0.0372  106 ASN C N   
2079 C CA  . ASN B 101 ? 0.2606 0.2707 0.2444 -0.0405 -0.0174 0.0391  106 ASN C CA  
2080 C C   . ASN B 101 ? 0.2135 0.2257 0.2058 -0.0352 -0.0157 0.0380  106 ASN C C   
2081 O O   . ASN B 101 ? 0.2333 0.2409 0.2238 -0.0343 -0.0154 0.0361  106 ASN C O   
2082 C CB  . ASN B 101 ? 0.2771 0.2927 0.2604 -0.0451 -0.0183 0.0402  106 ASN C CB  
2083 C CG  . ASN B 101 ? 0.3285 0.3449 0.3051 -0.0508 -0.0200 0.0416  106 ASN C CG  
2084 O OD1 . ASN B 101 ? 0.3545 0.3783 0.3346 -0.0512 -0.0200 0.0435  106 ASN C OD1 
2085 N ND2 . ASN B 101 ? 0.3679 0.3765 0.3346 -0.0552 -0.0211 0.0406  106 ASN C ND2 
2086 N N   . LEU B 102 ? 0.2069 0.2260 0.2078 -0.0323 -0.0144 0.0393  107 LEU C N   
2087 C CA  . LEU B 102 ? 0.1973 0.2191 0.2069 -0.0278 -0.0126 0.0384  107 LEU C CA  
2088 C C   . LEU B 102 ? 0.2009 0.2320 0.2173 -0.0284 -0.0119 0.0399  107 LEU C C   
2089 O O   . LEU B 102 ? 0.2034 0.2412 0.2219 -0.0298 -0.0122 0.0425  107 LEU C O   
2090 C CB  . LEU B 102 ? 0.1937 0.2162 0.2080 -0.0241 -0.0113 0.0389  107 LEU C CB  
2091 C CG  . LEU B 102 ? 0.1993 0.2240 0.2223 -0.0198 -0.0092 0.0380  107 LEU C CG  
2092 C CD1 . LEU B 102 ? 0.2313 0.2505 0.2525 -0.0183 -0.0090 0.0350  107 LEU C CD1 
2093 C CD2 . LEU B 102 ? 0.2164 0.2417 0.2431 -0.0170 -0.0081 0.0390  107 LEU C CD2 
2094 N N   . THR B 103 ? 0.2079 0.2397 0.2277 -0.0270 -0.0111 0.0384  108 THR C N   
2095 C CA  . THR B 103 ? 0.2003 0.2408 0.2279 -0.0261 -0.0100 0.0394  108 THR C CA  
2096 C C   . THR B 103 ? 0.2017 0.2427 0.2371 -0.0213 -0.0077 0.0383  108 THR C C   
2097 O O   . THR B 103 ? 0.1858 0.2219 0.2213 -0.0194 -0.0071 0.0357  108 THR C O   
2098 C CB  . THR B 103 ? 0.2129 0.2540 0.2384 -0.0283 -0.0106 0.0384  108 THR C CB  
2099 O OG1 . THR B 103 ? 0.2433 0.2829 0.2607 -0.0333 -0.0126 0.0394  108 THR C OG1 
2100 C CG2 . THR B 103 ? 0.2342 0.2846 0.2676 -0.0271 -0.0093 0.0394  108 THR C CG2 
2101 N N   . LEU B 104 ? 0.1761 0.2231 0.2183 -0.0193 -0.0063 0.0404  109 LEU C N   
2102 C CA  . LEU B 104 ? 0.1741 0.2212 0.2234 -0.0152 -0.0040 0.0398  109 LEU C CA  
2103 C C   . LEU B 104 ? 0.1782 0.2332 0.2345 -0.0135 -0.0024 0.0421  109 LEU C C   
2104 O O   . LEU B 104 ? 0.1834 0.2434 0.2392 -0.0147 -0.0029 0.0452  109 LEU C O   
2105 C CB  . LEU B 104 ? 0.1732 0.2165 0.2217 -0.0138 -0.0038 0.0402  109 LEU C CB  
2106 C CG  . LEU B 104 ? 0.1799 0.2233 0.2353 -0.0100 -0.0014 0.0401  109 LEU C CG  
2107 C CD1 . LEU B 104 ? 0.1961 0.2358 0.2540 -0.0083 -0.0002 0.0366  109 LEU C CD1 
2108 C CD2 . LEU B 104 ? 0.1909 0.2315 0.2446 -0.0093 -0.0015 0.0412  109 LEU C CD2 
2109 N N   . HIS B 105 ? 0.2029 0.2593 0.2650 -0.0110 -0.0004 0.0408  110 HIS C N   
2110 C CA  . HIS B 105 ? 0.1992 0.2625 0.2679 -0.0086 0.0014  0.0431  110 HIS C CA  
2111 C C   . HIS B 105 ? 0.2136 0.2849 0.2809 -0.0109 0.0002  0.0458  110 HIS C C   
2112 O O   . HIS B 105 ? 0.2182 0.2959 0.2887 -0.0096 0.0011  0.0491  110 HIS C O   
2113 C CB  . HIS B 105 ? 0.2193 0.2828 0.2915 -0.0060 0.0030  0.0454  110 HIS C CB  
2114 C CG  . HIS B 105 ? 0.1858 0.2542 0.2648 -0.0026 0.0056  0.0474  110 HIS C CG  
2115 N ND1 . HIS B 105 ? 0.2157 0.2903 0.2962 -0.0017 0.0060  0.0515  110 HIS C ND1 
2116 C CD2 . HIS B 105 ? 0.1949 0.2623 0.2792 0.0003  0.0082  0.0460  110 HIS C CD2 
2117 C CE1 . HIS B 105 ? 0.2099 0.2876 0.2963 0.0018  0.0087  0.0527  110 HIS C CE1 
2118 N NE2 . HIS B 105 ? 0.2350 0.3078 0.3237 0.0032  0.0101  0.0494  110 HIS C NE2 
2119 N N   . GLY B 106 ? 0.2463 0.3176 0.3090 -0.0142 -0.0015 0.0446  111 GLY C N   
2120 C CA  . GLY B 106 ? 0.2613 0.3404 0.3223 -0.0170 -0.0028 0.0469  111 GLY C CA  
2121 C C   . GLY B 106 ? 0.2611 0.3423 0.3169 -0.0206 -0.0048 0.0493  111 GLY C C   
2122 O O   . GLY B 106 ? 0.2749 0.3642 0.3296 -0.0232 -0.0058 0.0517  111 GLY C O   
2123 N N   . VAL B 107 ? 0.2102 0.2851 0.2626 -0.0210 -0.0055 0.0489  112 VAL C N   
2124 C CA  . VAL B 107 ? 0.2118 0.2886 0.2594 -0.0242 -0.0072 0.0511  112 VAL C CA  
2125 C C   . VAL B 107 ? 0.2216 0.2892 0.2608 -0.0274 -0.0091 0.0488  112 VAL C C   
2126 O O   . VAL B 107 ? 0.1935 0.2534 0.2324 -0.0251 -0.0085 0.0465  112 VAL C O   
2127 C CB  . VAL B 107 ? 0.2272 0.3058 0.2783 -0.0213 -0.0060 0.0533  112 VAL C CB  
2128 C CG1 . VAL B 107 ? 0.2160 0.2963 0.2615 -0.0249 -0.0080 0.0551  112 VAL C CG1 
2129 C CG2 . VAL B 107 ? 0.2378 0.3252 0.2971 -0.0175 -0.0037 0.0558  112 VAL C CG2 
2130 N N   . THR B 108 ? 0.2178 0.2864 0.2502 -0.0325 -0.0113 0.0496  113 THR C N   
2131 C CA  . THR B 108 ? 0.2224 0.2813 0.2455 -0.0358 -0.0131 0.0476  113 THR C CA  
2132 C C   . THR B 108 ? 0.2430 0.3020 0.2618 -0.0381 -0.0143 0.0491  113 THR C C   
2133 O O   . THR B 108 ? 0.2678 0.3351 0.2859 -0.0414 -0.0152 0.0517  113 THR C O   
2134 C CB  . THR B 108 ? 0.2426 0.2995 0.2597 -0.0402 -0.0146 0.0465  113 THR C CB  
2135 O OG1 . THR B 108 ? 0.2648 0.3211 0.2859 -0.0375 -0.0134 0.0448  113 THR C OG1 
2136 C CG2 . THR B 108 ? 0.2810 0.3268 0.2875 -0.0434 -0.0162 0.0447  113 THR C CG2 
2137 N N   . LYS B 109 ? 0.2440 0.2951 0.2595 -0.0367 -0.0143 0.0479  114 LYS C N   
2138 C CA  . LYS B 109 ? 0.2344 0.2848 0.2453 -0.0385 -0.0154 0.0491  114 LYS C CA  
2139 C C   . LYS B 109 ? 0.2426 0.2812 0.2448 -0.0394 -0.0164 0.0467  114 LYS C C   
2140 O O   . LYS B 109 ? 0.2142 0.2454 0.2161 -0.0365 -0.0156 0.0443  114 LYS C O   
2141 C CB  . LYS B 109 ? 0.2662 0.3221 0.2845 -0.0343 -0.0138 0.0511  114 LYS C CB  
2142 C CG  . LYS B 109 ? 0.3083 0.3767 0.3333 -0.0341 -0.0131 0.0542  114 LYS C CG  
2143 C CD  . LYS B 109 ? 0.3168 0.3921 0.3472 -0.0312 -0.0120 0.0572  114 LYS C CD  
2144 C CE  . LYS B 109 ? 0.3002 0.3885 0.3367 -0.0306 -0.0112 0.0606  114 LYS C CE  
2145 N NZ  . LYS B 109 ? 0.2542 0.3492 0.2976 -0.0261 -0.0093 0.0638  114 LYS C NZ  
2146 N N   . PRO B 110 ? 0.2272 0.2636 0.2221 -0.0430 -0.0179 0.0471  115 PRO C N   
2147 C CA  . PRO B 110 ? 0.2309 0.2557 0.2168 -0.0435 -0.0186 0.0450  115 PRO C CA  
2148 C C   . PRO B 110 ? 0.2260 0.2464 0.2145 -0.0381 -0.0174 0.0441  115 PRO C C   
2149 O O   . PRO B 110 ? 0.2235 0.2500 0.2193 -0.0349 -0.0162 0.0458  115 PRO C O   
2150 C CB  . PRO B 110 ? 0.2781 0.3041 0.2573 -0.0483 -0.0203 0.0461  115 PRO C CB  
2151 C CG  . PRO B 110 ? 0.2940 0.3312 0.2769 -0.0517 -0.0207 0.0484  115 PRO C CG  
2152 C CD  . PRO B 110 ? 0.2656 0.3109 0.2599 -0.0468 -0.0189 0.0498  115 PRO C CD  
2153 N N   . LEU B 111 ? 0.2283 0.2384 0.2116 -0.0365 -0.0173 0.0415  116 LEU C N   
2154 C CA  . LEU B 111 ? 0.2237 0.2288 0.2079 -0.0316 -0.0163 0.0404  116 LEU C CA  
2155 C C   . LEU B 111 ? 0.2603 0.2540 0.2342 -0.0318 -0.0170 0.0382  116 LEU C C   
2156 O O   . LEU B 111 ? 0.2644 0.2522 0.2330 -0.0333 -0.0175 0.0367  116 LEU C O   
2157 C CB  . LEU B 111 ? 0.2250 0.2327 0.2182 -0.0271 -0.0145 0.0396  116 LEU C CB  
2158 C CG  . LEU B 111 ? 0.2428 0.2457 0.2368 -0.0224 -0.0134 0.0382  116 LEU C CG  
2159 C CD1 . LEU B 111 ? 0.2637 0.2700 0.2612 -0.0204 -0.0127 0.0399  116 LEU C CD1 
2160 C CD2 . LEU B 111 ? 0.2414 0.2468 0.2431 -0.0195 -0.0118 0.0371  116 LEU C CD2 
2161 N N   . THR B 112 ? 0.2392 0.2293 0.2095 -0.0302 -0.0171 0.0382  117 THR C N   
2162 C CA  . THR B 112 ? 0.2509 0.2297 0.2107 -0.0298 -0.0177 0.0362  117 THR C CA  
2163 C C   . THR B 112 ? 0.2586 0.2354 0.2217 -0.0238 -0.0163 0.0352  117 THR C C   
2164 O O   . THR B 112 ? 0.2988 0.2821 0.2700 -0.0211 -0.0153 0.0364  117 THR C O   
2165 C CB  . THR B 112 ? 0.3001 0.2759 0.2517 -0.0329 -0.0189 0.0367  117 THR C CB  
2166 O OG1 . THR B 112 ? 0.3105 0.2865 0.2572 -0.0390 -0.0203 0.0371  117 THR C OG1 
2167 C CG2 . THR B 112 ? 0.3011 0.2653 0.2426 -0.0310 -0.0191 0.0348  117 THR C CG2 
2168 N N   . LEU B 113 ? 0.2630 0.2322 0.2214 -0.0218 -0.0160 0.0331  118 LEU C N   
2169 C CA  . LEU B 113 ? 0.2496 0.2168 0.2097 -0.0162 -0.0148 0.0321  118 LEU C CA  
2170 C C   . LEU B 113 ? 0.2838 0.2415 0.2331 -0.0150 -0.0153 0.0311  118 LEU C C   
2171 O O   . LEU B 113 ? 0.3402 0.2895 0.2798 -0.0171 -0.0161 0.0301  118 LEU C O   
2172 C CB  . LEU B 113 ? 0.2552 0.2220 0.2184 -0.0138 -0.0139 0.0305  118 LEU C CB  
2173 C CG  . LEU B 113 ? 0.2690 0.2443 0.2420 -0.0151 -0.0134 0.0311  118 LEU C CG  
2174 C CD1 . LEU B 113 ? 0.2908 0.2642 0.2644 -0.0131 -0.0128 0.0292  118 LEU C CD1 
2175 C CD2 . LEU B 113 ? 0.2710 0.2545 0.2545 -0.0131 -0.0122 0.0323  118 LEU C CD2 
2176 N N   . LYS B 114 ? 0.2611 0.2197 0.2117 -0.0114 -0.0147 0.0313  119 LYS C N   
2177 C CA  . LYS B 114 ? 0.2707 0.2206 0.2113 -0.0092 -0.0148 0.0303  119 LYS C CA  
2178 C C   . LYS B 114 ? 0.2603 0.2065 0.1995 -0.0044 -0.0139 0.0287  119 LYS C C   
2179 O O   . LYS B 114 ? 0.2560 0.2087 0.2042 -0.0013 -0.0127 0.0288  119 LYS C O   
2180 C CB  . LYS B 114 ? 0.2961 0.2499 0.2391 -0.0075 -0.0146 0.0316  119 LYS C CB  
2181 C CG  . LYS B 114 ? 0.4026 0.3582 0.3432 -0.0123 -0.0159 0.0329  119 LYS C CG  
2182 C CD  . LYS B 114 ? 0.4923 0.4368 0.4189 -0.0151 -0.0171 0.0316  119 LYS C CD  
2183 C CE  . LYS B 114 ? 0.5695 0.5158 0.4928 -0.0202 -0.0184 0.0326  119 LYS C CE  
2184 N NZ  . LYS B 114 ? 0.5627 0.5090 0.4842 -0.0260 -0.0194 0.0327  119 LYS C NZ  
2185 N N   . ILE B 115 ? 0.2571 0.1930 0.1852 -0.0036 -0.0141 0.0274  120 ILE C N   
2186 C CA  . ILE B 115 ? 0.2723 0.2051 0.1984 0.0013  -0.0132 0.0261  120 ILE C CA  
2187 C C   . ILE B 115 ? 0.2895 0.2205 0.2124 0.0058  -0.0126 0.0260  120 ILE C C   
2188 O O   . ILE B 115 ? 0.3321 0.2548 0.2445 0.0057  -0.0131 0.0258  120 ILE C O   
2189 C CB  . ILE B 115 ? 0.2813 0.2038 0.1968 0.0005  -0.0135 0.0250  120 ILE C CB  
2190 C CG1 . ILE B 115 ? 0.2758 0.2018 0.1960 -0.0034 -0.0139 0.0252  120 ILE C CG1 
2191 C CG2 . ILE B 115 ? 0.3055 0.2243 0.2172 0.0065  -0.0124 0.0239  120 ILE C CG2 
2192 C CD1 . ILE B 115 ? 0.3275 0.2443 0.2381 -0.0059 -0.0144 0.0246  120 ILE C CD1 
2193 N N   . ASP B 116 ? 0.2750 0.2137 0.2064 0.0097  -0.0115 0.0262  121 ASP C N   
2194 C CA  . ASP B 116 ? 0.3254 0.2639 0.2546 0.0144  -0.0109 0.0263  121 ASP C CA  
2195 C C   . ASP B 116 ? 0.3513 0.2840 0.2731 0.0193  -0.0102 0.0250  121 ASP C C   
2196 O O   . ASP B 116 ? 0.3600 0.2884 0.2748 0.0230  -0.0099 0.0249  121 ASP C O   
2197 C CB  . ASP B 116 ? 0.3394 0.2890 0.2809 0.0158  -0.0100 0.0272  121 ASP C CB  
2198 C CG  . ASP B 116 ? 0.4173 0.3719 0.3642 0.0122  -0.0104 0.0290  121 ASP C CG  
2199 O OD1 . ASP B 116 ? 0.4783 0.4282 0.4189 0.0089  -0.0116 0.0294  121 ASP C OD1 
2200 O OD2 . ASP B 116 ? 0.5080 0.4713 0.4655 0.0125  -0.0096 0.0300  121 ASP C OD2 
2201 N N   . SER B 117 ? 0.2918 0.2249 0.2151 0.0201  -0.0098 0.0241  122 SER C N   
2202 C CA  . SER B 117 ? 0.3303 0.2576 0.2455 0.0250  -0.0092 0.0231  122 SER C CA  
2203 C C   . SER B 117 ? 0.3083 0.2319 0.2211 0.0232  -0.0094 0.0224  122 SER C C   
2204 O O   . SER B 117 ? 0.2747 0.2033 0.1949 0.0193  -0.0097 0.0225  122 SER C O   
2205 C CB  . SER B 117 ? 0.3627 0.2984 0.2845 0.0299  -0.0080 0.0229  122 SER C CB  
2206 O OG  . SER B 117 ? 0.3958 0.3405 0.3287 0.0284  -0.0076 0.0226  122 SER C OG  
2207 N N   . PHE B 118 ? 0.3318 0.2452 0.2328 0.0258  -0.0091 0.0218  123 PHE C N   
2208 C CA  . PHE B 118 ? 0.3299 0.2380 0.2262 0.0248  -0.0092 0.0213  123 PHE C CA  
2209 C C   . PHE B 118 ? 0.3273 0.2296 0.2148 0.0312  -0.0081 0.0209  123 PHE C C   
2210 O O   . PHE B 118 ? 0.3535 0.2482 0.2314 0.0345  -0.0077 0.0210  123 PHE C O   
2211 C CB  . PHE B 118 ? 0.3511 0.2495 0.2394 0.0193  -0.0102 0.0216  123 PHE C CB  
2212 C CG  . PHE B 118 ? 0.3945 0.2853 0.2757 0.0184  -0.0101 0.0212  123 PHE C CG  
2213 C CD1 . PHE B 118 ? 0.4380 0.3168 0.3059 0.0221  -0.0094 0.0210  123 PHE C CD1 
2214 C CD2 . PHE B 118 ? 0.4381 0.3334 0.3255 0.0139  -0.0107 0.0214  123 PHE C CD2 
2215 C CE1 . PHE B 118 ? 0.4959 0.3672 0.3569 0.0214  -0.0091 0.0209  123 PHE C CE1 
2216 C CE2 . PHE B 118 ? 0.4463 0.3345 0.3269 0.0131  -0.0105 0.0212  123 PHE C CE2 
2217 C CZ  . PHE B 118 ? 0.4617 0.3376 0.3289 0.0166  -0.0098 0.0211  123 PHE C CZ  
2218 N N   . LYS B 119 ? 0.3255 0.2315 0.2159 0.0332  -0.0075 0.0205  124 LYS C N   
2219 C CA  . LYS B 119 ? 0.3441 0.2466 0.2272 0.0397  -0.0064 0.0203  124 LYS C CA  
2220 C C   . LYS B 119 ? 0.3340 0.2356 0.2163 0.0392  -0.0062 0.0200  124 LYS C C   
2221 O O   . LYS B 119 ? 0.3318 0.2425 0.2247 0.0360  -0.0066 0.0196  124 LYS C O   
2222 C CB  . LYS B 119 ? 0.3540 0.2680 0.2447 0.0448  -0.0055 0.0201  124 LYS C CB  
2223 C CG  . LYS B 119 ? 0.3788 0.2920 0.2634 0.0520  -0.0043 0.0200  124 LYS C CG  
2224 C CD  . LYS B 119 ? 0.4071 0.3337 0.3005 0.0560  -0.0036 0.0198  124 LYS C CD  
2225 C CE  . LYS B 119 ? 0.4417 0.3670 0.3271 0.0639  -0.0024 0.0201  124 LYS C CE  
2226 N NZ  . LYS B 119 ? 0.4651 0.4050 0.3593 0.0675  -0.0016 0.0198  124 LYS C NZ  
2227 N N   . CYS B 120 ? 0.3472 0.2378 0.2172 0.0422  -0.0056 0.0203  125 CYS C N   
2228 C CA  . CYS B 120 ? 0.3773 0.2676 0.2460 0.0430  -0.0051 0.0202  125 CYS C CA  
2229 C C   . CYS B 120 ? 0.3577 0.2474 0.2204 0.0513  -0.0037 0.0205  125 CYS C C   
2230 O O   . CYS B 120 ? 0.3890 0.2715 0.2427 0.0554  -0.0030 0.0208  125 CYS C O   
2231 C CB  . CYS B 120 ? 0.4208 0.2987 0.2804 0.0386  -0.0055 0.0207  125 CYS C CB  
2232 S SG  . CYS B 120 ? 0.5185 0.3972 0.3837 0.0287  -0.0072 0.0207  125 CYS C SG  
2233 N N   . MET B 121 ? 0.3585 0.2571 0.2268 0.0538  -0.0031 0.0202  126 MET C N   
2234 C CA  . MET B 121 ? 0.3667 0.2677 0.2309 0.0617  -0.0018 0.0205  126 MET C CA  
2235 C C   . MET B 121 ? 0.3637 0.2698 0.2303 0.0628  -0.0014 0.0204  126 MET C C   
2236 O O   . MET B 121 ? 0.3274 0.2392 0.2025 0.0575  -0.0022 0.0197  126 MET C O   
2237 C CB  . MET B 121 ? 0.3803 0.2937 0.2529 0.0648  -0.0016 0.0200  126 MET C CB  
2238 C CG  . MET B 121 ? 0.4053 0.3344 0.2938 0.0614  -0.0021 0.0189  126 MET C CG  
2239 S SD  . MET B 121 ? 0.4419 0.3860 0.3414 0.0637  -0.0017 0.0183  126 MET C SD  
2240 C CE  . MET B 121 ? 0.4953 0.4430 0.3883 0.0728  -0.0003 0.0187  126 MET C CE  
2241 N N   . PRO B 122 ? 0.3758 0.2790 0.2340 0.0696  -0.0001 0.0212  127 PRO C N   
2242 C CA  . PRO B 122 ? 0.3846 0.2969 0.2473 0.0716  0.0003  0.0209  127 PRO C CA  
2243 C C   . PRO B 122 ? 0.3803 0.3106 0.2568 0.0723  0.0002  0.0196  127 PRO C C   
2244 O O   . PRO B 122 ? 0.4302 0.3654 0.3076 0.0762  0.0006  0.0196  127 PRO C O   
2245 C CB  . PRO B 122 ? 0.4156 0.3211 0.2658 0.0797  0.0019  0.0224  127 PRO C CB  
2246 C CG  . PRO B 122 ? 0.4310 0.3225 0.2696 0.0816  0.0023  0.0232  127 PRO C CG  
2247 C CD  . PRO B 122 ? 0.4240 0.3187 0.2702 0.0765  0.0010  0.0222  127 PRO C CD  
2248 N N   . HIS B 123 ? 0.3642 0.3041 0.2512 0.0682  -0.0003 0.0185  128 HIS C N   
2249 C CA  . HIS B 123 ? 0.3426 0.2984 0.2423 0.0679  -0.0004 0.0170  128 HIS C CA  
2250 C C   . HIS B 123 ? 0.3916 0.3556 0.2895 0.0749  0.0007  0.0171  128 HIS C C   
2251 O O   . HIS B 123 ? 0.3655 0.3270 0.2578 0.0774  0.0012  0.0177  128 HIS C O   
2252 C CB  . HIS B 123 ? 0.3483 0.3101 0.2581 0.0615  -0.0012 0.0157  128 HIS C CB  
2253 C CG  . HIS B 123 ? 0.3429 0.3192 0.2661 0.0596  -0.0013 0.0139  128 HIS C CG  
2254 N ND1 . HIS B 123 ? 0.3462 0.3346 0.2737 0.0635  -0.0005 0.0130  128 HIS C ND1 
2255 C CD2 . HIS B 123 ? 0.3833 0.3640 0.3165 0.0543  -0.0019 0.0130  128 HIS C CD2 
2256 C CE1 . HIS B 123 ? 0.3511 0.3502 0.2903 0.0603  -0.0006 0.0114  128 HIS C CE1 
2257 N NE2 . HIS B 123 ? 0.3563 0.3506 0.2992 0.0549  -0.0014 0.0114  128 HIS C NE2 
2258 N N   . PRO B 124 ? 0.4213 0.3947 0.3229 0.0785  0.0012  0.0168  129 PRO C N   
2259 C CA  . PRO B 124 ? 0.4681 0.4484 0.3659 0.0858  0.0024  0.0173  129 PRO C CA  
2260 C C   . PRO B 124 ? 0.4594 0.4521 0.3643 0.0855  0.0025  0.0161  129 PRO C C   
2261 O O   . PRO B 124 ? 0.4610 0.4573 0.3608 0.0914  0.0034  0.0168  129 PRO C O   
2262 C CB  . PRO B 124 ? 0.4882 0.4771 0.3892 0.0891  0.0028  0.0173  129 PRO C CB  
2263 C CG  . PRO B 124 ? 0.4548 0.4448 0.3648 0.0825  0.0018  0.0162  129 PRO C CG  
2264 C CD  . PRO B 124 ? 0.4531 0.4296 0.3596 0.0773  0.0009  0.0165  129 PRO C CD  
2265 N N   . MET B 125 ? 0.4055 0.4045 0.3216 0.0788  0.0016  0.0142  130 MET C N   
2266 C CA  . MET B 125 ? 0.4025 0.4140 0.3261 0.0779  0.0017  0.0126  130 MET C CA  
2267 C C   . MET B 125 ? 0.3548 0.3599 0.2772 0.0742  0.0012  0.0125  130 MET C C   
2268 O O   . MET B 125 ? 0.3792 0.3891 0.3009 0.0761  0.0016  0.0123  130 MET C O   
2269 C CB  . MET B 125 ? 0.4343 0.4580 0.3714 0.0733  0.0014  0.0103  130 MET C CB  
2270 C CG  . MET B 125 ? 0.5325 0.5614 0.4706 0.0763  0.0018  0.0106  130 MET C CG  
2271 S SD  . MET B 125 ? 0.7167 0.7581 0.6699 0.0704  0.0016  0.0082  130 MET C SD  
2272 C CE  . MET B 125 ? 0.6513 0.6939 0.6010 0.0750  0.0022  0.0097  130 MET C CE  
2273 N N   . LEU B 126 ? 0.3467 0.3411 0.2683 0.0690  0.0004  0.0129  131 LEU C N   
2274 C CA  . LEU B 126 ? 0.3349 0.3232 0.2549 0.0652  -0.0001 0.0131  131 LEU C CA  
2275 C C   . LEU B 126 ? 0.3796 0.3554 0.2860 0.0690  0.0004  0.0153  131 LEU C C   
2276 O O   . LEU B 126 ? 0.3871 0.3599 0.2913 0.0675  0.0003  0.0157  131 LEU C O   
2277 C CB  . LEU B 126 ? 0.3355 0.3187 0.2606 0.0580  -0.0012 0.0127  131 LEU C CB  
2278 C CG  . LEU B 126 ? 0.3144 0.3089 0.2530 0.0539  -0.0015 0.0106  131 LEU C CG  
2279 C CD1 . LEU B 126 ? 0.3256 0.3132 0.2664 0.0481  -0.0024 0.0109  131 LEU C CD1 
2280 C CD2 . LEU B 126 ? 0.2920 0.2977 0.2388 0.0522  -0.0014 0.0086  131 LEU C CD2 
2281 N N   . LYS B 127 ? 0.3997 0.3678 0.2965 0.0740  0.0010  0.0169  132 LYS C N   
2282 C CA  . LYS B 127 ? 0.4444 0.3989 0.3268 0.0781  0.0019  0.0191  132 LYS C CA  
2283 C C   . LYS B 127 ? 0.4848 0.4266 0.3635 0.0718  0.0011  0.0197  132 LYS C C   
2284 O O   . LYS B 127 ? 0.5232 0.4578 0.3947 0.0722  0.0014  0.0209  132 LYS C O   
2285 C CB  . LYS B 127 ? 0.5016 0.4624 0.3811 0.0839  0.0030  0.0198  132 LYS C CB  
2286 C CG  . LYS B 127 ? 0.5988 0.5715 0.4798 0.0908  0.0039  0.0196  132 LYS C CG  
2287 C CD  . LYS B 127 ? 0.6641 0.6394 0.5382 0.0979  0.0052  0.0211  132 LYS C CD  
2288 C CE  . LYS B 127 ? 0.7311 0.7175 0.6049 0.1054  0.0062  0.0214  132 LYS C CE  
2289 N NZ  . LYS B 127 ? 0.7131 0.7196 0.6001 0.1038  0.0058  0.0191  132 LYS C NZ  
2290 N N   . ARG B 128 ? 0.4449 0.3845 0.3285 0.0660  0.0000  0.0190  133 ARG C N   
2291 C CA  . ARG B 128 ? 0.4137 0.3437 0.2954 0.0594  -0.0009 0.0193  133 ARG C CA  
2292 C C   . ARG B 128 ? 0.3750 0.2992 0.2562 0.0567  -0.0015 0.0193  133 ARG C C   
2293 O O   . ARG B 128 ? 0.3865 0.3186 0.2738 0.0585  -0.0015 0.0185  133 ARG C O   
2294 C CB  . ARG B 128 ? 0.4728 0.4130 0.3668 0.0537  -0.0018 0.0178  133 ARG C CB  
2295 C CG  . ARG B 128 ? 0.5283 0.4726 0.4225 0.0547  -0.0014 0.0179  133 ARG C CG  
2296 C CD  . ARG B 128 ? 0.5563 0.5012 0.4558 0.0478  -0.0024 0.0174  133 ARG C CD  
2297 N NE  . ARG B 128 ? 0.4984 0.4575 0.4116 0.0452  -0.0028 0.0153  133 ARG C NE  
2298 C CZ  . ARG B 128 ? 0.5284 0.4900 0.4485 0.0391  -0.0037 0.0147  133 ARG C CZ  
2299 N NH1 . ARG B 128 ? 0.5504 0.5025 0.4658 0.0346  -0.0044 0.0159  133 ARG C NH1 
2300 N NH2 . ARG B 128 ? 0.5339 0.5079 0.4655 0.0376  -0.0038 0.0126  133 ARG C NH2 
2301 N N   . GLU B 129 ? 0.3754 0.2868 0.2495 0.0524  -0.0021 0.0202  134 GLU C N   
2302 C CA  . GLU B 129 ? 0.3678 0.2734 0.2405 0.0498  -0.0027 0.0202  134 GLU C CA  
2303 C C   . GLU B 129 ? 0.3175 0.2338 0.2041 0.0442  -0.0039 0.0190  134 GLU C C   
2304 O O   . GLU B 129 ? 0.3109 0.2315 0.2037 0.0397  -0.0045 0.0186  134 GLU C O   
2305 C CB  . GLU B 129 ? 0.4245 0.3140 0.2861 0.0459  -0.0031 0.0213  134 GLU C CB  
2306 C CG  . GLU B 129 ? 0.5079 0.3928 0.3677 0.0444  -0.0036 0.0211  134 GLU C CG  
2307 C CD  . GLU B 129 ? 0.6290 0.4975 0.4763 0.0412  -0.0038 0.0219  134 GLU C CD  
2308 O OE1 . GLU B 129 ? 0.6509 0.5152 0.4972 0.0350  -0.0046 0.0222  134 GLU C OE1 
2309 O OE2 . GLU B 129 ? 0.6894 0.5496 0.5279 0.0448  -0.0032 0.0222  134 GLU C OE2 
2310 N N   . VAL B 130 ? 0.3103 0.2300 0.2009 0.0448  -0.0040 0.0186  135 VAL C N   
2311 C CA  . VAL B 130 ? 0.2989 0.2278 0.2022 0.0397  -0.0049 0.0177  135 VAL C CA  
2312 C C   . VAL B 130 ? 0.3234 0.2454 0.2232 0.0377  -0.0055 0.0183  135 VAL C C   
2313 O O   . VAL B 130 ? 0.3169 0.2333 0.2090 0.0420  -0.0049 0.0188  135 VAL C O   
2314 C CB  . VAL B 130 ? 0.3026 0.2454 0.2165 0.0425  -0.0044 0.0165  135 VAL C CB  
2315 C CG1 . VAL B 130 ? 0.3284 0.2713 0.2383 0.0483  -0.0036 0.0168  135 VAL C CG1 
2316 C CG2 . VAL B 130 ? 0.3013 0.2524 0.2276 0.0377  -0.0050 0.0157  135 VAL C CG2 
2317 N N   . CYS B 131 ? 0.2943 0.2162 0.1984 0.0315  -0.0065 0.0184  136 CYS C N   
2318 C CA  A CYS B 131 ? 0.3052 0.2230 0.2078 0.0291  -0.0071 0.0190  136 CYS C CA  
2319 C CA  B CYS B 131 ? 0.3080 0.2257 0.2105 0.0290  -0.0071 0.0190  136 CYS C CA  
2320 C C   . CYS B 131 ? 0.2790 0.2084 0.1949 0.0270  -0.0074 0.0185  136 CYS C C   
2321 O O   . CYS B 131 ? 0.2669 0.2040 0.1919 0.0243  -0.0075 0.0180  136 CYS C O   
2322 C CB  A CYS B 131 ? 0.3526 0.2606 0.2484 0.0236  -0.0080 0.0197  136 CYS C CB  
2323 C CB  B CYS B 131 ? 0.3569 0.2656 0.2536 0.0231  -0.0081 0.0197  136 CYS C CB  
2324 S SG  A CYS B 131 ? 0.4540 0.3464 0.3327 0.0267  -0.0074 0.0203  136 CYS C SG  
2325 S SG  B CYS B 131 ? 0.4755 0.3674 0.3549 0.0241  -0.0078 0.0204  136 CYS C SG  
2326 N N   . GLY B 132 ? 0.2576 0.1878 0.1740 0.0287  -0.0073 0.0188  137 GLY C N   
2327 C CA  . GLY B 132 ? 0.2320 0.1724 0.1603 0.0272  -0.0073 0.0186  137 GLY C CA  
2328 C C   . GLY B 132 ? 0.2315 0.1687 0.1588 0.0244  -0.0080 0.0196  137 GLY C C   
2329 O O   . GLY B 132 ? 0.2384 0.1667 0.1557 0.0258  -0.0081 0.0201  137 GLY C O   
2330 N N   . VAL B 133 ? 0.2214 0.1659 0.1589 0.0208  -0.0082 0.0199  138 VAL C N   
2331 C CA  . VAL B 133 ? 0.2434 0.1868 0.1813 0.0179  -0.0089 0.0210  138 VAL C CA  
2332 C C   . VAL B 133 ? 0.2314 0.1847 0.1806 0.0181  -0.0083 0.0213  138 VAL C C   
2333 O O   . VAL B 133 ? 0.2084 0.1697 0.1671 0.0178  -0.0077 0.0207  138 VAL C O   
2334 C CB  . VAL B 133 ? 0.2944 0.2342 0.2305 0.0123  -0.0100 0.0217  138 VAL C CB  
2335 C CG1 . VAL B 133 ? 0.3144 0.2421 0.2370 0.0119  -0.0104 0.0215  138 VAL C CG1 
2336 C CG2 . VAL B 133 ? 0.3137 0.2619 0.2604 0.0093  -0.0099 0.0215  138 VAL C CG2 
2337 N N   . ASP B 134 ? 0.2283 0.1812 0.1770 0.0182  -0.0084 0.0223  139 ASP C N   
2338 C CA  . ASP B 134 ? 0.2283 0.1894 0.1873 0.0167  -0.0081 0.0232  139 ASP C CA  
2339 C C   . ASP B 134 ? 0.2280 0.1862 0.1849 0.0124  -0.0091 0.0246  139 ASP C C   
2340 O O   . ASP B 134 ? 0.2278 0.1783 0.1749 0.0124  -0.0099 0.0249  139 ASP C O   
2341 C CB  . ASP B 134 ? 0.2651 0.2300 0.2264 0.0205  -0.0072 0.0235  139 ASP C CB  
2342 C CG  . ASP B 134 ? 0.3083 0.2827 0.2819 0.0193  -0.0064 0.0242  139 ASP C CG  
2343 O OD1 . ASP B 134 ? 0.3056 0.2857 0.2876 0.0180  -0.0057 0.0234  139 ASP C OD1 
2344 O OD2 . ASP B 134 ? 0.3954 0.3714 0.3705 0.0197  -0.0062 0.0255  139 ASP C OD2 
2345 N N   . ALA B 135 ? 0.2039 0.1680 0.1692 0.0091  -0.0092 0.0254  140 ALA C N   
2346 C CA  . ALA B 135 ? 0.2110 0.1739 0.1748 0.0048  -0.0102 0.0268  140 ALA C CA  
2347 C C   . ALA B 135 ? 0.2046 0.1760 0.1788 0.0038  -0.0096 0.0283  140 ALA C C   
2348 O O   . ALA B 135 ? 0.2097 0.1875 0.1930 0.0055  -0.0083 0.0281  140 ALA C O   
2349 C CB  . ALA B 135 ? 0.2270 0.1873 0.1882 0.0010  -0.0110 0.0265  140 ALA C CB  
2350 N N   . VAL B 136 ? 0.1954 0.1667 0.1679 0.0011  -0.0104 0.0299  141 VAL C N   
2351 C CA  . VAL B 136 ? 0.2095 0.1888 0.1914 0.0004  -0.0097 0.0318  141 VAL C CA  
2352 C C   . VAL B 136 ? 0.2274 0.2085 0.2092 -0.0040 -0.0107 0.0334  141 VAL C C   
2353 O O   . VAL B 136 ? 0.2440 0.2195 0.2168 -0.0067 -0.0122 0.0332  141 VAL C O   
2354 C CB  . VAL B 136 ? 0.2460 0.2263 0.2279 0.0030  -0.0093 0.0328  141 VAL C CB  
2355 C CG1 . VAL B 136 ? 0.2771 0.2581 0.2611 0.0073  -0.0081 0.0316  141 VAL C CG1 
2356 C CG2 . VAL B 136 ? 0.2619 0.2359 0.2332 0.0019  -0.0106 0.0331  141 VAL C CG2 
2357 N N   . GLY B 137 ? 0.2196 0.2084 0.2109 -0.0048 -0.0099 0.0348  142 GLY C N   
2358 C CA  . GLY B 137 ? 0.2390 0.2314 0.2309 -0.0086 -0.0108 0.0367  142 GLY C CA  
2359 C C   . GLY B 137 ? 0.2178 0.2184 0.2198 -0.0076 -0.0095 0.0388  142 GLY C C   
2360 O O   . GLY B 137 ? 0.2052 0.2080 0.2133 -0.0045 -0.0079 0.0387  142 GLY C O   
2361 N N   . GLU B 138 ? 0.2178 0.2234 0.2213 -0.0104 -0.0100 0.0410  143 GLU C N   
2362 C CA  . GLU B 138 ? 0.2573 0.2711 0.2703 -0.0091 -0.0086 0.0436  143 GLU C CA  
2363 C C   . GLU B 138 ? 0.2251 0.2445 0.2402 -0.0121 -0.0091 0.0453  143 GLU C C   
2364 O O   . GLU B 138 ? 0.2482 0.2662 0.2564 -0.0159 -0.0109 0.0452  143 GLU C O   
2365 C CB  . GLU B 138 ? 0.3282 0.3444 0.3411 -0.0081 -0.0085 0.0458  143 GLU C CB  
2366 C CG  . GLU B 138 ? 0.4725 0.4844 0.4828 -0.0051 -0.0081 0.0449  143 GLU C CG  
2367 C CD  . GLU B 138 ? 0.5665 0.5815 0.5764 -0.0045 -0.0081 0.0472  143 GLU C CD  
2368 O OE1 . GLU B 138 ? 0.6231 0.6444 0.6363 -0.0059 -0.0081 0.0498  143 GLU C OE1 
2369 O OE2 . GLU B 138 ? 0.6431 0.6543 0.6490 -0.0025 -0.0082 0.0464  143 GLU C OE2 
2370 N N   . PHE B 139 ? 0.1940 0.2196 0.2181 -0.0107 -0.0074 0.0468  144 PHE C N   
2371 C CA  . PHE B 139 ? 0.1975 0.2300 0.2245 -0.0129 -0.0076 0.0489  144 PHE C CA  
2372 C C   . PHE B 139 ? 0.1895 0.2288 0.2260 -0.0100 -0.0054 0.0515  144 PHE C C   
2373 O O   . PHE B 139 ? 0.1871 0.2252 0.2281 -0.0069 -0.0037 0.0513  144 PHE C O   
2374 C CB  . PHE B 139 ? 0.2075 0.2393 0.2340 -0.0147 -0.0080 0.0472  144 PHE C CB  
2375 C CG  . PHE B 139 ? 0.2277 0.2593 0.2612 -0.0119 -0.0061 0.0458  144 PHE C CG  
2376 C CD1 . PHE B 139 ? 0.2111 0.2489 0.2524 -0.0106 -0.0045 0.0473  144 PHE C CD1 
2377 C CD2 . PHE B 139 ? 0.2465 0.2718 0.2781 -0.0105 -0.0059 0.0428  144 PHE C CD2 
2378 C CE1 . PHE B 139 ? 0.2424 0.2799 0.2899 -0.0082 -0.0026 0.0458  144 PHE C CE1 
2379 C CE2 . PHE B 139 ? 0.2498 0.2755 0.2875 -0.0083 -0.0042 0.0414  144 PHE C CE2 
2380 C CZ  . PHE B 139 ? 0.2357 0.2671 0.2814 -0.0072 -0.0025 0.0427  144 PHE C CZ  
2381 N N   . SER B 140 ? 0.2034 0.2503 0.2422 -0.0112 -0.0055 0.0543  145 SER C N   
2382 C CA  . SER B 140 ? 0.1828 0.2361 0.2299 -0.0083 -0.0033 0.0572  145 SER C CA  
2383 C C   . SER B 140 ? 0.1690 0.2246 0.2215 -0.0076 -0.0020 0.0567  145 SER C C   
2384 O O   . SER B 140 ? 0.1902 0.2490 0.2411 -0.0100 -0.0031 0.0567  145 SER C O   
2385 C CB  . SER B 140 ? 0.2217 0.2828 0.2679 -0.0095 -0.0040 0.0608  145 SER C CB  
2386 O OG  . SER B 140 ? 0.3103 0.3770 0.3638 -0.0059 -0.0017 0.0641  145 SER C OG  
2387 N N   . ARG B 141 ? 0.1469 0.2007 0.2057 -0.0042 0.0003  0.0560  146 ARG C N   
2388 C CA  . ARG B 141 ? 0.1603 0.2144 0.2230 -0.0037 0.0014  0.0546  146 ARG C CA  
2389 C C   . ARG B 141 ? 0.1549 0.2173 0.2216 -0.0032 0.0022  0.0577  146 ARG C C   
2390 O O   . ARG B 141 ? 0.1648 0.2289 0.2330 -0.0036 0.0024  0.0567  146 ARG C O   
2391 C CB  . ARG B 141 ? 0.1702 0.2202 0.2381 -0.0007 0.0038  0.0529  146 ARG C CB  
2392 C CG  . ARG B 141 ? 0.1593 0.2104 0.2327 0.0024  0.0063  0.0554  146 ARG C CG  
2393 C CD  . ARG B 141 ? 0.1681 0.2146 0.2463 0.0043  0.0086  0.0529  146 ARG C CD  
2394 N NE  . ARG B 141 ? 0.1783 0.2243 0.2610 0.0069  0.0110  0.0548  146 ARG C NE  
2395 C CZ  . ARG B 141 ? 0.1812 0.2292 0.2696 0.0094  0.0137  0.0571  146 ARG C CZ  
2396 N NH1 . ARG B 141 ? 0.1966 0.2487 0.2870 0.0100  0.0142  0.0583  146 ARG C NH1 
2397 N NH2 . ARG B 141 ? 0.1909 0.2371 0.2827 0.0114  0.0158  0.0584  146 ARG C NH2 
2398 N N   . ASP B 142 ? 0.1805 0.2486 0.2491 -0.0019 0.0029  0.0615  147 ASP C N   
2399 C CA  . ASP B 142 ? 0.1914 0.2682 0.2631 -0.0013 0.0035  0.0646  147 ASP C CA  
2400 C C   . ASP B 142 ? 0.1895 0.2705 0.2562 -0.0055 0.0009  0.0644  147 ASP C C   
2401 O O   . ASP B 142 ? 0.2129 0.3007 0.2824 -0.0052 0.0014  0.0659  147 ASP C O   
2402 C CB  . ASP B 142 ? 0.1964 0.2790 0.2705 0.0008  0.0045  0.0688  147 ASP C CB  
2403 C CG  . ASP B 142 ? 0.2363 0.3186 0.3048 -0.0014 0.0024  0.0694  147 ASP C CG  
2404 O OD1 . ASP B 142 ? 0.2541 0.3301 0.3169 -0.0039 0.0005  0.0665  147 ASP C OD1 
2405 O OD2 . ASP B 142 ? 0.2798 0.3695 0.3492 -0.0005 0.0026  0.0732  147 ASP C OD2 
2406 N N   . ASP B 143 ? 0.1813 0.2583 0.2407 -0.0093 -0.0016 0.0625  148 ASP C N   
2407 C CA  . ASP B 143 ? 0.1888 0.2684 0.2426 -0.0140 -0.0041 0.0619  148 ASP C CA  
2408 C C   . ASP B 143 ? 0.1875 0.2659 0.2425 -0.0146 -0.0039 0.0598  148 ASP C C   
2409 O O   . ASP B 143 ? 0.1751 0.2581 0.2276 -0.0178 -0.0053 0.0601  148 ASP C O   
2410 C CB  . ASP B 143 ? 0.2185 0.2919 0.2635 -0.0179 -0.0066 0.0600  148 ASP C CB  
2411 C CG  . ASP B 143 ? 0.3088 0.3848 0.3512 -0.0186 -0.0074 0.0621  148 ASP C CG  
2412 O OD1 . ASP B 143 ? 0.3580 0.4426 0.4047 -0.0169 -0.0064 0.0657  148 ASP C OD1 
2413 O OD2 . ASP B 143 ? 0.3582 0.4274 0.3933 -0.0209 -0.0090 0.0602  148 ASP C OD2 
2414 N N   . PHE B 144 ? 0.1750 0.2480 0.2340 -0.0115 -0.0021 0.0575  149 PHE C N   
2415 C CA  . PHE B 144 ? 0.1577 0.2296 0.2180 -0.0116 -0.0017 0.0552  149 PHE C CA  
2416 C C   . PHE B 144 ? 0.1660 0.2418 0.2342 -0.0077 0.0009  0.0563  149 PHE C C   
2417 O O   . PHE B 144 ? 0.2124 0.2862 0.2830 -0.0067 0.0019  0.0540  149 PHE C O   
2418 C CB  . PHE B 144 ? 0.1661 0.2279 0.2237 -0.0116 -0.0020 0.0512  149 PHE C CB  
2419 C CG  . PHE B 144 ? 0.1629 0.2198 0.2119 -0.0153 -0.0046 0.0499  149 PHE C CG  
2420 C CD1 . PHE B 144 ? 0.1717 0.2256 0.2174 -0.0153 -0.0052 0.0505  149 PHE C CD1 
2421 C CD2 . PHE B 144 ? 0.1692 0.2242 0.2129 -0.0186 -0.0063 0.0481  149 PHE C CD2 
2422 C CE1 . PHE B 144 ? 0.1963 0.2448 0.2332 -0.0185 -0.0074 0.0492  149 PHE C CE1 
2423 C CE2 . PHE B 144 ? 0.2005 0.2497 0.2354 -0.0220 -0.0085 0.0470  149 PHE C CE2 
2424 C CZ  . PHE B 144 ? 0.1964 0.2420 0.2279 -0.0218 -0.0090 0.0474  149 PHE C CZ  
2425 N N   . GLY B 145 ? 0.1837 0.2652 0.2561 -0.0050 0.0025  0.0599  150 GLY C N   
2426 C CA  . GLY B 145 ? 0.1953 0.2801 0.2748 -0.0008 0.0054  0.0613  150 GLY C CA  
2427 C C   . GLY B 145 ? 0.1932 0.2709 0.2771 0.0026  0.0080  0.0596  150 GLY C C   
2428 O O   . GLY B 145 ? 0.2129 0.2906 0.3017 0.0055  0.0105  0.0592  150 GLY C O   
2429 N N   . LEU B 146 ? 0.2074 0.2785 0.2890 0.0021  0.0075  0.0582  151 LEU C N   
2430 C CA  . LEU B 146 ? 0.1857 0.2503 0.2709 0.0046  0.0097  0.0564  151 LEU C CA  
2431 C C   . LEU B 146 ? 0.2102 0.2752 0.2967 0.0064  0.0108  0.0593  151 LEU C C   
2432 O O   . LEU B 146 ? 0.1951 0.2562 0.2790 0.0056  0.0099  0.0586  151 LEU C O   
2433 C CB  . LEU B 146 ? 0.1994 0.2569 0.2805 0.0023  0.0082  0.0521  151 LEU C CB  
2434 C CG  . LEU B 146 ? 0.1955 0.2524 0.2742 0.0002  0.0068  0.0492  151 LEU C CG  
2435 C CD1 . LEU B 146 ? 0.2320 0.2824 0.3058 -0.0016 0.0052  0.0459  151 LEU C CD1 
2436 C CD2 . LEU B 146 ? 0.2141 0.2707 0.2984 0.0025  0.0093  0.0476  151 LEU C CD2 
2437 N N   . ASP B 147 ? 0.2343 0.3046 0.3250 0.0093  0.0127  0.0630  152 ASP C N   
2438 C CA  . ASP B 147 ? 0.2511 0.3230 0.3428 0.0110  0.0136  0.0665  152 ASP C CA  
2439 C C   . ASP B 147 ? 0.2562 0.3244 0.3535 0.0150  0.0172  0.0675  152 ASP C C   
2440 O O   . ASP B 147 ? 0.2663 0.3371 0.3654 0.0172  0.0185  0.0712  152 ASP C O   
2441 C CB  . ASP B 147 ? 0.3040 0.3859 0.3949 0.0110  0.0127  0.0708  152 ASP C CB  
2442 C CG  . ASP B 147 ? 0.4159 0.5035 0.5112 0.0140  0.0148  0.0731  152 ASP C CG  
2443 O OD1 . ASP B 147 ? 0.3738 0.4570 0.4720 0.0154  0.0166  0.0707  152 ASP C OD1 
2444 O OD2 . ASP B 147 ? 0.4980 0.5948 0.5935 0.0148  0.0146  0.0772  152 ASP C OD2 
2445 N N   . TYR B 148 ? 0.2367 0.2992 0.3369 0.0159  0.0191  0.0645  153 TYR C N   
2446 C CA  . TYR B 148 ? 0.2582 0.3160 0.3632 0.0190  0.0227  0.0650  153 TYR C CA  
2447 C C   . TYR B 148 ? 0.2677 0.3234 0.3724 0.0193  0.0230  0.0666  153 TYR C C   
2448 O O   . TYR B 148 ? 0.2532 0.3068 0.3543 0.0169  0.0207  0.0648  153 TYR C O   
2449 C CB  . TYR B 148 ? 0.3505 0.4011 0.4572 0.0184  0.0239  0.0603  153 TYR C CB  
2450 C CG  . TYR B 148 ? 0.3998 0.4448 0.5110 0.0209  0.0277  0.0607  153 TYR C CG  
2451 C CD1 . TYR B 148 ? 0.4645 0.5093 0.5797 0.0244  0.0311  0.0627  153 TYR C CD1 
2452 C CD2 . TYR B 148 ? 0.4789 0.5192 0.5900 0.0200  0.0280  0.0596  153 TYR C CD2 
2453 C CE1 . TYR B 148 ? 0.5047 0.5436 0.6235 0.0266  0.0348  0.0633  153 TYR C CE1 
2454 C CE2 . TYR B 148 ? 0.4987 0.5339 0.6136 0.0218  0.0315  0.0602  153 TYR C CE2 
2455 C CZ  . TYR B 148 ? 0.5195 0.5536 0.6382 0.0249  0.0349  0.0619  153 TYR C CZ  
2456 O OH  . TYR B 148 ? 0.6412 0.6691 0.7631 0.0264  0.0385  0.0625  153 TYR C OH  
2457 N N   . GLY B 149 ? 0.2487 0.3048 0.3570 0.0226  0.0258  0.0703  154 GLY C N   
2458 C CA  . GLY B 149 ? 0.2825 0.3367 0.3910 0.0232  0.0264  0.0720  154 GLY C CA  
2459 C C   . GLY B 149 ? 0.2620 0.3230 0.3686 0.0237  0.0251  0.0763  154 GLY C C   
2460 O O   . GLY B 149 ? 0.2774 0.3374 0.3845 0.0247  0.0259  0.0782  154 GLY C O   
2461 N N   . LYS B 150 ? 0.2608 0.3284 0.3644 0.0223  0.0226  0.0771  155 LYS C N   
2462 C CA  . LYS B 150 ? 0.3268 0.4016 0.4278 0.0220  0.0208  0.0806  155 LYS C CA  
2463 C C   . LYS B 150 ? 0.3732 0.4514 0.4784 0.0264  0.0240  0.0858  155 LYS C C   
2464 O O   . LYS B 150 ? 0.3731 0.4528 0.4779 0.0272  0.0241  0.0883  155 LYS C O   
2465 C CB  . LYS B 150 ? 0.3159 0.3975 0.4136 0.0195  0.0181  0.0805  155 LYS C CB  
2466 C CG  . LYS B 150 ? 0.3356 0.4225 0.4281 0.0167  0.0150  0.0817  155 LYS C CG  
2467 C CD  . LYS B 150 ? 0.3309 0.4239 0.4204 0.0139  0.0127  0.0813  155 LYS C CD  
2468 C CE  . LYS B 150 ? 0.3356 0.4334 0.4192 0.0103  0.0094  0.0819  155 LYS C CE  
2469 N NZ  . LYS B 150 ? 0.3477 0.4516 0.4288 0.0073  0.0075  0.0817  155 LYS C NZ  
2470 N N   . GLN B 151 ? 0.4582 0.5366 0.5676 0.0296  0.0268  0.0871  156 GLN C N   
2471 C CA  . GLN B 151 ? 0.5589 0.6395 0.6723 0.0345  0.0304  0.0920  156 GLN C CA  
2472 C C   . GLN B 151 ? 0.5245 0.5991 0.6396 0.0358  0.0325  0.0930  156 GLN C C   
2473 O O   . GLN B 151 ? 0.6417 0.7196 0.7587 0.0392  0.0345  0.0977  156 GLN C O   
2474 C CB  . GLN B 151 ? 0.6269 0.7052 0.7440 0.0377  0.0336  0.0919  156 GLN C CB  
2475 C CG  . GLN B 151 ? 0.6565 0.7384 0.7723 0.0360  0.0318  0.0895  156 GLN C CG  
2476 C CD  . GLN B 151 ? 0.6430 0.7182 0.7567 0.0317  0.0298  0.0834  156 GLN C CD  
2477 O OE1 . GLN B 151 ? 0.7056 0.7719 0.8208 0.0315  0.0314  0.0804  156 GLN C OE1 
2478 N NE2 . GLN B 151 ? 0.6246 0.7045 0.7347 0.0283  0.0263  0.0816  156 GLN C NE2 
2479 N N   . TYR B 152 ? 0.5006 0.5670 0.6153 0.0333  0.0322  0.0886  157 TYR C N   
2480 C CA  . TYR B 152 ? 0.4499 0.5101 0.5658 0.0336  0.0339  0.0887  157 TYR C CA  
2481 C C   . TYR B 152 ? 0.3979 0.4590 0.5103 0.0310  0.0311  0.0880  157 TYR C C   
2482 O O   . TYR B 152 ? 0.4513 0.5070 0.5646 0.0307  0.0322  0.0870  157 TYR C O   
2483 C CB  . TYR B 152 ? 0.5596 0.6105 0.6772 0.0323  0.0354  0.0840  157 TYR C CB  
2484 C CG  . TYR B 152 ? 0.6788 0.7253 0.8005 0.0352  0.0393  0.0846  157 TYR C CG  
2485 C CD1 . TYR B 152 ? 0.7721 0.8220 0.8944 0.0369  0.0397  0.0851  157 TYR C CD1 
2486 C CD2 . TYR B 152 ? 0.7614 0.8002 0.8861 0.0361  0.0428  0.0845  157 TYR C CD2 
2487 C CE1 . TYR B 152 ? 0.7712 0.8166 0.8968 0.0400  0.0436  0.0856  157 TYR C CE1 
2488 C CE2 . TYR B 152 ? 0.7942 0.8278 0.9220 0.0388  0.0468  0.0848  157 TYR C CE2 
2489 C CZ  . TYR B 152 ? 0.8370 0.8736 0.9651 0.0409  0.0471  0.0853  157 TYR C CZ  
2490 O OH  . TYR B 152 ? 0.9434 0.9739 1.0741 0.0437  0.0512  0.0856  157 TYR C OH  
2491 N N   . GLY B 153 ? 0.3705 0.4379 0.4786 0.0291  0.0276  0.0882  158 GLY C N   
2492 C CA  . GLY B 153 ? 0.3245 0.3927 0.4284 0.0267  0.0249  0.0874  158 GLY C CA  
2493 C C   . GLY B 153 ? 0.2925 0.3553 0.3924 0.0231  0.0223  0.0820  158 GLY C C   
2494 O O   . GLY B 153 ? 0.2681 0.3305 0.3641 0.0214  0.0203  0.0810  158 GLY C O   
2495 N N   . PHE B 154 ? 0.2702 0.3290 0.3710 0.0220  0.0226  0.0784  159 PHE C N   
2496 C CA  . PHE B 154 ? 0.2347 0.2887 0.3320 0.0189  0.0204  0.0733  159 PHE C CA  
2497 C C   . PHE B 154 ? 0.2195 0.2774 0.3106 0.0164  0.0167  0.0730  159 PHE C C   
2498 O O   . PHE B 154 ? 0.2316 0.2953 0.3219 0.0161  0.0158  0.0749  159 PHE C O   
2499 C CB  . PHE B 154 ? 0.2277 0.2784 0.3266 0.0181  0.0209  0.0698  159 PHE C CB  
2500 C CG  . PHE B 154 ? 0.2373 0.2821 0.3408 0.0193  0.0240  0.0682  159 PHE C CG  
2501 C CD1 . PHE B 154 ? 0.3004 0.3444 0.4088 0.0222  0.0276  0.0714  159 PHE C CD1 
2502 C CD2 . PHE B 154 ? 0.2593 0.2995 0.3622 0.0173  0.0235  0.0636  159 PHE C CD2 
2503 C CE1 . PHE B 154 ? 0.3194 0.3572 0.4316 0.0226  0.0305  0.0696  159 PHE C CE1 
2504 C CE2 . PHE B 154 ? 0.2668 0.3018 0.3738 0.0178  0.0263  0.0616  159 PHE C CE2 
2505 C CZ  . PHE B 154 ? 0.3185 0.3520 0.4299 0.0201  0.0298  0.0645  159 PHE C CZ  
2506 N N   . LYS B 155 ? 0.1957 0.2504 0.2821 0.0144  0.0146  0.0703  160 LYS C N   
2507 C CA  . LYS B 155 ? 0.2009 0.2573 0.2806 0.0117  0.0112  0.0693  160 LYS C CA  
2508 C C   . LYS B 155 ? 0.1959 0.2500 0.2731 0.0094  0.0097  0.0658  160 LYS C C   
2509 O O   . LYS B 155 ? 0.2071 0.2563 0.2863 0.0095  0.0106  0.0626  160 LYS C O   
2510 C CB  . LYS B 155 ? 0.2433 0.2964 0.3184 0.0110  0.0098  0.0679  160 LYS C CB  
2511 C CG  . LYS B 155 ? 0.3390 0.3941 0.4160 0.0132  0.0111  0.0711  160 LYS C CG  
2512 C CD  . LYS B 155 ? 0.4242 0.4776 0.4946 0.0121  0.0088  0.0698  160 LYS C CD  
2513 C CE  . LYS B 155 ? 0.5453 0.5981 0.6180 0.0143  0.0105  0.0713  160 LYS C CE  
2514 N NZ  . LYS B 155 ? 0.5996 0.6575 0.6776 0.0166  0.0127  0.0760  160 LYS C NZ  
2515 N N   . MET B 156 ? 0.1798 0.2377 0.2531 0.0071  0.0075  0.0662  161 MET C N   
2516 C CA  . MET B 156 ? 0.1682 0.2247 0.2388 0.0047  0.0060  0.0633  161 MET C CA  
2517 C C   . MET B 156 ? 0.1764 0.2274 0.2398 0.0020  0.0035  0.0598  161 MET C C   
2518 O O   . MET B 156 ? 0.1844 0.2326 0.2458 0.0004  0.0026  0.0570  161 MET C O   
2519 C CB  . MET B 156 ? 0.1811 0.2448 0.2508 0.0032  0.0049  0.0656  161 MET C CB  
2520 C CG  . MET B 156 ? 0.1768 0.2464 0.2532 0.0061  0.0074  0.0692  161 MET C CG  
2521 S SD  . MET B 156 ? 0.1942 0.2609 0.2769 0.0083  0.0101  0.0674  161 MET C SD  
2522 C CE  . MET B 156 ? 0.2014 0.2637 0.2896 0.0120  0.0135  0.0684  161 MET C CE  
2523 N N   . LYS B 157 ? 0.1859 0.2349 0.2453 0.0020  0.0025  0.0600  162 LYS C N   
2524 C CA  . LYS B 157 ? 0.2189 0.2623 0.2706 0.0000  0.0003  0.0570  162 LYS C CA  
2525 C C   . LYS B 157 ? 0.1983 0.2359 0.2512 0.0011  0.0011  0.0535  162 LYS C C   
2526 O O   . LYS B 157 ? 0.2234 0.2603 0.2813 0.0034  0.0031  0.0536  162 LYS C O   
2527 C CB  . LYS B 157 ? 0.2735 0.3159 0.3206 0.0002  -0.0006 0.0578  162 LYS C CB  
2528 C CG  . LYS B 157 ? 0.3641 0.3999 0.4022 -0.0016 -0.0028 0.0546  162 LYS C CG  
2529 C CD  . LYS B 157 ? 0.4596 0.4929 0.4938 -0.0002 -0.0032 0.0547  162 LYS C CD  
2530 C CE  . LYS B 157 ? 0.4987 0.5307 0.5382 0.0030  -0.0011 0.0543  162 LYS C CE  
2531 N NZ  . LYS B 157 ? 0.5878 0.6178 0.6228 0.0043  -0.0016 0.0543  162 LYS C NZ  
2532 N N   . THR B 158 ? 0.1796 0.2141 0.2285 -0.0008 -0.0002 0.0508  163 THR C N   
2533 C CA  . THR B 158 ? 0.1625 0.1926 0.2127 0.0000  0.0005  0.0475  163 THR C CA  
2534 C C   . THR B 158 ? 0.1657 0.1902 0.2074 -0.0009 -0.0015 0.0451  163 THR C C   
2535 O O   . THR B 158 ? 0.1825 0.2055 0.2178 -0.0035 -0.0035 0.0447  163 THR C O   
2536 C CB  . THR B 158 ? 0.1690 0.2006 0.2221 -0.0009 0.0008  0.0465  163 THR C CB  
2537 O OG1 . THR B 158 ? 0.1739 0.2106 0.2344 0.0004  0.0029  0.0491  163 THR C OG1 
2538 C CG2 . THR B 158 ? 0.1734 0.2014 0.2279 0.0000  0.0016  0.0431  163 THR C CG2 
2539 N N   . LYS B 159 ? 0.1650 0.1861 0.2060 0.0009  -0.0010 0.0434  164 LYS C N   
2540 C CA  . LYS B 159 ? 0.1832 0.1988 0.2157 0.0007  -0.0026 0.0413  164 LYS C CA  
2541 C C   . LYS B 159 ? 0.1641 0.1768 0.1958 0.0007  -0.0027 0.0382  164 LYS C C   
2542 O O   . LYS B 159 ? 0.1551 0.1699 0.1936 0.0018  -0.0010 0.0373  164 LYS C O   
2543 C CB  . LYS B 159 ? 0.2093 0.2234 0.2407 0.0033  -0.0021 0.0413  164 LYS C CB  
2544 C CG  . LYS B 159 ? 0.2751 0.2835 0.2968 0.0036  -0.0038 0.0397  164 LYS C CG  
2545 C CD  . LYS B 159 ? 0.3294 0.3373 0.3505 0.0066  -0.0031 0.0396  164 LYS C CD  
2546 C CE  . LYS B 159 ? 0.4347 0.4365 0.4457 0.0075  -0.0045 0.0379  164 LYS C CE  
2547 N NZ  . LYS B 159 ? 0.5360 0.5382 0.5461 0.0105  -0.0039 0.0384  164 LYS C NZ  
2548 N N   . LEU B 160 ? 0.1656 0.1737 0.1893 -0.0007 -0.0045 0.0367  165 LEU C N   
2549 C CA  . LEU B 160 ? 0.1768 0.1817 0.1984 -0.0003 -0.0047 0.0339  165 LEU C CA  
2550 C C   . LEU B 160 ? 0.1833 0.1831 0.1979 0.0015  -0.0052 0.0325  165 LEU C C   
2551 O O   . LEU B 160 ? 0.2126 0.2083 0.2195 0.0013  -0.0065 0.0331  165 LEU C O   
2552 C CB  . LEU B 160 ? 0.1893 0.1926 0.2067 -0.0033 -0.0060 0.0334  165 LEU C CB  
2553 C CG  . LEU B 160 ? 0.2257 0.2347 0.2495 -0.0051 -0.0055 0.0349  165 LEU C CG  
2554 C CD1 . LEU B 160 ? 0.2748 0.2825 0.2935 -0.0084 -0.0071 0.0347  165 LEU C CD1 
2555 C CD2 . LEU B 160 ? 0.2551 0.2673 0.2872 -0.0034 -0.0036 0.0336  165 LEU C CD2 
2556 N N   . LEU B 161 ? 0.1727 0.1728 0.1897 0.0038  -0.0043 0.0304  166 LEU C N   
2557 C CA  . LEU B 161 ? 0.1743 0.1706 0.1853 0.0064  -0.0045 0.0289  166 LEU C CA  
2558 C C   . LEU B 161 ? 0.1993 0.1937 0.2082 0.0066  -0.0048 0.0266  166 LEU C C   
2559 O O   . LEU B 161 ? 0.1823 0.1811 0.1983 0.0069  -0.0036 0.0254  166 LEU C O   
2560 C CB  . LEU B 161 ? 0.2057 0.2053 0.2213 0.0092  -0.0032 0.0290  166 LEU C CB  
2561 C CG  . LEU B 161 ? 0.2019 0.2033 0.2191 0.0092  -0.0029 0.0316  166 LEU C CG  
2562 C CD1 . LEU B 161 ? 0.2303 0.2371 0.2573 0.0078  -0.0015 0.0330  166 LEU C CD1 
2563 C CD2 . LEU B 161 ? 0.2652 0.2676 0.2822 0.0122  -0.0022 0.0316  166 LEU C CD2 
2564 N N   . ILE B 162 ? 0.1759 0.1642 0.1755 0.0060  -0.0062 0.0261  167 ILE C N   
2565 C CA  . ILE B 162 ? 0.1881 0.1746 0.1854 0.0055  -0.0065 0.0244  167 ILE C CA  
2566 C C   . ILE B 162 ? 0.1698 0.1529 0.1612 0.0090  -0.0065 0.0229  167 ILE C C   
2567 O O   . ILE B 162 ? 0.1782 0.1554 0.1609 0.0106  -0.0071 0.0232  167 ILE C O   
2568 C CB  . ILE B 162 ? 0.2395 0.2209 0.2297 0.0023  -0.0080 0.0251  167 ILE C CB  
2569 C CG1 . ILE B 162 ? 0.3170 0.3022 0.3117 -0.0012 -0.0083 0.0270  167 ILE C CG1 
2570 C CG2 . ILE B 162 ? 0.2560 0.2348 0.2427 0.0021  -0.0083 0.0236  167 ILE C CG2 
2571 C CD1 . ILE B 162 ? 0.3237 0.3158 0.3286 -0.0014 -0.0071 0.0269  167 ILE C CD1 
2572 N N   . THR B 163 ? 0.1625 0.1492 0.1578 0.0105  -0.0056 0.0211  168 THR C N   
2573 C CA  . THR B 163 ? 0.1726 0.1573 0.1626 0.0137  -0.0055 0.0196  168 THR C CA  
2574 C C   . THR B 163 ? 0.1535 0.1351 0.1396 0.0124  -0.0062 0.0187  168 THR C C   
2575 O O   . THR B 163 ? 0.1532 0.1388 0.1454 0.0101  -0.0060 0.0183  168 THR C O   
2576 C CB  . THR B 163 ? 0.1833 0.1758 0.1815 0.0156  -0.0041 0.0179  168 THR C CB  
2577 O OG1 . THR B 163 ? 0.2497 0.2463 0.2536 0.0163  -0.0032 0.0187  168 THR C OG1 
2578 C CG2 . THR B 163 ? 0.2046 0.1969 0.1979 0.0193  -0.0040 0.0165  168 THR C CG2 
2579 N N   . ALA B 164 ? 0.1714 0.1462 0.1476 0.0139  -0.0068 0.0186  169 ALA C N   
2580 C CA  . ALA B 164 ? 0.1937 0.1658 0.1662 0.0128  -0.0073 0.0179  169 ALA C CA  
2581 C C   . ALA B 164 ? 0.2052 0.1721 0.1687 0.0165  -0.0072 0.0173  169 ALA C C   
2582 O O   . ALA B 164 ? 0.2078 0.1684 0.1632 0.0188  -0.0074 0.0180  169 ALA C O   
2583 C CB  . ALA B 164 ? 0.2163 0.1836 0.1852 0.0083  -0.0084 0.0192  169 ALA C CB  
2584 N N   . GLU B 165 ? 0.1898 0.1588 0.1538 0.0176  -0.0069 0.0161  170 GLU C N   
2585 C CA  . GLU B 165 ? 0.1942 0.1581 0.1489 0.0214  -0.0067 0.0158  170 GLU C CA  
2586 C C   . GLU B 165 ? 0.2016 0.1635 0.1542 0.0193  -0.0071 0.0156  170 GLU C C   
2587 O O   . GLU B 165 ? 0.1889 0.1578 0.1498 0.0170  -0.0070 0.0148  170 GLU C O   
2588 C CB  . GLU B 165 ? 0.2043 0.1748 0.1618 0.0261  -0.0057 0.0146  170 GLU C CB  
2589 C CG  . GLU B 165 ? 0.2186 0.1920 0.1784 0.0284  -0.0052 0.0149  170 GLU C CG  
2590 C CD  . GLU B 165 ? 0.2451 0.2249 0.2060 0.0332  -0.0043 0.0139  170 GLU C CD  
2591 O OE1 . GLU B 165 ? 0.2644 0.2477 0.2255 0.0349  -0.0039 0.0128  170 GLU C OE1 
2592 O OE2 . GLU B 165 ? 0.3020 0.2838 0.2639 0.0352  -0.0039 0.0143  170 GLU C OE2 
2593 N N   . ALA B 166 ? 0.2140 0.1665 0.1556 0.0201  -0.0074 0.0164  171 ALA C N   
2594 C CA  . ALA B 166 ? 0.2225 0.1724 0.1613 0.0177  -0.0078 0.0165  171 ALA C CA  
2595 C C   . ALA B 166 ? 0.2437 0.1878 0.1728 0.0221  -0.0072 0.0166  171 ALA C C   
2596 O O   . ALA B 166 ? 0.2556 0.1925 0.1761 0.0254  -0.0070 0.0172  171 ALA C O   
2597 C CB  . ALA B 166 ? 0.2583 0.2011 0.1925 0.0126  -0.0088 0.0178  171 ALA C CB  
2598 N N   . VAL B 167 ? 0.2423 0.1894 0.1725 0.0221  -0.0070 0.0161  172 VAL C N   
2599 C CA  . VAL B 167 ? 0.2732 0.2170 0.1956 0.0269  -0.0063 0.0162  172 VAL C CA  
2600 C C   . VAL B 167 ? 0.2795 0.2140 0.1933 0.0244  -0.0066 0.0174  172 VAL C C   
2601 O O   . VAL B 167 ? 0.2766 0.2137 0.1949 0.0196  -0.0073 0.0174  172 VAL C O   
2602 C CB  . VAL B 167 ? 0.2927 0.2485 0.2231 0.0296  -0.0056 0.0146  172 VAL C CB  
2603 C CG1 . VAL B 167 ? 0.3090 0.2623 0.2314 0.0351  -0.0047 0.0150  172 VAL C CG1 
2604 C CG2 . VAL B 167 ? 0.3062 0.2717 0.2460 0.0311  -0.0052 0.0133  172 VAL C CG2 
2605 N N   . LYS B 168 ? 0.3153 0.2387 0.2164 0.0277  -0.0061 0.0185  173 LYS C N   
2606 C CA  . LYS B 168 ? 0.3879 0.3000 0.2789 0.0252  -0.0062 0.0199  173 LYS C CA  
2607 C C   . LYS B 168 ? 0.4327 0.3498 0.3262 0.0249  -0.0060 0.0198  173 LYS C C   
2608 O O   . LYS B 168 ? 0.4158 0.3402 0.3123 0.0296  -0.0052 0.0191  173 LYS C O   
2609 C CB  . LYS B 168 ? 0.4490 0.3478 0.3256 0.0295  -0.0053 0.0210  173 LYS C CB  
2610 C CG  . LYS B 168 ? 0.5407 0.4275 0.4065 0.0268  -0.0052 0.0225  173 LYS C CG  
2611 C CD  . LYS B 168 ? 0.6321 0.5047 0.4830 0.0316  -0.0040 0.0236  173 LYS C CD  
2612 C CE  . LYS B 168 ? 0.6333 0.4972 0.4784 0.0307  -0.0043 0.0235  173 LYS C CE  
2613 N NZ  . LYS B 168 ? 0.7002 0.5464 0.5286 0.0326  -0.0033 0.0247  173 LYS C NZ  
2614 N N   . GLN B 169 ? 0.4593 0.3741 0.3527 0.0191  -0.0068 0.0205  174 GLN C N   
2615 C CA  . GLN B 169 ? 0.5228 0.4427 0.4191 0.0182  -0.0066 0.0205  174 GLN C CA  
2616 C C   . GLN B 169 ? 0.4635 0.3726 0.3471 0.0206  -0.0058 0.0220  174 GLN C C   
2617 O O   . GLN B 169 ? 0.5625 0.4755 0.4457 0.0253  -0.0049 0.0219  174 GLN C O   
2618 C CB  . GLN B 169 ? 0.5617 0.4851 0.4640 0.0111  -0.0077 0.0206  174 GLN C CB  
2619 C CG  . GLN B 169 ? 0.6182 0.5528 0.5334 0.0093  -0.0083 0.0192  174 GLN C CG  
2620 C CD  . GLN B 169 ? 0.6192 0.5655 0.5434 0.0137  -0.0076 0.0173  174 GLN C CD  
2621 O OE1 . GLN B 169 ? 0.5278 0.4760 0.4528 0.0182  -0.0070 0.0166  174 GLN C OE1 
2622 N NE2 . GLN B 169 ? 0.5852 0.5400 0.5164 0.0123  -0.0076 0.0165  174 GLN C NE2 
2623 N N   . ALA C 2   ? 0.2480 0.2292 0.2251 0.0311  0.0083  0.0428  7   ALA A N   
2624 C CA  . ALA C 2   ? 0.2285 0.2066 0.2113 0.0294  0.0102  0.0427  7   ALA A CA  
2625 C C   . ALA C 2   ? 0.2175 0.1957 0.2019 0.0265  0.0092  0.0382  7   ALA A C   
2626 O O   . ALA C 2   ? 0.2319 0.2121 0.2125 0.0257  0.0076  0.0362  7   ALA A O   
2627 C CB  . ALA C 2   ? 0.2622 0.2394 0.2449 0.0296  0.0126  0.0456  7   ALA A CB  
2628 N N   . THR C 3   ? 0.2140 0.1905 0.2042 0.0250  0.0101  0.0367  8   THR A N   
2629 C CA  . THR C 3   ? 0.2029 0.1801 0.1951 0.0223  0.0093  0.0326  8   THR A CA  
2630 C C   . THR C 3   ? 0.2076 0.1830 0.2042 0.0207  0.0114  0.0322  8   THR A C   
2631 O O   . THR C 3   ? 0.2000 0.1732 0.2013 0.0212  0.0134  0.0340  8   THR A O   
2632 C CB  . THR C 3   ? 0.2398 0.2177 0.2353 0.0219  0.0082  0.0301  8   THR A CB  
2633 O OG1 . THR C 3   ? 0.2661 0.2457 0.2574 0.0235  0.0063  0.0307  8   THR A OG1 
2634 C CG2 . THR C 3   ? 0.2394 0.2189 0.2368 0.0192  0.0074  0.0261  8   THR A CG2 
2635 N N   . TYR C 4   ? 0.1754 0.1519 0.1710 0.0187  0.0109  0.0299  9   TYR A N   
2636 C CA  . TYR C 4   ? 0.1744 0.1497 0.1736 0.0171  0.0127  0.0292  9   TYR A CA  
2637 C C   . TYR C 4   ? 0.1807 0.1581 0.1814 0.0148  0.0114  0.0251  9   TYR A C   
2638 O O   . TYR C 4   ? 0.1930 0.1727 0.1901 0.0142  0.0092  0.0236  9   TYR A O   
2639 C CB  . TYR C 4   ? 0.1720 0.1472 0.1672 0.0174  0.0132  0.0309  9   TYR A CB  
2640 C CG  . TYR C 4   ? 0.1953 0.1697 0.1875 0.0197  0.0143  0.0350  9   TYR A CG  
2641 C CD1 . TYR C 4   ? 0.2173 0.1933 0.2046 0.0215  0.0127  0.0361  9   TYR A CD1 
2642 C CD2 . TYR C 4   ? 0.1999 0.1722 0.1947 0.0202  0.0170  0.0378  9   TYR A CD2 
2643 C CE1 . TYR C 4   ? 0.2432 0.2194 0.2273 0.0238  0.0136  0.0397  9   TYR A CE1 
2644 C CE2 . TYR C 4   ? 0.2367 0.2090 0.2285 0.0225  0.0181  0.0419  9   TYR A CE2 
2645 C CZ  . TYR C 4   ? 0.2530 0.2276 0.2394 0.0244  0.0163  0.0429  9   TYR A CZ  
2646 O OH  . TYR C 4   ? 0.2850 0.2605 0.2678 0.0268  0.0172  0.0469  9   TYR A OH  
2647 N N   . GLN C 5   ? 0.1593 0.1362 0.1656 0.0134  0.0127  0.0233  10  GLN A N   
2648 C CA  . GLN C 5   ? 0.1597 0.1392 0.1677 0.0112  0.0117  0.0194  10  GLN A CA  
2649 C C   . GLN C 5   ? 0.1450 0.1244 0.1531 0.0100  0.0125  0.0191  10  GLN A C   
2650 O O   . GLN C 5   ? 0.1486 0.1257 0.1596 0.0103  0.0147  0.0204  10  GLN A O   
2651 C CB  . GLN C 5   ? 0.1837 0.1640 0.1984 0.0104  0.0124  0.0167  10  GLN A CB  
2652 C CG  . GLN C 5   ? 0.2151 0.1953 0.2302 0.0118  0.0117  0.0171  10  GLN A CG  
2653 C CD  . GLN C 5   ? 0.2436 0.2267 0.2539 0.0116  0.0091  0.0160  10  GLN A CD  
2654 O OE1 . GLN C 5   ? 0.2426 0.2282 0.2500 0.0102  0.0078  0.0144  10  GLN A OE1 
2655 N NE2 . GLN C 5   ? 0.2801 0.2628 0.2896 0.0131  0.0085  0.0170  10  GLN A NE2 
2656 N N   . PHE C 6   ? 0.1296 0.1116 0.1347 0.0087  0.0107  0.0174  11  PHE A N   
2657 C CA  . PHE C 6   ? 0.1368 0.1189 0.1425 0.0075  0.0114  0.0168  11  PHE A CA  
2658 C C   . PHE C 6   ? 0.1366 0.1188 0.1488 0.0064  0.0130  0.0146  11  PHE A C   
2659 O O   . PHE C 6   ? 0.1377 0.1220 0.1535 0.0057  0.0127  0.0119  11  PHE A O   
2660 C CB  . PHE C 6   ? 0.1322 0.1173 0.1348 0.0063  0.0092  0.0154  11  PHE A CB  
2661 C CG  . PHE C 6   ? 0.1352 0.1200 0.1321 0.0072  0.0077  0.0173  11  PHE A CG  
2662 C CD1 . PHE C 6   ? 0.1518 0.1346 0.1466 0.0081  0.0086  0.0194  11  PHE A CD1 
2663 C CD2 . PHE C 6   ? 0.1500 0.1370 0.1442 0.0070  0.0055  0.0168  11  PHE A CD2 
2664 C CE1 . PHE C 6   ? 0.1550 0.1381 0.1451 0.0091  0.0071  0.0206  11  PHE A CE1 
2665 C CE2 . PHE C 6   ? 0.1561 0.1431 0.1460 0.0079  0.0041  0.0182  11  PHE A CE2 
2666 C CZ  . PHE C 6   ? 0.1665 0.1516 0.1544 0.0089  0.0049  0.0199  11  PHE A CZ  
2667 N N   . ASP C 7   ? 0.1492 0.1294 0.1635 0.0063  0.0149  0.0155  12  ASP A N   
2668 C CA  . ASP C 7   ? 0.1643 0.1448 0.1849 0.0051  0.0165  0.0130  12  ASP A CA  
2669 C C   . ASP C 7   ? 0.1621 0.1460 0.1815 0.0035  0.0149  0.0104  12  ASP A C   
2670 O O   . ASP C 7   ? 0.1561 0.1395 0.1725 0.0034  0.0148  0.0117  12  ASP A O   
2671 C CB  . ASP C 7   ? 0.1871 0.1642 0.2100 0.0057  0.0192  0.0154  12  ASP A CB  
2672 C CG  . ASP C 7   ? 0.2346 0.2122 0.2638 0.0043  0.0207  0.0128  12  ASP A CG  
2673 O OD1 . ASP C 7   ? 0.2175 0.1982 0.2497 0.0030  0.0197  0.0090  12  ASP A OD1 
2674 O OD2 . ASP C 7   ? 0.2627 0.2378 0.2933 0.0045  0.0228  0.0146  12  ASP A OD2 
2675 N N   . PRO C 8   ? 0.1595 0.1473 0.1811 0.0022  0.0137  0.0070  13  PRO A N   
2676 C CA  . PRO C 8   ? 0.1598 0.1515 0.1798 0.0008  0.0120  0.0050  13  PRO A CA  
2677 C C   . PRO C 8   ? 0.1769 0.1680 0.1993 0.0002  0.0132  0.0045  13  PRO A C   
2678 O O   . PRO C 8   ? 0.1800 0.1724 0.1994 -0.0002 0.0120  0.0048  13  PRO A O   
2679 C CB  . PRO C 8   ? 0.1719 0.1681 0.1952 0.0000  0.0112  0.0013  13  PRO A CB  
2680 C CG  . PRO C 8   ? 0.1769 0.1718 0.2006 0.0009  0.0114  0.0020  13  PRO A CG  
2681 C CD  . PRO C 8   ? 0.1663 0.1560 0.1920 0.0021  0.0137  0.0046  13  PRO A CD  
2682 N N   A SER C 9   ? 0.1750 0.1638 0.2027 0.0003  0.0157  0.0040  14  SER A N   
2683 N N   B SER C 9   ? 0.1874 0.1762 0.2152 0.0003  0.0157  0.0041  14  SER A N   
2684 C CA  A SER C 9   ? 0.1765 0.1649 0.2070 -0.0003 0.0169  0.0032  14  SER A CA  
2685 C CA  B SER C 9   ? 0.1973 0.1853 0.2278 -0.0002 0.0171  0.0034  14  SER A CA  
2686 C C   A SER C 9   ? 0.1735 0.1588 0.2000 0.0003  0.0175  0.0065  14  SER A C   
2687 C C   B SER C 9   ? 0.1843 0.1698 0.2103 0.0003  0.0172  0.0065  14  SER A C   
2688 O O   A SER C 9   ? 0.1824 0.1675 0.2109 -0.0002 0.0184  0.0059  14  SER A O   
2689 O O   B SER C 9   ? 0.1945 0.1805 0.2213 -0.0003 0.0175  0.0058  14  SER A O   
2690 C CB  A SER C 9   ? 0.1759 0.1630 0.2143 -0.0005 0.0195  0.0015  14  SER A CB  
2691 C CB  B SER C 9   ? 0.2138 0.1994 0.2516 -0.0001 0.0200  0.0028  14  SER A CB  
2692 O OG  A SER C 9   ? 0.1783 0.1608 0.2174 0.0008  0.0215  0.0049  14  SER A OG  
2693 O OG  B SER C 9   ? 0.2434 0.2318 0.2864 -0.0007 0.0198  -0.0008 14  SER A OG  
2694 N N   . HIS C 10  ? 0.1758 0.1590 0.1972 0.0016  0.0170  0.0098  15  HIS A N   
2695 C CA  . HIS C 10  ? 0.1752 0.1565 0.1922 0.0023  0.0171  0.0126  15  HIS A CA  
2696 C C   . HIS C 10  ? 0.1731 0.1553 0.1837 0.0029  0.0147  0.0139  15  HIS A C   
2697 O O   . HIS C 10  ? 0.1956 0.1762 0.2024 0.0041  0.0147  0.0164  15  HIS A O   
2698 C CB  . HIS C 10  ? 0.1962 0.1738 0.2141 0.0036  0.0198  0.0156  15  HIS A CB  
2699 C CG  . HIS C 10  ? 0.2132 0.1895 0.2377 0.0030  0.0225  0.0146  15  HIS A CG  
2700 N ND1 . HIS C 10  ? 0.2320 0.2080 0.2627 0.0027  0.0237  0.0132  15  HIS A ND1 
2701 C CD2 . HIS C 10  ? 0.2420 0.2181 0.2686 0.0023  0.0237  0.0140  15  HIS A CD2 
2702 C CE1 . HIS C 10  ? 0.2570 0.2321 0.2935 0.0020  0.0260  0.0121  15  HIS A CE1 
2703 N NE2 . HIS C 10  ? 0.2352 0.2103 0.2691 0.0017  0.0261  0.0128  15  HIS A NE2 
2704 N N   . THR C 11  ? 0.1527 0.1381 0.1627 0.0021  0.0124  0.0120  16  THR A N   
2705 C CA  . THR C 11  ? 0.1487 0.1351 0.1535 0.0025  0.0101  0.0131  16  THR A CA  
2706 C C   . THR C 11  ? 0.1541 0.1442 0.1588 0.0011  0.0081  0.0113  16  THR A C   
2707 O O   . THR C 11  ? 0.1406 0.1338 0.1475 0.0001  0.0074  0.0092  16  THR A O   
2708 C CB  . THR C 11  ? 0.1570 0.1436 0.1608 0.0032  0.0095  0.0134  16  THR A CB  
2709 O OG1 . THR C 11  ? 0.1519 0.1353 0.1562 0.0047  0.0114  0.0155  16  THR A OG1 
2710 C CG2 . THR C 11  ? 0.1633 0.1513 0.1624 0.0035  0.0071  0.0143  16  THR A CG2 
2711 N N   . TYR C 12  ? 0.1374 0.1274 0.1395 0.0011  0.0070  0.0123  17  TYR A N   
2712 C CA  . TYR C 12  ? 0.1403 0.1334 0.1425 0.0000  0.0051  0.0113  17  TYR A CA  
2713 C C   . TYR C 12  ? 0.1361 0.1288 0.1351 0.0003  0.0034  0.0129  17  TYR A C   
2714 O O   . TYR C 12  ? 0.1613 0.1516 0.1593 0.0011  0.0042  0.0140  17  TYR A O   
2715 C CB  . TYR C 12  ? 0.1566 0.1504 0.1623 -0.0008 0.0060  0.0098  17  TYR A CB  
2716 C CG  . TYR C 12  ? 0.1491 0.1430 0.1594 -0.0012 0.0080  0.0077  17  TYR A CG  
2717 C CD1 . TYR C 12  ? 0.1565 0.1545 0.1695 -0.0023 0.0074  0.0050  17  TYR A CD1 
2718 C CD2 . TYR C 12  ? 0.1550 0.1454 0.1673 -0.0006 0.0106  0.0083  17  TYR A CD2 
2719 C CE1 . TYR C 12  ? 0.1460 0.1445 0.1638 -0.0026 0.0091  0.0027  17  TYR A CE1 
2720 C CE2 . TYR C 12  ? 0.1517 0.1422 0.1692 -0.0010 0.0125  0.0063  17  TYR A CE2 
2721 C CZ  . TYR C 12  ? 0.1687 0.1631 0.1894 -0.0020 0.0118  0.0032  17  TYR A CZ  
2722 O OH  . TYR C 12  ? 0.1896 0.1842 0.2162 -0.0024 0.0136  0.0008  17  TYR A OH  
2723 N N   . PRO C 13  ? 0.1265 0.1218 0.1242 -0.0002 0.0011  0.0131  18  PRO A N   
2724 C CA  . PRO C 13  ? 0.1282 0.1237 0.1247 -0.0002 -0.0004 0.0142  18  PRO A CA  
2725 C C   . PRO C 13  ? 0.1248 0.1220 0.1235 -0.0012 -0.0010 0.0136  18  PRO A C   
2726 O O   . PRO C 13  ? 0.1302 0.1308 0.1304 -0.0022 -0.0017 0.0127  18  PRO A O   
2727 C CB  . PRO C 13  ? 0.1322 0.1300 0.1272 -0.0005 -0.0024 0.0150  18  PRO A CB  
2728 C CG  . PRO C 13  ? 0.1391 0.1395 0.1351 -0.0012 -0.0021 0.0137  18  PRO A CG  
2729 C CD  . PRO C 13  ? 0.1312 0.1298 0.1292 -0.0010 0.0001  0.0124  18  PRO A CD  
2730 N N   . SER C 14  ? 0.1155 0.1106 0.1145 -0.0007 -0.0006 0.0138  19  SER A N   
2731 C CA  . SER C 14  ? 0.1052 0.1018 0.1063 -0.0015 -0.0015 0.0134  19  SER A CA  
2732 C C   . SER C 14  ? 0.1090 0.1059 0.1095 -0.0013 -0.0036 0.0148  19  SER A C   
2733 O O   . SER C 14  ? 0.1107 0.1062 0.1092 -0.0006 -0.0041 0.0156  19  SER A O   
2734 C CB  . SER C 14  ? 0.1220 0.1164 0.1246 -0.0011 0.0003  0.0126  19  SER A CB  
2735 O OG  . SER C 14  ? 0.1291 0.1229 0.1332 -0.0012 0.0026  0.0114  19  SER A OG  
2736 N N   . PHE C 15  ? 0.1033 0.1021 0.1059 -0.0020 -0.0050 0.0149  20  PHE A N   
2737 C CA  . PHE C 15  ? 0.1086 0.1079 0.1118 -0.0021 -0.0071 0.0163  20  PHE A CA  
2738 C C   . PHE C 15  ? 0.1161 0.1153 0.1221 -0.0022 -0.0078 0.0160  20  PHE A C   
2739 O O   . PHE C 15  ? 0.1130 0.1132 0.1206 -0.0026 -0.0070 0.0149  20  PHE A O   
2740 C CB  . PHE C 15  ? 0.1170 0.1195 0.1200 -0.0028 -0.0089 0.0177  20  PHE A CB  
2741 C CG  . PHE C 15  ? 0.1298 0.1362 0.1339 -0.0038 -0.0090 0.0172  20  PHE A CG  
2742 C CD1 . PHE C 15  ? 0.1503 0.1586 0.1569 -0.0042 -0.0102 0.0177  20  PHE A CD1 
2743 C CD2 . PHE C 15  ? 0.1274 0.1356 0.1305 -0.0041 -0.0081 0.0161  20  PHE A CD2 
2744 C CE1 . PHE C 15  ? 0.1605 0.1730 0.1682 -0.0049 -0.0104 0.0170  20  PHE A CE1 
2745 C CE2 . PHE C 15  ? 0.1552 0.1676 0.1598 -0.0049 -0.0083 0.0151  20  PHE A CE2 
2746 C CZ  . PHE C 15  ? 0.1631 0.1778 0.1696 -0.0053 -0.0095 0.0156  20  PHE A CZ  
2747 N N   . GLU C 16  ? 0.1239 0.1226 0.1312 -0.0020 -0.0093 0.0170  21  GLU A N   
2748 C CA  . GLU C 16  ? 0.1415 0.1408 0.1522 -0.0022 -0.0106 0.0172  21  GLU A CA  
2749 C C   . GLU C 16  ? 0.1305 0.1314 0.1430 -0.0026 -0.0130 0.0194  21  GLU A C   
2750 O O   . GLU C 16  ? 0.1408 0.1409 0.1526 -0.0023 -0.0136 0.0201  21  GLU A O   
2751 C CB  . GLU C 16  ? 0.1635 0.1602 0.1753 -0.0014 -0.0101 0.0159  21  GLU A CB  
2752 C CG  . GLU C 16  ? 0.1768 0.1718 0.1870 -0.0009 -0.0075 0.0141  21  GLU A CG  
2753 C CD  . GLU C 16  ? 0.2436 0.2368 0.2547 0.0000  -0.0069 0.0128  21  GLU A CD  
2754 O OE1 . GLU C 16  ? 0.2782 0.2714 0.2912 0.0002  -0.0085 0.0129  21  GLU A OE1 
2755 O OE2 . GLU C 16  ? 0.2731 0.2652 0.2834 0.0003  -0.0047 0.0116  21  GLU A OE2 
2756 N N   . ALA C 17  ? 0.1297 0.1331 0.1448 -0.0032 -0.0144 0.0205  22  ALA A N   
2757 C CA  . ALA C 17  ? 0.1424 0.1478 0.1599 -0.0037 -0.0166 0.0232  22  ALA A CA  
2758 C C   . ALA C 17  ? 0.1510 0.1571 0.1727 -0.0037 -0.0180 0.0239  22  ALA A C   
2759 O O   . ALA C 17  ? 0.1457 0.1523 0.1682 -0.0037 -0.0174 0.0225  22  ALA A O   
2760 C CB  . ALA C 17  ? 0.1512 0.1604 0.1669 -0.0044 -0.0170 0.0247  22  ALA A CB  
2761 N N   . ASP C 18  ? 0.1557 0.1621 0.1812 -0.0038 -0.0199 0.0262  23  ASP A N   
2762 C CA  . ASP C 18  ? 0.1668 0.1738 0.1972 -0.0038 -0.0214 0.0271  23  ASP A CA  
2763 C C   . ASP C 18  ? 0.1658 0.1770 0.1968 -0.0043 -0.0224 0.0292  23  ASP A C   
2764 O O   . ASP C 18  ? 0.1818 0.1962 0.2107 -0.0049 -0.0228 0.0312  23  ASP A O   
2765 C CB  . ASP C 18  ? 0.1887 0.1945 0.2235 -0.0037 -0.0231 0.0290  23  ASP A CB  
2766 C CG  . ASP C 18  ? 0.2065 0.2126 0.2473 -0.0036 -0.0248 0.0302  23  ASP A CG  
2767 O OD1 . ASP C 18  ? 0.2146 0.2188 0.2571 -0.0030 -0.0243 0.0275  23  ASP A OD1 
2768 O OD2 . ASP C 18  ? 0.2454 0.2537 0.2894 -0.0040 -0.0265 0.0340  23  ASP A OD2 
2769 N N   . HIS C 19  ? 0.1499 0.1616 0.1842 -0.0041 -0.0231 0.0289  24  HIS A N   
2770 C CA  . HIS C 19  ? 0.1555 0.1717 0.1918 -0.0044 -0.0247 0.0314  24  HIS A CA  
2771 C C   . HIS C 19  ? 0.1774 0.1928 0.2200 -0.0041 -0.0267 0.0334  24  HIS A C   
2772 O O   . HIS C 19  ? 0.1655 0.1782 0.2111 -0.0036 -0.0265 0.0311  24  HIS A O   
2773 C CB  . HIS C 19  ? 0.1733 0.1915 0.2081 -0.0044 -0.0238 0.0290  24  HIS A CB  
2774 C CG  . HIS C 19  ? 0.1853 0.2092 0.2213 -0.0046 -0.0253 0.0313  24  HIS A CG  
2775 N ND1 . HIS C 19  ? 0.1969 0.2223 0.2357 -0.0043 -0.0260 0.0304  24  HIS A ND1 
2776 C CD2 . HIS C 19  ? 0.1923 0.2213 0.2266 -0.0051 -0.0263 0.0342  24  HIS A CD2 
2777 C CE1 . HIS C 19  ? 0.1952 0.2265 0.2340 -0.0044 -0.0274 0.0328  24  HIS A CE1 
2778 N NE2 . HIS C 19  ? 0.2148 0.2486 0.2507 -0.0049 -0.0275 0.0350  24  HIS A NE2 
2779 N N   . PHE C 20  ? 0.2156 0.2336 0.2607 -0.0044 -0.0285 0.0376  25  PHE A N   
2780 C CA  . PHE C 20  ? 0.2440 0.2617 0.2960 -0.0041 -0.0305 0.0402  25  PHE A CA  
2781 C C   . PHE C 20  ? 0.2413 0.2542 0.2980 -0.0036 -0.0307 0.0385  25  PHE A C   
2782 O O   . PHE C 20  ? 0.2766 0.2885 0.3385 -0.0031 -0.0316 0.0377  25  PHE A O   
2783 C CB  . PHE C 20  ? 0.2613 0.2821 0.3150 -0.0038 -0.0314 0.0405  25  PHE A CB  
2784 C CG  . PHE C 20  ? 0.3260 0.3526 0.3784 -0.0041 -0.0326 0.0445  25  PHE A CG  
2785 C CD1 . PHE C 20  ? 0.4165 0.4447 0.4724 -0.0043 -0.0342 0.0497  25  PHE A CD1 
2786 C CD2 . PHE C 20  ? 0.3288 0.3597 0.3765 -0.0043 -0.0318 0.0432  25  PHE A CD2 
2787 C CE1 . PHE C 20  ? 0.4736 0.5080 0.5281 -0.0046 -0.0352 0.0539  25  PHE A CE1 
2788 C CE2 . PHE C 20  ? 0.4275 0.4649 0.4737 -0.0046 -0.0329 0.0469  25  PHE A CE2 
2789 C CZ  . PHE C 20  ? 0.4529 0.4923 0.5021 -0.0047 -0.0345 0.0523  25  PHE A CZ  
2790 N N   . GLY C 21  ? 0.2583 0.2685 0.3133 -0.0037 -0.0298 0.0373  26  GLY A N   
2791 C CA  . GLY C 21  ? 0.2756 0.2821 0.3356 -0.0032 -0.0301 0.0356  26  GLY A CA  
2792 C C   . GLY C 21  ? 0.2574 0.2615 0.3182 -0.0025 -0.0292 0.0312  26  GLY A C   
2793 O O   . GLY C 21  ? 0.2850 0.2876 0.3523 -0.0021 -0.0303 0.0304  26  GLY A O   
2794 N N   . GLY C 22  ? 0.2050 0.2088 0.2597 -0.0025 -0.0272 0.0283  27  GLY A N   
2795 C CA  . GLY C 22  ? 0.1922 0.1939 0.2470 -0.0019 -0.0259 0.0241  27  GLY A CA  
2796 C C   . GLY C 22  ? 0.1772 0.1802 0.2321 -0.0019 -0.0256 0.0231  27  GLY A C   
2797 O O   . GLY C 22  ? 0.1946 0.1962 0.2503 -0.0015 -0.0246 0.0198  27  GLY A O   
2798 N N   . LEU C 23  ? 0.1775 0.1839 0.2316 -0.0023 -0.0265 0.0259  28  LEU A N   
2799 C CA  . LEU C 23  ? 0.1655 0.1738 0.2201 -0.0023 -0.0264 0.0248  28  LEU A CA  
2800 C C   . LEU C 23  ? 0.1516 0.1593 0.2012 -0.0024 -0.0239 0.0214  28  LEU A C   
2801 O O   . LEU C 23  ? 0.1566 0.1635 0.2071 -0.0021 -0.0229 0.0185  28  LEU A O   
2802 C CB  . LEU C 23  ? 0.1703 0.1831 0.2254 -0.0026 -0.0281 0.0285  28  LEU A CB  
2803 C CG  . LEU C 23  ? 0.1752 0.1905 0.2313 -0.0024 -0.0283 0.0273  28  LEU A CG  
2804 C CD1 . LEU C 23  ? 0.1924 0.2062 0.2551 -0.0018 -0.0295 0.0264  28  LEU A CD1 
2805 C CD2 . LEU C 23  ? 0.2090 0.2298 0.2645 -0.0027 -0.0299 0.0309  28  LEU A CD2 
2806 N N   . SER C 24  ? 0.1436 0.1516 0.1879 -0.0028 -0.0227 0.0217  29  SER A N   
2807 C CA  . SER C 24  ? 0.1480 0.1550 0.1879 -0.0028 -0.0201 0.0187  29  SER A CA  
2808 C C   . SER C 24  ? 0.1375 0.1437 0.1727 -0.0030 -0.0191 0.0193  29  SER A C   
2809 O O   . SER C 24  ? 0.1395 0.1462 0.1748 -0.0032 -0.0203 0.0218  29  SER A O   
2810 C CB  . SER C 24  ? 0.1520 0.1622 0.1911 -0.0032 -0.0196 0.0179  29  SER A CB  
2811 O OG  . SER C 24  ? 0.1752 0.1891 0.2121 -0.0037 -0.0204 0.0201  29  SER A OG  
2812 N N   . VAL C 25  ? 0.1313 0.1364 0.1627 -0.0030 -0.0167 0.0171  30  VAL A N   
2813 C CA  . VAL C 25  ? 0.1360 0.1399 0.1630 -0.0030 -0.0154 0.0172  30  VAL A CA  
2814 C C   . VAL C 25  ? 0.1300 0.1366 0.1543 -0.0036 -0.0145 0.0169  30  VAL A C   
2815 O O   . VAL C 25  ? 0.1576 0.1640 0.1815 -0.0036 -0.0127 0.0146  30  VAL A O   
2816 C CB  . VAL C 25  ? 0.1427 0.1432 0.1680 -0.0024 -0.0135 0.0150  30  VAL A CB  
2817 C CG1 . VAL C 25  ? 0.1477 0.1472 0.1687 -0.0022 -0.0123 0.0153  30  VAL A CG1 
2818 C CG2 . VAL C 25  ? 0.1535 0.1521 0.1820 -0.0017 -0.0143 0.0144  30  VAL A CG2 
2819 N N   . TRP C 26  ? 0.1323 0.1413 0.1547 -0.0040 -0.0153 0.0188  31  TRP A N   
2820 C CA  . TRP C 26  ? 0.1247 0.1360 0.1443 -0.0045 -0.0142 0.0180  31  TRP A CA  
2821 C C   . TRP C 26  ? 0.1333 0.1414 0.1500 -0.0041 -0.0120 0.0164  31  TRP A C   
2822 O O   . TRP C 26  ? 0.1320 0.1378 0.1472 -0.0038 -0.0121 0.0173  31  TRP A O   
2823 C CB  . TRP C 26  ? 0.1328 0.1478 0.1512 -0.0050 -0.0158 0.0206  31  TRP A CB  
2824 C CG  . TRP C 26  ? 0.1377 0.1581 0.1578 -0.0054 -0.0174 0.0220  31  TRP A CG  
2825 C CD1 . TRP C 26  ? 0.1481 0.1710 0.1704 -0.0055 -0.0197 0.0253  31  TRP A CD1 
2826 C CD2 . TRP C 26  ? 0.1306 0.1551 0.1507 -0.0057 -0.0169 0.0200  31  TRP A CD2 
2827 N NE1 . TRP C 26  ? 0.1483 0.1765 0.1715 -0.0057 -0.0206 0.0257  31  TRP A NE1 
2828 C CE2 . TRP C 26  ? 0.1380 0.1675 0.1598 -0.0058 -0.0190 0.0222  31  TRP A CE2 
2829 C CE3 . TRP C 26  ? 0.1418 0.1662 0.1608 -0.0058 -0.0148 0.0166  31  TRP A CE3 
2830 C CZ2 . TRP C 26  ? 0.1529 0.1878 0.1751 -0.0060 -0.0192 0.0207  31  TRP A CZ2 
2831 C CZ3 . TRP C 26  ? 0.1385 0.1680 0.1587 -0.0061 -0.0150 0.0150  31  TRP A CZ3 
2832 C CH2 . TRP C 26  ? 0.1548 0.1896 0.1764 -0.0062 -0.0172 0.0168  31  TRP A CH2 
2833 N N   . ARG C 27  ? 0.1246 0.1327 0.1407 -0.0042 -0.0100 0.0142  32  ARG A N   
2834 C CA  . ARG C 27  ? 0.1163 0.1217 0.1300 -0.0039 -0.0078 0.0130  32  ARG A CA  
2835 C C   . ARG C 27  ? 0.1432 0.1514 0.1561 -0.0045 -0.0071 0.0119  32  ARG A C   
2836 O O   . ARG C 27  ? 0.1675 0.1796 0.1823 -0.0050 -0.0075 0.0108  32  ARG A O   
2837 C CB  . ARG C 27  ? 0.1462 0.1485 0.1609 -0.0035 -0.0058 0.0112  32  ARG A CB  
2838 C CG  . ARG C 27  ? 0.1520 0.1517 0.1672 -0.0028 -0.0061 0.0116  32  ARG A CG  
2839 C CD  . ARG C 27  ? 0.1655 0.1624 0.1809 -0.0023 -0.0036 0.0099  32  ARG A CD  
2840 N NE  . ARG C 27  ? 0.1830 0.1782 0.1986 -0.0016 -0.0040 0.0100  32  ARG A NE  
2841 C CZ  . ARG C 27  ? 0.2021 0.1977 0.2207 -0.0016 -0.0053 0.0096  32  ARG A CZ  
2842 N NH1 . ARG C 27  ? 0.2139 0.2112 0.2353 -0.0022 -0.0060 0.0091  32  ARG A NH1 
2843 N NH2 . ARG C 27  ? 0.2698 0.2640 0.2886 -0.0009 -0.0056 0.0094  32  ARG A NH2 
2844 N N   . GLY C 28  ? 0.1176 0.1245 0.1282 -0.0042 -0.0060 0.0119  33  GLY A N   
2845 C CA  . GLY C 28  ? 0.1217 0.1311 0.1322 -0.0047 -0.0051 0.0105  33  GLY A CA  
2846 C C   . GLY C 28  ? 0.1178 0.1246 0.1260 -0.0042 -0.0038 0.0106  33  GLY A C   
2847 O O   . GLY C 28  ? 0.1177 0.1210 0.1242 -0.0035 -0.0035 0.0118  33  GLY A O   
2848 N N   . LYS C 29  ? 0.1112 0.1204 0.1193 -0.0046 -0.0033 0.0095  34  LYS A N   
2849 C CA  . LYS C 29  ? 0.1107 0.1177 0.1170 -0.0041 -0.0022 0.0097  34  LYS A CA  
2850 C C   . LYS C 29  ? 0.1167 0.1280 0.1229 -0.0047 -0.0028 0.0088  34  LYS A C   
2851 O O   . LYS C 29  ? 0.1351 0.1511 0.1428 -0.0055 -0.0037 0.0077  34  LYS A O   
2852 C CB  . LYS C 29  ? 0.1307 0.1340 0.1382 -0.0036 0.0004  0.0084  34  LYS A CB  
2853 C CG  . LYS C 29  ? 0.1470 0.1525 0.1582 -0.0042 0.0017  0.0057  34  LYS A CG  
2854 C CD  . LYS C 29  ? 0.2119 0.2138 0.2255 -0.0038 0.0045  0.0046  34  LYS A CD  
2855 C CE  . LYS C 29  ? 0.2028 0.2001 0.2143 -0.0028 0.0058  0.0065  34  LYS A CE  
2856 N NZ  . LYS C 29  ? 0.2023 0.1969 0.2168 -0.0025 0.0087  0.0059  34  LYS A NZ  
2857 N N   . PHE C 30  ? 0.1056 0.1156 0.1102 -0.0043 -0.0023 0.0091  35  PHE A N   
2858 C CA  . PHE C 30  ? 0.1116 0.1251 0.1165 -0.0047 -0.0023 0.0077  35  PHE A CA  
2859 C C   . PHE C 30  ? 0.1178 0.1293 0.1250 -0.0044 -0.0001 0.0055  35  PHE A C   
2860 O O   . PHE C 30  ? 0.1270 0.1337 0.1336 -0.0035 0.0012  0.0065  35  PHE A O   
2861 C CB  . PHE C 30  ? 0.1167 0.1302 0.1186 -0.0045 -0.0035 0.0095  35  PHE A CB  
2862 C CG  . PHE C 30  ? 0.1223 0.1381 0.1228 -0.0050 -0.0057 0.0118  35  PHE A CG  
2863 C CD1 . PHE C 30  ? 0.1321 0.1445 0.1318 -0.0045 -0.0063 0.0138  35  PHE A CD1 
2864 C CD2 . PHE C 30  ? 0.1159 0.1374 0.1164 -0.0058 -0.0070 0.0118  35  PHE A CD2 
2865 C CE1 . PHE C 30  ? 0.1423 0.1568 0.1417 -0.0049 -0.0083 0.0159  35  PHE A CE1 
2866 C CE2 . PHE C 30  ? 0.1321 0.1557 0.1317 -0.0062 -0.0089 0.0144  35  PHE A CE2 
2867 C CZ  . PHE C 30  ? 0.1434 0.1633 0.1428 -0.0058 -0.0096 0.0165  35  PHE A CZ  
2868 N N   . ASP C 31  ? 0.1170 0.1323 0.1273 -0.0051 0.0003  0.0027  36  ASP A N   
2869 C CA  . ASP C 31  ? 0.1335 0.1471 0.1475 -0.0049 0.0026  0.0003  36  ASP A CA  
2870 C C   . ASP C 31  ? 0.1355 0.1479 0.1496 -0.0044 0.0034  0.0000  36  ASP A C   
2871 O O   . ASP C 31  ? 0.1427 0.1523 0.1600 -0.0040 0.0054  -0.0011 36  ASP A O   
2872 C CB  . ASP C 31  ? 0.1491 0.1674 0.1675 -0.0057 0.0029  -0.0032 36  ASP A CB  
2873 C CG  . ASP C 31  ? 0.1937 0.2127 0.2133 -0.0061 0.0026  -0.0035 36  ASP A CG  
2874 O OD1 . ASP C 31  ? 0.2110 0.2263 0.2288 -0.0057 0.0026  -0.0011 36  ASP A OD1 
2875 O OD2 . ASP C 31  ? 0.2565 0.2804 0.2798 -0.0067 0.0026  -0.0069 36  ASP A OD2 
2876 N N   . LYS C 32  ? 0.1212 0.1361 0.1327 -0.0045 0.0019  0.0006  37  LYS A N   
2877 C CA  . LYS C 32  ? 0.1433 0.1578 0.1554 -0.0041 0.0025  -0.0001 37  LYS A CA  
2878 C C   . LYS C 32  ? 0.1239 0.1358 0.1316 -0.0034 0.0016  0.0028  37  LYS A C   
2879 O O   . LYS C 32  ? 0.1332 0.1479 0.1379 -0.0038 -0.0002 0.0040  37  LYS A O   
2880 C CB  . LYS C 32  ? 0.1740 0.1955 0.1877 -0.0051 0.0016  -0.0030 37  LYS A CB  
2881 C CG  . LYS C 32  ? 0.2373 0.2623 0.2563 -0.0057 0.0026  -0.0070 37  LYS A CG  
2882 C CD  . LYS C 32  ? 0.3332 0.3652 0.3539 -0.0064 0.0018  -0.0102 37  LYS A CD  
2883 C CE  . LYS C 32  ? 0.4009 0.4311 0.4209 -0.0058 0.0021  -0.0099 37  LYS A CE  
2884 N NZ  . LYS C 32  ? 0.5164 0.5522 0.5389 -0.0063 0.0019  -0.0134 37  LYS A NZ  
2885 N N   . SER C 33  ? 0.1221 0.1292 0.1298 -0.0022 0.0030  0.0038  38  SER A N   
2886 C CA  . SER C 33  ? 0.1245 0.1292 0.1287 -0.0013 0.0024  0.0061  38  SER A CA  
2887 C C   . SER C 33  ? 0.1413 0.1438 0.1475 -0.0003 0.0038  0.0056  38  SER A C   
2888 O O   . SER C 33  ? 0.1485 0.1497 0.1588 -0.0002 0.0056  0.0042  38  SER A O   
2889 C CB  . SER C 33  ? 0.1403 0.1409 0.1416 -0.0004 0.0025  0.0088  38  SER A CB  
2890 O OG  . SER C 33  ? 0.1560 0.1583 0.1561 -0.0012 0.0010  0.0095  38  SER A OG  
2891 N N   . SER C 34  ? 0.1272 0.1291 0.1305 0.0003  0.0029  0.0068  39  SER A N   
2892 C CA  . SER C 34  ? 0.1422 0.1417 0.1470 0.0014  0.0041  0.0069  39  SER A CA  
2893 C C   . SER C 34  ? 0.1355 0.1333 0.1362 0.0026  0.0031  0.0092  39  SER A C   
2894 O O   . SER C 34  ? 0.1386 0.1379 0.1359 0.0023  0.0014  0.0101  39  SER A O   
2895 C CB  . SER C 34  ? 0.1766 0.1798 0.1851 0.0008  0.0041  0.0038  39  SER A CB  
2896 O OG  . SER C 34  ? 0.2176 0.2247 0.2236 0.0001  0.0022  0.0033  39  SER A OG  
2897 N N   . GLY C 35  ? 0.1230 0.1179 0.1243 0.0041  0.0041  0.0102  40  GLY A N   
2898 C CA  . GLY C 35  ? 0.1333 0.1270 0.1308 0.0054  0.0031  0.0121  40  GLY A CA  
2899 C C   . GLY C 35  ? 0.1251 0.1150 0.1224 0.0073  0.0044  0.0142  40  GLY A C   
2900 O O   . GLY C 35  ? 0.1320 0.1200 0.1330 0.0077  0.0063  0.0143  40  GLY A O   
2901 N N   . THR C 36  ? 0.1364 0.1255 0.1298 0.0087  0.0034  0.0160  41  THR A N   
2902 C CA  . THR C 36  ? 0.1488 0.1354 0.1416 0.0107  0.0042  0.0180  41  THR A CA  
2903 C C   . THR C 36  ? 0.1452 0.1309 0.1332 0.0121  0.0037  0.0203  41  THR A C   
2904 O O   . THR C 36  ? 0.1431 0.1305 0.1283 0.0116  0.0019  0.0197  41  THR A O   
2905 C CB  . THR C 36  ? 0.1654 0.1534 0.1586 0.0112  0.0032  0.0171  41  THR A CB  
2906 O OG1 . THR C 36  ? 0.1972 0.1870 0.1950 0.0098  0.0036  0.0144  41  THR A OG1 
2907 C CG2 . THR C 36  ? 0.1840 0.1696 0.1768 0.0136  0.0040  0.0195  41  THR A CG2 
2908 N N   . VAL C 37  ? 0.1490 0.1324 0.1364 0.0138  0.0051  0.0227  42  VAL A N   
2909 C CA  . VAL C 37  ? 0.1531 0.1364 0.1361 0.0155  0.0047  0.0246  42  VAL A CA  
2910 C C   . VAL C 37  ? 0.1655 0.1482 0.1477 0.0178  0.0049  0.0266  42  VAL A C   
2911 O O   . VAL C 37  ? 0.1692 0.1502 0.1547 0.0183  0.0065  0.0276  42  VAL A O   
2912 C CB  . VAL C 37  ? 0.1795 0.1613 0.1624 0.0157  0.0065  0.0262  42  VAL A CB  
2913 C CG1 . VAL C 37  ? 0.1872 0.1695 0.1657 0.0178  0.0063  0.0283  42  VAL A CG1 
2914 C CG2 . VAL C 37  ? 0.2126 0.1950 0.1964 0.0136  0.0061  0.0244  42  VAL A CG2 
2915 N N   . THR C 38  ? 0.1573 0.1415 0.1357 0.0190  0.0034  0.0269  43  THR A N   
2916 C CA  . THR C 38  ? 0.1702 0.1544 0.1468 0.0217  0.0035  0.0292  43  THR A CA  
2917 C C   . THR C 38  ? 0.1765 0.1615 0.1490 0.0232  0.0037  0.0309  43  THR A C   
2918 O O   . THR C 38  ? 0.1609 0.1473 0.1315 0.0225  0.0027  0.0295  43  THR A O   
2919 C CB  . THR C 38  ? 0.1946 0.1804 0.1703 0.0223  0.0016  0.0280  43  THR A CB  
2920 O OG1 . THR C 38  ? 0.2098 0.1979 0.1821 0.0222  -0.0004 0.0265  43  THR A OG1 
2921 C CG2 . THR C 38  ? 0.1989 0.1846 0.1784 0.0207  0.0013  0.0259  43  THR A CG2 
2922 N N   . LEU C 39  ? 0.2026 0.1870 0.1743 0.0254  0.0052  0.0342  44  LEU A N   
2923 C CA  . LEU C 39  ? 0.2366 0.2228 0.2043 0.0270  0.0055  0.0358  44  LEU A CA  
2924 C C   . LEU C 39  ? 0.2761 0.2634 0.2417 0.0300  0.0057  0.0386  44  LEU A C   
2925 O O   . LEU C 39  ? 0.3019 0.2872 0.2702 0.0306  0.0072  0.0412  44  LEU A O   
2926 C CB  . LEU C 39  ? 0.2728 0.2573 0.2418 0.0265  0.0080  0.0376  44  LEU A CB  
2927 C CG  . LEU C 39  ? 0.3394 0.3239 0.3083 0.0248  0.0083  0.0360  44  LEU A CG  
2928 C CD1 . LEU C 39  ? 0.3376 0.3213 0.3069 0.0254  0.0110  0.0388  44  LEU A CD1 
2929 C CD2 . LEU C 39  ? 0.2993 0.2869 0.2645 0.0251  0.0062  0.0339  44  LEU A CD2 
2930 N N   . ASP C 40  ? 0.2860 0.2767 0.2474 0.0316  0.0040  0.0380  45  ASP A N   
2931 C CA  . ASP C 40  ? 0.3465 0.3395 0.3050 0.0348  0.0040  0.0409  45  ASP A CA  
2932 C C   . ASP C 40  ? 0.3556 0.3519 0.3100 0.0361  0.0043  0.0416  45  ASP A C   
2933 O O   . ASP C 40  ? 0.3586 0.3582 0.3102 0.0366  0.0025  0.0391  45  ASP A O   
2934 C CB  . ASP C 40  ? 0.3653 0.3603 0.3227 0.0357  0.0015  0.0390  45  ASP A CB  
2935 C CG  . ASP C 40  ? 0.4738 0.4716 0.4283 0.0393  0.0014  0.0422  45  ASP A CG  
2936 O OD1 . ASP C 40  ? 0.4933 0.4920 0.4460 0.0409  0.0032  0.0457  45  ASP A OD1 
2937 O OD2 . ASP C 40  ? 0.5986 0.5977 0.5529 0.0403  -0.0002 0.0412  45  ASP A OD2 
2938 N N   A ARG C 41  ? 0.3960 0.3913 0.3506 0.0365  0.0069  0.0449  46  ARG A N   
2939 N N   B ARG C 41  ? 0.3988 0.3942 0.3534 0.0364  0.0068  0.0447  46  ARG A N   
2940 C CA  A ARG C 41  ? 0.4439 0.4422 0.3953 0.0373  0.0077  0.0455  46  ARG A CA  
2941 C CA  B ARG C 41  ? 0.4462 0.4450 0.3972 0.0375  0.0075  0.0455  46  ARG A CA  
2942 C C   A ARG C 41  ? 0.5112 0.5150 0.4577 0.0406  0.0068  0.0468  46  ARG A C   
2943 C C   B ARG C 41  ? 0.4943 0.4984 0.4406 0.0405  0.0061  0.0458  46  ARG A C   
2944 O O   A ARG C 41  ? 0.4991 0.5068 0.4424 0.0413  0.0066  0.0455  46  ARG A O   
2945 O O   B ARG C 41  ? 0.3990 0.4071 0.3425 0.0410  0.0047  0.0430  46  ARG A O   
2946 C CB  A ARG C 41  ? 0.4493 0.4451 0.4029 0.0366  0.0109  0.0486  46  ARG A CB  
2947 C CB  B ARG C 41  ? 0.4810 0.4783 0.4330 0.0381  0.0107  0.0500  46  ARG A CB  
2948 C CG  A ARG C 41  ? 0.4478 0.4395 0.4058 0.0333  0.0117  0.0465  46  ARG A CG  
2949 C CG  B ARG C 41  ? 0.4661 0.4597 0.4219 0.0354  0.0125  0.0493  46  ARG A CG  
2950 C CD  A ARG C 41  ? 0.4258 0.4152 0.3864 0.0327  0.0149  0.0493  46  ARG A CD  
2951 C CD  B ARG C 41  ? 0.4330 0.4229 0.3930 0.0354  0.0151  0.0532  46  ARG A CD  
2952 N NE  A ARG C 41  ? 0.4215 0.4137 0.3792 0.0331  0.0158  0.0497  46  ARG A NE  
2953 N NE  B ARG C 41  ? 0.4354 0.4219 0.3996 0.0327  0.0167  0.0521  46  ARG A NE  
2954 C CZ  A ARG C 41  ? 0.3836 0.3750 0.3426 0.0328  0.0186  0.0521  46  ARG A CZ  
2955 C CZ  B ARG C 41  ? 0.3941 0.3769 0.3634 0.0308  0.0169  0.0508  46  ARG A CZ  
2956 N NH1 A ARG C 41  ? 0.4009 0.3883 0.3646 0.0320  0.0209  0.0546  46  ARG A NH1 
2957 N NH1 B ARG C 41  ? 0.3469 0.3287 0.3181 0.0311  0.0157  0.0503  46  ARG A NH1 
2958 N NH2 A ARG C 41  ? 0.3986 0.3932 0.3545 0.0333  0.0191  0.0518  46  ARG A NH2 
2959 N NH2 B ARG C 41  ? 0.3930 0.3735 0.3657 0.0287  0.0184  0.0497  46  ARG A NH2 
2960 N N   . ALA C 42  ? 0.5673 0.5717 0.5133 0.0426  0.0063  0.0490  47  ALA A N   
2961 C CA  . ALA C 42  ? 0.5975 0.6074 0.5389 0.0459  0.0051  0.0499  47  ALA A CA  
2962 C C   . ALA C 42  ? 0.5816 0.5947 0.5214 0.0457  0.0020  0.0447  47  ALA A C   
2963 O O   . ALA C 42  ? 0.5660 0.5843 0.5024 0.0471  0.0011  0.0430  47  ALA A O   
2964 C CB  . ALA C 42  ? 0.5839 0.5931 0.5261 0.0479  0.0053  0.0537  47  ALA A CB  
2965 N N   . ALA C 43  ? 0.4763 0.4863 0.4191 0.0439  0.0005  0.0420  48  ALA A N   
2966 C CA  . ALA C 43  ? 0.3829 0.3950 0.3255 0.0432  -0.0021 0.0372  48  ALA A CA  
2967 C C   . ALA C 43  ? 0.3649 0.3768 0.3085 0.0408  -0.0026 0.0336  48  ALA A C   
2968 O O   . ALA C 43  ? 0.3833 0.3966 0.3274 0.0401  -0.0047 0.0297  48  ALA A O   
2969 C CB  . ALA C 43  ? 0.4170 0.4262 0.3626 0.0421  -0.0033 0.0360  48  ALA A CB  
2970 N N   . LYS C 44  ? 0.3483 0.3579 0.2929 0.0395  -0.0005 0.0350  49  LYS A N   
2971 C CA  . LYS C 44  ? 0.3409 0.3500 0.2867 0.0374  -0.0007 0.0322  49  LYS A CA  
2972 C C   . LYS C 44  ? 0.2890 0.2955 0.2381 0.0348  -0.0024 0.0289  49  LYS A C   
2973 O O   . LYS C 44  ? 0.2579 0.2662 0.2076 0.0341  -0.0041 0.0255  49  LYS A O   
2974 C CB  . LYS C 44  ? 0.3769 0.3915 0.3198 0.0389  -0.0016 0.0300  49  LYS A CB  
2975 C CG  . LYS C 44  ? 0.4737 0.4911 0.4135 0.0408  0.0005  0.0332  49  LYS A CG  
2976 C CD  . LYS C 44  ? 0.5942 0.6187 0.5299 0.0438  -0.0005 0.0321  49  LYS A CD  
2977 C CE  . LYS C 44  ? 0.6149 0.6428 0.5514 0.0434  -0.0031 0.0265  49  LYS A CE  
2978 N NZ  . LYS C 44  ? 0.6431 0.6684 0.5827 0.0406  -0.0030 0.0238  49  LYS A NZ  
2979 N N   . THR C 45  ? 0.2716 0.2742 0.2233 0.0335  -0.0018 0.0301  50  THR A N   
2980 C CA  . THR C 45  ? 0.2613 0.2619 0.2161 0.0309  -0.0031 0.0274  50  THR A CA  
2981 C C   . THR C 45  ? 0.2365 0.2330 0.1944 0.0291  -0.0014 0.0289  50  THR A C   
2982 O O   . THR C 45  ? 0.2339 0.2287 0.1922 0.0297  0.0005  0.0318  50  THR A O   
2983 C CB  . THR C 45  ? 0.3101 0.3123 0.2649 0.0315  -0.0053 0.0256  50  THR A CB  
2984 O OG1 . THR C 45  ? 0.3360 0.3372 0.2936 0.0289  -0.0067 0.0229  50  THR A OG1 
2985 C CG2 . THR C 45  ? 0.3311 0.3323 0.2858 0.0330  -0.0046 0.0282  50  THR A CG2 
2986 N N   . GLY C 46  ? 0.1960 0.1911 0.1564 0.0266  -0.0023 0.0267  51  GLY A N   
2987 C CA  . GLY C 46  ? 0.1805 0.1726 0.1441 0.0247  -0.0011 0.0272  51  GLY A CA  
2988 C C   . GLY C 46  ? 0.1540 0.1460 0.1199 0.0222  -0.0025 0.0246  51  GLY A C   
2989 O O   . GLY C 46  ? 0.1395 0.1335 0.1047 0.0219  -0.0043 0.0227  51  GLY A O   
2990 N N   . THR C 47  ? 0.1470 0.1372 0.1159 0.0204  -0.0018 0.0243  52  THR A N   
2991 C CA  . THR C 47  ? 0.1393 0.1300 0.1101 0.0180  -0.0030 0.0223  52  THR A CA  
2992 C C   . THR C 47  ? 0.1424 0.1315 0.1160 0.0162  -0.0015 0.0223  52  THR A C   
2993 O O   . THR C 47  ? 0.1434 0.1309 0.1183 0.0166  0.0002  0.0236  52  THR A O   
2994 C CB  . THR C 47  ? 0.1534 0.1453 0.1252 0.0176  -0.0043 0.0210  52  THR A CB  
2995 O OG1 . THR C 47  ? 0.1661 0.1566 0.1398 0.0179  -0.0030 0.0218  52  THR A OG1 
2996 C CG2 . THR C 47  ? 0.1649 0.1585 0.1345 0.0193  -0.0058 0.0206  52  THR A CG2 
2997 N N   . VAL C 48  ? 0.1319 0.1219 0.1068 0.0142  -0.0025 0.0208  53  VAL A N   
2998 C CA  . VAL C 48  ? 0.1377 0.1273 0.1154 0.0122  -0.0017 0.0202  53  VAL A CA  
2999 C C   . VAL C 48  ? 0.1374 0.1291 0.1165 0.0106  -0.0030 0.0187  53  VAL A C   
3000 O O   . VAL C 48  ? 0.1370 0.1304 0.1153 0.0102  -0.0047 0.0182  53  VAL A O   
3001 C CB  . VAL C 48  ? 0.1575 0.1469 0.1352 0.0114  -0.0016 0.0202  53  VAL A CB  
3002 C CG1 . VAL C 48  ? 0.1859 0.1754 0.1664 0.0094  -0.0010 0.0194  53  VAL A CG1 
3003 C CG2 . VAL C 48  ? 0.1830 0.1709 0.1593 0.0129  -0.0001 0.0216  53  VAL A CG2 
3004 N N   . ASP C 49  ? 0.1318 0.1237 0.1136 0.0094  -0.0021 0.0179  54  ASP A N   
3005 C CA  . ASP C 49  ? 0.1463 0.1411 0.1297 0.0076  -0.0031 0.0164  54  ASP A CA  
3006 C C   . ASP C 49  ? 0.1365 0.1317 0.1226 0.0062  -0.0020 0.0155  54  ASP A C   
3007 O O   . ASP C 49  ? 0.1589 0.1527 0.1472 0.0067  -0.0003 0.0153  54  ASP A O   
3008 C CB  . ASP C 49  ? 0.1945 0.1904 0.1788 0.0079  -0.0033 0.0155  54  ASP A CB  
3009 C CG  . ASP C 49  ? 0.3118 0.3113 0.2975 0.0060  -0.0042 0.0138  54  ASP A CG  
3010 O OD1 . ASP C 49  ? 0.3541 0.3555 0.3390 0.0049  -0.0054 0.0140  54  ASP A OD1 
3011 O OD2 . ASP C 49  ? 0.4211 0.4219 0.4089 0.0059  -0.0037 0.0124  54  ASP A OD2 
3012 N N   . VAL C 50  ? 0.1180 0.1149 0.1044 0.0048  -0.0027 0.0152  55  VAL A N   
3013 C CA  . VAL C 50  ? 0.1346 0.1321 0.1234 0.0036  -0.0018 0.0143  55  VAL A CA  
3014 C C   . VAL C 50  ? 0.1367 0.1384 0.1262 0.0018  -0.0031 0.0134  55  VAL A C   
3015 O O   . VAL C 50  ? 0.1296 0.1326 0.1176 0.0014  -0.0047 0.0143  55  VAL A O   
3016 C CB  . VAL C 50  ? 0.1555 0.1504 0.1438 0.0041  -0.0010 0.0154  55  VAL A CB  
3017 C CG1 . VAL C 50  ? 0.1602 0.1552 0.1465 0.0040  -0.0025 0.0164  55  VAL A CG1 
3018 C CG2 . VAL C 50  ? 0.1694 0.1645 0.1604 0.0031  0.0001  0.0144  55  VAL A CG2 
3019 N N   . THR C 51  ? 0.1318 0.1357 0.1239 0.0007  -0.0024 0.0117  56  THR A N   
3020 C CA  . THR C 51  ? 0.1335 0.1422 0.1264 -0.0007 -0.0035 0.0108  56  THR A CA  
3021 C C   . THR C 51  ? 0.1318 0.1415 0.1268 -0.0015 -0.0028 0.0099  56  THR A C   
3022 O O   . THR C 51  ? 0.1532 0.1610 0.1506 -0.0011 -0.0011 0.0086  56  THR A O   
3023 C CB  . THR C 51  ? 0.1585 0.1708 0.1528 -0.0012 -0.0035 0.0088  56  THR A CB  
3024 O OG1 . THR C 51  ? 0.1812 0.1924 0.1734 -0.0004 -0.0042 0.0098  56  THR A OG1 
3025 C CG2 . THR C 51  ? 0.2014 0.2195 0.1961 -0.0028 -0.0045 0.0080  56  THR A CG2 
3026 N N   . THR C 52  ? 0.1284 0.1406 0.1231 -0.0025 -0.0040 0.0105  57  THR A N   
3027 C CA  . THR C 52  ? 0.1358 0.1495 0.1325 -0.0032 -0.0036 0.0096  57  THR A CA  
3028 C C   . THR C 52  ? 0.1331 0.1533 0.1304 -0.0046 -0.0048 0.0087  57  THR A C   
3029 O O   . THR C 52  ? 0.1303 0.1532 0.1259 -0.0051 -0.0062 0.0102  57  THR A O   
3030 C CB  . THR C 52  ? 0.1613 0.1721 0.1568 -0.0029 -0.0041 0.0117  57  THR A CB  
3031 O OG1 . THR C 52  ? 0.1697 0.1753 0.1644 -0.0016 -0.0029 0.0124  57  THR A OG1 
3032 C CG2 . THR C 52  ? 0.1782 0.1905 0.1756 -0.0036 -0.0040 0.0111  57  THR A CG2 
3033 N N   . ASP C 53  ? 0.1239 0.1472 0.1240 -0.0051 -0.0041 0.0062  58  ASP A N   
3034 C CA  . ASP C 53  ? 0.1375 0.1678 0.1383 -0.0063 -0.0051 0.0051  58  ASP A CA  
3035 C C   . ASP C 53  ? 0.1290 0.1612 0.1293 -0.0068 -0.0063 0.0068  58  ASP A C   
3036 O O   . ASP C 53  ? 0.1260 0.1562 0.1277 -0.0066 -0.0057 0.0064  58  ASP A O   
3037 C CB  . ASP C 53  ? 0.1677 0.2009 0.1720 -0.0065 -0.0038 0.0011  58  ASP A CB  
3038 C CG  . ASP C 53  ? 0.2611 0.2942 0.2665 -0.0062 -0.0030 -0.0007 58  ASP A CG  
3039 O OD1 . ASP C 53  ? 0.3239 0.3548 0.3269 -0.0057 -0.0034 0.0009  58  ASP A OD1 
3040 O OD2 . ASP C 53  ? 0.3630 0.3984 0.3723 -0.0064 -0.0019 -0.0043 58  ASP A OD2 
3041 N N   . ILE C 54  ? 0.1230 0.1591 0.1216 -0.0074 -0.0079 0.0090  59  ILE A N   
3042 C CA  . ILE C 54  ? 0.1217 0.1596 0.1201 -0.0078 -0.0092 0.0111  59  ILE A CA  
3043 C C   . ILE C 54  ? 0.1284 0.1711 0.1290 -0.0083 -0.0092 0.0090  59  ILE A C   
3044 O O   . ILE C 54  ? 0.1272 0.1692 0.1286 -0.0082 -0.0096 0.0099  59  ILE A O   
3045 C CB  . ILE C 54  ? 0.1277 0.1697 0.1245 -0.0085 -0.0109 0.0143  59  ILE A CB  
3046 C CG1 . ILE C 54  ? 0.1301 0.1667 0.1253 -0.0079 -0.0111 0.0164  59  ILE A CG1 
3047 C CG2 . ILE C 54  ? 0.1382 0.1833 0.1355 -0.0089 -0.0124 0.0168  59  ILE A CG2 
3048 C CD1 . ILE C 54  ? 0.1455 0.1760 0.1409 -0.0072 -0.0113 0.0181  59  ILE A CD1 
3049 N N   . ALA C 55  ? 0.1185 0.1663 0.1203 -0.0087 -0.0086 0.0058  60  ALA A N   
3050 C CA  . ALA C 55  ? 0.1244 0.1777 0.1285 -0.0090 -0.0086 0.0031  60  ALA A CA  
3051 C C   . ALA C 55  ? 0.1258 0.1747 0.1329 -0.0086 -0.0071 0.0007  60  ALA A C   
3052 O O   . ALA C 55  ? 0.1447 0.1976 0.1540 -0.0089 -0.0072 -0.0012 60  ALA A O   
3053 C CB  . ALA C 55  ? 0.1365 0.1964 0.1418 -0.0095 -0.0083 -0.0003 60  ALA A CB  
3054 N N   . SER C 56  ? 0.1073 0.1484 0.1142 -0.0079 -0.0058 0.0014  61  SER A N   
3055 C CA  . SER C 56  ? 0.1068 0.1432 0.1163 -0.0075 -0.0042 0.0000  61  SER A CA  
3056 C C   . SER C 56  ? 0.1027 0.1355 0.1116 -0.0072 -0.0046 0.0021  61  SER A C   
3057 O O   . SER C 56  ? 0.1131 0.1417 0.1240 -0.0068 -0.0031 0.0012  61  SER A O   
3058 C CB  . SER C 56  ? 0.1139 0.1444 0.1240 -0.0067 -0.0024 -0.0006 61  SER A CB  
3059 O OG  . SER C 56  ? 0.1183 0.1432 0.1253 -0.0060 -0.0025 0.0026  61  SER A OG  
3060 N N   . ILE C 57  ? 0.1127 0.1473 0.1195 -0.0074 -0.0065 0.0050  62  ILE A N   
3061 C CA  . ILE C 57  ? 0.1292 0.1605 0.1359 -0.0071 -0.0071 0.0072  62  ILE A CA  
3062 C C   . ILE C 57  ? 0.1393 0.1728 0.1490 -0.0073 -0.0068 0.0050  62  ILE A C   
3063 O O   . ILE C 57  ? 0.1477 0.1874 0.1589 -0.0078 -0.0071 0.0028  62  ILE A O   
3064 C CB  . ILE C 57  ? 0.1491 0.1822 0.1539 -0.0073 -0.0093 0.0108  62  ILE A CB  
3065 C CG1 . ILE C 57  ? 0.1530 0.1810 0.1579 -0.0068 -0.0096 0.0129  62  ILE A CG1 
3066 C CG2 . ILE C 57  ? 0.1579 0.1985 0.1633 -0.0080 -0.0108 0.0110  62  ILE A CG2 
3067 C CD1 . ILE C 57  ? 0.1487 0.1774 0.1528 -0.0070 -0.0116 0.0165  62  ILE A CD1 
3068 N N   A HIS C 58  ? 0.1278 0.1560 0.1384 -0.0069 -0.0059 0.0052  63  HIS A N   
3069 N N   B HIS C 58  ? 0.1313 0.1599 0.1419 -0.0069 -0.0061 0.0054  63  HIS A N   
3070 C CA  A HIS C 58  ? 0.1320 0.1613 0.1456 -0.0070 -0.0056 0.0035  63  HIS A CA  
3071 C CA  B HIS C 58  ? 0.1355 0.1660 0.1491 -0.0071 -0.0059 0.0034  63  HIS A CA  
3072 C C   A HIS C 58  ? 0.1288 0.1552 0.1419 -0.0067 -0.0066 0.0061  63  HIS A C   
3073 C C   B HIS C 58  ? 0.1311 0.1577 0.1446 -0.0067 -0.0064 0.0057  63  HIS A C   
3074 O O   A HIS C 58  ? 0.1315 0.1525 0.1434 -0.0062 -0.0060 0.0075  63  HIS A O   
3075 O O   B HIS C 58  ? 0.1275 0.1484 0.1406 -0.0062 -0.0051 0.0061  63  HIS A O   
3076 C CB  A HIS C 58  ? 0.1354 0.1611 0.1518 -0.0068 -0.0030 0.0007  63  HIS A CB  
3077 C CB  B HIS C 58  ? 0.1446 0.1733 0.1614 -0.0071 -0.0034 0.0000  63  HIS A CB  
3078 C CG  A HIS C 58  ? 0.1480 0.1759 0.1681 -0.0071 -0.0027 -0.0018 63  HIS A CG  
3079 C CG  B HIS C 58  ? 0.1632 0.1966 0.1815 -0.0075 -0.0030 -0.0030 63  HIS A CG  
3080 N ND1 A HIS C 58  ? 0.1792 0.2035 0.2006 -0.0069 -0.0021 -0.0014 63  HIS A ND1 
3081 N ND1 B HIS C 58  ? 0.1929 0.2330 0.2139 -0.0080 -0.0035 -0.0062 63  HIS A ND1 
3082 C CD2 A HIS C 58  ? 0.1646 0.1985 0.1876 -0.0076 -0.0028 -0.0050 63  HIS A CD2 
3083 C CD2 B HIS C 58  ? 0.1684 0.2011 0.1859 -0.0074 -0.0023 -0.0034 63  HIS A CD2 
3084 C CE1 A HIS C 58  ? 0.1496 0.1775 0.1744 -0.0072 -0.0021 -0.0040 63  HIS A CE1 
3085 C CE1 B HIS C 58  ? 0.1900 0.2335 0.2119 -0.0083 -0.0030 -0.0086 63  HIS A CE1 
3086 N NE2 A HIS C 58  ? 0.1601 0.1939 0.1861 -0.0076 -0.0025 -0.0064 63  HIS A NE2 
3087 N NE2 B HIS C 58  ? 0.1823 0.2213 0.2021 -0.0079 -0.0023 -0.0068 63  HIS A NE2 
3088 N N   . THR C 59  ? 0.1293 0.1596 0.1433 -0.0070 -0.0084 0.0069  64  THR A N   
3089 C CA  . THR C 59  ? 0.1420 0.1696 0.1565 -0.0066 -0.0093 0.0089  64  THR A CA  
3090 C C   . THR C 59  ? 0.1501 0.1787 0.1679 -0.0067 -0.0090 0.0068  64  THR A C   
3091 O O   . THR C 59  ? 0.1878 0.2137 0.2065 -0.0063 -0.0095 0.0080  64  THR A O   
3092 C CB  . THR C 59  ? 0.1480 0.1793 0.1618 -0.0068 -0.0119 0.0122  64  THR A CB  
3093 O OG1 . THR C 59  ? 0.1494 0.1879 0.1641 -0.0072 -0.0130 0.0114  64  THR A OG1 
3094 C CG2 . THR C 59  ? 0.1636 0.1947 0.1746 -0.0069 -0.0125 0.0145  64  THR A CG2 
3095 N N   . GLY C 60  ? 0.1529 0.1852 0.1726 -0.0070 -0.0081 0.0035  65  GLY A N   
3096 C CA  . GLY C 60  ? 0.1534 0.1882 0.1765 -0.0071 -0.0081 0.0012  65  GLY A CA  
3097 C C   . GLY C 60  ? 0.1541 0.1962 0.1777 -0.0072 -0.0104 0.0015  65  GLY A C   
3098 O O   . GLY C 60  ? 0.1419 0.1878 0.1683 -0.0073 -0.0105 -0.0008 65  GLY A O   
3099 N N   . SER C 61  ? 0.1534 0.1985 0.1743 -0.0073 -0.0122 0.0046  66  SER A N   
3100 C CA  . SER C 61  ? 0.1498 0.2027 0.1706 -0.0074 -0.0144 0.0058  66  SER A CA  
3101 C C   . SER C 61  ? 0.1591 0.2177 0.1777 -0.0078 -0.0147 0.0057  66  SER A C   
3102 O O   . SER C 61  ? 0.1541 0.2106 0.1702 -0.0079 -0.0149 0.0083  66  SER A O   
3103 C CB  . SER C 61  ? 0.1514 0.2036 0.1717 -0.0071 -0.0165 0.0105  66  SER A CB  
3104 O OG  . SER C 61  ? 0.1800 0.2398 0.1997 -0.0071 -0.0187 0.0128  66  SER A OG  
3105 N N   . ALA C 62  ? 0.1722 0.2375 0.1922 -0.0080 -0.0146 0.0021  67  ALA A N   
3106 C CA  . ALA C 62  ? 0.1595 0.2307 0.1778 -0.0083 -0.0148 0.0013  67  ALA A CA  
3107 C C   . ALA C 62  ? 0.1554 0.2313 0.1709 -0.0084 -0.0169 0.0059  67  ALA A C   
3108 O O   . ALA C 62  ? 0.1435 0.2213 0.1566 -0.0087 -0.0169 0.0070  67  ALA A O   
3109 C CB  . ALA C 62  ? 0.1913 0.2703 0.2122 -0.0085 -0.0144 -0.0038 67  ALA A CB  
3110 N N   . LYS C 63  ? 0.1580 0.2366 0.1741 -0.0081 -0.0188 0.0087  68  LYS A N   
3111 C CA  . LYS C 63  ? 0.1630 0.2460 0.1771 -0.0081 -0.0208 0.0136  68  LYS A CA  
3112 C C   . LYS C 63  ? 0.1504 0.2267 0.1628 -0.0082 -0.0207 0.0177  68  LYS A C   
3113 O O   . LYS C 63  ? 0.1378 0.2173 0.1481 -0.0086 -0.0215 0.0206  68  LYS A O   
3114 C CB  . LYS C 63  ? 0.2188 0.3063 0.2345 -0.0075 -0.0229 0.0160  68  LYS A CB  
3115 C CG  . LYS C 63  ? 0.2915 0.3727 0.3086 -0.0072 -0.0238 0.0198  68  LYS A CG  
3116 C CD  . LYS C 63  ? 0.3053 0.3925 0.3242 -0.0066 -0.0261 0.0224  68  LYS A CD  
3117 C CE  . LYS C 63  ? 0.3757 0.4558 0.3971 -0.0062 -0.0269 0.0256  68  LYS A CE  
3118 N NZ  . LYS C 63  ? 0.4100 0.4866 0.4307 -0.0064 -0.0276 0.0308  68  LYS A NZ  
3119 N N   . LEU C 64  ? 0.1285 0.1957 0.1420 -0.0080 -0.0198 0.0176  69  LEU A N   
3120 C CA  . LEU C 64  ? 0.1247 0.1858 0.1369 -0.0081 -0.0197 0.0207  69  LEU A CA  
3121 C C   . LEU C 64  ? 0.1232 0.1828 0.1332 -0.0084 -0.0182 0.0190  69  LEU A C   
3122 O O   . LEU C 64  ? 0.1317 0.1912 0.1399 -0.0086 -0.0187 0.0218  69  LEU A O   
3123 C CB  . LEU C 64  ? 0.1195 0.1721 0.1335 -0.0076 -0.0192 0.0207  69  LEU A CB  
3124 C CG  . LEU C 64  ? 0.1171 0.1635 0.1301 -0.0075 -0.0190 0.0231  69  LEU A CG  
3125 C CD1 . LEU C 64  ? 0.1414 0.1898 0.1546 -0.0077 -0.0209 0.0279  69  LEU A CD1 
3126 C CD2 . LEU C 64  ? 0.1345 0.1738 0.1494 -0.0070 -0.0184 0.0224  69  LEU A CD2 
3127 N N   . ASP C 65  ? 0.1203 0.1788 0.1307 -0.0084 -0.0164 0.0145  70  ASP A N   
3128 C CA  . ASP C 65  ? 0.1280 0.1854 0.1368 -0.0086 -0.0150 0.0127  70  ASP A CA  
3129 C C   . ASP C 65  ? 0.1244 0.1895 0.1313 -0.0091 -0.0160 0.0140  70  ASP A C   
3130 O O   . ASP C 65  ? 0.1395 0.2029 0.1445 -0.0093 -0.0157 0.0151  70  ASP A O   
3131 C CB  . ASP C 65  ? 0.1366 0.1939 0.1472 -0.0086 -0.0131 0.0077  70  ASP A CB  
3132 C CG  . ASP C 65  ? 0.1826 0.2327 0.1952 -0.0082 -0.0116 0.0061  70  ASP A CG  
3133 O OD1 . ASP C 65  ? 0.2047 0.2490 0.2167 -0.0079 -0.0117 0.0086  70  ASP A OD1 
3134 O OD2 . ASP C 65  ? 0.2276 0.2788 0.2428 -0.0083 -0.0101 0.0019  70  ASP A OD2 
3135 N N   . GLU C 66  ? 0.1141 0.1877 0.1215 -0.0093 -0.0172 0.0137  71  GLU A N   
3136 C CA  . GLU C 66  ? 0.1231 0.2048 0.1285 -0.0098 -0.0180 0.0146  71  GLU A CA  
3137 C C   . GLU C 66  ? 0.1293 0.2112 0.1332 -0.0099 -0.0195 0.0205  71  GLU A C   
3138 O O   . GLU C 66  ? 0.1456 0.2297 0.1476 -0.0104 -0.0195 0.0221  71  GLU A O   
3139 C CB  . GLU C 66  ? 0.1497 0.2412 0.1561 -0.0097 -0.0186 0.0119  71  GLU A CB  
3140 C CG  . GLU C 66  ? 0.1845 0.2859 0.1888 -0.0102 -0.0195 0.0130  71  GLU A CG  
3141 C CD  . GLU C 66  ? 0.2567 0.3582 0.2592 -0.0107 -0.0186 0.0124  71  GLU A CD  
3142 O OE1 . GLU C 66  ? 0.2753 0.3724 0.2789 -0.0107 -0.0169 0.0080  71  GLU A OE1 
3143 O OE2 . GLU C 66  ? 0.2644 0.3708 0.2646 -0.0111 -0.0196 0.0163  71  GLU A OE2 
3144 N N   . HIS C 67  ? 0.1308 0.2102 0.1360 -0.0096 -0.0208 0.0241  72  HIS A N   
3145 C CA  . HIS C 67  ? 0.1487 0.2279 0.1536 -0.0097 -0.0221 0.0296  72  HIS A CA  
3146 C C   . HIS C 67  ? 0.1326 0.2045 0.1366 -0.0099 -0.0212 0.0305  72  HIS A C   
3147 O O   . HIS C 67  ? 0.1454 0.2188 0.1484 -0.0103 -0.0217 0.0338  72  HIS A O   
3148 C CB  . HIS C 67  ? 0.1780 0.2542 0.1856 -0.0092 -0.0234 0.0324  72  HIS A CB  
3149 C CG  . HIS C 67  ? 0.2246 0.2983 0.2330 -0.0093 -0.0245 0.0380  72  HIS A CG  
3150 N ND1 . HIS C 67  ? 0.2946 0.3750 0.3029 -0.0096 -0.0260 0.0427  72  HIS A ND1 
3151 C CD2 . HIS C 67  ? 0.2932 0.3589 0.3028 -0.0093 -0.0243 0.0394  72  HIS A CD2 
3152 C CE1 . HIS C 67  ? 0.2898 0.3659 0.3000 -0.0097 -0.0267 0.0470  72  HIS A CE1 
3153 N NE2 . HIS C 67  ? 0.3394 0.4068 0.3503 -0.0095 -0.0257 0.0448  72  HIS A NE2 
3154 N N   . LEU C 68  ? 0.1204 0.1850 0.1247 -0.0096 -0.0198 0.0275  73  LEU A N   
3155 C CA  . LEU C 68  ? 0.1235 0.1813 0.1270 -0.0095 -0.0190 0.0281  73  LEU A CA  
3156 C C   . LEU C 68  ? 0.1229 0.1835 0.1241 -0.0100 -0.0183 0.0271  73  LEU A C   
3157 O O   . LEU C 68  ? 0.1261 0.1831 0.1264 -0.0101 -0.0181 0.0286  73  LEU A O   
3158 C CB  . LEU C 68  ? 0.1294 0.1791 0.1336 -0.0089 -0.0177 0.0255  73  LEU A CB  
3159 C CG  . LEU C 68  ? 0.1559 0.2018 0.1624 -0.0085 -0.0184 0.0269  73  LEU A CG  
3160 C CD1 . LEU C 68  ? 0.1671 0.2065 0.1741 -0.0079 -0.0167 0.0236  73  LEU A CD1 
3161 C CD2 . LEU C 68  ? 0.1761 0.2199 0.1839 -0.0085 -0.0198 0.0311  73  LEU A CD2 
3162 N N   A GLN C 69  ? 0.1047 0.1715 0.1052 -0.0102 -0.0178 0.0240  74  GLN A N   
3163 N N   B GLN C 69  ? 0.1290 0.1958 0.1295 -0.0103 -0.0178 0.0240  74  GLN A N   
3164 C CA  A GLN C 69  ? 0.1017 0.1724 0.1005 -0.0107 -0.0171 0.0225  74  GLN A CA  
3165 C CA  B GLN C 69  ? 0.1460 0.2162 0.1447 -0.0107 -0.0171 0.0226  74  GLN A CA  
3166 C C   A GLN C 69  ? 0.1102 0.1868 0.1077 -0.0114 -0.0184 0.0266  74  GLN A C   
3167 C C   B GLN C 69  ? 0.1352 0.2121 0.1327 -0.0114 -0.0183 0.0264  74  GLN A C   
3168 O O   A GLN C 69  ? 0.1106 0.1888 0.1066 -0.0118 -0.0179 0.0264  74  GLN A O   
3169 O O   B GLN C 69  ? 0.1364 0.2155 0.1324 -0.0118 -0.0178 0.0258  74  GLN A O   
3170 C CB  A GLN C 69  ? 0.0915 0.1681 0.0908 -0.0108 -0.0165 0.0180  74  GLN A CB  
3171 C CB  B GLN C 69  ? 0.1681 0.2435 0.1672 -0.0108 -0.0162 0.0177  74  GLN A CB  
3172 C CG  A GLN C 69  ? 0.0831 0.1549 0.0843 -0.0103 -0.0150 0.0137  74  GLN A CG  
3173 C CG  B GLN C 69  ? 0.1968 0.2696 0.1981 -0.0103 -0.0154 0.0141  74  GLN A CG  
3174 C CD  A GLN C 69  ? 0.0748 0.1383 0.0756 -0.0100 -0.0137 0.0129  74  GLN A CD  
3175 C CD  B GLN C 69  ? 0.2229 0.2915 0.2250 -0.0101 -0.0134 0.0100  74  GLN A CD  
3176 O OE1 A GLN C 69  ? 0.0701 0.1338 0.0700 -0.0101 -0.0129 0.0117  74  GLN A OE1 
3177 O OE1 B GLN C 69  ? 0.2374 0.3031 0.2382 -0.0101 -0.0129 0.0104  74  GLN A OE1 
3178 N NE2 A GLN C 69  ? 0.0701 0.1266 0.0720 -0.0094 -0.0131 0.0130  74  GLN A NE2 
3179 N NE2 B GLN C 69  ? 0.3089 0.3772 0.3135 -0.0099 -0.0124 0.0059  74  GLN A NE2 
3180 N N   . THR C 70  ? 0.1289 0.2095 0.1272 -0.0114 -0.0198 0.0302  75  THR A N   
3181 C CA  . THR C 70  ? 0.1385 0.2264 0.1358 -0.0120 -0.0209 0.0344  75  THR A CA  
3182 C C   . THR C 70  ? 0.1557 0.2392 0.1531 -0.0124 -0.0212 0.0384  75  THR A C   
3183 O O   . THR C 70  ? 0.1480 0.2227 0.1465 -0.0120 -0.0207 0.0381  75  THR A O   
3184 C CB  . THR C 70  ? 0.1401 0.2333 0.1385 -0.0119 -0.0225 0.0377  75  THR A CB  
3185 O OG1 . THR C 70  ? 0.1545 0.2411 0.1553 -0.0116 -0.0233 0.0414  75  THR A OG1 
3186 C CG2 . THR C 70  ? 0.1494 0.2472 0.1481 -0.0115 -0.0225 0.0340  75  THR A CG2 
3187 N N   . ALA C 71  ? 0.1715 0.2616 0.1682 -0.0131 -0.0218 0.0422  76  ALA A N   
3188 C CA  . ALA C 71  ? 0.1944 0.2808 0.1921 -0.0135 -0.0221 0.0464  76  ALA A CA  
3189 C C   . ALA C 71  ? 0.1950 0.2756 0.1961 -0.0132 -0.0231 0.0503  76  ALA A C   
3190 O O   . ALA C 71  ? 0.2300 0.3055 0.2328 -0.0133 -0.0232 0.0526  76  ALA A O   
3191 C CB  . ALA C 71  ? 0.1923 0.2872 0.1890 -0.0143 -0.0224 0.0499  76  ALA A CB  
3192 N N   . GLU C 72  ? 0.2027 0.2836 0.2051 -0.0126 -0.0239 0.0505  77  GLU A N   
3193 C CA  . GLU C 72  ? 0.2264 0.3015 0.2325 -0.0122 -0.0249 0.0533  77  GLU A CA  
3194 C C   . GLU C 72  ? 0.1998 0.2649 0.2066 -0.0116 -0.0240 0.0498  77  GLU A C   
3195 O O   . GLU C 72  ? 0.2207 0.2801 0.2307 -0.0112 -0.0247 0.0514  77  GLU A O   
3196 C CB  . GLU C 72  ? 0.2751 0.3541 0.2823 -0.0117 -0.0260 0.0543  77  GLU A CB  
3197 C CG  . GLU C 72  ? 0.3864 0.4751 0.3934 -0.0121 -0.0271 0.0590  77  GLU A CG  
3198 C CD  . GLU C 72  ? 0.5093 0.5964 0.5204 -0.0122 -0.0284 0.0656  77  GLU A CD  
3199 O OE1 . GLU C 72  ? 0.6180 0.6986 0.6326 -0.0116 -0.0290 0.0659  77  GLU A OE1 
3200 O OE2 . GLU C 72  ? 0.5562 0.6487 0.5677 -0.0128 -0.0289 0.0706  77  GLU A OE2 
3201 N N   . PHE C 73  ? 0.1692 0.2327 0.1733 -0.0115 -0.0226 0.0450  78  PHE A N   
3202 C CA  . PHE C 73  ? 0.1551 0.2101 0.1594 -0.0108 -0.0217 0.0419  78  PHE A CA  
3203 C C   . PHE C 73  ? 0.1380 0.1912 0.1398 -0.0108 -0.0204 0.0389  78  PHE A C   
3204 O O   . PHE C 73  ? 0.1431 0.1961 0.1448 -0.0113 -0.0205 0.0407  78  PHE A O   
3205 C CB  . PHE C 73  ? 0.1512 0.2039 0.1564 -0.0101 -0.0215 0.0393  78  PHE A CB  
3206 C CG  . PHE C 73  ? 0.1613 0.2054 0.1681 -0.0094 -0.0211 0.0381  78  PHE A CG  
3207 C CD1 . PHE C 73  ? 0.1595 0.1987 0.1647 -0.0089 -0.0197 0.0346  78  PHE A CD1 
3208 C CD2 . PHE C 73  ? 0.1938 0.2354 0.2041 -0.0092 -0.0223 0.0407  78  PHE A CD2 
3209 C CE1 . PHE C 73  ? 0.1682 0.2007 0.1746 -0.0082 -0.0193 0.0335  78  PHE A CE1 
3210 C CE2 . PHE C 73  ? 0.2094 0.2441 0.2213 -0.0085 -0.0220 0.0392  78  PHE A CE2 
3211 C CZ  . PHE C 73  ? 0.1705 0.2008 0.1802 -0.0080 -0.0205 0.0357  78  PHE A CZ  
3212 N N   . PHE C 74  ? 0.1297 0.1817 0.1298 -0.0105 -0.0190 0.0344  79  PHE A N   
3213 C CA  . PHE C 74  ? 0.1248 0.1746 0.1230 -0.0104 -0.0178 0.0319  79  PHE A CA  
3214 C C   . PHE C 74  ? 0.1350 0.1912 0.1316 -0.0111 -0.0178 0.0322  79  PHE A C   
3215 O O   . PHE C 74  ? 0.1440 0.1983 0.1396 -0.0111 -0.0171 0.0311  79  PHE A O   
3216 C CB  . PHE C 74  ? 0.1235 0.1709 0.1210 -0.0098 -0.0164 0.0275  79  PHE A CB  
3217 C CG  . PHE C 74  ? 0.1209 0.1613 0.1196 -0.0090 -0.0159 0.0266  79  PHE A CG  
3218 C CD1 . PHE C 74  ? 0.1386 0.1729 0.1373 -0.0084 -0.0158 0.0273  79  PHE A CD1 
3219 C CD2 . PHE C 74  ? 0.1318 0.1722 0.1315 -0.0087 -0.0155 0.0247  79  PHE A CD2 
3220 C CE1 . PHE C 74  ? 0.1404 0.1691 0.1401 -0.0076 -0.0154 0.0264  79  PHE A CE1 
3221 C CE2 . PHE C 74  ? 0.1303 0.1644 0.1310 -0.0080 -0.0149 0.0238  79  PHE A CE2 
3222 C CZ  . PHE C 74  ? 0.1322 0.1608 0.1328 -0.0074 -0.0149 0.0248  79  PHE A CZ  
3223 N N   . ASP C 75  ? 0.1454 0.2094 0.1418 -0.0117 -0.0183 0.0331  80  ASP A N   
3224 C CA  . ASP C 75  ? 0.1546 0.2262 0.1494 -0.0125 -0.0182 0.0330  80  ASP A CA  
3225 C C   . ASP C 75  ? 0.1608 0.2317 0.1544 -0.0122 -0.0167 0.0278  80  ASP A C   
3226 O O   . ASP C 75  ? 0.1660 0.2362 0.1586 -0.0124 -0.0162 0.0273  80  ASP A O   
3227 C CB  . ASP C 75  ? 0.1828 0.2549 0.1777 -0.0131 -0.0188 0.0371  80  ASP A CB  
3228 C CG  . ASP C 75  ? 0.2334 0.3150 0.2270 -0.0140 -0.0189 0.0383  80  ASP A CG  
3229 O OD1 . ASP C 75  ? 0.2790 0.3674 0.2714 -0.0141 -0.0186 0.0354  80  ASP A OD1 
3230 O OD2 . ASP C 75  ? 0.2649 0.3474 0.2589 -0.0146 -0.0193 0.0419  80  ASP A OD2 
3231 N N   . ALA C 76  ? 0.1558 0.2264 0.1499 -0.0118 -0.0160 0.0240  81  ALA A N   
3232 C CA  . ALA C 76  ? 0.1504 0.2195 0.1444 -0.0115 -0.0146 0.0193  81  ALA A CA  
3233 C C   . ALA C 76  ? 0.1599 0.2367 0.1532 -0.0121 -0.0143 0.0175  81  ALA A C   
3234 O O   . ALA C 76  ? 0.1713 0.2461 0.1647 -0.0119 -0.0132 0.0143  81  ALA A O   
3235 C CB  . ALA C 76  ? 0.1809 0.2496 0.1765 -0.0111 -0.0139 0.0158  81  ALA A CB  
3236 N N   . ALA C 77  ? 0.1659 0.2514 0.1584 -0.0128 -0.0152 0.0192  82  ALA A N   
3237 C CA  . ALA C 77  ? 0.1850 0.2783 0.1766 -0.0135 -0.0149 0.0174  82  ALA A CA  
3238 C C   . ALA C 77  ? 0.2001 0.2901 0.1908 -0.0137 -0.0146 0.0189  82  ALA A C   
3239 O O   . ALA C 77  ? 0.2430 0.3354 0.2336 -0.0139 -0.0139 0.0158  82  ALA A O   
3240 C CB  . ALA C 77  ? 0.1853 0.2894 0.1761 -0.0141 -0.0160 0.0195  82  ALA A CB  
3241 N N   . LYS C 78  ? 0.1713 0.2559 0.1618 -0.0137 -0.0153 0.0232  83  LYS A N   
3242 C CA  . LYS C 78  ? 0.1893 0.2707 0.1793 -0.0138 -0.0152 0.0248  83  LYS A CA  
3243 C C   . LYS C 78  ? 0.1799 0.2524 0.1703 -0.0129 -0.0144 0.0226  83  LYS A C   
3244 O O   . LYS C 78  ? 0.1862 0.2567 0.1761 -0.0128 -0.0139 0.0213  83  LYS A O   
3245 C CB  . LYS C 78  ? 0.2598 0.3404 0.2502 -0.0143 -0.0163 0.0305  83  LYS A CB  
3246 C CG  . LYS C 78  ? 0.3871 0.4768 0.3771 -0.0154 -0.0168 0.0339  83  LYS A CG  
3247 C CD  . LYS C 78  ? 0.4651 0.5513 0.4564 -0.0158 -0.0174 0.0388  83  LYS A CD  
3248 C CE  . LYS C 78  ? 0.5433 0.6363 0.5352 -0.0166 -0.0183 0.0441  83  LYS A CE  
3249 N NZ  . LYS C 78  ? 0.6019 0.7051 0.5923 -0.0175 -0.0180 0.0446  83  LYS A NZ  
3250 N N   . PHE C 79  ? 0.1566 0.2228 0.1478 -0.0121 -0.0144 0.0225  84  PHE A N   
3251 C CA  . PHE C 79  ? 0.1592 0.2167 0.1504 -0.0111 -0.0137 0.0212  84  PHE A CA  
3252 C C   . PHE C 79  ? 0.1538 0.2090 0.1460 -0.0104 -0.0128 0.0180  84  PHE A C   
3253 O O   . PHE C 79  ? 0.1508 0.2018 0.1437 -0.0100 -0.0129 0.0189  84  PHE A O   
3254 C CB  . PHE C 79  ? 0.1831 0.2353 0.1750 -0.0108 -0.0146 0.0249  84  PHE A CB  
3255 C CG  . PHE C 79  ? 0.1986 0.2532 0.1906 -0.0116 -0.0155 0.0285  84  PHE A CG  
3256 C CD1 . PHE C 79  ? 0.2144 0.2681 0.2059 -0.0116 -0.0152 0.0280  84  PHE A CD1 
3257 C CD2 . PHE C 79  ? 0.2292 0.2864 0.2225 -0.0122 -0.0166 0.0324  84  PHE A CD2 
3258 C CE1 . PHE C 79  ? 0.2164 0.2726 0.2088 -0.0125 -0.0160 0.0315  84  PHE A CE1 
3259 C CE2 . PHE C 79  ? 0.2681 0.3274 0.2623 -0.0130 -0.0173 0.0360  84  PHE A CE2 
3260 C CZ  . PHE C 79  ? 0.2327 0.2913 0.2265 -0.0131 -0.0169 0.0354  84  PHE A CZ  
3261 N N   . PRO C 80  ? 0.1418 0.1988 0.1344 -0.0103 -0.0117 0.0141  85  PRO A N   
3262 C CA  . PRO C 80  ? 0.1489 0.2040 0.1434 -0.0098 -0.0107 0.0109  85  PRO A CA  
3263 C C   . PRO C 80  ? 0.1327 0.1791 0.1274 -0.0087 -0.0098 0.0108  85  PRO A C   
3264 O O   . PRO C 80  ? 0.1481 0.1926 0.1444 -0.0083 -0.0090 0.0090  85  PRO A O   
3265 C CB  . PRO C 80  ? 0.1694 0.2286 0.1651 -0.0099 -0.0098 0.0067  85  PRO A CB  
3266 C CG  . PRO C 80  ? 0.1748 0.2379 0.1690 -0.0105 -0.0103 0.0078  85  PRO A CG  
3267 C CD  . PRO C 80  ? 0.1716 0.2344 0.1639 -0.0109 -0.0116 0.0125  85  PRO A CD  
3268 N N   . GLN C 81  ? 0.1420 0.1837 0.1353 -0.0081 -0.0099 0.0123  86  GLN A N   
3269 C CA  . GLN C 81  ? 0.1574 0.1914 0.1507 -0.0069 -0.0089 0.0120  86  GLN A CA  
3270 C C   . GLN C 81  ? 0.1426 0.1726 0.1347 -0.0065 -0.0098 0.0150  86  GLN A C   
3271 O O   . GLN C 81  ? 0.1421 0.1745 0.1336 -0.0071 -0.0111 0.0173  86  GLN A O   
3272 C CB  . GLN C 81  ? 0.2019 0.2343 0.1955 -0.0062 -0.0079 0.0098  86  GLN A CB  
3273 C CG  . GLN C 81  ? 0.2186 0.2544 0.2148 -0.0065 -0.0068 0.0062  86  GLN A CG  
3274 C CD  . GLN C 81  ? 0.3182 0.3525 0.3155 -0.0058 -0.0058 0.0041  86  GLN A CD  
3275 O OE1 . GLN C 81  ? 0.3350 0.3702 0.3310 -0.0058 -0.0063 0.0045  86  GLN A OE1 
3276 N NE2 . GLN C 81  ? 0.3618 0.3940 0.3619 -0.0053 -0.0044 0.0016  86  GLN A NE2 
3277 N N   . ALA C 82  ? 0.1199 0.1441 0.1119 -0.0055 -0.0091 0.0151  87  ALA A N   
3278 C CA  . ALA C 82  ? 0.1246 0.1443 0.1156 -0.0047 -0.0097 0.0171  87  ALA A CA  
3279 C C   . ALA C 82  ? 0.1259 0.1415 0.1160 -0.0034 -0.0086 0.0159  87  ALA A C   
3280 O O   . ALA C 82  ? 0.1301 0.1447 0.1209 -0.0029 -0.0072 0.0140  87  ALA A O   
3281 C CB  . ALA C 82  ? 0.1248 0.1419 0.1164 -0.0045 -0.0099 0.0181  87  ALA A CB  
3282 N N   . ASN C 83  ? 0.1288 0.1424 0.1176 -0.0027 -0.0092 0.0169  88  ASN A N   
3283 C CA  . ASN C 83  ? 0.1329 0.1435 0.1207 -0.0013 -0.0084 0.0160  88  ASN A CA  
3284 C C   . ASN C 83  ? 0.1458 0.1527 0.1324 -0.0001 -0.0089 0.0172  88  ASN A C   
3285 O O   . ASN C 83  ? 0.1744 0.1821 0.1612 -0.0006 -0.0103 0.0184  88  ASN A O   
3286 C CB  . ASN C 83  ? 0.1676 0.1805 0.1550 -0.0014 -0.0087 0.0152  88  ASN A CB  
3287 C CG  . ASN C 83  ? 0.2163 0.2258 0.2026 0.0002  -0.0081 0.0148  88  ASN A CG  
3288 O OD1 . ASN C 83  ? 0.2798 0.2888 0.2650 0.0007  -0.0091 0.0155  88  ASN A OD1 
3289 N ND2 . ASN C 83  ? 0.2096 0.2171 0.1964 0.0011  -0.0066 0.0136  88  ASN A ND2 
3290 N N   . TYR C 84  ? 0.1211 0.1245 0.1067 0.0012  -0.0078 0.0168  89  TYR A N   
3291 C CA  . TYR C 84  ? 0.1157 0.1166 0.1001 0.0025  -0.0082 0.0175  89  TYR A CA  
3292 C C   . TYR C 84  ? 0.1178 0.1171 0.1006 0.0041  -0.0076 0.0171  89  TYR A C   
3293 O O   . TYR C 84  ? 0.1243 0.1225 0.1072 0.0047  -0.0061 0.0167  89  TYR A O   
3294 C CB  . TYR C 84  ? 0.1286 0.1270 0.1131 0.0030  -0.0074 0.0178  89  TYR A CB  
3295 C CG  . TYR C 84  ? 0.1287 0.1252 0.1119 0.0044  -0.0077 0.0181  89  TYR A CG  
3296 C CD1 . TYR C 84  ? 0.1360 0.1331 0.1201 0.0042  -0.0092 0.0183  89  TYR A CD1 
3297 C CD2 . TYR C 84  ? 0.1458 0.1402 0.1272 0.0062  -0.0064 0.0181  89  TYR A CD2 
3298 C CE1 . TYR C 84  ? 0.1424 0.1383 0.1257 0.0056  -0.0095 0.0180  89  TYR A CE1 
3299 C CE2 . TYR C 84  ? 0.1613 0.1550 0.1414 0.0076  -0.0068 0.0181  89  TYR A CE2 
3300 C CZ  . TYR C 84  ? 0.1580 0.1525 0.1390 0.0073  -0.0084 0.0178  89  TYR A CZ  
3301 O OH  . TYR C 84  ? 0.1798 0.1742 0.1599 0.0089  -0.0088 0.0172  89  TYR A OH  
3302 N N   A LYS C 85  ? 0.1227 0.1219 0.1044 0.0050  -0.0086 0.0173  90  LYS A N   
3303 N N   B LYS C 85  ? 0.1229 0.1221 0.1046 0.0050  -0.0087 0.0173  90  LYS A N   
3304 C CA  A LYS C 85  ? 0.1266 0.1244 0.1066 0.0069  -0.0082 0.0171  90  LYS A CA  
3305 C CA  B LYS C 85  ? 0.1270 0.1252 0.1071 0.0068  -0.0084 0.0170  90  LYS A CA  
3306 C C   A LYS C 85  ? 0.1201 0.1170 0.0989 0.0082  -0.0089 0.0173  90  LYS A C   
3307 C C   B LYS C 85  ? 0.1206 0.1177 0.0994 0.0082  -0.0090 0.0172  90  LYS A C   
3308 O O   A LYS C 85  ? 0.1106 0.1083 0.0903 0.0076  -0.0101 0.0171  90  LYS A O   
3309 O O   B LYS C 85  ? 0.1095 0.1076 0.0893 0.0075  -0.0104 0.0171  90  LYS A O   
3310 C CB  A LYS C 85  ? 0.1526 0.1522 0.1325 0.0069  -0.0090 0.0164  90  LYS A CB  
3311 C CB  B LYS C 85  ? 0.1518 0.1522 0.1321 0.0064  -0.0094 0.0164  90  LYS A CB  
3312 C CG  A LYS C 85  ? 0.1788 0.1799 0.1601 0.0058  -0.0082 0.0158  90  LYS A CG  
3313 C CG  B LYS C 85  ? 0.1843 0.1867 0.1659 0.0051  -0.0090 0.0158  90  LYS A CG  
3314 C CD  A LYS C 85  ? 0.2000 0.2025 0.1812 0.0063  -0.0087 0.0149  90  LYS A CD  
3315 C CD  B LYS C 85  ? 0.2032 0.2076 0.1849 0.0051  -0.0097 0.0149  90  LYS A CD  
3316 C CE  A LYS C 85  ? 0.2125 0.2165 0.1933 0.0061  -0.0104 0.0149  90  LYS A CE  
3317 C CE  B LYS C 85  ? 0.2240 0.2298 0.2071 0.0045  -0.0086 0.0138  90  LYS A CE  
3318 N NZ  A LYS C 85  ? 0.2355 0.2416 0.2167 0.0061  -0.0107 0.0138  90  LYS A NZ  
3319 N NZ  B LYS C 85  ? 0.2528 0.2618 0.2368 0.0038  -0.0092 0.0126  90  LYS A NZ  
3320 N N   . GLY C 86  ? 0.1167 0.1121 0.0936 0.0101  -0.0080 0.0175  91  GLY A N   
3321 C CA  . GLY C 86  ? 0.1119 0.1074 0.0875 0.0115  -0.0087 0.0173  91  GLY A CA  
3322 C C   . GLY C 86  ? 0.1141 0.1088 0.0871 0.0139  -0.0077 0.0179  91  GLY A C   
3323 O O   . GLY C 86  ? 0.1234 0.1170 0.0960 0.0144  -0.0064 0.0189  91  GLY A O   
3324 N N   . THR C 87  ? 0.1240 0.1198 0.0958 0.0153  -0.0086 0.0173  92  THR A N   
3325 C CA  . THR C 87  ? 0.1346 0.1308 0.1035 0.0178  -0.0080 0.0179  92  THR A CA  
3326 C C   . THR C 87  ? 0.1395 0.1355 0.1072 0.0187  -0.0069 0.0185  92  THR A C   
3327 O O   . THR C 87  ? 0.1467 0.1434 0.1154 0.0181  -0.0076 0.0172  92  THR A O   
3328 C CB  . THR C 87  ? 0.1469 0.1456 0.1152 0.0191  -0.0099 0.0163  92  THR A CB  
3329 O OG1 . THR C 87  ? 0.1725 0.1715 0.1421 0.0181  -0.0108 0.0158  92  THR A OG1 
3330 C CG2 . THR C 87  ? 0.1539 0.1538 0.1191 0.0218  -0.0094 0.0170  92  THR A CG2 
3331 N N   . ILE C 88  ? 0.1380 0.1330 0.1039 0.0201  -0.0051 0.0204  93  ILE A N   
3332 C CA  . ILE C 88  ? 0.1510 0.1459 0.1157 0.0209  -0.0036 0.0213  93  ILE A CA  
3333 C C   . ILE C 88  ? 0.1560 0.1541 0.1181 0.0232  -0.0044 0.0206  93  ILE A C   
3334 O O   . ILE C 88  ? 0.1673 0.1668 0.1274 0.0251  -0.0049 0.0211  93  ILE A O   
3335 C CB  . ILE C 88  ? 0.1523 0.1451 0.1168 0.0214  -0.0012 0.0240  93  ILE A CB  
3336 C CG1 . ILE C 88  ? 0.1575 0.1479 0.1252 0.0191  -0.0005 0.0239  93  ILE A CG1 
3337 C CG2 . ILE C 88  ? 0.1563 0.1495 0.1196 0.0223  0.0003  0.0251  93  ILE A CG2 
3338 C CD1 . ILE C 88  ? 0.1668 0.1549 0.1358 0.0193  0.0017  0.0260  93  ILE A CD1 
3339 N N   . LYS C 89  ? 0.1505 0.1500 0.1127 0.0231  -0.0047 0.0192  94  LYS A N   
3340 C CA  . LYS C 89  ? 0.1872 0.1905 0.1472 0.0253  -0.0052 0.0180  94  LYS A CA  
3341 C C   . LYS C 89  ? 0.1881 0.1919 0.1458 0.0265  -0.0031 0.0199  94  LYS A C   
3342 O O   . LYS C 89  ? 0.1920 0.1937 0.1510 0.0252  -0.0016 0.0208  94  LYS A O   
3343 C CB  . LYS C 89  ? 0.2063 0.2112 0.1687 0.0244  -0.0070 0.0147  94  LYS A CB  
3344 C CG  . LYS C 89  ? 0.2785 0.2828 0.2438 0.0229  -0.0089 0.0132  94  LYS A CG  
3345 C CD  . LYS C 89  ? 0.3178 0.3236 0.2818 0.0242  -0.0101 0.0128  94  LYS A CD  
3346 C CE  . LYS C 89  ? 0.3809 0.3859 0.3483 0.0224  -0.0117 0.0116  94  LYS A CE  
3347 N NZ  . LYS C 89  ? 0.4536 0.4610 0.4198 0.0240  -0.0130 0.0105  94  LYS A NZ  
3348 N N   . PHE C 90  ? 0.2416 0.2488 0.1961 0.0290  -0.0028 0.0205  95  PHE A N   
3349 C CA  . PHE C 90  ? 0.2644 0.2733 0.2162 0.0305  -0.0007 0.0226  95  PHE A CA  
3350 C C   . PHE C 90  ? 0.3162 0.3300 0.2670 0.0317  -0.0014 0.0199  95  PHE A C   
3351 O O   . PHE C 90  ? 0.3370 0.3536 0.2881 0.0323  -0.0036 0.0168  95  PHE A O   
3352 C CB  . PHE C 90  ? 0.3107 0.3207 0.2594 0.0329  0.0001  0.0258  95  PHE A CB  
3353 C CG  . PHE C 90  ? 0.2893 0.2948 0.2395 0.0321  0.0016  0.0291  95  PHE A CG  
3354 C CD1 . PHE C 90  ? 0.2875 0.2899 0.2401 0.0306  0.0005  0.0284  95  PHE A CD1 
3355 C CD2 . PHE C 90  ? 0.3361 0.3407 0.2853 0.0330  0.0043  0.0331  95  PHE A CD2 
3356 C CE1 . PHE C 90  ? 0.2822 0.2809 0.2368 0.0298  0.0020  0.0308  95  PHE A CE1 
3357 C CE2 . PHE C 90  ? 0.2943 0.2947 0.2457 0.0323  0.0058  0.0357  95  PHE A CE2 
3358 C CZ  . PHE C 90  ? 0.2936 0.2913 0.2478 0.0308  0.0045  0.0344  95  PHE A CZ  
3359 N N   . ASP C 91  ? 0.3645 0.3790 0.3148 0.0316  0.0003  0.0204  96  ASP A N   
3360 C CA  . ASP C 91  ? 0.3720 0.3919 0.3212 0.0329  0.0000  0.0177  96  ASP A CA  
3361 C C   . ASP C 91  ? 0.5580 0.5803 0.5029 0.0351  0.0023  0.0216  96  ASP A C   
3362 O O   . ASP C 91  ? 0.6304 0.6518 0.5751 0.0347  0.0047  0.0238  96  ASP A O   
3363 C CB  . ASP C 91  ? 0.3554 0.3740 0.3082 0.0308  0.0001  0.0154  96  ASP A CB  
3364 C CG  . ASP C 91  ? 0.3679 0.3920 0.3209 0.0318  -0.0006 0.0115  96  ASP A CG  
3365 O OD1 . ASP C 91  ? 0.3151 0.3448 0.2648 0.0344  -0.0011 0.0109  96  ASP A OD1 
3366 O OD2 . ASP C 91  ? 0.2840 0.3068 0.2407 0.0300  -0.0009 0.0092  96  ASP A OD2 
3367 N N   . GLY C 92  ? 0.5756 0.6002 0.5177 0.0372  0.0016  0.0229  97  GLY A N   
3368 C CA  . GLY C 92  ? 0.6517 0.6796 0.5895 0.0400  0.0031  0.0267  97  GLY A CA  
3369 C C   . GLY C 92  ? 0.6165 0.6396 0.5545 0.0397  0.0048  0.0316  97  GLY A C   
3370 O O   . GLY C 92  ? 0.5509 0.5714 0.4897 0.0397  0.0037  0.0322  97  GLY A O   
3371 N N   . ASP C 93  ? 0.6393 0.6610 0.5772 0.0395  0.0076  0.0350  98  ASP A N   
3372 C CA  . ASP C 93  ? 0.6544 0.6716 0.5936 0.0392  0.0099  0.0398  98  ASP A CA  
3373 C C   . ASP C 93  ? 0.5437 0.5542 0.4877 0.0359  0.0103  0.0389  98  ASP A C   
3374 O O   . ASP C 93  ? 0.5271 0.5332 0.4736 0.0352  0.0114  0.0415  98  ASP A O   
3375 C CB  . ASP C 93  ? 0.7836 0.8031 0.7208 0.0404  0.0129  0.0437  98  ASP A CB  
3376 C CG  . ASP C 93  ? 0.8803 0.8980 0.8174 0.0417  0.0150  0.0495  98  ASP A CG  
3377 O OD1 . ASP C 93  ? 0.9539 0.9688 0.8922 0.0419  0.0140  0.0504  98  ASP A OD1 
3378 O OD2 . ASP C 93  ? 0.9017 0.9209 0.8378 0.0425  0.0178  0.0533  98  ASP A OD2 
3379 N N   . LYS C 94  ? 0.4286 0.4387 0.3744 0.0340  0.0092  0.0350  99  LYS A N   
3380 C CA  . LYS C 94  ? 0.4020 0.4071 0.3520 0.0313  0.0098  0.0344  99  LYS A CA  
3381 C C   . LYS C 94  ? 0.3105 0.3138 0.2630 0.0294  0.0070  0.0307  99  LYS A C   
3382 O O   . LYS C 94  ? 0.2949 0.3012 0.2467 0.0298  0.0049  0.0276  99  LYS A O   
3383 C CB  . LYS C 94  ? 0.4804 0.4863 0.4311 0.0304  0.0111  0.0335  99  LYS A CB  
3384 C CG  . LYS C 94  ? 0.5036 0.5046 0.4583 0.0280  0.0127  0.0344  99  LYS A CG  
3385 C CD  . LYS C 94  ? 0.5419 0.5420 0.4966 0.0286  0.0162  0.0385  99  LYS A CD  
3386 C CE  . LYS C 94  ? 0.5307 0.5282 0.4891 0.0262  0.0174  0.0372  99  LYS A CE  
3387 N NZ  . LYS C 94  ? 0.5355 0.5318 0.4953 0.0262  0.0209  0.0408  99  LYS A NZ  
3388 N N   . PRO C 95  ? 0.2680 0.2669 0.2236 0.0275  0.0072  0.0311  100 PRO A N   
3389 C CA  . PRO C 95  ? 0.2453 0.2430 0.2033 0.0256  0.0049  0.0278  100 PRO A CA  
3390 C C   . PRO C 95  ? 0.2334 0.2318 0.1929 0.0242  0.0043  0.0251  100 PRO A C   
3391 O O   . PRO C 95  ? 0.2461 0.2434 0.2068 0.0235  0.0062  0.0259  100 PRO A O   
3392 C CB  . PRO C 95  ? 0.2569 0.2504 0.2180 0.0238  0.0057  0.0289  100 PRO A CB  
3393 C CG  . PRO C 95  ? 0.3000 0.2924 0.2606 0.0251  0.0078  0.0324  100 PRO A CG  
3394 C CD  . PRO C 95  ? 0.2936 0.2887 0.2513 0.0270  0.0093  0.0342  100 PRO A CD  
3395 N N   . VAL C 96  ? 0.2018 0.2017 0.1622 0.0238  0.0019  0.0221  101 VAL A N   
3396 C CA  . VAL C 96  ? 0.2099 0.2106 0.1724 0.0226  0.0011  0.0194  101 VAL A CA  
3397 C C   . VAL C 96  ? 0.1811 0.1798 0.1473 0.0204  -0.0006 0.0177  101 VAL A C   
3398 O O   . VAL C 96  ? 0.1879 0.1861 0.1567 0.0190  -0.0009 0.0163  101 VAL A O   
3399 C CB  . VAL C 96  ? 0.2258 0.2312 0.1870 0.0243  0.0000  0.0170  101 VAL A CB  
3400 C CG1 . VAL C 96  ? 0.3244 0.3322 0.2821 0.0263  0.0020  0.0189  101 VAL A CG1 
3401 C CG2 . VAL C 96  ? 0.2382 0.2454 0.1991 0.0251  -0.0024 0.0152  101 VAL A CG2 
3402 N N   . SER C 97  ? 0.1684 0.1662 0.1349 0.0200  -0.0019 0.0179  102 SER A N   
3403 C CA  . SER C 97  ? 0.1704 0.1670 0.1401 0.0180  -0.0036 0.0166  102 SER A CA  
3404 C C   . SER C 97  ? 0.1617 0.1571 0.1313 0.0176  -0.0040 0.0176  102 SER A C   
3405 O O   . SER C 97  ? 0.1656 0.1613 0.1328 0.0190  -0.0034 0.0188  102 SER A O   
3406 C CB  . SER C 97  ? 0.2048 0.2034 0.1766 0.0178  -0.0058 0.0139  102 SER A CB  
3407 O OG  . SER C 97  ? 0.2361 0.2370 0.2061 0.0194  -0.0069 0.0131  102 SER A OG  
3408 N N   . VAL C 98  ? 0.1409 0.1352 0.1132 0.0156  -0.0050 0.0171  103 VAL A N   
3409 C CA  . VAL C 98  ? 0.1385 0.1324 0.1111 0.0149  -0.0058 0.0175  103 VAL A CA  
3410 C C   . VAL C 98  ? 0.1360 0.1311 0.1110 0.0138  -0.0080 0.0159  103 VAL A C   
3411 O O   . VAL C 98  ? 0.1434 0.1383 0.1210 0.0123  -0.0086 0.0155  103 VAL A O   
3412 C CB  . VAL C 98  ? 0.1572 0.1493 0.1311 0.0134  -0.0046 0.0186  103 VAL A CB  
3413 C CG1 . VAL C 98  ? 0.1669 0.1591 0.1408 0.0131  -0.0052 0.0188  103 VAL A CG1 
3414 C CG2 . VAL C 98  ? 0.1608 0.1513 0.1336 0.0143  -0.0022 0.0201  103 VAL A CG2 
3415 N N   . VAL C 99  ? 0.1239 0.1204 0.0986 0.0144  -0.0093 0.0152  104 VAL A N   
3416 C CA  . VAL C 99  ? 0.1311 0.1288 0.1085 0.0135  -0.0113 0.0139  104 VAL A CA  
3417 C C   . VAL C 99  ? 0.1363 0.1339 0.1143 0.0123  -0.0118 0.0146  104 VAL A C   
3418 O O   . VAL C 99  ? 0.1341 0.1320 0.1101 0.0133  -0.0115 0.0148  104 VAL A O   
3419 C CB  . VAL C 99  ? 0.1555 0.1554 0.1327 0.0152  -0.0125 0.0120  104 VAL A CB  
3420 C CG1 . VAL C 99  ? 0.1799 0.1808 0.1610 0.0140  -0.0144 0.0107  104 VAL A CG1 
3421 C CG2 . VAL C 99  ? 0.1820 0.1827 0.1585 0.0164  -0.0119 0.0110  104 VAL A CG2 
3422 N N   . GLY C 100 ? 0.1221 0.1197 0.1029 0.0102  -0.0123 0.0150  105 GLY A N   
3423 C CA  . GLY C 100 ? 0.1273 0.1254 0.1085 0.0089  -0.0125 0.0158  105 GLY A CA  
3424 C C   . GLY C 100 ? 0.1196 0.1187 0.1040 0.0069  -0.0135 0.0164  105 GLY A C   
3425 O O   . GLY C 100 ? 0.1210 0.1205 0.1080 0.0065  -0.0147 0.0160  105 GLY A O   
3426 N N   . ASN C 101 ? 0.1201 0.1198 0.1045 0.0056  -0.0130 0.0173  106 ASN A N   
3427 C CA  . ASN C 101 ? 0.1151 0.1166 0.1019 0.0036  -0.0139 0.0182  106 ASN A CA  
3428 C C   . ASN C 101 ? 0.1172 0.1193 0.1039 0.0024  -0.0129 0.0190  106 ASN A C   
3429 O O   . ASN C 101 ? 0.1205 0.1225 0.1055 0.0028  -0.0118 0.0185  106 ASN A O   
3430 C CB  . ASN C 101 ? 0.1285 0.1320 0.1158 0.0031  -0.0147 0.0182  106 ASN A CB  
3431 C CG  . ASN C 101 ? 0.1522 0.1556 0.1404 0.0042  -0.0158 0.0171  106 ASN A CG  
3432 O OD1 . ASN C 101 ? 0.1828 0.1856 0.1688 0.0059  -0.0155 0.0159  106 ASN A OD1 
3433 N ND2 . ASN C 101 ? 0.1577 0.1616 0.1493 0.0034  -0.0169 0.0175  106 ASN A ND2 
3434 N N   . LEU C 102 ? 0.1142 0.1173 0.1031 0.0011  -0.0135 0.0200  107 LEU A N   
3435 C CA  . LEU C 102 ? 0.1126 0.1171 0.1017 0.0000  -0.0129 0.0206  107 LEU A CA  
3436 C C   . LEU C 102 ? 0.1096 0.1176 0.1000 -0.0015 -0.0138 0.0218  107 LEU A C   
3437 O O   . LEU C 102 ? 0.1140 0.1229 0.1066 -0.0021 -0.0150 0.0230  107 LEU A O   
3438 C CB  . LEU C 102 ? 0.1266 0.1302 0.1173 -0.0003 -0.0129 0.0211  107 LEU A CB  
3439 C CG  . LEU C 102 ? 0.1351 0.1408 0.1265 -0.0015 -0.0126 0.0216  107 LEU A CG  
3440 C CD1 . LEU C 102 ? 0.1568 0.1619 0.1464 -0.0011 -0.0109 0.0202  107 LEU A CD1 
3441 C CD2 . LEU C 102 ? 0.1485 0.1532 0.1418 -0.0017 -0.0129 0.0222  107 LEU A CD2 
3442 N N   . THR C 103 ? 0.1113 0.1219 0.1009 -0.0022 -0.0131 0.0215  108 THR A N   
3443 C CA  . THR C 103 ? 0.1086 0.1237 0.0991 -0.0038 -0.0138 0.0226  108 THR A CA  
3444 C C   . THR C 103 ? 0.1112 0.1284 0.1023 -0.0047 -0.0135 0.0230  108 THR A C   
3445 O O   . THR C 103 ? 0.1308 0.1481 0.1211 -0.0044 -0.0123 0.0213  108 THR A O   
3446 C CB  . THR C 103 ? 0.1226 0.1402 0.1119 -0.0040 -0.0134 0.0215  108 THR A CB  
3447 O OG1 . THR C 103 ? 0.1401 0.1553 0.1288 -0.0029 -0.0136 0.0209  108 THR A OG1 
3448 C CG2 . THR C 103 ? 0.1320 0.1548 0.1222 -0.0056 -0.0140 0.0228  108 THR A CG2 
3449 N N   . LEU C 104 ? 0.1031 0.1220 0.0962 -0.0055 -0.0146 0.0252  109 LEU A N   
3450 C CA  . LEU C 104 ? 0.1128 0.1337 0.1067 -0.0062 -0.0146 0.0257  109 LEU A CA  
3451 C C   . LEU C 104 ? 0.1201 0.1461 0.1155 -0.0075 -0.0158 0.0285  109 LEU A C   
3452 O O   . LEU C 104 ? 0.1206 0.1461 0.1178 -0.0078 -0.0168 0.0307  109 LEU A O   
3453 C CB  . LEU C 104 ? 0.1238 0.1408 0.1191 -0.0055 -0.0147 0.0259  109 LEU A CB  
3454 C CG  . LEU C 104 ? 0.1316 0.1505 0.1283 -0.0061 -0.0151 0.0267  109 LEU A CG  
3455 C CD1 . LEU C 104 ? 0.1487 0.1699 0.1443 -0.0063 -0.0140 0.0248  109 LEU A CD1 
3456 C CD2 . LEU C 104 ? 0.1315 0.1465 0.1299 -0.0054 -0.0154 0.0269  109 LEU A CD2 
3457 N N   . HIS C 105 ? 0.1252 0.1562 0.1201 -0.0084 -0.0156 0.0285  110 HIS A N   
3458 C CA  . HIS C 105 ? 0.1338 0.1705 0.1297 -0.0096 -0.0167 0.0315  110 HIS A CA  
3459 C C   . HIS C 105 ? 0.1370 0.1752 0.1330 -0.0101 -0.0170 0.0327  110 HIS A C   
3460 O O   . HIS C 105 ? 0.1484 0.1884 0.1463 -0.0108 -0.0179 0.0361  110 HIS A O   
3461 C CB  . HIS C 105 ? 0.1370 0.1727 0.1357 -0.0097 -0.0178 0.0344  110 HIS A CB  
3462 C CG  . HIS C 105 ? 0.1497 0.1912 0.1497 -0.0108 -0.0188 0.0380  110 HIS A CG  
3463 N ND1 . HIS C 105 ? 0.1735 0.2146 0.1766 -0.0112 -0.0199 0.0417  110 HIS A ND1 
3464 C CD2 . HIS C 105 ? 0.1555 0.2038 0.1545 -0.0115 -0.0189 0.0386  110 HIS A CD2 
3465 C CE1 . HIS C 105 ? 0.1882 0.2355 0.1920 -0.0121 -0.0206 0.0450  110 HIS A CE1 
3466 N NE2 . HIS C 105 ? 0.1760 0.2281 0.1771 -0.0123 -0.0200 0.0432  110 HIS A NE2 
3467 N N   . GLY C 106 ? 0.1487 0.1855 0.1428 -0.0095 -0.0161 0.0300  111 GLY A N   
3468 C CA  . GLY C 106 ? 0.1430 0.1809 0.1370 -0.0099 -0.0162 0.0304  111 GLY A CA  
3469 C C   . GLY C 106 ? 0.1540 0.1875 0.1497 -0.0094 -0.0168 0.0314  111 GLY A C   
3470 O O   . GLY C 106 ? 0.2161 0.2505 0.2119 -0.0096 -0.0169 0.0315  111 GLY A O   
3471 N N   . VAL C 107 ? 0.1230 0.1520 0.1201 -0.0087 -0.0172 0.0317  112 VAL A N   
3472 C CA  . VAL C 107 ? 0.1204 0.1457 0.1198 -0.0082 -0.0179 0.0323  112 VAL A CA  
3473 C C   . VAL C 107 ? 0.1148 0.1351 0.1125 -0.0065 -0.0173 0.0293  112 VAL A C   
3474 O O   . VAL C 107 ? 0.1160 0.1343 0.1126 -0.0059 -0.0168 0.0281  112 VAL A O   
3475 C CB  . VAL C 107 ? 0.1179 0.1425 0.1210 -0.0086 -0.0190 0.0351  112 VAL A CB  
3476 C CG1 . VAL C 107 ? 0.1203 0.1411 0.1267 -0.0080 -0.0197 0.0349  112 VAL A CG1 
3477 C CG2 . VAL C 107 ? 0.1297 0.1598 0.1344 -0.0101 -0.0195 0.0387  112 VAL A CG2 
3478 N N   . THR C 108 ? 0.1098 0.1282 0.1077 -0.0058 -0.0175 0.0282  113 THR A N   
3479 C CA  . THR C 108 ? 0.1167 0.1312 0.1130 -0.0042 -0.0171 0.0258  113 THR A CA  
3480 C C   . THR C 108 ? 0.1310 0.1427 0.1301 -0.0035 -0.0180 0.0258  113 THR A C   
3481 O O   . THR C 108 ? 0.1257 0.1382 0.1280 -0.0041 -0.0189 0.0268  113 THR A O   
3482 C CB  . THR C 108 ? 0.1298 0.1447 0.1242 -0.0036 -0.0167 0.0242  113 THR A CB  
3483 O OG1 . THR C 108 ? 0.1349 0.1526 0.1272 -0.0042 -0.0159 0.0238  113 THR A OG1 
3484 C CG2 . THR C 108 ? 0.1474 0.1587 0.1399 -0.0017 -0.0163 0.0220  113 THR A CG2 
3485 N N   . LYS C 109 ? 0.1160 0.1249 0.1145 -0.0024 -0.0176 0.0246  114 LYS A N   
3486 C CA  . LYS C 109 ? 0.1258 0.1323 0.1268 -0.0016 -0.0184 0.0238  114 LYS A CA  
3487 C C   . LYS C 109 ? 0.1233 0.1273 0.1216 0.0002  -0.0176 0.0214  114 LYS A C   
3488 O O   . LYS C 109 ? 0.1272 0.1307 0.1220 0.0007  -0.0164 0.0208  114 LYS A O   
3489 C CB  . LYS C 109 ? 0.1431 0.1494 0.1473 -0.0023 -0.0189 0.0253  114 LYS A CB  
3490 C CG  . LYS C 109 ? 0.1535 0.1624 0.1612 -0.0040 -0.0198 0.0283  114 LYS A CG  
3491 C CD  . LYS C 109 ? 0.1901 0.1991 0.2024 -0.0042 -0.0210 0.0288  114 LYS A CD  
3492 C CE  . LYS C 109 ? 0.2270 0.2393 0.2415 -0.0059 -0.0214 0.0320  114 LYS A CE  
3493 N NZ  . LYS C 109 ? 0.2883 0.3013 0.3073 -0.0068 -0.0222 0.0348  114 LYS A NZ  
3494 N N   . PRO C 110 ? 0.1310 0.1339 0.1310 0.0012  -0.0183 0.0199  115 PRO A N   
3495 C CA  . PRO C 110 ? 0.1291 0.1303 0.1263 0.0030  -0.0176 0.0179  115 PRO A CA  
3496 C C   . PRO C 110 ? 0.1379 0.1377 0.1344 0.0032  -0.0167 0.0180  115 PRO A C   
3497 O O   . PRO C 110 ? 0.1541 0.1539 0.1538 0.0023  -0.0172 0.0188  115 PRO A O   
3498 C CB  . PRO C 110 ? 0.1375 0.1387 0.1378 0.0039  -0.0187 0.0161  115 PRO A CB  
3499 C CG  . PRO C 110 ? 0.1432 0.1458 0.1475 0.0027  -0.0199 0.0170  115 PRO A CG  
3500 C CD  . PRO C 110 ? 0.1270 0.1304 0.1320 0.0009  -0.0197 0.0198  115 PRO A CD  
3501 N N   . LEU C 111 ? 0.1310 0.1297 0.1237 0.0044  -0.0153 0.0172  116 LEU A N   
3502 C CA  . LEU C 111 ? 0.1446 0.1420 0.1365 0.0047  -0.0142 0.0171  116 LEU A CA  
3503 C C   . LEU C 111 ? 0.1419 0.1383 0.1303 0.0066  -0.0130 0.0160  116 LEU A C   
3504 O O   . LEU C 111 ? 0.1395 0.1359 0.1251 0.0073  -0.0123 0.0161  116 LEU A O   
3505 C CB  . LEU C 111 ? 0.1422 0.1398 0.1336 0.0034  -0.0134 0.0185  116 LEU A CB  
3506 C CG  . LEU C 111 ? 0.1570 0.1532 0.1478 0.0036  -0.0121 0.0182  116 LEU A CG  
3507 C CD1 . LEU C 111 ? 0.1859 0.1818 0.1800 0.0033  -0.0129 0.0180  116 LEU A CD1 
3508 C CD2 . LEU C 111 ? 0.1677 0.1644 0.1579 0.0025  -0.0111 0.0190  116 LEU A CD2 
3509 N N   . THR C 112 ? 0.1508 0.1468 0.1398 0.0075  -0.0128 0.0148  117 THR A N   
3510 C CA  . THR C 112 ? 0.1552 0.1509 0.1411 0.0093  -0.0115 0.0141  117 THR A CA  
3511 C C   . THR C 112 ? 0.1595 0.1538 0.1448 0.0090  -0.0099 0.0147  117 THR A C   
3512 O O   . THR C 112 ? 0.1769 0.1709 0.1650 0.0079  -0.0103 0.0147  117 THR A O   
3513 C CB  . THR C 112 ? 0.1781 0.1750 0.1650 0.0106  -0.0125 0.0120  117 THR A CB  
3514 O OG1 . THR C 112 ? 0.2105 0.2088 0.1978 0.0111  -0.0137 0.0112  117 THR A OG1 
3515 C CG2 . THR C 112 ? 0.2132 0.2106 0.1969 0.0124  -0.0110 0.0114  117 THR A CG2 
3516 N N   . LEU C 113 ? 0.1625 0.1560 0.1448 0.0098  -0.0081 0.0155  118 LEU A N   
3517 C CA  . LEU C 113 ? 0.1750 0.1672 0.1568 0.0097  -0.0063 0.0161  118 LEU A CA  
3518 C C   . LEU C 113 ? 0.1953 0.1879 0.1749 0.0115  -0.0051 0.0156  118 LEU A C   
3519 O O   . LEU C 113 ? 0.2279 0.2211 0.2048 0.0131  -0.0048 0.0159  118 LEU A O   
3520 C CB  . LEU C 113 ? 0.1984 0.1895 0.1793 0.0092  -0.0048 0.0173  118 LEU A CB  
3521 C CG  . LEU C 113 ? 0.2167 0.2082 0.1993 0.0075  -0.0058 0.0176  118 LEU A CG  
3522 C CD1 . LEU C 113 ? 0.2385 0.2294 0.2206 0.0071  -0.0044 0.0182  118 LEU A CD1 
3523 C CD2 . LEU C 113 ? 0.2223 0.2143 0.2078 0.0061  -0.0067 0.0174  118 LEU A CD2 
3524 N N   . LYS C 114 ? 0.1635 0.1562 0.1442 0.0116  -0.0045 0.0149  119 LYS A N   
3525 C CA  . LYS C 114 ? 0.1815 0.1752 0.1600 0.0132  -0.0032 0.0146  119 LYS A CA  
3526 C C   . LYS C 114 ? 0.1764 0.1686 0.1534 0.0134  -0.0007 0.0164  119 LYS A C   
3527 O O   . LYS C 114 ? 0.1764 0.1670 0.1554 0.0119  0.0000  0.0168  119 LYS A O   
3528 C CB  . LYS C 114 ? 0.2204 0.2152 0.2015 0.0130  -0.0038 0.0127  119 LYS A CB  
3529 C CG  . LYS C 114 ? 0.3372 0.3341 0.3166 0.0147  -0.0028 0.0117  119 LYS A CG  
3530 C CD  . LYS C 114 ? 0.4249 0.4212 0.4021 0.0152  -0.0001 0.0132  119 LYS A CD  
3531 C CE  . LYS C 114 ? 0.4906 0.4898 0.4674 0.0164  0.0004  0.0115  119 LYS A CE  
3532 N NZ  . LYS C 114 ? 0.5101 0.5101 0.4839 0.0175  0.0032  0.0132  119 LYS A NZ  
3533 N N   . ILE C 115 ? 0.1609 0.1536 0.1348 0.0151  0.0006  0.0177  120 ILE A N   
3534 C CA  . ILE C 115 ? 0.1689 0.1599 0.1420 0.0152  0.0033  0.0198  120 ILE A CA  
3535 C C   . ILE C 115 ? 0.1891 0.1814 0.1618 0.0159  0.0049  0.0197  120 ILE A C   
3536 O O   . ILE C 115 ? 0.2266 0.2215 0.1967 0.0177  0.0049  0.0194  120 ILE A O   
3537 C CB  . ILE C 115 ? 0.1843 0.1753 0.1548 0.0168  0.0041  0.0219  120 ILE A CB  
3538 C CG1 . ILE C 115 ? 0.1966 0.1864 0.1680 0.0159  0.0028  0.0218  120 ILE A CG1 
3539 C CG2 . ILE C 115 ? 0.1898 0.1794 0.1599 0.0173  0.0070  0.0243  120 ILE A CG2 
3540 C CD1 . ILE C 115 ? 0.2158 0.2059 0.1848 0.0176  0.0031  0.0234  120 ILE A CD1 
3541 N N   . ASP C 116 ? 0.1854 0.1762 0.1605 0.0146  0.0061  0.0196  121 ASP A N   
3542 C CA  . ASP C 116 ? 0.2062 0.1981 0.1814 0.0149  0.0076  0.0192  121 ASP A CA  
3543 C C   . ASP C 116 ? 0.2269 0.2183 0.2004 0.0159  0.0105  0.0219  121 ASP A C   
3544 O O   . ASP C 116 ? 0.2630 0.2566 0.2349 0.0171  0.0119  0.0222  121 ASP A O   
3545 C CB  . ASP C 116 ? 0.2518 0.2426 0.2307 0.0131  0.0074  0.0178  121 ASP A CB  
3546 C CG  . ASP C 116 ? 0.3015 0.2933 0.2823 0.0125  0.0047  0.0153  121 ASP A CG  
3547 O OD1 . ASP C 116 ? 0.3924 0.3864 0.3719 0.0136  0.0032  0.0142  121 ASP A OD1 
3548 O OD2 . ASP C 116 ? 0.4168 0.4075 0.4010 0.0108  0.0040  0.0146  121 ASP A OD2 
3549 N N   . SER C 117 ? 0.2237 0.2127 0.1979 0.0155  0.0116  0.0239  122 SER A N   
3550 C CA  . SER C 117 ? 0.2495 0.2378 0.2228 0.0166  0.0145  0.0269  122 SER A CA  
3551 C C   . SER C 117 ? 0.2213 0.2078 0.1946 0.0169  0.0145  0.0287  122 SER A C   
3552 O O   . SER C 117 ? 0.1956 0.1807 0.1705 0.0157  0.0129  0.0275  122 SER A O   
3553 C CB  . SER C 117 ? 0.2909 0.2773 0.2676 0.0152  0.0168  0.0273  122 SER A CB  
3554 O OG  . SER C 117 ? 0.3062 0.2900 0.2866 0.0134  0.0166  0.0266  122 SER A OG  
3555 N N   . PHE C 118 ? 0.2168 0.2036 0.1882 0.0186  0.0163  0.0318  123 PHE A N   
3556 C CA  . PHE C 118 ? 0.2096 0.1948 0.1813 0.0193  0.0166  0.0338  123 PHE A CA  
3557 C C   . PHE C 118 ? 0.2315 0.2160 0.2037 0.0204  0.0198  0.0377  123 PHE A C   
3558 O O   . PHE C 118 ? 0.2428 0.2298 0.2122 0.0218  0.0210  0.0392  123 PHE A O   
3559 C CB  . PHE C 118 ? 0.2265 0.2141 0.1944 0.0210  0.0145  0.0337  123 PHE A CB  
3560 C CG  . PHE C 118 ? 0.2392 0.2257 0.2069 0.0222  0.0149  0.0362  123 PHE A CG  
3561 C CD1 . PHE C 118 ? 0.2675 0.2519 0.2375 0.0211  0.0137  0.0351  123 PHE A CD1 
3562 C CD2 . PHE C 118 ? 0.2625 0.2503 0.2277 0.0245  0.0166  0.0398  123 PHE A CD2 
3563 C CE1 . PHE C 118 ? 0.2828 0.2663 0.2531 0.0223  0.0141  0.0372  123 PHE A CE1 
3564 C CE2 . PHE C 118 ? 0.2644 0.2511 0.2299 0.0257  0.0167  0.0421  123 PHE A CE2 
3565 C CZ  . PHE C 118 ? 0.2780 0.2624 0.2464 0.0245  0.0155  0.0406  123 PHE A CZ  
3566 N N   . LYS C 119 ? 0.2038 0.1853 0.1798 0.0197  0.0213  0.0390  124 LYS A N   
3567 C CA  . LYS C 119 ? 0.2458 0.2260 0.2234 0.0207  0.0245  0.0431  124 LYS A CA  
3568 C C   . LYS C 119 ? 0.2506 0.2283 0.2315 0.0207  0.0248  0.0443  124 LYS A C   
3569 O O   . LYS C 119 ? 0.2367 0.2128 0.2204 0.0192  0.0234  0.0416  124 LYS A O   
3570 C CB  . LYS C 119 ? 0.2639 0.2427 0.2453 0.0191  0.0268  0.0427  124 LYS A CB  
3571 C CG  . LYS C 119 ? 0.2837 0.2609 0.2682 0.0197  0.0304  0.0468  124 LYS A CG  
3572 C CD  . LYS C 119 ? 0.2756 0.2514 0.2646 0.0178  0.0325  0.0458  124 LYS A CD  
3573 C CE  . LYS C 119 ? 0.3013 0.2759 0.2933 0.0186  0.0363  0.0504  124 LYS A CE  
3574 N NZ  . LYS C 119 ? 0.3184 0.2903 0.3172 0.0166  0.0385  0.0494  124 LYS A NZ  
3575 N N   . CYS C 120 ? 0.2343 0.2119 0.2148 0.0227  0.0264  0.0485  125 CYS A N   
3576 C CA  . CYS C 120 ? 0.2663 0.2410 0.2511 0.0227  0.0271  0.0498  125 CYS A CA  
3577 C C   . CYS C 120 ? 0.2543 0.2272 0.2431 0.0231  0.0306  0.0538  125 CYS A C   
3578 O O   . CYS C 120 ? 0.2843 0.2591 0.2704 0.0244  0.0323  0.0569  125 CYS A O   
3579 C CB  . CYS C 120 ? 0.3011 0.2769 0.2830 0.0248  0.0255  0.0514  125 CYS A CB  
3580 S SG  . CYS C 120 ? 0.3778 0.3558 0.3556 0.0245  0.0213  0.0470  125 CYS A SG  
3581 N N   . MET C 121 ? 0.2419 0.2115 0.2375 0.0220  0.0319  0.0538  126 MET A N   
3582 C CA  . MET C 121 ? 0.2601 0.2275 0.2612 0.0222  0.0357  0.0576  126 MET A CA  
3583 C C   . MET C 121 ? 0.2543 0.2186 0.2627 0.0216  0.0362  0.0573  126 MET A C   
3584 O O   . MET C 121 ? 0.2371 0.2010 0.2467 0.0205  0.0340  0.0533  126 MET A O   
3585 C CB  . MET C 121 ? 0.2722 0.2391 0.2760 0.0203  0.0374  0.0559  126 MET A CB  
3586 C CG  . MET C 121 ? 0.2913 0.2571 0.2988 0.0178  0.0360  0.0505  126 MET A CG  
3587 S SD  . MET C 121 ? 0.3366 0.3026 0.3462 0.0156  0.0372  0.0477  126 MET A SD  
3588 C CE  . MET C 121 ? 0.3504 0.3137 0.3676 0.0156  0.0417  0.0516  126 MET A CE  
3589 N N   . PRO C 122 ? 0.2469 0.2089 0.2609 0.0222  0.0392  0.0612  127 PRO A N   
3590 C CA  . PRO C 122 ? 0.2695 0.2285 0.2918 0.0214  0.0398  0.0602  127 PRO A CA  
3591 C C   . PRO C 122 ? 0.2816 0.2395 0.3095 0.0187  0.0400  0.0551  127 PRO A C   
3592 O O   . PRO C 122 ? 0.3416 0.2998 0.3695 0.0176  0.0413  0.0545  127 PRO A O   
3593 C CB  . PRO C 122 ? 0.2863 0.2433 0.3138 0.0227  0.0436  0.0663  127 PRO A CB  
3594 C CG  . PRO C 122 ? 0.2842 0.2439 0.3040 0.0247  0.0439  0.0706  127 PRO A CG  
3595 C CD  . PRO C 122 ? 0.2840 0.2465 0.2973 0.0237  0.0422  0.0668  127 PRO A CD  
3596 N N   . HIS C 123 ? 0.3046 0.2620 0.3364 0.0175  0.0384  0.0508  128 HIS A N   
3597 C CA  . HIS C 123 ? 0.3479 0.3051 0.3848 0.0151  0.0384  0.0458  128 HIS A CA  
3598 C C   . HIS C 123 ? 0.4329 0.3874 0.4798 0.0144  0.0419  0.0470  128 HIS A C   
3599 O O   . HIS C 123 ? 0.4201 0.3726 0.4727 0.0153  0.0431  0.0491  128 HIS A O   
3600 C CB  . HIS C 123 ? 0.3744 0.3326 0.4128 0.0142  0.0358  0.0411  128 HIS A CB  
3601 C CG  . HIS C 123 ? 0.4286 0.3883 0.4691 0.0119  0.0349  0.0356  128 HIS A CG  
3602 N ND1 . HIS C 123 ? 0.4559 0.4146 0.5050 0.0104  0.0369  0.0335  128 HIS A ND1 
3603 C CD2 . HIS C 123 ? 0.4426 0.4051 0.4781 0.0108  0.0321  0.0319  128 HIS A CD2 
3604 C CE1 . HIS C 123 ? 0.4997 0.4607 0.5485 0.0086  0.0354  0.0286  128 HIS A CE1 
3605 N NE2 . HIS C 123 ? 0.5245 0.4878 0.5653 0.0088  0.0324  0.0278  128 HIS A NE2 
3606 N N   . PRO C 124 ? 0.5281 0.4825 0.5775 0.0129  0.0435  0.0456  129 PRO A N   
3607 C CA  . PRO C 124 ? 0.5746 0.5264 0.6343 0.0121  0.0469  0.0462  129 PRO A CA  
3608 C C   . PRO C 124 ? 0.5476 0.4981 0.6168 0.0115  0.0470  0.0433  129 PRO A C   
3609 O O   . PRO C 124 ? 0.6086 0.5565 0.6844 0.0124  0.0492  0.0467  129 PRO A O   
3610 C CB  . PRO C 124 ? 0.5807 0.5338 0.6410 0.0101  0.0472  0.0424  129 PRO A CB  
3611 C CG  . PRO C 124 ? 0.5416 0.4969 0.5911 0.0107  0.0455  0.0435  129 PRO A CG  
3612 C CD  . PRO C 124 ? 0.5376 0.4942 0.5808 0.0120  0.0424  0.0436  129 PRO A CD  
3613 N N   . MET C 125 ? 0.5782 0.5306 0.6481 0.0100  0.0446  0.0372  130 MET A N   
3614 C CA  . MET C 125 ? 0.6087 0.5607 0.6881 0.0093  0.0446  0.0335  130 MET A CA  
3615 C C   . MET C 125 ? 0.5542 0.5061 0.6325 0.0107  0.0430  0.0344  130 MET A C   
3616 O O   . MET C 125 ? 0.5237 0.4738 0.6106 0.0111  0.0442  0.0346  130 MET A O   
3617 C CB  . MET C 125 ? 0.7104 0.6655 0.7920 0.0072  0.0430  0.0263  130 MET A CB  
3618 C CG  . MET C 125 ? 0.8304 0.7857 0.9153 0.0056  0.0447  0.0245  130 MET A CG  
3619 S SD  . MET C 125 ? 0.9886 0.9410 1.0884 0.0048  0.0488  0.0241  130 MET A SD  
3620 C CE  . MET C 125 ? 0.8854 0.8336 0.9846 0.0066  0.0522  0.0330  130 MET A CE  
3621 N N   . LEU C 126 ? 0.4605 0.4145 0.5288 0.0116  0.0401  0.0348  131 LEU A N   
3622 C CA  . LEU C 126 ? 0.4379 0.3924 0.5053 0.0126  0.0381  0.0343  131 LEU A CA  
3623 C C   . LEU C 126 ? 0.3757 0.3279 0.4418 0.0151  0.0391  0.0407  131 LEU A C   
3624 O O   . LEU C 126 ? 0.4191 0.3711 0.4866 0.0162  0.0380  0.0408  131 LEU A O   
3625 C CB  . LEU C 126 ? 0.4386 0.3966 0.4967 0.0122  0.0345  0.0314  131 LEU A CB  
3626 C CG  . LEU C 126 ? 0.4911 0.4521 0.5502 0.0099  0.0331  0.0252  131 LEU A CG  
3627 C CD1 . LEU C 126 ? 0.5080 0.4721 0.5572 0.0097  0.0299  0.0238  131 LEU A CD1 
3628 C CD2 . LEU C 126 ? 0.4907 0.4529 0.5580 0.0090  0.0328  0.0205  131 LEU A CD2 
3629 N N   . LYS C 127 ? 0.3845 0.3355 0.4471 0.0161  0.0409  0.0458  132 LYS A N   
3630 C CA  . LYS C 127 ? 0.3928 0.3423 0.4539 0.0187  0.0420  0.0524  132 LYS A CA  
3631 C C   . LYS C 127 ? 0.3758 0.3270 0.4295 0.0203  0.0390  0.0531  132 LYS A C   
3632 O O   . LYS C 127 ? 0.3886 0.3386 0.4447 0.0221  0.0392  0.0560  132 LYS A O   
3633 C CB  . LYS C 127 ? 0.4204 0.3666 0.4933 0.0191  0.0446  0.0544  132 LYS A CB  
3634 C CG  . LYS C 127 ? 0.4711 0.4157 0.5528 0.0172  0.0475  0.0530  132 LYS A CG  
3635 C CD  . LYS C 127 ? 0.5313 0.4727 0.6256 0.0175  0.0497  0.0541  132 LYS A CD  
3636 C CE  . LYS C 127 ? 0.5975 0.5362 0.6977 0.0177  0.0537  0.0593  132 LYS A CE  
3637 N NZ  . LYS C 127 ? 0.6405 0.5759 0.7526 0.0186  0.0558  0.0620  132 LYS A NZ  
3638 N N   . ARG C 128 ? 0.2991 0.2533 0.3446 0.0197  0.0363  0.0498  133 ARG A N   
3639 C CA  . ARG C 128 ? 0.2958 0.2521 0.3327 0.0210  0.0335  0.0503  133 ARG A CA  
3640 C C   . ARG C 128 ? 0.2530 0.2116 0.2814 0.0207  0.0326  0.0501  133 ARG A C   
3641 O O   . ARG C 128 ? 0.2513 0.2098 0.2807 0.0191  0.0336  0.0485  133 ARG A O   
3642 C CB  . ARG C 128 ? 0.3253 0.2832 0.3628 0.0200  0.0307  0.0449  133 ARG A CB  
3643 C CG  . ARG C 128 ? 0.3722 0.3283 0.4189 0.0202  0.0315  0.0442  133 ARG A CG  
3644 C CD  . ARG C 128 ? 0.4207 0.3787 0.4672 0.0200  0.0288  0.0403  133 ARG A CD  
3645 N NE  . ARG C 128 ? 0.4460 0.4069 0.4898 0.0178  0.0268  0.0346  133 ARG A NE  
3646 C CZ  . ARG C 128 ? 0.4709 0.4327 0.5209 0.0158  0.0270  0.0298  133 ARG A CZ  
3647 N NH1 . ARG C 128 ? 0.4985 0.4584 0.5584 0.0154  0.0292  0.0291  133 ARG A NH1 
3648 N NH2 . ARG C 128 ? 0.4793 0.4444 0.5258 0.0141  0.0250  0.0255  133 ARG A NH2 
3649 N N   . GLU C 129 ? 0.2468 0.2073 0.2672 0.0225  0.0309  0.0521  134 GLU A N   
3650 C CA  . GLU C 129 ? 0.2230 0.1860 0.2353 0.0225  0.0298  0.0518  134 GLU A CA  
3651 C C   . GLU C 129 ? 0.2170 0.1814 0.2286 0.0200  0.0278  0.0461  134 GLU A C   
3652 O O   . GLU C 129 ? 0.2206 0.1856 0.2330 0.0193  0.0258  0.0428  134 GLU A O   
3653 C CB  . GLU C 129 ? 0.2463 0.2117 0.2511 0.0247  0.0279  0.0538  134 GLU A CB  
3654 C CG  . GLU C 129 ? 0.2958 0.2640 0.2932 0.0249  0.0270  0.0537  134 GLU A CG  
3655 C CD  . GLU C 129 ? 0.3555 0.3266 0.3459 0.0273  0.0252  0.0555  134 GLU A CD  
3656 O OE1 . GLU C 129 ? 0.3602 0.3322 0.3491 0.0278  0.0228  0.0537  134 GLU A OE1 
3657 O OE2 . GLU C 129 ? 0.4498 0.4227 0.4365 0.0288  0.0265  0.0588  134 GLU A OE2 
3658 N N   . VAL C 130 ? 0.2163 0.1814 0.2256 0.0191  0.0283  0.0455  135 VAL A N   
3659 C CA  . VAL C 130 ? 0.1898 0.1566 0.1971 0.0172  0.0263  0.0409  135 VAL A CA  
3660 C C   . VAL C 130 ? 0.1996 0.1686 0.1995 0.0179  0.0250  0.0415  135 VAL A C   
3661 O O   . VAL C 130 ? 0.2111 0.1803 0.2091 0.0189  0.0268  0.0446  135 VAL A O   
3662 C CB  . VAL C 130 ? 0.1923 0.1581 0.2054 0.0149  0.0277  0.0382  135 VAL A CB  
3663 C CG1 . VAL C 130 ? 0.1967 0.1614 0.2112 0.0150  0.0306  0.0409  135 VAL A CG1 
3664 C CG2 . VAL C 130 ? 0.2007 0.1686 0.2117 0.0131  0.0254  0.0339  135 VAL A CG2 
3665 N N   . CYS C 131 ? 0.1932 0.1643 0.1894 0.0173  0.0221  0.0386  136 CYS A N   
3666 C CA  . CYS C 131 ? 0.2179 0.1912 0.2080 0.0178  0.0208  0.0384  136 CYS A CA  
3667 C C   . CYS C 131 ? 0.1938 0.1678 0.1848 0.0155  0.0196  0.0346  136 CYS A C   
3668 O O   . CYS C 131 ? 0.2031 0.1771 0.1967 0.0141  0.0185  0.0319  136 CYS A O   
3669 C CB  . CYS C 131 ? 0.2547 0.2300 0.2397 0.0192  0.0184  0.0384  136 CYS A CB  
3670 S SG  . CYS C 131 ? 0.3733 0.3485 0.3566 0.0223  0.0196  0.0433  136 CYS A SG  
3671 N N   . GLY C 132 ? 0.1925 0.1674 0.1812 0.0154  0.0199  0.0346  137 GLY A N   
3672 C CA  . GLY C 132 ? 0.1835 0.1591 0.1731 0.0135  0.0188  0.0315  137 GLY A CA  
3673 C C   . GLY C 132 ? 0.1853 0.1630 0.1705 0.0139  0.0171  0.0306  137 GLY A C   
3674 O O   . GLY C 132 ? 0.1995 0.1784 0.1813 0.0155  0.0178  0.0326  137 GLY A O   
3675 N N   . VAL C 133 ? 0.1727 0.1515 0.1582 0.0124  0.0150  0.0278  138 VAL A N   
3676 C CA  . VAL C 133 ? 0.1773 0.1581 0.1596 0.0126  0.0131  0.0267  138 VAL A CA  
3677 C C   . VAL C 133 ? 0.1817 0.1628 0.1663 0.0108  0.0125  0.0244  138 VAL A C   
3678 O O   . VAL C 133 ? 0.1805 0.1608 0.1684 0.0093  0.0127  0.0233  138 VAL A O   
3679 C CB  . VAL C 133 ? 0.2224 0.2046 0.2021 0.0131  0.0104  0.0258  138 VAL A CB  
3680 C CG1 . VAL C 133 ? 0.2196 0.2023 0.1963 0.0152  0.0105  0.0277  138 VAL A CG1 
3681 C CG2 . VAL C 133 ? 0.2472 0.2293 0.2294 0.0114  0.0091  0.0241  138 VAL A CG2 
3682 N N   . ASP C 134 ? 0.1768 0.1591 0.1598 0.0110  0.0118  0.0237  139 ASP A N   
3683 C CA  . ASP C 134 ? 0.1816 0.1648 0.1662 0.0096  0.0102  0.0215  139 ASP A CA  
3684 C C   . ASP C 134 ? 0.1793 0.1642 0.1617 0.0101  0.0076  0.0206  139 ASP A C   
3685 O O   . ASP C 134 ? 0.1895 0.1756 0.1690 0.0118  0.0076  0.0211  139 ASP A O   
3686 C CB  . ASP C 134 ? 0.2022 0.1855 0.1880 0.0094  0.0115  0.0210  139 ASP A CB  
3687 C CG  . ASP C 134 ? 0.2559 0.2394 0.2453 0.0074  0.0104  0.0189  139 ASP A CG  
3688 O OD1 . ASP C 134 ? 0.2213 0.2044 0.2131 0.0062  0.0101  0.0183  139 ASP A OD1 
3689 O OD2 . ASP C 134 ? 0.3200 0.3043 0.3098 0.0073  0.0098  0.0177  139 ASP A OD2 
3690 N N   . ALA C 135 ? 0.1611 0.1465 0.1448 0.0089  0.0055  0.0193  140 ALA A N   
3691 C CA  . ALA C 135 ? 0.1524 0.1393 0.1349 0.0093  0.0030  0.0185  140 ALA A CA  
3692 C C   . ALA C 135 ? 0.1388 0.1265 0.1240 0.0078  0.0011  0.0172  140 ALA A C   
3693 O O   . ALA C 135 ? 0.1614 0.1486 0.1489 0.0065  0.0015  0.0169  140 ALA A O   
3694 C CB  . ALA C 135 ? 0.1556 0.1427 0.1369 0.0095  0.0021  0.0191  140 ALA A CB  
3695 N N   . VAL C 136 ? 0.1379 0.1268 0.1231 0.0081  -0.0007 0.0164  141 VAL A N   
3696 C CA  . VAL C 136 ? 0.1525 0.1420 0.1407 0.0069  -0.0025 0.0154  141 VAL A CA  
3697 C C   . VAL C 136 ? 0.1533 0.1439 0.1419 0.0068  -0.0048 0.0153  141 VAL A C   
3698 O O   . VAL C 136 ? 0.1692 0.1604 0.1559 0.0081  -0.0052 0.0150  141 VAL A O   
3699 C CB  . VAL C 136 ? 0.1884 0.1785 0.1783 0.0073  -0.0026 0.0141  141 VAL A CB  
3700 C CG1 . VAL C 136 ? 0.2034 0.1925 0.1933 0.0071  -0.0003 0.0142  141 VAL A CG1 
3701 C CG2 . VAL C 136 ? 0.2303 0.2216 0.2185 0.0089  -0.0029 0.0131  141 VAL A CG2 
3702 N N   . GLY C 137 ? 0.1574 0.1485 0.1488 0.0055  -0.0064 0.0154  142 GLY A N   
3703 C CA  . GLY C 137 ? 0.1571 0.1493 0.1500 0.0052  -0.0085 0.0154  142 GLY A CA  
3704 C C   . GLY C 137 ? 0.1533 0.1461 0.1500 0.0039  -0.0101 0.0158  142 GLY A C   
3705 O O   . GLY C 137 ? 0.1579 0.1506 0.1560 0.0031  -0.0096 0.0160  142 GLY A O   
3706 N N   . GLU C 138 ? 0.1503 0.1439 0.1495 0.0036  -0.0120 0.0160  143 GLU A N   
3707 C CA  . GLU C 138 ? 0.1585 0.1528 0.1620 0.0024  -0.0135 0.0168  143 GLU A CA  
3708 C C   . GLU C 138 ? 0.1429 0.1384 0.1479 0.0018  -0.0150 0.0181  143 GLU A C   
3709 O O   . GLU C 138 ? 0.1494 0.1449 0.1534 0.0025  -0.0154 0.0173  143 GLU A O   
3710 C CB  . GLU C 138 ? 0.2064 0.2004 0.2136 0.0029  -0.0143 0.0153  143 GLU A CB  
3711 C CG  . GLU C 138 ? 0.3293 0.3226 0.3353 0.0038  -0.0128 0.0135  143 GLU A CG  
3712 C CD  . GLU C 138 ? 0.4205 0.4140 0.4313 0.0040  -0.0138 0.0119  143 GLU A CD  
3713 O OE1 . GLU C 138 ? 0.5400 0.5340 0.5550 0.0039  -0.0156 0.0116  143 GLU A OE1 
3714 O OE2 . GLU C 138 ? 0.5182 0.5113 0.5289 0.0042  -0.0127 0.0110  143 GLU A OE2 
3715 N N   . PHE C 139 ? 0.1418 0.1385 0.1491 0.0004  -0.0160 0.0200  144 PHE A N   
3716 C CA  . PHE C 139 ? 0.1323 0.1304 0.1419 -0.0003 -0.0175 0.0218  144 PHE A CA  
3717 C C   . PHE C 139 ? 0.1467 0.1461 0.1607 -0.0015 -0.0188 0.0240  144 PHE A C   
3718 O O   . PHE C 139 ? 0.1612 0.1607 0.1757 -0.0017 -0.0186 0.0242  144 PHE A O   
3719 C CB  . PHE C 139 ? 0.1426 0.1420 0.1485 -0.0007 -0.0169 0.0227  144 PHE A CB  
3720 C CG  . PHE C 139 ? 0.1593 0.1604 0.1635 -0.0017 -0.0162 0.0238  144 PHE A CG  
3721 C CD1 . PHE C 139 ? 0.1872 0.1873 0.1882 -0.0011 -0.0144 0.0223  144 PHE A CD1 
3722 C CD2 . PHE C 139 ? 0.1510 0.1547 0.1569 -0.0029 -0.0171 0.0259  144 PHE A CD2 
3723 C CE1 . PHE C 139 ? 0.2117 0.2135 0.2118 -0.0019 -0.0138 0.0226  144 PHE A CE1 
3724 C CE2 . PHE C 139 ? 0.1593 0.1654 0.1635 -0.0036 -0.0165 0.0264  144 PHE A CE2 
3725 C CZ  . PHE C 139 ? 0.1707 0.1756 0.1722 -0.0031 -0.0148 0.0244  144 PHE A CZ  
3726 N N   . SER C 140 ? 0.1523 0.1529 0.1697 -0.0022 -0.0202 0.0258  145 SER A N   
3727 C CA  . SER C 140 ? 0.1512 0.1532 0.1730 -0.0032 -0.0215 0.0286  145 SER A CA  
3728 C C   . SER C 140 ? 0.1466 0.1518 0.1661 -0.0043 -0.0214 0.0312  145 SER A C   
3729 O O   . SER C 140 ? 0.1520 0.1581 0.1703 -0.0046 -0.0214 0.0318  145 SER A O   
3730 C CB  . SER C 140 ? 0.1904 0.1917 0.2183 -0.0032 -0.0229 0.0289  145 SER A CB  
3731 O OG  . SER C 140 ? 0.2372 0.2393 0.2703 -0.0039 -0.0242 0.0316  145 SER A OG  
3732 N N   . ARG C 141 ? 0.1205 0.1277 0.1389 -0.0049 -0.0213 0.0325  146 ARG A N   
3733 C CA  . ARG C 141 ? 0.1211 0.1320 0.1366 -0.0058 -0.0210 0.0341  146 ARG A CA  
3734 C C   . ARG C 141 ? 0.1186 0.1322 0.1365 -0.0067 -0.0221 0.0374  146 ARG A C   
3735 O O   . ARG C 141 ? 0.1178 0.1345 0.1330 -0.0074 -0.0217 0.0383  146 ARG A O   
3736 C CB  . ARG C 141 ? 0.1236 0.1365 0.1376 -0.0060 -0.0205 0.0340  146 ARG A CB  
3737 C CG  . ARG C 141 ? 0.1404 0.1541 0.1586 -0.0063 -0.0218 0.0359  146 ARG A CG  
3738 C CD  . ARG C 141 ? 0.1600 0.1770 0.1760 -0.0066 -0.0213 0.0357  146 ARG A CD  
3739 N NE  . ARG C 141 ? 0.1777 0.1955 0.1969 -0.0066 -0.0222 0.0368  146 ARG A NE  
3740 C CZ  . ARG C 141 ? 0.2034 0.2246 0.2255 -0.0071 -0.0237 0.0403  146 ARG A CZ  
3741 N NH1 . ARG C 141 ? 0.1871 0.2114 0.2095 -0.0078 -0.0244 0.0435  146 ARG A NH1 
3742 N NH2 . ARG C 141 ? 0.2222 0.2438 0.2472 -0.0069 -0.0246 0.0409  146 ARG A NH2 
3743 N N   . ASP C 142 ? 0.1343 0.1471 0.1577 -0.0069 -0.0234 0.0394  147 ASP A N   
3744 C CA  . ASP C 142 ? 0.1523 0.1676 0.1788 -0.0078 -0.0243 0.0430  147 ASP A CA  
3745 C C   . ASP C 142 ? 0.1596 0.1743 0.1850 -0.0079 -0.0239 0.0420  147 ASP A C   
3746 O O   . ASP C 142 ? 0.1701 0.1880 0.1962 -0.0088 -0.0242 0.0448  147 ASP A O   
3747 C CB  . ASP C 142 ? 0.1730 0.1873 0.2068 -0.0080 -0.0258 0.0455  147 ASP A CB  
3748 C CG  . ASP C 142 ? 0.2189 0.2288 0.2561 -0.0070 -0.0260 0.0425  147 ASP A CG  
3749 O OD1 . ASP C 142 ? 0.2285 0.2360 0.2623 -0.0061 -0.0251 0.0386  147 ASP A OD1 
3750 O OD2 . ASP C 142 ? 0.2832 0.2921 0.3275 -0.0072 -0.0273 0.0441  147 ASP A OD2 
3751 N N   . ASP C 143 ? 0.1393 0.1507 0.1628 -0.0068 -0.0232 0.0383  148 ASP A N   
3752 C CA  . ASP C 143 ? 0.1610 0.1719 0.1829 -0.0066 -0.0228 0.0368  148 ASP A CA  
3753 C C   . ASP C 143 ? 0.1803 0.1943 0.1971 -0.0071 -0.0219 0.0371  148 ASP A C   
3754 O O   . ASP C 143 ? 0.2036 0.2183 0.2195 -0.0073 -0.0217 0.0368  148 ASP A O   
3755 C CB  . ASP C 143 ? 0.1756 0.1831 0.1958 -0.0051 -0.0222 0.0328  148 ASP A CB  
3756 C CG  . ASP C 143 ? 0.2359 0.2409 0.2615 -0.0045 -0.0232 0.0318  148 ASP A CG  
3757 O OD1 . ASP C 143 ? 0.2770 0.2828 0.3087 -0.0054 -0.0244 0.0344  148 ASP A OD1 
3758 O OD2 . ASP C 143 ? 0.2804 0.2833 0.3048 -0.0032 -0.0228 0.0284  148 ASP A OD2 
3759 N N   . PHE C 144 ? 0.1413 0.1571 0.1549 -0.0073 -0.0213 0.0372  149 PHE A N   
3760 C CA  . PHE C 144 ? 0.1516 0.1711 0.1611 -0.0079 -0.0204 0.0371  149 PHE A CA  
3761 C C   . PHE C 144 ? 0.1630 0.1877 0.1733 -0.0091 -0.0210 0.0405  149 PHE A C   
3762 O O   . PHE C 144 ? 0.1583 0.1869 0.1653 -0.0096 -0.0203 0.0401  149 PHE A O   
3763 C CB  . PHE C 144 ? 0.1422 0.1603 0.1477 -0.0071 -0.0192 0.0340  149 PHE A CB  
3764 C CG  . PHE C 144 ? 0.1294 0.1433 0.1333 -0.0058 -0.0184 0.0311  149 PHE A CG  
3765 C CD1 . PHE C 144 ? 0.1310 0.1449 0.1323 -0.0055 -0.0177 0.0297  149 PHE A CD1 
3766 C CD2 . PHE C 144 ? 0.1317 0.1418 0.1372 -0.0048 -0.0185 0.0299  149 PHE A CD2 
3767 C CE1 . PHE C 144 ? 0.1241 0.1345 0.1237 -0.0041 -0.0171 0.0272  149 PHE A CE1 
3768 C CE2 . PHE C 144 ? 0.1426 0.1496 0.1462 -0.0036 -0.0178 0.0274  149 PHE A CE2 
3769 C CZ  . PHE C 144 ? 0.1320 0.1390 0.1326 -0.0031 -0.0171 0.0262  149 PHE A CZ  
3770 N N   . GLY C 145 ? 0.1758 0.2011 0.1907 -0.0097 -0.0222 0.0438  150 GLY A N   
3771 C CA  . GLY C 145 ? 0.1822 0.2128 0.1981 -0.0107 -0.0228 0.0476  150 GLY A CA  
3772 C C   . GLY C 145 ? 0.1992 0.2318 0.2145 -0.0106 -0.0230 0.0480  150 GLY A C   
3773 O O   . GLY C 145 ? 0.2390 0.2771 0.2542 -0.0113 -0.0234 0.0510  150 GLY A O   
3774 N N   . LEU C 146 ? 0.1758 0.2044 0.1907 -0.0097 -0.0227 0.0452  151 LEU A N   
3775 C CA  . LEU C 146 ? 0.1773 0.2078 0.1915 -0.0096 -0.0227 0.0449  151 LEU A CA  
3776 C C   . LEU C 146 ? 0.1933 0.2215 0.2124 -0.0093 -0.0239 0.0467  151 LEU A C   
3777 O O   . LEU C 146 ? 0.2135 0.2373 0.2334 -0.0084 -0.0237 0.0441  151 LEU A O   
3778 C CB  . LEU C 146 ? 0.1702 0.1981 0.1808 -0.0088 -0.0213 0.0404  151 LEU A CB  
3779 C CG  . LEU C 146 ? 0.1631 0.1927 0.1694 -0.0089 -0.0201 0.0381  151 LEU A CG  
3780 C CD1 . LEU C 146 ? 0.1777 0.2033 0.1818 -0.0080 -0.0187 0.0341  151 LEU A CD1 
3781 C CD2 . LEU C 146 ? 0.1655 0.2020 0.1702 -0.0097 -0.0201 0.0388  151 LEU A CD2 
3782 N N   . ASP C 147 ? 0.2426 0.2738 0.2652 -0.0099 -0.0252 0.0512  152 ASP A N   
3783 C CA  . ASP C 147 ? 0.2639 0.2928 0.2924 -0.0097 -0.0265 0.0532  152 ASP A CA  
3784 C C   . ASP C 147 ? 0.2537 0.2862 0.2834 -0.0097 -0.0274 0.0555  152 ASP A C   
3785 O O   . ASP C 147 ? 0.2740 0.3056 0.3095 -0.0096 -0.0287 0.0585  152 ASP A O   
3786 C CB  . ASP C 147 ? 0.3098 0.3388 0.3433 -0.0103 -0.0273 0.0571  152 ASP A CB  
3787 C CG  . ASP C 147 ? 0.3798 0.4153 0.4123 -0.0113 -0.0275 0.0615  152 ASP A CG  
3788 O OD1 . ASP C 147 ? 0.3687 0.4094 0.3971 -0.0115 -0.0273 0.0619  152 ASP A OD1 
3789 O OD2 . ASP C 147 ? 0.4866 0.5224 0.5228 -0.0119 -0.0279 0.0647  152 ASP A OD2 
3790 N N   . TYR C 148 ? 0.2493 0.2859 0.2745 -0.0097 -0.0268 0.0542  153 TYR A N   
3791 C CA  . TYR C 148 ? 0.2641 0.3047 0.2902 -0.0096 -0.0277 0.0559  153 TYR A CA  
3792 C C   . TYR C 148 ? 0.2841 0.3199 0.3144 -0.0088 -0.0284 0.0550  153 TYR A C   
3793 O O   . TYR C 148 ? 0.2591 0.2894 0.2893 -0.0083 -0.0276 0.0510  153 TYR A O   
3794 C CB  . TYR C 148 ? 0.3060 0.3506 0.3268 -0.0096 -0.0267 0.0527  153 TYR A CB  
3795 C CG  . TYR C 148 ? 0.3674 0.4188 0.3883 -0.0096 -0.0277 0.0547  153 TYR A CG  
3796 C CD1 . TYR C 148 ? 0.4484 0.5075 0.4677 -0.0102 -0.0282 0.0579  153 TYR A CD1 
3797 C CD2 . TYR C 148 ? 0.4279 0.4781 0.4502 -0.0090 -0.0281 0.0532  153 TYR A CD2 
3798 C CE1 . TYR C 148 ? 0.5060 0.5720 0.5252 -0.0100 -0.0292 0.0596  153 TYR A CE1 
3799 C CE2 . TYR C 148 ? 0.4403 0.4968 0.4629 -0.0088 -0.0291 0.0548  153 TYR A CE2 
3800 C CZ  . TYR C 148 ? 0.5372 0.6018 0.5582 -0.0093 -0.0297 0.0580  153 TYR A CZ  
3801 O OH  . TYR C 148 ? 0.5876 0.6594 0.6083 -0.0090 -0.0308 0.0595  153 TYR A OH  
3802 N N   . GLY C 149 ? 0.2786 0.3166 0.3132 -0.0088 -0.0299 0.0587  154 GLY A N   
3803 C CA  . GLY C 149 ? 0.2862 0.3204 0.3250 -0.0080 -0.0306 0.0575  154 GLY A CA  
3804 C C   . GLY C 149 ? 0.3001 0.3293 0.3451 -0.0079 -0.0314 0.0587  154 GLY A C   
3805 O O   . GLY C 149 ? 0.2814 0.3084 0.3312 -0.0073 -0.0323 0.0586  154 GLY A O   
3806 N N   . LYS C 150 ? 0.3292 0.3567 0.3747 -0.0083 -0.0310 0.0592  155 LYS A N   
3807 C CA  . LYS C 150 ? 0.3899 0.4127 0.4415 -0.0081 -0.0315 0.0591  155 LYS A CA  
3808 C C   . LYS C 150 ? 0.4307 0.4545 0.4899 -0.0082 -0.0333 0.0640  155 LYS A C   
3809 O O   . LYS C 150 ? 0.4671 0.4871 0.5327 -0.0077 -0.0341 0.0631  155 LYS A O   
3810 C CB  . LYS C 150 ? 0.3821 0.4041 0.4328 -0.0087 -0.0309 0.0592  155 LYS A CB  
3811 C CG  . LYS C 150 ? 0.3689 0.3855 0.4246 -0.0083 -0.0310 0.0569  155 LYS A CG  
3812 C CD  . LYS C 150 ? 0.3936 0.4101 0.4472 -0.0087 -0.0302 0.0564  155 LYS A CD  
3813 C CE  . LYS C 150 ? 0.4214 0.4335 0.4801 -0.0083 -0.0305 0.0540  155 LYS A CE  
3814 N NZ  . LYS C 150 ? 0.3866 0.3988 0.4436 -0.0087 -0.0298 0.0534  155 LYS A NZ  
3815 N N   . GLN C 151 ? 0.5250 0.5543 0.5837 -0.0087 -0.0339 0.0690  156 GLN A N   
3816 C CA  . GLN C 151 ? 0.5729 0.6043 0.6387 -0.0088 -0.0357 0.0748  156 GLN A CA  
3817 C C   . GLN C 151 ? 0.5339 0.5645 0.6030 -0.0079 -0.0368 0.0743  156 GLN A C   
3818 O O   . GLN C 151 ? 0.5667 0.5975 0.6429 -0.0077 -0.0383 0.0783  156 GLN A O   
3819 C CB  . GLN C 151 ? 0.6881 0.7269 0.7512 -0.0094 -0.0360 0.0803  156 GLN A CB  
3820 C CG  . GLN C 151 ? 0.7273 0.7677 0.7889 -0.0104 -0.0351 0.0823  156 GLN A CG  
3821 C CD  . GLN C 151 ? 0.7598 0.7956 0.8295 -0.0107 -0.0356 0.0839  156 GLN A CD  
3822 O OE1 . GLN C 151 ? 0.7774 0.8079 0.8476 -0.0105 -0.0349 0.0794  156 GLN A OE1 
3823 N NE2 . GLN C 151 ? 0.8124 0.8500 0.8889 -0.0109 -0.0368 0.0902  156 GLN A NE2 
3824 N N   . TYR C 152 ? 0.4752 0.5051 0.5392 -0.0074 -0.0360 0.0694  157 TYR A N   
3825 C CA  . TYR C 152 ? 0.4864 0.5165 0.5518 -0.0067 -0.0367 0.0682  157 TYR A CA  
3826 C C   . TYR C 152 ? 0.4326 0.4567 0.4992 -0.0060 -0.0361 0.0624  157 TYR A C   
3827 O O   . TYR C 152 ? 0.4792 0.5033 0.5453 -0.0055 -0.0361 0.0600  157 TYR A O   
3828 C CB  . TYR C 152 ? 0.5604 0.5962 0.6186 -0.0067 -0.0362 0.0675  157 TYR A CB  
3829 C CG  . TYR C 152 ? 0.6795 0.7228 0.7364 -0.0071 -0.0370 0.0732  157 TYR A CG  
3830 C CD1 . TYR C 152 ? 0.6852 0.7310 0.7395 -0.0080 -0.0364 0.0756  157 TYR A CD1 
3831 C CD2 . TYR C 152 ? 0.7720 0.8205 0.8301 -0.0066 -0.0384 0.0762  157 TYR A CD2 
3832 C CE1 . TYR C 152 ? 0.7420 0.7952 0.7949 -0.0083 -0.0370 0.0807  157 TYR A CE1 
3833 C CE2 . TYR C 152 ? 0.7977 0.8540 0.8543 -0.0069 -0.0392 0.0815  157 TYR A CE2 
3834 C CZ  . TYR C 152 ? 0.7475 0.8061 0.8015 -0.0078 -0.0384 0.0837  157 TYR A CZ  
3835 O OH  . TYR C 152 ? 0.8981 0.9648 0.9505 -0.0080 -0.0390 0.0889  157 TYR A OH  
3836 N N   . GLY C 153 ? 0.3866 0.4062 0.4547 -0.0061 -0.0354 0.0599  158 GLY A N   
3837 C CA  . GLY C 153 ? 0.3646 0.3791 0.4344 -0.0054 -0.0348 0.0545  158 GLY A CA  
3838 C C   . GLY C 153 ? 0.3443 0.3572 0.4065 -0.0052 -0.0328 0.0492  158 GLY A C   
3839 O O   . GLY C 153 ? 0.2859 0.2951 0.3491 -0.0045 -0.0322 0.0448  158 GLY A O   
3840 N N   . PHE C 154 ? 0.2842 0.3001 0.3394 -0.0057 -0.0317 0.0495  159 PHE A N   
3841 C CA  . PHE C 154 ? 0.2467 0.2613 0.2951 -0.0055 -0.0297 0.0450  159 PHE A CA  
3842 C C   . PHE C 154 ? 0.2214 0.2323 0.2697 -0.0054 -0.0290 0.0429  159 PHE A C   
3843 O O   . PHE C 154 ? 0.2420 0.2529 0.2931 -0.0057 -0.0297 0.0453  159 PHE A O   
3844 C CB  . PHE C 154 ? 0.2464 0.2652 0.2883 -0.0061 -0.0288 0.0457  159 PHE A CB  
3845 C CG  . PHE C 154 ? 0.2692 0.2920 0.3091 -0.0061 -0.0289 0.0458  159 PHE A CG  
3846 C CD1 . PHE C 154 ? 0.3168 0.3427 0.3608 -0.0060 -0.0307 0.0493  159 PHE A CD1 
3847 C CD2 . PHE C 154 ? 0.2724 0.2957 0.3072 -0.0060 -0.0273 0.0421  159 PHE A CD2 
3848 C CE1 . PHE C 154 ? 0.3521 0.3825 0.3942 -0.0059 -0.0309 0.0492  159 PHE A CE1 
3849 C CE2 . PHE C 154 ? 0.3090 0.3364 0.3425 -0.0060 -0.0274 0.0418  159 PHE A CE2 
3850 C CZ  . PHE C 154 ? 0.3399 0.3710 0.3767 -0.0060 -0.0292 0.0451  159 PHE A CZ  
3851 N N   . LYS C 155 ? 0.2208 0.2287 0.2670 -0.0047 -0.0278 0.0386  160 LYS A N   
3852 C CA  . LYS C 155 ? 0.1985 0.2034 0.2437 -0.0043 -0.0269 0.0358  160 LYS A CA  
3853 C C   . LYS C 155 ? 0.1804 0.1864 0.2187 -0.0046 -0.0255 0.0355  160 LYS A C   
3854 O O   . LYS C 155 ? 0.1760 0.1841 0.2097 -0.0048 -0.0246 0.0351  160 LYS A O   
3855 C CB  . LYS C 155 ? 0.2648 0.2668 0.3097 -0.0034 -0.0259 0.0315  160 LYS A CB  
3856 C CG  . LYS C 155 ? 0.3133 0.3143 0.3651 -0.0030 -0.0272 0.0310  160 LYS A CG  
3857 C CD  . LYS C 155 ? 0.4389 0.4374 0.4898 -0.0021 -0.0259 0.0262  160 LYS A CD  
3858 C CE  . LYS C 155 ? 0.4768 0.4751 0.5285 -0.0018 -0.0255 0.0243  160 LYS A CE  
3859 N NZ  . LYS C 155 ? 0.5170 0.5140 0.5759 -0.0012 -0.0266 0.0226  160 LYS A NZ  
3860 N N   . MET C 156 ? 0.1533 0.1581 0.1917 -0.0046 -0.0255 0.0352  161 MET A N   
3861 C CA  . MET C 156 ? 0.1616 0.1675 0.1943 -0.0048 -0.0244 0.0350  161 MET A CA  
3862 C C   . MET C 156 ? 0.1520 0.1554 0.1801 -0.0040 -0.0227 0.0311  161 MET A C   
3863 O O   . MET C 156 ? 0.1411 0.1453 0.1641 -0.0040 -0.0215 0.0305  161 MET A O   
3864 C CB  . MET C 156 ? 0.1737 0.1801 0.2085 -0.0053 -0.0251 0.0370  161 MET A CB  
3865 C CG  . MET C 156 ? 0.1869 0.1961 0.2261 -0.0062 -0.0266 0.0417  161 MET A CG  
3866 S SD  . MET C 156 ? 0.2047 0.2193 0.2392 -0.0071 -0.0263 0.0446  161 MET A SD  
3867 C CE  . MET C 156 ? 0.2096 0.2254 0.2468 -0.0069 -0.0272 0.0457  161 MET A CE  
3868 N N   . LYS C 157 ? 0.1572 0.1581 0.1870 -0.0031 -0.0224 0.0284  162 LYS A N   
3869 C CA  . LYS C 157 ? 0.1758 0.1748 0.2015 -0.0021 -0.0208 0.0251  162 LYS A CA  
3870 C C   . LYS C 157 ? 0.1653 0.1648 0.1863 -0.0022 -0.0192 0.0244  162 LYS A C   
3871 O O   . LYS C 157 ? 0.1743 0.1746 0.1964 -0.0025 -0.0193 0.0247  162 LYS A O   
3872 C CB  . LYS C 157 ? 0.2246 0.2216 0.2532 -0.0012 -0.0208 0.0224  162 LYS A CB  
3873 C CG  . LYS C 157 ? 0.2805 0.2762 0.3048 -0.0001 -0.0190 0.0192  162 LYS A CG  
3874 C CD  . LYS C 157 ? 0.3750 0.3697 0.4022 0.0005  -0.0189 0.0168  162 LYS A CD  
3875 C CE  . LYS C 157 ? 0.4815 0.4754 0.5048 0.0017  -0.0170 0.0140  162 LYS A CE  
3876 N NZ  . LYS C 157 ? 0.5668 0.5603 0.5932 0.0022  -0.0169 0.0117  162 LYS A NZ  
3877 N N   . THR C 158 ? 0.1295 0.1289 0.1457 -0.0020 -0.0179 0.0237  163 THR A N   
3878 C CA  . THR C 158 ? 0.1314 0.1314 0.1437 -0.0021 -0.0163 0.0230  163 THR A CA  
3879 C C   . THR C 158 ? 0.1434 0.1411 0.1524 -0.0010 -0.0145 0.0206  163 THR A C   
3880 O O   . THR C 158 ? 0.1439 0.1408 0.1514 -0.0004 -0.0145 0.0203  163 THR A O   
3881 C CB  . THR C 158 ? 0.1307 0.1333 0.1408 -0.0029 -0.0164 0.0246  163 THR A CB  
3882 O OG1 . THR C 158 ? 0.1453 0.1506 0.1584 -0.0039 -0.0181 0.0272  163 THR A OG1 
3883 C CG2 . THR C 158 ? 0.1556 0.1593 0.1627 -0.0032 -0.0148 0.0235  163 THR A CG2 
3884 N N   . LYS C 159 ? 0.1370 0.1337 0.1451 -0.0007 -0.0131 0.0192  164 LYS A N   
3885 C CA  . LYS C 159 ? 0.1370 0.1318 0.1421 0.0003  -0.0112 0.0175  164 LYS A CA  
3886 C C   . LYS C 159 ? 0.1349 0.1298 0.1368 0.0001  -0.0095 0.0175  164 LYS A C   
3887 O O   . LYS C 159 ? 0.1295 0.1258 0.1321 -0.0006 -0.0094 0.0178  164 LYS A O   
3888 C CB  . LYS C 159 ? 0.1709 0.1645 0.1773 0.0008  -0.0104 0.0160  164 LYS A CB  
3889 C CG  . LYS C 159 ? 0.2284 0.2217 0.2384 0.0013  -0.0118 0.0151  164 LYS A CG  
3890 C CD  . LYS C 159 ? 0.3224 0.3151 0.3339 0.0016  -0.0108 0.0134  164 LYS A CD  
3891 C CE  . LYS C 159 ? 0.4172 0.4100 0.4331 0.0021  -0.0123 0.0122  164 LYS A CE  
3892 N NZ  . LYS C 159 ? 0.5155 0.5080 0.5315 0.0029  -0.0109 0.0098  164 LYS A NZ  
3893 N N   . LEU C 160 ? 0.1364 0.1301 0.1353 0.0011  -0.0084 0.0171  165 LEU A N   
3894 C CA  . LEU C 160 ? 0.1347 0.1282 0.1313 0.0011  -0.0067 0.0170  165 LEU A CA  
3895 C C   . LEU C 160 ? 0.1463 0.1377 0.1415 0.0022  -0.0046 0.0162  165 LEU A C   
3896 O O   . LEU C 160 ? 0.1596 0.1502 0.1539 0.0033  -0.0045 0.0158  165 LEU A O   
3897 C CB  . LEU C 160 ? 0.1601 0.1538 0.1544 0.0015  -0.0069 0.0175  165 LEU A CB  
3898 C CG  . LEU C 160 ? 0.1868 0.1829 0.1820 0.0004  -0.0086 0.0185  165 LEU A CG  
3899 C CD1 . LEU C 160 ? 0.2303 0.2265 0.2234 0.0009  -0.0089 0.0188  165 LEU A CD1 
3900 C CD2 . LEU C 160 ? 0.2260 0.2244 0.2223 -0.0008 -0.0085 0.0186  165 LEU A CD2 
3901 N N   . LEU C 161 ? 0.1313 0.1223 0.1269 0.0018  -0.0029 0.0158  166 LEU A N   
3902 C CA  . LEU C 161 ? 0.1361 0.1253 0.1308 0.0026  -0.0004 0.0154  166 LEU A CA  
3903 C C   . LEU C 161 ? 0.1372 0.1260 0.1312 0.0026  0.0010  0.0157  166 LEU A C   
3904 O O   . LEU C 161 ? 0.1444 0.1341 0.1404 0.0016  0.0013  0.0151  166 LEU A O   
3905 C CB  . LEU C 161 ? 0.1566 0.1457 0.1539 0.0021  0.0003  0.0145  166 LEU A CB  
3906 C CG  . LEU C 161 ? 0.1692 0.1587 0.1679 0.0022  -0.0011 0.0140  166 LEU A CG  
3907 C CD1 . LEU C 161 ? 0.2112 0.2023 0.2124 0.0011  -0.0033 0.0142  166 LEU A CD1 
3908 C CD2 . LEU C 161 ? 0.2053 0.1941 0.2054 0.0024  0.0005  0.0131  166 LEU A CD2 
3909 N N   . ILE C 162 ? 0.1361 0.1237 0.1277 0.0038  0.0019  0.0165  167 ILE A N   
3910 C CA  . ILE C 162 ? 0.1468 0.1341 0.1381 0.0039  0.0029  0.0169  167 ILE A CA  
3911 C C   . ILE C 162 ? 0.1483 0.1336 0.1397 0.0047  0.0055  0.0175  167 ILE A C   
3912 O O   . ILE C 162 ? 0.1553 0.1396 0.1449 0.0059  0.0065  0.0184  167 ILE A O   
3913 C CB  . ILE C 162 ? 0.1797 0.1673 0.1684 0.0047  0.0016  0.0176  167 ILE A CB  
3914 C CG1 . ILE C 162 ? 0.2229 0.2128 0.2123 0.0036  -0.0008 0.0172  167 ILE A CG1 
3915 C CG2 . ILE C 162 ? 0.1990 0.1861 0.1874 0.0051  0.0027  0.0179  167 ILE A CG2 
3916 C CD1 . ILE C 162 ? 0.2639 0.2540 0.2512 0.0044  -0.0021 0.0176  167 ILE A CD1 
3917 N N   . THR C 163 ? 0.1459 0.1310 0.1399 0.0040  0.0068  0.0169  168 THR A N   
3918 C CA  . THR C 163 ? 0.1543 0.1374 0.1496 0.0046  0.0095  0.0176  168 THR A CA  
3919 C C   . THR C 163 ? 0.1448 0.1278 0.1400 0.0050  0.0096  0.0181  168 THR A C   
3920 O O   . THR C 163 ? 0.1368 0.1215 0.1332 0.0040  0.0083  0.0167  168 THR A O   
3921 C CB  . THR C 163 ? 0.1781 0.1615 0.1780 0.0032  0.0107  0.0160  168 THR A CB  
3922 O OG1 . THR C 163 ? 0.2512 0.2352 0.2518 0.0025  0.0103  0.0151  168 THR A OG1 
3923 C CG2 . THR C 163 ? 0.2042 0.1855 0.2069 0.0036  0.0136  0.0167  168 THR A CG2 
3924 N N   . ALA C 164 ? 0.1442 0.1254 0.1382 0.0065  0.0110  0.0200  169 ALA A N   
3925 C CA  . ALA C 164 ? 0.1544 0.1353 0.1490 0.0069  0.0111  0.0202  169 ALA A CA  
3926 C C   . ALA C 164 ? 0.1569 0.1355 0.1525 0.0082  0.0136  0.0224  169 ALA A C   
3927 O O   . ALA C 164 ? 0.1667 0.1445 0.1598 0.0095  0.0146  0.0245  169 ALA A O   
3928 C CB  . ALA C 164 ? 0.1699 0.1521 0.1608 0.0076  0.0088  0.0205  169 ALA A CB  
3929 N N   . GLU C 165 ? 0.1475 0.1254 0.1469 0.0080  0.0147  0.0220  170 GLU A N   
3930 C CA  . GLU C 165 ? 0.1685 0.1440 0.1697 0.0093  0.0170  0.0244  170 GLU A CA  
3931 C C   . GLU C 165 ? 0.1577 0.1334 0.1603 0.0096  0.0163  0.0239  170 GLU A C   
3932 O O   . GLU C 165 ? 0.1609 0.1382 0.1659 0.0084  0.0153  0.0212  170 GLU A O   
3933 C CB  . GLU C 165 ? 0.1835 0.1574 0.1904 0.0085  0.0196  0.0241  170 GLU A CB  
3934 C CG  . GLU C 165 ? 0.1942 0.1680 0.2001 0.0082  0.0206  0.0246  170 GLU A CG  
3935 C CD  . GLU C 165 ? 0.2230 0.1951 0.2343 0.0077  0.0235  0.0250  170 GLU A CD  
3936 O OE1 . GLU C 165 ? 0.2319 0.2028 0.2486 0.0075  0.0250  0.0246  170 GLU A OE1 
3937 O OE2 . GLU C 165 ? 0.2404 0.2125 0.2508 0.0075  0.0243  0.0253  170 GLU A OE2 
3938 N N   . ALA C 166 ? 0.1629 0.1375 0.1634 0.0115  0.0166  0.0266  171 ALA A N   
3939 C CA  . ALA C 166 ? 0.1627 0.1375 0.1645 0.0120  0.0159  0.0263  171 ALA A CA  
3940 C C   . ALA C 166 ? 0.1682 0.1405 0.1731 0.0136  0.0182  0.0293  171 ALA A C   
3941 O O   . ALA C 166 ? 0.1757 0.1470 0.1782 0.0150  0.0194  0.0325  171 ALA A O   
3942 C CB  . ALA C 166 ? 0.1683 0.1448 0.1648 0.0129  0.0135  0.0264  171 ALA A CB  
3943 N N   . VAL C 167 ? 0.1535 0.1251 0.1638 0.0132  0.0188  0.0280  172 VAL A N   
3944 C CA  . VAL C 167 ? 0.1789 0.1480 0.1939 0.0145  0.0211  0.0307  172 VAL A CA  
3945 C C   . VAL C 167 ? 0.1743 0.1434 0.1882 0.0161  0.0200  0.0319  172 VAL A C   
3946 O O   . VAL C 167 ? 0.1667 0.1376 0.1807 0.0155  0.0180  0.0289  172 VAL A O   
3947 C CB  . VAL C 167 ? 0.2019 0.1699 0.2255 0.0131  0.0228  0.0283  172 VAL A CB  
3948 C CG1 . VAL C 167 ? 0.2213 0.1863 0.2510 0.0144  0.0253  0.0314  172 VAL A CG1 
3949 C CG2 . VAL C 167 ? 0.2282 0.1966 0.2529 0.0115  0.0236  0.0267  172 VAL A CG2 
3950 N N   . LYS C 168 ? 0.2013 0.1688 0.2144 0.0182  0.0212  0.0362  173 LYS A N   
3951 C CA  . LYS C 168 ? 0.2107 0.1785 0.2218 0.0202  0.0200  0.0380  173 LYS A CA  
3952 C C   . LYS C 168 ? 0.2422 0.2091 0.2602 0.0198  0.0202  0.0361  173 LYS A C   
3953 O O   . LYS C 168 ? 0.2635 0.2286 0.2887 0.0191  0.0223  0.0358  173 LYS A O   
3954 C CB  . LYS C 168 ? 0.2355 0.2021 0.2444 0.0227  0.0215  0.0435  173 LYS A CB  
3955 C CG  . LYS C 168 ? 0.2684 0.2361 0.2739 0.0249  0.0199  0.0452  173 LYS A CG  
3956 C CD  . LYS C 168 ? 0.3267 0.2947 0.3282 0.0273  0.0210  0.0504  173 LYS A CD  
3957 C CE  . LYS C 168 ? 0.3928 0.3613 0.3932 0.0299  0.0203  0.0534  173 LYS A CE  
3958 N NZ  . LYS C 168 ? 0.4888 0.4589 0.4840 0.0322  0.0212  0.0580  173 LYS A NZ  
3959 N N   . GLN C 169 ? 0.2674 0.2359 0.2841 0.0202  0.0181  0.0344  174 GLN A N   
3960 C CA  . GLN C 169 ? 0.3029 0.2710 0.3272 0.0197  0.0184  0.0320  174 GLN A CA  
3961 C C   . GLN C 169 ? 0.3457 0.3112 0.3746 0.0219  0.0198  0.0356  174 GLN A C   
3962 O O   . GLN C 169 ? 0.3844 0.3487 0.4103 0.0237  0.0207  0.0403  174 GLN A O   
3963 C CB  . GLN C 169 ? 0.3894 0.3606 0.4121 0.0186  0.0158  0.0277  174 GLN A CB  
3964 C CG  . GLN C 169 ? 0.4027 0.3748 0.4203 0.0203  0.0140  0.0291  174 GLN A CG  
3965 C CD  . GLN C 169 ? 0.4086 0.3840 0.4246 0.0191  0.0115  0.0248  174 GLN A CD  
3966 O OE1 . GLN C 169 ? 0.4134 0.3910 0.4306 0.0168  0.0110  0.0210  174 GLN A OE1 
3967 N NE2 . GLN C 169 ? 0.3793 0.3555 0.3926 0.0205  0.0101  0.0257  174 GLN A NE2 
3968 N N   . SER D 1   ? 0.4495 0.3397 0.4443 0.0159  0.0784  0.0539  6   SER D N   
3969 C CA  . SER D 1   ? 0.4680 0.3612 0.4619 0.0129  0.0781  0.0457  6   SER D CA  
3970 C C   . SER D 1   ? 0.4635 0.3593 0.4687 0.0118  0.0834  0.0442  6   SER D C   
3971 O O   . SER D 1   ? 0.5203 0.4136 0.5345 0.0130  0.0914  0.0462  6   SER D O   
3972 C CB  . SER D 1   ? 0.4914 0.3828 0.4819 0.0113  0.0828  0.0383  6   SER D CB  
3973 O OG  . SER D 1   ? 0.5013 0.3972 0.4908 0.0082  0.0815  0.0317  6   SER D OG  
3974 N N   . ALA D 2   ? 0.4290 0.3291 0.4332 0.0095  0.0797  0.0403  7   ALA D N   
3975 C CA  . ALA D 2   ? 0.4651 0.3674 0.4785 0.0082  0.0843  0.0385  7   ALA D CA  
3976 C C   . ALA D 2   ? 0.3891 0.2954 0.3996 0.0044  0.0832  0.0305  7   ALA D C   
3977 O O   . ALA D 2   ? 0.3645 0.2735 0.3668 0.0038  0.0761  0.0288  7   ALA D O   
3978 C CB  . ALA D 2   ? 0.4905 0.3954 0.5090 0.0101  0.0799  0.0462  7   ALA D CB  
3979 N N   . THR D 3   ? 0.3569 0.2635 0.3741 0.0020  0.0905  0.0261  8   THR D N   
3980 C CA  . THR D 3   ? 0.3473 0.2585 0.3626 -0.0019 0.0900  0.0191  8   THR D CA  
3981 C C   . THR D 3   ? 0.3313 0.2448 0.3527 -0.0021 0.0897  0.0207  8   THR D C   
3982 O O   . THR D 3   ? 0.3278 0.2380 0.3577 -0.0009 0.0959  0.0239  8   THR D O   
3983 C CB  . THR D 3   ? 0.4223 0.3326 0.4389 -0.0060 0.0985  0.0117  8   THR D CB  
3984 O OG1 . THR D 3   ? 0.4837 0.3918 0.4958 -0.0058 0.0997  0.0105  8   THR D OG1 
3985 C CG2 . THR D 3   ? 0.4433 0.3601 0.4570 -0.0106 0.0967  0.0051  8   THR D CG2 
3986 N N   . TYR D 4   ? 0.2979 0.2169 0.3152 -0.0037 0.0834  0.0182  9   TYR D N   
3987 C CA  . TYR D 4   ? 0.3154 0.2372 0.3375 -0.0040 0.0820  0.0196  9   TYR D CA  
3988 C C   . TYR D 4   ? 0.2854 0.2119 0.3055 -0.0085 0.0832  0.0120  9   TYR D C   
3989 O O   . TYR D 4   ? 0.3107 0.2411 0.3239 -0.0105 0.0799  0.0077  9   TYR D O   
3990 C CB  . TYR D 4   ? 0.3090 0.2336 0.3277 -0.0015 0.0719  0.0251  9   TYR D CB  
3991 C CG  . TYR D 4   ? 0.3265 0.2481 0.3448 0.0020  0.0684  0.0330  9   TYR D CG  
3992 C CD1 . TYR D 4   ? 0.3439 0.2625 0.3555 0.0029  0.0671  0.0333  9   TYR D CD1 
3993 C CD2 . TYR D 4   ? 0.3148 0.2373 0.3395 0.0042  0.0662  0.0406  9   TYR D CD2 
3994 C CE1 . TYR D 4   ? 0.3939 0.3100 0.4044 0.0057  0.0639  0.0406  9   TYR D CE1 
3995 C CE2 . TYR D 4   ? 0.3487 0.2700 0.3724 0.0068  0.0622  0.0482  9   TYR D CE2 
3996 C CZ  . TYR D 4   ? 0.3813 0.2991 0.3982 0.0075  0.0616  0.0481  9   TYR D CZ  
3997 O OH  . TYR D 4   ? 0.4308 0.3477 0.4461 0.0095  0.0575  0.0560  9   TYR D OH  
3998 N N   A GLN D 5   ? 0.2792 0.2058 0.3053 -0.0099 0.0876  0.0110  10  GLN D N   
3999 N N   B GLN D 5   ? 0.2679 0.1943 0.2941 -0.0101 0.0881  0.0107  10  GLN D N   
4000 C CA  A GLN D 5   ? 0.2699 0.2009 0.2944 -0.0146 0.0892  0.0042  10  GLN D CA  
4001 C CA  B GLN D 5   ? 0.2518 0.1829 0.2762 -0.0147 0.0893  0.0040  10  GLN D CA  
4002 C C   A GLN D 5   ? 0.2589 0.1950 0.2837 -0.0139 0.0826  0.0062  10  GLN D C   
4003 C C   B GLN D 5   ? 0.2496 0.1855 0.2738 -0.0132 0.0816  0.0070  10  GLN D C   
4004 O O   A GLN D 5   ? 0.2379 0.1725 0.2690 -0.0117 0.0831  0.0107  10  GLN D O   
4005 O O   B GLN D 5   ? 0.2366 0.1705 0.2664 -0.0099 0.0804  0.0133  10  GLN D O   
4006 C CB  A GLN D 5   ? 0.3036 0.2302 0.3331 -0.0180 0.1004  0.0000  10  GLN D CB  
4007 C CB  B GLN D 5   ? 0.2660 0.1930 0.2960 -0.0179 0.0999  0.0004  10  GLN D CB  
4008 C CG  A GLN D 5   ? 0.3175 0.2389 0.3469 -0.0194 0.1078  -0.0024 10  GLN D CG  
4009 C CG  B GLN D 5   ? 0.2610 0.1928 0.2878 -0.0239 0.1019  -0.0072 10  GLN D CG  
4010 C CD  A GLN D 5   ? 0.3462 0.2723 0.3679 -0.0233 0.1057  -0.0083 10  GLN D CD  
4011 C CD  B GLN D 5   ? 0.2665 0.2012 0.2872 -0.0287 0.1035  -0.0137 10  GLN D CD  
4012 O OE1 A GLN D 5   ? 0.3757 0.3094 0.3929 -0.0260 0.1006  -0.0116 10  GLN D OE1 
4013 O OE1 B GLN D 5   ? 0.2818 0.2116 0.3030 -0.0290 0.1089  -0.0145 10  GLN D OE1 
4014 N NE2 A GLN D 5   ? 0.3684 0.2907 0.3892 -0.0234 0.1096  -0.0092 10  GLN D NE2 
4015 N NE2 B GLN D 5   ? 0.2419 0.1853 0.2574 -0.0326 0.0991  -0.0179 10  GLN D NE2 
4016 N N   . PHE D 6   ? 0.2607 0.2031 0.2792 -0.0157 0.0767  0.0030  11  PHE D N   
4017 C CA  . PHE D 6   ? 0.2514 0.1982 0.2699 -0.0148 0.0705  0.0050  11  PHE D CA  
4018 C C   . PHE D 6   ? 0.2480 0.1944 0.2729 -0.0165 0.0760  0.0039  11  PHE D C   
4019 O O   . PHE D 6   ? 0.2539 0.2001 0.2792 -0.0208 0.0831  -0.0019 11  PHE D O   
4020 C CB  . PHE D 6   ? 0.2479 0.2022 0.2596 -0.0170 0.0653  0.0012  11  PHE D CB  
4021 C CG  . PHE D 6   ? 0.2595 0.2141 0.2647 -0.0144 0.0589  0.0036  11  PHE D CG  
4022 C CD1 . PHE D 6   ? 0.2587 0.2101 0.2627 -0.0105 0.0528  0.0096  11  PHE D CD1 
4023 C CD2 . PHE D 6   ? 0.2633 0.2212 0.2636 -0.0164 0.0594  -0.0001 11  PHE D CD2 
4024 C CE1 . PHE D 6   ? 0.2900 0.2400 0.2869 -0.0086 0.0478  0.0114  11  PHE D CE1 
4025 C CE2 . PHE D 6   ? 0.2942 0.2514 0.2886 -0.0137 0.0546  0.0021  11  PHE D CE2 
4026 C CZ  . PHE D 6   ? 0.2949 0.2473 0.2872 -0.0099 0.0493  0.0075  11  PHE D CZ  
4027 N N   . ASP D 7   ? 0.2505 0.1967 0.2803 -0.0136 0.0728  0.0095  12  ASP D N   
4028 C CA  . ASP D 7   ? 0.2552 0.2017 0.2907 -0.0147 0.0769  0.0091  12  ASP D CA  
4029 C C   . ASP D 7   ? 0.2452 0.1987 0.2763 -0.0171 0.0721  0.0055  12  ASP D C   
4030 O O   . ASP D 7   ? 0.2421 0.1990 0.2710 -0.0149 0.0637  0.0090  12  ASP D O   
4031 C CB  . ASP D 7   ? 0.2654 0.2100 0.3086 -0.0101 0.0747  0.0178  12  ASP D CB  
4032 C CG  . ASP D 7   ? 0.3153 0.2607 0.3647 -0.0104 0.0776  0.0187  12  ASP D CG  
4033 O OD1 . ASP D 7   ? 0.3418 0.2878 0.3898 -0.0142 0.0827  0.0123  12  ASP D OD1 
4034 O OD2 . ASP D 7   ? 0.3988 0.3451 0.4538 -0.0070 0.0735  0.0262  12  ASP D OD2 
4035 N N   . PRO D 8   ? 0.2590 0.2149 0.2879 -0.0219 0.0769  -0.0012 13  PRO D N   
4036 C CA  . PRO D 8   ? 0.2656 0.2294 0.2901 -0.0242 0.0720  -0.0040 13  PRO D CA  
4037 C C   . PRO D 8   ? 0.2713 0.2368 0.2995 -0.0219 0.0681  -0.0001 13  PRO D C   
4038 O O   . PRO D 8   ? 0.2630 0.2346 0.2875 -0.0217 0.0613  0.0000  13  PRO D O   
4039 C CB  . PRO D 8   ? 0.2826 0.2481 0.3048 -0.0306 0.0793  -0.0116 13  PRO D CB  
4040 C CG  . PRO D 8   ? 0.2834 0.2426 0.3063 -0.0319 0.0863  -0.0136 13  PRO D CG  
4041 C CD  . PRO D 8   ? 0.2857 0.2375 0.3152 -0.0262 0.0871  -0.0068 13  PRO D CD  
4042 N N   . SER D 9   ? 0.2786 0.2390 0.3144 -0.0200 0.0724  0.0035  14  SER D N   
4043 C CA  . SER D 9   ? 0.2811 0.2432 0.3215 -0.0177 0.0691  0.0078  14  SER D CA  
4044 C C   . SER D 9   ? 0.2767 0.2408 0.3164 -0.0138 0.0592  0.0142  14  SER D C   
4045 O O   . SER D 9   ? 0.2721 0.2392 0.3137 -0.0127 0.0548  0.0170  14  SER D O   
4046 C CB  . SER D 9   ? 0.3412 0.2975 0.3913 -0.0166 0.0775  0.0108  14  SER D CB  
4047 O OG  . SER D 9   ? 0.3879 0.3400 0.4436 -0.0124 0.0773  0.0178  14  SER D OG  
4048 N N   . HIS D 10  ? 0.2525 0.2149 0.2883 -0.0122 0.0555  0.0161  15  HIS D N   
4049 C CA  . HIS D 10  ? 0.2321 0.1954 0.2652 -0.0094 0.0465  0.0213  15  HIS D CA  
4050 C C   . HIS D 10  ? 0.2179 0.1820 0.2416 -0.0100 0.0427  0.0184  15  HIS D C   
4051 O O   . HIS D 10  ? 0.2556 0.2177 0.2757 -0.0081 0.0376  0.0220  15  HIS D O   
4052 C CB  . HIS D 10  ? 0.2537 0.2128 0.2925 -0.0065 0.0465  0.0286  15  HIS D CB  
4053 C CG  . HIS D 10  ? 0.2794 0.2387 0.3282 -0.0051 0.0488  0.0335  15  HIS D CG  
4054 N ND1 . HIS D 10  ? 0.3288 0.2849 0.3855 -0.0050 0.0584  0.0334  15  HIS D ND1 
4055 C CD2 . HIS D 10  ? 0.2942 0.2566 0.3462 -0.0040 0.0434  0.0383  15  HIS D CD2 
4056 C CE1 . HIS D 10  ? 0.3027 0.2601 0.3678 -0.0034 0.0589  0.0385  15  HIS D CE1 
4057 N NE2 . HIS D 10  ? 0.3062 0.2678 0.3688 -0.0029 0.0495  0.0417  15  HIS D NE2 
4058 N N   . THR D 11  ? 0.2105 0.1780 0.2302 -0.0129 0.0457  0.0119  16  THR D N   
4059 C CA  . THR D 11  ? 0.1950 0.1641 0.2068 -0.0132 0.0427  0.0097  16  THR D CA  
4060 C C   . THR D 11  ? 0.1857 0.1622 0.1940 -0.0152 0.0406  0.0063  16  THR D C   
4061 O O   . THR D 11  ? 0.1946 0.1754 0.2039 -0.0188 0.0452  0.0016  16  THR D O   
4062 C CB  . THR D 11  ? 0.2059 0.1725 0.2169 -0.0147 0.0485  0.0064  16  THR D CB  
4063 O OG1 . THR D 11  ? 0.2067 0.1666 0.2213 -0.0122 0.0499  0.0108  16  THR D OG1 
4064 C CG2 . THR D 11  ? 0.2085 0.1769 0.2119 -0.0146 0.0456  0.0049  16  THR D CG2 
4065 N N   . TYR D 12  ? 0.1851 0.1632 0.1888 -0.0132 0.0339  0.0087  17  TYR D N   
4066 C CA  . TYR D 12  ? 0.1829 0.1684 0.1841 -0.0144 0.0319  0.0066  17  TYR D CA  
4067 C C   . TYR D 12  ? 0.1886 0.1741 0.1833 -0.0122 0.0269  0.0086  17  TYR D C   
4068 O O   . TYR D 12  ? 0.1950 0.1750 0.1876 -0.0098 0.0227  0.0124  17  TYR D O   
4069 C CB  . TYR D 12  ? 0.1806 0.1683 0.1857 -0.0143 0.0302  0.0081  17  TYR D CB  
4070 C CG  . TYR D 12  ? 0.1893 0.1756 0.2015 -0.0158 0.0352  0.0075  17  TYR D CG  
4071 C CD1 . TYR D 12  ? 0.1966 0.1873 0.2101 -0.0195 0.0404  0.0027  17  TYR D CD1 
4072 C CD2 . TYR D 12  ? 0.2056 0.1862 0.2229 -0.0138 0.0353  0.0117  17  TYR D CD2 
4073 C CE1 . TYR D 12  ? 0.2063 0.1942 0.2258 -0.0209 0.0461  0.0020  17  TYR D CE1 
4074 C CE2 . TYR D 12  ? 0.2193 0.1981 0.2438 -0.0145 0.0407  0.0119  17  TYR D CE2 
4075 C CZ  . TYR D 12  ? 0.2263 0.2078 0.2516 -0.0178 0.0464  0.0069  17  TYR D CZ  
4076 O OH  . TYR D 12  ? 0.2296 0.2081 0.2615 -0.0187 0.0530  0.0067  17  TYR D OH  
4077 N N   . PRO D 13  ? 0.1756 0.1676 0.1670 -0.0131 0.0273  0.0063  18  PRO D N   
4078 C CA  . PRO D 13  ? 0.1791 0.1714 0.1651 -0.0106 0.0231  0.0087  18  PRO D CA  
4079 C C   . PRO D 13  ? 0.1504 0.1479 0.1374 -0.0103 0.0205  0.0098  18  PRO D C   
4080 O O   . PRO D 13  ? 0.1559 0.1619 0.1456 -0.0127 0.0223  0.0075  18  PRO D O   
4081 C CB  . PRO D 13  ? 0.1820 0.1799 0.1653 -0.0114 0.0254  0.0068  18  PRO D CB  
4082 C CG  . PRO D 13  ? 0.1812 0.1863 0.1688 -0.0157 0.0295  0.0028  18  PRO D CG  
4083 C CD  . PRO D 13  ? 0.1815 0.1813 0.1739 -0.0168 0.0314  0.0020  18  PRO D CD  
4084 N N   . SER D 14  ? 0.1547 0.1468 0.1390 -0.0079 0.0163  0.0131  19  SER D N   
4085 C CA  . SER D 14  ? 0.1483 0.1436 0.1325 -0.0071 0.0136  0.0147  19  SER D CA  
4086 C C   . SER D 14  ? 0.1523 0.1476 0.1306 -0.0048 0.0125  0.0162  19  SER D C   
4087 O O   . SER D 14  ? 0.1684 0.1585 0.1420 -0.0036 0.0130  0.0166  19  SER D O   
4088 C CB  . SER D 14  ? 0.1690 0.1584 0.1547 -0.0065 0.0101  0.0175  19  SER D CB  
4089 O OG  . SER D 14  ? 0.1681 0.1574 0.1605 -0.0080 0.0118  0.0170  19  SER D OG  
4090 N N   . PHE D 15  ? 0.1609 0.1614 0.1395 -0.0040 0.0115  0.0173  20  PHE D N   
4091 C CA  . PHE D 15  ? 0.1713 0.1725 0.1455 -0.0014 0.0115  0.0194  20  PHE D CA  
4092 C C   . PHE D 15  ? 0.1695 0.1692 0.1427 0.0001  0.0092  0.0219  20  PHE D C   
4093 O O   . PHE D 15  ? 0.1662 0.1678 0.1433 -0.0010 0.0076  0.0219  20  PHE D O   
4094 C CB  . PHE D 15  ? 0.1723 0.1857 0.1488 -0.0021 0.0145  0.0186  20  PHE D CB  
4095 C CG  . PHE D 15  ? 0.1831 0.2073 0.1648 -0.0044 0.0148  0.0175  20  PHE D CG  
4096 C CD1 . PHE D 15  ? 0.1937 0.2226 0.1763 -0.0030 0.0136  0.0199  20  PHE D CD1 
4097 C CD2 . PHE D 15  ? 0.1992 0.2283 0.1844 -0.0083 0.0169  0.0139  20  PHE D CD2 
4098 C CE1 . PHE D 15  ? 0.2239 0.2627 0.2110 -0.0056 0.0139  0.0187  20  PHE D CE1 
4099 C CE2 . PHE D 15  ? 0.2104 0.2483 0.1993 -0.0111 0.0176  0.0124  20  PHE D CE2 
4100 C CZ  . PHE D 15  ? 0.1934 0.2365 0.1831 -0.0098 0.0160  0.0148  20  PHE D CZ  
4101 N N   . GLU D 16  ? 0.1742 0.1696 0.1419 0.0028  0.0097  0.0242  21  GLU D N   
4102 C CA  . GLU D 16  ? 0.1884 0.1830 0.1549 0.0046  0.0088  0.0267  21  GLU D CA  
4103 C C   . GLU D 16  ? 0.1801 0.1811 0.1460 0.0074  0.0120  0.0290  21  GLU D C   
4104 O O   . GLU D 16  ? 0.2082 0.2058 0.1703 0.0089  0.0143  0.0295  21  GLU D O   
4105 C CB  . GLU D 16  ? 0.2198 0.2004 0.1789 0.0053  0.0070  0.0280  21  GLU D CB  
4106 C CG  . GLU D 16  ? 0.2422 0.2166 0.2017 0.0026  0.0031  0.0273  21  GLU D CG  
4107 C CD  . GLU D 16  ? 0.3298 0.2911 0.2811 0.0021  0.0007  0.0286  21  GLU D CD  
4108 O OE1 . GLU D 16  ? 0.3465 0.3014 0.2907 0.0038  0.0027  0.0296  21  GLU D OE1 
4109 O OE2 . GLU D 16  ? 0.3706 0.3279 0.3224 -0.0004 -0.0029 0.0290  21  GLU D OE2 
4110 N N   . ALA D 17  ? 0.1793 0.1883 0.1487 0.0085  0.0124  0.0311  22  ALA D N   
4111 C CA  . ALA D 17  ? 0.1854 0.2020 0.1556 0.0115  0.0156  0.0344  22  ALA D CA  
4112 C C   . ALA D 17  ? 0.1960 0.2126 0.1665 0.0140  0.0159  0.0378  22  ALA D C   
4113 O O   . ALA D 17  ? 0.2067 0.2223 0.1788 0.0128  0.0135  0.0372  22  ALA D O   
4114 C CB  . ALA D 17  ? 0.2161 0.2488 0.1924 0.0094  0.0165  0.0338  22  ALA D CB  
4115 N N   . ASP D 18  ? 0.2005 0.2172 0.1695 0.0178  0.0194  0.0419  23  ASP D N   
4116 C CA  . ASP D 18  ? 0.2159 0.2315 0.1850 0.0208  0.0208  0.0456  23  ASP D CA  
4117 C C   . ASP D 18  ? 0.2157 0.2477 0.1924 0.0210  0.0206  0.0481  23  ASP D C   
4118 O O   . ASP D 18  ? 0.2282 0.2751 0.2100 0.0197  0.0208  0.0486  23  ASP D O   
4119 C CB  . ASP D 18  ? 0.2191 0.2288 0.1842 0.0255  0.0262  0.0499  23  ASP D CB  
4120 C CG  . ASP D 18  ? 0.2243 0.2326 0.1899 0.0291  0.0291  0.0543  23  ASP D CG  
4121 O OD1 . ASP D 18  ? 0.2734 0.2689 0.2341 0.0280  0.0277  0.0526  23  ASP D OD1 
4122 O OD2 . ASP D 18  ? 0.2360 0.2560 0.2070 0.0326  0.0326  0.0597  23  ASP D OD2 
4123 N N   . HIS D 19  ? 0.2012 0.2311 0.1786 0.0221  0.0201  0.0497  24  HIS D N   
4124 C CA  . HIS D 19  ? 0.2160 0.2596 0.1996 0.0233  0.0207  0.0533  24  HIS D CA  
4125 C C   . HIS D 19  ? 0.2148 0.2531 0.1971 0.0282  0.0245  0.0586  24  HIS D C   
4126 O O   . HIS D 19  ? 0.2186 0.2428 0.1962 0.0285  0.0244  0.0577  24  HIS D O   
4127 C CB  . HIS D 19  ? 0.2067 0.2525 0.1930 0.0198  0.0167  0.0502  24  HIS D CB  
4128 C CG  . HIS D 19  ? 0.2363 0.2976 0.2287 0.0199  0.0168  0.0529  24  HIS D CG  
4129 N ND1 . HIS D 19  ? 0.2640 0.3254 0.2585 0.0205  0.0160  0.0542  24  HIS D ND1 
4130 C CD2 . HIS D 19  ? 0.2626 0.3412 0.2594 0.0190  0.0176  0.0548  24  HIS D CD2 
4131 C CE1 . HIS D 19  ? 0.2333 0.3108 0.2329 0.0204  0.0164  0.0569  24  HIS D CE1 
4132 N NE2 . HIS D 19  ? 0.2604 0.3488 0.2613 0.0191  0.0172  0.0573  24  HIS D NE2 
4133 N N   . PHE D 20  ? 0.2252 0.2751 0.2117 0.0317  0.0283  0.0643  25  PHE D N   
4134 C CA  . PHE D 20  ? 0.2585 0.3069 0.2460 0.0370  0.0330  0.0706  25  PHE D CA  
4135 C C   . PHE D 20  ? 0.2986 0.3268 0.2782 0.0395  0.0368  0.0706  25  PHE D C   
4136 O O   . PHE D 20  ? 0.3593 0.3786 0.3368 0.0417  0.0394  0.0726  25  PHE D O   
4137 C CB  . PHE D 20  ? 0.2694 0.3225 0.2606 0.0369  0.0315  0.0720  25  PHE D CB  
4138 C CG  . PHE D 20  ? 0.2977 0.3726 0.2969 0.0371  0.0310  0.0761  25  PHE D CG  
4139 C CD1 . PHE D 20  ? 0.3287 0.4138 0.3322 0.0418  0.0357  0.0838  25  PHE D CD1 
4140 C CD2 . PHE D 20  ? 0.3299 0.4152 0.3321 0.0324  0.0264  0.0726  25  PHE D CD2 
4141 C CE1 . PHE D 20  ? 0.3624 0.4693 0.3733 0.0416  0.0351  0.0885  25  PHE D CE1 
4142 C CE2 . PHE D 20  ? 0.3835 0.4893 0.3919 0.0317  0.0260  0.0762  25  PHE D CE2 
4143 C CZ  . PHE D 20  ? 0.3669 0.4843 0.3797 0.0361  0.0300  0.0844  25  PHE D CZ  
4144 N N   . GLY D 21  ? 0.2813 0.3015 0.2559 0.0390  0.0378  0.0684  26  GLY D N   
4145 C CA  . GLY D 21  ? 0.3202 0.3209 0.2862 0.0414  0.0425  0.0688  26  GLY D CA  
4146 C C   . GLY D 21  ? 0.3480 0.3309 0.3061 0.0384  0.0403  0.0643  26  GLY D C   
4147 O O   . GLY D 21  ? 0.3571 0.3280 0.3107 0.0405  0.0446  0.0662  26  GLY D O   
4148 N N   . GLY D 22  ? 0.3132 0.2946 0.2698 0.0333  0.0339  0.0587  27  GLY D N   
4149 C CA  . GLY D 22  ? 0.3114 0.2775 0.2609 0.0297  0.0310  0.0549  27  GLY D CA  
4150 C C   . GLY D 22  ? 0.2853 0.2568 0.2399 0.0279  0.0271  0.0545  27  GLY D C   
4151 O O   . GLY D 22  ? 0.3110 0.2710 0.2607 0.0250  0.0249  0.0524  27  GLY D O   
4152 N N   . LEU D 23  ? 0.2492 0.2381 0.2132 0.0292  0.0264  0.0569  28  LEU D N   
4153 C CA  . LEU D 23  ? 0.2368 0.2303 0.2053 0.0277  0.0233  0.0567  28  LEU D CA  
4154 C C   . LEU D 23  ? 0.2406 0.2330 0.2094 0.0226  0.0171  0.0516  28  LEU D C   
4155 O O   . LEU D 23  ? 0.2417 0.2274 0.2093 0.0203  0.0143  0.0503  28  LEU D O   
4156 C CB  . LEU D 23  ? 0.2333 0.2451 0.2107 0.0303  0.0246  0.0608  28  LEU D CB  
4157 C CG  . LEU D 23  ? 0.2284 0.2456 0.2105 0.0293  0.0222  0.0612  28  LEU D CG  
4158 C CD1 . LEU D 23  ? 0.2331 0.2378 0.2118 0.0312  0.0249  0.0633  28  LEU D CD1 
4159 C CD2 . LEU D 23  ? 0.2180 0.2553 0.2081 0.0312  0.0233  0.0650  28  LEU D CD2 
4160 N N   . SER D 24  ? 0.2101 0.2084 0.1803 0.0209  0.0154  0.0492  29  SER D N   
4161 C CA  . SER D 24  ? 0.2132 0.2093 0.1837 0.0165  0.0105  0.0450  29  SER D CA  
4162 C C   . SER D 24  ? 0.2261 0.2249 0.1960 0.0155  0.0106  0.0428  29  SER D C   
4163 O O   . SER D 24  ? 0.2246 0.2266 0.1936 0.0181  0.0141  0.0445  29  SER D O   
4164 C CB  . SER D 24  ? 0.2212 0.2270 0.1990 0.0146  0.0077  0.0442  29  SER D CB  
4165 O OG  . SER D 24  ? 0.2279 0.2492 0.2114 0.0149  0.0088  0.0445  29  SER D OG  
4166 N N   . VAL D 25  ? 0.2082 0.2051 0.1788 0.0119  0.0069  0.0393  30  VAL D N   
4167 C CA  . VAL D 25  ? 0.2016 0.1984 0.1711 0.0105  0.0068  0.0368  30  VAL D CA  
4168 C C   . VAL D 25  ? 0.1944 0.2021 0.1707 0.0081  0.0056  0.0346  30  VAL D C   
4169 O O   . VAL D 25  ? 0.2152 0.2221 0.1947 0.0059  0.0029  0.0334  30  VAL D O   
4170 C CB  . VAL D 25  ? 0.2152 0.1981 0.1782 0.0085  0.0045  0.0351  30  VAL D CB  
4171 C CG1 . VAL D 25  ? 0.2395 0.2223 0.2015 0.0075  0.0049  0.0330  30  VAL D CG1 
4172 C CG2 . VAL D 25  ? 0.2415 0.2122 0.1961 0.0100  0.0063  0.0368  30  VAL D CG2 
4173 N N   . TRP D 26  ? 0.1937 0.2124 0.1728 0.0082  0.0079  0.0342  31  TRP D N   
4174 C CA  . TRP D 26  ? 0.1731 0.2004 0.1571 0.0050  0.0076  0.0312  31  TRP D CA  
4175 C C   . TRP D 26  ? 0.1736 0.1932 0.1559 0.0029  0.0068  0.0282  31  TRP D C   
4176 O O   . TRP D 26  ? 0.1974 0.2118 0.1754 0.0039  0.0078  0.0282  31  TRP D O   
4177 C CB  . TRP D 26  ? 0.1900 0.2304 0.1762 0.0045  0.0102  0.0313  31  TRP D CB  
4178 C CG  . TRP D 26  ? 0.2151 0.2690 0.2055 0.0044  0.0108  0.0332  31  TRP D CG  
4179 C CD1 . TRP D 26  ? 0.2510 0.3132 0.2423 0.0073  0.0124  0.0377  31  TRP D CD1 
4180 C CD2 . TRP D 26  ? 0.2038 0.2645 0.1982 0.0012  0.0100  0.0311  31  TRP D CD2 
4181 N NE1 . TRP D 26  ? 0.2489 0.3231 0.2443 0.0060  0.0122  0.0387  31  TRP D NE1 
4182 C CE2 . TRP D 26  ? 0.2138 0.2869 0.2107 0.0020  0.0107  0.0343  31  TRP D CE2 
4183 C CE3 . TRP D 26  ? 0.2072 0.2647 0.2034 -0.0021 0.0093  0.0271  31  TRP D CE3 
4184 C CZ2 . TRP D 26  ? 0.1981 0.2800 0.1983 -0.0009 0.0105  0.0330  31  TRP D CZ2 
4185 C CZ3 . TRP D 26  ? 0.2028 0.2677 0.2023 -0.0045 0.0096  0.0260  31  TRP D CZ3 
4186 C CH2 . TRP D 26  ? 0.2056 0.2825 0.2067 -0.0043 0.0101  0.0285  31  TRP D CH2 
4187 N N   . ARG D 27  ? 0.1572 0.1766 0.1434 0.0003  0.0054  0.0261  32  ARG D N   
4188 C CA  . ARG D 27  ? 0.1531 0.1664 0.1392 -0.0015 0.0052  0.0239  32  ARG D CA  
4189 C C   . ARG D 27  ? 0.1694 0.1902 0.1606 -0.0044 0.0073  0.0208  32  ARG D C   
4190 O O   . ARG D 27  ? 0.2052 0.2332 0.2003 -0.0056 0.0079  0.0204  32  ARG D O   
4191 C CB  . ARG D 27  ? 0.1672 0.1707 0.1531 -0.0019 0.0020  0.0250  32  ARG D CB  
4192 C CG  . ARG D 27  ? 0.1974 0.1918 0.1767 -0.0002 0.0000  0.0274  32  ARG D CG  
4193 C CD  . ARG D 27  ? 0.2108 0.1961 0.1891 -0.0017 -0.0036 0.0286  32  ARG D CD  
4194 N NE  . ARG D 27  ? 0.2460 0.2215 0.2160 -0.0012 -0.0052 0.0301  32  ARG D NE  
4195 C CZ  . ARG D 27  ? 0.2541 0.2263 0.2208 -0.0004 -0.0059 0.0317  32  ARG D CZ  
4196 N NH1 . ARG D 27  ? 0.2686 0.2463 0.2402 0.0000  -0.0062 0.0326  32  ARG D NH1 
4197 N NH2 . ARG D 27  ? 0.3204 0.2819 0.2780 -0.0005 -0.0063 0.0324  32  ARG D NH2 
4198 N N   . GLY D 28  ? 0.1503 0.1698 0.1411 -0.0059 0.0092  0.0185  33  GLY D N   
4199 C CA  . GLY D 28  ? 0.1527 0.1772 0.1474 -0.0092 0.0121  0.0152  33  GLY D CA  
4200 C C   . GLY D 28  ? 0.1460 0.1656 0.1399 -0.0102 0.0141  0.0132  33  GLY D C   
4201 O O   . GLY D 28  ? 0.1331 0.1451 0.1236 -0.0083 0.0127  0.0147  33  GLY D O   
4202 N N   . LYS D 29  ? 0.1421 0.1656 0.1385 -0.0136 0.0178  0.0097  34  LYS D N   
4203 C CA  . LYS D 29  ? 0.1499 0.1688 0.1459 -0.0147 0.0205  0.0077  34  LYS D CA  
4204 C C   . LYS D 29  ? 0.1563 0.1824 0.1532 -0.0191 0.0250  0.0033  34  LYS D C   
4205 O O   . LYS D 29  ? 0.1762 0.2106 0.1740 -0.0217 0.0259  0.0019  34  LYS D O   
4206 C CB  . LYS D 29  ? 0.1701 0.1800 0.1695 -0.0142 0.0209  0.0085  34  LYS D CB  
4207 C CG  . LYS D 29  ? 0.1796 0.1910 0.1846 -0.0165 0.0238  0.0070  34  LYS D CG  
4208 C CD  . LYS D 29  ? 0.2244 0.2279 0.2343 -0.0149 0.0235  0.0099  34  LYS D CD  
4209 C CE  . LYS D 29  ? 0.2197 0.2162 0.2295 -0.0138 0.0240  0.0112  34  LYS D CE  
4210 N NZ  . LYS D 29  ? 0.2155 0.2062 0.2313 -0.0126 0.0243  0.0149  34  LYS D NZ  
4211 N N   . PHE D 30  ? 0.1607 0.1834 0.1570 -0.0205 0.0281  0.0011  35  PHE D N   
4212 C CA  . PHE D 30  ? 0.1706 0.1986 0.1674 -0.0257 0.0329  -0.0034 35  PHE D CA  
4213 C C   . PHE D 30  ? 0.1723 0.1916 0.1726 -0.0268 0.0371  -0.0052 35  PHE D C   
4214 O O   . PHE D 30  ? 0.1745 0.1851 0.1760 -0.0239 0.0367  -0.0030 35  PHE D O   
4215 C CB  . PHE D 30  ? 0.1864 0.2173 0.1801 -0.0266 0.0340  -0.0044 35  PHE D CB  
4216 C CG  . PHE D 30  ? 0.1843 0.2245 0.1756 -0.0253 0.0309  -0.0019 35  PHE D CG  
4217 C CD1 . PHE D 30  ? 0.1960 0.2323 0.1852 -0.0198 0.0270  0.0026  35  PHE D CD1 
4218 C CD2 . PHE D 30  ? 0.1873 0.2405 0.1784 -0.0297 0.0321  -0.0036 35  PHE D CD2 
4219 C CE1 . PHE D 30  ? 0.2014 0.2457 0.1891 -0.0180 0.0252  0.0056  35  PHE D CE1 
4220 C CE2 . PHE D 30  ? 0.1935 0.2561 0.1836 -0.0280 0.0296  -0.0001 35  PHE D CE2 
4221 C CZ  . PHE D 30  ? 0.1838 0.2423 0.1726 -0.0220 0.0266  0.0045  35  PHE D CZ  
4222 N N   . ASP D 31  ? 0.1836 0.2054 0.1860 -0.0309 0.0412  -0.0085 36  ASP D N   
4223 C CA  . ASP D 31  ? 0.2006 0.2139 0.2073 -0.0317 0.0464  -0.0098 36  ASP D CA  
4224 C C   . ASP D 31  ? 0.2232 0.2313 0.2299 -0.0341 0.0523  -0.0129 36  ASP D C   
4225 O O   . ASP D 31  ? 0.2377 0.2373 0.2486 -0.0330 0.0562  -0.0121 36  ASP D O   
4226 C CB  . ASP D 31  ? 0.2190 0.2356 0.2269 -0.0353 0.0498  -0.0125 36  ASP D CB  
4227 C CG  . ASP D 31  ? 0.2754 0.2945 0.2851 -0.0325 0.0453  -0.0090 36  ASP D CG  
4228 O OD1 . ASP D 31  ? 0.2634 0.2816 0.2735 -0.0278 0.0394  -0.0044 36  ASP D OD1 
4229 O OD2 . ASP D 31  ? 0.2885 0.3105 0.2989 -0.0356 0.0483  -0.0113 36  ASP D OD2 
4230 N N   . LYS D 32  ? 0.1947 0.2082 0.1972 -0.0375 0.0533  -0.0161 37  LYS D N   
4231 C CA  . LYS D 32  ? 0.2340 0.2428 0.2364 -0.0406 0.0594  -0.0196 37  LYS D CA  
4232 C C   . LYS D 32  ? 0.2213 0.2301 0.2212 -0.0388 0.0573  -0.0184 37  LYS D C   
4233 O O   . LYS D 32  ? 0.2395 0.2570 0.2360 -0.0402 0.0547  -0.0189 37  LYS D O   
4234 C CB  . LYS D 32  ? 0.2689 0.2835 0.2686 -0.0484 0.0647  -0.0258 37  LYS D CB  
4235 C CG  . LYS D 32  ? 0.3463 0.3537 0.3461 -0.0522 0.0727  -0.0301 37  LYS D CG  
4236 C CD  . LYS D 32  ? 0.4450 0.4550 0.4418 -0.0609 0.0794  -0.0368 37  LYS D CD  
4237 C CE  . LYS D 32  ? 0.4890 0.4926 0.4845 -0.0656 0.0874  -0.0416 37  LYS D CE  
4238 N NZ  . LYS D 32  ? 0.5599 0.5626 0.5520 -0.0746 0.0956  -0.0487 37  LYS D NZ  
4239 N N   . SER D 33  ? 0.2267 0.2259 0.2288 -0.0358 0.0592  -0.0167 38  SER D N   
4240 C CA  . SER D 33  ? 0.2146 0.2114 0.2147 -0.0339 0.0584  -0.0156 38  SER D CA  
4241 C C   . SER D 33  ? 0.2567 0.2444 0.2595 -0.0347 0.0653  -0.0172 38  SER D C   
4242 O O   . SER D 33  ? 0.2624 0.2440 0.2695 -0.0348 0.0698  -0.0172 38  SER D O   
4243 C CB  . SER D 33  ? 0.2220 0.2150 0.2213 -0.0274 0.0519  -0.0097 38  SER D CB  
4244 O OG  . SER D 33  ? 0.2431 0.2436 0.2397 -0.0263 0.0463  -0.0081 38  SER D OG  
4245 N N   . SER D 34  ? 0.2224 0.2093 0.2230 -0.0351 0.0665  -0.0180 39  SER D N   
4246 C CA  . SER D 34  ? 0.2259 0.2039 0.2290 -0.0349 0.0724  -0.0185 39  SER D CA  
4247 C C   . SER D 34  ? 0.2519 0.2283 0.2523 -0.0324 0.0707  -0.0168 39  SER D C   
4248 O O   . SER D 34  ? 0.2472 0.2304 0.2437 -0.0323 0.0663  -0.0165 39  SER D O   
4249 C CB  . SER D 34  ? 0.2537 0.2318 0.2572 -0.0418 0.0808  -0.0250 39  SER D CB  
4250 O OG  . SER D 34  ? 0.3003 0.2868 0.2993 -0.0464 0.0802  -0.0285 39  SER D OG  
4251 N N   . GLY D 35  ? 0.2414 0.2092 0.2441 -0.0310 0.0752  -0.0159 40  GLY D N   
4252 C CA  . GLY D 35  ? 0.2585 0.2243 0.2586 -0.0290 0.0745  -0.0147 40  GLY D CA  
4253 C C   . GLY D 35  ? 0.2752 0.2312 0.2781 -0.0246 0.0762  -0.0104 40  GLY D C   
4254 O O   . GLY D 35  ? 0.2603 0.2109 0.2682 -0.0236 0.0795  -0.0087 40  GLY D O   
4255 N N   . THR D 36  ? 0.2593 0.2131 0.2588 -0.0217 0.0737  -0.0080 41  THR D N   
4256 C CA  . THR D 36  ? 0.2948 0.2400 0.2962 -0.0181 0.0758  -0.0042 41  THR D CA  
4257 C C   . THR D 36  ? 0.2943 0.2378 0.2903 -0.0136 0.0689  0.0005  41  THR D C   
4258 O O   . THR D 36  ? 0.2868 0.2349 0.2773 -0.0136 0.0646  -0.0003 41  THR D O   
4259 C CB  . THR D 36  ? 0.3519 0.2947 0.3541 -0.0211 0.0834  -0.0080 41  THR D CB  
4260 O OG1 . THR D 36  ? 0.4354 0.3834 0.4324 -0.0223 0.0809  -0.0100 41  THR D OG1 
4261 C CG2 . THR D 36  ? 0.3938 0.3379 0.3993 -0.0268 0.0906  -0.0137 41  THR D CG2 
4262 N N   . VAL D 37  ? 0.2840 0.2209 0.2813 -0.0100 0.0681  0.0058  42  VAL D N   
4263 C CA  . VAL D 37  ? 0.2895 0.2231 0.2807 -0.0065 0.0627  0.0100  42  VAL D CA  
4264 C C   . VAL D 37  ? 0.3040 0.2312 0.2973 -0.0048 0.0672  0.0124  42  VAL D C   
4265 O O   . VAL D 37  ? 0.3218 0.2464 0.3223 -0.0048 0.0725  0.0135  42  VAL D O   
4266 C CB  . VAL D 37  ? 0.3346 0.2672 0.3247 -0.0041 0.0559  0.0153  42  VAL D CB  
4267 C CG1 . VAL D 37  ? 0.3560 0.2845 0.3382 -0.0015 0.0507  0.0191  42  VAL D CG1 
4268 C CG2 . VAL D 37  ? 0.3651 0.3037 0.3544 -0.0055 0.0521  0.0133  42  VAL D CG2 
4269 N N   . THR D 38  ? 0.3045 0.2291 0.2917 -0.0034 0.0661  0.0130  43  THR D N   
4270 C CA  . THR D 38  ? 0.3253 0.2434 0.3127 -0.0010 0.0687  0.0167  43  THR D CA  
4271 C C   . THR D 38  ? 0.3279 0.2428 0.3079 0.0018  0.0614  0.0220  43  THR D C   
4272 O O   . THR D 38  ? 0.3346 0.2505 0.3069 0.0019  0.0564  0.0211  43  THR D O   
4273 C CB  . THR D 38  ? 0.3698 0.2868 0.3557 -0.0020 0.0738  0.0131  43  THR D CB  
4274 O OG1 . THR D 38  ? 0.4031 0.3222 0.3809 -0.0017 0.0695  0.0118  43  THR D OG1 
4275 C CG2 . THR D 38  ? 0.3743 0.2947 0.3661 -0.0062 0.0807  0.0072  43  THR D CG2 
4276 N N   . LEU D 39  ? 0.3255 0.2363 0.3073 0.0040  0.0611  0.0279  44  LEU D N   
4277 C CA  . LEU D 39  ? 0.3378 0.2457 0.3123 0.0056  0.0544  0.0330  44  LEU D CA  
4278 C C   . LEU D 39  ? 0.3410 0.2440 0.3153 0.0077  0.0563  0.0379  44  LEU D C   
4279 O O   . LEU D 39  ? 0.3567 0.2594 0.3398 0.0086  0.0614  0.0404  44  LEU D O   
4280 C CB  . LEU D 39  ? 0.3788 0.2897 0.3568 0.0055  0.0495  0.0370  44  LEU D CB  
4281 C CG  . LEU D 39  ? 0.4508 0.3603 0.4211 0.0057  0.0412  0.0420  44  LEU D CG  
4282 C CD1 . LEU D 39  ? 0.4471 0.3549 0.4059 0.0048  0.0370  0.0384  44  LEU D CD1 
4283 C CD2 . LEU D 39  ? 0.4744 0.3884 0.4519 0.0052  0.0382  0.0455  44  LEU D CD2 
4284 N N   . ASP D 40  ? 0.3329 0.2318 0.2970 0.0086  0.0528  0.0395  45  ASP D N   
4285 C CA  . ASP D 40  ? 0.3598 0.2541 0.3219 0.0105  0.0533  0.0452  45  ASP D CA  
4286 C C   . ASP D 40  ? 0.3767 0.2684 0.3276 0.0101  0.0454  0.0491  45  ASP D C   
4287 O O   . ASP D 40  ? 0.3764 0.2637 0.3166 0.0099  0.0440  0.0469  45  ASP D O   
4288 C CB  . ASP D 40  ? 0.4225 0.3130 0.3825 0.0113  0.0591  0.0422  45  ASP D CB  
4289 C CG  . ASP D 40  ? 0.4877 0.3736 0.4462 0.0134  0.0603  0.0482  45  ASP D CG  
4290 O OD1 . ASP D 40  ? 0.5263 0.4117 0.4811 0.0138  0.0549  0.0545  45  ASP D OD1 
4291 O OD2 . ASP D 40  ? 0.5494 0.4328 0.5105 0.0145  0.0667  0.0467  45  ASP D OD2 
4292 N N   . ARG D 41  ? 0.3534 0.2478 0.3068 0.0096  0.0405  0.0551  46  ARG D N   
4293 C CA  . ARG D 41  ? 0.3937 0.2862 0.3359 0.0079  0.0323  0.0585  46  ARG D CA  
4294 C C   . ARG D 41  ? 0.3863 0.2731 0.3188 0.0082  0.0313  0.0620  46  ARG D C   
4295 O O   . ARG D 41  ? 0.4055 0.2872 0.3242 0.0064  0.0269  0.0613  46  ARG D O   
4296 C CB  . ARG D 41  ? 0.4055 0.3037 0.3541 0.0068  0.0274  0.0644  46  ARG D CB  
4297 C CG  . ARG D 41  ? 0.4501 0.3524 0.4022 0.0055  0.0257  0.0604  46  ARG D CG  
4298 C CD  . ARG D 41  ? 0.4713 0.3796 0.4305 0.0045  0.0211  0.0662  46  ARG D CD  
4299 N NE  . ARG D 41  ? 0.4454 0.3576 0.4195 0.0067  0.0274  0.0681  46  ARG D NE  
4300 C CZ  . ARG D 41  ? 0.5331 0.4510 0.5176 0.0069  0.0266  0.0724  46  ARG D CZ  
4301 N NH1 . ARG D 41  ? 0.5372 0.4583 0.5187 0.0047  0.0190  0.0753  46  ARG D NH1 
4302 N NH2 . ARG D 41  ? 0.5265 0.4462 0.5242 0.0092  0.0340  0.0742  46  ARG D NH2 
4303 N N   . ALA D 42  ? 0.3667 0.2532 0.3056 0.0104  0.0362  0.0656  47  ALA D N   
4304 C CA  . ALA D 42  ? 0.3913 0.2726 0.3213 0.0110  0.0359  0.0691  47  ALA D CA  
4305 C C   . ALA D 42  ? 0.3987 0.2730 0.3181 0.0112  0.0384  0.0627  47  ALA D C   
4306 O O   . ALA D 42  ? 0.4220 0.2904 0.3275 0.0099  0.0350  0.0634  47  ALA D O   
4307 C CB  . ALA D 42  ? 0.3838 0.2665 0.3244 0.0138  0.0418  0.0741  47  ALA D CB  
4308 N N   . ALA D 43  ? 0.3817 0.2570 0.3070 0.0122  0.0442  0.0561  48  ALA D N   
4309 C CA  . ALA D 43  ? 0.3872 0.2576 0.3044 0.0126  0.0469  0.0505  48  ALA D CA  
4310 C C   . ALA D 43  ? 0.4389 0.3084 0.3481 0.0110  0.0432  0.0463  48  ALA D C   
4311 O O   . ALA D 43  ? 0.4552 0.3205 0.3570 0.0116  0.0452  0.0427  48  ALA D O   
4312 C CB  . ALA D 43  ? 0.3857 0.2590 0.3135 0.0138  0.0545  0.0460  48  ALA D CB  
4313 N N   . LYS D 44  ? 0.4109 0.2847 0.3226 0.0093  0.0384  0.0471  49  LYS D N   
4314 C CA  . LYS D 44  ? 0.4325 0.3060 0.3379 0.0078  0.0346  0.0439  49  LYS D CA  
4315 C C   . LYS D 44  ? 0.4190 0.2957 0.3288 0.0087  0.0392  0.0379  49  LYS D C   
4316 O O   . LYS D 44  ? 0.4242 0.2976 0.3260 0.0089  0.0392  0.0352  49  LYS D O   
4317 C CB  . LYS D 44  ? 0.4902 0.3551 0.3792 0.0065  0.0311  0.0448  49  LYS D CB  
4318 C CG  . LYS D 44  ? 0.5613 0.4239 0.4440 0.0043  0.0255  0.0509  49  LYS D CG  
4319 C CD  . LYS D 44  ? 0.6542 0.5067 0.5187 0.0024  0.0232  0.0509  49  LYS D CD  
4320 C CE  . LYS D 44  ? 0.7389 0.5903 0.5952 -0.0018 0.0156  0.0540  49  LYS D CE  
4321 N NZ  . LYS D 44  ? 0.8035 0.6605 0.6649 -0.0032 0.0115  0.0610  49  LYS D NZ  
4322 N N   . THR D 45  ? 0.4106 0.2936 0.3330 0.0091  0.0432  0.0362  50  THR D N   
4323 C CA  . THR D 45  ? 0.4228 0.3106 0.3502 0.0090  0.0472  0.0307  50  THR D CA  
4324 C C   . THR D 45  ? 0.3799 0.2754 0.3185 0.0076  0.0477  0.0293  50  THR D C   
4325 O O   . THR D 45  ? 0.3610 0.2575 0.3053 0.0074  0.0466  0.0327  50  THR D O   
4326 C CB  . THR D 45  ? 0.4337 0.3209 0.3641 0.0100  0.0540  0.0287  50  THR D CB  
4327 O OG1 . THR D 45  ? 0.4977 0.3860 0.4372 0.0100  0.0576  0.0302  50  THR D OG1 
4328 C CG2 . THR D 45  ? 0.4940 0.3733 0.4141 0.0116  0.0547  0.0302  50  THR D CG2 
4329 N N   . GLY D 46  ? 0.3217 0.2228 0.2636 0.0065  0.0496  0.0246  51  GLY D N   
4330 C CA  . GLY D 46  ? 0.2983 0.2061 0.2501 0.0048  0.0516  0.0223  51  GLY D CA  
4331 C C   . GLY D 46  ? 0.2954 0.2100 0.2482 0.0033  0.0524  0.0176  51  GLY D C   
4332 O O   . GLY D 46  ? 0.2897 0.2039 0.2362 0.0041  0.0515  0.0169  51  GLY D O   
4333 N N   . THR D 47  ? 0.2880 0.2088 0.2489 0.0010  0.0550  0.0147  52  THR D N   
4334 C CA  . THR D 47  ? 0.2955 0.2245 0.2583 -0.0012 0.0561  0.0104  52  THR D CA  
4335 C C   . THR D 47  ? 0.2927 0.2272 0.2613 -0.0033 0.0551  0.0089  52  THR D C   
4336 O O   . THR D 47  ? 0.3151 0.2474 0.2886 -0.0036 0.0561  0.0102  52  THR D O   
4337 C CB  . THR D 47  ? 0.3431 0.2753 0.3097 -0.0034 0.0624  0.0067  52  THR D CB  
4338 O OG1 . THR D 47  ? 0.4019 0.3333 0.3756 -0.0054 0.0671  0.0053  52  THR D OG1 
4339 C CG2 . THR D 47  ? 0.3592 0.2860 0.3210 -0.0012 0.0641  0.0082  52  THR D CG2 
4340 N N   . VAL D 48  ? 0.2608 0.2023 0.2287 -0.0046 0.0532  0.0069  53  VAL D N   
4341 C CA  . VAL D 48  ? 0.2597 0.2072 0.2324 -0.0070 0.0525  0.0051  53  VAL D CA  
4342 C C   . VAL D 48  ? 0.2636 0.2204 0.2389 -0.0107 0.0557  0.0006  53  VAL D C   
4343 O O   . VAL D 48  ? 0.2609 0.2215 0.2330 -0.0103 0.0552  0.0005  53  VAL D O   
4344 C CB  . VAL D 48  ? 0.2787 0.2270 0.2478 -0.0053 0.0462  0.0075  53  VAL D CB  
4345 C CG1 . VAL D 48  ? 0.3005 0.2556 0.2744 -0.0076 0.0455  0.0057  53  VAL D CG1 
4346 C CG2 . VAL D 48  ? 0.2944 0.2344 0.2605 -0.0028 0.0424  0.0121  53  VAL D CG2 
4347 N N   . ASP D 49  ? 0.2392 0.2003 0.2202 -0.0146 0.0590  -0.0027 54  ASP D N   
4348 C CA  . ASP D 49  ? 0.2603 0.2314 0.2428 -0.0191 0.0609  -0.0068 54  ASP D CA  
4349 C C   . ASP D 49  ? 0.2585 0.2334 0.2442 -0.0216 0.0604  -0.0084 54  ASP D C   
4350 O O   . ASP D 49  ? 0.2844 0.2548 0.2741 -0.0229 0.0640  -0.0096 54  ASP D O   
4351 C CB  . ASP D 49  ? 0.3092 0.2803 0.2940 -0.0230 0.0675  -0.0106 54  ASP D CB  
4352 C CG  . ASP D 49  ? 0.3735 0.3561 0.3593 -0.0292 0.0696  -0.0150 54  ASP D CG  
4353 O OD1 . ASP D 49  ? 0.4837 0.4750 0.4691 -0.0306 0.0663  -0.0151 54  ASP D OD1 
4354 O OD2 . ASP D 49  ? 0.4871 0.4705 0.4741 -0.0330 0.0747  -0.0182 54  ASP D OD2 
4355 N N   . VAL D 50  ? 0.2238 0.2065 0.2082 -0.0219 0.0563  -0.0080 55  VAL D N   
4356 C CA  . VAL D 50  ? 0.2420 0.2283 0.2291 -0.0241 0.0557  -0.0094 55  VAL D CA  
4357 C C   . VAL D 50  ? 0.2486 0.2473 0.2354 -0.0282 0.0552  -0.0118 55  VAL D C   
4358 O O   . VAL D 50  ? 0.2735 0.2786 0.2579 -0.0274 0.0531  -0.0104 55  VAL D O   
4359 C CB  . VAL D 50  ? 0.2689 0.2507 0.2550 -0.0194 0.0502  -0.0049 55  VAL D CB  
4360 C CG1 . VAL D 50  ? 0.3102 0.2936 0.2913 -0.0161 0.0454  -0.0019 55  VAL D CG1 
4361 C CG2 . VAL D 50  ? 0.2951 0.2805 0.2842 -0.0210 0.0492  -0.0057 55  VAL D CG2 
4362 N N   . THR D 51  ? 0.2231 0.2254 0.2123 -0.0324 0.0573  -0.0150 56  THR D N   
4363 C CA  . THR D 51  ? 0.2252 0.2400 0.2138 -0.0369 0.0565  -0.0171 56  THR D CA  
4364 C C   . THR D 51  ? 0.2289 0.2448 0.2190 -0.0369 0.0548  -0.0170 56  THR D C   
4365 O O   . THR D 51  ? 0.2475 0.2554 0.2401 -0.0367 0.0574  -0.0178 56  THR D O   
4366 C CB  . THR D 51  ? 0.2659 0.2853 0.2549 -0.0445 0.0624  -0.0227 56  THR D CB  
4367 O OG1 . THR D 51  ? 0.3252 0.3428 0.3133 -0.0442 0.0643  -0.0227 56  THR D OG1 
4368 C CG2 . THR D 51  ? 0.2740 0.3081 0.2618 -0.0499 0.0610  -0.0243 56  THR D CG2 
4369 N N   . THR D 52  ? 0.2008 0.2265 0.1898 -0.0372 0.0509  -0.0156 57  THR D N   
4370 C CA  . THR D 52  ? 0.2121 0.2399 0.2024 -0.0371 0.0488  -0.0151 57  THR D CA  
4371 C C   . THR D 52  ? 0.2170 0.2584 0.2064 -0.0429 0.0492  -0.0176 57  THR D C   
4372 O O   . THR D 52  ? 0.2202 0.2721 0.2082 -0.0444 0.0477  -0.0166 57  THR D O   
4373 C CB  . THR D 52  ? 0.2397 0.2658 0.2288 -0.0304 0.0427  -0.0094 57  THR D CB  
4374 O OG1 . THR D 52  ? 0.2274 0.2413 0.2165 -0.0260 0.0421  -0.0072 57  THR D OG1 
4375 C CG2 . THR D 52  ? 0.2509 0.2794 0.2414 -0.0299 0.0403  -0.0085 57  THR D CG2 
4376 N N   . ASP D 53  ? 0.2292 0.2711 0.2194 -0.0467 0.0514  -0.0206 58  ASP D N   
4377 C CA  . ASP D 53  ? 0.2340 0.2887 0.2227 -0.0531 0.0519  -0.0232 58  ASP D CA  
4378 C C   . ASP D 53  ? 0.2046 0.2677 0.1934 -0.0499 0.0462  -0.0188 58  ASP D C   
4379 O O   . ASP D 53  ? 0.2176 0.2757 0.2080 -0.0465 0.0446  -0.0171 58  ASP D O   
4380 C CB  . ASP D 53  ? 0.2692 0.3190 0.2580 -0.0583 0.0574  -0.0283 58  ASP D CB  
4381 C CG  . ASP D 53  ? 0.3638 0.4069 0.3520 -0.0632 0.0644  -0.0334 58  ASP D CG  
4382 O OD1 . ASP D 53  ? 0.3984 0.4419 0.3860 -0.0632 0.0647  -0.0333 58  ASP D OD1 
4383 O OD2 . ASP D 53  ? 0.4165 0.4532 0.4048 -0.0669 0.0701  -0.0374 58  ASP D OD2 
4384 N N   . ILE D 54  ? 0.1917 0.2682 0.1794 -0.0512 0.0435  -0.0166 59  ILE D N   
4385 C CA  . ILE D 54  ? 0.1910 0.2757 0.1794 -0.0479 0.0389  -0.0119 59  ILE D CA  
4386 C C   . ILE D 54  ? 0.1963 0.2843 0.1846 -0.0510 0.0392  -0.0138 59  ILE D C   
4387 O O   . ILE D 54  ? 0.1928 0.2812 0.1823 -0.0469 0.0360  -0.0103 59  ILE D O   
4388 C CB  . ILE D 54  ? 0.2037 0.3043 0.1918 -0.0495 0.0371  -0.0088 59  ILE D CB  
4389 C CG1 . ILE D 54  ? 0.2284 0.3249 0.2168 -0.0451 0.0368  -0.0060 59  ILE D CG1 
4390 C CG2 . ILE D 54  ? 0.2239 0.3349 0.2130 -0.0471 0.0333  -0.0039 59  ILE D CG2 
4391 C CD1 . ILE D 54  ? 0.2345 0.3197 0.2230 -0.0363 0.0343  -0.0017 59  ILE D CD1 
4392 N N   . ALA D 55  ? 0.1944 0.2860 0.1808 -0.0593 0.0434  -0.0194 60  ALA D N   
4393 C CA  . ALA D 55  ? 0.2193 0.3130 0.2048 -0.0628 0.0445  -0.0217 60  ALA D CA  
4394 C C   . ALA D 55  ? 0.2117 0.2916 0.1996 -0.0587 0.0458  -0.0219 60  ALA D C   
4395 O O   . ALA D 55  ? 0.2130 0.2945 0.2008 -0.0604 0.0463  -0.0228 60  ALA D O   
4396 C CB  . ALA D 55  ? 0.2246 0.3224 0.2063 -0.0732 0.0497  -0.0284 60  ALA D CB  
4397 N N   . SER D 56  ? 0.2014 0.2689 0.1917 -0.0532 0.0459  -0.0205 61  SER D N   
4398 C CA  . SER D 56  ? 0.1891 0.2443 0.1827 -0.0491 0.0467  -0.0196 61  SER D CA  
4399 C C   . SER D 56  ? 0.1775 0.2316 0.1729 -0.0418 0.0407  -0.0136 61  SER D C   
4400 O O   . SER D 56  ? 0.1731 0.2176 0.1716 -0.0378 0.0401  -0.0117 61  SER D O   
4401 C CB  . SER D 56  ? 0.1851 0.2278 0.1803 -0.0480 0.0506  -0.0210 61  SER D CB  
4402 O OG  . SER D 56  ? 0.1913 0.2302 0.1868 -0.0426 0.0472  -0.0173 61  SER D OG  
4403 N N   . ILE D 57  ? 0.1933 0.2574 0.1872 -0.0404 0.0365  -0.0105 62  ILE D N   
4404 C CA  . ILE D 57  ? 0.1848 0.2475 0.1797 -0.0341 0.0316  -0.0052 62  ILE D CA  
4405 C C   . ILE D 57  ? 0.1914 0.2529 0.1885 -0.0338 0.0312  -0.0049 62  ILE D C   
4406 O O   . ILE D 57  ? 0.1770 0.2444 0.1738 -0.0385 0.0336  -0.0078 62  ILE D O   
4407 C CB  . ILE D 57  ? 0.2259 0.2993 0.2194 -0.0321 0.0282  -0.0012 62  ILE D CB  
4408 C CG1 . ILE D 57  ? 0.2335 0.3007 0.2272 -0.0251 0.0243  0.0038  62  ILE D CG1 
4409 C CG2 . ILE D 57  ? 0.2131 0.3005 0.2063 -0.0363 0.0282  -0.0015 62  ILE D CG2 
4410 C CD1 . ILE D 57  ? 0.2534 0.3283 0.2458 -0.0220 0.0223  0.0084  62  ILE D CD1 
4411 N N   . HIS D 58  ? 0.1654 0.2189 0.1644 -0.0283 0.0281  -0.0012 63  HIS D N   
4412 C CA  . HIS D 58  ? 0.1699 0.2223 0.1715 -0.0270 0.0268  0.0002  63  HIS D CA  
4413 C C   . HIS D 58  ? 0.1709 0.2221 0.1721 -0.0215 0.0217  0.0054  63  HIS D C   
4414 O O   . HIS D 58  ? 0.1864 0.2285 0.1874 -0.0182 0.0198  0.0075  63  HIS D O   
4415 C CB  . HIS D 58  ? 0.1895 0.2311 0.1949 -0.0267 0.0292  -0.0006 63  HIS D CB  
4416 C CG  . HIS D 58  ? 0.2399 0.2811 0.2487 -0.0260 0.0288  0.0007  63  HIS D CG  
4417 N ND1 . HIS D 58  ? 0.2973 0.3350 0.3079 -0.0215 0.0243  0.0053  63  HIS D ND1 
4418 C CD2 . HIS D 58  ? 0.2650 0.3090 0.2751 -0.0294 0.0325  -0.0018 63  HIS D CD2 
4419 C CE1 . HIS D 58  ? 0.2504 0.2891 0.2644 -0.0220 0.0251  0.0057  63  HIS D CE1 
4420 N NE2 . HIS D 58  ? 0.3015 0.3436 0.3151 -0.0266 0.0303  0.0013  63  HIS D NE2 
4421 N N   . THR D 59  ? 0.1684 0.2280 0.1694 -0.0211 0.0200  0.0074  64  THR D N   
4422 C CA  . THR D 59  ? 0.1961 0.2550 0.1968 -0.0163 0.0162  0.0121  64  THR D CA  
4423 C C   . THR D 59  ? 0.1967 0.2527 0.2003 -0.0149 0.0147  0.0138  64  THR D C   
4424 O O   . THR D 59  ? 0.2241 0.2763 0.2273 -0.0112 0.0118  0.0174  64  THR D O   
4425 C CB  . THR D 59  ? 0.1970 0.2682 0.1962 -0.0159 0.0157  0.0145  64  THR D CB  
4426 O OG1 . THR D 59  ? 0.1966 0.2777 0.1972 -0.0195 0.0169  0.0131  64  THR D OG1 
4427 C CG2 . THR D 59  ? 0.2297 0.3048 0.2267 -0.0167 0.0167  0.0142  64  THR D CG2 
4428 N N   . GLY D 60  ? 0.1927 0.2498 0.1990 -0.0180 0.0171  0.0112  65  GLY D N   
4429 C CA  . GLY D 60  ? 0.1954 0.2522 0.2049 -0.0172 0.0163  0.0127  65  GLY D CA  
4430 C C   . GLY D 60  ? 0.1945 0.2627 0.2036 -0.0194 0.0174  0.0122  65  GLY D C   
4431 O O   . GLY D 60  ? 0.2074 0.2761 0.2192 -0.0198 0.0180  0.0124  65  GLY D O   
4432 N N   . SER D 61  ? 0.2132 0.2914 0.2193 -0.0206 0.0174  0.0124  66  SER D N   
4433 C CA  . SER D 61  ? 0.2489 0.3406 0.2542 -0.0235 0.0181  0.0125  66  SER D CA  
4434 C C   . SER D 61  ? 0.2406 0.3394 0.2431 -0.0297 0.0212  0.0081  66  SER D C   
4435 O O   . SER D 61  ? 0.2322 0.3337 0.2329 -0.0300 0.0209  0.0082  66  SER D O   
4436 C CB  . SER D 61  ? 0.2423 0.3419 0.2469 -0.0199 0.0154  0.0176  66  SER D CB  
4437 O OG  . SER D 61  ? 0.3113 0.4261 0.3152 -0.0231 0.0160  0.0184  66  SER D OG  
4438 N N   . ALA D 62  ? 0.2610 0.3611 0.2628 -0.0348 0.0245  0.0041  67  ALA D N   
4439 C CA  . ALA D 62  ? 0.2808 0.3865 0.2789 -0.0420 0.0281  -0.0009 67  ALA D CA  
4440 C C   . ALA D 62  ? 0.2746 0.3974 0.2700 -0.0449 0.0263  0.0010  67  ALA D C   
4441 O O   . ALA D 62  ? 0.2421 0.3702 0.2350 -0.0488 0.0272  -0.0008 67  ALA D O   
4442 C CB  . ALA D 62  ? 0.3183 0.4219 0.3154 -0.0472 0.0327  -0.0055 67  ALA D CB  
4443 N N   . LYS D 63  ? 0.2664 0.3976 0.2630 -0.0420 0.0234  0.0059  68  LYS D N   
4444 C CA  . LYS D 63  ? 0.2893 0.4372 0.2848 -0.0432 0.0213  0.0097  68  LYS D CA  
4445 C C   . LYS D 63  ? 0.2727 0.4213 0.2696 -0.0389 0.0194  0.0136  68  LYS D C   
4446 O O   . LYS D 63  ? 0.2427 0.4038 0.2383 -0.0421 0.0192  0.0147  68  LYS D O   
4447 C CB  . LYS D 63  ? 0.3470 0.5035 0.3444 -0.0404 0.0192  0.0149  68  LYS D CB  
4448 C CG  . LYS D 63  ? 0.4614 0.6348 0.4559 -0.0470 0.0196  0.0148  68  LYS D CG  
4449 C CD  . LYS D 63  ? 0.5156 0.6852 0.5060 -0.0544 0.0233  0.0076  68  LYS D CD  
4450 C CE  . LYS D 63  ? 0.5504 0.7374 0.5373 -0.0607 0.0231  0.0085  68  LYS D CE  
4451 N NZ  . LYS D 63  ? 0.5729 0.7582 0.5541 -0.0692 0.0273  0.0014  68  LYS D NZ  
4452 N N   . LEU D 64  ? 0.2471 0.3830 0.2461 -0.0320 0.0181  0.0157  69  LEU D N   
4453 C CA  . LEU D 64  ? 0.2421 0.3767 0.2414 -0.0282 0.0171  0.0188  69  LEU D CA  
4454 C C   . LEU D 64  ? 0.2596 0.3907 0.2568 -0.0323 0.0192  0.0140  69  LEU D C   
4455 O O   . LEU D 64  ? 0.2642 0.4021 0.2610 -0.0327 0.0191  0.0157  69  LEU D O   
4456 C CB  . LEU D 64  ? 0.2457 0.3670 0.2464 -0.0208 0.0155  0.0219  69  LEU D CB  
4457 C CG  . LEU D 64  ? 0.2688 0.3850 0.2686 -0.0169 0.0152  0.0242  69  LEU D CG  
4458 C CD1 . LEU D 64  ? 0.2746 0.4048 0.2755 -0.0151 0.0151  0.0300  69  LEU D CD1 
4459 C CD2 . LEU D 64  ? 0.2944 0.3955 0.2939 -0.0109 0.0139  0.0263  69  LEU D CD2 
4460 N N   . ASP D 65  ? 0.2441 0.3642 0.2406 -0.0350 0.0214  0.0083  70  ASP D N   
4461 C CA  . ASP D 65  ? 0.2400 0.3555 0.2347 -0.0387 0.0241  0.0038  70  ASP D CA  
4462 C C   . ASP D 65  ? 0.2251 0.3562 0.2174 -0.0458 0.0252  0.0022  70  ASP D C   
4463 O O   . ASP D 65  ? 0.2082 0.3404 0.1996 -0.0473 0.0261  0.0013  70  ASP D O   
4464 C CB  . ASP D 65  ? 0.2486 0.3528 0.2431 -0.0418 0.0276  -0.0018 70  ASP D CB  
4465 C CG  . ASP D 65  ? 0.2829 0.3723 0.2804 -0.0360 0.0266  -0.0003 70  ASP D CG  
4466 O OD1 . ASP D 65  ? 0.2860 0.3717 0.2843 -0.0301 0.0233  0.0039  70  ASP D OD1 
4467 O OD2 . ASP D 65  ? 0.2667 0.3482 0.2657 -0.0375 0.0295  -0.0033 70  ASP D OD2 
4468 N N   . GLU D 66  ? 0.2321 0.3731 0.2231 -0.0505 0.0256  0.0013  71  GLU D N   
4469 C CA  . GLU D 66  ? 0.2584 0.4165 0.2462 -0.0588 0.0262  0.0000  71  GLU D CA  
4470 C C   . GLU D 66  ? 0.2516 0.4239 0.2416 -0.0561 0.0230  0.0069  71  GLU D C   
4471 O O   . GLU D 66  ? 0.2439 0.4237 0.2330 -0.0597 0.0234  0.0067  71  GLU D O   
4472 C CB  . GLU D 66  ? 0.3001 0.4655 0.2858 -0.0635 0.0268  -0.0013 71  GLU D CB  
4473 C CG  . GLU D 66  ? 0.3778 0.5312 0.3606 -0.0681 0.0315  -0.0086 71  GLU D CG  
4474 C CD  . GLU D 66  ? 0.4925 0.6526 0.4726 -0.0727 0.0324  -0.0099 71  GLU D CD  
4475 O OE1 . GLU D 66  ? 0.6283 0.7767 0.6085 -0.0724 0.0356  -0.0132 71  GLU D OE1 
4476 O OE2 . GLU D 66  ? 0.5969 0.7745 0.5752 -0.0763 0.0300  -0.0069 71  GLU D OE2 
4477 N N   . HIS D 67  ? 0.2344 0.4096 0.2276 -0.0492 0.0202  0.0136  72  HIS D N   
4478 C CA  . HIS D 67  ? 0.2745 0.4621 0.2707 -0.0453 0.0181  0.0212  72  HIS D CA  
4479 C C   . HIS D 67  ? 0.2573 0.4391 0.2546 -0.0419 0.0185  0.0224  72  HIS D C   
4480 O O   . HIS D 67  ? 0.3015 0.4956 0.3003 -0.0427 0.0182  0.0263  72  HIS D O   
4481 C CB  . HIS D 67  ? 0.3060 0.4935 0.3055 -0.0377 0.0162  0.0277  72  HIS D CB  
4482 C CG  . HIS D 67  ? 0.4392 0.6377 0.4424 -0.0327 0.0151  0.0363  72  HIS D CG  
4483 N ND1 . HIS D 67  ? 0.4806 0.7006 0.4853 -0.0366 0.0142  0.0409  72  HIS D ND1 
4484 C CD2 . HIS D 67  ? 0.4826 0.6739 0.4883 -0.0244 0.0152  0.0415  72  HIS D CD2 
4485 C CE1 . HIS D 67  ? 0.5279 0.7538 0.5370 -0.0302 0.0141  0.0492  72  HIS D CE1 
4486 N NE2 . HIS D 67  ? 0.5668 0.7749 0.5762 -0.0227 0.0150  0.0494  72  HIS D NE2 
4487 N N   . LEU D 68  ? 0.2162 0.3790 0.2128 -0.0379 0.0195  0.0193  73  LEU D N   
4488 C CA  . LEU D 68  ? 0.2120 0.3682 0.2088 -0.0349 0.0202  0.0200  73  LEU D CA  
4489 C C   . LEU D 68  ? 0.2284 0.3889 0.2235 -0.0417 0.0221  0.0157  73  LEU D C   
4490 O O   . LEU D 68  ? 0.2133 0.3730 0.2090 -0.0398 0.0226  0.0173  73  LEU D O   
4491 C CB  . LEU D 68  ? 0.2202 0.3553 0.2162 -0.0296 0.0204  0.0179  73  LEU D CB  
4492 C CG  . LEU D 68  ? 0.2590 0.3883 0.2563 -0.0225 0.0186  0.0226  73  LEU D CG  
4493 C CD1 . LEU D 68  ? 0.2414 0.3514 0.2372 -0.0192 0.0185  0.0201  73  LEU D CD1 
4494 C CD2 . LEU D 68  ? 0.2969 0.4312 0.2955 -0.0173 0.0183  0.0294  73  LEU D CD2 
4495 N N   . GLN D 69  ? 0.2339 0.3981 0.2264 -0.0498 0.0237  0.0099  74  GLN D N   
4496 C CA  . GLN D 69  ? 0.2440 0.4122 0.2345 -0.0570 0.0259  0.0055  74  GLN D CA  
4497 C C   . GLN D 69  ? 0.2580 0.4485 0.2496 -0.0612 0.0243  0.0102  74  GLN D C   
4498 O O   . GLN D 69  ? 0.2765 0.4726 0.2674 -0.0660 0.0254  0.0087  74  GLN D O   
4499 C CB  . GLN D 69  ? 0.2392 0.4046 0.2257 -0.0654 0.0289  -0.0021 74  GLN D CB  
4500 C CG  . GLN D 69  ? 0.2803 0.4268 0.2663 -0.0628 0.0311  -0.0065 74  GLN D CG  
4501 C CD  . GLN D 69  ? 0.2987 0.4303 0.2857 -0.0590 0.0327  -0.0080 74  GLN D CD  
4502 O OE1 . GLN D 69  ? 0.2747 0.4059 0.2602 -0.0632 0.0353  -0.0113 74  GLN D OE1 
4503 N NE2 . GLN D 69  ? 0.3058 0.4256 0.2950 -0.0510 0.0311  -0.0052 74  GLN D NE2 
4504 N N   . THR D 70  ? 0.2629 0.4654 0.2568 -0.0587 0.0217  0.0164  75  THR D N   
4505 C CA  . THR D 70  ? 0.2702 0.4964 0.2661 -0.0627 0.0199  0.0222  75  THR D CA  
4506 C C   . THR D 70  ? 0.2909 0.5206 0.2914 -0.0568 0.0196  0.0289  75  THR D C   
4507 O O   . THR D 70  ? 0.2795 0.4936 0.2810 -0.0492 0.0206  0.0295  75  THR D O   
4508 C CB  . THR D 70  ? 0.2463 0.4852 0.2440 -0.0614 0.0174  0.0279  75  THR D CB  
4509 O OG1 . THR D 70  ? 0.2894 0.5237 0.2916 -0.0507 0.0165  0.0350  75  THR D OG1 
4510 C CG2 . THR D 70  ? 0.2607 0.4950 0.2542 -0.0658 0.0180  0.0222  75  THR D CG2 
4511 N N   . ALA D 71  ? 0.3085 0.5597 0.3117 -0.0608 0.0183  0.0344  76  ALA D N   
4512 C CA  . ALA D 71  ? 0.3257 0.5823 0.3338 -0.0561 0.0187  0.0410  76  ALA D CA  
4513 C C   . ALA D 71  ? 0.3268 0.5801 0.3395 -0.0447 0.0185  0.0495  76  ALA D C   
4514 O O   . ALA D 71  ? 0.3797 0.6314 0.3959 -0.0388 0.0199  0.0546  76  ALA D O   
4515 C CB  . ALA D 71  ? 0.3538 0.6361 0.3643 -0.0636 0.0171  0.0456  76  ALA D CB  
4516 N N   . GLU D 72  ? 0.3285 0.5798 0.3411 -0.0416 0.0174  0.0509  77  GLU D N   
4517 C CA  . GLU D 72  ? 0.3906 0.6341 0.4065 -0.0306 0.0182  0.0577  77  GLU D CA  
4518 C C   . GLU D 72  ? 0.3890 0.6073 0.4019 -0.0247 0.0199  0.0533  77  GLU D C   
4519 O O   . GLU D 72  ? 0.4233 0.6326 0.4377 -0.0160 0.0212  0.0582  77  GLU D O   
4520 C CB  . GLU D 72  ? 0.4279 0.6740 0.4440 -0.0291 0.0167  0.0596  77  GLU D CB  
4521 C CG  . GLU D 72  ? 0.4959 0.7674 0.5144 -0.0351 0.0146  0.0642  77  GLU D CG  
4522 C CD  . GLU D 72  ? 0.5595 0.8358 0.5803 -0.0308 0.0138  0.0696  77  GLU D CD  
4523 O OE1 . GLU D 72  ? 0.5420 0.8015 0.5606 -0.0266 0.0142  0.0663  77  GLU D OE1 
4524 O OE2 . GLU D 72  ? 0.7091 1.0069 0.7343 -0.0317 0.0126  0.0779  77  GLU D OE2 
4525 N N   . PHE D 73  ? 0.3369 0.5432 0.3453 -0.0294 0.0204  0.0443  78  PHE D N   
4526 C CA  . PHE D 73  ? 0.3299 0.5140 0.3356 -0.0241 0.0218  0.0410  78  PHE D CA  
4527 C C   . PHE D 73  ? 0.3440 0.5221 0.3472 -0.0288 0.0232  0.0347  78  PHE D C   
4528 O O   . PHE D 73  ? 0.3013 0.4848 0.3063 -0.0286 0.0243  0.0375  78  PHE D O   
4529 C CB  . PHE D 73  ? 0.3295 0.4994 0.3327 -0.0217 0.0208  0.0377  78  PHE D CB  
4530 C CG  . PHE D 73  ? 0.3067 0.4566 0.3079 -0.0146 0.0216  0.0378  78  PHE D CG  
4531 C CD1 . PHE D 73  ? 0.3522 0.4993 0.3547 -0.0073 0.0221  0.0442  78  PHE D CD1 
4532 C CD2 . PHE D 73  ? 0.2975 0.4313 0.2953 -0.0157 0.0221  0.0314  78  PHE D CD2 
4533 C CE1 . PHE D 73  ? 0.4076 0.5356 0.4069 -0.0016 0.0229  0.0440  78  PHE D CE1 
4534 C CE2 . PHE D 73  ? 0.3048 0.4212 0.3000 -0.0099 0.0223  0.0317  78  PHE D CE2 
4535 C CZ  . PHE D 73  ? 0.3520 0.4649 0.3473 -0.0033 0.0226  0.0375  78  PHE D CZ  
4536 N N   . PHE D 74  ? 0.2913 0.4585 0.2909 -0.0332 0.0236  0.0266  79  PHE D N   
4537 C CA  . PHE D 74  ? 0.3093 0.4684 0.3068 -0.0364 0.0257  0.0212  79  PHE D CA  
4538 C C   . PHE D 74  ? 0.3089 0.4838 0.3069 -0.0445 0.0265  0.0200  79  PHE D C   
4539 O O   . PHE D 74  ? 0.3091 0.4802 0.3067 -0.0459 0.0283  0.0179  79  PHE D O   
4540 C CB  . PHE D 74  ? 0.2618 0.4050 0.2560 -0.0388 0.0268  0.0134  79  PHE D CB  
4541 C CG  . PHE D 74  ? 0.2508 0.3766 0.2442 -0.0314 0.0261  0.0141  79  PHE D CG  
4542 C CD1 . PHE D 74  ? 0.2527 0.3679 0.2453 -0.0259 0.0266  0.0162  79  PHE D CD1 
4543 C CD2 . PHE D 74  ? 0.2700 0.3896 0.2630 -0.0307 0.0250  0.0126  79  PHE D CD2 
4544 C CE1 . PHE D 74  ? 0.2524 0.3515 0.2432 -0.0201 0.0256  0.0167  79  PHE D CE1 
4545 C CE2 . PHE D 74  ? 0.2618 0.3661 0.2539 -0.0247 0.0240  0.0135  79  PHE D CE2 
4546 C CZ  . PHE D 74  ? 0.2591 0.3538 0.2499 -0.0199 0.0241  0.0155  79  PHE D CZ  
4547 N N   . ASP D 75  ? 0.3692 0.5615 0.3680 -0.0502 0.0250  0.0213  80  ASP D N   
4548 C CA  . ASP D 75  ? 0.3757 0.5846 0.3741 -0.0599 0.0254  0.0197  80  ASP D CA  
4549 C C   . ASP D 75  ? 0.3616 0.5582 0.3555 -0.0663 0.0286  0.0100  80  ASP D C   
4550 O O   . ASP D 75  ? 0.3292 0.5260 0.3233 -0.0688 0.0303  0.0086  80  ASP D O   
4551 C CB  . ASP D 75  ? 0.4127 0.6333 0.4157 -0.0573 0.0252  0.0270  80  ASP D CB  
4552 C CG  . ASP D 75  ? 0.4866 0.7319 0.4913 -0.0658 0.0237  0.0299  80  ASP D CG  
4553 O OD1 . ASP D 75  ? 0.5069 0.7587 0.5077 -0.0751 0.0232  0.0246  80  ASP D OD1 
4554 O OD2 . ASP D 75  ? 0.4368 0.6953 0.4468 -0.0635 0.0232  0.0376  80  ASP D OD2 
4555 N N   . ALA D 76  ? 0.3115 0.4962 0.3021 -0.0680 0.0298  0.0039  81  ALA D N   
4556 C CA  . ALA D 76  ? 0.3381 0.5074 0.3254 -0.0718 0.0338  -0.0044 81  ALA D CA  
4557 C C   . ALA D 76  ? 0.3719 0.5503 0.3560 -0.0832 0.0363  -0.0096 81  ALA D C   
4558 O O   . ALA D 76  ? 0.3691 0.5375 0.3512 -0.0867 0.0402  -0.0154 81  ALA D O   
4559 C CB  . ALA D 76  ? 0.3458 0.5015 0.3312 -0.0707 0.0350  -0.0086 81  ALA D CB  
4560 N N   . ALA D 77  ? 0.3498 0.5476 0.3332 -0.0897 0.0342  -0.0076 82  ALA D N   
4561 C CA  . ALA D 77  ? 0.3418 0.5506 0.3214 -0.1018 0.0360  -0.0121 82  ALA D CA  
4562 C C   . ALA D 77  ? 0.3377 0.5474 0.3198 -0.1014 0.0370  -0.0108 82  ALA D C   
4563 O O   . ALA D 77  ? 0.3705 0.5735 0.3497 -0.1075 0.0410  -0.0173 82  ALA D O   
4564 C CB  . ALA D 77  ? 0.3252 0.5576 0.3043 -0.1080 0.0324  -0.0079 82  ALA D CB  
4565 N N   . LYS D 78  ? 0.3375 0.5539 0.3252 -0.0934 0.0339  -0.0022 83  LYS D N   
4566 C CA  . LYS D 78  ? 0.3697 0.5882 0.3607 -0.0914 0.0345  0.0006  83  LYS D CA  
4567 C C   . LYS D 78  ? 0.3401 0.5359 0.3310 -0.0843 0.0374  -0.0021 83  LYS D C   
4568 O O   . LYS D 78  ? 0.3128 0.5039 0.3033 -0.0868 0.0402  -0.0052 83  LYS D O   
4569 C CB  . LYS D 78  ? 0.4165 0.6514 0.4137 -0.0850 0.0306  0.0119  83  LYS D CB  
4570 C CG  . LYS D 78  ? 0.4297 0.6663 0.4318 -0.0794 0.0311  0.0177  83  LYS D CG  
4571 C CD  . LYS D 78  ? 0.4462 0.6972 0.4488 -0.0888 0.0317  0.0169  83  LYS D CD  
4572 C CE  . LYS D 78  ? 0.4220 0.6742 0.4301 -0.0827 0.0327  0.0230  83  LYS D CE  
4573 N NZ  . LYS D 78  ? 0.4356 0.6927 0.4423 -0.0925 0.0346  0.0182  83  LYS D NZ  
4574 N N   . PHE D 79  ? 0.3387 0.5203 0.3296 -0.0760 0.0368  -0.0015 84  PHE D N   
4575 C CA  . PHE D 79  ? 0.3130 0.4741 0.3039 -0.0685 0.0386  -0.0027 84  PHE D CA  
4576 C C   . PHE D 79  ? 0.3237 0.4683 0.3119 -0.0675 0.0401  -0.0081 84  PHE D C   
4577 O O   . PHE D 79  ? 0.2776 0.4152 0.2666 -0.0604 0.0379  -0.0053 84  PHE D O   
4578 C CB  . PHE D 79  ? 0.3501 0.5096 0.3442 -0.0579 0.0362  0.0052  84  PHE D CB  
4579 C CG  . PHE D 79  ? 0.3550 0.5308 0.3531 -0.0572 0.0352  0.0121  84  PHE D CG  
4580 C CD1 . PHE D 79  ? 0.4046 0.5808 0.4037 -0.0588 0.0374  0.0118  84  PHE D CD1 
4581 C CD2 . PHE D 79  ? 0.3391 0.5293 0.3407 -0.0541 0.0324  0.0198  84  PHE D CD2 
4582 C CE1 . PHE D 79  ? 0.3934 0.5849 0.3971 -0.0576 0.0366  0.0191  84  PHE D CE1 
4583 C CE2 . PHE D 79  ? 0.3564 0.5617 0.3628 -0.0525 0.0319  0.0276  84  PHE D CE2 
4584 C CZ  . PHE D 79  ? 0.3438 0.5501 0.3514 -0.0544 0.0340  0.0272  84  PHE D CZ  
4585 N N   . PRO D 80  ? 0.2655 0.4032 0.2509 -0.0743 0.0442  -0.0155 85  PRO D N   
4586 C CA  . PRO D 80  ? 0.2838 0.4080 0.2675 -0.0738 0.0462  -0.0199 85  PRO D CA  
4587 C C   . PRO D 80  ? 0.2572 0.3624 0.2421 -0.0661 0.0472  -0.0198 85  PRO D C   
4588 O O   . PRO D 80  ? 0.2646 0.3604 0.2494 -0.0642 0.0478  -0.0213 85  PRO D O   
4589 C CB  . PRO D 80  ? 0.2853 0.4088 0.2655 -0.0843 0.0514  -0.0278 85  PRO D CB  
4590 C CG  . PRO D 80  ? 0.2867 0.4174 0.2668 -0.0888 0.0526  -0.0283 85  PRO D CG  
4591 C CD  . PRO D 80  ? 0.3072 0.4529 0.2907 -0.0844 0.0473  -0.0201 85  PRO D CD  
4592 N N   . GLN D 81  ? 0.2630 0.3629 0.2488 -0.0626 0.0478  -0.0183 86  GLN D N   
4593 C CA  . GLN D 81  ? 0.2698 0.3524 0.2561 -0.0556 0.0486  -0.0176 86  GLN D CA  
4594 C C   . GLN D 81  ? 0.2807 0.3629 0.2678 -0.0476 0.0449  -0.0111 86  GLN D C   
4595 O O   . GLN D 81  ? 0.2662 0.3601 0.2542 -0.0472 0.0432  -0.0073 86  GLN D O   
4596 C CB  . GLN D 81  ? 0.3252 0.4004 0.3110 -0.0585 0.0533  -0.0215 86  GLN D CB  
4597 C CG  . GLN D 81  ? 0.4476 0.5241 0.4319 -0.0678 0.0584  -0.0284 86  GLN D CG  
4598 C CD  . GLN D 81  ? 0.5287 0.5907 0.5135 -0.0669 0.0620  -0.0315 86  GLN D CD  
4599 O OE1 . GLN D 81  ? 0.6122 0.6695 0.5981 -0.0617 0.0594  -0.0289 86  GLN D OE1 
4600 N NE2 . GLN D 81  ? 0.6167 0.6708 0.6009 -0.0715 0.0685  -0.0367 86  GLN D NE2 
4601 N N   . ALA D 82  ? 0.2196 0.2881 0.2063 -0.0412 0.0438  -0.0096 87  ALA D N   
4602 C CA  . ALA D 82  ? 0.2139 0.2760 0.1998 -0.0342 0.0420  -0.0051 87  ALA D CA  
4603 C C   . ALA D 82  ? 0.2224 0.2710 0.2074 -0.0331 0.0448  -0.0073 87  ALA D C   
4604 O O   . ALA D 82  ? 0.2274 0.2687 0.2131 -0.0351 0.0471  -0.0107 87  ALA D O   
4605 C CB  . ALA D 82  ? 0.2284 0.2860 0.2135 -0.0283 0.0382  -0.0011 87  ALA D CB  
4606 N N   . ASN D 83  ? 0.2099 0.2558 0.1937 -0.0300 0.0453  -0.0049 88  ASN D N   
4607 C CA  . ASN D 83  ? 0.2675 0.3017 0.2505 -0.0293 0.0483  -0.0068 88  ASN D CA  
4608 C C   . ASN D 83  ? 0.2516 0.2758 0.2314 -0.0221 0.0462  -0.0024 88  ASN D C   
4609 O O   . ASN D 83  ? 0.2642 0.2924 0.2425 -0.0188 0.0442  0.0015  88  ASN D O   
4610 C CB  . ASN D 83  ? 0.3101 0.3499 0.2939 -0.0334 0.0519  -0.0088 88  ASN D CB  
4611 C CG  . ASN D 83  ? 0.4062 0.4566 0.3918 -0.0418 0.0543  -0.0134 88  ASN D CG  
4612 O OD1 . ASN D 83  ? 0.5344 0.5983 0.5208 -0.0455 0.0542  -0.0128 88  ASN D OD1 
4613 N ND2 . ASN D 83  ? 0.3999 0.4445 0.3859 -0.0451 0.0569  -0.0177 88  ASN D ND2 
4614 N N   . TYR D 84  ? 0.2265 0.2375 0.2048 -0.0197 0.0466  -0.0026 89  TYR D N   
4615 C CA  . TYR D 84  ? 0.2315 0.2327 0.2057 -0.0143 0.0450  0.0008  89  TYR D CA  
4616 C C   . TYR D 84  ? 0.2403 0.2328 0.2139 -0.0142 0.0482  -0.0003 89  TYR D C   
4617 O O   . TYR D 84  ? 0.2465 0.2347 0.2227 -0.0163 0.0504  -0.0027 89  TYR D O   
4618 C CB  . TYR D 84  ? 0.2230 0.2169 0.1949 -0.0110 0.0409  0.0031  89  TYR D CB  
4619 C CG  . TYR D 84  ? 0.2345 0.2181 0.2006 -0.0065 0.0393  0.0064  89  TYR D CG  
4620 C CD1 . TYR D 84  ? 0.2343 0.2187 0.1964 -0.0034 0.0384  0.0093  89  TYR D CD1 
4621 C CD2 . TYR D 84  ? 0.2356 0.2081 0.1996 -0.0052 0.0391  0.0069  89  TYR D CD2 
4622 C CE1 . TYR D 84  ? 0.2229 0.1966 0.1784 0.0001  0.0374  0.0119  89  TYR D CE1 
4623 C CE2 . TYR D 84  ? 0.2823 0.2453 0.2396 -0.0019 0.0376  0.0098  89  TYR D CE2 
4624 C CZ  . TYR D 84  ? 0.2546 0.2172 0.2068 0.0007  0.0369  0.0120  89  TYR D CZ  
4625 O OH  . TYR D 84  ? 0.2851 0.2367 0.2292 0.0036  0.0359  0.0144  89  TYR D OH  
4626 N N   . LYS D 85  ? 0.2397 0.2292 0.2101 -0.0115 0.0491  0.0016  90  LYS D N   
4627 C CA  . LYS D 85  ? 0.2393 0.2207 0.2088 -0.0111 0.0521  0.0010  90  LYS D CA  
4628 C C   . LYS D 85  ? 0.2629 0.2351 0.2259 -0.0058 0.0502  0.0049  90  LYS D C   
4629 O O   . LYS D 85  ? 0.2554 0.2305 0.2156 -0.0035 0.0491  0.0073  90  LYS D O   
4630 C CB  . LYS D 85  ? 0.3070 0.2954 0.2792 -0.0143 0.0565  -0.0011 90  LYS D CB  
4631 C CG  . LYS D 85  ? 0.3618 0.3574 0.3389 -0.0207 0.0595  -0.0058 90  LYS D CG  
4632 C CD  . LYS D 85  ? 0.4474 0.4473 0.4261 -0.0240 0.0638  -0.0078 90  LYS D CD  
4633 C CE  . LYS D 85  ? 0.5308 0.5370 0.5132 -0.0315 0.0675  -0.0131 90  LYS D CE  
4634 N NZ  . LYS D 85  ? 0.5738 0.5943 0.5574 -0.0353 0.0652  -0.0135 90  LYS D NZ  
4635 N N   . GLY D 86  ? 0.2407 0.2018 0.2010 -0.0041 0.0501  0.0058  91  GLY D N   
4636 C CA  . GLY D 86  ? 0.2478 0.1995 0.2006 -0.0001 0.0486  0.0090  91  GLY D CA  
4637 C C   . GLY D 86  ? 0.2357 0.1769 0.1860 0.0009  0.0491  0.0101  91  GLY D C   
4638 O O   . GLY D 86  ? 0.2826 0.2237 0.2381 -0.0009 0.0511  0.0087  91  GLY D O   
4639 N N   . THR D 87  ? 0.2684 0.2010 0.2106 0.0039  0.0481  0.0127  92  THR D N   
4640 C CA  . THR D 87  ? 0.2836 0.2064 0.2219 0.0050  0.0481  0.0146  92  THR D CA  
4641 C C   . THR D 87  ? 0.2888 0.2049 0.2212 0.0057  0.0428  0.0173  92  THR D C   
4642 O O   . THR D 87  ? 0.2729 0.1879 0.2000 0.0065  0.0401  0.0181  92  THR D O   
4643 C CB  . THR D 87  ? 0.3624 0.2800 0.2944 0.0073  0.0510  0.0156  92  THR D CB  
4644 O OG1 . THR D 87  ? 0.4126 0.3370 0.3513 0.0060  0.0558  0.0132  92  THR D OG1 
4645 C CG2 . THR D 87  ? 0.3957 0.3028 0.3215 0.0086  0.0506  0.0179  92  THR D CG2 
4646 N N   . ILE D 88  ? 0.2731 0.1851 0.2067 0.0053  0.0417  0.0192  93  ILE D N   
4647 C CA  . ILE D 88  ? 0.2861 0.1928 0.2148 0.0051  0.0363  0.0225  93  ILE D CA  
4648 C C   . ILE D 88  ? 0.2871 0.1836 0.2040 0.0063  0.0351  0.0249  93  ILE D C   
4649 O O   . ILE D 88  ? 0.3155 0.2082 0.2310 0.0073  0.0382  0.0255  93  ILE D O   
4650 C CB  . ILE D 88  ? 0.2777 0.1859 0.2141 0.0042  0.0359  0.0244  93  ILE D CB  
4651 C CG1 . ILE D 88  ? 0.2778 0.1945 0.2245 0.0027  0.0373  0.0218  93  ILE D CG1 
4652 C CG2 . ILE D 88  ? 0.2914 0.1955 0.2230 0.0037  0.0298  0.0287  93  ILE D CG2 
4653 C CD1 . ILE D 88  ? 0.2966 0.2153 0.2528 0.0020  0.0393  0.0231  93  ILE D CD1 
4654 N N   . LYS D 89  ? 0.2923 0.1840 0.2003 0.0060  0.0313  0.0259  94  LYS D N   
4655 C CA  . LYS D 89  ? 0.3216 0.2025 0.2164 0.0061  0.0300  0.0279  94  LYS D CA  
4656 C C   . LYS D 89  ? 0.3174 0.1948 0.2079 0.0037  0.0241  0.0313  94  LYS D C   
4657 O O   . LYS D 89  ? 0.3135 0.1962 0.2095 0.0024  0.0207  0.0319  94  LYS D O   
4658 C CB  . LYS D 89  ? 0.3708 0.2473 0.2571 0.0070  0.0307  0.0266  94  LYS D CB  
4659 C CG  . LYS D 89  ? 0.4291 0.3117 0.3211 0.0092  0.0357  0.0242  94  LYS D CG  
4660 C CD  . LYS D 89  ? 0.5067 0.3860 0.3969 0.0109  0.0405  0.0241  94  LYS D CD  
4661 C CE  . LYS D 89  ? 0.5384 0.4256 0.4355 0.0126  0.0453  0.0223  94  LYS D CE  
4662 N NZ  . LYS D 89  ? 0.6155 0.4971 0.5043 0.0149  0.0476  0.0231  94  LYS D NZ  
4663 N N   . PHE D 90  ? 0.3472 0.2167 0.2285 0.0030  0.0230  0.0339  95  PHE D N   
4664 C CA  . PHE D 90  ? 0.3563 0.2240 0.2338 0.0001  0.0171  0.0382  95  PHE D CA  
4665 C C   . PHE D 90  ? 0.3751 0.2325 0.2361 -0.0023 0.0142  0.0386  95  PHE D C   
4666 O O   . PHE D 90  ? 0.4377 0.2872 0.2893 -0.0011 0.0181  0.0362  95  PHE D O   
4667 C CB  . PHE D 90  ? 0.3363 0.2041 0.2167 0.0006  0.0181  0.0417  95  PHE D CB  
4668 C CG  . PHE D 90  ? 0.3579 0.2349 0.2545 0.0021  0.0203  0.0427  95  PHE D CG  
4669 C CD1 . PHE D 90  ? 0.3541 0.2355 0.2595 0.0042  0.0259  0.0387  95  PHE D CD1 
4670 C CD2 . PHE D 90  ? 0.3731 0.2541 0.2758 0.0010  0.0170  0.0479  95  PHE D CD2 
4671 C CE1 . PHE D 90  ? 0.3837 0.2722 0.3028 0.0049  0.0287  0.0388  95  PHE D CE1 
4672 C CE2 . PHE D 90  ? 0.3796 0.2678 0.2972 0.0026  0.0202  0.0489  95  PHE D CE2 
4673 C CZ  . PHE D 90  ? 0.3495 0.2407 0.2747 0.0043  0.0262  0.0439  95  PHE D CZ  
4674 N N   . ASP D 91  ? 0.3847 0.2415 0.2413 -0.0061 0.0080  0.0413  96  ASP D N   
4675 C CA  . ASP D 91  ? 0.3769 0.2228 0.2159 -0.0099 0.0052  0.0417  96  ASP D CA  
4676 C C   . ASP D 91  ? 0.4456 0.2946 0.2841 -0.0139 -0.0014 0.0472  96  ASP D C   
4677 O O   . ASP D 91  ? 0.4614 0.3178 0.3077 -0.0155 -0.0058 0.0492  96  ASP D O   
4678 C CB  . ASP D 91  ? 0.3839 0.2270 0.2183 -0.0111 0.0044  0.0388  96  ASP D CB  
4679 C CG  . ASP D 91  ? 0.3918 0.2214 0.2069 -0.0149 0.0036  0.0378  96  ASP D CG  
4680 O OD1 . ASP D 91  ? 0.3928 0.2147 0.1973 -0.0162 0.0044  0.0388  96  ASP D OD1 
4681 O OD2 . ASP D 91  ? 0.3975 0.2247 0.2094 -0.0164 0.0027  0.0359  96  ASP D OD2 
4682 N N   . GLY D 92  ? 0.5439 0.3876 0.3732 -0.0156 -0.0022 0.0499  97  GLY D N   
4683 C CA  . GLY D 92  ? 0.5845 0.4333 0.4154 -0.0188 -0.0080 0.0565  97  GLY D CA  
4684 C C   . GLY D 92  ? 0.6380 0.4970 0.4872 -0.0142 -0.0051 0.0589  97  GLY D C   
4685 O O   . GLY D 92  ? 0.6951 0.5528 0.5484 -0.0100 0.0012  0.0560  97  GLY D O   
4686 N N   . ASP D 93  ? 0.6852 0.5538 0.5455 -0.0152 -0.0092 0.0642  98  ASP D N   
4687 C CA  . ASP D 93  ? 0.6755 0.5528 0.5529 -0.0112 -0.0059 0.0674  98  ASP D CA  
4688 C C   . ASP D 93  ? 0.6542 0.5361 0.5442 -0.0078 -0.0013 0.0626  98  ASP D C   
4689 O O   . ASP D 93  ? 0.6194 0.5058 0.5219 -0.0043 0.0036  0.0628  98  ASP D O   
4690 C CB  . ASP D 93  ? 0.7486 0.6350 0.6342 -0.0134 -0.0116 0.0756  98  ASP D CB  
4691 C CG  . ASP D 93  ? 0.8016 0.6889 0.6847 -0.0142 -0.0133 0.0829  98  ASP D CG  
4692 O OD1 . ASP D 93  ? 0.9065 0.7882 0.7848 -0.0121 -0.0089 0.0816  98  ASP D OD1 
4693 O OD2 . ASP D 93  ? 0.7837 0.6782 0.6705 -0.0169 -0.0190 0.0905  98  ASP D OD2 
4694 N N   . LYS D 94  ? 0.5247 0.4053 0.4111 -0.0091 -0.0028 0.0583  99  LYS D N   
4695 C CA  . LYS D 94  ? 0.5212 0.4089 0.4198 -0.0077 -0.0018 0.0563  99  LYS D CA  
4696 C C   . LYS D 94  ? 0.4245 0.3100 0.3227 -0.0051 0.0035  0.0493  99  LYS D C   
4697 O O   . LYS D 94  ? 0.3897 0.2677 0.2760 -0.0056 0.0041  0.0463  99  LYS D O   
4698 C CB  . LYS D 94  ? 0.6270 0.5159 0.5222 -0.0113 -0.0081 0.0574  99  LYS D CB  
4699 C CG  . LYS D 94  ? 0.7001 0.5991 0.6101 -0.0110 -0.0100 0.0610  99  LYS D CG  
4700 C CD  . LYS D 94  ? 0.8009 0.7042 0.7148 -0.0125 -0.0138 0.0695  99  LYS D CD  
4701 C CE  . LYS D 94  ? 0.8220 0.7354 0.7526 -0.0113 -0.0140 0.0741  99  LYS D CE  
4702 N NZ  . LYS D 94  ? 0.8383 0.7541 0.7704 -0.0129 -0.0170 0.0718  99  LYS D NZ  
4703 N N   . PRO D 95  ? 0.3627 0.2551 0.2740 -0.0028 0.0074  0.0470  100 PRO D N   
4704 C CA  . PRO D 95  ? 0.3456 0.2386 0.2575 -0.0013 0.0112  0.0410  100 PRO D CA  
4705 C C   . PRO D 95  ? 0.3606 0.2517 0.2656 -0.0031 0.0074  0.0395  100 PRO D C   
4706 O O   . PRO D 95  ? 0.3874 0.2817 0.2951 -0.0051 0.0028  0.0420  100 PRO D O   
4707 C CB  . PRO D 95  ? 0.3513 0.2531 0.2784 -0.0001 0.0146  0.0397  100 PRO D CB  
4708 C CG  . PRO D 95  ? 0.3628 0.2661 0.2964 0.0001  0.0149  0.0447  100 PRO D CG  
4709 C CD  . PRO D 95  ? 0.3796 0.2794 0.3054 -0.0017 0.0090  0.0500  100 PRO D CD  
4710 N N   . VAL D 96  ? 0.3425 0.2290 0.2399 -0.0021 0.0099  0.0358  101 VAL D N   
4711 C CA  . VAL D 96  ? 0.3477 0.2316 0.2385 -0.0034 0.0074  0.0344  101 VAL D CA  
4712 C C   . VAL D 96  ? 0.3097 0.1973 0.2041 -0.0012 0.0111  0.0306  101 VAL D C   
4713 O O   . VAL D 96  ? 0.3120 0.1997 0.2045 -0.0019 0.0094  0.0299  101 VAL D O   
4714 C CB  . VAL D 96  ? 0.3973 0.2699 0.2721 -0.0054 0.0058  0.0350  101 VAL D CB  
4715 C CG1 . VAL D 96  ? 0.4334 0.3046 0.3050 -0.0089 0.0002  0.0397  101 VAL D CG1 
4716 C CG2 . VAL D 96  ? 0.3598 0.2262 0.2283 -0.0029 0.0112  0.0329  101 VAL D CG2 
4717 N N   . SER D 97  ? 0.2966 0.1880 0.1967 0.0011  0.0162  0.0285  102 SER D N   
4718 C CA  . SER D 97  ? 0.2980 0.1956 0.2032 0.0028  0.0196  0.0256  102 SER D CA  
4719 C C   . SER D 97  ? 0.2842 0.1888 0.1985 0.0040  0.0242  0.0237  102 SER D C   
4720 O O   . SER D 97  ? 0.2908 0.1940 0.2068 0.0040  0.0258  0.0243  102 SER D O   
4721 C CB  . SER D 97  ? 0.3178 0.2090 0.2132 0.0043  0.0217  0.0248  102 SER D CB  
4722 O OG  . SER D 97  ? 0.3594 0.2452 0.2498 0.0058  0.0255  0.0247  102 SER D OG  
4723 N N   . VAL D 98  ? 0.2751 0.1880 0.1957 0.0044  0.0262  0.0214  103 VAL D N   
4724 C CA  . VAL D 98  ? 0.2712 0.1911 0.1988 0.0048  0.0308  0.0192  103 VAL D CA  
4725 C C   . VAL D 98  ? 0.2773 0.1995 0.2022 0.0066  0.0334  0.0186  103 VAL D C   
4726 O O   . VAL D 98  ? 0.2730 0.1979 0.1971 0.0070  0.0320  0.0189  103 VAL D O   
4727 C CB  . VAL D 98  ? 0.2612 0.1906 0.1992 0.0029  0.0311  0.0174  103 VAL D CB  
4728 C CG1 . VAL D 98  ? 0.2596 0.1946 0.2036 0.0022  0.0362  0.0148  103 VAL D CG1 
4729 C CG2 . VAL D 98  ? 0.2792 0.2066 0.2204 0.0017  0.0284  0.0191  103 VAL D CG2 
4730 N N   . VAL D 99  ? 0.2696 0.1898 0.1924 0.0079  0.0373  0.0184  104 VAL D N   
4731 C CA  . VAL D 99  ? 0.2939 0.2163 0.2148 0.0101  0.0407  0.0189  104 VAL D CA  
4732 C C   . VAL D 99  ? 0.2645 0.1991 0.1950 0.0089  0.0439  0.0170  104 VAL D C   
4733 O O   . VAL D 99  ? 0.2594 0.1944 0.1930 0.0078  0.0463  0.0157  104 VAL D O   
4734 C CB  . VAL D 99  ? 0.3274 0.2387 0.2388 0.0123  0.0430  0.0204  104 VAL D CB  
4735 C CG1 . VAL D 99  ? 0.3611 0.2747 0.2717 0.0151  0.0472  0.0216  104 VAL D CG1 
4736 C CG2 . VAL D 99  ? 0.3492 0.2483 0.2498 0.0122  0.0397  0.0218  104 VAL D CG2 
4737 N N   . GLY D 100 ? 0.2568 0.2017 0.1922 0.0085  0.0438  0.0169  105 GLY D N   
4738 C CA  . GLY D 100 ? 0.2646 0.2226 0.2089 0.0059  0.0462  0.0149  105 GLY D CA  
4739 C C   . GLY D 100 ? 0.2550 0.2244 0.2029 0.0062  0.0465  0.0162  105 GLY D C   
4740 O O   . GLY D 100 ? 0.2535 0.2204 0.1973 0.0095  0.0470  0.0194  105 GLY D O   
4741 N N   . ASN D 101 ? 0.2319 0.2137 0.1872 0.0023  0.0469  0.0140  106 ASN D N   
4742 C CA  . ASN D 101 ? 0.2382 0.2346 0.1986 0.0013  0.0473  0.0153  106 ASN D CA  
4743 C C   . ASN D 101 ? 0.2171 0.2222 0.1823 -0.0028 0.0451  0.0126  106 ASN D C   
4744 O O   . ASN D 101 ? 0.2370 0.2425 0.2051 -0.0069 0.0460  0.0086  106 ASN D O   
4745 C CB  . ASN D 101 ? 0.2615 0.2669 0.2258 -0.0003 0.0509  0.0154  106 ASN D CB  
4746 C CG  . ASN D 101 ? 0.2817 0.2798 0.2418 0.0041  0.0537  0.0187  106 ASN D CG  
4747 O OD1 . ASN D 101 ? 0.3194 0.3180 0.2778 0.0079  0.0542  0.0229  106 ASN D OD1 
4748 N ND2 . ASN D 101 ? 0.3269 0.3160 0.2844 0.0042  0.0555  0.0171  106 ASN D ND2 
4749 N N   . LEU D 102 ? 0.2185 0.2307 0.1849 -0.0018 0.0432  0.0150  107 LEU D N   
4750 C CA  . LEU D 102 ? 0.2154 0.2366 0.1859 -0.0053 0.0412  0.0131  107 LEU D CA  
4751 C C   . LEU D 102 ? 0.2339 0.2724 0.2095 -0.0083 0.0424  0.0142  107 LEU D C   
4752 O O   . LEU D 102 ? 0.2161 0.2601 0.1922 -0.0051 0.0431  0.0188  107 LEU D O   
4753 C CB  . LEU D 102 ? 0.2190 0.2371 0.1874 -0.0025 0.0382  0.0154  107 LEU D CB  
4754 C CG  . LEU D 102 ? 0.2293 0.2575 0.2018 -0.0055 0.0361  0.0142  107 LEU D CG  
4755 C CD1 . LEU D 102 ? 0.2606 0.2860 0.2350 -0.0098 0.0359  0.0093  107 LEU D CD1 
4756 C CD2 . LEU D 102 ? 0.2379 0.2631 0.2085 -0.0022 0.0335  0.0171  107 LEU D CD2 
4757 N N   . THR D 103 ? 0.2167 0.2631 0.1958 -0.0143 0.0429  0.0102  108 THR D N   
4758 C CA  . THR D 103 ? 0.2125 0.2771 0.1961 -0.0189 0.0432  0.0106  108 THR D CA  
4759 C C   . THR D 103 ? 0.2405 0.3114 0.2254 -0.0209 0.0406  0.0101  108 THR D C   
4760 O O   . THR D 103 ? 0.2443 0.3108 0.2288 -0.0243 0.0405  0.0054  108 THR D O   
4761 C CB  . THR D 103 ? 0.2317 0.3012 0.2172 -0.0255 0.0461  0.0062  108 THR D CB  
4762 O OG1 . THR D 103 ? 0.2455 0.3084 0.2299 -0.0234 0.0487  0.0069  108 THR D OG1 
4763 C CG2 . THR D 103 ? 0.2883 0.3783 0.2778 -0.0313 0.0460  0.0073  108 THR D CG2 
4764 N N   . LEU D 104 ? 0.2159 0.2977 0.2026 -0.0189 0.0389  0.0151  109 LEU D N   
4765 C CA  . LEU D 104 ? 0.2319 0.3190 0.2196 -0.0199 0.0363  0.0152  109 LEU D CA  
4766 C C   . LEU D 104 ? 0.2177 0.3249 0.2095 -0.0217 0.0359  0.0197  109 LEU D C   
4767 O O   . LEU D 104 ? 0.2212 0.3314 0.2143 -0.0170 0.0367  0.0256  109 LEU D O   
4768 C CB  . LEU D 104 ? 0.2403 0.3153 0.2250 -0.0132 0.0345  0.0179  109 LEU D CB  
4769 C CG  . LEU D 104 ? 0.2429 0.3221 0.2287 -0.0126 0.0319  0.0193  109 LEU D CG  
4770 C CD1 . LEU D 104 ? 0.2451 0.3265 0.2319 -0.0185 0.0312  0.0139  109 LEU D CD1 
4771 C CD2 . LEU D 104 ? 0.2616 0.3279 0.2440 -0.0066 0.0305  0.0218  109 LEU D CD2 
4772 N N   . HIS D 105 ? 0.2128 0.3325 0.2064 -0.0278 0.0348  0.0179  110 HIS D N   
4773 C CA  . HIS D 105 ? 0.1975 0.3377 0.1952 -0.0295 0.0337  0.0232  110 HIS D CA  
4774 C C   . HIS D 105 ? 0.2256 0.3746 0.2260 -0.0302 0.0356  0.0265  110 HIS D C   
4775 O O   . HIS D 105 ? 0.2204 0.3822 0.2249 -0.0273 0.0354  0.0341  110 HIS D O   
4776 C CB  . HIS D 105 ? 0.2039 0.3449 0.2028 -0.0225 0.0321  0.0297  110 HIS D CB  
4777 C CG  . HIS D 105 ? 0.2190 0.3813 0.2226 -0.0239 0.0309  0.0359  110 HIS D CG  
4778 N ND1 . HIS D 105 ? 0.2436 0.4129 0.2510 -0.0180 0.0319  0.0445  110 HIS D ND1 
4779 C CD2 . HIS D 105 ? 0.2519 0.4304 0.2571 -0.0307 0.0292  0.0352  110 HIS D CD2 
4780 C CE1 . HIS D 105 ? 0.2239 0.4141 0.2360 -0.0208 0.0306  0.0495  110 HIS D CE1 
4781 N NE2 . HIS D 105 ? 0.2352 0.4317 0.2456 -0.0288 0.0286  0.0439  110 HIS D NE2 
4782 N N   . GLY D 106 ? 0.2108 0.3534 0.2095 -0.0339 0.0377  0.0213  111 GLY D N   
4783 C CA  . GLY D 106 ? 0.2324 0.3834 0.2337 -0.0359 0.0397  0.0233  111 GLY D CA  
4784 C C   . GLY D 106 ? 0.2211 0.3639 0.2229 -0.0278 0.0415  0.0284  111 GLY D C   
4785 O O   . GLY D 106 ? 0.2747 0.4226 0.2787 -0.0285 0.0435  0.0303  111 GLY D O   
4786 N N   . VAL D 107 ? 0.2078 0.3367 0.2068 -0.0202 0.0412  0.0303  112 VAL D N   
4787 C CA  . VAL D 107 ? 0.1873 0.3069 0.1854 -0.0125 0.0436  0.0351  112 VAL D CA  
4788 C C   . VAL D 107 ? 0.2096 0.3078 0.2016 -0.0104 0.0444  0.0300  112 VAL D C   
4789 O O   . VAL D 107 ? 0.2030 0.2913 0.1917 -0.0106 0.0425  0.0261  112 VAL D O   
4790 C CB  . VAL D 107 ? 0.1880 0.3073 0.1866 -0.0056 0.0432  0.0416  112 VAL D CB  
4791 C CG1 . VAL D 107 ? 0.2034 0.3110 0.1997 0.0022  0.0466  0.0462  112 VAL D CG1 
4792 C CG2 . VAL D 107 ? 0.2011 0.3430 0.2063 -0.0076 0.0421  0.0474  112 VAL D CG2 
4793 N N   . THR D 108 ? 0.2287 0.3208 0.2197 -0.0087 0.0472  0.0303  113 THR D N   
4794 C CA  . THR D 108 ? 0.2379 0.3099 0.2229 -0.0062 0.0482  0.0266  113 THR D CA  
4795 C C   . THR D 108 ? 0.2679 0.3282 0.2488 0.0014  0.0498  0.0313  113 THR D C   
4796 O O   . THR D 108 ? 0.2684 0.3334 0.2515 0.0046  0.0529  0.0364  113 THR D O   
4797 C CB  . THR D 108 ? 0.2598 0.3315 0.2457 -0.0105 0.0506  0.0227  113 THR D CB  
4798 O OG1 . THR D 108 ? 0.2590 0.3402 0.2476 -0.0183 0.0497  0.0179  113 THR D OG1 
4799 C CG2 . THR D 108 ? 0.2983 0.3505 0.2786 -0.0080 0.0517  0.0195  113 THR D CG2 
4800 N N   . LYS D 109 ? 0.2426 0.2870 0.2174 0.0046  0.0485  0.0298  114 LYS D N   
4801 C CA  . LYS D 109 ? 0.2681 0.2996 0.2372 0.0109  0.0502  0.0333  114 LYS D CA  
4802 C C   . LYS D 109 ? 0.2768 0.2901 0.2385 0.0112  0.0492  0.0293  114 LYS D C   
4803 O O   . LYS D 109 ? 0.2545 0.2658 0.2163 0.0077  0.0463  0.0249  114 LYS D O   
4804 C CB  . LYS D 109 ? 0.2886 0.3209 0.2571 0.0141  0.0490  0.0369  114 LYS D CB  
4805 C CG  . LYS D 109 ? 0.3584 0.4090 0.3344 0.0144  0.0498  0.0420  114 LYS D CG  
4806 C CD  . LYS D 109 ? 0.4378 0.4909 0.4155 0.0185  0.0545  0.0478  114 LYS D CD  
4807 C CE  . LYS D 109 ? 0.4547 0.5153 0.4359 0.0233  0.0565  0.0553  114 LYS D CE  
4808 N NZ  . LYS D 109 ? 0.4947 0.5534 0.4766 0.0282  0.0621  0.0610  114 LYS D NZ  
4809 N N   . PRO D 110 ? 0.2714 0.2713 0.2265 0.0154  0.0516  0.0311  115 PRO D N   
4810 C CA  . PRO D 110 ? 0.2773 0.2599 0.2243 0.0157  0.0502  0.0282  115 PRO D CA  
4811 C C   . PRO D 110 ? 0.2787 0.2567 0.2232 0.0151  0.0461  0.0270  115 PRO D C   
4812 O O   . PRO D 110 ? 0.2653 0.2453 0.2096 0.0172  0.0458  0.0297  115 PRO D O   
4813 C CB  . PRO D 110 ? 0.2935 0.2638 0.2330 0.0206  0.0540  0.0315  115 PRO D CB  
4814 C CG  . PRO D 110 ? 0.3415 0.3233 0.2869 0.0226  0.0580  0.0356  115 PRO D CG  
4815 C CD  . PRO D 110 ? 0.2930 0.2931 0.2476 0.0201  0.0561  0.0365  115 PRO D CD  
4816 N N   . LEU D 111 ? 0.2739 0.2433 0.2154 0.0128  0.0432  0.0236  116 LEU D N   
4817 C CA  . LEU D 111 ? 0.2682 0.2325 0.2073 0.0121  0.0392  0.0228  116 LEU D CA  
4818 C C   . LEU D 111 ? 0.2542 0.2058 0.1877 0.0110  0.0375  0.0210  116 LEU D C   
4819 O O   . LEU D 111 ? 0.2521 0.2056 0.1891 0.0089  0.0380  0.0188  116 LEU D O   
4820 C CB  . LEU D 111 ? 0.2682 0.2445 0.2152 0.0087  0.0368  0.0208  116 LEU D CB  
4821 C CG  . LEU D 111 ? 0.2724 0.2439 0.2183 0.0076  0.0326  0.0198  116 LEU D CG  
4822 C CD1 . LEU D 111 ? 0.2995 0.2663 0.2406 0.0103  0.0316  0.0226  116 LEU D CD1 
4823 C CD2 . LEU D 111 ? 0.3012 0.2831 0.2549 0.0038  0.0312  0.0172  116 LEU D CD2 
4824 N N   . THR D 112 ? 0.2697 0.2095 0.1951 0.0122  0.0356  0.0221  117 THR D N   
4825 C CA  . THR D 112 ? 0.2766 0.2056 0.1963 0.0108  0.0330  0.0213  117 THR D CA  
4826 C C   . THR D 112 ? 0.2829 0.2123 0.2045 0.0085  0.0282  0.0209  117 THR D C   
4827 O O   . THR D 112 ? 0.2967 0.2283 0.2185 0.0090  0.0268  0.0217  117 THR D O   
4828 C CB  . THR D 112 ? 0.3228 0.2375 0.2303 0.0127  0.0343  0.0230  117 THR D CB  
4829 O OG1 . THR D 112 ? 0.3658 0.2794 0.2720 0.0149  0.0391  0.0236  117 THR D OG1 
4830 C CG2 . THR D 112 ? 0.3353 0.2393 0.2358 0.0104  0.0305  0.0228  117 THR D CG2 
4831 N N   . LEU D 113 ? 0.2676 0.1970 0.1926 0.0063  0.0260  0.0200  118 LEU D N   
4832 C CA  . LEU D 113 ? 0.2740 0.2040 0.2017 0.0044  0.0217  0.0203  118 LEU D CA  
4833 C C   . LEU D 113 ? 0.2952 0.2138 0.2147 0.0036  0.0189  0.0221  118 LEU D C   
4834 O O   . LEU D 113 ? 0.3236 0.2388 0.2421 0.0035  0.0201  0.0222  118 LEU D O   
4835 C CB  . LEU D 113 ? 0.2636 0.2021 0.2017 0.0025  0.0223  0.0186  118 LEU D CB  
4836 C CG  . LEU D 113 ? 0.2800 0.2300 0.2248 0.0022  0.0253  0.0165  118 LEU D CG  
4837 C CD1 . LEU D 113 ? 0.2926 0.2489 0.2461 -0.0003 0.0268  0.0141  118 LEU D CD1 
4838 C CD2 . LEU D 113 ? 0.2998 0.2547 0.2451 0.0027  0.0237  0.0171  118 LEU D CD2 
4839 N N   . LYS D 114 ? 0.2510 0.1643 0.1648 0.0027  0.0153  0.0234  119 LYS D N   
4840 C CA  . LYS D 114 ? 0.2884 0.1924 0.1943 0.0008  0.0118  0.0253  119 LYS D CA  
4841 C C   . LYS D 114 ? 0.2883 0.1971 0.2019 -0.0011 0.0081  0.0268  119 LYS D C   
4842 O O   . LYS D 114 ? 0.2842 0.1992 0.2045 -0.0017 0.0065  0.0267  119 LYS D O   
4843 C CB  . LYS D 114 ? 0.3218 0.2185 0.2184 0.0000  0.0099  0.0260  119 LYS D CB  
4844 C CG  . LYS D 114 ? 0.4001 0.2877 0.2874 -0.0034 0.0052  0.0280  119 LYS D CG  
4845 C CD  . LYS D 114 ? 0.4944 0.3726 0.3704 -0.0050 0.0043  0.0279  119 LYS D CD  
4846 C CE  . LYS D 114 ? 0.5195 0.4024 0.4002 -0.0063 0.0010  0.0283  119 LYS D CE  
4847 N NZ  . LYS D 114 ? 0.6367 0.5094 0.5059 -0.0075 0.0017  0.0279  119 LYS D NZ  
4848 N N   . ILE D 115 ? 0.2926 0.1977 0.2047 -0.0022 0.0067  0.0289  120 ILE D N   
4849 C CA  . ILE D 115 ? 0.2976 0.2071 0.2176 -0.0037 0.0038  0.0315  120 ILE D CA  
4850 C C   . ILE D 115 ? 0.3274 0.2330 0.2417 -0.0066 -0.0020 0.0348  120 ILE D C   
4851 O O   . ILE D 115 ? 0.3376 0.2356 0.2418 -0.0082 -0.0041 0.0364  120 ILE D O   
4852 C CB  . ILE D 115 ? 0.3010 0.2105 0.2247 -0.0031 0.0060  0.0329  120 ILE D CB  
4853 C CG1 . ILE D 115 ? 0.2875 0.2020 0.2179 -0.0010 0.0122  0.0293  120 ILE D CG1 
4854 C CG2 . ILE D 115 ? 0.3112 0.2247 0.2429 -0.0043 0.0030  0.0371  120 ILE D CG2 
4855 C CD1 . ILE D 115 ? 0.2976 0.2104 0.2300 -0.0002 0.0156  0.0299  120 ILE D CD1 
4856 N N   . ASP D 116 ? 0.3055 0.2162 0.2257 -0.0076 -0.0048 0.0355  121 ASP D N   
4857 C CA  . ASP D 116 ? 0.3592 0.2666 0.2740 -0.0110 -0.0108 0.0387  121 ASP D CA  
4858 C C   . ASP D 116 ? 0.3319 0.2432 0.2530 -0.0126 -0.0142 0.0438  121 ASP D C   
4859 O O   . ASP D 116 ? 0.3881 0.2962 0.3027 -0.0161 -0.0195 0.0475  121 ASP D O   
4860 C CB  . ASP D 116 ? 0.3955 0.3063 0.3133 -0.0114 -0.0123 0.0377  121 ASP D CB  
4861 C CG  . ASP D 116 ? 0.4725 0.3778 0.3814 -0.0105 -0.0100 0.0343  121 ASP D CG  
4862 O OD1 . ASP D 116 ? 0.4953 0.3927 0.3943 -0.0101 -0.0077 0.0331  121 ASP D OD1 
4863 O OD2 . ASP D 116 ? 0.5222 0.4307 0.4342 -0.0102 -0.0103 0.0334  121 ASP D OD2 
4864 N N   . SER D 117 ? 0.3258 0.2440 0.2594 -0.0104 -0.0112 0.0445  122 SER D N   
4865 C CA  . SER D 117 ? 0.3371 0.2591 0.2782 -0.0111 -0.0132 0.0504  122 SER D CA  
4866 C C   . SER D 117 ? 0.3107 0.2356 0.2607 -0.0081 -0.0072 0.0498  122 SER D C   
4867 O O   . SER D 117 ? 0.2747 0.2014 0.2285 -0.0062 -0.0022 0.0450  122 SER D O   
4868 C CB  . SER D 117 ? 0.3513 0.2801 0.3020 -0.0121 -0.0162 0.0537  122 SER D CB  
4869 O OG  . SER D 117 ? 0.3876 0.3221 0.3492 -0.0096 -0.0115 0.0507  122 SER D OG  
4870 N N   . PHE D 118 ? 0.2990 0.2241 0.2517 -0.0081 -0.0077 0.0548  123 PHE D N   
4871 C CA  . PHE D 118 ? 0.3148 0.2412 0.2750 -0.0055 -0.0019 0.0551  123 PHE D CA  
4872 C C   . PHE D 118 ? 0.3239 0.2544 0.2924 -0.0057 -0.0039 0.0631  123 PHE D C   
4873 O O   . PHE D 118 ? 0.3581 0.2871 0.3199 -0.0079 -0.0094 0.0680  123 PHE D O   
4874 C CB  . PHE D 118 ? 0.3247 0.2444 0.2752 -0.0049 0.0002  0.0527  123 PHE D CB  
4875 C CG  . PHE D 118 ? 0.3611 0.2814 0.3186 -0.0025 0.0061  0.0533  123 PHE D CG  
4876 C CD1 . PHE D 118 ? 0.3635 0.2853 0.3268 -0.0008 0.0128  0.0481  123 PHE D CD1 
4877 C CD2 . PHE D 118 ? 0.3794 0.2990 0.3378 -0.0023 0.0051  0.0596  123 PHE D CD2 
4878 C CE1 . PHE D 118 ? 0.4136 0.3352 0.3835 0.0008  0.0189  0.0485  123 PHE D CE1 
4879 C CE2 . PHE D 118 ? 0.4133 0.3330 0.3788 0.0000  0.0112  0.0605  123 PHE D CE2 
4880 C CZ  . PHE D 118 ? 0.3801 0.3002 0.3510 0.0015  0.0183  0.0546  123 PHE D CZ  
4881 N N   . LYS D 119 ? 0.3061 0.2413 0.2882 -0.0035 0.0011  0.0645  124 LYS D N   
4882 C CA  . LYS D 119 ? 0.3134 0.2531 0.3058 -0.0027 0.0007  0.0731  124 LYS D CA  
4883 C C   . LYS D 119 ? 0.3099 0.2500 0.3131 0.0004  0.0097  0.0725  124 LYS D C   
4884 O O   . LYS D 119 ? 0.2928 0.2324 0.2990 0.0012  0.0153  0.0660  124 LYS D O   
4885 C CB  . LYS D 119 ? 0.3184 0.2643 0.3184 -0.0038 -0.0028 0.0768  124 LYS D CB  
4886 C CG  . LYS D 119 ? 0.3395 0.2912 0.3523 -0.0024 -0.0022 0.0865  124 LYS D CG  
4887 C CD  . LYS D 119 ? 0.3831 0.3410 0.4035 -0.0034 -0.0057 0.0904  124 LYS D CD  
4888 C CE  . LYS D 119 ? 0.4125 0.3772 0.4446 -0.0023 -0.0066 0.1021  124 LYS D CE  
4889 N NZ  . LYS D 119 ? 0.4107 0.3820 0.4538 -0.0023 -0.0078 0.1064  124 LYS D NZ  
4890 N N   . CYS D 120 ? 0.3015 0.2424 0.3103 0.0020  0.0115  0.0795  125 CYS D N   
4891 C CA  . CYS D 120 ? 0.3648 0.3058 0.3857 0.0051  0.0208  0.0805  125 CYS D CA  
4892 C C   . CYS D 120 ? 0.3611 0.3079 0.3940 0.0066  0.0202  0.0913  125 CYS D C   
4893 O O   . CYS D 120 ? 0.3598 0.3104 0.3899 0.0050  0.0124  0.0986  125 CYS D O   
4894 C CB  . CYS D 120 ? 0.4113 0.3472 0.4294 0.0067  0.0262  0.0788  125 CYS D CB  
4895 S SG  . CYS D 120 ? 0.4564 0.3862 0.4597 0.0051  0.0260  0.0681  125 CYS D SG  
4896 N N   . MET D 121 ? 0.3663 0.3143 0.4122 0.0090  0.0281  0.0921  126 MET D N   
4897 C CA  . MET D 121 ? 0.3409 0.2946 0.4010 0.0112  0.0296  0.1028  126 MET D CA  
4898 C C   . MET D 121 ? 0.3446 0.2955 0.4165 0.0144  0.0418  0.1018  126 MET D C   
4899 O O   . MET D 121 ? 0.3301 0.2758 0.3995 0.0139  0.0480  0.0924  126 MET D O   
4900 C CB  . MET D 121 ? 0.3481 0.3078 0.4123 0.0098  0.0243  0.1053  126 MET D CB  
4901 C CG  . MET D 121 ? 0.3501 0.3076 0.4150 0.0092  0.0287  0.0961  126 MET D CG  
4902 S SD  . MET D 121 ? 0.4078 0.3717 0.4753 0.0072  0.0214  0.0985  126 MET D SD  
4903 C CE  . MET D 121 ? 0.3967 0.3649 0.4840 0.0110  0.0292  0.1075  126 MET D CE  
4904 N N   . PRO D 122 ? 0.3379 0.2922 0.4236 0.0177  0.0461  0.1124  127 PRO D N   
4905 C CA  . PRO D 122 ? 0.3461 0.2966 0.4432 0.0204  0.0588  0.1110  127 PRO D CA  
4906 C C   . PRO D 122 ? 0.3596 0.3110 0.4612 0.0196  0.0610  0.1071  127 PRO D C   
4907 O O   . PRO D 122 ? 0.4245 0.3824 0.5293 0.0190  0.0544  0.1124  127 PRO D O   
4908 C CB  . PRO D 122 ? 0.3646 0.3196 0.4759 0.0245  0.0621  0.1251  127 PRO D CB  
4909 C CG  . PRO D 122 ? 0.3727 0.3340 0.4777 0.0233  0.0505  0.1329  127 PRO D CG  
4910 C CD  . PRO D 122 ? 0.3726 0.3343 0.4632 0.0186  0.0400  0.1255  127 PRO D CD  
4911 N N   . HIS D 123 ? 0.3783 0.3234 0.4804 0.0191  0.0703  0.0983  128 HIS D N   
4912 C CA  . HIS D 123 ? 0.4547 0.4002 0.5612 0.0181  0.0736  0.0943  128 HIS D CA  
4913 C C   . HIS D 123 ? 0.4796 0.4267 0.6030 0.0219  0.0812  0.1041  128 HIS D C   
4914 O O   . HIS D 123 ? 0.4544 0.3968 0.5854 0.0246  0.0916  0.1068  128 HIS D O   
4915 C CB  . HIS D 123 ? 0.5194 0.4577 0.6200 0.0156  0.0817  0.0816  128 HIS D CB  
4916 C CG  . HIS D 123 ? 0.6324 0.5702 0.7352 0.0137  0.0857  0.0759  128 HIS D CG  
4917 N ND1 . HIS D 123 ? 0.6440 0.5871 0.7527 0.0144  0.0819  0.0807  128 HIS D ND1 
4918 C CD2 . HIS D 123 ? 0.6952 0.6280 0.7945 0.0108  0.0934  0.0657  128 HIS D CD2 
4919 C CE1 . HIS D 123 ? 0.7180 0.6589 0.8266 0.0123  0.0871  0.0737  128 HIS D CE1 
4920 N NE2 . HIS D 123 ? 0.7548 0.6896 0.8575 0.0099  0.0941  0.0645  128 HIS D NE2 
4921 N N   . PRO D 124 ? 0.5066 0.4602 0.6362 0.0223  0.0765  0.1098  129 PRO D N   
4922 C CA  . PRO D 124 ? 0.5548 0.5101 0.7016 0.0263  0.0846  0.1196  129 PRO D CA  
4923 C C   . PRO D 124 ? 0.6032 0.5496 0.7563 0.0273  0.1001  0.1142  129 PRO D C   
4924 O O   . PRO D 124 ? 0.5706 0.5158 0.7375 0.0314  0.1094  0.1226  129 PRO D O   
4925 C CB  . PRO D 124 ? 0.5746 0.5379 0.7240 0.0253  0.0762  0.1236  129 PRO D CB  
4926 C CG  . PRO D 124 ? 0.5761 0.5383 0.7101 0.0207  0.0685  0.1120  129 PRO D CG  
4927 C CD  . PRO D 124 ? 0.5668 0.5261 0.6891 0.0192  0.0648  0.1078  129 PRO D CD  
4928 N N   . MET D 125 ? 0.6384 0.5786 0.7815 0.0235  0.1032  0.1008  130 MET D N   
4929 C CA  . MET D 125 ? 0.6741 0.6056 0.8212 0.0231  0.1178  0.0947  130 MET D CA  
4930 C C   . MET D 125 ? 0.6827 0.6047 0.8247 0.0216  0.1273  0.0870  130 MET D C   
4931 O O   . MET D 125 ? 0.6517 0.5659 0.8014 0.0230  0.1412  0.0872  130 MET D O   
4932 C CB  . MET D 125 ? 0.7256 0.6575 0.8669 0.0192  0.1160  0.0859  130 MET D CB  
4933 C CG  . MET D 125 ? 0.7540 0.6946 0.9005 0.0204  0.1073  0.0930  130 MET D CG  
4934 S SD  . MET D 125 ? 0.8813 0.8222 1.0473 0.0253  0.1173  0.1043  130 MET D SD  
4935 C CE  . MET D 125 ? 0.8098 0.7595 0.9875 0.0304  0.1114  0.1216  130 MET D CE  
4936 N N   . LEU D 126 ? 0.6194 0.5417 0.7490 0.0188  0.1206  0.0804  131 LEU D N   
4937 C CA  . LEU D 126 ? 0.6471 0.5612 0.7718 0.0171  0.1289  0.0735  131 LEU D CA  
4938 C C   . LEU D 126 ? 0.5736 0.4873 0.7026 0.0211  0.1294  0.0818  131 LEU D C   
4939 O O   . LEU D 126 ? 0.5837 0.4905 0.7109 0.0206  0.1372  0.0781  131 LEU D O   
4940 C CB  . LEU D 126 ? 0.6707 0.5849 0.7802 0.0118  0.1232  0.0614  131 LEU D CB  
4941 C CG  . LEU D 126 ? 0.7112 0.6255 0.8137 0.0067  0.1234  0.0509  131 LEU D CG  
4942 C CD1 . LEU D 126 ? 0.7063 0.6216 0.7953 0.0023  0.1184  0.0413  131 LEU D CD1 
4943 C CD2 . LEU D 126 ? 0.7121 0.6186 0.8194 0.0049  0.1378  0.0464  131 LEU D CD2 
4944 N N   . LYS D 127 ? 0.5793 0.5008 0.7133 0.0245  0.1208  0.0931  132 LYS D N   
4945 C CA  . LYS D 127 ? 0.5962 0.5189 0.7348 0.0283  0.1205  0.1026  132 LYS D CA  
4946 C C   . LYS D 127 ? 0.5787 0.4978 0.7057 0.0263  0.1185  0.0961  132 LYS D C   
4947 O O   . LYS D 127 ? 0.5327 0.4482 0.6633 0.0289  0.1242  0.1002  132 LYS D O   
4948 C CB  . LYS D 127 ? 0.6563 0.5743 0.8106 0.0329  0.1348  0.1105  132 LYS D CB  
4949 C CG  . LYS D 127 ? 0.7285 0.6482 0.8904 0.0376  0.1364  0.1223  132 LYS D CG  
4950 C CD  . LYS D 127 ? 0.7807 0.6990 0.9610 0.0432  0.1487  0.1336  132 LYS D CD  
4951 C CE  . LYS D 127 ? 0.8062 0.7111 0.9901 0.0430  0.1666  0.1264  132 LYS D CE  
4952 N NZ  . LYS D 127 ? 0.7589 0.6551 0.9356 0.0414  0.1727  0.1190  132 LYS D NZ  
4953 N N   . ARG D 128 ? 0.5213 0.4415 0.6347 0.0220  0.1104  0.0865  133 ARG D N   
4954 C CA  . ARG D 128 ? 0.5195 0.4382 0.6211 0.0202  0.1056  0.0816  133 ARG D CA  
4955 C C   . ARG D 128 ? 0.4315 0.3568 0.5227 0.0180  0.0911  0.0804  133 ARG D C   
4956 O O   . ARG D 128 ? 0.4063 0.3362 0.4989 0.0172  0.0865  0.0809  133 ARG D O   
4957 C CB  . ARG D 128 ? 0.5671 0.4789 0.6619 0.0164  0.1129  0.0690  133 ARG D CB  
4958 C CG  . ARG D 128 ? 0.6194 0.5231 0.7184 0.0176  0.1252  0.0683  133 ARG D CG  
4959 C CD  . ARG D 128 ? 0.6671 0.5650 0.7593 0.0124  0.1322  0.0554  133 ARG D CD  
4960 N NE  . ARG D 128 ? 0.7281 0.6265 0.8204 0.0091  0.1343  0.0494  133 ARG D NE  
4961 C CZ  . ARG D 128 ? 0.7574 0.6560 0.8408 0.0035  0.1338  0.0385  133 ARG D CZ  
4962 N NH1 . ARG D 128 ? 0.7949 0.6933 0.8689 0.0006  0.1314  0.0320  133 ARG D NH1 
4963 N NH2 . ARG D 128 ? 0.7538 0.6531 0.8378 0.0008  0.1358  0.0343  133 ARG D NH2 
4964 N N   . GLU D 129 ? 0.3964 0.3216 0.4776 0.0173  0.0848  0.0791  134 GLU D N   
4965 C CA  . GLU D 129 ? 0.3738 0.3036 0.4441 0.0155  0.0719  0.0788  134 GLU D CA  
4966 C C   . GLU D 129 ? 0.3521 0.2819 0.4141 0.0118  0.0694  0.0682  134 GLU D C   
4967 O O   . GLU D 129 ? 0.3253 0.2514 0.3852 0.0098  0.0761  0.0595  134 GLU D O   
4968 C CB  . GLU D 129 ? 0.4190 0.3470 0.4800 0.0157  0.0676  0.0797  134 GLU D CB  
4969 C CG  . GLU D 129 ? 0.4706 0.4012 0.5187 0.0134  0.0555  0.0786  134 GLU D CG  
4970 C CD  . GLU D 129 ? 0.5101 0.4378 0.5476 0.0133  0.0516  0.0789  134 GLU D CD  
4971 O OE1 . GLU D 129 ? 0.4981 0.4212 0.5287 0.0125  0.0546  0.0716  134 GLU D OE1 
4972 O OE2 . GLU D 129 ? 0.6298 0.5602 0.6650 0.0136  0.0449  0.0867  134 GLU D OE2 
4973 N N   . VAL D 130 ? 0.3173 0.2521 0.3761 0.0107  0.0604  0.0699  135 VAL D N   
4974 C CA  . VAL D 130 ? 0.2998 0.2360 0.3509 0.0077  0.0567  0.0616  135 VAL D CA  
4975 C C   . VAL D 130 ? 0.2980 0.2358 0.3381 0.0067  0.0460  0.0626  135 VAL D C   
4976 O O   . VAL D 130 ? 0.2935 0.2339 0.3339 0.0074  0.0396  0.0703  135 VAL D O   
4977 C CB  . VAL D 130 ? 0.3039 0.2434 0.3622 0.0071  0.0580  0.0614  135 VAL D CB  
4978 C CG1 . VAL D 130 ? 0.3232 0.2676 0.3878 0.0088  0.0520  0.0714  135 VAL D CG1 
4979 C CG2 . VAL D 130 ? 0.3079 0.2492 0.3578 0.0040  0.0542  0.0529  135 VAL D CG2 
4980 N N   . CYS D 131 ? 0.3071 0.2434 0.3368 0.0046  0.0441  0.0547  136 CYS D N   
4981 C CA  A CYS D 131 ? 0.3038 0.2401 0.3218 0.0035  0.0351  0.0545  136 CYS D CA  
4982 C CA  B CYS D 131 ? 0.3063 0.2427 0.3244 0.0035  0.0351  0.0546  136 CYS D CA  
4983 C C   . CYS D 131 ? 0.2768 0.2157 0.2911 0.0015  0.0324  0.0488  136 CYS D C   
4984 O O   . CYS D 131 ? 0.2981 0.2379 0.3145 0.0006  0.0376  0.0427  136 CYS D O   
4985 C CB  A CYS D 131 ? 0.3484 0.2801 0.3571 0.0035  0.0358  0.0511  136 CYS D CB  
4986 C CB  B CYS D 131 ? 0.3543 0.2861 0.3632 0.0035  0.0356  0.0514  136 CYS D CB  
4987 S SG  A CYS D 131 ? 0.4287 0.3568 0.4385 0.0057  0.0377  0.0580  136 CYS D SG  
4988 S SG  B CYS D 131 ? 0.4461 0.3745 0.4570 0.0058  0.0379  0.0584  136 CYS D SG  
4989 N N   . GLY D 132 ? 0.2553 0.1958 0.2647 0.0007  0.0246  0.0514  137 GLY D N   
4990 C CA  . GLY D 132 ? 0.2170 0.1602 0.2234 -0.0008 0.0215  0.0473  137 GLY D CA  
4991 C C   . GLY D 132 ? 0.2300 0.1707 0.2238 -0.0019 0.0149  0.0462  137 GLY D C   
4992 O O   . GLY D 132 ? 0.2496 0.1876 0.2376 -0.0022 0.0101  0.0505  137 GLY D O   
4993 N N   . VAL D 133 ? 0.2266 0.1683 0.2158 -0.0027 0.0148  0.0404  138 VAL D N   
4994 C CA  . VAL D 133 ? 0.2391 0.1779 0.2168 -0.0034 0.0098  0.0390  138 VAL D CA  
4995 C C   . VAL D 133 ? 0.2416 0.1836 0.2186 -0.0043 0.0073  0.0369  138 VAL D C   
4996 O O   . VAL D 133 ? 0.2355 0.1826 0.2195 -0.0043 0.0104  0.0342  138 VAL D O   
4997 C CB  . VAL D 133 ? 0.2719 0.2078 0.2427 -0.0028 0.0132  0.0342  138 VAL D CB  
4998 C CG1 . VAL D 133 ? 0.3068 0.2386 0.2766 -0.0019 0.0155  0.0361  138 VAL D CG1 
4999 C CG2 . VAL D 133 ? 0.2990 0.2399 0.2737 -0.0030 0.0178  0.0287  138 VAL D CG2 
5000 N N   . ASP D 134 ? 0.2256 0.1641 0.1932 -0.0052 0.0022  0.0377  139 ASP D N   
5001 C CA  . ASP D 134 ? 0.2379 0.1776 0.2020 -0.0056 0.0003  0.0352  139 ASP D CA  
5002 C C   . ASP D 134 ? 0.2432 0.1777 0.1965 -0.0051 0.0010  0.0324  139 ASP D C   
5003 O O   . ASP D 134 ? 0.2647 0.1927 0.2098 -0.0056 -0.0010 0.0342  139 ASP D O   
5004 C CB  . ASP D 134 ? 0.2697 0.2094 0.2330 -0.0073 -0.0052 0.0385  139 ASP D CB  
5005 C CG  . ASP D 134 ? 0.3064 0.2502 0.2714 -0.0072 -0.0053 0.0358  139 ASP D CG  
5006 O OD1 . ASP D 134 ? 0.2850 0.2351 0.2581 -0.0064 -0.0016 0.0334  139 ASP D OD1 
5007 O OD2 . ASP D 134 ? 0.3940 0.3349 0.3524 -0.0082 -0.0090 0.0363  139 ASP D OD2 
5008 N N   . ALA D 135 ? 0.2176 0.1557 0.1712 -0.0040 0.0042  0.0284  140 ALA D N   
5009 C CA  . ALA D 135 ? 0.2317 0.1659 0.1767 -0.0029 0.0059  0.0264  140 ALA D CA  
5010 C C   . ALA D 135 ? 0.2320 0.1690 0.1753 -0.0022 0.0061  0.0247  140 ALA D C   
5011 O O   . ALA D 135 ? 0.2259 0.1696 0.1758 -0.0025 0.0057  0.0242  140 ALA D O   
5012 C CB  . ALA D 135 ? 0.2472 0.1832 0.1945 -0.0019 0.0109  0.0241  140 ALA D CB  
5013 N N   . VAL D 136 ? 0.2280 0.1594 0.1623 -0.0010 0.0069  0.0244  141 VAL D N   
5014 C CA  . VAL D 136 ? 0.2415 0.1752 0.1742 0.0001  0.0077  0.0237  141 VAL D CA  
5015 C C   . VAL D 136 ? 0.2512 0.1848 0.1806 0.0024  0.0121  0.0227  141 VAL D C   
5016 O O   . VAL D 136 ? 0.2637 0.1909 0.1875 0.0030  0.0137  0.0228  141 VAL D O   
5017 C CB  . VAL D 136 ? 0.2766 0.2020 0.2009 -0.0006 0.0044  0.0254  141 VAL D CB  
5018 C CG1 . VAL D 136 ? 0.3075 0.2344 0.2359 -0.0030 -0.0001 0.0271  141 VAL D CG1 
5019 C CG2 . VAL D 136 ? 0.3218 0.2349 0.2340 -0.0012 0.0042  0.0262  141 VAL D CG2 
5020 N N   . GLY D 137 ? 0.2694 0.2106 0.2023 0.0039  0.0143  0.0222  142 GLY D N   
5021 C CA  . GLY D 137 ? 0.2623 0.2038 0.1921 0.0065  0.0185  0.0226  142 GLY D CA  
5022 C C   . GLY D 137 ? 0.2568 0.2037 0.1883 0.0081  0.0194  0.0238  142 GLY D C   
5023 O O   . GLY D 137 ? 0.2351 0.1863 0.1706 0.0071  0.0169  0.0239  142 GLY D O   
5024 N N   . GLU D 138 ? 0.2580 0.2053 0.1872 0.0110  0.0234  0.0254  143 GLU D N   
5025 C CA  . GLU D 138 ? 0.2752 0.2290 0.2071 0.0132  0.0250  0.0276  143 GLU D CA  
5026 C C   . GLU D 138 ? 0.2571 0.2189 0.1922 0.0156  0.0296  0.0294  143 GLU D C   
5027 O O   . GLU D 138 ? 0.2579 0.2140 0.1889 0.0169  0.0324  0.0296  143 GLU D O   
5028 C CB  . GLU D 138 ? 0.3497 0.2910 0.2727 0.0149  0.0258  0.0294  143 GLU D CB  
5029 C CG  . GLU D 138 ? 0.4549 0.3875 0.3734 0.0120  0.0212  0.0282  143 GLU D CG  
5030 C CD  . GLU D 138 ? 0.5289 0.4508 0.4393 0.0128  0.0221  0.0298  143 GLU D CD  
5031 O OE1 . GLU D 138 ? 0.6132 0.5322 0.5206 0.0162  0.0272  0.0319  143 GLU D OE1 
5032 O OE2 . GLU D 138 ? 0.6179 0.5341 0.5252 0.0098  0.0178  0.0290  143 GLU D OE2 
5033 N N   . PHE D 139 ? 0.2334 0.2079 0.1752 0.0165  0.0304  0.0312  144 PHE D N   
5034 C CA  . PHE D 139 ? 0.2330 0.2168 0.1785 0.0192  0.0347  0.0345  144 PHE D CA  
5035 C C   . PHE D 139 ? 0.2529 0.2454 0.2025 0.0215  0.0358  0.0384  144 PHE D C   
5036 O O   . PHE D 139 ? 0.2470 0.2426 0.1988 0.0203  0.0329  0.0379  144 PHE D O   
5037 C CB  . PHE D 139 ? 0.2464 0.2427 0.1987 0.0160  0.0344  0.0323  144 PHE D CB  
5038 C CG  . PHE D 139 ? 0.2618 0.2696 0.2208 0.0121  0.0313  0.0299  144 PHE D CG  
5039 C CD1 . PHE D 139 ? 0.2993 0.3024 0.2581 0.0088  0.0282  0.0258  144 PHE D CD1 
5040 C CD2 . PHE D 139 ? 0.2475 0.2717 0.2133 0.0114  0.0318  0.0319  144 PHE D CD2 
5041 C CE1 . PHE D 139 ? 0.2903 0.3035 0.2550 0.0054  0.0264  0.0238  144 PHE D CE1 
5042 C CE2 . PHE D 139 ? 0.2741 0.3085 0.2449 0.0075  0.0295  0.0296  144 PHE D CE2 
5043 C CZ  . PHE D 139 ? 0.2873 0.3159 0.2574 0.0045  0.0272  0.0253  144 PHE D CZ  
5044 N N   . SER D 140 ? 0.2531 0.2524 0.2055 0.0248  0.0401  0.0429  145 SER D N   
5045 C CA  . SER D 140 ? 0.2541 0.2644 0.2120 0.0274  0.0416  0.0479  145 SER D CA  
5046 C C   . SER D 140 ? 0.2249 0.2562 0.1923 0.0242  0.0400  0.0481  145 SER D C   
5047 O O   . SER D 140 ? 0.2477 0.2866 0.2181 0.0233  0.0415  0.0487  145 SER D O   
5048 C CB  . SER D 140 ? 0.2894 0.2956 0.2455 0.0330  0.0480  0.0537  145 SER D CB  
5049 O OG  . SER D 140 ? 0.3403 0.3549 0.3013 0.0361  0.0499  0.0591  145 SER D OG  
5050 N N   . ARG D 141 ? 0.1959 0.2368 0.1676 0.0216  0.0367  0.0472  146 ARG D N   
5051 C CA  . ARG D 141 ? 0.1853 0.2440 0.1639 0.0171  0.0349  0.0460  146 ARG D CA  
5052 C C   . ARG D 141 ? 0.2255 0.3026 0.2109 0.0181  0.0374  0.0521  146 ARG D C   
5053 O O   . ARG D 141 ? 0.2083 0.2994 0.1981 0.0136  0.0364  0.0509  146 ARG D O   
5054 C CB  . ARG D 141 ? 0.1955 0.2593 0.1762 0.0135  0.0310  0.0431  146 ARG D CB  
5055 C CG  . ARG D 141 ? 0.1878 0.2553 0.1704 0.0167  0.0311  0.0477  146 ARG D CG  
5056 C CD  . ARG D 141 ? 0.2021 0.2774 0.1877 0.0127  0.0276  0.0451  146 ARG D CD  
5057 N NE  . ARG D 141 ? 0.1974 0.2726 0.1838 0.0155  0.0272  0.0483  146 ARG D NE  
5058 C CZ  . ARG D 141 ? 0.2156 0.3051 0.2070 0.0171  0.0281  0.0538  146 ARG D CZ  
5059 N NH1 . ARG D 141 ? 0.2304 0.3368 0.2268 0.0159  0.0293  0.0571  146 ARG D NH1 
5060 N NH2 . ARG D 141 ? 0.2232 0.3115 0.2152 0.0193  0.0277  0.0560  146 ARG D NH2 
5061 N N   . ASP D 142 ? 0.2226 0.2998 0.2089 0.0239  0.0409  0.0589  147 ASP D N   
5062 C CA  . ASP D 142 ? 0.2423 0.3364 0.2357 0.0257  0.0439  0.0660  147 ASP D CA  
5063 C C   . ASP D 142 ? 0.2369 0.3299 0.2300 0.0254  0.0462  0.0656  147 ASP D C   
5064 O O   . ASP D 142 ? 0.2448 0.3557 0.2448 0.0240  0.0470  0.0698  147 ASP D O   
5065 C CB  . ASP D 142 ? 0.2551 0.3489 0.2503 0.0325  0.0480  0.0739  147 ASP D CB  
5066 C CG  . ASP D 142 ? 0.2905 0.3619 0.2779 0.0376  0.0520  0.0739  147 ASP D CG  
5067 O OD1 . ASP D 142 ? 0.2917 0.3455 0.2708 0.0360  0.0507  0.0674  147 ASP D OD1 
5068 O OD2 . ASP D 142 ? 0.3362 0.4077 0.3256 0.0436  0.0571  0.0813  147 ASP D OD2 
5069 N N   . ASP D 143 ? 0.2360 0.3105 0.2217 0.0258  0.0468  0.0608  148 ASP D N   
5070 C CA  . ASP D 143 ? 0.2735 0.3467 0.2587 0.0249  0.0487  0.0597  148 ASP D CA  
5071 C C   . ASP D 143 ? 0.2258 0.3130 0.2155 0.0181  0.0459  0.0560  148 ASP D C   
5072 O O   . ASP D 143 ? 0.2658 0.3579 0.2576 0.0169  0.0477  0.0565  148 ASP D O   
5073 C CB  . ASP D 143 ? 0.2924 0.3441 0.2686 0.0258  0.0494  0.0550  148 ASP D CB  
5074 C CG  . ASP D 143 ? 0.4392 0.4768 0.4100 0.0321  0.0540  0.0589  148 ASP D CG  
5075 O OD1 . ASP D 143 ? 0.5031 0.5476 0.4781 0.0365  0.0577  0.0660  148 ASP D OD1 
5076 O OD2 . ASP D 143 ? 0.5713 0.5904 0.5333 0.0325  0.0543  0.0551  148 ASP D OD2 
5077 N N   . PHE D 144 ? 0.2309 0.3220 0.2210 0.0134  0.0418  0.0515  149 PHE D N   
5078 C CA  . PHE D 144 ? 0.2109 0.3154 0.2047 0.0059  0.0395  0.0474  149 PHE D CA  
5079 C C   . PHE D 144 ? 0.2433 0.3693 0.2435 0.0028  0.0381  0.0509  149 PHE D C   
5080 O O   . PHE D 144 ? 0.2342 0.3709 0.2362 -0.0043 0.0359  0.0470  149 PHE D O   
5081 C CB  . PHE D 144 ? 0.2052 0.2982 0.1946 0.0017  0.0367  0.0390  149 PHE D CB  
5082 C CG  . PHE D 144 ? 0.1969 0.2713 0.1805 0.0037  0.0377  0.0358  149 PHE D CG  
5083 C CD1 . PHE D 144 ? 0.2156 0.2739 0.1936 0.0086  0.0378  0.0366  149 PHE D CD1 
5084 C CD2 . PHE D 144 ? 0.1965 0.2692 0.1798 0.0005  0.0389  0.0321  149 PHE D CD2 
5085 C CE1 . PHE D 144 ? 0.2275 0.2691 0.1994 0.0099  0.0384  0.0339  149 PHE D CE1 
5086 C CE2 . PHE D 144 ? 0.2056 0.2615 0.1835 0.0023  0.0398  0.0295  149 PHE D CE2 
5087 C CZ  . PHE D 144 ? 0.2307 0.2716 0.2028 0.0072  0.0395  0.0308  149 PHE D CZ  
5088 N N   . GLY D 145 ? 0.2419 0.3746 0.2455 0.0080  0.0395  0.0588  150 GLY D N   
5089 C CA  . GLY D 145 ? 0.2570 0.4119 0.2673 0.0056  0.0381  0.0639  150 GLY D CA  
5090 C C   . GLY D 145 ? 0.2642 0.4210 0.2736 0.0031  0.0347  0.0612  150 GLY D C   
5091 O O   . GLY D 145 ? 0.2709 0.4455 0.2843 -0.0008 0.0326  0.0631  150 GLY D O   
5092 N N   . LEU D 146 ? 0.2286 0.3666 0.2323 0.0051  0.0339  0.0564  151 LEU D N   
5093 C CA  . LEU D 146 ? 0.2331 0.3703 0.2359 0.0038  0.0311  0.0542  151 LEU D CA  
5094 C C   . LEU D 146 ? 0.2757 0.4078 0.2788 0.0112  0.0327  0.0604  151 LEU D C   
5095 O O   . LEU D 146 ? 0.2543 0.3678 0.2521 0.0146  0.0331  0.0582  151 LEU D O   
5096 C CB  . LEU D 146 ? 0.2249 0.3447 0.2220 0.0013  0.0295  0.0457  151 LEU D CB  
5097 C CG  . LEU D 146 ? 0.2257 0.3487 0.2225 -0.0056 0.0290  0.0394  151 LEU D CG  
5098 C CD1 . LEU D 146 ? 0.2609 0.3650 0.2527 -0.0062 0.0284  0.0327  151 LEU D CD1 
5099 C CD2 . LEU D 146 ? 0.2298 0.3694 0.2295 -0.0123 0.0273  0.0379  151 LEU D CD2 
5100 N N   . ASP D 147 ? 0.2626 0.4107 0.2716 0.0136  0.0340  0.0685  152 ASP D N   
5101 C CA  . ASP D 147 ? 0.2767 0.4193 0.2864 0.0214  0.0373  0.0755  152 ASP D CA  
5102 C C   . ASP D 147 ? 0.2635 0.4144 0.2761 0.0218  0.0355  0.0782  152 ASP D C   
5103 O O   . ASP D 147 ? 0.2635 0.4136 0.2783 0.0280  0.0386  0.0851  152 ASP D O   
5104 C CB  . ASP D 147 ? 0.3093 0.4599 0.3240 0.0264  0.0419  0.0843  152 ASP D CB  
5105 C CG  . ASP D 147 ? 0.3241 0.5015 0.3472 0.0232  0.0408  0.0901  152 ASP D CG  
5106 O OD1 . ASP D 147 ? 0.3270 0.5158 0.3508 0.0165  0.0365  0.0864  152 ASP D OD1 
5107 O OD2 . ASP D 147 ? 0.3169 0.5038 0.3458 0.0276  0.0446  0.0991  152 ASP D OD2 
5108 N N   . TYR D 148 ? 0.2501 0.4078 0.2625 0.0154  0.0313  0.0730  153 TYR D N   
5109 C CA  . TYR D 148 ? 0.3005 0.4654 0.3150 0.0152  0.0297  0.0749  153 TYR D CA  
5110 C C   . TYR D 148 ? 0.2847 0.4326 0.2962 0.0213  0.0312  0.0760  153 TYR D C   
5111 O O   . TYR D 148 ? 0.2518 0.3800 0.2573 0.0222  0.0311  0.0707  153 TYR D O   
5112 C CB  . TYR D 148 ? 0.3261 0.4950 0.3389 0.0074  0.0255  0.0674  153 TYR D CB  
5113 C CG  . TYR D 148 ? 0.4561 0.6364 0.4718 0.0070  0.0240  0.0706  153 TYR D CG  
5114 C CD1 . TYR D 148 ? 0.5443 0.7129 0.5583 0.0107  0.0239  0.0703  153 TYR D CD1 
5115 C CD2 . TYR D 148 ? 0.5686 0.7722 0.5890 0.0031  0.0229  0.0750  153 TYR D CD2 
5116 C CE1 . TYR D 148 ? 0.6347 0.8138 0.6517 0.0108  0.0229  0.0738  153 TYR D CE1 
5117 C CE2 . TYR D 148 ? 0.6239 0.8387 0.6469 0.0029  0.0216  0.0786  153 TYR D CE2 
5118 C CZ  . TYR D 148 ? 0.6629 0.8651 0.6843 0.0070  0.0218  0.0780  153 TYR D CZ  
5119 O OH  . TYR D 148 ? 0.8094 1.0229 0.8336 0.0070  0.0207  0.0818  153 TYR D OH  
5120 N N   . GLY D 149 ? 0.2606 0.4167 0.2764 0.0253  0.0328  0.0832  154 GLY D N   
5121 C CA  . GLY D 149 ? 0.2550 0.3962 0.2682 0.0304  0.0345  0.0843  154 GLY D CA  
5122 C C   . GLY D 149 ? 0.2640 0.3942 0.2762 0.0378  0.0404  0.0900  154 GLY D C   
5123 O O   . GLY D 149 ? 0.2600 0.3799 0.2705 0.0419  0.0426  0.0919  154 GLY D O   
5124 N N   . LYS D 150 ? 0.2940 0.4257 0.3073 0.0398  0.0436  0.0931  155 LYS D N   
5125 C CA  . LYS D 150 ? 0.3537 0.4752 0.3666 0.0476  0.0506  0.0997  155 LYS D CA  
5126 C C   . LYS D 150 ? 0.4032 0.5316 0.4217 0.0533  0.0546  0.1088  155 LYS D C   
5127 O O   . LYS D 150 ? 0.4546 0.5671 0.4697 0.0586  0.0598  0.1111  155 LYS D O   
5128 C CB  . LYS D 150 ? 0.3745 0.5010 0.3900 0.0496  0.0542  0.1039  155 LYS D CB  
5129 C CG  . LYS D 150 ? 0.3813 0.4939 0.3896 0.0463  0.0526  0.0958  155 LYS D CG  
5130 C CD  . LYS D 150 ? 0.3585 0.4760 0.3699 0.0489  0.0568  0.1006  155 LYS D CD  
5131 C CE  . LYS D 150 ? 0.3524 0.4511 0.3555 0.0479  0.0575  0.0940  155 LYS D CE  
5132 N NZ  . LYS D 150 ? 0.3407 0.4440 0.3468 0.0502  0.0617  0.0986  155 LYS D NZ  
5133 N N   . GLN D 151 ? 0.4401 0.5924 0.4670 0.0519  0.0526  0.1144  156 GLN D N   
5134 C CA  . GLN D 151 ? 0.4624 0.6242 0.4957 0.0571  0.0560  0.1237  156 GLN D CA  
5135 C C   . GLN D 151 ? 0.4869 0.6338 0.5158 0.0586  0.0561  0.1208  156 GLN D C   
5136 O O   . GLN D 151 ? 0.5277 0.6722 0.5595 0.0648  0.0616  0.1280  156 GLN D O   
5137 C CB  . GLN D 151 ? 0.4760 0.6682 0.5184 0.0536  0.0523  0.1295  156 GLN D CB  
5138 C CG  . GLN D 151 ? 0.5121 0.7141 0.5523 0.0440  0.0444  0.1210  156 GLN D CG  
5139 C CD  . GLN D 151 ? 0.5418 0.7422 0.5785 0.0384  0.0419  0.1141  156 GLN D CD  
5140 O OE1 . GLN D 151 ? 0.6816 0.8780 0.7190 0.0416  0.0456  0.1168  156 GLN D OE1 
5141 N NE2 . GLN D 151 ? 0.4796 0.6820 0.5127 0.0303  0.0363  0.1051  156 GLN D NE2 
5142 N N   . TYR D 152 ? 0.4000 0.5369 0.4225 0.0530  0.0505  0.1107  157 TYR D N   
5143 C CA  . TYR D 152 ? 0.4301 0.5534 0.4485 0.0535  0.0498  0.1074  157 TYR D CA  
5144 C C   . TYR D 152 ? 0.3912 0.4878 0.4000 0.0542  0.0516  0.1014  157 TYR D C   
5145 O O   . TYR D 152 ? 0.4292 0.5135 0.4335 0.0527  0.0495  0.0967  157 TYR D O   
5146 C CB  . TYR D 152 ? 0.4292 0.5601 0.4475 0.0466  0.0426  0.1009  157 TYR D CB  
5147 C CG  . TYR D 152 ? 0.5368 0.6942 0.5628 0.0442  0.0404  0.1057  157 TYR D CG  
5148 C CD1 . TYR D 152 ? 0.6169 0.7874 0.6492 0.0476  0.0422  0.1139  157 TYR D CD1 
5149 C CD2 . TYR D 152 ? 0.6206 0.7906 0.6476 0.0385  0.0370  0.1028  157 TYR D CD2 
5150 C CE1 . TYR D 152 ? 0.6648 0.8609 0.7038 0.0449  0.0399  0.1191  157 TYR D CE1 
5151 C CE2 . TYR D 152 ? 0.6962 0.8910 0.7293 0.0353  0.0349  0.1074  157 TYR D CE2 
5152 C CZ  . TYR D 152 ? 0.6872 0.8954 0.7262 0.0384  0.0362  0.1156  157 TYR D CZ  
5153 O OH  . TYR D 152 ? 0.8175 1.0515 0.8620 0.0345  0.0337  0.1204  157 TYR D OH  
5154 N N   . GLY D 153 ? 0.3882 0.4769 0.3940 0.0560  0.0550  0.1016  158 GLY D N   
5155 C CA  . GLY D 153 ? 0.3678 0.4318 0.3637 0.0564  0.0571  0.0964  158 GLY D CA  
5156 C C   . GLY D 153 ? 0.3490 0.4038 0.3383 0.0499  0.0506  0.0863  158 GLY D C   
5157 O O   . GLY D 153 ? 0.3235 0.3583 0.3044 0.0492  0.0508  0.0818  158 GLY D O   
5158 N N   . PHE D 154 ? 0.2863 0.3552 0.2793 0.0451  0.0452  0.0831  159 PHE D N   
5159 C CA  . PHE D 154 ? 0.2613 0.3218 0.2491 0.0394  0.0400  0.0743  159 PHE D CA  
5160 C C   . PHE D 154 ? 0.2477 0.2955 0.2296 0.0405  0.0427  0.0728  159 PHE D C   
5161 O O   . PHE D 154 ? 0.2630 0.3171 0.2476 0.0434  0.0467  0.0774  159 PHE D O   
5162 C CB  . PHE D 154 ? 0.2408 0.3182 0.2335 0.0340  0.0352  0.0713  159 PHE D CB  
5163 C CG  . PHE D 154 ? 0.2439 0.3305 0.2401 0.0310  0.0314  0.0700  159 PHE D CG  
5164 C CD1 . PHE D 154 ? 0.2705 0.3641 0.2707 0.0342  0.0330  0.0756  159 PHE D CD1 
5165 C CD2 . PHE D 154 ? 0.2656 0.3544 0.2614 0.0252  0.0269  0.0634  159 PHE D CD2 
5166 C CE1 . PHE D 154 ? 0.2780 0.3814 0.2816 0.0312  0.0296  0.0745  159 PHE D CE1 
5167 C CE2 . PHE D 154 ? 0.2967 0.3942 0.2956 0.0222  0.0240  0.0621  159 PHE D CE2 
5168 C CZ  . PHE D 154 ? 0.2795 0.3845 0.2821 0.0252  0.0252  0.0676  159 PHE D CZ  
5169 N N   . LYS D 155 ? 0.2256 0.2559 0.1994 0.0379  0.0406  0.0665  160 LYS D N   
5170 C CA  . LYS D 155 ? 0.2406 0.2586 0.2079 0.0382  0.0426  0.0645  160 LYS D CA  
5171 C C   . LYS D 155 ? 0.2235 0.2490 0.1927 0.0340  0.0389  0.0603  160 LYS D C   
5172 O O   . LYS D 155 ? 0.2399 0.2724 0.2120 0.0296  0.0340  0.0564  160 LYS D O   
5173 C CB  . LYS D 155 ? 0.2733 0.2699 0.2306 0.0368  0.0417  0.0601  160 LYS D CB  
5174 C CG  . LYS D 155 ? 0.3445 0.3304 0.2982 0.0400  0.0456  0.0632  160 LYS D CG  
5175 C CD  . LYS D 155 ? 0.4170 0.3853 0.3617 0.0362  0.0421  0.0577  160 LYS D CD  
5176 C CE  . LYS D 155 ? 0.4758 0.4294 0.4110 0.0334  0.0411  0.0532  160 LYS D CE  
5177 N NZ  . LYS D 155 ? 0.4211 0.3776 0.3570 0.0283  0.0341  0.0480  160 LYS D NZ  
5178 N N   . MET D 156 ? 0.2162 0.2399 0.1838 0.0351  0.0417  0.0609  161 MET D N   
5179 C CA  . MET D 156 ? 0.2007 0.2314 0.1703 0.0314  0.0394  0.0574  161 MET D CA  
5180 C C   . MET D 156 ? 0.2033 0.2196 0.1659 0.0279  0.0364  0.0507  161 MET D C   
5181 O O   . MET D 156 ? 0.1864 0.2077 0.1509 0.0243  0.0340  0.0470  161 MET D O   
5182 C CB  . MET D 156 ? 0.2122 0.2498 0.1847 0.0344  0.0440  0.0621  161 MET D CB  
5183 C CG  . MET D 156 ? 0.2258 0.2822 0.2072 0.0372  0.0463  0.0696  161 MET D CG  
5184 S SD  . MET D 156 ? 0.2462 0.3270 0.2364 0.0317  0.0412  0.0690  161 MET D SD  
5185 C CE  . MET D 156 ? 0.2380 0.3190 0.2295 0.0337  0.0403  0.0715  161 MET D CE  
5186 N N   . LYS D 157 ? 0.2272 0.2256 0.1816 0.0290  0.0369  0.0495  162 LYS D N   
5187 C CA  . LYS D 157 ? 0.2533 0.2386 0.2009 0.0259  0.0341  0.0444  162 LYS D CA  
5188 C C   . LYS D 157 ? 0.2243 0.2153 0.1758 0.0213  0.0285  0.0402  162 LYS D C   
5189 O O   . LYS D 157 ? 0.2362 0.2298 0.1901 0.0205  0.0262  0.0403  162 LYS D O   
5190 C CB  . LYS D 157 ? 0.3147 0.2815 0.2527 0.0266  0.0347  0.0439  162 LYS D CB  
5191 C CG  . LYS D 157 ? 0.3742 0.3284 0.3049 0.0229  0.0312  0.0393  162 LYS D CG  
5192 C CD  . LYS D 157 ? 0.4858 0.4212 0.4050 0.0233  0.0332  0.0393  162 LYS D CD  
5193 C CE  . LYS D 157 ? 0.5542 0.4854 0.4720 0.0215  0.0302  0.0389  162 LYS D CE  
5194 N NZ  . LYS D 157 ? 0.6029 0.5246 0.5146 0.0168  0.0251  0.0353  162 LYS D NZ  
5195 N N   . THR D 158 ? 0.2131 0.2056 0.1654 0.0184  0.0270  0.0369  163 THR D N   
5196 C CA  . THR D 158 ? 0.2012 0.1985 0.1576 0.0142  0.0229  0.0330  163 THR D CA  
5197 C C   . THR D 158 ? 0.2167 0.2016 0.1678 0.0122  0.0210  0.0299  163 THR D C   
5198 O O   . THR D 158 ? 0.2273 0.2076 0.1751 0.0127  0.0230  0.0294  163 THR D O   
5199 C CB  . THR D 158 ? 0.1941 0.2066 0.1574 0.0121  0.0236  0.0321  163 THR D CB  
5200 O OG1 . THR D 158 ? 0.2041 0.2297 0.1721 0.0140  0.0255  0.0361  163 THR D OG1 
5201 C CG2 . THR D 158 ? 0.2009 0.2188 0.1687 0.0075  0.0208  0.0280  163 THR D CG2 
5202 N N   . LYS D 159 ? 0.1957 0.1758 0.1466 0.0100  0.0172  0.0282  164 LYS D N   
5203 C CA  . LYS D 159 ? 0.2096 0.1794 0.1564 0.0080  0.0150  0.0262  164 LYS D CA  
5204 C C   . LYS D 159 ? 0.1912 0.1676 0.1445 0.0051  0.0139  0.0236  164 LYS D C   
5205 O O   . LYS D 159 ? 0.1816 0.1674 0.1415 0.0037  0.0133  0.0228  164 LYS D O   
5206 C CB  . LYS D 159 ? 0.2499 0.2104 0.1923 0.0073  0.0119  0.0270  164 LYS D CB  
5207 C CG  . LYS D 159 ? 0.3454 0.2971 0.2800 0.0098  0.0141  0.0293  164 LYS D CG  
5208 C CD  . LYS D 159 ? 0.4468 0.3884 0.3759 0.0081  0.0110  0.0297  164 LYS D CD  
5209 C CE  . LYS D 159 ? 0.4936 0.4280 0.4195 0.0045  0.0067  0.0284  164 LYS D CE  
5210 N NZ  . LYS D 159 ? 0.5462 0.4737 0.4679 0.0025  0.0037  0.0294  164 LYS D NZ  
5211 N N   . LEU D 160 ? 0.1949 0.1665 0.1465 0.0041  0.0142  0.0222  165 LEU D N   
5212 C CA  . LEU D 160 ? 0.2089 0.1836 0.1660 0.0015  0.0139  0.0200  165 LEU D CA  
5213 C C   . LEU D 160 ? 0.2214 0.1866 0.1762 0.0005  0.0107  0.0206  165 LEU D C   
5214 O O   . LEU D 160 ? 0.2464 0.2018 0.1939 0.0011  0.0096  0.0219  165 LEU D O   
5215 C CB  . LEU D 160 ? 0.2443 0.2210 0.2020 0.0012  0.0172  0.0183  165 LEU D CB  
5216 C CG  . LEU D 160 ? 0.2555 0.2437 0.2163 0.0014  0.0203  0.0180  165 LEU D CG  
5217 C CD1 . LEU D 160 ? 0.3021 0.2903 0.2627 0.0009  0.0232  0.0166  165 LEU D CD1 
5218 C CD2 . LEU D 160 ? 0.3257 0.3255 0.2934 -0.0011 0.0203  0.0164  165 LEU D CD2 
5219 N N   . LEU D 161 ? 0.2092 0.1779 0.1706 -0.0013 0.0094  0.0201  166 LEU D N   
5220 C CA  . LEU D 161 ? 0.2091 0.1715 0.1707 -0.0025 0.0063  0.0217  166 LEU D CA  
5221 C C   . LEU D 161 ? 0.2055 0.1719 0.1744 -0.0037 0.0091  0.0201  166 LEU D C   
5222 O O   . LEU D 161 ? 0.2071 0.1806 0.1827 -0.0048 0.0105  0.0187  166 LEU D O   
5223 C CB  . LEU D 161 ? 0.2355 0.1980 0.1990 -0.0031 0.0026  0.0237  166 LEU D CB  
5224 C CG  . LEU D 161 ? 0.2593 0.2169 0.2154 -0.0022 0.0008  0.0250  166 LEU D CG  
5225 C CD1 . LEU D 161 ? 0.2895 0.2544 0.2473 -0.0006 0.0031  0.0241  166 LEU D CD1 
5226 C CD2 . LEU D 161 ? 0.3242 0.2781 0.2798 -0.0037 -0.0036 0.0274  166 LEU D CD2 
5227 N N   . ILE D 162 ? 0.1980 0.1592 0.1654 -0.0038 0.0098  0.0206  167 ILE D N   
5228 C CA  . ILE D 162 ? 0.2172 0.1810 0.1906 -0.0047 0.0138  0.0188  167 ILE D CA  
5229 C C   . ILE D 162 ? 0.2184 0.1788 0.1965 -0.0052 0.0127  0.0216  167 ILE D C   
5230 O O   . ILE D 162 ? 0.2349 0.1891 0.2088 -0.0047 0.0095  0.0248  167 ILE D O   
5231 C CB  . ILE D 162 ? 0.2484 0.2093 0.2178 -0.0041 0.0166  0.0175  167 ILE D CB  
5232 C CG1 . ILE D 162 ? 0.2839 0.2488 0.2493 -0.0033 0.0180  0.0158  167 ILE D CG1 
5233 C CG2 . ILE D 162 ? 0.2618 0.2233 0.2370 -0.0053 0.0207  0.0161  167 ILE D CG2 
5234 C CD1 . ILE D 162 ? 0.2960 0.2705 0.2659 -0.0045 0.0195  0.0137  167 ILE D CD1 
5235 N N   . THR D 163 ? 0.2112 0.1756 0.1976 -0.0062 0.0159  0.0206  168 THR D N   
5236 C CA  . THR D 163 ? 0.2289 0.1908 0.2218 -0.0062 0.0165  0.0239  168 THR D CA  
5237 C C   . THR D 163 ? 0.2087 0.1703 0.2048 -0.0067 0.0229  0.0212  168 THR D C   
5238 O O   . THR D 163 ? 0.2008 0.1668 0.1983 -0.0083 0.0270  0.0167  168 THR D O   
5239 C CB  . THR D 163 ? 0.2507 0.2171 0.2514 -0.0069 0.0173  0.0243  168 THR D CB  
5240 O OG1 . THR D 163 ? 0.2955 0.2632 0.2937 -0.0067 0.0120  0.0260  168 THR D OG1 
5241 C CG2 . THR D 163 ? 0.2704 0.2353 0.2797 -0.0065 0.0195  0.0279  168 THR D CG2 
5242 N N   . ALA D 164 ? 0.2266 0.1835 0.2240 -0.0057 0.0239  0.0241  169 ALA D N   
5243 C CA  . ALA D 164 ? 0.2269 0.1828 0.2280 -0.0062 0.0306  0.0218  169 ALA D CA  
5244 C C   . ALA D 164 ? 0.2176 0.1694 0.2244 -0.0048 0.0320  0.0270  169 ALA D C   
5245 O O   . ALA D 164 ? 0.2391 0.1882 0.2430 -0.0035 0.0269  0.0320  169 ALA D O   
5246 C CB  . ALA D 164 ? 0.2394 0.1937 0.2333 -0.0062 0.0313  0.0191  169 ALA D CB  
5247 N N   . GLU D 165 ? 0.2178 0.1693 0.2320 -0.0053 0.0392  0.0257  170 GLU D N   
5248 C CA  . GLU D 165 ? 0.2330 0.1810 0.2542 -0.0035 0.0424  0.0309  170 GLU D CA  
5249 C C   . GLU D 165 ? 0.2291 0.1743 0.2521 -0.0044 0.0510  0.0266  170 GLU D C   
5250 O O   . GLU D 165 ? 0.2385 0.1856 0.2620 -0.0071 0.0558  0.0206  170 GLU D O   
5251 C CB  . GLU D 165 ? 0.2530 0.2026 0.2839 -0.0028 0.0439  0.0349  170 GLU D CB  
5252 C CG  . GLU D 165 ? 0.2739 0.2261 0.3038 -0.0020 0.0353  0.0404  170 GLU D CG  
5253 C CD  . GLU D 165 ? 0.3093 0.2637 0.3497 -0.0009 0.0360  0.0462  170 GLU D CD  
5254 O OE1 . GLU D 165 ? 0.3297 0.2828 0.3793 0.0000  0.0440  0.0473  170 GLU D OE1 
5255 O OE2 . GLU D 165 ? 0.3122 0.2696 0.3515 -0.0010 0.0288  0.0499  170 GLU D OE2 
5256 N N   . ALA D 166 ? 0.2426 0.1835 0.2663 -0.0027 0.0529  0.0299  171 ALA D N   
5257 C CA  . ALA D 166 ? 0.2543 0.1918 0.2796 -0.0035 0.0612  0.0262  171 ALA D CA  
5258 C C   . ALA D 166 ? 0.2652 0.1984 0.2985 -0.0008 0.0659  0.0326  171 ALA D C   
5259 O O   . ALA D 166 ? 0.2970 0.2299 0.3303 0.0017  0.0608  0.0396  171 ALA D O   
5260 C CB  . ALA D 166 ? 0.2716 0.2083 0.2882 -0.0041 0.0594  0.0229  171 ALA D CB  
5261 N N   . VAL D 167 ? 0.3011 0.2312 0.3407 -0.0017 0.0757  0.0300  172 VAL D N   
5262 C CA  . VAL D 167 ? 0.2971 0.2230 0.3463 0.0009  0.0824  0.0361  172 VAL D CA  
5263 C C   . VAL D 167 ? 0.3206 0.2414 0.3680 0.0012  0.0879  0.0345  172 VAL D C   
5264 O O   . VAL D 167 ? 0.2950 0.2141 0.3389 -0.0020 0.0930  0.0268  172 VAL D O   
5265 C CB  . VAL D 167 ? 0.3185 0.2426 0.3758 -0.0002 0.0915  0.0339  172 VAL D CB  
5266 C CG1 . VAL D 167 ? 0.3348 0.2537 0.4032 0.0030  0.1004  0.0406  172 VAL D CG1 
5267 C CG2 . VAL D 167 ? 0.3249 0.2538 0.3834 -0.0009 0.0870  0.0342  172 VAL D CG2 
5268 N N   . LYS D 168 ? 0.3442 0.2632 0.3939 0.0048  0.0865  0.0421  173 LYS D N   
5269 C CA  . LYS D 168 ? 0.4035 0.3177 0.4522 0.0056  0.0916  0.0418  173 LYS D CA  
5270 C C   . LYS D 168 ? 0.4331 0.3417 0.4883 0.0042  0.1045  0.0379  173 LYS D C   
5271 O O   . LYS D 168 ? 0.4209 0.3278 0.4852 0.0050  0.1111  0.0402  173 LYS D O   
5272 C CB  . LYS D 168 ? 0.4258 0.3395 0.4771 0.0097  0.0886  0.0517  173 LYS D CB  
5273 C CG  . LYS D 168 ? 0.4628 0.3718 0.5104 0.0105  0.0920  0.0511  173 LYS D CG  
5274 C CD  . LYS D 168 ? 0.5436 0.4524 0.5952 0.0146  0.0905  0.0616  173 LYS D CD  
5275 C CE  . LYS D 168 ? 0.5554 0.4687 0.5997 0.0150  0.0782  0.0667  173 LYS D CE  
5276 N NZ  . LYS D 168 ? 0.7049 0.6191 0.7529 0.0183  0.0766  0.0775  173 LYS D NZ  
5277 N N   . GLN D 169 ? 0.4518 0.3572 0.5020 0.0018  0.1087  0.0315  174 GLN D N   
5278 C CA  . GLN D 169 ? 0.6102 0.5097 0.6647 -0.0007 0.1213  0.0262  174 GLN D CA  
5279 C C   . GLN D 169 ? 0.6139 0.5072 0.6735 0.0026  0.1281  0.0314  174 GLN D C   
5280 O O   . GLN D 169 ? 0.5912 0.4813 0.6606 0.0058  0.1341  0.0379  174 GLN D O   
5281 C CB  . GLN D 169 ? 0.6592 0.5597 0.7057 -0.0067 0.1228  0.0154  174 GLN D CB  
5282 C CG  . GLN D 169 ? 0.7513 0.6504 0.7921 -0.0072 0.1226  0.0132  174 GLN D CG  
5283 C CD  . GLN D 169 ? 0.7709 0.6724 0.8053 -0.0136 0.1244  0.0033  174 GLN D CD  
5284 O OE1 . GLN D 169 ? 0.7884 0.6954 0.8199 -0.0172 0.1214  -0.0011 174 GLN D OE1 
5285 N NE2 . GLN D 169 ? 0.8489 0.7471 0.8815 -0.0152 0.1294  0.0003  174 GLN D NE2 
5286 O O7  . OTP E .   ? 0.5902 0.5830 0.6486 0.0246  0.0238  0.0191  201 OTP B O7  
5287 P P2  . OTP E .   ? 0.8026 0.7914 0.8599 0.0235  0.0241  0.0176  201 OTP B P2  
5288 O O5  . OTP E .   ? 0.8457 0.8312 0.9081 0.0249  0.0260  0.0179  201 OTP B O5  
5289 O O6  . OTP E .   ? 0.8402 0.8292 0.8936 0.0223  0.0222  0.0189  201 OTP B O6  
5290 O O4  . OTP E .   ? 0.8527 0.8407 0.9078 0.0219  0.0250  0.0131  201 OTP B O4  
5291 P P1  . OTP E .   ? 0.9733 0.9607 1.0233 0.0194  0.0240  0.0104  201 OTP B P1  
5292 O O2  . OTP E .   ? 0.7618 0.7518 0.8107 0.0189  0.0243  0.0083  201 OTP B O2  
5293 O O3  . OTP E .   ? 0.8593 0.8429 0.9099 0.0187  0.0252  0.0084  201 OTP B O3  
5294 O O1  . OTP E .   ? 0.8359 0.8246 0.8817 0.0186  0.0215  0.0125  201 OTP B O1  
5295 C C40 . OTP E .   ? 0.6927 0.6799 0.7378 0.0185  0.0207  0.0142  201 OTP B C40 
5296 C C39 . OTP E .   ? 0.6269 0.6141 0.6672 0.0168  0.0190  0.0133  201 OTP B C39 
5297 C C37 . OTP E .   ? 0.6298 0.6148 0.6688 0.0157  0.0193  0.0114  201 OTP B C37 
5298 C C38 . OTP E .   ? 0.5545 0.5365 0.5965 0.0158  0.0214  0.0098  201 OTP B C38 
5299 C C36 . OTP E .   ? 0.5611 0.5463 0.5956 0.0142  0.0176  0.0106  201 OTP B C36 
5300 C C35 . OTP E .   ? 0.5027 0.4904 0.5344 0.0141  0.0155  0.0120  201 OTP B C35 
5301 C C34 . OTP E .   ? 0.3802 0.3680 0.4078 0.0127  0.0139  0.0109  201 OTP B C34 
5302 C C32 . OTP E .   ? 0.3240 0.3126 0.3491 0.0116  0.0131  0.0095  201 OTP B C32 
5303 C C33 . OTP E .   ? 0.2892 0.2791 0.3151 0.0113  0.0137  0.0086  201 OTP B C33 
5304 C C31 . OTP E .   ? 0.2635 0.2520 0.2849 0.0105  0.0114  0.0088  201 OTP B C31 
5305 C C30 . OTP E .   ? 0.2461 0.2336 0.2665 0.0092  0.0119  0.0065  201 OTP B C30 
5306 C C29 . OTP E .   ? 0.2305 0.2182 0.2475 0.0083  0.0099  0.0063  201 OTP B C29 
5307 C C27 . OTP E .   ? 0.1909 0.1780 0.2066 0.0085  0.0091  0.0065  201 OTP B C27 
5308 C C28 . OTP E .   ? 0.2180 0.2042 0.2349 0.0092  0.0098  0.0072  201 OTP B C28 
5309 C C26 . OTP E .   ? 0.1850 0.1723 0.1976 0.0077  0.0072  0.0061  201 OTP B C26 
5310 C C25 . OTP E .   ? 0.1721 0.1588 0.1836 0.0067  0.0073  0.0046  201 OTP B C25 
5311 C C24 . OTP E .   ? 0.1912 0.1784 0.2001 0.0062  0.0053  0.0044  201 OTP B C24 
5312 C C22 . OTP E .   ? 0.2066 0.1940 0.2140 0.0049  0.0048  0.0033  201 OTP B C22 
5313 C C23 . OTP E .   ? 0.2210 0.2087 0.2290 0.0036  0.0064  0.0017  201 OTP B C23 
5314 C C21 . OTP E .   ? 0.2726 0.2602 0.2777 0.0045  0.0026  0.0036  201 OTP B C21 
5315 C C20 . OTP E .   ? 0.2830 0.2703 0.2873 0.0050  0.0019  0.0035  201 OTP B C20 
5316 C C19 . OTP E .   ? 0.3223 0.3094 0.3247 0.0049  -0.0003 0.0038  201 OTP B C19 
5317 C C17 . OTP E .   ? 0.2551 0.2425 0.2563 0.0040  -0.0013 0.0034  201 OTP B C17 
5318 C C18 . OTP E .   ? 0.2853 0.2738 0.2867 0.0029  -0.0002 0.0024  201 OTP B C18 
5319 C C16 . OTP E .   ? 0.2632 0.2500 0.2631 0.0044  -0.0036 0.0040  201 OTP B C16 
5320 C C15 . OTP E .   ? 0.2641 0.2508 0.2634 0.0034  -0.0047 0.0047  201 OTP B C15 
5321 C C14 . OTP E .   ? 0.2246 0.2102 0.2226 0.0035  -0.0069 0.0052  201 OTP B C14 
5322 C C12 . OTP E .   ? 0.2301 0.2158 0.2274 0.0022  -0.0083 0.0059  201 OTP B C12 
5323 C C13 . OTP E .   ? 0.2234 0.2107 0.2208 0.0004  -0.0075 0.0061  201 OTP B C13 
5324 C C11 . OTP E .   ? 0.2142 0.1984 0.2107 0.0025  -0.0106 0.0066  201 OTP B C11 
5325 C C10 . OTP E .   ? 0.2130 0.1957 0.2095 0.0044  -0.0114 0.0061  201 OTP B C10 
5326 C C9  . OTP E .   ? 0.2311 0.2118 0.2270 0.0046  -0.0138 0.0067  201 OTP B C9  
5327 C C7  . OTP E .   ? 0.2362 0.2149 0.2318 0.0056  -0.0152 0.0066  201 OTP B C7  
5328 C C8  . OTP E .   ? 0.2388 0.2171 0.2343 0.0067  -0.0146 0.0060  201 OTP B C8  
5329 C C6  . OTP E .   ? 0.2360 0.2126 0.2315 0.0059  -0.0175 0.0070  201 OTP B C6  
5330 C C5  . OTP E .   ? 0.2626 0.2397 0.2580 0.0043  -0.0183 0.0083  201 OTP B C5  
5331 C C4  . OTP E .   ? 0.2763 0.2509 0.2718 0.0045  -0.0208 0.0091  201 OTP B C4  
5332 C C2  . OTP E .   ? 0.2573 0.2313 0.2525 0.0027  -0.0223 0.0107  201 OTP B C2  
5333 C C3  . OTP E .   ? 0.2954 0.2662 0.2911 0.0036  -0.0247 0.0112  201 OTP B C3  
5334 C C1  . OTP E .   ? 0.2567 0.2324 0.2513 0.0002  -0.0221 0.0119  201 OTP B C1  
5335 C C1  . PEG F .   ? 0.3359 0.3076 0.3662 0.0026  0.0229  -0.0014 202 PEG B C1  
5336 O O1  . PEG F .   ? 0.3837 0.3561 0.4119 0.0009  0.0225  -0.0023 202 PEG B O1  
5337 C C2  . PEG F .   ? 0.4153 0.3872 0.4468 0.0045  0.0220  0.0018  202 PEG B C2  
5338 O O2  . PEG F .   ? 0.4026 0.3750 0.4352 0.0061  0.0218  0.0028  202 PEG B O2  
5339 C C3  . PEG F .   ? 0.3362 0.3108 0.3676 0.0074  0.0201  0.0053  202 PEG B C3  
5340 C C4  . PEG F .   ? 0.4396 0.4138 0.4740 0.0091  0.0202  0.0082  202 PEG B C4  
5341 O O4  . PEG F .   ? 0.3507 0.3263 0.3856 0.0105  0.0197  0.0093  202 PEG B O4  
5342 O O7  . OTP G .   ? 1.0175 1.0290 1.1388 0.0141  0.0372  0.0395  201 OTP C O7  
5343 P P2  . OTP G .   ? 1.1019 1.1169 1.2219 0.0156  0.0360  0.0445  201 OTP C P2  
5344 O O5  . OTP G .   ? 0.9696 0.9906 1.0861 0.0158  0.0326  0.0459  201 OTP C O5  
5345 O O6  . OTP G .   ? 1.2158 1.2287 1.3389 0.0186  0.0395  0.0487  201 OTP C O6  
5346 O O4  . OTP G .   ? 0.9562 0.9706 1.0749 0.0135  0.0349  0.0438  201 OTP C O4  
5347 P P1  . OTP G .   ? 0.9170 0.9338 1.0343 0.0142  0.0339  0.0478  201 OTP C P1  
5348 O O2  . OTP G .   ? 0.8108 0.8251 0.9317 0.0164  0.0374  0.0518  201 OTP C O2  
5349 O O3  . OTP G .   ? 0.5689 0.5860 0.6838 0.0120  0.0319  0.0453  201 OTP C O3  
5350 O O1  . OTP G .   ? 0.8080 0.8305 0.9212 0.0148  0.0304  0.0499  201 OTP C O1  
5351 C C40 . OTP G .   ? 0.8036 0.8277 0.9131 0.0129  0.0274  0.0467  201 OTP C C40 
5352 C C39 . OTP G .   ? 0.7629 0.7906 0.8672 0.0122  0.0239  0.0480  201 OTP C C39 
5353 C C37 . OTP G .   ? 0.7859 0.8172 0.8877 0.0121  0.0220  0.0490  201 OTP C C37 
5354 C C38 . OTP G .   ? 0.7839 0.8166 0.8881 0.0131  0.0232  0.0493  201 OTP C C38 
5355 C C36 . OTP G .   ? 0.7198 0.7536 0.8157 0.0108  0.0186  0.0500  201 OTP C C36 
5356 C C35 . OTP G .   ? 0.6449 0.6793 0.7364 0.0088  0.0159  0.0472  201 OTP C C35 
5357 C C34 . OTP G .   ? 0.5484 0.5790 0.6398 0.0079  0.0161  0.0431  201 OTP C C34 
5358 C C32 . OTP G .   ? 0.4152 0.4444 0.5022 0.0064  0.0139  0.0401  201 OTP C C32 
5359 C C33 . OTP G .   ? 0.4115 0.4380 0.5009 0.0063  0.0153  0.0368  201 OTP C C33 
5360 C C31 . OTP G .   ? 0.3415 0.3711 0.4215 0.0048  0.0107  0.0397  201 OTP C C31 
5361 C C30 . OTP G .   ? 0.3177 0.3477 0.3967 0.0036  0.0099  0.0374  201 OTP C C30 
5362 C C29 . OTP G .   ? 0.2668 0.2953 0.3384 0.0019  0.0070  0.0361  201 OTP C C29 
5363 C C27 . OTP G .   ? 0.2641 0.2940 0.3310 0.0003  0.0050  0.0376  201 OTP C C27 
5364 C C28 . OTP G .   ? 0.2709 0.3054 0.3399 0.0001  0.0052  0.0410  201 OTP C C28 
5365 C C26 . OTP G .   ? 0.2328 0.2597 0.2919 -0.0014 0.0024  0.0360  201 OTP C C26 
5366 C C25 . OTP G .   ? 0.2428 0.2709 0.3001 -0.0032 0.0014  0.0351  201 OTP C C25 
5367 C C24 . OTP G .   ? 0.2814 0.3051 0.3306 -0.0046 -0.0007 0.0334  201 OTP C C24 
5368 C C22 . OTP G .   ? 0.2927 0.3146 0.3388 -0.0055 -0.0015 0.0311  201 OTP C C22 
5369 C C23 . OTP G .   ? 0.2721 0.2972 0.3229 -0.0056 -0.0006 0.0299  201 OTP C C23 
5370 C C21 . OTP G .   ? 0.3511 0.3675 0.3888 -0.0060 -0.0032 0.0298  201 OTP C C21 
5371 C C20 . OTP G .   ? 0.3883 0.4034 0.4206 -0.0085 -0.0048 0.0295  201 OTP C C20 
5372 C C19 . OTP G .   ? 0.3717 0.3802 0.3944 -0.0091 -0.0064 0.0290  201 OTP C C19 
5373 C C17 . OTP G .   ? 0.3305 0.3354 0.3469 -0.0105 -0.0076 0.0279  201 OTP C C17 
5374 C C18 . OTP G .   ? 0.3430 0.3512 0.3622 -0.0118 -0.0074 0.0271  201 OTP C C18 
5375 C C16 . OTP G .   ? 0.3345 0.3319 0.3408 -0.0108 -0.0089 0.0277  201 OTP C C16 
5376 C C15 . OTP G .   ? 0.3360 0.3301 0.3408 -0.0075 -0.0083 0.0256  201 OTP C C15 
5377 C C14 . OTP G .   ? 0.2969 0.2830 0.2908 -0.0075 -0.0095 0.0250  201 OTP C C14 
5378 C C12 . OTP G .   ? 0.2975 0.2807 0.2886 -0.0047 -0.0091 0.0231  201 OTP C C12 
5379 C C13 . OTP G .   ? 0.3057 0.2943 0.3045 -0.0019 -0.0077 0.0214  201 OTP C C13 
5380 C C11 . OTP G .   ? 0.2752 0.2497 0.2550 -0.0040 -0.0100 0.0227  201 OTP C C11 
5381 C C10 . OTP G .   ? 0.2907 0.2592 0.2625 -0.0069 -0.0113 0.0242  201 OTP C C10 
5382 C C9  . OTP G .   ? 0.3314 0.2899 0.2912 -0.0059 -0.0118 0.0236  201 OTP C C9  
5383 C C7  . OTP G .   ? 0.3399 0.2915 0.2917 -0.0052 -0.0122 0.0240  201 OTP C C7  
5384 C C8  . OTP G .   ? 0.3394 0.2936 0.2939 -0.0050 -0.0123 0.0250  201 OTP C C8  
5385 C C6  . OTP G .   ? 0.3936 0.3340 0.3325 -0.0043 -0.0126 0.0234  201 OTP C C6  
5386 C C5  . OTP G .   ? 0.3810 0.3208 0.3192 -0.0014 -0.0119 0.0222  201 OTP C C5  
5387 C C4  . OTP G .   ? 0.4333 0.3621 0.3590 0.0008  -0.0118 0.0218  201 OTP C C4  
5388 C C2  . OTP G .   ? 0.4362 0.3634 0.3592 0.0060  -0.0109 0.0209  201 OTP C C2  
5389 C C3  . OTP G .   ? 0.5330 0.4474 0.4418 0.0076  -0.0109 0.0210  201 OTP C C3  
5390 C C1  . OTP G .   ? 0.4153 0.3521 0.3475 0.0101  -0.0099 0.0198  201 OTP C C1  
5391 O O7  . OTP H .   ? 0.4488 0.4969 0.4826 -0.0051 -0.0296 0.0384  201 OTP A O7  
5392 P P2  . OTP H .   ? 0.4282 0.4828 0.4583 -0.0056 -0.0297 0.0402  201 OTP A P2  
5393 O O5  . OTP H .   ? 0.4967 0.5576 0.5249 -0.0056 -0.0293 0.0368  201 OTP A O5  
5394 O O6  . OTP H .   ? 0.4357 0.4956 0.4673 -0.0056 -0.0319 0.0463  201 OTP A O6  
5395 O O4  . OTP H .   ? 0.3791 0.4316 0.4049 -0.0063 -0.0278 0.0381  201 OTP A O4  
5396 P P1  . OTP H .   ? 0.3038 0.3510 0.3273 -0.0064 -0.0252 0.0331  201 OTP A P1  
5397 O O2  . OTP H .   ? 0.2506 0.2908 0.2767 -0.0060 -0.0247 0.0316  201 OTP A O2  
5398 O O3  . OTP H .   ? 0.3306 0.3834 0.3519 -0.0066 -0.0243 0.0295  201 OTP A O3  
5399 O O1  . OTP H .   ? 0.3438 0.3904 0.3651 -0.0069 -0.0251 0.0357  201 OTP A O1  
5400 C C40 . OTP H .   ? 0.3312 0.3720 0.3544 -0.0068 -0.0254 0.0377  201 OTP A C40 
5401 C C39 . OTP H .   ? 0.3330 0.3686 0.3538 -0.0069 -0.0237 0.0354  201 OTP A C39 
5402 C C37 . OTP H .   ? 0.3850 0.4211 0.4038 -0.0073 -0.0236 0.0370  201 OTP A C37 
5403 C C38 . OTP H .   ? 0.4146 0.4568 0.4331 -0.0078 -0.0249 0.0410  201 OTP A C38 
5404 C C36 . OTP H .   ? 0.4166 0.4480 0.4332 -0.0072 -0.0221 0.0350  201 OTP A C36 
5405 C C35 . OTP H .   ? 0.3688 0.3946 0.3857 -0.0066 -0.0209 0.0317  201 OTP A C35 
5406 C C34 . OTP H .   ? 0.3117 0.3338 0.3258 -0.0064 -0.0193 0.0298  201 OTP A C34 
5407 C C32 . OTP H .   ? 0.2535 0.2751 0.2650 -0.0062 -0.0175 0.0268  201 OTP A C32 
5408 C C33 . OTP H .   ? 0.2806 0.3042 0.2919 -0.0063 -0.0165 0.0241  201 OTP A C33 
5409 C C31 . OTP H .   ? 0.2430 0.2608 0.2521 -0.0058 -0.0162 0.0255  201 OTP A C31 
5410 C C30 . OTP H .   ? 0.2184 0.2386 0.2247 -0.0062 -0.0154 0.0246  201 OTP A C30 
5411 C C29 . OTP H .   ? 0.2093 0.2255 0.2134 -0.0056 -0.0139 0.0231  201 OTP A C29 
5412 C C27 . OTP H .   ? 0.1762 0.1904 0.1793 -0.0053 -0.0142 0.0240  201 OTP A C27 
5413 C C28 . OTP H .   ? 0.1845 0.1999 0.1891 -0.0057 -0.0160 0.0269  201 OTP A C28 
5414 C C26 . OTP H .   ? 0.1747 0.1854 0.1755 -0.0045 -0.0127 0.0223  201 OTP A C26 
5415 C C25 . OTP H .   ? 0.1677 0.1802 0.1665 -0.0047 -0.0125 0.0223  201 OTP A C25 
5416 C C24 . OTP H .   ? 0.1960 0.2048 0.1928 -0.0037 -0.0110 0.0207  201 OTP A C24 
5417 C C22 . OTP H .   ? 0.2461 0.2553 0.2414 -0.0036 -0.0098 0.0193  201 OTP A C22 
5418 C C23 . OTP H .   ? 0.2112 0.2253 0.2065 -0.0046 -0.0100 0.0189  201 OTP A C23 
5419 C C21 . OTP H .   ? 0.2606 0.2660 0.2545 -0.0024 -0.0081 0.0181  201 OTP A C21 
5420 C C20 . OTP H .   ? 0.3097 0.3141 0.3019 -0.0018 -0.0085 0.0186  201 OTP A C20 
5421 C C19 . OTP H .   ? 0.2780 0.2789 0.2687 -0.0004 -0.0071 0.0179  201 OTP A C19 
5422 C C17 . OTP H .   ? 0.2622 0.2626 0.2517 0.0001  -0.0061 0.0172  201 OTP A C17 
5423 C C18 . OTP H .   ? 0.2368 0.2405 0.2265 -0.0007 -0.0065 0.0167  201 OTP A C18 
5424 C C16 . OTP H .   ? 0.2732 0.2701 0.2613 0.0017  -0.0049 0.0173  201 OTP A C16 
5425 C C15 . OTP H .   ? 0.2667 0.2618 0.2556 0.0020  -0.0029 0.0167  201 OTP A C15 
5426 C C14 . OTP H .   ? 0.2482 0.2405 0.2355 0.0036  -0.0016 0.0172  201 OTP A C14 
5427 C C12 . OTP H .   ? 0.2488 0.2394 0.2370 0.0041  0.0004  0.0171  201 OTP A C12 
5428 C C13 . OTP H .   ? 0.2458 0.2373 0.2372 0.0029  0.0015  0.0158  201 OTP A C13 
5429 C C11 . OTP H .   ? 0.2401 0.2284 0.2267 0.0058  0.0017  0.0182  201 OTP A C11 
5430 C C10 . OTP H .   ? 0.2212 0.2093 0.2048 0.0072  0.0007  0.0191  201 OTP A C10 
5431 C C9  . OTP H .   ? 0.2206 0.2070 0.2025 0.0091  0.0021  0.0204  201 OTP A C9  
5432 C C7  . OTP H .   ? 0.2183 0.2043 0.1979 0.0105  0.0024  0.0213  201 OTP A C7  
5433 C C8  . OTP H .   ? 0.2497 0.2367 0.2287 0.0104  0.0012  0.0205  201 OTP A C8  
5434 C C6  . OTP H .   ? 0.2561 0.2413 0.2337 0.0126  0.0038  0.0230  201 OTP A C6  
5435 C C5  . OTP H .   ? 0.2645 0.2480 0.2443 0.0126  0.0056  0.0240  201 OTP A C5  
5436 C C4  . OTP H .   ? 0.3082 0.2910 0.2863 0.0147  0.0070  0.0263  201 OTP A C4  
5437 C C2  . OTP H .   ? 0.2831 0.2640 0.2633 0.0151  0.0095  0.0280  201 OTP A C2  
5438 C C3  . OTP H .   ? 0.3455 0.3262 0.3234 0.0174  0.0105  0.0308  201 OTP A C3  
5439 C C1  . OTP H .   ? 0.2849 0.2642 0.2694 0.0135  0.0112  0.0274  201 OTP A C1  
5440 O O7  . OTP I .   ? 0.8171 0.9701 0.8238 -0.0120 0.0129  0.0402  201 OTP D O7  
5441 P P2  . OTP I .   ? 1.0545 1.1953 1.0622 -0.0046 0.0126  0.0440  201 OTP D P2  
5442 O O5  . OTP I .   ? 0.7570 0.9045 0.7676 -0.0007 0.0126  0.0502  201 OTP D O5  
5443 O O6  . OTP I .   ? 1.0021 1.1247 1.0082 -0.0042 0.0119  0.0392  201 OTP D O6  
5444 O O4  . OTP I .   ? 0.8938 1.0338 0.9010 -0.0010 0.0138  0.0476  201 OTP D O4  
5445 P P1  . OTP I .   ? 0.8337 0.9584 0.8391 0.0051  0.0148  0.0498  201 OTP D P1  
5446 O O2  . OTP I .   ? 0.7869 0.9196 0.7949 0.0104  0.0169  0.0580  201 OTP D O2  
5447 O O3  . OTP I .   ? 0.4606 0.5661 0.4632 0.0068  0.0138  0.0467  201 OTP D O3  
5448 O O1  . OTP I .   ? 0.8019 0.9259 0.8052 0.0016  0.0152  0.0457  201 OTP D O1  
5449 C C40 . OTP I .   ? 0.8061 0.9395 0.8105 0.0022  0.0167  0.0492  201 OTP D C40 
5450 C C39 . OTP I .   ? 0.7284 0.8458 0.7292 0.0046  0.0176  0.0471  201 OTP D C39 
5451 C C37 . OTP I .   ? 0.6428 0.7628 0.6432 0.0039  0.0188  0.0471  201 OTP D C37 
5452 C C38 . OTP I .   ? 0.6973 0.8367 0.7009 0.0001  0.0193  0.0490  201 OTP D C38 
5453 C C36 . OTP I .   ? 0.6332 0.7360 0.6293 0.0062  0.0196  0.0449  201 OTP D C36 
5454 C C35 . OTP I .   ? 0.5551 0.6473 0.5490 0.0026  0.0175  0.0382  201 OTP D C35 
5455 C C34 . OTP I .   ? 0.5069 0.5879 0.4974 0.0023  0.0181  0.0350  201 OTP D C34 
5456 C C32 . OTP I .   ? 0.4332 0.5061 0.4224 -0.0007 0.0170  0.0297  201 OTP D C32 
5457 C C33 . OTP I .   ? 0.4367 0.5099 0.4279 -0.0041 0.0156  0.0263  201 OTP D C33 
5458 C C31 . OTP I .   ? 0.4068 0.4692 0.3928 -0.0006 0.0178  0.0274  201 OTP D C31 
5459 C C30 . OTP I .   ? 0.3476 0.4179 0.3354 -0.0055 0.0191  0.0237  201 OTP D C30 
5460 C C29 . OTP I .   ? 0.3362 0.3944 0.3212 -0.0059 0.0197  0.0206  201 OTP D C29 
5461 C C27 . OTP I .   ? 0.3434 0.3984 0.3262 -0.0044 0.0213  0.0214  201 OTP D C27 
5462 C C28 . OTP I .   ? 0.3601 0.4239 0.3435 -0.0020 0.0230  0.0258  201 OTP D C28 
5463 C C26 . OTP I .   ? 0.3248 0.3681 0.3050 -0.0050 0.0219  0.0183  201 OTP D C26 
5464 C C25 . OTP I .   ? 0.3069 0.3574 0.2888 -0.0088 0.0245  0.0157  201 OTP D C25 
5465 C C24 . OTP I .   ? 0.2980 0.3366 0.2780 -0.0094 0.0252  0.0127  201 OTP D C24 
5466 C C22 . OTP I .   ? 0.3062 0.3448 0.2877 -0.0131 0.0274  0.0088  201 OTP D C22 
5467 C C23 . OTP I .   ? 0.2880 0.3388 0.2724 -0.0187 0.0295  0.0058  201 OTP D C23 
5468 C C21 . OTP I .   ? 0.3021 0.3270 0.2820 -0.0123 0.0278  0.0073  201 OTP D C21 
5469 C C20 . OTP I .   ? 0.3282 0.3510 0.3066 -0.0126 0.0303  0.0065  201 OTP D C20 
5470 C C19 . OTP I .   ? 0.3553 0.3644 0.3314 -0.0107 0.0303  0.0064  201 OTP D C19 
5471 C C17 . OTP I .   ? 0.3343 0.3406 0.3118 -0.0130 0.0335  0.0036  201 OTP D C17 
5472 C C18 . OTP I .   ? 0.3462 0.3615 0.3271 -0.0182 0.0373  -0.0002 201 OTP D C18 
5473 C C16 . OTP I .   ? 0.3667 0.3603 0.3418 -0.0105 0.0332  0.0048  201 OTP D C16 
5474 C C15 . OTP I .   ? 0.3728 0.3616 0.3510 -0.0112 0.0324  0.0045  201 OTP D C15 
5475 C C14 . OTP I .   ? 0.3559 0.3344 0.3329 -0.0096 0.0328  0.0059  201 OTP D C14 
5476 C C12 . OTP I .   ? 0.3456 0.3197 0.3268 -0.0102 0.0339  0.0061  201 OTP D C12 
5477 C C13 . OTP I .   ? 0.3577 0.3361 0.3446 -0.0125 0.0350  0.0046  201 OTP D C13 
5478 C C11 . OTP I .   ? 0.3476 0.3127 0.3278 -0.0085 0.0344  0.0084  201 OTP D C11 
5479 C C10 . OTP I .   ? 0.3589 0.3180 0.3316 -0.0058 0.0318  0.0109  201 OTP D C10 
5480 C C9  . OTP I .   ? 0.3418 0.2932 0.3143 -0.0047 0.0323  0.0134  201 OTP D C9  
5481 C C7  . OTP I .   ? 0.3528 0.2971 0.3194 -0.0028 0.0285  0.0171  201 OTP D C7  
5482 C C8  . OTP I .   ? 0.3706 0.3127 0.3295 -0.0017 0.0236  0.0186  201 OTP D C8  
5483 C C6  . OTP I .   ? 0.4285 0.3664 0.3951 -0.0019 0.0291  0.0201  201 OTP D C6  
5484 C C5  . OTP I .   ? 0.4268 0.3668 0.4034 -0.0028 0.0331  0.0201  201 OTP D C5  
5485 C C4  . OTP I .   ? 0.4738 0.4081 0.4511 -0.0015 0.0336  0.0243  201 OTP D C4  
5486 C C2  . OTP I .   ? 0.4333 0.3673 0.4179 -0.0011 0.0343  0.0282  201 OTP D C2  
5487 C C3  . OTP I .   ? 0.4934 0.4224 0.4775 0.0003  0.0351  0.0326  201 OTP D C3  
5488 C C1  . OTP I .   ? 0.3715 0.3095 0.3645 -0.0018 0.0345  0.0293  201 OTP D C1  
5489 O O   . HOH J .   ? 0.3584 0.3515 0.4050 0.0197  0.0208  0.0147  301 HOH B O   
5490 O O   . HOH J .   ? 0.4897 0.4593 0.5004 0.0262  -0.0311 0.0055  302 HOH B O   
5491 O O   . HOH J .   ? 0.3022 0.2924 0.3028 0.0083  -0.0066 0.0107  303 HOH B O   
5492 O O   . HOH J .   ? 0.4511 0.4633 0.4475 -0.0160 -0.0019 0.0029  304 HOH B O   
5493 O O   . HOH J .   ? 0.4887 0.4693 0.4810 0.0010  -0.0176 0.0104  305 HOH B O   
5494 O O   . HOH J .   ? 0.2950 0.3003 0.3188 0.0026  0.0182  -0.0042 306 HOH B O   
5495 O O   . HOH J .   ? 0.4926 0.4979 0.5162 -0.0011 0.0223  -0.0124 307 HOH B O   
5496 O O   . HOH J .   ? 0.2539 0.2503 0.2626 0.0132  0.0022  0.0110  308 HOH B O   
5497 O O   . HOH J .   ? 0.2400 0.2345 0.2634 0.0146  0.0081  0.0190  309 HOH B O   
5498 O O   . HOH J .   ? 0.4258 0.3995 0.4273 0.0247  -0.0222 -0.0051 310 HOH B O   
5499 O O   . HOH J .   ? 0.3567 0.3471 0.3792 0.0133  0.0094  0.0151  311 HOH B O   
5500 O O   . HOH J .   ? 0.4554 0.4278 0.4481 -0.0269 -0.0464 0.0406  312 HOH B O   
5501 O O   . HOH J .   ? 0.4658 0.4135 0.4600 -0.0119 -0.0444 0.0257  313 HOH B O   
5502 O O   . HOH J .   ? 0.4883 0.4843 0.5357 0.0178  0.0245  0.0058  314 HOH B O   
5503 O O   . HOH J .   ? 0.4302 0.4004 0.4596 -0.0070 0.0296  -0.0172 315 HOH B O   
5504 O O   . HOH J .   ? 0.4649 0.4309 0.4660 -0.0161 -0.0488 0.0416  316 HOH B O   
5505 O O   . HOH J .   ? 0.1894 0.1736 0.2042 0.0001  0.0155  -0.0047 317 HOH B O   
5506 O O   . HOH J .   ? 0.2474 0.2418 0.2507 0.0137  -0.0020 0.0074  318 HOH B O   
5507 O O   . HOH J .   ? 0.1950 0.1769 0.1880 -0.0036 -0.0175 0.0126  319 HOH B O   
5508 O O   . HOH J .   ? 0.4484 0.4132 0.5106 0.0182  0.0310  0.0070  320 HOH B O   
5509 O O   . HOH J .   ? 0.3793 0.3473 0.4247 0.0112  0.0245  0.0091  321 HOH B O   
5510 O O   . HOH J .   ? 0.3427 0.3498 0.3680 0.0155  0.0055  0.0262  322 HOH B O   
5511 O O   . HOH J .   ? 0.3394 0.3387 0.3577 -0.0028 0.0193  -0.0109 323 HOH B O   
5512 O O   . HOH J .   ? 0.1908 0.1810 0.1902 0.0130  -0.0064 0.0057  324 HOH B O   
5513 O O   . HOH J .   ? 0.2436 0.2410 0.2486 0.0044  -0.0035 0.0143  325 HOH B O   
5514 O O   . HOH J .   ? 0.3371 0.3139 0.3644 -0.0040 0.0278  -0.0169 326 HOH B O   
5515 O O   . HOH J .   ? 0.4387 0.4183 0.4422 0.0270  -0.0214 -0.0049 327 HOH B O   
5516 O O   . HOH J .   ? 0.2975 0.2921 0.2966 0.0163  -0.0061 0.0015  328 HOH B O   
5517 O O   . HOH J .   ? 0.3661 0.3472 0.4012 0.0000  0.0318  -0.0208 329 HOH B O   
5518 O O   . HOH J .   ? 0.2577 0.2488 0.2562 -0.0013 -0.0072 0.0098  330 HOH B O   
5519 O O   . HOH J .   ? 0.4212 0.4130 0.4209 0.0099  -0.0074 0.0100  331 HOH B O   
5520 O O   . HOH J .   ? 0.2388 0.2297 0.2576 -0.0068 0.0237  -0.0180 332 HOH B O   
5521 O O   . HOH J .   ? 0.3734 0.3751 0.3698 -0.0039 -0.0115 0.0075  333 HOH B O   
5522 O O   . HOH J .   ? 0.3469 0.3403 0.3437 0.0189  -0.0102 -0.0025 334 HOH B O   
5523 O O   . HOH J .   ? 0.3844 0.4110 0.4155 0.0170  0.0035  0.0390  335 HOH B O   
5524 O O   . HOH J .   ? 0.4019 0.4057 0.3977 -0.0085 -0.0055 0.0035  336 HOH B O   
5525 O O   . HOH J .   ? 0.4487 0.4083 0.4463 0.0251  -0.0270 -0.0189 337 HOH B O   
5526 O O   . HOH J .   ? 0.3391 0.3297 0.3495 -0.0139 0.0205  -0.0161 338 HOH B O   
5527 O O   . HOH J .   ? 0.2199 0.2141 0.2231 0.0063  -0.0258 0.0168  339 HOH B O   
5528 O O   . HOH J .   ? 0.2580 0.2393 0.2770 0.0011  0.0166  0.0012  340 HOH B O   
5529 O O   . HOH J .   ? 0.3046 0.2975 0.3096 0.0125  0.0004  0.0070  341 HOH B O   
5530 O O   . HOH J .   ? 0.3470 0.3417 0.3384 -0.0177 -0.0248 0.0221  342 HOH B O   
5531 O O   . HOH J .   ? 0.4403 0.4324 0.4706 0.0158  0.0119  0.0191  343 HOH B O   
5532 O O   . HOH J .   ? 0.3837 0.3766 0.3969 -0.0121 0.0226  -0.0198 344 HOH B O   
5533 O O   . HOH J .   ? 0.4862 0.4449 0.5513 0.0155  0.0365  -0.0048 345 HOH B O   
5534 O O   . HOH J .   ? 0.2515 0.2573 0.2460 -0.0113 -0.0138 0.0112  346 HOH B O   
5535 O O   . HOH J .   ? 0.1409 0.1441 0.1351 -0.0115 -0.0120 0.0097  347 HOH B O   
5536 O O   . HOH J .   ? 0.3261 0.3331 0.3377 -0.0059 0.0133  -0.0064 348 HOH B O   
5537 O O   . HOH J .   ? 0.1786 0.1748 0.1876 -0.0086 0.0158  -0.0121 349 HOH B O   
5538 O O   . HOH J .   ? 0.1411 0.1384 0.1405 -0.0060 -0.0013 0.0034  350 HOH B O   
5539 O O   . HOH J .   ? 0.1837 0.1787 0.1895 0.0023  0.0076  0.0000  351 HOH B O   
5540 O O   . HOH J .   ? 0.2018 0.2054 0.1989 -0.0111 -0.0032 0.0041  352 HOH B O   
5541 O O   . HOH J .   ? 0.3697 0.3561 0.3974 0.0103  0.0136  0.0178  353 HOH B O   
5542 O O   . HOH J .   ? 0.2840 0.2935 0.2798 -0.0148 -0.0020 0.0017  354 HOH B O   
5543 O O   . HOH J .   ? 0.3868 0.3890 0.3996 0.0112  0.0002  0.0195  355 HOH B O   
5544 O O   . HOH J .   ? 0.4081 0.3941 0.4150 0.0067  -0.0336 0.0236  356 HOH B O   
5545 O O   . HOH J .   ? 0.5322 0.5300 0.5522 0.0117  0.0085  0.0191  357 HOH B O   
5546 O O   . HOH J .   ? 0.1728 0.1662 0.1731 0.0213  -0.0128 -0.0029 358 HOH B O   
5547 O O   . HOH J .   ? 0.2587 0.2536 0.2582 0.0133  -0.0066 0.0004  359 HOH B O   
5548 O O   . HOH J .   ? 0.4191 0.4277 0.4349 -0.0041 0.0161  -0.0076 360 HOH B O   
5549 O O   . HOH J .   ? 0.6202 0.6181 0.6617 0.0047  0.0341  -0.0222 361 HOH B O   
5550 O O   . HOH J .   ? 0.4742 0.4468 0.4663 0.0114  -0.0202 -0.0007 362 HOH B O   
5551 O O   . HOH J .   ? 0.5027 0.5203 0.5393 0.0089  0.0229  -0.0021 363 HOH B O   
5552 O O   . HOH J .   ? 0.3212 0.3170 0.3353 0.0072  0.0094  0.0102  364 HOH B O   
5553 O O   . HOH J .   ? 0.3802 0.3349 0.3870 0.0139  -0.0376 0.0146  365 HOH B O   
5554 O O   . HOH J .   ? 0.1712 0.1578 0.1815 0.0007  0.0115  -0.0027 366 HOH B O   
5555 O O   . HOH J .   ? 0.2033 0.2023 0.2080 -0.0006 -0.0007 0.0093  367 HOH B O   
5556 O O   . HOH J .   ? 0.2740 0.2722 0.2709 -0.0034 -0.0056 0.0031  368 HOH B O   
5557 O O   . HOH J .   ? 0.2571 0.2496 0.2562 0.0198  -0.0111 -0.0026 369 HOH B O   
5558 O O   . HOH J .   ? 0.4729 0.4770 0.4853 0.0003  0.0075  0.0045  370 HOH B O   
5559 O O   . HOH J .   ? 0.3219 0.3225 0.3412 0.0143  0.0043  0.0214  371 HOH B O   
5560 O O   . HOH J .   ? 0.3833 0.3875 0.3804 -0.0029 -0.0061 0.0030  372 HOH B O   
5561 O O   . HOH J .   ? 0.3531 0.3168 0.4071 0.0136  0.0276  0.0094  373 HOH B O   
5562 O O   . HOH J .   ? 0.3160 0.2819 0.3557 -0.0005 0.0329  -0.0170 374 HOH B O   
5563 O O   . HOH J .   ? 0.4066 0.3883 0.4558 0.0103  0.0345  -0.0155 375 HOH B O   
5564 O O   . HOH J .   ? 0.5189 0.4817 0.5698 0.0080  0.0339  -0.0101 376 HOH B O   
5565 O O   . HOH J .   ? 0.4223 0.4228 0.4516 0.0002  0.0270  -0.0169 377 HOH B O   
5566 O O   . HOH J .   ? 0.3462 0.3138 0.3469 0.0256  -0.0242 -0.0087 378 HOH B O   
5567 O O   . HOH J .   ? 0.5224 0.5222 0.5856 0.0273  0.0241  0.0224  379 HOH B O   
5568 O O   . HOH J .   ? 0.3503 0.3349 0.3461 0.0029  -0.0122 0.0103  380 HOH B O   
5569 O O   . HOH J .   ? 0.2741 0.2525 0.2782 0.0180  -0.0252 0.0068  381 HOH B O   
5570 O O   . HOH J .   ? 0.3842 0.3987 0.3803 -0.0171 -0.0033 0.0052  382 HOH B O   
5571 O O   . HOH J .   ? 0.4585 0.4150 0.4620 0.0082  -0.0371 0.0170  383 HOH B O   
5572 O O   . HOH J .   ? 0.2265 0.2307 0.2607 0.0163  0.0128  0.0192  384 HOH B O   
5573 O O   . HOH J .   ? 0.3214 0.3227 0.3167 -0.0147 -0.0275 0.0251  385 HOH B O   
5574 O O   . HOH J .   ? 0.1798 0.1684 0.1878 -0.0001 0.0104  -0.0028 386 HOH B O   
5575 O O   . HOH J .   ? 0.1879 0.1838 0.1945 0.0044  -0.0009 0.0119  387 HOH B O   
5576 O O   . HOH J .   ? 0.1680 0.1644 0.1649 -0.0068 -0.0087 0.0111  388 HOH B O   
5577 O O   . HOH J .   ? 0.2120 0.2051 0.2121 0.0145  -0.0051 0.0045  389 HOH B O   
5578 O O   . HOH J .   ? 0.1836 0.1796 0.1910 0.0044  0.0077  0.0025  390 HOH B O   
5579 O O   . HOH J .   ? 0.1731 0.1620 0.1716 0.0065  -0.0172 0.0080  391 HOH B O   
5580 O O   . HOH J .   ? 0.3999 0.3533 0.3995 -0.0089 -0.0455 0.0309  392 HOH B O   
5581 O O   . HOH J .   ? 0.4145 0.4136 0.4183 0.0144  -0.0005 0.0066  393 HOH B O   
5582 O O   . HOH J .   ? 0.4160 0.4263 0.4422 0.0165  0.0049  0.0300  394 HOH B O   
5583 O O   . HOH J .   ? 0.3829 0.3958 0.4185 0.0066  0.0253  -0.0082 395 HOH B O   
5584 O O   . HOH J .   ? 0.3997 0.4037 0.4448 0.0114  0.0302  -0.0104 396 HOH B O   
5585 O O   . HOH J .   ? 0.3823 0.3387 0.3728 0.0000  -0.0310 0.0083  397 HOH B O   
5586 O O   . HOH J .   ? 0.3251 0.2709 0.3203 -0.0033 -0.0402 0.0174  398 HOH B O   
5587 O O   . HOH J .   ? 0.4372 0.4521 0.4431 -0.0125 0.0107  -0.0073 399 HOH B O   
5588 O O   . HOH J .   ? 0.6021 0.5759 0.6339 0.0057  0.0201  0.0074  400 HOH B O   
5589 O O   . HOH J .   ? 0.3077 0.2896 0.3132 0.0018  -0.0364 0.0275  401 HOH B O   
5590 O O   . HOH J .   ? 0.2411 0.2335 0.2474 -0.0057 0.0120  -0.0073 402 HOH B O   
5591 O O   . HOH J .   ? 0.3791 0.3785 0.3862 0.0131  0.0023  0.0091  403 HOH B O   
5592 O O   . HOH J .   ? 0.2557 0.2362 0.2598 0.0213  -0.0230 0.0028  404 HOH B O   
5593 O O   . HOH J .   ? 0.3807 0.3830 0.3789 -0.0097 0.0012  -0.0011 405 HOH B O   
5594 O O   . HOH J .   ? 0.4513 0.4206 0.5038 0.0100  0.0353  -0.0135 406 HOH B O   
5595 O O   . HOH J .   ? 0.4650 0.4693 0.4628 -0.0012 -0.0038 0.0012  407 HOH B O   
5596 O O   . HOH J .   ? 0.4548 0.4311 0.4785 -0.0008 0.0202  -0.0010 408 HOH B O   
5597 O O   . HOH J .   ? 0.4418 0.4145 0.4451 -0.0101 -0.0450 0.0382  409 HOH B O   
5598 O O   . HOH J .   ? 0.4285 0.4366 0.4269 -0.0268 -0.0429 0.0468  410 HOH B O   
5599 O O   . HOH J .   ? 0.4015 0.4213 0.4056 -0.0137 0.0071  -0.0025 411 HOH B O   
5600 O O   . HOH J .   ? 0.3983 0.3901 0.3974 0.0231  -0.0130 -0.0055 412 HOH B O   
5601 O O   . HOH J .   ? 0.4434 0.4552 0.4564 0.0139  -0.0004 0.0239  413 HOH B O   
5602 O O   . HOH J .   ? 0.4348 0.3957 0.4819 0.0042  0.0333  -0.0114 414 HOH B O   
5603 O O   . HOH J .   ? 0.4544 0.4625 0.4519 -0.0138 0.0021  -0.0023 415 HOH B O   
5604 O O   . HOH J .   ? 0.3647 0.3666 0.3836 0.0135  0.0038  0.0211  416 HOH B O   
5605 O O   . HOH J .   ? 0.7363 0.7375 0.7415 -0.0065 -0.0372 0.0351  417 HOH B O   
5606 O O   . HOH J .   ? 0.3014 0.2953 0.3144 -0.0096 0.0206  -0.0168 418 HOH B O   
5607 O O   . HOH J .   ? 0.5397 0.5403 0.5473 0.0142  0.0004  0.0128  419 HOH B O   
5608 O O   . HOH J .   ? 0.4680 0.4463 0.4999 -0.0027 0.0310  -0.0210 420 HOH B O   
5609 O O   . HOH J .   ? 0.2775 0.2591 0.2992 0.0039  0.0158  0.0060  421 HOH B O   
5610 O O   . HOH J .   ? 0.4662 0.4639 0.4667 0.0158  -0.0042 0.0037  422 HOH B O   
5611 O O   . HOH J .   ? 0.4351 0.4108 0.4830 0.0074  0.0354  -0.0181 423 HOH B O   
5612 O O   . HOH J .   ? 0.5701 0.5585 0.5917 0.0076  0.0126  0.0133  424 HOH B O   
5613 O O   . HOH J .   ? 0.4003 0.3851 0.4239 -0.0068 0.0276  -0.0210 425 HOH B O   
5614 O O   . HOH J .   ? 0.4487 0.4570 0.4555 -0.0124 0.0141  -0.0121 426 HOH B O   
5615 O O   . HOH J .   ? 0.4209 0.4281 0.4158 -0.0104 -0.0098 0.0072  427 HOH B O   
5616 O O   . HOH J .   ? 0.2043 0.2073 0.2134 0.0001  0.0035  0.0078  428 HOH B O   
5617 O O   . HOH J .   ? 0.4808 0.4715 0.4785 0.0111  -0.0090 0.0074  429 HOH B O   
5618 O O   . HOH J .   ? 0.4095 0.4166 0.4029 -0.0181 -0.0237 0.0224  430 HOH B O   
5619 O O   . HOH J .   ? 0.4893 0.4656 0.5332 0.0026  0.0365  -0.0240 431 HOH B O   
5620 O O   . HOH J .   ? 0.4923 0.5019 0.4994 -0.0110 0.0125  -0.0091 432 HOH B O   
5621 O O   . HOH J .   ? 0.1755 0.1963 0.2015 -0.0051 -0.0152 0.0148  433 HOH B O   
5622 O O   . HOH J .   ? 0.2150 0.2120 0.2153 0.0033  -0.0214 0.0138  434 HOH B O   
5623 O O   . HOH J .   ? 0.2139 0.2133 0.2201 0.0017  -0.0010 0.0118  435 HOH B O   
5624 O O   . HOH J .   ? 0.4059 0.3978 0.4120 -0.0031 0.0106  -0.0047 436 HOH B O   
5625 O O   . HOH J .   ? 0.5257 0.5022 0.5320 0.0317  -0.0237 -0.0082 437 HOH B O   
5626 O O   . HOH J .   ? 0.4173 0.4332 0.4096 -0.0202 -0.0130 0.0122  438 HOH B O   
5627 O O   . HOH J .   ? 0.2761 0.2878 0.2694 -0.0165 -0.0096 0.0083  439 HOH B O   
5628 O O   . HOH J .   ? 0.3996 0.3959 0.4187 -0.0088 0.0255  -0.0217 440 HOH B O   
5629 O O   . HOH J .   ? 0.4191 0.4338 0.4131 -0.0180 -0.0046 0.0037  441 HOH B O   
5630 O O   . HOH J .   ? 0.3603 0.3665 0.3802 0.0150  0.0033  0.0252  442 HOH B O   
5631 O O   . HOH J .   ? 0.4396 0.4372 0.4435 -0.0102 0.0123  -0.0098 443 HOH B O   
5632 O O   . HOH J .   ? 0.2685 0.2673 0.2675 0.0183  -0.0064 -0.0006 444 HOH B O   
5633 O O   . HOH J .   ? 0.3679 0.3632 0.3702 -0.0021 0.0058  -0.0030 445 HOH B O   
5634 O O   . HOH J .   ? 0.3873 0.3916 0.3935 0.0136  0.0018  0.0085  446 HOH B O   
5635 O O   . HOH J .   ? 0.4788 0.4781 0.4767 0.0209  -0.0089 -0.0039 447 HOH B O   
5636 O O   . HOH J .   ? 0.3404 0.3451 0.3404 0.0180  -0.0043 0.0009  448 HOH B O   
5637 O O   . HOH K .   ? 0.6207 0.4392 0.4171 -0.0258 -0.0182 0.0171  301 HOH C O   
5638 O O   . HOH K .   ? 0.4936 0.5130 0.5184 -0.0070 -0.0052 0.0124  302 HOH C O   
5639 O O   . HOH K .   ? 0.3398 0.3149 0.2902 0.0129  -0.0071 0.0132  303 HOH C O   
5640 O O   . HOH K .   ? 0.5726 0.5458 0.5397 0.0117  -0.0091 0.0333  304 HOH C O   
5641 O O   . HOH K .   ? 0.4202 0.4659 0.4109 -0.0538 -0.0200 0.0480  305 HOH C O   
5642 O O   . HOH K .   ? 0.6015 0.5178 0.4824 0.0404  -0.0031 0.0206  306 HOH C O   
5643 O O   . HOH K .   ? 0.2526 0.2684 0.2940 0.0128  0.0030  0.0323  307 HOH C O   
5644 O O   . HOH K .   ? 0.3375 0.3638 0.4383 -0.0006 0.0210  0.0098  308 HOH C O   
5645 O O   . HOH K .   ? 0.3256 0.3543 0.4030 0.0045  0.0117  0.0147  309 HOH C O   
5646 O O   . HOH K .   ? 0.2704 0.3199 0.3472 -0.0031 0.0058  0.0327  310 HOH C O   
5647 O O   . HOH K .   ? 0.3487 0.3782 0.4424 0.0003  0.0161  0.0076  311 HOH C O   
5648 O O   . HOH K .   ? 0.2145 0.2548 0.2902 -0.0027 0.0066  0.0136  312 HOH C O   
5649 O O   . HOH K .   ? 0.3373 0.3876 0.3648 -0.0203 -0.0097 0.0540  313 HOH C O   
5650 O O   . HOH K .   ? 0.2521 0.2916 0.3244 0.0069  0.0082  0.0551  314 HOH C O   
5651 O O   . HOH K .   ? 0.6756 0.5898 0.5664 -0.0572 -0.0211 0.0297  315 HOH C O   
5652 O O   . HOH K .   ? 0.3598 0.3834 0.3622 -0.0240 -0.0135 0.0468  316 HOH C O   
5653 O O   . HOH K .   ? 0.5690 0.5668 0.5299 -0.0431 -0.0205 0.0413  317 HOH C O   
5654 O O   . HOH K .   ? 0.3801 0.4166 0.4571 0.0135  0.0129  0.0591  318 HOH C O   
5655 O O   . HOH K .   ? 0.4637 0.4118 0.3960 -0.0037 -0.0103 0.0195  319 HOH C O   
5656 O O   . HOH K .   ? 0.3923 0.3755 0.3105 0.0585  -0.0007 0.0133  320 HOH C O   
5657 O O   . HOH K .   ? 0.3301 0.3337 0.3496 0.0117  -0.0018 0.0204  321 HOH C O   
5658 O O   . HOH K .   ? 0.2622 0.2999 0.3364 0.0051  0.0082  0.0503  322 HOH C O   
5659 O O   . HOH K .   ? 0.4411 0.5142 0.4762 -0.0338 -0.0109 0.0469  323 HOH C O   
5660 O O   . HOH K .   ? 0.6000 0.6008 0.5840 -0.0322 -0.0140 0.0268  324 HOH C O   
5661 O O   . HOH K .   ? 0.3625 0.4521 0.4585 0.0105  0.0138  0.0631  325 HOH C O   
5662 O O   . HOH K .   ? 0.6145 0.5443 0.5160 -0.0372 -0.0214 0.0304  326 HOH C O   
5663 O O   . HOH K .   ? 0.3058 0.3957 0.3343 -0.0415 -0.0142 0.0564  327 HOH C O   
5664 O O   . HOH K .   ? 0.2182 0.2351 0.2472 0.0059  -0.0016 0.0079  328 HOH C O   
5665 O O   . HOH K .   ? 0.2422 0.2389 0.2262 -0.0180 -0.0139 0.0403  329 HOH C O   
5666 O O   . HOH K .   ? 0.2815 0.3028 0.3112 0.0026  -0.0023 0.0059  330 HOH C O   
5667 O O   . HOH K .   ? 0.2210 0.3214 0.3026 0.0024  0.0062  0.0721  331 HOH C O   
5668 O O   . HOH K .   ? 0.3256 0.3738 0.4312 0.0096  0.0216  0.0230  332 HOH C O   
5669 O O   . HOH K .   ? 0.5155 0.5253 0.5395 0.0152  -0.0001 0.0367  333 HOH C O   
5670 O O   . HOH K .   ? 0.3408 0.4128 0.4407 0.0111  0.0167  0.0498  334 HOH C O   
5671 O O   . HOH K .   ? 0.3828 0.4152 0.4661 0.0004  0.0122  0.0039  335 HOH C O   
5672 O O   . HOH K .   ? 0.2884 0.3293 0.3758 0.0108  0.0146  0.0573  336 HOH C O   
5673 O O   . HOH K .   ? 0.1593 0.1729 0.1927 0.0033  -0.0014 0.0129  337 HOH C O   
5674 O O   . HOH K .   ? 0.3828 0.4299 0.4665 0.0207  0.0181  0.0732  338 HOH C O   
5675 O O   . HOH K .   ? 0.4685 0.4723 0.4324 0.0443  -0.0020 0.0093  339 HOH C O   
5676 O O   . HOH K .   ? 0.3520 0.3529 0.3493 -0.0120 -0.0092 0.0171  340 HOH C O   
5677 O O   . HOH K .   ? 0.4630 0.4375 0.4277 -0.0206 -0.0128 0.0222  341 HOH C O   
5678 O O   . HOH K .   ? 0.1711 0.1621 0.1571 0.0025  -0.0075 0.0125  342 HOH C O   
5679 O O   . HOH K .   ? 0.4169 0.4014 0.3742 0.0358  -0.0039 0.0113  343 HOH C O   
5680 O O   . HOH K .   ? 0.3388 0.3597 0.3728 -0.0058 -0.0036 0.0134  344 HOH C O   
5681 O O   . HOH K .   ? 0.4035 0.2785 0.2574 0.0017  -0.0154 0.0226  345 HOH C O   
5682 O O   . HOH K .   ? 0.2818 0.3015 0.2813 -0.0359 -0.0148 0.0364  346 HOH C O   
5683 O O   . HOH K .   ? 0.3244 0.4314 0.4105 0.0084  0.0091  0.0801  347 HOH C O   
5684 O O   . HOH K .   ? 0.3396 0.3442 0.3192 -0.0293 -0.0167 0.0426  348 HOH C O   
5685 O O   . HOH K .   ? 0.2635 0.2876 0.3646 0.0098  0.0237  0.0449  349 HOH C O   
5686 O O   . HOH K .   ? 0.2005 0.2212 0.2514 0.0099  0.0046  0.0197  350 HOH C O   
5687 O O   . HOH K .   ? 0.2524 0.2993 0.3153 -0.0089 0.0006  0.0336  351 HOH C O   
5688 O O   . HOH K .   ? 0.5237 0.5489 0.5750 0.0096  0.0041  0.0482  352 HOH C O   
5689 O O   . HOH K .   ? 0.4159 0.4491 0.4558 0.0105  0.0015  0.0007  353 HOH C O   
5690 O O   . HOH K .   ? 0.4589 0.3049 0.2871 -0.0459 -0.0202 0.0223  354 HOH C O   
5691 O O   . HOH K .   ? 0.5327 0.5235 0.5520 -0.0367 0.0691  -0.0152 355 HOH C O   
5692 O O   . HOH K .   ? 0.5429 0.5081 0.4701 -0.0453 -0.0226 0.0363  356 HOH C O   
5693 O O   . HOH K .   ? 0.3357 0.4031 0.4336 0.0111  0.0162  0.0548  357 HOH C O   
5694 O O   . HOH K .   ? 0.4923 0.4985 0.6164 -0.0027 0.0387  0.0179  358 HOH C O   
5695 O O   . HOH K .   ? 0.3086 0.3345 0.4228 0.0084  0.0295  0.0130  359 HOH C O   
5696 O O   . HOH K .   ? 0.4167 0.4885 0.4976 -0.0044 0.0062  0.0230  360 HOH C O   
5697 O O   . HOH K .   ? 0.3403 0.3467 0.4644 -0.0046 0.0385  0.0093  361 HOH C O   
5698 O O   . HOH K .   ? 0.3443 0.3881 0.4173 0.0029  0.0093  -0.0039 362 HOH C O   
5699 O O   . HOH K .   ? 0.5141 0.3818 0.3596 0.0478  -0.0048 0.0208  363 HOH C O   
5700 O O   . HOH K .   ? 0.3441 0.3838 0.4415 0.0027  0.0168  0.0119  364 HOH C O   
5701 O O   . HOH K .   ? 0.2037 0.2202 0.2516 0.0097  0.0037  0.0291  365 HOH C O   
5702 O O   . HOH K .   ? 0.4396 0.4315 0.3984 -0.0525 -0.0204 0.0366  366 HOH C O   
5703 O O   . HOH K .   ? 0.4824 0.4578 0.4433 -0.0111 -0.0108 0.0184  367 HOH C O   
5704 O O   . HOH K .   ? 0.2521 0.2638 0.2731 0.0166  -0.0004 0.0149  368 HOH C O   
5705 O O   . HOH K .   ? 0.4849 0.4452 0.4270 -0.0417 -0.0180 0.0296  369 HOH C O   
5706 O O   . HOH K .   ? 0.3807 0.4014 0.4977 -0.0072 0.0315  0.0045  370 HOH C O   
5707 O O   . HOH K .   ? 0.5171 0.4109 0.3747 0.0505  -0.0014 0.0226  371 HOH C O   
5708 O O   . HOH K .   ? 0.3537 0.3427 0.3342 -0.0103 -0.0100 0.0169  372 HOH C O   
5709 O O   . HOH K .   ? 0.4887 0.5055 0.4711 0.0343  -0.0022 0.0049  373 HOH C O   
5710 O O   . HOH K .   ? 0.4706 0.5266 0.5249 -0.0161 -0.0033 0.0375  374 HOH C O   
5711 O O   . HOH K .   ? 0.2395 0.2176 0.2534 -0.0088 0.0185  0.0232  375 HOH C O   
5712 O O   . HOH K .   ? 0.5124 0.4145 0.3966 0.0334  -0.0085 0.0221  376 HOH C O   
5713 O O   . HOH K .   ? 0.4587 0.5209 0.5589 0.0139  0.0184  0.0584  377 HOH C O   
5714 O O   . HOH K .   ? 0.3661 0.3616 0.3577 -0.0184 -0.0111 0.0217  378 HOH C O   
5715 O O   . HOH K .   ? 0.6240 0.5809 0.5516 -0.0558 -0.0215 0.0330  379 HOH C O   
5716 O O   . HOH K .   ? 0.3906 0.4133 0.5013 -0.0015 0.0265  0.0019  380 HOH C O   
5717 O O   . HOH K .   ? 0.2992 0.3526 0.3566 -0.0137 -0.0018 0.0290  381 HOH C O   
5718 O O   . HOH K .   ? 0.3901 0.3273 0.3172 -0.0268 -0.0152 0.0252  382 HOH C O   
5719 O O   . HOH K .   ? 0.3709 0.4592 0.4067 -0.0371 -0.0120 0.0531  383 HOH C O   
5720 O O   . HOH K .   ? 0.5553 0.4733 0.4527 0.0361  -0.0081 0.0235  384 HOH C O   
5721 O O   . HOH K .   ? 0.4902 0.5310 0.6108 0.0258  0.0361  0.0400  385 HOH C O   
5722 O O   . HOH K .   ? 0.5842 0.5408 0.5158 -0.0516 -0.0201 0.0318  386 HOH C O   
5723 O O   . HOH K .   ? 0.7252 0.5404 0.5245 -0.0439 -0.0190 0.0193  387 HOH C O   
5724 O O   . HOH K .   ? 0.4700 0.5122 0.5747 0.0066  0.0212  0.0141  388 HOH C O   
5725 O O   . HOH K .   ? 0.4525 0.3834 0.3889 -0.0075 -0.0094 0.0314  389 HOH C O   
5726 O O   . HOH K .   ? 0.4270 0.5000 0.4736 -0.0260 -0.0073 0.0430  390 HOH C O   
5727 O O   .