data_5IY8
# 
_entry.id   5IY8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5IY8         
WWPDB D_1000219627 
EMDB  EMD-8133     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB . EMD-8133 'associated EM volume' 
EMDB . EMD-3307 'other EM volume'      
EMDB . EMD-8135 'other EM volume'      
EMDB . EMD-8132 'other EM volume'      
EMDB . EMD-8134 'other EM volume'      
EMDB . EMD-8136 'other EM volume'      
EMDB . EMD-8137 'other EM volume'      
EMDB . EMD-8138 'other EM volume'      
EMDB . EMD-8131 'other EM volume'      
PDB  . 5IVW     unspecified            
PDB  . 5IY6     unspecified            
PDB  . 5IYA     unspecified            
PDB  . 5IY7     unspecified            
PDB  . 5IY9     unspecified            
PDB  . 5IYB     unspecified            
PDB  . 5IYC     unspecified            
PDB  . 5IYD     unspecified            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5IY8 
_pdbx_database_status.recvd_initial_deposition_date   2016-03-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'He, Y.'      1 
'Yan, C.'     2 
'Fang, J.'    3 
'Inouye, C.'  4 
'Tjian, R.'   5 
'Ivanov, I.'  6 
'Nogales, E.' 7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            533 
_citation.language                  ? 
_citation.page_first                359 
_citation.page_last                 365 
_citation.title                     'Near-atomic resolution visualization of human transcription promoter opening.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature17970 
_citation.pdbx_database_id_PubMed   27193682 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'He, Y.'      1 ? 
primary 'Yan, C.'     2 ? 
primary 'Fang, J.'    3 ? 
primary 'Inouye, C.'  4 ? 
primary 'Tjian, R.'   5 ? 
primary 'Ivanov, I.'  6 ? 
primary 'Nogales, E.' 7 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase II subunit RPB1'                   217420.047 1  2.7.7.6,2.7.7.48 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase II subunit RPB2'                   134071.453 1  2.7.7.6          ? ? ? 
3  polymer     nat 'DNA-directed RNA polymerase II subunit RPB3'                   31478.148  1  ?                ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase II subunit RPB4'                   16331.255  1  ?                ? ? ? 
5  polymer     nat 'DNA-directed RNA polymerase II subunit RPB5'                   24584.223  1  ?                ? ? ? 
6  polymer     nat 'DNA-directed RNA polymerase II subunit RPB6'                   14491.026  1  ?                ? ? ? 
7  polymer     nat 'DNA-directed RNA polymerase II subunit RPB7'                   19314.283  1  ?                ? ? ? 
8  polymer     nat 'DNA-directed RNA polymerase II subunit RPB8'                   17162.273  1  ?                ? ? ? 
9  polymer     man 'DNA-directed RNA polymerase II subunit RPB9'                   14541.221  1  ?                ? ? ? 
10 polymer     nat 'DNA-directed RNA polymerase II subunit RPB10'                  7655.123   1  ?                ? ? ? 
11 polymer     nat 'DNA-directed RNA polymerase II subunit RPB11-a'                13310.284  1  ?                ? ? ? 
12 polymer     nat 'DNA-directed RNA polymerase II subunit RPB12'                  7018.244   1  ?                ? ? ? 
13 polymer     man 'Transcription initiation factor IIB'                           34877.949  1  ?                ? ? ? 
14 polymer     man 'Transcription initiation factor IIA subunit 1'                 41544.551  1  ?                ? ? ? 
15 polymer     man 'Transcription initiation factor IIA subunit 2'                 12469.091  1  ?                ? ? ? 
16 polymer     man 'TATA-box-binding protein'                                      37729.938  1  ?                ? ? ? 
17 polymer     man 'General transcription factor IIE subunit 1'                    49516.094  1  ?                ? ? ? 
18 polymer     man 'Transcription initiation factor IIE subunit beta'              33106.824  1  ?                ? ? ? 
19 polymer     man 'General transcription factor IIF subunit 1'                    58343.578  1  ?                ? ? ? 
20 polymer     man 'General transcription factor IIF subunit 2'                    28427.309  1  3.6.4.12         ? ? ? 
21 polymer     man 'Transcription elongation factor A protein 1'                   34022.723  1  ?                ? ? ? 
22 polymer     nat 'TFIIH basal transcription factor complex helicase XPB subunit' 89404.734  1  3.6.4.12         ? ? ? 
23 polymer     nat 'TFIIH basal transcription factor complex helicase XPD subunit' 87021.078  1  3.6.4.12         ? ? ? 
24 polymer     nat 'General transcription factor IIH subunit 2'                    44481.996  1  ?                ? ? ? 
25 polymer     nat 'General transcription factor IIH subunit 5'                    8060.362   1  ?                ? ? ? 
26 polymer     nat 'General transcription factor IIH subunit 4'                    52245.156  1  ?                ? ? ? 
27 polymer     nat 'General transcription factor IIH subunit 3'                    34416.008  1  ?                ? ? ? 
28 polymer     syn SCP-X                                                           25772.445  1  ?                ? ? ? 
29 polymer     syn SCP-Y                                                           25381.145  1  ?                ? ? ? 
30 non-polymer syn 'MAGNESIUM ION'                                                 24.305     2  ?                ? ? ? 
31 non-polymer syn 'ZINC ION'                                                      65.409     11 ?                ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  
;RNA polymerase II subunit B1, DNA-directed RNA polymerase II subunit A, DNA-directed RNA polymerase III largest subunit, RNA-directed RNA polymerase II subunit RPB1
;
2  
;DNA-directed RNA polymerase II 140 kDa polypeptide, DNA-directed RNA polymerase II subunit B, RNA polymerase II subunit 2, RNA polymerase II subunit B2
;
3  
;RNA polymerase II subunit B3, DNA-directed RNA polymerase II 33 kDa polypeptide, RPB33, DNA-directed RNA polymerase II subunit C, RPB31
;
4  'RNA polymerase II subunit B4, DNA-directed RNA polymerase II subunit D, RNA polymerase II 16 kDa subunit, RPB16' 
5  
;RNA polymerases I,II,and III subunit ABC1, DNA-directed RNA DNA-directed RNA polymerases I, II, and III subunit RPABC1, polymerase II 23 kDa polypeptide, DNA-directed RNA polymerase II subunit E, XAP4
;
6  
;DNA-directed RNA polymerases I, II, and III subunit RPABC2, RNA polymerases I,II,and III subunit ABC2, DNA-directed RNA polymerase II subunit F, DNA-directed RNA polymerases I,and III 14.4 kDa polypeptide, RPABC14.4, RPB14.4, RPC15
;
7  'RNA polymerase II subunit B7, DNA-directed RNA polymerase II subunit G, RNA polymerase II 19 kDa subunit, RPB19' 
8  
;DNA-directed RNA polymerases I, II, and III subunit RPABC3, RNA polymerases I,II,and III subunit ABC3, DNA-directed RNA polymerase II subunit H, DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide, RPB17, hRPB8
;
9  'RNA polymerase II subunit B9, DNA-directed RNA polymerase II subunit I, RNA polymerase II 14.5 kDa subunit, RPB14.5' 
10 
;DNA-directed RNA polymerases I, II, and III subunit RPABC5, RNA polymerases I,II,and III subunit ABC5, DNA-directed RNA polymerase III subunit L, RNA polymerase II 7.6 kDa subunit, RPB7.6
;
11 'RPB11a, DNA-directed RNA polymerase II subunit J-1, RNA polymerase II 13.3 kDa subunit' 
12 
;DNA-directed RNA polymerases I, II, and III subunit RPABC4, RNA polymerases I,II,and III subunit ABC4, ABC10-alpha, DNA-directed RNA polymerase II subunit K, RNA polymerase II 7.0 kDa subunit, RPB7.0, RPB10alpha
;
13 'General transcription factor TFIIB, S300-II' 
14 'General transcription factor IIA subunit 1, TFIIAL, Transcription initiation factor TFIIA 42 kDa subunit, TFIIA-42' 
15 
'General transcription factor IIA subunit 2, TFIIA p12 subunit, TFIIAS, Transcription initiation factor IIA gamma chain, TFIIA-gamma' 
16 'TATA sequence-binding protein, TATA-binding factor, TATA-box factor, Transcription initiation factor TFIID TBP subunit' 
17 'General transcription factor IIE 56 kDa subunit, Transcription initiation factor IIE subunit alpha, TFIIE-alpha' 
18 'TFIIE-beta, General transcription factor IIE subunit 2' 
19 
;General transcription factor IIF 74 kDa subunit, Transcription initiation factor IIF subunit alpha, TFIIF-alpha, Transcription initiation factor RAP74
;
20 
;ATP-dependent helicase GTF2F2, General transcription factor IIF 30 kDa subunit, Transcription initiation factor IIF subunit beta, TFIIF-beta, Transcription initiation factor RAP30
;
21 'Transcription elongation factor S-II protein 1, Transcription elongation factor TFIIS.o' 
22 
;Basic transcription factor 2 89 kDa subunit, BTF2 p89, DNA excision repair protein ERCC-3, DNA repair protein complementing XP-B cells, TFIIH basal transcription factor complex 89 kDa subunit, TFIIH p89, Xeroderma pigmentosum group B-complementing protein
;
23 
;Basic transcription factor 2 80 kDa subunit, BTF2 p80, CXPD, DNA excision repair protein ERCC-2, DNA repair protein complementing XP-D cells, TFIIH basal transcription factor complex 80 kDa subunit, TFIIH p80, Xeroderma pigmentosum group D-complementing protein
;
24 
;Basic transcription factor 2 44 kDa subunit, BTF2 p44, General transcription factor IIH polypeptide 2, TFIIH basal transcription factor complex p44 subunit
;
25 'General transcription factor IIH polypeptide 5, TFB5 ortholog, TFIIH basal transcription factor complex TTD-A subunit' 
26 
;Basic transcription factor 2 52 kDa subunit, BTF2 p52, General transcription factor IIH polypeptide 4, TFIIH basal transcription factor complex p52 subunit
;
27 
;Basic transcription factor 2 34 kDa subunit, BTF2 p34, General transcription factor IIH polypeptide 3, TFIIH basal transcription factor complex p34 subunit
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no 
;MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTE
CPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEM
DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDN
ELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNID
RLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEV
MNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGIL
CKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPF
GFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVR
NSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLL
FNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLG
VPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMD
DDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSN
DIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPW
NQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAY
EPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSP
SYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYT
PTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN
;
;MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTE
CPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEM
DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDN
ELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNID
RLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEV
MNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGIL
CKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPF
GFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVR
NSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLL
FNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLG
VPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMD
DDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSN
DIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPW
NQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAY
EPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSP
SYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYT
PTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN
;
A ? 
2  'polypeptide(L)'        no no 
;MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEE
PPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTY
CLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNF
IGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLL
AFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAA
IADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHI
DQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSA
VDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDEL
ESTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQ
IFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCN
LCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
;
;MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEE
PPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTY
CLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNF
IGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLL
AFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAA
IADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHI
DQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSA
VDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDEL
ESTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQ
IFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCN
LCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
;
B ? 
3  'polypeptide(L)'        no no 
;MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLISDDIVD
KLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELR
LRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
;
;MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLISDDIVD
KLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELR
LRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
;
C ? 
4  'polypeptide(L)'        no no 
;MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETI
ASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
;
;MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETI
ASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
;
D ? 
5  'polypeptide(L)'        no no 
;MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEP
KVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELL
ARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
;
;MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEP
KVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELL
ARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
;
E ? 
6  'polypeptide(L)'        no no 
;MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVM
VELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
;
;MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVM
VELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
;
F ? 
7  'polypeptide(L)'        no no 
;MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPF
KGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAI
GSLMDDYLGLVS
;
;MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPF
KGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAI
GSLMDDYLGLVS
;
G ? 
8  'polypeptide(L)'        no no 
;MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDD
RPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
;
;MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDD
RPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
;
H ? 
9  'polypeptide(L)'        no no 
;MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPR
TEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE
;
;MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPR
TEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE
;
I ? 
10 'polypeptide(L)'        no no MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK 
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK J ? 
11 'polypeptide(L)'        no no 
;MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPD
YSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
;
;MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPD
YSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
;
K ? 
12 'polypeptide(L)'        no no MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR 
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR L ? 
13 'polypeptide(L)'        no no 
;MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDL
STMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIA
SACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL
;
;MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDL
STMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIA
SACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL
;
M ? 
14 'polypeptide(L)'        no no 
;MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQ
HHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSG
QLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTV
AAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDV
SDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
;
;MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQ
HHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSG
QLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTV
AAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDV
SDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
;
N ? 
15 'polypeptide(L)'        no no 
;MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVE
FREVTELIKVDKVKIVACDGKNTGSNTTE
;
;MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVE
FREVTELIKVDKVKIVACDGKNTGSNTTE
;
O ? 
16 'polypeptide(L)'        no no 
;MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSG
IVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV
VQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAE
IYEAFENIYPILKGFRKTT
;
;MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSG
IVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV
VQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAE
IYEAFENIYPILKGFRKTT
;
P ? 
17 'polypeptide(L)'        no no 
;MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVET
AADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTE
VEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDHAATTAGAASLAGGHHREAWA
TKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIWLRESTVQGAYGSEDMKEGGIDMDAFQEREEGHAGPDDNEE
VMRALLIHEKKTSSAMAGSVGAAAPVTAANGSDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAG
RPFSYSEVSQRPELVAQMTPEEKEAYIAMGQRMFEDLFE
;
;MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVET
AADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTE
VEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDHAATTAGAASLAGGHHREAWA
TKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIWLRESTVQGAYGSEDMKEGGIDMDAFQEREEGHAGPDDNEE
VMRALLIHEKKTSSAMAGSVGAAAPVTAANGSDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAG
RPFSYSEVSQRPELVAQMTPEEKEAYIAMGQRMFEDLFE
;
Q ? 
18 'polypeptide(L)'        no no 
;MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAK
IVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVRDKKALLRLLDQHDQ
RGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQ
GISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK
;
;MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAK
IVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVRDKKALLRLLDQHDQ
RGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQ
GISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK
;
R ? 
19 'polypeptide(L)'        no no 
;MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEAR
RKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEA
EEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPL
AKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEED
KEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSST
LRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTK
KTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
;
;MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEAR
RKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEA
EEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPL
AKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEED
KEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSST
LRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTK
KTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
;
S ? 
20 'polypeptide(L)'        no no 
;MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPRE
HPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQ
YNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYR
HYQGEEKSD
;
;MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPRE
HPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQ
YNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYR
HYQGEEKSD
;
T ? 
21 'polypeptide(L)'        no no 
;MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGP
STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIA
IGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL
TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC
;
;MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGP
STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIA
IGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL
TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC
;
U ? 
22 'polypeptide(L)'        no no 
;MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAP
DGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCT
VSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQG
KSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQ
EKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKP
IGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDL
NFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIV
FADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRL
GRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAAT
DLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRFRK
;
;MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAP
DGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCT
VSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQG
KSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQ
EKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKP
IGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDL
NFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIV
FADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRL
GRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAAT
DLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRFRK
;
V ? 
23 'polypeptide(L)'        no no 
;MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEI
EKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEE
FDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNID
NVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVP
GSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLL
ANFATLVSTYAKGFTIIIEPFDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMAT
FTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILEN
IQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYL
RDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYF
LRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL
;
;MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEI
EKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEE
FDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNID
NVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVP
GSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLL
ANFATLVSTYAKGFTIIIEPFDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMAT
FTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILEN
IQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYL
RDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYF
LRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL
;
W ? 
24 'polypeptide(L)'        no no 
;MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNR
LTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMP
GHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLAR
SYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
;
;MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNR
LTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMP
GHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLAR
SYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
;
0 ? 
25 'polypeptide(L)'        no no MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK 
MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK 1 ? 
26 'polypeptide(L)'        no no 
;MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFS
KAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL
HFMVGSPSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQL
SFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGTVHQPGFIVVETNYRLYAYTE
SELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDR
LRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
;
;MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFS
KAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL
HFMVGSPSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQL
SFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGTVHQPGFIVVETNYRLYAYTE
SELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDR
LRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
;
2 ? 
27 'polypeptide(L)'        no no 
;MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGD
FFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSR
ILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQ
LILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA
;
;MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGD
FFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSR
ILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQ
LILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA
;
3 ? 
28 polydeoxyribonucleotide no no 
;(DG)(DA)(DA)(DG)(DG)(DG)(DC)(DG)(DC)(DC)(DT)(DA)(DT)(DA)(DA)(DA)(DA)(DG)(DG)(DG)
(DG)(DG)(DT)(DG)(DG)(DG)(DG)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)
(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DT)(DC)(DG)(DA)(DA)(DC)(DA)(DC)(DT)(DC)(DG)
(DA)(DG)(DC)(DC)(DG)(DA)(DG)(DC)(DA)(DG)(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DA)(DC)
(DG)(DG)(DA)
;
;GAAGGGCGCCTATAAAAGGGGGTGGGGGCGTTTTTTTTTTTTTTTTTTTTCGAACACTCGAGCCGAGCAGACGTGCCTAC
GGA
;
X ? 
29 polydeoxyribonucleotide no no 
;(DT)(DC)(DC)(DG)(DT)(DA)(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DC)(DT)(DG)(DC)(DT)(DC)(DG)
(DG)(DC)(DT)(DC)(DG)(DA)(DG)(DT)(DG)(DT)(DT)(DC)(DG)(DA)(DT)(DC)(DG)(DC)(DG)(DA)
(DC)(DT)(DG)(DA)(DG)(DG)(DA)(DC)(DG)(DA)(DA)(DC)(DG)(DC)(DG)(DC)(DC)(DC)(DC)(DC)
(DA)(DC)(DC)(DC)(DC)(DC)(DT)(DT)(DC)(DT)(DA)(DT)(DA)(DG)(DG)(DC)(DG)(DC)(DC)(DC)
(DT)(DT)(DC)
;
;TCCGTAGGCACGTCTGCTCGGCTCGAGTGTTCGATCGCGACTGAGGACGAACGCGCCCCCACCCCCTTCTATAGGCGCCC
TTC
;
Y ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    HIS n 
1  3    GLY n 
1  4    GLY n 
1  5    GLY n 
1  6    PRO n 
1  7    PRO n 
1  8    SER n 
1  9    GLY n 
1  10   ASP n 
1  11   SER n 
1  12   ALA n 
1  13   CYS n 
1  14   PRO n 
1  15   LEU n 
1  16   ARG n 
1  17   THR n 
1  18   ILE n 
1  19   LYS n 
1  20   ARG n 
1  21   VAL n 
1  22   GLN n 
1  23   PHE n 
1  24   GLY n 
1  25   VAL n 
1  26   LEU n 
1  27   SER n 
1  28   PRO n 
1  29   ASP n 
1  30   GLU n 
1  31   LEU n 
1  32   LYS n 
1  33   ARG n 
1  34   MET n 
1  35   SER n 
1  36   VAL n 
1  37   THR n 
1  38   GLU n 
1  39   GLY n 
1  40   GLY n 
1  41   ILE n 
1  42   LYS n 
1  43   TYR n 
1  44   PRO n 
1  45   GLU n 
1  46   THR n 
1  47   THR n 
1  48   GLU n 
1  49   GLY n 
1  50   GLY n 
1  51   ARG n 
1  52   PRO n 
1  53   LYS n 
1  54   LEU n 
1  55   GLY n 
1  56   GLY n 
1  57   LEU n 
1  58   MET n 
1  59   ASP n 
1  60   PRO n 
1  61   ARG n 
1  62   GLN n 
1  63   GLY n 
1  64   VAL n 
1  65   ILE n 
1  66   GLU n 
1  67   ARG n 
1  68   THR n 
1  69   GLY n 
1  70   ARG n 
1  71   CYS n 
1  72   GLN n 
1  73   THR n 
1  74   CYS n 
1  75   ALA n 
1  76   GLY n 
1  77   ASN n 
1  78   MET n 
1  79   THR n 
1  80   GLU n 
1  81   CYS n 
1  82   PRO n 
1  83   GLY n 
1  84   HIS n 
1  85   PHE n 
1  86   GLY n 
1  87   HIS n 
1  88   ILE n 
1  89   GLU n 
1  90   LEU n 
1  91   ALA n 
1  92   LYS n 
1  93   PRO n 
1  94   VAL n 
1  95   PHE n 
1  96   HIS n 
1  97   VAL n 
1  98   GLY n 
1  99   PHE n 
1  100  LEU n 
1  101  VAL n 
1  102  LYS n 
1  103  THR n 
1  104  MET n 
1  105  LYS n 
1  106  VAL n 
1  107  LEU n 
1  108  ARG n 
1  109  CYS n 
1  110  VAL n 
1  111  CYS n 
1  112  PHE n 
1  113  PHE n 
1  114  CYS n 
1  115  SER n 
1  116  LYS n 
1  117  LEU n 
1  118  LEU n 
1  119  VAL n 
1  120  ASP n 
1  121  SER n 
1  122  ASN n 
1  123  ASN n 
1  124  PRO n 
1  125  LYS n 
1  126  ILE n 
1  127  LYS n 
1  128  ASP n 
1  129  ILE n 
1  130  LEU n 
1  131  ALA n 
1  132  LYS n 
1  133  SER n 
1  134  LYS n 
1  135  GLY n 
1  136  GLN n 
1  137  PRO n 
1  138  LYS n 
1  139  LYS n 
1  140  ARG n 
1  141  LEU n 
1  142  THR n 
1  143  HIS n 
1  144  VAL n 
1  145  TYR n 
1  146  ASP n 
1  147  LEU n 
1  148  CYS n 
1  149  LYS n 
1  150  GLY n 
1  151  LYS n 
1  152  ASN n 
1  153  ILE n 
1  154  CYS n 
1  155  GLU n 
1  156  GLY n 
1  157  GLY n 
1  158  GLU n 
1  159  GLU n 
1  160  MET n 
1  161  ASP n 
1  162  ASN n 
1  163  LYS n 
1  164  PHE n 
1  165  GLY n 
1  166  VAL n 
1  167  GLU n 
1  168  GLN n 
1  169  PRO n 
1  170  GLU n 
1  171  GLY n 
1  172  ASP n 
1  173  GLU n 
1  174  ASP n 
1  175  LEU n 
1  176  THR n 
1  177  LYS n 
1  178  GLU n 
1  179  LYS n 
1  180  GLY n 
1  181  HIS n 
1  182  GLY n 
1  183  GLY n 
1  184  CYS n 
1  185  GLY n 
1  186  ARG n 
1  187  TYR n 
1  188  GLN n 
1  189  PRO n 
1  190  ARG n 
1  191  ILE n 
1  192  ARG n 
1  193  ARG n 
1  194  SER n 
1  195  GLY n 
1  196  LEU n 
1  197  GLU n 
1  198  LEU n 
1  199  TYR n 
1  200  ALA n 
1  201  GLU n 
1  202  TRP n 
1  203  LYS n 
1  204  HIS n 
1  205  VAL n 
1  206  ASN n 
1  207  GLU n 
1  208  ASP n 
1  209  SER n 
1  210  GLN n 
1  211  GLU n 
1  212  LYS n 
1  213  LYS n 
1  214  ILE n 
1  215  LEU n 
1  216  LEU n 
1  217  SER n 
1  218  PRO n 
1  219  GLU n 
1  220  ARG n 
1  221  VAL n 
1  222  HIS n 
1  223  GLU n 
1  224  ILE n 
1  225  PHE n 
1  226  LYS n 
1  227  ARG n 
1  228  ILE n 
1  229  SER n 
1  230  ASP n 
1  231  GLU n 
1  232  GLU n 
1  233  CYS n 
1  234  PHE n 
1  235  VAL n 
1  236  LEU n 
1  237  GLY n 
1  238  MET n 
1  239  GLU n 
1  240  PRO n 
1  241  ARG n 
1  242  TYR n 
1  243  ALA n 
1  244  ARG n 
1  245  PRO n 
1  246  GLU n 
1  247  TRP n 
1  248  MET n 
1  249  ILE n 
1  250  VAL n 
1  251  THR n 
1  252  VAL n 
1  253  LEU n 
1  254  PRO n 
1  255  VAL n 
1  256  PRO n 
1  257  PRO n 
1  258  LEU n 
1  259  SER n 
1  260  VAL n 
1  261  ARG n 
1  262  PRO n 
1  263  ALA n 
1  264  VAL n 
1  265  VAL n 
1  266  MET n 
1  267  GLN n 
1  268  GLY n 
1  269  SER n 
1  270  ALA n 
1  271  ARG n 
1  272  ASN n 
1  273  GLN n 
1  274  ASP n 
1  275  ASP n 
1  276  LEU n 
1  277  THR n 
1  278  HIS n 
1  279  LYS n 
1  280  LEU n 
1  281  ALA n 
1  282  ASP n 
1  283  ILE n 
1  284  VAL n 
1  285  LYS n 
1  286  ILE n 
1  287  ASN n 
1  288  ASN n 
1  289  GLN n 
1  290  LEU n 
1  291  ARG n 
1  292  ARG n 
1  293  ASN n 
1  294  GLU n 
1  295  GLN n 
1  296  ASN n 
1  297  GLY n 
1  298  ALA n 
1  299  ALA n 
1  300  ALA n 
1  301  HIS n 
1  302  VAL n 
1  303  ILE n 
1  304  ALA n 
1  305  GLU n 
1  306  ASP n 
1  307  VAL n 
1  308  LYS n 
1  309  LEU n 
1  310  LEU n 
1  311  GLN n 
1  312  PHE n 
1  313  HIS n 
1  314  VAL n 
1  315  ALA n 
1  316  THR n 
1  317  MET n 
1  318  VAL n 
1  319  ASP n 
1  320  ASN n 
1  321  GLU n 
1  322  LEU n 
1  323  PRO n 
1  324  GLY n 
1  325  LEU n 
1  326  PRO n 
1  327  ARG n 
1  328  ALA n 
1  329  MET n 
1  330  GLN n 
1  331  LYS n 
1  332  SER n 
1  333  GLY n 
1  334  ARG n 
1  335  PRO n 
1  336  LEU n 
1  337  LYS n 
1  338  SER n 
1  339  LEU n 
1  340  LYS n 
1  341  GLN n 
1  342  ARG n 
1  343  LEU n 
1  344  LYS n 
1  345  GLY n 
1  346  LYS n 
1  347  GLU n 
1  348  GLY n 
1  349  ARG n 
1  350  VAL n 
1  351  ARG n 
1  352  GLY n 
1  353  ASN n 
1  354  LEU n 
1  355  MET n 
1  356  GLY n 
1  357  LYS n 
1  358  ARG n 
1  359  VAL n 
1  360  ASP n 
1  361  PHE n 
1  362  SER n 
1  363  ALA n 
1  364  ARG n 
1  365  THR n 
1  366  VAL n 
1  367  ILE n 
1  368  THR n 
1  369  PRO n 
1  370  ASP n 
1  371  PRO n 
1  372  ASN n 
1  373  LEU n 
1  374  SER n 
1  375  ILE n 
1  376  ASP n 
1  377  GLN n 
1  378  VAL n 
1  379  GLY n 
1  380  VAL n 
1  381  PRO n 
1  382  ARG n 
1  383  SER n 
1  384  ILE n 
1  385  ALA n 
1  386  ALA n 
1  387  ASN n 
1  388  MET n 
1  389  THR n 
1  390  PHE n 
1  391  ALA n 
1  392  GLU n 
1  393  ILE n 
1  394  VAL n 
1  395  THR n 
1  396  PRO n 
1  397  PHE n 
1  398  ASN n 
1  399  ILE n 
1  400  ASP n 
1  401  ARG n 
1  402  LEU n 
1  403  GLN n 
1  404  GLU n 
1  405  LEU n 
1  406  VAL n 
1  407  ARG n 
1  408  ARG n 
1  409  GLY n 
1  410  ASN n 
1  411  SER n 
1  412  GLN n 
1  413  TYR n 
1  414  PRO n 
1  415  GLY n 
1  416  ALA n 
1  417  LYS n 
1  418  TYR n 
1  419  ILE n 
1  420  ILE n 
1  421  ARG n 
1  422  ASP n 
1  423  ASN n 
1  424  GLY n 
1  425  ASP n 
1  426  ARG n 
1  427  ILE n 
1  428  ASP n 
1  429  LEU n 
1  430  ARG n 
1  431  PHE n 
1  432  HIS n 
1  433  PRO n 
1  434  LYS n 
1  435  PRO n 
1  436  SER n 
1  437  ASP n 
1  438  LEU n 
1  439  HIS n 
1  440  LEU n 
1  441  GLN n 
1  442  THR n 
1  443  GLY n 
1  444  TYR n 
1  445  LYS n 
1  446  VAL n 
1  447  GLU n 
1  448  ARG n 
1  449  HIS n 
1  450  MET n 
1  451  CYS n 
1  452  ASP n 
1  453  GLY n 
1  454  ASP n 
1  455  ILE n 
1  456  VAL n 
1  457  ILE n 
1  458  PHE n 
1  459  ASN n 
1  460  ARG n 
1  461  GLN n 
1  462  PRO n 
1  463  THR n 
1  464  LEU n 
1  465  HIS n 
1  466  LYS n 
1  467  MET n 
1  468  SER n 
1  469  MET n 
1  470  MET n 
1  471  GLY n 
1  472  HIS n 
1  473  ARG n 
1  474  VAL n 
1  475  ARG n 
1  476  ILE n 
1  477  LEU n 
1  478  PRO n 
1  479  TRP n 
1  480  SER n 
1  481  THR n 
1  482  PHE n 
1  483  ARG n 
1  484  LEU n 
1  485  ASN n 
1  486  LEU n 
1  487  SER n 
1  488  VAL n 
1  489  THR n 
1  490  THR n 
1  491  PRO n 
1  492  TYR n 
1  493  ASN n 
1  494  ALA n 
1  495  ASP n 
1  496  PHE n 
1  497  ASP n 
1  498  GLY n 
1  499  ASP n 
1  500  GLU n 
1  501  MET n 
1  502  ASN n 
1  503  LEU n 
1  504  HIS n 
1  505  LEU n 
1  506  PRO n 
1  507  GLN n 
1  508  SER n 
1  509  LEU n 
1  510  GLU n 
1  511  THR n 
1  512  ARG n 
1  513  ALA n 
1  514  GLU n 
1  515  ILE n 
1  516  GLN n 
1  517  GLU n 
1  518  LEU n 
1  519  ALA n 
1  520  MET n 
1  521  VAL n 
1  522  PRO n 
1  523  ARG n 
1  524  MET n 
1  525  ILE n 
1  526  VAL n 
1  527  THR n 
1  528  PRO n 
1  529  GLN n 
1  530  SER n 
1  531  ASN n 
1  532  ARG n 
1  533  PRO n 
1  534  VAL n 
1  535  MET n 
1  536  GLY n 
1  537  ILE n 
1  538  VAL n 
1  539  GLN n 
1  540  ASP n 
1  541  THR n 
1  542  LEU n 
1  543  THR n 
1  544  ALA n 
1  545  VAL n 
1  546  ARG n 
1  547  LYS n 
1  548  PHE n 
1  549  THR n 
1  550  LYS n 
1  551  ARG n 
1  552  ASP n 
1  553  VAL n 
1  554  PHE n 
1  555  LEU n 
1  556  GLU n 
1  557  ARG n 
1  558  GLY n 
1  559  GLU n 
1  560  VAL n 
1  561  MET n 
1  562  ASN n 
1  563  LEU n 
1  564  LEU n 
1  565  MET n 
1  566  PHE n 
1  567  LEU n 
1  568  SER n 
1  569  THR n 
1  570  TRP n 
1  571  ASP n 
1  572  GLY n 
1  573  LYS n 
1  574  VAL n 
1  575  PRO n 
1  576  GLN n 
1  577  PRO n 
1  578  ALA n 
1  579  ILE n 
1  580  LEU n 
1  581  LYS n 
1  582  PRO n 
1  583  ARG n 
1  584  PRO n 
1  585  LEU n 
1  586  TRP n 
1  587  THR n 
1  588  GLY n 
1  589  LYS n 
1  590  GLN n 
1  591  ILE n 
1  592  PHE n 
1  593  SER n 
1  594  LEU n 
1  595  ILE n 
1  596  ILE n 
1  597  PRO n 
1  598  GLY n 
1  599  HIS n 
1  600  ILE n 
1  601  ASN n 
1  602  CYS n 
1  603  ILE n 
1  604  ARG n 
1  605  THR n 
1  606  HIS n 
1  607  SER n 
1  608  THR n 
1  609  HIS n 
1  610  PRO n 
1  611  ASP n 
1  612  ASP n 
1  613  GLU n 
1  614  ASP n 
1  615  SER n 
1  616  GLY n 
1  617  PRO n 
1  618  TYR n 
1  619  LYS n 
1  620  HIS n 
1  621  ILE n 
1  622  SER n 
1  623  PRO n 
1  624  GLY n 
1  625  ASP n 
1  626  THR n 
1  627  LYS n 
1  628  VAL n 
1  629  VAL n 
1  630  VAL n 
1  631  GLU n 
1  632  ASN n 
1  633  GLY n 
1  634  GLU n 
1  635  LEU n 
1  636  ILE n 
1  637  MET n 
1  638  GLY n 
1  639  ILE n 
1  640  LEU n 
1  641  CYS n 
1  642  LYS n 
1  643  LYS n 
1  644  SER n 
1  645  LEU n 
1  646  GLY n 
1  647  THR n 
1  648  SER n 
1  649  ALA n 
1  650  GLY n 
1  651  SER n 
1  652  LEU n 
1  653  VAL n 
1  654  HIS n 
1  655  ILE n 
1  656  SER n 
1  657  TYR n 
1  658  LEU n 
1  659  GLU n 
1  660  MET n 
1  661  GLY n 
1  662  HIS n 
1  663  ASP n 
1  664  ILE n 
1  665  THR n 
1  666  ARG n 
1  667  LEU n 
1  668  PHE n 
1  669  TYR n 
1  670  SER n 
1  671  ASN n 
1  672  ILE n 
1  673  GLN n 
1  674  THR n 
1  675  VAL n 
1  676  ILE n 
1  677  ASN n 
1  678  ASN n 
1  679  TRP n 
1  680  LEU n 
1  681  LEU n 
1  682  ILE n 
1  683  GLU n 
1  684  GLY n 
1  685  HIS n 
1  686  THR n 
1  687  ILE n 
1  688  GLY n 
1  689  ILE n 
1  690  GLY n 
1  691  ASP n 
1  692  SER n 
1  693  ILE n 
1  694  ALA n 
1  695  ASP n 
1  696  SER n 
1  697  LYS n 
1  698  THR n 
1  699  TYR n 
1  700  GLN n 
1  701  ASP n 
1  702  ILE n 
1  703  GLN n 
1  704  ASN n 
1  705  THR n 
1  706  ILE n 
1  707  LYS n 
1  708  LYS n 
1  709  ALA n 
1  710  LYS n 
1  711  GLN n 
1  712  ASP n 
1  713  VAL n 
1  714  ILE n 
1  715  GLU n 
1  716  VAL n 
1  717  ILE n 
1  718  GLU n 
1  719  LYS n 
1  720  ALA n 
1  721  HIS n 
1  722  ASN n 
1  723  ASN n 
1  724  GLU n 
1  725  LEU n 
1  726  GLU n 
1  727  PRO n 
1  728  THR n 
1  729  PRO n 
1  730  GLY n 
1  731  ASN n 
1  732  THR n 
1  733  LEU n 
1  734  ARG n 
1  735  GLN n 
1  736  THR n 
1  737  PHE n 
1  738  GLU n 
1  739  ASN n 
1  740  GLN n 
1  741  VAL n 
1  742  ASN n 
1  743  ARG n 
1  744  ILE n 
1  745  LEU n 
1  746  ASN n 
1  747  ASP n 
1  748  ALA n 
1  749  ARG n 
1  750  ASP n 
1  751  LYS n 
1  752  THR n 
1  753  GLY n 
1  754  SER n 
1  755  SER n 
1  756  ALA n 
1  757  GLN n 
1  758  LYS n 
1  759  SER n 
1  760  LEU n 
1  761  SER n 
1  762  GLU n 
1  763  TYR n 
1  764  ASN n 
1  765  ASN n 
1  766  PHE n 
1  767  LYS n 
1  768  SER n 
1  769  MET n 
1  770  VAL n 
1  771  VAL n 
1  772  SER n 
1  773  GLY n 
1  774  ALA n 
1  775  LYS n 
1  776  GLY n 
1  777  SER n 
1  778  LYS n 
1  779  ILE n 
1  780  ASN n 
1  781  ILE n 
1  782  SER n 
1  783  GLN n 
1  784  VAL n 
1  785  ILE n 
1  786  ALA n 
1  787  VAL n 
1  788  VAL n 
1  789  GLY n 
1  790  GLN n 
1  791  GLN n 
1  792  ASN n 
1  793  VAL n 
1  794  GLU n 
1  795  GLY n 
1  796  LYS n 
1  797  ARG n 
1  798  ILE n 
1  799  PRO n 
1  800  PHE n 
1  801  GLY n 
1  802  PHE n 
1  803  LYS n 
1  804  HIS n 
1  805  ARG n 
1  806  THR n 
1  807  LEU n 
1  808  PRO n 
1  809  HIS n 
1  810  PHE n 
1  811  ILE n 
1  812  LYS n 
1  813  ASP n 
1  814  ASP n 
1  815  TYR n 
1  816  GLY n 
1  817  PRO n 
1  818  GLU n 
1  819  SER n 
1  820  ARG n 
1  821  GLY n 
1  822  PHE n 
1  823  VAL n 
1  824  GLU n 
1  825  ASN n 
1  826  SER n 
1  827  TYR n 
1  828  LEU n 
1  829  ALA n 
1  830  GLY n 
1  831  LEU n 
1  832  THR n 
1  833  PRO n 
1  834  THR n 
1  835  GLU n 
1  836  PHE n 
1  837  PHE n 
1  838  PHE n 
1  839  HIS n 
1  840  ALA n 
1  841  MET n 
1  842  GLY n 
1  843  GLY n 
1  844  ARG n 
1  845  GLU n 
1  846  GLY n 
1  847  LEU n 
1  848  ILE n 
1  849  ASP n 
1  850  THR n 
1  851  ALA n 
1  852  VAL n 
1  853  LYS n 
1  854  THR n 
1  855  ALA n 
1  856  GLU n 
1  857  THR n 
1  858  GLY n 
1  859  TYR n 
1  860  ILE n 
1  861  GLN n 
1  862  ARG n 
1  863  ARG n 
1  864  LEU n 
1  865  ILE n 
1  866  LYS n 
1  867  SER n 
1  868  MET n 
1  869  GLU n 
1  870  SER n 
1  871  VAL n 
1  872  MET n 
1  873  VAL n 
1  874  LYS n 
1  875  TYR n 
1  876  ASP n 
1  877  ALA n 
1  878  THR n 
1  879  VAL n 
1  880  ARG n 
1  881  ASN n 
1  882  SER n 
1  883  ILE n 
1  884  ASN n 
1  885  GLN n 
1  886  VAL n 
1  887  VAL n 
1  888  GLN n 
1  889  LEU n 
1  890  ARG n 
1  891  TYR n 
1  892  GLY n 
1  893  GLU n 
1  894  ASP n 
1  895  GLY n 
1  896  LEU n 
1  897  ALA n 
1  898  GLY n 
1  899  GLU n 
1  900  SER n 
1  901  VAL n 
1  902  GLU n 
1  903  PHE n 
1  904  GLN n 
1  905  ASN n 
1  906  LEU n 
1  907  ALA n 
1  908  THR n 
1  909  LEU n 
1  910  LYS n 
1  911  PRO n 
1  912  SER n 
1  913  ASN n 
1  914  LYS n 
1  915  ALA n 
1  916  PHE n 
1  917  GLU n 
1  918  LYS n 
1  919  LYS n 
1  920  PHE n 
1  921  ARG n 
1  922  PHE n 
1  923  ASP n 
1  924  TYR n 
1  925  THR n 
1  926  ASN n 
1  927  GLU n 
1  928  ARG n 
1  929  ALA n 
1  930  LEU n 
1  931  ARG n 
1  932  ARG n 
1  933  THR n 
1  934  LEU n 
1  935  GLN n 
1  936  GLU n 
1  937  ASP n 
1  938  LEU n 
1  939  VAL n 
1  940  LYS n 
1  941  ASP n 
1  942  VAL n 
1  943  LEU n 
1  944  SER n 
1  945  ASN n 
1  946  ALA n 
1  947  HIS n 
1  948  ILE n 
1  949  GLN n 
1  950  ASN n 
1  951  GLU n 
1  952  LEU n 
1  953  GLU n 
1  954  ARG n 
1  955  GLU n 
1  956  PHE n 
1  957  GLU n 
1  958  ARG n 
1  959  MET n 
1  960  ARG n 
1  961  GLU n 
1  962  ASP n 
1  963  ARG n 
1  964  GLU n 
1  965  VAL n 
1  966  LEU n 
1  967  ARG n 
1  968  VAL n 
1  969  ILE n 
1  970  PHE n 
1  971  PRO n 
1  972  THR n 
1  973  GLY n 
1  974  ASP n 
1  975  SER n 
1  976  LYS n 
1  977  VAL n 
1  978  VAL n 
1  979  LEU n 
1  980  PRO n 
1  981  CYS n 
1  982  ASN n 
1  983  LEU n 
1  984  LEU n 
1  985  ARG n 
1  986  MET n 
1  987  ILE n 
1  988  TRP n 
1  989  ASN n 
1  990  ALA n 
1  991  GLN n 
1  992  LYS n 
1  993  ILE n 
1  994  PHE n 
1  995  HIS n 
1  996  ILE n 
1  997  ASN n 
1  998  PRO n 
1  999  ARG n 
1  1000 LEU n 
1  1001 PRO n 
1  1002 SER n 
1  1003 ASP n 
1  1004 LEU n 
1  1005 HIS n 
1  1006 PRO n 
1  1007 ILE n 
1  1008 LYS n 
1  1009 VAL n 
1  1010 VAL n 
1  1011 GLU n 
1  1012 GLY n 
1  1013 VAL n 
1  1014 LYS n 
1  1015 GLU n 
1  1016 LEU n 
1  1017 SER n 
1  1018 LYS n 
1  1019 LYS n 
1  1020 LEU n 
1  1021 VAL n 
1  1022 ILE n 
1  1023 VAL n 
1  1024 ASN n 
1  1025 GLY n 
1  1026 ASP n 
1  1027 ASP n 
1  1028 PRO n 
1  1029 LEU n 
1  1030 SER n 
1  1031 ARG n 
1  1032 GLN n 
1  1033 ALA n 
1  1034 GLN n 
1  1035 GLU n 
1  1036 ASN n 
1  1037 ALA n 
1  1038 THR n 
1  1039 LEU n 
1  1040 LEU n 
1  1041 PHE n 
1  1042 ASN n 
1  1043 ILE n 
1  1044 HIS n 
1  1045 LEU n 
1  1046 ARG n 
1  1047 SER n 
1  1048 THR n 
1  1049 LEU n 
1  1050 CYS n 
1  1051 SER n 
1  1052 ARG n 
1  1053 ARG n 
1  1054 MET n 
1  1055 ALA n 
1  1056 GLU n 
1  1057 GLU n 
1  1058 PHE n 
1  1059 ARG n 
1  1060 LEU n 
1  1061 SER n 
1  1062 GLY n 
1  1063 GLU n 
1  1064 ALA n 
1  1065 PHE n 
1  1066 ASP n 
1  1067 TRP n 
1  1068 LEU n 
1  1069 LEU n 
1  1070 GLY n 
1  1071 GLU n 
1  1072 ILE n 
1  1073 GLU n 
1  1074 SER n 
1  1075 LYS n 
1  1076 PHE n 
1  1077 ASN n 
1  1078 GLN n 
1  1079 ALA n 
1  1080 ILE n 
1  1081 ALA n 
1  1082 HIS n 
1  1083 PRO n 
1  1084 GLY n 
1  1085 GLU n 
1  1086 MET n 
1  1087 VAL n 
1  1088 GLY n 
1  1089 ALA n 
1  1090 LEU n 
1  1091 ALA n 
1  1092 ALA n 
1  1093 GLN n 
1  1094 SER n 
1  1095 LEU n 
1  1096 GLY n 
1  1097 GLU n 
1  1098 PRO n 
1  1099 ALA n 
1  1100 THR n 
1  1101 GLN n 
1  1102 MET n 
1  1103 THR n 
1  1104 LEU n 
1  1105 ASN n 
1  1106 THR n 
1  1107 PHE n 
1  1108 HIS n 
1  1109 TYR n 
1  1110 ALA n 
1  1111 GLY n 
1  1112 VAL n 
1  1113 SER n 
1  1114 ALA n 
1  1115 LYS n 
1  1116 ASN n 
1  1117 VAL n 
1  1118 THR n 
1  1119 LEU n 
1  1120 GLY n 
1  1121 VAL n 
1  1122 PRO n 
1  1123 ARG n 
1  1124 LEU n 
1  1125 LYS n 
1  1126 GLU n 
1  1127 LEU n 
1  1128 ILE n 
1  1129 ASN n 
1  1130 ILE n 
1  1131 SER n 
1  1132 LYS n 
1  1133 LYS n 
1  1134 PRO n 
1  1135 LYS n 
1  1136 THR n 
1  1137 PRO n 
1  1138 SER n 
1  1139 LEU n 
1  1140 THR n 
1  1141 VAL n 
1  1142 PHE n 
1  1143 LEU n 
1  1144 LEU n 
1  1145 GLY n 
1  1146 GLN n 
1  1147 SER n 
1  1148 ALA n 
1  1149 ARG n 
1  1150 ASP n 
1  1151 ALA n 
1  1152 GLU n 
1  1153 ARG n 
1  1154 ALA n 
1  1155 LYS n 
1  1156 ASP n 
1  1157 ILE n 
1  1158 LEU n 
1  1159 CYS n 
1  1160 ARG n 
1  1161 LEU n 
1  1162 GLU n 
1  1163 HIS n 
1  1164 THR n 
1  1165 THR n 
1  1166 LEU n 
1  1167 ARG n 
1  1168 LYS n 
1  1169 VAL n 
1  1170 THR n 
1  1171 ALA n 
1  1172 ASN n 
1  1173 THR n 
1  1174 ALA n 
1  1175 ILE n 
1  1176 TYR n 
1  1177 TYR n 
1  1178 ASP n 
1  1179 PRO n 
1  1180 ASN n 
1  1181 PRO n 
1  1182 GLN n 
1  1183 SER n 
1  1184 THR n 
1  1185 VAL n 
1  1186 VAL n 
1  1187 ALA n 
1  1188 GLU n 
1  1189 ASP n 
1  1190 GLN n 
1  1191 GLU n 
1  1192 TRP n 
1  1193 VAL n 
1  1194 ASN n 
1  1195 VAL n 
1  1196 TYR n 
1  1197 TYR n 
1  1198 GLU n 
1  1199 MET n 
1  1200 PRO n 
1  1201 ASP n 
1  1202 PHE n 
1  1203 ASP n 
1  1204 VAL n 
1  1205 ALA n 
1  1206 ARG n 
1  1207 ILE n 
1  1208 SER n 
1  1209 PRO n 
1  1210 TRP n 
1  1211 LEU n 
1  1212 LEU n 
1  1213 ARG n 
1  1214 VAL n 
1  1215 GLU n 
1  1216 LEU n 
1  1217 ASP n 
1  1218 ARG n 
1  1219 LYS n 
1  1220 HIS n 
1  1221 MET n 
1  1222 THR n 
1  1223 ASP n 
1  1224 ARG n 
1  1225 LYS n 
1  1226 LEU n 
1  1227 THR n 
1  1228 MET n 
1  1229 GLU n 
1  1230 GLN n 
1  1231 ILE n 
1  1232 ALA n 
1  1233 GLU n 
1  1234 LYS n 
1  1235 ILE n 
1  1236 ASN n 
1  1237 ALA n 
1  1238 GLY n 
1  1239 PHE n 
1  1240 GLY n 
1  1241 ASP n 
1  1242 ASP n 
1  1243 LEU n 
1  1244 ASN n 
1  1245 CYS n 
1  1246 ILE n 
1  1247 PHE n 
1  1248 ASN n 
1  1249 ASP n 
1  1250 ASP n 
1  1251 ASN n 
1  1252 ALA n 
1  1253 GLU n 
1  1254 LYS n 
1  1255 LEU n 
1  1256 VAL n 
1  1257 LEU n 
1  1258 ARG n 
1  1259 ILE n 
1  1260 ARG n 
1  1261 ILE n 
1  1262 MET n 
1  1263 ASN n 
1  1264 SER n 
1  1265 ASP n 
1  1266 GLU n 
1  1267 ASN n 
1  1268 LYS n 
1  1269 MET n 
1  1270 GLN n 
1  1271 GLU n 
1  1272 GLU n 
1  1273 GLU n 
1  1274 GLU n 
1  1275 VAL n 
1  1276 VAL n 
1  1277 ASP n 
1  1278 LYS n 
1  1279 MET n 
1  1280 ASP n 
1  1281 ASP n 
1  1282 ASP n 
1  1283 VAL n 
1  1284 PHE n 
1  1285 LEU n 
1  1286 ARG n 
1  1287 CYS n 
1  1288 ILE n 
1  1289 GLU n 
1  1290 SER n 
1  1291 ASN n 
1  1292 MET n 
1  1293 LEU n 
1  1294 THR n 
1  1295 ASP n 
1  1296 MET n 
1  1297 THR n 
1  1298 LEU n 
1  1299 GLN n 
1  1300 GLY n 
1  1301 ILE n 
1  1302 GLU n 
1  1303 GLN n 
1  1304 ILE n 
1  1305 SER n 
1  1306 LYS n 
1  1307 VAL n 
1  1308 TYR n 
1  1309 MET n 
1  1310 HIS n 
1  1311 LEU n 
1  1312 PRO n 
1  1313 GLN n 
1  1314 THR n 
1  1315 ASP n 
1  1316 ASN n 
1  1317 LYS n 
1  1318 LYS n 
1  1319 LYS n 
1  1320 ILE n 
1  1321 ILE n 
1  1322 ILE n 
1  1323 THR n 
1  1324 GLU n 
1  1325 ASP n 
1  1326 GLY n 
1  1327 GLU n 
1  1328 PHE n 
1  1329 LYS n 
1  1330 ALA n 
1  1331 LEU n 
1  1332 GLN n 
1  1333 GLU n 
1  1334 TRP n 
1  1335 ILE n 
1  1336 LEU n 
1  1337 GLU n 
1  1338 THR n 
1  1339 ASP n 
1  1340 GLY n 
1  1341 VAL n 
1  1342 SER n 
1  1343 LEU n 
1  1344 MET n 
1  1345 ARG n 
1  1346 VAL n 
1  1347 LEU n 
1  1348 SER n 
1  1349 GLU n 
1  1350 LYS n 
1  1351 ASP n 
1  1352 VAL n 
1  1353 ASP n 
1  1354 PRO n 
1  1355 VAL n 
1  1356 ARG n 
1  1357 THR n 
1  1358 THR n 
1  1359 SER n 
1  1360 ASN n 
1  1361 ASP n 
1  1362 ILE n 
1  1363 VAL n 
1  1364 GLU n 
1  1365 ILE n 
1  1366 PHE n 
1  1367 THR n 
1  1368 VAL n 
1  1369 LEU n 
1  1370 GLY n 
1  1371 ILE n 
1  1372 GLU n 
1  1373 ALA n 
1  1374 VAL n 
1  1375 ARG n 
1  1376 LYS n 
1  1377 ALA n 
1  1378 LEU n 
1  1379 GLU n 
1  1380 ARG n 
1  1381 GLU n 
1  1382 LEU n 
1  1383 TYR n 
1  1384 HIS n 
1  1385 VAL n 
1  1386 ILE n 
1  1387 SER n 
1  1388 PHE n 
1  1389 ASP n 
1  1390 GLY n 
1  1391 SER n 
1  1392 TYR n 
1  1393 VAL n 
1  1394 ASN n 
1  1395 TYR n 
1  1396 ARG n 
1  1397 HIS n 
1  1398 LEU n 
1  1399 ALA n 
1  1400 LEU n 
1  1401 LEU n 
1  1402 CYS n 
1  1403 ASP n 
1  1404 THR n 
1  1405 MET n 
1  1406 THR n 
1  1407 CYS n 
1  1408 ARG n 
1  1409 GLY n 
1  1410 HIS n 
1  1411 LEU n 
1  1412 MET n 
1  1413 ALA n 
1  1414 ILE n 
1  1415 THR n 
1  1416 ARG n 
1  1417 HIS n 
1  1418 GLY n 
1  1419 VAL n 
1  1420 ASN n 
1  1421 ARG n 
1  1422 GLN n 
1  1423 ASP n 
1  1424 THR n 
1  1425 GLY n 
1  1426 PRO n 
1  1427 LEU n 
1  1428 MET n 
1  1429 LYS n 
1  1430 CYS n 
1  1431 SER n 
1  1432 PHE n 
1  1433 GLU n 
1  1434 GLU n 
1  1435 THR n 
1  1436 VAL n 
1  1437 ASP n 
1  1438 VAL n 
1  1439 LEU n 
1  1440 MET n 
1  1441 GLU n 
1  1442 ALA n 
1  1443 ALA n 
1  1444 ALA n 
1  1445 HIS n 
1  1446 GLY n 
1  1447 GLU n 
1  1448 SER n 
1  1449 ASP n 
1  1450 PRO n 
1  1451 MET n 
1  1452 LYS n 
1  1453 GLY n 
1  1454 VAL n 
1  1455 SER n 
1  1456 GLU n 
1  1457 ASN n 
1  1458 ILE n 
1  1459 MET n 
1  1460 LEU n 
1  1461 GLY n 
1  1462 GLN n 
1  1463 LEU n 
1  1464 ALA n 
1  1465 PRO n 
1  1466 ALA n 
1  1467 GLY n 
1  1468 THR n 
1  1469 GLY n 
1  1470 CYS n 
1  1471 PHE n 
1  1472 ASP n 
1  1473 LEU n 
1  1474 LEU n 
1  1475 LEU n 
1  1476 ASP n 
1  1477 ALA n 
1  1478 GLU n 
1  1479 LYS n 
1  1480 CYS n 
1  1481 LYS n 
1  1482 TYR n 
1  1483 GLY n 
1  1484 MET n 
1  1485 GLU n 
1  1486 ILE n 
1  1487 PRO n 
1  1488 THR n 
1  1489 ASN n 
1  1490 ILE n 
1  1491 PRO n 
1  1492 GLY n 
1  1493 LEU n 
1  1494 GLY n 
1  1495 ALA n 
1  1496 ALA n 
1  1497 GLY n 
1  1498 PRO n 
1  1499 THR n 
1  1500 GLY n 
1  1501 MET n 
1  1502 PHE n 
1  1503 PHE n 
1  1504 GLY n 
1  1505 SER n 
1  1506 ALA n 
1  1507 PRO n 
1  1508 SER n 
1  1509 PRO n 
1  1510 MET n 
1  1511 GLY n 
1  1512 GLY n 
1  1513 ILE n 
1  1514 SER n 
1  1515 PRO n 
1  1516 ALA n 
1  1517 MET n 
1  1518 THR n 
1  1519 PRO n 
1  1520 TRP n 
1  1521 ASN n 
1  1522 GLN n 
1  1523 GLY n 
1  1524 ALA n 
1  1525 THR n 
1  1526 PRO n 
1  1527 ALA n 
1  1528 TYR n 
1  1529 GLY n 
1  1530 ALA n 
1  1531 TRP n 
1  1532 SER n 
1  1533 PRO n 
1  1534 SER n 
1  1535 VAL n 
1  1536 GLY n 
1  1537 SER n 
1  1538 GLY n 
1  1539 MET n 
1  1540 THR n 
1  1541 PRO n 
1  1542 GLY n 
1  1543 ALA n 
1  1544 ALA n 
1  1545 GLY n 
1  1546 PHE n 
1  1547 SER n 
1  1548 PRO n 
1  1549 SER n 
1  1550 ALA n 
1  1551 ALA n 
1  1552 SER n 
1  1553 ASP n 
1  1554 ALA n 
1  1555 SER n 
1  1556 GLY n 
1  1557 PHE n 
1  1558 SER n 
1  1559 PRO n 
1  1560 GLY n 
1  1561 TYR n 
1  1562 SER n 
1  1563 PRO n 
1  1564 ALA n 
1  1565 TRP n 
1  1566 SER n 
1  1567 PRO n 
1  1568 THR n 
1  1569 PRO n 
1  1570 GLY n 
1  1571 SER n 
1  1572 PRO n 
1  1573 GLY n 
1  1574 SER n 
1  1575 PRO n 
1  1576 GLY n 
1  1577 PRO n 
1  1578 SER n 
1  1579 SER n 
1  1580 PRO n 
1  1581 TYR n 
1  1582 ILE n 
1  1583 PRO n 
1  1584 SER n 
1  1585 PRO n 
1  1586 GLY n 
1  1587 GLY n 
1  1588 ALA n 
1  1589 MET n 
1  1590 SER n 
1  1591 PRO n 
1  1592 SER n 
1  1593 TYR n 
1  1594 SER n 
1  1595 PRO n 
1  1596 THR n 
1  1597 SER n 
1  1598 PRO n 
1  1599 ALA n 
1  1600 TYR n 
1  1601 GLU n 
1  1602 PRO n 
1  1603 ARG n 
1  1604 SER n 
1  1605 PRO n 
1  1606 GLY n 
1  1607 GLY n 
1  1608 TYR n 
1  1609 THR n 
1  1610 PRO n 
1  1611 GLN n 
1  1612 SER n 
1  1613 PRO n 
1  1614 SER n 
1  1615 TYR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 THR n 
1  1619 SER n 
1  1620 PRO n 
1  1621 SER n 
1  1622 TYR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 THR n 
1  1626 SER n 
1  1627 PRO n 
1  1628 SER n 
1  1629 TYR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 THR n 
1  1633 SER n 
1  1634 PRO n 
1  1635 ASN n 
1  1636 TYR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 THR n 
1  1640 SER n 
1  1641 PRO n 
1  1642 SER n 
1  1643 TYR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 THR n 
1  1647 SER n 
1  1648 PRO n 
1  1649 SER n 
1  1650 TYR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 THR n 
1  1654 SER n 
1  1655 PRO n 
1  1656 SER n 
1  1657 TYR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 THR n 
1  1661 SER n 
1  1662 PRO n 
1  1663 SER n 
1  1664 TYR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 THR n 
1  1668 SER n 
1  1669 PRO n 
1  1670 SER n 
1  1671 TYR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 THR n 
1  1675 SER n 
1  1676 PRO n 
1  1677 SER n 
1  1678 TYR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 THR n 
1  1682 SER n 
1  1683 PRO n 
1  1684 SER n 
1  1685 TYR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 THR n 
1  1689 SER n 
1  1690 PRO n 
1  1691 SER n 
1  1692 TYR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 THR n 
1  1696 SER n 
1  1697 PRO n 
1  1698 SER n 
1  1699 TYR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 THR n 
1  1703 SER n 
1  1704 PRO n 
1  1705 SER n 
1  1706 TYR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 THR n 
1  1710 SER n 
1  1711 PRO n 
1  1712 SER n 
1  1713 TYR n 
1  1714 SER n 
1  1715 PRO n 
1  1716 THR n 
1  1717 SER n 
1  1718 PRO n 
1  1719 SER n 
1  1720 TYR n 
1  1721 SER n 
1  1722 PRO n 
1  1723 THR n 
1  1724 SER n 
1  1725 PRO n 
1  1726 SER n 
1  1727 TYR n 
1  1728 SER n 
1  1729 PRO n 
1  1730 THR n 
1  1731 SER n 
1  1732 PRO n 
1  1733 SER n 
1  1734 TYR n 
1  1735 SER n 
1  1736 PRO n 
1  1737 THR n 
1  1738 SER n 
1  1739 PRO n 
1  1740 SER n 
1  1741 TYR n 
1  1742 SER n 
1  1743 PRO n 
1  1744 THR n 
1  1745 SER n 
1  1746 PRO n 
1  1747 ASN n 
1  1748 TYR n 
1  1749 SER n 
1  1750 PRO n 
1  1751 THR n 
1  1752 SER n 
1  1753 PRO n 
1  1754 ASN n 
1  1755 TYR n 
1  1756 THR n 
1  1757 PRO n 
1  1758 THR n 
1  1759 SER n 
1  1760 PRO n 
1  1761 SER n 
1  1762 TYR n 
1  1763 SER n 
1  1764 PRO n 
1  1765 THR n 
1  1766 SER n 
1  1767 PRO n 
1  1768 SER n 
1  1769 TYR n 
1  1770 SER n 
1  1771 PRO n 
1  1772 THR n 
1  1773 SER n 
1  1774 PRO n 
1  1775 ASN n 
1  1776 TYR n 
1  1777 THR n 
1  1778 PRO n 
1  1779 THR n 
1  1780 SER n 
1  1781 PRO n 
1  1782 ASN n 
1  1783 TYR n 
1  1784 SER n 
1  1785 PRO n 
1  1786 THR n 
1  1787 SER n 
1  1788 PRO n 
1  1789 SER n 
1  1790 TYR n 
1  1791 SER n 
1  1792 PRO n 
1  1793 THR n 
1  1794 SER n 
1  1795 PRO n 
1  1796 SER n 
1  1797 TYR n 
1  1798 SER n 
1  1799 PRO n 
1  1800 THR n 
1  1801 SER n 
1  1802 PRO n 
1  1803 SER n 
1  1804 TYR n 
1  1805 SER n 
1  1806 PRO n 
1  1807 SER n 
1  1808 SER n 
1  1809 PRO n 
1  1810 ARG n 
1  1811 TYR n 
1  1812 THR n 
1  1813 PRO n 
1  1814 GLN n 
1  1815 SER n 
1  1816 PRO n 
1  1817 THR n 
1  1818 TYR n 
1  1819 THR n 
1  1820 PRO n 
1  1821 SER n 
1  1822 SER n 
1  1823 PRO n 
1  1824 SER n 
1  1825 TYR n 
1  1826 SER n 
1  1827 PRO n 
1  1828 SER n 
1  1829 SER n 
1  1830 PRO n 
1  1831 SER n 
1  1832 TYR n 
1  1833 SER n 
1  1834 PRO n 
1  1835 ALA n 
1  1836 SER n 
1  1837 PRO n 
1  1838 LYS n 
1  1839 TYR n 
1  1840 THR n 
1  1841 PRO n 
1  1842 THR n 
1  1843 SER n 
1  1844 PRO n 
1  1845 SER n 
1  1846 TYR n 
1  1847 SER n 
1  1848 PRO n 
1  1849 SER n 
1  1850 SER n 
1  1851 PRO n 
1  1852 GLU n 
1  1853 TYR n 
1  1854 THR n 
1  1855 PRO n 
1  1856 THR n 
1  1857 SER n 
1  1858 PRO n 
1  1859 LYS n 
1  1860 TYR n 
1  1861 SER n 
1  1862 PRO n 
1  1863 THR n 
1  1864 SER n 
1  1865 PRO n 
1  1866 LYS n 
1  1867 TYR n 
1  1868 SER n 
1  1869 PRO n 
1  1870 THR n 
1  1871 SER n 
1  1872 PRO n 
1  1873 LYS n 
1  1874 TYR n 
1  1875 SER n 
1  1876 PRO n 
1  1877 THR n 
1  1878 SER n 
1  1879 PRO n 
1  1880 THR n 
1  1881 TYR n 
1  1882 SER n 
1  1883 PRO n 
1  1884 THR n 
1  1885 THR n 
1  1886 PRO n 
1  1887 LYS n 
1  1888 TYR n 
1  1889 SER n 
1  1890 PRO n 
1  1891 THR n 
1  1892 SER n 
1  1893 PRO n 
1  1894 THR n 
1  1895 TYR n 
1  1896 SER n 
1  1897 PRO n 
1  1898 THR n 
1  1899 SER n 
1  1900 PRO n 
1  1901 VAL n 
1  1902 TYR n 
1  1903 THR n 
1  1904 PRO n 
1  1905 THR n 
1  1906 SER n 
1  1907 PRO n 
1  1908 LYS n 
1  1909 TYR n 
1  1910 SER n 
1  1911 PRO n 
1  1912 THR n 
1  1913 SER n 
1  1914 PRO n 
1  1915 THR n 
1  1916 TYR n 
1  1917 SER n 
1  1918 PRO n 
1  1919 THR n 
1  1920 SER n 
1  1921 PRO n 
1  1922 LYS n 
1  1923 TYR n 
1  1924 SER n 
1  1925 PRO n 
1  1926 THR n 
1  1927 SER n 
1  1928 PRO n 
1  1929 THR n 
1  1930 TYR n 
1  1931 SER n 
1  1932 PRO n 
1  1933 THR n 
1  1934 SER n 
1  1935 PRO n 
1  1936 LYS n 
1  1937 GLY n 
1  1938 SER n 
1  1939 THR n 
1  1940 TYR n 
1  1941 SER n 
1  1942 PRO n 
1  1943 THR n 
1  1944 SER n 
1  1945 PRO n 
1  1946 GLY n 
1  1947 TYR n 
1  1948 SER n 
1  1949 PRO n 
1  1950 THR n 
1  1951 SER n 
1  1952 PRO n 
1  1953 THR n 
1  1954 TYR n 
1  1955 SER n 
1  1956 LEU n 
1  1957 THR n 
1  1958 SER n 
1  1959 PRO n 
1  1960 ALA n 
1  1961 ILE n 
1  1962 SER n 
1  1963 PRO n 
1  1964 ASP n 
1  1965 ASP n 
1  1966 SER n 
1  1967 ASP n 
1  1968 GLU n 
1  1969 GLU n 
1  1970 ASN n 
2  1    MET n 
2  2    TYR n 
2  3    ASP n 
2  4    ALA n 
2  5    ASP n 
2  6    GLU n 
2  7    ASP n 
2  8    MET n 
2  9    GLN n 
2  10   TYR n 
2  11   ASP n 
2  12   GLU n 
2  13   ASP n 
2  14   ASP n 
2  15   ASP n 
2  16   GLU n 
2  17   ILE n 
2  18   THR n 
2  19   PRO n 
2  20   ASP n 
2  21   LEU n 
2  22   TRP n 
2  23   GLN n 
2  24   GLU n 
2  25   ALA n 
2  26   CYS n 
2  27   TRP n 
2  28   ILE n 
2  29   VAL n 
2  30   ILE n 
2  31   SER n 
2  32   SER n 
2  33   TYR n 
2  34   PHE n 
2  35   ASP n 
2  36   GLU n 
2  37   LYS n 
2  38   GLY n 
2  39   LEU n 
2  40   VAL n 
2  41   ARG n 
2  42   GLN n 
2  43   GLN n 
2  44   LEU n 
2  45   ASP n 
2  46   SER n 
2  47   PHE n 
2  48   ASP n 
2  49   GLU n 
2  50   PHE n 
2  51   ILE n 
2  52   GLN n 
2  53   MET n 
2  54   SER n 
2  55   VAL n 
2  56   GLN n 
2  57   ARG n 
2  58   ILE n 
2  59   VAL n 
2  60   GLU n 
2  61   ASP n 
2  62   ALA n 
2  63   PRO n 
2  64   PRO n 
2  65   ILE n 
2  66   ASP n 
2  67   LEU n 
2  68   GLN n 
2  69   ALA n 
2  70   GLU n 
2  71   ALA n 
2  72   GLN n 
2  73   HIS n 
2  74   ALA n 
2  75   SER n 
2  76   GLY n 
2  77   GLU n 
2  78   VAL n 
2  79   GLU n 
2  80   GLU n 
2  81   PRO n 
2  82   PRO n 
2  83   ARG n 
2  84   TYR n 
2  85   LEU n 
2  86   LEU n 
2  87   LYS n 
2  88   PHE n 
2  89   GLU n 
2  90   GLN n 
2  91   ILE n 
2  92   TYR n 
2  93   LEU n 
2  94   SER n 
2  95   LYS n 
2  96   PRO n 
2  97   THR n 
2  98   HIS n 
2  99   TRP n 
2  100  GLU n 
2  101  ARG n 
2  102  ASP n 
2  103  GLY n 
2  104  ALA n 
2  105  PRO n 
2  106  SER n 
2  107  PRO n 
2  108  MET n 
2  109  MET n 
2  110  PRO n 
2  111  ASN n 
2  112  GLU n 
2  113  ALA n 
2  114  ARG n 
2  115  LEU n 
2  116  ARG n 
2  117  ASN n 
2  118  LEU n 
2  119  THR n 
2  120  TYR n 
2  121  SER n 
2  122  ALA n 
2  123  PRO n 
2  124  LEU n 
2  125  TYR n 
2  126  VAL n 
2  127  ASP n 
2  128  ILE n 
2  129  THR n 
2  130  LYS n 
2  131  THR n 
2  132  VAL n 
2  133  ILE n 
2  134  LYS n 
2  135  GLU n 
2  136  GLY n 
2  137  GLU n 
2  138  GLU n 
2  139  GLN n 
2  140  LEU n 
2  141  GLN n 
2  142  THR n 
2  143  GLN n 
2  144  HIS n 
2  145  GLN n 
2  146  LYS n 
2  147  THR n 
2  148  PHE n 
2  149  ILE n 
2  150  GLY n 
2  151  LYS n 
2  152  ILE n 
2  153  PRO n 
2  154  ILE n 
2  155  MET n 
2  156  LEU n 
2  157  ARG n 
2  158  SER n 
2  159  THR n 
2  160  TYR n 
2  161  CYS n 
2  162  LEU n 
2  163  LEU n 
2  164  ASN n 
2  165  GLY n 
2  166  LEU n 
2  167  THR n 
2  168  ASP n 
2  169  ARG n 
2  170  ASP n 
2  171  LEU n 
2  172  CYS n 
2  173  GLU n 
2  174  LEU n 
2  175  ASN n 
2  176  GLU n 
2  177  CYS n 
2  178  PRO n 
2  179  LEU n 
2  180  ASP n 
2  181  PRO n 
2  182  GLY n 
2  183  GLY n 
2  184  TYR n 
2  185  PHE n 
2  186  ILE n 
2  187  ILE n 
2  188  ASN n 
2  189  GLY n 
2  190  SER n 
2  191  GLU n 
2  192  LYS n 
2  193  VAL n 
2  194  LEU n 
2  195  ILE n 
2  196  ALA n 
2  197  GLN n 
2  198  GLU n 
2  199  LYS n 
2  200  MET n 
2  201  ALA n 
2  202  THR n 
2  203  ASN n 
2  204  THR n 
2  205  VAL n 
2  206  TYR n 
2  207  VAL n 
2  208  PHE n 
2  209  ALA n 
2  210  LYS n 
2  211  LYS n 
2  212  ASP n 
2  213  SER n 
2  214  LYS n 
2  215  TYR n 
2  216  ALA n 
2  217  TYR n 
2  218  THR n 
2  219  GLY n 
2  220  GLU n 
2  221  CYS n 
2  222  ARG n 
2  223  SER n 
2  224  CYS n 
2  225  LEU n 
2  226  GLU n 
2  227  ASN n 
2  228  SER n 
2  229  SER n 
2  230  ARG n 
2  231  PRO n 
2  232  THR n 
2  233  SER n 
2  234  THR n 
2  235  ILE n 
2  236  TRP n 
2  237  VAL n 
2  238  SER n 
2  239  MET n 
2  240  LEU n 
2  241  ALA n 
2  242  ARG n 
2  243  GLY n 
2  244  GLY n 
2  245  GLN n 
2  246  GLY n 
2  247  ALA n 
2  248  LYS n 
2  249  LYS n 
2  250  SER n 
2  251  ALA n 
2  252  ILE n 
2  253  GLY n 
2  254  GLN n 
2  255  ARG n 
2  256  ILE n 
2  257  VAL n 
2  258  ALA n 
2  259  THR n 
2  260  LEU n 
2  261  PRO n 
2  262  TYR n 
2  263  ILE n 
2  264  LYS n 
2  265  GLN n 
2  266  GLU n 
2  267  VAL n 
2  268  PRO n 
2  269  ILE n 
2  270  ILE n 
2  271  ILE n 
2  272  VAL n 
2  273  PHE n 
2  274  ARG n 
2  275  ALA n 
2  276  LEU n 
2  277  GLY n 
2  278  PHE n 
2  279  VAL n 
2  280  SER n 
2  281  ASP n 
2  282  ARG n 
2  283  ASP n 
2  284  ILE n 
2  285  LEU n 
2  286  GLU n 
2  287  HIS n 
2  288  ILE n 
2  289  ILE n 
2  290  TYR n 
2  291  ASP n 
2  292  PHE n 
2  293  GLU n 
2  294  ASP n 
2  295  PRO n 
2  296  GLU n 
2  297  MET n 
2  298  MET n 
2  299  GLU n 
2  300  MET n 
2  301  VAL n 
2  302  LYS n 
2  303  PRO n 
2  304  SER n 
2  305  LEU n 
2  306  ASP n 
2  307  GLU n 
2  308  ALA n 
2  309  PHE n 
2  310  VAL n 
2  311  ILE n 
2  312  GLN n 
2  313  GLU n 
2  314  GLN n 
2  315  ASN n 
2  316  VAL n 
2  317  ALA n 
2  318  LEU n 
2  319  ASN n 
2  320  PHE n 
2  321  ILE n 
2  322  GLY n 
2  323  SER n 
2  324  ARG n 
2  325  GLY n 
2  326  ALA n 
2  327  LYS n 
2  328  PRO n 
2  329  GLY n 
2  330  VAL n 
2  331  THR n 
2  332  LYS n 
2  333  GLU n 
2  334  LYS n 
2  335  ARG n 
2  336  ILE n 
2  337  LYS n 
2  338  TYR n 
2  339  ALA n 
2  340  LYS n 
2  341  GLU n 
2  342  VAL n 
2  343  LEU n 
2  344  GLN n 
2  345  LYS n 
2  346  GLU n 
2  347  MET n 
2  348  LEU n 
2  349  PRO n 
2  350  HIS n 
2  351  VAL n 
2  352  GLY n 
2  353  VAL n 
2  354  SER n 
2  355  ASP n 
2  356  PHE n 
2  357  CYS n 
2  358  GLU n 
2  359  THR n 
2  360  LYS n 
2  361  LYS n 
2  362  ALA n 
2  363  TYR n 
2  364  PHE n 
2  365  LEU n 
2  366  GLY n 
2  367  TYR n 
2  368  MET n 
2  369  VAL n 
2  370  HIS n 
2  371  ARG n 
2  372  LEU n 
2  373  LEU n 
2  374  LEU n 
2  375  ALA n 
2  376  ALA n 
2  377  LEU n 
2  378  GLY n 
2  379  ARG n 
2  380  ARG n 
2  381  GLU n 
2  382  LEU n 
2  383  ASP n 
2  384  ASP n 
2  385  ARG n 
2  386  ASP n 
2  387  HIS n 
2  388  TYR n 
2  389  GLY n 
2  390  ASN n 
2  391  LYS n 
2  392  ARG n 
2  393  LEU n 
2  394  ASP n 
2  395  LEU n 
2  396  ALA n 
2  397  GLY n 
2  398  PRO n 
2  399  LEU n 
2  400  LEU n 
2  401  ALA n 
2  402  PHE n 
2  403  LEU n 
2  404  PHE n 
2  405  ARG n 
2  406  GLY n 
2  407  MET n 
2  408  PHE n 
2  409  LYS n 
2  410  ASN n 
2  411  LEU n 
2  412  LEU n 
2  413  LYS n 
2  414  GLU n 
2  415  VAL n 
2  416  ARG n 
2  417  ILE n 
2  418  TYR n 
2  419  ALA n 
2  420  GLN n 
2  421  LYS n 
2  422  PHE n 
2  423  ILE n 
2  424  ASP n 
2  425  ARG n 
2  426  GLY n 
2  427  LYS n 
2  428  ASP n 
2  429  PHE n 
2  430  ASN n 
2  431  LEU n 
2  432  GLU n 
2  433  LEU n 
2  434  ALA n 
2  435  ILE n 
2  436  LYS n 
2  437  THR n 
2  438  ARG n 
2  439  ILE n 
2  440  ILE n 
2  441  SER n 
2  442  ASP n 
2  443  GLY n 
2  444  LEU n 
2  445  LYS n 
2  446  TYR n 
2  447  SER n 
2  448  LEU n 
2  449  ALA n 
2  450  THR n 
2  451  GLY n 
2  452  ASN n 
2  453  TRP n 
2  454  GLY n 
2  455  ASP n 
2  456  GLN n 
2  457  LYS n 
2  458  LYS n 
2  459  ALA n 
2  460  HIS n 
2  461  GLN n 
2  462  ALA n 
2  463  ARG n 
2  464  ALA n 
2  465  GLY n 
2  466  VAL n 
2  467  SER n 
2  468  GLN n 
2  469  VAL n 
2  470  LEU n 
2  471  ASN n 
2  472  ARG n 
2  473  LEU n 
2  474  THR n 
2  475  PHE n 
2  476  ALA n 
2  477  SER n 
2  478  THR n 
2  479  LEU n 
2  480  SER n 
2  481  HIS n 
2  482  LEU n 
2  483  ARG n 
2  484  ARG n 
2  485  LEU n 
2  486  ASN n 
2  487  SER n 
2  488  PRO n 
2  489  ILE n 
2  490  GLY n 
2  491  ARG n 
2  492  ASP n 
2  493  GLY n 
2  494  LYS n 
2  495  LEU n 
2  496  ALA n 
2  497  LYS n 
2  498  PRO n 
2  499  ARG n 
2  500  GLN n 
2  501  LEU n 
2  502  HIS n 
2  503  ASN n 
2  504  THR n 
2  505  LEU n 
2  506  TRP n 
2  507  GLY n 
2  508  MET n 
2  509  VAL n 
2  510  CYS n 
2  511  PRO n 
2  512  ALA n 
2  513  GLU n 
2  514  THR n 
2  515  PRO n 
2  516  GLU n 
2  517  GLY n 
2  518  HIS n 
2  519  ALA n 
2  520  VAL n 
2  521  GLY n 
2  522  LEU n 
2  523  VAL n 
2  524  LYS n 
2  525  ASN n 
2  526  LEU n 
2  527  ALA n 
2  528  LEU n 
2  529  MET n 
2  530  ALA n 
2  531  TYR n 
2  532  ILE n 
2  533  SER n 
2  534  VAL n 
2  535  GLY n 
2  536  SER n 
2  537  GLN n 
2  538  PRO n 
2  539  SER n 
2  540  PRO n 
2  541  ILE n 
2  542  LEU n 
2  543  GLU n 
2  544  PHE n 
2  545  LEU n 
2  546  GLU n 
2  547  GLU n 
2  548  TRP n 
2  549  SER n 
2  550  MET n 
2  551  GLU n 
2  552  ASN n 
2  553  LEU n 
2  554  GLU n 
2  555  GLU n 
2  556  ILE n 
2  557  SER n 
2  558  PRO n 
2  559  ALA n 
2  560  ALA n 
2  561  ILE n 
2  562  ALA n 
2  563  ASP n 
2  564  ALA n 
2  565  THR n 
2  566  LYS n 
2  567  ILE n 
2  568  PHE n 
2  569  VAL n 
2  570  ASN n 
2  571  GLY n 
2  572  CYS n 
2  573  TRP n 
2  574  VAL n 
2  575  GLY n 
2  576  ILE n 
2  577  HIS n 
2  578  LYS n 
2  579  ASP n 
2  580  PRO n 
2  581  GLU n 
2  582  GLN n 
2  583  LEU n 
2  584  MET n 
2  585  ASN n 
2  586  THR n 
2  587  LEU n 
2  588  ARG n 
2  589  LYS n 
2  590  LEU n 
2  591  ARG n 
2  592  ARG n 
2  593  GLN n 
2  594  MET n 
2  595  ASP n 
2  596  ILE n 
2  597  ILE n 
2  598  VAL n 
2  599  SER n 
2  600  GLU n 
2  601  VAL n 
2  602  SER n 
2  603  MET n 
2  604  ILE n 
2  605  ARG n 
2  606  ASP n 
2  607  ILE n 
2  608  ARG n 
2  609  GLU n 
2  610  ARG n 
2  611  GLU n 
2  612  ILE n 
2  613  ARG n 
2  614  ILE n 
2  615  TYR n 
2  616  THR n 
2  617  ASP n 
2  618  ALA n 
2  619  GLY n 
2  620  ARG n 
2  621  ILE n 
2  622  CYS n 
2  623  ARG n 
2  624  PRO n 
2  625  LEU n 
2  626  LEU n 
2  627  ILE n 
2  628  VAL n 
2  629  GLU n 
2  630  LYS n 
2  631  GLN n 
2  632  LYS n 
2  633  LEU n 
2  634  LEU n 
2  635  LEU n 
2  636  LYS n 
2  637  LYS n 
2  638  ARG n 
2  639  HIS n 
2  640  ILE n 
2  641  ASP n 
2  642  GLN n 
2  643  LEU n 
2  644  LYS n 
2  645  GLU n 
2  646  ARG n 
2  647  GLU n 
2  648  TYR n 
2  649  ASN n 
2  650  ASN n 
2  651  TYR n 
2  652  SER n 
2  653  TRP n 
2  654  GLN n 
2  655  ASP n 
2  656  LEU n 
2  657  VAL n 
2  658  ALA n 
2  659  SER n 
2  660  GLY n 
2  661  VAL n 
2  662  VAL n 
2  663  GLU n 
2  664  TYR n 
2  665  ILE n 
2  666  ASP n 
2  667  THR n 
2  668  LEU n 
2  669  GLU n 
2  670  GLU n 
2  671  GLU n 
2  672  THR n 
2  673  VAL n 
2  674  MET n 
2  675  LEU n 
2  676  ALA n 
2  677  MET n 
2  678  THR n 
2  679  PRO n 
2  680  ASP n 
2  681  ASP n 
2  682  LEU n 
2  683  GLN n 
2  684  GLU n 
2  685  LYS n 
2  686  GLU n 
2  687  VAL n 
2  688  ALA n 
2  689  TYR n 
2  690  CYS n 
2  691  SER n 
2  692  THR n 
2  693  TYR n 
2  694  THR n 
2  695  HIS n 
2  696  CYS n 
2  697  GLU n 
2  698  ILE n 
2  699  HIS n 
2  700  PRO n 
2  701  SER n 
2  702  MET n 
2  703  ILE n 
2  704  LEU n 
2  705  GLY n 
2  706  VAL n 
2  707  CYS n 
2  708  ALA n 
2  709  SER n 
2  710  ILE n 
2  711  ILE n 
2  712  PRO n 
2  713  PHE n 
2  714  PRO n 
2  715  ASP n 
2  716  HIS n 
2  717  ASN n 
2  718  GLN n 
2  719  SER n 
2  720  PRO n 
2  721  ARG n 
2  722  ASN n 
2  723  THR n 
2  724  TYR n 
2  725  GLN n 
2  726  SER n 
2  727  ALA n 
2  728  MET n 
2  729  GLY n 
2  730  LYS n 
2  731  GLN n 
2  732  ALA n 
2  733  MET n 
2  734  GLY n 
2  735  VAL n 
2  736  TYR n 
2  737  ILE n 
2  738  THR n 
2  739  ASN n 
2  740  PHE n 
2  741  HIS n 
2  742  VAL n 
2  743  ARG n 
2  744  MET n 
2  745  ASP n 
2  746  THR n 
2  747  LEU n 
2  748  ALA n 
2  749  HIS n 
2  750  VAL n 
2  751  LEU n 
2  752  TYR n 
2  753  TYR n 
2  754  PRO n 
2  755  GLN n 
2  756  LYS n 
2  757  PRO n 
2  758  LEU n 
2  759  VAL n 
2  760  THR n 
2  761  THR n 
2  762  ARG n 
2  763  SER n 
2  764  MET n 
2  765  GLU n 
2  766  TYR n 
2  767  LEU n 
2  768  ARG n 
2  769  PHE n 
2  770  ARG n 
2  771  GLU n 
2  772  LEU n 
2  773  PRO n 
2  774  ALA n 
2  775  GLY n 
2  776  ILE n 
2  777  ASN n 
2  778  SER n 
2  779  ILE n 
2  780  VAL n 
2  781  ALA n 
2  782  ILE n 
2  783  ALA n 
2  784  SER n 
2  785  TYR n 
2  786  THR n 
2  787  GLY n 
2  788  TYR n 
2  789  ASN n 
2  790  GLN n 
2  791  GLU n 
2  792  ASP n 
2  793  SER n 
2  794  VAL n 
2  795  ILE n 
2  796  MET n 
2  797  ASN n 
2  798  ARG n 
2  799  SER n 
2  800  ALA n 
2  801  VAL n 
2  802  ASP n 
2  803  ARG n 
2  804  GLY n 
2  805  PHE n 
2  806  PHE n 
2  807  ARG n 
2  808  SER n 
2  809  VAL n 
2  810  PHE n 
2  811  TYR n 
2  812  ARG n 
2  813  SER n 
2  814  TYR n 
2  815  LYS n 
2  816  GLU n 
2  817  GLN n 
2  818  GLU n 
2  819  SER n 
2  820  LYS n 
2  821  LYS n 
2  822  GLY n 
2  823  PHE n 
2  824  ASP n 
2  825  GLN n 
2  826  GLU n 
2  827  GLU n 
2  828  VAL n 
2  829  PHE n 
2  830  GLU n 
2  831  LYS n 
2  832  PRO n 
2  833  THR n 
2  834  ARG n 
2  835  GLU n 
2  836  THR n 
2  837  CYS n 
2  838  GLN n 
2  839  GLY n 
2  840  MET n 
2  841  ARG n 
2  842  HIS n 
2  843  ALA n 
2  844  ILE n 
2  845  TYR n 
2  846  ASP n 
2  847  LYS n 
2  848  LEU n 
2  849  ASP n 
2  850  ASP n 
2  851  ASP n 
2  852  GLY n 
2  853  LEU n 
2  854  ILE n 
2  855  ALA n 
2  856  PRO n 
2  857  GLY n 
2  858  VAL n 
2  859  ARG n 
2  860  VAL n 
2  861  SER n 
2  862  GLY n 
2  863  ASP n 
2  864  ASP n 
2  865  VAL n 
2  866  ILE n 
2  867  ILE n 
2  868  GLY n 
2  869  LYS n 
2  870  THR n 
2  871  VAL n 
2  872  THR n 
2  873  LEU n 
2  874  PRO n 
2  875  GLU n 
2  876  ASN n 
2  877  GLU n 
2  878  ASP n 
2  879  GLU n 
2  880  LEU n 
2  881  GLU n 
2  882  SER n 
2  883  THR n 
2  884  ASN n 
2  885  ARG n 
2  886  ARG n 
2  887  TYR n 
2  888  THR n 
2  889  LYS n 
2  890  ARG n 
2  891  ASP n 
2  892  CYS n 
2  893  SER n 
2  894  THR n 
2  895  PHE n 
2  896  LEU n 
2  897  ARG n 
2  898  THR n 
2  899  SER n 
2  900  GLU n 
2  901  THR n 
2  902  GLY n 
2  903  ILE n 
2  904  VAL n 
2  905  ASP n 
2  906  GLN n 
2  907  VAL n 
2  908  MET n 
2  909  VAL n 
2  910  THR n 
2  911  LEU n 
2  912  ASN n 
2  913  GLN n 
2  914  GLU n 
2  915  GLY n 
2  916  TYR n 
2  917  LYS n 
2  918  PHE n 
2  919  CYS n 
2  920  LYS n 
2  921  ILE n 
2  922  ARG n 
2  923  VAL n 
2  924  ARG n 
2  925  SER n 
2  926  VAL n 
2  927  ARG n 
2  928  ILE n 
2  929  PRO n 
2  930  GLN n 
2  931  ILE n 
2  932  GLY n 
2  933  ASP n 
2  934  LYS n 
2  935  PHE n 
2  936  ALA n 
2  937  SER n 
2  938  ARG n 
2  939  HIS n 
2  940  GLY n 
2  941  GLN n 
2  942  LYS n 
2  943  GLY n 
2  944  THR n 
2  945  CYS n 
2  946  GLY n 
2  947  ILE n 
2  948  GLN n 
2  949  TYR n 
2  950  ARG n 
2  951  GLN n 
2  952  GLU n 
2  953  ASP n 
2  954  MET n 
2  955  PRO n 
2  956  PHE n 
2  957  THR n 
2  958  CYS n 
2  959  GLU n 
2  960  GLY n 
2  961  ILE n 
2  962  THR n 
2  963  PRO n 
2  964  ASP n 
2  965  ILE n 
2  966  ILE n 
2  967  ILE n 
2  968  ASN n 
2  969  PRO n 
2  970  HIS n 
2  971  ALA n 
2  972  ILE n 
2  973  PRO n 
2  974  SER n 
2  975  ARG n 
2  976  MET n 
2  977  THR n 
2  978  ILE n 
2  979  GLY n 
2  980  HIS n 
2  981  LEU n 
2  982  ILE n 
2  983  GLU n 
2  984  CYS n 
2  985  LEU n 
2  986  GLN n 
2  987  GLY n 
2  988  LYS n 
2  989  VAL n 
2  990  SER n 
2  991  ALA n 
2  992  ASN n 
2  993  LYS n 
2  994  GLY n 
2  995  GLU n 
2  996  ILE n 
2  997  GLY n 
2  998  ASP n 
2  999  ALA n 
2  1000 THR n 
2  1001 PRO n 
2  1002 PHE n 
2  1003 ASN n 
2  1004 ASP n 
2  1005 ALA n 
2  1006 VAL n 
2  1007 ASN n 
2  1008 VAL n 
2  1009 GLN n 
2  1010 LYS n 
2  1011 ILE n 
2  1012 SER n 
2  1013 ASN n 
2  1014 LEU n 
2  1015 LEU n 
2  1016 SER n 
2  1017 ASP n 
2  1018 TYR n 
2  1019 GLY n 
2  1020 TYR n 
2  1021 HIS n 
2  1022 LEU n 
2  1023 ARG n 
2  1024 GLY n 
2  1025 ASN n 
2  1026 GLU n 
2  1027 VAL n 
2  1028 LEU n 
2  1029 TYR n 
2  1030 ASN n 
2  1031 GLY n 
2  1032 PHE n 
2  1033 THR n 
2  1034 GLY n 
2  1035 ARG n 
2  1036 LYS n 
2  1037 ILE n 
2  1038 THR n 
2  1039 SER n 
2  1040 GLN n 
2  1041 ILE n 
2  1042 PHE n 
2  1043 ILE n 
2  1044 GLY n 
2  1045 PRO n 
2  1046 THR n 
2  1047 TYR n 
2  1048 TYR n 
2  1049 GLN n 
2  1050 ARG n 
2  1051 LEU n 
2  1052 LYS n 
2  1053 HIS n 
2  1054 MET n 
2  1055 VAL n 
2  1056 ASP n 
2  1057 ASP n 
2  1058 LYS n 
2  1059 ILE n 
2  1060 HIS n 
2  1061 SER n 
2  1062 ARG n 
2  1063 ALA n 
2  1064 ARG n 
2  1065 GLY n 
2  1066 PRO n 
2  1067 ILE n 
2  1068 GLN n 
2  1069 ILE n 
2  1070 LEU n 
2  1071 ASN n 
2  1072 ARG n 
2  1073 GLN n 
2  1074 PRO n 
2  1075 MET n 
2  1076 GLU n 
2  1077 GLY n 
2  1078 ARG n 
2  1079 SER n 
2  1080 ARG n 
2  1081 ASP n 
2  1082 GLY n 
2  1083 GLY n 
2  1084 LEU n 
2  1085 ARG n 
2  1086 PHE n 
2  1087 GLY n 
2  1088 GLU n 
2  1089 MET n 
2  1090 GLU n 
2  1091 ARG n 
2  1092 ASP n 
2  1093 CYS n 
2  1094 GLN n 
2  1095 ILE n 
2  1096 ALA n 
2  1097 HIS n 
2  1098 GLY n 
2  1099 ALA n 
2  1100 ALA n 
2  1101 GLN n 
2  1102 PHE n 
2  1103 LEU n 
2  1104 ARG n 
2  1105 GLU n 
2  1106 ARG n 
2  1107 LEU n 
2  1108 PHE n 
2  1109 GLU n 
2  1110 ALA n 
2  1111 SER n 
2  1112 ASP n 
2  1113 PRO n 
2  1114 TYR n 
2  1115 GLN n 
2  1116 VAL n 
2  1117 HIS n 
2  1118 VAL n 
2  1119 CYS n 
2  1120 ASN n 
2  1121 LEU n 
2  1122 CYS n 
2  1123 GLY n 
2  1124 ILE n 
2  1125 MET n 
2  1126 ALA n 
2  1127 ILE n 
2  1128 ALA n 
2  1129 ASN n 
2  1130 THR n 
2  1131 ARG n 
2  1132 THR n 
2  1133 HIS n 
2  1134 THR n 
2  1135 TYR n 
2  1136 GLU n 
2  1137 CYS n 
2  1138 ARG n 
2  1139 GLY n 
2  1140 CYS n 
2  1141 ARG n 
2  1142 ASN n 
2  1143 LYS n 
2  1144 THR n 
2  1145 GLN n 
2  1146 ILE n 
2  1147 SER n 
2  1148 LEU n 
2  1149 VAL n 
2  1150 ARG n 
2  1151 MET n 
2  1152 PRO n 
2  1153 TYR n 
2  1154 ALA n 
2  1155 CYS n 
2  1156 LYS n 
2  1157 LEU n 
2  1158 LEU n 
2  1159 PHE n 
2  1160 GLN n 
2  1161 GLU n 
2  1162 LEU n 
2  1163 MET n 
2  1164 SER n 
2  1165 MET n 
2  1166 SER n 
2  1167 ILE n 
2  1168 ALA n 
2  1169 PRO n 
2  1170 ARG n 
2  1171 MET n 
2  1172 MET n 
2  1173 SER n 
2  1174 VAL n 
3  1    MET n 
3  2    PRO n 
3  3    TYR n 
3  4    ALA n 
3  5    ASN n 
3  6    GLN n 
3  7    PRO n 
3  8    THR n 
3  9    VAL n 
3  10   ARG n 
3  11   ILE n 
3  12   THR n 
3  13   GLU n 
3  14   LEU n 
3  15   THR n 
3  16   ASP n 
3  17   GLU n 
3  18   ASN n 
3  19   VAL n 
3  20   LYS n 
3  21   PHE n 
3  22   ILE n 
3  23   ILE n 
3  24   GLU n 
3  25   ASN n 
3  26   THR n 
3  27   ASP n 
3  28   LEU n 
3  29   ALA n 
3  30   VAL n 
3  31   ALA n 
3  32   ASN n 
3  33   SER n 
3  34   ILE n 
3  35   ARG n 
3  36   ARG n 
3  37   VAL n 
3  38   PHE n 
3  39   ILE n 
3  40   ALA n 
3  41   GLU n 
3  42   VAL n 
3  43   PRO n 
3  44   ILE n 
3  45   ILE n 
3  46   ALA n 
3  47   ILE n 
3  48   ASP n 
3  49   TRP n 
3  50   VAL n 
3  51   GLN n 
3  52   ILE n 
3  53   ASP n 
3  54   ALA n 
3  55   ASN n 
3  56   SER n 
3  57   SER n 
3  58   VAL n 
3  59   LEU n 
3  60   HIS n 
3  61   ASP n 
3  62   GLU n 
3  63   PHE n 
3  64   ILE n 
3  65   ALA n 
3  66   HIS n 
3  67   ARG n 
3  68   LEU n 
3  69   GLY n 
3  70   LEU n 
3  71   ILE n 
3  72   PRO n 
3  73   LEU n 
3  74   ILE n 
3  75   SER n 
3  76   ASP n 
3  77   ASP n 
3  78   ILE n 
3  79   VAL n 
3  80   ASP n 
3  81   LYS n 
3  82   LEU n 
3  83   GLN n 
3  84   TYR n 
3  85   SER n 
3  86   ARG n 
3  87   ASP n 
3  88   CYS n 
3  89   THR n 
3  90   CYS n 
3  91   GLU n 
3  92   GLU n 
3  93   PHE n 
3  94   CYS n 
3  95   PRO n 
3  96   GLU n 
3  97   CYS n 
3  98   SER n 
3  99   VAL n 
3  100  GLU n 
3  101  PHE n 
3  102  THR n 
3  103  LEU n 
3  104  ASP n 
3  105  VAL n 
3  106  ARG n 
3  107  CYS n 
3  108  ASN n 
3  109  GLU n 
3  110  ASP n 
3  111  GLN n 
3  112  THR n 
3  113  ARG n 
3  114  HIS n 
3  115  VAL n 
3  116  THR n 
3  117  SER n 
3  118  ARG n 
3  119  ASP n 
3  120  LEU n 
3  121  ILE n 
3  122  SER n 
3  123  ASN n 
3  124  SER n 
3  125  PRO n 
3  126  ARG n 
3  127  VAL n 
3  128  ILE n 
3  129  PRO n 
3  130  VAL n 
3  131  THR n 
3  132  SER n 
3  133  ARG n 
3  134  ASN n 
3  135  ARG n 
3  136  ASP n 
3  137  ASN n 
3  138  ASP n 
3  139  PRO n 
3  140  ASN n 
3  141  ASP n 
3  142  TYR n 
3  143  VAL n 
3  144  GLU n 
3  145  GLN n 
3  146  ASP n 
3  147  ASP n 
3  148  ILE n 
3  149  LEU n 
3  150  ILE n 
3  151  VAL n 
3  152  LYS n 
3  153  LEU n 
3  154  ARG n 
3  155  LYS n 
3  156  GLY n 
3  157  GLN n 
3  158  GLU n 
3  159  LEU n 
3  160  ARG n 
3  161  LEU n 
3  162  ARG n 
3  163  ALA n 
3  164  TYR n 
3  165  ALA n 
3  166  LYS n 
3  167  LYS n 
3  168  GLY n 
3  169  PHE n 
3  170  GLY n 
3  171  LYS n 
3  172  GLU n 
3  173  HIS n 
3  174  ALA n 
3  175  LYS n 
3  176  TRP n 
3  177  ASN n 
3  178  PRO n 
3  179  THR n 
3  180  ALA n 
3  181  GLY n 
3  182  VAL n 
3  183  ALA n 
3  184  PHE n 
3  185  GLU n 
3  186  TYR n 
3  187  ASP n 
3  188  PRO n 
3  189  ASP n 
3  190  ASN n 
3  191  ALA n 
3  192  LEU n 
3  193  ARG n 
3  194  HIS n 
3  195  THR n 
3  196  VAL n 
3  197  TYR n 
3  198  PRO n 
3  199  LYS n 
3  200  PRO n 
3  201  GLU n 
3  202  GLU n 
3  203  TRP n 
3  204  PRO n 
3  205  LYS n 
3  206  SER n 
3  207  GLU n 
3  208  TYR n 
3  209  SER n 
3  210  GLU n 
3  211  LEU n 
3  212  ASP n 
3  213  GLU n 
3  214  ASP n 
3  215  GLU n 
3  216  SER n 
3  217  GLN n 
3  218  ALA n 
3  219  PRO n 
3  220  TYR n 
3  221  ASP n 
3  222  PRO n 
3  223  ASN n 
3  224  GLY n 
3  225  LYS n 
3  226  PRO n 
3  227  GLU n 
3  228  ARG n 
3  229  PHE n 
3  230  TYR n 
3  231  TYR n 
3  232  ASN n 
3  233  VAL n 
3  234  GLU n 
3  235  SER n 
3  236  CYS n 
3  237  GLY n 
3  238  SER n 
3  239  LEU n 
3  240  ARG n 
3  241  PRO n 
3  242  GLU n 
3  243  THR n 
3  244  ILE n 
3  245  VAL n 
3  246  LEU n 
3  247  SER n 
3  248  ALA n 
3  249  LEU n 
3  250  SER n 
3  251  GLY n 
3  252  LEU n 
3  253  LYS n 
3  254  LYS n 
3  255  LYS n 
3  256  LEU n 
3  257  SER n 
3  258  ASP n 
3  259  LEU n 
3  260  GLN n 
3  261  THR n 
3  262  GLN n 
3  263  LEU n 
3  264  SER n 
3  265  HIS n 
3  266  GLU n 
3  267  ILE n 
3  268  GLN n 
3  269  SER n 
3  270  ASP n 
3  271  VAL n 
3  272  LEU n 
3  273  THR n 
3  274  ILE n 
3  275  ASN n 
4  1    MET n 
4  2    ALA n 
4  3    ALA n 
4  4    GLY n 
4  5    GLY n 
4  6    SER n 
4  7    ASP n 
4  8    PRO n 
4  9    ARG n 
4  10   ALA n 
4  11   GLY n 
4  12   ASP n 
4  13   VAL n 
4  14   GLU n 
4  15   GLU n 
4  16   ASP n 
4  17   ALA n 
4  18   SER n 
4  19   GLN n 
4  20   LEU n 
4  21   ILE n 
4  22   PHE n 
4  23   PRO n 
4  24   LYS n 
4  25   GLU n 
4  26   PHE n 
4  27   GLU n 
4  28   THR n 
4  29   ALA n 
4  30   GLU n 
4  31   THR n 
4  32   LEU n 
4  33   LEU n 
4  34   ASN n 
4  35   SER n 
4  36   GLU n 
4  37   VAL n 
4  38   HIS n 
4  39   MET n 
4  40   LEU n 
4  41   LEU n 
4  42   GLU n 
4  43   HIS n 
4  44   ARG n 
4  45   LYS n 
4  46   GLN n 
4  47   GLN n 
4  48   ASN n 
4  49   GLU n 
4  50   SER n 
4  51   ALA n 
4  52   GLU n 
4  53   ASP n 
4  54   GLU n 
4  55   GLN n 
4  56   GLU n 
4  57   LEU n 
4  58   SER n 
4  59   GLU n 
4  60   VAL n 
4  61   PHE n 
4  62   MET n 
4  63   LYS n 
4  64   THR n 
4  65   LEU n 
4  66   ASN n 
4  67   TYR n 
4  68   THR n 
4  69   ALA n 
4  70   ARG n 
4  71   PHE n 
4  72   SER n 
4  73   ARG n 
4  74   PHE n 
4  75   LYS n 
4  76   ASN n 
4  77   ARG n 
4  78   GLU n 
4  79   THR n 
4  80   ILE n 
4  81   ALA n 
4  82   SER n 
4  83   VAL n 
4  84   ARG n 
4  85   SER n 
4  86   LEU n 
4  87   LEU n 
4  88   LEU n 
4  89   GLN n 
4  90   LYS n 
4  91   LYS n 
4  92   LEU n 
4  93   HIS n 
4  94   LYS n 
4  95   PHE n 
4  96   GLU n 
4  97   LEU n 
4  98   ALA n 
4  99   CYS n 
4  100  LEU n 
4  101  ALA n 
4  102  ASN n 
4  103  LEU n 
4  104  CYS n 
4  105  PRO n 
4  106  GLU n 
4  107  THR n 
4  108  ALA n 
4  109  GLU n 
4  110  GLU n 
4  111  SER n 
4  112  LYS n 
4  113  ALA n 
4  114  LEU n 
4  115  ILE n 
4  116  PRO n 
4  117  SER n 
4  118  LEU n 
4  119  GLU n 
4  120  GLY n 
4  121  ARG n 
4  122  PHE n 
4  123  GLU n 
4  124  ASP n 
4  125  GLU n 
4  126  GLU n 
4  127  LEU n 
4  128  GLN n 
4  129  GLN n 
4  130  ILE n 
4  131  LEU n 
4  132  ASP n 
4  133  ASP n 
4  134  ILE n 
4  135  GLN n 
4  136  THR n 
4  137  LYS n 
4  138  ARG n 
4  139  SER n 
4  140  PHE n 
4  141  GLN n 
4  142  TYR n 
5  1    MET n 
5  2    ASP n 
5  3    ASP n 
5  4    GLU n 
5  5    GLU n 
5  6    GLU n 
5  7    THR n 
5  8    TYR n 
5  9    ARG n 
5  10   LEU n 
5  11   TRP n 
5  12   LYS n 
5  13   ILE n 
5  14   ARG n 
5  15   LYS n 
5  16   THR n 
5  17   ILE n 
5  18   MET n 
5  19   GLN n 
5  20   LEU n 
5  21   CYS n 
5  22   HIS n 
5  23   ASP n 
5  24   ARG n 
5  25   GLY n 
5  26   TYR n 
5  27   LEU n 
5  28   VAL n 
5  29   THR n 
5  30   GLN n 
5  31   ASP n 
5  32   GLU n 
5  33   LEU n 
5  34   ASP n 
5  35   GLN n 
5  36   THR n 
5  37   LEU n 
5  38   GLU n 
5  39   GLU n 
5  40   PHE n 
5  41   LYS n 
5  42   ALA n 
5  43   GLN n 
5  44   SER n 
5  45   GLY n 
5  46   ASP n 
5  47   LYS n 
5  48   PRO n 
5  49   SER n 
5  50   GLU n 
5  51   GLY n 
5  52   ARG n 
5  53   PRO n 
5  54   ARG n 
5  55   ARG n 
5  56   THR n 
5  57   ASP n 
5  58   LEU n 
5  59   THR n 
5  60   VAL n 
5  61   LEU n 
5  62   VAL n 
5  63   ALA n 
5  64   HIS n 
5  65   ASN n 
5  66   ASP n 
5  67   ASP n 
5  68   PRO n 
5  69   THR n 
5  70   ASP n 
5  71   GLN n 
5  72   MET n 
5  73   PHE n 
5  74   VAL n 
5  75   PHE n 
5  76   PHE n 
5  77   PRO n 
5  78   GLU n 
5  79   GLU n 
5  80   PRO n 
5  81   LYS n 
5  82   VAL n 
5  83   GLY n 
5  84   ILE n 
5  85   LYS n 
5  86   THR n 
5  87   ILE n 
5  88   LYS n 
5  89   VAL n 
5  90   TYR n 
5  91   CYS n 
5  92   GLN n 
5  93   ARG n 
5  94   MET n 
5  95   GLN n 
5  96   GLU n 
5  97   GLU n 
5  98   ASN n 
5  99   ILE n 
5  100  THR n 
5  101  ARG n 
5  102  ALA n 
5  103  LEU n 
5  104  ILE n 
5  105  VAL n 
5  106  VAL n 
5  107  GLN n 
5  108  GLN n 
5  109  GLY n 
5  110  MET n 
5  111  THR n 
5  112  PRO n 
5  113  SER n 
5  114  ALA n 
5  115  LYS n 
5  116  GLN n 
5  117  SER n 
5  118  LEU n 
5  119  VAL n 
5  120  ASP n 
5  121  MET n 
5  122  ALA n 
5  123  PRO n 
5  124  LYS n 
5  125  TYR n 
5  126  ILE n 
5  127  LEU n 
5  128  GLU n 
5  129  GLN n 
5  130  PHE n 
5  131  LEU n 
5  132  GLN n 
5  133  GLN n 
5  134  GLU n 
5  135  LEU n 
5  136  LEU n 
5  137  ILE n 
5  138  ASN n 
5  139  ILE n 
5  140  THR n 
5  141  GLU n 
5  142  HIS n 
5  143  GLU n 
5  144  LEU n 
5  145  VAL n 
5  146  PRO n 
5  147  GLU n 
5  148  HIS n 
5  149  VAL n 
5  150  VAL n 
5  151  MET n 
5  152  THR n 
5  153  LYS n 
5  154  GLU n 
5  155  GLU n 
5  156  VAL n 
5  157  THR n 
5  158  GLU n 
5  159  LEU n 
5  160  LEU n 
5  161  ALA n 
5  162  ARG n 
5  163  TYR n 
5  164  LYS n 
5  165  LEU n 
5  166  ARG n 
5  167  GLU n 
5  168  ASN n 
5  169  GLN n 
5  170  LEU n 
5  171  PRO n 
5  172  ARG n 
5  173  ILE n 
5  174  GLN n 
5  175  ALA n 
5  176  GLY n 
5  177  ASP n 
5  178  PRO n 
5  179  VAL n 
5  180  ALA n 
5  181  ARG n 
5  182  TYR n 
5  183  PHE n 
5  184  GLY n 
5  185  ILE n 
5  186  LYS n 
5  187  ARG n 
5  188  GLY n 
5  189  GLN n 
5  190  VAL n 
5  191  VAL n 
5  192  LYS n 
5  193  ILE n 
5  194  ILE n 
5  195  ARG n 
5  196  PRO n 
5  197  SER n 
5  198  GLU n 
5  199  THR n 
5  200  ALA n 
5  201  GLY n 
5  202  ARG n 
5  203  TYR n 
5  204  ILE n 
5  205  THR n 
5  206  TYR n 
5  207  ARG n 
5  208  LEU n 
5  209  VAL n 
5  210  GLN n 
6  1    MET n 
6  2    SER n 
6  3    ASP n 
6  4    ASN n 
6  5    GLU n 
6  6    ASP n 
6  7    ASN n 
6  8    PHE n 
6  9    ASP n 
6  10   GLY n 
6  11   ASP n 
6  12   ASP n 
6  13   PHE n 
6  14   ASP n 
6  15   ASP n 
6  16   VAL n 
6  17   GLU n 
6  18   GLU n 
6  19   ASP n 
6  20   GLU n 
6  21   GLY n 
6  22   LEU n 
6  23   ASP n 
6  24   ASP n 
6  25   LEU n 
6  26   GLU n 
6  27   ASN n 
6  28   ALA n 
6  29   GLU n 
6  30   GLU n 
6  31   GLU n 
6  32   GLY n 
6  33   GLN n 
6  34   GLU n 
6  35   ASN n 
6  36   VAL n 
6  37   GLU n 
6  38   ILE n 
6  39   LEU n 
6  40   PRO n 
6  41   SER n 
6  42   GLY n 
6  43   GLU n 
6  44   ARG n 
6  45   PRO n 
6  46   GLN n 
6  47   ALA n 
6  48   ASN n 
6  49   GLN n 
6  50   LYS n 
6  51   ARG n 
6  52   ILE n 
6  53   THR n 
6  54   THR n 
6  55   PRO n 
6  56   TYR n 
6  57   MET n 
6  58   THR n 
6  59   LYS n 
6  60   TYR n 
6  61   GLU n 
6  62   ARG n 
6  63   ALA n 
6  64   ARG n 
6  65   VAL n 
6  66   LEU n 
6  67   GLY n 
6  68   THR n 
6  69   ARG n 
6  70   ALA n 
6  71   LEU n 
6  72   GLN n 
6  73   ILE n 
6  74   ALA n 
6  75   MET n 
6  76   CYS n 
6  77   ALA n 
6  78   PRO n 
6  79   VAL n 
6  80   MET n 
6  81   VAL n 
6  82   GLU n 
6  83   LEU n 
6  84   GLU n 
6  85   GLY n 
6  86   GLU n 
6  87   THR n 
6  88   ASP n 
6  89   PRO n 
6  90   LEU n 
6  91   LEU n 
6  92   ILE n 
6  93   ALA n 
6  94   MET n 
6  95   LYS n 
6  96   GLU n 
6  97   LEU n 
6  98   LYS n 
6  99   ALA n 
6  100  ARG n 
6  101  LYS n 
6  102  ILE n 
6  103  PRO n 
6  104  ILE n 
6  105  ILE n 
6  106  ILE n 
6  107  ARG n 
6  108  ARG n 
6  109  TYR n 
6  110  LEU n 
6  111  PRO n 
6  112  ASP n 
6  113  GLY n 
6  114  SER n 
6  115  TYR n 
6  116  GLU n 
6  117  ASP n 
6  118  TRP n 
6  119  GLY n 
6  120  VAL n 
6  121  ASP n 
6  122  GLU n 
6  123  LEU n 
6  124  ILE n 
6  125  ILE n 
6  126  THR n 
6  127  ASP n 
7  1    MET n 
7  2    PHE n 
7  3    TYR n 
7  4    HIS n 
7  5    ILE n 
7  6    SER n 
7  7    LEU n 
7  8    GLU n 
7  9    HIS n 
7  10   GLU n 
7  11   ILE n 
7  12   LEU n 
7  13   LEU n 
7  14   HIS n 
7  15   PRO n 
7  16   ARG n 
7  17   TYR n 
7  18   PHE n 
7  19   GLY n 
7  20   PRO n 
7  21   ASN n 
7  22   LEU n 
7  23   LEU n 
7  24   ASN n 
7  25   THR n 
7  26   VAL n 
7  27   LYS n 
7  28   GLN n 
7  29   LYS n 
7  30   LEU n 
7  31   PHE n 
7  32   THR n 
7  33   GLU n 
7  34   VAL n 
7  35   GLU n 
7  36   GLY n 
7  37   THR n 
7  38   CYS n 
7  39   THR n 
7  40   GLY n 
7  41   LYS n 
7  42   TYR n 
7  43   GLY n 
7  44   PHE n 
7  45   VAL n 
7  46   ILE n 
7  47   ALA n 
7  48   VAL n 
7  49   THR n 
7  50   THR n 
7  51   ILE n 
7  52   ASP n 
7  53   ASN n 
7  54   ILE n 
7  55   GLY n 
7  56   ALA n 
7  57   GLY n 
7  58   VAL n 
7  59   ILE n 
7  60   GLN n 
7  61   PRO n 
7  62   GLY n 
7  63   ARG n 
7  64   GLY n 
7  65   PHE n 
7  66   VAL n 
7  67   LEU n 
7  68   TYR n 
7  69   PRO n 
7  70   VAL n 
7  71   LYS n 
7  72   TYR n 
7  73   LYS n 
7  74   ALA n 
7  75   ILE n 
7  76   VAL n 
7  77   PHE n 
7  78   ARG n 
7  79   PRO n 
7  80   PHE n 
7  81   LYS n 
7  82   GLY n 
7  83   GLU n 
7  84   VAL n 
7  85   VAL n 
7  86   ASP n 
7  87   ALA n 
7  88   VAL n 
7  89   VAL n 
7  90   THR n 
7  91   GLN n 
7  92   VAL n 
7  93   ASN n 
7  94   LYS n 
7  95   VAL n 
7  96   GLY n 
7  97   LEU n 
7  98   PHE n 
7  99   THR n 
7  100  GLU n 
7  101  ILE n 
7  102  GLY n 
7  103  PRO n 
7  104  MET n 
7  105  SER n 
7  106  CYS n 
7  107  PHE n 
7  108  ILE n 
7  109  SER n 
7  110  ARG n 
7  111  HIS n 
7  112  SER n 
7  113  ILE n 
7  114  PRO n 
7  115  SER n 
7  116  GLU n 
7  117  MET n 
7  118  GLU n 
7  119  PHE n 
7  120  ASP n 
7  121  PRO n 
7  122  ASN n 
7  123  SER n 
7  124  ASN n 
7  125  PRO n 
7  126  PRO n 
7  127  CYS n 
7  128  TYR n 
7  129  LYS n 
7  130  THR n 
7  131  MET n 
7  132  ASP n 
7  133  GLU n 
7  134  ASP n 
7  135  ILE n 
7  136  VAL n 
7  137  ILE n 
7  138  GLN n 
7  139  GLN n 
7  140  ASP n 
7  141  ASP n 
7  142  GLU n 
7  143  ILE n 
7  144  ARG n 
7  145  LEU n 
7  146  LYS n 
7  147  ILE n 
7  148  VAL n 
7  149  GLY n 
7  150  THR n 
7  151  ARG n 
7  152  VAL n 
7  153  ASP n 
7  154  LYS n 
7  155  ASN n 
7  156  ASP n 
7  157  ILE n 
7  158  PHE n 
7  159  ALA n 
7  160  ILE n 
7  161  GLY n 
7  162  SER n 
7  163  LEU n 
7  164  MET n 
7  165  ASP n 
7  166  ASP n 
7  167  TYR n 
7  168  LEU n 
7  169  GLY n 
7  170  LEU n 
7  171  VAL n 
7  172  SER n 
8  1    MET n 
8  2    ALA n 
8  3    GLY n 
8  4    ILE n 
8  5    LEU n 
8  6    PHE n 
8  7    GLU n 
8  8    ASP n 
8  9    ILE n 
8  10   PHE n 
8  11   ASP n 
8  12   VAL n 
8  13   LYS n 
8  14   ASP n 
8  15   ILE n 
8  16   ASP n 
8  17   PRO n 
8  18   GLU n 
8  19   GLY n 
8  20   LYS n 
8  21   LYS n 
8  22   PHE n 
8  23   ASP n 
8  24   ARG n 
8  25   VAL n 
8  26   SER n 
8  27   ARG n 
8  28   LEU n 
8  29   HIS n 
8  30   CYS n 
8  31   GLU n 
8  32   SER n 
8  33   GLU n 
8  34   SER n 
8  35   PHE n 
8  36   LYS n 
8  37   MET n 
8  38   ASP n 
8  39   LEU n 
8  40   ILE n 
8  41   LEU n 
8  42   ASP n 
8  43   VAL n 
8  44   ASN n 
8  45   ILE n 
8  46   GLN n 
8  47   ILE n 
8  48   TYR n 
8  49   PRO n 
8  50   VAL n 
8  51   ASP n 
8  52   LEU n 
8  53   GLY n 
8  54   ASP n 
8  55   LYS n 
8  56   PHE n 
8  57   ARG n 
8  58   LEU n 
8  59   VAL n 
8  60   ILE n 
8  61   ALA n 
8  62   SER n 
8  63   THR n 
8  64   LEU n 
8  65   TYR n 
8  66   GLU n 
8  67   ASP n 
8  68   GLY n 
8  69   THR n 
8  70   LEU n 
8  71   ASP n 
8  72   ASP n 
8  73   GLY n 
8  74   GLU n 
8  75   TYR n 
8  76   ASN n 
8  77   PRO n 
8  78   THR n 
8  79   ASP n 
8  80   ASP n 
8  81   ARG n 
8  82   PRO n 
8  83   SER n 
8  84   ARG n 
8  85   ALA n 
8  86   ASP n 
8  87   GLN n 
8  88   PHE n 
8  89   GLU n 
8  90   TYR n 
8  91   VAL n 
8  92   MET n 
8  93   TYR n 
8  94   GLY n 
8  95   LYS n 
8  96   VAL n 
8  97   TYR n 
8  98   ARG n 
8  99   ILE n 
8  100  GLU n 
8  101  GLY n 
8  102  ASP n 
8  103  GLU n 
8  104  THR n 
8  105  SER n 
8  106  THR n 
8  107  GLU n 
8  108  ALA n 
8  109  ALA n 
8  110  THR n 
8  111  ARG n 
8  112  LEU n 
8  113  SER n 
8  114  ALA n 
8  115  TYR n 
8  116  VAL n 
8  117  SER n 
8  118  TYR n 
8  119  GLY n 
8  120  GLY n 
8  121  LEU n 
8  122  LEU n 
8  123  MET n 
8  124  ARG n 
8  125  LEU n 
8  126  GLN n 
8  127  GLY n 
8  128  ASP n 
8  129  ALA n 
8  130  ASN n 
8  131  ASN n 
8  132  LEU n 
8  133  HIS n 
8  134  GLY n 
8  135  PHE n 
8  136  GLU n 
8  137  VAL n 
8  138  ASP n 
8  139  SER n 
8  140  ARG n 
8  141  VAL n 
8  142  TYR n 
8  143  LEU n 
8  144  LEU n 
8  145  MET n 
8  146  LYS n 
8  147  LYS n 
8  148  LEU n 
8  149  ALA n 
8  150  PHE n 
9  1    MET n 
9  2    GLU n 
9  3    PRO n 
9  4    ASP n 
9  5    GLY n 
9  6    THR n 
9  7    TYR n 
9  8    GLU n 
9  9    PRO n 
9  10   GLY n 
9  11   PHE n 
9  12   VAL n 
9  13   GLY n 
9  14   ILE n 
9  15   ARG n 
9  16   PHE n 
9  17   CYS n 
9  18   GLN n 
9  19   GLU n 
9  20   CYS n 
9  21   ASN n 
9  22   ASN n 
9  23   MET n 
9  24   LEU n 
9  25   TYR n 
9  26   PRO n 
9  27   LYS n 
9  28   GLU n 
9  29   ASP n 
9  30   LYS n 
9  31   GLU n 
9  32   ASN n 
9  33   ARG n 
9  34   ILE n 
9  35   LEU n 
9  36   LEU n 
9  37   TYR n 
9  38   ALA n 
9  39   CYS n 
9  40   ARG n 
9  41   ASN n 
9  42   CYS n 
9  43   ASP n 
9  44   TYR n 
9  45   GLN n 
9  46   GLN n 
9  47   GLU n 
9  48   ALA n 
9  49   ASP n 
9  50   ASN n 
9  51   SER n 
9  52   CYS n 
9  53   ILE n 
9  54   TYR n 
9  55   VAL n 
9  56   ASN n 
9  57   LYS n 
9  58   ILE n 
9  59   THR n 
9  60   HIS n 
9  61   GLU n 
9  62   VAL n 
9  63   ASP n 
9  64   GLU n 
9  65   LEU n 
9  66   THR n 
9  67   GLN n 
9  68   ILE n 
9  69   ILE n 
9  70   ALA n 
9  71   ASP n 
9  72   VAL n 
9  73   SER n 
9  74   GLN n 
9  75   ASP n 
9  76   PRO n 
9  77   THR n 
9  78   LEU n 
9  79   PRO n 
9  80   ARG n 
9  81   THR n 
9  82   GLU n 
9  83   ASP n 
9  84   HIS n 
9  85   PRO n 
9  86   CYS n 
9  87   GLN n 
9  88   LYS n 
9  89   CYS n 
9  90   GLY n 
9  91   HIS n 
9  92   LYS n 
9  93   GLU n 
9  94   ALA n 
9  95   VAL n 
9  96   PHE n 
9  97   PHE n 
9  98   GLN n 
9  99   SER n 
9  100  HIS n 
9  101  SER n 
9  102  ALA n 
9  103  ARG n 
9  104  ALA n 
9  105  GLU n 
9  106  ASP n 
9  107  ALA n 
9  108  MET n 
9  109  ARG n 
9  110  LEU n 
9  111  TYR n 
9  112  TYR n 
9  113  VAL n 
9  114  CYS n 
9  115  THR n 
9  116  ALA n 
9  117  PRO n 
9  118  HIS n 
9  119  CYS n 
9  120  GLY n 
9  121  HIS n 
9  122  ARG n 
9  123  TRP n 
9  124  THR n 
9  125  GLU n 
10 1    MET n 
10 2    ILE n 
10 3    ILE n 
10 4    PRO n 
10 5    VAL n 
10 6    ARG n 
10 7    CYS n 
10 8    PHE n 
10 9    THR n 
10 10   CYS n 
10 11   GLY n 
10 12   LYS n 
10 13   ILE n 
10 14   VAL n 
10 15   GLY n 
10 16   ASN n 
10 17   LYS n 
10 18   TRP n 
10 19   GLU n 
10 20   ALA n 
10 21   TYR n 
10 22   LEU n 
10 23   GLY n 
10 24   LEU n 
10 25   LEU n 
10 26   GLN n 
10 27   ALA n 
10 28   GLU n 
10 29   TYR n 
10 30   THR n 
10 31   GLU n 
10 32   GLY n 
10 33   ASP n 
10 34   ALA n 
10 35   LEU n 
10 36   ASP n 
10 37   ALA n 
10 38   LEU n 
10 39   GLY n 
10 40   LEU n 
10 41   LYS n 
10 42   ARG n 
10 43   TYR n 
10 44   CYS n 
10 45   CYS n 
10 46   ARG n 
10 47   ARG n 
10 48   MET n 
10 49   LEU n 
10 50   LEU n 
10 51   ALA n 
10 52   HIS n 
10 53   VAL n 
10 54   ASP n 
10 55   LEU n 
10 56   ILE n 
10 57   GLU n 
10 58   LYS n 
10 59   LEU n 
10 60   LEU n 
10 61   ASN n 
10 62   TYR n 
10 63   ALA n 
10 64   PRO n 
10 65   LEU n 
10 66   GLU n 
10 67   LYS n 
11 1    MET n 
11 2    ASN n 
11 3    ALA n 
11 4    PRO n 
11 5    PRO n 
11 6    ALA n 
11 7    PHE n 
11 8    GLU n 
11 9    SER n 
11 10   PHE n 
11 11   LEU n 
11 12   LEU n 
11 13   PHE n 
11 14   GLU n 
11 15   GLY n 
11 16   GLU n 
11 17   LYS n 
11 18   LYS n 
11 19   ILE n 
11 20   THR n 
11 21   ILE n 
11 22   ASN n 
11 23   LYS n 
11 24   ASP n 
11 25   THR n 
11 26   LYS n 
11 27   VAL n 
11 28   PRO n 
11 29   ASN n 
11 30   ALA n 
11 31   CYS n 
11 32   LEU n 
11 33   PHE n 
11 34   THR n 
11 35   ILE n 
11 36   ASN n 
11 37   LYS n 
11 38   GLU n 
11 39   ASP n 
11 40   HIS n 
11 41   THR n 
11 42   LEU n 
11 43   GLY n 
11 44   ASN n 
11 45   ILE n 
11 46   ILE n 
11 47   LYS n 
11 48   SER n 
11 49   GLN n 
11 50   LEU n 
11 51   LEU n 
11 52   LYS n 
11 53   ASP n 
11 54   PRO n 
11 55   GLN n 
11 56   VAL n 
11 57   LEU n 
11 58   PHE n 
11 59   ALA n 
11 60   GLY n 
11 61   TYR n 
11 62   LYS n 
11 63   VAL n 
11 64   PRO n 
11 65   HIS n 
11 66   PRO n 
11 67   LEU n 
11 68   GLU n 
11 69   HIS n 
11 70   LYS n 
11 71   ILE n 
11 72   ILE n 
11 73   ILE n 
11 74   ARG n 
11 75   VAL n 
11 76   GLN n 
11 77   THR n 
11 78   THR n 
11 79   PRO n 
11 80   ASP n 
11 81   TYR n 
11 82   SER n 
11 83   PRO n 
11 84   GLN n 
11 85   GLU n 
11 86   ALA n 
11 87   PHE n 
11 88   THR n 
11 89   ASN n 
11 90   ALA n 
11 91   ILE n 
11 92   THR n 
11 93   ASP n 
11 94   LEU n 
11 95   ILE n 
11 96   SER n 
11 97   GLU n 
11 98   LEU n 
11 99   SER n 
11 100  LEU n 
11 101  LEU n 
11 102  GLU n 
11 103  GLU n 
11 104  ARG n 
11 105  PHE n 
11 106  ARG n 
11 107  VAL n 
11 108  ALA n 
11 109  ILE n 
11 110  LYS n 
11 111  ASP n 
11 112  LYS n 
11 113  GLN n 
11 114  GLU n 
11 115  GLY n 
11 116  ILE n 
11 117  GLU n 
12 1    MET n 
12 2    ASP n 
12 3    THR n 
12 4    GLN n 
12 5    LYS n 
12 6    ASP n 
12 7    VAL n 
12 8    GLN n 
12 9    PRO n 
12 10   PRO n 
12 11   LYS n 
12 12   GLN n 
12 13   GLN n 
12 14   PRO n 
12 15   MET n 
12 16   ILE n 
12 17   TYR n 
12 18   ILE n 
12 19   CYS n 
12 20   GLY n 
12 21   GLU n 
12 22   CYS n 
12 23   HIS n 
12 24   THR n 
12 25   GLU n 
12 26   ASN n 
12 27   GLU n 
12 28   ILE n 
12 29   LYS n 
12 30   SER n 
12 31   ARG n 
12 32   ASP n 
12 33   PRO n 
12 34   ILE n 
12 35   ARG n 
12 36   CYS n 
12 37   ARG n 
12 38   GLU n 
12 39   CYS n 
12 40   GLY n 
12 41   TYR n 
12 42   ARG n 
12 43   ILE n 
12 44   MET n 
12 45   TYR n 
12 46   LYS n 
12 47   LYS n 
12 48   ARG n 
12 49   THR n 
12 50   LYS n 
12 51   ARG n 
12 52   LEU n 
12 53   VAL n 
12 54   VAL n 
12 55   PHE n 
12 56   ASP n 
12 57   ALA n 
12 58   ARG n 
13 1    MET n 
13 2    ALA n 
13 3    SER n 
13 4    THR n 
13 5    SER n 
13 6    ARG n 
13 7    LEU n 
13 8    ASP n 
13 9    ALA n 
13 10   LEU n 
13 11   PRO n 
13 12   ARG n 
13 13   VAL n 
13 14   THR n 
13 15   CYS n 
13 16   PRO n 
13 17   ASN n 
13 18   HIS n 
13 19   PRO n 
13 20   ASP n 
13 21   ALA n 
13 22   ILE n 
13 23   LEU n 
13 24   VAL n 
13 25   GLU n 
13 26   ASP n 
13 27   TYR n 
13 28   ARG n 
13 29   ALA n 
13 30   GLY n 
13 31   ASP n 
13 32   MET n 
13 33   ILE n 
13 34   CYS n 
13 35   PRO n 
13 36   GLU n 
13 37   CYS n 
13 38   GLY n 
13 39   LEU n 
13 40   VAL n 
13 41   VAL n 
13 42   GLY n 
13 43   ASP n 
13 44   ARG n 
13 45   VAL n 
13 46   ILE n 
13 47   ASP n 
13 48   VAL n 
13 49   GLY n 
13 50   SER n 
13 51   GLU n 
13 52   TRP n 
13 53   ARG n 
13 54   THR n 
13 55   PHE n 
13 56   SER n 
13 57   ASN n 
13 58   ASP n 
13 59   LYS n 
13 60   ALA n 
13 61   THR n 
13 62   LYS n 
13 63   ASP n 
13 64   PRO n 
13 65   SER n 
13 66   ARG n 
13 67   VAL n 
13 68   GLY n 
13 69   ASP n 
13 70   SER n 
13 71   GLN n 
13 72   ASN n 
13 73   PRO n 
13 74   LEU n 
13 75   LEU n 
13 76   SER n 
13 77   ASP n 
13 78   GLY n 
13 79   ASP n 
13 80   LEU n 
13 81   SER n 
13 82   THR n 
13 83   MET n 
13 84   ILE n 
13 85   GLY n 
13 86   LYS n 
13 87   GLY n 
13 88   THR n 
13 89   GLY n 
13 90   ALA n 
13 91   ALA n 
13 92   SER n 
13 93   PHE n 
13 94   ASP n 
13 95   GLU n 
13 96   PHE n 
13 97   GLY n 
13 98   ASN n 
13 99   SER n 
13 100  LYS n 
13 101  TYR n 
13 102  GLN n 
13 103  ASN n 
13 104  ARG n 
13 105  ARG n 
13 106  THR n 
13 107  MET n 
13 108  SER n 
13 109  SER n 
13 110  SER n 
13 111  ASP n 
13 112  ARG n 
13 113  ALA n 
13 114  MET n 
13 115  MET n 
13 116  ASN n 
13 117  ALA n 
13 118  PHE n 
13 119  LYS n 
13 120  GLU n 
13 121  ILE n 
13 122  THR n 
13 123  THR n 
13 124  MET n 
13 125  ALA n 
13 126  ASP n 
13 127  ARG n 
13 128  ILE n 
13 129  ASN n 
13 130  LEU n 
13 131  PRO n 
13 132  ARG n 
13 133  ASN n 
13 134  ILE n 
13 135  VAL n 
13 136  ASP n 
13 137  ARG n 
13 138  THR n 
13 139  ASN n 
13 140  ASN n 
13 141  LEU n 
13 142  PHE n 
13 143  LYS n 
13 144  GLN n 
13 145  VAL n 
13 146  TYR n 
13 147  GLU n 
13 148  GLN n 
13 149  LYS n 
13 150  SER n 
13 151  LEU n 
13 152  LYS n 
13 153  GLY n 
13 154  ARG n 
13 155  ALA n 
13 156  ASN n 
13 157  ASP n 
13 158  ALA n 
13 159  ILE n 
13 160  ALA n 
13 161  SER n 
13 162  ALA n 
13 163  CYS n 
13 164  LEU n 
13 165  TYR n 
13 166  ILE n 
13 167  ALA n 
13 168  CYS n 
13 169  ARG n 
13 170  GLN n 
13 171  GLU n 
13 172  GLY n 
13 173  VAL n 
13 174  PRO n 
13 175  ARG n 
13 176  THR n 
13 177  PHE n 
13 178  LYS n 
13 179  GLU n 
13 180  ILE n 
13 181  CYS n 
13 182  ALA n 
13 183  VAL n 
13 184  SER n 
13 185  ARG n 
13 186  ILE n 
13 187  SER n 
13 188  LYS n 
13 189  LYS n 
13 190  GLU n 
13 191  ILE n 
13 192  GLY n 
13 193  ARG n 
13 194  CYS n 
13 195  PHE n 
13 196  LYS n 
13 197  LEU n 
13 198  ILE n 
13 199  LEU n 
13 200  LYS n 
13 201  ALA n 
13 202  LEU n 
13 203  GLU n 
13 204  THR n 
13 205  SER n 
13 206  VAL n 
13 207  ASP n 
13 208  LEU n 
13 209  ILE n 
13 210  THR n 
13 211  THR n 
13 212  GLY n 
13 213  ASP n 
13 214  PHE n 
13 215  MET n 
13 216  SER n 
13 217  ARG n 
13 218  PHE n 
13 219  CYS n 
13 220  SER n 
13 221  ASN n 
13 222  LEU n 
13 223  CYS n 
13 224  LEU n 
13 225  PRO n 
13 226  LYS n 
13 227  GLN n 
13 228  VAL n 
13 229  GLN n 
13 230  MET n 
13 231  ALA n 
13 232  ALA n 
13 233  THR n 
13 234  HIS n 
13 235  ILE n 
13 236  ALA n 
13 237  ARG n 
13 238  LYS n 
13 239  ALA n 
13 240  VAL n 
13 241  GLU n 
13 242  LEU n 
13 243  ASP n 
13 244  LEU n 
13 245  VAL n 
13 246  PRO n 
13 247  GLY n 
13 248  ARG n 
13 249  SER n 
13 250  PRO n 
13 251  ILE n 
13 252  SER n 
13 253  VAL n 
13 254  ALA n 
13 255  ALA n 
13 256  ALA n 
13 257  ALA n 
13 258  ILE n 
13 259  TYR n 
13 260  MET n 
13 261  ALA n 
13 262  SER n 
13 263  GLN n 
13 264  ALA n 
13 265  SER n 
13 266  ALA n 
13 267  GLU n 
13 268  LYS n 
13 269  ARG n 
13 270  THR n 
13 271  GLN n 
13 272  LYS n 
13 273  GLU n 
13 274  ILE n 
13 275  GLY n 
13 276  ASP n 
13 277  ILE n 
13 278  ALA n 
13 279  GLY n 
13 280  VAL n 
13 281  ALA n 
13 282  ASP n 
13 283  VAL n 
13 284  THR n 
13 285  ILE n 
13 286  ARG n 
13 287  GLN n 
13 288  SER n 
13 289  TYR n 
13 290  ARG n 
13 291  LEU n 
13 292  ILE n 
13 293  TYR n 
13 294  PRO n 
13 295  ARG n 
13 296  ALA n 
13 297  PRO n 
13 298  ASP n 
13 299  LEU n 
13 300  PHE n 
13 301  PRO n 
13 302  THR n 
13 303  ASP n 
13 304  PHE n 
13 305  LYS n 
13 306  PHE n 
13 307  ASP n 
13 308  THR n 
13 309  PRO n 
13 310  VAL n 
13 311  ASP n 
13 312  LYS n 
13 313  LEU n 
13 314  PRO n 
13 315  GLN n 
13 316  LEU n 
14 1    MET n 
14 2    ALA n 
14 3    ASN n 
14 4    SER n 
14 5    ALA n 
14 6    ASN n 
14 7    THR n 
14 8    ASN n 
14 9    THR n 
14 10   VAL n 
14 11   PRO n 
14 12   LYS n 
14 13   LEU n 
14 14   TYR n 
14 15   ARG n 
14 16   SER n 
14 17   VAL n 
14 18   ILE n 
14 19   GLU n 
14 20   ASP n 
14 21   VAL n 
14 22   ILE n 
14 23   ASN n 
14 24   ASP n 
14 25   VAL n 
14 26   ARG n 
14 27   ASP n 
14 28   ILE n 
14 29   PHE n 
14 30   LEU n 
14 31   ASP n 
14 32   ASP n 
14 33   GLY n 
14 34   VAL n 
14 35   ASP n 
14 36   GLU n 
14 37   GLN n 
14 38   VAL n 
14 39   LEU n 
14 40   MET n 
14 41   GLU n 
14 42   LEU n 
14 43   LYS n 
14 44   THR n 
14 45   LEU n 
14 46   TRP n 
14 47   GLU n 
14 48   ASN n 
14 49   LYS n 
14 50   LEU n 
14 51   MET n 
14 52   GLN n 
14 53   SER n 
14 54   ARG n 
14 55   ALA n 
14 56   VAL n 
14 57   ASP n 
14 58   GLY n 
14 59   PHE n 
14 60   HIS n 
14 61   SER n 
14 62   GLU n 
14 63   GLU n 
14 64   GLN n 
14 65   GLN n 
14 66   LEU n 
14 67   LEU n 
14 68   LEU n 
14 69   GLN n 
14 70   VAL n 
14 71   GLN n 
14 72   GLN n 
14 73   GLN n 
14 74   HIS n 
14 75   GLN n 
14 76   PRO n 
14 77   GLN n 
14 78   GLN n 
14 79   GLN n 
14 80   GLN n 
14 81   HIS n 
14 82   HIS n 
14 83   HIS n 
14 84   HIS n 
14 85   HIS n 
14 86   HIS n 
14 87   HIS n 
14 88   GLN n 
14 89   GLN n 
14 90   ALA n 
14 91   GLN n 
14 92   PRO n 
14 93   GLN n 
14 94   GLN n 
14 95   THR n 
14 96   VAL n 
14 97   PRO n 
14 98   GLN n 
14 99   GLN n 
14 100  ALA n 
14 101  GLN n 
14 102  THR n 
14 103  GLN n 
14 104  GLN n 
14 105  VAL n 
14 106  LEU n 
14 107  ILE n 
14 108  PRO n 
14 109  ALA n 
14 110  SER n 
14 111  GLN n 
14 112  GLN n 
14 113  ALA n 
14 114  THR n 
14 115  ALA n 
14 116  PRO n 
14 117  GLN n 
14 118  VAL n 
14 119  ILE n 
14 120  VAL n 
14 121  PRO n 
14 122  ASP n 
14 123  SER n 
14 124  LYS n 
14 125  LEU n 
14 126  ILE n 
14 127  GLN n 
14 128  HIS n 
14 129  MET n 
14 130  ASN n 
14 131  ALA n 
14 132  SER n 
14 133  ASN n 
14 134  MET n 
14 135  SER n 
14 136  ALA n 
14 137  ALA n 
14 138  ALA n 
14 139  THR n 
14 140  ALA n 
14 141  ALA n 
14 142  THR n 
14 143  LEU n 
14 144  ALA n 
14 145  LEU n 
14 146  PRO n 
14 147  ALA n 
14 148  GLY n 
14 149  VAL n 
14 150  THR n 
14 151  PRO n 
14 152  VAL n 
14 153  GLN n 
14 154  GLN n 
14 155  ILE n 
14 156  LEU n 
14 157  THR n 
14 158  ASN n 
14 159  SER n 
14 160  GLY n 
14 161  GLN n 
14 162  LEU n 
14 163  LEU n 
14 164  GLN n 
14 165  VAL n 
14 166  VAL n 
14 167  ARG n 
14 168  ALA n 
14 169  ALA n 
14 170  ASN n 
14 171  GLY n 
14 172  ALA n 
14 173  GLN n 
14 174  TYR n 
14 175  ILE n 
14 176  PHE n 
14 177  GLN n 
14 178  PRO n 
14 179  GLN n 
14 180  GLN n 
14 181  SER n 
14 182  VAL n 
14 183  VAL n 
14 184  LEU n 
14 185  GLN n 
14 186  GLN n 
14 187  GLN n 
14 188  VAL n 
14 189  ILE n 
14 190  PRO n 
14 191  GLN n 
14 192  MET n 
14 193  GLN n 
14 194  PRO n 
14 195  GLY n 
14 196  GLY n 
14 197  VAL n 
14 198  GLN n 
14 199  ALA n 
14 200  PRO n 
14 201  VAL n 
14 202  ILE n 
14 203  GLN n 
14 204  GLN n 
14 205  VAL n 
14 206  LEU n 
14 207  ALA n 
14 208  PRO n 
14 209  LEU n 
14 210  PRO n 
14 211  GLY n 
14 212  GLY n 
14 213  ILE n 
14 214  SER n 
14 215  PRO n 
14 216  GLN n 
14 217  THR n 
14 218  GLY n 
14 219  VAL n 
14 220  ILE n 
14 221  ILE n 
14 222  GLN n 
14 223  PRO n 
14 224  GLN n 
14 225  GLN n 
14 226  ILE n 
14 227  LEU n 
14 228  PHE n 
14 229  THR n 
14 230  GLY n 
14 231  ASN n 
14 232  LYS n 
14 233  THR n 
14 234  GLN n 
14 235  VAL n 
14 236  ILE n 
14 237  PRO n 
14 238  THR n 
14 239  THR n 
14 240  VAL n 
14 241  ALA n 
14 242  ALA n 
14 243  PRO n 
14 244  THR n 
14 245  PRO n 
14 246  ALA n 
14 247  GLN n 
14 248  ALA n 
14 249  GLN n 
14 250  ILE n 
14 251  THR n 
14 252  ALA n 
14 253  THR n 
14 254  GLY n 
14 255  GLN n 
14 256  GLN n 
14 257  GLN n 
14 258  PRO n 
14 259  GLN n 
14 260  ALA n 
14 261  GLN n 
14 262  PRO n 
14 263  ALA n 
14 264  GLN n 
14 265  THR n 
14 266  GLN n 
14 267  ALA n 
14 268  PRO n 
14 269  LEU n 
14 270  VAL n 
14 271  LEU n 
14 272  GLN n 
14 273  VAL n 
14 274  ASP n 
14 275  GLY n 
14 276  THR n 
14 277  GLY n 
14 278  ASP n 
14 279  THR n 
14 280  SER n 
14 281  SER n 
14 282  GLU n 
14 283  GLU n 
14 284  ASP n 
14 285  GLU n 
14 286  ASP n 
14 287  GLU n 
14 288  GLU n 
14 289  GLU n 
14 290  ASP n 
14 291  TYR n 
14 292  ASP n 
14 293  ASP n 
14 294  ASP n 
14 295  GLU n 
14 296  GLU n 
14 297  GLU n 
14 298  ASP n 
14 299  LYS n 
14 300  GLU n 
14 301  LYS n 
14 302  ASP n 
14 303  GLY n 
14 304  ALA n 
14 305  GLU n 
14 306  ASP n 
14 307  GLY n 
14 308  GLN n 
14 309  VAL n 
14 310  GLU n 
14 311  GLU n 
14 312  GLU n 
14 313  PRO n 
14 314  LEU n 
14 315  ASN n 
14 316  SER n 
14 317  GLU n 
14 318  ASP n 
14 319  ASP n 
14 320  VAL n 
14 321  SER n 
14 322  ASP n 
14 323  GLU n 
14 324  GLU n 
14 325  GLY n 
14 326  GLN n 
14 327  GLU n 
14 328  LEU n 
14 329  PHE n 
14 330  ASP n 
14 331  THR n 
14 332  GLU n 
14 333  ASN n 
14 334  VAL n 
14 335  VAL n 
14 336  VAL n 
14 337  CYS n 
14 338  GLN n 
14 339  TYR n 
14 340  ASP n 
14 341  LYS n 
14 342  ILE n 
14 343  HIS n 
14 344  ARG n 
14 345  SER n 
14 346  LYS n 
14 347  ASN n 
14 348  LYS n 
14 349  TRP n 
14 350  LYS n 
14 351  PHE n 
14 352  HIS n 
14 353  LEU n 
14 354  LYS n 
14 355  ASP n 
14 356  GLY n 
14 357  ILE n 
14 358  MET n 
14 359  ASN n 
14 360  LEU n 
14 361  ASN n 
14 362  GLY n 
14 363  ARG n 
14 364  ASP n 
14 365  TYR n 
14 366  ILE n 
14 367  PHE n 
14 368  SER n 
14 369  LYS n 
14 370  ALA n 
14 371  ILE n 
14 372  GLY n 
14 373  ASP n 
14 374  ALA n 
14 375  GLU n 
14 376  TRP n 
15 1    MET n 
15 2    ALA n 
15 3    TYR n 
15 4    GLN n 
15 5    LEU n 
15 6    TYR n 
15 7    ARG n 
15 8    ASN n 
15 9    THR n 
15 10   THR n 
15 11   LEU n 
15 12   GLY n 
15 13   ASN n 
15 14   SER n 
15 15   LEU n 
15 16   GLN n 
15 17   GLU n 
15 18   SER n 
15 19   LEU n 
15 20   ASP n 
15 21   GLU n 
15 22   LEU n 
15 23   ILE n 
15 24   GLN n 
15 25   SER n 
15 26   GLN n 
15 27   GLN n 
15 28   ILE n 
15 29   THR n 
15 30   PRO n 
15 31   GLN n 
15 32   LEU n 
15 33   ALA n 
15 34   LEU n 
15 35   GLN n 
15 36   VAL n 
15 37   LEU n 
15 38   LEU n 
15 39   GLN n 
15 40   PHE n 
15 41   ASP n 
15 42   LYS n 
15 43   ALA n 
15 44   ILE n 
15 45   ASN n 
15 46   ALA n 
15 47   ALA n 
15 48   LEU n 
15 49   ALA n 
15 50   GLN n 
15 51   ARG n 
15 52   VAL n 
15 53   ARG n 
15 54   ASN n 
15 55   ARG n 
15 56   VAL n 
15 57   ASN n 
15 58   PHE n 
15 59   ARG n 
15 60   GLY n 
15 61   SER n 
15 62   LEU n 
15 63   ASN n 
15 64   THR n 
15 65   TYR n 
15 66   ARG n 
15 67   PHE n 
15 68   CYS n 
15 69   ASP n 
15 70   ASN n 
15 71   VAL n 
15 72   TRP n 
15 73   THR n 
15 74   PHE n 
15 75   VAL n 
15 76   LEU n 
15 77   ASN n 
15 78   ASP n 
15 79   VAL n 
15 80   GLU n 
15 81   PHE n 
15 82   ARG n 
15 83   GLU n 
15 84   VAL n 
15 85   THR n 
15 86   GLU n 
15 87   LEU n 
15 88   ILE n 
15 89   LYS n 
15 90   VAL n 
15 91   ASP n 
15 92   LYS n 
15 93   VAL n 
15 94   LYS n 
15 95   ILE n 
15 96   VAL n 
15 97   ALA n 
15 98   CYS n 
15 99   ASP n 
15 100  GLY n 
15 101  LYS n 
15 102  ASN n 
15 103  THR n 
15 104  GLY n 
15 105  SER n 
15 106  ASN n 
15 107  THR n 
15 108  THR n 
15 109  GLU n 
16 1    MET n 
16 2    ASP n 
16 3    GLN n 
16 4    ASN n 
16 5    ASN n 
16 6    SER n 
16 7    LEU n 
16 8    PRO n 
16 9    PRO n 
16 10   TYR n 
16 11   ALA n 
16 12   GLN n 
16 13   GLY n 
16 14   LEU n 
16 15   ALA n 
16 16   SER n 
16 17   PRO n 
16 18   GLN n 
16 19   GLY n 
16 20   ALA n 
16 21   MET n 
16 22   THR n 
16 23   PRO n 
16 24   GLY n 
16 25   ILE n 
16 26   PRO n 
16 27   ILE n 
16 28   PHE n 
16 29   SER n 
16 30   PRO n 
16 31   MET n 
16 32   MET n 
16 33   PRO n 
16 34   TYR n 
16 35   GLY n 
16 36   THR n 
16 37   GLY n 
16 38   LEU n 
16 39   THR n 
16 40   PRO n 
16 41   GLN n 
16 42   PRO n 
16 43   ILE n 
16 44   GLN n 
16 45   ASN n 
16 46   THR n 
16 47   ASN n 
16 48   SER n 
16 49   LEU n 
16 50   SER n 
16 51   ILE n 
16 52   LEU n 
16 53   GLU n 
16 54   GLU n 
16 55   GLN n 
16 56   GLN n 
16 57   ARG n 
16 58   GLN n 
16 59   GLN n 
16 60   GLN n 
16 61   GLN n 
16 62   GLN n 
16 63   GLN n 
16 64   GLN n 
16 65   GLN n 
16 66   GLN n 
16 67   GLN n 
16 68   GLN n 
16 69   GLN n 
16 70   GLN n 
16 71   GLN n 
16 72   GLN n 
16 73   GLN n 
16 74   GLN n 
16 75   GLN n 
16 76   GLN n 
16 77   GLN n 
16 78   GLN n 
16 79   GLN n 
16 80   GLN n 
16 81   GLN n 
16 82   GLN n 
16 83   GLN n 
16 84   GLN n 
16 85   GLN n 
16 86   GLN n 
16 87   GLN n 
16 88   GLN n 
16 89   GLN n 
16 90   GLN n 
16 91   GLN n 
16 92   GLN n 
16 93   GLN n 
16 94   GLN n 
16 95   GLN n 
16 96   ALA n 
16 97   VAL n 
16 98   ALA n 
16 99   ALA n 
16 100  ALA n 
16 101  ALA n 
16 102  VAL n 
16 103  GLN n 
16 104  GLN n 
16 105  SER n 
16 106  THR n 
16 107  SER n 
16 108  GLN n 
16 109  GLN n 
16 110  ALA n 
16 111  THR n 
16 112  GLN n 
16 113  GLY n 
16 114  THR n 
16 115  SER n 
16 116  GLY n 
16 117  GLN n 
16 118  ALA n 
16 119  PRO n 
16 120  GLN n 
16 121  LEU n 
16 122  PHE n 
16 123  HIS n 
16 124  SER n 
16 125  GLN n 
16 126  THR n 
16 127  LEU n 
16 128  THR n 
16 129  THR n 
16 130  ALA n 
16 131  PRO n 
16 132  LEU n 
16 133  PRO n 
16 134  GLY n 
16 135  THR n 
16 136  THR n 
16 137  PRO n 
16 138  LEU n 
16 139  TYR n 
16 140  PRO n 
16 141  SER n 
16 142  PRO n 
16 143  MET n 
16 144  THR n 
16 145  PRO n 
16 146  MET n 
16 147  THR n 
16 148  PRO n 
16 149  ILE n 
16 150  THR n 
16 151  PRO n 
16 152  ALA n 
16 153  THR n 
16 154  PRO n 
16 155  ALA n 
16 156  SER n 
16 157  GLU n 
16 158  SER n 
16 159  SER n 
16 160  GLY n 
16 161  ILE n 
16 162  VAL n 
16 163  PRO n 
16 164  GLN n 
16 165  LEU n 
16 166  GLN n 
16 167  ASN n 
16 168  ILE n 
16 169  VAL n 
16 170  SER n 
16 171  THR n 
16 172  VAL n 
16 173  ASN n 
16 174  LEU n 
16 175  GLY n 
16 176  CYS n 
16 177  LYS n 
16 178  LEU n 
16 179  ASP n 
16 180  LEU n 
16 181  LYS n 
16 182  THR n 
16 183  ILE n 
16 184  ALA n 
16 185  LEU n 
16 186  ARG n 
16 187  ALA n 
16 188  ARG n 
16 189  ASN n 
16 190  ALA n 
16 191  GLU n 
16 192  TYR n 
16 193  ASN n 
16 194  PRO n 
16 195  LYS n 
16 196  ARG n 
16 197  PHE n 
16 198  ALA n 
16 199  ALA n 
16 200  VAL n 
16 201  ILE n 
16 202  MET n 
16 203  ARG n 
16 204  ILE n 
16 205  ARG n 
16 206  GLU n 
16 207  PRO n 
16 208  ARG n 
16 209  THR n 
16 210  THR n 
16 211  ALA n 
16 212  LEU n 
16 213  ILE n 
16 214  PHE n 
16 215  SER n 
16 216  SER n 
16 217  GLY n 
16 218  LYS n 
16 219  MET n 
16 220  VAL n 
16 221  CYS n 
16 222  THR n 
16 223  GLY n 
16 224  ALA n 
16 225  LYS n 
16 226  SER n 
16 227  GLU n 
16 228  GLU n 
16 229  GLN n 
16 230  SER n 
16 231  ARG n 
16 232  LEU n 
16 233  ALA n 
16 234  ALA n 
16 235  ARG n 
16 236  LYS n 
16 237  TYR n 
16 238  ALA n 
16 239  ARG n 
16 240  VAL n 
16 241  VAL n 
16 242  GLN n 
16 243  LYS n 
16 244  LEU n 
16 245  GLY n 
16 246  PHE n 
16 247  PRO n 
16 248  ALA n 
16 249  LYS n 
16 250  PHE n 
16 251  LEU n 
16 252  ASP n 
16 253  PHE n 
16 254  LYS n 
16 255  ILE n 
16 256  GLN n 
16 257  ASN n 
16 258  MET n 
16 259  VAL n 
16 260  GLY n 
16 261  SER n 
16 262  CYS n 
16 263  ASP n 
16 264  VAL n 
16 265  LYS n 
16 266  PHE n 
16 267  PRO n 
16 268  ILE n 
16 269  ARG n 
16 270  LEU n 
16 271  GLU n 
16 272  GLY n 
16 273  LEU n 
16 274  VAL n 
16 275  LEU n 
16 276  THR n 
16 277  HIS n 
16 278  GLN n 
16 279  GLN n 
16 280  PHE n 
16 281  SER n 
16 282  SER n 
16 283  TYR n 
16 284  GLU n 
16 285  PRO n 
16 286  GLU n 
16 287  LEU n 
16 288  PHE n 
16 289  PRO n 
16 290  GLY n 
16 291  LEU n 
16 292  ILE n 
16 293  TYR n 
16 294  ARG n 
16 295  MET n 
16 296  ILE n 
16 297  LYS n 
16 298  PRO n 
16 299  ARG n 
16 300  ILE n 
16 301  VAL n 
16 302  LEU n 
16 303  LEU n 
16 304  ILE n 
16 305  PHE n 
16 306  VAL n 
16 307  SER n 
16 308  GLY n 
16 309  LYS n 
16 310  VAL n 
16 311  VAL n 
16 312  LEU n 
16 313  THR n 
16 314  GLY n 
16 315  ALA n 
16 316  LYS n 
16 317  VAL n 
16 318  ARG n 
16 319  ALA n 
16 320  GLU n 
16 321  ILE n 
16 322  TYR n 
16 323  GLU n 
16 324  ALA n 
16 325  PHE n 
16 326  GLU n 
16 327  ASN n 
16 328  ILE n 
16 329  TYR n 
16 330  PRO n 
16 331  ILE n 
16 332  LEU n 
16 333  LYS n 
16 334  GLY n 
16 335  PHE n 
16 336  ARG n 
16 337  LYS n 
16 338  THR n 
16 339  THR n 
17 1    MET n 
17 2    ALA n 
17 3    ASP n 
17 4    PRO n 
17 5    ASP n 
17 6    VAL n 
17 7    LEU n 
17 8    THR n 
17 9    GLU n 
17 10   VAL n 
17 11   PRO n 
17 12   ALA n 
17 13   ALA n 
17 14   LEU n 
17 15   LYS n 
17 16   ARG n 
17 17   LEU n 
17 18   ALA n 
17 19   LYS n 
17 20   TYR n 
17 21   VAL n 
17 22   ILE n 
17 23   ARG n 
17 24   GLY n 
17 25   PHE n 
17 26   TYR n 
17 27   GLY n 
17 28   ILE n 
17 29   GLU n 
17 30   HIS n 
17 31   ALA n 
17 32   LEU n 
17 33   ALA n 
17 34   LEU n 
17 35   ASP n 
17 36   ILE n 
17 37   LEU n 
17 38   ILE n 
17 39   ARG n 
17 40   ASN n 
17 41   SER n 
17 42   CYS n 
17 43   VAL n 
17 44   LYS n 
17 45   GLU n 
17 46   GLU n 
17 47   ASP n 
17 48   MET n 
17 49   LEU n 
17 50   GLU n 
17 51   LEU n 
17 52   LEU n 
17 53   LYS n 
17 54   PHE n 
17 55   ASP n 
17 56   ARG n 
17 57   LYS n 
17 58   GLN n 
17 59   LEU n 
17 60   ARG n 
17 61   SER n 
17 62   VAL n 
17 63   LEU n 
17 64   ASN n 
17 65   ASN n 
17 66   LEU n 
17 67   LYS n 
17 68   GLY n 
17 69   ASP n 
17 70   LYS n 
17 71   PHE n 
17 72   ILE n 
17 73   LYS n 
17 74   CYS n 
17 75   ARG n 
17 76   MET n 
17 77   ARG n 
17 78   VAL n 
17 79   GLU n 
17 80   THR n 
17 81   ALA n 
17 82   ALA n 
17 83   ASP n 
17 84   GLY n 
17 85   LYS n 
17 86   THR n 
17 87   THR n 
17 88   ARG n 
17 89   HIS n 
17 90   ASN n 
17 91   TYR n 
17 92   TYR n 
17 93   PHE n 
17 94   ILE n 
17 95   ASN n 
17 96   TYR n 
17 97   ARG n 
17 98   THR n 
17 99   LEU n 
17 100  VAL n 
17 101  ASN n 
17 102  VAL n 
17 103  VAL n 
17 104  LYS n 
17 105  TYR n 
17 106  LYS n 
17 107  LEU n 
17 108  ASP n 
17 109  HIS n 
17 110  MET n 
17 111  ARG n 
17 112  ARG n 
17 113  ARG n 
17 114  ILE n 
17 115  GLU n 
17 116  THR n 
17 117  ASP n 
17 118  GLU n 
17 119  ARG n 
17 120  ASP n 
17 121  SER n 
17 122  THR n 
17 123  ASN n 
17 124  ARG n 
17 125  ALA n 
17 126  SER n 
17 127  PHE n 
17 128  LYS n 
17 129  CYS n 
17 130  PRO n 
17 131  VAL n 
17 132  CYS n 
17 133  SER n 
17 134  SER n 
17 135  THR n 
17 136  PHE n 
17 137  THR n 
17 138  ASP n 
17 139  LEU n 
17 140  GLU n 
17 141  ALA n 
17 142  ASN n 
17 143  GLN n 
17 144  LEU n 
17 145  PHE n 
17 146  ASP n 
17 147  PRO n 
17 148  MET n 
17 149  THR n 
17 150  GLY n 
17 151  THR n 
17 152  PHE n 
17 153  ARG n 
17 154  CYS n 
17 155  THR n 
17 156  PHE n 
17 157  CYS n 
17 158  HIS n 
17 159  THR n 
17 160  GLU n 
17 161  VAL n 
17 162  GLU n 
17 163  GLU n 
17 164  ASP n 
17 165  GLU n 
17 166  SER n 
17 167  ALA n 
17 168  MET n 
17 169  PRO n 
17 170  LYS n 
17 171  LYS n 
17 172  ASP n 
17 173  ALA n 
17 174  ARG n 
17 175  THR n 
17 176  LEU n 
17 177  LEU n 
17 178  ALA n 
17 179  ARG n 
17 180  PHE n 
17 181  ASN n 
17 182  GLU n 
17 183  GLN n 
17 184  ILE n 
17 185  GLU n 
17 186  PRO n 
17 187  ILE n 
17 188  TYR n 
17 189  ALA n 
17 190  LEU n 
17 191  LEU n 
17 192  ARG n 
17 193  GLU n 
17 194  THR n 
17 195  GLU n 
17 196  ASP n 
17 197  VAL n 
17 198  ASN n 
17 199  LEU n 
17 200  ALA n 
17 201  TYR n 
17 202  GLU n 
17 203  ILE n 
17 204  LEU n 
17 205  GLU n 
17 206  PRO n 
17 207  GLU n 
17 208  PRO n 
17 209  THR n 
17 210  GLU n 
17 211  ILE n 
17 212  PRO n 
17 213  ALA n 
17 214  LEU n 
17 215  LYS n 
17 216  GLN n 
17 217  SER n 
17 218  LYS n 
17 219  ASP n 
17 220  HIS n 
17 221  ALA n 
17 222  ALA n 
17 223  THR n 
17 224  THR n 
17 225  ALA n 
17 226  GLY n 
17 227  ALA n 
17 228  ALA n 
17 229  SER n 
17 230  LEU n 
17 231  ALA n 
17 232  GLY n 
17 233  GLY n 
17 234  HIS n 
17 235  HIS n 
17 236  ARG n 
17 237  GLU n 
17 238  ALA n 
17 239  TRP n 
17 240  ALA n 
17 241  THR n 
17 242  LYS n 
17 243  GLY n 
17 244  PRO n 
17 245  SER n 
17 246  TYR n 
17 247  GLU n 
17 248  ASP n 
17 249  LEU n 
17 250  TYR n 
17 251  THR n 
17 252  GLN n 
17 253  ASN n 
17 254  VAL n 
17 255  VAL n 
17 256  ILE n 
17 257  ASN n 
17 258  MET n 
17 259  ASP n 
17 260  ASP n 
17 261  GLN n 
17 262  GLU n 
17 263  ASP n 
17 264  LEU n 
17 265  HIS n 
17 266  ARG n 
17 267  ALA n 
17 268  SER n 
17 269  LEU n 
17 270  GLU n 
17 271  GLY n 
17 272  LYS n 
17 273  SER n 
17 274  ALA n 
17 275  LYS n 
17 276  GLU n 
17 277  ARG n 
17 278  PRO n 
17 279  ILE n 
17 280  TRP n 
17 281  LEU n 
17 282  ARG n 
17 283  GLU n 
17 284  SER n 
17 285  THR n 
17 286  VAL n 
17 287  GLN n 
17 288  GLY n 
17 289  ALA n 
17 290  TYR n 
17 291  GLY n 
17 292  SER n 
17 293  GLU n 
17 294  ASP n 
17 295  MET n 
17 296  LYS n 
17 297  GLU n 
17 298  GLY n 
17 299  GLY n 
17 300  ILE n 
17 301  ASP n 
17 302  MET n 
17 303  ASP n 
17 304  ALA n 
17 305  PHE n 
17 306  GLN n 
17 307  GLU n 
17 308  ARG n 
17 309  GLU n 
17 310  GLU n 
17 311  GLY n 
17 312  HIS n 
17 313  ALA n 
17 314  GLY n 
17 315  PRO n 
17 316  ASP n 
17 317  ASP n 
17 318  ASN n 
17 319  GLU n 
17 320  GLU n 
17 321  VAL n 
17 322  MET n 
17 323  ARG n 
17 324  ALA n 
17 325  LEU n 
17 326  LEU n 
17 327  ILE n 
17 328  HIS n 
17 329  GLU n 
17 330  LYS n 
17 331  LYS n 
17 332  THR n 
17 333  SER n 
17 334  SER n 
17 335  ALA n 
17 336  MET n 
17 337  ALA n 
17 338  GLY n 
17 339  SER n 
17 340  VAL n 
17 341  GLY n 
17 342  ALA n 
17 343  ALA n 
17 344  ALA n 
17 345  PRO n 
17 346  VAL n 
17 347  THR n 
17 348  ALA n 
17 349  ALA n 
17 350  ASN n 
17 351  GLY n 
17 352  SER n 
17 353  ASP n 
17 354  SER n 
17 355  GLU n 
17 356  SER n 
17 357  GLU n 
17 358  THR n 
17 359  SER n 
17 360  GLU n 
17 361  SER n 
17 362  ASP n 
17 363  ASP n 
17 364  ASP n 
17 365  SER n 
17 366  PRO n 
17 367  PRO n 
17 368  ARG n 
17 369  PRO n 
17 370  ALA n 
17 371  ALA n 
17 372  VAL n 
17 373  ALA n 
17 374  VAL n 
17 375  HIS n 
17 376  LYS n 
17 377  ARG n 
17 378  GLU n 
17 379  GLU n 
17 380  ASP n 
17 381  GLU n 
17 382  GLU n 
17 383  GLU n 
17 384  ASP n 
17 385  ASP n 
17 386  GLU n 
17 387  PHE n 
17 388  GLU n 
17 389  GLU n 
17 390  VAL n 
17 391  ALA n 
17 392  ASP n 
17 393  ASP n 
17 394  PRO n 
17 395  ILE n 
17 396  VAL n 
17 397  MET n 
17 398  VAL n 
17 399  ALA n 
17 400  GLY n 
17 401  ARG n 
17 402  PRO n 
17 403  PHE n 
17 404  SER n 
17 405  TYR n 
17 406  SER n 
17 407  GLU n 
17 408  VAL n 
17 409  SER n 
17 410  GLN n 
17 411  ARG n 
17 412  PRO n 
17 413  GLU n 
17 414  LEU n 
17 415  VAL n 
17 416  ALA n 
17 417  GLN n 
17 418  MET n 
17 419  THR n 
17 420  PRO n 
17 421  GLU n 
17 422  GLU n 
17 423  LYS n 
17 424  GLU n 
17 425  ALA n 
17 426  TYR n 
17 427  ILE n 
17 428  ALA n 
17 429  MET n 
17 430  GLY n 
17 431  GLN n 
17 432  ARG n 
17 433  MET n 
17 434  PHE n 
17 435  GLU n 
17 436  ASP n 
17 437  LEU n 
17 438  PHE n 
17 439  GLU n 
18 1    MET n 
18 2    ASP n 
18 3    PRO n 
18 4    SER n 
18 5    LEU n 
18 6    LEU n 
18 7    ARG n 
18 8    GLU n 
18 9    ARG n 
18 10   GLU n 
18 11   LEU n 
18 12   PHE n 
18 13   LYS n 
18 14   LYS n 
18 15   ARG n 
18 16   ALA n 
18 17   LEU n 
18 18   SER n 
18 19   THR n 
18 20   PRO n 
18 21   VAL n 
18 22   VAL n 
18 23   GLU n 
18 24   LYS n 
18 25   ARG n 
18 26   SER n 
18 27   ALA n 
18 28   SER n 
18 29   SER n 
18 30   GLU n 
18 31   SER n 
18 32   SER n 
18 33   SER n 
18 34   SER n 
18 35   SER n 
18 36   SER n 
18 37   LYS n 
18 38   LYS n 
18 39   LYS n 
18 40   LYS n 
18 41   THR n 
18 42   LYS n 
18 43   VAL n 
18 44   GLU n 
18 45   HIS n 
18 46   GLY n 
18 47   GLY n 
18 48   SER n 
18 49   SER n 
18 50   GLY n 
18 51   SER n 
18 52   LYS n 
18 53   GLN n 
18 54   ASN n 
18 55   SER n 
18 56   ASP n 
18 57   HIS n 
18 58   SER n 
18 59   ASN n 
18 60   GLY n 
18 61   SER n 
18 62   PHE n 
18 63   ASN n 
18 64   LEU n 
18 65   LYS n 
18 66   ALA n 
18 67   LEU n 
18 68   SER n 
18 69   GLY n 
18 70   SER n 
18 71   SER n 
18 72   GLY n 
18 73   TYR n 
18 74   LYS n 
18 75   PHE n 
18 76   GLY n 
18 77   VAL n 
18 78   LEU n 
18 79   ALA n 
18 80   LYS n 
18 81   ILE n 
18 82   VAL n 
18 83   ASN n 
18 84   TYR n 
18 85   MET n 
18 86   LYS n 
18 87   THR n 
18 88   ARG n 
18 89   HIS n 
18 90   GLN n 
18 91   ARG n 
18 92   GLY n 
18 93   ASP n 
18 94   THR n 
18 95   HIS n 
18 96   PRO n 
18 97   LEU n 
18 98   THR n 
18 99   LEU n 
18 100  ASP n 
18 101  GLU n 
18 102  ILE n 
18 103  LEU n 
18 104  ASP n 
18 105  GLU n 
18 106  THR n 
18 107  GLN n 
18 108  HIS n 
18 109  LEU n 
18 110  ASP n 
18 111  ILE n 
18 112  GLY n 
18 113  LEU n 
18 114  LYS n 
18 115  GLN n 
18 116  LYS n 
18 117  GLN n 
18 118  TRP n 
18 119  LEU n 
18 120  MET n 
18 121  THR n 
18 122  GLU n 
18 123  ALA n 
18 124  LEU n 
18 125  VAL n 
18 126  ASN n 
18 127  ASN n 
18 128  PRO n 
18 129  LYS n 
18 130  ILE n 
18 131  GLU n 
18 132  VAL n 
18 133  ILE n 
18 134  ASP n 
18 135  GLY n 
18 136  LYS n 
18 137  TYR n 
18 138  ALA n 
18 139  PHE n 
18 140  LYS n 
18 141  PRO n 
18 142  LYS n 
18 143  TYR n 
18 144  ASN n 
18 145  VAL n 
18 146  ARG n 
18 147  ASP n 
18 148  LYS n 
18 149  LYS n 
18 150  ALA n 
18 151  LEU n 
18 152  LEU n 
18 153  ARG n 
18 154  LEU n 
18 155  LEU n 
18 156  ASP n 
18 157  GLN n 
18 158  HIS n 
18 159  ASP n 
18 160  GLN n 
18 161  ARG n 
18 162  GLY n 
18 163  LEU n 
18 164  GLY n 
18 165  GLY n 
18 166  ILE n 
18 167  LEU n 
18 168  LEU n 
18 169  GLU n 
18 170  ASP n 
18 171  ILE n 
18 172  GLU n 
18 173  GLU n 
18 174  ALA n 
18 175  LEU n 
18 176  PRO n 
18 177  ASN n 
18 178  SER n 
18 179  GLN n 
18 180  LYS n 
18 181  ALA n 
18 182  VAL n 
18 183  LYS n 
18 184  ALA n 
18 185  LEU n 
18 186  GLY n 
18 187  ASP n 
18 188  GLN n 
18 189  ILE n 
18 190  LEU n 
18 191  PHE n 
18 192  VAL n 
18 193  ASN n 
18 194  ARG n 
18 195  PRO n 
18 196  ASP n 
18 197  LYS n 
18 198  LYS n 
18 199  LYS n 
18 200  ILE n 
18 201  LEU n 
18 202  PHE n 
18 203  PHE n 
18 204  ASN n 
18 205  ASP n 
18 206  LYS n 
18 207  SER n 
18 208  CYS n 
18 209  GLN n 
18 210  PHE n 
18 211  SER n 
18 212  VAL n 
18 213  ASP n 
18 214  GLU n 
18 215  GLU n 
18 216  PHE n 
18 217  GLN n 
18 218  LYS n 
18 219  LEU n 
18 220  TRP n 
18 221  ARG n 
18 222  SER n 
18 223  VAL n 
18 224  THR n 
18 225  VAL n 
18 226  ASP n 
18 227  SER n 
18 228  MET n 
18 229  ASP n 
18 230  GLU n 
18 231  GLU n 
18 232  LYS n 
18 233  ILE n 
18 234  GLU n 
18 235  GLU n 
18 236  TYR n 
18 237  LEU n 
18 238  LYS n 
18 239  ARG n 
18 240  GLN n 
18 241  GLY n 
18 242  ILE n 
18 243  SER n 
18 244  SER n 
18 245  MET n 
18 246  GLN n 
18 247  GLU n 
18 248  SER n 
18 249  GLY n 
18 250  PRO n 
18 251  LYS n 
18 252  LYS n 
18 253  VAL n 
18 254  ALA n 
18 255  PRO n 
18 256  ILE n 
18 257  GLN n 
18 258  ARG n 
18 259  ARG n 
18 260  LYS n 
18 261  LYS n 
18 262  PRO n 
18 263  ALA n 
18 264  SER n 
18 265  GLN n 
18 266  LYS n 
18 267  LYS n 
18 268  ARG n 
18 269  ARG n 
18 270  PHE n 
18 271  LYS n 
18 272  THR n 
18 273  HIS n 
18 274  ASN n 
18 275  GLU n 
18 276  HIS n 
18 277  LEU n 
18 278  ALA n 
18 279  GLY n 
18 280  VAL n 
18 281  LEU n 
18 282  LYS n 
18 283  ASP n 
18 284  TYR n 
18 285  SER n 
18 286  ASP n 
18 287  ILE n 
18 288  THR n 
18 289  SER n 
18 290  SER n 
18 291  LYS n 
19 1    MET n 
19 2    ALA n 
19 3    ALA n 
19 4    LEU n 
19 5    GLY n 
19 6    PRO n 
19 7    SER n 
19 8    SER n 
19 9    GLN n 
19 10   ASN n 
19 11   VAL n 
19 12   THR n 
19 13   GLU n 
19 14   TYR n 
19 15   VAL n 
19 16   VAL n 
19 17   ARG n 
19 18   VAL n 
19 19   PRO n 
19 20   LYS n 
19 21   ASN n 
19 22   THR n 
19 23   THR n 
19 24   LYS n 
19 25   LYS n 
19 26   TYR n 
19 27   ASN n 
19 28   ILE n 
19 29   MET n 
19 30   ALA n 
19 31   PHE n 
19 32   ASN n 
19 33   ALA n 
19 34   ALA n 
19 35   ASP n 
19 36   LYS n 
19 37   VAL n 
19 38   ASN n 
19 39   PHE n 
19 40   ALA n 
19 41   THR n 
19 42   TRP n 
19 43   ASN n 
19 44   GLN n 
19 45   ALA n 
19 46   ARG n 
19 47   LEU n 
19 48   GLU n 
19 49   ARG n 
19 50   ASP n 
19 51   LEU n 
19 52   SER n 
19 53   ASN n 
19 54   LYS n 
19 55   LYS n 
19 56   ILE n 
19 57   TYR n 
19 58   GLN n 
19 59   GLU n 
19 60   GLU n 
19 61   GLU n 
19 62   MET n 
19 63   PRO n 
19 64   GLU n 
19 65   SER n 
19 66   GLY n 
19 67   ALA n 
19 68   GLY n 
19 69   SER n 
19 70   GLU n 
19 71   PHE n 
19 72   ASN n 
19 73   ARG n 
19 74   LYS n 
19 75   LEU n 
19 76   ARG n 
19 77   GLU n 
19 78   GLU n 
19 79   ALA n 
19 80   ARG n 
19 81   ARG n 
19 82   LYS n 
19 83   LYS n 
19 84   TYR n 
19 85   GLY n 
19 86   ILE n 
19 87   VAL n 
19 88   LEU n 
19 89   LYS n 
19 90   GLU n 
19 91   PHE n 
19 92   ARG n 
19 93   PRO n 
19 94   GLU n 
19 95   ASP n 
19 96   GLN n 
19 97   PRO n 
19 98   TRP n 
19 99   LEU n 
19 100  LEU n 
19 101  ARG n 
19 102  VAL n 
19 103  ASN n 
19 104  GLY n 
19 105  LYS n 
19 106  SER n 
19 107  GLY n 
19 108  ARG n 
19 109  LYS n 
19 110  PHE n 
19 111  LYS n 
19 112  GLY n 
19 113  ILE n 
19 114  LYS n 
19 115  LYS n 
19 116  GLY n 
19 117  GLY n 
19 118  VAL n 
19 119  THR n 
19 120  GLU n 
19 121  ASN n 
19 122  THR n 
19 123  SER n 
19 124  TYR n 
19 125  TYR n 
19 126  ILE n 
19 127  PHE n 
19 128  THR n 
19 129  GLN n 
19 130  CYS n 
19 131  PRO n 
19 132  ASP n 
19 133  GLY n 
19 134  ALA n 
19 135  PHE n 
19 136  GLU n 
19 137  ALA n 
19 138  PHE n 
19 139  PRO n 
19 140  VAL n 
19 141  HIS n 
19 142  ASN n 
19 143  TRP n 
19 144  TYR n 
19 145  ASN n 
19 146  PHE n 
19 147  THR n 
19 148  PRO n 
19 149  LEU n 
19 150  ALA n 
19 151  ARG n 
19 152  HIS n 
19 153  ARG n 
19 154  THR n 
19 155  LEU n 
19 156  THR n 
19 157  ALA n 
19 158  GLU n 
19 159  GLU n 
19 160  ALA n 
19 161  GLU n 
19 162  GLU n 
19 163  GLU n 
19 164  TRP n 
19 165  GLU n 
19 166  ARG n 
19 167  ARG n 
19 168  ASN n 
19 169  LYS n 
19 170  VAL n 
19 171  LEU n 
19 172  ASN n 
19 173  HIS n 
19 174  PHE n 
19 175  SER n 
19 176  ILE n 
19 177  MET n 
19 178  GLN n 
19 179  GLN n 
19 180  ARG n 
19 181  ARG n 
19 182  LEU n 
19 183  LYS n 
19 184  ASP n 
19 185  GLN n 
19 186  ASP n 
19 187  GLN n 
19 188  ASP n 
19 189  GLU n 
19 190  ASP n 
19 191  GLU n 
19 192  GLU n 
19 193  GLU n 
19 194  LYS n 
19 195  GLU n 
19 196  LYS n 
19 197  ARG n 
19 198  GLY n 
19 199  ARG n 
19 200  ARG n 
19 201  LYS n 
19 202  ALA n 
19 203  SER n 
19 204  GLU n 
19 205  LEU n 
19 206  ARG n 
19 207  ILE n 
19 208  HIS n 
19 209  ASP n 
19 210  LEU n 
19 211  GLU n 
19 212  ASP n 
19 213  ASP n 
19 214  LEU n 
19 215  GLU n 
19 216  MET n 
19 217  SER n 
19 218  SER n 
19 219  ASP n 
19 220  ALA n 
19 221  SER n 
19 222  ASP n 
19 223  ALA n 
19 224  SER n 
19 225  GLY n 
19 226  GLU n 
19 227  GLU n 
19 228  GLY n 
19 229  GLY n 
19 230  ARG n 
19 231  VAL n 
19 232  PRO n 
19 233  LYS n 
19 234  ALA n 
19 235  LYS n 
19 236  LYS n 
19 237  LYS n 
19 238  ALA n 
19 239  PRO n 
19 240  LEU n 
19 241  ALA n 
19 242  LYS n 
19 243  GLY n 
19 244  GLY n 
19 245  ARG n 
19 246  LYS n 
19 247  LYS n 
19 248  LYS n 
19 249  LYS n 
19 250  LYS n 
19 251  LYS n 
19 252  GLY n 
19 253  SER n 
19 254  ASP n 
19 255  ASP n 
19 256  GLU n 
19 257  ALA n 
19 258  PHE n 
19 259  GLU n 
19 260  ASP n 
19 261  SER n 
19 262  ASP n 
19 263  ASP n 
19 264  GLY n 
19 265  ASP n 
19 266  PHE n 
19 267  GLU n 
19 268  GLY n 
19 269  GLN n 
19 270  GLU n 
19 271  VAL n 
19 272  ASP n 
19 273  TYR n 
19 274  MET n 
19 275  SER n 
19 276  ASP n 
19 277  GLY n 
19 278  SER n 
19 279  SER n 
19 280  SER n 
19 281  SER n 
19 282  GLN n 
19 283  GLU n 
19 284  GLU n 
19 285  PRO n 
19 286  GLU n 
19 287  SER n 
19 288  LYS n 
19 289  ALA n 
19 290  LYS n 
19 291  ALA n 
19 292  PRO n 
19 293  GLN n 
19 294  GLN n 
19 295  GLU n 
19 296  GLU n 
19 297  GLY n 
19 298  PRO n 
19 299  LYS n 
19 300  GLY n 
19 301  VAL n 
19 302  ASP n 
19 303  GLU n 
19 304  GLN n 
19 305  SER n 
19 306  ASP n 
19 307  SER n 
19 308  SER n 
19 309  GLU n 
19 310  GLU n 
19 311  SER n 
19 312  GLU n 
19 313  GLU n 
19 314  GLU n 
19 315  LYS n 
19 316  PRO n 
19 317  PRO n 
19 318  GLU n 
19 319  GLU n 
19 320  ASP n 
19 321  LYS n 
19 322  GLU n 
19 323  GLU n 
19 324  GLU n 
19 325  GLU n 
19 326  GLU n 
19 327  LYS n 
19 328  LYS n 
19 329  ALA n 
19 330  PRO n 
19 331  THR n 
19 332  PRO n 
19 333  GLN n 
19 334  GLU n 
19 335  LYS n 
19 336  LYS n 
19 337  ARG n 
19 338  ARG n 
19 339  LYS n 
19 340  ASP n 
19 341  SER n 
19 342  SER n 
19 343  GLU n 
19 344  GLU n 
19 345  SER n 
19 346  ASP n 
19 347  SER n 
19 348  SER n 
19 349  GLU n 
19 350  GLU n 
19 351  SER n 
19 352  ASP n 
19 353  ILE n 
19 354  ASP n 
19 355  SER n 
19 356  GLU n 
19 357  ALA n 
19 358  SER n 
19 359  SER n 
19 360  ALA n 
19 361  LEU n 
19 362  PHE n 
19 363  MET n 
19 364  ALA n 
19 365  LYS n 
19 366  LYS n 
19 367  LYS n 
19 368  THR n 
19 369  PRO n 
19 370  PRO n 
19 371  LYS n 
19 372  ARG n 
19 373  GLU n 
19 374  ARG n 
19 375  LYS n 
19 376  PRO n 
19 377  SER n 
19 378  GLY n 
19 379  GLY n 
19 380  SER n 
19 381  SER n 
19 382  ARG n 
19 383  GLY n 
19 384  ASN n 
19 385  SER n 
19 386  ARG n 
19 387  PRO n 
19 388  GLY n 
19 389  THR n 
19 390  PRO n 
19 391  SER n 
19 392  ALA n 
19 393  GLU n 
19 394  GLY n 
19 395  GLY n 
19 396  SER n 
19 397  THR n 
19 398  SER n 
19 399  SER n 
19 400  THR n 
19 401  LEU n 
19 402  ARG n 
19 403  ALA n 
19 404  ALA n 
19 405  ALA n 
19 406  SER n 
19 407  LYS n 
19 408  LEU n 
19 409  GLU n 
19 410  GLN n 
19 411  GLY n 
19 412  LYS n 
19 413  ARG n 
19 414  VAL n 
19 415  SER n 
19 416  GLU n 
19 417  MET n 
19 418  PRO n 
19 419  ALA n 
19 420  ALA n 
19 421  LYS n 
19 422  ARG n 
19 423  LEU n 
19 424  ARG n 
19 425  LEU n 
19 426  ASP n 
19 427  THR n 
19 428  GLY n 
19 429  PRO n 
19 430  GLN n 
19 431  SER n 
19 432  LEU n 
19 433  SER n 
19 434  GLY n 
19 435  LYS n 
19 436  SER n 
19 437  THR n 
19 438  PRO n 
19 439  GLN n 
19 440  PRO n 
19 441  PRO n 
19 442  SER n 
19 443  GLY n 
19 444  LYS n 
19 445  THR n 
19 446  THR n 
19 447  PRO n 
19 448  ASN n 
19 449  SER n 
19 450  GLY n 
19 451  ASP n 
19 452  VAL n 
19 453  GLN n 
19 454  VAL n 
19 455  THR n 
19 456  GLU n 
19 457  ASP n 
19 458  ALA n 
19 459  VAL n 
19 460  ARG n 
19 461  ARG n 
19 462  TYR n 
19 463  LEU n 
19 464  THR n 
19 465  ARG n 
19 466  LYS n 
19 467  PRO n 
19 468  MET n 
19 469  THR n 
19 470  THR n 
19 471  LYS n 
19 472  ASP n 
19 473  LEU n 
19 474  LEU n 
19 475  LYS n 
19 476  LYS n 
19 477  PHE n 
19 478  GLN n 
19 479  THR n 
19 480  LYS n 
19 481  LYS n 
19 482  THR n 
19 483  GLY n 
19 484  LEU n 
19 485  SER n 
19 486  SER n 
19 487  GLU n 
19 488  GLN n 
19 489  THR n 
19 490  VAL n 
19 491  ASN n 
19 492  VAL n 
19 493  LEU n 
19 494  ALA n 
19 495  GLN n 
19 496  ILE n 
19 497  LEU n 
19 498  LYS n 
19 499  ARG n 
19 500  LEU n 
19 501  ASN n 
19 502  PRO n 
19 503  GLU n 
19 504  ARG n 
19 505  LYS n 
19 506  MET n 
19 507  ILE n 
19 508  ASN n 
19 509  ASP n 
19 510  LYS n 
19 511  MET n 
19 512  HIS n 
19 513  PHE n 
19 514  SER n 
19 515  LEU n 
19 516  LYS n 
19 517  GLU n 
20 1    MET n 
20 2    ALA n 
20 3    GLU n 
20 4    ARG n 
20 5    GLY n 
20 6    GLU n 
20 7    LEU n 
20 8    ASP n 
20 9    LEU n 
20 10   THR n 
20 11   GLY n 
20 12   ALA n 
20 13   LYS n 
20 14   GLN n 
20 15   ASN n 
20 16   THR n 
20 17   GLY n 
20 18   VAL n 
20 19   TRP n 
20 20   LEU n 
20 21   VAL n 
20 22   LYS n 
20 23   VAL n 
20 24   PRO n 
20 25   LYS n 
20 26   TYR n 
20 27   LEU n 
20 28   SER n 
20 29   GLN n 
20 30   GLN n 
20 31   TRP n 
20 32   ALA n 
20 33   LYS n 
20 34   ALA n 
20 35   SER n 
20 36   GLY n 
20 37   ARG n 
20 38   GLY n 
20 39   GLU n 
20 40   VAL n 
20 41   GLY n 
20 42   LYS n 
20 43   LEU n 
20 44   ARG n 
20 45   ILE n 
20 46   ALA n 
20 47   LYS n 
20 48   THR n 
20 49   GLN n 
20 50   GLY n 
20 51   ARG n 
20 52   THR n 
20 53   GLU n 
20 54   VAL n 
20 55   SER n 
20 56   PHE n 
20 57   THR n 
20 58   LEU n 
20 59   ASN n 
20 60   GLU n 
20 61   ASP n 
20 62   LEU n 
20 63   ALA n 
20 64   ASN n 
20 65   ILE n 
20 66   HIS n 
20 67   ASP n 
20 68   ILE n 
20 69   GLY n 
20 70   GLY n 
20 71   LYS n 
20 72   PRO n 
20 73   ALA n 
20 74   SER n 
20 75   VAL n 
20 76   SER n 
20 77   ALA n 
20 78   PRO n 
20 79   ARG n 
20 80   GLU n 
20 81   HIS n 
20 82   PRO n 
20 83   PHE n 
20 84   VAL n 
20 85   LEU n 
20 86   GLN n 
20 87   SER n 
20 88   VAL n 
20 89   GLY n 
20 90   GLY n 
20 91   GLN n 
20 92   THR n 
20 93   LEU n 
20 94   THR n 
20 95   VAL n 
20 96   PHE n 
20 97   THR n 
20 98   GLU n 
20 99   SER n 
20 100  SER n 
20 101  SER n 
20 102  ASP n 
20 103  LYS n 
20 104  LEU n 
20 105  SER n 
20 106  LEU n 
20 107  GLU n 
20 108  GLY n 
20 109  ILE n 
20 110  VAL n 
20 111  VAL n 
20 112  GLN n 
20 113  ARG n 
20 114  ALA n 
20 115  GLU n 
20 116  CYS n 
20 117  ARG n 
20 118  PRO n 
20 119  ALA n 
20 120  ALA n 
20 121  SER n 
20 122  GLU n 
20 123  ASN n 
20 124  TYR n 
20 125  MET n 
20 126  ARG n 
20 127  LEU n 
20 128  LYS n 
20 129  ARG n 
20 130  LEU n 
20 131  GLN n 
20 132  ILE n 
20 133  GLU n 
20 134  GLU n 
20 135  SER n 
20 136  SER n 
20 137  LYS n 
20 138  PRO n 
20 139  VAL n 
20 140  ARG n 
20 141  LEU n 
20 142  SER n 
20 143  GLN n 
20 144  GLN n 
20 145  LEU n 
20 146  ASP n 
20 147  LYS n 
20 148  VAL n 
20 149  VAL n 
20 150  THR n 
20 151  THR n 
20 152  ASN n 
20 153  TYR n 
20 154  LYS n 
20 155  PRO n 
20 156  VAL n 
20 157  ALA n 
20 158  ASN n 
20 159  HIS n 
20 160  GLN n 
20 161  TYR n 
20 162  ASN n 
20 163  ILE n 
20 164  GLU n 
20 165  TYR n 
20 166  GLU n 
20 167  ARG n 
20 168  LYS n 
20 169  LYS n 
20 170  LYS n 
20 171  GLU n 
20 172  ASP n 
20 173  GLY n 
20 174  LYS n 
20 175  ARG n 
20 176  ALA n 
20 177  ARG n 
20 178  ALA n 
20 179  ASP n 
20 180  LYS n 
20 181  GLN n 
20 182  HIS n 
20 183  VAL n 
20 184  LEU n 
20 185  ASP n 
20 186  MET n 
20 187  LEU n 
20 188  PHE n 
20 189  SER n 
20 190  ALA n 
20 191  PHE n 
20 192  GLU n 
20 193  LYS n 
20 194  HIS n 
20 195  GLN n 
20 196  TYR n 
20 197  TYR n 
20 198  ASN n 
20 199  LEU n 
20 200  LYS n 
20 201  ASP n 
20 202  LEU n 
20 203  VAL n 
20 204  ASP n 
20 205  ILE n 
20 206  THR n 
20 207  LYS n 
20 208  GLN n 
20 209  PRO n 
20 210  VAL n 
20 211  VAL n 
20 212  TYR n 
20 213  LEU n 
20 214  LYS n 
20 215  GLU n 
20 216  ILE n 
20 217  LEU n 
20 218  LYS n 
20 219  GLU n 
20 220  ILE n 
20 221  GLY n 
20 222  VAL n 
20 223  GLN n 
20 224  ASN n 
20 225  VAL n 
20 226  LYS n 
20 227  GLY n 
20 228  ILE n 
20 229  HIS n 
20 230  LYS n 
20 231  ASN n 
20 232  THR n 
20 233  TRP n 
20 234  GLU n 
20 235  LEU n 
20 236  LYS n 
20 237  PRO n 
20 238  GLU n 
20 239  TYR n 
20 240  ARG n 
20 241  HIS n 
20 242  TYR n 
20 243  GLN n 
20 244  GLY n 
20 245  GLU n 
20 246  GLU n 
20 247  LYS n 
20 248  SER n 
20 249  ASP n 
21 1    MET n 
21 2    GLU n 
21 3    ASP n 
21 4    GLU n 
21 5    VAL n 
21 6    VAL n 
21 7    ARG n 
21 8    PHE n 
21 9    ALA n 
21 10   LYS n 
21 11   LYS n 
21 12   MET n 
21 13   ASP n 
21 14   LYS n 
21 15   MET n 
21 16   VAL n 
21 17   GLN n 
21 18   LYS n 
21 19   LYS n 
21 20   ASN n 
21 21   ALA n 
21 22   ALA n 
21 23   GLY n 
21 24   ALA n 
21 25   LEU n 
21 26   ASP n 
21 27   LEU n 
21 28   LEU n 
21 29   LYS n 
21 30   GLU n 
21 31   LEU n 
21 32   LYS n 
21 33   ASN n 
21 34   ILE n 
21 35   PRO n 
21 36   MET n 
21 37   THR n 
21 38   LEU n 
21 39   GLU n 
21 40   LEU n 
21 41   LEU n 
21 42   GLN n 
21 43   SER n 
21 44   THR n 
21 45   ARG n 
21 46   ILE n 
21 47   GLY n 
21 48   MET n 
21 49   SER n 
21 50   VAL n 
21 51   ASN n 
21 52   ALA n 
21 53   ILE n 
21 54   ARG n 
21 55   LYS n 
21 56   GLN n 
21 57   SER n 
21 58   THR n 
21 59   ASP n 
21 60   GLU n 
21 61   GLU n 
21 62   VAL n 
21 63   THR n 
21 64   SER n 
21 65   LEU n 
21 66   ALA n 
21 67   LYS n 
21 68   SER n 
21 69   LEU n 
21 70   ILE n 
21 71   LYS n 
21 72   SER n 
21 73   TRP n 
21 74   LYS n 
21 75   LYS n 
21 76   LEU n 
21 77   LEU n 
21 78   ASP n 
21 79   GLY n 
21 80   PRO n 
21 81   SER n 
21 82   THR n 
21 83   GLU n 
21 84   LYS n 
21 85   ASP n 
21 86   LEU n 
21 87   ASP n 
21 88   GLU n 
21 89   LYS n 
21 90   LYS n 
21 91   LYS n 
21 92   GLU n 
21 93   PRO n 
21 94   ALA n 
21 95   ILE n 
21 96   THR n 
21 97   SER n 
21 98   GLN n 
21 99   ASN n 
21 100  SER n 
21 101  PRO n 
21 102  GLU n 
21 103  ALA n 
21 104  ARG n 
21 105  GLU n 
21 106  GLU n 
21 107  SER n 
21 108  THR n 
21 109  SER n 
21 110  SER n 
21 111  GLY n 
21 112  ASN n 
21 113  VAL n 
21 114  SER n 
21 115  ASN n 
21 116  ARG n 
21 117  LYS n 
21 118  ASP n 
21 119  GLU n 
21 120  THR n 
21 121  ASN n 
21 122  ALA n 
21 123  ARG n 
21 124  ASP n 
21 125  THR n 
21 126  TYR n 
21 127  VAL n 
21 128  SER n 
21 129  SER n 
21 130  PHE n 
21 131  PRO n 
21 132  ARG n 
21 133  ALA n 
21 134  PRO n 
21 135  SER n 
21 136  THR n 
21 137  SER n 
21 138  ASP n 
21 139  SER n 
21 140  VAL n 
21 141  ARG n 
21 142  LEU n 
21 143  LYS n 
21 144  CYS n 
21 145  ARG n 
21 146  GLU n 
21 147  MET n 
21 148  LEU n 
21 149  ALA n 
21 150  ALA n 
21 151  ALA n 
21 152  LEU n 
21 153  ARG n 
21 154  THR n 
21 155  GLY n 
21 156  ASP n 
21 157  ASP n 
21 158  TYR n 
21 159  ILE n 
21 160  ALA n 
21 161  ILE n 
21 162  GLY n 
21 163  ALA n 
21 164  ASP n 
21 165  GLU n 
21 166  GLU n 
21 167  GLU n 
21 168  LEU n 
21 169  GLY n 
21 170  SER n 
21 171  GLN n 
21 172  ILE n 
21 173  GLU n 
21 174  GLU n 
21 175  ALA n 
21 176  ILE n 
21 177  TYR n 
21 178  GLN n 
21 179  GLU n 
21 180  ILE n 
21 181  ARG n 
21 182  ASN n 
21 183  THR n 
21 184  ASP n 
21 185  MET n 
21 186  LYS n 
21 187  TYR n 
21 188  LYS n 
21 189  ASN n 
21 190  ARG n 
21 191  VAL n 
21 192  ARG n 
21 193  SER n 
21 194  ARG n 
21 195  ILE n 
21 196  SER n 
21 197  ASN n 
21 198  LEU n 
21 199  LYS n 
21 200  ASP n 
21 201  ALA n 
21 202  LYS n 
21 203  ASN n 
21 204  PRO n 
21 205  ASN n 
21 206  LEU n 
21 207  ARG n 
21 208  LYS n 
21 209  ASN n 
21 210  VAL n 
21 211  LEU n 
21 212  CYS n 
21 213  GLY n 
21 214  ASN n 
21 215  ILE n 
21 216  PRO n 
21 217  PRO n 
21 218  ASP n 
21 219  LEU n 
21 220  PHE n 
21 221  ALA n 
21 222  ARG n 
21 223  MET n 
21 224  THR n 
21 225  ALA n 
21 226  GLU n 
21 227  GLU n 
21 228  MET n 
21 229  ALA n 
21 230  SER n 
21 231  ASP n 
21 232  GLU n 
21 233  LEU n 
21 234  LYS n 
21 235  GLU n 
21 236  MET n 
21 237  ARG n 
21 238  LYS n 
21 239  ASN n 
21 240  LEU n 
21 241  THR n 
21 242  LYS n 
21 243  GLU n 
21 244  ALA n 
21 245  ILE n 
21 246  ARG n 
21 247  GLU n 
21 248  HIS n 
21 249  GLN n 
21 250  MET n 
21 251  ALA n 
21 252  LYS n 
21 253  THR n 
21 254  GLY n 
21 255  GLY n 
21 256  THR n 
21 257  GLN n 
21 258  THR n 
21 259  ASP n 
21 260  LEU n 
21 261  PHE n 
21 262  THR n 
21 263  CYS n 
21 264  GLY n 
21 265  LYS n 
21 266  CYS n 
21 267  LYS n 
21 268  LYS n 
21 269  LYS n 
21 270  ASN n 
21 271  CYS n 
21 272  THR n 
21 273  TYR n 
21 274  THR n 
21 275  GLN n 
21 276  VAL n 
21 277  GLN n 
21 278  THR n 
21 279  ARG n 
21 280  SER n 
21 281  ALA n 
21 282  ASP n 
21 283  GLU n 
21 284  PRO n 
21 285  MET n 
21 286  THR n 
21 287  THR n 
21 288  PHE n 
21 289  VAL n 
21 290  VAL n 
21 291  CYS n 
21 292  ASN n 
21 293  GLU n 
21 294  CYS n 
21 295  GLY n 
21 296  ASN n 
21 297  ARG n 
21 298  TRP n 
21 299  LYS n 
21 300  PHE n 
21 301  CYS n 
22 1    MET n 
22 2    GLY n 
22 3    LYS n 
22 4    ARG n 
22 5    ASP n 
22 6    ARG n 
22 7    ALA n 
22 8    ASP n 
22 9    ARG n 
22 10   ASP n 
22 11   LYS n 
22 12   LYS n 
22 13   LYS n 
22 14   SER n 
22 15   ARG n 
22 16   LYS n 
22 17   ARG n 
22 18   HIS n 
22 19   TYR n 
22 20   GLU n 
22 21   ASP n 
22 22   GLU n 
22 23   GLU n 
22 24   ASP n 
22 25   ASP n 
22 26   GLU n 
22 27   GLU n 
22 28   ASP n 
22 29   ALA n 
22 30   PRO n 
22 31   GLY n 
22 32   ASN n 
22 33   ASP n 
22 34   PRO n 
22 35   GLN n 
22 36   GLU n 
22 37   ALA n 
22 38   VAL n 
22 39   PRO n 
22 40   SER n 
22 41   ALA n 
22 42   ALA n 
22 43   GLY n 
22 44   LYS n 
22 45   GLN n 
22 46   VAL n 
22 47   ASP n 
22 48   GLU n 
22 49   SER n 
22 50   GLY n 
22 51   THR n 
22 52   LYS n 
22 53   VAL n 
22 54   ASP n 
22 55   GLU n 
22 56   TYR n 
22 57   GLY n 
22 58   ALA n 
22 59   LYS n 
22 60   ASP n 
22 61   TYR n 
22 62   ARG n 
22 63   LEU n 
22 64   GLN n 
22 65   MET n 
22 66   PRO n 
22 67   LEU n 
22 68   LYS n 
22 69   ASP n 
22 70   ASP n 
22 71   HIS n 
22 72   THR n 
22 73   SER n 
22 74   ARG n 
22 75   PRO n 
22 76   LEU n 
22 77   TRP n 
22 78   VAL n 
22 79   ALA n 
22 80   PRO n 
22 81   ASP n 
22 82   GLY n 
22 83   HIS n 
22 84   ILE n 
22 85   PHE n 
22 86   LEU n 
22 87   GLU n 
22 88   ALA n 
22 89   PHE n 
22 90   SER n 
22 91   PRO n 
22 92   VAL n 
22 93   TYR n 
22 94   LYS n 
22 95   TYR n 
22 96   ALA n 
22 97   GLN n 
22 98   ASP n 
22 99   PHE n 
22 100  LEU n 
22 101  VAL n 
22 102  ALA n 
22 103  ILE n 
22 104  ALA n 
22 105  GLU n 
22 106  PRO n 
22 107  VAL n 
22 108  CYS n 
22 109  ARG n 
22 110  PRO n 
22 111  THR n 
22 112  HIS n 
22 113  VAL n 
22 114  HIS n 
22 115  GLU n 
22 116  TYR n 
22 117  LYS n 
22 118  LEU n 
22 119  THR n 
22 120  ALA n 
22 121  TYR n 
22 122  SER n 
22 123  LEU n 
22 124  TYR n 
22 125  ALA n 
22 126  ALA n 
22 127  VAL n 
22 128  SER n 
22 129  VAL n 
22 130  GLY n 
22 131  LEU n 
22 132  GLN n 
22 133  THR n 
22 134  SER n 
22 135  ASP n 
22 136  ILE n 
22 137  THR n 
22 138  GLU n 
22 139  TYR n 
22 140  LEU n 
22 141  ARG n 
22 142  LYS n 
22 143  LEU n 
22 144  SER n 
22 145  LYS n 
22 146  THR n 
22 147  GLY n 
22 148  VAL n 
22 149  PRO n 
22 150  ASP n 
22 151  GLY n 
22 152  ILE n 
22 153  MET n 
22 154  GLN n 
22 155  PHE n 
22 156  ILE n 
22 157  LYS n 
22 158  LEU n 
22 159  CYS n 
22 160  THR n 
22 161  VAL n 
22 162  SER n 
22 163  TYR n 
22 164  GLY n 
22 165  LYS n 
22 166  VAL n 
22 167  LYS n 
22 168  LEU n 
22 169  VAL n 
22 170  LEU n 
22 171  LYS n 
22 172  HIS n 
22 173  ASN n 
22 174  ARG n 
22 175  TYR n 
22 176  PHE n 
22 177  VAL n 
22 178  GLU n 
22 179  SER n 
22 180  CYS n 
22 181  HIS n 
22 182  PRO n 
22 183  ASP n 
22 184  VAL n 
22 185  ILE n 
22 186  GLN n 
22 187  HIS n 
22 188  LEU n 
22 189  LEU n 
22 190  GLN n 
22 191  ASP n 
22 192  PRO n 
22 193  VAL n 
22 194  ILE n 
22 195  ARG n 
22 196  GLU n 
22 197  CYS n 
22 198  ARG n 
22 199  LEU n 
22 200  ARG n 
22 201  ASN n 
22 202  SER n 
22 203  GLU n 
22 204  GLY n 
22 205  GLU n 
22 206  ALA n 
22 207  THR n 
22 208  GLU n 
22 209  LEU n 
22 210  ILE n 
22 211  THR n 
22 212  GLU n 
22 213  THR n 
22 214  PHE n 
22 215  THR n 
22 216  SER n 
22 217  LYS n 
22 218  SER n 
22 219  ALA n 
22 220  ILE n 
22 221  SER n 
22 222  LYS n 
22 223  THR n 
22 224  ALA n 
22 225  GLU n 
22 226  SER n 
22 227  SER n 
22 228  GLY n 
22 229  GLY n 
22 230  PRO n 
22 231  SER n 
22 232  THR n 
22 233  SER n 
22 234  ARG n 
22 235  VAL n 
22 236  THR n 
22 237  ASP n 
22 238  PRO n 
22 239  GLN n 
22 240  GLY n 
22 241  LYS n 
22 242  SER n 
22 243  ASP n 
22 244  ILE n 
22 245  PRO n 
22 246  MET n 
22 247  ASP n 
22 248  LEU n 
22 249  PHE n 
22 250  ASP n 
22 251  PHE n 
22 252  TYR n 
22 253  GLU n 
22 254  GLN n 
22 255  MET n 
22 256  ASP n 
22 257  LYS n 
22 258  ASP n 
22 259  GLU n 
22 260  GLU n 
22 261  GLU n 
22 262  GLU n 
22 263  GLU n 
22 264  GLU n 
22 265  THR n 
22 266  GLN n 
22 267  THR n 
22 268  VAL n 
22 269  SER n 
22 270  PHE n 
22 271  GLU n 
22 272  VAL n 
22 273  LYS n 
22 274  GLN n 
22 275  GLU n 
22 276  MET n 
22 277  ILE n 
22 278  GLU n 
22 279  GLU n 
22 280  LEU n 
22 281  GLN n 
22 282  LYS n 
22 283  ARG n 
22 284  CYS n 
22 285  ILE n 
22 286  HIS n 
22 287  LEU n 
22 288  GLU n 
22 289  TYR n 
22 290  PRO n 
22 291  LEU n 
22 292  LEU n 
22 293  ALA n 
22 294  GLU n 
22 295  TYR n 
22 296  ASP n 
22 297  PHE n 
22 298  ARG n 
22 299  ASN n 
22 300  ASP n 
22 301  SER n 
22 302  VAL n 
22 303  ASN n 
22 304  PRO n 
22 305  ASP n 
22 306  ILE n 
22 307  ASN n 
22 308  ILE n 
22 309  ASP n 
22 310  LEU n 
22 311  LYS n 
22 312  PRO n 
22 313  THR n 
22 314  ALA n 
22 315  VAL n 
22 316  LEU n 
22 317  ARG n 
22 318  PRO n 
22 319  TYR n 
22 320  GLN n 
22 321  GLU n 
22 322  LYS n 
22 323  SER n 
22 324  LEU n 
22 325  ARG n 
22 326  LYS n 
22 327  MET n 
22 328  PHE n 
22 329  GLY n 
22 330  ASN n 
22 331  GLY n 
22 332  ARG n 
22 333  ALA n 
22 334  ARG n 
22 335  SER n 
22 336  GLY n 
22 337  VAL n 
22 338  ILE n 
22 339  VAL n 
22 340  LEU n 
22 341  PRO n 
22 342  CYS n 
22 343  GLY n 
22 344  ALA n 
22 345  GLY n 
22 346  LYS n 
22 347  SER n 
22 348  LEU n 
22 349  VAL n 
22 350  GLY n 
22 351  VAL n 
22 352  THR n 
22 353  ALA n 
22 354  ALA n 
22 355  CYS n 
22 356  THR n 
22 357  VAL n 
22 358  ARG n 
22 359  LYS n 
22 360  ARG n 
22 361  CYS n 
22 362  LEU n 
22 363  VAL n 
22 364  LEU n 
22 365  GLY n 
22 366  ASN n 
22 367  SER n 
22 368  ALA n 
22 369  VAL n 
22 370  SER n 
22 371  VAL n 
22 372  GLU n 
22 373  GLN n 
22 374  TRP n 
22 375  LYS n 
22 376  ALA n 
22 377  GLN n 
22 378  PHE n 
22 379  LYS n 
22 380  MET n 
22 381  TRP n 
22 382  SER n 
22 383  THR n 
22 384  ILE n 
22 385  ASP n 
22 386  ASP n 
22 387  SER n 
22 388  GLN n 
22 389  ILE n 
22 390  CYS n 
22 391  ARG n 
22 392  PHE n 
22 393  THR n 
22 394  SER n 
22 395  ASP n 
22 396  ALA n 
22 397  LYS n 
22 398  ASP n 
22 399  LYS n 
22 400  PRO n 
22 401  ILE n 
22 402  GLY n 
22 403  CYS n 
22 404  SER n 
22 405  VAL n 
22 406  ALA n 
22 407  ILE n 
22 408  SER n 
22 409  THR n 
22 410  TYR n 
22 411  SER n 
22 412  MET n 
22 413  LEU n 
22 414  GLY n 
22 415  HIS n 
22 416  THR n 
22 417  THR n 
22 418  LYS n 
22 419  ARG n 
22 420  SER n 
22 421  TRP n 
22 422  GLU n 
22 423  ALA n 
22 424  GLU n 
22 425  ARG n 
22 426  VAL n 
22 427  MET n 
22 428  GLU n 
22 429  TRP n 
22 430  LEU n 
22 431  LYS n 
22 432  THR n 
22 433  GLN n 
22 434  GLU n 
22 435  TRP n 
22 436  GLY n 
22 437  LEU n 
22 438  MET n 
22 439  ILE n 
22 440  LEU n 
22 441  ASP n 
22 442  GLU n 
22 443  VAL n 
22 444  HIS n 
22 445  THR n 
22 446  ILE n 
22 447  PRO n 
22 448  ALA n 
22 449  LYS n 
22 450  MET n 
22 451  PHE n 
22 452  ARG n 
22 453  ARG n 
22 454  VAL n 
22 455  LEU n 
22 456  THR n 
22 457  ILE n 
22 458  VAL n 
22 459  GLN n 
22 460  ALA n 
22 461  HIS n 
22 462  CYS n 
22 463  LYS n 
22 464  LEU n 
22 465  GLY n 
22 466  LEU n 
22 467  THR n 
22 468  ALA n 
22 469  THR n 
22 470  LEU n 
22 471  VAL n 
22 472  ARG n 
22 473  GLU n 
22 474  ASP n 
22 475  ASP n 
22 476  LYS n 
22 477  ILE n 
22 478  VAL n 
22 479  ASP n 
22 480  LEU n 
22 481  ASN n 
22 482  PHE n 
22 483  LEU n 
22 484  ILE n 
22 485  GLY n 
22 486  PRO n 
22 487  LYS n 
22 488  LEU n 
22 489  TYR n 
22 490  GLU n 
22 491  ALA n 
22 492  ASN n 
22 493  TRP n 
22 494  MET n 
22 495  GLU n 
22 496  LEU n 
22 497  GLN n 
22 498  ASN n 
22 499  ASN n 
22 500  GLY n 
22 501  TYR n 
22 502  ILE n 
22 503  ALA n 
22 504  LYS n 
22 505  VAL n 
22 506  GLN n 
22 507  CYS n 
22 508  ALA n 
22 509  GLU n 
22 510  VAL n 
22 511  TRP n 
22 512  CYS n 
22 513  PRO n 
22 514  MET n 
22 515  SER n 
22 516  PRO n 
22 517  GLU n 
22 518  PHE n 
22 519  TYR n 
22 520  ARG n 
22 521  GLU n 
22 522  TYR n 
22 523  VAL n 
22 524  ALA n 
22 525  ILE n 
22 526  LYS n 
22 527  THR n 
22 528  LYS n 
22 529  LYS n 
22 530  ARG n 
22 531  ILE n 
22 532  LEU n 
22 533  LEU n 
22 534  TYR n 
22 535  THR n 
22 536  MET n 
22 537  ASN n 
22 538  PRO n 
22 539  ASN n 
22 540  LYS n 
22 541  PHE n 
22 542  ARG n 
22 543  ALA n 
22 544  CYS n 
22 545  GLN n 
22 546  PHE n 
22 547  LEU n 
22 548  ILE n 
22 549  LYS n 
22 550  PHE n 
22 551  HIS n 
22 552  GLU n 
22 553  ARG n 
22 554  ARG n 
22 555  ASN n 
22 556  ASP n 
22 557  LYS n 
22 558  ILE n 
22 559  ILE n 
22 560  VAL n 
22 561  PHE n 
22 562  ALA n 
22 563  ASP n 
22 564  ASN n 
22 565  VAL n 
22 566  PHE n 
22 567  ALA n 
22 568  LEU n 
22 569  LYS n 
22 570  GLU n 
22 571  TYR n 
22 572  ALA n 
22 573  ILE n 
22 574  ARG n 
22 575  LEU n 
22 576  ASN n 
22 577  LYS n 
22 578  PRO n 
22 579  TYR n 
22 580  ILE n 
22 581  TYR n 
22 582  GLY n 
22 583  PRO n 
22 584  THR n 
22 585  SER n 
22 586  GLN n 
22 587  GLY n 
22 588  GLU n 
22 589  ARG n 
22 590  MET n 
22 591  GLN n 
22 592  ILE n 
22 593  LEU n 
22 594  GLN n 
22 595  ASN n 
22 596  PHE n 
22 597  LYS n 
22 598  HIS n 
22 599  ASN n 
22 600  PRO n 
22 601  LYS n 
22 602  ILE n 
22 603  ASN n 
22 604  THR n 
22 605  ILE n 
22 606  PHE n 
22 607  ILE n 
22 608  SER n 
22 609  LYS n 
22 610  VAL n 
22 611  GLY n 
22 612  ASP n 
22 613  THR n 
22 614  SER n 
22 615  PHE n 
22 616  ASP n 
22 617  LEU n 
22 618  PRO n 
22 619  GLU n 
22 620  ALA n 
22 621  ASN n 
22 622  VAL n 
22 623  LEU n 
22 624  ILE n 
22 625  GLN n 
22 626  ILE n 
22 627  SER n 
22 628  SER n 
22 629  HIS n 
22 630  GLY n 
22 631  GLY n 
22 632  SER n 
22 633  ARG n 
22 634  ARG n 
22 635  GLN n 
22 636  GLU n 
22 637  ALA n 
22 638  GLN n 
22 639  ARG n 
22 640  LEU n 
22 641  GLY n 
22 642  ARG n 
22 643  VAL n 
22 644  LEU n 
22 645  ARG n 
22 646  ALA n 
22 647  LYS n 
22 648  LYS n 
22 649  GLY n 
22 650  MET n 
22 651  VAL n 
22 652  ALA n 
22 653  GLU n 
22 654  GLU n 
22 655  TYR n 
22 656  ASN n 
22 657  ALA n 
22 658  PHE n 
22 659  PHE n 
22 660  TYR n 
22 661  SER n 
22 662  LEU n 
22 663  VAL n 
22 664  SER n 
22 665  GLN n 
22 666  ASP n 
22 667  THR n 
22 668  GLN n 
22 669  GLU n 
22 670  MET n 
22 671  ALA n 
22 672  TYR n 
22 673  SER n 
22 674  THR n 
22 675  LYS n 
22 676  ARG n 
22 677  GLN n 
22 678  ARG n 
22 679  PHE n 
22 680  LEU n 
22 681  VAL n 
22 682  ASP n 
22 683  GLN n 
22 684  GLY n 
22 685  TYR n 
22 686  SER n 
22 687  PHE n 
22 688  LYS n 
22 689  VAL n 
22 690  ILE n 
22 691  THR n 
22 692  LYS n 
22 693  LEU n 
22 694  ALA n 
22 695  GLY n 
22 696  MET n 
22 697  GLU n 
22 698  GLU n 
22 699  GLU n 
22 700  ASP n 
22 701  LEU n 
22 702  ALA n 
22 703  PHE n 
22 704  SER n 
22 705  THR n 
22 706  LYS n 
22 707  GLU n 
22 708  GLU n 
22 709  GLN n 
22 710  GLN n 
22 711  GLN n 
22 712  LEU n 
22 713  LEU n 
22 714  GLN n 
22 715  LYS n 
22 716  VAL n 
22 717  LEU n 
22 718  ALA n 
22 719  ALA n 
22 720  THR n 
22 721  ASP n 
22 722  LEU n 
22 723  ASP n 
22 724  ALA n 
22 725  GLU n 
22 726  GLU n 
22 727  GLU n 
22 728  VAL n 
22 729  VAL n 
22 730  ALA n 
22 731  GLY n 
22 732  GLU n 
22 733  PHE n 
22 734  GLY n 
22 735  SER n 
22 736  ARG n 
22 737  SER n 
22 738  SER n 
22 739  GLN n 
22 740  ALA n 
22 741  SER n 
22 742  ARG n 
22 743  ARG n 
22 744  PHE n 
22 745  GLY n 
22 746  THR n 
22 747  MET n 
22 748  SER n 
22 749  SER n 
22 750  MET n 
22 751  SER n 
22 752  GLY n 
22 753  ALA n 
22 754  ASP n 
22 755  ASP n 
22 756  THR n 
22 757  VAL n 
22 758  TYR n 
22 759  MET n 
22 760  GLU n 
22 761  TYR n 
22 762  HIS n 
22 763  SER n 
22 764  SER n 
22 765  ARG n 
22 766  SER n 
22 767  LYS n 
22 768  ALA n 
22 769  PRO n 
22 770  SER n 
22 771  LYS n 
22 772  HIS n 
22 773  VAL n 
22 774  HIS n 
22 775  PRO n 
22 776  LEU n 
22 777  PHE n 
22 778  LYS n 
22 779  ARG n 
22 780  PHE n 
22 781  ARG n 
22 782  LYS n 
23 1    MET n 
23 2    LYS n 
23 3    LEU n 
23 4    ASN n 
23 5    VAL n 
23 6    ASP n 
23 7    GLY n 
23 8    LEU n 
23 9    LEU n 
23 10   VAL n 
23 11   TYR n 
23 12   PHE n 
23 13   PRO n 
23 14   TYR n 
23 15   ASP n 
23 16   TYR n 
23 17   ILE n 
23 18   TYR n 
23 19   PRO n 
23 20   GLU n 
23 21   GLN n 
23 22   PHE n 
23 23   SER n 
23 24   TYR n 
23 25   MET n 
23 26   ARG n 
23 27   GLU n 
23 28   LEU n 
23 29   LYS n 
23 30   ARG n 
23 31   THR n 
23 32   LEU n 
23 33   ASP n 
23 34   ALA n 
23 35   LYS n 
23 36   GLY n 
23 37   HIS n 
23 38   GLY n 
23 39   VAL n 
23 40   LEU n 
23 41   GLU n 
23 42   MET n 
23 43   PRO n 
23 44   SER n 
23 45   GLY n 
23 46   THR n 
23 47   GLY n 
23 48   LYS n 
23 49   THR n 
23 50   VAL n 
23 51   SER n 
23 52   LEU n 
23 53   LEU n 
23 54   ALA n 
23 55   LEU n 
23 56   ILE n 
23 57   MET n 
23 58   ALA n 
23 59   TYR n 
23 60   GLN n 
23 61   ARG n 
23 62   ALA n 
23 63   TYR n 
23 64   PRO n 
23 65   LEU n 
23 66   GLU n 
23 67   VAL n 
23 68   THR n 
23 69   LYS n 
23 70   LEU n 
23 71   ILE n 
23 72   TYR n 
23 73   CYS n 
23 74   SER n 
23 75   ARG n 
23 76   THR n 
23 77   VAL n 
23 78   PRO n 
23 79   GLU n 
23 80   ILE n 
23 81   GLU n 
23 82   LYS n 
23 83   VAL n 
23 84   ILE n 
23 85   GLU n 
23 86   GLU n 
23 87   LEU n 
23 88   ARG n 
23 89   LYS n 
23 90   LEU n 
23 91   LEU n 
23 92   ASN n 
23 93   PHE n 
23 94   TYR n 
23 95   GLU n 
23 96   LYS n 
23 97   GLN n 
23 98   GLU n 
23 99   GLY n 
23 100  GLU n 
23 101  LYS n 
23 102  LEU n 
23 103  PRO n 
23 104  PHE n 
23 105  LEU n 
23 106  GLY n 
23 107  LEU n 
23 108  ALA n 
23 109  LEU n 
23 110  SER n 
23 111  SER n 
23 112  ARG n 
23 113  LYS n 
23 114  ASN n 
23 115  LEU n 
23 116  CYS n 
23 117  ILE n 
23 118  HIS n 
23 119  PRO n 
23 120  GLU n 
23 121  VAL n 
23 122  THR n 
23 123  PRO n 
23 124  LEU n 
23 125  ARG n 
23 126  PHE n 
23 127  GLY n 
23 128  LYS n 
23 129  ASP n 
23 130  VAL n 
23 131  ASP n 
23 132  GLY n 
23 133  LYS n 
23 134  CYS n 
23 135  HIS n 
23 136  SER n 
23 137  LEU n 
23 138  THR n 
23 139  ALA n 
23 140  SER n 
23 141  TYR n 
23 142  VAL n 
23 143  ARG n 
23 144  ALA n 
23 145  GLN n 
23 146  TYR n 
23 147  GLN n 
23 148  HIS n 
23 149  ASP n 
23 150  THR n 
23 151  SER n 
23 152  LEU n 
23 153  PRO n 
23 154  HIS n 
23 155  CYS n 
23 156  ARG n 
23 157  PHE n 
23 158  TYR n 
23 159  GLU n 
23 160  GLU n 
23 161  PHE n 
23 162  ASP n 
23 163  ALA n 
23 164  HIS n 
23 165  GLY n 
23 166  ARG n 
23 167  GLU n 
23 168  VAL n 
23 169  PRO n 
23 170  LEU n 
23 171  PRO n 
23 172  ALA n 
23 173  GLY n 
23 174  ILE n 
23 175  TYR n 
23 176  ASN n 
23 177  LEU n 
23 178  ASP n 
23 179  ASP n 
23 180  LEU n 
23 181  LYS n 
23 182  ALA n 
23 183  LEU n 
23 184  GLY n 
23 185  ARG n 
23 186  ARG n 
23 187  GLN n 
23 188  GLY n 
23 189  TRP n 
23 190  CYS n 
23 191  PRO n 
23 192  TYR n 
23 193  PHE n 
23 194  LEU n 
23 195  ALA n 
23 196  ARG n 
23 197  TYR n 
23 198  SER n 
23 199  ILE n 
23 200  LEU n 
23 201  HIS n 
23 202  ALA n 
23 203  ASN n 
23 204  VAL n 
23 205  VAL n 
23 206  VAL n 
23 207  TYR n 
23 208  SER n 
23 209  TYR n 
23 210  HIS n 
23 211  TYR n 
23 212  LEU n 
23 213  LEU n 
23 214  ASP n 
23 215  PRO n 
23 216  LYS n 
23 217  ILE n 
23 218  ALA n 
23 219  ASP n 
23 220  LEU n 
23 221  VAL n 
23 222  SER n 
23 223  LYS n 
23 224  GLU n 
23 225  LEU n 
23 226  ALA n 
23 227  ARG n 
23 228  LYS n 
23 229  ALA n 
23 230  VAL n 
23 231  VAL n 
23 232  VAL n 
23 233  PHE n 
23 234  ASP n 
23 235  GLU n 
23 236  ALA n 
23 237  HIS n 
23 238  ASN n 
23 239  ILE n 
23 240  ASP n 
23 241  ASN n 
23 242  VAL n 
23 243  CYS n 
23 244  ILE n 
23 245  ASP n 
23 246  SER n 
23 247  MET n 
23 248  SER n 
23 249  VAL n 
23 250  ASN n 
23 251  LEU n 
23 252  THR n 
23 253  ARG n 
23 254  ARG n 
23 255  THR n 
23 256  LEU n 
23 257  ASP n 
23 258  ARG n 
23 259  CYS n 
23 260  GLN n 
23 261  GLY n 
23 262  ASN n 
23 263  LEU n 
23 264  GLU n 
23 265  THR n 
23 266  LEU n 
23 267  GLN n 
23 268  LYS n 
23 269  THR n 
23 270  VAL n 
23 271  LEU n 
23 272  ARG n 
23 273  ILE n 
23 274  LYS n 
23 275  GLU n 
23 276  THR n 
23 277  ASP n 
23 278  GLU n 
23 279  GLN n 
23 280  ARG n 
23 281  LEU n 
23 282  ARG n 
23 283  ASP n 
23 284  GLU n 
23 285  TYR n 
23 286  ARG n 
23 287  ARG n 
23 288  LEU n 
23 289  VAL n 
23 290  GLU n 
23 291  GLY n 
23 292  LEU n 
23 293  ARG n 
23 294  GLU n 
23 295  ALA n 
23 296  SER n 
23 297  ALA n 
23 298  ALA n 
23 299  ARG n 
23 300  GLU n 
23 301  THR n 
23 302  ASP n 
23 303  ALA n 
23 304  HIS n 
23 305  LEU n 
23 306  ALA n 
23 307  ASN n 
23 308  PRO n 
23 309  VAL n 
23 310  LEU n 
23 311  PRO n 
23 312  ASP n 
23 313  GLU n 
23 314  VAL n 
23 315  LEU n 
23 316  GLN n 
23 317  GLU n 
23 318  ALA n 
23 319  VAL n 
23 320  PRO n 
23 321  GLY n 
23 322  SER n 
23 323  ILE n 
23 324  ARG n 
23 325  THR n 
23 326  ALA n 
23 327  GLU n 
23 328  HIS n 
23 329  PHE n 
23 330  LEU n 
23 331  GLY n 
23 332  PHE n 
23 333  LEU n 
23 334  ARG n 
23 335  ARG n 
23 336  LEU n 
23 337  LEU n 
23 338  GLU n 
23 339  TYR n 
23 340  VAL n 
23 341  LYS n 
23 342  TRP n 
23 343  ARG n 
23 344  LEU n 
23 345  ARG n 
23 346  VAL n 
23 347  GLN n 
23 348  HIS n 
23 349  VAL n 
23 350  VAL n 
23 351  GLN n 
23 352  GLU n 
23 353  SER n 
23 354  PRO n 
23 355  PRO n 
23 356  ALA n 
23 357  PHE n 
23 358  LEU n 
23 359  SER n 
23 360  GLY n 
23 361  LEU n 
23 362  ALA n 
23 363  GLN n 
23 364  ARG n 
23 365  VAL n 
23 366  CYS n 
23 367  ILE n 
23 368  GLN n 
23 369  ARG n 
23 370  LYS n 
23 371  PRO n 
23 372  LEU n 
23 373  ARG n 
23 374  PHE n 
23 375  CYS n 
23 376  ALA n 
23 377  GLU n 
23 378  ARG n 
23 379  LEU n 
23 380  ARG n 
23 381  SER n 
23 382  LEU n 
23 383  LEU n 
23 384  HIS n 
23 385  THR n 
23 386  LEU n 
23 387  GLU n 
23 388  ILE n 
23 389  THR n 
23 390  ASP n 
23 391  LEU n 
23 392  ALA n 
23 393  ASP n 
23 394  PHE n 
23 395  SER n 
23 396  PRO n 
23 397  LEU n 
23 398  THR n 
23 399  LEU n 
23 400  LEU n 
23 401  ALA n 
23 402  ASN n 
23 403  PHE n 
23 404  ALA n 
23 405  THR n 
23 406  LEU n 
23 407  VAL n 
23 408  SER n 
23 409  THR n 
23 410  TYR n 
23 411  ALA n 
23 412  LYS n 
23 413  GLY n 
23 414  PHE n 
23 415  THR n 
23 416  ILE n 
23 417  ILE n 
23 418  ILE n 
23 419  GLU n 
23 420  PRO n 
23 421  PHE n 
23 422  ASP n 
23 423  ASP n 
23 424  ARG n 
23 425  THR n 
23 426  PRO n 
23 427  THR n 
23 428  ILE n 
23 429  ALA n 
23 430  ASN n 
23 431  PRO n 
23 432  ILE n 
23 433  LEU n 
23 434  HIS n 
23 435  PHE n 
23 436  SER n 
23 437  CYS n 
23 438  MET n 
23 439  ASP n 
23 440  ALA n 
23 441  SER n 
23 442  LEU n 
23 443  ALA n 
23 444  ILE n 
23 445  LYS n 
23 446  PRO n 
23 447  VAL n 
23 448  PHE n 
23 449  GLU n 
23 450  ARG n 
23 451  PHE n 
23 452  GLN n 
23 453  SER n 
23 454  VAL n 
23 455  ILE n 
23 456  ILE n 
23 457  THR n 
23 458  SER n 
23 459  GLY n 
23 460  THR n 
23 461  LEU n 
23 462  SER n 
23 463  PRO n 
23 464  LEU n 
23 465  ASP n 
23 466  ILE n 
23 467  TYR n 
23 468  PRO n 
23 469  LYS n 
23 470  ILE n 
23 471  LEU n 
23 472  ASP n 
23 473  PHE n 
23 474  HIS n 
23 475  PRO n 
23 476  VAL n 
23 477  THR n 
23 478  MET n 
23 479  ALA n 
23 480  THR n 
23 481  PHE n 
23 482  THR n 
23 483  MET n 
23 484  THR n 
23 485  LEU n 
23 486  ALA n 
23 487  ARG n 
23 488  VAL n 
23 489  CYS n 
23 490  LEU n 
23 491  CYS n 
23 492  PRO n 
23 493  MET n 
23 494  ILE n 
23 495  ILE n 
23 496  GLY n 
23 497  ARG n 
23 498  GLY n 
23 499  ASN n 
23 500  ASP n 
23 501  GLN n 
23 502  VAL n 
23 503  ALA n 
23 504  ILE n 
23 505  SER n 
23 506  SER n 
23 507  LYS n 
23 508  PHE n 
23 509  GLU n 
23 510  THR n 
23 511  ARG n 
23 512  GLU n 
23 513  ASP n 
23 514  ILE n 
23 515  ALA n 
23 516  VAL n 
23 517  ILE n 
23 518  ARG n 
23 519  ASN n 
23 520  TYR n 
23 521  GLY n 
23 522  ASN n 
23 523  LEU n 
23 524  LEU n 
23 525  LEU n 
23 526  GLU n 
23 527  MET n 
23 528  SER n 
23 529  ALA n 
23 530  VAL n 
23 531  VAL n 
23 532  PRO n 
23 533  ASP n 
23 534  GLY n 
23 535  ILE n 
23 536  VAL n 
23 537  ALA n 
23 538  PHE n 
23 539  PHE n 
23 540  THR n 
23 541  SER n 
23 542  TYR n 
23 543  GLN n 
23 544  TYR n 
23 545  MET n 
23 546  GLU n 
23 547  SER n 
23 548  THR n 
23 549  VAL n 
23 550  ALA n 
23 551  SER n 
23 552  TRP n 
23 553  TYR n 
23 554  GLU n 
23 555  GLN n 
23 556  GLY n 
23 557  ILE n 
23 558  LEU n 
23 559  GLU n 
23 560  ASN n 
23 561  ILE n 
23 562  GLN n 
23 563  ARG n 
23 564  ASN n 
23 565  LYS n 
23 566  LEU n 
23 567  LEU n 
23 568  PHE n 
23 569  ILE n 
23 570  GLU n 
23 571  THR n 
23 572  GLN n 
23 573  ASP n 
23 574  GLY n 
23 575  ALA n 
23 576  GLU n 
23 577  THR n 
23 578  SER n 
23 579  VAL n 
23 580  ALA n 
23 581  LEU n 
23 582  GLU n 
23 583  LYS n 
23 584  TYR n 
23 585  GLN n 
23 586  GLU n 
23 587  ALA n 
23 588  CYS n 
23 589  GLU n 
23 590  ASN n 
23 591  GLY n 
23 592  ARG n 
23 593  GLY n 
23 594  ALA n 
23 595  ILE n 
23 596  LEU n 
23 597  LEU n 
23 598  SER n 
23 599  VAL n 
23 600  ALA n 
23 601  ARG n 
23 602  GLY n 
23 603  LYS n 
23 604  VAL n 
23 605  SER n 
23 606  GLU n 
23 607  GLY n 
23 608  ILE n 
23 609  ASP n 
23 610  PHE n 
23 611  VAL n 
23 612  HIS n 
23 613  HIS n 
23 614  TYR n 
23 615  GLY n 
23 616  ARG n 
23 617  ALA n 
23 618  VAL n 
23 619  ILE n 
23 620  MET n 
23 621  PHE n 
23 622  GLY n 
23 623  VAL n 
23 624  PRO n 
23 625  TYR n 
23 626  VAL n 
23 627  TYR n 
23 628  THR n 
23 629  GLN n 
23 630  SER n 
23 631  ARG n 
23 632  ILE n 
23 633  LEU n 
23 634  LYS n 
23 635  ALA n 
23 636  ARG n 
23 637  LEU n 
23 638  GLU n 
23 639  TYR n 
23 640  LEU n 
23 641  ARG n 
23 642  ASP n 
23 643  GLN n 
23 644  PHE n 
23 645  GLN n 
23 646  ILE n 
23 647  ARG n 
23 648  GLU n 
23 649  ASN n 
23 650  ASP n 
23 651  PHE n 
23 652  LEU n 
23 653  THR n 
23 654  PHE n 
23 655  ASP n 
23 656  ALA n 
23 657  MET n 
23 658  ARG n 
23 659  HIS n 
23 660  ALA n 
23 661  ALA n 
23 662  GLN n 
23 663  CYS n 
23 664  VAL n 
23 665  GLY n 
23 666  ARG n 
23 667  ALA n 
23 668  ILE n 
23 669  ARG n 
23 670  GLY n 
23 671  LYS n 
23 672  THR n 
23 673  ASP n 
23 674  TYR n 
23 675  GLY n 
23 676  LEU n 
23 677  MET n 
23 678  VAL n 
23 679  PHE n 
23 680  ALA n 
23 681  ASP n 
23 682  LYS n 
23 683  ARG n 
23 684  PHE n 
23 685  ALA n 
23 686  ARG n 
23 687  GLY n 
23 688  ASP n 
23 689  LYS n 
23 690  ARG n 
23 691  GLY n 
23 692  LYS n 
23 693  LEU n 
23 694  PRO n 
23 695  ARG n 
23 696  TRP n 
23 697  ILE n 
23 698  GLN n 
23 699  GLU n 
23 700  HIS n 
23 701  LEU n 
23 702  THR n 
23 703  ASP n 
23 704  ALA n 
23 705  ASN n 
23 706  LEU n 
23 707  ASN n 
23 708  LEU n 
23 709  THR n 
23 710  VAL n 
23 711  ASP n 
23 712  GLU n 
23 713  GLY n 
23 714  VAL n 
23 715  GLN n 
23 716  VAL n 
23 717  ALA n 
23 718  LYS n 
23 719  TYR n 
23 720  PHE n 
23 721  LEU n 
23 722  ARG n 
23 723  GLN n 
23 724  MET n 
23 725  ALA n 
23 726  GLN n 
23 727  PRO n 
23 728  PHE n 
23 729  HIS n 
23 730  ARG n 
23 731  GLU n 
23 732  ASP n 
23 733  GLN n 
23 734  LEU n 
23 735  GLY n 
23 736  LEU n 
23 737  SER n 
23 738  LEU n 
23 739  LEU n 
23 740  SER n 
23 741  LEU n 
23 742  GLU n 
23 743  GLN n 
23 744  LEU n 
23 745  GLU n 
23 746  SER n 
23 747  GLU n 
23 748  GLU n 
23 749  THR n 
23 750  LEU n 
23 751  LYS n 
23 752  ARG n 
23 753  ILE n 
23 754  GLU n 
23 755  GLN n 
23 756  ILE n 
23 757  ALA n 
23 758  GLN n 
23 759  GLN n 
23 760  LEU n 
24 1    MET n 
24 2    ASP n 
24 3    GLU n 
24 4    GLU n 
24 5    PRO n 
24 6    GLU n 
24 7    ARG n 
24 8    THR n 
24 9    LYS n 
24 10   ARG n 
24 11   TRP n 
24 12   GLU n 
24 13   GLY n 
24 14   GLY n 
24 15   TYR n 
24 16   GLU n 
24 17   ARG n 
24 18   THR n 
24 19   TRP n 
24 20   GLU n 
24 21   ILE n 
24 22   LEU n 
24 23   LYS n 
24 24   GLU n 
24 25   ASP n 
24 26   GLU n 
24 27   SER n 
24 28   GLY n 
24 29   SER n 
24 30   LEU n 
24 31   LYS n 
24 32   ALA n 
24 33   THR n 
24 34   ILE n 
24 35   GLU n 
24 36   ASP n 
24 37   ILE n 
24 38   LEU n 
24 39   PHE n 
24 40   LYS n 
24 41   ALA n 
24 42   LYS n 
24 43   ARG n 
24 44   LYS n 
24 45   ARG n 
24 46   VAL n 
24 47   PHE n 
24 48   GLU n 
24 49   HIS n 
24 50   HIS n 
24 51   GLY n 
24 52   GLN n 
24 53   VAL n 
24 54   ARG n 
24 55   LEU n 
24 56   GLY n 
24 57   MET n 
24 58   MET n 
24 59   ARG n 
24 60   HIS n 
24 61   LEU n 
24 62   TYR n 
24 63   VAL n 
24 64   VAL n 
24 65   VAL n 
24 66   ASP n 
24 67   GLY n 
24 68   SER n 
24 69   ARG n 
24 70   THR n 
24 71   MET n 
24 72   GLU n 
24 73   ASP n 
24 74   GLN n 
24 75   ASP n 
24 76   LEU n 
24 77   LYS n 
24 78   PRO n 
24 79   ASN n 
24 80   ARG n 
24 81   LEU n 
24 82   THR n 
24 83   CYS n 
24 84   THR n 
24 85   LEU n 
24 86   LYS n 
24 87   LEU n 
24 88   LEU n 
24 89   GLU n 
24 90   TYR n 
24 91   PHE n 
24 92   VAL n 
24 93   GLU n 
24 94   GLU n 
24 95   TYR n 
24 96   PHE n 
24 97   ASP n 
24 98   GLN n 
24 99   ASN n 
24 100  PRO n 
24 101  ILE n 
24 102  SER n 
24 103  GLN n 
24 104  ILE n 
24 105  GLY n 
24 106  ILE n 
24 107  ILE n 
24 108  VAL n 
24 109  THR n 
24 110  LYS n 
24 111  SER n 
24 112  LYS n 
24 113  ARG n 
24 114  ALA n 
24 115  GLU n 
24 116  LYS n 
24 117  LEU n 
24 118  THR n 
24 119  GLU n 
24 120  LEU n 
24 121  SER n 
24 122  GLY n 
24 123  ASN n 
24 124  PRO n 
24 125  ARG n 
24 126  LYS n 
24 127  HIS n 
24 128  ILE n 
24 129  THR n 
24 130  SER n 
24 131  LEU n 
24 132  LYS n 
24 133  LYS n 
24 134  ALA n 
24 135  VAL n 
24 136  ASP n 
24 137  MET n 
24 138  THR n 
24 139  CYS n 
24 140  HIS n 
24 141  GLY n 
24 142  GLU n 
24 143  PRO n 
24 144  SER n 
24 145  LEU n 
24 146  TYR n 
24 147  ASN n 
24 148  SER n 
24 149  LEU n 
24 150  SER n 
24 151  ILE n 
24 152  ALA n 
24 153  MET n 
24 154  GLN n 
24 155  THR n 
24 156  LEU n 
24 157  LYS n 
24 158  HIS n 
24 159  MET n 
24 160  PRO n 
24 161  GLY n 
24 162  HIS n 
24 163  THR n 
24 164  SER n 
24 165  ARG n 
24 166  GLU n 
24 167  VAL n 
24 168  LEU n 
24 169  ILE n 
24 170  ILE n 
24 171  PHE n 
24 172  SER n 
24 173  SER n 
24 174  LEU n 
24 175  THR n 
24 176  THR n 
24 177  CYS n 
24 178  ASP n 
24 179  PRO n 
24 180  SER n 
24 181  ASN n 
24 182  ILE n 
24 183  TYR n 
24 184  ASP n 
24 185  LEU n 
24 186  ILE n 
24 187  LYS n 
24 188  THR n 
24 189  LEU n 
24 190  LYS n 
24 191  ALA n 
24 192  ALA n 
24 193  LYS n 
24 194  ILE n 
24 195  ARG n 
24 196  VAL n 
24 197  SER n 
24 198  VAL n 
24 199  ILE n 
24 200  GLY n 
24 201  LEU n 
24 202  SER n 
24 203  ALA n 
24 204  GLU n 
24 205  VAL n 
24 206  ARG n 
24 207  VAL n 
24 208  CYS n 
24 209  THR n 
24 210  VAL n 
24 211  LEU n 
24 212  ALA n 
24 213  ARG n 
24 214  GLU n 
24 215  THR n 
24 216  GLY n 
24 217  GLY n 
24 218  THR n 
24 219  TYR n 
24 220  HIS n 
24 221  VAL n 
24 222  ILE n 
24 223  LEU n 
24 224  ASP n 
24 225  GLU n 
24 226  SER n 
24 227  HIS n 
24 228  TYR n 
24 229  LYS n 
24 230  GLU n 
24 231  LEU n 
24 232  LEU n 
24 233  THR n 
24 234  HIS n 
24 235  HIS n 
24 236  VAL n 
24 237  SER n 
24 238  PRO n 
24 239  PRO n 
24 240  PRO n 
24 241  ALA n 
24 242  SER n 
24 243  SER n 
24 244  SER n 
24 245  SER n 
24 246  GLU n 
24 247  CYS n 
24 248  SER n 
24 249  LEU n 
24 250  ILE n 
24 251  ARG n 
24 252  MET n 
24 253  GLY n 
24 254  PHE n 
24 255  PRO n 
24 256  GLN n 
24 257  HIS n 
24 258  THR n 
24 259  ILE n 
24 260  ALA n 
24 261  SER n 
24 262  LEU n 
24 263  SER n 
24 264  ASP n 
24 265  GLN n 
24 266  ASP n 
24 267  ALA n 
24 268  LYS n 
24 269  PRO n 
24 270  SER n 
24 271  PHE n 
24 272  SER n 
24 273  MET n 
24 274  ALA n 
24 275  HIS n 
24 276  LEU n 
24 277  ASP n 
24 278  GLY n 
24 279  ASN n 
24 280  THR n 
24 281  GLU n 
24 282  PRO n 
24 283  GLY n 
24 284  LEU n 
24 285  THR n 
24 286  LEU n 
24 287  GLY n 
24 288  GLY n 
24 289  TYR n 
24 290  PHE n 
24 291  CYS n 
24 292  PRO n 
24 293  GLN n 
24 294  CYS n 
24 295  ARG n 
24 296  ALA n 
24 297  LYS n 
24 298  TYR n 
24 299  CYS n 
24 300  GLU n 
24 301  LEU n 
24 302  PRO n 
24 303  VAL n 
24 304  GLU n 
24 305  CYS n 
24 306  LYS n 
24 307  ILE n 
24 308  CYS n 
24 309  GLY n 
24 310  LEU n 
24 311  THR n 
24 312  LEU n 
24 313  VAL n 
24 314  SER n 
24 315  ALA n 
24 316  PRO n 
24 317  HIS n 
24 318  LEU n 
24 319  ALA n 
24 320  ARG n 
24 321  SER n 
24 322  TYR n 
24 323  HIS n 
24 324  HIS n 
24 325  LEU n 
24 326  PHE n 
24 327  PRO n 
24 328  LEU n 
24 329  ASP n 
24 330  ALA n 
24 331  PHE n 
24 332  GLN n 
24 333  GLU n 
24 334  ILE n 
24 335  PRO n 
24 336  LEU n 
24 337  GLU n 
24 338  GLU n 
24 339  TYR n 
24 340  ASN n 
24 341  GLY n 
24 342  GLU n 
24 343  ARG n 
24 344  PHE n 
24 345  CYS n 
24 346  TYR n 
24 347  GLY n 
24 348  CYS n 
24 349  GLN n 
24 350  GLY n 
24 351  GLU n 
24 352  LEU n 
24 353  LYS n 
24 354  ASP n 
24 355  GLN n 
24 356  HIS n 
24 357  VAL n 
24 358  TYR n 
24 359  VAL n 
24 360  CYS n 
24 361  ALA n 
24 362  VAL n 
24 363  CYS n 
24 364  GLN n 
24 365  ASN n 
24 366  VAL n 
24 367  PHE n 
24 368  CYS n 
24 369  VAL n 
24 370  ASP n 
24 371  CYS n 
24 372  ASP n 
24 373  VAL n 
24 374  PHE n 
24 375  VAL n 
24 376  HIS n 
24 377  ASP n 
24 378  SER n 
24 379  LEU n 
24 380  HIS n 
24 381  CYS n 
24 382  CYS n 
24 383  PRO n 
24 384  GLY n 
24 385  CYS n 
24 386  ILE n 
24 387  HIS n 
24 388  LYS n 
24 389  ILE n 
24 390  PRO n 
24 391  ALA n 
24 392  PRO n 
24 393  SER n 
24 394  GLY n 
24 395  VAL n 
25 1    MET n 
25 2    VAL n 
25 3    ASN n 
25 4    VAL n 
25 5    LEU n 
25 6    LYS n 
25 7    GLY n 
25 8    VAL n 
25 9    LEU n 
25 10   ILE n 
25 11   GLU n 
25 12   CYS n 
25 13   ASP n 
25 14   PRO n 
25 15   ALA n 
25 16   MET n 
25 17   LYS n 
25 18   GLN n 
25 19   PHE n 
25 20   LEU n 
25 21   LEU n 
25 22   TYR n 
25 23   LEU n 
25 24   ASP n 
25 25   GLU n 
25 26   SER n 
25 27   ASN n 
25 28   ALA n 
25 29   LEU n 
25 30   GLY n 
25 31   LYS n 
25 32   LYS n 
25 33   PHE n 
25 34   ILE n 
25 35   ILE n 
25 36   GLN n 
25 37   ASP n 
25 38   ILE n 
25 39   ASP n 
25 40   ASP n 
25 41   THR n 
25 42   HIS n 
25 43   VAL n 
25 44   PHE n 
25 45   VAL n 
25 46   ILE n 
25 47   ALA n 
25 48   GLU n 
25 49   LEU n 
25 50   VAL n 
25 51   ASN n 
25 52   VAL n 
25 53   LEU n 
25 54   GLN n 
25 55   GLU n 
25 56   ARG n 
25 57   VAL n 
25 58   GLY n 
25 59   GLU n 
25 60   LEU n 
25 61   MET n 
25 62   ASP n 
25 63   GLN n 
25 64   ASN n 
25 65   ALA n 
25 66   PHE n 
25 67   SER n 
25 68   LEU n 
25 69   THR n 
25 70   GLN n 
25 71   LYS n 
26 1    MET n 
26 2    GLU n 
26 3    SER n 
26 4    THR n 
26 5    PRO n 
26 6    SER n 
26 7    ARG n 
26 8    GLY n 
26 9    LEU n 
26 10   ASN n 
26 11   ARG n 
26 12   VAL n 
26 13   HIS n 
26 14   LEU n 
26 15   GLN n 
26 16   CYS n 
26 17   ARG n 
26 18   ASN n 
26 19   LEU n 
26 20   GLN n 
26 21   GLU n 
26 22   PHE n 
26 23   LEU n 
26 24   GLY n 
26 25   GLY n 
26 26   LEU n 
26 27   SER n 
26 28   PRO n 
26 29   GLY n 
26 30   VAL n 
26 31   LEU n 
26 32   ASP n 
26 33   ARG n 
26 34   LEU n 
26 35   TYR n 
26 36   GLY n 
26 37   HIS n 
26 38   PRO n 
26 39   ALA n 
26 40   THR n 
26 41   CYS n 
26 42   LEU n 
26 43   ALA n 
26 44   VAL n 
26 45   PHE n 
26 46   ARG n 
26 47   GLU n 
26 48   LEU n 
26 49   PRO n 
26 50   SER n 
26 51   LEU n 
26 52   ALA n 
26 53   LYS n 
26 54   ASN n 
26 55   TRP n 
26 56   VAL n 
26 57   MET n 
26 58   ARG n 
26 59   MET n 
26 60   LEU n 
26 61   PHE n 
26 62   LEU n 
26 63   GLU n 
26 64   GLN n 
26 65   PRO n 
26 66   LEU n 
26 67   PRO n 
26 68   GLN n 
26 69   ALA n 
26 70   ALA n 
26 71   VAL n 
26 72   ALA n 
26 73   LEU n 
26 74   TRP n 
26 75   VAL n 
26 76   LYS n 
26 77   LYS n 
26 78   GLU n 
26 79   PHE n 
26 80   SER n 
26 81   LYS n 
26 82   ALA n 
26 83   GLN n 
26 84   GLU n 
26 85   GLU n 
26 86   SER n 
26 87   THR n 
26 88   GLY n 
26 89   LEU n 
26 90   LEU n 
26 91   SER n 
26 92   GLY n 
26 93   LEU n 
26 94   ARG n 
26 95   ILE n 
26 96   TRP n 
26 97   HIS n 
26 98   THR n 
26 99   GLN n 
26 100  LEU n 
26 101  LEU n 
26 102  PRO n 
26 103  GLY n 
26 104  GLY n 
26 105  LEU n 
26 106  GLN n 
26 107  GLY n 
26 108  LEU n 
26 109  ILE n 
26 110  LEU n 
26 111  ASN n 
26 112  PRO n 
26 113  ILE n 
26 114  PHE n 
26 115  ARG n 
26 116  GLN n 
26 117  ASN n 
26 118  LEU n 
26 119  ARG n 
26 120  ILE n 
26 121  ALA n 
26 122  LEU n 
26 123  LEU n 
26 124  GLY n 
26 125  GLY n 
26 126  GLY n 
26 127  LYS n 
26 128  ALA n 
26 129  TRP n 
26 130  SER n 
26 131  ASP n 
26 132  ASP n 
26 133  THR n 
26 134  SER n 
26 135  GLN n 
26 136  LEU n 
26 137  GLY n 
26 138  PRO n 
26 139  ASP n 
26 140  LYS n 
26 141  HIS n 
26 142  ALA n 
26 143  ARG n 
26 144  ASP n 
26 145  VAL n 
26 146  PRO n 
26 147  SER n 
26 148  LEU n 
26 149  ASP n 
26 150  LYS n 
26 151  TYR n 
26 152  ALA n 
26 153  GLU n 
26 154  GLU n 
26 155  ARG n 
26 156  TRP n 
26 157  GLU n 
26 158  VAL n 
26 159  VAL n 
26 160  LEU n 
26 161  HIS n 
26 162  PHE n 
26 163  MET n 
26 164  VAL n 
26 165  GLY n 
26 166  SER n 
26 167  PRO n 
26 168  SER n 
26 169  ALA n 
26 170  ALA n 
26 171  VAL n 
26 172  SER n 
26 173  GLN n 
26 174  ASP n 
26 175  LEU n 
26 176  ALA n 
26 177  GLN n 
26 178  LEU n 
26 179  LEU n 
26 180  SER n 
26 181  GLN n 
26 182  ALA n 
26 183  GLY n 
26 184  LEU n 
26 185  MET n 
26 186  LYS n 
26 187  SER n 
26 188  THR n 
26 189  GLU n 
26 190  PRO n 
26 191  GLY n 
26 192  GLU n 
26 193  PRO n 
26 194  PRO n 
26 195  CYS n 
26 196  ILE n 
26 197  THR n 
26 198  SER n 
26 199  ALA n 
26 200  GLY n 
26 201  PHE n 
26 202  GLN n 
26 203  PHE n 
26 204  LEU n 
26 205  LEU n 
26 206  LEU n 
26 207  ASP n 
26 208  THR n 
26 209  PRO n 
26 210  ALA n 
26 211  GLN n 
26 212  LEU n 
26 213  TRP n 
26 214  TYR n 
26 215  PHE n 
26 216  MET n 
26 217  LEU n 
26 218  GLN n 
26 219  TYR n 
26 220  LEU n 
26 221  GLN n 
26 222  THR n 
26 223  ALA n 
26 224  GLN n 
26 225  SER n 
26 226  ARG n 
26 227  GLY n 
26 228  MET n 
26 229  ASP n 
26 230  LEU n 
26 231  VAL n 
26 232  GLU n 
26 233  ILE n 
26 234  LEU n 
26 235  SER n 
26 236  PHE n 
26 237  LEU n 
26 238  PHE n 
26 239  GLN n 
26 240  LEU n 
26 241  SER n 
26 242  PHE n 
26 243  SER n 
26 244  THR n 
26 245  LEU n 
26 246  GLY n 
26 247  LYS n 
26 248  ASP n 
26 249  TYR n 
26 250  SER n 
26 251  VAL n 
26 252  GLU n 
26 253  GLY n 
26 254  MET n 
26 255  SER n 
26 256  ASP n 
26 257  SER n 
26 258  LEU n 
26 259  LEU n 
26 260  ASN n 
26 261  PHE n 
26 262  LEU n 
26 263  GLN n 
26 264  HIS n 
26 265  LEU n 
26 266  ARG n 
26 267  GLU n 
26 268  PHE n 
26 269  GLY n 
26 270  LEU n 
26 271  VAL n 
26 272  PHE n 
26 273  GLN n 
26 274  ARG n 
26 275  LYS n 
26 276  ARG n 
26 277  LYS n 
26 278  SER n 
26 279  ARG n 
26 280  ARG n 
26 281  TYR n 
26 282  TYR n 
26 283  PRO n 
26 284  THR n 
26 285  ARG n 
26 286  LEU n 
26 287  ALA n 
26 288  ILE n 
26 289  ASN n 
26 290  LEU n 
26 291  SER n 
26 292  SER n 
26 293  GLY n 
26 294  VAL n 
26 295  SER n 
26 296  GLY n 
26 297  ALA n 
26 298  GLY n 
26 299  GLY n 
26 300  THR n 
26 301  VAL n 
26 302  HIS n 
26 303  GLN n 
26 304  PRO n 
26 305  GLY n 
26 306  PHE n 
26 307  ILE n 
26 308  VAL n 
26 309  VAL n 
26 310  GLU n 
26 311  THR n 
26 312  ASN n 
26 313  TYR n 
26 314  ARG n 
26 315  LEU n 
26 316  TYR n 
26 317  ALA n 
26 318  TYR n 
26 319  THR n 
26 320  GLU n 
26 321  SER n 
26 322  GLU n 
26 323  LEU n 
26 324  GLN n 
26 325  ILE n 
26 326  ALA n 
26 327  LEU n 
26 328  ILE n 
26 329  ALA n 
26 330  LEU n 
26 331  PHE n 
26 332  SER n 
26 333  GLU n 
26 334  MET n 
26 335  LEU n 
26 336  TYR n 
26 337  ARG n 
26 338  PHE n 
26 339  PRO n 
26 340  ASN n 
26 341  MET n 
26 342  VAL n 
26 343  VAL n 
26 344  ALA n 
26 345  GLN n 
26 346  VAL n 
26 347  THR n 
26 348  ARG n 
26 349  GLU n 
26 350  SER n 
26 351  VAL n 
26 352  GLN n 
26 353  GLN n 
26 354  ALA n 
26 355  ILE n 
26 356  ALA n 
26 357  SER n 
26 358  GLY n 
26 359  ILE n 
26 360  THR n 
26 361  ALA n 
26 362  GLN n 
26 363  GLN n 
26 364  ILE n 
26 365  ILE n 
26 366  HIS n 
26 367  PHE n 
26 368  LEU n 
26 369  ARG n 
26 370  THR n 
26 371  ARG n 
26 372  ALA n 
26 373  HIS n 
26 374  PRO n 
26 375  VAL n 
26 376  MET n 
26 377  LEU n 
26 378  LYS n 
26 379  GLN n 
26 380  THR n 
26 381  PRO n 
26 382  VAL n 
26 383  LEU n 
26 384  PRO n 
26 385  PRO n 
26 386  THR n 
26 387  ILE n 
26 388  THR n 
26 389  ASP n 
26 390  GLN n 
26 391  ILE n 
26 392  ARG n 
26 393  LEU n 
26 394  TRP n 
26 395  GLU n 
26 396  LEU n 
26 397  GLU n 
26 398  ARG n 
26 399  ASP n 
26 400  ARG n 
26 401  LEU n 
26 402  ARG n 
26 403  PHE n 
26 404  THR n 
26 405  GLU n 
26 406  GLY n 
26 407  VAL n 
26 408  LEU n 
26 409  TYR n 
26 410  ASN n 
26 411  GLN n 
26 412  PHE n 
26 413  LEU n 
26 414  SER n 
26 415  GLN n 
26 416  VAL n 
26 417  ASP n 
26 418  PHE n 
26 419  GLU n 
26 420  LEU n 
26 421  LEU n 
26 422  LEU n 
26 423  ALA n 
26 424  HIS n 
26 425  ALA n 
26 426  ARG n 
26 427  GLU n 
26 428  LEU n 
26 429  GLY n 
26 430  VAL n 
26 431  LEU n 
26 432  VAL n 
26 433  PHE n 
26 434  GLU n 
26 435  ASN n 
26 436  SER n 
26 437  ALA n 
26 438  LYS n 
26 439  ARG n 
26 440  LEU n 
26 441  MET n 
26 442  VAL n 
26 443  VAL n 
26 444  THR n 
26 445  PRO n 
26 446  ALA n 
26 447  GLY n 
26 448  HIS n 
26 449  SER n 
26 450  ASP n 
26 451  VAL n 
26 452  LYS n 
26 453  ARG n 
26 454  PHE n 
26 455  TRP n 
26 456  LYS n 
26 457  ARG n 
26 458  GLN n 
26 459  LYS n 
26 460  HIS n 
26 461  SER n 
26 462  SER n 
27 1    MET n 
27 2    VAL n 
27 3    SER n 
27 4    ASP n 
27 5    GLU n 
27 6    ASP n 
27 7    GLU n 
27 8    LEU n 
27 9    ASN n 
27 10   LEU n 
27 11   LEU n 
27 12   VAL n 
27 13   ILE n 
27 14   VAL n 
27 15   VAL n 
27 16   ASP n 
27 17   ALA n 
27 18   ASN n 
27 19   PRO n 
27 20   ILE n 
27 21   TRP n 
27 22   TRP n 
27 23   GLY n 
27 24   LYS n 
27 25   GLN n 
27 26   ALA n 
27 27   LEU n 
27 28   LYS n 
27 29   GLU n 
27 30   SER n 
27 31   GLN n 
27 32   PHE n 
27 33   THR n 
27 34   LEU n 
27 35   SER n 
27 36   LYS n 
27 37   CYS n 
27 38   ILE n 
27 39   ASP n 
27 40   ALA n 
27 41   VAL n 
27 42   MET n 
27 43   VAL n 
27 44   LEU n 
27 45   GLY n 
27 46   ASN n 
27 47   SER n 
27 48   HIS n 
27 49   LEU n 
27 50   PHE n 
27 51   MET n 
27 52   ASN n 
27 53   ARG n 
27 54   SER n 
27 55   ASN n 
27 56   LYS n 
27 57   LEU n 
27 58   ALA n 
27 59   VAL n 
27 60   ILE n 
27 61   ALA n 
27 62   SER n 
27 63   HIS n 
27 64   ILE n 
27 65   GLN n 
27 66   GLU n 
27 67   SER n 
27 68   ARG n 
27 69   PHE n 
27 70   LEU n 
27 71   TYR n 
27 72   PRO n 
27 73   GLY n 
27 74   LYS n 
27 75   ASN n 
27 76   GLY n 
27 77   ARG n 
27 78   LEU n 
27 79   GLY n 
27 80   ASP n 
27 81   PHE n 
27 82   PHE n 
27 83   GLY n 
27 84   ASP n 
27 85   PRO n 
27 86   GLY n 
27 87   ASN n 
27 88   PRO n 
27 89   PRO n 
27 90   GLU n 
27 91   PHE n 
27 92   ASN n 
27 93   PRO n 
27 94   SER n 
27 95   GLY n 
27 96   SER n 
27 97   LYS n 
27 98   ASP n 
27 99   GLY n 
27 100  LYS n 
27 101  TYR n 
27 102  GLU n 
27 103  LEU n 
27 104  LEU n 
27 105  THR n 
27 106  SER n 
27 107  ALA n 
27 108  ASN n 
27 109  GLU n 
27 110  VAL n 
27 111  ILE n 
27 112  VAL n 
27 113  GLU n 
27 114  GLU n 
27 115  ILE n 
27 116  LYS n 
27 117  ASP n 
27 118  LEU n 
27 119  MET n 
27 120  THR n 
27 121  LYS n 
27 122  SER n 
27 123  ASP n 
27 124  ILE n 
27 125  LYS n 
27 126  GLY n 
27 127  GLN n 
27 128  HIS n 
27 129  THR n 
27 130  GLU n 
27 131  THR n 
27 132  LEU n 
27 133  LEU n 
27 134  ALA n 
27 135  GLY n 
27 136  SER n 
27 137  LEU n 
27 138  ALA n 
27 139  LYS n 
27 140  ALA n 
27 141  LEU n 
27 142  CYS n 
27 143  TYR n 
27 144  ILE n 
27 145  HIS n 
27 146  ARG n 
27 147  MET n 
27 148  ASN n 
27 149  LYS n 
27 150  GLU n 
27 151  VAL n 
27 152  LYS n 
27 153  ASP n 
27 154  ASN n 
27 155  GLN n 
27 156  GLU n 
27 157  MET n 
27 158  LYS n 
27 159  SER n 
27 160  ARG n 
27 161  ILE n 
27 162  LEU n 
27 163  VAL n 
27 164  ILE n 
27 165  LYS n 
27 166  ALA n 
27 167  ALA n 
27 168  GLU n 
27 169  ASP n 
27 170  SER n 
27 171  ALA n 
27 172  LEU n 
27 173  GLN n 
27 174  TYR n 
27 175  MET n 
27 176  ASN n 
27 177  PHE n 
27 178  MET n 
27 179  ASN n 
27 180  VAL n 
27 181  ILE n 
27 182  PHE n 
27 183  ALA n 
27 184  ALA n 
27 185  GLN n 
27 186  LYS n 
27 187  GLN n 
27 188  ASN n 
27 189  ILE n 
27 190  LEU n 
27 191  ILE n 
27 192  ASP n 
27 193  ALA n 
27 194  CYS n 
27 195  VAL n 
27 196  LEU n 
27 197  ASP n 
27 198  SER n 
27 199  ASP n 
27 200  SER n 
27 201  GLY n 
27 202  LEU n 
27 203  LEU n 
27 204  GLN n 
27 205  GLN n 
27 206  ALA n 
27 207  CYS n 
27 208  ASP n 
27 209  ILE n 
27 210  THR n 
27 211  GLY n 
27 212  GLY n 
27 213  LEU n 
27 214  TYR n 
27 215  LEU n 
27 216  LYS n 
27 217  VAL n 
27 218  PRO n 
27 219  GLN n 
27 220  MET n 
27 221  PRO n 
27 222  SER n 
27 223  LEU n 
27 224  LEU n 
27 225  GLN n 
27 226  TYR n 
27 227  LEU n 
27 228  LEU n 
27 229  TRP n 
27 230  VAL n 
27 231  PHE n 
27 232  LEU n 
27 233  PRO n 
27 234  ASP n 
27 235  GLN n 
27 236  ASP n 
27 237  GLN n 
27 238  ARG n 
27 239  SER n 
27 240  GLN n 
27 241  LEU n 
27 242  ILE n 
27 243  LEU n 
27 244  PRO n 
27 245  PRO n 
27 246  PRO n 
27 247  VAL n 
27 248  HIS n 
27 249  VAL n 
27 250  ASP n 
27 251  TYR n 
27 252  ARG n 
27 253  ALA n 
27 254  ALA n 
27 255  CYS n 
27 256  PHE n 
27 257  CYS n 
27 258  HIS n 
27 259  ARG n 
27 260  ASN n 
27 261  LEU n 
27 262  ILE n 
27 263  GLU n 
27 264  ILE n 
27 265  GLY n 
27 266  TYR n 
27 267  VAL n 
27 268  CYS n 
27 269  SER n 
27 270  VAL n 
27 271  CYS n 
27 272  LEU n 
27 273  SER n 
27 274  ILE n 
27 275  PHE n 
27 276  CYS n 
27 277  ASN n 
27 278  PHE n 
27 279  SER n 
27 280  PRO n 
27 281  ILE n 
27 282  CYS n 
27 283  THR n 
27 284  THR n 
27 285  CYS n 
27 286  GLU n 
27 287  THR n 
27 288  ALA n 
27 289  PHE n 
27 290  LYS n 
27 291  ILE n 
27 292  SER n 
27 293  LEU n 
27 294  PRO n 
27 295  PRO n 
27 296  VAL n 
27 297  LEU n 
27 298  LYS n 
27 299  ALA n 
27 300  LYS n 
27 301  LYS n 
27 302  LYS n 
27 303  LYS n 
27 304  LEU n 
27 305  LYS n 
27 306  VAL n 
27 307  SER n 
27 308  ALA n 
28 1    DG  n 
28 2    DA  n 
28 3    DA  n 
28 4    DG  n 
28 5    DG  n 
28 6    DG  n 
28 7    DC  n 
28 8    DG  n 
28 9    DC  n 
28 10   DC  n 
28 11   DT  n 
28 12   DA  n 
28 13   DT  n 
28 14   DA  n 
28 15   DA  n 
28 16   DA  n 
28 17   DA  n 
28 18   DG  n 
28 19   DG  n 
28 20   DG  n 
28 21   DG  n 
28 22   DG  n 
28 23   DT  n 
28 24   DG  n 
28 25   DG  n 
28 26   DG  n 
28 27   DG  n 
28 28   DG  n 
28 29   DC  n 
28 30   DG  n 
28 31   DT  n 
28 32   DT  n 
28 33   DT  n 
28 34   DT  n 
28 35   DT  n 
28 36   DT  n 
28 37   DT  n 
28 38   DT  n 
28 39   DT  n 
28 40   DT  n 
28 41   DT  n 
28 42   DT  n 
28 43   DT  n 
28 44   DT  n 
28 45   DT  n 
28 46   DT  n 
28 47   DT  n 
28 48   DT  n 
28 49   DT  n 
28 50   DT  n 
28 51   DC  n 
28 52   DG  n 
28 53   DA  n 
28 54   DA  n 
28 55   DC  n 
28 56   DA  n 
28 57   DC  n 
28 58   DT  n 
28 59   DC  n 
28 60   DG  n 
28 61   DA  n 
28 62   DG  n 
28 63   DC  n 
28 64   DC  n 
28 65   DG  n 
28 66   DA  n 
28 67   DG  n 
28 68   DC  n 
28 69   DA  n 
28 70   DG  n 
28 71   DA  n 
28 72   DC  n 
28 73   DG  n 
28 74   DT  n 
28 75   DG  n 
28 76   DC  n 
28 77   DC  n 
28 78   DT  n 
28 79   DA  n 
28 80   DC  n 
28 81   DG  n 
28 82   DG  n 
28 83   DA  n 
29 1    DT  n 
29 2    DC  n 
29 3    DC  n 
29 4    DG  n 
29 5    DT  n 
29 6    DA  n 
29 7    DG  n 
29 8    DG  n 
29 9    DC  n 
29 10   DA  n 
29 11   DC  n 
29 12   DG  n 
29 13   DT  n 
29 14   DC  n 
29 15   DT  n 
29 16   DG  n 
29 17   DC  n 
29 18   DT  n 
29 19   DC  n 
29 20   DG  n 
29 21   DG  n 
29 22   DC  n 
29 23   DT  n 
29 24   DC  n 
29 25   DG  n 
29 26   DA  n 
29 27   DG  n 
29 28   DT  n 
29 29   DG  n 
29 30   DT  n 
29 31   DT  n 
29 32   DC  n 
29 33   DG  n 
29 34   DA  n 
29 35   DT  n 
29 36   DC  n 
29 37   DG  n 
29 38   DC  n 
29 39   DG  n 
29 40   DA  n 
29 41   DC  n 
29 42   DT  n 
29 43   DG  n 
29 44   DA  n 
29 45   DG  n 
29 46   DG  n 
29 47   DA  n 
29 48   DC  n 
29 49   DG  n 
29 50   DA  n 
29 51   DA  n 
29 52   DC  n 
29 53   DG  n 
29 54   DC  n 
29 55   DG  n 
29 56   DC  n 
29 57   DC  n 
29 58   DC  n 
29 59   DC  n 
29 60   DC  n 
29 61   DA  n 
29 62   DC  n 
29 63   DC  n 
29 64   DC  n 
29 65   DC  n 
29 66   DC  n 
29 67   DT  n 
29 68   DT  n 
29 69   DC  n 
29 70   DT  n 
29 71   DA  n 
29 72   DT  n 
29 73   DA  n 
29 74   DG  n 
29 75   DG  n 
29 76   DC  n 
29 77   DG  n 
29 78   DC  n 
29 79   DC  n 
29 80   DC  n 
29 81   DT  n 
29 82   DT  n 
29 83   DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
9  1 sample 'Biological sequence' 1 125 Human ? POLR2I                     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 'Biological sequence' 1 316 Human ? 'GTF2B, TF2B, TFIIB'       ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample 'Biological sequence' 1 376 Human ? 'GTF2A1, TF2A1'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample 'Biological sequence' 1 109 Human ? 'GTF2A2, TF2A2'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample 'Biological sequence' 1 339 Human ? 'TBP, GTF2D1, TF2D, TFIID' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample 'Biological sequence' 1 439 Human ? 'GTF2E1, TF2E1'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample 'Biological sequence' 1 291 Human ? 'GTF2E2, TF2E2'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample 'Biological sequence' 1 517 Human ? 'GTF2F1, RAP74'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample 'Biological sequence' 1 249 Human ? 'GTF2F2, RAP30'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample 'Biological sequence' 1 301 Human ? 'TCEA1, GTF2S, TFIIS'      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 1970 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 1 1174 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1 275  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1 142  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 210  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 127  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 172  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 150  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 67   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 117  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 58   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample 1 782  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample 1 760  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample 1 395  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample 1 71   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample 1 462  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample 1 308  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
28 1 sample 1 83 'Homo sapiens' Human 9606 ? 
29 1 sample 1 83 'Homo sapiens' Human 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP RPB1_HUMAN  P24928 ? 1  
;MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTE
CPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEM
DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDN
ELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNID
RLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEV
MNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGIL
CKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPF
GFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVR
NSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLL
FNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLG
VPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMD
DDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSN
DIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPW
NQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAY
EPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSP
SYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYT
PTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN
;
1 
2  UNP RPB2_HUMAN  P30876 ? 2  
;MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEE
PPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTY
CLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNF
IGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLL
AFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAA
IADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHI
DQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSA
VDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDEL
ESTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQ
IFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCN
LCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
;
1 
3  UNP RPB3_HUMAN  P19387 ? 3  
;MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLISDDIVD
KLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELR
LRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
;
1 
4  UNP RPB4_HUMAN  O15514 ? 4  
;MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETI
ASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
;
1 
5  UNP RPAB1_HUMAN P19388 ? 5  
;MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEP
KVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELL
ARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
;
1 
6  UNP RPAB2_HUMAN P61218 ? 6  
;MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVM
VELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
;
1 
7  UNP RPB7_HUMAN  P62487 ? 7  
;MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPF
KGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAI
GSLMDDYLGLVS
;
1 
8  UNP RPAB3_HUMAN P52434 ? 8  
;MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDD
RPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
;
1 
9  UNP RPB9_HUMAN  P36954 ? 9  
;MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPR
TEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE
;
1 
10 UNP RPAB5_HUMAN P62875 ? 10 MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK 1 
11 UNP RPB11_HUMAN P52435 ? 11 
;MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPD
YSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
;
1 
12 UNP RPAB4_HUMAN P53803 ? 12 MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR 1 
13 UNP TF2B_HUMAN  Q00403 ? 13 
;MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDL
STMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIA
SACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL
;
1 
14 UNP TF2AA_HUMAN P52655 ? 14 
;MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQ
HHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSG
QLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTV
AAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDV
SDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
;
1 
15 UNP T2AG_HUMAN  P52657 ? 15 
;MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVE
FREVTELIKVDKVKIVACDGKNTGSNTTE
;
1 
16 UNP TBP_HUMAN   P20226 ? 16 
;MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSG
IVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV
VQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAE
IYEAFENIYPILKGFRKTT
;
1 
17 UNP T2EA_HUMAN  P29083 ? 17 
;MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVET
AADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTE
VEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDHAATTAGAASLAGGHHREAWA
TKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIWLRESTVQGAYGSEDMKEGGIDMDAFQEREEGHAGPDDNEE
VMRALLIHEKKTSSAMAGSVGAAAPVTAANGSDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAG
RPFSYSEVSQRPELVAQMTPEEKEAYIAMGQRMFEDLFE
;
1 
18 UNP T2EB_HUMAN  P29084 ? 18 
;MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAK
IVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVRDKKALLRLLDQHDQ
RGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQ
GISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK
;
1 
19 UNP T2FA_HUMAN  P35269 ? 19 
;MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEAR
RKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEA
EEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPL
AKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEED
KEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSST
LRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTK
KTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
;
1 
20 UNP T2FB_HUMAN  P13984 ? 20 
;MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPRE
HPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQ
YNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYR
HYQGEEKSD
;
1 
21 UNP TCEA1_HUMAN P23193 ? 21 
;MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGP
STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIA
IGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL
TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC
;
1 
22 UNP ERCC3_HUMAN P19447 ? 22 
;MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAP
DGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCT
VSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQG
KSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQ
EKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKP
IGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDL
NFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIV
FADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRL
GRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAAT
DLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRFRK
;
1 
23 UNP ERCC2_HUMAN P18074 ? 23 
;MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEI
EKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEE
FDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNID
NVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVP
GSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLL
ANFATLVSTYAKGFTIIIEPFDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMAT
FTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILEN
IQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYL
RDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYF
LRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL
;
1 
24 UNP TF2H2_HUMAN Q13888 ? 24 
;MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNR
LTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMP
GHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLAR
SYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV
;
1 
25 UNP TF2H5_HUMAN Q6ZYL4 ? 25 MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK 1 
26 UNP TF2H4_HUMAN Q92759 ? 26 
;MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFS
KAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL
HFMVGSPSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQL
SFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGTVHQPGFIVVETNYRLYAYTE
SELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDR
LRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
;
1 
27 UNP TF2H3_HUMAN Q13889 ? 27 
;MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGD
FFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSR
ILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQ
LILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA
;
1 
28 PDB 5IY8        5IY8   ? 28 ? 1 
29 PDB 5IY8        5IY8   ? 29 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  5IY8 A 1 ? 1970 ? P24928 1  ? 1970 ? 1  1970 
2  2  5IY8 B 1 ? 1174 ? P30876 1  ? 1174 ? 1  1174 
3  3  5IY8 C 1 ? 275  ? P19387 1  ? 275  ? 1  275  
4  4  5IY8 D 1 ? 142  ? O15514 1  ? 142  ? 1  142  
5  5  5IY8 E 1 ? 210  ? P19388 1  ? 210  ? 1  210  
6  6  5IY8 F 1 ? 127  ? P61218 1  ? 127  ? 1  127  
7  7  5IY8 G 1 ? 172  ? P62487 1  ? 172  ? 1  172  
8  8  5IY8 H 1 ? 150  ? P52434 1  ? 150  ? 1  150  
9  9  5IY8 I 1 ? 125  ? P36954 1  ? 125  ? 1  125  
10 10 5IY8 J 1 ? 67   ? P62875 1  ? 67   ? 1  67   
11 11 5IY8 K 1 ? 117  ? P52435 1  ? 117  ? 1  117  
12 12 5IY8 L 1 ? 58   ? P53803 1  ? 58   ? 1  58   
13 13 5IY8 M 1 ? 316  ? Q00403 1  ? 316  ? 1  316  
14 14 5IY8 N 1 ? 376  ? P52655 1  ? 376  ? 1  376  
15 15 5IY8 O 1 ? 109  ? P52657 1  ? 109  ? 1  109  
16 16 5IY8 P 1 ? 339  ? P20226 1  ? 339  ? 1  339  
17 17 5IY8 Q 1 ? 439  ? P29083 1  ? 439  ? 1  439  
18 18 5IY8 R 1 ? 291  ? P29084 1  ? 291  ? 1  291  
19 19 5IY8 S 1 ? 517  ? P35269 1  ? 517  ? 1  517  
20 20 5IY8 T 1 ? 249  ? P13984 1  ? 249  ? 1  249  
21 21 5IY8 U 1 ? 301  ? P23193 1  ? 301  ? 1  301  
22 22 5IY8 V 1 ? 782  ? P19447 1  ? 782  ? 1  782  
23 23 5IY8 W 1 ? 760  ? P18074 1  ? 760  ? 1  760  
24 24 5IY8 0 1 ? 395  ? Q13888 1  ? 395  ? 1  395  
25 25 5IY8 1 1 ? 71   ? Q6ZYL4 1  ? 71   ? 1  71   
26 26 5IY8 2 1 ? 462  ? Q92759 1  ? 462  ? 1  462  
27 27 5IY8 3 1 ? 308  ? Q13889 1  ? 308  ? 1  308  
28 28 5IY8 X 1 ? 83   ? 5IY8   1  ? 83   ? 1  83   
29 29 5IY8 Y 1 ? 83   ? 5IY8   11 ? 93   ? 11 93   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5IY8 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5IY8 
_struct.title                        'Human holo-PIC in the initial transcribing state' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase II subunit RPB1, DNA-directed RNA polymerase II subunit RPB2, DNA-directed RNA polymerase II subunit RPB3, DNA-directed RNA polymerase II subunit RPB4, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerase II subunit RPB7, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase II subunit RPB9, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerase II subunit RPB11-a, DNA-directed RNA polymerases I, II, and III subunit RPABC4, Transcription initiation factor IIB, Transcription initiation factor IIA subunit 1, Transcription initiation factor IIA subunit 2, TATA-box-binding protein, General transcription factor IIE subunit 1, Transcription initiation factor IIE subunit beta, General transcription factor IIF subunit 1, General transcription factor IIF subunit 2, Transcription elongation factor A protein 1, TFIIH basal transcription factor complex helicase XPB subunit, TFIIH basal transcription factor complex helicase XPD subunit, General transcription factor IIH subunit 2, General transcription factor IIH subunit 5, General transcription factor IIH subunit 4, General transcription factor IIH subunit 3/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5IY8 
_struct_keywords.text            'initiation, RNA polymerase II, human, TRANSCRIPTION, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION, TRANSFERASE/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 30 ? 
FA N N 31 ? 
GA N N 31 ? 
HA N N 31 ? 
IA N N 31 ? 
JA N N 31 ? 
KA N N 31 ? 
LA N N 31 ? 
MA N N 31 ? 
NA N N 31 ? 
OA N N 31 ? 
PA N N 31 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER A  27   ? SER A  35   ? SER A 27   SER A 35   1 ? 9  
HELX_P HELX_P2   AA2 PHE A  99   ? VAL A  110  ? PHE A 99   VAL A 110  1 ? 12 
HELX_P HELX_P3   AA3 ASN A  123  ? LYS A  132  ? ASN A 123  LYS A 132  1 ? 10 
HELX_P HELX_P4   AA4 GLN A  136  ? LYS A  151  ? GLN A 136  LYS A 151  1 ? 16 
HELX_P HELX_P5   AA5 SER A  217  ? ILE A  228  ? SER A 217  ILE A 228  1 ? 12 
HELX_P HELX_P6   AA6 SER A  229  ? GLY A  237  ? SER A 229  GLY A 237  1 ? 9  
HELX_P HELX_P7   AA7 ARG A  244  ? TRP A  247  ? ARG A 244  TRP A 247  5 ? 4  
HELX_P HELX_P8   AA8 PRO A  257  ? ARG A  261  ? PRO A 257  ARG A 261  5 ? 5  
HELX_P HELX_P9   AA9 ASP A  274  ? ASN A  296  ? ASP A 274  ASN A 296  1 ? 23 
HELX_P HELX_P10  AB1 ALA A  300  ? ASP A  319  ? ALA A 300  ASP A 319  1 ? 20 
HELX_P HELX_P11  AB2 SER A  338  ? GLY A  345  ? SER A 338  GLY A 345  1 ? 8  
HELX_P HELX_P12  AB3 GLY A  348  ? ASN A  353  ? GLY A 348  ASN A 353  1 ? 6  
HELX_P HELX_P13  AB4 ARG A  382  ? MET A  388  ? ARG A 382  MET A 388  1 ? 7  
HELX_P HELX_P14  AB5 ASN A  398  ? GLY A  409  ? ASN A 398  GLY A 409  1 ? 12 
HELX_P HELX_P15  AB6 LYS A  434  ? LEU A  438  ? LYS A 434  LEU A 438  5 ? 5  
HELX_P HELX_P16  AB7 HIS A  465  ? MET A  469  ? HIS A 465  MET A 469  5 ? 5  
HELX_P HELX_P17  AB8 LEU A  486  ? THR A  490  ? LEU A 486  THR A 490  5 ? 5  
HELX_P HELX_P18  AB9 SER A  508  ? LEU A  518  ? SER A 508  LEU A 518  1 ? 11 
HELX_P HELX_P19  AC1 MET A  520  ? MET A  524  ? MET A 520  MET A 524  5 ? 5  
HELX_P HELX_P20  AC2 GLN A  539  ? LYS A  550  ? GLN A 539  LYS A 550  1 ? 12 
HELX_P HELX_P21  AC3 GLU A  556  ? LEU A  567  ? GLU A 556  LEU A 567  1 ? 12 
HELX_P HELX_P22  AC4 GLY A  588  ? ILE A  596  ? GLY A 588  ILE A 596  1 ? 9  
HELX_P HELX_P23  AC5 CYS A  641  ? GLY A  646  ? CYS A 641  GLY A 646  1 ? 6  
HELX_P HELX_P24  AC6 SER A  651  ? GLY A  661  ? SER A 651  GLY A 661  1 ? 11 
HELX_P HELX_P25  AC7 GLY A  661  ? GLY A  684  ? GLY A 661  GLY A 684  1 ? 24 
HELX_P HELX_P26  AC8 GLY A  688  ? SER A  692  ? GLY A 688  SER A 692  5 ? 5  
HELX_P HELX_P27  AC9 ASP A  695  ? ASN A  722  ? ASP A 695  ASN A 722  1 ? 28 
HELX_P HELX_P28  AD1 THR A  732  ? LEU A  760  ? THR A 732  LEU A 760  1 ? 29 
HELX_P HELX_P29  AD2 ASN A  764  ? SER A  772  ? ASN A 764  SER A 772  1 ? 9  
HELX_P HELX_P30  AD3 SER A  777  ? ALA A  786  ? SER A 777  ALA A 786  1 ? 10 
HELX_P HELX_P31  AD4 PRO A  817  ? ARG A  820  ? PRO A 817  ARG A 820  5 ? 4  
HELX_P HELX_P32  AD5 THR A  832  ? GLU A  869  ? THR A 832  GLU A 869  1 ? 38 
HELX_P HELX_P33  AD6 ARG A  890  ? ASP A  894  ? ARG A 890  ASP A 894  5 ? 5  
HELX_P HELX_P34  AD7 ALA A  907  ? LYS A  910  ? ALA A 907  LYS A 910  5 ? 4  
HELX_P HELX_P35  AD8 SER A  912  ? ARG A  921  ? SER A 912  ARG A 921  1 ? 10 
HELX_P HELX_P36  AD9 ASP A  937  ? LEU A  943  ? ASP A 937  LEU A 943  5 ? 7  
HELX_P HELX_P37  AE1 ASN A  945  ? PHE A  970  ? ASN A 945  PHE A 970  1 ? 26 
HELX_P HELX_P38  AE2 ASN A  982  ? PHE A  994  ? ASN A 982  PHE A 994  1 ? 13 
HELX_P HELX_P39  AE3 HIS A  1005 ? LEU A  1020 ? HIS A 1005 LEU A 1020 1 ? 16 
HELX_P HELX_P40  AE4 ASP A  1027 ? THR A  1038 ? ASP A 1027 THR A 1038 1 ? 12 
HELX_P HELX_P41  AE5 THR A  1038 ? LEU A  1049 ? THR A 1038 LEU A 1049 1 ? 12 
HELX_P HELX_P42  AE6 CYS A  1050 ? GLU A  1057 ? CYS A 1050 GLU A 1057 1 ? 8  
HELX_P HELX_P43  AE7 SER A  1061 ? ILE A  1080 ? SER A 1061 ILE A 1080 1 ? 20 
HELX_P HELX_P44  AE8 MET A  1086 ? GLN A  1101 ? MET A 1086 GLN A 1101 1 ? 16 
HELX_P HELX_P45  AE9 GLY A  1120 ? ILE A  1130 ? GLY A 1120 ILE A 1130 1 ? 11 
HELX_P HELX_P46  AF1 GLY A  1145 ? ASP A  1150 ? GLY A 1145 ASP A 1150 1 ? 6  
HELX_P HELX_P47  AF2 ASP A  1150 ? GLU A  1162 ? ASP A 1150 GLU A 1162 1 ? 13 
HELX_P HELX_P48  AF3 LEU A  1166 ? VAL A  1169 ? LEU A 1166 VAL A 1169 1 ? 4  
HELX_P HELX_P49  AF4 ASN A  1180 ? THR A  1184 ? ASN A 1180 THR A 1184 5 ? 5  
HELX_P HELX_P50  AF5 ASP A  1189 ? TYR A  1196 ? ASP A 1189 TYR A 1196 1 ? 8  
HELX_P HELX_P51  AF6 PHE A  1202 ? ARG A  1206 ? PHE A 1202 ARG A 1206 5 ? 5  
HELX_P HELX_P52  AF7 ASP A  1217 ? ARG A  1224 ? ASP A 1217 ARG A 1224 1 ? 8  
HELX_P HELX_P53  AF8 THR A  1227 ? GLY A  1240 ? THR A 1227 GLY A 1240 1 ? 14 
HELX_P HELX_P54  AF9 ASP A  1280 ? MET A  1296 ? ASP A 1280 MET A 1296 1 ? 17 
HELX_P HELX_P55  AG1 SER A  1342 ? LEU A  1347 ? SER A 1342 LEU A 1347 1 ? 6  
HELX_P HELX_P56  AG2 ASP A  1361 ? SER A  1387 ? ASP A 1361 SER A 1387 1 ? 27 
HELX_P HELX_P57  AG3 ASN A  1394 ? THR A  1406 ? ASN A 1394 THR A 1406 1 ? 13 
HELX_P HELX_P58  AG4 THR A  1415 ? ASN A  1420 ? THR A 1415 ASN A 1420 1 ? 6  
HELX_P HELX_P59  AG5 GLY A  1425 ? SER A  1431 ? GLY A 1425 SER A 1431 1 ? 7  
HELX_P HELX_P60  AG6 THR A  1435 ? GLY A  1446 ? THR A 1435 GLY A 1446 1 ? 12 
HELX_P HELX_P61  AG7 GLY A  1453 ? GLY A  1461 ? GLY A 1453 GLY A 1461 1 ? 9  
HELX_P HELX_P62  AG8 ALA A  1466 ? GLY A  1469 ? ALA A 1466 GLY A 1469 5 ? 4  
HELX_P HELX_P63  AG9 ASP A  1476 ? MET A  1484 ? ASP A 1476 MET A 1484 1 ? 9  
HELX_P HELX_P64  AH1 TRP B  22   ? LYS B  37   ? TRP B 22   LYS B 37   1 ? 16 
HELX_P HELX_P65  AH2 VAL B  40   ? MET B  53   ? VAL B 40   MET B 53   1 ? 14 
HELX_P HELX_P66  AH3 MET B  53   ? ALA B  62   ? MET B 53   ALA B 62   1 ? 10 
HELX_P HELX_P67  AH4 MET B  109  ? ARG B  116  ? MET B 109  ARG B 116  1 ? 8  
HELX_P HELX_P68  AH5 CYS B  161  ? GLY B  165  ? CYS B 161  GLY B 165  5 ? 5  
HELX_P HELX_P69  AH6 THR B  167  ? LEU B  174  ? THR B 167  LEU B 174  1 ? 8  
HELX_P HELX_P70  AH7 ILE B  269  ? GLY B  277  ? ILE B 269  GLY B 277  1 ? 9  
HELX_P HELX_P71  AH8 SER B  280  ? ILE B  289  ? SER B 280  ILE B 289  1 ? 10 
HELX_P HELX_P72  AH9 ASP B  294  ? PHE B  309  ? ASP B 294  PHE B 309  1 ? 16 
HELX_P HELX_P73  AI1 GLU B  313  ? ALA B  326  ? GLU B 313  ALA B 326  1 ? 14 
HELX_P HELX_P74  AI2 LYS B  332  ? GLU B  346  ? LYS B 332  GLU B 346  1 ? 15 
HELX_P HELX_P75  AI3 LEU B  348  ? GLY B  352  ? LEU B 348  GLY B 352  5 ? 5  
HELX_P HELX_P76  AI4 SER B  354  ? PHE B  356  ? SER B 354  PHE B 356  5 ? 3  
HELX_P HELX_P77  AI5 CYS B  357  ? GLY B  378  ? CYS B 357  GLY B 378  1 ? 22 
HELX_P HELX_P78  AI6 HIS B  387  ? GLY B  389  ? HIS B 387  GLY B 389  5 ? 3  
HELX_P HELX_P79  AI7 LEU B  395  ? GLY B  426  ? LEU B 395  GLY B 426  1 ? 32 
HELX_P HELX_P80  AI8 ASN B  430  ? ILE B  435  ? ASN B 430  ILE B 435  1 ? 6  
HELX_P HELX_P81  AI9 THR B  437  ? GLY B  451  ? THR B 437  GLY B 451  1 ? 15 
HELX_P HELX_P82  AJ1 THR B  474  ? ARG B  483  ? THR B 474  ARG B 483  1 ? 10 
HELX_P HELX_P83  AJ2 HIS B  502  ? TRP B  506  ? HIS B 502  TRP B 506  5 ? 5  
HELX_P HELX_P84  AJ3 PRO B  538  ? TRP B  548  ? PRO B 538  TRP B 548  1 ? 11 
HELX_P HELX_P85  AJ4 GLU B  554  ? ILE B  556  ? GLU B 554  ILE B 556  5 ? 3  
HELX_P HELX_P86  AJ5 SER B  557  ? ILE B  561  ? SER B 557  ILE B 561  5 ? 5  
HELX_P HELX_P87  AJ6 ASP B  579  ? GLN B  593  ? ASP B 579  GLN B 593  1 ? 15 
HELX_P HELX_P88  AJ7 ILE B  597  ? VAL B  601  ? ILE B 597  VAL B 601  5 ? 5  
HELX_P HELX_P89  AJ8 LYS B  636  ? ARG B  646  ? LYS B 636  ARG B 646  1 ? 11 
HELX_P HELX_P90  AJ9 SER B  652  ? SER B  659  ? SER B 652  SER B 659  1 ? 8  
HELX_P HELX_P91  AK1 THR B  678  ? LYS B  685  ? THR B 678  LYS B 685  1 ? 8  
HELX_P HELX_P92  AK2 HIS B  699  ? LEU B  704  ? HIS B 699  LEU B 704  5 ? 6  
HELX_P HELX_P93  AK3 VAL B  706  ? ILE B  710  ? VAL B 706  ILE B 710  5 ? 5  
HELX_P HELX_P94  AK4 PHE B  713  ? ASN B  717  ? PHE B 713  ASN B 717  5 ? 5  
HELX_P HELX_P95  AK5 GLN B  718  ? LYS B  730  ? GLN B 718  LYS B 730  1 ? 13 
HELX_P HELX_P96  AK6 ASN B  739  ? ARG B  743  ? ASN B 739  ARG B 743  5 ? 5  
HELX_P HELX_P97  AK7 THR B  761  ? GLU B  765  ? THR B 761  GLU B 765  5 ? 5  
HELX_P HELX_P98  AK8 ARG B  798  ? ARG B  803  ? ARG B 798  ARG B 803  1 ? 6  
HELX_P HELX_P99  AK9 PRO B  969  ? ILE B  972  ? PRO B 969  ILE B 972  5 ? 4  
HELX_P HELX_P100 AL1 ILE B  978  ? GLY B  994  ? ILE B 978  GLY B 994  1 ? 17 
HELX_P HELX_P101 AL2 VAL B  1006 ? GLY B  1019 ? VAL B 1006 GLY B 1019 1 ? 14 
HELX_P HELX_P102 AL3 MET B  1054 ? ILE B  1059 ? MET B 1054 ILE B 1059 1 ? 6  
HELX_P HELX_P103 AL4 GLY B  1077 ? ASP B  1081 ? GLY B 1077 ASP B 1081 5 ? 5  
HELX_P HELX_P104 AL5 GLY B  1087 ? GLY B  1098 ? GLY B 1087 GLY B 1098 1 ? 12 
HELX_P HELX_P105 AL6 ALA B  1099 ? LEU B  1107 ? ALA B 1099 LEU B 1107 1 ? 9  
HELX_P HELX_P106 AL7 PRO B  1152 ? MET B  1165 ? PRO B 1152 MET B 1165 1 ? 14 
HELX_P HELX_P107 AL8 ASP C  27   ? GLU C  41   ? ASP C 27   GLU C 41   1 ? 15 
HELX_P HELX_P108 AL9 HIS C  60   ? ILE C  71   ? HIS C 60   ILE C 71   1 ? 12 
HELX_P HELX_P109 AM1 HIS C  173  ? ASN C  177  ? HIS C 173  ASN C 177  5 ? 5  
HELX_P HELX_P110 AM2 LYS C  199  ? TRP C  203  ? LYS C 199  TRP C 203  5 ? 5  
HELX_P HELX_P111 AM3 ARG C  240  ? SER C  269  ? ARG C 240  SER C 269  1 ? 30 
HELX_P HELX_P112 AM4 ASP D  16   ? LEU D  20   ? ASP D 16   LEU D 20   5 ? 5  
HELX_P HELX_P113 AM5 PRO D  23   ? THR D  28   ? PRO D 23   THR D 28   1 ? 6  
HELX_P HELX_P114 AM6 LEU D  33   ? GLU D  52   ? LEU D 33   GLU D 52   1 ? 20 
HELX_P HELX_P115 AM7 SER D  58   ? PHE D  71   ? SER D 58   PHE D 71   1 ? 14 
HELX_P HELX_P116 AM8 ASN D  76   ? GLN D  89   ? ASN D 76   GLN D 89   1 ? 14 
HELX_P HELX_P117 AM9 HIS D  93   ? CYS D  104  ? HIS D 93   CYS D 104  1 ? 12 
HELX_P HELX_P118 AN1 THR D  107  ? ILE D  115  ? THR D 107  ILE D 115  1 ? 9  
HELX_P HELX_P119 AN2 PRO D  116  ? GLU D  119  ? PRO D 116  GLU D 119  5 ? 4  
HELX_P HELX_P120 AN3 GLU D  123  ? ARG D  138  ? GLU D 123  ARG D 138  1 ? 16 
HELX_P HELX_P121 AN4 ASP E  2    ? GLY E  25   ? ASP E 2    GLY E 25   1 ? 24 
HELX_P HELX_P122 AN5 THR E  29   ? GLN E  35   ? THR E 29   GLN E 35   1 ? 7  
HELX_P HELX_P123 AN6 THR E  36   ? SER E  44   ? THR E 36   SER E 44   1 ? 9  
HELX_P HELX_P124 AN7 PRO E  53   ? THR E  59   ? PRO E 53   THR E 59   1 ? 7  
HELX_P HELX_P125 AN8 GLY E  83   ? ASN E  98   ? GLY E 83   ASN E 98   1 ? 16 
HELX_P HELX_P126 AN9 THR E  111  ? ALA E  122  ? THR E 111  ALA E 122  1 ? 12 
HELX_P HELX_P127 AO1 GLN E  132  ? LEU E  136  ? GLN E 132  LEU E 136  1 ? 5  
HELX_P HELX_P128 AO2 ASN E  138  ? HIS E  142  ? ASN E 138  HIS E 142  5 ? 5  
HELX_P HELX_P129 AO3 THR E  152  ? LYS E  164  ? THR E 152  LYS E 164  1 ? 13 
HELX_P HELX_P130 AO4 ARG E  166  ? LEU E  170  ? ARG E 166  LEU E 170  5 ? 5  
HELX_P HELX_P131 AO5 ASP E  177  ? GLY E  184  ? ASP E 177  GLY E 184  1 ? 8  
HELX_P HELX_P132 AO6 THR F  58   ? MET F  75   ? THR F 58   MET F 75   1 ? 18 
HELX_P HELX_P133 AO7 ASP F  88   ? ARG F  100  ? ASP F 88   ARG F 100  1 ? 13 
HELX_P HELX_P134 AO8 ASP F  121  ? LEU F  123  ? ASP F 121  LEU F 123  5 ? 3  
HELX_P HELX_P135 AO9 HIS G  14   ? PHE G  18   ? HIS G 14   PHE G 18   5 ? 5  
HELX_P HELX_P136 AP1 ASN G  21   ? GLU G  35   ? ASN G 21   GLU G 35   1 ? 15 
HELX_P HELX_P137 AP2 HIS G  111  ? ILE G  113  ? HIS G 111  ILE G 113  5 ? 3  
HELX_P HELX_P138 AP3 ASN H  130  ? GLY H  134  ? ASN H 130  GLY H 134  5 ? 5  
HELX_P HELX_P139 AP4 ILE I  69   ? ASP I  75   ? ILE I 69   ASP I 75   5 ? 7  
HELX_P HELX_P140 AP5 VAL J  14   ? ASN J  16   ? VAL J 14   ASN J 16   5 ? 3  
HELX_P HELX_P141 AP6 LYS J  17   ? GLU J  28   ? LYS J 17   GLU J 28   1 ? 12 
HELX_P HELX_P142 AP7 THR J  30   ? LEU J  38   ? THR J 30   LEU J 38   1 ? 9  
HELX_P HELX_P143 AP8 ARG J  42   ? ALA J  51   ? ARG J 42   ALA J 51   1 ? 10 
HELX_P HELX_P144 AP9 LEU J  55   ? ASN J  61   ? LEU J 55   ASN J 61   1 ? 7  
HELX_P HELX_P145 AQ1 PRO K  5    ? PHE K  10   ? PRO K 5    PHE K 10   5 ? 6  
HELX_P HELX_P146 AQ2 ASP K  39   ? ASP K  53   ? ASP K 39   ASP K 53   1 ? 15 
HELX_P HELX_P147 AQ3 SER K  82   ? LYS K  110  ? SER K 82   LYS K 110  1 ? 29 
HELX_P HELX_P148 AQ4 ASP M  111  ? ILE M  128  ? ASP M 111  ILE M 128  1 ? 18 
HELX_P HELX_P149 AQ5 PRO M  131  ? LYS M  149  ? PRO M 131  LYS M 149  1 ? 19 
HELX_P HELX_P150 AQ6 ALA M  155  ? GLU M  171  ? ALA M 155  GLU M 171  1 ? 17 
HELX_P HELX_P151 AQ7 THR M  176  ? VAL M  183  ? THR M 176  VAL M 183  1 ? 8  
HELX_P HELX_P152 AQ8 SER M  187  ? LEU M  202  ? SER M 187  LEU M 202  1 ? 16 
HELX_P HELX_P153 AQ9 THR M  211  ? LEU M  222  ? THR M 211  LEU M 222  1 ? 12 
HELX_P HELX_P154 AR1 PRO M  225  ? LEU M  242  ? PRO M 225  LEU M 242  1 ? 18 
HELX_P HELX_P155 AR2 SER M  249  ? ALA M  264  ? SER M 249  ALA M 264  1 ? 16 
HELX_P HELX_P156 AR3 THR M  270  ? GLY M  279  ? THR M 270  GLY M 279  1 ? 10 
HELX_P HELX_P157 AR4 ALA M  281  ? TYR M  293  ? ALA M 281  TYR M 293  1 ? 13 
HELX_P HELX_P158 AR5 ARG M  295  ? PHE M  300  ? ARG M 295  PHE M 300  1 ? 6  
HELX_P HELX_P159 AR6 PRO M  309  ? LEU M  313  ? PRO M 309  LEU M 313  5 ? 5  
HELX_P HELX_P160 AR7 VAL N  10   ? GLY N  33   ? VAL N 10   GLY N 33   1 ? 24 
HELX_P HELX_P161 AR8 ASP N  35   ? MET N  51   ? ASP N 35   MET N 51   1 ? 17 
HELX_P HELX_P162 AR9 GLY N  307  ? GLU N  311  ? GLY N 307  GLU N 311  5 ? 5  
HELX_P HELX_P163 AS1 GLU N  312  ? ASP N  318  ? GLU N 312  ASP N 318  5 ? 7  
HELX_P HELX_P164 AS2 TYR O  3    ? ASN O  8    ? TYR O 3    ASN O 8    5 ? 6  
HELX_P HELX_P165 AS3 THR O  9    ? SER O  25   ? THR O 9    SER O 25   1 ? 17 
HELX_P HELX_P166 AS4 THR O  29   ? ARG O  51   ? THR O 29   ARG O 51   1 ? 23 
HELX_P HELX_P167 AS5 THR P  153  ? GLY P  160  ? THR P 153  GLY P 160  5 ? 8  
HELX_P HELX_P168 AS6 ASP P  179  ? ALA P  187  ? ASP P 179  ALA P 187  1 ? 9  
HELX_P HELX_P169 AS7 SER P  226  ? GLY P  245  ? SER P 226  GLY P 245  1 ? 20 
HELX_P HELX_P170 AS8 ARG P  269  ? HIS P  277  ? ARG P 269  HIS P 277  1 ? 9  
HELX_P HELX_P171 AS9 VAL P  317  ? GLY P  334  ? VAL P 317  GLY P 334  1 ? 18 
HELX_P HELX_P172 AT1 ALA Q  12   ? PHE Q  25   ? ALA Q 12   PHE Q 25   1 ? 14 
HELX_P HELX_P173 AT2 GLY Q  27   ? ASN Q  40   ? GLY Q 27   ASN Q 40   1 ? 14 
HELX_P HELX_P174 AT3 GLU Q  45   ? LYS Q  53   ? GLU Q 45   LYS Q 53   1 ? 9  
HELX_P HELX_P175 AT4 ASP Q  55   ? LYS Q  70   ? ASP Q 55   LYS Q 70   1 ? 16 
HELX_P HELX_P176 AT5 VAL Q  103  ? ARG Q  119  ? VAL Q 103  ARG Q 119  1 ? 17 
HELX_P HELX_P177 AT6 THR Q  137  ? LEU Q  144  ? THR Q 137  LEU Q 144  1 ? 8  
HELX_P HELX_P178 AT7 LYS Q  170  ? TYR Q  188  ? LYS Q 170  TYR Q 188  1 ? 19 
HELX_P HELX_P179 AT8 TYR Q  188  ? LEU Q  204  ? TYR Q 188  LEU Q 204  1 ? 17 
HELX_P HELX_P180 AT9 GLY R  76   ? GLY R  92   ? GLY R 76   GLY R 92   1 ? 17 
HELX_P HELX_P181 AU1 THR R  98   ? THR R  106  ? THR R 98   THR R 106  1 ? 9  
HELX_P HELX_P182 AU2 HIS R  108  ? ILE R  111  ? HIS R 108  ILE R 111  5 ? 4  
HELX_P HELX_P183 AU3 GLY R  112  ? THR R  121  ? GLY R 112  THR R 121  1 ? 10 
HELX_P HELX_P184 AU4 LEU R  151  ? GLN R  157  ? LEU R 151  GLN R 157  1 ? 7  
HELX_P HELX_P185 AU5 LEU R  167  ? ALA R  174  ? LEU R 167  ALA R 174  1 ? 8  
HELX_P HELX_P186 AU6 PRO R  176  ? LEU R  185  ? PRO R 176  LEU R 185  1 ? 10 
HELX_P HELX_P187 AU7 GLU R  215  ? ARG R  221  ? GLU R 215  ARG R 221  1 ? 7  
HELX_P HELX_P188 AU8 ASP R  229  ? ARG R  239  ? ASP R 229  ARG R 239  1 ? 11 
HELX_P HELX_P189 AU9 ALA S  34   ? LYS S  36   ? ALA S 34   LYS S 36   5 ? 3  
HELX_P HELX_P190 AV1 ASN S  38   ? TRP S  42   ? ASN S 38   TRP S 42   5 ? 5  
HELX_P HELX_P191 AV2 GLY S  104  ? GLY S  107  ? GLY S 104  GLY S 107  5 ? 4  
HELX_P HELX_P192 AV3 ALA S  160  ? ASN S  168  ? ALA S 160  ASN S 168  1 ? 9  
HELX_P HELX_P193 AV4 HIS S  173  ? ARG S  180  ? HIS S 173  ARG S 180  1 ? 8  
HELX_P HELX_P194 AV5 ALA T  2    ? GLY T  5    ? ALA T 2    GLY T 5    5 ? 4  
HELX_P HELX_P195 AV6 LEU T  9    ? ASN T  15   ? LEU T 9    ASN T 15   1 ? 7  
HELX_P HELX_P196 AV7 LYS T  25   ? LYS T  33   ? LYS T 25   LYS T 33   1 ? 9  
HELX_P HELX_P197 AV8 ASN T  123  ? LYS T  137  ? ASN T 123  LYS T 137  1 ? 15 
HELX_P HELX_P198 AV9 ASN T  158  ? LYS T  169  ? ASN T 158  LYS T 169  1 ? 12 
HELX_P HELX_P199 AW1 ASP T  179  ? HIS T  194  ? ASP T 179  HIS T 194  1 ? 16 
HELX_P HELX_P200 AW2 LEU T  199  ? LYS T  207  ? LEU T 199  LYS T 207  1 ? 9  
HELX_P HELX_P201 AW3 PRO T  209  ? GLY T  221  ? PRO T 209  GLY T 221  1 ? 13 
HELX_P HELX_P202 AW4 ASP U  138  ? ARG U  153  ? ASP U 138  ARG U 153  1 ? 16 
HELX_P HELX_P203 AW5 ASP U  156  ? GLY U  162  ? ASP U 156  GLY U 162  1 ? 7  
HELX_P HELX_P204 AW6 ASP U  164  ? ARG U  181  ? ASP U 164  ARG U 181  1 ? 18 
HELX_P HELX_P205 AW7 ASP U  184  ? LYS U  199  ? ASP U 184  LYS U 199  1 ? 16 
HELX_P HELX_P206 AW8 ASN U  203  ? CYS U  212  ? ASN U 203  CYS U 212  1 ? 10 
HELX_P HELX_P207 AW9 PRO U  216  ? ALA U  221  ? PRO U 216  ALA U 221  1 ? 6  
HELX_P HELX_P208 AX1 LEU U  233  ? HIS U  248  ? LEU U 233  HIS U 248  1 ? 16 
HELX_P HELX_P209 AX2 ASN U  292  ? GLY U  295  ? ASN U 292  GLY U 295  5 ? 4  
HELX_P HELX_P210 AX3 LYS V  282  ? HIS V  286  ? LYS V 282  HIS V 286  5 ? 5  
HELX_P HELX_P211 AX4 LEU V  287  ? GLU V  294  ? LEU V 287  GLU V 294  1 ? 8  
HELX_P HELX_P212 AX5 ARG V  317  ? GLY V  331  ? ARG V 317  GLY V 331  1 ? 15 
HELX_P HELX_P213 AX6 ARG V  332  ? SER V  335  ? ARG V 332  SER V 335  5 ? 4  
HELX_P HELX_P214 AX7 GLY V  345  ? ARG V  358  ? GLY V 345  ARG V 358  1 ? 14 
HELX_P HELX_P215 AX8 SER V  367  ? PHE V  378  ? SER V 367  PHE V 378  1 ? 12 
HELX_P HELX_P216 AX9 LYS V  379  ? TRP V  381  ? LYS V 379  TRP V 381  5 ? 3  
HELX_P HELX_P217 AY1 THR V  417  ? ALA V  423  ? THR V 417  ALA V 423  1 ? 7  
HELX_P HELX_P218 AY2 VAL V  443  ? ILE V  446  ? VAL V 443  ILE V 446  5 ? 4  
HELX_P HELX_P219 AY3 PHE V  451  ? ILE V  457  ? PHE V 451  ILE V 457  1 ? 7  
HELX_P HELX_P220 AY4 LYS V  476  ? ILE V  484  ? LYS V 476  ILE V 484  1 ? 9  
HELX_P HELX_P221 AY5 TRP V  493  ? GLN V  497  ? TRP V 493  GLN V 497  5 ? 5  
HELX_P HELX_P222 AY6 GLU V  517  ? ILE V  525  ? GLU V 517  ILE V 525  1 ? 9  
HELX_P HELX_P223 AY7 LYS V  529  ? ASN V  537  ? LYS V 529  ASN V 537  1 ? 9  
HELX_P HELX_P224 AY8 ASN V  537  ? ARG V  554  ? ASN V 537  ARG V 554  1 ? 18 
HELX_P HELX_P225 AY9 ASN V  564  ? ASN V  576  ? ASN V 564  ASN V 576  1 ? 13 
HELX_P HELX_P226 AZ1 SER V  585  ? ASN V  599  ? SER V 585  ASN V 599  1 ? 15 
HELX_P HELX_P227 AZ2 LYS V  609  ? ASP V  612  ? LYS V 609  ASP V 612  5 ? 4  
HELX_P HELX_P228 AZ3 SER V  632  ? LEU V  644  ? SER V 632  LEU V 644  1 ? 13 
HELX_P HELX_P229 AZ4 THR V  667  ? ALA V  671  ? THR V 667  ALA V 671  5 ? 5  
HELX_P HELX_P230 AZ5 TYR V  672  ? GLN V  683  ? TYR V 672  GLN V 683  1 ? 12 
HELX_P HELX_P231 AZ6 GLY V  695  ? GLU V  699  ? GLY V 695  GLU V 699  5 ? 5  
HELX_P HELX_P232 AZ7 THR V  705  ? ALA V  718  ? THR V 705  ALA V 718  1 ? 14 
HELX_P HELX_P233 AZ8 TYR W  18   ? ALA W  34   ? TYR W 18   ALA W 34   1 ? 17 
HELX_P HELX_P234 AZ9 GLY W  47   ? ALA W  58   ? GLY W 47   ALA W 58   1 ? 12 
HELX_P HELX_P235 BA1 THR W  76   ? ASN W  92   ? THR W 76   ASN W 92   1 ? 17 
HELX_P HELX_P236 BA2 SER W  111  ? CYS W  116  ? SER W 111  CYS W 116  1 ? 6  
HELX_P HELX_P237 BA3 ILE W  117  ? THR W  122  ? ILE W 117  THR W 122  1 ? 6  
HELX_P HELX_P238 BA4 ASP W  129  ? GLN W  147  ? ASP W 129  GLN W 147  1 ? 19 
HELX_P HELX_P239 BA5 TYR W  158  ? ASP W  162  ? TYR W 158  ASP W 162  5 ? 5  
HELX_P HELX_P240 BA6 ALA W  163  ? VAL W  168  ? ALA W 163  VAL W 168  1 ? 6  
HELX_P HELX_P241 BA7 VAL W  168  ? ILE W  174  ? VAL W 168  ILE W 174  1 ? 7  
HELX_P HELX_P242 BA8 ASN W  176  ? GLY W  188  ? ASN W 176  GLY W 188  1 ? 13 
HELX_P HELX_P243 BA9 CYS W  190  ? ILE W  199  ? CYS W 190  ILE W 199  1 ? 10 
HELX_P HELX_P244 BB1 LEU W  200  ? ALA W  202  ? LEU W 200  ALA W 202  5 ? 3  
HELX_P HELX_P245 BB2 TYR W  209  ? ASP W  214  ? TYR W 209  ASP W 214  1 ? 6  
HELX_P HELX_P246 BB3 ASP W  214  ? ALA W  226  ? ASP W 214  ALA W 226  1 ? 13 
HELX_P HELX_P247 BB4 ASN W  238  ? SER W  248  ? ASN W 238  SER W 248  1 ? 11 
HELX_P HELX_P248 BB5 THR W  252  ? LEU W  266  ? THR W 252  LEU W 266  1 ? 15 
HELX_P HELX_P249 BB6 ASP W  277  ? SER W  296  ? ASP W 277  SER W 296  1 ? 20 
HELX_P HELX_P250 BB7 PRO W  308  ? GLU W  317  ? PRO W 308  GLU W 317  1 ? 10 
HELX_P HELX_P251 BB8 VAL W  319  ? ARG W  343  ? VAL W 319  ARG W 343  1 ? 25 
HELX_P HELX_P252 BB9 SER W  395  ? SER W  408  ? SER W 395  SER W 408  1 ? 14 
HELX_P HELX_P253 BC1 ASP W  439  ? LYS W  445  ? ASP W 439  LYS W 445  1 ? 7  
HELX_P HELX_P254 BC2 PRO W  446  ? PHE W  448  ? PRO W 446  PHE W 448  5 ? 3  
HELX_P HELX_P255 BC3 ASP W  465  ? ASP W  472  ? ASP W 465  ASP W 472  1 ? 8  
HELX_P HELX_P256 BC4 LEU W  485  ? ARG W  487  ? LEU W 485  ARG W 487  5 ? 3  
HELX_P HELX_P257 BC5 GLU W  512  ? ARG W  518  ? GLU W 512  ARG W 518  1 ? 7  
HELX_P HELX_P258 BC6 ARG W  518  ? VAL W  531  ? ARG W 518  VAL W 531  1 ? 14 
HELX_P HELX_P259 BC7 SER W  541  ? VAL W  549  ? SER W 541  VAL W 549  1 ? 9  
HELX_P HELX_P260 BC8 ASP W  573  ? ALA W  587  ? ASP W 573  ALA W 587  1 ? 15 
HELX_P HELX_P261 BC9 GLY W  602  ? GLY W  607  ? GLY W 602  GLY W 607  5 ? 6  
HELX_P HELX_P262 BD1 ARG W  631  ? GLN W  645  ? ARG W 631  GLN W 645  1 ? 15 
HELX_P HELX_P263 BD2 ILE W  646  ? LEU W  652  ? ILE W 646  LEU W 652  1 ? 7  
HELX_P HELX_P264 BD3 LEU W  652  ? ARG W  669  ? LEU W 652  ARG W 669  1 ? 18 
HELX_P HELX_P265 BD4 ARG W  683  ? LYS W  689  ? ARG W 683  LYS W 689  1 ? 7  
HELX_P HELX_P266 BD5 ARG W  690  ? LYS W  692  ? ARG W 690  LYS W 692  5 ? 3  
HELX_P HELX_P267 BD6 GLU W  699  ? ASP W  703  ? GLU W 699  ASP W 703  5 ? 5  
HELX_P HELX_P268 BD7 ASP W  711  ? GLN W  726  ? ASP W 711  GLN W 726  1 ? 16 
HELX_P HELX_P269 BD8 SER X  68   ? ASP X  73   ? SER 0 68   ASP 0 73   5 ? 6  
HELX_P HELX_P270 BD9 ASN X  79   ? ASN X  99   ? ASN 0 79   ASN 0 99   1 ? 21 
HELX_P HELX_P271 BE1 ASN X  123  ? ASP X  136  ? ASN 0 123  ASP 0 136  1 ? 14 
HELX_P HELX_P272 BE2 SER X  144  ? HIS X  158  ? SER 0 144  HIS 0 158  1 ? 15 
HELX_P HELX_P273 BE3 ASN X  181  ? LYS X  193  ? ASN 0 181  LYS 0 193  1 ? 13 
HELX_P HELX_P274 BE4 VAL X  205  ? GLY X  216  ? VAL 0 205  GLY 0 216  1 ? 12 
HELX_P HELX_P275 BE5 ASP X  224  ? SER X  237  ? ASP 0 224  SER 0 237  1 ? 14 
HELX_P HELX_P276 BE6 LYS Y  17   ? SER Y  26   ? LYS 1 17   SER 1 26   1 ? 10 
HELX_P HELX_P277 BE7 LEU Y  49   ? MET Y  61   ? LEU 1 49   MET 1 61   1 ? 13 
HELX_P HELX_P278 BE8 GLY Z  29   ? PHE Z  45   ? GLY 2 29   PHE 2 45   1 ? 17 
HELX_P HELX_P279 BE9 LEU Z  51   ? LEU Z  62   ? LEU 2 51   LEU 2 62   1 ? 12 
HELX_P HELX_P280 BF1 LYS Z  77   ? GLU Z  84   ? LYS 2 77   GLU 2 84   1 ? 8  
HELX_P HELX_P281 BF2 GLU Z  85   ? LEU Z  101  ? GLU 2 85   LEU 2 101  1 ? 17 
HELX_P HELX_P282 BF3 LEU Z  118  ? TRP Z  129  ? LEU 2 118  TRP 2 129  1 ? 12 
HELX_P HELX_P283 BF4 TRP Z  129  ? HIS Z  141  ? TRP 2 129  HIS 2 141  1 ? 13 
HELX_P HELX_P284 BF5 LEU Z  160  ? GLN Z  177  ? LEU 2 160  GLN 2 177  1 ? 18 
HELX_P HELX_P285 BF6 SER Z  180  ? MET Z  185  ? SER 2 180  MET 2 185  1 ? 6  
HELX_P HELX_P286 BF7 SER Z  187  ? ALA Z  199  ? SER 2 187  ALA 2 199  1 ? 13 
HELX_P HELX_P287 BF8 PHE Z  203  ? GLN Z  221  ? PHE 2 203  GLN 2 221  1 ? 19 
HELX_P HELX_P288 BF9 MET Z  228  ? ILE Z  233  ? MET 2 228  ILE 2 233  1 ? 6  
HELX_P HELX_P289 BG1 LEU Z  234  ? PHE Z  238  ? LEU 2 234  PHE 2 238  5 ? 5  
HELX_P HELX_P290 BG2 GLN Z  239  ? ASP Z  248  ? GLN 2 239  ASP 2 248  1 ? 10 
HELX_P HELX_P291 BG3 VAL Z  251  ? PHE Z  268  ? VAL 2 251  PHE 2 268  1 ? 18 
HELX_P HELX_P292 BG4 GLN Z  390  ? ASP Z  399  ? GLN 2 390  ASP 2 399  1 ? 10 
HELX_P HELX_P293 BG5 GLN Z  415  ? LEU Z  428  ? GLN 2 415  LEU 2 428  1 ? 14 
HELX_P HELX_P294 BG6 HIS Z  448  ? LYS Z  456  ? HIS 2 448  LYS 2 456  1 ? 9  
HELX_P HELX_P295 BG7 ILE AA 20   ? GLN AA 25   ? ILE 3 20   GLN 3 25   1 ? 6  
HELX_P HELX_P296 BG8 LEU AA 34   ? ASN AA 52   ? LEU 3 34   ASN 3 52   1 ? 19 
HELX_P HELX_P297 BG9 LYS AA 100  ? GLU AA 102  ? LYS 3 100  GLU 3 102  5 ? 3  
HELX_P HELX_P298 BH1 LEU AA 103  ? MET AA 119  ? LEU 3 103  MET 3 119  1 ? 17 
HELX_P HELX_P299 BH2 ILE AA 124  ? HIS AA 128  ? ILE 3 124  HIS 3 128  5 ? 5  
HELX_P HELX_P300 BH3 LEU AA 132  ? ASN AA 154  ? LEU 3 132  ASN 3 154  1 ? 23 
HELX_P HELX_P301 BH4 GLN AA 173  ? ASN AA 188  ? GLN 3 173  ASN 3 188  1 ? 16 
HELX_P HELX_P302 BH5 SER AA 200  ? GLY AA 211  ? SER 3 200  GLY 3 211  1 ? 12 
HELX_P HELX_P303 BH6 GLN AA 219  ? PRO AA 221  ? GLN 3 219  PRO 3 221  5 ? 3  
HELX_P HELX_P304 BH7 SER AA 222  ? PHE AA 231  ? SER 3 222  PHE 3 231  1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? BA DG 1  N1 ? ? ? 1_555 CA DC 83 N3 ? ? X DG 1  Y DC 93 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2   hydrog ? ? BA DG 1  N2 ? ? ? 1_555 CA DC 83 O2 ? ? X DG 1  Y DC 93 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3   hydrog ? ? BA DG 1  O6 ? ? ? 1_555 CA DC 83 N4 ? ? X DG 1  Y DC 93 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4   hydrog ? ? BA DA 2  N1 ? ? ? 1_555 CA DT 82 N3 ? ? X DA 2  Y DT 92 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5   hydrog ? ? BA DA 2  N6 ? ? ? 1_555 CA DT 82 O4 ? ? X DA 2  Y DT 92 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6   hydrog ? ? BA DA 3  N1 ? ? ? 1_555 CA DT 81 N3 ? ? X DA 3  Y DT 91 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7   hydrog ? ? BA DA 3  N6 ? ? ? 1_555 CA DT 81 O4 ? ? X DA 3  Y DT 91 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8   hydrog ? ? BA DG 4  N1 ? ? ? 1_555 CA DC 80 N3 ? ? X DG 4  Y DC 90 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9   hydrog ? ? BA DG 4  N2 ? ? ? 1_555 CA DC 80 O2 ? ? X DG 4  Y DC 90 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10  hydrog ? ? BA DG 4  O6 ? ? ? 1_555 CA DC 80 N4 ? ? X DG 4  Y DC 90 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11  hydrog ? ? BA DG 5  N1 ? ? ? 1_555 CA DC 79 N3 ? ? X DG 5  Y DC 89 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12  hydrog ? ? BA DG 5  N2 ? ? ? 1_555 CA DC 79 O2 ? ? X DG 5  Y DC 89 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13  hydrog ? ? BA DG 5  O6 ? ? ? 1_555 CA DC 79 N4 ? ? X DG 5  Y DC 89 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14  hydrog ? ? BA DG 6  N1 ? ? ? 1_555 CA DC 78 N3 ? ? X DG 6  Y DC 88 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15  hydrog ? ? BA DG 6  N2 ? ? ? 1_555 CA DC 78 O2 ? ? X DG 6  Y DC 88 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16  hydrog ? ? BA DG 6  O6 ? ? ? 1_555 CA DC 78 N4 ? ? X DG 6  Y DC 88 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17  hydrog ? ? BA DC 7  N3 ? ? ? 1_555 CA DG 77 N1 ? ? X DC 7  Y DG 87 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18  hydrog ? ? BA DC 7  N4 ? ? ? 1_555 CA DG 77 O6 ? ? X DC 7  Y DG 87 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog19  hydrog ? ? BA DC 7  O2 ? ? ? 1_555 CA DG 77 N2 ? ? X DC 7  Y DG 87 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20  hydrog ? ? BA DG 8  N1 ? ? ? 1_555 CA DC 76 N3 ? ? X DG 8  Y DC 86 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21  hydrog ? ? BA DG 8  N2 ? ? ? 1_555 CA DC 76 O2 ? ? X DG 8  Y DC 86 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22  hydrog ? ? BA DG 8  O6 ? ? ? 1_555 CA DC 76 N4 ? ? X DG 8  Y DC 86 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23  hydrog ? ? BA DC 9  N3 ? ? ? 1_555 CA DG 75 N1 ? ? X DC 9  Y DG 85 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24  hydrog ? ? BA DC 9  N4 ? ? ? 1_555 CA DG 75 O6 ? ? X DC 9  Y DG 85 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25  hydrog ? ? BA DC 9  O2 ? ? ? 1_555 CA DG 75 N2 ? ? X DC 9  Y DG 85 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26  hydrog ? ? BA DC 10 N3 ? ? ? 1_555 CA DG 74 N1 ? ? X DC 10 Y DG 84 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27  hydrog ? ? BA DC 10 N4 ? ? ? 1_555 CA DG 74 O6 ? ? X DC 10 Y DG 84 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28  hydrog ? ? BA DC 10 O2 ? ? ? 1_555 CA DG 74 N2 ? ? X DC 10 Y DG 84 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29  hydrog ? ? BA DT 11 N3 ? ? ? 1_555 CA DA 73 N1 ? ? X DT 11 Y DA 83 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30  hydrog ? ? BA DT 11 O4 ? ? ? 1_555 CA DA 73 N6 ? ? X DT 11 Y DA 83 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog31  hydrog ? ? BA DA 12 N1 ? ? ? 1_555 CA DT 72 N3 ? ? X DA 12 Y DT 82 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32  hydrog ? ? BA DA 12 N6 ? ? ? 1_555 CA DT 72 O4 ? ? X DA 12 Y DT 82 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33  hydrog ? ? BA DT 13 N3 ? ? ? 1_555 CA DA 71 N1 ? ? X DT 13 Y DA 81 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34  hydrog ? ? BA DT 13 O4 ? ? ? 1_555 CA DA 71 N6 ? ? X DT 13 Y DA 81 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog35  hydrog ? ? BA DA 14 N1 ? ? ? 1_555 CA DT 70 N3 ? ? X DA 14 Y DT 80 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36  hydrog ? ? BA DA 14 N6 ? ? ? 1_555 CA DT 70 O4 ? ? X DA 14 Y DT 80 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37  hydrog ? ? BA DA 15 N1 ? ? ? 1_555 CA DC 69 N4 ? ? X DA 15 Y DC 79 1_555 ? ? ? ? ? ? TYPE_26_PAIR    ? ? 
hydrog38  hydrog ? ? BA DA 15 N6 ? ? ? 1_555 CA DC 69 N3 ? ? X DA 15 Y DC 79 1_555 ? ? ? ? ? ? TYPE_26_PAIR    ? ? 
hydrog39  hydrog ? ? BA DA 16 N6 ? ? ? 1_555 CA DT 67 O4 ? ? X DA 16 Y DT 77 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog40  hydrog ? ? BA DA 16 N1 ? ? ? 1_555 CA DT 68 N3 ? ? X DA 16 Y DT 78 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41  hydrog ? ? BA DA 16 N6 ? ? ? 1_555 CA DT 68 O4 ? ? X DA 16 Y DT 78 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42  hydrog ? ? BA DG 18 N1 ? ? ? 1_555 CA DC 66 O2 ? ? X DG 18 Y DC 76 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog43  hydrog ? ? BA DG 19 N1 ? ? ? 1_555 CA DC 65 N3 ? ? X DG 19 Y DC 75 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog44  hydrog ? ? BA DG 19 N2 ? ? ? 1_555 CA DC 65 O2 ? ? X DG 19 Y DC 75 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45  hydrog ? ? BA DG 19 O6 ? ? ? 1_555 CA DC 65 N4 ? ? X DG 19 Y DC 75 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog46  hydrog ? ? BA DG 19 N1 ? ? ? 1_555 CA DC 66 O2 ? ? X DG 19 Y DC 76 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog47  hydrog ? ? BA DG 20 N1 ? ? ? 1_555 CA DC 64 N3 ? ? X DG 20 Y DC 74 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48  hydrog ? ? BA DG 20 N2 ? ? ? 1_555 CA DC 64 O2 ? ? X DG 20 Y DC 74 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49  hydrog ? ? BA DG 20 O6 ? ? ? 1_555 CA DC 64 N4 ? ? X DG 20 Y DC 74 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog50  hydrog ? ? BA DG 20 N1 ? ? ? 1_555 CA DC 65 N3 ? ? X DG 20 Y DC 75 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog51  hydrog ? ? BA DG 21 N1 ? ? ? 1_555 CA DC 63 N3 ? ? X DG 21 Y DC 73 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog52  hydrog ? ? BA DG 21 N2 ? ? ? 1_555 CA DC 63 O2 ? ? X DG 21 Y DC 73 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53  hydrog ? ? BA DG 21 O6 ? ? ? 1_555 CA DC 63 N4 ? ? X DG 21 Y DC 73 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54  hydrog ? ? BA DG 22 N1 ? ? ? 1_555 CA DC 62 N3 ? ? X DG 22 Y DC 72 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55  hydrog ? ? BA DG 22 N2 ? ? ? 1_555 CA DC 62 O2 ? ? X DG 22 Y DC 72 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56  hydrog ? ? BA DG 22 O6 ? ? ? 1_555 CA DC 62 N4 ? ? X DG 22 Y DC 72 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57  hydrog ? ? BA DG 22 N2 ? ? ? 1_555 CA DC 63 O2 ? ? X DG 22 Y DC 73 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog58  hydrog ? ? BA DT 23 N3 ? ? ? 1_555 CA DA 61 N1 ? ? X DT 23 Y DA 71 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59  hydrog ? ? BA DT 23 O4 ? ? ? 1_555 CA DA 61 N6 ? ? X DT 23 Y DA 71 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog60  hydrog ? ? BA DG 24 N1 ? ? ? 1_555 CA DC 60 N3 ? ? X DG 24 Y DC 70 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61  hydrog ? ? BA DG 24 N2 ? ? ? 1_555 CA DC 60 O2 ? ? X DG 24 Y DC 70 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62  hydrog ? ? BA DG 24 O6 ? ? ? 1_555 CA DC 60 N4 ? ? X DG 24 Y DC 70 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog63  hydrog ? ? BA DG 25 N1 ? ? ? 1_555 CA DC 59 N3 ? ? X DG 25 Y DC 69 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog64  hydrog ? ? BA DG 25 N2 ? ? ? 1_555 CA DC 59 O2 ? ? X DG 25 Y DC 69 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog65  hydrog ? ? BA DG 25 O6 ? ? ? 1_555 CA DC 59 N4 ? ? X DG 25 Y DC 69 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog66  hydrog ? ? BA DG 25 N1 ? ? ? 1_555 CA DC 60 O2 ? ? X DG 25 Y DC 70 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog67  hydrog ? ? BA DG 26 N1 ? ? ? 1_555 CA DC 58 N3 ? ? X DG 26 Y DC 68 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68  hydrog ? ? BA DG 26 N2 ? ? ? 1_555 CA DC 58 O2 ? ? X DG 26 Y DC 68 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69  hydrog ? ? BA DG 26 O6 ? ? ? 1_555 CA DC 58 N4 ? ? X DG 26 Y DC 68 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70  hydrog ? ? BA DG 26 N1 ? ? ? 1_555 CA DC 59 N3 ? ? X DG 26 Y DC 69 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog71  hydrog ? ? BA DG 27 N1 ? ? ? 1_555 CA DC 57 N3 ? ? X DG 27 Y DC 67 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72  hydrog ? ? BA DG 27 N2 ? ? ? 1_555 CA DC 57 O2 ? ? X DG 27 Y DC 67 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73  hydrog ? ? BA DG 27 O6 ? ? ? 1_555 CA DC 57 N4 ? ? X DG 27 Y DC 67 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog74  hydrog ? ? BA DG 27 N1 ? ? ? 1_555 CA DC 58 N3 ? ? X DG 27 Y DC 68 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog75  hydrog ? ? BA DG 27 N2 ? ? ? 1_555 CA DC 58 O2 ? ? X DG 27 Y DC 68 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76  hydrog ? ? BA DG 27 O6 ? ? ? 1_555 CA DC 58 N4 ? ? X DG 27 Y DC 68 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog77  hydrog ? ? BA DG 28 N1 ? ? ? 1_555 CA DC 56 N3 ? ? X DG 28 Y DC 66 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog78  hydrog ? ? BA DG 28 N2 ? ? ? 1_555 CA DC 56 O2 ? ? X DG 28 Y DC 66 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog79  hydrog ? ? BA DG 28 O6 ? ? ? 1_555 CA DC 56 N4 ? ? X DG 28 Y DC 66 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog80  hydrog ? ? BA DC 29 N3 ? ? ? 1_555 CA DG 55 N1 ? ? X DC 29 Y DG 65 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog81  hydrog ? ? BA DC 29 N4 ? ? ? 1_555 CA DG 55 O6 ? ? X DC 29 Y DG 65 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog82  hydrog ? ? BA DC 29 O2 ? ? ? 1_555 CA DG 55 N2 ? ? X DC 29 Y DG 65 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog83  hydrog ? ? BA DG 30 N1 ? ? ? 1_555 CA DC 54 O2 ? ? X DG 30 Y DC 64 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog84  hydrog ? ? BA DC 51 O2 ? ? ? 1_555 CA DG 33 N2 ? ? X DC 51 Y DG 43 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog85  hydrog ? ? BA DG 52 N1 ? ? ? 1_555 CA DC 32 O2 ? ? X DG 52 Y DC 42 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog86  hydrog ? ? BA DA 53 N1 ? ? ? 1_555 CA DT 31 N3 ? ? X DA 53 Y DT 41 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog87  hydrog ? ? BA DA 54 N6 ? ? ? 1_555 CA DG 29 O6 ? ? X DA 54 Y DG 39 1_555 ? ? ? ? ? ? 'DA-DG MISPAIR' ? ? 
hydrog88  hydrog ? ? BA DA 54 N1 ? ? ? 1_555 CA DT 30 N3 ? ? X DA 54 Y DT 40 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog89  hydrog ? ? BA DC 55 O2 ? ? ? 1_555 CA DG 29 N2 ? ? X DC 55 Y DG 39 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog90  hydrog ? ? BA DA 56 N1 ? ? ? 1_555 CA DT 28 N3 ? ? X DA 56 Y DT 38 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog91  hydrog ? ? BA DA 56 N6 ? ? ? 1_555 CA DT 28 O4 ? ? X DA 56 Y DT 38 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog92  hydrog ? ? BA DC 57 N3 ? ? ? 1_555 CA DG 27 N1 ? ? X DC 57 Y DG 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog93  hydrog ? ? BA DC 57 N4 ? ? ? 1_555 CA DG 27 O6 ? ? X DC 57 Y DG 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog94  hydrog ? ? BA DC 57 O2 ? ? ? 1_555 CA DG 27 N2 ? ? X DC 57 Y DG 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog95  hydrog ? ? BA DT 58 N3 ? ? ? 1_555 CA DA 26 N1 ? ? X DT 58 Y DA 36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog96  hydrog ? ? BA DT 58 O4 ? ? ? 1_555 CA DA 26 N6 ? ? X DT 58 Y DA 36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog97  hydrog ? ? BA DC 59 N3 ? ? ? 1_555 CA DG 25 N1 ? ? X DC 59 Y DG 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog98  hydrog ? ? BA DC 59 N4 ? ? ? 1_555 CA DG 25 O6 ? ? X DC 59 Y DG 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog99  hydrog ? ? BA DC 59 O2 ? ? ? 1_555 CA DG 25 N2 ? ? X DC 59 Y DG 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog100 hydrog ? ? BA DA 61 N1 ? ? ? 1_555 CA DT 23 N3 ? ? X DA 61 Y DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog101 hydrog ? ? BA DA 61 N6 ? ? ? 1_555 CA DT 23 O4 ? ? X DA 61 Y DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog102 hydrog ? ? BA DG 62 N1 ? ? ? 1_555 CA DC 22 N3 ? ? X DG 62 Y DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog103 hydrog ? ? BA DG 62 N2 ? ? ? 1_555 CA DC 22 O2 ? ? X DG 62 Y DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog104 hydrog ? ? BA DG 62 O6 ? ? ? 1_555 CA DC 22 N4 ? ? X DG 62 Y DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog105 hydrog ? ? BA DC 63 N3 ? ? ? 1_555 CA DG 21 N1 ? ? X DC 63 Y DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog106 hydrog ? ? BA DC 63 N4 ? ? ? 1_555 CA DG 21 O6 ? ? X DC 63 Y DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog107 hydrog ? ? BA DC 63 O2 ? ? ? 1_555 CA DG 21 N2 ? ? X DC 63 Y DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog108 hydrog ? ? BA DC 64 N3 ? ? ? 1_555 CA DG 20 N1 ? ? X DC 64 Y DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog109 hydrog ? ? BA DC 64 N4 ? ? ? 1_555 CA DG 20 O6 ? ? X DC 64 Y DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog110 hydrog ? ? BA DC 64 O2 ? ? ? 1_555 CA DG 20 N2 ? ? X DC 64 Y DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog111 hydrog ? ? BA DG 65 N1 ? ? ? 1_555 CA DC 19 N3 ? ? X DG 65 Y DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog112 hydrog ? ? BA DG 65 N2 ? ? ? 1_555 CA DC 19 O2 ? ? X DG 65 Y DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog113 hydrog ? ? BA DG 65 O6 ? ? ? 1_555 CA DC 19 N4 ? ? X DG 65 Y DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog114 hydrog ? ? BA DA 66 N1 ? ? ? 1_555 CA DT 18 N3 ? ? X DA 66 Y DT 28 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog115 hydrog ? ? BA DG 67 N1 ? ? ? 1_555 CA DC 17 N3 ? ? X DG 67 Y DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog116 hydrog ? ? BA DG 67 N2 ? ? ? 1_555 CA DC 17 O2 ? ? X DG 67 Y DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog117 hydrog ? ? BA DG 67 O6 ? ? ? 1_555 CA DC 17 N4 ? ? X DG 67 Y DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog118 hydrog ? ? BA DC 68 O2 ? ? ? 1_555 CA DG 16 N2 ? ? X DC 68 Y DG 26 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog119 hydrog ? ? BA DA 69 N1 ? ? ? 1_555 CA DT 15 N3 ? ? X DA 69 Y DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog120 hydrog ? ? BA DA 69 N6 ? ? ? 1_555 CA DT 15 O4 ? ? X DA 69 Y DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog121 hydrog ? ? BA DG 70 N1 ? ? ? 1_555 CA DC 14 N3 ? ? X DG 70 Y DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog122 hydrog ? ? BA DG 70 N2 ? ? ? 1_555 CA DC 14 O2 ? ? X DG 70 Y DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog123 hydrog ? ? BA DG 70 O6 ? ? ? 1_555 CA DC 14 N4 ? ? X DG 70 Y DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog124 hydrog ? ? BA DA 71 N1 ? ? ? 1_555 CA DT 13 N3 ? ? X DA 71 Y DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog125 hydrog ? ? BA DA 71 N6 ? ? ? 1_555 CA DT 13 O4 ? ? X DA 71 Y DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog126 hydrog ? ? BA DC 72 N3 ? ? ? 1_555 CA DG 12 N1 ? ? X DC 72 Y DG 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog127 hydrog ? ? BA DC 72 N4 ? ? ? 1_555 CA DG 12 O6 ? ? X DC 72 Y DG 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog128 hydrog ? ? BA DC 72 O2 ? ? ? 1_555 CA DG 12 N2 ? ? X DC 72 Y DG 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog129 hydrog ? ? BA DG 73 N1 ? ? ? 1_555 CA DA 10 N1 ? ? X DG 73 Y DA 20 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog130 hydrog ? ? BA DG 73 O6 ? ? ? 1_555 CA DA 10 N6 ? ? X DG 73 Y DA 20 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog131 hydrog ? ? BA DG 73 N1 ? ? ? 1_555 CA DC 11 N3 ? ? X DG 73 Y DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog132 hydrog ? ? BA DG 73 N2 ? ? ? 1_555 CA DC 11 O2 ? ? X DG 73 Y DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog133 hydrog ? ? BA DG 73 O6 ? ? ? 1_555 CA DC 11 N4 ? ? X DG 73 Y DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog134 hydrog ? ? BA DT 74 N3 ? ? ? 1_555 CA DA 10 N1 ? ? X DT 74 Y DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog135 hydrog ? ? BA DT 74 O4 ? ? ? 1_555 CA DA 10 N6 ? ? X DT 74 Y DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog136 hydrog ? ? BA DG 75 N1 ? ? ? 1_555 CA DC 9  N3 ? ? X DG 75 Y DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog137 hydrog ? ? BA DG 75 N2 ? ? ? 1_555 CA DC 9  O2 ? ? X DG 75 Y DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog138 hydrog ? ? BA DG 75 O6 ? ? ? 1_555 CA DC 9  N4 ? ? X DG 75 Y DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog139 hydrog ? ? BA DC 76 N3 ? ? ? 1_555 CA DG 8  N1 ? ? X DC 76 Y DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog140 hydrog ? ? BA DC 76 N4 ? ? ? 1_555 CA DG 8  O6 ? ? X DC 76 Y DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog141 hydrog ? ? BA DC 76 O2 ? ? ? 1_555 CA DG 8  N2 ? ? X DC 76 Y DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog142 hydrog ? ? BA DC 77 N3 ? ? ? 1_555 CA DG 7  N1 ? ? X DC 77 Y DG 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog143 hydrog ? ? BA DC 77 N4 ? ? ? 1_555 CA DG 7  O6 ? ? X DC 77 Y DG 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog144 hydrog ? ? BA DC 77 O2 ? ? ? 1_555 CA DG 7  N2 ? ? X DC 77 Y DG 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog145 hydrog ? ? BA DT 78 N3 ? ? ? 1_555 CA DA 6  N1 ? ? X DT 78 Y DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog146 hydrog ? ? BA DT 78 O4 ? ? ? 1_555 CA DA 6  N6 ? ? X DT 78 Y DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog147 hydrog ? ? BA DA 79 N1 ? ? ? 1_555 CA DT 5  N3 ? ? X DA 79 Y DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog148 hydrog ? ? BA DA 79 N6 ? ? ? 1_555 CA DT 5  O4 ? ? X DA 79 Y DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog149 hydrog ? ? BA DC 80 N3 ? ? ? 1_555 CA DG 4  N1 ? ? X DC 80 Y DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog150 hydrog ? ? BA DC 80 N4 ? ? ? 1_555 CA DG 4  O6 ? ? X DC 80 Y DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog151 hydrog ? ? BA DC 80 O2 ? ? ? 1_555 CA DG 4  N2 ? ? X DC 80 Y DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog152 hydrog ? ? BA DG 81 N1 ? ? ? 1_555 CA DC 3  N3 ? ? X DG 81 Y DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog153 hydrog ? ? BA DG 81 N2 ? ? ? 1_555 CA DC 3  O2 ? ? X DG 81 Y DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog154 hydrog ? ? BA DG 81 O6 ? ? ? 1_555 CA DC 3  N4 ? ? X DG 81 Y DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog155 hydrog ? ? BA DG 82 N1 ? ? ? 1_555 CA DC 2  N3 ? ? X DG 82 Y DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog156 hydrog ? ? BA DG 82 N2 ? ? ? 1_555 CA DC 2  O2 ? ? X DG 82 Y DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog157 hydrog ? ? BA DG 82 O6 ? ? ? 1_555 CA DC 2  N4 ? ? X DG 82 Y DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 461 A . ? GLN 461 A PRO 462 A ? PRO 462 A 1 3.79 
2 LYS 581 A . ? LYS 581 A PRO 582 A ? PRO 582 A 1 4.36 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 2  ? 
AA3 ? 3  ? 
AA4 ? 2  ? 
AA5 ? 8  ? 
AA6 ? 4  ? 
AA7 ? 2  ? 
AA8 ? 2  ? 
AA9 ? 10 ? 
AB1 ? 2  ? 
AB2 ? 2  ? 
AB3 ? 3  ? 
AB4 ? 2  ? 
AB5 ? 3  ? 
AB6 ? 2  ? 
AB7 ? 5  ? 
AB8 ? 2  ? 
AB9 ? 3  ? 
AC1 ? 4  ? 
AC2 ? 2  ? 
AC3 ? 3  ? 
AC4 ? 4  ? 
AC5 ? 5  ? 
AC6 ? 3  ? 
AC7 ? 4  ? 
AC8 ? 5  ? 
AC9 ? 5  ? 
AD1 ? 2  ? 
AD2 ? 8  ? 
AD3 ? 3  ? 
AD4 ? 2  ? 
AD5 ? 2  ? 
AD6 ? 4  ? 
AD7 ? 5  ? 
AD8 ? 2  ? 
AD9 ? 5  ? 
AE1 ? 4  ? 
AE2 ? 4  ? 
AE3 ? 2  ? 
AE4 ? 4  ? 
AE5 ? 7  ? 
AE6 ? 2  ? 
AE7 ? 3  ? 
AE8 ? 4  ? 
AE9 ? 4  ? 
AF1 ? 2  ? 
AF2 ? 16 ? 
AF3 ? 14 ? 
AF4 ? 3  ? 
AF5 ? 2  ? 
AF6 ? 2  ? 
AF7 ? 3  ? 
AF8 ? 14 ? 
AF9 ? 8  ? 
AG1 ? 3  ? 
AG2 ? 3  ? 
AG3 ? 3  ? 
AG4 ? 6  ? 
AG5 ? 2  ? 
AG6 ? 7  ? 
AG7 ? 2  ? 
AG8 ? 5  ? 
AG9 ? 3  ? 
AH1 ? 3  ? 
AH2 ? 5  ? 
AH3 ? 6  ? 
AH4 ? 6  ? 
AH5 ? 6  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA3 2  3  ? anti-parallel 
AA4 1  2  ? anti-parallel 
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA5 4  5  ? anti-parallel 
AA5 5  6  ? parallel      
AA5 6  7  ? anti-parallel 
AA5 7  8  ? parallel      
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA6 3  4  ? anti-parallel 
AA7 1  2  ? anti-parallel 
AA8 1  2  ? anti-parallel 
AA9 1  2  ? anti-parallel 
AA9 2  3  ? anti-parallel 
AA9 3  4  ? anti-parallel 
AA9 4  5  ? anti-parallel 
AA9 5  6  ? anti-parallel 
AA9 6  7  ? anti-parallel 
AA9 7  8  ? anti-parallel 
AA9 8  9  ? anti-parallel 
AA9 9  10 ? anti-parallel 
AB1 1  2  ? anti-parallel 
AB2 1  2  ? anti-parallel 
AB3 1  2  ? anti-parallel 
AB3 2  3  ? anti-parallel 
AB4 1  2  ? anti-parallel 
AB5 1  2  ? anti-parallel 
AB5 2  3  ? anti-parallel 
AB6 1  2  ? anti-parallel 
AB7 1  2  ? anti-parallel 
AB7 2  3  ? anti-parallel 
AB7 3  4  ? anti-parallel 
AB7 4  5  ? anti-parallel 
AB8 1  2  ? anti-parallel 
AB9 1  2  ? anti-parallel 
AB9 2  3  ? anti-parallel 
AC1 1  2  ? anti-parallel 
AC1 2  3  ? anti-parallel 
AC1 3  4  ? anti-parallel 
AC2 1  2  ? anti-parallel 
AC3 1  2  ? anti-parallel 
AC3 2  3  ? anti-parallel 
AC4 1  2  ? anti-parallel 
AC4 2  3  ? parallel      
AC4 3  4  ? anti-parallel 
AC5 1  2  ? anti-parallel 
AC5 2  3  ? anti-parallel 
AC5 3  4  ? anti-parallel 
AC5 4  5  ? anti-parallel 
AC6 1  2  ? anti-parallel 
AC6 2  3  ? anti-parallel 
AC7 1  2  ? anti-parallel 
AC7 2  3  ? anti-parallel 
AC7 3  4  ? parallel      
AC8 1  2  ? anti-parallel 
AC8 2  3  ? anti-parallel 
AC8 3  4  ? parallel      
AC8 4  5  ? anti-parallel 
AC9 1  2  ? anti-parallel 
AC9 2  3  ? anti-parallel 
AC9 3  4  ? anti-parallel 
AC9 4  5  ? anti-parallel 
AD1 1  2  ? parallel      
AD2 1  2  ? anti-parallel 
AD2 2  3  ? anti-parallel 
AD2 3  4  ? anti-parallel 
AD2 4  5  ? parallel      
AD2 5  6  ? anti-parallel 
AD2 6  7  ? parallel      
AD2 7  8  ? anti-parallel 
AD3 1  2  ? anti-parallel 
AD3 2  3  ? anti-parallel 
AD4 1  2  ? anti-parallel 
AD5 1  2  ? anti-parallel 
AD6 1  2  ? anti-parallel 
AD6 2  3  ? anti-parallel 
AD6 3  4  ? anti-parallel 
AD7 1  2  ? anti-parallel 
AD7 2  3  ? anti-parallel 
AD7 3  4  ? anti-parallel 
AD7 4  5  ? anti-parallel 
AD8 1  2  ? anti-parallel 
AD9 1  2  ? anti-parallel 
AD9 2  3  ? anti-parallel 
AD9 3  4  ? anti-parallel 
AD9 4  5  ? anti-parallel 
AE1 1  2  ? anti-parallel 
AE1 2  3  ? anti-parallel 
AE1 3  4  ? anti-parallel 
AE2 1  2  ? anti-parallel 
AE2 2  3  ? parallel      
AE2 3  4  ? parallel      
AE3 1  2  ? parallel      
AE4 1  2  ? anti-parallel 
AE4 2  3  ? anti-parallel 
AE4 3  4  ? parallel      
AE5 1  2  ? anti-parallel 
AE5 2  3  ? anti-parallel 
AE5 3  4  ? parallel      
AE5 4  5  ? anti-parallel 
AE5 5  6  ? anti-parallel 
AE5 6  7  ? anti-parallel 
AE6 1  2  ? anti-parallel 
AE7 1  2  ? anti-parallel 
AE7 2  3  ? anti-parallel 
AE8 1  2  ? anti-parallel 
AE8 2  3  ? anti-parallel 
AE8 3  4  ? anti-parallel 
AE9 1  2  ? anti-parallel 
AE9 2  3  ? anti-parallel 
AE9 3  4  ? anti-parallel 
AF1 1  2  ? anti-parallel 
AF2 1  2  ? anti-parallel 
AF2 2  3  ? anti-parallel 
AF2 3  4  ? parallel      
AF2 4  5  ? anti-parallel 
AF2 5  6  ? anti-parallel 
AF2 6  7  ? parallel      
AF2 7  8  ? anti-parallel 
AF2 8  9  ? anti-parallel 
AF2 9  10 ? anti-parallel 
AF2 10 11 ? anti-parallel 
AF2 11 12 ? anti-parallel 
AF2 12 13 ? anti-parallel 
AF2 13 14 ? anti-parallel 
AF2 14 15 ? anti-parallel 
AF2 15 16 ? anti-parallel 
AF3 1  2  ? anti-parallel 
AF3 2  3  ? anti-parallel 
AF3 3  4  ? parallel      
AF3 4  5  ? parallel      
AF3 5  6  ? anti-parallel 
AF3 6  7  ? anti-parallel 
AF3 7  8  ? anti-parallel 
AF3 8  9  ? anti-parallel 
AF3 9  10 ? anti-parallel 
AF3 10 11 ? anti-parallel 
AF3 11 12 ? anti-parallel 
AF3 12 13 ? anti-parallel 
AF3 13 14 ? anti-parallel 
AF4 1  2  ? anti-parallel 
AF4 2  3  ? anti-parallel 
AF5 1  2  ? anti-parallel 
AF6 1  2  ? anti-parallel 
AF7 1  2  ? anti-parallel 
AF7 2  3  ? anti-parallel 
AF8 1  2  ? anti-parallel 
AF8 2  3  ? anti-parallel 
AF8 3  4  ? anti-parallel 
AF8 4  5  ? parallel      
AF8 5  6  ? anti-parallel 
AF8 6  7  ? anti-parallel 
AF8 7  8  ? parallel      
AF8 8  9  ? anti-parallel 
AF8 9  10 ? anti-parallel 
AF8 10 11 ? parallel      
AF8 11 12 ? anti-parallel 
AF8 12 13 ? anti-parallel 
AF8 13 14 ? anti-parallel 
AF9 1  2  ? anti-parallel 
AF9 2  3  ? anti-parallel 
AF9 3  4  ? anti-parallel 
AF9 4  5  ? parallel      
AF9 5  6  ? anti-parallel 
AF9 6  7  ? anti-parallel 
AF9 7  8  ? parallel      
AG1 1  2  ? anti-parallel 
AG1 2  3  ? anti-parallel 
AG2 1  2  ? anti-parallel 
AG2 2  3  ? anti-parallel 
AG3 1  2  ? anti-parallel 
AG3 2  3  ? anti-parallel 
AG4 1  2  ? parallel      
AG4 2  3  ? parallel      
AG4 3  4  ? parallel      
AG4 4  5  ? parallel      
AG4 5  6  ? parallel      
AG5 1  2  ? parallel      
AG6 1  2  ? parallel      
AG6 2  3  ? parallel      
AG6 3  4  ? parallel      
AG6 4  5  ? parallel      
AG6 5  6  ? parallel      
AG6 6  7  ? parallel      
AG7 1  2  ? parallel      
AG8 1  2  ? parallel      
AG8 2  3  ? parallel      
AG8 3  4  ? parallel      
AG8 4  5  ? parallel      
AG9 1  2  ? anti-parallel 
AG9 2  3  ? anti-parallel 
AH1 1  2  ? parallel      
AH1 2  3  ? parallel      
AH2 1  2  ? parallel      
AH2 2  3  ? parallel      
AH2 3  4  ? parallel      
AH2 4  5  ? parallel      
AH3 1  2  ? anti-parallel 
AH3 2  3  ? parallel      
AH3 3  4  ? parallel      
AH3 4  5  ? parallel      
AH3 5  6  ? parallel      
AH4 1  2  ? anti-parallel 
AH4 2  3  ? anti-parallel 
AH4 3  4  ? anti-parallel 
AH4 4  5  ? anti-parallel 
AH4 5  6  ? anti-parallel 
AH5 1  2  ? anti-parallel 
AH5 2  3  ? parallel      
AH5 3  4  ? parallel      
AH5 4  5  ? parallel      
AH5 5  6  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  SER A  1448 ? ASP A  1449 ? SER A 1448 ASP A 1449 
AA1 2  ARG A  20   ? GLN A  22   ? ARG A 20   GLN A 22   
AA1 3  ARG B  1170 ? MET B  1172 ? ARG B 1170 MET B 1172 
AA2 1  GLY A  86   ? PHE A  95   ? GLY A 86   PHE A 95   
AA2 2  ILE A  249  ? VAL A  255  ? ILE A 249  VAL A 255  
AA3 1  ARG A  192  ? SER A  194  ? ARG A 192  SER A 194  
AA3 2  GLU A  197  ? ALA A  200  ? GLU A 197  ALA A 200  
AA3 3  ILE A  214  ? LEU A  215  ? ILE A 214  LEU A 215  
AA4 1  ALA A  328  ? MET A  329  ? ALA A 328  MET A 329  
AA4 2  MET M  83   ? ILE M  84   ? MET M 83   ILE M 84   
AA5 1  HIS B  1060 ? ARG B  1062 ? HIS B 1060 ARG B 1062 
AA5 2  SER A  362  ? PRO A  369  ? SER A 362  PRO A 369  
AA5 3  GLU A  500  ? HIS A  504  ? GLU A 500  HIS A 504  
AA5 4  ILE A  455  ? ASN A  459  ? ILE A 455  ASN A 459  
AA5 5  GLY A  471  ? LEU A  477  ? GLY A 471  LEU A 477  
AA5 6  GLN A  377  ? PRO A  381  ? GLN A 377  PRO A 381  
AA5 7  PHE A  482  ? LEU A  484  ? PHE A 482  LEU A 484  
AA5 8  SER A  362  ? PRO A  369  ? SER A 362  PRO A 369  
AA6 1  THR A  389  ? ILE A  393  ? THR A 389  ILE A 393  
AA6 2  LYS A  445  ? HIS A  449  ? LYS A 445  HIS A 449  
AA6 3  ALA A  416  ? ILE A  420  ? ALA A 416  ILE A 420  
AA6 4  ARG A  426  ? ASP A  428  ? ARG A 426  ASP A 428  
AA7 1  VAL A  526  ? THR A  527  ? VAL A 526  THR A 527  
AA7 2  ARG A  532  ? PRO A  533  ? ARG A 532  PRO A 533  
AA8 1  PHE A  554  ? LEU A  555  ? PHE A 554  LEU A 555  
AA8 2  TRP A  586  ? THR A  587  ? TRP A 586  THR A 587  
AA9 1  ILE A  579  ? LYS A  581  ? ILE A 579  LYS A 581  
AA9 2  TYR H  90   ? GLU H  100  ? TYR H 90   GLU H 100  
AA9 3  VAL H  141  ? LYS H  146  ? VAL H 141  LYS H 146  
AA9 4  LYS H  55   ? ALA H  61   ? LYS H 55   ALA H 61   
AA9 5  ILE H  4    ? ASP H  14   ? ILE H 4    ASP H 14   
AA9 6  SER H  26   ? SER H  32   ? SER H 26   SER H 32   
AA9 7  ASP H  38   ? VAL H  43   ? ASP H 38   VAL H 43   
AA9 8  LEU H  121  ? GLY H  127  ? LEU H 121  GLY H 127  
AA9 9  LEU H  112  ? TYR H  118  ? LEU H 112  TYR H 118  
AA9 10 TYR H  90   ? GLU H  100  ? TYR H 90   GLU H 100  
AB1 1  VAL A  629  ? GLU A  631  ? VAL A 629  GLU A 631  
AB1 2  GLU A  634  ? MET A  637  ? GLU A 634  MET A 637  
AB2 1  GLY A  789  ? GLN A  790  ? GLY A 789  GLN A 790  
AB2 2  PHE A  822  ? VAL A  823  ? PHE A 822  VAL A 823  
AB3 1  MET A  872  ? VAL A  873  ? MET A 872  VAL A 873  
AB3 2  VAL A  879  ? ARG A  880  ? VAL A 879  ARG A 880  
AB3 3  VAL A  886  ? GLN A  888  ? VAL A 886  GLN A 888  
AB4 1  VAL A  901  ? ASN A  905  ? VAL A 901  ASN A 905  
AB4 2  LYS A  976  ? PRO A  980  ? LYS A 976  PRO A 980  
AB5 1  LEU A  1139 ? PHE A  1142 ? LEU A 1139 PHE A 1142 
AB5 2  GLU A  1333 ? THR A  1338 ? GLU A 1333 THR A 1338 
AB5 3  MET A  1309 ? GLN A  1313 ? MET A 1309 GLN A 1313 
AB6 1  HIS A  1163 ? THR A  1165 ? HIS A 1163 THR A 1165 
AB6 2  THR A  1297 ? GLN A  1299 ? THR A 1297 GLN A 1299 
AB7 1  CYS A  1245 ? PHE A  1247 ? CYS A 1245 PHE A 1247 
AB7 2  VAL A  1256 ? ILE A  1259 ? VAL A 1256 ILE A 1259 
AB7 3  TRP A  1210 ? LEU A  1216 ? TRP A 1210 LEU A 1216 
AB7 4  THR A  1170 ? TYR A  1177 ? THR A 1170 TYR A 1177 
AB7 5  CYS I  52   ? ASN I  56   ? CYS I 52   ASN I 56   
AB8 1  ILE A  1321 ? ILE A  1322 ? ILE A 1321 ILE A 1322 
AB8 2  PHE A  1328 ? LYS A  1329 ? PHE A 1328 LYS A 1329 
AB9 1  PHE A  1471 ? LEU A  1475 ? PHE A 1471 LEU A 1475 
AB9 2  ILE F  104  ? TYR F  109  ? ILE F 104  TYR F 109  
AB9 3  TYR F  115  ? GLY F  119  ? TYR F 115  GLY F 119  
AC1 1  ILE B  65   ? GLN B  68   ? ILE B 65   GLN B 68   
AC1 2  ARG B  83   ? LEU B  93   ? ARG B 83   LEU B 93   
AC1 3  SER B  121  ? VAL B  132  ? SER B 121  VAL B 132  
AC1 4  GLN B  141  ? PRO B  153  ? GLN B 141  PRO B 153  
AC2 1  THR B  97   ? TRP B  99   ? THR B 97   TRP B 99   
AC2 2  PRO B  105  ? PRO B  107  ? PRO B 105  PRO B 107  
AC3 1  PHE B  185  ? ILE B  187  ? PHE B 185  ILE B 187  
AC3 2  SER B  190  ? LEU B  194  ? SER B 190  LEU B 194  
AC3 3  SER B  467  ? VAL B  469  ? SER B 467  VAL B 469  
AC4 1  LYS B  391  ? ASP B  394  ? LYS B 391  ASP B 394  
AC4 2  ALA B  196  ? MET B  200  ? ALA B 196  MET B 200  
AC4 3  LEU B  485  ? ASN B  486  ? LEU B 485  ASN B 486  
AC4 4  VAL B  523  ? LYS B  524  ? VAL B 523  LYS B 524  
AC5 1  VAL B  205  ? ALA B  209  ? VAL B 205  ALA B 209  
AC5 2  TYR B  215  ? ARG B  222  ? TYR B 215  ARG B 222  
AC5 3  THR B  234  ? LEU B  240  ? THR B 234  LEU B 240  
AC5 4  VAL B  257  ? THR B  259  ? VAL B 257  THR B 259  
AC5 5  VAL B  267  ? PRO B  268  ? VAL B 267  PRO B 268  
AC6 1  TYR B  531  ? ILE B  532  ? TYR B 531  ILE B 532  
AC6 2  ILE B  621  ? GLU B  629  ? ILE B 621  GLU B 629  
AC6 3  VAL B  662  ? ASP B  666  ? VAL B 662  ASP B 666  
AC7 1  LYS B  632  ? LEU B  633  ? LYS B 632  LEU B 633  
AC7 2  ILE B  621  ? GLU B  629  ? ILE B 621  GLU B 629  
AC7 3  HIS B  695  ? CYS B  696  ? HIS B 695  CYS B 696  
AC7 4  LEU B  675  ? ALA B  676  ? LEU B 675  ALA B 676  
AC8 1  GLU B  551  ? ASN B  552  ? GLU B 551  ASN B 552  
AC8 2  CYS B  572  ? HIS B  577  ? CYS B 572  HIS B 577  
AC8 3  THR B  565  ? VAL B  569  ? THR B 565  VAL B 569  
AC8 4  GLU B  611  ? TYR B  615  ? GLU B 611  TYR B 615  
AC8 5  SER B  602  ? ASP B  606  ? SER B 602  ASP B 606  
AC9 1  LEU B  747  ? LEU B  751  ? LEU B 747  LEU B 751  
AC9 2  SER B  808  ? GLN B  817  ? SER B 808  GLN B 817  
AC9 3  LYS B  917  ? ARG B  927  ? LYS B 917  ARG B 927  
AC9 4  THR B  901  ? LEU B  911  ? THR B 901  LEU B 911  
AC9 5  ARG B  859  ? SER B  861  ? ARG B 859  SER B 861  
AD1 1  VAL B  759  ? THR B  760  ? VAL B 759  THR B 760  
AD1 2  GLY B  997  ? ASP B  998  ? GLY B 997  ASP B 998  
AD2 1  ASN B  1025 ? GLU B  1026 ? ASN B 1025 GLU B 1026 
AD2 2  ILE B  1041 ? ARG B  1050 ? ILE B 1041 ARG B 1050 
AD2 3  LYS B  934  ? SER B  937  ? LYS B 934  SER B 937  
AD2 4  LYS B  942  ? TYR B  949  ? LYS B 942  TYR B 949  
AD2 5  SER B  793  ? ASN B  797  ? SER B 793  ASN B 797  
AD2 6  ILE B  965  ? ILE B  967  ? ILE B 965  ILE B 967  
AD2 7  ILE B  776  ? ILE B  782  ? ILE B 776  ILE B 782  
AD2 8  ILE B  1041 ? ARG B  1050 ? ILE B 1041 ARG B 1050 
AD3 1  GLU B  826  ? PHE B  829  ? GLU B 826  PHE B 829  
AD3 2  LYS B  869  ? THR B  872  ? LYS B 869  THR B 872  
AD3 3  LYS B  889  ? ASP B  891  ? LYS B 889  ASP B 891  
AD4 1  VAL B  865  ? ILE B  867  ? VAL B 865  ILE B 867  
AD4 2  THR B  894  ? PHE B  895  ? THR B 894  PHE B 895  
AD5 1  GLN B  1115 ? CYS B  1119 ? GLN B 1115 CYS B 1119 
AD5 2  ILE B  1146 ? ARG B  1150 ? ILE B 1146 ARG B 1150 
AD6 1  VAL C  9    ? LEU C  14   ? VAL C 9    LEU C 14   
AD6 2  ASN C  18   ? ILE C  23   ? ASN C 18   ILE C 23   
AD6 3  PHE C  229  ? SER C  235  ? PHE C 229  SER C 235  
AD6 4  THR C  179  ? TYR C  186  ? THR C 179  TYR C 186  
AD7 1  ILE C  121  ? SER C  122  ? ILE C 121  SER C 122  
AD7 2  SER C  98   ? ARG C  106  ? SER C 98   ARG C 106  
AD7 3  GLU C  158  ? PHE C  169  ? GLU C 158  PHE C 169  
AD7 4  PRO C  43   ? ASN C  55   ? PRO C 43   ASN C 55   
AD7 5  PHE L  55   ? ASP L  56   ? PHE L 55   ASP L 56   
AD8 1  ARG C  113  ? VAL C  115  ? ARG C 113  VAL C 115  
AD8 2  VAL C  151  ? LEU C  153  ? VAL C 151  LEU C 153  
AD9 1  GLU D  30   ? THR D  31   ? GLU D 30   THR D 31   
AD9 2  PHE G  2    ? LEU G  13   ? PHE G 2    LEU G 13   
AD9 3  VAL G  66   ? PHE G  77   ? VAL G 66   PHE G 77   
AD9 4  GLY G  43   ? ILE G  54   ? GLY G 43   ILE G 54   
AD9 5  CYS G  38   ? THR G  39   ? CYS G 38   THR G 39   
AE1 1  GLU D  30   ? THR D  31   ? GLU D 30   THR D 31   
AE1 2  PHE G  2    ? LEU G  13   ? PHE G 2    LEU G 13   
AE1 3  VAL G  66   ? PHE G  77   ? VAL G 66   PHE G 77   
AE1 4  VAL G  58   ? ILE G  59   ? VAL G 58   ILE G 59   
AE2 1  VAL E  60   ? VAL E  62   ? VAL E 60   VAL E 62   
AE2 2  MET E  72   ? PHE E  75   ? MET E 72   PHE E 75   
AE2 3  ARG E  101  ? VAL E  106  ? ARG E 101  VAL E 106  
AE2 4  ILE E  126  ? LEU E  131  ? ILE E 126  LEU E 131  
AE3 1  LYS E  81   ? VAL E  82   ? LYS E 81   VAL E 82   
AE3 2  GLY E  109  ? MET E  110  ? GLY E 109  MET E 110  
AE4 1  GLU E  147  ? VAL E  150  ? GLU E 147  VAL E 150  
AE4 2  VAL E  190  ? SER E  197  ? VAL E 190  SER E 197  
AE4 3  GLY E  201  ? VAL E  209  ? GLY E 201  VAL E 209  
AE4 4  ARG E  172  ? ILE E  173  ? ARG E 172  ILE E 173  
AE5 1  GLY G  169  ? LEU G  170  ? GLY G 169  LEU G 170  
AE5 2  GLU G  142  ? ASP G  153  ? GLU G 142  ASP G 153  
AE5 3  ASP G  156  ? SER G  162  ? ASP G 156  SER G 162  
AE5 4  MET G  104  ? SER G  109  ? MET G 104  SER G 109  
AE5 5  GLY G  96   ? ILE G  101  ? GLY G 96   ILE G 101  
AE5 6  VAL G  84   ? ASN G  93   ? VAL G 84   ASN G 93   
AE5 7  GLU G  142  ? ASP G  153  ? GLU G 142  ASP G 153  
AE6 1  GLU G  118  ? ASP G  120  ? GLU G 118  ASP G 120  
AE6 2  CYS G  127  ? LYS G  129  ? CYS G 127  LYS G 129  
AE7 1  TYR I  25   ? ASP I  29   ? TYR I 25   ASP I 29   
AE7 2  ILE I  34   ? ALA I  38   ? ILE I 34   ALA I 38   
AE7 3  GLN I  45   ? GLU I  47   ? GLN I 45   GLU I 47   
AE8 1  ARG I  80   ? THR I  81   ? ARG I 80   THR I 81   
AE8 2  ALA I  94   ? GLN I  98   ? ALA I 94   GLN I 98   
AE8 3  LEU I  110  ? CYS I  114  ? LEU I 110  CYS I 114  
AE8 4  ARG I  122  ? THR I  124  ? ARG I 122  THR I 124  
AE9 1  ILE K  19   ? LYS K  23   ? ILE K 19   LYS K 23   
AE9 2  ALA K  30   ? ASN K  36   ? ALA K 30   ASN K 36   
AE9 3  LYS K  70   ? THR K  77   ? LYS K 70   THR K 77   
AE9 4  VAL K  56   ? LYS K  62   ? VAL K 56   LYS K 62   
AF1 1  VAL M  24   ? GLU M  25   ? VAL M 24   GLU M 25   
AF1 2  MET M  32   ? ILE M  33   ? MET M 32   ILE M 33   
AF2 1  ARG N  363  ? ILE N  366  ? ARG N 363  ILE N 366  
AF2 2  LYS N  348  ? LEU N  360  ? LYS N 348  LEU N 360  
AF2 3  ASN N  333  ? SER N  345  ? ASN N 333  SER N 345  
AF2 4  LEU O  87   ? CYS O  98   ? LEU O 87   CYS O 98   
AF2 5  VAL O  71   ? ARG O  82   ? VAL O 71   ARG O 82   
AF2 6  ARG O  55   ? CYS O  68   ? ARG O 55   CYS O 68   
AF2 7  ALA P  190  ? GLU P  191  ? ALA P 190  GLU P 191  
AF2 8  VAL P  200  ? ILE P  204  ? VAL P 200  ILE P 204  
AF2 9  THR P  209  ? ILE P  213  ? THR P 209  ILE P 213  
AF2 10 LYS P  218  ? THR P  222  ? LYS P 218  THR P 222  
AF2 11 GLN P  164  ? ASN P  173  ? GLN P 164  ASN P 173  
AF2 12 LEU P  251  ? ASP P  263  ? LEU P 251  ASP P 263  
AF2 13 LYS P  309  ? ALA P  315  ? LYS P 309  ALA P 315  
AF2 14 VAL P  301  ? ILE P  304  ? VAL P 301  ILE P 304  
AF2 15 LEU P  291  ? ARG P  294  ? LEU P 291  ARG P 294  
AF2 16 SER P  281  ? TYR P  283  ? SER P 281  TYR P 283  
AF3 1  ARG N  363  ? ILE N  366  ? ARG N 363  ILE N 366  
AF3 2  LYS N  348  ? LEU N  360  ? LYS N 348  LEU N 360  
AF3 3  LYS N  369  ? GLU N  375  ? LYS N 369  GLU N 375  
AF3 4  ARG O  55   ? CYS O  68   ? ARG O 55   CYS O 68   
AF3 5  ALA P  190  ? GLU P  191  ? ALA P 190  GLU P 191  
AF3 6  VAL P  200  ? ILE P  204  ? VAL P 200  ILE P 204  
AF3 7  THR P  209  ? ILE P  213  ? THR P 209  ILE P 213  
AF3 8  LYS P  218  ? THR P  222  ? LYS P 218  THR P 222  
AF3 9  GLN P  164  ? ASN P  173  ? GLN P 164  ASN P 173  
AF3 10 LEU P  251  ? ASP P  263  ? LEU P 251  ASP P 263  
AF3 11 LYS P  309  ? ALA P  315  ? LYS P 309  ALA P 315  
AF3 12 VAL P  301  ? ILE P  304  ? VAL P 301  ILE P 304  
AF3 13 LEU P  291  ? ARG P  294  ? LEU P 291  ARG P 294  
AF3 14 SER P  281  ? TYR P  283  ? SER P 281  TYR P 283  
AF4 1  VAL Q  43   ? LYS Q  44   ? VAL Q 43   LYS Q 44   
AF4 2  ILE Q  94   ? THR Q  98   ? ILE Q 94   THR Q 98   
AF4 3  ILE Q  72   ? MET Q  76   ? ILE Q 72   MET Q 76   
AF5 1  PHE Q  145  ? ASP Q  146  ? PHE Q 145  ASP Q 146  
AF5 2  THR Q  151  ? PHE Q  152  ? THR Q 151  PHE Q 152  
AF6 1  GLU R  131  ? ILE R  133  ? GLU R 131  ILE R 133  
AF6 2  LYS R  136  ? ALA R  138  ? LYS R 136  ALA R 138  
AF7 1  GLY R  165  ? ILE R  166  ? GLY R 165  ILE R 166  
AF7 2  ILE R  200  ? PHE R  203  ? ILE R 200  PHE R 203  
AF7 3  LEU R  190  ? ASN R  193  ? LEU R 190  ASN R 193  
AF8 1  ALA S  45   ? ARG S  49   ? ALA S 45   ARG S 49   
AF8 2  TRP S  98   ? VAL S  102  ? TRP S 98   VAL S 102  
AF8 3  LYS S  109  ? LYS S  114  ? LYS S 109  LYS S 114  
AF8 4  ASN S  142  ? PRO S  148  ? ASN S 142  PRO S 148  
AF8 5  LYS S  25   ? ASN S  32   ? LYS S 25   ASN S 32   
AF8 6  GLN T  91   ? GLU T  98   ? GLN T 91   GLU T 98   
AF8 7  LEU T  104  ? CYS T  116  ? LEU T 104  CYS T 116  
AF8 8  GLY T  17   ? PRO T  24   ? GLY T 17   PRO T 24   
AF8 9  THR S  122  ? GLN S  129  ? THR S 122  GLN S 129  
AF8 10 PHE S  135  ? PRO S  139  ? PHE S 135  PRO S 139  
AF8 11 VAL S  11   ? ARG S  17   ? VAL S 11   ARG S 17   
AF8 12 GLY T  41   ? THR T  48   ? GLY T 41   THR T 48   
AF8 13 ARG T  51   ? LEU T  58   ? ARG T 51   LEU T 58   
AF8 14 HIS T  81   ? GLN T  86   ? HIS T 81   GLN T 86   
AF9 1  ALA S  45   ? ARG S  49   ? ALA S 45   ARG S 49   
AF9 2  TRP S  98   ? VAL S  102  ? TRP S 98   VAL S 102  
AF9 3  LYS S  109  ? LYS S  114  ? LYS S 109  LYS S 114  
AF9 4  ASN S  142  ? PRO S  148  ? ASN S 142  PRO S 148  
AF9 5  LYS S  25   ? ASN S  32   ? LYS S 25   ASN S 32   
AF9 6  GLN T  91   ? GLU T  98   ? GLN T 91   GLU T 98   
AF9 7  LEU T  104  ? CYS T  116  ? LEU T 104  CYS T 116  
AF9 8  LEU T  7    ? ASP T  8    ? LEU T 7    ASP T 8    
AG1 1  TYR T  197  ? ASN T  198  ? TYR T 197  ASN T 198  
AG1 2  LYS T  230  ? GLU T  234  ? LYS T 230  GLU T 234  
AG1 3  VAL T  222  ? LYS T  226  ? VAL T 222  LYS T 226  
AG2 1  THR U  272  ? THR U  274  ? THR U 272  THR U 274  
AG2 2  PHE U  288  ? CYS U  291  ? PHE U 288  CYS U 291  
AG2 3  ASN U  296  ? LYS U  299  ? ASN U 296  LYS U 299  
AG3 1  PHE V  251  ? GLU V  253  ? PHE V 251  GLU V 253  
AG3 2  ASP V  256  ? GLU V  259  ? ASP V 256  GLU V 259  
AG3 3  ILE V  277  ? LEU V  280  ? ILE V 277  LEU V 280  
AG4 1  ALA V  406  ? THR V  409  ? ALA V 406  THR V 409  
AG4 2  CYS V  361  ? GLY V  365  ? CYS V 361  GLY V 365  
AG4 3  LEU V  437  ? ASP V  441  ? LEU V 437  ASP V 441  
AG4 4  CYS V  462  ? THR V  467  ? CYS V 462  THR V 467  
AG4 5  VAL V  337  ? VAL V  339  ? VAL V 337  VAL V 339  
AG4 6  LYS V  487  ? TYR V  489  ? LYS V 487  TYR V 489  
AG5 1  ILE V  389  ? CYS V  390  ? ILE V 389  CYS V 390  
AG5 2  ILE V  401  ? GLY V  402  ? ILE V 401  GLY V 402  
AG6 1  TYR V  579  ? ILE V  580  ? TYR V 579  ILE V 580  
AG6 2  THR V  604  ? ILE V  607  ? THR V 604  ILE V 607  
AG6 3  ILE V  558  ? PHE V  561  ? ILE V 558  PHE V 561  
AG6 4  VAL V  622  ? GLN V  625  ? VAL V 622  GLN V 625  
AG6 5  ALA V  657  ? SER V  664  ? ALA V 657  SER V 664  
AG6 6  VAL V  505  ? CYS V  512  ? VAL V 505  CYS V 512  
AG6 7  PHE V  687  ? ILE V  690  ? PHE V 687  ILE V 690  
AG7 1  GLY W  38   ? GLU W  41   ? GLY W 38   GLU W 41   
AG7 2  VAL W  476  ? ALA W  479  ? VAL W 476  ALA W 479  
AG8 1  GLY W  106  ? ALA W  108  ? GLY W 106  ALA W 108  
AG8 2  VAL W  204  ? SER W  208  ? VAL W 204  SER W 208  
AG8 3  LYS W  69   ? SER W  74   ? LYS W 69   SER W 74   
AG8 4  ALA W  229  ? ASP W  234  ? ALA W 229  ASP W 234  
AG8 5  GLN W  452  ? THR W  457  ? GLN W 452  THR W 457  
AG9 1  VAL W  249  ? LEU W  251  ? VAL W 249  LEU W 251  
AG9 2  ILE W  432  ? SER W  436  ? ILE W 432  SER W 436  
AG9 3  THR W  415  ? GLU W  419  ? THR W 415  GLU W 419  
AH1 1  CYS W  489  ? LEU W  490  ? CYS W 489  LEU W 490  
AH1 2  GLY W  675  ? ALA W  680  ? GLY W 675  ALA W 680  
AH1 3  MET W  493  ? ILE W  494  ? MET W 493  ILE W 494  
AH2 1  CYS W  489  ? LEU W  490  ? CYS W 489  LEU W 490  
AH2 2  GLY W  675  ? ALA W  680  ? GLY W 675  ALA W 680  
AH2 3  ALA W  617  ? PHE W  621  ? ALA W 617  PHE W 621  
AH2 4  ILE W  535  ? PHE W  539  ? ILE W 535  PHE W 539  
AH2 5  LEU W  596  ? VAL W  599  ? LEU W 596  VAL W 599  
AH3 1  ARG X  113  ? SER X  121  ? ARG 0 113  SER 0 121  
AH3 2  SER X  102  ? LYS X  110  ? SER 0 102  LYS 0 110  
AH3 3  ARG X  59   ? ASP X  66   ? ARG 0 59   ASP 0 66   
AH3 4  SER X  164  ? PHE X  171  ? SER 0 164  PHE 0 171  
AH3 5  ILE X  194  ? LEU X  201  ? ILE 0 194  LEU 0 201  
AH3 6  THR X  218  ? ILE X  222  ? THR 0 218  ILE 0 222  
AH4 1  ILE Y  35   ? ASP Y  37   ? ILE 1 35   ASP 1 37   
AH4 2  VAL Y  43   ? ILE Y  46   ? VAL 1 43   ILE 1 46   
AH4 3  VAL Y  4    ? CYS Y  12   ? VAL 1 4    CYS 1 12   
AH4 4  GLU Z  405  ? GLN Z  411  ? GLU 2 405  GLN 2 411  
AH4 5  VAL Z  442  ? PRO Z  445  ? VAL 2 442  PRO 2 445  
AH4 6  GLU Z  434  ? ASN Z  435  ? GLU 2 434  ASN 2 435  
AH5 1  SER AA 67   ? TYR AA 71   ? SER 3 67   TYR 3 71   
AH5 2  ASN AA 55   ? SER AA 62   ? ASN 3 55   SER 3 62   
AH5 3  LEU AA 8    ? ASP AA 16   ? LEU 3 8    ASP 3 16   
AH5 4  MET AA 157  ? LYS AA 165  ? MET 3 157  LYS 3 165  
AH5 5  LEU AA 190  ? VAL AA 195  ? LEU 3 190  VAL 3 195  
AH5 6  TYR AA 214  ? LYS AA 216  ? TYR 3 214  LYS 3 216  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  O ASP A  1449 ? O ASP A 1449 N VAL A  21   ? N VAL A 21   
AA1 2  3  N GLN A  22   ? N GLN A 22   O ARG B  1170 ? O ARG B 1170 
AA2 1  2  N VAL A  94   ? N VAL A 94   O VAL A  250  ? O VAL A 250  
AA3 1  2  N SER A  194  ? N SER A 194  O GLU A  197  ? O GLU A 197  
AA3 2  3  N ALA A  200  ? N ALA A 200  O ILE A  214  ? O ILE A 214  
AA4 1  2  N MET A  329  ? N MET A 329  O MET M  83   ? O MET M 83   
AA5 1  2  O HIS B  1060 ? O HIS B 1060 N ARG A  364  ? N ARG A 364  
AA5 2  3  N ALA A  363  ? N ALA A 363  O LEU A  503  ? O LEU A 503  
AA5 3  4  O HIS A  504  ? O HIS A 504  N ILE A  457  ? N ILE A 457  
AA5 4  5  N VAL A  456  ? N VAL A 456  O HIS A  472  ? O HIS A 472  
AA5 5  6  O ARG A  475  ? O ARG A 475  N VAL A  378  ? N VAL A 378  
AA5 6  7  N GLY A  379  ? N GLY A 379  O ARG A  483  ? O ARG A 483  
AA5 7  8  O PHE A  482  ? O PHE A 482  N VAL A  366  ? N VAL A 366  
AA6 1  2  N GLU A  392  ? N GLU A 392  O VAL A  446  ? O VAL A 446  
AA6 2  3  O LYS A  445  ? O LYS A 445  N ILE A  420  ? N ILE A 420  
AA6 3  4  N ILE A  419  ? N ILE A 419  O ILE A  427  ? O ILE A 427  
AA7 1  2  N THR A  527  ? N THR A 527  O ARG A  532  ? O ARG A 532  
AA8 1  2  N LEU A  555  ? N LEU A 555  O TRP A  586  ? O TRP A 586  
AA9 1  2  N LEU A  580  ? N LEU A 580  O VAL H  91   ? O VAL H 91   
AA9 2  3  N MET H  92   ? N MET H 92   O LEU H  143  ? O LEU H 143  
AA9 3  4  O LYS H  146  ? O LYS H 146  N ARG H  57   ? N ARG H 57   
AA9 4  5  O PHE H  56   ? O PHE H 56   N PHE H  10   ? N PHE H 10   
AA9 5  6  N ASP H  11   ? N ASP H 11   O GLU H  31   ? O GLU H 31   
AA9 6  7  N LEU H  28   ? N LEU H 28   O LEU H  41   ? O LEU H 41   
AA9 7  8  N ILE H  40   ? N ILE H 40   O ARG H  124  ? O ARG H 124  
AA9 8  9  O LEU H  125  ? O LEU H 125  N ALA H  114  ? N ALA H 114  
AA9 9  10 O TYR H  115  ? O TYR H 115  N ARG H  98   ? N ARG H 98   
AB1 1  2  N GLU A  631  ? N GLU A 631  O GLU A  634  ? O GLU A 634  
AB2 1  2  N GLY A  789  ? N GLY A 789  O VAL A  823  ? O VAL A 823  
AB3 1  2  N MET A  872  ? N MET A 872  O ARG A  880  ? O ARG A 880  
AB3 2  3  N VAL A  879  ? N VAL A 879  O VAL A  887  ? O VAL A 887  
AB4 1  2  N GLU A  902  ? N GLU A 902  O LEU A  979  ? O LEU A 979  
AB5 1  2  N LEU A  1139 ? N LEU A 1139 O THR A  1338 ? O THR A 1338 
AB5 2  3  O GLU A  1333 ? O GLU A 1333 N GLN A  1313 ? N GLN A 1313 
AB6 1  2  N THR A  1164 ? N THR A 1164 O LEU A  1298 ? O LEU A 1298 
AB7 1  2  N ILE A  1246 ? N ILE A 1246 O ARG A  1258 ? O ARG A 1258 
AB7 2  3  O LEU A  1257 ? O LEU A 1257 N VAL A  1214 ? N VAL A 1214 
AB7 3  4  O LEU A  1211 ? O LEU A 1211 N TYR A  1176 ? N TYR A 1176 
AB7 4  5  N THR A  1173 ? N THR A 1173 O ASN I  56   ? O ASN I 56   
AB8 1  2  N ILE A  1321 ? N ILE A 1321 O LYS A  1329 ? O LYS A 1329 
AB9 1  2  N LEU A  1474 ? N LEU A 1474 O ILE F  105  ? O ILE F 105  
AB9 2  3  N ILE F  106  ? N ILE F 106  O TRP F  118  ? O TRP F 118  
AC1 1  2  N ILE B  65   ? N ILE B 65   O LEU B  86   ? O LEU B 86   
AC1 2  3  N TYR B  92   ? N TYR B 92   O TYR B  125  ? O TYR B 125  
AC1 3  4  N ALA B  122  ? N ALA B 122  O ILE B  152  ? O ILE B 152  
AC2 1  2  N HIS B  98   ? N HIS B 98   O SER B  106  ? O SER B 106  
AC3 1  2  N PHE B  185  ? N PHE B 185  O LYS B  192  ? O LYS B 192  
AC3 2  3  N VAL B  193  ? N VAL B 193  O GLN B  468  ? O GLN B 468  
AC4 1  2  O ASP B  394  ? O ASP B 394  N GLN B  197  ? N GLN B 197  
AC4 2  3  N ALA B  196  ? N ALA B 196  O ASN B  486  ? O ASN B 486  
AC4 3  4  N LEU B  485  ? N LEU B 485  O LYS B  524  ? O LYS B 524  
AC5 1  2  N TYR B  206  ? N TYR B 206  O GLU B  220  ? O GLU B 220  
AC5 2  3  N ALA B  216  ? N ALA B 216  O MET B  239  ? O MET B 239  
AC5 3  4  N SER B  238  ? N SER B 238  O VAL B  257  ? O VAL B 257  
AC5 4  5  N ALA B  258  ? N ALA B 258  O VAL B  267  ? O VAL B 267  
AC6 1  2  N TYR B  531  ? N TYR B 531  O CYS B  622  ? O CYS B 622  
AC6 2  3  N ARG B  623  ? N ARG B 623  O ILE B  665  ? O ILE B 665  
AC7 1  2  N LYS B  632  ? N LYS B 632  O GLU B  629  ? O GLU B 629  
AC7 2  3  N LEU B  626  ? N LEU B 626  O CYS B  696  ? O CYS B 696  
AC7 3  4  O HIS B  695  ? O HIS B 695  N ALA B  676  ? N ALA B 676  
AC8 1  2  N GLU B  551  ? N GLU B 551  O ILE B  576  ? O ILE B 576  
AC8 2  3  O CYS B  572  ? O CYS B 572  N VAL B  569  ? N VAL B 569  
AC8 3  4  N LYS B  566  ? N LYS B 566  O ILE B  612  ? O ILE B 612  
AC8 4  5  O TYR B  615  ? O TYR B 615  N SER B  602  ? N SER B 602  
AC9 1  2  N ALA B  748  ? N ALA B 748  O TYR B  811  ? O TYR B 811  
AC9 2  3  N TYR B  814  ? N TYR B 814  O ILE B  921  ? O ILE B 921  
AC9 3  4  O ARG B  924  ? O ARG B 924  N ILE B  903  ? N ILE B 903  
AC9 4  5  O GLY B  902  ? O GLY B 902  N VAL B  860  ? N VAL B 860  
AD1 1  2  N THR B  760  ? N THR B 760  O GLY B  997  ? O GLY B 997  
AD2 1  2  N GLU B  1026 ? N GLU B 1026 O ILE B  1041 ? O ILE B 1041 
AD2 2  3  O GLN B  1049 ? O GLN B 1049 N ALA B  936  ? N ALA B 936  
AD2 3  4  N PHE B  935  ? N PHE B 935  O GLY B  943  ? O GLY B 943  
AD2 4  5  O ILE B  947  ? O ILE B 947  N MET B  796  ? N MET B 796  
AD2 5  6  N ILE B  795  ? N ILE B 795  O ILE B  966  ? O ILE B 966  
AD2 6  7  O ILE B  965  ? O ILE B 965  N ALA B  781  ? N ALA B 781  
AD2 7  8  N ILE B  776  ? N ILE B 776  O TYR B  1048 ? O TYR B 1048 
AD3 1  2  N GLU B  826  ? N GLU B 826  O THR B  872  ? O THR B 872  
AD3 2  3  N VAL B  871  ? N VAL B 871  O ARG B  890  ? O ARG B 890  
AD4 1  2  N ILE B  867  ? N ILE B 867  O THR B  894  ? O THR B 894  
AD5 1  2  N VAL B  1116 ? N VAL B 1116 O VAL B  1149 ? O VAL B 1149 
AD6 1  2  N GLU C  13   ? N GLU C 13   O LYS C  20   ? O LYS C 20   
AD6 2  3  N PHE C  21   ? N PHE C 21   O TYR C  231  ? O TYR C 231  
AD6 3  4  O TYR C  230  ? O TYR C 230  N GLU C  185  ? N GLU C 185  
AD7 1  2  O ILE C  121  ? O ILE C 121  N THR C  102  ? N THR C 102  
AD7 2  3  N VAL C  105  ? N VAL C 105  O LEU C  159  ? O LEU C 159  
AD7 3  4  O ARG C  162  ? O ARG C 162  N GLN C  51   ? N GLN C 51   
AD7 4  5  N VAL C  50   ? N VAL C 50   O PHE L  55   ? O PHE L 55   
AD8 1  2  N ARG C  113  ? N ARG C 113  O LEU C  153  ? O LEU C 153  
AD9 1  2  N GLU D  30   ? N GLU D 30   O HIS G  4    ? O HIS G 4    
AD9 2  3  N LEU G  7    ? N LEU G 7    O TYR G  72   ? O TYR G 72   
AD9 3  4  O LYS G  71   ? O LYS G 71   N ASN G  53   ? N ASN G 53   
AD9 4  5  O GLY G  43   ? O GLY G 43   N THR G  39   ? N THR G 39   
AE1 1  2  N GLU D  30   ? N GLU D 30   O HIS G  4    ? O HIS G 4    
AE1 2  3  N LEU G  7    ? N LEU G 7    O TYR G  72   ? O TYR G 72   
AE1 3  4  O LEU G  67   ? O LEU G 67   N VAL G  58   ? N VAL G 58   
AE2 1  2  N VAL E  62   ? N VAL E 62   O MET E  72   ? O MET E 72   
AE2 2  3  N PHE E  75   ? N PHE E 75   O LEU E  103  ? O LEU E 103  
AE2 3  4  N ALA E  102  ? N ALA E 102  O ILE E  126  ? O ILE E 126  
AE3 1  2  N VAL E  82   ? N VAL E 82   O GLY E  109  ? O GLY E 109  
AE4 1  2  N VAL E  149  ? N VAL E 149  O LYS E  192  ? O LYS E 192  
AE4 2  3  N ILE E  193  ? N ILE E 193  O THR E  205  ? O THR E 205  
AE4 3  4  O LEU E  208  ? O LEU E 208  N ILE E  173  ? N ILE E 173  
AE5 1  2  O GLY G  169  ? O GLY G 169  N ARG G  144  ? N ARG G 144  
AE5 2  3  N ASP G  153  ? N ASP G 153  O ASP G  156  ? O ASP G 156  
AE5 3  4  O ALA G  159  ? O ALA G 159  N SER G  105  ? N SER G 105  
AE5 4  5  O ILE G  108  ? O ILE G 108  N LEU G  97   ? N LEU G 97   
AE5 5  6  O PHE G  98   ? O PHE G 98   N GLN G  91   ? N GLN G 91   
AE5 6  7  N ALA G  87   ? N ALA G 87   O ILE G  143  ? O ILE G 143  
AE6 1  2  N GLU G  118  ? N GLU G 118  O LYS G  129  ? O LYS G 129  
AE7 1  2  N TYR I  25   ? N TYR I 25   O ALA I  38   ? O ALA I 38   
AE7 2  3  N TYR I  37   ? N TYR I 37   O GLN I  46   ? O GLN I 46   
AE8 1  2  N THR I  81   ? N THR I 81   O ALA I  94   ? O ALA I 94   
AE8 2  3  N VAL I  95   ? N VAL I 95   O VAL I  113  ? O VAL I 113  
AE8 3  4  N TYR I  112  ? N TYR I 112  O TRP I  123  ? O TRP I 123  
AE9 1  2  N THR K  20   ? N THR K 20   O THR K  34   ? O THR K 34   
AE9 2  3  N PHE K  33   ? N PHE K 33   O ILE K  73   ? O ILE K 73   
AE9 3  4  O GLN K  76   ? O GLN K 76   N PHE K  58   ? N PHE K 58   
AF1 1  2  N VAL M  24   ? N VAL M 24   O ILE M  33   ? O ILE M 33   
AF2 1  2  O ARG N  363  ? O ARG N 363  N LEU N  360  ? N LEU N 360  
AF2 2  3  O LYS N  350  ? O LYS N 350  N HIS N  343  ? N HIS N 343  
AF2 3  4  N VAL N  335  ? N VAL N 335  O LYS O  94   ? O LYS O 94   
AF2 4  5  O ASP O  91   ? O ASP O 91   N ASP O  78   ? N ASP O 78   
AF2 5  6  O ARG O  82   ? O ARG O 82   N ASN O  57   ? N ASN O 57   
AF2 6  7  N TYR O  65   ? N TYR O 65   O ALA P  190  ? O ALA P 190  
AF2 7  8  N GLU P  191  ? N GLU P 191  O ILE P  201  ? O ILE P 201  
AF2 8  9  N MET P  202  ? N MET P 202  O ALA P  211  ? O ALA P 211  
AF2 9  10 N THR P  210  ? N THR P 210  O THR P  222  ? O THR P 222  
AF2 10 11 O MET P  219  ? O MET P 219  N VAL P  172  ? N VAL P 172  
AF2 11 12 N VAL P  169  ? N VAL P 169  O GLN P  256  ? O GLN P 256  
AF2 12 13 N GLY P  260  ? N GLY P 260  O LEU P  312  ? O LEU P 312  
AF2 13 14 O THR P  313  ? O THR P 313  N VAL P  301  ? N VAL P 301  
AF2 14 15 O LEU P  302  ? O LEU P 302  N TYR P  293  ? N TYR P 293  
AF2 15 16 O ILE P  292  ? O ILE P 292  N SER P  282  ? N SER P 282  
AF3 1  2  O ARG N  363  ? O ARG N 363  N LEU N  360  ? N LEU N 360  
AF3 2  3  N LEU N  353  ? N LEU N 353  O ALA N  370  ? O ALA N 370  
AF3 3  4  N GLU N  375  ? N GLU N 375  O LEU O  62   ? O LEU O 62   
AF3 4  5  N TYR O  65   ? N TYR O 65   O ALA P  190  ? O ALA P 190  
AF3 5  6  N GLU P  191  ? N GLU P 191  O ILE P  201  ? O ILE P 201  
AF3 6  7  N MET P  202  ? N MET P 202  O ALA P  211  ? O ALA P 211  
AF3 7  8  N THR P  210  ? N THR P 210  O THR P  222  ? O THR P 222  
AF3 8  9  O MET P  219  ? O MET P 219  N VAL P  172  ? N VAL P 172  
AF3 9  10 N VAL P  169  ? N VAL P 169  O GLN P  256  ? O GLN P 256  
AF3 10 11 N GLY P  260  ? N GLY P 260  O LEU P  312  ? O LEU P 312  
AF3 11 12 O THR P  313  ? O THR P 313  N VAL P  301  ? N VAL P 301  
AF3 12 13 O LEU P  302  ? O LEU P 302  N TYR P  293  ? N TYR P 293  
AF3 13 14 O ILE P  292  ? O ILE P 292  N SER P  282  ? N SER P 282  
AF4 1  2  N VAL Q  43   ? N VAL Q 43   O TYR Q  96   ? O TYR Q 96   
AF4 2  3  O ARG Q  97   ? O ARG Q 97   N LYS Q  73   ? N LYS Q 73   
AF5 1  2  N ASP Q  146  ? N ASP Q 146  O THR Q  151  ? O THR Q 151  
AF6 1  2  N GLU R  131  ? N GLU R 131  O ALA R  138  ? O ALA R 138  
AF7 1  2  N GLY R  165  ? N GLY R 165  O PHE R  202  ? O PHE R 202  
AF7 2  3  O LEU R  201  ? O LEU R 201  N VAL R  192  ? N VAL R 192  
AF8 1  2  N ARG S  46   ? N ARG S 46   O ARG S  101  ? O ARG S 101  
AF8 2  3  N LEU S  100  ? N LEU S 100  O PHE S  110  ? O PHE S 110  
AF8 3  4  N ILE S  113  ? N ILE S 113  O ASN S  145  ? O ASN S 145  
AF8 4  5  O TYR S  144  ? O TYR S 144  N ILE S  28   ? N ILE S 28   
AF8 5  6  N PHE S  31   ? N PHE S 31   O THR T  92   ? O THR T 92   
AF8 6  7  N THR T  97   ? N THR T 97   O SER T  105  ? O SER T 105  
AF8 7  8  O CYS T  116  ? O CYS T 116  N LYS T  22   ? N LYS T 22   
AF8 8  9  O TRP T  19   ? O TRP T 19   N PHE S  127  ? N PHE S 127  
AF8 9  10 N THR S  128  ? N THR S 128  O GLU S  136  ? O GLU S 136  
AF8 10 11 O PHE S  135  ? O PHE S 135  N VAL S  15   ? N VAL S 15   
AF8 11 12 N TYR S  14   ? N TYR S 14   O LEU T  43   ? O LEU T 43   
AF8 12 13 N ALA T  46   ? N ALA T 46   O GLU T  53   ? O GLU T 53   
AF8 13 14 N PHE T  56   ? N PHE T 56   O HIS T  81   ? O HIS T 81   
AF9 1  2  N ARG S  46   ? N ARG S 46   O ARG S  101  ? O ARG S 101  
AF9 2  3  N LEU S  100  ? N LEU S 100  O PHE S  110  ? O PHE S 110  
AF9 3  4  N ILE S  113  ? N ILE S 113  O ASN S  145  ? O ASN S 145  
AF9 4  5  O TYR S  144  ? O TYR S 144  N ILE S  28   ? N ILE S 28   
AF9 5  6  N PHE S  31   ? N PHE S 31   O THR T  92   ? O THR T 92   
AF9 6  7  N THR T  97   ? N THR T 97   O SER T  105  ? O SER T 105  
AF9 7  8  O LEU T  106  ? O LEU T 106  N ASP T  8    ? N ASP T 8    
AG1 1  2  N TYR T  197  ? N TYR T 197  O TRP T  233  ? O TRP T 233  
AG1 2  3  O THR T  232  ? O THR T 232  N ASN T  224  ? N ASN T 224  
AG2 1  2  N THR U  272  ? N THR U 272  O VAL U  290  ? O VAL U 290  
AG2 2  3  N CYS U  291  ? N CYS U 291  O ASN U  296  ? O ASN U 296  
AG3 1  2  N GLU V  253  ? N GLU V 253  O ASP V  256  ? O ASP V 256  
AG3 2  3  N GLU V  259  ? N GLU V 259  O ILE V  277  ? O ILE V 277  
AG4 1  2  O SER V  408  ? O SER V 408  N VAL V  363  ? N VAL V 363  
AG4 2  3  N LEU V  364  ? N LEU V 364  O ILE V  439  ? O ILE V 439  
AG4 3  4  N MET V  438  ? N MET V 438  O LEU V  464  ? O LEU V 464  
AG4 4  5  O GLY V  465  ? O GLY V 465  N ILE V  338  ? N ILE V 338  
AG4 5  6  N VAL V  337  ? N VAL V 337  O LEU V  488  ? O LEU V 488  
AG5 1  2  N CYS V  390  ? N CYS V 390  O ILE V  401  ? O ILE V 401  
AG6 1  2  N ILE V  580  ? N ILE V 580  O PHE V  606  ? O PHE V 606  
AG6 2  3  O ILE V  605  ? O ILE V 605  N VAL V  560  ? N VAL V 560  
AG6 3  4  N PHE V  561  ? N PHE V 561  O ILE V  624  ? O ILE V 624  
AG6 4  5  N GLN V  625  ? N GLN V 625  O TYR V  660  ? O TYR V 660  
AG6 5  6  O SER V  661  ? O SER V 661  N VAL V  510  ? N VAL V 510  
AG6 6  7  N GLU V  509  ? N GLU V 509  O ILE V  690  ? O ILE V 690  
AG7 1  2  N VAL W  39   ? N VAL W 39   O VAL W  476  ? O VAL W 476  
AG8 1  2  N LEU W  107  ? N LEU W 107  O VAL W  206  ? O VAL W 206  
AG8 2  3  O VAL W  205  ? O VAL W 205  N TYR W  72   ? N TYR W 72   
AG8 3  4  N LYS W  69   ? N LYS W 69   O VAL W  230  ? O VAL W 230  
AG8 4  5  N VAL W  231  ? N VAL W 231  O SER W  453  ? O SER W 453  
AG9 1  2  N LEU W  251  ? N LEU W 251  O LEU W  433  ? O LEU W 433  
AG9 2  3  O HIS W  434  ? O HIS W 434  N ILE W  417  ? N ILE W 417  
AH1 1  2  N LEU W  490  ? N LEU W 490  O MET W  677  ? O MET W 677  
AH1 2  3  O PHE W  679  ? O PHE W 679  N ILE W  494  ? N ILE W 494  
AH2 1  2  N LEU W  490  ? N LEU W 490  O MET W  677  ? O MET W 677  
AH2 2  3  O VAL W  678  ? O VAL W 678  N VAL W  618  ? N VAL W 618  
AH2 3  4  O PHE W  621  ? O PHE W 621  N PHE W  538  ? N PHE W 538  
AH2 4  5  N ALA W  537  ? N ALA W 537  O LEU W  596  ? O LEU W 596  
AH3 1  2  O GLU X  115  ? O GLU 0 115  N VAL X  108  ? N VAL 0 108  
AH3 2  3  O GLN X  103  ? O GLN 0 103  N ARG X  59   ? N ARG 0 59   
AH3 3  4  N TYR X  62   ? N TYR 0 62   O GLU X  166  ? O GLU 0 166  
AH3 4  5  N ILE X  169  ? N ILE 0 169  O ILE X  199  ? O ILE 0 199  
AH3 5  6  N GLY X  200  ? N GLY 0 200  O HIS X  220  ? O HIS 0 220  
AH4 1  2  N ASP Y  37   ? N ASP 1 37   O VAL Y  45   ? O VAL 1 45   
AH4 2  3  O PHE Y  44   ? O PHE 1 44   N GLU Y  11   ? N GLU 1 11   
AH4 3  4  N VAL Y  8    ? N VAL 1 8    O VAL Z  407  ? O VAL 2 407  
AH4 4  5  N LEU Z  408  ? N LEU 2 408  O THR Z  444  ? O THR 2 444  
AH4 5  6  O VAL Z  443  ? O VAL 2 443  N GLU Z  434  ? N GLU 2 434  
AH5 1  2  O ARG AA 68   ? O ARG 3 68   N ALA AA 61   ? N ALA 3 61   
AH5 2  3  O ILE AA 60   ? O ILE 3 60   N VAL AA 15   ? N VAL 3 15   
AH5 3  4  N VAL AA 14   ? N VAL 3 14   O LEU AA 162  ? O LEU 3 162  
AH5 4  5  N ILE AA 161  ? N ILE 3 161  O ASP AA 192  ? O ASP 3 192  
AH5 5  6  N VAL AA 195  ? N VAL 3 195  O LEU AA 215  ? O LEU 3 215  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG 2001 ? 3 'binding site for residue MG A 2001' 
AC2 Software A MG 2002 ? 4 'binding site for residue MG A 2002' 
AC3 Software A ZN 2003 ? 4 'binding site for residue ZN A 2003' 
AC4 Software A ZN 2004 ? 4 'binding site for residue ZN A 2004' 
AC5 Software B ZN 1201 ? 4 'binding site for residue ZN B 1201' 
AC6 Software C ZN 301  ? 4 'binding site for residue ZN C 301'  
AC7 Software I ZN 201  ? 5 'binding site for residue ZN I 201'  
AC8 Software I ZN 202  ? 4 'binding site for residue ZN I 202'  
AC9 Software J ZN 101  ? 4 'binding site for residue ZN J 101'  
AD1 Software L ZN 101  ? 4 'binding site for residue ZN L 101'  
AD2 Software M ZN 401  ? 5 'binding site for residue ZN M 401'  
AD3 Software Q ZN 501  ? 4 'binding site for residue ZN Q 501'  
AD4 Software U ZN 401  ? 4 'binding site for residue ZN U 401'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 ASN A 493  ? ASN A 493  . ? 1_555 ? 
2  AC1 3 ASP A 495  ? ASP A 495  . ? 1_555 ? 
3  AC1 3 ASP A 499  ? ASP A 499  . ? 1_555 ? 
4  AC2 4 ALA A 494  ? ALA A 494  . ? 1_555 ? 
5  AC2 4 ASP A 495  ? ASP A 495  . ? 1_555 ? 
6  AC2 4 GLU B 791  ? GLU B 791  . ? 1_555 ? 
7  AC2 4 ASP U 282  ? ASP U 282  . ? 1_555 ? 
8  AC3 4 CYS A 71   ? CYS A 71   . ? 1_555 ? 
9  AC3 4 CYS A 74   ? CYS A 74   . ? 1_555 ? 
10 AC3 4 CYS A 81   ? CYS A 81   . ? 1_555 ? 
11 AC3 4 HIS A 84   ? HIS A 84   . ? 1_555 ? 
12 AC4 4 CYS A 111  ? CYS A 111  . ? 1_555 ? 
13 AC4 4 CYS A 114  ? CYS A 114  . ? 1_555 ? 
14 AC4 4 CYS A 154  ? CYS A 154  . ? 1_555 ? 
15 AC4 4 CYS A 184  ? CYS A 184  . ? 1_555 ? 
16 AC5 4 CYS B 1119 ? CYS B 1119 . ? 1_555 ? 
17 AC5 4 CYS B 1122 ? CYS B 1122 . ? 1_555 ? 
18 AC5 4 CYS B 1137 ? CYS B 1137 . ? 1_555 ? 
19 AC5 4 CYS B 1140 ? CYS B 1140 . ? 1_555 ? 
20 AC6 4 CYS C 88   ? CYS C 88   . ? 1_555 ? 
21 AC6 4 CYS C 90   ? CYS C 90   . ? 1_555 ? 
22 AC6 4 CYS C 94   ? CYS C 94   . ? 1_555 ? 
23 AC6 4 CYS C 97   ? CYS C 97   . ? 1_555 ? 
24 AC7 5 CYS I 17   ? CYS I 17   . ? 1_555 ? 
25 AC7 5 CYS I 20   ? CYS I 20   . ? 1_555 ? 
26 AC7 5 CYS I 39   ? CYS I 39   . ? 1_555 ? 
27 AC7 5 ASN I 41   ? ASN I 41   . ? 1_555 ? 
28 AC7 5 CYS I 42   ? CYS I 42   . ? 1_555 ? 
29 AC8 4 CYS I 86   ? CYS I 86   . ? 1_555 ? 
30 AC8 4 CYS I 89   ? CYS I 89   . ? 1_555 ? 
31 AC8 4 CYS I 114  ? CYS I 114  . ? 1_555 ? 
32 AC8 4 CYS I 119  ? CYS I 119  . ? 1_555 ? 
33 AC9 4 CYS J 7    ? CYS J 7    . ? 1_555 ? 
34 AC9 4 CYS J 10   ? CYS J 10   . ? 1_555 ? 
35 AC9 4 CYS J 44   ? CYS J 44   . ? 1_555 ? 
36 AC9 4 CYS J 45   ? CYS J 45   . ? 1_555 ? 
37 AD1 4 CYS L 19   ? CYS L 19   . ? 1_555 ? 
38 AD1 4 CYS L 22   ? CYS L 22   . ? 1_555 ? 
39 AD1 4 CYS L 36   ? CYS L 36   . ? 1_555 ? 
40 AD1 4 CYS L 39   ? CYS L 39   . ? 1_555 ? 
41 AD2 5 CYS M 15   ? CYS M 15   . ? 1_555 ? 
42 AD2 5 HIS M 18   ? HIS M 18   . ? 1_555 ? 
43 AD2 5 CYS M 34   ? CYS M 34   . ? 1_555 ? 
44 AD2 5 GLU M 36   ? GLU M 36   . ? 1_555 ? 
45 AD2 5 CYS M 37   ? CYS M 37   . ? 1_555 ? 
46 AD3 4 CYS Q 129  ? CYS Q 129  . ? 1_555 ? 
47 AD3 4 CYS Q 132  ? CYS Q 132  . ? 1_555 ? 
48 AD3 4 CYS Q 154  ? CYS Q 154  . ? 1_555 ? 
49 AD3 4 CYS Q 157  ? CYS Q 157  . ? 1_555 ? 
50 AD4 4 CYS U 263  ? CYS U 263  . ? 1_555 ? 
51 AD4 4 CYS U 266  ? CYS U 266  . ? 1_555 ? 
52 AD4 4 CYS U 291  ? CYS U 291  . ? 1_555 ? 
53 AD4 4 CYS U 294  ? CYS U 294  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5IY8 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ASP A  1  10   ? 212.048 304.015 249.823 1.00 0.00 ? 10   ASP A N     1 
ATOM   2     C  CA    . ASP A  1  10   ? 212.594 304.020 251.177 1.00 0.00 ? 10   ASP A CA    1 
ATOM   3     C  C     . ASP A  1  10   ? 212.681 302.602 251.744 1.00 0.00 ? 10   ASP A C     1 
ATOM   4     O  O     . ASP A  1  10   ? 211.698 302.068 252.267 1.00 0.00 ? 10   ASP A O     1 
ATOM   5     C  CB    . ASP A  1  10   ? 211.744 304.905 252.098 1.00 0.00 ? 10   ASP A CB    1 
ATOM   6     C  CG    . ASP A  1  10   ? 212.457 305.259 253.398 1.00 0.00 ? 10   ASP A CG    1 
ATOM   7     O  OD1   . ASP A  1  10   ? 213.684 305.032 253.492 1.00 0.00 ? 10   ASP A OD1   1 
ATOM   8     O  OD2   . ASP A  1  10   ? 211.786 305.763 254.328 1.00 0.00 ? 10   ASP A OD2   1 
ATOM   9     N  N     . SER A  1  11   ? 213.864 302.004 251.640 1.00 0.00 ? 11   SER A N     1 
ATOM   10    C  CA    . SER A  1  11   ? 214.133 300.700 252.241 1.00 0.00 ? 11   SER A CA    1 
ATOM   11    C  C     . SER A  1  11   ? 214.595 300.831 253.691 1.00 0.00 ? 11   SER A C     1 
ATOM   12    O  O     . SER A  1  11   ? 214.746 299.826 254.388 1.00 0.00 ? 11   SER A O     1 
ATOM   13    C  CB    . SER A  1  11   ? 215.187 299.945 251.437 1.00 0.00 ? 11   SER A CB    1 
ATOM   14    O  OG    . SER A  1  11   ? 216.433 300.614 251.505 1.00 0.00 ? 11   SER A OG    1 
ATOM   15    N  N     . ALA A  1  12   ? 214.830 302.069 254.126 1.00 0.00 ? 12   ALA A N     1 
ATOM   16    C  CA    . ALA A  1  12   ? 215.338 302.370 255.469 1.00 0.00 ? 12   ALA A CA    1 
ATOM   17    C  C     . ALA A  1  12   ? 216.705 301.730 255.704 1.00 0.00 ? 12   ALA A C     1 
ATOM   18    O  O     . ALA A  1  12   ? 216.988 301.199 256.782 1.00 0.00 ? 12   ALA A O     1 
ATOM   19    C  CB    . ALA A  1  12   ? 214.342 301.923 256.542 1.00 0.00 ? 12   ALA A CB    1 
ATOM   20    N  N     . CYS A  1  13   ? 217.548 301.792 254.681 1.00 0.00 ? 13   CYS A N     1 
ATOM   21    C  CA    . CYS A  1  13   ? 218.861 301.170 254.718 1.00 0.00 ? 13   CYS A CA    1 
ATOM   22    C  C     . CYS A  1  13   ? 219.832 302.007 253.901 1.00 0.00 ? 13   CYS A C     1 
ATOM   23    O  O     . CYS A  1  13   ? 219.483 302.473 252.817 1.00 0.00 ? 13   CYS A O     1 
ATOM   24    C  CB    . CYS A  1  13   ? 218.795 299.740 254.181 1.00 0.00 ? 13   CYS A CB    1 
ATOM   25    S  SG    . CYS A  1  13   ? 220.373 298.865 254.127 1.00 0.00 ? 13   CYS A SG    1 
ATOM   26    N  N     . PRO A  1  14   ? 221.055 302.205 254.417 1.00 0.00 ? 14   PRO A N     1 
ATOM   27    C  CA    . PRO A  1  14   ? 222.014 303.049 253.697 1.00 0.00 ? 14   PRO A CA    1 
ATOM   28    C  C     . PRO A  1  14   ? 222.606 302.394 252.445 1.00 0.00 ? 14   PRO A C     1 
ATOM   29    O  O     . PRO A  1  14   ? 223.002 301.227 252.467 1.00 0.00 ? 14   PRO A O     1 
ATOM   30    C  CB    . PRO A  1  14   ? 223.099 303.310 254.749 1.00 0.00 ? 14   PRO A CB    1 
ATOM   31    C  CG    . PRO A  1  14   ? 223.014 302.143 255.680 1.00 0.00 ? 14   PRO A CG    1 
ATOM   32    C  CD    . PRO A  1  14   ? 221.556 301.788 255.740 1.00 0.00 ? 14   PRO A CD    1 
ATOM   33    N  N     . LEU A  1  15   ? 222.639 303.174 251.365 1.00 0.00 ? 15   LEU A N     1 
ATOM   34    C  CA    . LEU A  1  15   ? 223.211 302.795 250.074 1.00 0.00 ? 15   LEU A CA    1 
ATOM   35    C  C     . LEU A  1  15   ? 224.741 302.804 250.080 1.00 0.00 ? 15   LEU A C     1 
ATOM   36    O  O     . LEU A  1  15   ? 225.354 303.753 250.569 1.00 0.00 ? 15   LEU A O     1 
ATOM   37    C  CB    . LEU A  1  15   ? 222.705 303.749 248.996 1.00 0.00 ? 15   LEU A CB    1 
ATOM   38    C  CG    . LEU A  1  15   ? 223.070 303.388 247.565 1.00 0.00 ? 15   LEU A CG    1 
ATOM   39    C  CD1   . LEU A  1  15   ? 222.351 302.119 247.190 1.00 0.00 ? 15   LEU A CD1   1 
ATOM   40    C  CD2   . LEU A  1  15   ? 222.714 304.520 246.615 1.00 0.00 ? 15   LEU A CD2   1 
ATOM   41    N  N     . ARG A  1  16   ? 225.357 301.772 249.513 1.00 0.00 ? 16   ARG A N     1 
ATOM   42    C  CA    . ARG A  1  16   ? 226.816 301.650 249.540 1.00 0.00 ? 16   ARG A CA    1 
ATOM   43    C  C     . ARG A  1  16   ? 227.327 301.162 248.208 1.00 0.00 ? 16   ARG A C     1 
ATOM   44    O  O     . ARG A  1  16   ? 226.568 300.642 247.402 1.00 0.00 ? 16   ARG A O     1 
ATOM   45    C  CB    . ARG A  1  16   ? 227.280 300.680 250.635 1.00 0.00 ? 16   ARG A CB    1 
ATOM   46    C  CG    . ARG A  1  16   ? 227.052 301.162 252.050 1.00 0.00 ? 16   ARG A CG    1 
ATOM   47    C  CD    . ARG A  1  16   ? 227.932 302.351 252.361 1.00 0.00 ? 16   ARG A CD    1 
ATOM   48    N  NE    . ARG A  1  16   ? 227.805 302.749 253.758 1.00 0.00 ? 16   ARG A NE    1 
ATOM   49    C  CZ    . ARG A  1  16   ? 226.887 303.601 254.206 1.00 0.00 ? 16   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A  1  16   ? 226.017 304.138 253.358 1.00 0.00 ? 16   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A  1  16   ? 226.845 303.921 255.496 1.00 0.00 ? 16   ARG A NH2   1 
ATOM   52    N  N     . THR A  1  17   ? 228.625 301.299 247.990 1.00 0.00 ? 17   THR A N     1 
ATOM   53    C  CA    . THR A  1  17   ? 229.228 300.839 246.749 1.00 0.00 ? 17   THR A CA    1 
ATOM   54    C  C     . THR A  1  17   ? 230.295 299.800 247.073 1.00 0.00 ? 17   THR A C     1 
ATOM   55    O  O     . THR A  1  17   ? 230.771 299.730 248.212 1.00 0.00 ? 17   THR A O     1 
ATOM   56    C  CB    . THR A  1  17   ? 229.826 302.000 245.950 1.00 0.00 ? 17   THR A CB    1 
ATOM   57    O  OG1   . THR A  1  17   ? 230.552 302.859 246.836 1.00 0.00 ? 17   THR A OG1   1 
ATOM   58    C  CG2   . THR A  1  17   ? 228.720 302.803 245.295 1.00 0.00 ? 17   THR A CG2   1 
ATOM   59    N  N     . ILE A  1  18   ? 230.660 298.976 246.095 1.00 0.00 ? 18   ILE A N     1 
ATOM   60    C  CA    . ILE A  1  18   ? 231.621 297.910 246.362 1.00 0.00 ? 18   ILE A CA    1 
ATOM   61    C  C     . ILE A  1  18   ? 233.051 298.467 246.343 1.00 0.00 ? 18   ILE A C     1 
ATOM   62    O  O     . ILE A  1  18   ? 233.361 299.351 245.557 1.00 0.00 ? 18   ILE A O     1 
ATOM   63    C  CB    . ILE A  1  18   ? 231.468 296.766 245.352 1.00 0.00 ? 18   ILE A CB    1 
ATOM   64    C  CG1   . ILE A  1  18   ? 230.093 296.144 245.500 1.00 0.00 ? 18   ILE A CG1   1 
ATOM   65    C  CG2   . ILE A  1  18   ? 232.498 295.690 245.594 1.00 0.00 ? 18   ILE A CG2   1 
ATOM   66    C  CD1   . ILE A  1  18   ? 229.818 295.715 246.909 1.00 0.00 ? 18   ILE A CD1   1 
ATOM   67    N  N     . LYS A  1  19   ? 233.909 297.994 247.240 1.00 0.00 ? 19   LYS A N     1 
ATOM   68    C  CA    . LYS A  1  19   ? 235.285 298.469 247.264 1.00 0.00 ? 19   LYS A CA    1 
ATOM   69    C  C     . LYS A  1  19   ? 236.271 297.343 246.976 1.00 0.00 ? 19   LYS A C     1 
ATOM   70    O  O     . LYS A  1  19   ? 237.409 297.591 246.594 1.00 0.00 ? 19   LYS A O     1 
ATOM   71    C  CB    . LYS A  1  19   ? 235.613 299.095 248.620 1.00 0.00 ? 19   LYS A CB    1 
ATOM   72    C  CG    . LYS A  1  19   ? 234.636 300.149 249.070 1.00 0.00 ? 19   LYS A CG    1 
ATOM   73    C  CD    . LYS A  1  19   ? 234.574 301.314 248.103 1.00 0.00 ? 19   LYS A CD    1 
ATOM   74    C  CE    . LYS A  1  19   ? 233.711 302.441 248.672 1.00 0.00 ? 19   LYS A CE    1 
ATOM   75    N  NZ    . LYS A  1  19   ? 233.696 303.665 247.805 1.00 0.00 ? 19   LYS A NZ    1 
ATOM   76    N  N     . ARG A  1  20   ? 235.826 296.106 247.161 1.00 0.00 ? 20   ARG A N     1 
ATOM   77    C  CA    . ARG A  1  20   ? 236.682 294.935 246.989 1.00 0.00 ? 20   ARG A CA    1 
ATOM   78    C  C     . ARG A  1  20   ? 235.835 293.697 246.781 1.00 0.00 ? 20   ARG A C     1 
ATOM   79    O  O     . ARG A  1  20   ? 234.748 293.623 247.338 1.00 0.00 ? 20   ARG A O     1 
ATOM   80    C  CB    . ARG A  1  20   ? 237.579 294.755 248.213 1.00 0.00 ? 20   ARG A CB    1 
ATOM   81    C  CG    . ARG A  1  20   ? 238.557 293.616 248.096 1.00 0.00 ? 20   ARG A CG    1 
ATOM   82    C  CD    . ARG A  1  20   ? 239.617 293.714 249.169 1.00 0.00 ? 20   ARG A CD    1 
ATOM   83    N  NE    . ARG A  1  20   ? 239.046 293.748 250.513 1.00 0.00 ? 20   ARG A NE    1 
ATOM   84    C  CZ    . ARG A  1  20   ? 238.777 292.662 251.226 1.00 0.00 ? 20   ARG A CZ    1 
ATOM   85    N  NH1   . ARG A  1  20   ? 239.016 291.463 250.713 1.00 0.00 ? 20   ARG A NH1   1 
ATOM   86    N  NH2   . ARG A  1  20   ? 238.259 292.769 252.442 1.00 0.00 ? 20   ARG A NH2   1 
ATOM   87    N  N     . VAL A  1  21   ? 236.298 292.725 245.997 1.00 0.00 ? 21   VAL A N     1 
ATOM   88    C  CA    . VAL A  1  21   ? 235.556 291.464 245.908 1.00 0.00 ? 21   VAL A CA    1 
ATOM   89    C  C     . VAL A  1  21   ? 236.368 290.229 246.301 1.00 0.00 ? 21   VAL A C     1 
ATOM   90    O  O     . VAL A  1  21   ? 237.246 289.778 245.562 1.00 0.00 ? 21   VAL A O     1 
ATOM   91    C  CB    . VAL A  1  21   ? 234.994 291.251 244.523 1.00 0.00 ? 21   VAL A CB    1 
ATOM   92    C  CG1   . VAL A  1  21   ? 234.349 289.903 244.445 1.00 0.00 ? 21   VAL A CG1   1 
ATOM   93    C  CG2   . VAL A  1  21   ? 233.997 292.337 244.217 1.00 0.00 ? 21   VAL A CG2   1 
ATOM   94    N  N     . GLN A  1  22   ? 236.022 289.664 247.458 1.00 0.00 ? 22   GLN A N     1 
ATOM   95    C  CA    . GLN A  1  22   ? 236.754 288.557 248.068 1.00 0.00 ? 22   GLN A CA    1 
ATOM   96    C  C     . GLN A  1  22   ? 236.189 287.185 247.705 1.00 0.00 ? 22   GLN A C     1 
ATOM   97    O  O     . GLN A  1  22   ? 235.101 286.816 248.147 1.00 0.00 ? 22   GLN A O     1 
ATOM   98    C  CB    . GLN A  1  22   ? 236.746 288.712 249.591 1.00 0.00 ? 22   GLN A CB    1 
ATOM   99    C  CG    . GLN A  1  22   ? 237.589 287.686 250.317 1.00 0.00 ? 22   GLN A CG    1 
ATOM   100   C  CD    . GLN A  1  22   ? 239.057 287.805 249.962 1.00 0.00 ? 22   GLN A CD    1 
ATOM   101   O  OE1   . GLN A  1  22   ? 239.683 288.839 250.201 1.00 0.00 ? 22   GLN A OE1   1 
ATOM   102   N  NE2   . GLN A  1  22   ? 239.614 286.750 249.380 1.00 0.00 ? 22   GLN A NE2   1 
ATOM   103   N  N     . PHE A  1  23   ? 236.955 286.434 246.919 1.00 0.00 ? 23   PHE A N     1 
ATOM   104   C  CA    . PHE A  1  23   ? 236.612 285.066 246.543 1.00 0.00 ? 23   PHE A CA    1 
ATOM   105   C  C     . PHE A  1  23   ? 237.104 284.078 247.570 1.00 0.00 ? 23   PHE A C     1 
ATOM   106   O  O     . PHE A  1  23   ? 237.942 284.417 248.400 1.00 0.00 ? 23   PHE A O     1 
ATOM   107   C  CB    . PHE A  1  23   ? 237.214 284.725 245.190 1.00 0.00 ? 23   PHE A CB    1 
ATOM   108   C  CG    . PHE A  1  23   ? 236.576 285.446 244.063 1.00 0.00 ? 23   PHE A CG    1 
ATOM   109   C  CD1   . PHE A  1  23   ? 236.883 286.766 243.820 1.00 0.00 ? 23   PHE A CD1   1 
ATOM   110   C  CD2   . PHE A  1  23   ? 235.643 284.818 243.267 1.00 0.00 ? 23   PHE A CD2   1 
ATOM   111   C  CE1   . PHE A  1  23   ? 236.291 287.437 242.798 1.00 0.00 ? 23   PHE A CE1   1 
ATOM   112   C  CE2   . PHE A  1  23   ? 235.053 285.482 242.235 1.00 0.00 ? 23   PHE A CE2   1 
ATOM   113   C  CZ    . PHE A  1  23   ? 235.371 286.798 242.003 1.00 0.00 ? 23   PHE A CZ    1 
ATOM   114   N  N     . GLY A  1  24   ? 236.607 282.849 247.501 1.00 0.00 ? 24   GLY A N     1 
ATOM   115   C  CA    . GLY A  1  24   ? 237.014 281.821 248.440 1.00 0.00 ? 24   GLY A CA    1 
ATOM   116   C  C     . GLY A  1  24   ? 235.905 280.820 248.652 1.00 0.00 ? 24   GLY A C     1 
ATOM   117   O  O     . GLY A  1  24   ? 234.768 281.215 248.902 1.00 0.00 ? 24   GLY A O     1 
ATOM   118   N  N     . VAL A  1  25   ? 236.242 279.535 248.569 1.00 0.00 ? 25   VAL A N     1 
ATOM   119   C  CA    . VAL A  1  25   ? 235.262 278.453 248.657 1.00 0.00 ? 25   VAL A CA    1 
ATOM   120   C  C     . VAL A  1  25   ? 234.390 278.588 249.903 1.00 0.00 ? 25   VAL A C     1 
ATOM   121   O  O     . VAL A  1  25   ? 234.882 278.974 250.958 1.00 0.00 ? 25   VAL A O     1 
ATOM   122   C  CB    . VAL A  1  25   ? 235.944 277.076 248.677 1.00 0.00 ? 25   VAL A CB    1 
ATOM   123   C  CG1   . VAL A  1  25   ? 234.925 275.995 248.437 1.00 0.00 ? 25   VAL A CG1   1 
ATOM   124   C  CG2   . VAL A  1  25   ? 237.009 276.995 247.619 1.00 0.00 ? 25   VAL A CG2   1 
ATOM   125   N  N     . LEU A  1  26   ? 233.092 278.321 249.777 1.00 0.00 ? 26   LEU A N     1 
ATOM   126   C  CA    . LEU A  1  26   ? 232.175 278.434 250.912 1.00 0.00 ? 26   LEU A CA    1 
ATOM   127   C  C     . LEU A  1  26   ? 232.289 277.257 251.893 1.00 0.00 ? 26   LEU A C     1 
ATOM   128   O  O     . LEU A  1  26   ? 232.347 276.105 251.474 1.00 0.00 ? 26   LEU A O     1 
ATOM   129   C  CB    . LEU A  1  26   ? 230.733 278.564 250.411 1.00 0.00 ? 26   LEU A CB    1 
ATOM   130   C  CG    . LEU A  1  26   ? 230.164 277.677 249.286 1.00 0.00 ? 26   LEU A CG    1 
ATOM   131   C  CD1   . LEU A  1  26   ? 230.010 276.203 249.667 1.00 0.00 ? 26   LEU A CD1   1 
ATOM   132   C  CD2   . LEU A  1  26   ? 228.827 278.220 248.781 1.00 0.00 ? 26   LEU A CD2   1 
ATOM   133   N  N     . SER A  1  27   ? 232.355 277.525 253.194 1.00 0.00 ? 27   SER A N     1 
ATOM   134   C  CA    . SER A  1  27   ? 232.284 276.435 254.167 1.00 0.00 ? 27   SER A CA    1 
ATOM   135   C  C     . SER A  1  27   ? 230.973 275.656 254.028 1.00 0.00 ? 27   SER A C     1 
ATOM   136   O  O     . SER A  1  27   ? 229.904 276.256 253.908 1.00 0.00 ? 27   SER A O     1 
ATOM   137   C  CB    . SER A  1  27   ? 232.423 276.962 255.597 1.00 0.00 ? 27   SER A CB    1 
ATOM   138   O  OG    . SER A  1  27   ? 232.257 275.914 256.548 1.00 0.00 ? 27   SER A OG    1 
ATOM   139   N  N     . PRO A  1  28   ? 231.050 274.314 254.031 1.00 0.00 ? 28   PRO A N     1 
ATOM   140   C  CA    . PRO A  1  28   ? 229.812 273.534 253.990 1.00 0.00 ? 28   PRO A CA    1 
ATOM   141   C  C     . PRO A  1  28   ? 229.022 273.682 255.283 1.00 0.00 ? 28   PRO A C     1 
ATOM   142   O  O     . PRO A  1  28   ? 227.793 273.627 255.280 1.00 0.00 ? 28   PRO A O     1 
ATOM   143   C  CB    . PRO A  1  28   ? 230.304 272.091 253.832 1.00 0.00 ? 28   PRO A CB    1 
ATOM   144   C  CG    . PRO A  1  28   ? 231.673 272.092 254.416 1.00 0.00 ? 28   PRO A CG    1 
ATOM   145   C  CD    . PRO A  1  28   ? 232.243 273.456 254.105 1.00 0.00 ? 28   PRO A CD    1 
ATOM   146   N  N     . ASP A  1  29   ? 229.750 273.915 256.373 1.00 0.00 ? 29   ASP A N     1 
ATOM   147   C  CA    . ASP A  1  29   ? 229.182 274.084 257.706 1.00 0.00 ? 29   ASP A CA    1 
ATOM   148   C  C     . ASP A  1  29   ? 228.431 275.419 257.726 1.00 0.00 ? 29   ASP A C     1 
ATOM   149   O  O     . ASP A  1  29   ? 227.347 275.540 258.296 1.00 0.00 ? 29   ASP A O     1 
ATOM   150   C  CB    . ASP A  1  29   ? 230.269 274.014 258.787 1.00 0.00 ? 29   ASP A CB    1 
ATOM   151   C  CG    . ASP A  1  29   ? 229.787 274.508 260.158 1.00 0.00 ? 29   ASP A CG    1 
ATOM   152   O  OD1   . ASP A  1  29   ? 228.624 274.220 260.531 1.00 0.00 ? 29   ASP A OD1   1 
ATOM   153   O  OD2   . ASP A  1  29   ? 230.585 275.144 260.887 1.00 0.00 ? 29   ASP A OD2   1 
ATOM   154   N  N     . GLU A  1  30   ? 229.012 276.412 257.064 1.00 0.00 ? 30   GLU A N     1 
ATOM   155   C  CA    . GLU A  1  30   ? 228.342 277.688 256.837 1.00 0.00 ? 30   GLU A CA    1 
ATOM   156   C  C     . GLU A  1  30   ? 227.176 277.533 255.861 1.00 0.00 ? 30   GLU A C     1 
ATOM   157   O  O     . GLU A  1  30   ? 226.108 278.107 256.074 1.00 0.00 ? 30   GLU A O     1 
ATOM   158   C  CB    . GLU A  1  30   ? 229.341 278.710 256.283 1.00 0.00 ? 30   GLU A CB    1 
ATOM   159   C  CG    . GLU A  1  30   ? 228.929 280.161 256.436 1.00 0.00 ? 30   GLU A CG    1 
ATOM   160   C  CD    . GLU A  1  30   ? 228.696 280.535 257.883 1.00 0.00 ? 30   GLU A CD    1 
ATOM   161   O  OE1   . GLU A  1  30   ? 229.688 280.632 258.637 1.00 0.00 ? 30   GLU A OE1   1 
ATOM   162   O  OE2   . GLU A  1  30   ? 227.524 280.709 258.280 1.00 0.00 ? 30   GLU A OE2   1 
ATOM   163   N  N     . LEU A  1  31   ? 227.373 276.759 254.801 1.00 0.00 ? 31   LEU A N     1 
ATOM   164   C  CA    . LEU A  1  31   ? 226.337 276.577 253.796 1.00 0.00 ? 31   LEU A CA    1 
ATOM   165   C  C     . LEU A  1  31   ? 225.100 275.961 254.445 1.00 0.00 ? 31   LEU A C     1 
ATOM   166   O  O     . LEU A  1  31   ? 223.969 276.317 254.119 1.00 0.00 ? 31   LEU A O     1 
ATOM   167   C  CB    . LEU A  1  31   ? 226.835 275.705 252.650 1.00 0.00 ? 31   LEU A CB    1 
ATOM   168   C  CG    . LEU A  1  31   ? 225.780 275.473 251.571 1.00 0.00 ? 31   LEU A CG    1 
ATOM   169   C  CD1   . LEU A  1  31   ? 225.333 276.808 251.006 1.00 0.00 ? 31   LEU A CD1   1 
ATOM   170   C  CD2   . LEU A  1  31   ? 226.322 274.585 250.468 1.00 0.00 ? 31   LEU A CD2   1 
ATOM   171   N  N     . LYS A  1  32   ? 225.335 275.046 255.381 1.00 0.00 ? 32   LYS A N     1 
ATOM   172   C  CA    . LYS A  1  32   ? 224.266 274.432 256.167 1.00 0.00 ? 32   LYS A CA    1 
ATOM   173   C  C     . LYS A  1  32   ? 223.566 275.428 257.098 1.00 0.00 ? 32   LYS A C     1 
ATOM   174   O  O     . LYS A  1  32   ? 222.363 275.311 257.343 1.00 0.00 ? 32   LYS A O     1 
ATOM   175   C  CB    . LYS A  1  32   ? 224.850 273.292 257.007 1.00 0.00 ? 32   LYS A CB    1 
ATOM   176   C  CG    . LYS A  1  32   ? 225.182 272.018 256.253 1.00 0.00 ? 32   LYS A CG    1 
ATOM   177   C  CD    . LYS A  1  32   ? 225.784 270.988 257.201 1.00 0.00 ? 32   LYS A CD    1 
ATOM   178   C  CE    . LYS A  1  32   ? 224.796 270.527 258.253 1.00 0.00 ? 32   LYS A CE    1 
ATOM   179   N  NZ    . LYS A  1  32   ? 225.284 269.304 258.955 1.00 0.00 ? 32   LYS A NZ    1 
ATOM   180   N  N     . ARG A  1  33   ? 224.317 276.393 257.626 1.00 0.00 ? 33   ARG A N     1 
ATOM   181   C  CA    . ARG A  1  33   ? 223.728 277.522 258.352 1.00 0.00 ? 33   ARG A CA    1 
ATOM   182   C  C     . ARG A  1  33   ? 222.957 278.441 257.417 1.00 0.00 ? 33   ARG A C     1 
ATOM   183   O  O     . ARG A  1  33   ? 221.894 278.955 257.764 1.00 0.00 ? 33   ARG A O     1 
ATOM   184   C  CB    . ARG A  1  33   ? 224.785 278.320 259.121 1.00 0.00 ? 33   ARG A CB    1 
ATOM   185   C  CG    . ARG A  1  33   ? 225.231 277.669 260.411 1.00 0.00 ? 33   ARG A CG    1 
ATOM   186   C  CD    . ARG A  1  33   ? 226.051 278.645 261.236 1.00 0.00 ? 33   ARG A CD    1 
ATOM   187   N  NE    . ARG A  1  33   ? 227.292 279.006 260.560 1.00 0.00 ? 33   ARG A NE    1 
ATOM   188   C  CZ    . ARG A  1  33   ? 228.397 278.271 260.622 1.00 0.00 ? 33   ARG A CZ    1 
ATOM   189   N  NH1   . ARG A  1  33   ? 228.413 277.167 261.358 1.00 0.00 ? 33   ARG A NH1   1 
ATOM   190   N  NH2   . ARG A  1  33   ? 229.492 278.647 259.978 1.00 0.00 ? 33   ARG A NH2   1 
ATOM   191   N  N     . MET A  1  34   ? 223.516 278.655 256.235 1.00 0.00 ? 34   MET A N     1 
ATOM   192   C  CA    . MET A  1  34   ? 222.913 279.535 255.253 1.00 0.00 ? 34   MET A CA    1 
ATOM   193   C  C     . MET A  1  34   ? 221.613 279.005 254.673 1.00 0.00 ? 34   MET A C     1 
ATOM   194   O  O     . MET A  1  34   ? 220.603 279.705 254.687 1.00 0.00 ? 34   MET A O     1 
ATOM   195   C  CB    . MET A  1  34   ? 223.903 279.778 254.120 1.00 0.00 ? 34   MET A CB    1 
ATOM   196   C  CG    . MET A  1  34   ? 223.747 281.115 253.434 1.00 0.00 ? 34   MET A CG    1 
ATOM   197   S  SD    . MET A  1  34   ? 225.063 281.409 252.235 1.00 0.00 ? 34   MET A SD    1 
ATOM   198   C  CE    . MET A  1  34   ? 226.443 280.582 253.034 1.00 0.00 ? 34   MET A CE    1 
ATOM   199   N  N     . SER A  1  35   ? 221.625 277.765 254.196 1.00 0.00 ? 35   SER A N     1 
ATOM   200   C  CA    . SER A  1  35   ? 220.525 277.268 253.375 1.00 0.00 ? 35   SER A CA    1 
ATOM   201   C  C     . SER A  1  35   ? 219.225 277.174 254.142 1.00 0.00 ? 35   SER A C     1 
ATOM   202   O  O     . SER A  1  35   ? 219.223 276.993 255.358 1.00 0.00 ? 35   SER A O     1 
ATOM   203   C  CB    . SER A  1  35   ? 220.847 275.896 252.792 1.00 0.00 ? 35   SER A CB    1 
ATOM   204   O  OG    . SER A  1  35   ? 219.704 275.373 252.134 1.00 0.00 ? 35   SER A OG    1 
ATOM   205   N  N     . VAL A  1  36   ? 218.116 277.298 253.423 1.00 0.00 ? 36   VAL A N     1 
ATOM   206   C  CA    . VAL A  1  36   ? 216.820 277.282 254.075 1.00 0.00 ? 36   VAL A CA    1 
ATOM   207   C  C     . VAL A  1  36   ? 216.014 275.999 253.823 1.00 0.00 ? 36   VAL A C     1 
ATOM   208   O  O     . VAL A  1  36   ? 214.969 275.790 254.433 1.00 0.00 ? 36   VAL A O     1 
ATOM   209   C  CB    . VAL A  1  36   ? 215.994 278.502 253.638 1.00 0.00 ? 36   VAL A CB    1 
ATOM   210   C  CG1   . VAL A  1  36   ? 215.319 278.229 252.310 1.00 0.00 ? 36   VAL A CG1   1 
ATOM   211   C  CG2   . VAL A  1  36   ? 214.976 278.871 254.711 1.00 0.00 ? 36   VAL A CG2   1 
ATOM   212   N  N     . THR A  1  37   ? 216.508 275.123 252.957 1.00 0.00 ? 37   THR A N     1 
ATOM   213   C  CA    . THR A  1  37   ? 215.795 273.876 252.665 1.00 0.00 ? 37   THR A CA    1 
ATOM   214   C  C     . THR A  1  37   ? 215.806 272.845 253.807 1.00 0.00 ? 37   THR A C     1 
ATOM   215   O  O     . THR A  1  37   ? 214.828 272.109 253.984 1.00 0.00 ? 37   THR A O     1 
ATOM   216   C  CB    . THR A  1  37   ? 216.348 273.225 251.396 1.00 0.00 ? 37   THR A CB    1 
ATOM   217   O  OG1   . THR A  1  37   ? 216.401 274.217 250.370 1.00 0.00 ? 37   THR A OG1   1 
ATOM   218   C  CG2   . THR A  1  37   ? 215.434 272.109 250.920 1.00 0.00 ? 37   THR A CG2   1 
ATOM   219   N  N     . GLU A  1  38   ? 216.910 272.787 254.556 1.00 0.00 ? 38   GLU A N     1 
ATOM   220   C  CA    . GLU A  1  38   ? 217.100 271.844 255.676 1.00 0.00 ? 38   GLU A CA    1 
ATOM   221   C  C     . GLU A  1  38   ? 217.242 270.378 255.258 1.00 0.00 ? 38   GLU A C     1 
ATOM   222   O  O     . GLU A  1  38   ? 217.687 269.542 256.048 1.00 0.00 ? 38   GLU A O     1 
ATOM   223   C  CB    . GLU A  1  38   ? 215.955 271.967 256.676 1.00 0.00 ? 38   GLU A CB    1 
ATOM   224   C  CG    . GLU A  1  38   ? 215.833 273.337 257.283 1.00 0.00 ? 38   GLU A CG    1 
ATOM   225   C  CD    . GLU A  1  38   ? 214.767 273.386 258.340 1.00 0.00 ? 38   GLU A CD    1 
ATOM   226   O  OE1   . GLU A  1  38   ? 213.996 272.408 258.441 1.00 0.00 ? 38   GLU A OE1   1 
ATOM   227   O  OE2   . GLU A  1  38   ? 214.697 274.394 259.074 1.00 0.00 ? 38   GLU A OE2   1 
ATOM   228   N  N     . GLY A  1  39   ? 216.852 270.069 254.024 1.00 0.00 ? 39   GLY A N     1 
ATOM   229   C  CA    . GLY A  1  39   ? 217.021 268.736 253.472 1.00 0.00 ? 39   GLY A CA    1 
ATOM   230   C  C     . GLY A  1  39   ? 216.195 268.454 252.224 1.00 0.00 ? 39   GLY A C     1 
ATOM   231   O  O     . GLY A  1  39   ? 214.970 268.536 252.260 1.00 0.00 ? 39   GLY A O     1 
ATOM   232   N  N     . GLY A  1  40   ? 216.862 268.136 251.114 1.00 0.00 ? 40   GLY A N     1 
ATOM   233   C  CA    . GLY A  1  40   ? 216.166 267.693 249.918 1.00 0.00 ? 40   GLY A CA    1 
ATOM   234   C  C     . GLY A  1  40   ? 215.958 266.189 250.002 1.00 0.00 ? 40   GLY A C     1 
ATOM   235   O  O     . GLY A  1  40   ? 216.115 265.476 249.013 1.00 0.00 ? 40   GLY A O     1 
ATOM   236   N  N     . ILE A  1  41   ? 215.595 265.723 251.199 1.00 0.00 ? 41   ILE A N     1 
ATOM   237   C  CA    . ILE A  1  41   ? 215.367 264.306 251.491 1.00 0.00 ? 41   ILE A CA    1 
ATOM   238   C  C     . ILE A  1  41   ? 214.190 263.742 250.695 1.00 0.00 ? 41   ILE A C     1 
ATOM   239   O  O     . ILE A  1  41   ? 214.173 262.560 250.344 1.00 0.00 ? 41   ILE A O     1 
ATOM   240   C  CB    . ILE A  1  41   ? 215.127 264.077 253.018 1.00 0.00 ? 41   ILE A CB    1 
ATOM   241   C  CG1   . ILE A  1  41   ? 214.982 262.585 253.336 1.00 0.00 ? 41   ILE A CG1   1 
ATOM   242   C  CG2   . ILE A  1  41   ? 213.897 264.833 253.508 1.00 0.00 ? 41   ILE A CG2   1 
ATOM   243   C  CD1   . ILE A  1  41   ? 214.956 262.267 254.819 1.00 0.00 ? 41   ILE A CD1   1 
ATOM   244   N  N     . LYS A  1  42   ? 213.204 264.592 250.420 1.00 0.00 ? 42   LYS A N     1 
ATOM   245   C  CA    . LYS A  1  42   ? 212.054 264.215 249.608 1.00 0.00 ? 42   LYS A CA    1 
ATOM   246   C  C     . LYS A  1  42   ? 212.477 263.730 248.224 1.00 0.00 ? 42   LYS A C     1 
ATOM   247   O  O     . LYS A  1  42   ? 213.400 264.282 247.615 1.00 0.00 ? 42   LYS A O     1 
ATOM   248   C  CB    . LYS A  1  42   ? 211.076 265.386 249.472 1.00 0.00 ? 42   LYS A CB    1 
ATOM   249   C  CG    . LYS A  1  42   ? 209.697 264.980 248.965 1.00 0.00 ? 42   LYS A CG    1 
ATOM   250   C  CD    . LYS A  1  42   ? 208.820 266.185 248.667 1.00 0.00 ? 42   LYS A CD    1 
ATOM   251   C  CE    . LYS A  1  42   ? 209.383 267.010 247.520 1.00 0.00 ? 42   LYS A CE    1 
ATOM   252   N  NZ    . LYS A  1  42   ? 209.742 266.161 246.354 1.00 0.00 ? 42   LYS A NZ    1 
ATOM   253   N  N     . TYR A  1  43   ? 211.802 262.683 247.753 1.00 0.00 ? 43   TYR A N     1 
ATOM   254   C  CA    . TYR A  1  43   ? 211.966 262.185 246.388 1.00 0.00 ? 43   TYR A CA    1 
ATOM   255   C  C     . TYR A  1  43   ? 211.874 263.302 245.355 1.00 0.00 ? 43   TYR A C     1 
ATOM   256   O  O     . TYR A  1  43   ? 211.145 264.275 245.546 1.00 0.00 ? 43   TYR A O     1 
ATOM   257   C  CB    . TYR A  1  43   ? 210.904 261.115 246.081 1.00 0.00 ? 43   TYR A CB    1 
ATOM   258   C  CG    . TYR A  1  43   ? 211.085 260.425 244.739 1.00 0.00 ? 43   TYR A CG    1 
ATOM   259   C  CD1   . TYR A  1  43   ? 211.972 259.360 244.590 1.00 0.00 ? 43   TYR A CD1   1 
ATOM   260   C  CD2   . TYR A  1  43   ? 210.376 260.855 243.615 1.00 0.00 ? 43   TYR A CD2   1 
ATOM   261   C  CE1   . TYR A  1  43   ? 212.147 258.739 243.357 1.00 0.00 ? 43   TYR A CE1   1 
ATOM   262   C  CE2   . TYR A  1  43   ? 210.539 260.237 242.383 1.00 0.00 ? 43   TYR A CE2   1 
ATOM   263   C  CZ    . TYR A  1  43   ? 211.426 259.181 242.259 1.00 0.00 ? 43   TYR A CZ    1 
ATOM   264   O  OH    . TYR A  1  43   ? 211.587 258.561 241.038 1.00 0.00 ? 43   TYR A OH    1 
ATOM   265   N  N     . PRO A  1  44   ? 212.624 263.162 244.253 1.00 0.00 ? 44   PRO A N     1 
ATOM   266   C  CA    . PRO A  1  44   ? 212.538 264.062 243.102 1.00 0.00 ? 44   PRO A CA    1 
ATOM   267   C  C     . PRO A  1  44   ? 211.127 264.183 242.529 1.00 0.00 ? 44   PRO A C     1 
ATOM   268   O  O     . PRO A  1  44   ? 210.884 263.739 241.408 1.00 0.00 ? 44   PRO A O     1 
ATOM   269   C  CB    . PRO A  1  44   ? 213.472 263.407 242.086 1.00 0.00 ? 44   PRO A CB    1 
ATOM   270   C  CG    . PRO A  1  44   ? 214.494 262.722 242.915 1.00 0.00 ? 44   PRO A CG    1 
ATOM   271   C  CD    . PRO A  1  44   ? 213.827 262.312 244.196 1.00 0.00 ? 44   PRO A CD    1 
ATOM   272   N  N     . GLU A  1  45   ? 210.215 264.776 243.292 1.00 0.00 ? 45   GLU A N     1 
ATOM   273   C  CA    . GLU A  1  45   ? 208.867 265.061 242.811 1.00 0.00 ? 45   GLU A CA    1 
ATOM   274   C  C     . GLU A  1  45   ? 208.799 266.476 242.241 1.00 0.00 ? 45   GLU A C     1 
ATOM   275   O  O     . GLU A  1  45   ? 209.487 267.381 242.718 1.00 0.00 ? 45   GLU A O     1 
ATOM   276   C  CB    . GLU A  1  45   ? 207.835 264.880 243.931 1.00 0.00 ? 45   GLU A CB    1 
ATOM   277   C  CG    . GLU A  1  45   ? 207.750 263.465 244.482 1.00 0.00 ? 45   GLU A CG    1 
ATOM   278   C  CD    . GLU A  1  45   ? 206.976 262.532 243.564 1.00 0.00 ? 45   GLU A CD    1 
ATOM   279   O  OE1   . GLU A  1  45   ? 206.181 263.034 242.739 1.00 0.00 ? 45   GLU A OE1   1 
ATOM   280   O  OE2   . GLU A  1  45   ? 207.160 261.300 243.665 1.00 0.00 ? 45   GLU A OE2   1 
ATOM   281   N  N     . THR A  1  46   ? 207.985 266.658 241.207 1.00 0.00 ? 46   THR A N     1 
ATOM   282   C  CA    . THR A  1  46   ? 207.825 267.973 240.600 1.00 0.00 ? 46   THR A CA    1 
ATOM   283   C  C     . THR A  1  46   ? 206.906 268.873 241.427 1.00 0.00 ? 46   THR A C     1 
ATOM   284   O  O     . THR A  1  46   ? 207.328 269.925 241.905 1.00 0.00 ? 46   THR A O     1 
ATOM   285   C  CB    . THR A  1  46   ? 207.266 267.867 239.169 1.00 0.00 ? 46   THR A CB    1 
ATOM   286   O  OG1   . THR A  1  46   ? 208.062 266.951 238.408 1.00 0.00 ? 46   THR A OG1   1 
ATOM   287   C  CG2   . THR A  1  46   ? 207.274 269.229 238.491 1.00 0.00 ? 46   THR A CG2   1 
ATOM   288   N  N     . THR A  1  47   ? 205.663 268.424 241.595 1.00 0.00 ? 47   THR A N     1 
ATOM   289   C  CA    . THR A  1  47   ? 204.657 269.155 242.358 1.00 0.00 ? 47   THR A CA    1 
ATOM   290   C  C     . THR A  1  47   ? 203.617 268.225 242.993 1.00 0.00 ? 47   THR A C     1 
ATOM   291   O  O     . THR A  1  47   ? 203.615 268.033 244.210 1.00 0.00 ? 47   THR A O     1 
ATOM   292   C  CB    . THR A  1  47   ? 203.932 270.195 241.482 1.00 0.00 ? 47   THR A CB    1 
ATOM   293   O  OG1   . THR A  1  47   ? 204.869 270.807 240.588 1.00 0.00 ? 47   THR A OG1   1 
ATOM   294   C  CG2   . THR A  1  47   ? 203.291 271.267 242.349 1.00 0.00 ? 47   THR A CG2   1 
ATOM   295   N  N     . GLU A  1  48   ? 202.731 267.667 242.166 1.00 0.00 ? 48   GLU A N     1 
ATOM   296   C  CA    . GLU A  1  48   ? 201.659 266.762 242.614 1.00 0.00 ? 48   GLU A CA    1 
ATOM   297   C  C     . GLU A  1  48   ? 200.827 267.362 243.751 1.00 0.00 ? 48   GLU A C     1 
ATOM   298   O  O     . GLU A  1  48   ? 200.507 268.553 243.730 1.00 0.00 ? 48   GLU A O     1 
ATOM   299   C  CB    . GLU A  1  48   ? 202.221 265.393 243.016 1.00 0.00 ? 48   GLU A CB    1 
ATOM   300   C  CG    . GLU A  1  48   ? 203.398 264.933 242.172 1.00 0.00 ? 48   GLU A CG    1 
ATOM   301   C  CD    . GLU A  1  48   ? 203.109 264.995 240.685 1.00 0.00 ? 48   GLU A CD    1 
ATOM   302   O  OE1   . GLU A  1  48   ? 202.716 266.077 240.199 1.00 0.00 ? 48   GLU A OE1   1 
ATOM   303   O  OE2   . GLU A  1  48   ? 203.275 263.963 240.002 1.00 0.00 ? 48   GLU A OE2   1 
ATOM   304   N  N     . GLY A  1  49   ? 200.433 266.543 244.725 1.00 0.00 ? 49   GLY A N     1 
ATOM   305   C  CA    . GLY A  1  49   ? 199.687 267.091 245.842 1.00 0.00 ? 49   GLY A CA    1 
ATOM   306   C  C     . GLY A  1  49   ? 198.659 268.116 245.406 1.00 0.00 ? 49   GLY A C     1 
ATOM   307   O  O     . GLY A  1  49   ? 198.284 269.000 246.177 1.00 0.00 ? 49   GLY A O     1 
ATOM   308   N  N     . GLY A  1  50   ? 198.200 267.996 244.165 1.00 0.00 ? 50   GLY A N     1 
ATOM   309   C  CA    . GLY A  1  50   ? 197.213 268.912 243.624 1.00 0.00 ? 50   GLY A CA    1 
ATOM   310   C  C     . GLY A  1  50   ? 197.822 270.229 243.186 1.00 0.00 ? 50   GLY A C     1 
ATOM   311   O  O     . GLY A  1  50   ? 197.786 270.579 242.007 1.00 0.00 ? 50   GLY A O     1 
ATOM   312   N  N     . ARG A  1  51   ? 198.383 270.963 244.142 1.00 0.00 ? 51   ARG A N     1 
ATOM   313   C  CA    . ARG A  1  51   ? 199.005 272.253 243.854 1.00 0.00 ? 51   ARG A CA    1 
ATOM   314   C  C     . ARG A  1  51   ? 200.186 272.584 244.778 1.00 0.00 ? 51   ARG A C     1 
ATOM   315   O  O     . ARG A  1  51   ? 201.200 273.103 244.303 1.00 0.00 ? 51   ARG A O     1 
ATOM   316   C  CB    . ARG A  1  51   ? 197.960 273.370 243.920 1.00 0.00 ? 51   ARG A CB    1 
ATOM   317   C  CG    . ARG A  1  51   ? 198.532 274.759 243.684 1.00 0.00 ? 51   ARG A CG    1 
ATOM   318   C  CD    . ARG A  1  51   ? 197.462 275.828 243.792 1.00 0.00 ? 51   ARG A CD    1 
ATOM   319   N  NE    . ARG A  1  51   ? 196.484 275.714 242.713 1.00 0.00 ? 51   ARG A NE    1 
ATOM   320   C  CZ    . ARG A  1  51   ? 195.446 276.527 242.553 1.00 0.00 ? 51   ARG A CZ    1 
ATOM   321   N  NH1   . ARG A  1  51   ? 195.238 277.516 243.413 1.00 0.00 ? 51   ARG A NH1   1 
ATOM   322   N  NH2   . ARG A  1  51   ? 194.607 276.342 241.541 1.00 0.00 ? 51   ARG A NH2   1 
ATOM   323   N  N     . PRO A  1  52   ? 200.075 272.293 246.094 1.00 0.00 ? 52   PRO A N     1 
ATOM   324   C  CA    . PRO A  1  52   ? 201.291 272.526 246.880 1.00 0.00 ? 52   PRO A CA    1 
ATOM   325   C  C     . PRO A  1  52   ? 202.415 271.584 246.458 1.00 0.00 ? 52   PRO A C     1 
ATOM   326   O  O     . PRO A  1  52   ? 202.188 270.386 246.297 1.00 0.00 ? 52   PRO A O     1 
ATOM   327   C  CB    . PRO A  1  52   ? 200.846 272.254 248.323 1.00 0.00 ? 52   PRO A CB    1 
ATOM   328   C  CG    . PRO A  1  52   ? 199.618 271.426 248.209 1.00 0.00 ? 52   PRO A CG    1 
ATOM   329   C  CD    . PRO A  1  52   ? 198.949 271.854 246.941 1.00 0.00 ? 52   PRO A CD    1 
ATOM   330   N  N     . LYS A  1  53   ? 203.612 272.130 246.276 1.00 0.00 ? 53   LYS A N     1 
ATOM   331   C  CA    . LYS A  1  53   ? 204.754 271.346 245.820 1.00 0.00 ? 53   LYS A CA    1 
ATOM   332   C  C     . LYS A  1  53   ? 205.460 270.581 246.945 1.00 0.00 ? 53   LYS A C     1 
ATOM   333   O  O     . LYS A  1  53   ? 206.679 270.404 246.913 1.00 0.00 ? 53   LYS A O     1 
ATOM   334   C  CB    . LYS A  1  53   ? 205.743 272.264 245.099 1.00 0.00 ? 53   LYS A CB    1 
ATOM   335   C  CG    . LYS A  1  53   ? 205.130 272.947 243.885 1.00 0.00 ? 53   LYS A CG    1 
ATOM   336   C  CD    . LYS A  1  53   ? 206.139 273.784 243.120 1.00 0.00 ? 53   LYS A CD    1 
ATOM   337   C  CE    . LYS A  1  53   ? 206.137 275.223 243.597 1.00 0.00 ? 53   LYS A CE    1 
ATOM   338   N  NZ    . LYS A  1  53   ? 206.873 276.115 242.650 1.00 0.00 ? 53   LYS A NZ    1 
ATOM   339   N  N     . LEU A  1  54   ? 204.683 270.147 247.938 1.00 0.00 ? 54   LEU A N     1 
ATOM   340   C  CA    . LEU A  1  54   ? 205.178 269.328 249.046 1.00 0.00 ? 54   LEU A CA    1 
ATOM   341   C  C     . LEU A  1  54   ? 206.241 270.061 249.862 1.00 0.00 ? 54   LEU A C     1 
ATOM   342   O  O     . LEU A  1  54   ? 205.935 270.708 250.864 1.00 0.00 ? 54   LEU A O     1 
ATOM   343   C  CB    . LEU A  1  54   ? 205.731 267.993 248.528 1.00 0.00 ? 54   LEU A CB    1 
ATOM   344   C  CG    . LEU A  1  54   ? 204.760 267.068 247.786 1.00 0.00 ? 54   LEU A CG    1 
ATOM   345   C  CD1   . LEU A  1  54   ? 205.487 265.853 247.223 1.00 0.00 ? 54   LEU A CD1   1 
ATOM   346   C  CD2   . LEU A  1  54   ? 203.614 266.634 248.686 1.00 0.00 ? 54   LEU A CD2   1 
ATOM   347   N  N     . GLY A  1  55   ? 207.490 269.954 249.426 1.00 0.00 ? 55   GLY A N     1 
ATOM   348   C  CA    . GLY A  1  55   ? 208.571 270.703 250.032 1.00 0.00 ? 55   GLY A CA    1 
ATOM   349   C  C     . GLY A  1  55   ? 209.838 269.880 250.088 1.00 0.00 ? 55   GLY A C     1 
ATOM   350   O  O     . GLY A  1  55   ? 210.101 269.205 251.080 1.00 0.00 ? 55   GLY A O     1 
ATOM   351   N  N     . GLY A  1  56   ? 210.623 269.930 249.019 1.00 0.00 ? 56   GLY A N     1 
ATOM   352   C  CA    . GLY A  1  56   ? 211.787 269.075 248.898 1.00 0.00 ? 56   GLY A CA    1 
ATOM   353   C  C     . GLY A  1  56   ? 212.670 269.420 247.715 1.00 0.00 ? 56   GLY A C     1 
ATOM   354   O  O     . GLY A  1  56   ? 213.895 269.441 247.851 1.00 0.00 ? 56   GLY A O     1 
ATOM   355   N  N     . LEU A  1  57   ? 212.055 269.671 246.558 1.00 0.00 ? 57   LEU A N     1 
ATOM   356   C  CA    . LEU A  1  57   ? 212.805 269.999 245.343 1.00 0.00 ? 57   LEU A CA    1 
ATOM   357   C  C     . LEU A  1  57   ? 212.642 271.454 244.933 1.00 0.00 ? 57   LEU A C     1 
ATOM   358   O  O     . LEU A  1  57   ? 213.539 272.262 245.152 1.00 0.00 ? 57   LEU A O     1 
ATOM   359   C  CB    . LEU A  1  57   ? 212.386 269.097 244.180 1.00 0.00 ? 57   LEU A CB    1 
ATOM   360   C  CG    . LEU A  1  57   ? 213.341 269.053 242.982 1.00 0.00 ? 57   LEU A CG    1 
ATOM   361   C  CD1   . LEU A  1  57   ? 213.248 267.705 242.300 1.00 0.00 ? 57   LEU A CD1   1 
ATOM   362   C  CD2   . LEU A  1  57   ? 213.078 270.157 241.976 1.00 0.00 ? 57   LEU A CD2   1 
ATOM   363   N  N     . MET A  1  58   ? 211.502 271.788 244.331 1.00 0.00 ? 58   MET A N     1 
ATOM   364   C  CA    . MET A  1  58   ? 211.299 273.152 243.860 1.00 0.00 ? 58   MET A CA    1 
ATOM   365   C  C     . MET A  1  58   ? 210.288 273.915 244.703 1.00 0.00 ? 58   MET A C     1 
ATOM   366   O  O     . MET A  1  58   ? 209.225 273.402 245.052 1.00 0.00 ? 58   MET A O     1 
ATOM   367   C  CB    . MET A  1  58   ? 210.874 273.182 242.386 1.00 0.00 ? 58   MET A CB    1 
ATOM   368   C  CG    . MET A  1  58   ? 209.671 272.331 242.010 1.00 0.00 ? 58   MET A CG    1 
ATOM   369   S  SD    . MET A  1  58   ? 209.201 272.610 240.279 1.00 0.00 ? 58   MET A SD    1 
ATOM   370   C  CE    . MET A  1  58   ? 208.818 274.364 240.291 1.00 0.00 ? 58   MET A CE    1 
ATOM   371   N  N     . ASP A  1  59   ? 210.659 275.156 245.008 1.00 0.00 ? 59   ASP A N     1 
ATOM   372   C  CA    . ASP A  1  59   ? 209.951 276.035 245.933 1.00 0.00 ? 59   ASP A CA    1 
ATOM   373   C  C     . ASP A  1  59   ? 209.338 275.308 247.108 1.00 0.00 ? 59   ASP A C     1 
ATOM   374   O  O     . ASP A  1  59   ? 208.120 275.203 247.223 1.00 0.00 ? 59   ASP A O     1 
ATOM   375   C  CB    . ASP A  1  59   ? 208.873 276.844 245.212 1.00 0.00 ? 59   ASP A CB    1 
ATOM   376   C  CG    . ASP A  1  59   ? 208.236 277.896 246.111 1.00 0.00 ? 59   ASP A CG    1 
ATOM   377   O  OD1   . ASP A  1  59   ? 208.971 278.550 246.884 1.00 0.00 ? 59   ASP A OD1   1 
ATOM   378   O  OD2   . ASP A  1  59   ? 207.002 278.073 246.041 1.00 0.00 ? 59   ASP A OD2   1 
ATOM   379   N  N     . PRO A  1  60   ? 210.190 274.775 247.982 1.00 0.00 ? 60   PRO A N     1 
ATOM   380   C  CA    . PRO A  1  60   ? 209.592 274.496 249.279 1.00 0.00 ? 60   PRO A CA    1 
ATOM   381   C  C     . PRO A  1  60   ? 209.346 275.826 249.981 1.00 0.00 ? 60   PRO A C     1 
ATOM   382   O  O     . PRO A  1  60   ? 208.307 276.014 250.616 1.00 0.00 ? 60   PRO A O     1 
ATOM   383   C  CB    . PRO A  1  60   ? 210.649 273.642 249.982 1.00 0.00 ? 60   PRO A CB    1 
ATOM   384   C  CG    . PRO A  1  60   ? 211.952 274.037 249.348 1.00 0.00 ? 60   PRO A CG    1 
ATOM   385   C  CD    . PRO A  1  60   ? 211.646 274.547 247.957 1.00 0.00 ? 60   PRO A CD    1 
ATOM   386   N  N     . ARG A  1  61   ? 210.286 276.752 249.820 1.00 0.00 ? 61   ARG A N     1 
ATOM   387   C  CA    . ARG A  1  61   ? 210.223 278.048 250.471 1.00 0.00 ? 61   ARG A CA    1 
ATOM   388   C  C     . ARG A  1  61   ? 211.041 279.059 249.682 1.00 0.00 ? 61   ARG A C     1 
ATOM   389   O  O     . ARG A  1  61   ? 210.890 280.265 249.861 1.00 0.00 ? 61   ARG A O     1 
ATOM   390   C  CB    . ARG A  1  61   ? 210.747 277.958 251.909 1.00 0.00 ? 61   ARG A CB    1 
ATOM   391   C  CG    . ARG A  1  61   ? 209.741 277.467 252.945 1.00 0.00 ? 61   ARG A CG    1 
ATOM   392   C  CD    . ARG A  1  61   ? 210.440 276.966 254.203 1.00 0.00 ? 61   ARG A CD    1 
ATOM   393   N  NE    . ARG A  1  61   ? 211.189 275.735 253.958 1.00 0.00 ? 61   ARG A NE    1 
ATOM   394   C  CZ    . ARG A  1  61   ? 212.019 275.178 254.834 1.00 0.00 ? 61   ARG A CZ    1 
ATOM   395   N  NH1   . ARG A  1  61   ? 212.208 275.733 256.024 1.00 0.00 ? 61   ARG A NH1   1 
ATOM   396   N  NH2   . ARG A  1  61   ? 212.666 274.064 254.516 1.00 0.00 ? 61   ARG A NH2   1 
ATOM   397   N  N     . GLN A  1  62   ? 211.891 278.555 248.792 1.00 0.00 ? 62   GLN A N     1 
ATOM   398   C  CA    . GLN A  1  62   ? 212.868 279.389 248.092 1.00 0.00 ? 62   GLN A CA    1 
ATOM   399   C  C     . GLN A  1  62   ? 212.261 280.166 246.917 1.00 0.00 ? 62   GLN A C     1 
ATOM   400   O  O     . GLN A  1  62   ? 211.143 280.667 247.012 1.00 0.00 ? 62   GLN A O     1 
ATOM   401   C  CB    . GLN A  1  62   ? 214.046 278.528 247.625 1.00 0.00 ? 62   GLN A CB    1 
ATOM   402   C  CG    . GLN A  1  62   ? 213.661 277.334 246.769 1.00 0.00 ? 62   GLN A CG    1 
ATOM   403   C  CD    . GLN A  1  62   ? 214.858 276.495 246.359 1.00 0.00 ? 62   GLN A CD    1 
ATOM   404   O  OE1   . GLN A  1  62   ? 215.902 276.518 247.010 1.00 0.00 ? 62   GLN A OE1   1 
ATOM   405   N  NE2   . GLN A  1  62   ? 214.709 275.747 245.274 1.00 0.00 ? 62   GLN A NE2   1 
ATOM   406   N  N     . GLY A  1  63   ? 212.994 280.278 245.814 1.00 0.00 ? 63   GLY A N     1 
ATOM   407   C  CA    . GLY A  1  63   ? 212.551 281.104 244.706 1.00 0.00 ? 63   GLY A CA    1 
ATOM   408   C  C     . GLY A  1  63   ? 211.346 280.561 243.965 1.00 0.00 ? 63   GLY A C     1 
ATOM   409   O  O     . GLY A  1  63   ? 211.310 279.381 243.643 1.00 0.00 ? 63   GLY A O     1 
ATOM   410   N  N     . VAL A  1  64   ? 210.359 281.422 243.713 1.00 0.00 ? 64   VAL A N     1 
ATOM   411   C  CA    . VAL A  1  64   ? 209.137 281.035 243.004 1.00 0.00 ? 64   VAL A CA    1 
ATOM   412   C  C     . VAL A  1  64   ? 208.898 281.903 241.765 1.00 0.00 ? 64   VAL A C     1 
ATOM   413   O  O     . VAL A  1  64   ? 209.174 283.102 241.783 1.00 0.00 ? 64   VAL A O     1 
ATOM   414   C  CB    . VAL A  1  64   ? 207.897 281.100 243.928 1.00 0.00 ? 64   VAL A CB    1 
ATOM   415   C  CG1   . VAL A  1  64   ? 207.582 282.534 244.334 1.00 0.00 ? 64   VAL A CG1   1 
ATOM   416   C  CG2   . VAL A  1  64   ? 206.697 280.430 243.265 1.00 0.00 ? 64   VAL A CG2   1 
ATOM   417   N  N     . ILE A  1  65   ? 208.409 281.290 240.684 1.00 0.00 ? 65   ILE A N     1 
ATOM   418   C  CA    . ILE A  1  65   ? 208.060 282.015 239.449 1.00 0.00 ? 65   ILE A CA    1 
ATOM   419   C  C     . ILE A  1  65   ? 206.802 281.453 238.762 1.00 0.00 ? 65   ILE A C     1 
ATOM   420   O  O     . ILE A  1  65   ? 206.837 280.369 238.172 1.00 0.00 ? 65   ILE A O     1 
ATOM   421   C  CB    . ILE A  1  65   ? 209.225 282.003 238.412 1.00 0.00 ? 65   ILE A CB    1 
ATOM   422   C  CG1   . ILE A  1  65   ? 210.506 282.598 239.003 1.00 0.00 ? 65   ILE A CG1   1 
ATOM   423   C  CG2   . ILE A  1  65   ? 208.850 282.803 237.176 1.00 0.00 ? 65   ILE A CG2   1 
ATOM   424   C  CD1   . ILE A  1  65   ? 211.651 282.673 238.029 1.00 0.00 ? 65   ILE A CD1   1 
ATOM   425   N  N     . GLU A  1  66   ? 205.704 282.209 238.840 1.00 0.00 ? 66   GLU A N     1 
ATOM   426   C  CA    . GLU A  1  66   ? 204.397 281.801 238.310 1.00 0.00 ? 66   GLU A CA    1 
ATOM   427   C  C     . GLU A  1  66   ? 203.417 282.985 238.381 1.00 0.00 ? 66   GLU A C     1 
ATOM   428   O  O     . GLU A  1  66   ? 202.209 282.805 238.566 1.00 0.00 ? 66   GLU A O     1 
ATOM   429   C  CB    . GLU A  1  66   ? 203.854 280.591 239.087 1.00 0.00 ? 66   GLU A CB    1 
ATOM   430   C  CG    . GLU A  1  66   ? 202.844 279.706 238.342 1.00 0.00 ? 66   GLU A CG    1 
ATOM   431   C  CD    . GLU A  1  66   ? 203.402 279.087 237.063 1.00 0.00 ? 66   GLU A CD    1 
ATOM   432   O  OE1   . GLU A  1  66   ? 204.571 278.641 237.069 1.00 0.00 ? 66   GLU A OE1   1 
ATOM   433   O  OE2   . GLU A  1  66   ? 202.658 279.024 236.061 1.00 0.00 ? 66   GLU A OE2   1 
ATOM   434   N  N     . ARG A  1  67   ? 203.963 284.191 238.229 1.00 0.00 ? 67   ARG A N     1 
ATOM   435   C  CA    . ARG A  1  67   ? 203.220 285.451 238.311 1.00 0.00 ? 67   ARG A CA    1 
ATOM   436   C  C     . ARG A  1  67   ? 202.369 285.508 239.584 1.00 0.00 ? 67   ARG A C     1 
ATOM   437   O  O     . ARG A  1  67   ? 201.241 286.005 239.585 1.00 0.00 ? 67   ARG A O     1 
ATOM   438   C  CB    . ARG A  1  67   ? 202.350 285.645 237.065 1.00 0.00 ? 67   ARG A CB    1 
ATOM   439   C  CG    . ARG A  1  67   ? 201.872 287.076 236.861 1.00 0.00 ? 67   ARG A CG    1 
ATOM   440   C  CD    . ARG A  1  67   ? 201.086 287.211 235.580 1.00 0.00 ? 67   ARG A CD    1 
ATOM   441   N  NE    . ARG A  1  67   ? 201.954 287.299 234.411 1.00 0.00 ? 67   ARG A NE    1 
ATOM   442   C  CZ    . ARG A  1  67   ? 201.506 287.411 233.165 1.00 0.00 ? 67   ARG A CZ    1 
ATOM   443   N  NH1   . ARG A  1  67   ? 200.201 287.443 232.934 1.00 0.00 ? 67   ARG A NH1   1 
ATOM   444   N  NH2   . ARG A  1  67   ? 202.357 287.501 232.154 1.00 0.00 ? 67   ARG A NH2   1 
ATOM   445   N  N     . THR A  1  68   ? 202.923 284.985 240.674 1.00 0.00 ? 68   THR A N     1 
ATOM   446   C  CA    . THR A  1  68   ? 202.244 284.985 241.964 1.00 0.00 ? 68   THR A CA    1 
ATOM   447   C  C     . THR A  1  68   ? 203.203 285.335 243.101 1.00 0.00 ? 68   THR A C     1 
ATOM   448   O  O     . THR A  1  68   ? 204.419 285.166 242.979 1.00 0.00 ? 68   THR A O     1 
ATOM   449   C  CB    . THR A  1  68   ? 201.587 283.620 242.257 1.00 0.00 ? 68   THR A CB    1 
ATOM   450   O  OG1   . THR A  1  68   ? 200.712 283.744 243.384 1.00 0.00 ? 68   THR A OG1   1 
ATOM   451   C  CG2   . THR A  1  68   ? 202.645 282.568 242.565 1.00 0.00 ? 68   THR A CG2   1 
ATOM   452   N  N     . GLY A  1  69   ? 202.652 285.826 244.207 1.00 0.00 ? 69   GLY A N     1 
ATOM   453   C  CA    . GLY A  1  69   ? 203.463 286.290 245.318 1.00 0.00 ? 69   GLY A CA    1 
ATOM   454   C  C     . GLY A  1  69   ? 204.023 285.161 246.161 1.00 0.00 ? 69   GLY A C     1 
ATOM   455   O  O     . GLY A  1  69   ? 204.426 284.125 245.639 1.00 0.00 ? 69   GLY A O     1 
ATOM   456   N  N     . ARG A  1  70   ? 204.016 285.379 247.472 1.00 0.00 ? 70   ARG A N     1 
ATOM   457   C  CA    . ARG A  1  70   ? 204.434 284.395 248.478 1.00 0.00 ? 70   ARG A CA    1 
ATOM   458   C  C     . ARG A  1  70   ? 205.818 283.771 248.299 1.00 0.00 ? 70   ARG A C     1 
ATOM   459   O  O     . ARG A  1  70   ? 206.082 283.045 247.343 1.00 0.00 ? 70   ARG A O     1 
ATOM   460   C  CB    . ARG A  1  70   ? 203.409 283.263 248.571 1.00 0.00 ? 70   ARG A CB    1 
ATOM   461   C  CG    . ARG A  1  70   ? 203.643 282.364 249.781 1.00 0.00 ? 70   ARG A CG    1 
ATOM   462   C  CD    . ARG A  1  70   ? 202.607 281.260 249.894 1.00 0.00 ? 70   ARG A CD    1 
ATOM   463   N  NE    . ARG A  1  70   ? 202.891 280.363 251.014 1.00 0.00 ? 70   ARG A NE    1 
ATOM   464   C  CZ    . ARG A  1  70   ? 202.483 280.568 252.264 1.00 0.00 ? 70   ARG A CZ    1 
ATOM   465   N  NH1   . ARG A  1  70   ? 201.767 281.642 252.567 1.00 0.00 ? 70   ARG A NH1   1 
ATOM   466   N  NH2   . ARG A  1  70   ? 202.795 279.696 253.215 1.00 0.00 ? 70   ARG A NH2   1 
ATOM   467   N  N     . CYS A  1  71   ? 206.695 284.058 249.254 1.00 0.00 ? 71   CYS A N     1 
ATOM   468   C  CA    . CYS A  1  71   ? 208.021 283.461 249.297 1.00 0.00 ? 71   CYS A CA    1 
ATOM   469   C  C     . CYS A  1  71   ? 208.589 283.596 250.702 1.00 0.00 ? 71   CYS A C     1 
ATOM   470   O  O     . CYS A  1  71   ? 209.374 284.506 250.970 1.00 0.00 ? 71   CYS A O     1 
ATOM   471   C  CB    . CYS A  1  71   ? 208.948 284.117 248.281 1.00 0.00 ? 71   CYS A CB    1 
ATOM   472   S  SG    . CYS A  1  71   ? 210.641 283.524 248.388 1.00 0.00 ? 71   CYS A SG    1 
ATOM   473   N  N     . GLN A  1  72   ? 208.151 282.715 251.599 1.00 0.00 ? 72   GLN A N     1 
ATOM   474   C  CA    . GLN A  1  72   ? 208.550 282.757 253.005 1.00 0.00 ? 72   GLN A CA    1 
ATOM   475   C  C     . GLN A  1  72   ? 208.041 284.036 253.654 1.00 0.00 ? 72   GLN A C     1 
ATOM   476   O  O     . GLN A  1  72   ? 207.041 284.609 253.218 1.00 0.00 ? 72   GLN A O     1 
ATOM   477   C  CB    . GLN A  1  72   ? 210.066 282.676 253.168 1.00 0.00 ? 72   GLN A CB    1 
ATOM   478   C  CG    . GLN A  1  72   ? 210.679 281.399 252.707 1.00 0.00 ? 72   GLN A CG    1 
ATOM   479   C  CD    . GLN A  1  72   ? 212.171 281.530 252.562 1.00 0.00 ? 72   GLN A CD    1 
ATOM   480   O  OE1   . GLN A  1  72   ? 212.692 282.638 252.416 1.00 0.00 ? 72   GLN A OE1   1 
ATOM   481   N  NE2   . GLN A  1  72   ? 212.873 280.406 252.606 1.00 0.00 ? 72   GLN A NE2   1 
ATOM   482   N  N     . THR A  1  73   ? 208.717 284.455 254.720 1.00 0.00 ? 73   THR A N     1 
ATOM   483   C  CA    . THR A  1  73   ? 208.504 285.781 255.291 1.00 0.00 ? 73   THR A CA    1 
ATOM   484   C  C     . THR A  1  73   ? 208.984 286.844 254.300 1.00 0.00 ? 73   THR A C     1 
ATOM   485   O  O     . THR A  1  73   ? 208.451 287.956 254.255 1.00 0.00 ? 73   THR A O     1 
ATOM   486   C  CB    . THR A  1  73   ? 209.221 285.949 256.660 1.00 0.00 ? 73   THR A CB    1 
ATOM   487   O  OG1   . THR A  1  73   ? 208.936 287.247 257.202 1.00 0.00 ? 73   THR A OG1   1 
ATOM   488   C  CG2   . THR A  1  73   ? 210.731 285.773 256.524 1.00 0.00 ? 73   THR A CG2   1 
ATOM   489   N  N     . CYS A  1  74   ? 209.994 286.486 253.509 1.00 0.00 ? 74   CYS A N     1 
ATOM   490   C  CA    . CYS A  1  74   ? 210.539 287.353 252.470 1.00 0.00 ? 74   CYS A CA    1 
ATOM   491   C  C     . CYS A  1  74   ? 209.455 287.882 251.526 1.00 0.00 ? 74   CYS A C     1 
ATOM   492   O  O     . CYS A  1  74   ? 209.552 289.006 251.030 1.00 0.00 ? 74   CYS A O     1 
ATOM   493   C  CB    . CYS A  1  74   ? 211.617 286.601 251.686 1.00 0.00 ? 74   CYS A CB    1 
ATOM   494   S  SG    . CYS A  1  74   ? 211.890 287.199 250.012 1.00 0.00 ? 74   CYS A SG    1 
ATOM   495   N  N     . ALA A  1  75   ? 208.413 287.075 251.324 1.00 0.00 ? 75   ALA A N     1 
ATOM   496   C  CA    . ALA A  1  75   ? 207.274 287.417 250.467 1.00 0.00 ? 75   ALA A CA    1 
ATOM   497   C  C     . ALA A  1  75   ? 207.655 288.049 249.127 1.00 0.00 ? 75   ALA A C     1 
ATOM   498   O  O     . ALA A  1  75   ? 208.746 287.822 248.604 1.00 0.00 ? 75   ALA A O     1 
ATOM   499   C  CB    . ALA A  1  75   ? 206.329 288.344 251.222 1.00 0.00 ? 75   ALA A CB    1 
ATOM   500   N  N     . GLY A  1  76   ? 206.733 288.825 248.567 1.00 0.00 ? 76   GLY A N     1 
ATOM   501   C  CA    . GLY A  1  76   ? 207.019 289.585 247.365 1.00 0.00 ? 76   GLY A CA    1 
ATOM   502   C  C     . GLY A  1  76   ? 206.730 288.770 246.125 1.00 0.00 ? 76   GLY A C     1 
ATOM   503   O  O     . GLY A  1  76   ? 206.230 287.649 246.208 1.00 0.00 ? 76   GLY A O     1 
ATOM   504   N  N     . ASN A  1  77   ? 207.048 289.332 244.967 1.00 0.00 ? 77   ASN A N     1 
ATOM   505   C  CA    . ASN A  1  77   ? 206.862 288.632 243.709 1.00 0.00 ? 77   ASN A CA    1 
ATOM   506   C  C     . ASN A  1  77   ? 208.196 288.153 243.163 1.00 0.00 ? 77   ASN A C     1 
ATOM   507   O  O     . ASN A  1  77   ? 209.156 287.996 243.913 1.00 0.00 ? 77   ASN A O     1 
ATOM   508   C  CB    . ASN A  1  77   ? 206.162 289.532 242.700 1.00 0.00 ? 77   ASN A CB    1 
ATOM   509   C  CG    . ASN A  1  77   ? 206.982 290.753 242.353 1.00 0.00 ? 77   ASN A CG    1 
ATOM   510   O  OD1   . ASN A  1  77   ? 207.935 291.092 243.057 1.00 0.00 ? 77   ASN A OD1   1 
ATOM   511   N  ND2   . ASN A  1  77   ? 206.625 291.417 241.262 1.00 0.00 ? 77   ASN A ND2   1 
ATOM   512   N  N     . MET A  1  78   ? 208.258 287.926 241.856 1.00 0.00 ? 78   MET A N     1 
ATOM   513   C  CA    . MET A  1  78   ? 209.454 287.354 241.254 1.00 0.00 ? 78   MET A CA    1 
ATOM   514   C  C     . MET A  1  78   ? 210.490 288.424 240.931 1.00 0.00 ? 78   MET A C     1 
ATOM   515   O  O     . MET A  1  78   ? 211.645 288.120 240.637 1.00 0.00 ? 78   MET A O     1 
ATOM   516   C  CB    . MET A  1  78   ? 209.093 286.595 239.987 1.00 0.00 ? 78   MET A CB    1 
ATOM   517   C  CG    . MET A  1  78   ? 208.448 287.470 238.948 1.00 0.00 ? 78   MET A CG    1 
ATOM   518   S  SD    . MET A  1  78   ? 208.185 286.568 237.421 1.00 0.00 ? 78   MET A SD    1 
ATOM   519   C  CE    . MET A  1  78   ? 206.746 285.617 237.862 1.00 0.00 ? 78   MET A CE    1 
ATOM   520   N  N     . THR A  1  79   ? 210.073 289.679 240.977 1.00 0.00 ? 79   THR A N     1 
ATOM   521   C  CA    . THR A  1  79   ? 210.993 290.772 240.715 1.00 0.00 ? 79   THR A CA    1 
ATOM   522   C  C     . THR A  1  79   ? 211.482 291.392 242.015 1.00 0.00 ? 79   THR A C     1 
ATOM   523   O  O     . THR A  1  79   ? 212.007 292.504 242.022 1.00 0.00 ? 79   THR A O     1 
ATOM   524   C  CB    . THR A  1  79   ? 210.351 291.856 239.857 1.00 0.00 ? 79   THR A CB    1 
ATOM   525   O  OG1   . THR A  1  79   ? 209.308 292.491 240.604 1.00 0.00 ? 79   THR A OG1   1 
ATOM   526   C  CG2   . THR A  1  79   ? 209.776 291.244 238.601 1.00 0.00 ? 79   THR A CG2   1 
ATOM   527   N  N     . GLU A  1  80   ? 211.288 290.680 243.116 1.00 0.00 ? 80   GLU A N     1 
ATOM   528   C  CA    . GLU A  1  80   ? 211.802 291.145 244.395 1.00 0.00 ? 80   GLU A CA    1 
ATOM   529   C  C     . GLU A  1  80   ? 212.618 290.036 245.054 1.00 0.00 ? 80   GLU A C     1 
ATOM   530   O  O     . GLU A  1  80   ? 213.548 290.301 245.816 1.00 0.00 ? 80   GLU A O     1 
ATOM   531   C  CB    . GLU A  1  80   ? 210.654 291.596 245.299 1.00 0.00 ? 80   GLU A CB    1 
ATOM   532   C  CG    . GLU A  1  80   ? 211.085 292.164 246.648 1.00 0.00 ? 80   GLU A CG    1 
ATOM   533   C  CD    . GLU A  1  80   ? 211.950 293.415 246.522 1.00 0.00 ? 80   GLU A CD    1 
ATOM   534   O  OE1   . GLU A  1  80   ? 211.849 294.119 245.488 1.00 0.00 ? 80   GLU A OE1   1 
ATOM   535   O  OE2   . GLU A  1  80   ? 212.723 293.698 247.467 1.00 0.00 ? 80   GLU A OE2   1 
ATOM   536   N  N     . CYS A  1  81   ? 212.256 288.793 244.752 1.00 0.00 ? 81   CYS A N     1 
ATOM   537   C  CA    . CYS A  1  81   ? 212.952 287.630 245.294 1.00 0.00 ? 81   CYS A CA    1 
ATOM   538   C  C     . CYS A  1  81   ? 214.083 287.174 244.377 1.00 0.00 ? 81   CYS A C     1 
ATOM   539   O  O     . CYS A  1  81   ? 213.839 286.647 243.291 1.00 0.00 ? 81   CYS A O     1 
ATOM   540   C  CB    . CYS A  1  81   ? 211.973 286.471 245.526 1.00 0.00 ? 81   CYS A CB    1 
ATOM   541   S  SG    . CYS A  1  81   ? 212.705 284.967 246.247 1.00 0.00 ? 81   CYS A SG    1 
ATOM   542   N  N     . PRO A  1  82   ? 215.331 287.367 244.818 1.00 0.00 ? 82   PRO A N     1 
ATOM   543   C  CA    . PRO A  1  82   ? 216.462 286.855 244.048 1.00 0.00 ? 82   PRO A CA    1 
ATOM   544   C  C     . PRO A  1  82   ? 216.485 285.328 244.007 1.00 0.00 ? 82   PRO A C     1 
ATOM   545   O  O     . PRO A  1  82   ? 217.131 284.745 243.147 1.00 0.00 ? 82   PRO A O     1 
ATOM   546   C  CB    . PRO A  1  82   ? 217.674 287.415 244.801 1.00 0.00 ? 82   PRO A CB    1 
ATOM   547   C  CG    . PRO A  1  82   ? 217.192 287.622 246.198 1.00 0.00 ? 82   PRO A CG    1 
ATOM   548   C  CD    . PRO A  1  82   ? 215.761 288.042 246.057 1.00 0.00 ? 82   PRO A CD    1 
ATOM   549   N  N     . GLY A  1  83   ? 215.756 284.685 244.908 1.00 0.00 ? 83   GLY A N     1 
ATOM   550   C  CA    . GLY A  1  83   ? 215.874 283.250 245.066 1.00 0.00 ? 83   GLY A CA    1 
ATOM   551   C  C     . GLY A  1  83   ? 216.634 282.919 246.333 1.00 0.00 ? 83   GLY A C     1 
ATOM   552   O  O     . GLY A  1  83   ? 217.256 283.789 246.933 1.00 0.00 ? 83   GLY A O     1 
ATOM   553   N  N     . HIS A  1  84   ? 216.550 281.665 246.761 1.00 0.00 ? 84   HIS A N     1 
ATOM   554   C  CA    . HIS A  1  84   ? 217.198 281.223 247.988 1.00 0.00 ? 84   HIS A CA    1 
ATOM   555   C  C     . HIS A  1  84   ? 217.848 279.867 247.786 1.00 0.00 ? 84   HIS A C     1 
ATOM   556   O  O     . HIS A  1  84   ? 217.278 278.986 247.147 1.00 0.00 ? 84   HIS A O     1 
ATOM   557   C  CB    . HIS A  1  84   ? 216.189 281.149 249.126 1.00 0.00 ? 84   HIS A CB    1 
ATOM   558   C  CG    . HIS A  1  84   ? 215.417 282.412 249.324 1.00 0.00 ? 84   HIS A CG    1 
ATOM   559   N  ND1   . HIS A  1  84   ? 215.905 283.469 250.059 1.00 0.00 ? 84   HIS A ND1   1 
ATOM   560   C  CD2   . HIS A  1  84   ? 214.193 282.789 248.884 1.00 0.00 ? 84   HIS A CD2   1 
ATOM   561   C  CE1   . HIS A  1  84   ? 215.012 284.445 250.068 1.00 0.00 ? 84   HIS A CE1   1 
ATOM   562   N  NE2   . HIS A  1  84   ? 213.964 284.058 249.361 1.00 0.00 ? 84   HIS A NE2   1 
ATOM   563   N  N     . PHE A  1  85   ? 219.034 279.687 248.347 1.00 0.00 ? 85   PHE A N     1 
ATOM   564   C  CA    . PHE A  1  85   ? 219.781 278.467 248.107 1.00 0.00 ? 85   PHE A CA    1 
ATOM   565   C  C     . PHE A  1  85   ? 219.162 277.321 248.860 1.00 0.00 ? 85   PHE A C     1 
ATOM   566   O  O     . PHE A  1  85   ? 218.615 277.503 249.947 1.00 0.00 ? 85   PHE A O     1 
ATOM   567   C  CB    . PHE A  1  85   ? 221.234 278.604 248.544 1.00 0.00 ? 85   PHE A CB    1 
ATOM   568   C  CG    . PHE A  1  85   ? 222.038 279.494 247.678 1.00 0.00 ? 85   PHE A CG    1 
ATOM   569   C  CD1   . PHE A  1  85   ? 222.518 279.047 246.460 1.00 0.00 ? 85   PHE A CD1   1 
ATOM   570   C  CD2   . PHE A  1  85   ? 222.334 280.770 248.081 1.00 0.00 ? 85   PHE A CD2   1 
ATOM   571   C  CE1   . PHE A  1  85   ? 223.267 279.866 245.652 1.00 0.00 ? 85   PHE A CE1   1 
ATOM   572   C  CE2   . PHE A  1  85   ? 223.079 281.596 247.275 1.00 0.00 ? 85   PHE A CE2   1 
ATOM   573   C  CZ    . PHE A  1  85   ? 223.545 281.142 246.053 1.00 0.00 ? 85   PHE A CZ    1 
ATOM   574   N  N     . GLY A  1  86   ? 219.222 276.136 248.275 1.00 0.00 ? 86   GLY A N     1 
ATOM   575   C  CA    . GLY A  1  86   ? 218.990 274.964 249.083 1.00 0.00 ? 86   GLY A CA    1 
ATOM   576   C  C     . GLY A  1  86   ? 220.297 274.249 249.338 1.00 0.00 ? 86   GLY A C     1 
ATOM   577   O  O     . GLY A  1  86   ? 221.363 274.765 249.006 1.00 0.00 ? 86   GLY A O     1 
ATOM   578   N  N     . HIS A  1  87   ? 220.221 273.070 249.944 1.00 0.00 ? 87   HIS A N     1 
ATOM   579   C  CA    . HIS A  1  87   ? 221.377 272.195 250.046 1.00 0.00 ? 87   HIS A CA    1 
ATOM   580   C  C     . HIS A  1  87   ? 220.946 270.737 250.084 1.00 0.00 ? 87   HIS A C     1 
ATOM   581   O  O     . HIS A  1  87   ? 219.828 270.433 250.490 1.00 0.00 ? 87   HIS A O     1 
ATOM   582   C  CB    . HIS A  1  87   ? 222.190 272.573 251.277 1.00 0.00 ? 87   HIS A CB    1 
ATOM   583   C  CG    . HIS A  1  87   ? 221.665 271.989 252.543 1.00 0.00 ? 87   HIS A CG    1 
ATOM   584   N  ND1   . HIS A  1  87   ? 220.685 272.607 253.288 1.00 0.00 ? 87   HIS A ND1   1 
ATOM   585   C  CD2   . HIS A  1  87   ? 221.983 270.853 253.204 1.00 0.00 ? 87   HIS A CD2   1 
ATOM   586   C  CE1   . HIS A  1  87   ? 220.418 271.874 254.353 1.00 0.00 ? 87   HIS A CE1   1 
ATOM   587   N  NE2   . HIS A  1  87   ? 221.191 270.804 254.325 1.00 0.00 ? 87   HIS A NE2   1 
ATOM   588   N  N     . ILE A  1  88   ? 221.859 269.837 249.745 1.00 0.00 ? 88   ILE A N     1 
ATOM   589   C  CA    . ILE A  1  88   ? 221.746 268.420 250.061 1.00 0.00 ? 88   ILE A CA    1 
ATOM   590   C  C     . ILE A  1  88   ? 223.006 267.847 250.689 1.00 0.00 ? 88   ILE A C     1 
ATOM   591   O  O     . ILE A  1  88   ? 224.103 268.253 250.321 1.00 0.00 ? 88   ILE A O     1 
ATOM   592   C  CB    . ILE A  1  88   ? 221.390 267.591 248.803 1.00 0.00 ? 88   ILE A CB    1 
ATOM   593   C  CG1   . ILE A  1  88   ? 222.392 267.830 247.683 1.00 0.00 ? 88   ILE A CG1   1 
ATOM   594   C  CG2   . ILE A  1  88   ? 220.016 267.956 248.273 1.00 0.00 ? 88   ILE A CG2   1 
ATOM   595   C  CD1   . ILE A  1  88   ? 222.148 266.941 246.477 1.00 0.00 ? 88   ILE A CD1   1 
ATOM   596   N  N     . GLU A  1  89   ? 222.863 266.952 251.663 1.00 0.00 ? 89   GLU A N     1 
ATOM   597   C  CA    . GLU A  1  89   ? 224.034 266.380 252.325 1.00 0.00 ? 89   GLU A CA    1 
ATOM   598   C  C     . GLU A  1  89   ? 224.253 264.999 251.730 1.00 0.00 ? 89   GLU A C     1 
ATOM   599   O  O     . GLU A  1  89   ? 223.394 264.128 251.855 1.00 0.00 ? 89   GLU A O     1 
ATOM   600   C  CB    . GLU A  1  89   ? 223.849 266.258 253.836 1.00 0.00 ? 89   GLU A CB    1 
ATOM   601   C  CG    . GLU A  1  89   ? 223.779 267.554 254.600 1.00 0.00 ? 89   GLU A CG    1 
ATOM   602   C  CD    . GLU A  1  89   ? 223.166 267.362 255.978 1.00 0.00 ? 89   GLU A CD    1 
ATOM   603   O  OE1   . GLU A  1  89   ? 222.750 266.224 256.298 1.00 0.00 ? 89   GLU A OE1   1 
ATOM   604   O  OE2   . GLU A  1  89   ? 223.109 268.347 256.744 1.00 0.00 ? 89   GLU A OE2   1 
ATOM   605   N  N     . LEU A  1  90   ? 225.404 264.789 251.098 1.00 0.00 ? 90   LEU A N     1 
ATOM   606   C  CA    . LEU A  1  90   ? 225.630 263.555 250.354 1.00 0.00 ? 90   LEU A CA    1 
ATOM   607   C  C     . LEU A  1  90   ? 226.060 262.417 251.266 1.00 0.00 ? 90   LEU A C     1 
ATOM   608   O  O     . LEU A  1  90   ? 226.810 262.624 252.217 1.00 0.00 ? 90   LEU A O     1 
ATOM   609   C  CB    . LEU A  1  90   ? 226.672 263.771 249.260 1.00 0.00 ? 90   LEU A CB    1 
ATOM   610   C  CG    . LEU A  1  90   ? 226.349 264.862 248.245 1.00 0.00 ? 90   LEU A CG    1 
ATOM   611   C  CD1   . LEU A  1  90   ? 227.415 264.886 247.182 1.00 0.00 ? 90   LEU A CD1   1 
ATOM   612   C  CD2   . LEU A  1  90   ? 224.996 264.628 247.625 1.00 0.00 ? 90   LEU A CD2   1 
ATOM   613   N  N     . ALA A  1  91   ? 225.567 261.215 250.969 1.00 0.00 ? 91   ALA A N     1 
ATOM   614   C  CA    . ALA A  1  91   ? 225.837 260.029 251.785 1.00 0.00 ? 91   ALA A CA    1 
ATOM   615   C  C     . ALA A  1  91   ? 227.327 259.753 251.883 1.00 0.00 ? 91   ALA A C     1 
ATOM   616   O  O     . ALA A  1  91   ? 227.816 259.248 252.893 1.00 0.00 ? 91   ALA A O     1 
ATOM   617   C  CB    . ALA A  1  91   ? 225.114 258.816 251.220 1.00 0.00 ? 91   ALA A CB    1 
ATOM   618   N  N     . LYS A  1  92   ? 228.041 260.081 250.816 1.00 0.00 ? 92   LYS A N     1 
ATOM   619   C  CA    . LYS A  1  92   ? 229.486 260.028 250.823 1.00 0.00 ? 92   LYS A CA    1 
ATOM   620   C  C     . LYS A  1  92   ? 230.044 261.277 250.170 1.00 0.00 ? 92   LYS A C     1 
ATOM   621   O  O     . LYS A  1  92   ? 229.390 261.879 249.323 1.00 0.00 ? 92   LYS A O     1 
ATOM   622   C  CB    . LYS A  1  92   ? 229.976 258.777 250.099 1.00 0.00 ? 92   LYS A CB    1 
ATOM   623   C  CG    . LYS A  1  92   ? 229.580 257.486 250.779 1.00 0.00 ? 92   LYS A CG    1 
ATOM   624   C  CD    . LYS A  1  92   ? 230.402 256.335 250.242 1.00 0.00 ? 92   LYS A CD    1 
ATOM   625   C  CE    . LYS A  1  92   ? 230.074 255.033 250.948 1.00 0.00 ? 92   LYS A CE    1 
ATOM   626   N  NZ    . LYS A  1  92   ? 230.271 255.133 252.423 1.00 0.00 ? 92   LYS A NZ    1 
ATOM   627   N  N     . PRO A  1  93   ? 231.258 261.680 250.565 1.00 0.00 ? 93   PRO A N     1 
ATOM   628   C  CA    . PRO A  1  93   ? 231.884 262.826 249.901 1.00 0.00 ? 93   PRO A CA    1 
ATOM   629   C  C     . PRO A  1  93   ? 232.251 262.484 248.457 1.00 0.00 ? 93   PRO A C     1 
ATOM   630   O  O     . PRO A  1  93   ? 232.429 261.305 248.154 1.00 0.00 ? 93   PRO A O     1 
ATOM   631   C  CB    . PRO A  1  93   ? 233.127 263.094 250.757 1.00 0.00 ? 93   PRO A CB    1 
ATOM   632   C  CG    . PRO A  1  93   ? 233.414 261.777 251.441 1.00 0.00 ? 93   PRO A CG    1 
ATOM   633   C  CD    . PRO A  1  93   ? 232.075 261.151 251.674 1.00 0.00 ? 93   PRO A CD    1 
ATOM   634   N  N     . VAL A  1  94   ? 232.332 263.484 247.582 1.00 0.00 ? 94   VAL A N     1 
ATOM   635   C  CA    . VAL A  1  94   ? 232.813 263.270 246.215 1.00 0.00 ? 94   VAL A CA    1 
ATOM   636   C  C     . VAL A  1  94   ? 233.777 264.370 245.799 1.00 0.00 ? 94   VAL A C     1 
ATOM   637   O  O     . VAL A  1  94   ? 233.731 265.470 246.342 1.00 0.00 ? 94   VAL A O     1 
ATOM   638   C  CB    . VAL A  1  94   ? 231.669 263.229 245.207 1.00 0.00 ? 94   VAL A CB    1 
ATOM   639   C  CG1   . VAL A  1  94   ? 230.893 261.938 245.340 1.00 0.00 ? 94   VAL A CG1   1 
ATOM   640   C  CG2   . VAL A  1  94   ? 230.773 264.426 245.403 1.00 0.00 ? 94   VAL A CG2   1 
ATOM   641   N  N     . PHE A  1  95   ? 234.632 264.089 244.820 1.00 0.00 ? 95   PHE A N     1 
ATOM   642   C  CA    . PHE A  1  95   ? 235.597 265.087 244.376 1.00 0.00 ? 95   PHE A CA    1 
ATOM   643   C  C     . PHE A  1  95   ? 234.890 266.199 243.639 1.00 0.00 ? 95   PHE A C     1 
ATOM   644   O  O     . PHE A  1  95   ? 233.990 265.953 242.852 1.00 0.00 ? 95   PHE A O     1 
ATOM   645   C  CB    . PHE A  1  95   ? 236.652 264.475 243.464 1.00 0.00 ? 95   PHE A CB    1 
ATOM   646   C  CG    . PHE A  1  95   ? 237.572 263.536 244.158 1.00 0.00 ? 95   PHE A CG    1 
ATOM   647   C  CD1   . PHE A  1  95   ? 238.739 263.986 244.733 1.00 0.00 ? 95   PHE A CD1   1 
ATOM   648   C  CD2   . PHE A  1  95   ? 237.280 262.194 244.216 1.00 0.00 ? 95   PHE A CD2   1 
ATOM   649   C  CE1   . PHE A  1  95   ? 239.587 263.107 245.369 1.00 0.00 ? 95   PHE A CE1   1 
ATOM   650   C  CE2   . PHE A  1  95   ? 238.124 261.315 244.847 1.00 0.00 ? 95   PHE A CE2   1 
ATOM   651   C  CZ    . PHE A  1  95   ? 239.276 261.770 245.425 1.00 0.00 ? 95   PHE A CZ    1 
ATOM   652   N  N     . HIS A  1  96   ? 235.308 267.427 243.894 1.00 0.00 ? 96   HIS A N     1 
ATOM   653   C  CA    . HIS A  1  96   ? 234.838 268.561 243.134 1.00 0.00 ? 96   HIS A CA    1 
ATOM   654   C  C     . HIS A  1  96   ? 235.664 268.613 241.860 1.00 0.00 ? 96   HIS A C     1 
ATOM   655   O  O     . HIS A  1  96   ? 236.892 268.661 241.916 1.00 0.00 ? 96   HIS A O     1 
ATOM   656   C  CB    . HIS A  1  96   ? 234.984 269.818 243.969 1.00 0.00 ? 96   HIS A CB    1 
ATOM   657   C  CG    . HIS A  1  96   ? 234.406 271.036 243.340 1.00 0.00 ? 96   HIS A CG    1 
ATOM   658   N  ND1   . HIS A  1  96   ? 235.055 271.734 242.347 1.00 0.00 ? 96   HIS A ND1   1 
ATOM   659   C  CD2   . HIS A  1  96   ? 233.255 271.702 243.584 1.00 0.00 ? 96   HIS A CD2   1 
ATOM   660   C  CE1   . HIS A  1  96   ? 234.318 272.773 241.996 1.00 0.00 ? 96   HIS A CE1   1 
ATOM   661   N  NE2   . HIS A  1  96   ? 233.221 272.776 242.732 1.00 0.00 ? 96   HIS A NE2   1 
ATOM   662   N  N     . VAL A  1  97   ? 235.007 268.582 240.711 1.00 0.00 ? 97   VAL A N     1 
ATOM   663   C  CA    . VAL A  1  97   ? 235.733 268.367 239.464 1.00 0.00 ? 97   VAL A CA    1 
ATOM   664   C  C     . VAL A  1  97   ? 236.612 269.551 239.015 1.00 0.00 ? 97   VAL A C     1 
ATOM   665   O  O     . VAL A  1  97   ? 237.628 269.354 238.338 1.00 0.00 ? 97   VAL A O     1 
ATOM   666   C  CB    . VAL A  1  97   ? 234.763 268.001 238.324 1.00 0.00 ? 97   VAL A CB    1 
ATOM   667   C  CG1   . VAL A  1  97   ? 233.915 269.199 237.935 1.00 0.00 ? 97   VAL A CG1   1 
ATOM   668   C  CG2   . VAL A  1  97   ? 235.532 267.445 237.122 1.00 0.00 ? 97   VAL A CG2   1 
ATOM   669   N  N     . GLY A  1  98   ? 236.237 270.774 239.382 1.00 0.00 ? 98   GLY A N     1 
ATOM   670   C  CA    . GLY A  1  98   ? 237.041 271.938 239.044 1.00 0.00 ? 98   GLY A CA    1 
ATOM   671   C  C     . GLY A  1  98   ? 238.334 272.040 239.834 1.00 0.00 ? 98   GLY A C     1 
ATOM   672   O  O     . GLY A  1  98   ? 239.359 272.455 239.297 1.00 0.00 ? 98   GLY A O     1 
ATOM   673   N  N     . PHE A  1  99   ? 238.289 271.654 241.107 1.00 0.00 ? 99   PHE A N     1 
ATOM   674   C  CA    . PHE A  1  99   ? 239.467 271.676 241.962 1.00 0.00 ? 99   PHE A CA    1 
ATOM   675   C  C     . PHE A  1  99   ? 240.315 270.429 241.856 1.00 0.00 ? 99   PHE A C     1 
ATOM   676   O  O     . PHE A  1  99   ? 241.363 270.367 242.482 1.00 0.00 ? 99   PHE A O     1 
ATOM   677   C  CB    . PHE A  1  99   ? 239.074 271.871 243.423 1.00 0.00 ? 99   PHE A CB    1 
ATOM   678   C  CG    . PHE A  1  99   ? 238.452 273.192 243.708 1.00 0.00 ? 99   PHE A CG    1 
ATOM   679   C  CD1   . PHE A  1  99   ? 238.855 274.319 243.026 1.00 0.00 ? 99   PHE A CD1   1 
ATOM   680   C  CD2   . PHE A  1  99   ? 237.482 273.316 244.675 1.00 0.00 ? 99   PHE A CD2   1 
ATOM   681   C  CE1   . PHE A  1  99   ? 238.282 275.541 243.294 1.00 0.00 ? 99   PHE A CE1   1 
ATOM   682   C  CE2   . PHE A  1  99   ? 236.910 274.537 244.945 1.00 0.00 ? 99   PHE A CE2   1 
ATOM   683   C  CZ    . PHE A  1  99   ? 237.311 275.648 244.254 1.00 0.00 ? 99   PHE A CZ    1 
ATOM   684   N  N     . LEU A  1  100  ? 239.863 269.434 241.099 1.00 0.00 ? 100  LEU A N     1 
ATOM   685   C  CA    . LEU A  1  100  ? 240.580 268.159 241.008 1.00 0.00 ? 100  LEU A CA    1 
ATOM   686   C  C     . LEU A  1  100  ? 242.083 268.297 240.725 1.00 0.00 ? 100  LEU A C     1 
ATOM   687   O  O     . LEU A  1  100  ? 242.890 267.541 241.275 1.00 0.00 ? 100  LEU A O     1 
ATOM   688   C  CB    . LEU A  1  100  ? 239.944 267.275 239.937 1.00 0.00 ? 100  LEU A CB    1 
ATOM   689   C  CG    . LEU A  1  100  ? 240.502 265.853 239.897 1.00 0.00 ? 100  LEU A CG    1 
ATOM   690   C  CD1   . LEU A  1  100  ? 240.290 265.176 241.229 1.00 0.00 ? 100  LEU A CD1   1 
ATOM   691   C  CD2   . LEU A  1  100  ? 239.869 265.051 238.782 1.00 0.00 ? 100  LEU A CD2   1 
ATOM   692   N  N     . VAL A  1  101  ? 242.450 269.243 239.860 1.00 0.00 ? 101  VAL A N     1 
ATOM   693   C  CA    . VAL A  1  101  ? 243.859 269.573 239.600 1.00 0.00 ? 101  VAL A CA    1 
ATOM   694   C  C     . VAL A  1  101  ? 244.599 270.080 240.847 1.00 0.00 ? 101  VAL A C     1 
ATOM   695   O  O     . VAL A  1  101  ? 245.697 269.617 241.177 1.00 0.00 ? 101  VAL A O     1 
ATOM   696   C  CB    . VAL A  1  101  ? 243.994 270.635 238.487 1.00 0.00 ? 101  VAL A CB    1 
ATOM   697   C  CG1   . VAL A  1  101  ? 245.458 270.991 238.268 1.00 0.00 ? 101  VAL A CG1   1 
ATOM   698   C  CG2   . VAL A  1  101  ? 243.381 270.128 237.200 1.00 0.00 ? 101  VAL A CG2   1 
ATOM   699   N  N     . LYS A  1  102  ? 243.977 271.037 241.529 1.00 0.00 ? 102  LYS A N     1 
ATOM   700   C  CA    . LYS A  1  102  ? 244.509 271.620 242.755 1.00 0.00 ? 102  LYS A CA    1 
ATOM   701   C  C     . LYS A  1  102  ? 244.616 270.603 243.881 1.00 0.00 ? 102  LYS A C     1 
ATOM   702   O  O     . LYS A  1  102  ? 245.639 270.534 244.556 1.00 0.00 ? 102  LYS A O     1 
ATOM   703   C  CB    . LYS A  1  102  ? 243.645 272.788 243.217 1.00 0.00 ? 102  LYS A CB    1 
ATOM   704   C  CG    . LYS A  1  102  ? 243.851 274.052 242.422 1.00 0.00 ? 102  LYS A CG    1 
ATOM   705   C  CD    . LYS A  1  102  ? 245.163 274.719 242.756 1.00 0.00 ? 102  LYS A CD    1 
ATOM   706   C  CE    . LYS A  1  102  ? 245.265 276.057 242.043 1.00 0.00 ? 102  LYS A CE    1 
ATOM   707   N  NZ    . LYS A  1  102  ? 245.388 275.904 240.565 1.00 0.00 ? 102  LYS A NZ    1 
ATOM   708   N  N     . THR A  1  103  ? 243.554 269.826 244.082 1.00 0.00 ? 103  THR A N     1 
ATOM   709   C  CA    . THR A  1  103  ? 243.539 268.769 245.096 1.00 0.00 ? 103  THR A CA    1 
ATOM   710   C  C     . THR A  1  103  ? 244.665 267.778 244.873 1.00 0.00 ? 103  THR A C     1 
ATOM   711   O  O     . THR A  1  103  ? 245.346 267.377 245.817 1.00 0.00 ? 103  THR A O     1 
ATOM   712   C  CB    . THR A  1  103  ? 242.222 267.980 245.108 1.00 0.00 ? 103  THR A CB    1 
ATOM   713   O  OG1   . THR A  1  103  ? 241.996 267.396 243.819 1.00 0.00 ? 103  THR A OG1   1 
ATOM   714   C  CG2   . THR A  1  103  ? 241.058 268.874 245.495 1.00 0.00 ? 103  THR A CG2   1 
ATOM   715   N  N     . MET A  1  104  ? 244.844 267.371 243.625 1.00 0.00 ? 104  MET A N     1 
ATOM   716   C  CA    . MET A  1  104  ? 245.936 266.481 243.278 1.00 0.00 ? 104  MET A CA    1 
ATOM   717   C  C     . MET A  1  104  ? 247.290 267.131 243.553 1.00 0.00 ? 104  MET A C     1 
ATOM   718   O  O     . MET A  1  104  ? 248.204 266.481 244.052 1.00 0.00 ? 104  MET A O     1 
ATOM   719   C  CB    . MET A  1  104  ? 245.853 266.067 241.816 1.00 0.00 ? 104  MET A CB    1 
ATOM   720   C  CG    . MET A  1  104  ? 246.925 265.079 241.428 1.00 0.00 ? 104  MET A CG    1 
ATOM   721   S  SD    . MET A  1  104  ? 246.545 264.266 239.876 1.00 0.00 ? 104  MET A SD    1 
ATOM   722   C  CE    . MET A  1  104  ? 246.811 265.630 238.747 1.00 0.00 ? 104  MET A CE    1 
ATOM   723   N  N     . LYS A  1  105  ? 247.408 268.417 243.252 1.00 0.00 ? 105  LYS A N     1 
ATOM   724   C  CA    . LYS A  1  105  ? 248.644 269.144 243.510 1.00 0.00 ? 105  LYS A CA    1 
ATOM   725   C  C     . LYS A  1  105  ? 248.926 269.331 245.001 1.00 0.00 ? 105  LYS A C     1 
ATOM   726   O  O     . LYS A  1  105  ? 250.062 269.185 245.438 1.00 0.00 ? 105  LYS A O     1 
ATOM   727   C  CB    . LYS A  1  105  ? 248.580 270.515 242.830 1.00 0.00 ? 105  LYS A CB    1 
ATOM   728   C  CG    . LYS A  1  105  ? 249.877 271.315 242.856 1.00 0.00 ? 105  LYS A CG    1 
ATOM   729   C  CD    . LYS A  1  105  ? 249.936 272.289 241.681 1.00 0.00 ? 105  LYS A CD    1 
ATOM   730   C  CE    . LYS A  1  105  ? 250.209 271.577 240.369 1.00 0.00 ? 105  LYS A CE    1 
ATOM   731   N  NZ    . LYS A  1  105  ? 251.473 270.802 240.410 1.00 0.00 ? 105  LYS A NZ    1 
ATOM   732   N  N     . VAL A  1  106  ? 247.897 269.639 245.781 1.00 0.00 ? 106  VAL A N     1 
ATOM   733   C  CA    . VAL A  1  106  ? 248.016 269.682 247.238 1.00 0.00 ? 106  VAL A CA    1 
ATOM   734   C  C     . VAL A  1  106  ? 248.342 268.327 247.859 1.00 0.00 ? 106  VAL A C     1 
ATOM   735   O  O     . VAL A  1  106  ? 249.173 268.229 248.759 1.00 0.00 ? 106  VAL A O     1 
ATOM   736   C  CB    . VAL A  1  106  ? 246.730 270.227 247.882 1.00 0.00 ? 106  VAL A CB    1 
ATOM   737   C  CG1   . VAL A  1  106  ? 246.778 270.081 249.393 1.00 0.00 ? 106  VAL A CG1   1 
ATOM   738   C  CG2   . VAL A  1  106  ? 246.545 271.676 247.514 1.00 0.00 ? 106  VAL A CG2   1 
ATOM   739   N  N     . LEU A  1  107  ? 247.709 267.280 247.355 1.00 0.00 ? 107  LEU A N     1 
ATOM   740   C  CA    . LEU A  1  107  ? 247.919 265.935 247.870 1.00 0.00 ? 107  LEU A CA    1 
ATOM   741   C  C     . LEU A  1  107  ? 249.300 265.370 247.538 1.00 0.00 ? 107  LEU A C     1 
ATOM   742   O  O     . LEU A  1  107  ? 249.827 264.548 248.276 1.00 0.00 ? 107  LEU A O     1 
ATOM   743   C  CB    . LEU A  1  107  ? 246.831 265.007 247.338 1.00 0.00 ? 107  LEU A CB    1 
ATOM   744   C  CG    . LEU A  1  107  ? 246.634 263.698 248.091 1.00 0.00 ? 107  LEU A CG    1 
ATOM   745   C  CD1   . LEU A  1  107  ? 246.103 263.998 249.480 1.00 0.00 ? 107  LEU A CD1   1 
ATOM   746   C  CD2   . LEU A  1  107  ? 245.669 262.806 247.336 1.00 0.00 ? 107  LEU A CD2   1 
ATOM   747   N  N     . ARG A  1  108  ? 249.881 265.804 246.427 1.00 0.00 ? 108  ARG A N     1 
ATOM   748   C  CA    . ARG A  1  108  ? 251.289 265.528 246.142 1.00 0.00 ? 108  ARG A CA    1 
ATOM   749   C  C     . ARG A  1  108  ? 252.289 266.260 247.046 1.00 0.00 ? 108  ARG A C     1 
ATOM   750   O  O     . ARG A  1  108  ? 253.357 265.727 247.328 1.00 0.00 ? 108  ARG A O     1 
ATOM   751   C  CB    . ARG A  1  108  ? 251.568 265.895 244.687 1.00 0.00 ? 108  ARG A CB    1 
ATOM   752   C  CG    . ARG A  1  108  ? 251.035 264.888 243.692 1.00 0.00 ? 108  ARG A CG    1 
ATOM   753   C  CD    . ARG A  1  108  ? 251.172 265.411 242.272 1.00 0.00 ? 108  ARG A CD    1 
ATOM   754   N  NE    . ARG A  1  108  ? 250.933 264.378 241.272 1.00 0.00 ? 108  ARG A NE    1 
ATOM   755   C  CZ    . ARG A  1  108  ? 251.228 264.509 239.983 1.00 0.00 ? 108  ARG A CZ    1 
ATOM   756   N  NH1   . ARG A  1  108  ? 251.742 265.645 239.530 1.00 0.00 ? 108  ARG A NH1   1 
ATOM   757   N  NH2   . ARG A  1  108  ? 251.024 263.497 239.152 1.00 0.00 ? 108  ARG A NH2   1 
ATOM   758   N  N     . CYS A  1  109  ? 251.970 267.477 247.479 1.00 0.00 ? 109  CYS A N     1 
ATOM   759   C  CA    . CYS A  1  109  ? 252.795 268.162 248.485 1.00 0.00 ? 109  CYS A CA    1 
ATOM   760   C  C     . CYS A  1  109  ? 252.662 267.634 249.906 1.00 0.00 ? 109  CYS A C     1 
ATOM   761   O  O     . CYS A  1  109  ? 253.652 267.511 250.618 1.00 0.00 ? 109  CYS A O     1 
ATOM   762   C  CB    . CYS A  1  109  ? 252.509 269.659 248.481 1.00 0.00 ? 109  CYS A CB    1 
ATOM   763   S  SG    . CYS A  1  109  ? 253.177 270.483 247.035 1.00 0.00 ? 109  CYS A SG    1 
ATOM   764   N  N     . VAL A  1  110  ? 251.439 267.339 250.327 1.00 0.00 ? 110  VAL A N     1 
ATOM   765   C  CA    . VAL A  1  110  ? 251.210 266.936 251.706 1.00 0.00 ? 110  VAL A CA    1 
ATOM   766   C  C     . VAL A  1  110  ? 251.453 265.437 251.781 1.00 0.00 ? 110  VAL A C     1 
ATOM   767   O  O     . VAL A  1  110  ? 251.133 264.709 250.847 1.00 0.00 ? 110  VAL A O     1 
ATOM   768   C  CB    . VAL A  1  110  ? 249.781 267.289 252.181 1.00 0.00 ? 110  VAL A CB    1 
ATOM   769   C  CG1   . VAL A  1  110  ? 249.467 266.631 253.519 1.00 0.00 ? 110  VAL A CG1   1 
ATOM   770   C  CG2   . VAL A  1  110  ? 249.617 268.797 252.287 1.00 0.00 ? 110  VAL A CG2   1 
ATOM   771   N  N     . CYS A  1  111  ? 252.028 264.972 252.882 1.00 0.00 ? 111  CYS A N     1 
ATOM   772   C  CA    . CYS A  1  111  ? 252.471 263.588 252.962 1.00 0.00 ? 111  CYS A CA    1 
ATOM   773   C  C     . CYS A  1  111  ? 251.350 262.632 253.344 1.00 0.00 ? 111  CYS A C     1 
ATOM   774   O  O     . CYS A  1  111  ? 250.623 262.862 254.307 1.00 0.00 ? 111  CYS A O     1 
ATOM   775   C  CB    . CYS A  1  111  ? 253.618 263.449 253.963 1.00 0.00 ? 111  CYS A CB    1 
ATOM   776   S  SG    . CYS A  1  111  ? 253.868 261.755 254.553 1.00 0.00 ? 111  CYS A SG    1 
ATOM   777   N  N     . PHE A  1  112  ? 251.200 261.574 252.556 1.00 0.00 ? 112  PHE A N     1 
ATOM   778   C  CA    . PHE A  1  112  ? 250.241 260.515 252.839 1.00 0.00 ? 112  PHE A CA    1 
ATOM   779   C  C     . PHE A  1  112  ? 250.431 259.903 254.232 1.00 0.00 ? 112  PHE A C     1 
ATOM   780   O  O     . PHE A  1  112  ? 251.549 259.553 254.614 1.00 0.00 ? 112  PHE A O     1 
ATOM   781   C  CB    . PHE A  1  112  ? 250.335 259.419 251.781 1.00 0.00 ? 112  PHE A CB    1 
ATOM   782   C  CG    . PHE A  1  112  ? 249.312 258.345 251.940 1.00 0.00 ? 112  PHE A CG    1 
ATOM   783   C  CD1   . PHE A  1  112  ? 248.027 258.521 251.460 1.00 0.00 ? 112  PHE A CD1   1 
ATOM   784   C  CD2   . PHE A  1  112  ? 249.631 257.158 252.582 1.00 0.00 ? 112  PHE A CD2   1 
ATOM   785   C  CE1   . PHE A  1  112  ? 247.077 257.531 251.614 1.00 0.00 ? 112  PHE A CE1   1 
ATOM   786   C  CE2   . PHE A  1  112  ? 248.688 256.163 252.740 1.00 0.00 ? 112  PHE A CE2   1 
ATOM   787   C  CZ    . PHE A  1  112  ? 247.409 256.348 252.256 1.00 0.00 ? 112  PHE A CZ    1 
ATOM   788   N  N     . PHE A  1  113  ? 249.335 259.826 254.988 1.00 0.00 ? 113  PHE A N     1 
ATOM   789   C  CA    . PHE A  1  113  ? 249.286 259.224 256.330 1.00 0.00 ? 113  PHE A CA    1 
ATOM   790   C  C     . PHE A  1  113  ? 249.947 260.082 257.407 1.00 0.00 ? 113  PHE A C     1 
ATOM   791   O  O     . PHE A  1  113  ? 249.439 260.187 258.524 1.00 0.00 ? 113  PHE A O     1 
ATOM   792   C  CB    . PHE A  1  113  ? 249.923 257.828 256.333 1.00 0.00 ? 113  PHE A CB    1 
ATOM   793   C  CG    . PHE A  1  113  ? 250.050 257.226 257.703 1.00 0.00 ? 113  PHE A CG    1 
ATOM   794   C  CD1   . PHE A  1  113  ? 248.970 256.603 258.305 1.00 0.00 ? 113  PHE A CD1   1 
ATOM   795   C  CD2   . PHE A  1  113  ? 251.251 257.284 258.391 1.00 0.00 ? 113  PHE A CD2   1 
ATOM   796   C  CE1   . PHE A  1  113  ? 249.085 256.050 259.568 1.00 0.00 ? 113  PHE A CE1   1 
ATOM   797   C  CE2   . PHE A  1  113  ? 251.372 256.734 259.654 1.00 0.00 ? 113  PHE A CE2   1 
ATOM   798   C  CZ    . PHE A  1  113  ? 250.287 256.114 260.243 1.00 0.00 ? 113  PHE A CZ    1 
ATOM   799   N  N     . CYS A  1  114  ? 251.074 260.695 257.070 1.00 0.00 ? 114  CYS A N     1 
ATOM   800   C  CA    . CYS A  1  114  ? 251.741 261.603 257.989 1.00 0.00 ? 114  CYS A CA    1 
ATOM   801   C  C     . CYS A  1  114  ? 250.946 262.899 258.058 1.00 0.00 ? 114  CYS A C     1 
ATOM   802   O  O     . CYS A  1  114  ? 250.824 263.511 259.120 1.00 0.00 ? 114  CYS A O     1 
ATOM   803   C  CB    . CYS A  1  114  ? 253.184 261.863 257.548 1.00 0.00 ? 114  CYS A CB    1 
ATOM   804   S  SG    . CYS A  1  114  ? 254.228 262.709 258.774 1.00 0.00 ? 114  CYS A SG    1 
ATOM   805   N  N     . SER A  1  115  ? 250.427 263.315 256.902 1.00 0.00 ? 115  SER A N     1 
ATOM   806   C  CA    . SER A  1  115  ? 249.660 264.549 256.766 1.00 0.00 ? 115  SER A CA    1 
ATOM   807   C  C     . SER A  1  115  ? 250.522 265.751 257.114 1.00 0.00 ? 115  SER A C     1 
ATOM   808   O  O     . SER A  1  115  ? 250.123 266.613 257.894 1.00 0.00 ? 115  SER A O     1 
ATOM   809   C  CB    . SER A  1  115  ? 248.409 264.515 257.639 1.00 0.00 ? 115  SER A CB    1 
ATOM   810   O  OG    . SER A  1  115  ? 247.573 263.428 257.281 1.00 0.00 ? 115  SER A OG    1 
ATOM   811   N  N     . LYS A  1  116  ? 251.712 265.792 256.525 1.00 0.00 ? 116  LYS A N     1 
ATOM   812   C  CA    . LYS A  1  116  ? 252.620 266.914 256.700 1.00 0.00 ? 116  LYS A CA    1 
ATOM   813   C  C     . LYS A  1  116  ? 253.224 267.371 255.375 1.00 0.00 ? 116  LYS A C     1 
ATOM   814   O  O     . LYS A  1  116  ? 253.434 266.568 254.468 1.00 0.00 ? 116  LYS A O     1 
ATOM   815   C  CB    . LYS A  1  116  ? 253.732 266.539 257.674 1.00 0.00 ? 116  LYS A CB    1 
ATOM   816   C  CG    . LYS A  1  116  ? 254.617 267.695 258.044 1.00 0.00 ? 116  LYS A CG    1 
ATOM   817   C  CD    . LYS A  1  116  ? 255.957 267.210 258.526 1.00 0.00 ? 116  LYS A CD    1 
ATOM   818   C  CE    . LYS A  1  116  ? 256.926 268.366 258.616 1.00 0.00 ? 116  LYS A CE    1 
ATOM   819   N  NZ    . LYS A  1  116  ? 256.348 269.469 259.419 1.00 0.00 ? 116  LYS A NZ    1 
ATOM   820   N  N     . LEU A  1  117  ? 253.489 268.668 255.263 1.00 0.00 ? 117  LEU A N     1 
ATOM   821   C  CA    . LEU A  1  117  ? 254.283 269.187 254.161 1.00 0.00 ? 117  LEU A CA    1 
ATOM   822   C  C     . LEU A  1  117  ? 255.660 268.537 254.171 1.00 0.00 ? 117  LEU A C     1 
ATOM   823   O  O     . LEU A  1  117  ? 256.336 268.540 255.195 1.00 0.00 ? 117  LEU A O     1 
ATOM   824   C  CB    . LEU A  1  117  ? 254.393 270.706 254.264 1.00 0.00 ? 117  LEU A CB    1 
ATOM   825   C  CG    . LEU A  1  117  ? 254.297 271.463 252.945 1.00 0.00 ? 117  LEU A CG    1 
ATOM   826   C  CD1   . LEU A  1  117  ? 253.680 272.834 253.153 1.00 0.00 ? 117  LEU A CD1   1 
ATOM   827   C  CD2   . LEU A  1  117  ? 255.679 271.592 252.338 1.00 0.00 ? 117  LEU A CD2   1 
ATOM   828   N  N     . LEU A  1  118  ? 256.056 267.967 253.036 1.00 0.00 ? 118  LEU A N     1 
ATOM   829   C  CA    . LEU A  1  118  ? 257.324 267.251 252.920 1.00 0.00 ? 118  LEU A CA    1 
ATOM   830   C  C     . LEU A  1  118  ? 258.515 268.044 253.422 1.00 0.00 ? 118  LEU A C     1 
ATOM   831   O  O     . LEU A  1  118  ? 259.305 267.550 254.223 1.00 0.00 ? 118  LEU A O     1 
ATOM   832   C  CB    . LEU A  1  118  ? 257.576 266.839 251.473 1.00 0.00 ? 118  LEU A CB    1 
ATOM   833   C  CG    . LEU A  1  118  ? 256.545 265.892 250.868 1.00 0.00 ? 118  LEU A CG    1 
ATOM   834   C  CD1   . LEU A  1  118  ? 256.821 265.688 249.388 1.00 0.00 ? 118  LEU A CD1   1 
ATOM   835   C  CD2   . LEU A  1  118  ? 256.553 264.565 251.610 1.00 0.00 ? 118  LEU A CD2   1 
ATOM   836   N  N     . VAL A  1  119  ? 258.646 269.273 252.945 1.00 0.00 ? 119  VAL A N     1 
ATOM   837   C  CA    . VAL A  1  119  ? 259.794 270.086 253.306 1.00 0.00 ? 119  VAL A CA    1 
ATOM   838   C  C     . VAL A  1  119  ? 259.503 270.982 254.509 1.00 0.00 ? 119  VAL A C     1 
ATOM   839   O  O     . VAL A  1  119  ? 258.421 271.559 254.628 1.00 0.00 ? 119  VAL A O     1 
ATOM   840   C  CB    . VAL A  1  119  ? 260.268 270.940 252.108 1.00 0.00 ? 119  VAL A CB    1 
ATOM   841   C  CG1   . VAL A  1  119  ? 259.167 271.870 251.632 1.00 0.00 ? 119  VAL A CG1   1 
ATOM   842   C  CG2   . VAL A  1  119  ? 261.541 271.703 252.460 1.00 0.00 ? 119  VAL A CG2   1 
ATOM   843   N  N     . ASP A  1  120  ? 260.475 271.066 255.412 1.00 0.00 ? 120  ASP A N     1 
ATOM   844   C  CA    . ASP A  1  120  ? 260.382 271.935 256.577 1.00 0.00 ? 120  ASP A CA    1 
ATOM   845   C  C     . ASP A  1  120  ? 260.500 273.405 256.190 1.00 0.00 ? 120  ASP A C     1 
ATOM   846   O  O     . ASP A  1  120  ? 261.373 273.782 255.408 1.00 0.00 ? 120  ASP A O     1 
ATOM   847   C  CB    . ASP A  1  120  ? 261.465 271.570 257.589 1.00 0.00 ? 120  ASP A CB    1 
ATOM   848   C  CG    . ASP A  1  120  ? 261.349 272.347 258.879 1.00 0.00 ? 120  ASP A CG    1 
ATOM   849   O  OD1   . ASP A  1  120  ? 260.242 272.843 259.176 1.00 0.00 ? 120  ASP A OD1   1 
ATOM   850   O  OD2   . ASP A  1  120  ? 262.363 272.455 259.600 1.00 0.00 ? 120  ASP A OD2   1 
ATOM   851   N  N     . SER A  1  121  ? 259.611 274.229 256.738 1.00 0.00 ? 121  SER A N     1 
ATOM   852   C  CA    . SER A  1  121  ? 259.613 275.666 256.475 1.00 0.00 ? 121  SER A CA    1 
ATOM   853   C  C     . SER A  1  121  ? 260.869 276.377 256.999 1.00 0.00 ? 121  SER A C     1 
ATOM   854   O  O     . SER A  1  121  ? 261.165 277.501 256.590 1.00 0.00 ? 121  SER A O     1 
ATOM   855   C  CB    . SER A  1  121  ? 258.363 276.318 257.074 1.00 0.00 ? 121  SER A CB    1 
ATOM   856   O  OG    . SER A  1  121  ? 257.181 275.696 256.602 1.00 0.00 ? 121  SER A OG    1 
ATOM   857   N  N     . ASN A  1  122  ? 261.602 275.724 257.899 1.00 0.00 ? 122  ASN A N     1 
ATOM   858   C  CA    . ASN A  1  122  ? 262.825 276.298 258.465 1.00 0.00 ? 122  ASN A CA    1 
ATOM   859   C  C     . ASN A  1  122  ? 263.957 276.358 257.452 1.00 0.00 ? 122  ASN A C     1 
ATOM   860   O  O     . ASN A  1  122  ? 264.955 277.050 257.656 1.00 0.00 ? 122  ASN A O     1 
ATOM   861   C  CB    . ASN A  1  122  ? 263.277 275.504 259.690 1.00 0.00 ? 122  ASN A CB    1 
ATOM   862   C  CG    . ASN A  1  122  ? 262.327 275.645 260.857 1.00 0.00 ? 122  ASN A CG    1 
ATOM   863   O  OD1   . ASN A  1  122  ? 261.901 274.654 261.448 1.00 0.00 ? 122  ASN A OD1   1 
ATOM   864   N  ND2   . ASN A  1  122  ? 261.985 276.882 261.196 1.00 0.00 ? 122  ASN A ND2   1 
ATOM   865   N  N     . ASN A  1  123  ? 263.798 275.608 256.368 1.00 0.00 ? 123  ASN A N     1 
ATOM   866   C  CA    . ASN A  1  123  ? 264.798 275.537 255.315 1.00 0.00 ? 123  ASN A CA    1 
ATOM   867   C  C     . ASN A  1  123  ? 264.996 276.919 254.694 1.00 0.00 ? 123  ASN A C     1 
ATOM   868   O  O     . ASN A  1  123  ? 264.025 277.585 254.333 1.00 0.00 ? 123  ASN A O     1 
ATOM   869   C  CB    . ASN A  1  123  ? 264.368 274.507 254.260 1.00 0.00 ? 123  ASN A CB    1 
ATOM   870   C  CG    . ASN A  1  123  ? 265.436 274.240 253.211 1.00 0.00 ? 123  ASN A CG    1 
ATOM   871   O  OD1   . ASN A  1  123  ? 266.017 275.160 252.636 1.00 0.00 ? 123  ASN A OD1   1 
ATOM   872   N  ND2   . ASN A  1  123  ? 265.688 272.964 252.946 1.00 0.00 ? 123  ASN A ND2   1 
ATOM   873   N  N     . PRO A  1  124  ? 266.262 277.352 254.576 1.00 0.00 ? 124  PRO A N     1 
ATOM   874   C  CA    . PRO A  1  124  ? 266.685 278.623 253.977 1.00 0.00 ? 124  PRO A CA    1 
ATOM   875   C  C     . PRO A  1  124  ? 266.066 278.868 252.600 1.00 0.00 ? 124  PRO A C     1 
ATOM   876   O  O     . PRO A  1  124  ? 265.752 280.008 252.253 1.00 0.00 ? 124  PRO A O     1 
ATOM   877   C  CB    . PRO A  1  124  ? 268.211 278.481 253.885 1.00 0.00 ? 124  PRO A CB    1 
ATOM   878   C  CG    . PRO A  1  124  ? 268.556 277.541 254.983 1.00 0.00 ? 124  PRO A CG    1 
ATOM   879   C  CD    . PRO A  1  124  ? 267.415 276.567 255.053 1.00 0.00 ? 124  PRO A CD    1 
ATOM   880   N  N     . LYS A  1  125  ? 265.897 277.798 251.836 1.00 0.00 ? 125  LYS A N     1 
ATOM   881   C  CA    . LYS A  1  125  ? 265.279 277.859 250.514 1.00 0.00 ? 125  LYS A CA    1 
ATOM   882   C  C     . LYS A  1  125  ? 263.760 278.087 250.560 1.00 0.00 ? 125  LYS A C     1 
ATOM   883   O  O     . LYS A  1  125  ? 263.206 278.757 249.688 1.00 0.00 ? 125  LYS A O     1 
ATOM   884   C  CB    . LYS A  1  125  ? 265.590 276.571 249.743 1.00 0.00 ? 125  LYS A CB    1 
ATOM   885   C  CG    . LYS A  1  125  ? 265.122 276.567 248.295 1.00 0.00 ? 125  LYS A CG    1 
ATOM   886   C  CD    . LYS A  1  125  ? 265.897 275.558 247.462 1.00 0.00 ? 125  LYS A CD    1 
ATOM   887   C  CE    . LYS A  1  125  ? 265.203 275.296 246.134 1.00 0.00 ? 125  LYS A CE    1 
ATOM   888   N  NZ    . LYS A  1  125  ? 265.947 274.318 245.298 1.00 0.00 ? 125  LYS A NZ    1 
ATOM   889   N  N     . ILE A  1  126  ? 263.087 277.528 251.561 1.00 0.00 ? 126  ILE A N     1 
ATOM   890   C  CA    . ILE A  1  126  ? 261.669 277.820 251.793 1.00 0.00 ? 126  ILE A CA    1 
ATOM   891   C  C     . ILE A  1  126  ? 261.418 279.283 252.202 1.00 0.00 ? 126  ILE A C     1 
ATOM   892   O  O     . ILE A  1  126  ? 260.465 279.912 251.740 1.00 0.00 ? 126  ILE A O     1 
ATOM   893   C  CB    . ILE A  1  126  ? 261.078 276.880 252.865 1.00 0.00 ? 126  ILE A CB    1 
ATOM   894   C  CG1   . ILE A  1  126  ? 261.086 275.438 252.356 1.00 0.00 ? 126  ILE A CG1   1 
ATOM   895   C  CG2   . ILE A  1  126  ? 259.667 277.314 253.255 1.00 0.00 ? 126  ILE A CG2   1 
ATOM   896   C  CD1   . ILE A  1  126  ? 260.240 275.234 251.116 1.00 0.00 ? 126  ILE A CD1   1 
ATOM   897   N  N     . LYS A  1  127  ? 262.280 279.814 253.063 1.00 0.00 ? 127  LYS A N     1 
ATOM   898   C  CA    . LYS A  1  127  ? 262.233 281.225 253.455 1.00 0.00 ? 127  LYS A CA    1 
ATOM   899   C  C     . LYS A  1  127  ? 262.435 282.162 252.258 1.00 0.00 ? 127  LYS A C     1 
ATOM   900   O  O     . LYS A  1  127  ? 261.741 283.171 252.121 1.00 0.00 ? 127  LYS A O     1 
ATOM   901   C  CB    . LYS A  1  127  ? 263.276 281.525 254.534 1.00 0.00 ? 127  LYS A CB    1 
ATOM   902   C  CG    . LYS A  1  127  ? 262.898 281.026 255.920 1.00 0.00 ? 127  LYS A CG    1 
ATOM   903   C  CD    . LYS A  1  127  ? 263.992 281.335 256.924 1.00 0.00 ? 127  LYS A CD    1 
ATOM   904   C  CE    . LYS A  1  127  ? 265.212 280.470 256.686 1.00 0.00 ? 127  LYS A CE    1 
ATOM   905   N  NZ    . LYS A  1  127  ? 266.232 280.644 257.752 1.00 0.00 ? 127  LYS A NZ    1 
ATOM   906   N  N     . ASP A  1  128  ? 263.388 281.810 251.401 1.00 0.00 ? 128  ASP A N     1 
ATOM   907   C  CA    . ASP A  1  128  ? 263.621 282.500 250.131 1.00 0.00 ? 128  ASP A CA    1 
ATOM   908   C  C     . ASP A  1  128  ? 262.419 282.347 249.195 1.00 0.00 ? 128  ASP A C     1 
ATOM   909   O  O     . ASP A  1  128  ? 262.138 283.231 248.384 1.00 0.00 ? 128  ASP A O     1 
ATOM   910   C  CB    . ASP A  1  128  ? 264.895 281.978 249.460 1.00 0.00 ? 128  ASP A CB    1 
ATOM   911   C  CG    . ASP A  1  128  ? 265.413 282.911 248.377 1.00 0.00 ? 128  ASP A CG    1 
ATOM   912   O  OD1   . ASP A  1  128  ? 265.085 284.117 248.416 1.00 0.00 ? 128  ASP A OD1   1 
ATOM   913   O  OD2   . ASP A  1  128  ? 266.159 282.440 247.491 1.00 0.00 ? 128  ASP A OD2   1 
ATOM   914   N  N     . ILE A  1  129  ? 261.717 281.224 249.304 1.00 0.00 ? 129  ILE A N     1 
ATOM   915   C  CA    . ILE A  1  129  ? 260.477 281.028 248.561 1.00 0.00 ? 129  ILE A CA    1 
ATOM   916   C  C     . ILE A  1  129  ? 259.449 281.996 249.139 1.00 0.00 ? 129  ILE A C     1 
ATOM   917   O  O     . ILE A  1  129  ? 258.790 282.727 248.398 1.00 0.00 ? 129  ILE A O     1 
ATOM   918   C  CB    . ILE A  1  129  ? 259.950 279.579 248.639 1.00 0.00 ? 129  ILE A CB    1 
ATOM   919   C  CG1   . ILE A  1  129  ? 260.754 278.660 247.720 1.00 0.00 ? 129  ILE A CG1   1 
ATOM   920   C  CG2   . ILE A  1  129  ? 258.470 279.526 248.267 1.00 0.00 ? 129  ILE A CG2   1 
ATOM   921   C  CD1   . ILE A  1  129  ? 260.528 277.185 247.981 1.00 0.00 ? 129  ILE A CD1   1 
ATOM   922   N  N     . LEU A  1  130  ? 259.295 281.984 250.460 1.00 0.00 ? 130  LEU A N     1 
ATOM   923   C  CA    . LEU A  1  130  ? 258.364 282.890 251.128 1.00 0.00 ? 130  LEU A CA    1 
ATOM   924   C  C     . LEU A  1  130  ? 258.714 284.359 250.863 1.00 0.00 ? 130  LEU A C     1 
ATOM   925   O  O     . LEU A  1  130  ? 257.827 285.210 250.771 1.00 0.00 ? 130  LEU A O     1 
ATOM   926   C  CB    . LEU A  1  130  ? 258.370 282.638 252.640 1.00 0.00 ? 130  LEU A CB    1 
ATOM   927   C  CG    . LEU A  1  130  ? 257.798 281.330 253.188 1.00 0.00 ? 130  LEU A CG    1 
ATOM   928   C  CD1   . LEU A  1  130  ? 257.961 281.278 254.701 1.00 0.00 ? 130  LEU A CD1   1 
ATOM   929   C  CD2   . LEU A  1  130  ? 256.334 281.175 252.801 1.00 0.00 ? 130  LEU A CD2   1 
ATOM   930   N  N     . ALA A  1  131  ? 260.008 284.646 250.723 1.00 0.00 ? 131  ALA A N     1 
ATOM   931   C  CA    . ALA A  1  131  ? 260.464 285.966 250.295 1.00 0.00 ? 131  ALA A CA    1 
ATOM   932   C  C     . ALA A  1  131  ? 260.038 286.306 248.864 1.00 0.00 ? 131  ALA A C     1 
ATOM   933   O  O     . ALA A  1  131  ? 259.652 287.442 248.582 1.00 0.00 ? 131  ALA A O     1 
ATOM   934   C  CB    . ALA A  1  131  ? 261.980 286.065 250.427 1.00 0.00 ? 131  ALA A CB    1 
ATOM   935   N  N     . LYS A  1  132  ? 260.379 285.374 247.968 1.00 0.00 ? 132  LYS A N     1 
ATOM   936   C  CA    . LYS A  1  132  ? 260.121 285.467 246.534 1.00 0.00 ? 132  LYS A CA    1 
ATOM   937   C  C     . LYS A  1  132  ? 258.632 285.399 246.399 1.00 0.00 ? 132  LYS A C     1 
ATOM   938   O  O     . LYS A  1  132  ? 258.069 284.568 245.687 1.00 0.00 ? 132  LYS A O     1 
ATOM   939   C  CB    . LYS A  1  132  ? 260.778 284.306 245.789 1.00 0.00 ? 132  LYS A CB    1 
ATOM   940   C  CG    . LYS A  1  132  ? 261.595 284.728 244.579 1.00 0.00 ? 132  LYS A CG    1 
ATOM   941   C  CD    . LYS A  1  132  ? 262.880 283.923 244.473 1.00 0.00 ? 132  LYS A CD    1 
ATOM   942   C  CE    . LYS A  1  132  ? 264.023 284.609 245.203 1.00 0.00 ? 132  LYS A CE    1 
ATOM   943   N  NZ    . LYS A  1  132  ? 265.322 284.423 244.501 1.00 0.00 ? 132  LYS A NZ    1 
ATOM   944   N  N     . SER A  1  133  ? 257.935 286.352 247.001 1.00 0.00 ? 133  SER A N     1 
ATOM   945   C  CA    . SER A  1  133  ? 256.507 286.394 246.714 1.00 0.00 ? 133  SER A CA    1 
ATOM   946   C  C     . SER A  1  133  ? 255.409 286.341 247.766 1.00 0.00 ? 133  SER A C     1 
ATOM   947   O  O     . SER A  1  133  ? 254.273 286.036 247.401 1.00 0.00 ? 133  SER A O     1 
ATOM   948   C  CB    . SER A  1  133  ? 256.190 285.351 245.630 1.00 0.00 ? 133  SER A CB    1 
ATOM   949   O  OG    . SER A  1  133  ? 255.081 285.753 244.844 1.00 0.00 ? 133  SER A OG    1 
ATOM   950   N  N     . LYS A  1  134  ? 255.653 286.618 249.040 1.00 0.00 ? 134  LYS A N     1 
ATOM   951   C  CA    . LYS A  1  134  ? 254.441 286.554 249.854 1.00 0.00 ? 134  LYS A CA    1 
ATOM   952   C  C     . LYS A  1  134  ? 253.156 286.927 249.091 1.00 0.00 ? 134  LYS A C     1 
ATOM   953   O  O     . LYS A  1  134  ? 252.113 286.299 249.280 1.00 0.00 ? 134  LYS A O     1 
ATOM   954   C  CB    . LYS A  1  134  ? 254.594 287.436 251.100 1.00 0.00 ? 134  LYS A CB    1 
ATOM   955   C  CG    . LYS A  1  134  ? 254.890 288.899 250.829 1.00 0.00 ? 134  LYS A CG    1 
ATOM   956   C  CD    . LYS A  1  134  ? 255.312 289.606 252.107 1.00 0.00 ? 134  LYS A CD    1 
ATOM   957   C  CE    . LYS A  1  134  ? 255.470 291.103 251.897 1.00 0.00 ? 134  LYS A CE    1 
ATOM   958   N  NZ    . LYS A  1  134  ? 256.557 291.424 250.933 1.00 0.00 ? 134  LYS A NZ    1 
ATOM   959   N  N     . GLY A  1  135  ? 253.226 287.940 248.230 1.00 0.00 ? 135  GLY A N     1 
ATOM   960   C  CA    . GLY A  1  135  ? 252.063 288.363 247.465 1.00 0.00 ? 135  GLY A CA    1 
ATOM   961   C  C     . GLY A  1  135  ? 251.624 287.471 246.311 1.00 0.00 ? 135  GLY A C     1 
ATOM   962   O  O     . GLY A  1  135  ? 250.677 287.801 245.595 1.00 0.00 ? 135  GLY A O     1 
ATOM   963   N  N     . GLN A  1  136  ? 252.294 286.335 246.135 1.00 0.00 ? 136  GLN A N     1 
ATOM   964   C  CA    . GLN A  1  136  ? 252.022 285.464 244.993 1.00 0.00 ? 136  GLN A CA    1 
ATOM   965   C  C     . GLN A  1  136  ? 251.877 284.001 245.406 1.00 0.00 ? 136  GLN A C     1 
ATOM   966   O  O     . GLN A  1  136  ? 252.814 283.213 245.262 1.00 0.00 ? 136  GLN A O     1 
ATOM   967   C  CB    . GLN A  1  136  ? 253.130 285.595 243.938 1.00 0.00 ? 136  GLN A CB    1 
ATOM   968   C  CG    . GLN A  1  136  ? 253.162 286.933 243.204 1.00 0.00 ? 136  GLN A CG    1 
ATOM   969   C  CD    . GLN A  1  136  ? 254.206 286.984 242.091 1.00 0.00 ? 136  GLN A CD    1 
ATOM   970   O  OE1   . GLN A  1  136  ? 255.158 286.200 242.075 1.00 0.00 ? 136  GLN A OE1   1 
ATOM   971   N  NE2   . GLN A  1  136  ? 254.025 287.911 241.157 1.00 0.00 ? 136  GLN A NE2   1 
ATOM   972   N  N     . PRO A  1  137  ? 250.697 283.635 245.929 1.00 0.00 ? 137  PRO A N     1 
ATOM   973   C  CA    . PRO A  1  137  ? 250.448 282.264 246.376 1.00 0.00 ? 137  PRO A CA    1 
ATOM   974   C  C     . PRO A  1  137  ? 250.629 281.237 245.255 1.00 0.00 ? 137  PRO A C     1 
ATOM   975   O  O     . PRO A  1  137  ? 251.080 280.120 245.513 1.00 0.00 ? 137  PRO A O     1 
ATOM   976   C  CB    . PRO A  1  137  ? 248.987 282.305 246.847 1.00 0.00 ? 137  PRO A CB    1 
ATOM   977   C  CG    . PRO A  1  137  ? 248.380 283.436 246.097 1.00 0.00 ? 137  PRO A CG    1 
ATOM   978   C  CD    . PRO A  1  137  ? 249.477 284.457 245.974 1.00 0.00 ? 137  PRO A CD    1 
ATOM   979   N  N     . LYS A  1  138  ? 250.313 281.629 244.024 1.00 0.00 ? 138  LYS A N     1 
ATOM   980   C  CA    . LYS A  1  138  ? 250.512 280.761 242.865 1.00 0.00 ? 138  LYS A CA    1 
ATOM   981   C  C     . LYS A  1  138  ? 251.958 280.392 242.517 1.00 0.00 ? 138  LYS A C     1 
ATOM   982   O  O     . LYS A  1  138  ? 252.267 279.213 242.336 1.00 0.00 ? 138  LYS A O     1 
ATOM   983   C  CB    . LYS A  1  138  ? 249.868 281.406 241.633 1.00 0.00 ? 138  LYS A CB    1 
ATOM   984   C  CG    . LYS A  1  138  ? 249.870 280.520 240.393 1.00 0.00 ? 138  LYS A CG    1 
ATOM   985   C  CD    . LYS A  1  138  ? 249.217 281.215 239.205 1.00 0.00 ? 138  LYS A CD    1 
ATOM   986   C  CE    . LYS A  1  138  ? 249.176 280.309 237.977 1.00 0.00 ? 138  LYS A CE    1 
ATOM   987   N  NZ    . LYS A  1  138  ? 248.271 279.143 238.092 1.00 0.00 ? 138  LYS A NZ    1 
ATOM   988   N  N     . LYS A  1  139  ? 252.843 281.380 242.445 1.00 0.00 ? 139  LYS A N     1 
ATOM   989   C  CA    . LYS A  1  139  ? 254.262 281.106 242.212 1.00 0.00 ? 139  LYS A CA    1 
ATOM   990   C  C     . LYS A  1  139  ? 254.885 280.266 243.335 1.00 0.00 ? 139  LYS A C     1 
ATOM   991   O  O     . LYS A  1  139  ? 255.671 279.356 243.066 1.00 0.00 ? 139  LYS A O     1 
ATOM   992   C  CB    . LYS A  1  139  ? 255.024 282.418 241.997 1.00 0.00 ? 139  LYS A CB    1 
ATOM   993   C  CG    . LYS A  1  139  ? 256.504 282.257 241.674 1.00 0.00 ? 139  LYS A CG    1 
ATOM   994   C  CD    . LYS A  1  139  ? 257.180 283.615 241.594 1.00 0.00 ? 139  LYS A CD    1 
ATOM   995   C  CE    . LYS A  1  139  ? 258.680 283.486 241.426 1.00 0.00 ? 139  LYS A CE    1 
ATOM   996   N  NZ    . LYS A  1  139  ? 259.370 284.786 241.648 1.00 0.00 ? 139  LYS A NZ    1 
ATOM   997   N  N     . ARG A  1  140  ? 254.537 280.575 244.584 1.00 0.00 ? 140  ARG A N     1 
ATOM   998   C  CA    . ARG A  1  140  ? 255.018 279.817 245.746 1.00 0.00 ? 140  ARG A CA    1 
ATOM   999   C  C     . ARG A  1  140  ? 254.611 278.353 245.643 1.00 0.00 ? 140  ARG A C     1 
ATOM   1000  O  O     . ARG A  1  140  ? 255.427 277.454 245.848 1.00 0.00 ? 140  ARG A O     1 
ATOM   1001  C  CB    . ARG A  1  140  ? 254.526 280.386 247.079 1.00 0.00 ? 140  ARG A CB    1 
ATOM   1002  C  CG    . ARG A  1  140  ? 255.208 281.668 247.518 1.00 0.00 ? 140  ARG A CG    1 
ATOM   1003  C  CD    . ARG A  1  140  ? 254.795 282.027 248.937 1.00 0.00 ? 140  ARG A CD    1 
ATOM   1004  N  NE    . ARG A  1  140  ? 253.528 282.746 248.965 1.00 0.00 ? 140  ARG A NE    1 
ATOM   1005  C  CZ    . ARG A  1  140  ? 252.432 282.291 249.564 1.00 0.00 ? 140  ARG A CZ    1 
ATOM   1006  N  NH1   . ARG A  1  140  ? 252.458 281.113 250.175 1.00 0.00 ? 140  ARG A NH1   1 
ATOM   1007  N  NH2   . ARG A  1  140  ? 251.346 283.048 249.638 1.00 0.00 ? 140  ARG A NH2   1 
ATOM   1008  N  N     . LEU A  1  141  ? 253.343 278.130 245.315 1.00 0.00 ? 141  LEU A N     1 
ATOM   1009  C  CA    . LEU A  1  141  ? 252.818 276.784 245.141 1.00 0.00 ? 141  LEU A CA    1 
ATOM   1010  C  C     . LEU A  1  141  ? 253.589 276.069 244.051 1.00 0.00 ? 141  LEU A C     1 
ATOM   1011  O  O     . LEU A  1  141  ? 253.960 274.907 244.214 1.00 0.00 ? 141  LEU A O     1 
ATOM   1012  C  CB    . LEU A  1  141  ? 251.333 276.834 244.777 1.00 0.00 ? 141  LEU A CB    1 
ATOM   1013  C  CG    . LEU A  1  141  ? 250.618 275.503 244.538 1.00 0.00 ? 141  LEU A CG    1 
ATOM   1014  C  CD1   . LEU A  1  141  ? 250.688 274.621 245.770 1.00 0.00 ? 141  LEU A CD1   1 
ATOM   1015  C  CD2   . LEU A  1  141  ? 249.177 275.743 244.115 1.00 0.00 ? 141  LEU A CD2   1 
ATOM   1016  N  N     . THR A  1  142  ? 253.837 276.754 242.944 1.00 0.00 ? 142  THR A N     1 
ATOM   1017  C  CA    . THR A  1  142  ? 254.636 276.168 241.880 1.00 0.00 ? 142  THR A CA    1 
ATOM   1018  C  C     . THR A  1  142  ? 256.039 275.827 242.387 1.00 0.00 ? 142  THR A C     1 
ATOM   1019  O  O     . THR A  1  142  ? 256.565 274.750 242.101 1.00 0.00 ? 142  THR A O     1 
ATOM   1020  C  CB    . THR A  1  142  ? 254.747 277.116 240.679 1.00 0.00 ? 142  THR A CB    1 
ATOM   1021  O  OG1   . THR A  1  142  ? 253.445 277.608 240.340 1.00 0.00 ? 142  THR A OG1   1 
ATOM   1022  C  CG2   . THR A  1  142  ? 255.340 276.387 239.484 1.00 0.00 ? 142  THR A CG2   1 
ATOM   1023  N  N     . HIS A  1  143  ? 256.629 276.742 243.152 1.00 0.00 ? 143  HIS A N     1 
ATOM   1024  C  CA    . HIS A  1  143  ? 257.967 276.535 243.707 1.00 0.00 ? 143  HIS A CA    1 
ATOM   1025  C  C     . HIS A  1  143  ? 258.019 275.459 244.792 1.00 0.00 ? 143  HIS A C     1 
ATOM   1026  O  O     . HIS A  1  143  ? 258.969 274.677 244.850 1.00 0.00 ? 143  HIS A O     1 
ATOM   1027  C  CB    . HIS A  1  143  ? 258.509 277.849 244.285 1.00 0.00 ? 143  HIS A CB    1 
ATOM   1028  C  CG    . HIS A  1  143  ? 258.982 278.823 243.249 1.00 0.00 ? 143  HIS A CG    1 
ATOM   1029  N  ND1   . HIS A  1  143  ? 258.889 278.583 241.895 1.00 0.00 ? 143  HIS A ND1   1 
ATOM   1030  C  CD2   . HIS A  1  143  ? 259.551 280.047 243.374 1.00 0.00 ? 143  HIS A CD2   1 
ATOM   1031  C  CE1   . HIS A  1  143  ? 259.382 279.613 241.231 1.00 0.00 ? 143  HIS A CE1   1 
ATOM   1032  N  NE2   . HIS A  1  143  ? 259.792 280.514 242.106 1.00 0.00 ? 143  HIS A NE2   1 
ATOM   1033  N  N     . VAL A  1  144  ? 257.012 275.430 245.661 1.00 0.00 ? 144  VAL A N     1 
ATOM   1034  C  CA    . VAL A  1  144  ? 256.863 274.340 246.621 1.00 0.00 ? 144  VAL A CA    1 
ATOM   1035  C  C     . VAL A  1  144  ? 256.668 272.987 245.944 1.00 0.00 ? 144  VAL A C     1 
ATOM   1036  O  O     . VAL A  1  144  ? 257.231 271.984 246.375 1.00 0.00 ? 144  VAL A O     1 
ATOM   1037  C  CB    . VAL A  1  144  ? 255.683 274.600 247.589 1.00 0.00 ? 144  VAL A CB    1 
ATOM   1038  C  CG1   . VAL A  1  144  ? 255.362 273.355 248.406 1.00 0.00 ? 144  VAL A CG1   1 
ATOM   1039  C  CG2   . VAL A  1  144  ? 256.003 275.770 248.508 1.00 0.00 ? 144  VAL A CG2   1 
ATOM   1040  N  N     . TYR A  1  145  ? 255.894 272.970 244.865 1.00 0.00 ? 145  TYR A N     1 
ATOM   1041  C  CA    . TYR A  1  145  ? 255.651 271.736 244.129 1.00 0.00 ? 145  TYR A CA    1 
ATOM   1042  C  C     . TYR A  1  145  ? 256.903 271.157 243.485 1.00 0.00 ? 145  TYR A C     1 
ATOM   1043  O  O     . TYR A  1  145  ? 257.140 269.950 243.544 1.00 0.00 ? 145  TYR A O     1 
ATOM   1044  C  CB    . TYR A  1  145  ? 254.602 271.966 243.046 1.00 0.00 ? 145  TYR A CB    1 
ATOM   1045  C  CG    . TYR A  1  145  ? 254.235 270.705 242.304 1.00 0.00 ? 145  TYR A CG    1 
ATOM   1046  C  CD1   . TYR A  1  145  ? 253.528 269.691 242.931 1.00 0.00 ? 145  TYR A CD1   1 
ATOM   1047  C  CD2   . TYR A  1  145  ? 254.628 270.513 240.990 1.00 0.00 ? 145  TYR A CD2   1 
ATOM   1048  C  CE1   . TYR A  1  145  ? 253.189 268.538 242.255 1.00 0.00 ? 145  TYR A CE1   1 
ATOM   1049  C  CE2   . TYR A  1  145  ? 254.304 269.359 240.311 1.00 0.00 ? 145  TYR A CE2   1 
ATOM   1050  C  CZ    . TYR A  1  145  ? 253.582 268.376 240.948 1.00 0.00 ? 145  TYR A CZ    1 
ATOM   1051  O  OH    . TYR A  1  145  ? 253.266 267.222 240.274 1.00 0.00 ? 145  TYR A OH    1 
ATOM   1052  N  N     . ASP A  1  146  ? 257.679 272.022 242.843 1.00 0.00 ? 146  ASP A N     1 
ATOM   1053  C  CA    . ASP A  1  146  ? 258.929 271.633 242.192 1.00 0.00 ? 146  ASP A CA    1 
ATOM   1054  C  C     . ASP A  1  146  ? 259.979 271.048 243.154 1.00 0.00 ? 146  ASP A C     1 
ATOM   1055  O  O     . ASP A  1  146  ? 260.711 270.121 242.800 1.00 0.00 ? 146  ASP A O     1 
ATOM   1056  C  CB    . ASP A  1  146  ? 259.500 272.845 241.440 1.00 0.00 ? 146  ASP A CB    1 
ATOM   1057  C  CG    . ASP A  1  146  ? 261.011 272.797 241.294 1.00 0.00 ? 146  ASP A CG    1 
ATOM   1058  O  OD1   . ASP A  1  146  ? 261.728 273.185 242.244 1.00 0.00 ? 146  ASP A OD1   1 
ATOM   1059  O  OD2   . ASP A  1  146  ? 261.479 272.399 240.206 1.00 0.00 ? 146  ASP A OD2   1 
ATOM   1060  N  N     . LEU A  1  147  ? 260.039 271.587 244.368 1.00 0.00 ? 147  LEU A N     1 
ATOM   1061  C  CA    . LEU A  1  147  ? 260.825 271.004 245.457 1.00 0.00 ? 147  LEU A CA    1 
ATOM   1062  C  C     . LEU A  1  147  ? 260.274 269.653 245.932 1.00 0.00 ? 147  LEU A C     1 
ATOM   1063  O  O     . LEU A  1  147  ? 261.032 268.712 246.157 1.00 0.00 ? 147  LEU A O     1 
ATOM   1064  C  CB    . LEU A  1  147  ? 260.910 271.984 246.626 1.00 0.00 ? 147  LEU A CB    1 
ATOM   1065  C  CG    . LEU A  1  147  ? 261.655 271.480 247.861 1.00 0.00 ? 147  LEU A CG    1 
ATOM   1066  C  CD1   . LEU A  1  147  ? 263.102 271.187 247.507 1.00 0.00 ? 147  LEU A CD1   1 
ATOM   1067  C  CD2   . LEU A  1  147  ? 261.582 272.513 248.962 1.00 0.00 ? 147  LEU A CD2   1 
ATOM   1068  N  N     . CYS A  1  148  ? 258.955 269.573 246.083 1.00 0.00 ? 148  CYS A N     1 
ATOM   1069  C  CA    . CYS A  1  148  ? 258.290 268.398 246.641 1.00 0.00 ? 148  CYS A CA    1 
ATOM   1070  C  C     . CYS A  1  148  ? 258.331 267.246 245.647 1.00 0.00 ? 148  CYS A C     1 
ATOM   1071  O  O     . CYS A  1  148  ? 258.341 266.075 246.023 1.00 0.00 ? 148  CYS A O     1 
ATOM   1072  C  CB    . CYS A  1  148  ? 256.827 268.711 246.977 1.00 0.00 ? 148  CYS A CB    1 
ATOM   1073  S  SG    . CYS A  1  148  ? 256.542 269.699 248.457 1.00 0.00 ? 148  CYS A SG    1 
ATOM   1074  N  N     . LYS A  1  149  ? 258.371 267.609 244.372 1.00 0.00 ? 149  LYS A N     1 
ATOM   1075  C  CA    . LYS A  1  149  ? 258.564 266.667 243.283 1.00 0.00 ? 149  LYS A CA    1 
ATOM   1076  C  C     . LYS A  1  149  ? 259.926 265.986 243.369 1.00 0.00 ? 149  LYS A C     1 
ATOM   1077  O  O     . LYS A  1  149  ? 260.052 264.803 243.059 1.00 0.00 ? 149  LYS A O     1 
ATOM   1078  C  CB    . LYS A  1  149  ? 258.431 267.406 241.952 1.00 0.00 ? 149  LYS A CB    1 
ATOM   1079  C  CG    . LYS A  1  149  ? 258.285 266.544 240.722 1.00 0.00 ? 149  LYS A CG    1 
ATOM   1080  C  CD    . LYS A  1  149  ? 257.899 267.407 239.533 1.00 0.00 ? 149  LYS A CD    1 
ATOM   1081  C  CE    . LYS A  1  149  ? 259.101 268.219 239.056 1.00 0.00 ? 149  LYS A CE    1 
ATOM   1082  N  NZ    . LYS A  1  149  ? 259.799 267.615 237.886 1.00 0.00 ? 149  LYS A NZ    1 
ATOM   1083  N  N     . GLY A  1  150  ? 260.940 266.733 243.791 1.00 0.00 ? 150  GLY A N     1 
ATOM   1084  C  CA    . GLY A  1  150  ? 262.218 266.156 244.160 1.00 0.00 ? 150  GLY A CA    1 
ATOM   1085  C  C     . GLY A  1  150  ? 262.184 265.230 245.368 1.00 0.00 ? 150  GLY A C     1 
ATOM   1086  O  O     . GLY A  1  150  ? 262.957 264.273 245.450 1.00 0.00 ? 150  GLY A O     1 
ATOM   1087  N  N     . LYS A  1  151  ? 261.279 265.508 246.299 1.00 0.00 ? 151  LYS A N     1 
ATOM   1088  C  CA    . LYS A  1  151  ? 261.244 264.801 247.574 1.00 0.00 ? 151  LYS A CA    1 
ATOM   1089  C  C     . LYS A  1  151  ? 260.354 263.566 247.500 1.00 0.00 ? 151  LYS A C     1 
ATOM   1090  O  O     . LYS A  1  151  ? 259.141 263.647 247.683 1.00 0.00 ? 151  LYS A O     1 
ATOM   1091  C  CB    . LYS A  1  151  ? 260.763 265.741 248.680 1.00 0.00 ? 151  LYS A CB    1 
ATOM   1092  C  CG    . LYS A  1  151  ? 261.747 266.857 248.999 1.00 0.00 ? 151  LYS A CG    1 
ATOM   1093  C  CD    . LYS A  1  151  ? 261.521 267.430 250.389 1.00 0.00 ? 151  LYS A CD    1 
ATOM   1094  C  CE    . LYS A  1  151  ? 262.607 268.433 250.764 1.00 0.00 ? 151  LYS A CE    1 
ATOM   1095  N  NZ    . LYS A  1  151  ? 263.963 267.822 250.814 1.00 0.00 ? 151  LYS A NZ    1 
ATOM   1096  N  N     . ASN A  1  152  ? 260.972 262.421 247.233 1.00 0.00 ? 152  ASN A N     1 
ATOM   1097  C  CA    . ASN A  1  152  ? 260.232 261.182 247.041 1.00 0.00 ? 152  ASN A CA    1 
ATOM   1098  C  C     . ASN A  1  152  ? 259.914 260.444 248.340 1.00 0.00 ? 152  ASN A C     1 
ATOM   1099  O  O     . ASN A  1  152  ? 258.968 259.660 248.397 1.00 0.00 ? 152  ASN A O     1 
ATOM   1100  C  CB    . ASN A  1  152  ? 261.009 260.262 246.097 1.00 0.00 ? 152  ASN A CB    1 
ATOM   1101  C  CG    . ASN A  1  152  ? 260.274 258.974 245.805 1.00 0.00 ? 152  ASN A CG    1 
ATOM   1102  O  OD1   . ASN A  1  152  ? 260.850 257.887 245.869 1.00 0.00 ? 152  ASN A OD1   1 
ATOM   1103  N  ND2   . ASN A  1  152  ? 258.989 259.087 245.492 1.00 0.00 ? 152  ASN A ND2   1 
ATOM   1104  N  N     . ILE A  1  153  ? 260.697 260.691 249.384 1.00 0.00 ? 153  ILE A N     1 
ATOM   1105  C  CA    . ILE A  1  153  ? 260.486 259.996 250.649 1.00 0.00 ? 153  ILE A CA    1 
ATOM   1106  C  C     . ILE A  1  153  ? 260.147 260.962 251.786 1.00 0.00 ? 153  ILE A C     1 
ATOM   1107  O  O     . ILE A  1  153  ? 260.782 262.007 251.930 1.00 0.00 ? 153  ILE A O     1 
ATOM   1108  C  CB    . ILE A  1  153  ? 261.735 259.173 251.036 1.00 0.00 ? 153  ILE A CB    1 
ATOM   1109  C  CG1   . ILE A  1  153  ? 261.996 258.078 250.000 1.00 0.00 ? 153  ILE A CG1   1 
ATOM   1110  C  CG2   . ILE A  1  153  ? 261.599 258.592 252.436 1.00 0.00 ? 153  ILE A CG2   1 
ATOM   1111  C  CD1   . ILE A  1  153  ? 261.020 256.929 250.070 1.00 0.00 ? 153  ILE A CD1   1 
ATOM   1112  N  N     . CYS A  1  154  ? 259.151 260.604 252.595 1.00 0.00 ? 154  CYS A N     1 
ATOM   1113  C  CA    . CYS A  1  154  ? 258.889 261.307 253.850 1.00 0.00 ? 154  CYS A CA    1 
ATOM   1114  C  C     . CYS A  1  154  ? 259.875 260.864 254.915 1.00 0.00 ? 154  CYS A C     1 
ATOM   1115  O  O     . CYS A  1  154  ? 259.967 259.681 255.233 1.00 0.00 ? 154  CYS A O     1 
ATOM   1116  C  CB    . CYS A  1  154  ? 257.460 261.065 254.344 1.00 0.00 ? 154  CYS A CB    1 
ATOM   1117  S  SG    . CYS A  1  154  ? 257.077 261.845 255.956 1.00 0.00 ? 154  CYS A SG    1 
ATOM   1118  N  N     . GLU A  1  155  ? 260.605 261.820 255.473 1.00 0.00 ? 155  GLU A N     1 
ATOM   1119  C  CA    . GLU A  1  155  ? 261.512 261.520 256.568 1.00 0.00 ? 155  GLU A CA    1 
ATOM   1120  C  C     . GLU A  1  155  ? 261.279 262.448 257.747 1.00 0.00 ? 155  GLU A C     1 
ATOM   1121  O  O     . GLU A  1  155  ? 260.281 262.331 258.457 1.00 0.00 ? 155  GLU A O     1 
ATOM   1122  C  CB    . GLU A  1  155  ? 262.960 261.618 256.093 1.00 0.00 ? 155  GLU A CB    1 
ATOM   1123  C  CG    . GLU A  1  155  ? 263.296 260.656 254.970 1.00 0.00 ? 155  GLU A CG    1 
ATOM   1124  C  CD    . GLU A  1  155  ? 264.688 260.874 254.417 1.00 0.00 ? 155  GLU A CD    1 
ATOM   1125  O  OE1   . GLU A  1  155  ? 265.302 261.910 254.749 1.00 0.00 ? 155  GLU A OE1   1 
ATOM   1126  O  OE2   . GLU A  1  155  ? 265.168 260.011 253.653 1.00 0.00 ? 155  GLU A OE2   1 
ATOM   1127  N  N     . GLY A  1  156  ? 262.201 263.381 257.946 1.00 0.00 ? 156  GLY A N     1 
ATOM   1128  C  CA    . GLY A  1  156  ? 262.169 264.209 259.130 1.00 0.00 ? 156  GLY A CA    1 
ATOM   1129  C  C     . GLY A  1  156  ? 263.524 264.561 259.705 1.00 0.00 ? 156  GLY A C     1 
ATOM   1130  O  O     . GLY A  1  156  ? 263.911 264.055 260.758 1.00 0.00 ? 156  GLY A O     1 
ATOM   1131  N  N     . GLY A  1  157  ? 264.264 265.399 258.986 1.00 0.00 ? 157  GLY A N     1 
ATOM   1132  C  CA    . GLY A  1  157  ? 265.357 266.138 259.588 1.00 0.00 ? 157  GLY A CA    1 
ATOM   1133  C  C     . GLY A  1  157  ? 265.761 267.349 258.765 1.00 0.00 ? 157  GLY A C     1 
ATOM   1134  O  O     . GLY A  1  157  ? 266.016 267.253 257.564 1.00 0.00 ? 157  GLY A O     1 
ATOM   1135  N  N     . GLY A  1  180  ? 263.760 266.495 263.943 1.00 0.00 ? 180  GLY A N     1 
ATOM   1136  C  CA    . GLY A  1  180  ? 262.896 265.568 263.238 1.00 0.00 ? 180  GLY A CA    1 
ATOM   1137  C  C     . GLY A  1  180  ? 261.463 266.022 263.085 1.00 0.00 ? 180  GLY A C     1 
ATOM   1138  O  O     . GLY A  1  180  ? 260.814 266.435 264.045 1.00 0.00 ? 180  GLY A O     1 
ATOM   1139  N  N     . HIS A  1  181  ? 260.955 265.915 261.861 1.00 0.00 ? 181  HIS A N     1 
ATOM   1140  C  CA    . HIS A  1  181  ? 259.583 266.302 261.560 1.00 0.00 ? 181  HIS A CA    1 
ATOM   1141  C  C     . HIS A  1  181  ? 258.617 265.777 262.617 1.00 0.00 ? 181  HIS A C     1 
ATOM   1142  O  O     . HIS A  1  181  ? 257.985 266.557 263.330 1.00 0.00 ? 181  HIS A O     1 
ATOM   1143  C  CB    . HIS A  1  181  ? 259.175 265.794 260.175 1.00 0.00 ? 181  HIS A CB    1 
ATOM   1144  C  CG    . HIS A  1  181  ? 260.057 266.283 259.069 1.00 0.00 ? 181  HIS A CG    1 
ATOM   1145  N  ND1   . HIS A  1  181  ? 259.955 265.818 257.775 1.00 0.00 ? 181  HIS A ND1   1 
ATOM   1146  C  CD2   . HIS A  1  181  ? 261.057 267.196 259.062 1.00 0.00 ? 181  HIS A CD2   1 
ATOM   1147  C  CE1   . HIS A  1  181  ? 260.854 266.423 257.020 1.00 0.00 ? 181  HIS A CE1   1 
ATOM   1148  N  NE2   . HIS A  1  181  ? 261.536 267.264 257.776 1.00 0.00 ? 181  HIS A NE2   1 
ATOM   1149  N  N     . GLY A  1  182  ? 258.504 264.456 262.718 1.00 0.00 ? 182  GLY A N     1 
ATOM   1150  C  CA    . GLY A  1  182  ? 257.613 263.855 263.693 1.00 0.00 ? 182  GLY A CA    1 
ATOM   1151  C  C     . GLY A  1  182  ? 257.525 262.339 263.663 1.00 0.00 ? 182  GLY A C     1 
ATOM   1152  O  O     . GLY A  1  182  ? 257.305 261.711 264.699 1.00 0.00 ? 182  GLY A O     1 
ATOM   1153  N  N     . GLY A  1  183  ? 257.695 261.745 262.486 1.00 0.00 ? 183  GLY A N     1 
ATOM   1154  C  CA    . GLY A  1  183  ? 257.612 260.304 262.360 1.00 0.00 ? 183  GLY A CA    1 
ATOM   1155  C  C     . GLY A  1  183  ? 257.245 259.994 260.923 1.00 0.00 ? 183  GLY A C     1 
ATOM   1156  O  O     . GLY A  1  183  ? 257.419 260.845 260.048 1.00 0.00 ? 183  GLY A O     1 
ATOM   1157  N  N     . CYS A  1  184  ? 256.734 258.789 260.684 1.00 0.00 ? 184  CYS A N     1 
ATOM   1158  C  CA    . CYS A  1  184  ? 256.355 258.341 259.342 1.00 0.00 ? 184  CYS A CA    1 
ATOM   1159  C  C     . CYS A  1  184  ? 257.519 258.364 258.355 1.00 0.00 ? 184  CYS A C     1 
ATOM   1160  O  O     . CYS A  1  184  ? 257.825 259.396 257.760 1.00 0.00 ? 184  CYS A O     1 
ATOM   1161  C  CB    . CYS A  1  184  ? 255.207 259.203 258.807 1.00 0.00 ? 184  CYS A CB    1 
ATOM   1162  S  SG    . CYS A  1  184  ? 254.530 258.675 257.224 1.00 0.00 ? 184  CYS A SG    1 
ATOM   1163  N  N     . GLY A  1  185  ? 258.155 257.211 258.173 1.00 0.00 ? 185  GLY A N     1 
ATOM   1164  C  CA    . GLY A  1  185  ? 259.200 257.061 257.175 1.00 0.00 ? 185  GLY A CA    1 
ATOM   1165  C  C     . GLY A  1  185  ? 258.680 256.459 255.883 1.00 0.00 ? 185  GLY A C     1 
ATOM   1166  O  O     . GLY A  1  185  ? 259.457 256.097 255.001 1.00 0.00 ? 185  GLY A O     1 
ATOM   1167  N  N     . ARG A  1  186  ? 257.360 256.347 255.786 1.00 0.00 ? 186  ARG A N     1 
ATOM   1168  C  CA    . ARG A  1  186  ? 256.703 255.714 254.646 1.00 0.00 ? 186  ARG A CA    1 
ATOM   1169  C  C     . ARG A  1  186  ? 257.106 256.338 253.315 1.00 0.00 ? 186  ARG A C     1 
ATOM   1170  O  O     . ARG A  1  186  ? 257.336 257.544 253.228 1.00 0.00 ? 186  ARG A O     1 
ATOM   1171  C  CB    . ARG A  1  186  ? 255.185 255.790 254.805 1.00 0.00 ? 186  ARG A CB    1 
ATOM   1172  C  CG    . ARG A  1  186  ? 254.678 255.230 256.116 1.00 0.00 ? 186  ARG A CG    1 
ATOM   1173  C  CD    . ARG A  1  186  ? 254.816 253.727 256.163 1.00 0.00 ? 186  ARG A CD    1 
ATOM   1174  N  NE    . ARG A  1  186  ? 254.476 253.207 257.480 1.00 0.00 ? 186  ARG A NE    1 
ATOM   1175  C  CZ    . ARG A  1  186  ? 254.361 251.914 257.763 1.00 0.00 ? 186  ARG A CZ    1 
ATOM   1176  N  NH1   . ARG A  1  186  ? 254.561 251.008 256.817 1.00 0.00 ? 186  ARG A NH1   1 
ATOM   1177  N  NH2   . ARG A  1  186  ? 254.061 251.526 258.994 1.00 0.00 ? 186  ARG A NH2   1 
ATOM   1178  N  N     . TYR A  1  187  ? 257.202 255.510 252.280 1.00 0.00 ? 187  TYR A N     1 
ATOM   1179  C  CA    . TYR A  1  187  ? 257.407 256.001 250.922 1.00 0.00 ? 187  TYR A CA    1 
ATOM   1180  C  C     . TYR A  1  187  ? 256.180 256.773 250.429 1.00 0.00 ? 187  TYR A C     1 
ATOM   1181  O  O     . TYR A  1  187  ? 255.044 256.391 250.707 1.00 0.00 ? 187  TYR A O     1 
ATOM   1182  C  CB    . TYR A  1  187  ? 257.738 254.840 249.974 1.00 0.00 ? 187  TYR A CB    1 
ATOM   1183  C  CG    . TYR A  1  187  ? 257.569 255.173 248.505 1.00 0.00 ? 187  TYR A CG    1 
ATOM   1184  C  CD1   . TYR A  1  187  ? 258.608 255.740 247.777 1.00 0.00 ? 187  TYR A CD1   1 
ATOM   1185  C  CD2   . TYR A  1  187  ? 256.373 254.899 247.839 1.00 0.00 ? 187  TYR A CD2   1 
ATOM   1186  C  CE1   . TYR A  1  187  ? 258.459 256.040 246.432 1.00 0.00 ? 187  TYR A CE1   1 
ATOM   1187  C  CE2   . TYR A  1  187  ? 256.214 255.198 246.495 1.00 0.00 ? 187  TYR A CE2   1 
ATOM   1188  C  CZ    . TYR A  1  187  ? 257.259 255.767 245.798 1.00 0.00 ? 187  TYR A CZ    1 
ATOM   1189  O  OH    . TYR A  1  187  ? 257.101 256.066 244.463 1.00 0.00 ? 187  TYR A OH    1 
ATOM   1190  N  N     . GLN A  1  188  ? 256.416 257.866 249.704 1.00 0.00 ? 188  GLN A N     1 
ATOM   1191  C  CA    . GLN A  1  188  ? 255.328 258.664 249.143 1.00 0.00 ? 188  GLN A CA    1 
ATOM   1192  C  C     . GLN A  1  188  ? 254.876 258.109 247.792 1.00 0.00 ? 188  GLN A C     1 
ATOM   1193  O  O     . GLN A  1  188  ? 255.626 258.163 246.819 1.00 0.00 ? 188  GLN A O     1 
ATOM   1194  C  CB    . GLN A  1  188  ? 255.762 260.122 248.990 1.00 0.00 ? 188  GLN A CB    1 
ATOM   1195  C  CG    . GLN A  1  188  ? 255.934 260.853 250.308 1.00 0.00 ? 188  GLN A CG    1 
ATOM   1196  C  CD    . GLN A  1  188  ? 254.646 260.930 251.098 1.00 0.00 ? 188  GLN A CD    1 
ATOM   1197  O  OE1   . GLN A  1  188  ? 253.703 261.619 250.709 1.00 0.00 ? 188  GLN A OE1   1 
ATOM   1198  N  NE2   . GLN A  1  188  ? 254.593 260.211 252.212 1.00 0.00 ? 188  GLN A NE2   1 
ATOM   1199  N  N     . PRO A  1  189  ? 253.633 257.612 247.722 1.00 0.00 ? 189  PRO A N     1 
ATOM   1200  C  CA    . PRO A  1  189  ? 253.099 257.012 246.495 1.00 0.00 ? 189  PRO A CA    1 
ATOM   1201  C  C     . PRO A  1  189  ? 253.057 257.985 245.327 1.00 0.00 ? 189  PRO A C     1 
ATOM   1202  O  O     . PRO A  1  189  ? 252.971 259.192 245.538 1.00 0.00 ? 189  PRO A O     1 
ATOM   1203  C  CB    . PRO A  1  189  ? 251.684 256.588 246.898 1.00 0.00 ? 189  PRO A CB    1 
ATOM   1204  C  CG    . PRO A  1  189  ? 251.329 257.470 248.033 1.00 0.00 ? 189  PRO A CG    1 
ATOM   1205  C  CD    . PRO A  1  189  ? 252.606 257.744 248.768 1.00 0.00 ? 189  PRO A CD    1 
ATOM   1206  N  N     . ARG A  1  190  ? 253.120 257.460 244.109 1.00 0.00 ? 190  ARG A N     1 
ATOM   1207  C  CA    . ARG A  1  190  ? 252.992 258.289 242.918 1.00 0.00 ? 190  ARG A CA    1 
ATOM   1208  C  C     . ARG A  1  190  ? 251.542 258.350 242.448 1.00 0.00 ? 190  ARG A C     1 
ATOM   1209  O  O     . ARG A  1  190  ? 251.025 257.391 241.878 1.00 0.00 ? 190  ARG A O     1 
ATOM   1210  C  CB    . ARG A  1  190  ? 253.891 257.767 241.795 1.00 0.00 ? 190  ARG A CB    1 
ATOM   1211  C  CG    . ARG A  1  190  ? 253.894 258.654 240.560 1.00 0.00 ? 190  ARG A CG    1 
ATOM   1212  C  CD    . ARG A  1  190  ? 254.943 258.217 239.551 1.00 0.00 ? 190  ARG A CD    1 
ATOM   1213  N  NE    . ARG A  1  190  ? 255.080 259.185 238.467 1.00 0.00 ? 190  ARG A NE    1 
ATOM   1214  C  CZ    . ARG A  1  190  ? 255.936 259.066 237.459 1.00 0.00 ? 190  ARG A CZ    1 
ATOM   1215  N  NH1   . ARG A  1  190  ? 256.738 258.012 237.388 1.00 0.00 ? 190  ARG A NH1   1 
ATOM   1216  N  NH2   . ARG A  1  190  ? 255.982 259.992 236.512 1.00 0.00 ? 190  ARG A NH2   1 
ATOM   1217  N  N     . ILE A  1  191  ? 250.892 259.483 242.698 1.00 0.00 ? 191  ILE A N     1 
ATOM   1218  C  CA    . ILE A  1  191  ? 249.476 259.655 242.396 1.00 0.00 ? 191  ILE A CA    1 
ATOM   1219  C  C     . ILE A  1  191  ? 249.274 259.911 240.910 1.00 0.00 ? 191  ILE A C     1 
ATOM   1220  O  O     . ILE A  1  191  ? 249.998 260.704 240.313 1.00 0.00 ? 191  ILE A O     1 
ATOM   1221  C  CB    . ILE A  1  191  ? 248.874 260.836 243.181 1.00 0.00 ? 191  ILE A CB    1 
ATOM   1222  C  CG1   . ILE A  1  191  ? 249.011 260.618 244.686 1.00 0.00 ? 191  ILE A CG1   1 
ATOM   1223  C  CG2   . ILE A  1  191  ? 247.422 261.066 242.790 1.00 0.00 ? 191  ILE A CG2   1 
ATOM   1224  C  CD1   . ILE A  1  191  ? 248.583 261.814 245.500 1.00 0.00 ? 191  ILE A CD1   1 
ATOM   1225  N  N     . ARG A  1  192  ? 248.290 259.248 240.308 1.00 0.00 ? 192  ARG A N     1 
ATOM   1226  C  CA    . ARG A  1  192  ? 248.013 259.472 238.898 1.00 0.00 ? 192  ARG A CA    1 
ATOM   1227  C  C     . ARG A  1  192  ? 246.520 259.691 238.712 1.00 0.00 ? 192  ARG A C     1 
ATOM   1228  O  O     . ARG A  1  192  ? 245.718 259.235 239.525 1.00 0.00 ? 192  ARG A O     1 
ATOM   1229  C  CB    . ARG A  1  192  ? 248.471 258.268 238.072 1.00 0.00 ? 192  ARG A CB    1 
ATOM   1230  C  CG    . ARG A  1  192  ? 249.977 258.090 238.003 1.00 0.00 ? 192  ARG A CG    1 
ATOM   1231  C  CD    . ARG A  1  192  ? 250.366 256.980 237.039 1.00 0.00 ? 192  ARG A CD    1 
ATOM   1232  N  NE    . ARG A  1  192  ? 251.794 256.700 237.088 1.00 0.00 ? 192  ARG A NE    1 
ATOM   1233  C  CZ    . ARG A  1  192  ? 252.647 256.886 236.086 1.00 0.00 ? 192  ARG A CZ    1 
ATOM   1234  N  NH1   . ARG A  1  192  ? 252.223 257.441 234.961 1.00 0.00 ? 192  ARG A NH1   1 
ATOM   1235  N  NH2   . ARG A  1  192  ? 253.858 256.361 236.136 1.00 0.00 ? 192  ARG A NH2   1 
ATOM   1236  N  N     . ARG A  1  193  ? 246.142 260.389 237.647 1.00 0.00 ? 193  ARG A N     1 
ATOM   1237  C  CA    . ARG A  1  193  ? 244.728 260.658 237.408 1.00 0.00 ? 193  ARG A CA    1 
ATOM   1238  C  C     . ARG A  1  193  ? 244.191 259.792 236.270 1.00 0.00 ? 193  ARG A C     1 
ATOM   1239  O  O     . ARG A  1  193  ? 244.839 259.660 235.230 1.00 0.00 ? 193  ARG A O     1 
ATOM   1240  C  CB    . ARG A  1  193  ? 244.510 262.138 237.109 1.00 0.00 ? 193  ARG A CB    1 
ATOM   1241  C  CG    . ARG A  1  193  ? 243.086 262.481 236.755 1.00 0.00 ? 193  ARG A CG    1 
ATOM   1242  C  CD    . ARG A  1  193  ? 242.954 263.958 236.486 1.00 0.00 ? 193  ARG A CD    1 
ATOM   1243  N  NE    . ARG A  1  193  ? 241.630 264.295 235.979 1.00 0.00 ? 193  ARG A NE    1 
ATOM   1244  C  CZ    . ARG A  1  193  ? 241.313 265.479 235.466 1.00 0.00 ? 193  ARG A CZ    1 
ATOM   1245  N  NH1   . ARG A  1  193  ? 242.229 266.436 235.403 1.00 0.00 ? 193  ARG A NH1   1 
ATOM   1246  N  NH2   . ARG A  1  193  ? 240.095 265.692 234.984 1.00 0.00 ? 193  ARG A NH2   1 
ATOM   1247  N  N     . SER A  1  194  ? 242.992 259.243 236.445 1.00 0.00 ? 194  SER A N     1 
ATOM   1248  C  CA    . SER A  1  194  ? 242.305 258.533 235.369 1.00 0.00 ? 194  SER A CA    1 
ATOM   1249  C  C     . SER A  1  194  ? 240.848 258.973 235.266 1.00 0.00 ? 194  SER A C     1 
ATOM   1250  O  O     . SER A  1  194  ? 239.993 258.480 236.004 1.00 0.00 ? 194  SER A O     1 
ATOM   1251  C  CB    . SER A  1  194  ? 242.373 257.016 235.585 1.00 0.00 ? 194  SER A CB    1 
ATOM   1252  O  OG    . SER A  1  194  ? 243.710 256.544 235.635 1.00 0.00 ? 194  SER A OG    1 
ATOM   1253  N  N     . GLY A  1  195  ? 240.572 259.883 234.337 1.00 0.00 ? 195  GLY A N     1 
ATOM   1254  C  CA    . GLY A  1  195  ? 239.242 260.451 234.192 1.00 0.00 ? 195  GLY A CA    1 
ATOM   1255  C  C     . GLY A  1  195  ? 238.758 261.074 235.484 1.00 0.00 ? 195  GLY A C     1 
ATOM   1256  O  O     . GLY A  1  195  ? 239.026 262.243 235.760 1.00 0.00 ? 195  GLY A O     1 
ATOM   1257  N  N     . LEU A  1  196  ? 238.035 260.290 236.275 1.00 0.00 ? 196  LEU A N     1 
ATOM   1258  C  CA    . LEU A  1  196  ? 237.592 260.732 237.591 1.00 0.00 ? 196  LEU A CA    1 
ATOM   1259  C  C     . LEU A  1  196  ? 238.167 259.906 238.733 1.00 0.00 ? 196  LEU A C     1 
ATOM   1260  O  O     . LEU A  1  196  ? 237.923 260.216 239.898 1.00 0.00 ? 196  LEU A O     1 
ATOM   1261  C  CB    . LEU A  1  196  ? 236.072 260.731 237.683 1.00 0.00 ? 196  LEU A CB    1 
ATOM   1262  C  CG    . LEU A  1  196  ? 235.380 261.793 236.839 1.00 0.00 ? 196  LEU A CG    1 
ATOM   1263  C  CD1   . LEU A  1  196  ? 233.889 261.711 237.052 1.00 0.00 ? 196  LEU A CD1   1 
ATOM   1264  C  CD2   . LEU A  1  196  ? 235.902 263.161 237.214 1.00 0.00 ? 196  LEU A CD2   1 
ATOM   1265  N  N     . GLU A  1  197  ? 238.914 258.850 238.427 1.00 0.00 ? 197  GLU A N     1 
ATOM   1266  C  CA    . GLU A  1  197  ? 239.465 258.053 239.512 1.00 0.00 ? 197  GLU A CA    1 
ATOM   1267  C  C     . GLU A  1  197  ? 240.896 258.492 239.782 1.00 0.00 ? 197  GLU A C     1 
ATOM   1268  O  O     . GLU A  1  197  ? 241.559 259.033 238.901 1.00 0.00 ? 197  GLU A O     1 
ATOM   1269  C  CB    . GLU A  1  197  ? 239.455 256.565 239.142 1.00 0.00 ? 197  GLU A CB    1 
ATOM   1270  C  CG    . GLU A  1  197  ? 238.079 255.916 239.053 1.00 0.00 ? 197  GLU A CG    1 
ATOM   1271  C  CD    . GLU A  1  197  ? 238.094 254.624 238.240 1.00 0.00 ? 197  GLU A CD    1 
ATOM   1272  O  OE1   . GLU A  1  197  ? 238.517 254.667 237.063 1.00 0.00 ? 197  GLU A OE1   1 
ATOM   1273  O  OE2   . GLU A  1  197  ? 237.672 253.571 238.769 1.00 0.00 ? 197  GLU A OE2   1 
ATOM   1274  N  N     . LEU A  1  198  ? 241.380 258.263 240.996 1.00 0.00 ? 198  LEU A N     1 
ATOM   1275  C  CA    . LEU A  1  198  ? 242.766 258.570 241.307 1.00 0.00 ? 198  LEU A CA    1 
ATOM   1276  C  C     . LEU A  1  198  ? 243.477 257.273 241.623 1.00 0.00 ? 198  LEU A C     1 
ATOM   1277  O  O     . LEU A  1  198  ? 242.893 256.405 242.270 1.00 0.00 ? 198  LEU A O     1 
ATOM   1278  C  CB    . LEU A  1  198  ? 242.856 259.544 242.476 1.00 0.00 ? 198  LEU A CB    1 
ATOM   1279  C  CG    . LEU A  1  198  ? 242.163 260.882 242.234 1.00 0.00 ? 198  LEU A CG    1 
ATOM   1280  C  CD1   . LEU A  1  198  ? 242.466 261.842 243.363 1.00 0.00 ? 198  LEU A CD1   1 
ATOM   1281  C  CD2   . LEU A  1  198  ? 242.616 261.455 240.907 1.00 0.00 ? 198  LEU A CD2   1 
ATOM   1282  N  N     . TYR A  1  199  ? 244.718 257.107 241.181 1.00 0.00 ? 199  TYR A N     1 
ATOM   1283  C  CA    . TYR A  1  199  ? 245.405 255.886 241.556 1.00 0.00 ? 199  TYR A CA    1 
ATOM   1284  C  C     . TYR A  1  199  ? 246.685 256.195 242.319 1.00 0.00 ? 199  TYR A C     1 
ATOM   1285  O  O     . TYR A  1  199  ? 247.293 257.243 242.100 1.00 0.00 ? 199  TYR A O     1 
ATOM   1286  C  CB    . TYR A  1  199  ? 245.740 255.094 240.294 1.00 0.00 ? 199  TYR A CB    1 
ATOM   1287  C  CG    . TYR A  1  199  ? 244.539 254.436 239.663 1.00 0.00 ? 199  TYR A CG    1 
ATOM   1288  C  CD1   . TYR A  1  199  ? 243.566 253.823 240.439 1.00 0.00 ? 199  TYR A CD1   1 
ATOM   1289  C  CD2   . TYR A  1  199  ? 244.352 254.477 238.287 1.00 0.00 ? 199  TYR A CD2   1 
ATOM   1290  C  CE1   . TYR A  1  199  ? 242.462 253.228 239.857 1.00 0.00 ? 199  TYR A CE1   1 
ATOM   1291  C  CE2   . TYR A  1  199  ? 243.249 253.894 237.698 1.00 0.00 ? 199  TYR A CE2   1 
ATOM   1292  C  CZ    . TYR A  1  199  ? 242.308 253.270 238.488 1.00 0.00 ? 199  TYR A CZ    1 
ATOM   1293  O  OH    . TYR A  1  199  ? 241.203 252.696 237.908 1.00 0.00 ? 199  TYR A OH    1 
ATOM   1294  N  N     . ALA A  1  200  ? 247.102 255.312 243.220 1.00 0.00 ? 200  ALA A N     1 
ATOM   1295  C  CA    . ALA A  1  200  ? 248.360 255.542 243.920 1.00 0.00 ? 200  ALA A CA    1 
ATOM   1296  C  C     . ALA A  1  200  ? 249.176 254.256 243.854 1.00 0.00 ? 200  ALA A C     1 
ATOM   1297  O  O     . ALA A  1  200  ? 248.590 253.184 243.799 1.00 0.00 ? 200  ALA A O     1 
ATOM   1298  C  CB    . ALA A  1  200  ? 248.116 255.959 245.358 1.00 0.00 ? 200  ALA A CB    1 
ATOM   1299  N  N     . GLU A  1  201  ? 250.504 254.330 243.886 1.00 0.00 ? 201  GLU A N     1 
ATOM   1300  C  CA    . GLU A  1  201  ? 251.286 253.101 243.742 1.00 0.00 ? 201  GLU A CA    1 
ATOM   1301  C  C     . GLU A  1  201  ? 252.454 253.165 244.729 1.00 0.00 ? 201  GLU A C     1 
ATOM   1302  O  O     . GLU A  1  201  ? 252.934 254.253 245.034 1.00 0.00 ? 201  GLU A O     1 
ATOM   1303  C  CB    . GLU A  1  201  ? 251.751 252.867 242.304 1.00 0.00 ? 201  GLU A CB    1 
ATOM   1304  C  CG    . GLU A  1  201  ? 252.516 251.555 242.156 1.00 0.00 ? 201  GLU A CG    1 
ATOM   1305  C  CD    . GLU A  1  201  ? 253.233 251.414 240.838 1.00 0.00 ? 201  GLU A CD    1 
ATOM   1306  O  OE1   . GLU A  1  201  ? 252.984 252.234 239.929 1.00 0.00 ? 201  GLU A OE1   1 
ATOM   1307  O  OE2   . GLU A  1  201  ? 254.032 250.464 240.708 1.00 0.00 ? 201  GLU A OE2   1 
ATOM   1308  N  N     . TRP A  1  202  ? 252.928 252.024 245.215 1.00 0.00 ? 202  TRP A N     1 
ATOM   1309  C  CA    . TRP A  1  202  ? 254.039 252.039 246.160 1.00 0.00 ? 202  TRP A CA    1 
ATOM   1310  C  C     . TRP A  1  202  ? 255.242 251.201 245.705 1.00 0.00 ? 202  TRP A C     1 
ATOM   1311  O  O     . TRP A  1  202  ? 255.357 250.019 246.034 1.00 0.00 ? 202  TRP A O     1 
ATOM   1312  C  CB    . TRP A  1  202  ? 253.546 251.567 247.529 1.00 0.00 ? 202  TRP A CB    1 
ATOM   1313  C  CG    . TRP A  1  202  ? 252.759 252.620 248.261 1.00 0.00 ? 202  TRP A CG    1 
ATOM   1314  C  CD1   . TRP A  1  202  ? 253.252 253.610 249.061 1.00 0.00 ? 202  TRP A CD1   1 
ATOM   1315  C  CD2   . TRP A  1  202  ? 251.340 252.811 248.221 1.00 0.00 ? 202  TRP A CD2   1 
ATOM   1316  N  NE1   . TRP A  1  202  ? 252.226 254.391 249.538 1.00 0.00 ? 202  TRP A NE1   1 
ATOM   1317  C  CE2   . TRP A  1  202  ? 251.042 253.922 249.035 1.00 0.00 ? 202  TRP A CE2   1 
ATOM   1318  C  CE3   . TRP A  1  202  ? 250.291 252.145 247.580 1.00 0.00 ? 202  TRP A CE3   1 
ATOM   1319  C  CZ2   . TRP A  1  202  ? 249.741 254.379 249.227 1.00 0.00 ? 202  TRP A CZ2   1 
ATOM   1320  C  CZ3   . TRP A  1  202  ? 249.000 252.600 247.772 1.00 0.00 ? 202  TRP A CZ3   1 
ATOM   1321  C  CH2   . TRP A  1  202  ? 248.736 253.707 248.588 1.00 0.00 ? 202  TRP A CH2   1 
ATOM   1322  N  N     . LYS A  1  203  ? 256.120 251.886 244.975 1.00 0.00 ? 203  LYS A N     1 
ATOM   1323  C  CA    . LYS A  1  203  ? 257.353 251.357 244.399 1.00 0.00 ? 203  LYS A CA    1 
ATOM   1324  C  C     . LYS A  1  203  ? 257.871 250.046 244.991 1.00 0.00 ? 203  LYS A C     1 
ATOM   1325  O  O     . LYS A  1  203  ? 257.171 249.033 244.973 1.00 0.00 ? 203  LYS A O     1 
ATOM   1326  C  CB    . LYS A  1  203  ? 258.445 252.437 244.417 1.00 0.00 ? 203  LYS A CB    1 
ATOM   1327  C  CG    . LYS A  1  203  ? 259.380 252.394 243.219 1.00 0.00 ? 203  LYS A CG    1 
ATOM   1328  C  CD    . LYS A  1  203  ? 258.857 251.454 242.144 1.00 0.00 ? 203  LYS A CD    1 
ATOM   1329  C  CE    . LYS A  1  203  ? 257.763 252.112 241.320 1.00 0.00 ? 203  LYS A CE    1 
ATOM   1330  N  NZ    . LYS A  1  203  ? 256.556 251.247 241.208 1.00 0.00 ? 203  LYS A NZ    1 
ATOM   1331  N  N     . HIS A  1  204  ? 259.095 250.065 245.514 1.00 0.00 ? 204  HIS A N     1 
ATOM   1332  C  CA    . HIS A  1  204  ? 259.690 248.848 246.046 1.00 0.00 ? 204  HIS A CA    1 
ATOM   1333  C  C     . HIS A  1  204  ? 260.290 248.894 247.452 1.00 0.00 ? 204  HIS A C     1 
ATOM   1334  O  O     . HIS A  1  204  ? 260.259 247.878 248.147 1.00 0.00 ? 204  HIS A O     1 
ATOM   1335  C  CB    . HIS A  1  204  ? 260.739 248.310 245.065 1.00 0.00 ? 204  HIS A CB    1 
ATOM   1336  C  CG    . HIS A  1  204  ? 260.680 246.827 244.870 1.00 0.00 ? 204  HIS A CG    1 
ATOM   1337  N  ND1   . HIS A  1  204  ? 259.494 246.148 244.688 1.00 0.00 ? 204  HIS A ND1   1 
ATOM   1338  C  CD2   . HIS A  1  204  ? 261.659 245.893 244.828 1.00 0.00 ? 204  HIS A CD2   1 
ATOM   1339  C  CE1   . HIS A  1  204  ? 259.746 244.859 244.543 1.00 0.00 ? 204  HIS A CE1   1 
ATOM   1340  N  NE2   . HIS A  1  204  ? 261.052 244.678 244.623 1.00 0.00 ? 204  HIS A NE2   1 
ATOM   1341  N  N     . VAL A  1  205  ? 260.767 250.070 247.841 1.00 0.00 ? 205  VAL A N     1 
ATOM   1342  C  CA    . VAL A  1  205  ? 261.374 250.293 249.142 1.00 0.00 ? 205  VAL A CA    1 
ATOM   1343  C  C     . VAL A  1  205  ? 260.679 249.570 250.291 1.00 0.00 ? 205  VAL A C     1 
ATOM   1344  O  O     . VAL A  1  205  ? 259.569 249.922 250.692 1.00 0.00 ? 205  VAL A O     1 
ATOM   1345  C  CB    . VAL A  1  205  ? 261.442 251.796 249.476 1.00 0.00 ? 205  VAL A CB    1 
ATOM   1346  C  CG1   . VAL A  1  205  ? 262.363 252.514 248.501 1.00 0.00 ? 205  VAL A CG1   1 
ATOM   1347  C  CG2   . VAL A  1  205  ? 260.050 252.408 249.455 1.00 0.00 ? 205  VAL A CG2   1 
ATOM   1348  N  N     . ASN A  1  206  ? 261.357 248.543 250.791 1.00 0.00 ? 206  ASN A N     1 
ATOM   1349  C  CA    . ASN A  1  206  ? 260.922 247.747 251.938 1.00 0.00 ? 206  ASN A CA    1 
ATOM   1350  C  C     . ASN A  1  206  ? 259.605 246.955 251.948 1.00 0.00 ? 206  ASN A C     1 
ATOM   1351  O  O     . ASN A  1  206  ? 259.453 246.093 252.813 1.00 0.00 ? 206  ASN A O     1 
ATOM   1352  C  CB    . ASN A  1  206  ? 261.023 248.579 253.227 1.00 0.00 ? 206  ASN A CB    1 
ATOM   1353  C  CG    . ASN A  1  206  ? 262.114 248.084 254.156 1.00 0.00 ? 206  ASN A CG    1 
ATOM   1354  O  OD1   . ASN A  1  206  ? 262.373 246.884 254.244 1.00 0.00 ? 206  ASN A OD1   1 
ATOM   1355  N  ND2   . ASN A  1  206  ? 262.760 249.009 254.855 1.00 0.00 ? 206  ASN A ND2   1 
ATOM   1356  N  N     . GLU A  1  207  ? 258.650 247.191 251.048 1.00 0.00 ? 207  GLU A N     1 
ATOM   1357  C  CA    . GLU A  1  207  ? 257.446 246.367 251.202 1.00 0.00 ? 207  GLU A CA    1 
ATOM   1358  C  C     . GLU A  1  207  ? 256.425 246.920 252.207 1.00 0.00 ? 207  GLU A C     1 
ATOM   1359  O  O     . GLU A  1  207  ? 255.238 246.619 252.092 1.00 0.00 ? 207  GLU A O     1 
ATOM   1360  C  CB    . GLU A  1  207  ? 257.833 244.935 251.597 1.00 0.00 ? 207  GLU A CB    1 
ATOM   1361  C  CG    . GLU A  1  207  ? 258.527 244.152 250.491 1.00 0.00 ? 207  GLU A CG    1 
ATOM   1362  C  CD    . GLU A  1  207  ? 258.916 242.748 250.921 1.00 0.00 ? 207  GLU A CD    1 
ATOM   1363  O  OE1   . GLU A  1  207  ? 258.680 242.396 252.096 1.00 0.00 ? 207  GLU A OE1   1 
ATOM   1364  O  OE2   . GLU A  1  207  ? 259.459 241.999 250.083 1.00 0.00 ? 207  GLU A OE2   1 
ATOM   1365  N  N     . ASP A  1  208  ? 256.902 247.732 253.156 1.00 0.00 ? 208  ASP A N     1 
ATOM   1366  C  CA    . ASP A  1  208  ? 256.132 248.307 254.276 1.00 0.00 ? 208  ASP A CA    1 
ATOM   1367  C  C     . ASP A  1  208  ? 254.809 247.607 254.587 1.00 0.00 ? 208  ASP A C     1 
ATOM   1368  O  O     . ASP A  1  208  ? 254.665 246.949 255.620 1.00 0.00 ? 208  ASP A O     1 
ATOM   1369  C  CB    . ASP A  1  208  ? 255.881 249.808 254.033 1.00 0.00 ? 208  ASP A CB    1 
ATOM   1370  C  CG    . ASP A  1  208  ? 255.409 250.118 252.619 1.00 0.00 ? 208  ASP A CG    1 
ATOM   1371  O  OD1   . ASP A  1  208  ? 254.596 249.349 252.068 1.00 0.00 ? 208  ASP A OD1   1 
ATOM   1372  O  OD2   . ASP A  1  208  ? 255.848 251.147 252.063 1.00 0.00 ? 208  ASP A OD2   1 
ATOM   1373  N  N     . SER A  1  209  ? 253.853 247.753 253.676 1.00 0.00 ? 209  SER A N     1 
ATOM   1374  C  CA    . SER A  1  209  ? 252.573 247.076 253.767 1.00 0.00 ? 209  SER A CA    1 
ATOM   1375  C  C     . SER A  1  209  ? 251.858 247.219 252.438 1.00 0.00 ? 209  SER A C     1 
ATOM   1376  O  O     . SER A  1  209  ? 252.025 248.226 251.751 1.00 0.00 ? 209  SER A O     1 
ATOM   1377  C  CB    . SER A  1  209  ? 251.716 247.658 254.895 1.00 0.00 ? 209  SER A CB    1 
ATOM   1378  O  OG    . SER A  1  209  ? 251.321 248.987 254.596 1.00 0.00 ? 209  SER A OG    1 
ATOM   1379  N  N     . GLN A  1  210  ? 251.104 246.187 252.069 1.00 0.00 ? 210  GLN A N     1 
ATOM   1380  C  CA    . GLN A  1  210  ? 250.163 246.223 250.947 1.00 0.00 ? 210  GLN A CA    1 
ATOM   1381  C  C     . GLN A  1  210  ? 250.750 246.629 249.585 1.00 0.00 ? 210  GLN A C     1 
ATOM   1382  O  O     . GLN A  1  210  ? 251.961 246.797 249.434 1.00 0.00 ? 210  GLN A O     1 
ATOM   1383  C  CB    . GLN A  1  210  ? 248.981 247.135 251.310 1.00 0.00 ? 210  GLN A CB    1 
ATOM   1384  C  CG    . GLN A  1  210  ? 249.159 248.637 251.097 1.00 0.00 ? 210  GLN A CG    1 
ATOM   1385  C  CD    . GLN A  1  210  ? 247.952 249.441 251.540 1.00 0.00 ? 210  GLN A CD    1 
ATOM   1386  O  OE1   . GLN A  1  210  ? 247.409 249.221 252.623 1.00 0.00 ? 210  GLN A OE1   1 
ATOM   1387  N  NE2   . GLN A  1  210  ? 247.521 250.375 250.699 1.00 0.00 ? 210  GLN A NE2   1 
ATOM   1388  N  N     . GLU A  1  211  ? 249.867 246.587 248.589 1.00 0.00 ? 211  GLU A N     1 
ATOM   1389  C  CA    . GLU A  1  211  ? 250.185 246.788 247.173 1.00 0.00 ? 211  GLU A CA    1 
ATOM   1390  C  C     . GLU A  1  211  ? 250.734 248.114 246.668 1.00 0.00 ? 211  GLU A C     1 
ATOM   1391  O  O     . GLU A  1  211  ? 250.910 249.078 247.413 1.00 0.00 ? 211  GLU A O     1 
ATOM   1392  C  CB    . GLU A  1  211  ? 248.972 246.397 246.318 1.00 0.00 ? 211  GLU A CB    1 
ATOM   1393  C  CG    . GLU A  1  211  ? 247.638 246.529 247.035 1.00 0.00 ? 211  GLU A CG    1 
ATOM   1394  C  CD    . GLU A  1  211  ? 246.456 246.341 246.106 1.00 0.00 ? 211  GLU A CD    1 
ATOM   1395  O  OE1   . GLU A  1  211  ? 246.666 246.290 244.875 1.00 0.00 ? 211  GLU A OE1   1 
ATOM   1396  O  OE2   . GLU A  1  211  ? 245.315 246.243 246.605 1.00 0.00 ? 211  GLU A OE2   1 
ATOM   1397  N  N     . LYS A  1  212  ? 250.998 248.118 245.363 1.00 0.00 ? 212  LYS A N     1 
ATOM   1398  C  CA    . LYS A  1  212  ? 251.524 249.271 244.653 1.00 0.00 ? 212  LYS A CA    1 
ATOM   1399  C  C     . LYS A  1  212  ? 250.390 250.137 244.120 1.00 0.00 ? 212  LYS A C     1 
ATOM   1400  O  O     . LYS A  1  212  ? 250.283 251.306 244.489 1.00 0.00 ? 212  LYS A O     1 
ATOM   1401  C  CB    . LYS A  1  212  ? 252.430 248.825 243.503 1.00 0.00 ? 212  LYS A CB    1 
ATOM   1402  C  CG    . LYS A  1  212  ? 253.416 247.731 243.879 1.00 0.00 ? 212  LYS A CG    1 
ATOM   1403  C  CD    . LYS A  1  212  ? 252.989 246.386 243.317 1.00 0.00 ? 212  LYS A CD    1 
ATOM   1404  C  CE    . LYS A  1  212  ? 252.486 245.463 244.415 1.00 0.00 ? 212  LYS A CE    1 
ATOM   1405  N  NZ    . LYS A  1  212  ? 253.415 245.428 245.579 1.00 0.00 ? 212  LYS A NZ    1 
ATOM   1406  N  N     . LYS A  1  213  ? 249.540 249.582 243.256 1.00 0.00 ? 213  LYS A N     1 
ATOM   1407  C  CA    . LYS A  1  213  ? 248.444 250.400 242.741 1.00 0.00 ? 213  LYS A CA    1 
ATOM   1408  C  C     . LYS A  1  213  ? 247.044 250.091 243.292 1.00 0.00 ? 213  LYS A C     1 
ATOM   1409  O  O     . LYS A  1  213  ? 246.599 248.943 243.295 1.00 0.00 ? 213  LYS A O     1 
ATOM   1410  C  CB    . LYS A  1  213  ? 248.423 250.279 241.213 1.00 0.00 ? 213  LYS A CB    1 
ATOM   1411  C  CG    . LYS A  1  213  ? 247.417 251.168 240.502 1.00 0.00 ? 213  LYS A CG    1 
ATOM   1412  C  CD    . LYS A  1  213  ? 247.468 250.920 239.002 1.00 0.00 ? 213  LYS A CD    1 
ATOM   1413  C  CE    . LYS A  1  213  ? 246.467 251.774 238.253 1.00 0.00 ? 213  LYS A CE    1 
ATOM   1414  N  NZ    . LYS A  1  213  ? 246.520 251.527 236.787 1.00 0.00 ? 213  LYS A NZ    1 
ATOM   1415  N  N     . ILE A  1  214  ? 246.365 251.143 243.756 1.00 0.00 ? 214  ILE A N     1 
ATOM   1416  C  CA    . ILE A  1  214  ? 244.998 251.052 244.278 1.00 0.00 ? 214  ILE A CA    1 
ATOM   1417  C  C     . ILE A  1  214  ? 244.185 252.283 243.892 1.00 0.00 ? 214  ILE A C     1 
ATOM   1418  O  O     . ILE A  1  214  ? 244.747 253.302 243.488 1.00 0.00 ? 214  ILE A O     1 
ATOM   1419  C  CB    . ILE A  1  214  ? 244.952 250.948 245.816 1.00 0.00 ? 214  ILE A CB    1 
ATOM   1420  C  CG1   . ILE A  1  214  ? 245.622 252.168 246.457 1.00 0.00 ? 214  ILE A CG1   1 
ATOM   1421  C  CG2   . ILE A  1  214  ? 245.566 249.653 246.299 1.00 0.00 ? 214  ILE A CG2   1 
ATOM   1422  C  CD1   . ILE A  1  214  ? 245.458 252.233 247.957 1.00 0.00 ? 214  ILE A CD1   1 
ATOM   1423  N  N     . LEU A  1  215  ? 242.866 252.193 244.020 1.00 0.00 ? 215  LEU A N     1 
ATOM   1424  C  CA    . LEU A  1  215  ? 242.008 253.348 243.787 1.00 0.00 ? 215  LEU A CA    1 
ATOM   1425  C  C     . LEU A  1  215  ? 242.010 254.181 245.076 1.00 0.00 ? 215  LEU A C     1 
ATOM   1426  O  O     . LEU A  1  215  ? 242.002 253.612 246.168 1.00 0.00 ? 215  LEU A O     1 
ATOM   1427  C  CB    . LEU A  1  215  ? 240.596 252.922 243.371 1.00 0.00 ? 215  LEU A CB    1 
ATOM   1428  C  CG    . LEU A  1  215  ? 239.583 254.019 243.023 1.00 0.00 ? 215  LEU A CG    1 
ATOM   1429  C  CD1   . LEU A  1  215  ? 238.597 253.502 241.984 1.00 0.00 ? 215  LEU A CD1   1 
ATOM   1430  C  CD2   . LEU A  1  215  ? 238.832 254.527 244.247 1.00 0.00 ? 215  LEU A CD2   1 
ATOM   1431  N  N     . LEU A  1  216  ? 242.030 255.508 244.966 1.00 0.00 ? 216  LEU A N     1 
ATOM   1432  C  CA    . LEU A  1  216  ? 241.952 256.360 246.155 1.00 0.00 ? 216  LEU A CA    1 
ATOM   1433  C  C     . LEU A  1  216  ? 240.535 256.839 246.450 1.00 0.00 ? 216  LEU A C     1 
ATOM   1434  O  O     . LEU A  1  216  ? 239.877 257.449 245.603 1.00 0.00 ? 216  LEU A O     1 
ATOM   1435  C  CB    . LEU A  1  216  ? 242.884 257.561 246.025 1.00 0.00 ? 216  LEU A CB    1 
ATOM   1436  C  CG    . LEU A  1  216  ? 244.362 257.188 246.126 1.00 0.00 ? 216  LEU A CG    1 
ATOM   1437  C  CD1   . LEU A  1  216  ? 245.240 258.390 245.826 1.00 0.00 ? 216  LEU A CD1   1 
ATOM   1438  C  CD2   . LEU A  1  216  ? 244.675 256.606 247.500 1.00 0.00 ? 216  LEU A CD2   1 
ATOM   1439  N  N     . SER A  1  217  ? 240.079 256.558 247.665 1.00 0.00 ? 217  SER A N     1 
ATOM   1440  C  CA    . SER A  1  217  ? 238.740 256.943 248.108 1.00 0.00 ? 217  SER A CA    1 
ATOM   1441  C  C     . SER A  1  217  ? 238.653 258.419 248.487 1.00 0.00 ? 217  SER A C     1 
ATOM   1442  O  O     . SER A  1  217  ? 239.491 258.921 249.237 1.00 0.00 ? 217  SER A O     1 
ATOM   1443  C  CB    . SER A  1  217  ? 238.310 256.081 249.300 1.00 0.00 ? 217  SER A CB    1 
ATOM   1444  O  OG    . SER A  1  217  ? 237.087 256.540 249.853 1.00 0.00 ? 217  SER A OG    1 
ATOM   1445  N  N     . PRO A  1  218  ? 237.616 259.107 247.988 1.00 0.00 ? 218  PRO A N     1 
ATOM   1446  C  CA    . PRO A  1  218  ? 237.395 260.527 248.289 1.00 0.00 ? 218  PRO A CA    1 
ATOM   1447  C  C     . PRO A  1  218  ? 237.304 260.847 249.786 1.00 0.00 ? 218  PRO A C     1 
ATOM   1448  O  O     . PRO A  1  218  ? 237.721 261.916 250.206 1.00 0.00 ? 218  PRO A O     1 
ATOM   1449  C  CB    . PRO A  1  218  ? 236.061 260.833 247.609 1.00 0.00 ? 218  PRO A CB    1 
ATOM   1450  C  CG    . PRO A  1  218  ? 235.756 259.666 246.728 1.00 0.00 ? 218  PRO A CG    1 
ATOM   1451  C  CD    . PRO A  1  218  ? 236.650 258.552 247.025 1.00 0.00 ? 218  PRO A CD    1 
ATOM   1452  N  N     . GLU A  1  219  ? 236.702 259.956 250.555 1.00 0.00 ? 219  GLU A N     1 
ATOM   1453  C  CA    . GLU A  1  219  ? 236.620 260.086 252.002 1.00 0.00 ? 219  GLU A CA    1 
ATOM   1454  C  C     . GLU A  1  219  ? 237.986 260.031 252.683 1.00 0.00 ? 219  GLU A C     1 
ATOM   1455  O  O     . GLU A  1  219  ? 238.267 260.803 253.597 1.00 0.00 ? 219  GLU A O     1 
ATOM   1456  C  CB    . GLU A  1  219  ? 235.741 258.980 252.543 1.00 0.00 ? 219  GLU A CB    1 
ATOM   1457  C  CG    . GLU A  1  219  ? 235.236 259.199 253.936 1.00 0.00 ? 219  GLU A CG    1 
ATOM   1458  C  CD    . GLU A  1  219  ? 234.835 257.925 254.609 1.00 0.00 ? 219  GLU A CD    1 
ATOM   1459  O  OE1   . GLU A  1  219  ? 233.639 257.581 254.560 1.00 0.00 ? 219  GLU A OE1   1 
ATOM   1460  O  OE2   . GLU A  1  219  ? 235.678 257.409 255.366 1.00 0.00 ? 219  GLU A OE2   1 
ATOM   1461  N  N     . ARG A  1  220  ? 238.834 259.114 252.220 1.00 0.00 ? 220  ARG A N     1 
ATOM   1462  C  CA    . ARG A  1  220  ? 240.166 258.935 252.800 1.00 0.00 ? 220  ARG A CA    1 
ATOM   1463  C  C     . ARG A  1  220  ? 241.075 260.134 252.583 1.00 0.00 ? 220  ARG A C     1 
ATOM   1464  O  O     . ARG A  1  220  ? 241.703 260.616 253.530 1.00 0.00 ? 220  ARG A O     1 
ATOM   1465  C  CB    . ARG A  1  220  ? 240.850 257.685 252.228 1.00 0.00 ? 220  ARG A CB    1 
ATOM   1466  C  CG    . ARG A  1  220  ? 240.102 256.393 252.478 1.00 0.00 ? 220  ARG A CG    1 
ATOM   1467  C  CD    . ARG A  1  220  ? 240.004 256.089 253.956 1.00 0.00 ? 220  ARG A CD    1 
ATOM   1468  N  NE    . ARG A  1  220  ? 239.441 254.764 254.188 1.00 0.00 ? 220  ARG A NE    1 
ATOM   1469  C  CZ    . ARG A  1  220  ? 238.412 254.510 254.989 1.00 0.00 ? 220  ARG A CZ    1 
ATOM   1470  N  NH1   . ARG A  1  220  ? 237.790 255.505 255.609 1.00 0.00 ? 220  ARG A NH1   1 
ATOM   1471  N  NH2   . ARG A  1  220  ? 238.047 253.257 255.225 1.00 0.00 ? 220  ARG A NH2   1 
ATOM   1472  N  N     . VAL A  1  221  ? 241.128 260.646 251.359 1.00 0.00 ? 221  VAL A N     1 
ATOM   1473  C  CA    . VAL A  1  221  ? 241.879 261.873 251.107 1.00 0.00 ? 221  VAL A CA    1 
ATOM   1474  C  C     . VAL A  1  221  ? 241.290 263.048 251.884 1.00 0.00 ? 221  VAL A C     1 
ATOM   1475  O  O     . VAL A  1  221  ? 242.019 263.940 252.316 1.00 0.00 ? 221  VAL A O     1 
ATOM   1476  C  CB    . VAL A  1  221  ? 241.947 262.215 249.597 1.00 0.00 ? 221  VAL A CB    1 
ATOM   1477  C  CG1   . VAL A  1  221  ? 242.547 261.064 248.822 1.00 0.00 ? 221  VAL A CG1   1 
ATOM   1478  C  CG2   . VAL A  1  221  ? 240.587 262.566 249.045 1.00 0.00 ? 221  VAL A CG2   1 
ATOM   1479  N  N     . HIS A  1  222  ? 239.971 263.051 252.042 1.00 0.00 ? 222  HIS A N     1 
ATOM   1480  C  CA    . HIS A  1  222  ? 239.276 264.049 252.845 1.00 0.00 ? 222  HIS A CA    1 
ATOM   1481  C  C     . HIS A  1  222  ? 239.831 264.085 254.266 1.00 0.00 ? 222  HIS A C     1 
ATOM   1482  O  O     . HIS A  1  222  ? 240.043 265.150 254.846 1.00 0.00 ? 222  HIS A O     1 
ATOM   1483  C  CB    . HIS A  1  222  ? 237.779 263.766 252.879 1.00 0.00 ? 222  HIS A CB    1 
ATOM   1484  C  CG    . HIS A  1  222  ? 236.984 264.833 253.559 1.00 0.00 ? 222  HIS A CG    1 
ATOM   1485  N  ND1   . HIS A  1  222  ? 236.024 264.558 254.508 1.00 0.00 ? 222  HIS A ND1   1 
ATOM   1486  C  CD2   . HIS A  1  222  ? 236.992 266.179 253.410 1.00 0.00 ? 222  HIS A CD2   1 
ATOM   1487  C  CE1   . HIS A  1  222  ? 235.484 265.690 254.925 1.00 0.00 ? 222  HIS A CE1   1 
ATOM   1488  N  NE2   . HIS A  1  222  ? 236.054 266.687 254.273 1.00 0.00 ? 222  HIS A NE2   1 
ATOM   1489  N  N     . GLU A  1  223  ? 240.066 262.895 254.806 1.00 0.00 ? 223  GLU A N     1 
ATOM   1490  C  CA    . GLU A  1  223  ? 240.665 262.716 256.126 1.00 0.00 ? 223  GLU A CA    1 
ATOM   1491  C  C     . GLU A  1  223  ? 242.105 263.240 256.193 1.00 0.00 ? 223  GLU A C     1 
ATOM   1492  O  O     . GLU A  1  223  ? 242.506 263.834 257.196 1.00 0.00 ? 223  GLU A O     1 
ATOM   1493  C  CB    . GLU A  1  223  ? 240.614 261.247 256.534 1.00 0.00 ? 223  GLU A CB    1 
ATOM   1494  C  CG    . GLU A  1  223  ? 241.096 260.999 257.945 1.00 0.00 ? 223  GLU A CG    1 
ATOM   1495  C  CD    . GLU A  1  223  ? 241.031 259.539 258.324 1.00 0.00 ? 223  GLU A CD    1 
ATOM   1496  O  OE1   . GLU A  1  223  ? 239.909 259.019 258.499 1.00 0.00 ? 223  GLU A OE1   1 
ATOM   1497  O  OE2   . GLU A  1  223  ? 242.101 258.910 258.450 1.00 0.00 ? 223  GLU A OE2   1 
ATOM   1498  N  N     . ILE A  1  224  ? 242.876 263.006 255.133 1.00 0.00 ? 224  ILE A N     1 
ATOM   1499  C  CA    . ILE A  1  224  ? 244.253 263.502 255.027 1.00 0.00 ? 224  ILE A CA    1 
ATOM   1500  C  C     . ILE A  1  224  ? 244.258 265.032 255.032 1.00 0.00 ? 224  ILE A C     1 
ATOM   1501  O  O     . ILE A  1  224  ? 245.128 265.664 255.631 1.00 0.00 ? 224  ILE A O     1 
ATOM   1502  C  CB    . ILE A  1  224  ? 244.955 262.971 253.752 1.00 0.00 ? 224  ILE A CB    1 
ATOM   1503  C  CG1   . ILE A  1  224  ? 245.163 261.455 253.846 1.00 0.00 ? 224  ILE A CG1   1 
ATOM   1504  C  CG2   . ILE A  1  224  ? 246.287 263.669 253.529 1.00 0.00 ? 224  ILE A CG2   1 
ATOM   1505  C  CD1   . ILE A  1  224  ? 245.591 260.806 252.545 1.00 0.00 ? 224  ILE A CD1   1 
ATOM   1506  N  N     . PHE A  1  225  ? 243.273 265.622 254.369 1.00 0.00 ? 225  PHE A N     1 
ATOM   1507  C  CA    . PHE A  1  225  ? 243.116 267.071 254.355 1.00 0.00 ? 225  PHE A CA    1 
ATOM   1508  C  C     . PHE A  1  225  ? 242.724 267.601 255.732 1.00 0.00 ? 225  PHE A C     1 
ATOM   1509  O  O     . PHE A  1  225  ? 243.187 268.662 256.148 1.00 0.00 ? 225  PHE A O     1 
ATOM   1510  C  CB    . PHE A  1  225  ? 242.072 267.524 253.325 1.00 0.00 ? 225  PHE A CB    1 
ATOM   1511  C  CG    . PHE A  1  225  ? 242.490 267.324 251.893 1.00 0.00 ? 225  PHE A CG    1 
ATOM   1512  C  CD1   . PHE A  1  225  ? 243.697 267.824 251.438 1.00 0.00 ? 225  PHE A CD1   1 
ATOM   1513  C  CD2   . PHE A  1  225  ? 241.661 266.673 250.996 1.00 0.00 ? 225  PHE A CD2   1 
ATOM   1514  C  CE1   . PHE A  1  225  ? 244.081 267.653 250.123 1.00 0.00 ? 225  PHE A CE1   1 
ATOM   1515  C  CE2   . PHE A  1  225  ? 242.043 266.500 249.679 1.00 0.00 ? 225  PHE A CE2   1 
ATOM   1516  C  CZ    . PHE A  1  225  ? 243.252 266.992 249.243 1.00 0.00 ? 225  PHE A CZ    1 
ATOM   1517  N  N     . LYS A  1  226  ? 241.893 266.852 256.448 1.00 0.00 ? 226  LYS A N     1 
ATOM   1518  C  CA    . LYS A  1  226  ? 241.496 267.237 257.797 1.00 0.00 ? 226  LYS A CA    1 
ATOM   1519  C  C     . LYS A  1  226  ? 242.669 267.332 258.774 1.00 0.00 ? 226  LYS A C     1 
ATOM   1520  O  O     . LYS A  1  226  ? 242.686 268.215 259.629 1.00 0.00 ? 226  LYS A O     1 
ATOM   1521  C  CB    . LYS A  1  226  ? 240.486 266.212 258.301 1.00 0.00 ? 226  LYS A CB    1 
ATOM   1522  C  CG    . LYS A  1  226  ? 239.079 266.473 257.814 1.00 0.00 ? 226  LYS A CG    1 
ATOM   1523  C  CD    . LYS A  1  226  ? 238.100 265.458 258.361 1.00 0.00 ? 226  LYS A CD    1 
ATOM   1524  C  CE    . LYS A  1  226  ? 236.675 265.897 258.090 1.00 0.00 ? 226  LYS A CE    1 
ATOM   1525  N  NZ    . LYS A  1  226  ? 236.213 266.968 259.008 1.00 0.00 ? 226  LYS A NZ    1 
ATOM   1526  N  N     . ARG A  1  227  ? 243.647 266.444 258.648 1.00 0.00 ? 227  ARG A N     1 
ATOM   1527  C  CA    . ARG A  1  227  ? 244.796 266.450 259.555 1.00 0.00 ? 227  ARG A CA    1 
ATOM   1528  C  C     . ARG A  1  227  ? 245.735 267.631 259.297 1.00 0.00 ? 227  ARG A C     1 
ATOM   1529  O  O     . ARG A  1  227  ? 246.512 268.009 260.174 1.00 0.00 ? 227  ARG A O     1 
ATOM   1530  C  CB    . ARG A  1  227  ? 245.580 265.136 259.467 1.00 0.00 ? 227  ARG A CB    1 
ATOM   1531  C  CG    . ARG A  1  227  ? 244.864 263.860 259.912 1.00 0.00 ? 227  ARG A CG    1 
ATOM   1532  C  CD    . ARG A  1  227  ? 243.635 264.124 260.767 1.00 0.00 ? 227  ARG A CD    1 
ATOM   1533  N  NE    . ARG A  1  227  ? 243.565 263.149 261.846 1.00 0.00 ? 227  ARG A NE    1 
ATOM   1534  C  CZ    . ARG A  1  227  ? 243.408 263.438 263.135 1.00 0.00 ? 227  ARG A CZ    1 
ATOM   1535  N  NH1   . ARG A  1  227  ? 243.230 264.698 263.507 1.00 0.00 ? 227  ARG A NH1   1 
ATOM   1536  N  NH2   . ARG A  1  227  ? 243.620 262.514 264.057 1.00 0.00 ? 227  ARG A NH2   1 
ATOM   1537  N  N     . ILE A  1  228  ? 245.668 268.192 258.091 1.00 0.00 ? 228  ILE A N     1 
ATOM   1538  C  CA    . ILE A  1  228  ? 246.569 269.272 257.687 1.00 0.00 ? 228  ILE A CA    1 
ATOM   1539  C  C     . ILE A  1  228  ? 246.581 270.454 258.656 1.00 0.00 ? 228  ILE A C     1 
ATOM   1540  O  O     . ILE A  1  228  ? 245.532 270.976 259.032 1.00 0.00 ? 228  ILE A O     1 
ATOM   1541  C  CB    . ILE A  1  228  ? 246.220 269.789 256.280 1.00 0.00 ? 228  ILE A CB    1 
ATOM   1542  C  CG1   . ILE A  1  228  ? 246.449 268.687 255.247 1.00 0.00 ? 228  ILE A CG1   1 
ATOM   1543  C  CG2   . ILE A  1  228  ? 247.063 270.998 255.921 1.00 0.00 ? 228  ILE A CG2   1 
ATOM   1544  C  CD1   . ILE A  1  228  ? 246.051 269.079 253.850 1.00 0.00 ? 228  ILE A CD1   1 
ATOM   1545  N  N     . SER A  1  229  ? 247.785 270.868 259.043 1.00 0.00 ? 229  SER A N     1 
ATOM   1546  C  CA    . SER A  1  229  ? 247.970 271.957 259.996 1.00 0.00 ? 229  SER A CA    1 
ATOM   1547  C  C     . SER A  1  229  ? 247.682 273.319 259.379 1.00 0.00 ? 229  SER A C     1 
ATOM   1548  O  O     . SER A  1  229  ? 247.554 273.453 258.161 1.00 0.00 ? 229  SER A O     1 
ATOM   1549  C  CB    . SER A  1  229  ? 249.393 271.937 260.563 1.00 0.00 ? 229  SER A CB    1 
ATOM   1550  O  OG    . SER A  1  229  ? 250.329 272.419 259.615 1.00 0.00 ? 229  SER A OG    1 
ATOM   1551  N  N     . ASP A  1  230  ? 247.593 274.327 260.237 1.00 0.00 ? 230  ASP A N     1 
ATOM   1552  C  CA    . ASP A  1  230  ? 247.308 275.688 259.802 1.00 0.00 ? 230  ASP A CA    1 
ATOM   1553  C  C     . ASP A  1  230  ? 248.489 276.367 259.107 1.00 0.00 ? 230  ASP A C     1 
ATOM   1554  O  O     . ASP A  1  230  ? 248.319 277.051 258.098 1.00 0.00 ? 230  ASP A O     1 
ATOM   1555  C  CB    . ASP A  1  230  ? 246.878 276.514 261.015 1.00 0.00 ? 230  ASP A CB    1 
ATOM   1556  C  CG    . ASP A  1  230  ? 245.822 277.541 260.677 1.00 0.00 ? 230  ASP A CG    1 
ATOM   1557  O  OD1   . ASP A  1  230  ? 245.176 277.405 259.614 1.00 0.00 ? 230  ASP A OD1   1 
ATOM   1558  O  OD2   . ASP A  1  230  ? 245.637 278.478 261.483 1.00 0.00 ? 230  ASP A OD2   1 
ATOM   1559  N  N     . GLU A  1  231  ? 249.683 276.149 259.645 1.00 0.00 ? 231  GLU A N     1 
ATOM   1560  C  CA    . GLU A  1  231  ? 250.915 276.733 259.115 1.00 0.00 ? 231  GLU A CA    1 
ATOM   1561  C  C     . GLU A  1  231  ? 251.239 276.274 257.704 1.00 0.00 ? 231  GLU A C     1 
ATOM   1562  O  O     . GLU A  1  231  ? 251.743 277.044 256.884 1.00 0.00 ? 231  GLU A O     1 
ATOM   1563  C  CB    . GLU A  1  231  ? 252.100 276.419 260.032 1.00 0.00 ? 231  GLU A CB    1 
ATOM   1564  C  CG    . GLU A  1  231  ? 252.040 277.056 261.417 1.00 0.00 ? 231  GLU A CG    1 
ATOM   1565  C  CD    . GLU A  1  231  ? 250.860 276.590 262.251 1.00 0.00 ? 231  GLU A CD    1 
ATOM   1566  O  OE1   . GLU A  1  231  ? 250.256 275.548 261.911 1.00 0.00 ? 231  GLU A OE1   1 
ATOM   1567  O  OE2   . GLU A  1  231  ? 250.534 277.272 263.244 1.00 0.00 ? 231  GLU A OE2   1 
ATOM   1568  N  N     . GLU A  1  232  ? 250.926 275.016 257.425 1.00 0.00 ? 232  GLU A N     1 
ATOM   1569  C  CA    . GLU A  1  232  ? 251.131 274.446 256.104 1.00 0.00 ? 232  GLU A CA    1 
ATOM   1570  C  C     . GLU A  1  232  ? 250.247 275.076 255.037 1.00 0.00 ? 232  GLU A C     1 
ATOM   1571  O  O     . GLU A  1  232  ? 250.704 275.307 253.916 1.00 0.00 ? 232  GLU A O     1 
ATOM   1572  C  CB    . GLU A  1  232  ? 250.892 272.940 256.157 1.00 0.00 ? 232  GLU A CB    1 
ATOM   1573  C  CG    . GLU A  1  232  ? 252.084 272.166 256.679 1.00 0.00 ? 232  GLU A CG    1 
ATOM   1574  C  CD    . GLU A  1  232  ? 251.804 270.687 256.816 1.00 0.00 ? 232  GLU A CD    1 
ATOM   1575  O  OE1   . GLU A  1  232  ? 250.828 270.204 256.204 1.00 0.00 ? 232  GLU A OE1   1 
ATOM   1576  O  OE2   . GLU A  1  232  ? 252.564 270.011 257.539 1.00 0.00 ? 232  GLU A OE2   1 
ATOM   1577  N  N     . CYS A  1  233  ? 248.994 275.361 255.373 1.00 0.00 ? 233  CYS A N     1 
ATOM   1578  C  CA    . CYS A  1  233  ? 248.102 275.953 254.390 1.00 0.00 ? 233  CYS A CA    1 
ATOM   1579  C  C     . CYS A  1  233  ? 248.639 277.308 253.953 1.00 0.00 ? 233  CYS A C     1 
ATOM   1580  O  O     . CYS A  1  233  ? 248.492 277.703 252.800 1.00 0.00 ? 233  CYS A O     1 
ATOM   1581  C  CB    . CYS A  1  233  ? 246.697 276.116 254.965 1.00 0.00 ? 233  CYS A CB    1 
ATOM   1582  S  SG    . CYS A  1  233  ? 245.835 274.565 255.266 1.00 0.00 ? 233  CYS A SG    1 
ATOM   1583  N  N     . PHE A  1  234  ? 249.308 277.988 254.874 1.00 0.00 ? 234  PHE A N     1 
ATOM   1584  C  CA    . PHE A  1  234  ? 249.968 279.253 254.588 1.00 0.00 ? 234  PHE A CA    1 
ATOM   1585  C  C     . PHE A  1  234  ? 251.139 279.089 253.629 1.00 0.00 ? 234  PHE A C     1 
ATOM   1586  O  O     . PHE A  1  234  ? 251.351 279.916 252.746 1.00 0.00 ? 234  PHE A O     1 
ATOM   1587  C  CB    . PHE A  1  234  ? 250.437 279.925 255.873 1.00 0.00 ? 234  PHE A CB    1 
ATOM   1588  C  CG    . PHE A  1  234  ? 250.978 281.301 255.654 1.00 0.00 ? 234  PHE A CG    1 
ATOM   1589  C  CD1   . PHE A  1  234  ? 250.134 282.397 255.677 1.00 0.00 ? 234  PHE A CD1   1 
ATOM   1590  C  CD2   . PHE A  1  234  ? 252.328 281.503 255.420 1.00 0.00 ? 234  PHE A CD2   1 
ATOM   1591  C  CE1   . PHE A  1  234  ? 250.624 283.667 255.468 1.00 0.00 ? 234  PHE A CE1   1 
ATOM   1592  C  CE2   . PHE A  1  234  ? 252.823 282.774 255.211 1.00 0.00 ? 234  PHE A CE2   1 
ATOM   1593  C  CZ    . PHE A  1  234  ? 251.969 283.858 255.235 1.00 0.00 ? 234  PHE A CZ    1 
ATOM   1594  N  N     . VAL A  1  235  ? 251.911 278.029 253.830 1.00 0.00 ? 235  VAL A N     1 
ATOM   1595  C  CA    . VAL A  1  235  ? 253.030 277.713 252.956 1.00 0.00 ? 235  VAL A CA    1 
ATOM   1596  C  C     . VAL A  1  235  ? 252.591 277.291 251.561 1.00 0.00 ? 235  VAL A C     1 
ATOM   1597  O  O     . VAL A  1  235  ? 253.215 277.676 250.574 1.00 0.00 ? 235  VAL A O     1 
ATOM   1598  C  CB    . VAL A  1  235  ? 253.900 276.600 253.558 1.00 0.00 ? 235  VAL A CB    1 
ATOM   1599  C  CG1   . VAL A  1  235  ? 255.049 276.251 252.623 1.00 0.00 ? 235  VAL A CG1   1 
ATOM   1600  C  CG2   . VAL A  1  235  ? 254.424 277.026 254.919 1.00 0.00 ? 235  VAL A CG2   1 
ATOM   1601  N  N     . LEU A  1  236  ? 251.518 276.518 251.467 1.00 0.00 ? 236  LEU A N     1 
ATOM   1602  C  CA    . LEU A  1  236  ? 250.976 276.173 250.156 1.00 0.00 ? 236  LEU A CA    1 
ATOM   1603  C  C     . LEU A  1  236  ? 250.360 277.362 249.427 1.00 0.00 ? 236  LEU A C     1 
ATOM   1604  O  O     . LEU A  1  236  ? 250.184 277.320 248.212 1.00 0.00 ? 236  LEU A O     1 
ATOM   1605  C  CB    . LEU A  1  236  ? 249.930 275.072 250.285 1.00 0.00 ? 236  LEU A CB    1 
ATOM   1606  C  CG    . LEU A  1  236  ? 250.455 273.731 250.783 1.00 0.00 ? 236  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A  1  236  ? 249.299 272.779 251.047 1.00 0.00 ? 236  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A  1  236  ? 251.430 273.153 249.773 1.00 0.00 ? 236  LEU A CD2   1 
ATOM   1609  N  N     . GLY A  1  237  ? 250.040 278.420 250.164 1.00 0.00 ? 237  GLY A N     1 
ATOM   1610  C  CA    . GLY A  1  237  ? 249.534 279.641 249.560 1.00 0.00 ? 237  GLY A CA    1 
ATOM   1611  C  C     . GLY A  1  237  ? 248.044 279.855 249.754 1.00 0.00 ? 237  GLY A C     1 
ATOM   1612  O  O     . GLY A  1  237  ? 247.526 280.951 249.528 1.00 0.00 ? 237  GLY A O     1 
ATOM   1613  N  N     . MET A  1  238  ? 247.350 278.803 250.170 1.00 0.00 ? 238  MET A N     1 
ATOM   1614  C  CA    . MET A  1  238  ? 245.928 278.900 250.467 1.00 0.00 ? 238  MET A CA    1 
ATOM   1615  C  C     . MET A  1  238  ? 245.698 279.665 251.767 1.00 0.00 ? 238  MET A C     1 
ATOM   1616  O  O     . MET A  1  238  ? 246.488 279.557 252.700 1.00 0.00 ? 238  MET A O     1 
ATOM   1617  C  CB    . MET A  1  238  ? 245.316 277.508 250.548 1.00 0.00 ? 238  MET A CB    1 
ATOM   1618  C  CG    . MET A  1  238  ? 245.528 276.693 249.289 1.00 0.00 ? 238  MET A CG    1 
ATOM   1619  S  SD    . MET A  1  238  ? 244.842 275.036 249.430 1.00 0.00 ? 238  MET A SD    1 
ATOM   1620  C  CE    . MET A  1  238  ? 243.090 275.387 249.316 1.00 0.00 ? 238  MET A CE    1 
ATOM   1621  N  N     . GLU A  1  239  ? 244.610 280.424 251.839 1.00 0.00 ? 239  GLU A N     1 
ATOM   1622  C  CA    . GLU A  1  239  ? 244.319 281.214 253.032 1.00 0.00 ? 239  GLU A CA    1 
ATOM   1623  C  C     . GLU A  1  239  ? 243.299 280.541 253.959 1.00 0.00 ? 239  GLU A C     1 
ATOM   1624  O  O     . GLU A  1  239  ? 242.118 280.447 253.613 1.00 0.00 ? 239  GLU A O     1 
ATOM   1625  C  CB    . GLU A  1  239  ? 243.813 282.605 252.635 1.00 0.00 ? 239  GLU A CB    1 
ATOM   1626  C  CG    . GLU A  1  239  ? 243.532 283.520 253.820 1.00 0.00 ? 239  GLU A CG    1 
ATOM   1627  C  CD    . GLU A  1  239  ? 244.682 283.552 254.822 1.00 0.00 ? 239  GLU A CD    1 
ATOM   1628  O  OE1   . GLU A  1  239  ? 245.857 283.574 254.392 1.00 0.00 ? 239  GLU A OE1   1 
ATOM   1629  O  OE2   . GLU A  1  239  ? 244.412 283.550 256.044 1.00 0.00 ? 239  GLU A OE2   1 
ATOM   1630  N  N     . PRO A  1  240  ? 243.753 280.067 255.142 1.00 0.00 ? 240  PRO A N     1 
ATOM   1631  C  CA    . PRO A  1  240  ? 242.883 279.387 256.113 1.00 0.00 ? 240  PRO A CA    1 
ATOM   1632  C  C     . PRO A  1  240  ? 241.605 280.168 256.427 1.00 0.00 ? 240  PRO A C     1 
ATOM   1633  O  O     . PRO A  1  240  ? 240.599 279.567 256.807 1.00 0.00 ? 240  PRO A O     1 
ATOM   1634  C  CB    . PRO A  1  240  ? 243.765 279.289 257.358 1.00 0.00 ? 240  PRO A CB    1 
ATOM   1635  C  CG    . PRO A  1  240  ? 245.146 279.220 256.813 1.00 0.00 ? 240  PRO A CG    1 
ATOM   1636  C  CD    . PRO A  1  240  ? 245.146 280.141 255.624 1.00 0.00 ? 240  PRO A CD    1 
ATOM   1637  N  N     . ARG A  1  241  ? 241.659 281.491 256.281 1.00 0.00 ? 241  ARG A N     1 
ATOM   1638  C  CA    . ARG A  1  241  ? 240.490 282.356 256.433 1.00 0.00 ? 241  ARG A CA    1 
ATOM   1639  C  C     . ARG A  1  241  ? 239.468 282.182 255.313 1.00 0.00 ? 241  ARG A C     1 
ATOM   1640  O  O     . ARG A  1  241  ? 238.304 282.545 255.467 1.00 0.00 ? 241  ARG A O     1 
ATOM   1641  C  CB    . ARG A  1  241  ? 240.915 283.826 256.496 1.00 0.00 ? 241  ARG A CB    1 
ATOM   1642  C  CG    . ARG A  1  241  ? 241.744 284.197 257.715 1.00 0.00 ? 241  ARG A CG    1 
ATOM   1643  C  CD    . ARG A  1  241  ? 240.977 284.000 259.012 1.00 0.00 ? 241  ARG A CD    1 
ATOM   1644  N  NE    . ARG A  1  241  ? 241.736 284.484 260.164 1.00 0.00 ? 241  ARG A NE    1 
ATOM   1645  C  CZ    . ARG A  1  241  ? 242.590 283.743 260.866 1.00 0.00 ? 241  ARG A CZ    1 
ATOM   1646  N  NH1   . ARG A  1  241  ? 242.794 282.474 260.535 1.00 0.00 ? 241  ARG A NH1   1 
ATOM   1647  N  NH2   . ARG A  1  241  ? 243.244 284.270 261.896 1.00 0.00 ? 241  ARG A NH2   1 
ATOM   1648  N  N     . TYR A  1  242  ? 239.900 281.650 254.174 1.00 0.00 ? 242  TYR A N     1 
ATOM   1649  C  CA    . TYR A  1  242  ? 239.000 281.531 253.035 1.00 0.00 ? 242  TYR A CA    1 
ATOM   1650  C  C     . TYR A  1  242  ? 238.955 280.142 252.420 1.00 0.00 ? 242  TYR A C     1 
ATOM   1651  O  O     . TYR A  1  242  ? 237.887 279.661 252.051 1.00 0.00 ? 242  TYR A O     1 
ATOM   1652  C  CB    . TYR A  1  242  ? 239.399 282.531 251.951 1.00 0.00 ? 242  TYR A CB    1 
ATOM   1653  C  CG    . TYR A  1  242  ? 239.478 283.959 252.424 1.00 0.00 ? 242  TYR A CG    1 
ATOM   1654  C  CD1   . TYR A  1  242  ? 238.395 284.562 253.049 1.00 0.00 ? 242  TYR A CD1   1 
ATOM   1655  C  CD2   . TYR A  1  242  ? 240.634 284.709 252.235 1.00 0.00 ? 242  TYR A CD2   1 
ATOM   1656  C  CE1   . TYR A  1  242  ? 238.461 285.873 253.483 1.00 0.00 ? 242  TYR A CE1   1 
ATOM   1657  C  CE2   . TYR A  1  242  ? 240.712 286.020 252.661 1.00 0.00 ? 242  TYR A CE2   1 
ATOM   1658  C  CZ    . TYR A  1  242  ? 239.621 286.598 253.287 1.00 0.00 ? 242  TYR A CZ    1 
ATOM   1659  O  OH    . TYR A  1  242  ? 239.685 287.906 253.717 1.00 0.00 ? 242  TYR A OH    1 
ATOM   1660  N  N     . ALA A  1  243  ? 240.114 279.498 252.317 1.00 0.00 ? 243  ALA A N     1 
ATOM   1661  C  CA    . ALA A  1  243  ? 240.207 278.220 251.621 1.00 0.00 ? 243  ALA A CA    1 
ATOM   1662  C  C     . ALA A  1  243  ? 240.916 277.159 252.447 1.00 0.00 ? 243  ALA A C     1 
ATOM   1663  O  O     . ALA A  1  243  ? 242.123 276.947 252.328 1.00 0.00 ? 243  ALA A O     1 
ATOM   1664  C  CB    . ALA A  1  243  ? 240.914 278.401 250.286 1.00 0.00 ? 243  ALA A CB    1 
ATOM   1665  N  N     . ARG A  1  244  ? 240.141 276.488 253.280 1.00 0.00 ? 244  ARG A N     1 
ATOM   1666  C  CA    . ARG A  1  244  ? 240.619 275.337 254.020 1.00 0.00 ? 244  ARG A CA    1 
ATOM   1667  C  C     . ARG A  1  244  ? 240.475 274.111 253.100 1.00 0.00 ? 244  ARG A C     1 
ATOM   1668  O  O     . ARG A  1  244  ? 239.387 273.858 252.576 1.00 0.00 ? 244  ARG A O     1 
ATOM   1669  C  CB    . ARG A  1  244  ? 239.817 275.219 255.318 1.00 0.00 ? 244  ARG A CB    1 
ATOM   1670  C  CG    . ARG A  1  244  ? 240.132 274.055 256.189 1.00 0.00 ? 244  ARG A CG    1 
ATOM   1671  C  CD    . ARG A  1  244  ? 241.518 274.102 256.760 1.00 0.00 ? 244  ARG A CD    1 
ATOM   1672  N  NE    . ARG A  1  244  ? 241.818 272.830 257.404 1.00 0.00 ? 244  ARG A NE    1 
ATOM   1673  C  CZ    . ARG A  1  244  ? 242.979 272.528 257.971 1.00 0.00 ? 244  ARG A CZ    1 
ATOM   1674  N  NH1   . ARG A  1  244  ? 243.967 273.412 257.969 1.00 0.00 ? 244  ARG A NH1   1 
ATOM   1675  N  NH2   . ARG A  1  244  ? 243.162 271.335 258.524 1.00 0.00 ? 244  ARG A NH2   1 
ATOM   1676  N  N     . PRO A  1  245  ? 241.576 273.355 252.895 1.00 0.00 ? 245  PRO A N     1 
ATOM   1677  C  CA    . PRO A  1  245  ? 241.738 272.265 251.912 1.00 0.00 ? 245  PRO A CA    1 
ATOM   1678  C  C     . PRO A  1  245  ? 240.646 271.187 251.857 1.00 0.00 ? 245  PRO A C     1 
ATOM   1679  O  O     . PRO A  1  245  ? 240.362 270.700 250.765 1.00 0.00 ? 245  PRO A O     1 
ATOM   1680  C  CB    . PRO A  1  245  ? 243.070 271.629 252.322 1.00 0.00 ? 245  PRO A CB    1 
ATOM   1681  C  CG    . PRO A  1  245  ? 243.813 272.726 252.949 1.00 0.00 ? 245  PRO A CG    1 
ATOM   1682  C  CD    . PRO A  1  245  ? 242.808 273.563 253.669 1.00 0.00 ? 245  PRO A CD    1 
ATOM   1683  N  N     . GLU A  1  246  ? 240.088 270.780 252.990 1.00 0.00 ? 246  GLU A N     1 
ATOM   1684  C  CA    . GLU A  1  246  ? 239.023 269.777 252.984 1.00 0.00 ? 246  GLU A CA    1 
ATOM   1685  C  C     . GLU A  1  246  ? 237.796 270.268 252.222 1.00 0.00 ? 246  GLU A C     1 
ATOM   1686  O  O     . GLU A  1  246  ? 237.103 269.471 251.605 1.00 0.00 ? 246  GLU A O     1 
ATOM   1687  C  CB    . GLU A  1  246  ? 238.640 269.317 254.396 1.00 0.00 ? 246  GLU A CB    1 
ATOM   1688  C  CG    . GLU A  1  246  ? 238.167 270.380 255.358 1.00 0.00 ? 246  GLU A CG    1 
ATOM   1689  C  CD    . GLU A  1  246  ? 239.310 270.953 256.178 1.00 0.00 ? 246  GLU A CD    1 
ATOM   1690  O  OE1   . GLU A  1  246  ? 240.457 270.989 255.675 1.00 0.00 ? 246  GLU A OE1   1 
ATOM   1691  O  OE2   . GLU A  1  246  ? 239.060 271.353 257.338 1.00 0.00 ? 246  GLU A OE2   1 
ATOM   1692  N  N     . TRP A  1  247  ? 237.523 271.570 252.272 1.00 0.00 ? 247  TRP A N     1 
ATOM   1693  C  CA    . TRP A  1  247  ? 236.353 272.127 251.592 1.00 0.00 ? 247  TRP A CA    1 
ATOM   1694  C  C     . TRP A  1  247  ? 236.450 272.030 250.072 1.00 0.00 ? 247  TRP A C     1 
ATOM   1695  O  O     . TRP A  1  247  ? 235.449 272.184 249.380 1.00 0.00 ? 247  TRP A O     1 
ATOM   1696  C  CB    . TRP A  1  247  ? 236.154 273.606 251.946 1.00 0.00 ? 247  TRP A CB    1 
ATOM   1697  C  CG    . TRP A  1  247  ? 236.139 273.916 253.387 1.00 0.00 ? 247  TRP A CG    1 
ATOM   1698  C  CD1   . TRP A  1  247  ? 235.860 273.064 254.399 1.00 0.00 ? 247  TRP A CD1   1 
ATOM   1699  C  CD2   . TRP A  1  247  ? 236.365 275.196 253.987 1.00 0.00 ? 247  TRP A CD2   1 
ATOM   1700  N  NE1   . TRP A  1  247  ? 235.934 273.717 255.606 1.00 0.00 ? 247  TRP A NE1   1 
ATOM   1701  C  CE2   . TRP A  1  247  ? 236.237 275.033 255.377 1.00 0.00 ? 247  TRP A CE2   1 
ATOM   1702  C  CE3   . TRP A  1  247  ? 236.681 276.459 253.486 1.00 0.00 ? 247  TRP A CE3   1 
ATOM   1703  C  CZ2   . TRP A  1  247  ? 236.408 276.087 256.276 1.00 0.00 ? 247  TRP A CZ2   1 
ATOM   1704  C  CZ3   . TRP A  1  247  ? 236.853 277.503 254.379 1.00 0.00 ? 247  TRP A CZ3   1 
ATOM   1705  C  CH2   . TRP A  1  247  ? 236.713 277.311 255.756 1.00 0.00 ? 247  TRP A CH2   1 
ATOM   1706  N  N     . MET A  1  248  ? 237.641 271.753 249.552 1.00 0.00 ? 248  MET A N     1 
ATOM   1707  C  CA    . MET A  1  248  ? 237.809 271.447 248.130 1.00 0.00 ? 248  MET A CA    1 
ATOM   1708  C  C     . MET A  1  248  ? 237.161 270.128 247.714 1.00 0.00 ? 248  MET A C     1 
ATOM   1709  O  O     . MET A  1  248  ? 236.972 269.875 246.531 1.00 0.00 ? 248  MET A O     1 
ATOM   1710  C  CB    . MET A  1  248  ? 239.298 271.426 247.773 1.00 0.00 ? 248  MET A CB    1 
ATOM   1711  C  CG    . MET A  1  248  ? 240.018 272.750 248.036 1.00 0.00 ? 248  MET A CG    1 
ATOM   1712  S  SD    . MET A  1  248  ? 241.621 272.898 247.216 1.00 0.00 ? 248  MET A SD    1 
ATOM   1713  C  CE    . MET A  1  248  ? 242.589 271.745 248.180 1.00 0.00 ? 248  MET A CE    1 
ATOM   1714  N  N     . ILE A  1  249  ? 236.827 269.291 248.685 1.00 0.00 ? 249  ILE A N     1 
ATOM   1715  C  CA    . ILE A  1  249  ? 236.046 268.091 248.416 1.00 0.00 ? 249  ILE A CA    1 
ATOM   1716  C  C     . ILE A  1  249  ? 234.570 268.400 248.671 1.00 0.00 ? 249  ILE A C     1 
ATOM   1717  O  O     . ILE A  1  249  ? 234.242 269.179 249.564 1.00 0.00 ? 249  ILE A O     1 
ATOM   1718  C  CB    . ILE A  1  249  ? 236.532 266.904 249.286 1.00 0.00 ? 249  ILE A CB    1 
ATOM   1719  C  CG1   . ILE A  1  249  ? 238.007 266.636 249.016 1.00 0.00 ? 249  ILE A CG1   1 
ATOM   1720  C  CG2   . ILE A  1  249  ? 235.742 265.634 249.001 1.00 0.00 ? 249  ILE A CG2   1 
ATOM   1721  C  CD1   . ILE A  1  249  ? 238.287 266.277 247.574 1.00 0.00 ? 249  ILE A CD1   1 
ATOM   1722  N  N     . VAL A  1  250  ? 233.681 267.809 247.880 1.00 0.00 ? 250  VAL A N     1 
ATOM   1723  C  CA    . VAL A  1  250  ? 232.255 268.091 248.004 1.00 0.00 ? 250  VAL A CA    1 
ATOM   1724  C  C     . VAL A  1  250  ? 231.598 267.223 249.058 1.00 0.00 ? 250  VAL A C     1 
ATOM   1725  O  O     . VAL A  1  250  ? 231.444 266.020 248.863 1.00 0.00 ? 250  VAL A O     1 
ATOM   1726  C  CB    . VAL A  1  250  ? 231.516 267.854 246.682 1.00 0.00 ? 250  VAL A CB    1 
ATOM   1727  C  CG1   . VAL A  1  250  ? 230.053 268.191 246.834 1.00 0.00 ? 250  VAL A CG1   1 
ATOM   1728  C  CG2   . VAL A  1  250  ? 232.146 268.657 245.568 1.00 0.00 ? 250  VAL A CG2   1 
ATOM   1729  N  N     . THR A  1  251  ? 231.194 267.838 250.166 1.00 0.00 ? 251  THR A N     1 
ATOM   1730  C  CA    . THR A  1  251  ? 230.374 267.153 251.164 1.00 0.00 ? 251  THR A CA    1 
ATOM   1731  C  C     . THR A  1  251  ? 228.915 267.586 251.025 1.00 0.00 ? 251  THR A C     1 
ATOM   1732  O  O     . THR A  1  251  ? 228.048 266.789 250.658 1.00 0.00 ? 251  THR A O     1 
ATOM   1733  C  CB    . THR A  1  251  ? 230.875 267.420 252.616 1.00 0.00 ? 251  THR A CB    1 
ATOM   1734  O  OG1   . THR A  1  251  ? 230.954 268.830 252.862 1.00 0.00 ? 251  THR A OG1   1 
ATOM   1735  C  CG2   . THR A  1  251  ? 232.249 266.801 252.843 1.00 0.00 ? 251  THR A CG2   1 
ATOM   1736  N  N     . VAL A  1  252  ? 228.661 268.858 251.313 1.00 0.00 ? 252  VAL A N     1 
ATOM   1737  C  CA    . VAL A  1  252  ? 227.344 269.447 251.145 1.00 0.00 ? 252  VAL A CA    1 
ATOM   1738  C  C     . VAL A  1  252  ? 227.290 270.156 249.808 1.00 0.00 ? 252  VAL A C     1 
ATOM   1739  O  O     . VAL A  1  252  ? 228.177 270.932 249.488 1.00 0.00 ? 252  VAL A O     1 
ATOM   1740  C  CB    . VAL A  1  252  ? 227.018 270.434 252.279 1.00 0.00 ? 252  VAL A CB    1 
ATOM   1741  C  CG1   . VAL A  1  252  ? 225.606 270.967 252.142 1.00 0.00 ? 252  VAL A CG1   1 
ATOM   1742  C  CG2   . VAL A  1  252  ? 227.224 269.769 253.634 1.00 0.00 ? 252  VAL A CG2   1 
ATOM   1743  N  N     . LEU A  1  253  ? 226.242 269.905 249.033 1.00 0.00 ? 253  LEU A N     1 
ATOM   1744  C  CA    . LEU A  1  253  ? 226.153 270.416 247.669 1.00 0.00 ? 253  LEU A CA    1 
ATOM   1745  C  C     . LEU A  1  253  ? 225.035 271.427 247.510 1.00 0.00 ? 253  LEU A C     1 
ATOM   1746  O  O     . LEU A  1  253  ? 223.863 271.057 247.543 1.00 0.00 ? 253  LEU A O     1 
ATOM   1747  C  CB    . LEU A  1  253  ? 225.929 269.267 246.688 1.00 0.00 ? 253  LEU A CB    1 
ATOM   1748  C  CG    . LEU A  1  253  ? 225.794 269.687 245.228 1.00 0.00 ? 253  LEU A CG    1 
ATOM   1749  C  CD1   . LEU A  1  253  ? 227.081 270.288 244.763 1.00 0.00 ? 253  LEU A CD1   1 
ATOM   1750  C  CD2   . LEU A  1  253  ? 225.417 268.507 244.359 1.00 0.00 ? 253  LEU A CD2   1 
ATOM   1751  N  N     . PRO A  1  254  ? 225.398 272.704 247.299 1.00 0.00 ? 254  PRO A N     1 
ATOM   1752  C  CA    . PRO A  1  254  ? 224.432 273.795 247.160 1.00 0.00 ? 254  PRO A CA    1 
ATOM   1753  C  C     . PRO A  1  254  ? 223.529 273.602 245.961 1.00 0.00 ? 254  PRO A C     1 
ATOM   1754  O  O     . PRO A  1  254  ? 224.025 273.288 244.887 1.00 0.00 ? 254  PRO A O     1 
ATOM   1755  C  CB    . PRO A  1  254  ? 225.317 275.028 246.971 1.00 0.00 ? 254  PRO A CB    1 
ATOM   1756  C  CG    . PRO A  1  254  ? 226.586 274.510 246.450 1.00 0.00 ? 254  PRO A CG    1 
ATOM   1757  C  CD    . PRO A  1  254  ? 226.774 273.164 247.065 1.00 0.00 ? 254  PRO A CD    1 
ATOM   1758  N  N     . VAL A  1  255  ? 222.228 273.789 246.156 1.00 0.00 ? 255  VAL A N     1 
ATOM   1759  C  CA    . VAL A  1  255  ? 221.243 273.797 245.077 1.00 0.00 ? 255  VAL A CA    1 
ATOM   1760  C  C     . VAL A  1  255  ? 220.916 275.232 244.651 1.00 0.00 ? 255  VAL A C     1 
ATOM   1761  O  O     . VAL A  1  255  ? 220.394 276.012 245.448 1.00 0.00 ? 255  VAL A O     1 
ATOM   1762  C  CB    . VAL A  1  255  ? 219.952 273.087 245.498 1.00 0.00 ? 255  VAL A CB    1 
ATOM   1763  C  CG1   . VAL A  1  255  ? 218.910 273.202 244.416 1.00 0.00 ? 255  VAL A CG1   1 
ATOM   1764  C  CG2   . VAL A  1  255  ? 220.233 271.644 245.841 1.00 0.00 ? 255  VAL A CG2   1 
ATOM   1765  N  N     . PRO A  1  256  ? 221.220 275.586 243.395 1.00 0.00 ? 256  PRO A N     1 
ATOM   1766  C  CA    . PRO A  1  256  ? 220.930 276.937 242.899 1.00 0.00 ? 256  PRO A CA    1 
ATOM   1767  C  C     . PRO A  1  256  ? 219.442 277.251 242.953 1.00 0.00 ? 256  PRO A C     1 
ATOM   1768  O  O     . PRO A  1  256  ? 218.631 276.373 242.707 1.00 0.00 ? 256  PRO A O     1 
ATOM   1769  C  CB    . PRO A  1  256  ? 221.430 276.897 241.458 1.00 0.00 ? 256  PRO A CB    1 
ATOM   1770  C  CG    . PRO A  1  256  ? 221.492 275.459 241.103 1.00 0.00 ? 256  PRO A CG    1 
ATOM   1771  C  CD    . PRO A  1  256  ? 221.774 274.712 242.348 1.00 0.00 ? 256  PRO A CD    1 
ATOM   1772  N  N     . PRO A  1  257  ? 219.091 278.499 243.272 1.00 0.00 ? 257  PRO A N     1 
ATOM   1773  C  CA    . PRO A  1  257  ? 217.695 278.917 243.409 1.00 0.00 ? 257  PRO A CA    1 
ATOM   1774  C  C     . PRO A  1  257  ? 216.961 278.922 242.078 1.00 0.00 ? 257  PRO A C     1 
ATOM   1775  O  O     . PRO A  1  257  ? 217.577 278.974 241.019 1.00 0.00 ? 257  PRO A O     1 
ATOM   1776  C  CB    . PRO A  1  257  ? 217.800 280.325 244.001 1.00 0.00 ? 257  PRO A CB    1 
ATOM   1777  C  CG    . PRO A  1  257  ? 219.134 280.790 243.657 1.00 0.00 ? 257  PRO A CG    1 
ATOM   1778  C  CD    . PRO A  1  257  ? 220.030 279.601 243.527 1.00 0.00 ? 257  PRO A CD    1 
ATOM   1779  N  N     . LEU A  1  258  ? 215.640 278.872 242.154 1.00 0.00 ? 258  LEU A N     1 
ATOM   1780  C  CA    . LEU A  1  258  ? 214.794 278.690 240.988 1.00 0.00 ? 258  LEU A CA    1 
ATOM   1781  C  C     . LEU A  1  258  ? 214.960 279.779 239.929 1.00 0.00 ? 258  LEU A C     1 
ATOM   1782  O  O     . LEU A  1  258  ? 214.854 279.492 238.748 1.00 0.00 ? 258  LEU A O     1 
ATOM   1783  C  CB    . LEU A  1  258  ? 213.337 278.603 241.426 1.00 0.00 ? 258  LEU A CB    1 
ATOM   1784  C  CG    . LEU A  1  258  ? 212.453 277.747 240.520 1.00 0.00 ? 258  LEU A CG    1 
ATOM   1785  C  CD1   . LEU A  1  258  ? 212.976 276.305 240.498 1.00 0.00 ? 258  LEU A CD1   1 
ATOM   1786  C  CD2   . LEU A  1  258  ? 210.999 277.773 240.973 1.00 0.00 ? 258  LEU A CD2   1 
ATOM   1787  N  N     . SER A  1  259  ? 215.208 281.018 240.354 1.00 0.00 ? 259  SER A N     1 
ATOM   1788  C  CA    . SER A  1  259  ? 215.544 282.122 239.442 1.00 0.00 ? 259  SER A CA    1 
ATOM   1789  C  C     . SER A  1  259  ? 216.672 281.768 238.483 1.00 0.00 ? 259  SER A C     1 
ATOM   1790  O  O     . SER A  1  259  ? 216.816 282.423 237.463 1.00 0.00 ? 259  SER A O     1 
ATOM   1791  C  CB    . SER A  1  259  ? 215.876 283.422 240.185 1.00 0.00 ? 259  SER A CB    1 
ATOM   1792  O  OG    . SER A  1  259  ? 216.935 283.268 241.093 1.00 0.00 ? 259  SER A OG    1 
ATOM   1793  N  N     . VAL A  1  260  ? 217.546 280.838 238.850 1.00 0.00 ? 260  VAL A N     1 
ATOM   1794  C  CA    . VAL A  1  260  ? 218.557 280.383 237.897 1.00 0.00 ? 260  VAL A CA    1 
ATOM   1795  C  C     . VAL A  1  260  ? 217.977 279.374 236.887 1.00 0.00 ? 260  VAL A C     1 
ATOM   1796  O  O     . VAL A  1  260  ? 218.481 279.244 235.778 1.00 0.00 ? 260  VAL A O     1 
ATOM   1797  C  CB    . VAL A  1  260  ? 219.769 279.765 238.606 1.00 0.00 ? 260  VAL A CB    1 
ATOM   1798  C  CG1   . VAL A  1  260  ? 220.869 279.424 237.604 1.00 0.00 ? 260  VAL A CG1   1 
ATOM   1799  C  CG2   . VAL A  1  260  ? 220.297 280.722 239.654 1.00 0.00 ? 260  VAL A CG2   1 
ATOM   1800  N  N     . ARG A  1  261  ? 216.922 278.663 237.263 1.00 0.00 ? 261  ARG A N     1 
ATOM   1801  C  CA    . ARG A  1  261  ? 216.315 277.661 236.379 1.00 0.00 ? 261  ARG A CA    1 
ATOM   1802  C  C     . ARG A  1  261  ? 214.802 277.875 236.213 1.00 0.00 ? 261  ARG A C     1 
ATOM   1803  O  O     . ARG A  1  261  ? 214.006 277.008 236.549 1.00 0.00 ? 261  ARG A O     1 
ATOM   1804  C  CB    . ARG A  1  261  ? 216.601 276.280 236.947 1.00 0.00 ? 261  ARG A CB    1 
ATOM   1805  C  CG    . ARG A  1  261  ? 216.254 276.210 238.431 1.00 0.00 ? 261  ARG A CG    1 
ATOM   1806  C  CD    . ARG A  1  261  ? 216.835 275.016 239.129 1.00 0.00 ? 261  ARG A CD    1 
ATOM   1807  N  NE    . ARG A  1  261  ? 216.522 275.095 240.544 1.00 0.00 ? 261  ARG A NE    1 
ATOM   1808  C  CZ    . ARG A  1  261  ? 216.257 274.048 241.301 1.00 0.00 ? 261  ARG A CZ    1 
ATOM   1809  N  NH1   . ARG A  1  261  ? 216.271 272.836 240.769 1.00 0.00 ? 261  ARG A NH1   1 
ATOM   1810  N  NH2   . ARG A  1  261  ? 215.980 274.215 242.584 1.00 0.00 ? 261  ARG A NH2   1 
ATOM   1811  N  N     . PRO A  1  262  ? 214.434 279.032 235.670 1.00 0.00 ? 262  PRO A N     1 
ATOM   1812  C  CA    . PRO A  1  262  ? 213.026 279.369 235.436 1.00 0.00 ? 262  PRO A CA    1 
ATOM   1813  C  C     . PRO A  1  262  ? 212.413 278.472 234.365 1.00 0.00 ? 262  PRO A C     1 
ATOM   1814  O  O     . PRO A  1  262  ? 211.437 278.855 233.719 1.00 0.00 ? 262  PRO A O     1 
ATOM   1815  C  CB    . PRO A  1  262  ? 213.095 280.813 234.938 1.00 0.00 ? 262  PRO A CB    1 
ATOM   1816  C  CG    . PRO A  1  262  ? 214.435 280.918 234.295 1.00 0.00 ? 262  PRO A CG    1 
ATOM   1817  C  CD    . PRO A  1  262  ? 215.348 280.039 235.103 1.00 0.00 ? 262  PRO A CD    1 
ATOM   1818  N  N     . ALA A  1  263  ? 213.001 277.293 234.183 1.00 0.00 ? 263  ALA A N     1 
ATOM   1819  C  CA    . ALA A  1  263  ? 212.532 276.311 233.207 1.00 0.00 ? 263  ALA A CA    1 
ATOM   1820  C  C     . ALA A  1  263  ? 212.348 276.856 231.789 1.00 0.00 ? 263  ALA A C     1 
ATOM   1821  O  O     . ALA A  1  263  ? 213.209 276.667 230.929 1.00 0.00 ? 263  ALA A O     1 
ATOM   1822  C  CB    . ALA A  1  263  ? 211.252 275.643 233.694 1.00 0.00 ? 263  ALA A CB    1 
ATOM   1823  N  N     . VAL A  1  264  ? 211.227 277.529 231.551 1.00 0.00 ? 264  VAL A N     1 
ATOM   1824  C  CA    . VAL A  1  264  ? 210.922 278.061 230.230 1.00 0.00 ? 264  VAL A CA    1 
ATOM   1825  C  C     . VAL A  1  264  ? 209.489 277.835 229.784 1.00 0.00 ? 264  VAL A C     1 
ATOM   1826  O  O     . VAL A  1  264  ? 209.103 278.289 228.712 1.00 0.00 ? 264  VAL A O     1 
ATOM   1827  C  CB    . VAL A  1  264  ? 211.844 277.448 229.168 1.00 0.00 ? 264  VAL A CB    1 
ATOM   1828  C  CG1   . VAL A  1  264  ? 213.309 277.733 229.485 1.00 0.00 ? 264  VAL A CG1   1 
ATOM   1829  C  CG2   . VAL A  1  264  ? 211.594 275.959 229.050 1.00 0.00 ? 264  VAL A CG2   1 
ATOM   1830  N  N     . VAL A  1  265  ? 208.704 277.174 230.630 1.00 0.00 ? 265  VAL A N     1 
ATOM   1831  C  CA    . VAL A  1  265  ? 207.371 276.652 230.291 1.00 0.00 ? 265  VAL A CA    1 
ATOM   1832  C  C     . VAL A  1  265  ? 207.130 276.377 228.796 1.00 0.00 ? 265  VAL A C     1 
ATOM   1833  O  O     . VAL A  1  265  ? 207.060 275.216 228.391 1.00 0.00 ? 265  VAL A O     1 
ATOM   1834  C  CB    . VAL A  1  265  ? 206.228 277.573 230.821 1.00 0.00 ? 265  VAL A CB    1 
ATOM   1835  C  CG1   . VAL A  1  265  ? 205.940 277.264 232.293 1.00 0.00 ? 265  VAL A CG1   1 
ATOM   1836  C  CG2   . VAL A  1  265  ? 206.551 279.044 230.642 1.00 0.00 ? 265  VAL A CG2   1 
ATOM   1837  N  N     . MET A  1  266  ? 207.021 277.432 227.989 1.00 0.00 ? 266  MET A N     1 
ATOM   1838  C  CA    . MET A  1  266  ? 206.792 277.310 226.545 1.00 0.00 ? 266  MET A CA    1 
ATOM   1839  C  C     . MET A  1  266  ? 205.494 276.533 226.314 1.00 0.00 ? 266  MET A C     1 
ATOM   1840  O  O     . MET A  1  266  ? 205.515 275.352 225.955 1.00 0.00 ? 266  MET A O     1 
ATOM   1841  C  CB    . MET A  1  266  ? 207.988 276.636 225.846 1.00 0.00 ? 266  MET A CB    1 
ATOM   1842  C  CG    . MET A  1  266  ? 207.852 276.471 224.323 1.00 0.00 ? 266  MET A CG    1 
ATOM   1843  S  SD    . MET A  1  266  ? 209.092 275.369 223.602 1.00 0.00 ? 266  MET A SD    1 
ATOM   1844  C  CE    . MET A  1  266  ? 208.522 275.248 221.907 1.00 0.00 ? 266  MET A CE    1 
ATOM   1845  N  N     . GLN A  1  267  ? 204.373 277.219 226.539 1.00 0.00 ? 267  GLN A N     1 
ATOM   1846  C  CA    . GLN A  1  267  ? 203.035 276.620 226.527 1.00 0.00 ? 267  GLN A CA    1 
ATOM   1847  C  C     . GLN A  1  267  ? 202.922 275.518 227.581 1.00 0.00 ? 267  GLN A C     1 
ATOM   1848  O  O     . GLN A  1  267  ? 203.651 275.527 228.576 1.00 0.00 ? 267  GLN A O     1 
ATOM   1849  C  CB    . GLN A  1  267  ? 202.685 276.067 225.139 1.00 0.00 ? 267  GLN A CB    1 
ATOM   1850  C  CG    . GLN A  1  267  ? 202.344 277.131 224.107 1.00 0.00 ? 267  GLN A CG    1 
ATOM   1851  C  CD    . GLN A  1  267  ? 203.569 277.892 223.625 1.00 0.00 ? 267  GLN A CD    1 
ATOM   1852  O  OE1   . GLN A  1  267  ? 204.667 277.340 223.553 1.00 0.00 ? 267  GLN A OE1   1 
ATOM   1853  N  NE2   . GLN A  1  267  ? 203.384 279.165 223.295 1.00 0.00 ? 267  GLN A NE2   1 
ATOM   1854  N  N     . GLY A  1  268  ? 201.974 274.608 227.396 1.00 0.00 ? 268  GLY A N     1 
ATOM   1855  C  CA    . GLY A  1  268  ? 201.767 273.577 228.391 1.00 0.00 ? 268  GLY A CA    1 
ATOM   1856  C  C     . GLY A  1  268  ? 201.764 274.270 229.745 1.00 0.00 ? 268  GLY A C     1 
ATOM   1857  O  O     . GLY A  1  268  ? 201.262 275.389 229.877 1.00 0.00 ? 268  GLY A O     1 
ATOM   1858  N  N     . SER A  1  269  ? 202.334 273.607 230.745 1.00 0.00 ? 269  SER A N     1 
ATOM   1859  C  CA    . SER A  1  269  ? 202.429 274.141 232.100 1.00 0.00 ? 269  SER A CA    1 
ATOM   1860  C  C     . SER A  1  269  ? 203.425 273.273 232.841 1.00 0.00 ? 269  SER A C     1 
ATOM   1861  O  O     . SER A  1  269  ? 203.162 272.090 233.061 1.00 0.00 ? 269  SER A O     1 
ATOM   1862  C  CB    . SER A  1  269  ? 201.074 274.084 232.809 1.00 0.00 ? 269  SER A CB    1 
ATOM   1863  O  OG    . SER A  1  269  ? 200.581 272.757 232.861 1.00 0.00 ? 269  SER A OG    1 
ATOM   1864  N  N     . ALA A  1  270  ? 204.558 273.856 233.190 1.00 0.00 ? 270  ALA A N     1 
ATOM   1865  C  CA    . ALA A  1  270  ? 205.582 273.107 233.871 1.00 0.00 ? 270  ALA A CA    1 
ATOM   1866  C  C     . ALA A  1  270  ? 206.371 272.308 232.847 1.00 0.00 ? 270  ALA A C     1 
ATOM   1867  O  O     . ALA A  1  270  ? 207.457 271.822 233.164 1.00 0.00 ? 270  ALA A O     1 
ATOM   1868  C  CB    . ALA A  1  270  ? 204.963 272.183 234.907 1.00 0.00 ? 270  ALA A CB    1 
ATOM   1869  N  N     . ARG A  1  271  ? 205.862 272.155 231.620 1.00 0.00 ? 271  ARG A N     1 
ATOM   1870  C  CA    . ARG A  1  271  ? 206.676 271.385 230.692 1.00 0.00 ? 271  ARG A CA    1 
ATOM   1871  C  C     . ARG A  1  271  ? 207.719 272.422 230.666 1.00 0.00 ? 271  ARG A C     1 
ATOM   1872  O  O     . ARG A  1  271  ? 207.610 273.392 229.916 1.00 0.00 ? 271  ARG A O     1 
ATOM   1873  C  CB    . ARG A  1  271  ? 205.994 271.271 229.333 1.00 0.00 ? 271  ARG A CB    1 
ATOM   1874  C  CG    . ARG A  1  271  ? 205.657 269.846 228.925 1.00 0.00 ? 271  ARG A CG    1 
ATOM   1875  C  CD    . ARG A  1  271  ? 204.211 269.728 228.472 1.00 0.00 ? 271  ARG A CD    1 
ATOM   1876  N  NE    . ARG A  1  271  ? 203.970 270.438 227.220 1.00 0.00 ? 271  ARG A NE    1 
ATOM   1877  C  CZ    . ARG A  1  271  ? 202.769 270.609 226.677 1.00 0.00 ? 271  ARG A CZ    1 
ATOM   1878  N  NH1   . ARG A  1  271  ? 201.692 270.120 227.276 1.00 0.00 ? 271  ARG A NH1   1 
ATOM   1879  N  NH2   . ARG A  1  271  ? 202.644 271.270 225.534 1.00 0.00 ? 271  ARG A NH2   1 
ATOM   1880  N  N     . ASN A  1  272  ? 208.759 272.288 231.479 1.00 0.00 ? 272  ASN A N     1 
ATOM   1881  C  CA    . ASN A  1  272  ? 209.800 273.314 231.465 1.00 0.00 ? 272  ASN A CA    1 
ATOM   1882  C  C     . ASN A  1  272  ? 210.906 273.161 232.502 1.00 0.00 ? 272  ASN A C     1 
ATOM   1883  O  O     . ASN A  1  272  ? 211.628 274.117 232.786 1.00 0.00 ? 272  ASN A O     1 
ATOM   1884  C  CB    . ASN A  1  272  ? 209.171 274.706 231.584 1.00 0.00 ? 272  ASN A CB    1 
ATOM   1885  C  CG    . ASN A  1  272  ? 209.336 275.529 230.322 1.00 0.00 ? 272  ASN A CG    1 
ATOM   1886  O  OD1   . ASN A  1  272  ? 209.124 275.037 229.213 1.00 0.00 ? 272  ASN A OD1   1 
ATOM   1887  N  ND2   . ASN A  1  272  ? 209.716 276.791 230.484 1.00 0.00 ? 272  ASN A ND2   1 
ATOM   1888  N  N     . GLN A  1  273  ? 211.042 271.968 233.067 1.00 0.00 ? 273  GLN A N     1 
ATOM   1889  C  CA    . GLN A  1  273  ? 212.087 271.734 234.052 1.00 0.00 ? 273  GLN A CA    1 
ATOM   1890  C  C     . GLN A  1  273  ? 213.439 272.021 233.411 1.00 0.00 ? 273  GLN A C     1 
ATOM   1891  O  O     . GLN A  1  273  ? 213.818 271.364 232.441 1.00 0.00 ? 273  GLN A O     1 
ATOM   1892  C  CB    . GLN A  1  273  ? 212.036 270.293 234.560 1.00 0.00 ? 273  GLN A CB    1 
ATOM   1893  C  CG    . GLN A  1  273  ? 211.813 269.258 233.469 1.00 0.00 ? 273  GLN A CG    1 
ATOM   1894  C  CD    . GLN A  1  273  ? 210.530 268.475 233.663 1.00 0.00 ? 273  GLN A CD    1 
ATOM   1895  O  OE1   . GLN A  1  273  ? 209.436 269.039 233.648 1.00 0.00 ? 273  GLN A OE1   1 
ATOM   1896  N  NE2   . GLN A  1  273  ? 210.657 267.166 233.847 1.00 0.00 ? 273  GLN A NE2   1 
ATOM   1897  N  N     . ASP A  1  274  ? 214.148 273.017 233.940 1.00 0.00 ? 274  ASP A N     1 
ATOM   1898  C  CA    . ASP A  1  274  ? 215.462 273.393 233.425 1.00 0.00 ? 274  ASP A CA    1 
ATOM   1899  C  C     . ASP A  1  274  ? 216.364 272.168 233.393 1.00 0.00 ? 274  ASP A C     1 
ATOM   1900  O  O     . ASP A  1  274  ? 216.932 271.776 234.413 1.00 0.00 ? 274  ASP A O     1 
ATOM   1901  C  CB    . ASP A  1  274  ? 216.087 274.488 234.289 1.00 0.00 ? 274  ASP A CB    1 
ATOM   1902  C  CG    . ASP A  1  274  ? 217.412 274.980 233.739 1.00 0.00 ? 274  ASP A CG    1 
ATOM   1903  O  OD1   . ASP A  1  274  ? 217.398 275.786 232.784 1.00 0.00 ? 274  ASP A OD1   1 
ATOM   1904  O  OD2   . ASP A  1  274  ? 218.466 274.562 234.260 1.00 0.00 ? 274  ASP A OD2   1 
ATOM   1905  N  N     . ASP A  1  275  ? 216.491 271.565 232.216 1.00 0.00 ? 275  ASP A N     1 
ATOM   1906  C  CA    . ASP A  1  275  ? 217.290 270.356 232.077 1.00 0.00 ? 275  ASP A CA    1 
ATOM   1907  C  C     . ASP A  1  275  ? 218.416 270.203 233.102 1.00 0.00 ? 275  ASP A C     1 
ATOM   1908  O  O     . ASP A  1  275  ? 218.788 269.084 233.448 1.00 0.00 ? 275  ASP A O     1 
ATOM   1909  C  CB    . ASP A  1  275  ? 217.855 270.295 230.658 1.00 0.00 ? 275  ASP A CB    1 
ATOM   1910  C  CG    . ASP A  1  275  ? 219.009 271.249 230.446 1.00 0.00 ? 275  ASP A CG    1 
ATOM   1911  O  OD1   . ASP A  1  275  ? 219.204 272.161 231.282 1.00 0.00 ? 275  ASP A OD1   1 
ATOM   1912  O  OD2   . ASP A  1  275  ? 219.720 271.088 229.432 1.00 0.00 ? 275  ASP A OD2   1 
ATOM   1913  N  N     . LEU A  1  276  ? 218.941 271.322 233.593 1.00 0.00 ? 276  LEU A N     1 
ATOM   1914  C  CA    . LEU A  1  276  ? 219.845 271.298 234.742 1.00 0.00 ? 276  LEU A CA    1 
ATOM   1915  C  C     . LEU A  1  276  ? 219.149 270.796 236.006 1.00 0.00 ? 276  LEU A C     1 
ATOM   1916  O  O     . LEU A  1  276  ? 219.743 270.081 236.813 1.00 0.00 ? 276  LEU A O     1 
ATOM   1917  C  CB    . LEU A  1  276  ? 220.440 272.684 234.980 1.00 0.00 ? 276  LEU A CB    1 
ATOM   1918  C  CG    . LEU A  1  276  ? 221.546 272.777 236.026 1.00 0.00 ? 276  LEU A CG    1 
ATOM   1919  C  CD1   . LEU A  1  276  ? 222.599 273.766 235.559 1.00 0.00 ? 276  LEU A CD1   1 
ATOM   1920  C  CD2   . LEU A  1  276  ? 220.978 273.201 237.370 1.00 0.00 ? 276  LEU A CD2   1 
ATOM   1921  N  N     . THR A  1  277  ? 217.898 271.200 236.186 1.00 0.00 ? 277  THR A N     1 
ATOM   1922  C  CA    . THR A  1  277  ? 217.045 270.633 237.222 1.00 0.00 ? 277  THR A CA    1 
ATOM   1923  C  C     . THR A  1  277  ? 216.868 269.135 237.021 1.00 0.00 ? 277  THR A C     1 
ATOM   1924  O  O     . THR A  1  277  ? 216.953 268.363 237.968 1.00 0.00 ? 277  THR A O     1 
ATOM   1925  C  CB    . THR A  1  277  ? 215.673 271.309 237.251 1.00 0.00 ? 277  THR A CB    1 
ATOM   1926  O  OG1   . THR A  1  277  ? 215.854 272.721 237.371 1.00 0.00 ? 277  THR A OG1   1 
ATOM   1927  C  CG2   . THR A  1  277  ? 214.881 270.840 238.440 1.00 0.00 ? 277  THR A CG2   1 
ATOM   1928  N  N     . HIS A  1  278  ? 216.640 268.734 235.777 1.00 0.00 ? 278  HIS A N     1 
ATOM   1929  C  CA    . HIS A  1  278  ? 216.509 267.327 235.427 1.00 0.00 ? 278  HIS A CA    1 
ATOM   1930  C  C     . HIS A  1  278  ? 217.764 266.534 235.814 1.00 0.00 ? 278  HIS A C     1 
ATOM   1931  O  O     . HIS A  1  278  ? 217.668 265.422 236.327 1.00 0.00 ? 278  HIS A O     1 
ATOM   1932  C  CB    . HIS A  1  278  ? 216.199 267.162 233.942 1.00 0.00 ? 278  HIS A CB    1 
ATOM   1933  C  CG    . HIS A  1  278  ? 215.527 265.864 233.620 1.00 0.00 ? 278  HIS A CG    1 
ATOM   1934  N  ND1   . HIS A  1  278  ? 215.713 265.198 232.431 1.00 0.00 ? 278  HIS A ND1   1 
ATOM   1935  C  CD2   . HIS A  1  278  ? 214.650 265.119 234.336 1.00 0.00 ? 278  HIS A CD2   1 
ATOM   1936  C  CE1   . HIS A  1  278  ? 214.996 264.087 232.433 1.00 0.00 ? 278  HIS A CE1   1 
ATOM   1937  N  NE2   . HIS A  1  278  ? 214.337 264.019 233.576 1.00 0.00 ? 278  HIS A NE2   1 
ATOM   1938  N  N     . LYS A  1  279  ? 218.934 267.114 235.586 1.00 0.00 ? 279  LYS A N     1 
ATOM   1939  C  CA    . LYS A  1  279  ? 220.173 266.544 236.114 1.00 0.00 ? 279  LYS A CA    1 
ATOM   1940  C  C     . LYS A  1  279  ? 220.223 266.595 237.635 1.00 0.00 ? 279  LYS A C     1 
ATOM   1941  O  O     . LYS A  1  279  ? 220.692 265.654 238.265 1.00 0.00 ? 279  LYS A O     1 
ATOM   1942  C  CB    . LYS A  1  279  ? 221.388 267.283 235.548 1.00 0.00 ? 279  LYS A CB    1 
ATOM   1943  C  CG    . LYS A  1  279  ? 222.739 266.835 236.107 1.00 0.00 ? 279  LYS A CG    1 
ATOM   1944  C  CD    . LYS A  1  279  ? 222.974 265.336 236.007 1.00 0.00 ? 279  LYS A CD    1 
ATOM   1945  C  CE    . LYS A  1  279  ? 223.034 264.875 234.566 1.00 0.00 ? 279  LYS A CE    1 
ATOM   1946  N  NZ    . LYS A  1  279  ? 222.982 263.400 234.455 1.00 0.00 ? 279  LYS A NZ    1 
ATOM   1947  N  N     . LEU A  1  280  ? 219.724 267.669 238.232 1.00 0.00 ? 280  LEU A N     1 
ATOM   1948  C  CA    . LEU A  1  280  ? 219.701 267.762 239.685 1.00 0.00 ? 280  LEU A CA    1 
ATOM   1949  C  C     . LEU A  1  280  ? 218.768 266.703 240.272 1.00 0.00 ? 280  LEU A C     1 
ATOM   1950  O  O     . LEU A  1  280  ? 219.035 266.155 241.337 1.00 0.00 ? 280  LEU A O     1 
ATOM   1951  C  CB    . LEU A  1  280  ? 219.278 269.159 240.129 1.00 0.00 ? 280  LEU A CB    1 
ATOM   1952  C  CG    . LEU A  1  280  ? 219.418 269.435 241.622 1.00 0.00 ? 280  LEU A CG    1 
ATOM   1953  C  CD1   . LEU A  1  280  ? 220.824 269.130 242.082 1.00 0.00 ? 280  LEU A CD1   1 
ATOM   1954  C  CD2   . LEU A  1  280  ? 219.066 270.863 241.912 1.00 0.00 ? 280  LEU A CD2   1 
ATOM   1955  N  N     . ALA A  1  281  ? 217.690 266.399 239.556 1.00 0.00 ? 281  ALA A N     1 
ATOM   1956  C  CA    . ALA A  1  281  ? 216.788 265.312 239.928 1.00 0.00 ? 281  ALA A CA    1 
ATOM   1957  C  C     . ALA A  1  281  ? 217.477 263.954 239.865 1.00 0.00 ? 281  ALA A C     1 
ATOM   1958  O  O     . ALA A  1  281  ? 217.216 263.084 240.690 1.00 0.00 ? 281  ALA A O     1 
ATOM   1959  C  CB    . ALA A  1  281  ? 215.556 265.317 239.038 1.00 0.00 ? 281  ALA A CB    1 
ATOM   1960  N  N     . ASP A  1  282  ? 218.341 263.761 238.877 1.00 0.00 ? 282  ASP A N     1 
ATOM   1961  C  CA    . ASP A  1  282  ? 219.143 262.547 238.820 1.00 0.00 ? 282  ASP A CA    1 
ATOM   1962  C  C     . ASP A  1  282  ? 220.104 262.386 240.002 1.00 0.00 ? 282  ASP A C     1 
ATOM   1963  O  O     . ASP A  1  282  ? 220.184 261.310 240.583 1.00 0.00 ? 282  ASP A O     1 
ATOM   1964  C  CB    . ASP A  1  282  ? 219.950 262.517 237.524 1.00 0.00 ? 282  ASP A CB    1 
ATOM   1965  C  CG    . ASP A  1  282  ? 220.484 261.136 237.203 1.00 0.00 ? 282  ASP A CG    1 
ATOM   1966  O  OD1   . ASP A  1  282  ? 220.150 260.188 237.942 1.00 0.00 ? 282  ASP A OD1   1 
ATOM   1967  O  OD2   . ASP A  1  282  ? 221.259 261.002 236.232 1.00 0.00 ? 282  ASP A OD2   1 
ATOM   1968  N  N     . ILE A  1  283  ? 220.812 263.448 240.368 1.00 0.00 ? 283  ILE A N     1 
ATOM   1969  C  CA    . ILE A  1  283  ? 221.669 263.427 241.554 1.00 0.00 ? 283  ILE A CA    1 
ATOM   1970  C  C     . ILE A  1  283  ? 220.920 263.078 242.833 1.00 0.00 ? 283  ILE A C     1 
ATOM   1971  O  O     . ILE A  1  283  ? 221.357 262.211 243.586 1.00 0.00 ? 283  ILE A O     1 
ATOM   1972  C  CB    . ILE A  1  283  ? 222.389 264.762 241.754 1.00 0.00 ? 283  ILE A CB    1 
ATOM   1973  C  CG1   . ILE A  1  283  ? 223.498 264.900 240.710 1.00 0.00 ? 283  ILE A CG1   1 
ATOM   1974  C  CG2   . ILE A  1  283  ? 222.996 264.839 243.142 1.00 0.00 ? 283  ILE A CG2   1 
ATOM   1975  C  CD1   . ILE A  1  283  ? 224.061 266.303 240.564 1.00 0.00 ? 283  ILE A CD1   1 
ATOM   1976  N  N     . VAL A  1  284  ? 219.800 263.746 243.084 1.00 0.00 ? 284  VAL A N     1 
ATOM   1977  C  CA    . VAL A  1  284  ? 219.011 263.459 244.276 1.00 0.00 ? 284  VAL A CA    1 
ATOM   1978  C  C     . VAL A  1  284  ? 218.510 262.021 244.293 1.00 0.00 ? 284  VAL A C     1 
ATOM   1979  O  O     . VAL A  1  284  ? 218.555 261.366 245.331 1.00 0.00 ? 284  VAL A O     1 
ATOM   1980  C  CB    . VAL A  1  284  ? 217.798 264.406 244.394 1.00 0.00 ? 284  VAL A CB    1 
ATOM   1981  C  CG1   . VAL A  1  284  ? 216.886 263.982 245.535 1.00 0.00 ? 284  VAL A CG1   1 
ATOM   1982  C  CG2   . VAL A  1  284  ? 218.261 265.845 244.571 1.00 0.00 ? 284  VAL A CG2   1 
ATOM   1983  N  N     . LYS A  1  285  ? 218.061 261.524 243.145 1.00 0.00 ? 285  LYS A N     1 
ATOM   1984  C  CA    . LYS A  1  285  ? 217.543 260.160 243.058 1.00 0.00 ? 285  LYS A CA    1 
ATOM   1985  C  C     . LYS A  1  285  ? 218.561 259.085 243.456 1.00 0.00 ? 285  LYS A C     1 
ATOM   1986  O  O     . LYS A  1  285  ? 218.260 258.214 244.270 1.00 0.00 ? 285  LYS A O     1 
ATOM   1987  C  CB    . LYS A  1  285  ? 217.030 259.873 241.648 1.00 0.00 ? 285  LYS A CB    1 
ATOM   1988  C  CG    . LYS A  1  285  ? 216.770 258.403 241.405 1.00 0.00 ? 285  LYS A CG    1 
ATOM   1989  C  CD    . LYS A  1  285  ? 216.014 258.162 240.120 1.00 0.00 ? 285  LYS A CD    1 
ATOM   1990  C  CE    . LYS A  1  285  ? 215.558 256.720 240.054 1.00 0.00 ? 285  LYS A CE    1 
ATOM   1991  N  NZ    . LYS A  1  285  ? 216.709 255.803 239.848 1.00 0.00 ? 285  LYS A NZ    1 
ATOM   1992  N  N     . ILE A  1  286  ? 219.763 259.146 242.889 1.00 0.00 ? 286  ILE A N     1 
ATOM   1993  C  CA    . ILE A  1  286  ? 220.803 258.173 243.219 1.00 0.00 ? 286  ILE A CA    1 
ATOM   1994  C  C     . ILE A  1  286  ? 221.326 258.371 244.636 1.00 0.00 ? 286  ILE A C     1 
ATOM   1995  O  O     . ILE A  1  286  ? 221.659 257.402 245.309 1.00 0.00 ? 286  ILE A O     1 
ATOM   1996  C  CB    . ILE A  1  286  ? 221.968 258.208 242.219 1.00 0.00 ? 286  ILE A CB    1 
ATOM   1997  C  CG1   . ILE A  1  286  ? 222.714 259.537 242.293 1.00 0.00 ? 286  ILE A CG1   1 
ATOM   1998  C  CG2   . ILE A  1  286  ? 221.455 257.980 240.813 1.00 0.00 ? 286  ILE A CG2   1 
ATOM   1999  C  CD1   . ILE A  1  286  ? 224.026 259.527 241.564 1.00 0.00 ? 286  ILE A CD1   1 
ATOM   2000  N  N     . ASN A  1  287  ? 221.426 259.616 245.082 1.00 0.00 ? 287  ASN A N     1 
ATOM   2001  C  CA    . ASN A  1  287  ? 221.861 259.867 246.445 1.00 0.00 ? 287  ASN A CA    1 
ATOM   2002  C  C     . ASN A  1  287  ? 220.865 259.382 247.478 1.00 0.00 ? 287  ASN A C     1 
ATOM   2003  O  O     . ASN A  1  287  ? 221.249 258.922 248.548 1.00 0.00 ? 287  ASN A O     1 
ATOM   2004  C  CB    . ASN A  1  287  ? 222.120 261.345 246.672 1.00 0.00 ? 287  ASN A CB    1 
ATOM   2005  C  CG    . ASN A  1  287  ? 222.735 261.611 248.022 1.00 0.00 ? 287  ASN A CG    1 
ATOM   2006  O  OD1   . ASN A  1  287  ? 223.770 261.039 248.368 1.00 0.00 ? 287  ASN A OD1   1 
ATOM   2007  N  ND2   . ASN A  1  287  ? 222.101 262.482 248.798 1.00 0.00 ? 287  ASN A ND2   1 
ATOM   2008  N  N     . ASN A  1  288  ? 219.584 259.501 247.159 1.00 0.00 ? 288  ASN A N     1 
ATOM   2009  C  CA    . ASN A  1  288  ? 218.544 258.872 247.949 1.00 0.00 ? 288  ASN A CA    1 
ATOM   2010  C  C     . ASN A  1  288  ? 218.741 257.359 247.986 1.00 0.00 ? 288  ASN A C     1 
ATOM   2011  O  O     . ASN A  1  288  ? 218.624 256.743 249.044 1.00 0.00 ? 288  ASN A O     1 
ATOM   2012  C  CB    . ASN A  1  288  ? 217.168 259.254 247.384 1.00 0.00 ? 288  ASN A CB    1 
ATOM   2013  C  CG    . ASN A  1  288  ? 216.021 258.451 247.982 1.00 0.00 ? 288  ASN A CG    1 
ATOM   2014  O  OD1   . ASN A  1  288  ? 216.000 257.221 247.943 1.00 0.00 ? 288  ASN A OD1   1 
ATOM   2015  N  ND2   . ASN A  1  288  ? 215.043 259.162 248.533 1.00 0.00 ? 288  ASN A ND2   1 
ATOM   2016  N  N     . GLN A  1  289  ? 219.072 256.770 246.838 1.00 0.00 ? 289  GLN A N     1 
ATOM   2017  C  CA    . GLN A  1  289  ? 219.251 255.320 246.738 1.00 0.00 ? 289  GLN A CA    1 
ATOM   2018  C  C     . GLN A  1  289  ? 220.478 254.811 247.482 1.00 0.00 ? 289  GLN A C     1 
ATOM   2019  O  O     . GLN A  1  289  ? 220.417 253.787 248.159 1.00 0.00 ? 289  GLN A O     1 
ATOM   2020  C  CB    . GLN A  1  289  ? 219.356 254.896 245.269 1.00 0.00 ? 289  GLN A CB    1 
ATOM   2021  C  CG    . GLN A  1  289  ? 219.406 253.387 245.053 1.00 0.00 ? 289  GLN A CG    1 
ATOM   2022  C  CD    . GLN A  1  289  ? 219.441 253.006 243.586 1.00 0.00 ? 289  GLN A CD    1 
ATOM   2023  O  OE1   . GLN A  1  289  ? 218.584 253.413 242.803 1.00 0.00 ? 289  GLN A OE1   1 
ATOM   2024  N  NE2   . GLN A  1  289  ? 220.436 252.210 243.208 1.00 0.00 ? 289  GLN A NE2   1 
ATOM   2025  N  N     . LEU A  1  290  ? 221.589 255.522 247.345 1.00 0.00 ? 290  LEU A N     1 
ATOM   2026  C  CA    . LEU A  1  290  ? 222.800 255.188 248.078 1.00 0.00 ? 290  LEU A CA    1 
ATOM   2027  C  C     . LEU A  1  290  ? 222.602 255.385 249.575 1.00 0.00 ? 290  LEU A C     1 
ATOM   2028  O  O     . LEU A  1  290  ? 223.133 254.630 250.380 1.00 0.00 ? 290  LEU A O     1 
ATOM   2029  C  CB    . LEU A  1  290  ? 223.972 256.038 247.584 1.00 0.00 ? 290  LEU A CB    1 
ATOM   2030  C  CG    . LEU A  1  290  ? 225.304 255.876 248.320 1.00 0.00 ? 290  LEU A CG    1 
ATOM   2031  C  CD1   . LEU A  1  290  ? 225.724 254.419 248.343 1.00 0.00 ? 290  LEU A CD1   1 
ATOM   2032  C  CD2   . LEU A  1  290  ? 226.388 256.735 247.688 1.00 0.00 ? 290  LEU A CD2   1 
ATOM   2033  N  N     . ARG A  1  291  ? 221.841 256.409 249.944 1.00 0.00 ? 291  ARG A N     1 
ATOM   2034  C  CA    . ARG A  1  291  ? 221.433 256.587 251.330 1.00 0.00 ? 291  ARG A CA    1 
ATOM   2035  C  C     . ARG A  1  291  ? 220.614 255.396 251.832 1.00 0.00 ? 291  ARG A C     1 
ATOM   2036  O  O     . ARG A  1  291  ? 220.878 254.873 252.913 1.00 0.00 ? 291  ARG A O     1 
ATOM   2037  C  CB    . ARG A  1  291  ? 220.656 257.890 251.483 1.00 0.00 ? 291  ARG A CB    1 
ATOM   2038  C  CG    . ARG A  1  291  ? 220.273 258.213 252.903 1.00 0.00 ? 291  ARG A CG    1 
ATOM   2039  C  CD    . ARG A  1  291  ? 219.657 259.594 252.990 1.00 0.00 ? 291  ARG A CD    1 
ATOM   2040  N  NE    . ARG A  1  291  ? 219.137 259.866 254.325 1.00 0.00 ? 291  ARG A NE    1 
ATOM   2041  C  CZ    . ARG A  1  291  ? 219.872 260.335 255.329 1.00 0.00 ? 291  ARG A CZ    1 
ATOM   2042  N  NH1   . ARG A  1  291  ? 221.160 260.603 255.143 1.00 0.00 ? 291  ARG A NH1   1 
ATOM   2043  N  NH2   . ARG A  1  291  ? 219.344 260.460 256.540 1.00 0.00 ? 291  ARG A NH2   1 
ATOM   2044  N  N     . ARG A  1  292  ? 219.621 254.976 251.050 1.00 0.00 ? 292  ARG A N     1 
ATOM   2045  C  CA    . ARG A  1  292  ? 218.768 253.839 251.414 1.00 0.00 ? 292  ARG A CA    1 
ATOM   2046  C  C     . ARG A  1  292  ? 219.571 252.548 251.436 1.00 0.00 ? 292  ARG A C     1 
ATOM   2047  O  O     . ARG A  1  292  ? 219.288 251.628 252.201 1.00 0.00 ? 292  ARG A O     1 
ATOM   2048  C  CB    . ARG A  1  292  ? 217.610 253.657 250.436 1.00 0.00 ? 292  ARG A CB    1 
ATOM   2049  C  CG    . ARG A  1  292  ? 216.492 254.665 250.503 1.00 0.00 ? 292  ARG A CG    1 
ATOM   2050  C  CD    . ARG A  1  292  ? 215.391 254.174 249.584 1.00 0.00 ? 292  ARG A CD    1 
ATOM   2051  N  NE    . ARG A  1  292  ? 215.792 254.267 248.185 1.00 0.00 ? 292  ARG A NE    1 
ATOM   2052  C  CZ    . ARG A  1  292  ? 215.769 253.247 247.333 1.00 0.00 ? 292  ARG A CZ    1 
ATOM   2053  N  NH1   . ARG A  1  292  ? 215.411 252.039 247.754 1.00 0.00 ? 292  ARG A NH1   1 
ATOM   2054  N  NH2   . ARG A  1  292  ? 216.036 253.443 246.049 1.00 0.00 ? 292  ARG A NH2   1 
ATOM   2055  N  N     . ASN A  1  293  ? 220.580 252.508 250.574 1.00 0.00 ? 293  ASN A N     1 
ATOM   2056  C  CA    . ASN A  1  293  ? 221.528 251.407 250.484 1.00 0.00 ? 293  ASN A CA    1 
ATOM   2057  C  C     . ASN A  1  293  ? 222.325 251.282 251.782 1.00 0.00 ? 293  ASN A C     1 
ATOM   2058  O  O     . ASN A  1  293  ? 222.497 250.182 252.307 1.00 0.00 ? 293  ASN A O     1 
ATOM   2059  C  CB    . ASN A  1  293  ? 222.457 251.619 249.281 1.00 0.00 ? 293  ASN A CB    1 
ATOM   2060  C  CG    . ASN A  1  293  ? 223.361 250.428 249.007 1.00 0.00 ? 293  ASN A CG    1 
ATOM   2061  O  OD1   . ASN A  1  293  ? 223.444 249.499 249.798 1.00 0.00 ? 293  ASN A OD1   1 
ATOM   2062  N  ND2   . ASN A  1  293  ? 224.044 250.460 247.870 1.00 0.00 ? 293  ASN A ND2   1 
ATOM   2063  N  N     . GLU A  1  294  ? 222.799 252.409 252.303 1.00 0.00 ? 294  GLU A N     1 
ATOM   2064  C  CA    . GLU A  1  294  ? 223.426 252.421 253.620 1.00 0.00 ? 294  GLU A CA    1 
ATOM   2065  C  C     . GLU A  1  294  ? 222.436 252.041 254.714 1.00 0.00 ? 294  GLU A C     1 
ATOM   2066  O  O     . GLU A  1  294  ? 222.790 251.323 255.648 1.00 0.00 ? 294  GLU A O     1 
ATOM   2067  C  CB    . GLU A  1  294  ? 224.004 253.801 253.922 1.00 0.00 ? 294  GLU A CB    1 
ATOM   2068  C  CG    . GLU A  1  294  ? 224.812 253.869 255.204 1.00 0.00 ? 294  GLU A CG    1 
ATOM   2069  C  CD    . GLU A  1  294  ? 225.757 255.053 255.230 1.00 0.00 ? 294  GLU A CD    1 
ATOM   2070  O  OE1   . GLU A  1  294  ? 225.644 255.923 254.338 1.00 0.00 ? 294  GLU A OE1   1 
ATOM   2071  O  OE2   . GLU A  1  294  ? 226.605 255.117 256.144 1.00 0.00 ? 294  GLU A OE2   1 
ATOM   2072  N  N     . GLN A  1  295  ? 221.202 252.527 254.607 1.00 0.00 ? 295  GLN A N     1 
ATOM   2073  C  CA    . GLN A  1  295  ? 220.163 252.159 255.562 1.00 0.00 ? 295  GLN A CA    1 
ATOM   2074  C  C     . GLN A  1  295  ? 219.883 250.665 255.481 1.00 0.00 ? 295  GLN A C     1 
ATOM   2075  O  O     . GLN A  1  295  ? 219.775 249.979 256.499 1.00 0.00 ? 295  GLN A O     1 
ATOM   2076  C  CB    . GLN A  1  295  ? 218.874 252.940 255.311 1.00 0.00 ? 295  GLN A CB    1 
ATOM   2077  C  CG    . GLN A  1  295  ? 217.793 252.671 256.350 1.00 0.00 ? 295  GLN A CG    1 
ATOM   2078  C  CD    . GLN A  1  295  ? 216.706 253.726 256.356 1.00 0.00 ? 295  GLN A CD    1 
ATOM   2079  O  OE1   . GLN A  1  295  ? 216.716 254.650 255.542 1.00 0.00 ? 295  GLN A OE1   1 
ATOM   2080  N  NE2   . GLN A  1  295  ? 215.755 253.591 257.275 1.00 0.00 ? 295  GLN A NE2   1 
ATOM   2081  N  N     . ASN A  1  296  ? 219.769 250.171 254.252 1.00 0.00 ? 296  ASN A N     1 
ATOM   2082  C  CA    . ASN A  1  296  ? 219.442 248.774 254.006 1.00 0.00 ? 296  ASN A CA    1 
ATOM   2083  C  C     . ASN A  1  296  ? 220.695 247.919 253.861 1.00 0.00 ? 296  ASN A C     1 
ATOM   2084  O  O     . ASN A  1  296  ? 221.740 248.220 254.439 1.00 0.00 ? 296  ASN A O     1 
ATOM   2085  C  CB    . ASN A  1  296  ? 218.577 248.646 252.749 1.00 0.00 ? 296  ASN A CB    1 
ATOM   2086  C  CG    . ASN A  1  296  ? 217.205 249.271 252.917 1.00 0.00 ? 296  ASN A CG    1 
ATOM   2087  O  OD1   . ASN A  1  296  ? 216.791 250.113 252.116 1.00 0.00 ? 296  ASN A OD1   1 
ATOM   2088  N  ND2   . ASN A  1  296  ? 216.494 248.867 253.964 1.00 0.00 ? 296  ASN A ND2   1 
ATOM   2089  N  N     . GLY A  1  297  ? 220.575 246.846 253.086 1.00 0.00 ? 297  GLY A N     1 
ATOM   2090  C  CA    . GLY A  1  297  ? 221.657 245.897 252.905 1.00 0.00 ? 297  GLY A CA    1 
ATOM   2091  C  C     . GLY A  1  297  ? 222.797 246.397 252.042 1.00 0.00 ? 297  GLY A C     1 
ATOM   2092  O  O     . GLY A  1  297  ? 222.946 245.977 250.894 1.00 0.00 ? 297  GLY A O     1 
ATOM   2093  N  N     . ALA A  1  298  ? 223.600 247.297 252.598 1.00 0.00 ? 298  ALA A N     1 
ATOM   2094  C  CA    . ALA A  1  298  ? 224.774 247.840 251.918 1.00 0.00 ? 298  ALA A CA    1 
ATOM   2095  C  C     . ALA A  1  298  ? 225.774 246.769 251.487 1.00 0.00 ? 298  ALA A C     1 
ATOM   2096  O  O     . ALA A  1  298  ? 226.246 245.993 252.311 1.00 0.00 ? 298  ALA A O     1 
ATOM   2097  C  CB    . ALA A  1  298  ? 225.458 248.860 252.812 1.00 0.00 ? 298  ALA A CB    1 
ATOM   2098  N  N     . ALA A  1  299  ? 226.099 246.742 250.196 1.00 0.00 ? 299  ALA A N     1 
ATOM   2099  C  CA    . ALA A  1  299  ? 226.960 245.696 249.646 1.00 0.00 ? 299  ALA A CA    1 
ATOM   2100  C  C     . ALA A  1  299  ? 228.435 246.054 249.787 1.00 0.00 ? 299  ALA A C     1 
ATOM   2101  O  O     . ALA A  1  299  ? 228.968 246.110 250.895 1.00 0.00 ? 299  ALA A O     1 
ATOM   2102  C  CB    . ALA A  1  299  ? 226.616 245.439 248.184 1.00 0.00 ? 299  ALA A CB    1 
ATOM   2103  N  N     . ALA A  1  300  ? 229.089 246.289 248.654 1.00 0.00 ? 300  ALA A N     1 
ATOM   2104  C  CA    . ALA A  1  300  ? 230.483 246.705 248.639 1.00 0.00 ? 300  ALA A CA    1 
ATOM   2105  C  C     . ALA A  1  300  ? 230.814 247.348 247.302 1.00 0.00 ? 300  ALA A C     1 
ATOM   2106  O  O     . ALA A  1  300  ? 230.955 248.567 247.189 1.00 0.00 ? 300  ALA A O     1 
ATOM   2107  C  CB    . ALA A  1  300  ? 231.401 245.518 248.904 1.00 0.00 ? 300  ALA A CB    1 
ATOM   2108  N  N     . HIS A  1  301  ? 230.910 246.498 246.287 1.00 0.00 ? 301  HIS A N     1 
ATOM   2109  C  CA    . HIS A  1  301  ? 231.195 246.913 244.922 1.00 0.00 ? 301  HIS A CA    1 
ATOM   2110  C  C     . HIS A  1  301  ? 230.059 247.751 244.358 1.00 0.00 ? 301  HIS A C     1 
ATOM   2111  O  O     . HIS A  1  301  ? 230.280 248.689 243.595 1.00 0.00 ? 301  HIS A O     1 
ATOM   2112  C  CB    . HIS A  1  301  ? 231.446 245.688 244.035 1.00 0.00 ? 301  HIS A CB    1 
ATOM   2113  C  CG    . HIS A  1  301  ? 230.291 244.736 243.966 1.00 0.00 ? 301  HIS A CG    1 
ATOM   2114  N  ND1   . HIS A  1  301  ? 229.755 244.128 245.081 1.00 0.00 ? 301  HIS A ND1   1 
ATOM   2115  C  CD2   . HIS A  1  301  ? 229.570 244.287 242.911 1.00 0.00 ? 301  HIS A CD2   1 
ATOM   2116  C  CE1   . HIS A  1  301  ? 228.753 243.349 244.717 1.00 0.00 ? 301  HIS A CE1   1 
ATOM   2117  N  NE2   . HIS A  1  301  ? 228.620 243.426 243.405 1.00 0.00 ? 301  HIS A NE2   1 
ATOM   2118  N  N     . VAL A  1  302  ? 228.841 247.406 244.751 1.00 0.00 ? 302  VAL A N     1 
ATOM   2119  C  CA    . VAL A  1  302  ? 227.666 248.169 244.370 1.00 0.00 ? 302  VAL A CA    1 
ATOM   2120  C  C     . VAL A  1  302  ? 227.643 249.551 245.016 1.00 0.00 ? 302  VAL A C     1 
ATOM   2121  O  O     . VAL A  1  302  ? 227.204 250.519 244.395 1.00 0.00 ? 302  VAL A O     1 
ATOM   2122  C  CB    . VAL A  1  302  ? 226.380 247.414 244.747 1.00 0.00 ? 302  VAL A CB    1 
ATOM   2123  C  CG1   . VAL A  1  302  ? 225.161 248.126 244.188 1.00 0.00 ? 302  VAL A CG1   1 
ATOM   2124  C  CG2   . VAL A  1  302  ? 226.439 245.991 244.226 1.00 0.00 ? 302  VAL A CG2   1 
ATOM   2125  N  N     . ILE A  1  303  ? 228.138 249.662 246.243 1.00 0.00 ? 303  ILE A N     1 
ATOM   2126  C  CA    . ILE A  1  303  ? 228.336 250.983 246.825 1.00 0.00 ? 303  ILE A CA    1 
ATOM   2127  C  C     . ILE A  1  303  ? 229.432 251.765 246.102 1.00 0.00 ? 303  ILE A C     1 
ATOM   2128  O  O     . ILE A  1  303  ? 229.291 252.965 245.847 1.00 0.00 ? 303  ILE A O     1 
ATOM   2129  C  CB    . ILE A  1  303  ? 228.699 250.872 248.314 1.00 0.00 ? 303  ILE A CB    1 
ATOM   2130  C  CG1   . ILE A  1  303  ? 227.494 250.405 249.122 1.00 0.00 ? 303  ILE A CG1   1 
ATOM   2131  C  CG2   . ILE A  1  303  ? 229.218 252.194 248.850 1.00 0.00 ? 303  ILE A CG2   1 
ATOM   2132  C  CD1   . ILE A  1  303  ? 227.814 250.187 250.571 1.00 0.00 ? 303  ILE A CD1   1 
ATOM   2133  N  N     . ALA A  1  304  ? 230.504 251.065 245.745 1.00 0.00 ? 304  ALA A N     1 
ATOM   2134  C  CA    . ALA A  1  304  ? 231.626 251.640 244.997 1.00 0.00 ? 304  ALA A CA    1 
ATOM   2135  C  C     . ALA A  1  304  ? 231.192 252.236 243.653 1.00 0.00 ? 304  ALA A C     1 
ATOM   2136  O  O     . ALA A  1  304  ? 231.670 253.289 243.218 1.00 0.00 ? 304  ALA A O     1 
ATOM   2137  C  CB    . ALA A  1  304  ? 232.705 250.587 244.783 1.00 0.00 ? 304  ALA A CB    1 
ATOM   2138  N  N     . GLU A  1  305  ? 230.254 251.534 243.030 1.00 0.00 ? 305  GLU A N     1 
ATOM   2139  C  CA    . GLU A  1  305  ? 229.606 251.906 241.777 1.00 0.00 ? 305  GLU A CA    1 
ATOM   2140  C  C     . GLU A  1  305  ? 228.735 253.155 241.923 1.00 0.00 ? 305  GLU A C     1 
ATOM   2141  O  O     . GLU A  1  305  ? 228.738 254.039 241.064 1.00 0.00 ? 305  GLU A O     1 
ATOM   2142  C  CB    . GLU A  1  305  ? 228.772 250.724 241.278 1.00 0.00 ? 305  GLU A CB    1 
ATOM   2143  C  CG    . GLU A  1  305  ? 229.586 249.709 240.480 1.00 0.00 ? 305  GLU A CG    1 
ATOM   2144  C  CD    . GLU A  1  305  ? 229.586 249.971 238.991 1.00 0.00 ? 305  GLU A CD    1 
ATOM   2145  O  OE1   . GLU A  1  305  ? 229.145 251.063 238.577 1.00 0.00 ? 305  GLU A OE1   1 
ATOM   2146  O  OE2   . GLU A  1  305  ? 230.045 249.085 238.238 1.00 0.00 ? 305  GLU A OE2   1 
ATOM   2147  N  N     . ASP A  1  306  ? 227.998 253.213 243.024 1.00 0.00 ? 306  ASP A N     1 
ATOM   2148  C  CA    . ASP A  1  306  ? 227.163 254.358 243.364 1.00 0.00 ? 306  ASP A CA    1 
ATOM   2149  C  C     . ASP A  1  306  ? 228.009 255.599 243.564 1.00 0.00 ? 306  ASP A C     1 
ATOM   2150  O  O     . ASP A  1  306  ? 227.632 256.693 243.142 1.00 0.00 ? 306  ASP A O     1 
ATOM   2151  C  CB    . ASP A  1  306  ? 226.359 254.082 244.629 1.00 0.00 ? 306  ASP A CB    1 
ATOM   2152  C  CG    . ASP A  1  306  ? 225.181 253.180 244.374 1.00 0.00 ? 306  ASP A CG    1 
ATOM   2153  O  OD1   . ASP A  1  306  ? 224.792 253.039 243.195 1.00 0.00 ? 306  ASP A OD1   1 
ATOM   2154  O  OD2   . ASP A  1  306  ? 224.645 252.615 245.349 1.00 0.00 ? 306  ASP A OD2   1 
ATOM   2155  N  N     . VAL A  1  307  ? 229.158 255.429 244.201 1.00 0.00 ? 307  VAL A N     1 
ATOM   2156  C  CA    . VAL A  1  307  ? 230.061 256.544 244.394 1.00 0.00 ? 307  VAL A CA    1 
ATOM   2157  C  C     . VAL A  1  307  ? 230.585 256.998 243.032 1.00 0.00 ? 307  VAL A C     1 
ATOM   2158  O  O     . VAL A  1  307  ? 230.609 258.198 242.746 1.00 0.00 ? 307  VAL A O     1 
ATOM   2159  C  CB    . VAL A  1  307  ? 231.238 256.158 245.313 1.00 0.00 ? 307  VAL A CB    1 
ATOM   2160  C  CG1   . VAL A  1  307  ? 232.339 257.206 245.260 1.00 0.00 ? 307  VAL A CG1   1 
ATOM   2161  C  CG2   . VAL A  1  307  ? 230.748 255.957 246.733 1.00 0.00 ? 307  VAL A CG2   1 
ATOM   2162  N  N     . LYS A  1  308  ? 230.959 256.050 242.180 1.00 0.00 ? 308  LYS A N     1 
ATOM   2163  C  CA    . LYS A  1  308  ? 231.386 256.380 240.818 1.00 0.00 ? 308  LYS A CA    1 
ATOM   2164  C  C     . LYS A  1  308  ? 230.295 257.071 240.005 1.00 0.00 ? 308  LYS A C     1 
ATOM   2165  O  O     . LYS A  1  308  ? 230.560 258.036 239.283 1.00 0.00 ? 308  LYS A O     1 
ATOM   2166  C  CB    . LYS A  1  308  ? 231.844 255.124 240.065 1.00 0.00 ? 308  LYS A CB    1 
ATOM   2167  C  CG    . LYS A  1  308  ? 232.546 255.432 238.737 1.00 0.00 ? 308  LYS A CG    1 
ATOM   2168  C  CD    . LYS A  1  308  ? 233.018 254.174 238.015 1.00 0.00 ? 308  LYS A CD    1 
ATOM   2169  C  CE    . LYS A  1  308  ? 233.753 254.524 236.725 1.00 0.00 ? 308  LYS A CE    1 
ATOM   2170  N  NZ    . LYS A  1  308  ? 235.161 254.939 236.967 1.00 0.00 ? 308  LYS A NZ    1 
ATOM   2171  N  N     . LEU A  1  309  ? 229.067 256.587 240.137 1.00 0.00 ? 309  LEU A N     1 
ATOM   2172  C  CA    . LEU A  1  309  ? 227.937 257.243 239.501 1.00 0.00 ? 309  LEU A CA    1 
ATOM   2173  C  C     . LEU A  1  309  ? 227.636 258.621 240.087 1.00 0.00 ? 309  LEU A C     1 
ATOM   2174  O  O     . LEU A  1  309  ? 227.367 259.566 239.344 1.00 0.00 ? 309  LEU A O     1 
ATOM   2175  C  CB    . LEU A  1  309  ? 226.703 256.345 239.617 1.00 0.00 ? 309  LEU A CB    1 
ATOM   2176  C  CG    . LEU A  1  309  ? 225.490 256.668 238.753 1.00 0.00 ? 309  LEU A CG    1 
ATOM   2177  C  CD1   . LEU A  1  309  ? 225.853 256.563 237.282 1.00 0.00 ? 309  LEU A CD1   1 
ATOM   2178  C  CD2   . LEU A  1  309  ? 224.346 255.727 239.099 1.00 0.00 ? 309  LEU A CD2   1 
ATOM   2179  N  N     . LEU A  1  310  ? 227.714 258.751 241.406 1.00 0.00 ? 310  LEU A N     1 
ATOM   2180  C  CA    . LEU A  1  310  ? 227.496 260.050 242.027 1.00 0.00 ? 310  LEU A CA    1 
ATOM   2181  C  C     . LEU A  1  310  ? 228.562 261.055 241.644 1.00 0.00 ? 310  LEU A C     1 
ATOM   2182  O  O     . LEU A  1  310  ? 228.261 262.194 241.297 1.00 0.00 ? 310  LEU A O     1 
ATOM   2183  C  CB    . LEU A  1  310  ? 227.446 259.918 243.547 1.00 0.00 ? 310  LEU A CB    1 
ATOM   2184  C  CG    . LEU A  1  310  ? 227.198 261.234 244.288 1.00 0.00 ? 310  LEU A CG    1 
ATOM   2185  C  CD1   . LEU A  1  310  ? 225.901 261.882 243.844 1.00 0.00 ? 310  LEU A CD1   1 
ATOM   2186  C  CD2   . LEU A  1  310  ? 227.203 261.004 245.786 1.00 0.00 ? 310  LEU A CD2   1 
ATOM   2187  N  N     . GLN A  1  311  ? 229.808 260.602 241.663 1.00 0.00 ? 311  GLN A N     1 
ATOM   2188  C  CA    . GLN A  1  311  ? 230.940 261.414 241.242 1.00 0.00 ? 311  GLN A CA    1 
ATOM   2189  C  C     . GLN A  1  311  ? 230.803 261.885 239.800 1.00 0.00 ? 311  GLN A C     1 
ATOM   2190  O  O     . GLN A  1  311  ? 231.109 263.033 239.485 1.00 0.00 ? 311  GLN A O     1 
ATOM   2191  C  CB    . GLN A  1  311  ? 232.242 260.632 241.427 1.00 0.00 ? 311  GLN A CB    1 
ATOM   2192  C  CG    . GLN A  1  311  ? 233.521 261.416 241.152 1.00 0.00 ? 311  GLN A CG    1 
ATOM   2193  C  CD    . GLN A  1  311  ? 233.661 262.643 242.030 1.00 0.00 ? 311  GLN A CD    1 
ATOM   2194  O  OE1   . GLN A  1  311  ? 234.130 262.564 243.160 1.00 0.00 ? 311  GLN A OE1   1 
ATOM   2195  N  NE2   . GLN A  1  311  ? 233.290 263.789 241.496 1.00 0.00 ? 311  GLN A NE2   1 
ATOM   2196  N  N     . PHE A  1  312  ? 230.334 261.004 238.926 1.00 0.00 ? 312  PHE A N     1 
ATOM   2197  C  CA    . PHE A  1  312  ? 230.040 261.400 237.555 1.00 0.00 ? 312  PHE A CA    1 
ATOM   2198  C  C     . PHE A  1  312  ? 228.924 262.437 237.441 1.00 0.00 ? 312  PHE A C     1 
ATOM   2199  O  O     . PHE A  1  312  ? 229.095 263.459 236.780 1.00 0.00 ? 312  PHE A O     1 
ATOM   2200  C  CB    . PHE A  1  312  ? 229.688 260.167 236.721 1.00 0.00 ? 312  PHE A CB    1 
ATOM   2201  C  CG    . PHE A  1  312  ? 229.390 260.468 235.278 1.00 0.00 ? 312  PHE A CG    1 
ATOM   2202  C  CD1   . PHE A  1  312  ? 230.401 260.440 234.334 1.00 0.00 ? 312  PHE A CD1   1 
ATOM   2203  C  CD2   . PHE A  1  312  ? 228.099 260.752 234.858 1.00 0.00 ? 312  PHE A CD2   1 
ATOM   2204  C  CE1   . PHE A  1  312  ? 230.134 260.711 233.006 1.00 0.00 ? 312  PHE A CE1   1 
ATOM   2205  C  CE2   . PHE A  1  312  ? 227.826 261.020 233.531 1.00 0.00 ? 312  PHE A CE2   1 
ATOM   2206  C  CZ    . PHE A  1  312  ? 228.843 261.000 232.605 1.00 0.00 ? 312  PHE A CZ    1 
ATOM   2207  N  N     . HIS A  1  313  ? 227.781 262.175 238.065 1.00 0.00 ? 313  HIS A N     1 
ATOM   2208  C  CA    . HIS A  1  313  ? 226.659 263.109 237.990 1.00 0.00 ? 313  HIS A CA    1 
ATOM   2209  C  C     . HIS A  1  313  ? 226.942 264.516 238.530 1.00 0.00 ? 313  HIS A C     1 
ATOM   2210  O  O     . HIS A  1  313  ? 226.510 265.496 237.925 1.00 0.00 ? 313  HIS A O     1 
ATOM   2211  C  CB    . HIS A  1  313  ? 225.445 262.505 238.687 1.00 0.00 ? 313  HIS A CB    1 
ATOM   2212  C  CG    . HIS A  1  313  ? 224.781 261.433 237.881 1.00 0.00 ? 313  HIS A CG    1 
ATOM   2213  N  ND1   . HIS A  1  313  ? 225.246 261.047 236.642 1.00 0.00 ? 313  HIS A ND1   1 
ATOM   2214  C  CD2   . HIS A  1  313  ? 223.693 260.668 238.130 1.00 0.00 ? 313  HIS A CD2   1 
ATOM   2215  C  CE1   . HIS A  1  313  ? 224.475 260.087 236.165 1.00 0.00 ? 313  HIS A CE1   1 
ATOM   2216  N  NE2   . HIS A  1  313  ? 223.525 259.838 237.048 1.00 0.00 ? 313  HIS A NE2   1 
ATOM   2217  N  N     . VAL A  1  314  ? 227.613 264.628 239.673 1.00 0.00 ? 314  VAL A N     1 
ATOM   2218  C  CA    . VAL A  1  314  ? 227.985 265.948 240.195 1.00 0.00 ? 314  VAL A CA    1 
ATOM   2219  C  C     . VAL A  1  314  ? 229.036 266.635 239.314 1.00 0.00 ? 314  VAL A C     1 
ATOM   2220  O  O     . VAL A  1  314  ? 229.022 267.857 239.174 1.00 0.00 ? 314  VAL A O     1 
ATOM   2221  C  CB    . VAL A  1  314  ? 228.486 265.912 241.646 1.00 0.00 ? 314  VAL A CB    1 
ATOM   2222  C  CG1   . VAL A  1  314  ? 227.422 265.329 242.544 1.00 0.00 ? 314  VAL A CG1   1 
ATOM   2223  C  CG2   . VAL A  1  314  ? 229.787 265.154 241.763 1.00 0.00 ? 314  VAL A CG2   1 
ATOM   2224  N  N     . ALA A  1  315  ? 229.972 265.871 238.758 1.00 0.00 ? 315  ALA A N     1 
ATOM   2225  C  CA    . ALA A  1  315  ? 230.931 266.438 237.815 1.00 0.00 ? 315  ALA A CA    1 
ATOM   2226  C  C     . ALA A  1  315  ? 230.204 266.953 236.573 1.00 0.00 ? 315  ALA A C     1 
ATOM   2227  O  O     . ALA A  1  315  ? 230.377 268.106 236.192 1.00 0.00 ? 315  ALA A O     1 
ATOM   2228  C  CB    . ALA A  1  315  ? 231.984 265.419 237.435 1.00 0.00 ? 315  ALA A CB    1 
ATOM   2229  N  N     . THR A  1  316  ? 229.383 266.109 235.953 1.00 0.00 ? 316  THR A N     1 
ATOM   2230  C  CA    . THR A  1  316  ? 228.640 266.511 234.761 1.00 0.00 ? 316  THR A CA    1 
ATOM   2231  C  C     . THR A  1  316  ? 227.675 267.647 235.061 1.00 0.00 ? 316  THR A C     1 
ATOM   2232  O  O     . THR A  1  316  ? 227.234 268.332 234.152 1.00 0.00 ? 316  THR A O     1 
ATOM   2233  C  CB    . THR A  1  316  ? 227.859 265.369 234.152 1.00 0.00 ? 316  THR A CB    1 
ATOM   2234  O  OG1   . THR A  1  316  ? 227.084 264.732 235.169 1.00 0.00 ? 316  THR A OG1   1 
ATOM   2235  C  CG2   . THR A  1  316  ? 228.812 264.382 233.522 1.00 0.00 ? 316  THR A CG2   1 
ATOM   2236  N  N     . MET A  1  317  ? 227.254 267.784 236.310 1.00 0.00 ? 317  MET A N     1 
ATOM   2237  C  CA    . MET A  1  317  ? 226.491 268.969 236.693 1.00 0.00 ? 317  MET A CA    1 
ATOM   2238  C  C     . MET A  1  317  ? 227.284 270.257 236.569 1.00 0.00 ? 317  MET A C     1 
ATOM   2239  O  O     . MET A  1  317  ? 226.789 271.248 236.044 1.00 0.00 ? 317  MET A O     1 
ATOM   2240  C  CB    . MET A  1  317  ? 225.995 268.871 238.121 1.00 0.00 ? 317  MET A CB    1 
ATOM   2241  C  CG    . MET A  1  317  ? 225.269 270.129 238.540 1.00 0.00 ? 317  MET A CG    1 
ATOM   2242  S  SD    . MET A  1  317  ? 224.696 270.073 240.234 1.00 0.00 ? 317  MET A SD    1 
ATOM   2243  C  CE    . MET A  1  317  ? 224.349 271.803 240.519 1.00 0.00 ? 317  MET A CE    1 
ATOM   2244  N  N     . VAL A  1  318  ? 228.515 270.244 237.054 1.00 0.00 ? 318  VAL A N     1 
ATOM   2245  C  CA    . VAL A  1  318  ? 229.347 271.434 236.980 1.00 0.00 ? 318  VAL A CA    1 
ATOM   2246  C  C     . VAL A  1  318  ? 229.945 271.627 235.573 1.00 0.00 ? 318  VAL A C     1 
ATOM   2247  O  O     . VAL A  1  318  ? 229.913 272.730 235.022 1.00 0.00 ? 318  VAL A O     1 
ATOM   2248  C  CB    . VAL A  1  318  ? 230.462 271.381 238.052 1.00 0.00 ? 318  VAL A CB    1 
ATOM   2249  C  CG1   . VAL A  1  318  ? 231.388 272.582 237.936 1.00 0.00 ? 318  VAL A CG1   1 
ATOM   2250  C  CG2   . VAL A  1  318  ? 229.846 271.323 239.444 1.00 0.00 ? 318  VAL A CG2   1 
ATOM   2251  N  N     . ASP A  1  319  ? 230.444 270.550 234.976 1.00 0.00 ? 319  ASP A N     1 
ATOM   2252  C  CA    . ASP A  1  319  ? 231.114 270.613 233.676 1.00 0.00 ? 319  ASP A CA    1 
ATOM   2253  C  C     . ASP A  1  319  ? 230.762 269.388 232.843 1.00 0.00 ? 319  ASP A C     1 
ATOM   2254  O  O     . ASP A  1  319  ? 231.009 268.259 233.263 1.00 0.00 ? 319  ASP A O     1 
ATOM   2255  C  CB    . ASP A  1  319  ? 232.630 270.704 233.876 1.00 0.00 ? 319  ASP A CB    1 
ATOM   2256  C  CG    . ASP A  1  319  ? 233.403 270.778 232.566 1.00 0.00 ? 319  ASP A CG    1 
ATOM   2257  O  OD1   . ASP A  1  319  ? 232.768 270.791 231.486 1.00 0.00 ? 319  ASP A OD1   1 
ATOM   2258  O  OD2   . ASP A  1  319  ? 234.658 270.817 232.625 1.00 0.00 ? 319  ASP A OD2   1 
ATOM   2259  N  N     . ASN A  1  320  ? 230.255 269.605 231.632 1.00 0.00 ? 320  ASN A N     1 
ATOM   2260  C  CA    . ASN A  1  320  ? 229.729 268.488 230.851 1.00 0.00 ? 320  ASN A CA    1 
ATOM   2261  C  C     . ASN A  1  320  ? 230.611 268.123 229.667 1.00 0.00 ? 320  ASN A C     1 
ATOM   2262  O  O     . ASN A  1  320  ? 230.329 267.176 228.937 1.00 0.00 ? 320  ASN A O     1 
ATOM   2263  C  CB    . ASN A  1  320  ? 228.313 268.815 230.363 1.00 0.00 ? 320  ASN A CB    1 
ATOM   2264  C  CG    . ASN A  1  320  ? 227.545 267.577 229.904 1.00 0.00 ? 320  ASN A CG    1 
ATOM   2265  O  OD1   . ASN A  1  320  ? 227.562 266.534 230.559 1.00 0.00 ? 320  ASN A OD1   1 
ATOM   2266  N  ND2   . ASN A  1  320  ? 226.860 267.699 228.776 1.00 0.00 ? 320  ASN A ND2   1 
ATOM   2267  N  N     . GLU A  1  321  ? 231.706 268.849 229.504 1.00 0.00 ? 321  GLU A N     1 
ATOM   2268  C  CA    . GLU A  1  321  ? 232.642 268.552 228.433 1.00 0.00 ? 321  GLU A CA    1 
ATOM   2269  C  C     . GLU A  1  321  ? 233.951 268.029 229.013 1.00 0.00 ? 321  GLU A C     1 
ATOM   2270  O  O     . GLU A  1  321  ? 235.022 268.564 228.729 1.00 0.00 ? 321  GLU A O     1 
ATOM   2271  C  CB    . GLU A  1  321  ? 232.889 269.797 227.574 1.00 0.00 ? 321  GLU A CB    1 
ATOM   2272  C  CG    . GLU A  1  321  ? 231.684 270.232 226.725 1.00 0.00 ? 321  GLU A CG    1 
ATOM   2273  C  CD    . GLU A  1  321  ? 231.893 271.572 226.006 1.00 0.00 ? 321  GLU A CD    1 
ATOM   2274  O  OE1   . GLU A  1  321  ? 232.898 272.266 226.297 1.00 0.00 ? 321  GLU A OE1   1 
ATOM   2275  O  OE2   . GLU A  1  321  ? 231.044 271.931 225.154 1.00 0.00 ? 321  GLU A OE2   1 
ATOM   2276  N  N     . LEU A  1  322  ? 233.858 266.987 229.834 1.00 0.00 ? 322  LEU A N     1 
ATOM   2277  C  CA    . LEU A  1  322  ? 235.049 266.374 230.407 1.00 0.00 ? 322  LEU A CA    1 
ATOM   2278  C  C     . LEU A  1  322  ? 235.708 265.437 229.401 1.00 0.00 ? 322  LEU A C     1 
ATOM   2279  O  O     . LEU A  1  322  ? 235.046 264.588 228.806 1.00 0.00 ? 322  LEU A O     1 
ATOM   2280  C  CB    . LEU A  1  322  ? 234.708 265.613 231.687 1.00 0.00 ? 322  LEU A CB    1 
ATOM   2281  C  CG    . LEU A  1  322  ? 234.046 266.455 232.772 1.00 0.00 ? 322  LEU A CG    1 
ATOM   2282  C  CD1   . LEU A  1  322  ? 233.600 265.583 233.925 1.00 0.00 ? 322  LEU A CD1   1 
ATOM   2283  C  CD2   . LEU A  1  322  ? 235.001 267.534 233.250 1.00 0.00 ? 322  LEU A CD2   1 
ATOM   2284  N  N     . PRO A  1  323  ? 237.025 265.588 229.217 1.00 0.00 ? 323  PRO A N     1 
ATOM   2285  C  CA    . PRO A  1  323  ? 237.811 264.807 228.255 1.00 0.00 ? 323  PRO A CA    1 
ATOM   2286  C  C     . PRO A  1  323  ? 237.893 263.323 228.618 1.00 0.00 ? 323  PRO A C     1 
ATOM   2287  O  O     . PRO A  1  323  ? 238.138 262.979 229.773 1.00 0.00 ? 323  PRO A O     1 
ATOM   2288  C  CB    . PRO A  1  323  ? 239.190 265.471 228.308 1.00 0.00 ? 323  PRO A CB    1 
ATOM   2289  C  CG    . PRO A  1  323  ? 239.246 266.121 229.646 1.00 0.00 ? 323  PRO A CG    1 
ATOM   2290  C  CD    . PRO A  1  323  ? 237.851 266.572 229.938 1.00 0.00 ? 323  PRO A CD    1 
ATOM   2291  N  N     . GLY A  1  324  ? 237.681 262.462 227.626 1.00 0.00 ? 324  GLY A N     1 
ATOM   2292  C  CA    . GLY A  1  324  ? 237.725 261.021 227.815 1.00 0.00 ? 324  GLY A CA    1 
ATOM   2293  C  C     . GLY A  1  324  ? 236.557 260.473 228.618 1.00 0.00 ? 324  GLY A C     1 
ATOM   2294  O  O     . GLY A  1  324  ? 236.537 259.291 228.977 1.00 0.00 ? 324  GLY A O     1 
ATOM   2295  N  N     . LEU A  1  325  ? 235.581 261.333 228.895 1.00 0.00 ? 325  LEU A N     1 
ATOM   2296  C  CA    . LEU A  1  325  ? 234.376 260.938 229.620 1.00 0.00 ? 325  LEU A CA    1 
ATOM   2297  C  C     . LEU A  1  325  ? 233.160 261.052 228.709 1.00 0.00 ? 325  LEU A C     1 
ATOM   2298  O  O     . LEU A  1  325  ? 233.067 261.984 227.917 1.00 0.00 ? 325  LEU A O     1 
ATOM   2299  C  CB    . LEU A  1  325  ? 234.183 261.805 230.863 1.00 0.00 ? 325  LEU A CB    1 
ATOM   2300  C  CG    . LEU A  1  325  ? 234.753 261.267 232.175 1.00 0.00 ? 325  LEU A CG    1 
ATOM   2301  C  CD1   . LEU A  1  325  ? 236.272 261.272 232.143 1.00 0.00 ? 325  LEU A CD1   1 
ATOM   2302  C  CD2   . LEU A  1  325  ? 234.239 262.073 233.349 1.00 0.00 ? 325  LEU A CD2   1 
ATOM   2303  N  N     . PRO A  1  326  ? 232.222 260.104 228.816 1.00 0.00 ? 326  PRO A N     1 
ATOM   2304  C  CA    . PRO A  1  326  ? 230.933 260.270 228.142 1.00 0.00 ? 326  PRO A CA    1 
ATOM   2305  C  C     . PRO A  1  326  ? 230.236 261.538 228.617 1.00 0.00 ? 326  PRO A C     1 
ATOM   2306  O  O     . PRO A  1  326  ? 230.505 261.985 229.729 1.00 0.00 ? 326  PRO A O     1 
ATOM   2307  C  CB    . PRO A  1  326  ? 230.158 259.020 228.557 1.00 0.00 ? 326  PRO A CB    1 
ATOM   2308  C  CG    . PRO A  1  326  ? 231.214 258.014 228.879 1.00 0.00 ? 326  PRO A CG    1 
ATOM   2309  C  CD    . PRO A  1  326  ? 232.321 258.808 229.504 1.00 0.00 ? 326  PRO A CD    1 
ATOM   2310  N  N     . ARG A  1  327  ? 229.355 262.098 227.797 1.00 0.00 ? 327  ARG A N     1 
ATOM   2311  C  CA    . ARG A  1  327  ? 228.675 263.344 228.136 1.00 0.00 ? 327  ARG A CA    1 
ATOM   2312  C  C     . ARG A  1  327  ? 227.209 263.110 228.503 1.00 0.00 ? 327  ARG A C     1 
ATOM   2313  O  O     . ARG A  1  327  ? 226.585 262.186 227.995 1.00 0.00 ? 327  ARG A O     1 
ATOM   2314  C  CB    . ARG A  1  327  ? 228.786 264.325 226.971 1.00 0.00 ? 327  ARG A CB    1 
ATOM   2315  C  CG    . ARG A  1  327  ? 230.174 264.913 226.825 1.00 0.00 ? 327  ARG A CG    1 
ATOM   2316  C  CD    . ARG A  1  327  ? 230.244 265.959 225.728 1.00 0.00 ? 327  ARG A CD    1 
ATOM   2317  N  NE    . ARG A  1  327  ? 231.577 266.543 225.634 1.00 0.00 ? 327  ARG A NE    1 
ATOM   2318  C  CZ    . ARG A  1  327  ? 232.600 265.976 225.002 1.00 0.00 ? 327  ARG A CZ    1 
ATOM   2319  N  NH1   . ARG A  1  327  ? 232.445 264.802 224.401 1.00 0.00 ? 327  ARG A NH1   1 
ATOM   2320  N  NH2   . ARG A  1  327  ? 233.779 266.584 224.968 1.00 0.00 ? 327  ARG A NH2   1 
ATOM   2321  N  N     . ALA A  1  328  ? 226.660 263.945 229.378 1.00 0.00 ? 328  ALA A N     1 
ATOM   2322  C  CA    . ALA A  1  328  ? 225.250 263.839 229.736 1.00 0.00 ? 328  ALA A CA    1 
ATOM   2323  C  C     . ALA A  1  328  ? 224.384 264.189 228.534 1.00 0.00 ? 328  ALA A C     1 
ATOM   2324  O  O     . ALA A  1  328  ? 224.726 265.070 227.750 1.00 0.00 ? 328  ALA A O     1 
ATOM   2325  C  CB    . ALA A  1  328  ? 224.926 264.737 230.913 1.00 0.00 ? 328  ALA A CB    1 
ATOM   2326  N  N     . MET A  1  329  ? 223.269 263.488 228.386 1.00 0.00 ? 329  MET A N     1 
ATOM   2327  C  CA    . MET A  1  329  ? 222.417 263.644 227.214 1.00 0.00 ? 329  MET A CA    1 
ATOM   2328  C  C     . MET A  1  329  ? 220.948 263.627 227.613 1.00 0.00 ? 329  MET A C     1 
ATOM   2329  O  O     . MET A  1  329  ? 220.617 263.445 228.783 1.00 0.00 ? 329  MET A O     1 
ATOM   2330  C  CB    . MET A  1  329  ? 222.693 262.526 226.200 1.00 0.00 ? 329  MET A CB    1 
ATOM   2331  C  CG    . MET A  1  329  ? 224.102 262.512 225.610 1.00 0.00 ? 329  MET A CG    1 
ATOM   2332  S  SD    . MET A  1  329  ? 224.488 260.999 224.687 1.00 0.00 ? 329  MET A SD    1 
ATOM   2333  C  CE    . MET A  1  329  ? 223.518 261.215 223.199 1.00 0.00 ? 329  MET A CE    1 
ATOM   2334  N  N     . GLN A  1  330  ? 220.069 263.820 226.640 1.00 0.00 ? 330  GLN A N     1 
ATOM   2335  C  CA    . GLN A  1  330  ? 218.639 263.679 226.873 1.00 0.00 ? 330  GLN A CA    1 
ATOM   2336  C  C     . GLN A  1  330  ? 218.026 262.673 225.912 1.00 0.00 ? 330  GLN A C     1 
ATOM   2337  O  O     . GLN A  1  330  ? 218.732 262.046 225.123 1.00 0.00 ? 330  GLN A O     1 
ATOM   2338  C  CB    . GLN A  1  330  ? 217.938 265.021 226.732 1.00 0.00 ? 330  GLN A CB    1 
ATOM   2339  C  CG    . GLN A  1  330  ? 218.470 266.083 227.647 1.00 0.00 ? 330  GLN A CG    1 
ATOM   2340  C  CD    . GLN A  1  330  ? 217.659 267.347 227.553 1.00 0.00 ? 330  GLN A CD    1 
ATOM   2341  O  OE1   . GLN A  1  330  ? 217.615 267.989 226.503 1.00 0.00 ? 330  GLN A OE1   1 
ATOM   2342  N  NE2   . GLN A  1  330  ? 216.993 267.707 228.643 1.00 0.00 ? 330  GLN A NE2   1 
ATOM   2343  N  N     . LYS A  1  331  ? 216.707 262.516 225.996 1.00 0.00 ? 331  LYS A N     1 
ATOM   2344  C  CA    . LYS A  1  331  ? 215.985 261.643 225.083 1.00 0.00 ? 331  LYS A CA    1 
ATOM   2345  C  C     . LYS A  1  331  ? 216.220 262.122 223.652 1.00 0.00 ? 331  LYS A C     1 
ATOM   2346  O  O     . LYS A  1  331  ? 216.203 261.331 222.711 1.00 0.00 ? 331  LYS A O     1 
ATOM   2347  C  CB    . LYS A  1  331  ? 214.489 261.633 225.408 1.00 0.00 ? 331  LYS A CB    1 
ATOM   2348  C  CG    . LYS A  1  331  ? 214.162 261.250 226.846 1.00 0.00 ? 331  LYS A CG    1 
ATOM   2349  C  CD    . LYS A  1  331  ? 212.670 261.004 227.033 1.00 0.00 ? 331  LYS A CD    1 
ATOM   2350  C  CE    . LYS A  1  331  ? 212.378 260.288 228.346 1.00 0.00 ? 331  LYS A CE    1 
ATOM   2351  N  NZ    . LYS A  1  331  ? 213.080 258.981 228.464 1.00 0.00 ? 331  LYS A NZ    1 
ATOM   2352  N  N     . SER A  1  332  ? 216.443 263.427 223.508 1.00 0.00 ? 332  SER A N     1 
ATOM   2353  C  CA    . SER A  1  332  ? 216.781 264.027 222.219 1.00 0.00 ? 332  SER A CA    1 
ATOM   2354  C  C     . SER A  1  332  ? 218.219 263.716 221.806 1.00 0.00 ? 332  SER A C     1 
ATOM   2355  O  O     . SER A  1  332  ? 218.603 263.929 220.656 1.00 0.00 ? 332  SER A O     1 
ATOM   2356  C  CB    . SER A  1  332  ? 216.583 265.548 222.260 1.00 0.00 ? 332  SER A CB    1 
ATOM   2357  O  OG    . SER A  1  332  ? 217.167 266.116 223.421 1.00 0.00 ? 332  SER A OG    1 
ATOM   2358  N  N     . GLY A  1  333  ? 219.007 263.202 222.746 1.00 0.00 ? 333  GLY A N     1 
ATOM   2359  C  CA    . GLY A  1  333  ? 220.416 262.940 222.509 1.00 0.00 ? 333  GLY A CA    1 
ATOM   2360  C  C     . GLY A  1  333  ? 221.296 264.180 222.570 1.00 0.00 ? 333  GLY A C     1 
ATOM   2361  O  O     . GLY A  1  333  ? 222.499 264.108 222.318 1.00 0.00 ? 333  GLY A O     1 
ATOM   2362  N  N     . ARG A  1  334  ? 220.703 265.320 222.913 1.00 0.00 ? 334  ARG A N     1 
ATOM   2363  C  CA    . ARG A  1  334  ? 221.437 266.581 222.951 1.00 0.00 ? 334  ARG A CA    1 
ATOM   2364  C  C     . ARG A  1  334  ? 222.272 266.663 224.227 1.00 0.00 ? 334  ARG A C     1 
ATOM   2365  O  O     . ARG A  1  334  ? 221.799 266.296 225.304 1.00 0.00 ? 334  ARG A O     1 
ATOM   2366  C  CB    . ARG A  1  334  ? 220.476 267.768 222.861 1.00 0.00 ? 334  ARG A CB    1 
ATOM   2367  C  CG    . ARG A  1  334  ? 221.154 269.093 222.557 1.00 0.00 ? 334  ARG A CG    1 
ATOM   2368  C  CD    . ARG A  1  334  ? 220.205 270.255 222.772 1.00 0.00 ? 334  ARG A CD    1 
ATOM   2369  N  NE    . ARG A  1  334  ? 219.554 270.179 224.075 1.00 0.00 ? 334  ARG A NE    1 
ATOM   2370  C  CZ    . ARG A  1  334  ? 220.097 270.609 225.209 1.00 0.00 ? 334  ARG A CZ    1 
ATOM   2371  N  NH1   . ARG A  1  334  ? 221.304 271.157 225.202 1.00 0.00 ? 334  ARG A NH1   1 
ATOM   2372  N  NH2   . ARG A  1  334  ? 219.434 270.484 226.352 1.00 0.00 ? 334  ARG A NH2   1 
ATOM   2373  N  N     . PRO A  1  335  ? 223.526 267.131 224.108 1.00 0.00 ? 335  PRO A N     1 
ATOM   2374  C  CA    . PRO A  1  335  ? 224.380 267.314 225.288 1.00 0.00 ? 335  PRO A CA    1 
ATOM   2375  C  C     . PRO A  1  335  ? 223.811 268.325 226.290 1.00 0.00 ? 335  PRO A C     1 
ATOM   2376  O  O     . PRO A  1  335  ? 223.346 269.386 225.886 1.00 0.00 ? 335  PRO A O     1 
ATOM   2377  C  CB    . PRO A  1  335  ? 225.695 267.832 224.690 1.00 0.00 ? 335  PRO A CB    1 
ATOM   2378  C  CG    . PRO A  1  335  ? 225.669 267.405 223.263 1.00 0.00 ? 335  PRO A CG    1 
ATOM   2379  C  CD    . PRO A  1  335  ? 224.236 267.444 222.856 1.00 0.00 ? 335  PRO A CD    1 
ATOM   2380  N  N     . LEU A  1  336  ? 223.876 267.990 227.579 1.00 0.00 ? 336  LEU A N     1 
ATOM   2381  C  CA    . LEU A  1  336  ? 223.367 268.837 228.665 1.00 0.00 ? 336  LEU A CA    1 
ATOM   2382  C  C     . LEU A  1  336  ? 224.136 270.160 228.795 1.00 0.00 ? 336  LEU A C     1 
ATOM   2383  O  O     . LEU A  1  336  ? 225.351 270.184 228.628 1.00 0.00 ? 336  LEU A O     1 
ATOM   2384  C  CB    . LEU A  1  336  ? 223.433 268.070 229.988 1.00 0.00 ? 336  LEU A CB    1 
ATOM   2385  C  CG    . LEU A  1  336  ? 222.930 268.807 231.223 1.00 0.00 ? 336  LEU A CG    1 
ATOM   2386  C  CD1   . LEU A  1  336  ? 221.441 268.986 231.119 1.00 0.00 ? 336  LEU A CD1   1 
ATOM   2387  C  CD2   . LEU A  1  336  ? 223.291 268.056 232.487 1.00 0.00 ? 336  LEU A CD2   1 
ATOM   2388  N  N     . LYS A  1  337  ? 223.434 271.256 229.090 1.00 0.00 ? 337  LYS A N     1 
ATOM   2389  C  CA    . LYS A  1  337  ? 224.086 272.564 229.251 1.00 0.00 ? 337  LYS A CA    1 
ATOM   2390  C  C     . LYS A  1  337  ? 224.467 272.894 230.687 1.00 0.00 ? 337  LYS A C     1 
ATOM   2391  O  O     . LYS A  1  337  ? 223.793 273.693 231.336 1.00 0.00 ? 337  LYS A O     1 
ATOM   2392  C  CB    . LYS A  1  337  ? 223.190 273.688 228.722 1.00 0.00 ? 337  LYS A CB    1 
ATOM   2393  C  CG    . LYS A  1  337  ? 222.889 273.614 227.243 1.00 0.00 ? 337  LYS A CG    1 
ATOM   2394  C  CD    . LYS A  1  337  ? 224.144 273.745 226.408 1.00 0.00 ? 337  LYS A CD    1 
ATOM   2395  C  CE    . LYS A  1  337  ? 224.782 275.107 226.579 1.00 0.00 ? 337  LYS A CE    1 
ATOM   2396  N  NZ    . LYS A  1  337  ? 225.962 275.265 225.680 1.00 0.00 ? 337  LYS A NZ    1 
ATOM   2397  N  N     . SER A  1  338  ? 225.543 272.288 231.181 1.00 0.00 ? 338  SER A N     1 
ATOM   2398  C  CA    . SER A  1  338  ? 225.997 272.500 232.557 1.00 0.00 ? 338  SER A CA    1 
ATOM   2399  C  C     . SER A  1  338  ? 226.524 273.906 232.813 1.00 0.00 ? 338  SER A C     1 
ATOM   2400  O  O     . SER A  1  338  ? 226.668 274.711 231.888 1.00 0.00 ? 338  SER A O     1 
ATOM   2401  C  CB    . SER A  1  338  ? 227.074 271.485 232.914 1.00 0.00 ? 338  SER A CB    1 
ATOM   2402  O  OG    . SER A  1  338  ? 226.549 270.179 232.808 1.00 0.00 ? 338  SER A OG    1 
ATOM   2403  N  N     . LEU A  1  339  ? 226.812 274.194 234.076 1.00 0.00 ? 339  LEU A N     1 
ATOM   2404  C  CA    . LEU A  1  339  ? 227.190 275.540 234.468 1.00 0.00 ? 339  LEU A CA    1 
ATOM   2405  C  C     . LEU A  1  339  ? 228.437 276.102 233.780 1.00 0.00 ? 339  LEU A C     1 
ATOM   2406  O  O     . LEU A  1  339  ? 228.459 277.281 233.422 1.00 0.00 ? 339  LEU A O     1 
ATOM   2407  C  CB    . LEU A  1  339  ? 227.398 275.605 235.968 1.00 0.00 ? 339  LEU A CB    1 
ATOM   2408  C  CG    . LEU A  1  339  ? 226.092 275.421 236.705 1.00 0.00 ? 339  LEU A CG    1 
ATOM   2409  C  CD1   . LEU A  1  339  ? 226.408 275.182 238.154 1.00 0.00 ? 339  LEU A CD1   1 
ATOM   2410  C  CD2   . LEU A  1  339  ? 225.210 276.623 236.516 1.00 0.00 ? 339  LEU A CD2   1 
ATOM   2411  N  N     . LYS A  1  340  ? 229.444 275.269 233.538 1.00 0.00 ? 340  LYS A N     1 
ATOM   2412  C  CA    . LYS A  1  340  ? 230.610 275.737 232.796 1.00 0.00 ? 340  LYS A CA    1 
ATOM   2413  C  C     . LYS A  1  340  ? 230.235 276.166 231.386 1.00 0.00 ? 340  LYS A C     1 
ATOM   2414  O  O     . LYS A  1  340  ? 230.632 277.243 230.965 1.00 0.00 ? 340  LYS A O     1 
ATOM   2415  C  CB    . LYS A  1  340  ? 231.705 274.684 232.750 1.00 0.00 ? 340  LYS A CB    1 
ATOM   2416  C  CG    . LYS A  1  340  ? 232.943 275.160 232.018 1.00 0.00 ? 340  LYS A CG    1 
ATOM   2417  C  CD    . LYS A  1  340  ? 233.954 274.044 231.833 1.00 0.00 ? 340  LYS A CD    1 
ATOM   2418  C  CE    . LYS A  1  340  ? 235.167 274.489 231.019 1.00 0.00 ? 340  LYS A CE    1 
ATOM   2419  N  NZ    . LYS A  1  340  ? 236.060 273.333 230.701 1.00 0.00 ? 340  LYS A NZ    1 
ATOM   2420  N  N     . GLN A  1  341  ? 229.468 275.349 230.668 1.00 0.00 ? 341  GLN A N     1 
ATOM   2421  C  CA    . GLN A  1  341  ? 229.058 275.692 229.302 1.00 0.00 ? 341  GLN A CA    1 
ATOM   2422  C  C     . GLN A  1  341  ? 228.265 276.985 229.290 1.00 0.00 ? 341  GLN A C     1 
ATOM   2423  O  O     . GLN A  1  341  ? 228.442 277.818 228.399 1.00 0.00 ? 341  GLN A O     1 
ATOM   2424  C  CB    . GLN A  1  341  ? 228.243 274.590 228.617 1.00 0.00 ? 341  GLN A CB    1 
ATOM   2425  C  CG    . GLN A  1  341  ? 229.036 273.361 228.216 1.00 0.00 ? 341  GLN A CG    1 
ATOM   2426  C  CD    . GLN A  1  341  ? 229.606 272.608 229.394 1.00 0.00 ? 341  GLN A CD    1 
ATOM   2427  O  OE1   . GLN A  1  341  ? 228.922 272.396 230.395 1.00 0.00 ? 341  GLN A OE1   1 
ATOM   2428  N  NE2   . GLN A  1  341  ? 230.868 272.212 229.291 1.00 0.00 ? 341  GLN A NE2   1 
ATOM   2429  N  N     . ARG A  1  342  ? 227.380 277.158 230.263 1.00 0.00 ? 342  ARG A N     1 
ATOM   2430  C  CA    . ARG A  1  342  ? 226.602 278.382 230.308 1.00 0.00 ? 342  ARG A CA    1 
ATOM   2431  C  C     . ARG A  1  342  ? 227.499 279.603 230.432 1.00 0.00 ? 342  ARG A C     1 
ATOM   2432  O  O     . ARG A  1  342  ? 227.234 280.612 229.807 1.00 0.00 ? 342  ARG A O     1 
ATOM   2433  C  CB    . ARG A  1  342  ? 225.629 278.350 231.481 1.00 0.00 ? 342  ARG A CB    1 
ATOM   2434  C  CG    . ARG A  1  342  ? 224.471 277.441 231.233 1.00 0.00 ? 342  ARG A CG    1 
ATOM   2435  C  CD    . ARG A  1  342  ? 223.560 277.361 232.418 1.00 0.00 ? 342  ARG A CD    1 
ATOM   2436  N  NE    . ARG A  1  342  ? 222.522 276.368 232.182 1.00 0.00 ? 342  ARG A NE    1 
ATOM   2437  C  CZ    . ARG A  1  342  ? 221.273 276.482 232.603 1.00 0.00 ? 342  ARG A CZ    1 
ATOM   2438  N  NH1   . ARG A  1  342  ? 220.899 277.563 233.271 1.00 0.00 ? 342  ARG A NH1   1 
ATOM   2439  N  NH2   . ARG A  1  342  ? 220.390 275.535 232.321 1.00 0.00 ? 342  ARG A NH2   1 
ATOM   2440  N  N     . LEU A  1  343  ? 228.576 279.512 231.197 1.00 0.00 ? 343  LEU A N     1 
ATOM   2441  C  CA    . LEU A  1  343  ? 229.486 280.643 231.315 1.00 0.00 ? 343  LEU A CA    1 
ATOM   2442  C  C     . LEU A  1  343  ? 230.363 280.841 230.060 1.00 0.00 ? 343  LEU A C     1 
ATOM   2443  O  O     . LEU A  1  343  ? 230.659 281.969 229.684 1.00 0.00 ? 343  LEU A O     1 
ATOM   2444  C  CB    . LEU A  1  343  ? 230.338 280.483 232.565 1.00 0.00 ? 343  LEU A CB    1 
ATOM   2445  C  CG    . LEU A  1  343  ? 229.749 281.186 233.788 1.00 0.00 ? 343  LEU A CG    1 
ATOM   2446  C  CD1   . LEU A  1  343  ? 228.420 280.592 234.168 1.00 0.00 ? 343  LEU A CD1   1 
ATOM   2447  C  CD2   . LEU A  1  343  ? 230.706 281.106 234.957 1.00 0.00 ? 343  LEU A CD2   1 
ATOM   2448  N  N     . LYS A  1  344  ? 230.795 279.744 229.442 1.00 0.00 ? 344  LYS A N     1 
ATOM   2449  C  CA    . LYS A  1  344  ? 232.027 279.691 228.638 1.00 0.00 ? 344  LYS A CA    1 
ATOM   2450  C  C     . LYS A  1  344  ? 232.133 280.626 227.437 1.00 0.00 ? 344  LYS A C     1 
ATOM   2451  O  O     . LYS A  1  344  ? 232.964 281.530 227.420 1.00 0.00 ? 344  LYS A O     1 
ATOM   2452  C  CB    . LYS A  1  344  ? 232.242 278.270 228.131 1.00 0.00 ? 344  LYS A CB    1 
ATOM   2453  C  CG    . LYS A  1  344  ? 233.643 277.994 227.641 1.00 0.00 ? 344  LYS A CG    1 
ATOM   2454  C  CD    . LYS A  1  344  ? 234.414 277.149 228.634 1.00 0.00 ? 344  LYS A CD    1 
ATOM   2455  C  CE    . LYS A  1  344  ? 235.826 276.936 228.146 1.00 0.00 ? 344  LYS A CE    1 
ATOM   2456  N  NZ    . LYS A  1  344  ? 235.813 276.251 226.823 1.00 0.00 ? 344  LYS A NZ    1 
ATOM   2457  N  N     . GLY A  1  345  ? 231.299 280.385 226.427 1.00 0.00 ? 345  GLY A N     1 
ATOM   2458  C  CA    . GLY A  1  345  ? 231.540 280.900 225.087 1.00 0.00 ? 345  GLY A CA    1 
ATOM   2459  C  C     . GLY A  1  345  ? 230.951 282.275 224.821 1.00 0.00 ? 345  GLY A C     1 
ATOM   2460  O  O     . GLY A  1  345  ? 230.536 282.965 225.753 1.00 0.00 ? 345  GLY A O     1 
ATOM   2461  N  N     . LYS A  1  346  ? 230.925 282.684 223.552 1.00 0.00 ? 346  LYS A N     1 
ATOM   2462  C  CA    . LYS A  1  346  ? 230.341 283.969 223.166 1.00 0.00 ? 346  LYS A CA    1 
ATOM   2463  C  C     . LYS A  1  346  ? 228.901 284.177 223.650 1.00 0.00 ? 346  LYS A C     1 
ATOM   2464  O  O     . LYS A  1  346  ? 228.533 285.278 224.060 1.00 0.00 ? 346  LYS A O     1 
ATOM   2465  C  CB    . LYS A  1  346  ? 230.375 284.132 221.649 1.00 0.00 ? 346  LYS A CB    1 
ATOM   2466  C  CG    . LYS A  1  346  ? 229.820 285.467 221.173 1.00 0.00 ? 346  LYS A CG    1 
ATOM   2467  C  CD    . LYS A  1  346  ? 229.588 285.472 219.677 1.00 0.00 ? 346  LYS A CD    1 
ATOM   2468  C  CE    . LYS A  1  346  ? 230.831 284.988 218.949 1.00 0.00 ? 346  LYS A CE    1 
ATOM   2469  N  NZ    . LYS A  1  346  ? 230.752 285.160 217.469 1.00 0.00 ? 346  LYS A NZ    1 
ATOM   2470  N  N     . GLU A  1  347  ? 228.102 283.112 223.612 1.00 0.00 ? 347  GLU A N     1 
ATOM   2471  C  CA    . GLU A  1  347  ? 226.700 283.159 224.047 1.00 0.00 ? 347  GLU A CA    1 
ATOM   2472  C  C     . GLU A  1  347  ? 226.557 282.931 225.554 1.00 0.00 ? 347  GLU A C     1 
ATOM   2473  O  O     . GLU A  1  347  ? 225.441 282.804 226.073 1.00 0.00 ? 347  GLU A O     1 
ATOM   2474  C  CB    . GLU A  1  347  ? 225.864 282.118 223.291 1.00 0.00 ? 347  GLU A CB    1 
ATOM   2475  C  CG    . GLU A  1  347  ? 226.144 280.669 223.694 1.00 0.00 ? 347  GLU A CG    1 
ATOM   2476  C  CD    . GLU A  1  347  ? 227.522 280.177 223.256 1.00 0.00 ? 347  GLU A CD    1 
ATOM   2477  O  OE1   . GLU A  1  347  ? 228.233 280.917 222.530 1.00 0.00 ? 347  GLU A OE1   1 
ATOM   2478  O  OE2   . GLU A  1  347  ? 227.890 279.044 223.650 1.00 0.00 ? 347  GLU A OE2   1 
ATOM   2479  N  N     . GLY A  1  348  ? 227.691 282.852 226.249 1.00 0.00 ? 348  GLY A N     1 
ATOM   2480  C  CA    . GLY A  1  348  ? 227.691 282.644 227.686 1.00 0.00 ? 348  GLY A CA    1 
ATOM   2481  C  C     . GLY A  1  348  ? 227.611 283.899 228.532 1.00 0.00 ? 348  GLY A C     1 
ATOM   2482  O  O     . GLY A  1  348  ? 227.866 284.996 228.046 1.00 0.00 ? 348  GLY A O     1 
ATOM   2483  N  N     . ARG A  1  349  ? 227.284 283.724 229.810 1.00 0.00 ? 349  ARG A N     1 
ATOM   2484  C  CA    . ARG A  1  349  ? 227.001 284.830 230.711 1.00 0.00 ? 349  ARG A CA    1 
ATOM   2485  C  C     . ARG A  1  349  ? 228.075 285.888 230.693 1.00 0.00 ? 349  ARG A C     1 
ATOM   2486  O  O     . ARG A  1  349  ? 227.764 287.059 230.615 1.00 0.00 ? 349  ARG A O     1 
ATOM   2487  C  CB    . ARG A  1  349  ? 226.836 284.334 232.134 1.00 0.00 ? 349  ARG A CB    1 
ATOM   2488  C  CG    . ARG A  1  349  ? 225.772 283.294 232.291 1.00 0.00 ? 349  ARG A CG    1 
ATOM   2489  C  CD    . ARG A  1  349  ? 224.395 283.850 232.081 1.00 0.00 ? 349  ARG A CD    1 
ATOM   2490  N  NE    . ARG A  1  349  ? 223.424 282.825 232.421 1.00 0.00 ? 349  ARG A NE    1 
ATOM   2491  C  CZ    . ARG A  1  349  ? 222.232 282.707 231.856 1.00 0.00 ? 349  ARG A CZ    1 
ATOM   2492  N  NH1   . ARG A  1  349  ? 221.837 283.560 230.920 1.00 0.00 ? 349  ARG A NH1   1 
ATOM   2493  N  NH2   . ARG A  1  349  ? 221.436 281.721 232.236 1.00 0.00 ? 349  ARG A NH2   1 
ATOM   2494  N  N     . VAL A  1  350  ? 229.335 285.475 230.730 1.00 0.00 ? 350  VAL A N     1 
ATOM   2495  C  CA    . VAL A  1  350  ? 230.437 286.420 230.845 1.00 0.00 ? 350  VAL A CA    1 
ATOM   2496  C  C     . VAL A  1  350  ? 230.466 287.437 229.704 1.00 0.00 ? 350  VAL A C     1 
ATOM   2497  O  O     . VAL A  1  350  ? 230.557 288.649 229.947 1.00 0.00 ? 350  VAL A O     1 
ATOM   2498  C  CB    . VAL A  1  350  ? 231.780 285.690 230.885 1.00 0.00 ? 350  VAL A CB    1 
ATOM   2499  C  CG1   . VAL A  1  350  ? 232.905 286.680 231.041 1.00 0.00 ? 350  VAL A CG1   1 
ATOM   2500  C  CG2   . VAL A  1  350  ? 231.794 284.688 232.024 1.00 0.00 ? 350  VAL A CG2   1 
ATOM   2501  N  N     . ARG A  1  351  ? 230.381 286.935 228.471 1.00 0.00 ? 351  ARG A N     1 
ATOM   2502  C  CA    . ARG A  1  351  ? 230.461 287.756 227.253 1.00 0.00 ? 351  ARG A CA    1 
ATOM   2503  C  C     . ARG A  1  351  ? 229.117 288.154 226.647 1.00 0.00 ? 351  ARG A C     1 
ATOM   2504  O  O     . ARG A  1  351  ? 228.916 289.305 226.260 1.00 0.00 ? 351  ARG A O     1 
ATOM   2505  C  CB    . ARG A  1  351  ? 231.271 287.024 226.188 1.00 0.00 ? 351  ARG A CB    1 
ATOM   2506  C  CG    . ARG A  1  351  ? 232.724 286.831 226.574 1.00 0.00 ? 351  ARG A CG    1 
ATOM   2507  C  CD    . ARG A  1  351  ? 233.369 285.862 225.630 1.00 0.00 ? 351  ARG A CD    1 
ATOM   2508  N  NE    . ARG A  1  351  ? 233.477 286.401 224.285 1.00 0.00 ? 351  ARG A NE    1 
ATOM   2509  C  CZ    . ARG A  1  351  ? 233.778 285.664 223.223 1.00 0.00 ? 351  ARG A CZ    1 
ATOM   2510  N  NH1   . ARG A  1  351  ? 233.964 284.352 223.352 1.00 0.00 ? 351  ARG A NH1   1 
ATOM   2511  N  NH2   . ARG A  1  351  ? 233.864 286.233 222.031 1.00 0.00 ? 351  ARG A NH2   1 
ATOM   2512  N  N     . GLY A  1  352  ? 228.225 287.177 226.527 1.00 0.00 ? 352  GLY A N     1 
ATOM   2513  C  CA    . GLY A  1  352  ? 226.943 287.351 225.869 1.00 0.00 ? 352  GLY A CA    1 
ATOM   2514  C  C     . GLY A  1  352  ? 225.904 288.177 226.600 1.00 0.00 ? 352  GLY A C     1 
ATOM   2515  O  O     . GLY A  1  352  ? 225.176 288.933 225.960 1.00 0.00 ? 352  GLY A O     1 
ATOM   2516  N  N     . ASN A  1  353  ? 225.784 288.011 227.913 1.00 0.00 ? 353  ASN A N     1 
ATOM   2517  C  CA    . ASN A  1  353  ? 224.801 288.784 228.643 1.00 0.00 ? 353  ASN A CA    1 
ATOM   2518  C  C     . ASN A  1  353  ? 225.371 289.787 229.581 1.00 0.00 ? 353  ASN A C     1 
ATOM   2519  O  O     . ASN A  1  353  ? 224.839 290.873 229.697 1.00 0.00 ? 353  ASN A O     1 
ATOM   2520  C  CB    . ASN A  1  353  ? 223.896 287.855 229.408 1.00 0.00 ? 353  ASN A CB    1 
ATOM   2521  C  CG    . ASN A  1  353  ? 223.230 286.851 228.507 1.00 0.00 ? 353  ASN A CG    1 
ATOM   2522  O  OD1   . ASN A  1  353  ? 222.417 287.216 227.648 1.00 0.00 ? 353  ASN A OD1   1 
ATOM   2523  N  ND2   . ASN A  1  353  ? 223.563 285.573 228.687 1.00 0.00 ? 353  ASN A ND2   1 
ATOM   2524  N  N     . LEU A  1  354  ? 226.450 289.428 230.251 1.00 0.00 ? 354  LEU A N     1 
ATOM   2525  C  CA    . LEU A  1  354  ? 226.987 290.288 231.291 1.00 0.00 ? 354  LEU A CA    1 
ATOM   2526  C  C     . LEU A  1  354  ? 227.535 291.585 230.711 1.00 0.00 ? 354  LEU A C     1 
ATOM   2527  O  O     . LEU A  1  354  ? 227.173 292.678 231.141 1.00 0.00 ? 354  LEU A O     1 
ATOM   2528  C  CB    . LEU A  1  354  ? 228.089 289.576 232.059 1.00 0.00 ? 354  LEU A CB    1 
ATOM   2529  C  CG    . LEU A  1  354  ? 228.581 290.338 233.270 1.00 0.00 ? 354  LEU A CG    1 
ATOM   2530  C  CD1   . LEU A  1  354  ? 227.411 290.517 234.242 1.00 0.00 ? 354  LEU A CD1   1 
ATOM   2531  C  CD2   . LEU A  1  354  ? 229.741 289.602 233.901 1.00 0.00 ? 354  LEU A CD2   1 
ATOM   2532  N  N     . MET A  1  355  ? 228.408 291.449 229.722 1.00 0.00 ? 355  MET A N     1 
ATOM   2533  C  CA    . MET A  1  355  ? 229.083 292.591 229.140 1.00 0.00 ? 355  MET A CA    1 
ATOM   2534  C  C     . MET A  1  355  ? 228.525 293.028 227.774 1.00 0.00 ? 355  MET A C     1 
ATOM   2535  O  O     . MET A  1  355  ? 228.704 294.170 227.380 1.00 0.00 ? 355  MET A O     1 
ATOM   2536  C  CB    . MET A  1  355  ? 230.563 292.262 229.031 1.00 0.00 ? 355  MET A CB    1 
ATOM   2537  C  CG    . MET A  1  355  ? 231.439 293.464 228.811 1.00 0.00 ? 355  MET A CG    1 
ATOM   2538  S  SD    . MET A  1  355  ? 233.169 293.192 229.237 1.00 0.00 ? 355  MET A SD    1 
ATOM   2539  C  CE    . MET A  1  355  ? 233.546 291.781 228.206 1.00 0.00 ? 355  MET A CE    1 
ATOM   2540  N  N     . GLY A  1  356  ? 227.834 292.141 227.061 1.00 0.00 ? 356  GLY A N     1 
ATOM   2541  C  CA    . GLY A  1  356  ? 227.122 292.529 225.845 1.00 0.00 ? 356  GLY A CA    1 
ATOM   2542  C  C     . GLY A  1  356  ? 225.595 292.511 225.944 1.00 0.00 ? 356  GLY A C     1 
ATOM   2543  O  O     . GLY A  1  356  ? 224.931 291.621 225.405 1.00 0.00 ? 356  GLY A O     1 
ATOM   2544  N  N     . LYS A  1  357  ? 225.032 293.527 226.593 1.00 0.00 ? 357  LYS A N     1 
ATOM   2545  C  CA    . LYS A  1  357  ? 223.613 293.557 226.960 1.00 0.00 ? 357  LYS A CA    1 
ATOM   2546  C  C     . LYS A  1  357  ? 222.664 294.021 225.835 1.00 0.00 ? 357  LYS A C     1 
ATOM   2547  O  O     . LYS A  1  357  ? 223.064 294.804 224.998 1.00 0.00 ? 357  LYS A O     1 
ATOM   2548  C  CB    . LYS A  1  357  ? 223.486 294.464 228.182 1.00 0.00 ? 357  LYS A CB    1 
ATOM   2549  C  CG    . LYS A  1  357  ? 224.305 293.952 229.342 1.00 0.00 ? 357  LYS A CG    1 
ATOM   2550  C  CD    . LYS A  1  357  ? 224.180 294.820 230.559 1.00 0.00 ? 357  LYS A CD    1 
ATOM   2551  C  CE    . LYS A  1  357  ? 224.635 294.081 231.819 1.00 0.00 ? 357  LYS A CE    1 
ATOM   2552  N  NZ    . LYS A  1  357  ? 223.666 293.010 232.199 1.00 0.00 ? 357  LYS A NZ    1 
ATOM   2553  N  N     . ARG A  1  358  ? 221.412 293.565 225.818 1.00 0.00 ? 358  ARG A N     1 
ATOM   2554  C  CA    . ARG A  1  358  ? 220.404 294.119 224.915 1.00 0.00 ? 358  ARG A CA    1 
ATOM   2555  C  C     . ARG A  1  358  ? 219.922 295.398 225.526 1.00 0.00 ? 358  ARG A C     1 
ATOM   2556  O  O     . ARG A  1  358  ? 219.620 295.393 226.703 1.00 0.00 ? 358  ARG A O     1 
ATOM   2557  C  CB    . ARG A  1  358  ? 219.220 293.182 224.765 1.00 0.00 ? 358  ARG A CB    1 
ATOM   2558  C  CG    . ARG A  1  358  ? 219.591 291.762 224.529 1.00 0.00 ? 358  ARG A CG    1 
ATOM   2559  C  CD    . ARG A  1  358  ? 220.123 291.613 223.156 1.00 0.00 ? 358  ARG A CD    1 
ATOM   2560  N  NE    . ARG A  1  358  ? 219.045 291.423 222.200 1.00 0.00 ? 358  ARG A NE    1 
ATOM   2561  C  CZ    . ARG A  1  358  ? 219.242 291.048 220.940 1.00 0.00 ? 358  ARG A CZ    1 
ATOM   2562  N  NH1   . ARG A  1  358  ? 220.487 290.845 220.482 1.00 0.00 ? 358  ARG A NH1   1 
ATOM   2563  N  NH2   . ARG A  1  358  ? 218.193 290.901 220.137 1.00 0.00 ? 358  ARG A NH2   1 
ATOM   2564  N  N     . VAL A  1  359  ? 219.825 296.489 224.770 1.00 0.00 ? 359  VAL A N     1 
ATOM   2565  C  CA    . VAL A  1  359  ? 219.405 297.748 225.393 1.00 0.00 ? 359  VAL A CA    1 
ATOM   2566  C  C     . VAL A  1  359  ? 218.027 298.201 224.975 1.00 0.00 ? 359  VAL A C     1 
ATOM   2567  O  O     . VAL A  1  359  ? 217.505 297.778 223.984 1.00 0.00 ? 359  VAL A O     1 
ATOM   2568  C  CB    . VAL A  1  359  ? 220.358 298.950 225.111 1.00 0.00 ? 359  VAL A CB    1 
ATOM   2569  C  CG1   . VAL A  1  359  ? 221.781 298.651 225.459 1.00 0.00 ? 359  VAL A CG1   1 
ATOM   2570  C  CG2   . VAL A  1  359  ? 220.221 299.437 223.723 1.00 0.00 ? 359  VAL A CG2   1 
ATOM   2571  N  N     . ASP A  1  360  ? 217.415 299.033 225.792 1.00 0.00 ? 360  ASP A N     1 
ATOM   2572  C  CA    . ASP A  1  360  ? 216.195 299.712 225.440 1.00 0.00 ? 360  ASP A CA    1 
ATOM   2573  C  C     . ASP A  1  360  ? 216.465 301.067 224.832 1.00 0.00 ? 360  ASP A C     1 
ATOM   2574  O  O     . ASP A  1  360  ? 217.562 301.607 224.972 1.00 0.00 ? 360  ASP A O     1 
ATOM   2575  C  CB    . ASP A  1  360  ? 215.371 299.833 226.681 1.00 0.00 ? 360  ASP A CB    1 
ATOM   2576  C  CG    . ASP A  1  360  ? 214.940 298.502 227.132 1.00 0.00 ? 360  ASP A CG    1 
ATOM   2577  O  OD1   . ASP A  1  360  ? 215.081 297.634 226.227 1.00 0.00 ? 360  ASP A OD1   1 
ATOM   2578  O  OD2   . ASP A  1  360  ? 214.480 298.315 228.299 1.00 0.00 ? 360  ASP A OD2   1 
ATOM   2579  N  N     . PHE A  1  361  ? 215.443 301.652 224.225 1.00 0.00 ? 361  PHE A N     1 
ATOM   2580  C  CA    . PHE A  1  361  ? 215.628 302.865 223.453 1.00 0.00 ? 361  PHE A CA    1 
ATOM   2581  C  C     . PHE A  1  361  ? 216.620 302.660 222.334 1.00 0.00 ? 361  PHE A C     1 
ATOM   2582  O  O     . PHE A  1  361  ? 217.506 303.474 222.140 1.00 0.00 ? 361  PHE A O     1 
ATOM   2583  C  CB    . PHE A  1  361  ? 216.071 303.997 224.373 1.00 0.00 ? 361  PHE A CB    1 
ATOM   2584  C  CG    . PHE A  1  361  ? 215.115 304.233 225.465 1.00 0.00 ? 361  PHE A CG    1 
ATOM   2585  C  CD1   . PHE A  1  361  ? 214.040 305.060 225.261 1.00 0.00 ? 361  PHE A CD1   1 
ATOM   2586  C  CD2   . PHE A  1  361  ? 215.220 303.564 226.667 1.00 0.00 ? 361  PHE A CD2   1 
ATOM   2587  C  CE1   . PHE A  1  361  ? 213.105 305.253 226.244 1.00 0.00 ? 361  PHE A CE1   1 
ATOM   2588  C  CE2   . PHE A  1  361  ? 214.275 303.754 227.665 1.00 0.00 ? 361  PHE A CE2   1 
ATOM   2589  C  CZ    . PHE A  1  361  ? 213.222 304.609 227.451 1.00 0.00 ? 361  PHE A CZ    1 
ATOM   2590  N  N     . SER A  1  362  ? 216.412 301.609 221.548 1.00 0.00 ? 362  SER A N     1 
ATOM   2591  C  CA    . SER A  1  362  ? 217.275 301.320 220.433 1.00 0.00 ? 362  SER A CA    1 
ATOM   2592  C  C     . SER A  1  362  ? 216.440 301.252 219.160 1.00 0.00 ? 362  SER A C     1 
ATOM   2593  O  O     . SER A  1  362  ? 215.335 300.713 219.215 1.00 0.00 ? 362  SER A O     1 
ATOM   2594  C  CB    . SER A  1  362  ? 217.926 299.961 220.714 1.00 0.00 ? 362  SER A CB    1 
ATOM   2595  O  OG    . SER A  1  362  ? 219.099 299.655 219.979 1.00 0.00 ? 362  SER A OG    1 
ATOM   2596  N  N     . ALA A  1  363  ? 217.001 301.590 217.991 1.00 0.00 ? 363  ALA A N     1 
ATOM   2597  C  CA    . ALA A  1  363  ? 216.231 301.518 216.730 1.00 0.00 ? 363  ALA A CA    1 
ATOM   2598  C  C     . ALA A  1  363  ? 217.112 301.140 215.546 1.00 0.00 ? 363  ALA A C     1 
ATOM   2599  O  O     . ALA A  1  363  ? 218.264 301.418 215.564 1.00 0.00 ? 363  ALA A O     1 
ATOM   2600  C  CB    . ALA A  1  363  ? 215.579 302.852 216.445 1.00 0.00 ? 363  ALA A CB    1 
ATOM   2601  N  N     . ARG A  1  364  ? 216.578 300.560 214.487 1.00 0.00 ? 364  ARG A N     1 
ATOM   2602  C  CA    . ARG A  1  364  ? 217.402 300.190 213.347 1.00 0.00 ? 364  ARG A CA    1 
ATOM   2603  C  C     . ARG A  1  364  ? 216.529 300.323 212.110 1.00 0.00 ? 364  ARG A C     1 
ATOM   2604  O  O     . ARG A  1  364  ? 215.460 299.677 212.099 1.00 0.00 ? 364  ARG A O     1 
ATOM   2605  C  CB    . ARG A  1  364  ? 217.856 298.760 213.472 1.00 0.00 ? 364  ARG A CB    1 
ATOM   2606  C  CG    . ARG A  1  364  ? 218.561 298.200 212.288 1.00 0.00 ? 364  ARG A CG    1 
ATOM   2607  C  CD    . ARG A  1  364  ? 219.166 296.800 212.639 1.00 0.00 ? 364  ARG A CD    1 
ATOM   2608  N  NE    . ARG A  1  364  ? 220.310 296.697 213.551 1.00 0.00 ? 364  ARG A NE    1 
ATOM   2609  C  CZ    . ARG A  1  364  ? 221.557 296.391 213.178 1.00 0.00 ? 364  ARG A CZ    1 
ATOM   2610  N  NH1   . ARG A  1  364  ? 221.837 296.144 211.900 1.00 0.00 ? 364  ARG A NH1   1 
ATOM   2611  N  NH2   . ARG A  1  364  ? 222.529 296.303 214.087 1.00 0.00 ? 364  ARG A NH2   1 
ATOM   2612  N  N     . THR A  1  365  ? 217.003 301.011 211.046 1.00 0.00 ? 365  THR A N     1 
ATOM   2613  C  CA    . THR A  1  365  ? 216.358 301.065 209.700 1.00 0.00 ? 365  THR A CA    1 
ATOM   2614  C  C     . THR A  1  365  ? 217.440 301.145 208.623 1.00 0.00 ? 365  THR A C     1 
ATOM   2615  O  O     . THR A  1  365  ? 218.591 301.203 208.940 1.00 0.00 ? 365  THR A O     1 
ATOM   2616  C  CB    . THR A  1  365  ? 215.422 302.219 209.481 1.00 0.00 ? 365  THR A CB    1 
ATOM   2617  O  OG1   . THR A  1  365  ? 216.188 303.372 209.665 1.00 0.00 ? 365  THR A OG1   1 
ATOM   2618  C  CG2   . THR A  1  365  ? 214.412 302.334 210.504 1.00 0.00 ? 365  THR A CG2   1 
ATOM   2619  N  N     . VAL A  1  366  ? 217.070 301.232 207.358 1.00 0.00 ? 366  VAL A N     1 
ATOM   2620  C  CA    . VAL A  1  366  ? 218.041 301.432 206.288 1.00 0.00 ? 366  VAL A CA    1 
ATOM   2621  C  C     . VAL A  1  366  ? 218.534 302.886 206.228 1.00 0.00 ? 366  VAL A C     1 
ATOM   2622  O  O     . VAL A  1  366  ? 217.881 303.778 206.696 1.00 0.00 ? 366  VAL A O     1 
ATOM   2623  C  CB    . VAL A  1  366  ? 217.382 301.010 204.949 1.00 0.00 ? 366  VAL A CB    1 
ATOM   2624  C  CG1   . VAL A  1  366  ? 218.288 301.219 203.830 1.00 0.00 ? 366  VAL A CG1   1 
ATOM   2625  C  CG2   . VAL A  1  366  ? 217.103 299.540 204.940 1.00 0.00 ? 366  VAL A CG2   1 
ATOM   2626  N  N     . ILE A  1  367  ? 219.713 303.138 205.706 1.00 0.00 ? 367  ILE A N     1 
ATOM   2627  C  CA    . ILE A  1  367  ? 220.183 304.511 205.591 1.00 0.00 ? 367  ILE A CA    1 
ATOM   2628  C  C     . ILE A  1  367  ? 220.021 304.927 204.108 1.00 0.00 ? 367  ILE A C     1 
ATOM   2629  O  O     . ILE A  1  367  ? 220.095 304.103 203.232 1.00 0.00 ? 367  ILE A O     1 
ATOM   2630  C  CB    . ILE A  1  367  ? 221.636 304.654 206.080 1.00 0.00 ? 367  ILE A CB    1 
ATOM   2631  C  CG1   . ILE A  1  367  ? 222.597 303.733 205.322 1.00 0.00 ? 367  ILE A CG1   1 
ATOM   2632  C  CG2   . ILE A  1  367  ? 221.679 304.355 207.548 1.00 0.00 ? 367  ILE A CG2   1 
ATOM   2633  C  CD1   . ILE A  1  367  ? 224.036 303.904 205.662 1.00 0.00 ? 367  ILE A CD1   1 
ATOM   2634  N  N     . THR A  1  368  ? 219.678 306.152 203.793 1.00 0.00 ? 368  THR A N     1 
ATOM   2635  C  CA    . THR A  1  368  ? 219.671 306.540 202.383 1.00 0.00 ? 368  THR A CA    1 
ATOM   2636  C  C     . THR A  1  368  ? 220.246 307.895 202.340 1.00 0.00 ? 368  THR A C     1 
ATOM   2637  O  O     . THR A  1  368  ? 220.149 308.594 203.303 1.00 0.00 ? 368  THR A O     1 
ATOM   2638  C  CB    . THR A  1  368  ? 218.290 306.466 201.650 1.00 0.00 ? 368  THR A CB    1 
ATOM   2639  O  OG1   . THR A  1  368  ? 217.297 307.320 202.265 1.00 0.00 ? 368  THR A OG1   1 
ATOM   2640  C  CG2   . THR A  1  368  ? 217.818 304.999 201.505 1.00 0.00 ? 368  THR A CG2   1 
ATOM   2641  N  N     . PRO A  1  369  ? 220.819 308.309 201.216 1.00 0.00 ? 369  PRO A N     1 
ATOM   2642  C  CA    . PRO A  1  369  ? 221.566 309.543 201.356 1.00 0.00 ? 369  PRO A CA    1 
ATOM   2643  C  C     . PRO A  1  369  ? 220.695 310.735 201.384 1.00 0.00 ? 369  PRO A C     1 
ATOM   2644  O  O     . PRO A  1  369  ? 219.613 310.652 200.854 1.00 0.00 ? 369  PRO A O     1 
ATOM   2645  C  CB    . PRO A  1  369  ? 222.376 309.572 200.078 1.00 0.00 ? 369  PRO A CB    1 
ATOM   2646  C  CG    . PRO A  1  369  ? 221.492 308.877 199.117 1.00 0.00 ? 369  PRO A CG    1 
ATOM   2647  C  CD    . PRO A  1  369  ? 220.825 307.817 199.833 1.00 0.00 ? 369  PRO A CD    1 
ATOM   2648  N  N     . ASP A  1  370  ? 221.157 311.772 202.077 1.00 0.00 ? 370  ASP A N     1 
ATOM   2649  C  CA    . ASP A  1  370  ? 220.496 313.064 202.159 1.00 0.00 ? 370  ASP A CA    1 
ATOM   2650  C  C     . ASP A  1  370  ? 221.455 314.266 202.244 1.00 0.00 ? 370  ASP A C     1 
ATOM   2651  O  O     . ASP A  1  370  ? 221.886 314.625 203.340 1.00 0.00 ? 370  ASP A O     1 
ATOM   2652  C  CB    . ASP A  1  370  ? 219.562 313.095 203.353 1.00 0.00 ? 370  ASP A CB    1 
ATOM   2653  C  CG    . ASP A  1  370  ? 218.408 314.054 203.154 1.00 0.00 ? 370  ASP A CG    1 
ATOM   2654  O  OD1   . ASP A  1  370  ? 218.589 315.081 202.448 1.00 0.00 ? 370  ASP A OD1   1 
ATOM   2655  O  OD2   . ASP A  1  370  ? 217.319 313.791 203.715 1.00 0.00 ? 370  ASP A OD2   1 
ATOM   2656  N  N     . PRO A  1  371  ? 221.776 314.878 201.080 1.00 0.00 ? 371  PRO A N     1 
ATOM   2657  C  CA    . PRO A  1  371  ? 222.487 316.129 200.744 1.00 0.00 ? 371  PRO A CA    1 
ATOM   2658  C  C     . PRO A  1  371  ? 222.090 317.415 201.474 1.00 0.00 ? 371  PRO A C     1 
ATOM   2659  O  O     . PRO A  1  371  ? 222.761 318.442 201.341 1.00 0.00 ? 371  PRO A O     1 
ATOM   2660  C  CB    . PRO A  1  371  ? 222.182 316.292 199.253 1.00 0.00 ? 371  PRO A CB    1 
ATOM   2661  C  CG    . PRO A  1  371  ? 222.139 314.914 198.781 1.00 0.00 ? 371  PRO A CG    1 
ATOM   2662  C  CD    . PRO A  1  371  ? 221.483 314.112 199.856 1.00 0.00 ? 371  PRO A CD    1 
ATOM   2663  N  N     . ASN A  1  372  ? 220.997 317.389 202.209 1.00 0.00 ? 372  ASN A N     1 
ATOM   2664  C  CA    . ASN A  1  372  ? 220.603 318.605 202.879 1.00 0.00 ? 372  ASN A CA    1 
ATOM   2665  C  C     . ASN A  1  372  ? 220.865 318.601 204.346 1.00 0.00 ? 372  ASN A C     1 
ATOM   2666  O  O     . ASN A  1  372  ? 220.739 319.614 205.007 1.00 0.00 ? 372  ASN A O     1 
ATOM   2667  C  CB    . ASN A  1  372  ? 219.157 318.844 202.620 1.00 0.00 ? 372  ASN A CB    1 
ATOM   2668  C  CG    . ASN A  1  372  ? 218.921 319.060 201.211 1.00 0.00 ? 372  ASN A CG    1 
ATOM   2669  O  OD1   . ASN A  1  372  ? 219.824 318.854 200.396 1.00 0.00 ? 372  ASN A OD1   1 
ATOM   2670  N  ND2   . ASN A  1  372  ? 217.718 319.500 200.874 1.00 0.00 ? 372  ASN A ND2   1 
ATOM   2671  N  N     . LEU A  1  373  ? 221.252 317.469 204.879 1.00 0.00 ? 373  LEU A N     1 
ATOM   2672  C  CA    . LEU A  1  373  ? 221.474 317.434 206.291 1.00 0.00 ? 373  LEU A CA    1 
ATOM   2673  C  C     . LEU A  1  373  ? 222.782 318.193 206.556 1.00 0.00 ? 373  LEU A C     1 
ATOM   2674  O  O     . LEU A  1  373  ? 223.521 318.481 205.634 1.00 0.00 ? 373  LEU A O     1 
ATOM   2675  C  CB    . LEU A  1  373  ? 221.496 315.985 206.725 1.00 0.00 ? 373  LEU A CB    1 
ATOM   2676  C  CG    . LEU A  1  373  ? 220.169 315.398 207.202 1.00 0.00 ? 373  LEU A CG    1 
ATOM   2677  C  CD1   . LEU A  1  373  ? 219.084 315.452 206.163 1.00 0.00 ? 373  LEU A CD1   1 
ATOM   2678  C  CD2   . LEU A  1  373  ? 220.415 313.986 207.610 1.00 0.00 ? 373  LEU A CD2   1 
ATOM   2679  N  N     . SER A  1  374  ? 223.026 318.622 207.778 1.00 0.00 ? 374  SER A N     1 
ATOM   2680  C  CA    . SER A  1  374  ? 224.324 319.177 208.113 1.00 0.00 ? 374  SER A CA    1 
ATOM   2681  C  C     . SER A  1  374  ? 225.194 317.990 208.443 1.00 0.00 ? 374  SER A C     1 
ATOM   2682  O  O     . SER A  1  374  ? 224.686 316.896 208.390 1.00 0.00 ? 374  SER A O     1 
ATOM   2683  C  CB    . SER A  1  374  ? 224.207 320.144 209.277 1.00 0.00 ? 374  SER A CB    1 
ATOM   2684  O  OG    . SER A  1  374  ? 223.398 321.287 208.967 1.00 0.00 ? 374  SER A OG    1 
ATOM   2685  N  N     . ILE A  1  375  ? 226.481 318.158 208.745 1.00 0.00 ? 375  ILE A N     1 
ATOM   2686  C  CA    . ILE A  1  375  ? 227.330 316.974 208.969 1.00 0.00 ? 375  ILE A CA    1 
ATOM   2687  C  C     . ILE A  1  375  ? 226.865 316.137 210.126 1.00 0.00 ? 375  ILE A C     1 
ATOM   2688  O  O     . ILE A  1  375  ? 227.010 314.932 210.091 1.00 0.00 ? 375  ILE A O     1 
ATOM   2689  C  CB    . ILE A  1  375  ? 228.781 317.300 209.232 1.00 0.00 ? 375  ILE A CB    1 
ATOM   2690  C  CG1   . ILE A  1  375  ? 229.470 317.458 207.911 1.00 0.00 ? 375  ILE A CG1   1 
ATOM   2691  C  CG2   . ILE A  1  375  ? 229.461 316.099 209.743 1.00 0.00 ? 375  ILE A CG2   1 
ATOM   2692  C  CD1   . ILE A  1  375  ? 229.303 316.197 207.096 1.00 0.00 ? 375  ILE A CD1   1 
ATOM   2693  N  N     . ASP A  1  376  ? 226.275 316.739 211.147 1.00 0.00 ? 376  ASP A N     1 
ATOM   2694  C  CA    . ASP A  1  376  ? 225.878 315.913 212.265 1.00 0.00 ? 376  ASP A CA    1 
ATOM   2695  C  C     . ASP A  1  376  ? 224.367 315.785 212.473 1.00 0.00 ? 376  ASP A C     1 
ATOM   2696  O  O     . ASP A  1  376  ? 223.952 315.408 213.551 1.00 0.00 ? 376  ASP A O     1 
ATOM   2697  C  CB    . ASP A  1  376  ? 226.561 316.414 213.530 1.00 0.00 ? 376  ASP A CB    1 
ATOM   2698  C  CG    . ASP A  1  376  ? 226.327 317.881 213.783 1.00 0.00 ? 376  ASP A CG    1 
ATOM   2699  O  OD1   . ASP A  1  376  ? 225.706 318.541 212.909 1.00 0.00 ? 376  ASP A OD1   1 
ATOM   2700  O  OD2   . ASP A  1  376  ? 226.773 318.354 214.864 1.00 0.00 ? 376  ASP A OD2   1 
ATOM   2701  N  N     . GLN A  1  377  ? 223.547 316.069 211.457 1.00 0.00 ? 377  GLN A N     1 
ATOM   2702  C  CA    . GLN A  1  377  ? 222.114 315.776 211.561 1.00 0.00 ? 377  GLN A CA    1 
ATOM   2703  C  C     . GLN A  1  377  ? 221.789 314.397 211.013 1.00 0.00 ? 377  GLN A C     1 
ATOM   2704  O  O     . GLN A  1  377  ? 222.503 313.880 210.175 1.00 0.00 ? 377  GLN A O     1 
ATOM   2705  C  CB    . GLN A  1  377  ? 221.306 316.783 210.834 1.00 0.00 ? 377  GLN A CB    1 
ATOM   2706  C  CG    . GLN A  1  377  ? 221.324 318.052 211.579 1.00 0.00 ? 377  GLN A CG    1 
ATOM   2707  C  CD    . GLN A  1  377  ? 220.475 319.080 210.900 1.00 0.00 ? 377  GLN A CD    1 
ATOM   2708  O  OE1   . GLN A  1  377  ? 220.586 319.298 209.680 1.00 0.00 ? 377  GLN A OE1   1 
ATOM   2709  N  NE2   . GLN A  1  377  ? 219.687 319.816 211.707 1.00 0.00 ? 377  GLN A NE2   1 
ATOM   2710  N  N     . VAL A  1  378  ? 220.711 313.804 211.500 1.00 0.00 ? 378  VAL A N     1 
ATOM   2711  C  CA    . VAL A  1  378  ? 220.150 312.546 211.004 1.00 0.00 ? 378  VAL A CA    1 
ATOM   2712  C  C     . VAL A  1  378  ? 218.611 312.583 210.868 1.00 0.00 ? 378  VAL A C     1 
ATOM   2713  O  O     . VAL A  1  378  ? 217.917 313.010 211.770 1.00 0.00 ? 378  VAL A O     1 
ATOM   2714  C  CB    . VAL A  1  378  ? 220.668 311.336 211.899 1.00 0.00 ? 378  VAL A CB    1 
ATOM   2715  C  CG1   . VAL A  1  378  ? 220.256 311.413 213.304 1.00 0.00 ? 378  VAL A CG1   1 
ATOM   2716  C  CG2   . VAL A  1  378  ? 220.322 310.010 211.330 1.00 0.00 ? 378  VAL A CG2   1 
ATOM   2717  N  N     . GLY A  1  379  ? 218.077 312.296 209.693 1.00 0.00 ? 379  GLY A N     1 
ATOM   2718  C  CA    . GLY A  1  379  ? 216.636 312.262 209.515 1.00 0.00 ? 379  GLY A CA    1 
ATOM   2719  C  C     . GLY A  1  379  ? 216.106 311.047 210.250 1.00 0.00 ? 379  GLY A C     1 
ATOM   2720  O  O     . GLY A  1  379  ? 216.703 310.027 210.181 1.00 0.00 ? 379  GLY A O     1 
ATOM   2721  N  N     . VAL A  1  380  ? 215.028 311.128 211.003 1.00 0.00 ? 380  VAL A N     1 
ATOM   2722  C  CA    . VAL A  1  380  ? 214.572 309.966 211.777 1.00 0.00 ? 380  VAL A CA    1 
ATOM   2723  C  C     . VAL A  1  380  ? 213.116 309.790 211.340 1.00 0.00 ? 380  VAL A C     1 
ATOM   2724  O  O     . VAL A  1  380  ? 212.338 310.770 211.355 1.00 0.00 ? 380  VAL A O     1 
ATOM   2725  C  CB    . VAL A  1  380  ? 214.637 310.150 213.249 1.00 0.00 ? 380  VAL A CB    1 
ATOM   2726  C  CG1   . VAL A  1  380  ? 214.319 308.823 213.925 1.00 0.00 ? 380  VAL A CG1   1 
ATOM   2727  C  CG2   . VAL A  1  380  ? 215.988 310.489 213.637 1.00 0.00 ? 380  VAL A CG2   1 
ATOM   2728  N  N     . PRO A  1  381  ? 212.743 308.552 210.938 1.00 0.00 ? 381  PRO A N     1 
ATOM   2729  C  CA    . PRO A  1  381  ? 211.334 308.335 210.567 1.00 0.00 ? 381  PRO A CA    1 
ATOM   2730  C  C     . PRO A  1  381  ? 210.340 308.845 211.588 1.00 0.00 ? 381  PRO A C     1 
ATOM   2731  O  O     . PRO A  1  381  ? 210.509 308.479 212.722 1.00 0.00 ? 381  PRO A O     1 
ATOM   2732  C  CB    . PRO A  1  381  ? 211.239 306.820 210.562 1.00 0.00 ? 381  PRO A CB    1 
ATOM   2733  C  CG    . PRO A  1  381  ? 212.606 306.367 210.260 1.00 0.00 ? 381  PRO A CG    1 
ATOM   2734  C  CD    . PRO A  1  381  ? 213.515 307.302 210.960 1.00 0.00 ? 381  PRO A CD    1 
ATOM   2735  N  N     . ARG A  1  382  ? 209.219 309.427 211.185 1.00 0.00 ? 382  ARG A N     1 
ATOM   2736  C  CA    . ARG A  1  382  ? 208.284 309.947 212.171 1.00 0.00 ? 382  ARG A CA    1 
ATOM   2737  C  C     . ARG A  1  382  ? 207.751 308.889 213.111 1.00 0.00 ? 382  ARG A C     1 
ATOM   2738  O  O     . ARG A  1  382  ? 207.591 309.170 214.285 1.00 0.00 ? 382  ARG A O     1 
ATOM   2739  C  CB    . ARG A  1  382  ? 207.118 310.662 211.500 1.00 0.00 ? 382  ARG A CB    1 
ATOM   2740  C  CG    . ARG A  1  382  ? 206.111 311.214 212.498 1.00 0.00 ? 382  ARG A CG    1 
ATOM   2741  C  CD    . ARG A  1  382  ? 204.850 311.762 211.831 1.00 0.00 ? 382  ARG A CD    1 
ATOM   2742  N  NE    . ARG A  1  382  ? 205.137 312.880 210.930 1.00 0.00 ? 382  ARG A NE    1 
ATOM   2743  C  CZ    . ARG A  1  382  ? 204.218 313.716 210.433 1.00 0.00 ? 382  ARG A CZ    1 
ATOM   2744  N  NH1   . ARG A  1  382  ? 202.923 313.539 210.717 1.00 0.00 ? 382  ARG A NH1   1 
ATOM   2745  N  NH2   . ARG A  1  382  ? 204.600 314.733 209.646 1.00 0.00 ? 382  ARG A NH2   1 
ATOM   2746  N  N     . SER A  1  383  ? 207.522 307.670 212.629 1.00 0.00 ? 383  SER A N     1 
ATOM   2747  C  CA    . SER A  1  383  ? 207.022 306.589 213.501 1.00 0.00 ? 383  SER A CA    1 
ATOM   2748  C  C     . SER A  1  383  ? 208.022 306.206 214.626 1.00 0.00 ? 383  SER A C     1 
ATOM   2749  O  O     . SER A  1  383  ? 207.612 305.944 215.752 1.00 0.00 ? 383  SER A O     1 
ATOM   2750  C  CB    . SER A  1  383  ? 206.618 305.369 212.670 1.00 0.00 ? 383  SER A CB    1 
ATOM   2751  O  OG    . SER A  1  383  ? 207.677 304.950 211.849 1.00 0.00 ? 383  SER A OG    1 
ATOM   2752  N  N     . ILE A  1  384  ? 209.297 306.060 214.296 1.00 0.00 ? 384  ILE A N     1 
ATOM   2753  C  CA    . ILE A  1  384  ? 210.371 305.834 215.266 1.00 0.00 ? 384  ILE A CA    1 
ATOM   2754  C  C     . ILE A  1  384  ? 210.454 307.057 216.171 1.00 0.00 ? 384  ILE A C     1 
ATOM   2755  O  O     . ILE A  1  384  ? 210.747 306.927 217.314 1.00 0.00 ? 384  ILE A O     1 
ATOM   2756  C  CB    . ILE A  1  384  ? 211.709 305.493 214.607 1.00 0.00 ? 384  ILE A CB    1 
ATOM   2757  C  CG1   . ILE A  1  384  ? 211.587 304.100 213.986 1.00 0.00 ? 384  ILE A CG1   1 
ATOM   2758  C  CG2   . ILE A  1  384  ? 212.829 305.468 215.611 1.00 0.00 ? 384  ILE A CG2   1 
ATOM   2759  C  CD1   . ILE A  1  384  ? 212.810 303.586 213.331 1.00 0.00 ? 384  ILE A CD1   1 
ATOM   2760  N  N     . ALA A  1  385  ? 210.291 308.259 215.662 1.00 0.00 ? 385  ALA A N     1 
ATOM   2761  C  CA    . ALA A  1  385  ? 210.354 309.419 216.545 1.00 0.00 ? 385  ALA A CA    1 
ATOM   2762  C  C     . ALA A  1  385  ? 209.207 309.453 217.550 1.00 0.00 ? 385  ALA A C     1 
ATOM   2763  O  O     . ALA A  1  385  ? 209.402 309.855 218.691 1.00 0.00 ? 385  ALA A O     1 
ATOM   2764  C  CB    . ALA A  1  385  ? 210.353 310.686 215.737 1.00 0.00 ? 385  ALA A CB    1 
ATOM   2765  N  N     . ALA A  1  386  ? 208.014 309.057 217.127 1.00 0.00 ? 386  ALA A N     1 
ATOM   2766  C  CA    . ALA A  1  386  ? 206.881 308.875 218.051 1.00 0.00 ? 386  ALA A CA    1 
ATOM   2767  C  C     . ALA A  1  386  ? 206.999 307.740 219.063 1.00 0.00 ? 386  ALA A C     1 
ATOM   2768  O  O     . ALA A  1  386  ? 206.449 307.815 220.148 1.00 0.00 ? 386  ALA A O     1 
ATOM   2769  C  CB    . ALA A  1  386  ? 205.593 308.666 217.246 1.00 0.00 ? 386  ALA A CB    1 
ATOM   2770  N  N     . ASN A  1  387  ? 207.698 306.679 218.721 1.00 0.00 ? 387  ASN A N     1 
ATOM   2771  C  CA    . ASN A  1  387  ? 207.803 305.583 219.653 1.00 0.00 ? 387  ASN A CA    1 
ATOM   2772  C  C     . ASN A  1  387  ? 208.819 305.818 220.734 1.00 0.00 ? 387  ASN A C     1 
ATOM   2773  O  O     . ASN A  1  387  ? 208.644 305.347 221.840 1.00 0.00 ? 387  ASN A O     1 
ATOM   2774  C  CB    . ASN A  1  387  ? 208.149 304.313 218.930 1.00 0.00 ? 387  ASN A CB    1 
ATOM   2775  C  CG    . ASN A  1  387  ? 208.012 303.114 219.805 1.00 0.00 ? 387  ASN A CG    1 
ATOM   2776  O  OD1   . ASN A  1  387  ? 207.126 303.054 220.658 1.00 0.00 ? 387  ASN A OD1   1 
ATOM   2777  N  ND2   . ASN A  1  387  ? 208.911 302.159 219.640 1.00 0.00 ? 387  ASN A ND2   1 
ATOM   2778  N  N     . MET A  1  388  ? 209.910 306.497 220.432 1.00 0.00 ? 388  MET A N     1 
ATOM   2779  C  CA    . MET A  1  388  ? 210.911 306.658 221.473 1.00 0.00 ? 388  MET A CA    1 
ATOM   2780  C  C     . MET A  1  388  ? 211.021 307.992 222.167 1.00 0.00 ? 388  MET A C     1 
ATOM   2781  O  O     . MET A  1  388  ? 211.187 309.043 221.549 1.00 0.00 ? 388  MET A O     1 
ATOM   2782  C  CB    . MET A  1  388  ? 212.242 306.298 220.920 1.00 0.00 ? 388  MET A CB    1 
ATOM   2783  C  CG    . MET A  1  388  ? 212.331 304.845 220.719 1.00 0.00 ? 388  MET A CG    1 
ATOM   2784  S  SD    . MET A  1  388  ? 213.829 304.780 219.819 1.00 0.00 ? 388  MET A SD    1 
ATOM   2785  C  CE    . MET A  1  388  ? 215.002 305.518 220.990 1.00 0.00 ? 388  MET A CE    1 
ATOM   2786  N  N     . THR A  1  389  ? 211.047 307.875 223.489 1.00 0.00 ? 389  THR A N     1 
ATOM   2787  C  CA    . THR A  1  389  ? 210.764 308.949 224.413 1.00 0.00 ? 389  THR A CA    1 
ATOM   2788  C  C     . THR A  1  389  ? 211.978 309.398 225.217 1.00 0.00 ? 389  THR A C     1 
ATOM   2789  O  O     . THR A  1  389  ? 212.882 308.618 225.498 1.00 0.00 ? 389  THR A O     1 
ATOM   2790  C  CB    . THR A  1  389  ? 209.694 308.509 225.374 1.00 0.00 ? 389  THR A CB    1 
ATOM   2791  O  OG1   . THR A  1  389  ? 210.074 307.247 225.925 1.00 0.00 ? 389  THR A OG1   1 
ATOM   2792  C  CG2   . THR A  1  389  ? 208.410 308.312 224.643 1.00 0.00 ? 389  THR A CG2   1 
ATOM   2793  N  N     . PHE A  1  390  ? 211.924 310.644 225.656 1.00 0.00 ? 390  PHE A N     1 
ATOM   2794  C  CA    . PHE A  1  390  ? 212.870 311.264 226.565 1.00 0.00 ? 390  PHE A CA    1 
ATOM   2795  C  C     . PHE A  1  390  ? 212.174 311.883 227.743 1.00 0.00 ? 390  PHE A C     1 
ATOM   2796  O  O     . PHE A  1  390  ? 211.176 312.575 227.597 1.00 0.00 ? 390  PHE A O     1 
ATOM   2797  C  CB    . PHE A  1  390  ? 213.713 312.306 225.828 1.00 0.00 ? 390  PHE A CB    1 
ATOM   2798  C  CG    . PHE A  1  390  ? 214.882 312.812 226.619 1.00 0.00 ? 390  PHE A CG    1 
ATOM   2799  C  CD1   . PHE A  1  390  ? 216.045 312.067 226.737 1.00 0.00 ? 390  PHE A CD1   1 
ATOM   2800  C  CD2   . PHE A  1  390  ? 214.855 314.077 227.179 1.00 0.00 ? 390  PHE A CD2   1 
ATOM   2801  C  CE1   . PHE A  1  390  ? 217.145 312.558 227.463 1.00 0.00 ? 390  PHE A CE1   1 
ATOM   2802  C  CE2   . PHE A  1  390  ? 215.952 314.575 227.911 1.00 0.00 ? 390  PHE A CE2   1 
ATOM   2803  C  CZ    . PHE A  1  390  ? 217.096 313.817 228.042 1.00 0.00 ? 390  PHE A CZ    1 
ATOM   2804  N  N     . ALA A  1  391  ? 212.748 311.677 228.916 1.00 0.00 ? 391  ALA A N     1 
ATOM   2805  C  CA    . ALA A  1  391  ? 212.141 312.154 230.147 1.00 0.00 ? 391  ALA A CA    1 
ATOM   2806  C  C     . ALA A  1  391  ? 212.599 313.543 230.458 1.00 0.00 ? 391  ALA A C     1 
ATOM   2807  O  O     . ALA A  1  391  ? 213.759 313.755 230.785 1.00 0.00 ? 391  ALA A O     1 
ATOM   2808  C  CB    . ALA A  1  391  ? 212.459 311.213 231.310 1.00 0.00 ? 391  ALA A CB    1 
ATOM   2809  N  N     . GLU A  1  392  ? 211.746 314.520 230.188 1.00 0.00 ? 392  GLU A N     1 
ATOM   2810  C  CA    . GLU A  1  392  ? 212.071 315.853 230.654 1.00 0.00 ? 392  GLU A CA    1 
ATOM   2811  C  C     . GLU A  1  392  ? 211.496 316.033 232.031 1.00 0.00 ? 392  GLU A C     1 
ATOM   2812  O  O     . GLU A  1  392  ? 210.443 315.507 232.363 1.00 0.00 ? 392  GLU A O     1 
ATOM   2813  C  CB    . GLU A  1  392  ? 211.548 316.915 229.697 1.00 0.00 ? 392  GLU A CB    1 
ATOM   2814  C  CG    . GLU A  1  392  ? 212.338 316.995 228.394 1.00 0.00 ? 392  GLU A CG    1 
ATOM   2815  C  CD    . GLU A  1  392  ? 212.045 318.261 227.597 1.00 0.00 ? 392  GLU A CD    1 
ATOM   2816  O  OE1   . GLU A  1  392  ? 211.217 318.214 226.668 1.00 0.00 ? 392  GLU A OE1   1 
ATOM   2817  O  OE2   . GLU A  1  392  ? 212.640 319.323 227.941 1.00 0.00 ? 392  GLU A OE2   1 
ATOM   2818  N  N     . ILE A  1  393  ? 212.221 316.757 232.859 1.00 0.00 ? 393  ILE A N     1 
ATOM   2819  C  CA    . ILE A  1  393  ? 211.768 317.051 234.195 1.00 0.00 ? 393  ILE A CA    1 
ATOM   2820  C  C     . ILE A  1  393  ? 211.134 318.435 234.184 1.00 0.00 ? 393  ILE A C     1 
ATOM   2821  O  O     . ILE A  1  393  ? 211.669 319.367 233.593 1.00 0.00 ? 393  ILE A O     1 
ATOM   2822  C  CB    . ILE A  1  393  ? 212.934 316.925 235.192 1.00 0.00 ? 393  ILE A CB    1 
ATOM   2823  C  CG1   . ILE A  1  393  ? 212.452 317.199 236.602 1.00 0.00 ? 393  ILE A CG1   1 
ATOM   2824  C  CG2   . ILE A  1  393  ? 214.036 317.882 234.896 1.00 0.00 ? 393  ILE A CG2   1 
ATOM   2825  C  CD1   . ILE A  1  393  ? 213.479 316.856 237.658 1.00 0.00 ? 393  ILE A CD1   1 
ATOM   2826  N  N     . VAL A  1  394  ? 209.982 318.570 234.826 1.00 0.00 ? 394  VAL A N     1 
ATOM   2827  C  CA    . VAL A  1  394  ? 209.238 319.822 234.761 1.00 0.00 ? 394  VAL A CA    1 
ATOM   2828  C  C     . VAL A  1  394  ? 209.866 320.933 235.597 1.00 0.00 ? 394  VAL A C     1 
ATOM   2829  O  O     . VAL A  1  394  ? 210.077 320.785 236.804 1.00 0.00 ? 394  VAL A O     1 
ATOM   2830  C  CB    . VAL A  1  394  ? 207.776 319.638 235.213 1.00 0.00 ? 394  VAL A CB    1 
ATOM   2831  C  CG1   . VAL A  1  394  ? 207.092 320.980 235.362 1.00 0.00 ? 394  VAL A CG1   1 
ATOM   2832  C  CG2   . VAL A  1  394  ? 207.019 318.775 234.234 1.00 0.00 ? 394  VAL A CG2   1 
ATOM   2833  N  N     . THR A  1  395  ? 210.138 322.059 234.943 1.00 0.00 ? 395  THR A N     1 
ATOM   2834  C  CA    . THR A  1  395  ? 210.657 323.247 235.613 1.00 0.00 ? 395  THR A CA    1 
ATOM   2835  C  C     . THR A  1  395  ? 209.657 324.380 235.444 1.00 0.00 ? 395  THR A C     1 
ATOM   2836  O  O     . THR A  1  395  ? 208.915 324.413 234.462 1.00 0.00 ? 395  THR A O     1 
ATOM   2837  C  CB    . THR A  1  395  ? 212.016 323.703 235.027 1.00 0.00 ? 395  THR A CB    1 
ATOM   2838  O  OG1   . THR A  1  395  ? 211.807 324.501 233.851 1.00 0.00 ? 395  THR A OG1   1 
ATOM   2839  C  CG2   . THR A  1  395  ? 212.902 322.503 234.698 1.00 0.00 ? 395  THR A CG2   1 
ATOM   2840  N  N     . PRO A  1  396  ? 209.654 325.338 236.375 1.00 0.00 ? 396  PRO A N     1 
ATOM   2841  C  CA    . PRO A  1  396  ? 208.751 326.491 236.245 1.00 0.00 ? 396  PRO A CA    1 
ATOM   2842  C  C     . PRO A  1  396  ? 209.092 327.442 235.085 1.00 0.00 ? 396  PRO A C     1 
ATOM   2843  O  O     . PRO A  1  396  ? 208.893 328.651 235.223 1.00 0.00 ? 396  PRO A O     1 
ATOM   2844  C  CB    . PRO A  1  396  ? 208.902 327.205 237.592 1.00 0.00 ? 396  PRO A CB    1 
ATOM   2845  C  CG    . PRO A  1  396  ? 210.227 326.766 238.112 1.00 0.00 ? 396  PRO A CG    1 
ATOM   2846  C  CD    . PRO A  1  396  ? 210.414 325.359 237.635 1.00 0.00 ? 396  PRO A CD    1 
ATOM   2847  N  N     . PHE A  1  397  ? 209.610 326.912 233.978 1.00 0.00 ? 397  PHE A N     1 
ATOM   2848  C  CA    . PHE A  1  397  ? 209.843 327.713 232.776 1.00 0.00 ? 397  PHE A CA    1 
ATOM   2849  C  C     . PHE A  1  397  ? 209.257 327.068 231.532 1.00 0.00 ? 397  PHE A C     1 
ATOM   2850  O  O     . PHE A  1  397  ? 208.583 327.723 230.739 1.00 0.00 ? 397  PHE A O     1 
ATOM   2851  C  CB    . PHE A  1  397  ? 211.337 327.954 232.571 1.00 0.00 ? 397  PHE A CB    1 
ATOM   2852  C  CG    . PHE A  1  397  ? 212.002 328.575 233.750 1.00 0.00 ? 397  PHE A CG    1 
ATOM   2853  C  CD1   . PHE A  1  397  ? 211.898 329.938 233.970 1.00 0.00 ? 397  PHE A CD1   1 
ATOM   2854  C  CD2   . PHE A  1  397  ? 212.707 327.801 234.653 1.00 0.00 ? 397  PHE A CD2   1 
ATOM   2855  C  CE1   . PHE A  1  397  ? 212.498 330.529 235.067 1.00 0.00 ? 397  PHE A CE1   1 
ATOM   2856  C  CE2   . PHE A  1  397  ? 213.313 328.383 235.754 1.00 0.00 ? 397  PHE A CE2   1 
ATOM   2857  C  CZ    . PHE A  1  397  ? 213.208 329.751 235.962 1.00 0.00 ? 397  PHE A CZ    1 
ATOM   2858  N  N     . ASN A  1  398  ? 209.507 325.775 231.368 1.00 0.00 ? 398  ASN A N     1 
ATOM   2859  C  CA    . ASN A  1  398  ? 208.985 325.057 230.219 1.00 0.00 ? 398  ASN A CA    1 
ATOM   2860  C  C     . ASN A  1  398  ? 207.573 324.548 230.487 1.00 0.00 ? 398  ASN A C     1 
ATOM   2861  O  O     . ASN A  1  398  ? 206.921 324.026 229.584 1.00 0.00 ? 398  ASN A O     1 
ATOM   2862  C  CB    . ASN A  1  398  ? 209.930 323.917 229.831 1.00 0.00 ? 398  ASN A CB    1 
ATOM   2863  C  CG    . ASN A  1  398  ? 210.145 322.927 230.954 1.00 0.00 ? 398  ASN A CG    1 
ATOM   2864  O  OD1   . ASN A  1  398  ? 209.410 322.910 231.947 1.00 0.00 ? 398  ASN A OD1   1 
ATOM   2865  N  ND2   . ASN A  1  398  ? 211.170 322.094 230.810 1.00 0.00 ? 398  ASN A ND2   1 
ATOM   2866  N  N     . ILE A  1  399  ? 207.112 324.721 231.726 1.00 0.00 ? 399  ILE A N     1 
ATOM   2867  C  CA    . ILE A  1  399  ? 205.846 324.151 232.187 1.00 0.00 ? 399  ILE A CA    1 
ATOM   2868  C  C     . ILE A  1  399  ? 204.687 324.404 231.224 1.00 0.00 ? 399  ILE A C     1 
ATOM   2869  O  O     . ILE A  1  399  ? 203.836 323.534 231.034 1.00 0.00 ? 399  ILE A O     1 
ATOM   2870  C  CB    . ILE A  1  399  ? 205.462 324.668 233.589 1.00 0.00 ? 399  ILE A CB    1 
ATOM   2871  C  CG1   . ILE A  1  399  ? 204.264 323.879 234.124 1.00 0.00 ? 399  ILE A CG1   1 
ATOM   2872  C  CG2   . ILE A  1  399  ? 205.202 326.169 233.585 1.00 0.00 ? 399  ILE A CG2   1 
ATOM   2873  C  CD1   . ILE A  1  399  ? 204.014 324.074 235.596 1.00 0.00 ? 399  ILE A CD1   1 
ATOM   2874  N  N     . ASP A  1  400  ? 204.619 325.606 230.659 1.00 0.00 ? 400  ASP A N     1 
ATOM   2875  C  CA    . ASP A  1  400  ? 203.566 325.933 229.704 1.00 0.00 ? 400  ASP A CA    1 
ATOM   2876  C  C     . ASP A  1  400  ? 203.732 325.124 228.391 1.00 0.00 ? 400  ASP A C     1 
ATOM   2877  O  O     . ASP A  1  400  ? 202.755 324.686 227.773 1.00 0.00 ? 400  ASP A O     1 
ATOM   2878  C  CB    . ASP A  1  400  ? 203.560 327.438 229.425 1.00 0.00 ? 400  ASP A CB    1 
ATOM   2879  C  CG    . ASP A  1  400  ? 202.432 327.856 228.498 1.00 0.00 ? 400  ASP A CG    1 
ATOM   2880  O  OD1   . ASP A  1  400  ? 201.254 327.674 228.893 1.00 0.00 ? 400  ASP A OD1   1 
ATOM   2881  O  OD2   . ASP A  1  400  ? 202.725 328.341 227.379 1.00 0.00 ? 400  ASP A OD2   1 
ATOM   2882  N  N     . ARG A  1  401  ? 204.974 324.963 227.956 1.00 0.00 ? 401  ARG A N     1 
ATOM   2883  C  CA    . ARG A  1  401  ? 205.289 324.191 226.759 1.00 0.00 ? 401  ARG A CA    1 
ATOM   2884  C  C     . ARG A  1  401  ? 204.968 322.712 226.970 1.00 0.00 ? 401  ARG A C     1 
ATOM   2885  O  O     . ARG A  1  401  ? 204.366 322.081 226.116 1.00 0.00 ? 401  ARG A O     1 
ATOM   2886  C  CB    . ARG A  1  401  ? 206.733 324.401 226.345 1.00 0.00 ? 401  ARG A CB    1 
ATOM   2887  C  CG    . ARG A  1  401  ? 207.108 323.688 225.073 1.00 0.00 ? 401  ARG A CG    1 
ATOM   2888  C  CD    . ARG A  1  401  ? 208.514 324.083 224.711 1.00 0.00 ? 401  ARG A CD    1 
ATOM   2889  N  NE    . ARG A  1  401  ? 209.423 323.694 225.779 1.00 0.00 ? 401  ARG A NE    1 
ATOM   2890  C  CZ    . ARG A  1  401  ? 209.882 322.463 225.961 1.00 0.00 ? 401  ARG A CZ    1 
ATOM   2891  N  NH1   . ARG A  1  401  ? 209.516 321.486 225.137 1.00 0.00 ? 401  ARG A NH1   1 
ATOM   2892  N  NH2   . ARG A  1  401  ? 210.762 322.234 226.929 1.00 0.00 ? 401  ARG A NH2   1 
ATOM   2893  N  N     . LEU A  1  402  ? 205.386 322.160 228.101 1.00 0.00 ? 402  LEU A N     1 
ATOM   2894  C  CA    . LEU A  1  402  ? 205.150 320.755 228.422 1.00 0.00 ? 402  LEU A CA    1 
ATOM   2895  C  C     . LEU A  1  402  ? 203.665 320.524 228.643 1.00 0.00 ? 402  LEU A C     1 
ATOM   2896  O  O     . LEU A  1  402  ? 203.167 319.458 228.321 1.00 0.00 ? 402  LEU A O     1 
ATOM   2897  C  CB    . LEU A  1  402  ? 205.944 320.298 229.637 1.00 0.00 ? 402  LEU A CB    1 
ATOM   2898  C  CG    . LEU A  1  402  ? 207.461 320.327 229.492 1.00 0.00 ? 402  LEU A CG    1 
ATOM   2899  C  CD1   . LEU A  1  402  ? 208.097 319.643 230.688 1.00 0.00 ? 402  LEU A CD1   1 
ATOM   2900  C  CD2   . LEU A  1  402  ? 207.905 319.679 228.193 1.00 0.00 ? 402  LEU A CD2   1 
ATOM   2901  N  N     . GLN A  1  403  ? 202.968 321.501 229.211 1.00 0.00 ? 403  GLN A N     1 
ATOM   2902  C  CA    . GLN A  1  403  ? 201.508 321.426 229.343 1.00 0.00 ? 403  GLN A CA    1 
ATOM   2903  C  C     . GLN A  1  403  ? 200.820 321.265 227.987 1.00 0.00 ? 403  GLN A C     1 
ATOM   2904  O  O     . GLN A  1  403  ? 199.854 320.518 227.872 1.00 0.00 ? 403  GLN A O     1 
ATOM   2905  C  CB    . GLN A  1  403  ? 200.968 322.671 230.041 1.00 0.00 ? 403  GLN A CB    1 
ATOM   2906  C  CG    . GLN A  1  403  ? 199.491 322.613 230.359 1.00 0.00 ? 403  GLN A CG    1 
ATOM   2907  C  CD    . GLN A  1  403  ? 199.159 321.539 231.369 1.00 0.00 ? 403  GLN A CD    1 
ATOM   2908  O  OE1   . GLN A  1  403  ? 199.418 321.686 232.562 1.00 0.00 ? 403  GLN A OE1   1 
ATOM   2909  N  NE2   . GLN A  1  403  ? 198.565 320.454 230.896 1.00 0.00 ? 403  GLN A NE2   1 
ATOM   2910  N  N     . GLU A  1  404  ? 201.296 321.971 226.971 1.00 0.00 ? 404  GLU A N     1 
ATOM   2911  C  CA    . GLU A  1  404  ? 200.789 321.777 225.617 1.00 0.00 ? 404  GLU A CA    1 
ATOM   2912  C  C     . GLU A  1  404  ? 200.990 320.335 225.116 1.00 0.00 ? 404  GLU A C     1 
ATOM   2913  O  O     . GLU A  1  404  ? 200.080 319.764 224.518 1.00 0.00 ? 404  GLU A O     1 
ATOM   2914  C  CB    . GLU A  1  404  ? 201.470 322.751 224.660 1.00 0.00 ? 404  GLU A CB    1 
ATOM   2915  C  CG    . GLU A  1  404  ? 200.978 322.666 223.215 1.00 0.00 ? 404  GLU A CG    1 
ATOM   2916  C  CD    . GLU A  1  404  ? 201.145 323.978 222.440 1.00 0.00 ? 404  GLU A CD    1 
ATOM   2917  O  OE1   . GLU A  1  404  ? 201.483 325.014 223.077 1.00 0.00 ? 404  GLU A OE1   1 
ATOM   2918  O  OE2   . GLU A  1  404  ? 200.931 323.960 221.196 1.00 0.00 ? 404  GLU A OE2   1 
ATOM   2919  N  N     . LEU A  1  405  ? 202.171 319.760 225.360 1.00 0.00 ? 405  LEU A N     1 
ATOM   2920  C  CA    . LEU A  1  405  ? 202.506 318.384 224.940 1.00 0.00 ? 405  LEU A CA    1 
ATOM   2921  C  C     . LEU A  1  405  ? 201.638 317.299 225.585 1.00 0.00 ? 405  LEU A C     1 
ATOM   2922  O  O     . LEU A  1  405  ? 201.234 316.345 224.925 1.00 0.00 ? 405  LEU A O     1 
ATOM   2923  C  CB    . LEU A  1  405  ? 203.966 318.065 225.259 1.00 0.00 ? 405  LEU A CB    1 
ATOM   2924  C  CG    . LEU A  1  405  ? 204.984 318.296 224.161 1.00 0.00 ? 405  LEU A CG    1 
ATOM   2925  C  CD1   . LEU A  1  405  ? 204.777 319.650 223.528 1.00 0.00 ? 405  LEU A CD1   1 
ATOM   2926  C  CD2   . LEU A  1  405  ? 206.367 318.186 224.757 1.00 0.00 ? 405  LEU A CD2   1 
ATOM   2927  N  N     . VAL A  1  406  ? 201.406 317.413 226.887 1.00 0.00 ? 406  VAL A N     1 
ATOM   2928  C  CA    . VAL A  1  406  ? 200.449 316.560 227.574 1.00 0.00 ? 406  VAL A CA    1 
ATOM   2929  C  C     . VAL A  1  406  ? 199.050 316.691 226.988 1.00 0.00 ? 406  VAL A C     1 
ATOM   2930  O  O     . VAL A  1  406  ? 198.367 315.701 226.789 1.00 0.00 ? 406  VAL A O     1 
ATOM   2931  C  CB    . VAL A  1  406  ? 200.397 316.868 229.066 1.00 0.00 ? 406  VAL A CB    1 
ATOM   2932  C  CG1   . VAL A  1  406  ? 199.345 316.022 229.717 1.00 0.00 ? 406  VAL A CG1   1 
ATOM   2933  C  CG2   . VAL A  1  406  ? 201.738 316.583 229.712 1.00 0.00 ? 406  VAL A CG2   1 
ATOM   2934  N  N     . ARG A  1  407  ? 198.637 317.919 226.704 1.00 0.00 ? 407  ARG A N     1 
ATOM   2935  C  CA    . ARG A  1  407  ? 197.345 318.207 226.076 1.00 0.00 ? 407  ARG A CA    1 
ATOM   2936  C  C     . ARG A  1  407  ? 197.213 317.655 224.647 1.00 0.00 ? 407  ARG A C     1 
ATOM   2937  O  O     . ARG A  1  407  ? 196.129 317.235 224.243 1.00 0.00 ? 407  ARG A O     1 
ATOM   2938  C  CB    . ARG A  1  407  ? 197.090 319.718 226.072 1.00 0.00 ? 407  ARG A CB    1 
ATOM   2939  C  CG    . ARG A  1  407  ? 195.740 320.168 225.494 1.00 0.00 ? 407  ARG A CG    1 
ATOM   2940  C  CD    . ARG A  1  407  ? 195.558 321.666 225.745 1.00 0.00 ? 407  ARG A CD    1 
ATOM   2941  N  NE    . ARG A  1  407  ? 196.603 322.395 225.017 1.00 0.00 ? 407  ARG A NE    1 
ATOM   2942  C  CZ    . ARG A  1  407  ? 197.453 323.270 225.557 1.00 0.00 ? 407  ARG A CZ    1 
ATOM   2943  N  NH1   . ARG A  1  407  ? 197.386 323.560 226.855 1.00 0.00 ? 407  ARG A NH1   1 
ATOM   2944  N  NH2   . ARG A  1  407  ? 198.369 323.861 224.790 1.00 0.00 ? 407  ARG A NH2   1 
ATOM   2945  N  N     . ARG A  1  408  ? 198.313 317.661 223.895 1.00 0.00 ? 408  ARG A N     1 
ATOM   2946  C  CA    . ARG A  1  408  ? 198.354 317.072 222.552 1.00 0.00 ? 408  ARG A CA    1 
ATOM   2947  C  C     . ARG A  1  408  ? 198.094 315.564 222.512 1.00 0.00 ? 408  ARG A C     1 
ATOM   2948  O  O     . ARG A  1  408  ? 197.681 315.047 221.476 1.00 0.00 ? 408  ARG A O     1 
ATOM   2949  C  CB    . ARG A  1  408  ? 199.718 317.331 221.900 1.00 0.00 ? 408  ARG A CB    1 
ATOM   2950  C  CG    . ARG A  1  408  ? 199.910 318.711 221.295 1.00 0.00 ? 408  ARG A CG    1 
ATOM   2951  C  CD    . ARG A  1  408  ? 201.334 318.884 220.714 1.00 0.00 ? 408  ARG A CD    1 
ATOM   2952  N  NE    . ARG A  1  408  ? 201.545 320.229 220.180 1.00 0.00 ? 408  ARG A NE    1 
ATOM   2953  C  CZ    . ARG A  1  408  ? 201.387 320.579 218.903 1.00 0.00 ? 408  ARG A CZ    1 
ATOM   2954  N  NH1   . ARG A  1  408  ? 201.035 319.678 217.989 1.00 0.00 ? 408  ARG A NH1   1 
ATOM   2955  N  NH2   . ARG A  1  408  ? 201.681 321.816 218.526 1.00 0.00 ? 408  ARG A NH2   1 
ATOM   2956  N  N     . GLY A  1  409  ? 198.361 314.857 223.608 1.00 0.00 ? 409  GLY A N     1 
ATOM   2957  C  CA    . GLY A  1  409  ? 198.070 313.429 223.691 1.00 0.00 ? 409  GLY A CA    1 
ATOM   2958  C  C     . GLY A  1  409  ? 198.930 312.571 222.780 1.00 0.00 ? 409  GLY A C     1 
ATOM   2959  O  O     . GLY A  1  409  ? 199.770 313.089 222.044 1.00 0.00 ? 409  GLY A O     1 
ATOM   2960  N  N     . ASN A  1  410  ? 198.734 311.256 222.822 1.00 0.00 ? 410  ASN A N     1 
ATOM   2961  C  CA    . ASN A  1  410  ? 199.571 310.362 222.020 1.00 0.00 ? 410  ASN A CA    1 
ATOM   2962  C  C     . ASN A  1  410  ? 199.186 310.379 220.536 1.00 0.00 ? 410  ASN A C     1 
ATOM   2963  O  O     . ASN A  1  410  ? 199.999 310.031 219.672 1.00 0.00 ? 410  ASN A O     1 
ATOM   2964  C  CB    . ASN A  1  410  ? 199.525 308.926 222.560 1.00 0.00 ? 410  ASN A CB    1 
ATOM   2965  C  CG    . ASN A  1  410  ? 200.600 308.021 221.935 1.00 0.00 ? 410  ASN A CG    1 
ATOM   2966  O  OD1   . ASN A  1  410  ? 201.546 308.492 221.303 1.00 0.00 ? 410  ASN A OD1   1 
ATOM   2967  N  ND2   . ASN A  1  410  ? 200.454 306.719 222.127 1.00 0.00 ? 410  ASN A ND2   1 
ATOM   2968  N  N     . SER A  1  411  ? 197.955 310.801 220.245 1.00 0.00 ? 411  SER A N     1 
ATOM   2969  C  CA    . SER A  1  411  ? 197.370 310.687 218.903 1.00 0.00 ? 411  SER A CA    1 
ATOM   2970  C  C     . SER A  1  411  ? 198.180 311.348 217.785 1.00 0.00 ? 411  SER A C     1 
ATOM   2971  O  O     . SER A  1  411  ? 198.306 310.786 216.691 1.00 0.00 ? 411  SER A O     1 
ATOM   2972  C  CB    . SER A  1  411  ? 195.962 311.278 218.904 1.00 0.00 ? 411  SER A CB    1 
ATOM   2973  O  OG    . SER A  1  411  ? 195.158 310.657 219.890 1.00 0.00 ? 411  SER A OG    1 
ATOM   2974  N  N     . GLN A  1  412  ? 198.711 312.538 218.049 1.00 0.00 ? 412  GLN A N     1 
ATOM   2975  C  CA    . GLN A  1  412  ? 199.535 313.235 217.063 1.00 0.00 ? 412  GLN A CA    1 
ATOM   2976  C  C     . GLN A  1  412  ? 200.995 313.199 217.498 1.00 0.00 ? 412  GLN A C     1 
ATOM   2977  O  O     . GLN A  1  412  ? 201.279 312.988 218.682 1.00 0.00 ? 412  GLN A O     1 
ATOM   2978  C  CB    . GLN A  1  412  ? 199.059 314.671 216.871 1.00 0.00 ? 412  GLN A CB    1 
ATOM   2979  C  CG    . GLN A  1  412  ? 199.129 315.514 218.120 1.00 0.00 ? 412  GLN A CG    1 
ATOM   2980  C  CD    . GLN A  1  412  ? 198.528 316.891 217.917 1.00 0.00 ? 412  GLN A CD    1 
ATOM   2981  O  OE1   . GLN A  1  412  ? 198.758 317.795 218.712 1.00 0.00 ? 412  GLN A OE1   1 
ATOM   2982  N  NE2   . GLN A  1  412  ? 197.740 317.052 216.851 1.00 0.00 ? 412  GLN A NE2   1 
ATOM   2983  N  N     . TYR A  1  413  ? 201.904 313.392 216.537 1.00 0.00 ? 413  TYR A N     1 
ATOM   2984  C  CA    . TYR A  1  413  ? 203.355 313.244 216.756 1.00 0.00 ? 413  TYR A CA    1 
ATOM   2985  C  C     . TYR A  1  413  ? 204.062 314.168 217.796 1.00 0.00 ? 413  TYR A C     1 
ATOM   2986  O  O     . TYR A  1  413  ? 204.915 313.697 218.561 1.00 0.00 ? 413  TYR A O     1 
ATOM   2987  C  CB    . TYR A  1  413  ? 204.116 313.403 215.437 1.00 0.00 ? 413  TYR A CB    1 
ATOM   2988  C  CG    . TYR A  1  413  ? 205.534 313.716 215.743 1.00 0.00 ? 413  TYR A CG    1 
ATOM   2989  C  CD1   . TYR A  1  413  ? 206.379 312.724 216.192 1.00 0.00 ? 413  TYR A CD1   1 
ATOM   2990  C  CD2   . TYR A  1  413  ? 206.007 315.021 215.687 1.00 0.00 ? 413  TYR A CD2   1 
ATOM   2991  C  CE1   . TYR A  1  413  ? 207.667 312.999 216.523 1.00 0.00 ? 413  TYR A CE1   1 
ATOM   2992  C  CE2   . TYR A  1  413  ? 207.292 315.317 216.031 1.00 0.00 ? 413  TYR A CE2   1 
ATOM   2993  C  CZ    . TYR A  1  413  ? 208.141 314.299 216.442 1.00 0.00 ? 413  TYR A CZ    1 
ATOM   2994  O  OH    . TYR A  1  413  ? 209.467 314.561 216.772 1.00 0.00 ? 413  TYR A OH    1 
ATOM   2995  N  N     . PRO A  1  414  ? 203.781 315.488 217.798 1.00 0.00 ? 414  PRO A N     1 
ATOM   2996  C  CA    . PRO A  1  414  ? 204.510 316.302 218.784 1.00 0.00 ? 414  PRO A CA    1 
ATOM   2997  C  C     . PRO A  1  414  ? 203.999 316.108 220.215 1.00 0.00 ? 414  PRO A C     1 
ATOM   2998  O  O     . PRO A  1  414  ? 204.177 317.008 221.035 1.00 0.00 ? 414  PRO A O     1 
ATOM   2999  C  CB    . PRO A  1  414  ? 204.247 317.742 218.317 1.00 0.00 ? 414  PRO A CB    1 
ATOM   3000  C  CG    . PRO A  1  414  ? 203.744 317.610 216.905 1.00 0.00 ? 414  PRO A CG    1 
ATOM   3001  C  CD    . PRO A  1  414  ? 202.969 316.329 216.904 1.00 0.00 ? 414  PRO A CD    1 
ATOM   3002  N  N     . GLY A  1  415  ? 203.395 314.952 220.503 1.00 0.00 ? 415  GLY A N     1 
ATOM   3003  C  CA    . GLY A  1  415  ? 202.659 314.719 221.734 1.00 0.00 ? 415  GLY A CA    1 
ATOM   3004  C  C     . GLY A  1  415  ? 203.538 314.175 222.829 1.00 0.00 ? 415  GLY A C     1 
ATOM   3005  O  O     . GLY A  1  415  ? 204.750 314.302 222.754 1.00 0.00 ? 415  GLY A O     1 
ATOM   3006  N  N     . ALA A  1  416  ? 202.947 313.571 223.848 1.00 0.00 ? 416  ALA A N     1 
ATOM   3007  C  CA    . ALA A  1  416  ? 203.736 313.027 224.945 1.00 0.00 ? 416  ALA A CA    1 
ATOM   3008  C  C     . ALA A  1  416  ? 203.160 311.700 225.412 1.00 0.00 ? 416  ALA A C     1 
ATOM   3009  O  O     . ALA A  1  416  ? 201.956 311.547 225.471 1.00 0.00 ? 416  ALA A O     1 
ATOM   3010  C  CB    . ALA A  1  416  ? 203.789 314.024 226.086 1.00 0.00 ? 416  ALA A CB    1 
ATOM   3011  N  N     . LYS A  1  417  ? 204.008 310.750 225.783 1.00 0.00 ? 417  LYS A N     1 
ATOM   3012  C  CA    . LYS A  1  417  ? 203.509 309.478 226.302 1.00 0.00 ? 417  LYS A CA    1 
ATOM   3013  C  C     . LYS A  1  417  ? 203.097 309.370 227.771 1.00 0.00 ? 417  LYS A C     1 
ATOM   3014  O  O     . LYS A  1  417  ? 202.005 308.897 228.052 1.00 0.00 ? 417  LYS A O     1 
ATOM   3015  C  CB    . LYS A  1  417  ? 204.541 308.395 226.071 1.00 0.00 ? 417  LYS A CB    1 
ATOM   3016  C  CG    . LYS A  1  417  ? 204.785 308.025 224.645 1.00 0.00 ? 417  LYS A CG    1 
ATOM   3017  C  CD    . LYS A  1  417  ? 205.441 306.666 224.653 1.00 0.00 ? 417  LYS A CD    1 
ATOM   3018  C  CE    . LYS A  1  417  ? 205.479 306.070 223.294 1.00 0.00 ? 417  LYS A CE    1 
ATOM   3019  N  NZ    . LYS A  1  417  ? 206.098 304.745 223.423 1.00 0.00 ? 417  LYS A NZ    1 
ATOM   3020  N  N     . TYR A  1  418  ? 203.916 309.857 228.701 1.00 0.00 ? 418  TYR A N     1 
ATOM   3021  C  CA    . TYR A  1  418  ? 203.693 309.612 230.134 1.00 0.00 ? 418  TYR A CA    1 
ATOM   3022  C  C     . TYR A  1  418  ? 203.993 310.816 230.989 1.00 0.00 ? 418  TYR A C     1 
ATOM   3023  O  O     . TYR A  1  418  ? 204.736 311.712 230.603 1.00 0.00 ? 418  TYR A O     1 
ATOM   3024  C  CB    . TYR A  1  418  ? 204.558 308.474 230.683 1.00 0.00 ? 418  TYR A CB    1 
ATOM   3025  C  CG    . TYR A  1  418  ? 204.522 307.159 229.981 1.00 0.00 ? 418  TYR A CG    1 
ATOM   3026  C  CD1   . TYR A  1  418  ? 203.624 306.193 230.363 1.00 0.00 ? 418  TYR A CD1   1 
ATOM   3027  C  CD2   . TYR A  1  418  ? 205.412 306.849 228.997 1.00 0.00 ? 418  TYR A CD2   1 
ATOM   3028  C  CE1   . TYR A  1  418  ? 203.582 304.961 229.759 1.00 0.00 ? 418  TYR A CE1   1 
ATOM   3029  C  CE2   . TYR A  1  418  ? 205.377 305.617 228.380 1.00 0.00 ? 418  TYR A CE2   1 
ATOM   3030  C  CZ    . TYR A  1  418  ? 204.458 304.674 228.768 1.00 0.00 ? 418  TYR A CZ    1 
ATOM   3031  O  OH    . TYR A  1  418  ? 204.405 303.438 228.168 1.00 0.00 ? 418  TYR A OH    1 
ATOM   3032  N  N     . ILE A  1  419  ? 203.367 310.831 232.156 1.00 0.00 ? 419  ILE A N     1 
ATOM   3033  C  CA    . ILE A  1  419  ? 203.714 311.716 233.252 1.00 0.00 ? 419  ILE A CA    1 
ATOM   3034  C  C     . ILE A  1  419  ? 204.055 310.958 234.533 1.00 0.00 ? 419  ILE A C     1 
ATOM   3035  O  O     . ILE A  1  419  ? 203.409 309.966 234.844 1.00 0.00 ? 419  ILE A O     1 
ATOM   3036  C  CB    . ILE A  1  419  ? 202.583 312.709 233.525 1.00 0.00 ? 419  ILE A CB    1 
ATOM   3037  C  CG1   . ILE A  1  419  ? 201.314 311.953 233.885 1.00 0.00 ? 419  ILE A CG1   1 
ATOM   3038  C  CG2   . ILE A  1  419  ? 202.275 313.514 232.288 1.00 0.00 ? 419  ILE A CG2   1 
ATOM   3039  C  CD1   . ILE A  1  419  ? 200.235 312.835 234.379 1.00 0.00 ? 419  ILE A CD1   1 
ATOM   3040  N  N     . ILE A  1  420  ? 205.126 311.338 235.221 1.00 0.00 ? 420  ILE A N     1 
ATOM   3041  C  CA    . ILE A  1  420  ? 205.559 310.559 236.376 1.00 0.00 ? 420  ILE A CA    1 
ATOM   3042  C  C     . ILE A  1  420  ? 205.602 311.478 237.588 1.00 0.00 ? 420  ILE A C     1 
ATOM   3043  O  O     . ILE A  1  420  ? 206.388 312.416 237.630 1.00 0.00 ? 420  ILE A O     1 
ATOM   3044  C  CB    . ILE A  1  420  ? 206.938 309.926 236.224 1.00 0.00 ? 420  ILE A CB    1 
ATOM   3045  C  CG1   . ILE A  1  420  ? 207.061 309.135 234.924 1.00 0.00 ? 420  ILE A CG1   1 
ATOM   3046  C  CG2   . ILE A  1  420  ? 207.223 309.024 237.413 1.00 0.00 ? 420  ILE A CG2   1 
ATOM   3047  C  CD1   . ILE A  1  420  ? 207.535 309.934 233.731 1.00 0.00 ? 420  ILE A CD1   1 
ATOM   3048  N  N     . ARG A  1  421  ? 204.742 311.210 238.566 1.00 0.00 ? 421  ARG A N     1 
ATOM   3049  C  CA    . ARG A  1  421  ? 204.663 312.030 239.772 1.00 0.00 ? 421  ARG A CA    1 
ATOM   3050  C  C     . ARG A  1  421  ? 205.910 311.914 240.637 1.00 0.00 ? 421  ARG A C     1 
ATOM   3051  O  O     . ARG A  1  421  ? 206.640 310.925 240.557 1.00 0.00 ? 421  ARG A O     1 
ATOM   3052  C  CB    . ARG A  1  421  ? 203.440 311.643 240.592 1.00 0.00 ? 421  ARG A CB    1 
ATOM   3053  C  CG    . ARG A  1  421  ? 202.128 312.097 240.001 1.00 0.00 ? 421  ARG A CG    1 
ATOM   3054  C  CD    . ARG A  1  421  ? 201.046 311.995 241.041 1.00 0.00 ? 421  ARG A CD    1 
ATOM   3055  N  NE    . ARG A  1  421  ? 199.723 312.246 240.486 1.00 0.00 ? 421  ARG A NE    1 
ATOM   3056  C  CZ    . ARG A  1  421  ? 198.902 311.285 240.075 1.00 0.00 ? 421  ARG A CZ    1 
ATOM   3057  N  NH1   . ARG A  1  421  ? 199.279 310.015 240.151 1.00 0.00 ? 421  ARG A NH1   1 
ATOM   3058  N  NH2   . ARG A  1  421  ? 197.703 311.590 239.602 1.00 0.00 ? 421  ARG A NH2   1 
ATOM   3059  N  N     . ASP A  1  422  ? 206.130 312.924 241.478 1.00 0.00 ? 422  ASP A N     1 
ATOM   3060  C  CA    . ASP A  1  422  ? 207.270 312.956 242.398 1.00 0.00 ? 422  ASP A CA    1 
ATOM   3061  C  C     . ASP A  1  422  ? 207.398 311.664 243.204 1.00 0.00 ? 422  ASP A C     1 
ATOM   3062  O  O     . ASP A  1  422  ? 208.510 311.201 243.473 1.00 0.00 ? 422  ASP A O     1 
ATOM   3063  C  CB    . ASP A  1  422  ? 207.161 314.163 243.346 1.00 0.00 ? 422  ASP A CB    1 
ATOM   3064  C  CG    . ASP A  1  422  ? 208.318 314.245 244.344 1.00 0.00 ? 422  ASP A CG    1 
ATOM   3065  O  OD1   . ASP A  1  422  ? 209.381 314.802 243.968 1.00 0.00 ? 422  ASP A OD1   1 
ATOM   3066  O  OD2   . ASP A  1  422  ? 208.151 313.788 245.505 1.00 0.00 ? 422  ASP A OD2   1 
ATOM   3067  N  N     . ASN A  1  423  ? 206.260 311.073 243.554 1.00 0.00 ? 423  ASN A N     1 
ATOM   3068  C  CA    . ASN A  1  423  ? 206.244 309.822 244.306 1.00 0.00 ? 423  ASN A CA    1 
ATOM   3069  C  C     . ASN A  1  423  ? 206.836 308.642 243.529 1.00 0.00 ? 423  ASN A C     1 
ATOM   3070  O  O     . ASN A  1  423  ? 207.153 307.603 244.112 1.00 0.00 ? 423  ASN A O     1 
ATOM   3071  C  CB    . ASN A  1  423  ? 204.812 309.495 244.734 1.00 0.00 ? 423  ASN A CB    1 
ATOM   3072  C  CG    . ASN A  1  423  ? 203.863 309.333 243.549 1.00 0.00 ? 423  ASN A CG    1 
ATOM   3073  O  OD1   . ASN A  1  423  ? 204.284 309.153 242.403 1.00 0.00 ? 423  ASN A OD1   1 
ATOM   3074  N  ND2   . ASN A  1  423  ? 202.567 309.402 243.828 1.00 0.00 ? 423  ASN A ND2   1 
ATOM   3075  N  N     . GLY A  1  424  ? 206.971 308.811 242.215 1.00 0.00 ? 424  GLY A N     1 
ATOM   3076  C  CA    . GLY A  1  424  ? 207.532 307.784 241.354 1.00 0.00 ? 424  GLY A CA    1 
ATOM   3077  C  C     . GLY A  1  424  ? 206.478 307.005 240.589 1.00 0.00 ? 424  GLY A C     1 
ATOM   3078  O  O     . GLY A  1  424  ? 206.803 306.245 239.678 1.00 0.00 ? 424  GLY A O     1 
ATOM   3079  N  N     . ASP A  1  425  ? 205.211 307.198 240.953 1.00 0.00 ? 425  ASP A N     1 
ATOM   3080  C  CA    . ASP A  1  425  ? 204.109 306.510 240.282 1.00 0.00 ? 425  ASP A CA    1 
ATOM   3081  C  C     . ASP A  1  425  ? 203.942 307.034 238.858 1.00 0.00 ? 425  ASP A C     1 
ATOM   3082  O  O     . ASP A  1  425  ? 204.041 308.238 238.617 1.00 0.00 ? 425  ASP A O     1 
ATOM   3083  C  CB    . ASP A  1  425  ? 202.808 306.668 241.073 1.00 0.00 ? 425  ASP A CB    1 
ATOM   3084  C  CG    . ASP A  1  425  ? 201.684 305.825 240.507 1.00 0.00 ? 425  ASP A CG    1 
ATOM   3085  O  OD1   . ASP A  1  425  ? 201.984 304.926 239.691 1.00 0.00 ? 425  ASP A OD1   1 
ATOM   3086  O  OD2   . ASP A  1  425  ? 200.511 306.049 240.886 1.00 0.00 ? 425  ASP A OD2   1 
ATOM   3087  N  N     . ARG A  1  426  ? 203.690 306.126 237.919 1.00 0.00 ? 426  ARG A N     1 
ATOM   3088  C  CA    . ARG A  1  426  ? 203.706 306.468 236.501 1.00 0.00 ? 426  ARG A CA    1 
ATOM   3089  C  C     . ARG A  1  426  ? 202.289 306.464 235.923 1.00 0.00 ? 426  ARG A C     1 
ATOM   3090  O  O     . ARG A  1  426  ? 201.501 305.570 236.222 1.00 0.00 ? 426  ARG A O     1 
ATOM   3091  C  CB    . ARG A  1  426  ? 204.586 305.448 235.791 1.00 0.00 ? 426  ARG A CB    1 
ATOM   3092  C  CG    . ARG A  1  426  ? 204.730 305.525 234.304 1.00 0.00 ? 426  ARG A CG    1 
ATOM   3093  C  CD    . ARG A  1  426  ? 205.677 304.400 233.919 1.00 0.00 ? 426  ARG A CD    1 
ATOM   3094  N  NE    . ARG A  1  426  ? 207.042 304.710 234.321 1.00 0.00 ? 426  ARG A NE    1 
ATOM   3095  C  CZ    . ARG A  1  426  ? 207.958 305.233 233.522 1.00 0.00 ? 426  ARG A CZ    1 
ATOM   3096  N  NH1   . ARG A  1  426  ? 207.659 305.476 232.256 1.00 0.00 ? 426  ARG A NH1   1 
ATOM   3097  N  NH2   . ARG A  1  426  ? 209.148 305.562 234.003 1.00 0.00 ? 426  ARG A NH2   1 
ATOM   3098  N  N     . ILE A  1  427  ? 201.978 307.422 235.053 1.00 0.00 ? 427  ILE A N     1 
ATOM   3099  C  CA    . ILE A  1  427  ? 200.659 307.453 234.420 1.00 0.00 ? 427  ILE A CA    1 
ATOM   3100  C  C     . ILE A  1  427  ? 200.724 307.442 232.899 1.00 0.00 ? 427  ILE A C     1 
ATOM   3101  O  O     . ILE A  1  427  ? 201.370 308.286 232.284 1.00 0.00 ? 427  ILE A O     1 
ATOM   3102  C  CB    . ILE A  1  427  ? 199.868 308.689 234.872 1.00 0.00 ? 427  ILE A CB    1 
ATOM   3103  C  CG1   . ILE A  1  427  ? 199.440 308.532 236.328 1.00 0.00 ? 427  ILE A CG1   1 
ATOM   3104  C  CG2   . ILE A  1  427  ? 198.646 308.901 234.004 1.00 0.00 ? 427  ILE A CG2   1 
ATOM   3105  C  CD1   . ILE A  1  427  ? 198.645 309.703 236.852 1.00 0.00 ? 427  ILE A CD1   1 
ATOM   3106  N  N     . ASP A  1  428  ? 199.961 306.542 232.299 1.00 0.00 ? 428  ASP A N     1 
ATOM   3107  C  CA    . ASP A  1  428  ? 199.808 306.496 230.855 1.00 0.00 ? 428  ASP A CA    1 
ATOM   3108  C  C     . ASP A  1  428  ? 198.762 307.454 230.326 1.00 0.00 ? 428  ASP A C     1 
ATOM   3109  O  O     . ASP A  1  428  ? 197.701 307.610 230.917 1.00 0.00 ? 428  ASP A O     1 
ATOM   3110  C  CB    . ASP A  1  428  ? 199.457 305.079 230.428 1.00 0.00 ? 428  ASP A CB    1 
ATOM   3111  C  CG    . ASP A  1  428  ? 199.239 304.961 228.940 1.00 0.00 ? 428  ASP A CG    1 
ATOM   3112  O  OD1   . ASP A  1  428  ? 198.144 305.346 228.462 1.00 0.00 ? 428  ASP A OD1   1 
ATOM   3113  O  OD2   . ASP A  1  428  ? 200.169 304.480 228.255 1.00 0.00 ? 428  ASP A OD2   1 
ATOM   3114  N  N     . LEU A  1  429  ? 199.058 308.094 229.205 1.00 0.00 ? 429  LEU A N     1 
ATOM   3115  C  CA    . LEU A  1  429  ? 198.115 309.037 228.626 1.00 0.00 ? 429  LEU A CA    1 
ATOM   3116  C  C     . LEU A  1  429  ? 197.275 308.506 227.469 1.00 0.00 ? 429  LEU A C     1 
ATOM   3117  O  O     . LEU A  1  429  ? 196.682 309.298 226.749 1.00 0.00 ? 429  LEU A O     1 
ATOM   3118  C  CB    . LEU A  1  429  ? 198.856 310.285 228.164 1.00 0.00 ? 429  LEU A CB    1 
ATOM   3119  C  CG    . LEU A  1  429  ? 199.503 311.056 229.310 1.00 0.00 ? 429  LEU A CG    1 
ATOM   3120  C  CD1   . LEU A  1  429  ? 200.208 312.291 228.781 1.00 0.00 ? 429  LEU A CD1   1 
ATOM   3121  C  CD2   . LEU A  1  429  ? 198.453 311.432 230.352 1.00 0.00 ? 429  LEU A CD2   1 
ATOM   3122  N  N     . ARG A  1  430  ? 197.204 307.195 227.274 1.00 0.00 ? 430  ARG A N     1 
ATOM   3123  C  CA    . ARG A  1  430  ? 196.374 306.675 226.188 1.00 0.00 ? 430  ARG A CA    1 
ATOM   3124  C  C     . ARG A  1  430  ? 195.019 306.181 226.661 1.00 0.00 ? 430  ARG A C     1 
ATOM   3125  O  O     . ARG A  1  430  ? 194.064 306.125 225.887 1.00 0.00 ? 430  ARG A O     1 
ATOM   3126  C  CB    . ARG A  1  430  ? 197.086 305.542 225.446 1.00 0.00 ? 430  ARG A CB    1 
ATOM   3127  C  CG    . ARG A  1  430  ? 198.453 305.917 224.914 1.00 0.00 ? 430  ARG A CG    1 
ATOM   3128  C  CD    . ARG A  1  430  ? 199.189 304.704 224.358 1.00 0.00 ? 430  ARG A CD    1 
ATOM   3129  N  NE    . ARG A  1  430  ? 199.494 303.726 225.395 1.00 0.00 ? 430  ARG A NE    1 
ATOM   3130  C  CZ    . ARG A  1  430  ? 199.875 302.475 225.158 1.00 0.00 ? 430  ARG A CZ    1 
ATOM   3131  N  NH1   . ARG A  1  430  ? 200.021 302.045 223.910 1.00 0.00 ? 430  ARG A NH1   1 
ATOM   3132  N  NH2   . ARG A  1  430  ? 200.124 301.658 226.174 1.00 0.00 ? 430  ARG A NH2   1 
ATOM   3133  N  N     . PHE A  1  431  ? 194.935 305.813 227.930 1.00 0.00 ? 431  PHE A N     1 
ATOM   3134  C  CA    . PHE A  1  431  ? 193.725 305.178 228.421 1.00 0.00 ? 431  PHE A CA    1 
ATOM   3135  C  C     . PHE A  1  431  ? 192.983 306.009 229.458 1.00 0.00 ? 431  PHE A C     1 
ATOM   3136  O  O     . PHE A  1  431  ? 191.841 305.696 229.802 1.00 0.00 ? 431  PHE A O     1 
ATOM   3137  C  CB    . PHE A  1  431  ? 194.081 303.796 228.964 1.00 0.00 ? 431  PHE A CB    1 
ATOM   3138  C  CG    . PHE A  1  431  ? 194.507 302.837 227.890 1.00 0.00 ? 431  PHE A CG    1 
ATOM   3139  C  CD1   . PHE A  1  431  ? 193.566 302.077 227.209 1.00 0.00 ? 431  PHE A CD1   1 
ATOM   3140  C  CD2   . PHE A  1  431  ? 195.844 302.737 227.522 1.00 0.00 ? 431  PHE A CD2   1 
ATOM   3141  C  CE1   . PHE A  1  431  ? 193.955 301.206 226.202 1.00 0.00 ? 431  PHE A CE1   1 
ATOM   3142  C  CE2   . PHE A  1  431  ? 196.244 301.870 226.513 1.00 0.00 ? 431  PHE A CE2   1 
ATOM   3143  C  CZ    . PHE A  1  431  ? 195.297 301.102 225.852 1.00 0.00 ? 431  PHE A CZ    1 
ATOM   3144  N  N     . HIS A  1  432  ? 193.622 307.068 229.947 1.00 0.00 ? 432  HIS A N     1 
ATOM   3145  C  CA    . HIS A  1  432  ? 192.971 307.974 230.892 1.00 0.00 ? 432  HIS A CA    1 
ATOM   3146  C  C     . HIS A  1  432  ? 191.694 308.581 230.300 1.00 0.00 ? 432  HIS A C     1 
ATOM   3147  O  O     . HIS A  1  432  ? 191.704 309.078 229.171 1.00 0.00 ? 432  HIS A O     1 
ATOM   3148  C  CB    . HIS A  1  432  ? 193.931 309.083 231.326 1.00 0.00 ? 432  HIS A CB    1 
ATOM   3149  C  CG    . HIS A  1  432  ? 193.433 309.887 232.486 1.00 0.00 ? 432  HIS A CG    1 
ATOM   3150  N  ND1   . HIS A  1  432  ? 192.605 310.979 232.339 1.00 0.00 ? 432  HIS A ND1   1 
ATOM   3151  C  CD2   . HIS A  1  432  ? 193.630 309.744 233.818 1.00 0.00 ? 432  HIS A CD2   1 
ATOM   3152  C  CE1   . HIS A  1  432  ? 192.324 311.481 233.528 1.00 0.00 ? 432  HIS A CE1   1 
ATOM   3153  N  NE2   . HIS A  1  432  ? 192.934 310.749 234.443 1.00 0.00 ? 432  HIS A NE2   1 
ATOM   3154  N  N     . PRO A  1  433  ? 190.591 308.535 231.068 1.00 0.00 ? 433  PRO A N     1 
ATOM   3155  C  CA    . PRO A  1  433  ? 189.252 308.998 230.671 1.00 0.00 ? 433  PRO A CA    1 
ATOM   3156  C  C     . PRO A  1  433  ? 189.221 310.436 230.157 1.00 0.00 ? 433  PRO A C     1 
ATOM   3157  O  O     . PRO A  1  433  ? 188.404 310.767 229.299 1.00 0.00 ? 433  PRO A O     1 
ATOM   3158  C  CB    . PRO A  1  433  ? 188.443 308.877 231.964 1.00 0.00 ? 433  PRO A CB    1 
ATOM   3159  C  CG    . PRO A  1  433  ? 189.131 307.815 232.735 1.00 0.00 ? 433  PRO A CG    1 
ATOM   3160  C  CD    . PRO A  1  433  ? 190.589 307.960 232.425 1.00 0.00 ? 433  PRO A CD    1 
ATOM   3161  N  N     . LYS A  1  434  ? 190.104 311.275 230.683 1.00 0.00 ? 434  LYS A N     1 
ATOM   3162  C  CA    . LYS A  1  434  ? 190.119 312.693 230.344 1.00 0.00 ? 434  LYS A CA    1 
ATOM   3163  C  C     . LYS A  1  434  ? 191.539 313.241 230.469 1.00 0.00 ? 434  LYS A C     1 
ATOM   3164  O  O     . LYS A  1  434  ? 191.896 313.817 231.498 1.00 0.00 ? 434  LYS A O     1 
ATOM   3165  C  CB    . LYS A  1  434  ? 189.157 313.473 231.251 1.00 0.00 ? 434  LYS A CB    1 
ATOM   3166  C  CG    . LYS A  1  434  ? 189.012 314.951 230.907 1.00 0.00 ? 434  LYS A CG    1 
ATOM   3167  C  CD    . LYS A  1  434  ? 188.121 315.672 231.907 1.00 0.00 ? 434  LYS A CD    1 
ATOM   3168  C  CE    . LYS A  1  434  ? 188.000 317.150 231.565 1.00 0.00 ? 434  LYS A CE    1 
ATOM   3169  N  NZ    . LYS A  1  434  ? 187.176 317.385 230.353 1.00 0.00 ? 434  LYS A NZ    1 
ATOM   3170  N  N     . PRO A  1  435  ? 192.363 313.036 229.426 1.00 0.00 ? 435  PRO A N     1 
ATOM   3171  C  CA    . PRO A  1  435  ? 193.740 313.549 229.422 1.00 0.00 ? 435  PRO A CA    1 
ATOM   3172  C  C     . PRO A  1  435  ? 193.804 315.072 229.596 1.00 0.00 ? 435  PRO A C     1 
ATOM   3173  O  O     . PRO A  1  435  ? 194.801 315.608 230.087 1.00 0.00 ? 435  PRO A O     1 
ATOM   3174  C  CB    . PRO A  1  435  ? 194.261 313.137 228.040 1.00 0.00 ? 435  PRO A CB    1 
ATOM   3175  C  CG    . PRO A  1  435  ? 193.484 311.908 227.702 1.00 0.00 ? 435  PRO A CG    1 
ATOM   3176  C  CD    . PRO A  1  435  ? 192.107 312.138 228.286 1.00 0.00 ? 435  PRO A CD    1 
ATOM   3177  N  N     . SER A  1  436  ? 192.730 315.748 229.193 1.00 0.00 ? 436  SER A N     1 
ATOM   3178  C  CA    . SER A  1  436  ? 192.616 317.206 229.246 1.00 0.00 ? 436  SER A CA    1 
ATOM   3179  C  C     . SER A  1  436  ? 192.611 317.777 230.669 1.00 0.00 ? 436  SER A C     1 
ATOM   3180  O  O     . SER A  1  436  ? 192.832 318.973 230.866 1.00 0.00 ? 436  SER A O     1 
ATOM   3181  C  CB    . SER A  1  436  ? 191.351 317.658 228.511 1.00 0.00 ? 436  SER A CB    1 
ATOM   3182  O  OG    . SER A  1  436  ? 191.072 316.817 227.403 1.00 0.00 ? 436  SER A OG    1 
ATOM   3183  N  N     . ASP A  1  437  ? 192.344 316.923 231.652 1.00 0.00 ? 437  ASP A N     1 
ATOM   3184  C  CA    . ASP A  1  437  ? 192.236 317.348 233.049 1.00 0.00 ? 437  ASP A CA    1 
ATOM   3185  C  C     . ASP A  1  437  ? 193.521 317.327 233.896 1.00 0.00 ? 437  ASP A C     1 
ATOM   3186  O  O     . ASP A  1  437  ? 193.531 317.872 235.004 1.00 0.00 ? 437  ASP A O     1 
ATOM   3187  C  CB    . ASP A  1  437  ? 191.176 316.483 233.737 1.00 0.00 ? 437  ASP A CB    1 
ATOM   3188  C  CG    . ASP A  1  437  ? 190.593 317.143 234.967 1.00 0.00 ? 437  ASP A CG    1 
ATOM   3189  O  OD1   . ASP A  1  437  ? 190.108 318.289 234.853 1.00 0.00 ? 437  ASP A OD1   1 
ATOM   3190  O  OD2   . ASP A  1  437  ? 190.606 316.510 236.043 1.00 0.00 ? 437  ASP A OD2   1 
ATOM   3191  N  N     . LEU A  1  438  ? 194.591 316.705 233.405 1.00 0.00 ? 438  LEU A N     1 
ATOM   3192  C  CA    . LEU A  1  438  ? 195.811 316.587 234.210 1.00 0.00 ? 438  LEU A CA    1 
ATOM   3193  C  C     . LEU A  1  438  ? 196.612 317.890 234.252 1.00 0.00 ? 438  LEU A C     1 
ATOM   3194  O  O     . LEU A  1  438  ? 196.879 318.513 233.221 1.00 0.00 ? 438  LEU A O     1 
ATOM   3195  C  CB    . LEU A  1  438  ? 196.686 315.442 233.697 1.00 0.00 ? 438  LEU A CB    1 
ATOM   3196  C  CG    . LEU A  1  438  ? 196.038 314.073 233.911 1.00 0.00 ? 438  LEU A CG    1 
ATOM   3197  C  CD1   . LEU A  1  438  ? 196.865 312.972 233.285 1.00 0.00 ? 438  LEU A CD1   1 
ATOM   3198  C  CD2   . LEU A  1  438  ? 195.829 313.811 235.399 1.00 0.00 ? 438  LEU A CD2   1 
ATOM   3199  N  N     . HIS A  1  439  ? 197.010 318.268 235.465 1.00 0.00 ? 439  HIS A N     1 
ATOM   3200  C  CA    . HIS A  1  439  ? 197.759 319.493 235.717 1.00 0.00 ? 439  HIS A CA    1 
ATOM   3201  C  C     . HIS A  1  439  ? 199.203 319.159 236.037 1.00 0.00 ? 439  HIS A C     1 
ATOM   3202  O  O     . HIS A  1  439  ? 199.524 318.026 236.393 1.00 0.00 ? 439  HIS A O     1 
ATOM   3203  C  CB    . HIS A  1  439  ? 197.148 320.282 236.875 1.00 0.00 ? 439  HIS A CB    1 
ATOM   3204  C  CG    . HIS A  1  439  ? 195.767 320.776 236.601 1.00 0.00 ? 439  HIS A CG    1 
ATOM   3205  N  ND1   . HIS A  1  439  ? 195.512 322.040 236.116 1.00 0.00 ? 439  HIS A ND1   1 
ATOM   3206  C  CD2   . HIS A  1  439  ? 194.562 320.178 236.751 1.00 0.00 ? 439  HIS A CD2   1 
ATOM   3207  C  CE1   . HIS A  1  439  ? 194.208 322.199 235.975 1.00 0.00 ? 439  HIS A CE1   1 
ATOM   3208  N  NE2   . HIS A  1  439  ? 193.608 321.083 236.351 1.00 0.00 ? 439  HIS A NE2   1 
ATOM   3209  N  N     . LEU A  1  440  ? 200.076 320.148 235.902 1.00 0.00 ? 440  LEU A N     1 
ATOM   3210  C  CA    . LEU A  1  440  ? 201.489 319.934 236.170 1.00 0.00 ? 440  LEU A CA    1 
ATOM   3211  C  C     . LEU A  1  440  ? 201.972 320.802 237.330 1.00 0.00 ? 440  LEU A C     1 
ATOM   3212  O  O     . LEU A  1  440  ? 201.403 321.858 237.620 1.00 0.00 ? 440  LEU A O     1 
ATOM   3213  C  CB    . LEU A  1  440  ? 202.308 320.217 234.913 1.00 0.00 ? 440  LEU A CB    1 
ATOM   3214  C  CG    . LEU A  1  440  ? 201.803 319.376 233.746 1.00 0.00 ? 440  LEU A CG    1 
ATOM   3215  C  CD1   . LEU A  1  440  ? 202.481 319.779 232.463 1.00 0.00 ? 440  LEU A CD1   1 
ATOM   3216  C  CD2   . LEU A  1  440  ? 202.002 317.905 234.043 1.00 0.00 ? 440  LEU A CD2   1 
ATOM   3217  N  N     . GLN A  1  441  ? 203.015 320.331 238.001 1.00 0.00 ? 441  GLN A N     1 
ATOM   3218  C  CA    . GLN A  1  441  ? 203.658 321.088 239.060 1.00 0.00 ? 441  GLN A CA    1 
ATOM   3219  C  C     . GLN A  1  441  ? 205.091 320.624 239.178 1.00 0.00 ? 441  GLN A C     1 
ATOM   3220  O  O     . GLN A  1  441  ? 205.414 319.519 238.756 1.00 0.00 ? 441  GLN A O     1 
ATOM   3221  C  CB    . GLN A  1  441  ? 202.932 320.886 240.368 1.00 0.00 ? 441  GLN A CB    1 
ATOM   3222  C  CG    . GLN A  1  441  ? 203.014 319.463 240.827 1.00 0.00 ? 441  GLN A CG    1 
ATOM   3223  C  CD    . GLN A  1  441  ? 202.122 319.200 242.006 1.00 0.00 ? 441  GLN A CD    1 
ATOM   3224  O  OE1   . GLN A  1  441  ? 201.248 320.008 242.331 1.00 0.00 ? 441  GLN A OE1   1 
ATOM   3225  N  NE2   . GLN A  1  441  ? 202.327 318.062 242.659 1.00 0.00 ? 441  GLN A NE2   1 
ATOM   3226  N  N     . THR A  1  442  ? 205.945 321.462 239.750 1.00 0.00 ? 442  THR A N     1 
ATOM   3227  C  CA    . THR A  1  442  ? 207.357 321.137 239.897 1.00 0.00 ? 442  THR A CA    1 
ATOM   3228  C  C     . THR A  1  442  ? 207.593 319.778 240.552 1.00 0.00 ? 442  THR A C     1 
ATOM   3229  O  O     . THR A  1  442  ? 207.051 319.490 241.622 1.00 0.00 ? 442  THR A O     1 
ATOM   3230  C  CB    . THR A  1  442  ? 208.080 322.214 240.700 1.00 0.00 ? 442  THR A CB    1 
ATOM   3231  O  OG1   . THR A  1  442  ? 208.016 323.450 239.978 1.00 0.00 ? 442  THR A OG1   1 
ATOM   3232  C  CG2   . THR A  1  442  ? 209.530 321.839 240.891 1.00 0.00 ? 442  THR A CG2   1 
ATOM   3233  N  N     . GLY A  1  443  ? 208.372 318.937 239.876 1.00 0.00 ? 443  GLY A N     1 
ATOM   3234  C  CA    . GLY A  1  443  ? 208.693 317.607 240.367 1.00 0.00 ? 443  GLY A CA    1 
ATOM   3235  C  C     . GLY A  1  443  ? 208.159 316.508 239.471 1.00 0.00 ? 443  GLY A C     1 
ATOM   3236  O  O     . GLY A  1  443  ? 208.674 315.389 239.466 1.00 0.00 ? 443  GLY A O     1 
ATOM   3237  N  N     . TYR A  1  444  ? 207.125 316.833 238.704 1.00 0.00 ? 444  TYR A N     1 
ATOM   3238  C  CA    . TYR A  1  444  ? 206.590 315.906 237.720 1.00 0.00 ? 444  TYR A CA    1 
ATOM   3239  C  C     . TYR A  1  444  ? 207.601 315.723 236.614 1.00 0.00 ? 444  TYR A C     1 
ATOM   3240  O  O     . TYR A  1  444  ? 208.336 316.652 236.277 1.00 0.00 ? 444  TYR A O     1 
ATOM   3241  C  CB    . TYR A  1  444  ? 205.284 316.408 237.105 1.00 0.00 ? 444  TYR A CB    1 
ATOM   3242  C  CG    . TYR A  1  444  ? 204.080 316.345 237.992 1.00 0.00 ? 444  TYR A CG    1 
ATOM   3243  C  CD1   . TYR A  1  444  ? 204.091 315.594 239.155 1.00 0.00 ? 444  TYR A CD1   1 
ATOM   3244  C  CD2   . TYR A  1  444  ? 202.929 317.043 237.664 1.00 0.00 ? 444  TYR A CD2   1 
ATOM   3245  C  CE1   . TYR A  1  444  ? 202.987 315.538 239.969 1.00 0.00 ? 444  TYR A CE1   1 
ATOM   3246  C  CE2   . TYR A  1  444  ? 201.820 317.000 238.470 1.00 0.00 ? 444  TYR A CE2   1 
ATOM   3247  C  CZ    . TYR A  1  444  ? 201.850 316.243 239.627 1.00 0.00 ? 444  TYR A CZ    1 
ATOM   3248  O  OH    . TYR A  1  444  ? 200.744 316.191 240.451 1.00 0.00 ? 444  TYR A OH    1 
ATOM   3249  N  N     . LYS A  1  445  ? 207.654 314.507 236.086 1.00 0.00 ? 445  LYS A N     1 
ATOM   3250  C  CA    . LYS A  1  445  ? 208.374 314.216 234.865 1.00 0.00 ? 445  LYS A CA    1 
ATOM   3251  C  C     . LYS A  1  445  ? 207.340 313.966 233.773 1.00 0.00 ? 445  LYS A C     1 
ATOM   3252  O  O     . LYS A  1  445  ? 206.296 313.385 234.030 1.00 0.00 ? 445  LYS A O     1 
ATOM   3253  C  CB    . LYS A  1  445  ? 209.303 313.013 235.107 1.00 0.00 ? 445  LYS A CB    1 
ATOM   3254  C  CG    . LYS A  1  445  ? 210.591 313.431 235.832 1.00 0.00 ? 445  LYS A CG    1 
ATOM   3255  C  CD    . LYS A  1  445  ? 211.663 312.341 236.016 1.00 0.00 ? 445  LYS A CD    1 
ATOM   3256  C  CE    . LYS A  1  445  ? 211.155 311.251 237.002 1.00 0.00 ? 445  LYS A CE    1 
ATOM   3257  N  NZ    . LYS A  1  445  ? 212.172 310.250 237.482 1.00 0.00 ? 445  LYS A NZ    1 
ATOM   3258  N  N     . VAL A  1  446  ? 207.645 314.415 232.559 1.00 0.00 ? 446  VAL A N     1 
ATOM   3259  C  CA    . VAL A  1  446  ? 206.847 314.146 231.362 1.00 0.00 ? 446  VAL A CA    1 
ATOM   3260  C  C     . VAL A  1  446  ? 207.669 313.397 230.314 1.00 0.00 ? 446  VAL A C     1 
ATOM   3261  O  O     . VAL A  1  446  ? 208.596 313.950 229.737 1.00 0.00 ? 446  VAL A O     1 
ATOM   3262  C  CB    . VAL A  1  446  ? 206.339 315.402 230.731 1.00 0.00 ? 446  VAL A CB    1 
ATOM   3263  C  CG1   . VAL A  1  446  ? 205.655 315.061 229.442 1.00 0.00 ? 446  VAL A CG1   1 
ATOM   3264  C  CG2   . VAL A  1  446  ? 205.419 316.087 231.656 1.00 0.00 ? 446  VAL A CG2   1 
ATOM   3265  N  N     . GLU A  1  447  ? 207.309 312.160 230.020 1.00 0.00 ? 447  GLU A N     1 
ATOM   3266  C  CA    . GLU A  1  447  ? 208.079 311.361 229.083 1.00 0.00 ? 447  GLU A CA    1 
ATOM   3267  C  C     . GLU A  1  447  ? 207.546 311.598 227.670 1.00 0.00 ? 447  GLU A C     1 
ATOM   3268  O  O     . GLU A  1  447  ? 206.595 310.971 227.231 1.00 0.00 ? 447  GLU A O     1 
ATOM   3269  C  CB    . GLU A  1  447  ? 208.007 309.890 229.517 1.00 0.00 ? 447  GLU A CB    1 
ATOM   3270  C  CG    . GLU A  1  447  ? 209.079 308.959 228.949 1.00 0.00 ? 447  GLU A CG    1 
ATOM   3271  C  CD    . GLU A  1  447  ? 209.021 307.528 229.537 1.00 0.00 ? 447  GLU A CD    1 
ATOM   3272  O  OE1   . GLU A  1  447  ? 209.483 307.366 230.687 1.00 0.00 ? 447  GLU A OE1   1 
ATOM   3273  O  OE2   . GLU A  1  447  ? 208.600 306.560 228.849 1.00 0.00 ? 447  GLU A OE2   1 
ATOM   3274  N  N     . ARG A  1  448  ? 208.197 312.502 226.948 1.00 0.00 ? 448  ARG A N     1 
ATOM   3275  C  CA    . ARG A  1  448  ? 207.658 313.047 225.712 1.00 0.00 ? 448  ARG A CA    1 
ATOM   3276  C  C     . ARG A  1  448  ? 208.255 312.369 224.508 1.00 0.00 ? 448  ARG A C     1 
ATOM   3277  O  O     . ARG A  1  448  ? 209.225 311.651 224.652 1.00 0.00 ? 448  ARG A O     1 
ATOM   3278  C  CB    . ARG A  1  448  ? 207.947 314.530 225.669 1.00 0.00 ? 448  ARG A CB    1 
ATOM   3279  C  CG    . ARG A  1  448  ? 209.412 314.802 225.721 1.00 0.00 ? 448  ARG A CG    1 
ATOM   3280  C  CD    . ARG A  1  448  ? 209.809 316.074 225.031 1.00 0.00 ? 448  ARG A CD    1 
ATOM   3281  N  NE    . ARG A  1  448  ? 211.258 316.279 225.166 1.00 0.00 ? 448  ARG A NE    1 
ATOM   3282  C  CZ    . ARG A  1  448  ? 212.223 315.740 224.404 1.00 0.00 ? 448  ARG A CZ    1 
ATOM   3283  N  NH1   . ARG A  1  448  ? 211.935 314.965 223.370 1.00 0.00 ? 448  ARG A NH1   1 
ATOM   3284  N  NH2   . ARG A  1  448  ? 213.502 316.031 224.632 1.00 0.00 ? 448  ARG A NH2   1 
ATOM   3285  N  N     . HIS A  1  449  ? 207.614 312.498 223.347 1.00 0.00 ? 449  HIS A N     1 
ATOM   3286  C  CA    . HIS A  1  449  ? 208.166 311.973 222.094 1.00 0.00 ? 449  HIS A CA    1 
ATOM   3287  C  C     . HIS A  1  449  ? 209.418 312.708 221.705 1.00 0.00 ? 449  HIS A C     1 
ATOM   3288  O  O     . HIS A  1  449  ? 209.508 313.902 221.946 1.00 0.00 ? 449  HIS A O     1 
ATOM   3289  C  CB    . HIS A  1  449  ? 207.158 312.069 220.975 1.00 0.00 ? 449  HIS A CB    1 
ATOM   3290  C  CG    . HIS A  1  449  ? 205.926 311.271 221.226 1.00 0.00 ? 449  HIS A CG    1 
ATOM   3291  N  ND1   . HIS A  1  449  ? 205.851 309.911 221.028 1.00 0.00 ? 449  HIS A ND1   1 
ATOM   3292  C  CD2   . HIS A  1  449  ? 204.711 311.653 221.677 1.00 0.00 ? 449  HIS A CD2   1 
ATOM   3293  C  CE1   . HIS A  1  449  ? 204.636 309.492 221.340 1.00 0.00 ? 449  HIS A CE1   1 
ATOM   3294  N  NE2   . HIS A  1  449  ? 203.927 310.531 221.739 1.00 0.00 ? 449  HIS A NE2   1 
ATOM   3295  N  N     . MET A  1  450  ? 210.344 312.016 221.049 1.00 0.00 ? 450  MET A N     1 
ATOM   3296  C  CA    . MET A  1  450  ? 211.591 312.615 220.567 1.00 0.00 ? 450  MET A CA    1 
ATOM   3297  C  C     . MET A  1  450  ? 211.453 313.557 219.374 1.00 0.00 ? 450  MET A C     1 
ATOM   3298  O  O     . MET A  1  450  ? 210.955 313.174 218.311 1.00 0.00 ? 450  MET A O     1 
ATOM   3299  C  CB    . MET A  1  450  ? 212.557 311.510 220.182 1.00 0.00 ? 450  MET A CB    1 
ATOM   3300  C  CG    . MET A  1  450  ? 213.547 311.910 219.132 1.00 0.00 ? 450  MET A CG    1 
ATOM   3301  S  SD    . MET A  1  450  ? 214.696 310.575 218.831 1.00 0.00 ? 450  MET A SD    1 
ATOM   3302  C  CE    . MET A  1  450  ? 213.634 309.244 218.246 1.00 0.00 ? 450  MET A CE    1 
ATOM   3303  N  N     . CYS A  1  451  ? 211.974 314.767 219.519 1.00 0.00 ? 451  CYS A N     1 
ATOM   3304  C  CA    . CYS A  1  451  ? 211.758 315.783 218.488 1.00 0.00 ? 451  CYS A CA    1 
ATOM   3305  C  C     . CYS A  1  451  ? 213.052 316.357 217.897 1.00 0.00 ? 451  CYS A C     1 
ATOM   3306  O  O     . CYS A  1  451  ? 214.136 315.782 218.041 1.00 0.00 ? 451  CYS A O     1 
ATOM   3307  C  CB    . CYS A  1  451  ? 210.971 316.955 219.041 1.00 0.00 ? 451  CYS A CB    1 
ATOM   3308  S  SG    . CYS A  1  451  ? 212.079 318.035 219.934 1.00 0.00 ? 451  CYS A SG    1 
ATOM   3309  N  N     . ASP A  1  452  ? 212.939 317.508 217.234 1.00 0.00 ? 452  ASP A N     1 
ATOM   3310  C  CA    . ASP A  1  452  ? 214.125 318.136 216.648 1.00 0.00 ? 452  ASP A CA    1 
ATOM   3311  C  C     . ASP A  1  452  ? 215.170 318.570 217.642 1.00 0.00 ? 452  ASP A C     1 
ATOM   3312  O  O     . ASP A  1  452  ? 214.849 319.127 218.699 1.00 0.00 ? 452  ASP A O     1 
ATOM   3313  C  CB    . ASP A  1  452  ? 213.756 319.349 215.818 1.00 0.00 ? 452  ASP A CB    1 
ATOM   3314  C  CG    . ASP A  1  452  ? 213.084 318.968 214.524 1.00 0.00 ? 452  ASP A CG    1 
ATOM   3315  O  OD1   . ASP A  1  452  ? 213.291 317.800 214.053 1.00 0.00 ? 452  ASP A OD1   1 
ATOM   3316  O  OD2   . ASP A  1  452  ? 212.341 319.847 214.004 1.00 0.00 ? 452  ASP A OD2   1 
ATOM   3317  N  N     . GLY A  1  453  ? 216.423 318.348 217.263 1.00 0.00 ? 453  GLY A N     1 
ATOM   3318  C  CA    . GLY A  1  453  ? 217.534 318.839 218.038 1.00 0.00 ? 453  GLY A CA    1 
ATOM   3319  C  C     . GLY A  1  453  ? 217.620 318.065 219.327 1.00 0.00 ? 453  GLY A C     1 
ATOM   3320  O  O     . GLY A  1  453  ? 218.118 318.568 220.331 1.00 0.00 ? 453  GLY A O     1 
ATOM   3321  N  N     . ASP A  1  454  ? 217.099 316.845 219.311 1.00 0.00 ? 454  ASP A N     1 
ATOM   3322  C  CA    . ASP A  1  454  ? 217.377 315.926 220.387 1.00 0.00 ? 454  ASP A CA    1 
ATOM   3323  C  C     . ASP A  1  454  ? 218.536 315.099 219.849 1.00 0.00 ? 454  ASP A C     1 
ATOM   3324  O  O     . ASP A  1  454  ? 218.555 314.836 218.671 1.00 0.00 ? 454  ASP A O     1 
ATOM   3325  C  CB    . ASP A  1  454  ? 216.132 315.102 220.739 1.00 0.00 ? 454  ASP A CB    1 
ATOM   3326  C  CG    . ASP A  1  454  ? 214.995 315.967 221.439 1.00 0.00 ? 454  ASP A CG    1 
ATOM   3327  O  OD1   . ASP A  1  454  ? 215.309 317.063 221.994 1.00 0.00 ? 454  ASP A OD1   1 
ATOM   3328  O  OD2   . ASP A  1  454  ? 213.796 315.538 221.436 1.00 0.00 ? 454  ASP A OD2   1 
ATOM   3329  N  N     . ILE A  1  455  ? 219.502 314.716 220.685 1.00 0.00 ? 455  ILE A N     1 
ATOM   3330  C  CA    . ILE A  1  455  ? 220.788 314.167 220.220 1.00 0.00 ? 455  ILE A CA    1 
ATOM   3331  C  C     . ILE A  1  455  ? 220.923 312.681 220.408 1.00 0.00 ? 455  ILE A C     1 
ATOM   3332  O  O     . ILE A  1  455  ? 220.967 312.258 221.550 1.00 0.00 ? 455  ILE A O     1 
ATOM   3333  C  CB    . ILE A  1  455  ? 221.925 314.793 221.004 1.00 0.00 ? 455  ILE A CB    1 
ATOM   3334  C  CG1   . ILE A  1  455  ? 221.817 316.338 220.944 1.00 0.00 ? 455  ILE A CG1   1 
ATOM   3335  C  CG2   . ILE A  1  455  ? 223.246 314.128 220.612 1.00 0.00 ? 455  ILE A CG2   1 
ATOM   3336  C  CD1   . ILE A  1  455  ? 222.854 317.143 221.761 1.00 0.00 ? 455  ILE A CD1   1 
ATOM   3337  N  N     . VAL A  1  456  ? 221.293 311.922 219.376 1.00 0.00 ? 456  VAL A N     1 
ATOM   3338  C  CA    . VAL A  1  456  ? 221.312 310.473 219.543 1.00 0.00 ? 456  VAL A CA    1 
ATOM   3339  C  C     . VAL A  1  456  ? 222.659 309.960 219.165 1.00 0.00 ? 456  VAL A C     1 
ATOM   3340  O  O     . VAL A  1  456  ? 223.294 310.520 218.299 1.00 0.00 ? 456  VAL A O     1 
ATOM   3341  C  CB    . VAL A  1  456  ? 220.286 309.791 218.651 1.00 0.00 ? 456  VAL A CB    1 
ATOM   3342  C  CG1   . VAL A  1  456  ? 218.916 310.163 219.034 1.00 0.00 ? 456  VAL A CG1   1 
ATOM   3343  C  CG2   . VAL A  1  456  ? 220.502 310.174 217.254 1.00 0.00 ? 456  VAL A CG2   1 
ATOM   3344  N  N     . ILE A  1  457  ? 222.995 308.770 219.646 1.00 0.00 ? 457  ILE A N     1 
ATOM   3345  C  CA    . ILE A  1  457  ? 224.229 308.137 219.265 1.00 0.00 ? 457  ILE A CA    1 
ATOM   3346  C  C     . ILE A  1  457  ? 223.925 307.077 218.278 1.00 0.00 ? 457  ILE A C     1 
ATOM   3347  O  O     . ILE A  1  457  ? 222.996 306.324 218.357 1.00 0.00 ? 457  ILE A O     1 
ATOM   3348  C  CB    . ILE A  1  457  ? 224.996 307.700 220.450 1.00 0.00 ? 457  ILE A CB    1 
ATOM   3349  C  CG1   . ILE A  1  457  ? 225.828 308.894 220.831 1.00 0.00 ? 457  ILE A CG1   1 
ATOM   3350  C  CG2   . ILE A  1  457  ? 225.795 306.496 220.176 1.00 0.00 ? 457  ILE A CG2   1 
ATOM   3351  C  CD1   . ILE A  1  457  ? 226.985 309.084 219.994 1.00 0.00 ? 457  ILE A CD1   1 
ATOM   3352  N  N     . PHE A  1  458  ? 224.667 307.215 217.226 1.00 0.00 ? 458  PHE A N     1 
ATOM   3353  C  CA    . PHE A  1  458  ? 224.547 306.446 216.064 1.00 0.00 ? 458  PHE A CA    1 
ATOM   3354  C  C     . PHE A  1  458  ? 225.746 305.566 215.854 1.00 0.00 ? 458  PHE A C     1 
ATOM   3355  O  O     . PHE A  1  458  ? 226.821 305.848 216.272 1.00 0.00 ? 458  PHE A O     1 
ATOM   3356  C  CB    . PHE A  1  458  ? 224.371 307.511 214.995 1.00 0.00 ? 458  PHE A CB    1 
ATOM   3357  C  CG    . PHE A  1  458  ? 223.787 307.058 213.778 1.00 0.00 ? 458  PHE A CG    1 
ATOM   3358  C  CD1   . PHE A  1  458  ? 222.778 306.200 213.799 1.00 0.00 ? 458  PHE A CD1   1 
ATOM   3359  C  CD2   . PHE A  1  458  ? 224.126 307.614 212.608 1.00 0.00 ? 458  PHE A CD2   1 
ATOM   3360  C  CE1   . PHE A  1  458  ? 222.209 305.800 212.660 1.00 0.00 ? 458  PHE A CE1   1 
ATOM   3361  C  CE2   . PHE A  1  458  ? 223.523 307.219 211.461 1.00 0.00 ? 458  PHE A CE2   1 
ATOM   3362  C  CZ    . PHE A  1  458  ? 222.568 306.317 211.501 1.00 0.00 ? 458  PHE A CZ    1 
ATOM   3363  N  N     . ASN A  1  459  ? 225.509 304.385 215.384 1.00 0.00 ? 459  ASN A N     1 
ATOM   3364  C  CA    . ASN A  1  459  ? 226.508 303.367 215.484 1.00 0.00 ? 459  ASN A CA    1 
ATOM   3365  C  C     . ASN A  1  459  ? 226.349 302.531 214.257 1.00 0.00 ? 459  ASN A C     1 
ATOM   3366  O  O     . ASN A  1  459  ? 225.359 302.683 213.584 1.00 0.00 ? 459  ASN A O     1 
ATOM   3367  C  CB    . ASN A  1  459  ? 226.295 302.563 216.761 1.00 0.00 ? 459  ASN A CB    1 
ATOM   3368  C  CG    . ASN A  1  459  ? 227.121 301.300 216.808 1.00 0.00 ? 459  ASN A CG    1 
ATOM   3369  O  OD1   . ASN A  1  459  ? 226.795 300.302 216.169 1.00 0.00 ? 459  ASN A OD1   1 
ATOM   3370  N  ND2   . ASN A  1  459  ? 228.208 301.348 217.546 1.00 0.00 ? 459  ASN A ND2   1 
ATOM   3371  N  N     . ARG A  1  460  ? 227.242 301.601 213.981 1.00 0.00 ? 460  ARG A N     1 
ATOM   3372  C  CA    . ARG A  1  460  ? 226.849 300.493 213.108 1.00 0.00 ? 460  ARG A CA    1 
ATOM   3373  C  C     . ARG A  1  460  ? 227.694 299.289 213.473 1.00 0.00 ? 460  ARG A C     1 
ATOM   3374  O  O     . ARG A  1  460  ? 228.588 299.399 214.287 1.00 0.00 ? 460  ARG A O     1 
ATOM   3375  C  CB    . ARG A  1  460  ? 226.990 300.846 211.639 1.00 0.00 ? 460  ARG A CB    1 
ATOM   3376  C  CG    . ARG A  1  460  ? 228.367 300.848 211.207 1.00 0.00 ? 460  ARG A CG    1 
ATOM   3377  C  CD    . ARG A  1  460  ? 228.391 301.200 209.801 1.00 0.00 ? 460  ARG A CD    1 
ATOM   3378  N  NE    . ARG A  1  460  ? 227.434 300.466 208.973 1.00 0.00 ? 460  ARG A NE    1 
ATOM   3379  C  CZ    . ARG A  1  460  ? 227.743 299.403 208.228 1.00 0.00 ? 460  ARG A CZ    1 
ATOM   3380  N  NH1   . ARG A  1  460  ? 228.982 298.899 208.254 1.00 0.00 ? 460  ARG A NH1   1 
ATOM   3381  N  NH2   . ARG A  1  460  ? 226.813 298.836 207.461 1.00 0.00 ? 460  ARG A NH2   1 
ATOM   3382  N  N     . GLN A  1  461  ? 227.410 298.127 212.918 1.00 0.00 ? 461  GLN A N     1 
ATOM   3383  C  CA    . GLN A  1  461  ? 228.297 297.021 213.156 1.00 0.00 ? 461  GLN A CA    1 
ATOM   3384  C  C     . GLN A  1  461  ? 228.906 296.570 211.846 1.00 0.00 ? 461  GLN A C     1 
ATOM   3385  O  O     . GLN A  1  461  ? 228.241 296.593 210.818 1.00 0.00 ? 461  GLN A O     1 
ATOM   3386  C  CB    . GLN A  1  461  ? 227.538 295.926 213.851 1.00 0.00 ? 461  GLN A CB    1 
ATOM   3387  C  CG    . GLN A  1  461  ? 227.164 296.368 215.237 1.00 0.00 ? 461  GLN A CG    1 
ATOM   3388  C  CD    . GLN A  1  461  ? 225.834 295.794 215.730 1.00 0.00 ? 461  GLN A CD    1 
ATOM   3389  O  OE1   . GLN A  1  461  ? 224.958 295.403 214.940 1.00 0.00 ? 461  GLN A OE1   1 
ATOM   3390  N  NE2   . GLN A  1  461  ? 225.675 295.760 217.054 1.00 0.00 ? 461  GLN A NE2   1 
ATOM   3391  N  N     . PRO A  1  462  ? 230.180 296.166 211.855 1.00 0.00 ? 462  PRO A N     1 
ATOM   3392  C  CA    . PRO A  1  462  ? 231.133 296.001 212.959 1.00 0.00 ? 462  PRO A CA    1 
ATOM   3393  C  C     . PRO A  1  462  ? 231.832 297.289 213.396 1.00 0.00 ? 462  PRO A C     1 
ATOM   3394  O  O     . PRO A  1  462  ? 232.452 297.975 212.572 1.00 0.00 ? 462  PRO A O     1 
ATOM   3395  C  CB    . PRO A  1  462  ? 232.162 295.034 212.368 1.00 0.00 ? 462  PRO A CB    1 
ATOM   3396  C  CG    . PRO A  1  462  ? 232.215 295.452 210.915 1.00 0.00 ? 462  PRO A CG    1 
ATOM   3397  C  CD    . PRO A  1  462  ? 230.811 295.909 210.549 1.00 0.00 ? 462  PRO A CD    1 
ATOM   3398  N  N     . THR A  1  463  ? 231.780 297.597 214.687 1.00 0.00 ? 463  THR A N     1 
ATOM   3399  C  CA    . THR A  1  463  ? 232.375 298.835 215.182 1.00 0.00 ? 463  THR A CA    1 
ATOM   3400  C  C     . THR A  1  463  ? 233.883 298.689 215.357 1.00 0.00 ? 463  THR A C     1 
ATOM   3401  O  O     . THR A  1  463  ? 234.355 298.216 216.397 1.00 0.00 ? 463  THR A O     1 
ATOM   3402  C  CB    . THR A  1  463  ? 231.762 299.237 216.503 1.00 0.00 ? 463  THR A CB    1 
ATOM   3403  O  OG1   . THR A  1  463  ? 230.401 298.806 216.511 1.00 0.00 ? 463  THR A OG1   1 
ATOM   3404  C  CG2   . THR A  1  463  ? 231.829 300.737 216.701 1.00 0.00 ? 463  THR A CG2   1 
ATOM   3405  N  N     . LEU A  1  464  ? 234.632 299.112 214.338 1.00 0.00 ? 464  LEU A N     1 
ATOM   3406  C  CA    . LEU A  1  464  ? 236.063 298.857 214.273 1.00 0.00 ? 464  LEU A CA    1 
ATOM   3407  C  C     . LEU A  1  464  ? 236.966 299.903 214.895 1.00 0.00 ? 464  LEU A C     1 
ATOM   3408  O  O     . LEU A  1  464  ? 238.142 299.636 215.062 1.00 0.00 ? 464  LEU A O     1 
ATOM   3409  C  CB    . LEU A  1  464  ? 236.461 298.680 212.825 1.00 0.00 ? 464  LEU A CB    1 
ATOM   3410  C  CG    . LEU A  1  464  ? 235.675 297.477 212.337 1.00 0.00 ? 464  LEU A CG    1 
ATOM   3411  C  CD1   . LEU A  1  464  ? 235.853 297.306 210.830 1.00 0.00 ? 464  LEU A CD1   1 
ATOM   3412  C  CD2   . LEU A  1  464  ? 236.125 296.230 213.116 1.00 0.00 ? 464  LEU A CD2   1 
ATOM   3413  N  N     . HIS A  1  465  ? 236.434 301.073 215.236 1.00 0.00 ? 465  HIS A N     1 
ATOM   3414  C  CA    . HIS A  1  465  ? 237.220 302.121 215.868 1.00 0.00 ? 465  HIS A CA    1 
ATOM   3415  C  C     . HIS A  1  465  ? 236.318 303.220 216.335 1.00 0.00 ? 465  HIS A C     1 
ATOM   3416  O  O     . HIS A  1  465  ? 235.261 303.389 215.773 1.00 0.00 ? 465  HIS A O     1 
ATOM   3417  C  CB    . HIS A  1  465  ? 238.189 302.686 214.882 1.00 0.00 ? 465  HIS A CB    1 
ATOM   3418  C  CG    . HIS A  1  465  ? 237.506 303.199 213.677 1.00 0.00 ? 465  HIS A CG    1 
ATOM   3419  N  ND1   . HIS A  1  465  ? 236.794 304.375 213.687 1.00 0.00 ? 465  HIS A ND1   1 
ATOM   3420  C  CD2   . HIS A  1  465  ? 237.363 302.674 212.438 1.00 0.00 ? 465  HIS A CD2   1 
ATOM   3421  C  CE1   . HIS A  1  465  ? 236.268 304.574 212.492 1.00 0.00 ? 465  HIS A CE1   1 
ATOM   3422  N  NE2   . HIS A  1  465  ? 236.594 303.556 211.716 1.00 0.00 ? 465  HIS A NE2   1 
ATOM   3423  N  N     . LYS A  1  466  ? 236.785 304.014 217.290 1.00 0.00 ? 466  LYS A N     1 
ATOM   3424  C  CA    . LYS A  1  466  ? 235.988 305.034 217.988 1.00 0.00 ? 466  LYS A CA    1 
ATOM   3425  C  C     . LYS A  1  466  ? 235.094 305.967 217.160 1.00 0.00 ? 466  LYS A C     1 
ATOM   3426  O  O     . LYS A  1  466  ? 234.084 306.427 217.663 1.00 0.00 ? 466  LYS A O     1 
ATOM   3427  C  CB    . LYS A  1  466  ? 236.899 305.924 218.829 1.00 0.00 ? 466  LYS A CB    1 
ATOM   3428  C  CG    . LYS A  1  466  ? 237.598 306.972 217.988 1.00 0.00 ? 466  LYS A CG    1 
ATOM   3429  C  CD    . LYS A  1  466  ? 238.562 307.855 218.751 1.00 0.00 ? 466  LYS A CD    1 
ATOM   3430  C  CE    . LYS A  1  466  ? 237.811 308.726 219.735 1.00 0.00 ? 466  LYS A CE    1 
ATOM   3431  N  NZ    . LYS A  1  466  ? 238.768 309.537 220.503 1.00 0.00 ? 466  LYS A NZ    1 
ATOM   3432  N  N     . MET A  1  467  ? 235.511 306.287 215.937 1.00 0.00 ? 467  MET A N     1 
ATOM   3433  C  CA    . MET A  1  467  ? 234.766 307.081 214.956 1.00 0.00 ? 467  MET A CA    1 
ATOM   3434  C  C     . MET A  1  467  ? 233.586 306.349 214.263 1.00 0.00 ? 467  MET A C     1 
ATOM   3435  O  O     . MET A  1  467  ? 232.907 306.945 213.437 1.00 0.00 ? 467  MET A O     1 
ATOM   3436  C  CB    . MET A  1  467  ? 235.773 307.623 213.924 1.00 0.00 ? 467  MET A CB    1 
ATOM   3437  C  CG    . MET A  1  467  ? 236.821 308.585 214.540 1.00 0.00 ? 467  MET A CG    1 
ATOM   3438  S  SD    . MET A  1  467  ? 236.469 310.383 214.473 1.00 0.00 ? 467  MET A SD    1 
ATOM   3439  C  CE    . MET A  1  467  ? 237.918 311.153 215.249 1.00 0.00 ? 467  MET A CE    1 
ATOM   3440  N  N     . SER A  1  468  ? 233.442 305.044 214.480 1.00 0.00 ? 468  SER A N     1 
ATOM   3441  C  CA    . SER A  1  468  ? 232.235 304.306 214.059 1.00 0.00 ? 468  SER A CA    1 
ATOM   3442  C  C     . SER A  1  468  ? 230.948 304.654 214.835 1.00 0.00 ? 468  SER A C     1 
ATOM   3443  O  O     . SER A  1  468  ? 229.847 304.413 214.334 1.00 0.00 ? 468  SER A O     1 
ATOM   3444  C  CB    . SER A  1  468  ? 232.412 302.761 214.176 1.00 0.00 ? 468  SER A CB    1 
ATOM   3445  O  OG    . SER A  1  468  ? 233.388 302.176 213.329 1.00 0.00 ? 468  SER A OG    1 
ATOM   3446  N  N     . MET A  1  469  ? 231.068 305.291 215.994 1.00 0.00 ? 469  MET A N     1 
ATOM   3447  C  CA    . MET A  1  469  ? 229.892 305.700 216.764 1.00 0.00 ? 469  MET A CA    1 
ATOM   3448  C  C     . MET A  1  469  ? 229.920 307.086 217.277 1.00 0.00 ? 469  MET A C     1 
ATOM   3449  O  O     . MET A  1  469  ? 230.440 307.324 218.360 1.00 0.00 ? 469  MET A O     1 
ATOM   3450  C  CB    . MET A  1  469  ? 229.853 304.772 217.959 1.00 0.00 ? 469  MET A CB    1 
ATOM   3451  C  CG    . MET A  1  469  ? 228.707 304.804 218.908 1.00 0.00 ? 469  MET A CG    1 
ATOM   3452  S  SD    . MET A  1  469  ? 228.766 303.195 219.726 1.00 0.00 ? 469  MET A SD    1 
ATOM   3453  C  CE    . MET A  1  469  ? 230.013 303.477 220.952 1.00 0.00 ? 469  MET A CE    1 
ATOM   3454  N  N     . MET A  1  470  ? 229.131 307.941 216.645 1.00 0.00 ? 470  MET A N     1 
ATOM   3455  C  CA    . MET A  1  470  ? 229.219 309.355 216.916 1.00 0.00 ? 470  MET A CA    1 
ATOM   3456  C  C     . MET A  1  470  ? 227.921 310.055 217.111 1.00 0.00 ? 470  MET A C     1 
ATOM   3457  O  O     . MET A  1  470  ? 226.957 309.734 216.446 1.00 0.00 ? 470  MET A O     1 
ATOM   3458  C  CB    . MET A  1  470  ? 229.914 309.999 215.772 1.00 0.00 ? 470  MET A CB    1 
ATOM   3459  C  CG    . MET A  1  470  ? 231.208 309.391 215.528 1.00 0.00 ? 470  MET A CG    1 
ATOM   3460  S  SD    . MET A  1  470  ? 232.030 310.158 214.153 1.00 0.00 ? 470  MET A SD    1 
ATOM   3461  C  CE    . MET A  1  470  ? 230.995 309.624 212.771 1.00 0.00 ? 470  MET A CE    1 
ATOM   3462  N  N     . GLY A  1  471  ? 227.935 311.160 217.838 1.00 0.00 ? 471  GLY A N     1 
ATOM   3463  C  CA    . GLY A  1  471  ? 226.712 311.903 218.074 1.00 0.00 ? 471  GLY A CA    1 
ATOM   3464  C  C     . GLY A  1  471  ? 226.267 312.790 216.922 1.00 0.00 ? 471  GLY A C     1 
ATOM   3465  O  O     . GLY A  1  471  ? 227.018 313.546 216.314 1.00 0.00 ? 471  GLY A O     1 
ATOM   3466  N  N     . HIS A  1  472  ? 224.956 312.791 216.756 1.00 0.00 ? 472  HIS A N     1 
ATOM   3467  C  CA    . HIS A  1  472  ? 224.248 313.440 215.690 1.00 0.00 ? 472  HIS A CA    1 
ATOM   3468  C  C     . HIS A  1  472  ? 223.080 314.160 216.376 1.00 0.00 ? 472  HIS A C     1 
ATOM   3469  O  O     . HIS A  1  472  ? 222.828 313.926 217.544 1.00 0.00 ? 472  HIS A O     1 
ATOM   3470  C  CB    . HIS A  1  472  ? 223.683 312.346 214.772 1.00 0.00 ? 472  HIS A CB    1 
ATOM   3471  C  CG    . HIS A  1  472  ? 224.626 311.834 213.725 1.00 0.00 ? 472  HIS A CG    1 
ATOM   3472  N  ND1   . HIS A  1  472  ? 224.619 312.280 212.419 1.00 0.00 ? 472  HIS A ND1   1 
ATOM   3473  C  CD2   . HIS A  1  472  ? 225.559 310.851 213.779 1.00 0.00 ? 472  HIS A CD2   1 
ATOM   3474  C  CE1   . HIS A  1  472  ? 225.536 311.625 211.727 1.00 0.00 ? 472  HIS A CE1   1 
ATOM   3475  N  NE2   . HIS A  1  472  ? 226.128 310.761 212.532 1.00 0.00 ? 472  HIS A NE2   1 
ATOM   3476  N  N     . ARG A  1  473  ? 222.501 315.165 215.765 1.00 0.00 ? 473  ARG A N     1 
ATOM   3477  C  CA    . ARG A  1  473  ? 221.291 315.744 216.309 1.00 0.00 ? 473  ARG A CA    1 
ATOM   3478  C  C     . ARG A  1  473  ? 220.150 315.228 215.439 1.00 0.00 ? 473  ARG A C     1 
ATOM   3479  O  O     . ARG A  1  473  ? 220.317 315.267 214.253 1.00 0.00 ? 473  ARG A O     1 
ATOM   3480  C  CB    . ARG A  1  473  ? 221.433 317.235 216.327 1.00 0.00 ? 473  ARG A CB    1 
ATOM   3481  C  CG    . ARG A  1  473  ? 222.552 317.667 217.303 1.00 0.00 ? 473  ARG A CG    1 
ATOM   3482  C  CD    . ARG A  1  473  ? 222.593 319.157 217.285 1.00 0.00 ? 473  ARG A CD    1 
ATOM   3483  N  NE    . ARG A  1  473  ? 223.123 319.395 215.951 1.00 0.00 ? 473  ARG A NE    1 
ATOM   3484  C  CZ    . ARG A  1  473  ? 222.681 320.334 215.121 1.00 0.00 ? 473  ARG A CZ    1 
ATOM   3485  N  NH1   . ARG A  1  473  ? 221.690 321.136 215.519 1.00 0.00 ? 473  ARG A NH1   1 
ATOM   3486  N  NH2   . ARG A  1  473  ? 223.237 320.484 213.909 1.00 0.00 ? 473  ARG A NH2   1 
ATOM   3487  N  N     . VAL A  1  474  ? 219.012 314.746 215.921 1.00 0.00 ? 474  VAL A N     1 
ATOM   3488  C  CA    . VAL A  1  474  ? 218.008 314.259 214.945 1.00 0.00 ? 474  VAL A CA    1 
ATOM   3489  C  C     . VAL A  1  474  ? 217.235 315.404 214.276 1.00 0.00 ? 474  VAL A C     1 
ATOM   3490  O  O     . VAL A  1  474  ? 217.092 316.496 214.831 1.00 0.00 ? 474  VAL A O     1 
ATOM   3491  C  CB    . VAL A  1  474  ? 216.976 313.267 215.549 1.00 0.00 ? 474  VAL A CB    1 
ATOM   3492  C  CG1   . VAL A  1  474  ? 217.664 312.122 216.219 1.00 0.00 ? 474  VAL A CG1   1 
ATOM   3493  C  CG2   . VAL A  1  474  ? 216.074 313.926 216.533 1.00 0.00 ? 474  VAL A CG2   1 
ATOM   3494  N  N     . ARG A  1  475  ? 216.772 315.127 213.061 1.00 0.00 ? 475  ARG A N     1 
ATOM   3495  C  CA    . ARG A  1  475  ? 215.762 315.901 212.334 1.00 0.00 ? 475  ARG A CA    1 
ATOM   3496  C  C     . ARG A  1  475  ? 214.719 315.064 211.656 1.00 0.00 ? 475  ARG A C     1 
ATOM   3497  O  O     . ARG A  1  475  ? 215.006 314.452 210.653 1.00 0.00 ? 475  ARG A O     1 
ATOM   3498  C  CB    . ARG A  1  475  ? 216.412 316.709 211.260 1.00 0.00 ? 475  ARG A CB    1 
ATOM   3499  C  CG    . ARG A  1  475  ? 215.421 317.471 210.515 1.00 0.00 ? 475  ARG A CG    1 
ATOM   3500  C  CD    . ARG A  1  475  ? 216.129 318.254 209.479 1.00 0.00 ? 475  ARG A CD    1 
ATOM   3501  N  NE    . ARG A  1  475  ? 215.147 318.934 208.658 1.00 0.00 ? 475  ARG A NE    1 
ATOM   3502  C  CZ    . ARG A  1  475  ? 215.385 320.042 207.973 1.00 0.00 ? 475  ARG A CZ    1 
ATOM   3503  N  NH1   . ARG A  1  475  ? 216.565 320.648 208.139 1.00 0.00 ? 475  ARG A NH1   1 
ATOM   3504  N  NH2   . ARG A  1  475  ? 214.449 320.526 207.139 1.00 0.00 ? 475  ARG A NH2   1 
ATOM   3505  N  N     . ILE A  1  476  ? 213.493 315.097 212.167 1.00 0.00 ? 476  ILE A N     1 
ATOM   3506  C  CA    . ILE A  1  476  ? 212.405 314.199 211.739 1.00 0.00 ? 476  ILE A CA    1 
ATOM   3507  C  C     . ILE A  1  476  ? 211.789 314.443 210.340 1.00 0.00 ? 476  ILE A C     1 
ATOM   3508  O  O     . ILE A  1  476  ? 211.523 315.587 209.982 1.00 0.00 ? 476  ILE A O     1 
ATOM   3509  C  CB    . ILE A  1  476  ? 211.242 314.163 212.752 1.00 0.00 ? 476  ILE A CB    1 
ATOM   3510  C  CG1   . ILE A  1  476  ? 211.611 313.407 214.036 1.00 0.00 ? 476  ILE A CG1   1 
ATOM   3511  C  CG2   . ILE A  1  476  ? 210.045 313.461 212.142 1.00 0.00 ? 476  ILE A CG2   1 
ATOM   3512  C  CD1   . ILE A  1  476  ? 212.662 314.006 214.877 1.00 0.00 ? 476  ILE A CD1   1 
ATOM   3513  N  N     . LEU A  1  477  ? 211.692 313.391 209.514 1.00 0.00 ? 477  LEU A N     1 
ATOM   3514  C  CA    . LEU A  1  477  ? 211.316 313.498 208.096 1.00 0.00 ? 477  LEU A CA    1 
ATOM   3515  C  C     . LEU A  1  477  ? 210.278 312.389 207.732 1.00 0.00 ? 477  LEU A C     1 
ATOM   3516  O  O     . LEU A  1  477  ? 210.028 311.509 208.555 1.00 0.00 ? 477  LEU A O     1 
ATOM   3517  C  CB    . LEU A  1  477  ? 212.549 313.357 207.214 1.00 0.00 ? 477  LEU A CB    1 
ATOM   3518  C  CG    . LEU A  1  477  ? 213.317 314.653 207.184 1.00 0.00 ? 477  LEU A CG    1 
ATOM   3519  C  CD1   . LEU A  1  477  ? 214.712 314.505 206.507 1.00 0.00 ? 477  LEU A CD1   1 
ATOM   3520  C  CD2   . LEU A  1  477  ? 212.423 315.747 206.605 1.00 0.00 ? 477  LEU A CD2   1 
ATOM   3521  N  N     . PRO A  1  478  ? 209.618 312.465 206.545 1.00 0.00 ? 478  PRO A N     1 
ATOM   3522  C  CA    . PRO A  1  478  ? 208.753 311.390 206.016 1.00 0.00 ? 478  PRO A CA    1 
ATOM   3523  C  C     . PRO A  1  478  ? 209.484 310.206 205.337 1.00 0.00 ? 478  PRO A C     1 
ATOM   3524  O  O     . PRO A  1  478  ? 210.572 310.394 204.793 1.00 0.00 ? 478  PRO A O     1 
ATOM   3525  C  CB    . PRO A  1  478  ? 207.921 312.114 204.984 1.00 0.00 ? 478  PRO A CB    1 
ATOM   3526  C  CG    . PRO A  1  478  ? 208.780 313.179 204.531 1.00 0.00 ? 478  PRO A CG    1 
ATOM   3527  C  CD    . PRO A  1  478  ? 209.514 313.675 205.714 1.00 0.00 ? 478  PRO A CD    1 
ATOM   3528  N  N     . TRP A  1  479  ? 208.836 309.035 205.319 1.00 0.00 ? 479  TRP A N     1 
ATOM   3529  C  CA    . TRP A  1  479  ? 209.380 307.716 204.894 1.00 0.00 ? 479  TRP A CA    1 
ATOM   3530  C  C     . TRP A  1  479  ? 210.270 307.083 205.992 1.00 0.00 ? 479  TRP A C     1 
ATOM   3531  O  O     . TRP A  1  479  ? 210.606 307.750 206.962 1.00 0.00 ? 479  TRP A O     1 
ATOM   3532  C  CB    . TRP A  1  479  ? 210.092 307.837 203.534 1.00 0.00 ? 479  TRP A CB    1 
ATOM   3533  C  CG    . TRP A  1  479  ? 209.038 307.986 202.438 1.00 0.00 ? 479  TRP A CG    1 
ATOM   3534  C  CD1   . TRP A  1  479  ? 208.225 306.982 201.900 1.00 0.00 ? 479  TRP A CD1   1 
ATOM   3535  C  CD2   . TRP A  1  479  ? 208.633 309.181 201.800 1.00 0.00 ? 479  TRP A CD2   1 
ATOM   3536  N  NE1   . TRP A  1  479  ? 207.368 307.490 200.960 1.00 0.00 ? 479  TRP A NE1   1 
ATOM   3537  C  CE2   . TRP A  1  479  ? 207.587 308.836 200.875 1.00 0.00 ? 479  TRP A CE2   1 
ATOM   3538  C  CE3   . TRP A  1  479  ? 209.048 310.510 201.896 1.00 0.00 ? 479  TRP A CE3   1 
ATOM   3539  C  CZ2   . TRP A  1  479  ? 206.960 309.776 200.061 1.00 0.00 ? 479  TRP A CZ2   1 
ATOM   3540  C  CZ3   . TRP A  1  479  ? 208.422 311.450 201.066 1.00 0.00 ? 479  TRP A CZ3   1 
ATOM   3541  C  CH2   . TRP A  1  479  ? 207.386 311.070 200.158 1.00 0.00 ? 479  TRP A CH2   1 
ATOM   3542  N  N     . SER A  1  480  ? 210.608 305.794 205.891 1.00 0.00 ? 480  SER A N     1 
ATOM   3543  C  CA    . SER A  1  480  ? 211.155 305.099 207.071 1.00 0.00 ? 480  SER A CA    1 
ATOM   3544  C  C     . SER A  1  480  ? 212.615 304.652 207.062 1.00 0.00 ? 480  SER A C     1 
ATOM   3545  O  O     . SER A  1  480  ? 212.903 303.538 207.465 1.00 0.00 ? 480  SER A O     1 
ATOM   3546  C  CB    . SER A  1  480  ? 210.361 303.844 207.366 1.00 0.00 ? 480  SER A CB    1 
ATOM   3547  O  OG    . SER A  1  480  ? 208.984 304.029 207.505 1.00 0.00 ? 480  SER A OG    1 
ATOM   3548  N  N     . THR A  1  481  ? 213.558 305.454 206.616 1.00 0.00 ? 481  THR A N     1 
ATOM   3549  C  CA    . THR A  1  481  ? 214.945 304.997 206.656 1.00 0.00 ? 481  THR A CA    1 
ATOM   3550  C  C     . THR A  1  481  ? 215.677 306.066 207.443 1.00 0.00 ? 481  THR A C     1 
ATOM   3551  O  O     . THR A  1  481  ? 215.122 307.067 207.567 1.00 0.00 ? 481  THR A O     1 
ATOM   3552  C  CB    . THR A  1  481  ? 215.507 304.860 205.303 1.00 0.00 ? 481  THR A CB    1 
ATOM   3553  O  OG1   . THR A  1  481  ? 215.704 306.164 204.771 1.00 0.00 ? 481  THR A OG1   1 
ATOM   3554  C  CG2   . THR A  1  481  ? 214.593 304.086 204.374 1.00 0.00 ? 481  THR A CG2   1 
ATOM   3555  N  N     . PHE A  1  482  ? 216.836 305.869 208.058 1.00 0.00 ? 482  PHE A N     1 
ATOM   3556  C  CA    . PHE A  1  482  ? 217.555 307.002 208.627 1.00 0.00 ? 482  PHE A CA    1 
ATOM   3557  C  C     . PHE A  1  482  ? 218.189 307.653 207.473 1.00 0.00 ? 482  PHE A C     1 
ATOM   3558  O  O     . PHE A  1  482  ? 218.887 306.984 206.845 1.00 0.00 ? 482  PHE A O     1 
ATOM   3559  C  CB    . PHE A  1  482  ? 218.696 306.586 209.563 1.00 0.00 ? 482  PHE A CB    1 
ATOM   3560  C  CG    . PHE A  1  482  ? 218.285 305.894 210.800 1.00 0.00 ? 482  PHE A CG    1 
ATOM   3561  C  CD1   . PHE A  1  482  ? 217.236 306.311 211.528 1.00 0.00 ? 482  PHE A CD1   1 
ATOM   3562  C  CD2   . PHE A  1  482  ? 218.937 304.742 211.179 1.00 0.00 ? 482  PHE A CD2   1 
ATOM   3563  C  CE1   . PHE A  1  482  ? 216.911 305.611 212.631 1.00 0.00 ? 482  PHE A CE1   1 
ATOM   3564  C  CE2   . PHE A  1  482  ? 218.575 304.076 212.225 1.00 0.00 ? 482  PHE A CE2   1 
ATOM   3565  C  CZ    . PHE A  1  482  ? 217.595 304.480 212.953 1.00 0.00 ? 482  PHE A CZ    1 
ATOM   3566  N  N     . ARG A  1  483  ? 217.932 308.940 207.254 1.00 0.00 ? 483  ARG A N     1 
ATOM   3567  C  CA    . ARG A  1  483  ? 218.537 309.701 206.171 1.00 0.00 ? 483  ARG A CA    1 
ATOM   3568  C  C     . ARG A  1  483  ? 219.691 310.491 206.776 1.00 0.00 ? 483  ARG A C     1 
ATOM   3569  O  O     . ARG A  1  483  ? 219.489 311.341 207.643 1.00 0.00 ? 483  ARG A O     1 
ATOM   3570  C  CB    . ARG A  1  483  ? 217.518 310.646 205.537 1.00 0.00 ? 483  ARG A CB    1 
ATOM   3571  C  CG    . ARG A  1  483  ? 216.077 310.179 205.660 1.00 0.00 ? 483  ARG A CG    1 
ATOM   3572  C  CD    . ARG A  1  483  ? 215.197 310.816 204.597 1.00 0.00 ? 483  ARG A CD    1 
ATOM   3573  N  NE    . ARG A  1  483  ? 215.219 310.064 203.346 1.00 0.00 ? 483  ARG A NE    1 
ATOM   3574  C  CZ    . ARG A  1  483  ? 215.797 310.491 202.227 1.00 0.00 ? 483  ARG A CZ    1 
ATOM   3575  N  NH1   . ARG A  1  483  ? 216.404 311.669 202.200 1.00 0.00 ? 483  ARG A NH1   1 
ATOM   3576  N  NH2   . ARG A  1  483  ? 215.768 309.739 201.135 1.00 0.00 ? 483  ARG A NH2   1 
ATOM   3577  N  N     . LEU A  1  484  ? 220.901 310.202 206.313 1.00 0.00 ? 484  LEU A N     1 
ATOM   3578  C  CA    . LEU A  1  484  ? 222.106 310.837 206.826 1.00 0.00 ? 484  LEU A CA    1 
ATOM   3579  C  C     . LEU A  1  484  ? 223.065 311.440 205.824 1.00 0.00 ? 484  LEU A C     1 
ATOM   3580  O  O     . LEU A  1  484  ? 223.158 310.895 204.727 1.00 0.00 ? 484  LEU A O     1 
ATOM   3581  C  CB    . LEU A  1  484  ? 222.750 309.751 207.653 1.00 0.00 ? 484  LEU A CB    1 
ATOM   3582  C  CG    . LEU A  1  484  ? 223.538 308.648 207.009 1.00 0.00 ? 484  LEU A CG    1 
ATOM   3583  C  CD1   . LEU A  1  484  ? 224.767 308.928 206.184 1.00 0.00 ? 484  LEU A CD1   1 
ATOM   3584  C  CD2   . LEU A  1  484  ? 223.889 307.783 208.203 1.00 0.00 ? 484  LEU A CD2   1 
ATOM   3585  N  N     . ASN A  1  485  ? 223.860 312.451 206.233 1.00 0.00 ? 485  ASN A N     1 
ATOM   3586  C  CA    . ASN A  1  485  ? 224.762 313.196 205.302 1.00 0.00 ? 485  ASN A CA    1 
ATOM   3587  C  C     . ASN A  1  485  ? 225.803 312.351 204.588 1.00 0.00 ? 485  ASN A C     1 
ATOM   3588  O  O     . ASN A  1  485  ? 226.425 311.423 205.122 1.00 0.00 ? 485  ASN A O     1 
ATOM   3589  C  CB    . ASN A  1  485  ? 225.546 314.352 205.963 1.00 0.00 ? 485  ASN A CB    1 
ATOM   3590  C  CG    . ASN A  1  485  ? 226.328 315.196 204.923 1.00 0.00 ? 485  ASN A CG    1 
ATOM   3591  O  OD1   . ASN A  1  485  ? 226.598 314.759 203.823 1.00 0.00 ? 485  ASN A OD1   1 
ATOM   3592  N  ND2   . ASN A  1  485  ? 226.670 316.389 205.282 1.00 0.00 ? 485  ASN A ND2   1 
ATOM   3593  N  N     . LEU A  1  486  ? 226.003 312.740 203.344 1.00 0.00 ? 486  LEU A N     1 
ATOM   3594  C  CA    . LEU A  1  486  ? 226.679 311.882 202.417 1.00 0.00 ? 486  LEU A CA    1 
ATOM   3595  C  C     . LEU A  1  486  ? 228.124 311.761 202.789 1.00 0.00 ? 486  LEU A C     1 
ATOM   3596  O  O     . LEU A  1  486  ? 228.726 310.716 202.600 1.00 0.00 ? 486  LEU A O     1 
ATOM   3597  C  CB    . LEU A  1  486  ? 226.618 312.464 201.035 1.00 0.00 ? 486  LEU A CB    1 
ATOM   3598  C  CG    . LEU A  1  486  ? 227.191 311.384 200.155 1.00 0.00 ? 486  LEU A CG    1 
ATOM   3599  C  CD1   . LEU A  1  486  ? 226.308 310.108 200.221 1.00 0.00 ? 486  LEU A CD1   1 
ATOM   3600  C  CD2   . LEU A  1  486  ? 227.576 311.890 198.770 1.00 0.00 ? 486  LEU A CD2   1 
ATOM   3601  N  N     . SER A  1  487  ? 228.647 312.838 203.375 1.00 0.00 ? 487  SER A N     1 
ATOM   3602  C  CA    . SER A  1  487  ? 230.052 312.938 203.788 1.00 0.00 ? 487  SER A CA    1 
ATOM   3603  C  C     . SER A  1  487  ? 230.510 312.023 204.954 1.00 0.00 ? 487  SER A C     1 
ATOM   3604  O  O     . SER A  1  487  ? 231.698 311.623 205.019 1.00 0.00 ? 487  SER A O     1 
ATOM   3605  C  CB    . SER A  1  487  ? 230.310 314.378 204.210 1.00 0.00 ? 487  SER A CB    1 
ATOM   3606  O  OG    . SER A  1  487  ? 231.659 314.547 204.541 1.00 0.00 ? 487  SER A OG    1 
ATOM   3607  N  N     . VAL A  1  488  ? 229.582 311.756 205.889 1.00 0.00 ? 488  VAL A N     1 
ATOM   3608  C  CA    . VAL A  1  488  ? 229.714 310.753 206.938 1.00 0.00 ? 488  VAL A CA    1 
ATOM   3609  C  C     . VAL A  1  488  ? 229.712 309.319 206.431 1.00 0.00 ? 488  VAL A C     1 
ATOM   3610  O  O     . VAL A  1  488  ? 229.752 308.391 207.213 1.00 0.00 ? 488  VAL A O     1 
ATOM   3611  C  CB    . VAL A  1  488  ? 228.627 310.920 207.911 1.00 0.00 ? 488  VAL A CB    1 
ATOM   3612  C  CG1   . VAL A  1  488  ? 229.168 310.534 209.257 1.00 0.00 ? 488  VAL A CG1   1 
ATOM   3613  C  CG2   . VAL A  1  488  ? 228.306 312.374 207.917 1.00 0.00 ? 488  VAL A CG2   1 
ATOM   3614  N  N     . THR A  1  489  ? 229.681 309.132 205.122 1.00 0.00 ? 489  THR A N     1 
ATOM   3615  C  CA    . THR A  1  489  ? 229.729 307.793 204.587 1.00 0.00 ? 489  THR A CA    1 
ATOM   3616  C  C     . THR A  1  489  ? 231.049 307.072 204.873 1.00 0.00 ? 489  THR A C     1 
ATOM   3617  O  O     . THR A  1  489  ? 231.005 305.889 205.136 1.00 0.00 ? 489  THR A O     1 
ATOM   3618  C  CB    . THR A  1  489  ? 229.434 307.784 203.092 1.00 0.00 ? 489  THR A CB    1 
ATOM   3619  O  OG1   . THR A  1  489  ? 229.263 306.431 202.664 1.00 0.00 ? 489  THR A OG1   1 
ATOM   3620  C  CG2   . THR A  1  489  ? 230.546 308.438 202.276 1.00 0.00 ? 489  THR A CG2   1 
ATOM   3621  N  N     . THR A  1  490  ? 232.206 307.744 204.809 1.00 0.00 ? 490  THR A N     1 
ATOM   3622  C  CA    . THR A  1  490  ? 233.497 307.028 204.920 1.00 0.00 ? 490  THR A CA    1 
ATOM   3623  C  C     . THR A  1  490  ? 233.944 306.696 206.340 1.00 0.00 ? 490  THR A C     1 
ATOM   3624  O  O     . THR A  1  490  ? 234.606 305.696 206.551 1.00 0.00 ? 490  THR A O     1 
ATOM   3625  C  CB    . THR A  1  490  ? 234.682 307.773 204.250 1.00 0.00 ? 490  THR A CB    1 
ATOM   3626  O  OG1   . THR A  1  490  ? 234.295 308.269 202.970 1.00 0.00 ? 490  THR A OG1   1 
ATOM   3627  C  CG2   . THR A  1  490  ? 235.853 306.819 204.037 1.00 0.00 ? 490  THR A CG2   1 
ATOM   3628  N  N     . PRO A  1  491  ? 233.636 307.553 207.315 1.00 0.00 ? 491  PRO A N     1 
ATOM   3629  C  CA    . PRO A  1  491  ? 233.871 307.088 208.688 1.00 0.00 ? 491  PRO A CA    1 
ATOM   3630  C  C     . PRO A  1  491  ? 233.044 305.857 209.131 1.00 0.00 ? 491  PRO A C     1 
ATOM   3631  O  O     . PRO A  1  491  ? 233.618 304.961 209.763 1.00 0.00 ? 491  PRO A O     1 
ATOM   3632  C  CB    . PRO A  1  491  ? 233.534 308.338 209.528 1.00 0.00 ? 491  PRO A CB    1 
ATOM   3633  C  CG    . PRO A  1  491  ? 232.808 309.225 208.627 1.00 0.00 ? 491  PRO A CG    1 
ATOM   3634  C  CD    . PRO A  1  491  ? 233.431 309.003 207.287 1.00 0.00 ? 491  PRO A CD    1 
ATOM   3635  N  N     . TYR A  1  492  ? 231.763 305.768 208.786 1.00 0.00 ? 492  TYR A N     1 
ATOM   3636  C  CA    . TYR A  1  492  ? 231.027 304.551 209.104 1.00 0.00 ? 492  TYR A CA    1 
ATOM   3637  C  C     . TYR A  1  492  ? 231.231 303.421 208.091 1.00 0.00 ? 492  TYR A C     1 
ATOM   3638  O  O     . TYR A  1  492  ? 230.645 302.374 208.255 1.00 0.00 ? 492  TYR A O     1 
ATOM   3639  C  CB    . TYR A  1  492  ? 229.525 304.807 209.191 1.00 0.00 ? 492  TYR A CB    1 
ATOM   3640  C  CG    . TYR A  1  492  ? 229.093 305.769 210.235 1.00 0.00 ? 492  TYR A CG    1 
ATOM   3641  C  CD1   . TYR A  1  492  ? 229.653 305.748 211.489 1.00 0.00 ? 492  TYR A CD1   1 
ATOM   3642  C  CD2   . TYR A  1  492  ? 228.093 306.686 209.966 1.00 0.00 ? 492  TYR A CD2   1 
ATOM   3643  C  CE1   . TYR A  1  492  ? 229.263 306.657 212.447 1.00 0.00 ? 492  TYR A CE1   1 
ATOM   3644  C  CE2   . TYR A  1  492  ? 227.690 307.598 210.900 1.00 0.00 ? 492  TYR A CE2   1 
ATOM   3645  C  CZ    . TYR A  1  492  ? 228.286 307.601 212.159 1.00 0.00 ? 492  TYR A CZ    1 
ATOM   3646  O  OH    . TYR A  1  492  ? 227.909 308.517 213.138 1.00 0.00 ? 492  TYR A OH    1 
ATOM   3647  N  N     . ASN A  1  493  ? 232.036 303.603 207.053 1.00 0.00 ? 493  ASN A N     1 
ATOM   3648  C  CA    . ASN A  1  493  ? 232.165 302.557 206.033 1.00 0.00 ? 493  ASN A CA    1 
ATOM   3649  C  C     . ASN A  1  493  ? 230.826 302.050 205.490 1.00 0.00 ? 493  ASN A C     1 
ATOM   3650  O  O     . ASN A  1  493  ? 230.670 300.873 205.124 1.00 0.00 ? 493  ASN A O     1 
ATOM   3651  C  CB    . ASN A  1  493  ? 232.957 301.391 206.595 1.00 0.00 ? 493  ASN A CB    1 
ATOM   3652  C  CG    . ASN A  1  493  ? 234.443 301.610 206.496 1.00 0.00 ? 493  ASN A CG    1 
ATOM   3653  O  OD1   . ASN A  1  493  ? 234.961 301.899 205.410 1.00 0.00 ? 493  ASN A OD1   1 
ATOM   3654  N  ND2   . ASN A  1  493  ? 235.150 301.481 207.629 1.00 0.00 ? 493  ASN A ND2   1 
ATOM   3655  N  N     . ALA A  1  494  ? 229.865 302.967 205.436 1.00 0.00 ? 494  ALA A N     1 
ATOM   3656  C  CA    . ALA A  1  494  ? 228.511 302.663 205.011 1.00 0.00 ? 494  ALA A CA    1 
ATOM   3657  C  C     . ALA A  1  494  ? 228.399 302.710 203.489 1.00 0.00 ? 494  ALA A C     1 
ATOM   3658  O  O     . ALA A  1  494  ? 229.162 303.421 202.828 1.00 0.00 ? 494  ALA A O     1 
ATOM   3659  C  CB    . ALA A  1  494  ? 227.540 303.654 205.639 1.00 0.00 ? 494  ALA A CB    1 
ATOM   3660  N  N     . ASP A  1  495  ? 227.435 301.967 202.946 1.00 0.00 ? 495  ASP A N     1 
ATOM   3661  C  CA    . ASP A  1  495  ? 226.994 302.137 201.564 1.00 0.00 ? 495  ASP A CA    1 
ATOM   3662  C  C     . ASP A  1  495  ? 225.511 302.061 201.586 1.00 0.00 ? 495  ASP A C     1 
ATOM   3663  O  O     . ASP A  1  495  ? 224.976 301.277 202.329 1.00 0.00 ? 495  ASP A O     1 
ATOM   3664  C  CB    . ASP A  1  495  ? 227.557 301.060 200.659 1.00 0.00 ? 495  ASP A CB    1 
ATOM   3665  C  CG    . ASP A  1  495  ? 229.059 301.180 200.495 1.00 0.00 ? 495  ASP A CG    1 
ATOM   3666  O  OD1   . ASP A  1  495  ? 229.522 302.359 200.438 1.00 0.00 ? 495  ASP A OD1   1 
ATOM   3667  O  OD2   . ASP A  1  495  ? 229.763 300.122 200.445 1.00 0.00 ? 495  ASP A OD2   1 
ATOM   3668  N  N     . PHE A  1  496  ? 224.824 302.853 200.789 1.00 0.00 ? 496  PHE A N     1 
ATOM   3669  C  CA    . PHE A  1  496  ? 223.390 302.767 200.822 1.00 0.00 ? 496  PHE A CA    1 
ATOM   3670  C  C     . PHE A  1  496  ? 222.979 301.744 199.818 1.00 0.00 ? 496  PHE A C     1 
ATOM   3671  O  O     . PHE A  1  496  ? 222.082 302.002 199.052 1.00 0.00 ? 496  PHE A O     1 
ATOM   3672  C  CB    . PHE A  1  496  ? 222.775 304.093 200.506 1.00 0.00 ? 496  PHE A CB    1 
ATOM   3673  C  CG    . PHE A  1  496  ? 223.445 305.183 201.173 1.00 0.00 ? 496  PHE A CG    1 
ATOM   3674  C  CD1   . PHE A  1  496  ? 223.394 305.289 202.526 1.00 0.00 ? 496  PHE A CD1   1 
ATOM   3675  C  CD2   . PHE A  1  496  ? 224.166 306.075 200.469 1.00 0.00 ? 496  PHE A CD2   1 
ATOM   3676  C  CE1   . PHE A  1  496  ? 224.032 306.273 203.166 1.00 0.00 ? 496  PHE A CE1   1 
ATOM   3677  C  CE2   . PHE A  1  496  ? 224.808 307.056 201.092 1.00 0.00 ? 496  PHE A CE2   1 
ATOM   3678  C  CZ    . PHE A  1  496  ? 224.743 307.157 202.447 1.00 0.00 ? 496  PHE A CZ    1 
ATOM   3679  N  N     . ASP A  1  497  ? 223.660 300.599 199.792 1.00 0.00 ? 497  ASP A N     1 
ATOM   3680  C  CA    . ASP A  1  497  ? 223.216 299.421 199.046 1.00 0.00 ? 497  ASP A CA    1 
ATOM   3681  C  C     . ASP A  1  497  ? 222.469 298.417 199.910 1.00 0.00 ? 497  ASP A C     1 
ATOM   3682  O  O     . ASP A  1  497  ? 222.440 297.240 199.574 1.00 0.00 ? 497  ASP A O     1 
ATOM   3683  C  CB    . ASP A  1  497  ? 224.408 298.713 198.395 1.00 0.00 ? 497  ASP A CB    1 
ATOM   3684  C  CG    . ASP A  1  497  ? 225.602 298.495 199.367 1.00 0.00 ? 497  ASP A CG    1 
ATOM   3685  O  OD1   . ASP A  1  497  ? 225.517 298.774 200.602 1.00 0.00 ? 497  ASP A OD1   1 
ATOM   3686  O  OD2   . ASP A  1  497  ? 226.662 298.043 198.856 1.00 0.00 ? 497  ASP A OD2   1 
ATOM   3687  N  N     . GLY A  1  498  ? 221.886 298.889 201.018 1.00 0.00 ? 498  GLY A N     1 
ATOM   3688  C  CA    . GLY A  1  498  ? 221.042 298.092 201.902 1.00 0.00 ? 498  GLY A CA    1 
ATOM   3689  C  C     . GLY A  1  498  ? 221.620 297.853 203.289 1.00 0.00 ? 498  GLY A C     1 
ATOM   3690  O  O     . GLY A  1  498  ? 221.120 297.041 204.062 1.00 0.00 ? 498  GLY A O     1 
ATOM   3691  N  N     . ASP A  1  499  ? 222.673 298.599 203.607 1.00 0.00 ? 499  ASP A N     1 
ATOM   3692  C  CA    . ASP A  1  499  ? 223.302 298.565 204.941 1.00 0.00 ? 499  ASP A CA    1 
ATOM   3693  C  C     . ASP A  1  499  ? 222.458 299.423 205.871 1.00 0.00 ? 499  ASP A C     1 
ATOM   3694  O  O     . ASP A  1  499  ? 222.191 300.590 205.573 1.00 0.00 ? 499  ASP A O     1 
ATOM   3695  C  CB    . ASP A  1  499  ? 224.767 299.079 204.915 1.00 0.00 ? 499  ASP A CB    1 
ATOM   3696  C  CG    . ASP A  1  499  ? 225.674 298.323 203.875 1.00 0.00 ? 499  ASP A CG    1 
ATOM   3697  O  OD1   . ASP A  1  499  ? 225.416 297.126 203.519 1.00 0.00 ? 499  ASP A OD1   1 
ATOM   3698  O  OD2   . ASP A  1  499  ? 226.639 298.985 203.390 1.00 0.00 ? 499  ASP A OD2   1 
ATOM   3699  N  N     . GLU A  1  500  ? 222.072 298.844 206.992 1.00 0.00 ? 500  GLU A N     1 
ATOM   3700  C  CA    . GLU A  1  500  ? 221.228 299.498 207.950 1.00 0.00 ? 500  GLU A CA    1 
ATOM   3701  C  C     . GLU A  1  500  ? 222.075 299.878 209.147 1.00 0.00 ? 500  GLU A C     1 
ATOM   3702  O  O     . GLU A  1  500  ? 222.916 299.096 209.578 1.00 0.00 ? 500  GLU A O     1 
ATOM   3703  C  CB    . GLU A  1  500  ? 220.058 298.582 208.189 1.00 0.00 ? 500  GLU A CB    1 
ATOM   3704  C  CG    . GLU A  1  500  ? 220.478 297.298 208.664 1.00 0.00 ? 500  GLU A CG    1 
ATOM   3705  C  CD    . GLU A  1  500  ? 219.360 296.287 208.581 1.00 0.00 ? 500  GLU A CD    1 
ATOM   3706  O  OE1   . GLU A  1  500  ? 218.611 296.084 209.569 1.00 0.00 ? 500  GLU A OE1   1 
ATOM   3707  O  OE2   . GLU A  1  500  ? 219.289 295.647 207.497 1.00 0.00 ? 500  GLU A OE2   1 
ATOM   3708  N  N     . MET A  1  501  ? 221.726 300.970 209.815 1.00 0.00 ? 501  MET A N     1 
ATOM   3709  C  CA    . MET A  1  501  ? 222.526 301.398 210.957 1.00 0.00 ? 501  MET A CA    1 
ATOM   3710  C  C     . MET A  1  501  ? 221.728 301.638 212.178 1.00 0.00 ? 501  MET A C     1 
ATOM   3711  O  O     . MET A  1  501  ? 220.609 302.070 212.093 1.00 0.00 ? 501  MET A O     1 
ATOM   3712  C  CB    . MET A  1  501  ? 223.244 302.715 210.684 1.00 0.00 ? 501  MET A CB    1 
ATOM   3713  C  CG    . MET A  1  501  ? 224.434 302.608 209.851 1.00 0.00 ? 501  MET A CG    1 
ATOM   3714  S  SD    . MET A  1  501  ? 225.311 304.171 209.717 1.00 0.00 ? 501  MET A SD    1 
ATOM   3715  C  CE    . MET A  1  501  ? 225.933 304.433 211.347 1.00 0.00 ? 501  MET A CE    1 
ATOM   3716  N  N     . ASN A  1  502  ? 222.425 301.704 213.288 1.00 0.00 ? 502  ASN A N     1 
ATOM   3717  C  CA    . ASN A  1  502  ? 221.799 301.680 214.554 1.00 0.00 ? 502  ASN A CA    1 
ATOM   3718  C  C     . ASN A  1  502  ? 221.868 302.872 215.378 1.00 0.00 ? 502  ASN A C     1 
ATOM   3719  O  O     . ASN A  1  502  ? 222.906 303.454 215.476 1.00 0.00 ? 502  ASN A O     1 
ATOM   3720  C  CB    . ASN A  1  502  ? 222.581 300.610 215.249 1.00 0.00 ? 502  ASN A CB    1 
ATOM   3721  C  CG    . ASN A  1  502  ? 221.798 299.866 216.154 1.00 0.00 ? 502  ASN A CG    1 
ATOM   3722  O  OD1   . ASN A  1  502  ? 220.795 300.374 216.605 1.00 0.00 ? 502  ASN A OD1   1 
ATOM   3723  N  ND2   . ASN A  1  502  ? 222.265 298.673 216.540 1.00 0.00 ? 502  ASN A ND2   1 
ATOM   3724  N  N     . LEU A  1  503  ? 220.771 303.214 216.028 1.00 0.00 ? 503  LEU A N     1 
ATOM   3725  C  CA    . LEU A  1  503  ? 220.745 304.409 216.838 1.00 0.00 ? 503  LEU A CA    1 
ATOM   3726  C  C     . LEU A  1  503  ? 220.406 304.107 218.287 1.00 0.00 ? 503  LEU A C     1 
ATOM   3727  O  O     . LEU A  1  503  ? 219.451 303.372 218.527 1.00 0.00 ? 503  LEU A O     1 
ATOM   3728  C  CB    . LEU A  1  503  ? 219.789 305.324 216.117 1.00 0.00 ? 503  LEU A CB    1 
ATOM   3729  C  CG    . LEU A  1  503  ? 219.208 306.677 216.392 1.00 0.00 ? 503  LEU A CG    1 
ATOM   3730  C  CD1   . LEU A  1  503  ? 218.886 307.331 215.084 1.00 0.00 ? 503  LEU A CD1   1 
ATOM   3731  C  CD2   . LEU A  1  503  ? 217.900 306.460 217.136 1.00 0.00 ? 503  LEU A CD2   1 
ATOM   3732  N  N     . HIS A  1  504  ? 221.050 304.801 219.248 1.00 0.00 ? 504  HIS A N     1 
ATOM   3733  C  CA    . HIS A  1  504  ? 220.710 304.680 220.685 1.00 0.00 ? 504  HIS A CA    1 
ATOM   3734  C  C     . HIS A  1  504  ? 220.457 306.014 221.326 1.00 0.00 ? 504  HIS A C     1 
ATOM   3735  O  O     . HIS A  1  504  ? 221.319 306.865 221.261 1.00 0.00 ? 504  HIS A O     1 
ATOM   3736  C  CB    . HIS A  1  504  ? 221.918 304.141 221.403 1.00 0.00 ? 504  HIS A CB    1 
ATOM   3737  C  CG    . HIS A  1  504  ? 222.324 302.817 220.890 1.00 0.00 ? 504  HIS A CG    1 
ATOM   3738  N  ND1   . HIS A  1  504  ? 221.784 301.623 221.294 1.00 0.00 ? 504  HIS A ND1   1 
ATOM   3739  C  CD2   . HIS A  1  504  ? 223.224 302.522 219.928 1.00 0.00 ? 504  HIS A CD2   1 
ATOM   3740  C  CE1   . HIS A  1  504  ? 222.332 300.644 220.594 1.00 0.00 ? 504  HIS A CE1   1 
ATOM   3741  N  NE2   . HIS A  1  504  ? 223.218 301.166 219.766 1.00 0.00 ? 504  HIS A NE2   1 
ATOM   3742  N  N     . LEU A  1  505  ? 219.377 306.190 222.061 1.00 0.00 ? 505  LEU A N     1 
ATOM   3743  C  CA    . LEU A  1  505  ? 219.108 307.492 222.665 1.00 0.00 ? 505  LEU A CA    1 
ATOM   3744  C  C     . LEU A  1  505  ? 219.535 307.631 224.152 1.00 0.00 ? 505  LEU A C     1 
ATOM   3745  O  O     . LEU A  1  505  ? 219.286 306.766 224.998 1.00 0.00 ? 505  LEU A O     1 
ATOM   3746  C  CB    . LEU A  1  505  ? 217.620 307.799 222.518 1.00 0.00 ? 505  LEU A CB    1 
ATOM   3747  C  CG    . LEU A  1  505  ? 216.948 308.992 223.208 1.00 0.00 ? 505  LEU A CG    1 
ATOM   3748  C  CD1   . LEU A  1  505  ? 217.271 310.384 222.616 1.00 0.00 ? 505  LEU A CD1   1 
ATOM   3749  C  CD2   . LEU A  1  505  ? 215.452 308.723 223.248 1.00 0.00 ? 505  LEU A CD2   1 
ATOM   3750  N  N     . PRO A  1  506  ? 220.242 308.710 224.468 1.00 0.00 ? 506  PRO A N     1 
ATOM   3751  C  CA    . PRO A  1  506  ? 220.486 309.022 225.877 1.00 0.00 ? 506  PRO A CA    1 
ATOM   3752  C  C     . PRO A  1  506  ? 219.209 309.357 226.671 1.00 0.00 ? 506  PRO A C     1 
ATOM   3753  O  O     . PRO A  1  506  ? 218.265 309.901 226.126 1.00 0.00 ? 506  PRO A O     1 
ATOM   3754  C  CB    . PRO A  1  506  ? 221.437 310.217 225.789 1.00 0.00 ? 506  PRO A CB    1 
ATOM   3755  C  CG    . PRO A  1  506  ? 221.374 310.678 224.355 1.00 0.00 ? 506  PRO A CG    1 
ATOM   3756  C  CD    . PRO A  1  506  ? 221.117 309.473 223.573 1.00 0.00 ? 506  PRO A CD    1 
ATOM   3757  N  N     . GLN A  1  507  ? 219.189 309.063 227.962 1.00 0.00 ? 507  GLN A N     1 
ATOM   3758  C  CA    . GLN A  1  507  ? 217.972 309.276 228.717 1.00 0.00 ? 507  GLN A CA    1 
ATOM   3759  C  C     . GLN A  1  507  ? 218.080 310.349 229.825 1.00 0.00 ? 507  GLN A C     1 
ATOM   3760  O  O     . GLN A  1  507  ? 217.096 310.592 230.527 1.00 0.00 ? 507  GLN A O     1 
ATOM   3761  C  CB    . GLN A  1  507  ? 217.537 307.944 229.308 1.00 0.00 ? 507  GLN A CB    1 
ATOM   3762  C  CG    . GLN A  1  507  ? 217.305 306.864 228.245 1.00 0.00 ? 507  GLN A CG    1 
ATOM   3763  C  CD    . GLN A  1  507  ? 216.189 307.207 227.266 1.00 0.00 ? 507  GLN A CD    1 
ATOM   3764  O  OE1   . GLN A  1  507  ? 215.018 307.290 227.620 1.00 0.00 ? 507  GLN A OE1   1 
ATOM   3765  N  NE2   . GLN A  1  507  ? 216.553 307.380 226.015 1.00 0.00 ? 507  GLN A NE2   1 
ATOM   3766  N  N     . SER A  1  508  ? 219.236 311.008 229.976 1.00 0.00 ? 508  SER A N     1 
ATOM   3767  C  CA    . SER A  1  508  ? 219.310 312.176 230.885 1.00 0.00 ? 508  SER A CA    1 
ATOM   3768  C  C     . SER A  1  508  ? 220.102 313.343 230.287 1.00 0.00 ? 508  SER A C     1 
ATOM   3769  O  O     . SER A  1  508  ? 220.734 313.239 229.223 1.00 0.00 ? 508  SER A O     1 
ATOM   3770  C  CB    . SER A  1  508  ? 219.937 311.828 232.241 1.00 0.00 ? 508  SER A CB    1 
ATOM   3771  O  OG    . SER A  1  508  ? 221.331 312.085 232.244 1.00 0.00 ? 508  SER A OG    1 
ATOM   3772  N  N     . LEU A  1  509  ? 220.014 314.480 230.961 1.00 0.00 ? 509  LEU A N     1 
ATOM   3773  C  CA    . LEU A  1  509  ? 220.834 315.618 230.612 1.00 0.00 ? 509  LEU A CA    1 
ATOM   3774  C  C     . LEU A  1  509  ? 222.285 315.335 230.846 1.00 0.00 ? 509  LEU A C     1 
ATOM   3775  O  O     . LEU A  1  509  ? 223.125 315.734 230.047 1.00 0.00 ? 509  LEU A O     1 
ATOM   3776  C  CB    . LEU A  1  509  ? 220.445 316.852 231.417 1.00 0.00 ? 509  LEU A CB    1 
ATOM   3777  C  CG    . LEU A  1  509  ? 219.113 317.501 231.102 1.00 0.00 ? 509  LEU A CG    1 
ATOM   3778  C  CD1   . LEU A  1  509  ? 218.760 318.483 232.188 1.00 0.00 ? 509  LEU A CD1   1 
ATOM   3779  C  CD2   . LEU A  1  509  ? 219.239 318.180 229.740 1.00 0.00 ? 509  LEU A CD2   1 
ATOM   3780  N  N     . GLU A  1  510  ? 222.563 314.475 231.811 1.00 0.00 ? 510  GLU A N     1 
ATOM   3781  C  CA    . GLU A  1  510  ? 223.942 314.161 232.111 1.00 0.00 ? 510  GLU A CA    1 
ATOM   3782  C  C     . GLU A  1  510  ? 224.694 313.432 230.998 1.00 0.00 ? 510  GLU A C     1 
ATOM   3783  O  O     . GLU A  1  510  ? 225.830 313.825 230.690 1.00 0.00 ? 510  GLU A O     1 
ATOM   3784  C  CB    . GLU A  1  510  ? 223.944 313.304 233.337 1.00 0.00 ? 510  GLU A CB    1 
ATOM   3785  C  CG    . GLU A  1  510  ? 225.277 312.990 233.850 1.00 0.00 ? 510  GLU A CG    1 
ATOM   3786  C  CD    . GLU A  1  510  ? 225.154 311.916 234.906 1.00 0.00 ? 510  GLU A CD    1 
ATOM   3787  O  OE1   . GLU A  1  510  ? 224.215 311.100 234.719 1.00 0.00 ? 510  GLU A OE1   1 
ATOM   3788  O  OE2   . GLU A  1  510  ? 225.935 311.888 235.905 1.00 0.00 ? 510  GLU A OE2   1 
ATOM   3789  N  N     . THR A  1  511  ? 224.098 312.387 230.416 1.00 0.00 ? 511  THR A N     1 
ATOM   3790  C  CA    . THR A  1  511  ? 224.681 311.671 229.266 1.00 0.00 ? 511  THR A CA    1 
ATOM   3791  C  C     . THR A  1  511  ? 224.573 312.508 227.989 1.00 0.00 ? 511  THR A C     1 
ATOM   3792  O  O     . THR A  1  511  ? 225.398 312.380 227.109 1.00 0.00 ? 511  THR A O     1 
ATOM   3793  C  CB    . THR A  1  511  ? 224.047 310.318 229.016 1.00 0.00 ? 511  THR A CB    1 
ATOM   3794  O  OG1   . THR A  1  511  ? 222.650 310.483 228.789 1.00 0.00 ? 511  THR A OG1   1 
ATOM   3795  C  CG2   . THR A  1  511  ? 224.290 309.429 230.209 1.00 0.00 ? 511  THR A CG2   1 
ATOM   3796  N  N     . ARG A  1  512  ? 223.523 313.316 227.867 1.00 0.00 ? 512  ARG A N     1 
ATOM   3797  C  CA    . ARG A  1  512  ? 223.414 314.240 226.745 1.00 0.00 ? 512  ARG A CA    1 
ATOM   3798  C  C     . ARG A  1  512  ? 224.513 315.281 226.729 1.00 0.00 ? 512  ARG A C     1 
ATOM   3799  O  O     . ARG A  1  512  ? 224.950 315.685 225.658 1.00 0.00 ? 512  ARG A O     1 
ATOM   3800  C  CB    . ARG A  1  512  ? 222.112 315.014 226.769 1.00 0.00 ? 512  ARG A CB    1 
ATOM   3801  C  CG    . ARG A  1  512  ? 221.901 315.822 225.492 1.00 0.00 ? 512  ARG A CG    1 
ATOM   3802  C  CD    . ARG A  1  512  ? 220.650 316.612 225.611 1.00 0.00 ? 512  ARG A CD    1 
ATOM   3803  N  NE    . ARG A  1  512  ? 219.433 315.842 225.706 1.00 0.00 ? 512  ARG A NE    1 
ATOM   3804  C  CZ    . ARG A  1  512  ? 218.336 316.158 225.040 1.00 0.00 ? 512  ARG A CZ    1 
ATOM   3805  N  NH1   . ARG A  1  512  ? 218.322 317.255 224.274 1.00 0.00 ? 512  ARG A NH1   1 
ATOM   3806  N  NH2   . ARG A  1  512  ? 217.260 315.375 225.139 1.00 0.00 ? 512  ARG A NH2   1 
ATOM   3807  N  N     . ALA A  1  513  ? 224.919 315.744 227.908 1.00 0.00 ? 513  ALA A N     1 
ATOM   3808  C  CA    . ALA A  1  513  ? 226.042 316.674 228.035 1.00 0.00 ? 513  ALA A CA    1 
ATOM   3809  C  C     . ALA A  1  513  ? 227.358 316.036 227.622 1.00 0.00 ? 513  ALA A C     1 
ATOM   3810  O  O     . ALA A  1  513  ? 228.208 316.710 227.027 1.00 0.00 ? 513  ALA A O     1 
ATOM   3811  C  CB    . ALA A  1  513  ? 226.132 317.171 229.404 1.00 0.00 ? 513  ALA A CB    1 
ATOM   3812  N  N     . GLU A  1  514  ? 227.563 314.802 228.090 1.00 0.00 ? 514  GLU A N     1 
ATOM   3813  C  CA    . GLU A  1  514  ? 228.758 314.007 227.853 1.00 0.00 ? 514  GLU A CA    1 
ATOM   3814  C  C     . GLU A  1  514  ? 228.916 313.649 226.402 1.00 0.00 ? 514  GLU A C     1 
ATOM   3815  O  O     . GLU A  1  514  ? 230.005 313.705 225.878 1.00 0.00 ? 514  GLU A O     1 
ATOM   3816  C  CB    . GLU A  1  514  ? 228.662 312.692 228.616 1.00 0.00 ? 514  GLU A CB    1 
ATOM   3817  C  CG    . GLU A  1  514  ? 229.912 311.852 228.626 1.00 0.00 ? 514  GLU A CG    1 
ATOM   3818  C  CD    . GLU A  1  514  ? 229.770 310.581 229.494 1.00 0.00 ? 514  GLU A CD    1 
ATOM   3819  O  OE1   . GLU A  1  514  ? 229.218 309.610 228.963 1.00 0.00 ? 514  GLU A OE1   1 
ATOM   3820  O  OE2   . GLU A  1  514  ? 230.203 310.507 230.677 1.00 0.00 ? 514  GLU A OE2   1 
ATOM   3821  N  N     . ILE A  1  515  ? 227.812 313.314 225.743 1.00 0.00 ? 515  ILE A N     1 
ATOM   3822  C  CA    . ILE A  1  515  ? 227.806 313.073 224.316 1.00 0.00 ? 515  ILE A CA    1 
ATOM   3823  C  C     . ILE A  1  515  ? 228.077 314.311 223.516 1.00 0.00 ? 515  ILE A C     1 
ATOM   3824  O  O     . ILE A  1  515  ? 228.893 314.286 222.646 1.00 0.00 ? 515  ILE A O     1 
ATOM   3825  C  CB    . ILE A  1  515  ? 226.520 312.468 223.836 1.00 0.00 ? 515  ILE A CB    1 
ATOM   3826  C  CG1   . ILE A  1  515  ? 226.471 311.001 224.230 1.00 0.00 ? 515  ILE A CG1   1 
ATOM   3827  C  CG2   . ILE A  1  515  ? 226.474 312.504 222.353 1.00 0.00 ? 515  ILE A CG2   1 
ATOM   3828  C  CD1   . ILE A  1  515  ? 225.064 310.382 224.172 1.00 0.00 ? 515  ILE A CD1   1 
ATOM   3829  N  N     . GLN A  1  516  ? 227.421 315.403 223.836 1.00 0.00 ? 516  GLN A N     1 
ATOM   3830  C  CA    . GLN A  1  516  ? 227.592 316.620 223.086 1.00 0.00 ? 516  GLN A CA    1 
ATOM   3831  C  C     . GLN A  1  516  ? 229.016 317.068 223.105 1.00 0.00 ? 516  GLN A C     1 
ATOM   3832  O  O     . GLN A  1  516  ? 229.467 317.651 222.155 1.00 0.00 ? 516  GLN A O     1 
ATOM   3833  C  CB    . GLN A  1  516  ? 226.690 317.694 223.614 1.00 0.00 ? 516  GLN A CB    1 
ATOM   3834  C  CG    . GLN A  1  516  ? 226.721 318.915 222.779 1.00 0.00 ? 516  GLN A CG    1 
ATOM   3835  C  CD    . GLN A  1  516  ? 225.876 320.016 223.382 1.00 0.00 ? 516  GLN A CD    1 
ATOM   3836  O  OE1   . GLN A  1  516  ? 225.022 319.745 224.252 1.00 0.00 ? 516  GLN A OE1   1 
ATOM   3837  N  NE2   . GLN A  1  516  ? 226.095 321.276 222.926 1.00 0.00 ? 516  GLN A NE2   1 
ATOM   3838  N  N     . GLU A  1  517  ? 229.676 316.942 224.233 1.00 0.00 ? 517  GLU A N     1 
ATOM   3839  C  CA    . GLU A  1  517  ? 231.063 317.357 224.322 1.00 0.00 ? 517  GLU A CA    1 
ATOM   3840  C  C     . GLU A  1  517  ? 232.069 316.344 223.810 1.00 0.00 ? 517  GLU A C     1 
ATOM   3841  O  O     . GLU A  1  517  ? 232.981 316.711 223.102 1.00 0.00 ? 517  GLU A O     1 
ATOM   3842  C  CB    . GLU A  1  517  ? 231.360 317.799 225.740 1.00 0.00 ? 517  GLU A CB    1 
ATOM   3843  C  CG    . GLU A  1  517  ? 230.357 318.927 226.023 1.00 0.00 ? 517  GLU A CG    1 
ATOM   3844  C  CD    . GLU A  1  517  ? 230.265 319.924 224.814 1.00 0.00 ? 517  GLU A CD    1 
ATOM   3845  O  OE1   . GLU A  1  517  ? 231.297 320.537 224.441 1.00 0.00 ? 517  GLU A OE1   1 
ATOM   3846  O  OE2   . GLU A  1  517  ? 229.159 320.052 224.211 1.00 0.00 ? 517  GLU A OE2   1 
ATOM   3847  N  N     . LEU A  1  518  ? 231.919 315.073 224.125 1.00 0.00 ? 518  LEU A N     1 
ATOM   3848  C  CA    . LEU A  1  518  ? 232.949 314.159 223.677 1.00 0.00 ? 518  LEU A CA    1 
ATOM   3849  C  C     . LEU A  1  518  ? 232.560 313.595 222.339 1.00 0.00 ? 518  LEU A C     1 
ATOM   3850  O  O     . LEU A  1  518  ? 233.006 314.099 221.303 1.00 0.00 ? 518  LEU A O     1 
ATOM   3851  C  CB    . LEU A  1  518  ? 233.156 313.006 224.649 1.00 0.00 ? 518  LEU A CB    1 
ATOM   3852  C  CG    . LEU A  1  518  ? 233.387 313.407 226.090 1.00 0.00 ? 518  LEU A CG    1 
ATOM   3853  C  CD1   . LEU A  1  518  ? 233.586 312.149 226.902 1.00 0.00 ? 518  LEU A CD1   1 
ATOM   3854  C  CD2   . LEU A  1  518  ? 234.557 314.361 226.227 1.00 0.00 ? 518  LEU A CD2   1 
ATOM   3855  N  N     . ALA A  1  519  ? 231.690 312.602 222.322 1.00 0.00 ? 519  ALA A N     1 
ATOM   3856  C  CA    . ALA A  1  519  ? 231.382 311.954 221.055 1.00 0.00 ? 519  ALA A CA    1 
ATOM   3857  C  C     . ALA A  1  519  ? 230.464 312.690 220.051 1.00 0.00 ? 519  ALA A C     1 
ATOM   3858  O  O     . ALA A  1  519  ? 229.714 312.034 219.371 1.00 0.00 ? 519  ALA A O     1 
ATOM   3859  C  CB    . ALA A  1  519  ? 230.786 310.587 221.353 1.00 0.00 ? 519  ALA A CB    1 
ATOM   3860  N  N     . MET A  1  520  ? 230.481 314.002 219.890 1.00 0.00 ? 520  MET A N     1 
ATOM   3861  C  CA    . MET A  1  520  ? 229.545 314.539 218.897 1.00 0.00 ? 520  MET A CA    1 
ATOM   3862  C  C     . MET A  1  520  ? 230.294 314.572 217.585 1.00 0.00 ? 520  MET A C     1 
ATOM   3863  O  O     . MET A  1  520  ? 231.465 314.843 217.654 1.00 0.00 ? 520  MET A O     1 
ATOM   3864  C  CB    . MET A  1  520  ? 229.013 315.910 219.302 1.00 0.00 ? 520  MET A CB    1 
ATOM   3865  C  CG    . MET A  1  520  ? 227.777 316.354 218.464 1.00 0.00 ? 520  MET A CG    1 
ATOM   3866  S  SD    . MET A  1  520  ? 226.253 315.422 218.812 1.00 0.00 ? 520  MET A SD    1 
ATOM   3867  C  CE    . MET A  1  520  ? 225.786 316.328 220.265 1.00 0.00 ? 520  MET A CE    1 
ATOM   3868  N  N     . VAL A  1  521  ? 229.666 314.301 216.423 1.00 0.00 ? 521  VAL A N     1 
ATOM   3869  C  CA    . VAL A  1  521  ? 230.393 314.186 215.123 1.00 0.00 ? 521  VAL A CA    1 
ATOM   3870  C  C     . VAL A  1  521  ? 231.373 315.309 214.742 1.00 0.00 ? 521  VAL A C     1 
ATOM   3871  O  O     . VAL A  1  521  ? 232.502 315.002 214.423 1.00 0.00 ? 521  VAL A O     1 
ATOM   3872  C  CB    . VAL A  1  521  ? 229.469 314.099 213.851 1.00 0.00 ? 521  VAL A CB    1 
ATOM   3873  C  CG1   . VAL A  1  521  ? 230.307 313.919 212.602 1.00 0.00 ? 521  VAL A CG1   1 
ATOM   3874  C  CG2   . VAL A  1  521  ? 228.477 313.001 213.884 1.00 0.00 ? 521  VAL A CG2   1 
ATOM   3875  N  N     . PRO A  1  522  ? 230.963 316.594 214.730 1.00 0.00 ? 522  PRO A N     1 
ATOM   3876  C  CA    . PRO A  1  522  ? 231.909 317.614 214.290 1.00 0.00 ? 522  PRO A CA    1 
ATOM   3877  C  C     . PRO A  1  522  ? 233.246 317.638 214.975 1.00 0.00 ? 522  PRO A C     1 
ATOM   3878  O  O     . PRO A  1  522  ? 234.183 318.181 214.408 1.00 0.00 ? 522  PRO A O     1 
ATOM   3879  C  CB    . PRO A  1  522  ? 231.168 318.877 214.604 1.00 0.00 ? 522  PRO A CB    1 
ATOM   3880  C  CG    . PRO A  1  522  ? 229.813 318.499 214.373 1.00 0.00 ? 522  PRO A CG    1 
ATOM   3881  C  CD    . PRO A  1  522  ? 229.651 317.209 214.964 1.00 0.00 ? 522  PRO A CD    1 
ATOM   3882  N  N     . ARG A  1  523  ? 233.305 317.113 216.195 1.00 0.00 ? 523  ARG A N     1 
ATOM   3883  C  CA    . ARG A  1  523  ? 234.548 316.982 216.962 1.00 0.00 ? 523  ARG A CA    1 
ATOM   3884  C  C     . ARG A  1  523  ? 235.365 315.810 216.509 1.00 0.00 ? 523  ARG A C     1 
ATOM   3885  O  O     . ARG A  1  523  ? 236.593 315.846 216.539 1.00 0.00 ? 523  ARG A O     1 
ATOM   3886  C  CB    . ARG A  1  523  ? 234.257 316.854 218.451 1.00 0.00 ? 523  ARG A CB    1 
ATOM   3887  C  CG    . ARG A  1  523  ? 233.741 318.148 219.033 1.00 0.00 ? 523  ARG A CG    1 
ATOM   3888  C  CD    . ARG A  1  523  ? 233.312 317.925 220.432 1.00 0.00 ? 523  ARG A CD    1 
ATOM   3889  N  NE    . ARG A  1  523  ? 232.499 319.020 220.936 1.00 0.00 ? 523  ARG A NE    1 
ATOM   3890  C  CZ    . ARG A  1  523  ? 232.980 320.096 221.536 1.00 0.00 ? 523  ARG A CZ    1 
ATOM   3891  N  NH1   . ARG A  1  523  ? 234.293 320.219 221.718 1.00 0.00 ? 523  ARG A NH1   1 
ATOM   3892  N  NH2   . ARG A  1  523  ? 232.140 321.031 221.971 1.00 0.00 ? 523  ARG A NH2   1 
ATOM   3893  N  N     . MET A  1  524  ? 234.647 314.774 216.098 1.00 0.00 ? 524  MET A N     1 
ATOM   3894  C  CA    . MET A  1  524  ? 235.196 313.641 215.380 1.00 0.00 ? 524  MET A CA    1 
ATOM   3895  C  C     . MET A  1  524  ? 235.528 314.032 213.956 1.00 0.00 ? 524  MET A C     1 
ATOM   3896  O  O     . MET A  1  524  ? 234.925 313.517 213.042 1.00 0.00 ? 524  MET A O     1 
ATOM   3897  C  CB    . MET A  1  524  ? 234.195 312.459 215.380 1.00 0.00 ? 524  MET A CB    1 
ATOM   3898  C  CG    . MET A  1  524  ? 234.111 311.743 216.686 1.00 0.00 ? 524  MET A CG    1 
ATOM   3899  S  SD    . MET A  1  524  ? 235.471 312.513 217.565 1.00 0.00 ? 524  MET A SD    1 
ATOM   3900  C  CE    . MET A  1  524  ? 235.396 311.855 219.220 1.00 0.00 ? 524  MET A CE    1 
ATOM   3901  N  N     . ILE A  1  525  ? 236.443 314.948 213.705 1.00 0.00 ? 525  ILE A N     1 
ATOM   3902  C  CA    . ILE A  1  525  ? 236.820 315.062 212.314 1.00 0.00 ? 525  ILE A CA    1 
ATOM   3903  C  C     . ILE A  1  525  ? 238.205 314.517 212.138 1.00 0.00 ? 525  ILE A C     1 
ATOM   3904  O  O     . ILE A  1  525  ? 238.425 313.684 211.282 1.00 0.00 ? 525  ILE A O     1 
ATOM   3905  C  CB    . ILE A  1  525  ? 236.786 316.465 211.769 1.00 0.00 ? 525  ILE A CB    1 
ATOM   3906  C  CG1   . ILE A  1  525  ? 235.368 317.009 211.737 1.00 0.00 ? 525  ILE A CG1   1 
ATOM   3907  C  CG2   . ILE A  1  525  ? 237.253 316.439 210.336 1.00 0.00 ? 525  ILE A CG2   1 
ATOM   3908  C  CD1   . ILE A  1  525  ? 235.221 318.307 210.888 1.00 0.00 ? 525  ILE A CD1   1 
ATOM   3909  N  N     . VAL A  1  526  ? 239.152 314.979 212.933 1.00 0.00 ? 526  VAL A N     1 
ATOM   3910  C  CA    . VAL A  1  526  ? 240.519 314.548 212.732 1.00 0.00 ? 526  VAL A CA    1 
ATOM   3911  C  C     . VAL A  1  526  ? 240.947 313.454 213.683 1.00 0.00 ? 526  VAL A C     1 
ATOM   3912  O  O     . VAL A  1  526  ? 241.194 313.701 214.857 1.00 0.00 ? 526  VAL A O     1 
ATOM   3913  C  CB    . VAL A  1  526  ? 241.434 315.721 212.863 1.00 0.00 ? 526  VAL A CB    1 
ATOM   3914  C  CG1   . VAL A  1  526  ? 242.852 315.300 212.605 1.00 0.00 ? 526  VAL A CG1   1 
ATOM   3915  C  CG2   . VAL A  1  526  ? 241.005 316.738 211.848 1.00 0.00 ? 526  VAL A CG2   1 
ATOM   3916  N  N     . THR A  1  527  ? 241.070 312.248 213.153 1.00 0.00 ? 527  THR A N     1 
ATOM   3917  C  CA    . THR A  1  527  ? 241.350 311.067 213.943 1.00 0.00 ? 527  THR A CA    1 
ATOM   3918  C  C     . THR A  1  527  ? 242.775 310.968 214.500 1.00 0.00 ? 527  THR A C     1 
ATOM   3919  O  O     . THR A  1  527  ? 243.741 311.112 213.758 1.00 0.00 ? 527  THR A O     1 
ATOM   3920  C  CB    . THR A  1  527  ? 241.067 309.834 213.082 1.00 0.00 ? 527  THR A CB    1 
ATOM   3921  O  OG1   . THR A  1  527  ? 241.444 308.643 213.779 1.00 0.00 ? 527  THR A OG1   1 
ATOM   3922  C  CG2   . THR A  1  527  ? 241.811 309.933 211.751 1.00 0.00 ? 527  THR A CG2   1 
ATOM   3923  N  N     . PRO A  1  528  ? 242.904 310.648 215.805 1.00 0.00 ? 528  PRO A N     1 
ATOM   3924  C  CA    . PRO A  1  528  ? 244.157 310.472 216.548 1.00 0.00 ? 528  PRO A CA    1 
ATOM   3925  C  C     . PRO A  1  528  ? 244.911 309.201 216.164 1.00 0.00 ? 528  PRO A C     1 
ATOM   3926  O  O     . PRO A  1  528  ? 245.944 308.870 216.759 1.00 0.00 ? 528  PRO A O     1 
ATOM   3927  C  CB    . PRO A  1  528  ? 243.683 310.361 217.988 1.00 0.00 ? 528  PRO A CB    1 
ATOM   3928  C  CG    . PRO A  1  528  ? 242.380 309.704 217.870 1.00 0.00 ? 528  PRO A CG    1 
ATOM   3929  C  CD    . PRO A  1  528  ? 241.747 310.304 216.650 1.00 0.00 ? 528  PRO A CD    1 
ATOM   3930  N  N     . GLN A  1  529  ? 244.354 308.445 215.234 1.00 0.00 ? 529  GLN A N     1 
ATOM   3931  C  CA    . GLN A  1  529  ? 245.079 307.316 214.713 1.00 0.00 ? 529  GLN A CA    1 
ATOM   3932  C  C     . GLN A  1  529  ? 246.243 307.713 213.832 1.00 0.00 ? 529  GLN A C     1 
ATOM   3933  O  O     . GLN A  1  529  ? 247.342 307.169 213.934 1.00 0.00 ? 529  GLN A O     1 
ATOM   3934  C  CB    . GLN A  1  529  ? 244.197 306.445 213.914 1.00 0.00 ? 529  GLN A CB    1 
ATOM   3935  C  CG    . GLN A  1  529  ? 245.049 305.475 213.272 1.00 0.00 ? 529  GLN A CG    1 
ATOM   3936  C  CD    . GLN A  1  529  ? 244.244 304.529 212.527 1.00 0.00 ? 529  GLN A CD    1 
ATOM   3937  O  OE1   . GLN A  1  529  ? 244.636 303.358 212.366 1.00 0.00 ? 529  GLN A OE1   1 
ATOM   3938  N  NE2   . GLN A  1  529  ? 243.058 304.999 212.054 1.00 0.00 ? 529  GLN A NE2   1 
ATOM   3939  N  N     . SER A  1  530  ? 245.974 308.646 212.931 1.00 0.00 ? 530  SER A N     1 
ATOM   3940  C  CA    . SER A  1  530  ? 247.019 309.208 212.095 1.00 0.00 ? 530  SER A CA    1 
ATOM   3941  C  C     . SER A  1  530  ? 246.694 310.655 211.803 1.00 0.00 ? 530  SER A C     1 
ATOM   3942  O  O     . SER A  1  530  ? 246.552 311.016 210.648 1.00 0.00 ? 530  SER A O     1 
ATOM   3943  C  CB    . SER A  1  530  ? 247.178 308.432 210.779 1.00 0.00 ? 530  SER A CB    1 
ATOM   3944  O  OG    . SER A  1  530  ? 245.936 308.235 210.107 1.00 0.00 ? 530  SER A OG    1 
ATOM   3945  N  N     . ASN A  1  531  ? 246.537 311.460 212.851 1.00 0.00 ? 531  ASN A N     1 
ATOM   3946  C  CA    . ASN A  1  531  ? 246.373 312.913 212.742 1.00 0.00 ? 531  ASN A CA    1 
ATOM   3947  C  C     . ASN A  1  531  ? 245.992 313.516 211.379 1.00 0.00 ? 531  ASN A C     1 
ATOM   3948  O  O     . ASN A  1  531  ? 246.645 314.439 210.900 1.00 0.00 ? 531  ASN A O     1 
ATOM   3949  C  CB    . ASN A  1  531  ? 247.671 313.565 213.197 1.00 0.00 ? 531  ASN A CB    1 
ATOM   3950  C  CG    . ASN A  1  531  ? 248.848 313.208 212.298 1.00 0.00 ? 531  ASN A CG    1 
ATOM   3951  O  OD1   . ASN A  1  531  ? 249.127 312.032 212.063 1.00 0.00 ? 531  ASN A OD1   1 
ATOM   3952  N  ND2   . ASN A  1  531  ? 249.537 314.230 211.779 1.00 0.00 ? 531  ASN A ND2   1 
ATOM   3953  N  N     . ARG A  1  532  ? 244.947 312.984 210.756 1.00 0.00 ? 532  ARG A N     1 
ATOM   3954  C  CA    . ARG A  1  532  ? 244.471 313.445 209.454 1.00 0.00 ? 532  ARG A CA    1 
ATOM   3955  C  C     . ARG A  1  532  ? 242.969 313.510 209.569 1.00 0.00 ? 532  ARG A C     1 
ATOM   3956  O  O     . ARG A  1  532  ? 242.467 313.054 210.572 1.00 0.00 ? 532  ARG A O     1 
ATOM   3957  C  CB    . ARG A  1  532  ? 244.881 312.487 208.359 1.00 0.00 ? 532  ARG A CB    1 
ATOM   3958  C  CG    . ARG A  1  532  ? 244.407 311.090 208.560 1.00 0.00 ? 532  ARG A CG    1 
ATOM   3959  C  CD    . ARG A  1  532  ? 245.079 310.272 207.500 1.00 0.00 ? 532  ARG A CD    1 
ATOM   3960  N  NE    . ARG A  1  532  ? 244.947 308.812 207.611 1.00 0.00 ? 532  ARG A NE    1 
ATOM   3961  C  CZ    . ARG A  1  532  ? 243.992 308.076 207.034 1.00 0.00 ? 532  ARG A CZ    1 
ATOM   3962  N  NH1   . ARG A  1  532  ? 243.029 308.678 206.325 1.00 0.00 ? 532  ARG A NH1   1 
ATOM   3963  N  NH2   . ARG A  1  532  ? 243.991 306.742 207.189 1.00 0.00 ? 532  ARG A NH2   1 
ATOM   3964  N  N     . PRO A  1  533  ? 242.246 314.068 208.569 1.00 0.00 ? 533  PRO A N     1 
ATOM   3965  C  CA    . PRO A  1  533  ? 240.761 314.060 208.541 1.00 0.00 ? 533  PRO A CA    1 
ATOM   3966  C  C     . PRO A  1  533  ? 240.118 312.668 208.495 1.00 0.00 ? 533  PRO A C     1 
ATOM   3967  O  O     . PRO A  1  533  ? 240.510 311.835 207.694 1.00 0.00 ? 533  PRO A O     1 
ATOM   3968  C  CB    . PRO A  1  533  ? 240.437 314.808 207.246 1.00 0.00 ? 533  PRO A CB    1 
ATOM   3969  C  CG    . PRO A  1  533  ? 241.624 315.591 206.972 1.00 0.00 ? 533  PRO A CG    1 
ATOM   3970  C  CD    . PRO A  1  533  ? 242.801 314.868 207.465 1.00 0.00 ? 533  PRO A CD    1 
ATOM   3971  N  N     . VAL A  1  534  ? 239.140 312.369 209.317 1.00 0.00 ? 534  VAL A N     1 
ATOM   3972  C  CA    . VAL A  1  534  ? 238.567 311.072 209.117 1.00 0.00 ? 534  VAL A CA    1 
ATOM   3973  C  C     . VAL A  1  534  ? 237.617 311.216 207.965 1.00 0.00 ? 534  VAL A C     1 
ATOM   3974  O  O     . VAL A  1  534  ? 237.382 310.244 207.284 1.00 0.00 ? 534  VAL A O     1 
ATOM   3975  C  CB    . VAL A  1  534  ? 237.847 310.518 210.359 1.00 0.00 ? 534  VAL A CB    1 
ATOM   3976  C  CG1   . VAL A  1  534  ? 236.367 310.913 210.397 1.00 0.00 ? 534  VAL A CG1   1 
ATOM   3977  C  CG2   . VAL A  1  534  ? 237.962 309.015 210.392 1.00 0.00 ? 534  VAL A CG2   1 
ATOM   3978  N  N     . MET A  1  535  ? 237.116 312.424 207.688 1.00 0.00 ? 535  MET A N     1 
ATOM   3979  C  CA    . MET A  1  535  ? 236.071 312.544 206.652 1.00 0.00 ? 535  MET A CA    1 
ATOM   3980  C  C     . MET A  1  535  ? 236.192 313.729 205.715 1.00 0.00 ? 535  MET A C     1 
ATOM   3981  O  O     . MET A  1  535  ? 236.360 314.833 206.160 1.00 0.00 ? 535  MET A O     1 
ATOM   3982  C  CB    . MET A  1  535  ? 234.693 312.613 207.305 1.00 0.00 ? 535  MET A CB    1 
ATOM   3983  C  CG    . MET A  1  535  ? 234.476 313.820 208.182 1.00 0.00 ? 535  MET A CG    1 
ATOM   3984  S  SD    . MET A  1  535  ? 232.888 313.769 209.009 1.00 0.00 ? 535  MET A SD    1 
ATOM   3985  C  CE    . MET A  1  535  ? 233.267 312.674 210.367 1.00 0.00 ? 535  MET A CE    1 
ATOM   3986  N  N     . GLY A  1  536  ? 236.106 313.508 204.413 1.00 0.00 ? 536  GLY A N     1 
ATOM   3987  C  CA    . GLY A  1  536  ? 236.244 314.629 203.500 1.00 0.00 ? 536  GLY A CA    1 
ATOM   3988  C  C     . GLY A  1  536  ? 235.209 314.658 202.393 1.00 0.00 ? 536  GLY A C     1 
ATOM   3989  O  O     . GLY A  1  536  ? 234.247 313.893 202.377 1.00 0.00 ? 536  GLY A O     1 
ATOM   3990  N  N     . ILE A  1  537  ? 235.408 315.521 201.422 1.00 0.00 ? 537  ILE A N     1 
ATOM   3991  C  CA    . ILE A  1  537  ? 234.413 315.635 200.389 1.00 0.00 ? 537  ILE A CA    1 
ATOM   3992  C  C     . ILE A  1  537  ? 234.467 314.459 199.429 1.00 0.00 ? 537  ILE A C     1 
ATOM   3993  O  O     . ILE A  1  537  ? 235.466 314.291 198.738 1.00 0.00 ? 537  ILE A O     1 
ATOM   3994  C  CB    . ILE A  1  537  ? 234.619 316.945 199.706 1.00 0.00 ? 537  ILE A CB    1 
ATOM   3995  C  CG1   . ILE A  1  537  ? 234.557 318.004 200.791 1.00 0.00 ? 537  ILE A CG1   1 
ATOM   3996  C  CG2   . ILE A  1  537  ? 233.544 317.247 198.710 1.00 0.00 ? 537  ILE A CG2   1 
ATOM   3997  C  CD1   . ILE A  1  537  ? 233.364 317.857 201.711 1.00 0.00 ? 537  ILE A CD1   1 
ATOM   3998  N  N     . VAL A  1  538  ? 233.425 313.615 199.419 1.00 0.00 ? 538  VAL A N     1 
ATOM   3999  C  CA    . VAL A  1  538  ? 233.482 312.367 198.609 1.00 0.00 ? 538  VAL A CA    1 
ATOM   4000  C  C     . VAL A  1  538  ? 232.403 312.200 197.526 1.00 0.00 ? 538  VAL A C     1 
ATOM   4001  O  O     . VAL A  1  538  ? 231.314 312.830 197.587 1.00 0.00 ? 538  VAL A O     1 
ATOM   4002  C  CB    . VAL A  1  538  ? 233.410 311.063 199.449 1.00 0.00 ? 538  VAL A CB    1 
ATOM   4003  C  CG1   . VAL A  1  538  ? 234.800 310.658 199.944 1.00 0.00 ? 538  VAL A CG1   1 
ATOM   4004  C  CG2   . VAL A  1  538  ? 232.403 311.187 200.564 1.00 0.00 ? 538  VAL A CG2   1 
ATOM   4005  N  N     . GLN A  1  539  ? 232.733 311.327 196.556 1.00 0.00 ? 539  GLN A N     1 
ATOM   4006  C  CA    . GLN A  1  539  ? 231.940 311.092 195.334 1.00 0.00 ? 539  GLN A CA    1 
ATOM   4007  C  C     . GLN A  1  539  ? 231.626 312.261 194.390 1.00 0.00 ? 539  GLN A C     1 
ATOM   4008  O  O     . GLN A  1  539  ? 232.480 313.095 194.093 1.00 0.00 ? 539  GLN A O     1 
ATOM   4009  C  CB    . GLN A  1  539  ? 230.624 310.396 195.700 1.00 0.00 ? 539  GLN A CB    1 
ATOM   4010  C  CG    . GLN A  1  539  ? 230.903 309.147 196.392 1.00 0.00 ? 539  GLN A CG    1 
ATOM   4011  C  CD    . GLN A  1  539  ? 231.872 308.339 195.520 1.00 0.00 ? 539  GLN A CD    1 
ATOM   4012  O  OE1   . GLN A  1  539  ? 232.946 307.931 195.981 1.00 0.00 ? 539  GLN A OE1   1 
ATOM   4013  N  NE2   . GLN A  1  539  ? 231.506 308.137 194.233 1.00 0.00 ? 539  GLN A NE2   1 
ATOM   4014  N  N     . ASP A  1  540  ? 230.361 312.395 194.028 1.00 0.00 ? 540  ASP A N     1 
ATOM   4015  C  CA    . ASP A  1  540  ? 230.002 313.333 192.995 1.00 0.00 ? 540  ASP A CA    1 
ATOM   4016  C  C     . ASP A  1  540  ? 230.461 314.702 193.290 1.00 0.00 ? 540  ASP A C     1 
ATOM   4017  O  O     . ASP A  1  540  ? 230.967 315.379 192.403 1.00 0.00 ? 540  ASP A O     1 
ATOM   4018  C  CB    . ASP A  1  540  ? 228.517 313.495 192.902 1.00 0.00 ? 540  ASP A CB    1 
ATOM   4019  C  CG    . ASP A  1  540  ? 228.010 313.449 191.521 1.00 0.00 ? 540  ASP A CG    1 
ATOM   4020  O  OD1   . ASP A  1  540  ? 228.764 313.848 190.568 1.00 0.00 ? 540  ASP A OD1   1 
ATOM   4021  O  OD2   . ASP A  1  540  ? 226.768 313.182 191.451 1.00 0.00 ? 540  ASP A OD2   1 
ATOM   4022  N  N     . THR A  1  541  ? 230.259 315.123 194.532 1.00 0.00 ? 541  THR A N     1 
ATOM   4023  C  CA    . THR A  1  541  ? 230.742 316.432 194.907 1.00 0.00 ? 541  THR A CA    1 
ATOM   4024  C  C     . THR A  1  541  ? 232.199 316.475 194.694 1.00 0.00 ? 541  THR A C     1 
ATOM   4025  O  O     . THR A  1  541  ? 232.679 317.471 194.162 1.00 0.00 ? 541  THR A O     1 
ATOM   4026  C  CB    . THR A  1  541  ? 230.554 316.837 196.342 1.00 0.00 ? 541  THR A CB    1 
ATOM   4027  O  OG1   . THR A  1  541  ? 231.401 315.979 197.103 1.00 0.00 ? 541  THR A OG1   1 
ATOM   4028  C  CG2   . THR A  1  541  ? 229.151 316.655 196.810 1.00 0.00 ? 541  THR A CG2   1 
ATOM   4029  N  N     . LEU A  1  542  ? 232.938 315.431 195.066 1.00 0.00 ? 542  LEU A N     1 
ATOM   4030  C  CA    . LEU A  1  542  ? 234.360 315.602 194.796 1.00 0.00 ? 542  LEU A CA    1 
ATOM   4031  C  C     . LEU A  1  542  ? 234.632 315.761 193.281 1.00 0.00 ? 542  LEU A C     1 
ATOM   4032  O  O     . LEU A  1  542  ? 235.308 316.702 192.874 1.00 0.00 ? 542  LEU A O     1 
ATOM   4033  C  CB    . LEU A  1  542  ? 235.165 314.445 195.409 1.00 0.00 ? 542  LEU A CB    1 
ATOM   4034  C  CG    . LEU A  1  542  ? 236.678 314.572 195.359 1.00 0.00 ? 542  LEU A CG    1 
ATOM   4035  C  CD1   . LEU A  1  542  ? 237.108 315.833 196.056 1.00 0.00 ? 542  LEU A CD1   1 
ATOM   4036  C  CD2   . LEU A  1  542  ? 237.281 313.361 195.967 1.00 0.00 ? 542  LEU A CD2   1 
ATOM   4037  N  N     . THR A  1  543  ? 233.966 315.002 192.438 1.00 0.00 ? 543  THR A N     1 
ATOM   4038  C  CA    . THR A  1  543  ? 234.122 315.232 191.029 1.00 0.00 ? 543  THR A CA    1 
ATOM   4039  C  C     . THR A  1  543  ? 233.526 316.536 190.658 1.00 0.00 ? 543  THR A C     1 
ATOM   4040  O  O     . THR A  1  543  ? 234.038 317.223 189.833 1.00 0.00 ? 543  THR A O     1 
ATOM   4041  C  CB    . THR A  1  543  ? 233.514 314.162 190.169 1.00 0.00 ? 543  THR A CB    1 
ATOM   4042  O  OG1   . THR A  1  543  ? 234.191 312.937 190.424 1.00 0.00 ? 543  THR A OG1   1 
ATOM   4043  C  CG2   . THR A  1  543  ? 233.710 314.486 188.689 1.00 0.00 ? 543  THR A CG2   1 
ATOM   4044  N  N     . ALA A  1  544  ? 232.424 316.907 191.240 1.00 0.00 ? 544  ALA A N     1 
ATOM   4045  C  CA    . ALA A  1  544  ? 231.958 318.169 190.806 1.00 0.00 ? 544  ALA A CA    1 
ATOM   4046  C  C     . ALA A  1  544  ? 232.892 319.296 191.213 1.00 0.00 ? 544  ALA A C     1 
ATOM   4047  O  O     . ALA A  1  544  ? 233.138 320.111 190.368 1.00 0.00 ? 544  ALA A O     1 
ATOM   4048  C  CB    . ALA A  1  544  ? 230.589 318.397 191.339 1.00 0.00 ? 544  ALA A CB    1 
ATOM   4049  N  N     . VAL A  1  545  ? 233.574 319.271 192.362 1.00 0.00 ? 545  VAL A N     1 
ATOM   4050  C  CA    . VAL A  1  545  ? 234.565 320.352 192.638 1.00 0.00 ? 545  VAL A CA    1 
ATOM   4051  C  C     . VAL A  1  545  ? 235.722 320.577 191.645 1.00 0.00 ? 545  VAL A C     1 
ATOM   4052  O  O     . VAL A  1  545  ? 236.070 321.712 191.332 1.00 0.00 ? 545  VAL A O     1 
ATOM   4053  C  CB    . VAL A  1  545  ? 235.225 320.244 194.001 1.00 0.00 ? 545  VAL A CB    1 
ATOM   4054  C  CG1   . VAL A  1  545  ? 235.526 321.656 194.458 1.00 0.00 ? 545  VAL A CG1   1 
ATOM   4055  C  CG2   . VAL A  1  545  ? 234.329 319.627 194.986 1.00 0.00 ? 545  VAL A CG2   1 
ATOM   4056  N  N     . ARG A  1  546  ? 236.324 319.512 191.165 1.00 0.00 ? 546  ARG A N     1 
ATOM   4057  C  CA    . ARG A  1  546  ? 237.329 319.652 190.137 1.00 0.00 ? 546  ARG A CA    1 
ATOM   4058  C  C     . ARG A  1  546  ? 236.852 320.358 188.932 1.00 0.00 ? 546  ARG A C     1 
ATOM   4059  O  O     . ARG A  1  546  ? 237.473 321.304 188.485 1.00 0.00 ? 546  ARG A O     1 
ATOM   4060  C  CB    . ARG A  1  546  ? 237.753 318.271 189.676 1.00 0.00 ? 546  ARG A CB    1 
ATOM   4061  C  CG    . ARG A  1  546  ? 238.765 318.294 188.632 1.00 0.00 ? 546  ARG A CG    1 
ATOM   4062  C  CD    . ARG A  1  546  ? 238.801 316.937 188.090 1.00 0.00 ? 546  ARG A CD    1 
ATOM   4063  N  NE    . ARG A  1  546  ? 239.537 316.997 186.845 1.00 0.00 ? 546  ARG A NE    1 
ATOM   4064  C  CZ    . ARG A  1  546  ? 238.930 317.395 185.718 1.00 0.00 ? 546  ARG A CZ    1 
ATOM   4065  N  NH1   . ARG A  1  546  ? 237.648 317.728 185.769 1.00 0.00 ? 546  ARG A NH1   1 
ATOM   4066  N  NH2   . ARG A  1  546  ? 239.574 317.541 184.562 1.00 0.00 ? 546  ARG A NH2   1 
ATOM   4067  N  N     . LYS A  1  547  ? 235.723 319.897 188.435 1.00 0.00 ? 547  LYS A N     1 
ATOM   4068  C  CA    . LYS A  1  547  ? 235.112 320.415 187.236 1.00 0.00 ? 547  LYS A CA    1 
ATOM   4069  C  C     . LYS A  1  547  ? 234.756 321.953 187.371 1.00 0.00 ? 547  LYS A C     1 
ATOM   4070  O  O     . LYS A  1  547  ? 234.940 322.729 186.396 1.00 0.00 ? 547  LYS A O     1 
ATOM   4071  C  CB    . LYS A  1  547  ? 233.929 319.502 186.878 1.00 0.00 ? 547  LYS A CB    1 
ATOM   4072  C  CG    . LYS A  1  547  ? 233.363 319.703 185.511 1.00 0.00 ? 547  LYS A CG    1 
ATOM   4073  C  CD    . LYS A  1  547  ? 232.311 318.661 185.297 1.00 0.00 ? 547  LYS A CD    1 
ATOM   4074  C  CE    . LYS A  1  547  ? 231.588 318.799 183.971 1.00 0.00 ? 547  LYS A CE    1 
ATOM   4075  N  NZ    . LYS A  1  547  ? 230.518 317.749 183.808 1.00 0.00 ? 547  LYS A NZ    1 
ATOM   4076  N  N     . PHE A  1  548  ? 234.248 322.360 188.557 1.00 0.00 ? 548  PHE A N     1 
ATOM   4077  C  CA    . PHE A  1  548  ? 233.898 323.744 188.930 1.00 0.00 ? 548  PHE A CA    1 
ATOM   4078  C  C     . PHE A  1  548  ? 235.094 324.662 189.065 1.00 0.00 ? 548  PHE A C     1 
ATOM   4079  O  O     . PHE A  1  548  ? 234.978 325.825 188.775 1.00 0.00 ? 548  PHE A O     1 
ATOM   4080  C  CB    . PHE A  1  548  ? 233.183 323.721 190.273 1.00 0.00 ? 548  PHE A CB    1 
ATOM   4081  C  CG    . PHE A  1  548  ? 232.515 325.008 190.654 1.00 0.00 ? 548  PHE A CG    1 
ATOM   4082  C  CD1   . PHE A  1  548  ? 231.435 325.494 189.970 1.00 0.00 ? 548  PHE A CD1   1 
ATOM   4083  C  CD2   . PHE A  1  548  ? 233.024 325.790 191.652 1.00 0.00 ? 548  PHE A CD2   1 
ATOM   4084  C  CE1   . PHE A  1  548  ? 230.813 326.717 190.379 1.00 0.00 ? 548  PHE A CE1   1 
ATOM   4085  C  CE2   . PHE A  1  548  ? 232.428 327.004 192.026 1.00 0.00 ? 548  PHE A CE2   1 
ATOM   4086  C  CZ    . PHE A  1  548  ? 231.340 327.459 191.397 1.00 0.00 ? 548  PHE A CZ    1 
ATOM   4087  N  N     . THR A  1  549  ? 236.185 324.196 189.647 1.00 0.00 ? 549  THR A N     1 
ATOM   4088  C  CA    . THR A  1  549  ? 237.360 325.055 189.833 1.00 0.00 ? 549  THR A CA    1 
ATOM   4089  C  C     . THR A  1  549  ? 238.235 325.300 188.592 1.00 0.00 ? 549  THR A C     1 
ATOM   4090  O  O     . THR A  1  549  ? 239.139 326.112 188.666 1.00 0.00 ? 549  THR A O     1 
ATOM   4091  C  CB    . THR A  1  549  ? 238.286 324.587 190.997 1.00 0.00 ? 549  THR A CB    1 
ATOM   4092  O  OG1   . THR A  1  549  ? 238.537 323.178 190.896 1.00 0.00 ? 549  THR A OG1   1 
ATOM   4093  C  CG2   . THR A  1  549  ? 237.635 324.873 192.346 1.00 0.00 ? 549  THR A CG2   1 
ATOM   4094  N  N     . LYS A  1  550  ? 238.075 324.537 187.513 1.00 0.00 ? 550  LYS A N     1 
ATOM   4095  C  CA    . LYS A  1  550  ? 238.840 324.826 186.301 1.00 0.00 ? 550  LYS A CA    1 
ATOM   4096  C  C     . LYS A  1  550  ? 238.573 326.254 185.883 1.00 0.00 ? 550  LYS A C     1 
ATOM   4097  O  O     . LYS A  1  550  ? 237.414 326.686 185.806 1.00 0.00 ? 550  LYS A O     1 
ATOM   4098  C  CB    . LYS A  1  550  ? 238.471 323.905 185.160 1.00 0.00 ? 550  LYS A CB    1 
ATOM   4099  C  CG    . LYS A  1  550  ? 238.925 322.522 185.354 1.00 0.00 ? 550  LYS A CG    1 
ATOM   4100  C  CD    . LYS A  1  550  ? 238.237 321.595 184.401 1.00 0.00 ? 550  LYS A CD    1 
ATOM   4101  C  CE    . LYS A  1  550  ? 238.619 321.892 182.989 1.00 0.00 ? 550  LYS A CE    1 
ATOM   4102  N  NZ    . LYS A  1  550  ? 238.434 320.670 182.164 1.00 0.00 ? 550  LYS A NZ    1 
ATOM   4103  N  N     . ARG A  1  551  ? 239.643 326.997 185.624 1.00 0.00 ? 551  ARG A N     1 
ATOM   4104  C  CA    . ARG A  1  551  ? 239.504 328.411 185.281 1.00 0.00 ? 551  ARG A CA    1 
ATOM   4105  C  C     . ARG A  1  551  ? 238.923 328.726 183.891 1.00 0.00 ? 551  ARG A C     1 
ATOM   4106  O  O     . ARG A  1  551  ? 238.974 329.864 183.446 1.00 0.00 ? 551  ARG A O     1 
ATOM   4107  C  CB    . ARG A  1  551  ? 240.844 329.106 185.443 1.00 0.00 ? 551  ARG A CB    1 
ATOM   4108  C  CG    . ARG A  1  551  ? 241.830 328.754 184.398 1.00 0.00 ? 551  ARG A CG    1 
ATOM   4109  C  CD    . ARG A  1  551  ? 243.167 329.271 184.829 1.00 0.00 ? 551  ARG A CD    1 
ATOM   4110  N  NE    . ARG A  1  551  ? 244.055 329.423 183.692 1.00 0.00 ? 551  ARG A NE    1 
ATOM   4111  C  CZ    . ARG A  1  551  ? 244.670 328.408 183.105 1.00 0.00 ? 551  ARG A CZ    1 
ATOM   4112  N  NH1   . ARG A  1  551  ? 244.484 327.178 183.569 1.00 0.00 ? 551  ARG A NH1   1 
ATOM   4113  N  NH2   . ARG A  1  551  ? 245.472 328.624 182.065 1.00 0.00 ? 551  ARG A NH2   1 
ATOM   4114  N  N     . ASP A  1  552  ? 238.380 327.738 183.197 1.00 0.00 ? 552  ASP A N     1 
ATOM   4115  C  CA    . ASP A  1  552  ? 237.614 328.045 182.011 1.00 0.00 ? 552  ASP A CA    1 
ATOM   4116  C  C     . ASP A  1  552  ? 236.123 328.154 182.371 1.00 0.00 ? 552  ASP A C     1 
ATOM   4117  O  O     . ASP A  1  552  ? 235.309 328.483 181.516 1.00 0.00 ? 552  ASP A O     1 
ATOM   4118  C  CB    . ASP A  1  552  ? 237.895 327.010 180.906 1.00 0.00 ? 552  ASP A CB    1 
ATOM   4119  C  CG    . ASP A  1  552  ? 237.329 325.613 181.209 1.00 0.00 ? 552  ASP A CG    1 
ATOM   4120  O  OD1   . ASP A  1  552  ? 237.013 325.340 182.381 1.00 0.00 ? 552  ASP A OD1   1 
ATOM   4121  O  OD2   . ASP A  1  552  ? 237.228 324.773 180.274 1.00 0.00 ? 552  ASP A OD2   1 
ATOM   4122  N  N     . VAL A  1  553  ? 235.770 327.928 183.642 1.00 0.00 ? 553  VAL A N     1 
ATOM   4123  C  CA    . VAL A  1  553  ? 234.369 328.051 184.114 1.00 0.00 ? 553  VAL A CA    1 
ATOM   4124  C  C     . VAL A  1  553  ? 233.906 329.469 184.472 1.00 0.00 ? 553  VAL A C     1 
ATOM   4125  O  O     . VAL A  1  553  ? 234.416 330.086 185.428 1.00 0.00 ? 553  VAL A O     1 
ATOM   4126  C  CB    . VAL A  1  553  ? 234.110 327.195 185.357 1.00 0.00 ? 553  VAL A CB    1 
ATOM   4127  C  CG1   . VAL A  1  553  ? 232.839 327.640 186.057 1.00 0.00 ? 553  VAL A CG1   1 
ATOM   4128  C  CG2   . VAL A  1  553  ? 233.997 325.751 184.963 1.00 0.00 ? 553  VAL A CG2   1 
ATOM   4129  N  N     . PHE A  1  554  ? 232.890 329.947 183.750 1.00 0.00 ? 554  PHE A N     1 
ATOM   4130  C  CA    . PHE A  1  554  ? 232.331 331.283 183.958 1.00 0.00 ? 554  PHE A CA    1 
ATOM   4131  C  C     . PHE A  1  554  ? 230.833 331.278 184.240 1.00 0.00 ? 554  PHE A C     1 
ATOM   4132  O  O     . PHE A  1  554  ? 230.093 330.446 183.716 1.00 0.00 ? 554  PHE A O     1 
ATOM   4133  C  CB    . PHE A  1  554  ? 232.623 332.174 182.764 1.00 0.00 ? 554  PHE A CB    1 
ATOM   4134  C  CG    . PHE A  1  554  ? 234.070 332.297 182.466 1.00 0.00 ? 554  PHE A CG    1 
ATOM   4135  C  CD1   . PHE A  1  554  ? 234.871 333.116 183.223 1.00 0.00 ? 554  PHE A CD1   1 
ATOM   4136  C  CD2   . PHE A  1  554  ? 234.641 331.572 181.443 1.00 0.00 ? 554  PHE A CD2   1 
ATOM   4137  C  CE1   . PHE A  1  554  ? 236.221 333.231 182.947 1.00 0.00 ? 554  PHE A CE1   1 
ATOM   4138  C  CE2   . PHE A  1  554  ? 235.995 331.686 181.161 1.00 0.00 ? 554  PHE A CE2   1 
ATOM   4139  C  CZ    . PHE A  1  554  ? 236.785 332.517 181.918 1.00 0.00 ? 554  PHE A CZ    1 
ATOM   4140  N  N     . LEU A  1  555  ? 230.431 332.148 185.163 1.00 0.00 ? 555  LEU A N     1 
ATOM   4141  C  CA    . LEU A  1  555  ? 229.081 332.197 185.717 1.00 0.00 ? 555  LEU A CA    1 
ATOM   4142  C  C     . LEU A  1  555  ? 228.451 333.583 185.452 1.00 0.00 ? 555  LEU A C     1 
ATOM   4143  O  O     . LEU A  1  555  ? 229.085 334.604 185.723 1.00 0.00 ? 555  LEU A O     1 
ATOM   4144  C  CB    . LEU A  1  555  ? 229.147 331.935 187.218 1.00 0.00 ? 555  LEU A CB    1 
ATOM   4145  C  CG    . LEU A  1  555  ? 229.962 330.710 187.605 1.00 0.00 ? 555  LEU A CG    1 
ATOM   4146  C  CD1   . LEU A  1  555  ? 230.137 330.705 189.083 1.00 0.00 ? 555  LEU A CD1   1 
ATOM   4147  C  CD2   . LEU A  1  555  ? 229.264 329.457 187.159 1.00 0.00 ? 555  LEU A CD2   1 
ATOM   4148  N  N     . GLU A  1  556  ? 227.187 333.644 185.038 1.00 0.00 ? 556  GLU A N     1 
ATOM   4149  C  CA    . GLU A  1  556  ? 226.530 334.932 184.768 1.00 0.00 ? 556  GLU A CA    1 
ATOM   4150  C  C     . GLU A  1  556  ? 225.654 335.282 185.979 1.00 0.00 ? 556  GLU A C     1 
ATOM   4151  O  O     . GLU A  1  556  ? 225.335 334.389 186.761 1.00 0.00 ? 556  GLU A O     1 
ATOM   4152  C  CB    . GLU A  1  556  ? 225.717 334.925 183.464 1.00 0.00 ? 556  GLU A CB    1 
ATOM   4153  C  CG    . GLU A  1  556  ? 224.528 333.945 183.352 1.00 0.00 ? 556  GLU A CG    1 
ATOM   4154  C  CD    . GLU A  1  556  ? 223.916 333.856 181.886 1.00 0.00 ? 556  GLU A CD    1 
ATOM   4155  O  OE1   . GLU A  1  556  ? 222.956 334.620 181.562 1.00 0.00 ? 556  GLU A OE1   1 
ATOM   4156  O  OE2   . GLU A  1  556  ? 224.382 333.014 181.062 1.00 0.00 ? 556  GLU A OE2   1 
ATOM   4157  N  N     . ARG A  1  557  ? 225.258 336.556 186.124 1.00 0.00 ? 557  ARG A N     1 
ATOM   4158  C  CA    . ARG A  1  557  ? 224.721 337.122 187.380 1.00 0.00 ? 557  ARG A CA    1 
ATOM   4159  C  C     . ARG A  1  557  ? 223.661 336.243 187.992 1.00 0.00 ? 557  ARG A C     1 
ATOM   4160  O  O     . ARG A  1  557  ? 223.617 336.090 189.215 1.00 0.00 ? 557  ARG A O     1 
ATOM   4161  C  CB    . ARG A  1  557  ? 224.107 338.502 187.201 1.00 0.00 ? 557  ARG A CB    1 
ATOM   4162  C  CG    . ARG A  1  557  ? 223.798 339.113 188.575 1.00 0.00 ? 557  ARG A CG    1 
ATOM   4163  C  CD    . ARG A  1  557  ? 223.346 340.606 188.579 1.00 0.00 ? 557  ARG A CD    1 
ATOM   4164  N  NE    . ARG A  1  557  ? 221.899 340.895 188.574 1.00 0.00 ? 557  ARG A NE    1 
ATOM   4165  C  CZ    . ARG A  1  557  ? 221.029 340.672 187.583 1.00 0.00 ? 557  ARG A CZ    1 
ATOM   4166  N  NH1   . ARG A  1  557  ? 221.394 340.081 186.460 1.00 0.00 ? 557  ARG A NH1   1 
ATOM   4167  N  NH2   . ARG A  1  557  ? 219.759 341.059 187.733 1.00 0.00 ? 557  ARG A NH2   1 
ATOM   4168  N  N     . GLY A  1  558  ? 222.782 335.718 187.141 1.00 0.00 ? 558  GLY A N     1 
ATOM   4169  C  CA    . GLY A  1  558  ? 221.695 334.873 187.591 1.00 0.00 ? 558  GLY A CA    1 
ATOM   4170  C  C     . GLY A  1  558  ? 222.136 333.612 188.321 1.00 0.00 ? 558  GLY A C     1 
ATOM   4171  O  O     . GLY A  1  558  ? 221.570 333.327 189.367 1.00 0.00 ? 558  GLY A O     1 
ATOM   4172  N  N     . GLU A  1  559  ? 223.114 332.857 187.826 1.00 0.00 ? 559  GLU A N     1 
ATOM   4173  C  CA    . GLU A  1  559  ? 223.497 331.633 188.529 1.00 0.00 ? 559  GLU A CA    1 
ATOM   4174  C  C     . GLU A  1  559  ? 224.309 331.864 189.778 1.00 0.00 ? 559  GLU A C     1 
ATOM   4175  O  O     . GLU A  1  559  ? 224.089 331.205 190.778 1.00 0.00 ? 559  GLU A O     1 
ATOM   4176  C  CB    . GLU A  1  559  ? 224.328 330.711 187.652 1.00 0.00 ? 559  GLU A CB    1 
ATOM   4177  C  CG    . GLU A  1  559  ? 223.740 330.323 186.323 1.00 0.00 ? 559  GLU A CG    1 
ATOM   4178  C  CD    . GLU A  1  559  ? 222.323 329.759 186.453 1.00 0.00 ? 559  GLU A CD    1 
ATOM   4179  O  OE1   . GLU A  1  559  ? 222.180 328.503 186.272 1.00 0.00 ? 559  GLU A OE1   1 
ATOM   4180  O  OE2   . GLU A  1  559  ? 221.372 330.582 186.652 1.00 0.00 ? 559  GLU A OE2   1 
ATOM   4181  N  N     . VAL A  1  560  ? 225.179 332.859 189.751 1.00 0.00 ? 560  VAL A N     1 
ATOM   4182  C  CA    . VAL A  1  560  ? 225.944 333.226 190.922 1.00 0.00 ? 560  VAL A CA    1 
ATOM   4183  C  C     . VAL A  1  560  ? 225.093 333.581 192.095 1.00 0.00 ? 560  VAL A C     1 
ATOM   4184  O  O     . VAL A  1  560  ? 225.354 333.137 193.201 1.00 0.00 ? 560  VAL A O     1 
ATOM   4185  C  CB    . VAL A  1  560  ? 226.784 334.433 190.614 1.00 0.00 ? 560  VAL A CB    1 
ATOM   4186  C  CG1   . VAL A  1  560  ? 227.270 335.110 191.890 1.00 0.00 ? 560  VAL A CG1   1 
ATOM   4187  C  CG2   . VAL A  1  560  ? 227.905 334.042 189.690 1.00 0.00 ? 560  VAL A CG2   1 
ATOM   4188  N  N     . MET A  1  561  ? 224.066 334.377 191.860 1.00 0.00 ? 561  MET A N     1 
ATOM   4189  C  CA    . MET A  1  561  ? 223.138 334.659 192.924 1.00 0.00 ? 561  MET A CA    1 
ATOM   4190  C  C     . MET A  1  561  ? 222.480 333.402 193.473 1.00 0.00 ? 561  MET A C     1 
ATOM   4191  O  O     . MET A  1  561  ? 222.354 333.275 194.672 1.00 0.00 ? 561  MET A O     1 
ATOM   4192  C  CB    . MET A  1  561  ? 222.075 335.659 192.484 1.00 0.00 ? 561  MET A CB    1 
ATOM   4193  C  CG    . MET A  1  561  ? 222.603 337.043 192.297 1.00 0.00 ? 561  MET A CG    1 
ATOM   4194  S  SD    . MET A  1  561  ? 221.294 338.052 191.616 1.00 0.00 ? 561  MET A SD    1 
ATOM   4195  C  CE    . MET A  1  561  ? 222.061 339.661 191.581 1.00 0.00 ? 561  MET A CE    1 
ATOM   4196  N  N     . ASN A  1  562  ? 222.069 332.465 192.632 1.00 0.00 ? 562  ASN A N     1 
ATOM   4197  C  CA    . ASN A  1  562  ? 221.511 331.264 193.202 1.00 0.00 ? 562  ASN A CA    1 
ATOM   4198  C  C     . ASN A  1  562  ? 222.506 330.497 194.024 1.00 0.00 ? 562  ASN A C     1 
ATOM   4199  O  O     . ASN A  1  562  ? 222.163 330.123 195.123 1.00 0.00 ? 562  ASN A O     1 
ATOM   4200  C  CB    . ASN A  1  562  ? 220.933 330.360 192.132 1.00 0.00 ? 562  ASN A CB    1 
ATOM   4201  C  CG    . ASN A  1  562  ? 219.637 329.678 192.585 1.00 0.00 ? 562  ASN A CG    1 
ATOM   4202  O  OD1   . ASN A  1  562  ? 218.529 330.177 192.338 1.00 0.00 ? 562  ASN A OD1   1 
ATOM   4203  N  ND2   . ASN A  1  562  ? 219.771 328.533 193.256 1.00 0.00 ? 562  ASN A ND2   1 
ATOM   4204  N  N     . LEU A  1  563  ? 223.758 330.359 193.581 1.00 0.00 ? 563  LEU A N     1 
ATOM   4205  C  CA    . LEU A  1  563  ? 224.730 329.661 194.428 1.00 0.00 ? 563  LEU A CA    1 
ATOM   4206  C  C     . LEU A  1  563  ? 224.970 330.419 195.733 1.00 0.00 ? 563  LEU A C     1 
ATOM   4207  O  O     . LEU A  1  563  ? 224.862 329.829 196.791 1.00 0.00 ? 563  LEU A O     1 
ATOM   4208  C  CB    . LEU A  1  563  ? 226.071 329.406 193.727 1.00 0.00 ? 563  LEU A CB    1 
ATOM   4209  C  CG    . LEU A  1  563  ? 226.016 328.435 192.552 1.00 0.00 ? 563  LEU A CG    1 
ATOM   4210  C  CD1   . LEU A  1  563  ? 227.319 328.341 191.730 1.00 0.00 ? 563  LEU A CD1   1 
ATOM   4211  C  CD2   . LEU A  1  563  ? 225.513 327.123 192.973 1.00 0.00 ? 563  LEU A CD2   1 
ATOM   4212  N  N     . LEU A  1  564  ? 225.093 331.738 195.666 1.00 0.00 ? 564  LEU A N     1 
ATOM   4213  C  CA    . LEU A  1  564  ? 225.207 332.562 196.852 1.00 0.00 ? 564  LEU A CA    1 
ATOM   4214  C  C     . LEU A  1  564  ? 224.048 332.245 197.721 1.00 0.00 ? 564  LEU A C     1 
ATOM   4215  O  O     . LEU A  1  564  ? 224.235 332.051 198.896 1.00 0.00 ? 564  LEU A O     1 
ATOM   4216  C  CB    . LEU A  1  564  ? 225.202 334.051 196.522 1.00 0.00 ? 564  LEU A CB    1 
ATOM   4217  C  CG    . LEU A  1  564  ? 226.422 334.623 195.816 1.00 0.00 ? 564  LEU A CG    1 
ATOM   4218  C  CD1   . LEU A  1  564  ? 226.212 336.072 195.374 1.00 0.00 ? 564  LEU A CD1   1 
ATOM   4219  C  CD2   . LEU A  1  564  ? 227.613 334.509 196.751 1.00 0.00 ? 564  LEU A CD2   1 
ATOM   4220  N  N     . MET A  1  565  ? 222.879 332.052 197.136 1.00 0.00 ? 565  MET A N     1 
ATOM   4221  C  CA    . MET A  1  565  ? 221.718 331.734 197.943 1.00 0.00 ? 565  MET A CA    1 
ATOM   4222  C  C     . MET A  1  565  ? 221.693 330.459 198.742 1.00 0.00 ? 565  MET A C     1 
ATOM   4223  O  O     . MET A  1  565  ? 221.174 330.469 199.862 1.00 0.00 ? 565  MET A O     1 
ATOM   4224  C  CB    . MET A  1  565  ? 220.512 331.648 196.994 1.00 0.00 ? 565  MET A CB    1 
ATOM   4225  C  CG    . MET A  1  565  ? 219.219 331.758 197.680 1.00 0.00 ? 565  MET A CG    1 
ATOM   4226  S  SD    . MET A  1  565  ? 219.113 333.439 198.250 1.00 0.00 ? 565  MET A SD    1 
ATOM   4227  C  CE    . MET A  1  565  ? 218.894 333.108 200.002 1.00 0.00 ? 565  MET A CE    1 
ATOM   4228  N  N     . PHE A  1  566  ? 222.269 329.390 198.204 1.00 0.00 ? 566  PHE A N     1 
ATOM   4229  C  CA    . PHE A  1  566  ? 222.455 328.116 198.918 1.00 0.00 ? 566  PHE A CA    1 
ATOM   4230  C  C     . PHE A  1  566  ? 223.499 327.995 200.046 1.00 0.00 ? 566  PHE A C     1 
ATOM   4231  O  O     . PHE A  1  566  ? 223.474 327.069 200.856 1.00 0.00 ? 566  PHE A O     1 
ATOM   4232  C  CB    . PHE A  1  566  ? 222.685 327.063 197.895 1.00 0.00 ? 566  PHE A CB    1 
ATOM   4233  C  CG    . PHE A  1  566  ? 221.435 326.578 197.371 1.00 0.00 ? 566  PHE A CG    1 
ATOM   4234  C  CD1   . PHE A  1  566  ? 220.644 327.436 196.631 1.00 0.00 ? 566  PHE A CD1   1 
ATOM   4235  C  CD2   . PHE A  1  566  ? 221.022 325.313 197.579 1.00 0.00 ? 566  PHE A CD2   1 
ATOM   4236  C  CE1   . PHE A  1  566  ? 219.436 327.041 196.088 1.00 0.00 ? 566  PHE A CE1   1 
ATOM   4237  C  CE2   . PHE A  1  566  ? 219.803 324.897 197.062 1.00 0.00 ? 566  PHE A CE2   1 
ATOM   4238  C  CZ    . PHE A  1  566  ? 219.003 325.781 196.301 1.00 0.00 ? 566  PHE A CZ    1 
ATOM   4239  N  N     . LEU A  1  567  ? 224.450 328.918 200.025 1.00 0.00 ? 567  LEU A N     1 
ATOM   4240  C  CA    . LEU A  1  567  ? 225.505 329.073 201.019 1.00 0.00 ? 567  LEU A CA    1 
ATOM   4241  C  C     . LEU A  1  567  ? 224.943 329.605 202.331 1.00 0.00 ? 567  LEU A C     1 
ATOM   4242  O  O     . LEU A  1  567  ? 224.107 330.493 202.317 1.00 0.00 ? 567  LEU A O     1 
ATOM   4243  C  CB    . LEU A  1  567  ? 226.546 330.035 200.449 1.00 0.00 ? 567  LEU A CB    1 
ATOM   4244  C  CG    . LEU A  1  567  ? 228.016 330.109 200.805 1.00 0.00 ? 567  LEU A CG    1 
ATOM   4245  C  CD1   . LEU A  1  567  ? 228.599 331.059 199.824 1.00 0.00 ? 567  LEU A CD1   1 
ATOM   4246  C  CD2   . LEU A  1  567  ? 228.234 330.635 202.211 1.00 0.00 ? 567  LEU A CD2   1 
ATOM   4247  N  N     . SER A  1  568  ? 225.401 329.090 203.463 1.00 0.00 ? 568  SER A N     1 
ATOM   4248  C  CA    . SER A  1  568  ? 224.905 329.557 204.751 1.00 0.00 ? 568  SER A CA    1 
ATOM   4249  C  C     . SER A  1  568  ? 225.504 330.861 205.235 1.00 0.00 ? 568  SER A C     1 
ATOM   4250  O  O     . SER A  1  568  ? 224.873 331.933 205.199 1.00 0.00 ? 568  SER A O     1 
ATOM   4251  C  CB    . SER A  1  568  ? 225.183 328.528 205.819 1.00 0.00 ? 568  SER A CB    1 
ATOM   4252  O  OG    . SER A  1  568  ? 224.433 327.373 205.559 1.00 0.00 ? 568  SER A OG    1 
ATOM   4253  N  N     . THR A  1  569  ? 226.741 330.730 205.708 1.00 0.00 ? 569  THR A N     1 
ATOM   4254  C  CA    . THR A  1  569  ? 227.465 331.805 206.377 1.00 0.00 ? 569  THR A CA    1 
ATOM   4255  C  C     . THR A  1  569  ? 227.968 332.886 205.429 1.00 0.00 ? 569  THR A C     1 
ATOM   4256  O  O     . THR A  1  569  ? 229.073 333.411 205.612 1.00 0.00 ? 569  THR A O     1 
ATOM   4257  C  CB    . THR A  1  569  ? 228.672 331.242 207.126 1.00 0.00 ? 569  THR A CB    1 
ATOM   4258  O  OG1   . THR A  1  569  ? 229.615 330.749 206.172 1.00 0.00 ? 569  THR A OG1   1 
ATOM   4259  C  CG2   . THR A  1  569  ? 228.234 330.094 208.035 1.00 0.00 ? 569  THR A CG2   1 
ATOM   4260  N  N     . TRP A  1  570  ? 227.181 333.180 204.398 1.00 0.00 ? 570  TRP A N     1 
ATOM   4261  C  CA    . TRP A  1  570  ? 227.591 334.126 203.376 1.00 0.00 ? 570  TRP A CA    1 
ATOM   4262  C  C     . TRP A  1  570  ? 227.720 335.518 203.989 1.00 0.00 ? 570  TRP A C     1 
ATOM   4263  O  O     . TRP A  1  570  ? 226.950 335.884 204.878 1.00 0.00 ? 570  TRP A O     1 
ATOM   4264  C  CB    . TRP A  1  570  ? 226.605 334.131 202.212 1.00 0.00 ? 570  TRP A CB    1 
ATOM   4265  C  CG    . TRP A  1  570  ? 226.933 335.167 201.237 1.00 0.00 ? 570  TRP A CG    1 
ATOM   4266  C  CD1   . TRP A  1  570  ? 228.103 335.294 200.570 1.00 0.00 ? 570  TRP A CD1   1 
ATOM   4267  C  CD2   . TRP A  1  570  ? 226.089 336.231 200.789 1.00 0.00 ? 570  TRP A CD2   1 
ATOM   4268  N  NE1   . TRP A  1  570  ? 228.053 336.375 199.736 1.00 0.00 ? 570  TRP A NE1   1 
ATOM   4269  C  CE2   . TRP A  1  570  ? 226.823 336.971 199.850 1.00 0.00 ? 570  TRP A CE2   1 
ATOM   4270  C  CE3   . TRP A  1  570  ? 224.783 336.629 201.090 1.00 0.00 ? 570  TRP A CE3   1 
ATOM   4271  C  CZ2   . TRP A  1  570  ? 226.300 338.097 199.209 1.00 0.00 ? 570  TRP A CZ2   1 
ATOM   4272  C  CZ3   . TRP A  1  570  ? 224.263 337.738 200.453 1.00 0.00 ? 570  TRP A CZ3   1 
ATOM   4273  C  CH2   . TRP A  1  570  ? 225.019 338.458 199.521 1.00 0.00 ? 570  TRP A CH2   1 
ATOM   4274  N  N     . ASP A  1  571  ? 228.680 336.303 203.515 1.00 0.00 ? 571  ASP A N     1 
ATOM   4275  C  CA    . ASP A  1  571  ? 228.986 337.561 204.187 1.00 0.00 ? 571  ASP A CA    1 
ATOM   4276  C  C     . ASP A  1  571  ? 227.804 338.541 204.087 1.00 0.00 ? 571  ASP A C     1 
ATOM   4277  O  O     . ASP A  1  571  ? 227.489 339.259 205.043 1.00 0.00 ? 571  ASP A O     1 
ATOM   4278  C  CB    . ASP A  1  571  ? 230.275 338.170 203.589 1.00 0.00 ? 571  ASP A CB    1 
ATOM   4279  C  CG    . ASP A  1  571  ? 230.657 339.527 204.218 1.00 0.00 ? 571  ASP A CG    1 
ATOM   4280  O  OD1   . ASP A  1  571  ? 230.471 339.720 205.449 1.00 0.00 ? 571  ASP A OD1   1 
ATOM   4281  O  OD2   . ASP A  1  571  ? 231.151 340.403 203.462 1.00 0.00 ? 571  ASP A OD2   1 
ATOM   4282  N  N     . GLY A  1  572  ? 227.108 338.510 202.958 1.00 0.00 ? 572  GLY A N     1 
ATOM   4283  C  CA    . GLY A  1  572  ? 226.019 339.436 202.727 1.00 0.00 ? 572  GLY A CA    1 
ATOM   4284  C  C     . GLY A  1  572  ? 226.394 340.391 201.611 1.00 0.00 ? 572  GLY A C     1 
ATOM   4285  O  O     . GLY A  1  572  ? 225.532 340.971 200.948 1.00 0.00 ? 572  GLY A O     1 
ATOM   4286  N  N     . LYS A  1  573  ? 227.694 340.561 201.401 1.00 0.00 ? 573  LYS A N     1 
ATOM   4287  C  CA    . LYS A  1  573  ? 228.170 341.388 200.306 1.00 0.00 ? 573  LYS A CA    1 
ATOM   4288  C  C     . LYS A  1  573  ? 228.448 340.551 199.079 1.00 0.00 ? 573  LYS A C     1 
ATOM   4289  O  O     . LYS A  1  573  ? 229.061 339.498 199.171 1.00 0.00 ? 573  LYS A O     1 
ATOM   4290  C  CB    . LYS A  1  573  ? 229.433 342.144 200.707 1.00 0.00 ? 573  LYS A CB    1 
ATOM   4291  C  CG    . LYS A  1  573  ? 229.237 343.167 201.812 1.00 0.00 ? 573  LYS A CG    1 
ATOM   4292  C  CD    . LYS A  1  573  ? 230.447 344.084 201.884 1.00 0.00 ? 573  LYS A CD    1 
ATOM   4293  C  CE    . LYS A  1  573  ? 231.703 343.300 202.266 1.00 0.00 ? 573  LYS A CE    1 
ATOM   4294  N  NZ    . LYS A  1  573  ? 232.883 344.180 202.502 1.00 0.00 ? 573  LYS A NZ    1 
ATOM   4295  N  N     . VAL A  1  574  ? 228.034 341.037 197.922 1.00 0.00 ? 574  VAL A N     1 
ATOM   4296  C  CA    . VAL A  1  574  ? 228.229 340.296 196.691 1.00 0.00 ? 574  VAL A CA    1 
ATOM   4297  C  C     . VAL A  1  574  ? 229.565 340.716 196.078 1.00 0.00 ? 574  VAL A C     1 
ATOM   4298  O  O     . VAL A  1  574  ? 229.798 341.909 195.878 1.00 0.00 ? 574  VAL A O     1 
ATOM   4299  C  CB    . VAL A  1  574  ? 227.088 340.559 195.713 1.00 0.00 ? 574  VAL A CB    1 
ATOM   4300  C  CG1   . VAL A  1  574  ? 227.289 339.768 194.443 1.00 0.00 ? 574  VAL A CG1   1 
ATOM   4301  C  CG2   . VAL A  1  574  ? 225.768 340.215 196.361 1.00 0.00 ? 574  VAL A CG2   1 
ATOM   4302  N  N     . PRO A  1  575  ? 230.457 339.747 195.808 1.00 0.00 ? 575  PRO A N     1 
ATOM   4303  C  CA    . PRO A  1  575  ? 231.804 340.003 195.274 1.00 0.00 ? 575  PRO A CA    1 
ATOM   4304  C  C     . PRO A  1  575  ? 231.788 340.576 193.867 1.00 0.00 ? 575  PRO A C     1 
ATOM   4305  O  O     . PRO A  1  575  ? 230.872 340.259 193.102 1.00 0.00 ? 575  PRO A O     1 
ATOM   4306  C  CB    . PRO A  1  575  ? 232.448 338.619 195.260 1.00 0.00 ? 575  PRO A CB    1 
ATOM   4307  C  CG    . PRO A  1  575  ? 231.557 337.769 196.012 1.00 0.00 ? 575  PRO A CG    1 
ATOM   4308  C  CD    . PRO A  1  575  ? 230.192 338.308 195.914 1.00 0.00 ? 575  PRO A CD    1 
ATOM   4309  N  N     . GLN A  1  576  ? 232.780 341.401 193.532 1.00 0.00 ? 576  GLN A N     1 
ATOM   4310  C  CA    . GLN A  1  576  ? 232.917 341.929 192.172 1.00 0.00 ? 576  GLN A CA    1 
ATOM   4311  C  C     . GLN A  1  576  ? 233.466 340.909 191.169 1.00 0.00 ? 576  GLN A C     1 
ATOM   4312  O  O     . GLN A  1  576  ? 234.574 340.413 191.343 1.00 0.00 ? 576  GLN A O     1 
ATOM   4313  C  CB    . GLN A  1  576  ? 233.819 343.154 192.177 1.00 0.00 ? 576  GLN A CB    1 
ATOM   4314  C  CG    . GLN A  1  576  ? 233.972 343.780 190.819 1.00 0.00 ? 576  GLN A CG    1 
ATOM   4315  C  CD    . GLN A  1  576  ? 234.401 345.201 190.938 1.00 0.00 ? 576  GLN A CD    1 
ATOM   4316  O  OE1   . GLN A  1  576  ? 234.524 345.721 192.044 1.00 0.00 ? 576  GLN A OE1   1 
ATOM   4317  N  NE2   . GLN A  1  576  ? 234.615 345.858 189.806 1.00 0.00 ? 576  GLN A NE2   1 
ATOM   4318  N  N     . PRO A  1  577  ? 232.720 340.662 190.077 1.00 0.00 ? 577  PRO A N     1 
ATOM   4319  C  CA    . PRO A  1  577  ? 233.040 339.638 189.085 1.00 0.00 ? 577  PRO A CA    1 
ATOM   4320  C  C     . PRO A  1  577  ? 234.396 339.856 188.481 1.00 0.00 ? 577  PRO A C     1 
ATOM   4321  O  O     . PRO A  1  577  ? 234.772 340.970 188.216 1.00 0.00 ? 577  PRO A O     1 
ATOM   4322  C  CB    . PRO A  1  577  ? 231.950 339.814 188.031 1.00 0.00 ? 577  PRO A CB    1 
ATOM   4323  C  CG    . PRO A  1  577  ? 231.494 341.192 188.187 1.00 0.00 ? 577  PRO A CG    1 
ATOM   4324  C  CD    . PRO A  1  577  ? 231.584 341.489 189.646 1.00 0.00 ? 577  PRO A CD    1 
ATOM   4325  N  N     . ALA A  1  578  ? 235.132 338.782 188.293 1.00 0.00 ? 578  ALA A N     1 
ATOM   4326  C  CA    . ALA A  1  578  ? 236.455 338.836 187.731 1.00 0.00 ? 578  ALA A CA    1 
ATOM   4327  C  C     . ALA A  1  578  ? 236.444 339.345 186.300 1.00 0.00 ? 578  ALA A C     1 
ATOM   4328  O  O     . ALA A  1  578  ? 237.481 339.701 185.774 1.00 0.00 ? 578  ALA A O     1 
ATOM   4329  C  CB    . ALA A  1  578  ? 237.090 337.473 187.808 1.00 0.00 ? 578  ALA A CB    1 
ATOM   4330  N  N     . ILE A  1  579  ? 235.301 339.340 185.636 1.00 0.00 ? 579  ILE A N     1 
ATOM   4331  C  CA    . ILE A  1  579  ? 235.262 339.974 184.328 1.00 0.00 ? 579  ILE A CA    1 
ATOM   4332  C  C     . ILE A  1  579  ? 234.182 341.061 184.304 1.00 0.00 ? 579  ILE A C     1 
ATOM   4333  O  O     . ILE A  1  579  ? 233.003 340.766 184.432 1.00 0.00 ? 579  ILE A O     1 
ATOM   4334  C  CB    . ILE A  1  579  ? 235.012 338.944 183.225 1.00 0.00 ? 579  ILE A CB    1 
ATOM   4335  C  CG1   . ILE A  1  579  ? 236.144 337.928 183.174 1.00 0.00 ? 579  ILE A CG1   1 
ATOM   4336  C  CG2   . ILE A  1  579  ? 234.904 339.617 181.891 1.00 0.00 ? 579  ILE A CG2   1 
ATOM   4337  C  CD1   . ILE A  1  579  ? 235.867 336.794 182.221 1.00 0.00 ? 579  ILE A CD1   1 
ATOM   4338  N  N     . LEU A  1  580  ? 234.570 342.324 184.152 1.00 0.00 ? 580  LEU A N     1 
ATOM   4339  C  CA    . LEU A  1  580  ? 233.585 343.400 184.181 1.00 0.00 ? 580  LEU A CA    1 
ATOM   4340  C  C     . LEU A  1  580  ? 232.871 343.647 182.855 1.00 0.00 ? 580  LEU A C     1 
ATOM   4341  O  O     . LEU A  1  580  ? 231.692 343.986 182.843 1.00 0.00 ? 580  LEU A O     1 
ATOM   4342  C  CB    . LEU A  1  580  ? 234.243 344.695 184.625 1.00 0.00 ? 580  LEU A CB    1 
ATOM   4343  C  CG    . LEU A  1  580  ? 234.490 344.823 186.121 1.00 0.00 ? 580  LEU A CG    1 
ATOM   4344  C  CD1   . LEU A  1  580  ? 234.798 346.285 186.462 1.00 0.00 ? 580  LEU A CD1   1 
ATOM   4345  C  CD2   . LEU A  1  580  ? 233.306 344.289 186.928 1.00 0.00 ? 580  LEU A CD2   1 
ATOM   4346  N  N     . LYS A  1  581  ? 233.577 343.467 181.744 1.00 0.00 ? 581  LYS A N     1 
ATOM   4347  C  CA    . LYS A  1  581  ? 233.022 343.762 180.429 1.00 0.00 ? 581  LYS A CA    1 
ATOM   4348  C  C     . LYS A  1  581  ? 233.454 342.704 179.438 1.00 0.00 ? 581  LYS A C     1 
ATOM   4349  O  O     . LYS A  1  581  ? 234.531 342.152 179.568 1.00 0.00 ? 581  LYS A O     1 
ATOM   4350  C  CB    . LYS A  1  581  ? 233.473 345.136 179.942 1.00 0.00 ? 581  LYS A CB    1 
ATOM   4351  C  CG    . LYS A  1  581  ? 232.927 346.292 180.746 1.00 0.00 ? 581  LYS A CG    1 
ATOM   4352  C  CD    . LYS A  1  581  ? 233.353 347.631 180.146 1.00 0.00 ? 581  LYS A CD    1 
ATOM   4353  C  CE    . LYS A  1  581  ? 232.729 347.830 178.775 1.00 0.00 ? 581  LYS A CE    1 
ATOM   4354  N  NZ    . LYS A  1  581  ? 231.242 347.667 178.849 1.00 0.00 ? 581  LYS A NZ    1 
ATOM   4355  N  N     . PRO A  1  582  ? 232.641 342.445 178.410 1.00 0.00 ? 582  PRO A N     1 
ATOM   4356  C  CA    . PRO A  1  582  ? 231.392 343.117 178.046 1.00 0.00 ? 582  PRO A CA    1 
ATOM   4357  C  C     . PRO A  1  582  ? 230.239 342.926 179.051 1.00 0.00 ? 582  PRO A C     1 
ATOM   4358  O  O     . PRO A  1  582  ? 229.456 343.854 179.264 1.00 0.00 ? 582  PRO A O     1 
ATOM   4359  C  CB    . PRO A  1  582  ? 231.038 342.474 176.698 1.00 0.00 ? 582  PRO A CB    1 
ATOM   4360  C  CG    . PRO A  1  582  ? 232.322 341.924 176.178 1.00 0.00 ? 582  PRO A CG    1 
ATOM   4361  C  CD    . PRO A  1  582  ? 233.042 341.454 177.399 1.00 0.00 ? 582  PRO A CD    1 
ATOM   4362  N  N     . ARG A  1  583  ? 230.170 341.758 179.685 1.00 0.00 ? 583  ARG A N     1 
ATOM   4363  C  CA    . ARG A  1  583  ? 229.118 341.465 180.660 1.00 0.00 ? 583  ARG A CA    1 
ATOM   4364  C  C     . ARG A  1  583  ? 229.685 340.778 181.904 1.00 0.00 ? 583  ARG A C     1 
ATOM   4365  O  O     . ARG A  1  583  ? 230.593 339.946 181.816 1.00 0.00 ? 583  ARG A O     1 
ATOM   4366  C  CB    . ARG A  1  583  ? 228.037 340.591 180.015 1.00 0.00 ? 583  ARG A CB    1 
ATOM   4367  C  CG    . ARG A  1  583  ? 228.620 339.379 179.318 1.00 0.00 ? 583  ARG A CG    1 
ATOM   4368  C  CD    . ARG A  1  583  ? 227.553 338.529 178.665 1.00 0.00 ? 583  ARG A CD    1 
ATOM   4369  N  NE    . ARG A  1  583  ? 226.718 337.835 179.652 1.00 0.00 ? 583  ARG A NE    1 
ATOM   4370  C  CZ    . ARG A  1  583  ? 225.774 336.940 179.346 1.00 0.00 ? 583  ARG A CZ    1 
ATOM   4371  N  NH1   . ARG A  1  583  ? 225.535 336.642 178.072 1.00 0.00 ? 583  ARG A NH1   1 
ATOM   4372  N  NH2   . ARG A  1  583  ? 225.072 336.336 180.304 1.00 0.00 ? 583  ARG A NH2   1 
ATOM   4373  N  N     . PRO A  1  584  ? 229.120 341.100 183.073 1.00 0.00 ? 584  PRO A N     1 
ATOM   4374  C  CA    . PRO A  1  584  ? 229.657 340.569 184.327 1.00 0.00 ? 584  PRO A CA    1 
ATOM   4375  C  C     . PRO A  1  584  ? 229.678 339.037 184.365 1.00 0.00 ? 584  PRO A C     1 
ATOM   4376  O  O     . PRO A  1  584  ? 228.697 338.393 184.005 1.00 0.00 ? 584  PRO A O     1 
ATOM   4377  C  CB    . PRO A  1  584  ? 228.712 341.154 185.388 1.00 0.00 ? 584  PRO A CB    1 
ATOM   4378  C  CG    . PRO A  1  584  ? 227.469 341.525 184.655 1.00 0.00 ? 584  PRO A CG    1 
ATOM   4379  C  CD    . PRO A  1  584  ? 227.931 341.940 183.288 1.00 0.00 ? 584  PRO A CD    1 
ATOM   4380  N  N     . LEU A  1  585  ? 230.837 338.492 184.741 1.00 0.00 ? 585  LEU A N     1 
ATOM   4381  C  CA    . LEU A  1  585  ? 231.059 337.064 184.922 1.00 0.00 ? 585  LEU A CA    1 
ATOM   4382  C  C     . LEU A  1  585  ? 231.949 336.807 186.116 1.00 0.00 ? 585  LEU A C     1 
ATOM   4383  O  O     . LEU A  1  585  ? 232.946 337.494 186.282 1.00 0.00 ? 585  LEU A O     1 
ATOM   4384  C  CB    . LEU A  1  585  ? 231.767 336.486 183.715 1.00 0.00 ? 585  LEU A CB    1 
ATOM   4385  C  CG    . LEU A  1  585  ? 230.942 336.466 182.450 1.00 0.00 ? 585  LEU A CG    1 
ATOM   4386  C  CD1   . LEU A  1  585  ? 231.832 336.053 181.291 1.00 0.00 ? 585  LEU A CD1   1 
ATOM   4387  C  CD2   . LEU A  1  585  ? 229.760 335.544 182.630 1.00 0.00 ? 585  LEU A CD2   1 
ATOM   4388  N  N     . TRP A  1  586  ? 231.653 335.781 186.901 1.00 0.00 ? 586  TRP A N     1 
ATOM   4389  C  CA    . TRP A  1  586  ? 232.490 335.430 188.049 1.00 0.00 ? 586  TRP A CA    1 
ATOM   4390  C  C     . TRP A  1  586  ? 233.136 334.131 187.717 1.00 0.00 ? 586  TRP A C     1 
ATOM   4391  O  O     . TRP A  1  586  ? 232.479 333.222 187.248 1.00 0.00 ? 586  TRP A O     1 
ATOM   4392  C  CB    . TRP A  1  586  ? 231.714 335.239 189.344 1.00 0.00 ? 586  TRP A CB    1 
ATOM   4393  C  CG    . TRP A  1  586  ? 231.073 336.371 189.969 1.00 0.00 ? 586  TRP A CG    1 
ATOM   4394  C  CD1   . TRP A  1  586  ? 231.501 336.994 191.082 1.00 0.00 ? 586  TRP A CD1   1 
ATOM   4395  C  CD2   . TRP A  1  586  ? 229.936 337.095 189.508 1.00 0.00 ? 586  TRP A CD2   1 
ATOM   4396  N  NE1   . TRP A  1  586  ? 230.666 338.025 191.396 1.00 0.00 ? 586  TRP A NE1   1 
ATOM   4397  C  CE2   . TRP A  1  586  ? 229.702 338.122 190.428 1.00 0.00 ? 586  TRP A CE2   1 
ATOM   4398  C  CE3   . TRP A  1  586  ? 229.078 336.963 188.415 1.00 0.00 ? 586  TRP A CE3   1 
ATOM   4399  C  CZ2   . TRP A  1  586  ? 228.650 339.017 190.291 1.00 0.00 ? 586  TRP A CZ2   1 
ATOM   4400  C  CZ3   . TRP A  1  586  ? 228.025 337.847 188.285 1.00 0.00 ? 586  TRP A CZ3   1 
ATOM   4401  C  CH2   . TRP A  1  586  ? 227.822 338.861 189.214 1.00 0.00 ? 586  TRP A CH2   1 
ATOM   4402  N  N     . THR A  1  587  ? 234.389 333.966 188.066 1.00 0.00 ? 587  THR A N     1 
ATOM   4403  C  CA    . THR A  1  587  ? 234.999 332.718 187.702 1.00 0.00 ? 587  THR A CA    1 
ATOM   4404  C  C     . THR A  1  587  ? 234.633 331.694 188.768 1.00 0.00 ? 587  THR A C     1 
ATOM   4405  O  O     . THR A  1  587  ? 234.372 332.029 189.935 1.00 0.00 ? 587  THR A O     1 
ATOM   4406  C  CB    . THR A  1  587  ? 236.468 332.903 187.547 1.00 0.00 ? 587  THR A CB    1 
ATOM   4407  O  OG1   . THR A  1  587  ? 237.016 333.113 188.840 1.00 0.00 ? 587  THR A OG1   1 
ATOM   4408  C  CG2   . THR A  1  587  ? 236.694 334.175 186.874 1.00 0.00 ? 587  THR A CG2   1 
ATOM   4409  N  N     . GLY A  1  588  ? 234.805 330.430 188.441 1.00 0.00 ? 588  GLY A N     1 
ATOM   4410  C  CA    . GLY A  1  588  ? 234.594 329.428 189.452 1.00 0.00 ? 588  GLY A CA    1 
ATOM   4411  C  C     . GLY A  1  588  ? 235.430 329.547 190.668 1.00 0.00 ? 588  GLY A C     1 
ATOM   4412  O  O     . GLY A  1  588  ? 234.846 329.606 191.724 1.00 0.00 ? 588  GLY A O     1 
ATOM   4413  N  N     . LYS A  1  589  ? 236.710 329.820 190.529 1.00 0.00 ? 589  LYS A N     1 
ATOM   4414  C  CA    . LYS A  1  589  ? 237.521 330.014 191.703 1.00 0.00 ? 589  LYS A CA    1 
ATOM   4415  C  C     . LYS A  1  589  ? 236.949 331.114 192.505 1.00 0.00 ? 589  LYS A C     1 
ATOM   4416  O  O     . LYS A  1  589  ? 237.023 331.079 193.719 1.00 0.00 ? 589  LYS A O     1 
ATOM   4417  C  CB    . LYS A  1  589  ? 238.984 330.224 191.380 1.00 0.00 ? 589  LYS A CB    1 
ATOM   4418  C  CG    . LYS A  1  589  ? 239.503 329.098 190.568 1.00 0.00 ? 589  LYS A CG    1 
ATOM   4419  C  CD    . LYS A  1  589  ? 240.978 329.093 190.584 1.00 0.00 ? 589  LYS A CD    1 
ATOM   4420  C  CE    . LYS A  1  589  ? 241.477 328.524 189.276 1.00 0.00 ? 589  LYS A CE    1 
ATOM   4421  N  NZ    . LYS A  1  589  ? 241.152 327.090 189.064 1.00 0.00 ? 589  LYS A NZ    1 
ATOM   4422  N  N     . GLN A  1  590  ? 236.433 332.123 191.867 1.00 0.00 ? 590  GLN A N     1 
ATOM   4423  C  CA    . GLN A  1  590  ? 235.965 333.201 192.677 1.00 0.00 ? 590  GLN A CA    1 
ATOM   4424  C  C     . GLN A  1  590  ? 234.810 332.782 193.615 1.00 0.00 ? 590  GLN A C     1 
ATOM   4425  O  O     . GLN A  1  590  ? 234.810 333.104 194.815 1.00 0.00 ? 590  GLN A O     1 
ATOM   4426  C  CB    . GLN A  1  590  ? 235.589 334.340 191.805 1.00 0.00 ? 590  GLN A CB    1 
ATOM   4427  C  CG    . GLN A  1  590  ? 235.429 335.535 192.604 1.00 0.00 ? 590  GLN A CG    1 
ATOM   4428  C  CD    . GLN A  1  590  ? 235.004 336.582 191.734 1.00 0.00 ? 590  GLN A CD    1 
ATOM   4429  O  OE1   . GLN A  1  590  ? 234.421 336.306 190.696 1.00 0.00 ? 590  GLN A OE1   1 
ATOM   4430  N  NE2   . GLN A  1  590  ? 235.332 337.802 192.073 1.00 0.00 ? 590  GLN A NE2   1 
ATOM   4431  N  N     . ILE A  1  591  ? 233.804 332.113 193.086 1.00 0.00 ? 591  ILE A N     1 
ATOM   4432  C  CA    . ILE A  1  591  ? 232.735 331.663 193.982 1.00 0.00 ? 591  ILE A CA    1 
ATOM   4433  C  C     . ILE A  1  591  ? 233.168 330.560 194.998 1.00 0.00 ? 591  ILE A C     1 
ATOM   4434  O  O     . ILE A  1  591  ? 232.623 330.449 196.101 1.00 0.00 ? 591  ILE A O     1 
ATOM   4435  C  CB    . ILE A  1  591  ? 231.520 331.124 193.173 1.00 0.00 ? 591  ILE A CB    1 
ATOM   4436  C  CG1   . ILE A  1  591  ? 231.013 332.210 192.217 1.00 0.00 ? 591  ILE A CG1   1 
ATOM   4437  C  CG2   . ILE A  1  591  ? 230.390 330.541 194.130 1.00 0.00 ? 591  ILE A CG2   1 
ATOM   4438  C  CD1   . ILE A  1  591  ? 230.712 333.519 192.919 1.00 0.00 ? 591  ILE A CD1   1 
ATOM   4439  N  N     . PHE A  1  592  ? 234.075 329.674 194.611 1.00 0.00 ? 592  PHE A N     1 
ATOM   4440  C  CA    . PHE A  1  592  ? 234.606 328.758 195.601 1.00 0.00 ? 592  PHE A CA    1 
ATOM   4441  C  C     . PHE A  1  592  ? 235.233 329.569 196.748 1.00 0.00 ? 592  PHE A C     1 
ATOM   4442  O  O     . PHE A  1  592  ? 234.962 329.311 197.920 1.00 0.00 ? 592  PHE A O     1 
ATOM   4443  C  CB    . PHE A  1  592  ? 235.615 327.757 195.021 1.00 0.00 ? 592  PHE A CB    1 
ATOM   4444  C  CG    . PHE A  1  592  ? 236.001 326.694 196.019 1.00 0.00 ? 592  PHE A CG    1 
ATOM   4445  C  CD1   . PHE A  1  592  ? 235.236 325.540 196.127 1.00 0.00 ? 592  PHE A CD1   1 
ATOM   4446  C  CD2   . PHE A  1  592  ? 237.066 326.865 196.911 1.00 0.00 ? 592  PHE A CD2   1 
ATOM   4447  C  CE1   . PHE A  1  592  ? 235.543 324.564 197.060 1.00 0.00 ? 592  PHE A CE1   1 
ATOM   4448  C  CE2   . PHE A  1  592  ? 237.378 325.869 197.867 1.00 0.00 ? 592  PHE A CE2   1 
ATOM   4449  C  CZ    . PHE A  1  592  ? 236.604 324.728 197.932 1.00 0.00 ? 592  PHE A CZ    1 
ATOM   4450  N  N     . SER A  1  593  ? 235.917 330.656 196.419 1.00 0.00 ? 593  SER A N     1 
ATOM   4451  C  CA    . SER A  1  593  ? 236.590 331.450 197.458 1.00 0.00 ? 593  SER A CA    1 
ATOM   4452  C  C     . SER A  1  593  ? 235.726 332.098 198.583 1.00 0.00 ? 593  SER A C     1 
ATOM   4453  O  O     . SER A  1  593  ? 236.268 332.545 199.619 1.00 0.00 ? 593  SER A O     1 
ATOM   4454  C  CB    . SER A  1  593  ? 237.409 332.527 196.753 1.00 0.00 ? 593  SER A CB    1 
ATOM   4455  O  OG    . SER A  1  593  ? 238.415 331.918 195.954 1.00 0.00 ? 593  SER A OG    1 
ATOM   4456  N  N     . LEU A  1  594  ? 234.420 332.220 198.363 1.00 0.00 ? 594  LEU A N     1 
ATOM   4457  C  CA    . LEU A  1  594  ? 233.484 332.620 199.433 1.00 0.00 ? 594  LEU A CA    1 
ATOM   4458  C  C     . LEU A  1  594  ? 233.302 331.478 200.440 1.00 0.00 ? 594  LEU A C     1 
ATOM   4459  O  O     . LEU A  1  594  ? 232.933 331.736 201.583 1.00 0.00 ? 594  LEU A O     1 
ATOM   4460  C  CB    . LEU A  1  594  ? 232.153 333.116 198.922 1.00 0.00 ? 594  LEU A CB    1 
ATOM   4461  C  CG    . LEU A  1  594  ? 232.430 334.245 197.956 1.00 0.00 ? 594  LEU A CG    1 
ATOM   4462  C  CD1   . LEU A  1  594  ? 231.102 334.680 197.343 1.00 0.00 ? 594  LEU A CD1   1 
ATOM   4463  C  CD2   . LEU A  1  594  ? 233.173 335.360 198.694 1.00 0.00 ? 594  LEU A CD2   1 
ATOM   4464  N  N     . ILE A  1  595  ? 233.360 330.226 199.958 1.00 0.00 ? 595  ILE A N     1 
ATOM   4465  C  CA    . ILE A  1  595  ? 233.230 329.043 200.810 1.00 0.00 ? 595  ILE A CA    1 
ATOM   4466  C  C     . ILE A  1  595  ? 234.355 328.819 201.817 1.00 0.00 ? 595  ILE A C     1 
ATOM   4467  O  O     . ILE A  1  595  ? 234.115 328.287 202.904 1.00 0.00 ? 595  ILE A O     1 
ATOM   4468  C  CB    . ILE A  1  595  ? 233.115 327.781 199.990 1.00 0.00 ? 595  ILE A CB    1 
ATOM   4469  C  CG1   . ILE A  1  595  ? 231.946 327.916 199.045 1.00 0.00 ? 595  ILE A CG1   1 
ATOM   4470  C  CG2   . ILE A  1  595  ? 232.741 326.649 200.850 1.00 0.00 ? 595  ILE A CG2   1 
ATOM   4471  C  CD1   . ILE A  1  595  ? 231.684 326.668 198.204 1.00 0.00 ? 595  ILE A CD1   1 
ATOM   4472  N  N     . ILE A  1  596  ? 235.571 329.233 201.498 1.00 0.00 ? 596  ILE A N     1 
ATOM   4473  C  CA    . ILE A  1  596  ? 236.650 329.104 202.482 1.00 0.00 ? 596  ILE A CA    1 
ATOM   4474  C  C     . ILE A  1  596  ? 236.544 330.027 203.718 1.00 0.00 ? 596  ILE A C     1 
ATOM   4475  O  O     . ILE A  1  596  ? 236.620 331.269 203.590 1.00 0.00 ? 596  ILE A O     1 
ATOM   4476  C  CB    . ILE A  1  596  ? 237.980 329.303 201.790 1.00 0.00 ? 596  ILE A CB    1 
ATOM   4477  C  CG1   . ILE A  1  596  ? 238.115 328.147 200.805 1.00 0.00 ? 596  ILE A CG1   1 
ATOM   4478  C  CG2   . ILE A  1  596  ? 239.135 329.344 202.807 1.00 0.00 ? 596  ILE A CG2   1 
ATOM   4479  C  CD1   . ILE A  1  596  ? 239.399 328.093 200.100 1.00 0.00 ? 596  ILE A CD1   1 
ATOM   4480  N  N     . PRO A  1  597  ? 236.415 329.409 204.921 1.00 0.00 ? 597  PRO A N     1 
ATOM   4481  C  CA    . PRO A  1  597  ? 236.179 330.062 206.219 1.00 0.00 ? 597  PRO A CA    1 
ATOM   4482  C  C     . PRO A  1  597  ? 237.378 330.819 206.749 1.00 0.00 ? 597  PRO A C     1 
ATOM   4483  O  O     . PRO A  1  597  ? 238.495 330.291 206.745 1.00 0.00 ? 597  PRO A O     1 
ATOM   4484  C  CB    . PRO A  1  597  ? 235.875 328.896 207.142 1.00 0.00 ? 597  PRO A CB    1 
ATOM   4485  C  CG    . PRO A  1  597  ? 236.657 327.784 206.555 1.00 0.00 ? 597  PRO A CG    1 
ATOM   4486  C  CD    . PRO A  1  597  ? 236.596 327.955 205.075 1.00 0.00 ? 597  PRO A CD    1 
ATOM   4487  N  N     . GLY A  1  598  ? 237.122 332.039 207.214 1.00 0.00 ? 598  GLY A N     1 
ATOM   4488  C  CA    . GLY A  1  598  ? 238.135 332.925 207.772 1.00 0.00 ? 598  GLY A CA    1 
ATOM   4489  C  C     . GLY A  1  598  ? 239.285 333.243 206.832 1.00 0.00 ? 598  GLY A C     1 
ATOM   4490  O  O     . GLY A  1  598  ? 239.121 334.013 205.870 1.00 0.00 ? 598  GLY A O     1 
ATOM   4491  N  N     . HIS A  1  599  ? 240.446 332.650 207.101 1.00 0.00 ? 599  HIS A N     1 
ATOM   4492  C  CA    . HIS A  1  599  ? 241.593 332.857 206.236 1.00 0.00 ? 599  HIS A CA    1 
ATOM   4493  C  C     . HIS A  1  599  ? 242.686 331.797 206.379 1.00 0.00 ? 599  HIS A C     1 
ATOM   4494  O  O     . HIS A  1  599  ? 243.810 332.112 206.718 1.00 0.00 ? 599  HIS A O     1 
ATOM   4495  C  CB    . HIS A  1  599  ? 242.165 334.277 206.454 1.00 0.00 ? 599  HIS A CB    1 
ATOM   4496  C  CG    . HIS A  1  599  ? 242.440 334.641 207.889 1.00 0.00 ? 599  HIS A CG    1 
ATOM   4497  N  ND1   . HIS A  1  599  ? 243.435 334.048 208.638 1.00 0.00 ? 599  HIS A ND1   1 
ATOM   4498  C  CD2   . HIS A  1  599  ? 241.868 335.570 208.698 1.00 0.00 ? 599  HIS A CD2   1 
ATOM   4499  C  CE1   . HIS A  1  599  ? 243.458 334.584 209.846 1.00 0.00 ? 599  HIS A CE1   1 
ATOM   4500  N  NE2   . HIS A  1  599  ? 242.516 335.509 209.910 1.00 0.00 ? 599  HIS A NE2   1 
ATOM   4501  N  N     . ILE A  1  600  ? 242.375 330.540 206.109 1.00 0.00 ? 600  ILE A N     1 
ATOM   4502  C  CA    . ILE A  1  600  ? 243.405 329.514 206.241 1.00 0.00 ? 600  ILE A CA    1 
ATOM   4503  C  C     . ILE A  1  600  ? 244.417 329.566 205.082 1.00 0.00 ? 600  ILE A C     1 
ATOM   4504  O  O     . ILE A  1  600  ? 244.131 330.150 204.065 1.00 0.00 ? 600  ILE A O     1 
ATOM   4505  C  CB    . ILE A  1  600  ? 242.782 328.126 206.293 1.00 0.00 ? 600  ILE A CB    1 
ATOM   4506  C  CG1   . ILE A  1  600  ? 242.259 327.724 204.928 1.00 0.00 ? 600  ILE A CG1   1 
ATOM   4507  C  CG2   . ILE A  1  600  ? 241.648 328.058 207.323 1.00 0.00 ? 600  ILE A CG2   1 
ATOM   4508  C  CD1   . ILE A  1  600  ? 241.847 326.283 204.916 1.00 0.00 ? 600  ILE A CD1   1 
ATOM   4509  N  N     . ASN A  1  601  ? 245.587 328.948 205.211 1.00 0.00 ? 601  ASN A N     1 
ATOM   4510  C  CA    . ASN A  1  601  ? 246.573 328.977 204.122 1.00 0.00 ? 601  ASN A CA    1 
ATOM   4511  C  C     . ASN A  1  601  ? 247.312 327.670 203.800 1.00 0.00 ? 601  ASN A C     1 
ATOM   4512  O  O     . ASN A  1  601  ? 247.906 327.027 204.691 1.00 0.00 ? 601  ASN A O     1 
ATOM   4513  C  CB    . ASN A  1  601  ? 247.627 330.005 204.437 1.00 0.00 ? 601  ASN A CB    1 
ATOM   4514  C  CG    . ASN A  1  601  ? 247.050 331.315 204.709 1.00 0.00 ? 601  ASN A CG    1 
ATOM   4515  O  OD1   . ASN A  1  601  ? 247.330 331.926 205.731 1.00 0.00 ? 601  ASN A OD1   1 
ATOM   4516  N  ND2   . ASN A  1  601  ? 246.226 331.781 203.801 1.00 0.00 ? 601  ASN A ND2   1 
ATOM   4517  N  N     . CYS A  1  602  ? 247.373 327.316 202.522 1.00 0.00 ? 602  CYS A N     1 
ATOM   4518  C  CA    . CYS A  1  602  ? 248.211 326.185 202.144 1.00 0.00 ? 602  CYS A CA    1 
ATOM   4519  C  C     . CYS A  1  602  ? 248.604 326.147 200.678 1.00 0.00 ? 602  CYS A C     1 
ATOM   4520  O  O     . CYS A  1  602  ? 247.778 326.240 199.782 1.00 0.00 ? 602  CYS A O     1 
ATOM   4521  C  CB    . CYS A  1  602  ? 247.500 324.899 202.487 1.00 0.00 ? 602  CYS A CB    1 
ATOM   4522  S  SG    . CYS A  1  602  ? 245.913 324.812 201.666 1.00 0.00 ? 602  CYS A SG    1 
ATOM   4523  N  N     . ILE A  1  603  ? 249.889 325.980 200.444 1.00 0.00 ? 603  ILE A N     1 
ATOM   4524  C  CA    . ILE A  1  603  ? 250.397 325.841 199.110 1.00 0.00 ? 603  ILE A CA    1 
ATOM   4525  C  C     . ILE A  1  603  ? 250.203 324.374 198.781 1.00 0.00 ? 603  ILE A C     1 
ATOM   4526  O  O     . ILE A  1  603  ? 249.774 323.600 199.635 1.00 0.00 ? 603  ILE A O     1 
ATOM   4527  C  CB    . ILE A  1  603  ? 251.897 326.305 199.037 1.00 0.00 ? 603  ILE A CB    1 
ATOM   4528  C  CG1   . ILE A  1  603  ? 252.372 326.555 197.590 1.00 0.00 ? 603  ILE A CG1   1 
ATOM   4529  C  CG2   . ILE A  1  603  ? 252.817 325.377 199.850 1.00 0.00 ? 603  ILE A CG2   1 
ATOM   4530  C  CD1   . ILE A  1  603  ? 253.757 327.244 197.459 1.00 0.00 ? 603  ILE A CD1   1 
ATOM   4531  N  N     . ARG A  1  604  ? 250.461 324.009 197.533 1.00 0.00 ? 604  ARG A N     1 
ATOM   4532  C  CA    . ARG A  1  604  ? 250.564 322.609 197.128 1.00 0.00 ? 604  ARG A CA    1 
ATOM   4533  C  C     . ARG A  1  604  ? 249.314 321.808 197.452 1.00 0.00 ? 604  ARG A C     1 
ATOM   4534  O  O     . ARG A  1  604  ? 248.233 322.076 196.922 1.00 0.00 ? 604  ARG A O     1 
ATOM   4535  C  CB    . ARG A  1  604  ? 251.795 321.975 197.791 1.00 0.00 ? 604  ARG A CB    1 
ATOM   4536  C  CG    . ARG A  1  604  ? 252.286 320.651 197.201 1.00 0.00 ? 604  ARG A CG    1 
ATOM   4537  C  CD    . ARG A  1  604  ? 253.615 320.252 197.829 1.00 0.00 ? 604  ARG A CD    1 
ATOM   4538  N  NE    . ARG A  1  604  ? 254.693 321.120 197.353 1.00 0.00 ? 604  ARG A NE    1 
ATOM   4539  C  CZ    . ARG A  1  604  ? 255.124 322.217 197.975 1.00 0.00 ? 604  ARG A CZ    1 
ATOM   4540  N  NH1   . ARG A  1  604  ? 254.581 322.591 199.130 1.00 0.00 ? 604  ARG A NH1   1 
ATOM   4541  N  NH2   . ARG A  1  604  ? 256.105 322.935 197.435 1.00 0.00 ? 604  ARG A NH2   1 
ATOM   4542  N  N     . THR A  1  605  ? 249.486 320.840 198.347 1.00 0.00 ? 605  THR A N     1 
ATOM   4543  C  CA    . THR A  1  605  ? 248.436 319.942 198.793 1.00 0.00 ? 605  THR A CA    1 
ATOM   4544  C  C     . THR A  1  605  ? 247.482 319.605 197.643 1.00 0.00 ? 605  THR A C     1 
ATOM   4545  O  O     . THR A  1  605  ? 246.258 319.651 197.802 1.00 0.00 ? 605  THR A O     1 
ATOM   4546  C  CB    . THR A  1  605  ? 247.684 320.544 199.957 1.00 0.00 ? 605  THR A CB    1 
ATOM   4547  O  OG1   . THR A  1  605  ? 247.272 321.866 199.602 1.00 0.00 ? 605  THR A OG1   1 
ATOM   4548  C  CG2   . THR A  1  605  ? 248.607 320.599 201.172 1.00 0.00 ? 605  THR A CG2   1 
ATOM   4549  N  N     . HIS A  1  606  ? 248.094 319.298 196.488 1.00 0.00 ? 606  HIS A N     1 
ATOM   4550  C  CA    . HIS A  1  606  ? 247.456 318.832 195.243 1.00 0.00 ? 606  HIS A CA    1 
ATOM   4551  C  C     . HIS A  1  606  ? 248.024 317.459 194.767 1.00 0.00 ? 606  HIS A C     1 
ATOM   4552  O  O     . HIS A  1  606  ? 247.254 316.524 194.546 1.00 0.00 ? 606  HIS A O     1 
ATOM   4553  C  CB    . HIS A  1  606  ? 247.683 319.837 194.138 1.00 0.00 ? 606  HIS A CB    1 
ATOM   4554  C  CG    . HIS A  1  606  ? 249.116 319.911 193.771 1.00 0.00 ? 606  HIS A CG    1 
ATOM   4555  N  ND1   . HIS A  1  606  ? 250.081 320.216 194.704 1.00 0.00 ? 606  HIS A ND1   1 
ATOM   4556  C  CD2   . HIS A  1  606  ? 249.775 319.527 192.655 1.00 0.00 ? 606  HIS A CD2   1 
ATOM   4557  C  CE1   . HIS A  1  606  ? 251.270 320.118 194.145 1.00 0.00 ? 606  HIS A CE1   1 
ATOM   4558  N  NE2   . HIS A  1  606  ? 251.114 319.701 192.901 1.00 0.00 ? 606  HIS A NE2   1 
ATOM   4559  N  N     . SER A  1  607  ? 249.360 317.343 194.638 1.00 0.00 ? 607  SER A N     1 
ATOM   4560  C  CA    . SER A  1  607  ? 250.067 316.235 193.945 1.00 0.00 ? 607  SER A CA    1 
ATOM   4561  C  C     . SER A  1  607  ? 249.247 315.565 192.816 1.00 0.00 ? 607  SER A C     1 
ATOM   4562  O  O     . SER A  1  607  ? 249.316 314.342 192.610 1.00 0.00 ? 607  SER A O     1 
ATOM   4563  C  CB    . SER A  1  607  ? 250.515 315.161 194.954 1.00 0.00 ? 607  SER A CB    1 
ATOM   4564  O  OG    . SER A  1  607  ? 250.804 315.697 196.238 1.00 0.00 ? 607  SER A OG    1 
ATOM   4565  N  N     . THR A  1  608  ? 248.478 316.393 192.101 1.00 0.00 ? 608  THR A N     1 
ATOM   4566  C  CA    . THR A  1  608  ? 247.647 315.992 190.963 1.00 0.00 ? 608  THR A CA    1 
ATOM   4567  C  C     . THR A  1  608  ? 248.517 315.359 189.865 1.00 0.00 ? 608  THR A C     1 
ATOM   4568  O  O     . THR A  1  608  ? 249.737 315.521 189.881 1.00 0.00 ? 608  THR A O     1 
ATOM   4569  C  CB    . THR A  1  608  ? 246.838 317.220 190.403 1.00 0.00 ? 608  THR A CB    1 
ATOM   4570  O  OG1   . THR A  1  608  ? 247.729 318.300 190.111 1.00 0.00 ? 608  THR A OG1   1 
ATOM   4571  C  CG2   . THR A  1  608  ? 245.824 317.736 191.421 1.00 0.00 ? 608  THR A CG2   1 
ATOM   4572  N  N     . HIS A  1  609  ? 247.914 314.609 188.943 1.00 0.00 ? 609  HIS A N     1 
ATOM   4573  C  CA    . HIS A  1  609  ? 248.688 314.029 187.839 1.00 0.00 ? 609  HIS A CA    1 
ATOM   4574  C  C     . HIS A  1  609  ? 249.504 315.122 187.134 1.00 0.00 ? 609  HIS A C     1 
ATOM   4575  O  O     . HIS A  1  609  ? 250.666 314.906 186.797 1.00 0.00 ? 609  HIS A O     1 
ATOM   4576  C  CB    . HIS A  1  609  ? 247.772 313.294 186.837 1.00 0.00 ? 609  HIS A CB    1 
ATOM   4577  C  CG    . HIS A  1  609  ? 248.502 312.555 185.745 1.00 0.00 ? 609  HIS A CG    1 
ATOM   4578  N  ND1   . HIS A  1  609  ? 249.121 311.337 185.943 1.00 0.00 ? 609  HIS A ND1   1 
ATOM   4579  C  CD2   . HIS A  1  609  ? 248.680 312.853 184.433 1.00 0.00 ? 609  HIS A CD2   1 
ATOM   4580  C  CE1   . HIS A  1  609  ? 249.666 310.930 184.809 1.00 0.00 ? 609  HIS A CE1   1 
ATOM   4581  N  NE2   . HIS A  1  609  ? 249.413 311.831 183.878 1.00 0.00 ? 609  HIS A NE2   1 
ATOM   4582  N  N     . PRO A  1  610  ? 248.796 316.211 186.854 1.00 0.00 ? 610  PRO A N     1 
ATOM   4583  C  CA    . PRO A  1  610  ? 249.276 317.399 186.145 1.00 0.00 ? 610  PRO A CA    1 
ATOM   4584  C  C     . PRO A  1  610  ? 250.775 317.623 186.051 1.00 0.00 ? 610  PRO A C     1 
ATOM   4585  O  O     . PRO A  1  610  ? 251.580 317.084 186.812 1.00 0.00 ? 610  PRO A O     1 
ATOM   4586  C  CB    . PRO A  1  610  ? 248.636 318.548 186.933 1.00 0.00 ? 610  PRO A CB    1 
ATOM   4587  C  CG    . PRO A  1  610  ? 247.388 317.960 187.494 1.00 0.00 ? 610  PRO A CG    1 
ATOM   4588  C  CD    . PRO A  1  610  ? 247.719 316.528 187.808 1.00 0.00 ? 610  PRO A CD    1 
ATOM   4589  N  N     . ASP A  1  611  ? 251.112 318.441 185.061 1.00 0.00 ? 611  ASP A N     1 
ATOM   4590  C  CA    . ASP A  1  611  ? 252.467 318.886 184.769 1.00 0.00 ? 611  ASP A CA    1 
ATOM   4591  C  C     . ASP A  1  611  ? 253.565 317.872 184.445 1.00 0.00 ? 611  ASP A C     1 
ATOM   4592  O  O     . ASP A  1  611  ? 253.403 316.954 183.641 1.00 0.00 ? 611  ASP A O     1 
ATOM   4593  C  CB    . ASP A  1  611  ? 252.960 319.834 185.873 1.00 0.00 ? 611  ASP A CB    1 
ATOM   4594  C  CG    . ASP A  1  611  ? 252.752 321.294 185.523 1.00 0.00 ? 611  ASP A CG    1 
ATOM   4595  O  OD1   . ASP A  1  611  ? 252.009 321.576 184.560 1.00 0.00 ? 611  ASP A OD1   1 
ATOM   4596  O  OD2   . ASP A  1  611  ? 253.333 322.160 186.211 1.00 0.00 ? 611  ASP A OD2   1 
ATOM   4597  N  N     . ASP A  1  612  ? 254.684 318.096 185.117 1.00 0.00 ? 612  ASP A N     1 
ATOM   4598  C  CA    . ASP A  1  612  ? 255.949 317.392 184.960 1.00 0.00 ? 612  ASP A CA    1 
ATOM   4599  C  C     . ASP A  1  612  ? 256.682 317.266 186.290 1.00 0.00 ? 612  ASP A C     1 
ATOM   4600  O  O     . ASP A  1  612  ? 257.611 318.024 186.575 1.00 0.00 ? 612  ASP A O     1 
ATOM   4601  C  CB    . ASP A  1  612  ? 256.829 318.109 183.935 1.00 0.00 ? 612  ASP A CB    1 
ATOM   4602  C  CG    . ASP A  1  612  ? 258.141 317.396 183.693 1.00 0.00 ? 612  ASP A CG    1 
ATOM   4603  O  OD1   . ASP A  1  612  ? 258.132 316.350 183.010 1.00 0.00 ? 612  ASP A OD1   1 
ATOM   4604  O  OD2   . ASP A  1  612  ? 259.179 317.882 184.186 1.00 0.00 ? 612  ASP A OD2   1 
ATOM   4605  N  N     . GLU A  1  613  ? 256.199 316.331 187.099 1.00 0.00 ? 613  GLU A N     1 
ATOM   4606  C  CA    . GLU A  1  613  ? 256.781 316.079 188.395 1.00 0.00 ? 613  GLU A CA    1 
ATOM   4607  C  C     . GLU A  1  613  ? 258.284 316.250 188.307 1.00 0.00 ? 613  GLU A C     1 
ATOM   4608  O  O     . GLU A  1  613  ? 258.883 316.121 187.235 1.00 0.00 ? 613  GLU A O     1 
ATOM   4609  C  CB    . GLU A  1  613  ? 256.437 314.668 188.874 1.00 0.00 ? 613  GLU A CB    1 
ATOM   4610  C  CG    . GLU A  1  613  ? 256.565 314.473 190.376 1.00 0.00 ? 613  GLU A CG    1 
ATOM   4611  C  CD    . GLU A  1  613  ? 255.254 314.077 191.025 1.00 0.00 ? 613  GLU A CD    1 
ATOM   4612  O  OE1   . GLU A  1  613  ? 254.248 313.935 190.299 1.00 0.00 ? 613  GLU A OE1   1 
ATOM   4613  O  OE2   . GLU A  1  613  ? 255.229 313.908 192.263 1.00 0.00 ? 613  GLU A OE2   1 
ATOM   4614  N  N     . ASP A  1  614  ? 258.873 316.567 189.449 1.00 0.00 ? 614  ASP A N     1 
ATOM   4615  C  CA    . ASP A  1  614  ? 260.309 316.750 189.583 1.00 0.00 ? 614  ASP A CA    1 
ATOM   4616  C  C     . ASP A  1  614  ? 260.999 317.798 188.700 1.00 0.00 ? 614  ASP A C     1 
ATOM   4617  O  O     . ASP A  1  614  ? 262.118 318.185 189.034 1.00 0.00 ? 614  ASP A O     1 
ATOM   4618  C  CB    . ASP A  1  614  ? 261.051 315.405 189.496 1.00 0.00 ? 614  ASP A CB    1 
ATOM   4619  C  CG    . ASP A  1  614  ? 262.530 315.535 189.798 1.00 0.00 ? 614  ASP A CG    1 
ATOM   4620  O  OD1   . ASP A  1  614  ? 262.875 315.899 190.942 1.00 0.00 ? 614  ASP A OD1   1 
ATOM   4621  O  OD2   . ASP A  1  614  ? 263.349 315.272 188.892 1.00 0.00 ? 614  ASP A OD2   1 
ATOM   4622  N  N     . SER A  1  615  ? 260.414 318.284 187.600 1.00 0.00 ? 615  SER A N     1 
ATOM   4623  C  CA    . SER A  1  615  ? 261.240 319.264 186.916 1.00 0.00 ? 615  SER A CA    1 
ATOM   4624  C  C     . SER A  1  615  ? 260.393 320.354 186.257 1.00 0.00 ? 615  SER A C     1 
ATOM   4625  O  O     . SER A  1  615  ? 260.929 321.355 185.783 1.00 0.00 ? 615  SER A O     1 
ATOM   4626  C  CB    . SER A  1  615  ? 262.126 318.575 185.871 1.00 0.00 ? 615  SER A CB    1 
ATOM   4627  O  OG    . SER A  1  615  ? 263.106 317.752 186.489 1.00 0.00 ? 615  SER A OG    1 
ATOM   4628  N  N     . GLY A  1  616  ? 259.076 320.174 186.231 1.00 0.00 ? 616  GLY A N     1 
ATOM   4629  C  CA    . GLY A  1  616  ? 258.224 321.182 185.631 1.00 0.00 ? 616  GLY A CA    1 
ATOM   4630  C  C     . GLY A  1  616  ? 258.095 322.482 186.399 1.00 0.00 ? 616  GLY A C     1 
ATOM   4631  O  O     . GLY A  1  616  ? 258.195 323.532 185.784 1.00 0.00 ? 616  GLY A O     1 
ATOM   4632  N  N     . PRO A  1  617  ? 257.798 322.437 187.715 1.00 0.00 ? 617  PRO A N     1 
ATOM   4633  C  CA    . PRO A  1  617  ? 257.747 323.710 188.450 1.00 0.00 ? 617  PRO A CA    1 
ATOM   4634  C  C     . PRO A  1  617  ? 259.037 324.539 188.375 1.00 0.00 ? 617  PRO A C     1 
ATOM   4635  O  O     . PRO A  1  617  ? 258.993 325.755 188.561 1.00 0.00 ? 617  PRO A O     1 
ATOM   4636  C  CB    . PRO A  1  617  ? 257.479 323.267 189.895 1.00 0.00 ? 617  PRO A CB    1 
ATOM   4637  C  CG    . PRO A  1  617  ? 256.757 321.980 189.750 1.00 0.00 ? 617  PRO A CG    1 
ATOM   4638  C  CD    . PRO A  1  617  ? 257.389 321.307 188.560 1.00 0.00 ? 617  PRO A CD    1 
ATOM   4639  N  N     . TYR A  1  618  ? 260.173 323.872 188.176 1.00 0.00 ? 618  TYR A N     1 
ATOM   4640  C  CA    . TYR A  1  618  ? 261.472 324.539 188.018 1.00 0.00 ? 618  TYR A CA    1 
ATOM   4641  C  C     . TYR A  1  618  ? 261.703 325.145 186.632 1.00 0.00 ? 618  TYR A C     1 
ATOM   4642  O  O     . TYR A  1  618  ? 262.722 325.799 186.392 1.00 0.00 ? 618  TYR A O     1 
ATOM   4643  C  CB    . TYR A  1  618  ? 262.611 323.577 188.344 1.00 0.00 ? 618  TYR A CB    1 
ATOM   4644  C  CG    . TYR A  1  618  ? 262.511 322.944 189.710 1.00 0.00 ? 618  TYR A CG    1 
ATOM   4645  C  CD1   . TYR A  1  618  ? 262.490 323.728 190.856 1.00 0.00 ? 618  TYR A CD1   1 
ATOM   4646  C  CD2   . TYR A  1  618  ? 262.471 321.563 189.858 1.00 0.00 ? 618  TYR A CD2   1 
ATOM   4647  C  CE1   . TYR A  1  618  ? 262.422 323.155 192.112 1.00 0.00 ? 618  TYR A CE1   1 
ATOM   4648  C  CE2   . TYR A  1  618  ? 262.398 320.978 191.110 1.00 0.00 ? 618  TYR A CE2   1 
ATOM   4649  C  CZ    . TYR A  1  618  ? 262.375 321.778 192.236 1.00 0.00 ? 618  TYR A CZ    1 
ATOM   4650  O  OH    . TYR A  1  618  ? 262.292 321.201 193.484 1.00 0.00 ? 618  TYR A OH    1 
ATOM   4651  N  N     . LYS A  1  619  ? 260.741 324.893 185.750 1.00 0.00 ? 619  LYS A N     1 
ATOM   4652  C  CA    . LYS A  1  619  ? 260.765 325.388 184.388 1.00 0.00 ? 619  LYS A CA    1 
ATOM   4653  C  C     . LYS A  1  619  ? 259.792 326.552 184.266 1.00 0.00 ? 619  LYS A C     1 
ATOM   4654  O  O     . LYS A  1  619  ? 258.610 326.362 183.969 1.00 0.00 ? 619  LYS A O     1 
ATOM   4655  C  CB    . LYS A  1  619  ? 260.389 324.279 183.404 1.00 0.00 ? 619  LYS A CB    1 
ATOM   4656  C  CG    . LYS A  1  619  ? 261.574 323.670 182.672 1.00 0.00 ? 619  LYS A CG    1 
ATOM   4657  C  CD    . LYS A  1  619  ? 262.875 324.355 183.058 1.00 0.00 ? 619  LYS A CD    1 
ATOM   4658  C  CE    . LYS A  1  619  ? 264.032 323.370 183.082 1.00 0.00 ? 619  LYS A CE    1 
ATOM   4659  N  NZ    . LYS A  1  619  ? 265.344 324.057 183.227 1.00 0.00 ? 619  LYS A NZ    1 
ATOM   4660  N  N     . HIS A  1  620  ? 260.311 327.744 184.541 1.00 0.00 ? 620  HIS A N     1 
ATOM   4661  C  CA    . HIS A  1  620  ? 259.580 329.012 184.465 1.00 0.00 ? 620  HIS A CA    1 
ATOM   4662  C  C     . HIS A  1  620  ? 258.373 329.253 185.387 1.00 0.00 ? 620  HIS A C     1 
ATOM   4663  O  O     . HIS A  1  620  ? 257.860 330.371 185.405 1.00 0.00 ? 620  HIS A O     1 
ATOM   4664  C  CB    . HIS A  1  620  ? 259.224 329.365 183.010 1.00 0.00 ? 620  HIS A CB    1 
ATOM   4665  C  CG    . HIS A  1  620  ? 260.416 329.624 182.142 1.00 0.00 ? 620  HIS A CG    1 
ATOM   4666  N  ND1   . HIS A  1  620  ? 261.710 329.538 182.609 1.00 0.00 ? 620  HIS A ND1   1 
ATOM   4667  C  CD2   . HIS A  1  620  ? 260.510 329.968 180.836 1.00 0.00 ? 620  HIS A CD2   1 
ATOM   4668  C  CE1   . HIS A  1  620  ? 262.549 329.817 181.628 1.00 0.00 ? 620  HIS A CE1   1 
ATOM   4669  N  NE2   . HIS A  1  620  ? 261.847 330.081 180.541 1.00 0.00 ? 620  HIS A NE2   1 
ATOM   4670  N  N     . ILE A  1  621  ? 257.898 328.266 186.148 1.00 0.00 ? 621  ILE A N     1 
ATOM   4671  C  CA    . ILE A  1  621  ? 256.773 328.600 186.993 1.00 0.00 ? 621  ILE A CA    1 
ATOM   4672  C  C     . ILE A  1  621  ? 255.692 329.252 186.104 1.00 0.00 ? 621  ILE A C     1 
ATOM   4673  O  O     . ILE A  1  621  ? 254.937 330.101 186.585 1.00 0.00 ? 621  ILE A O     1 
ATOM   4674  C  CB    . ILE A  1  621  ? 257.172 329.575 188.113 1.00 0.00 ? 621  ILE A CB    1 
ATOM   4675  C  CG1   . ILE A  1  621  ? 258.445 329.093 188.812 1.00 0.00 ? 621  ILE A CG1   1 
ATOM   4676  C  CG2   . ILE A  1  621  ? 256.036 329.731 189.113 1.00 0.00 ? 621  ILE A CG2   1 
ATOM   4677  C  CD1   . ILE A  1  621  ? 258.184 328.252 190.043 1.00 0.00 ? 621  ILE A CD1   1 
ATOM   4678  N  N     . SER A  1  622  ? 255.656 328.887 184.810 1.00 0.00 ? 622  SER A N     1 
ATOM   4679  C  CA    . SER A  1  622  ? 254.658 329.380 183.855 1.00 0.00 ? 622  SER A CA    1 
ATOM   4680  C  C     . SER A  1  622  ? 253.399 328.912 184.528 1.00 0.00 ? 622  SER A C     1 
ATOM   4681  O  O     . SER A  1  622  ? 252.718 327.981 184.098 1.00 0.00 ? 622  SER A O     1 
ATOM   4682  C  CB    . SER A  1  622  ? 254.824 328.710 182.495 1.00 0.00 ? 622  SER A CB    1 
ATOM   4683  O  OG    . SER A  1  622  ? 256.193 328.510 182.188 1.00 0.00 ? 622  SER A OG    1 
ATOM   4684  N  N     . PRO A  1  623  ? 253.124 329.608 185.617 1.00 0.00 ? 623  PRO A N     1 
ATOM   4685  C  CA    . PRO A  1  623  ? 252.055 329.265 186.562 1.00 0.00 ? 623  PRO A CA    1 
ATOM   4686  C  C     . PRO A  1  623  ? 251.442 327.873 186.360 1.00 0.00 ? 623  PRO A C     1 
ATOM   4687  O  O     . PRO A  1  623  ? 251.084 327.210 187.341 1.00 0.00 ? 623  PRO A O     1 
ATOM   4688  C  CB    . PRO A  1  623  ? 251.011 330.345 186.293 1.00 0.00 ? 623  PRO A CB    1 
ATOM   4689  C  CG    . PRO A  1  623  ? 251.773 331.506 185.842 1.00 0.00 ? 623  PRO A CG    1 
ATOM   4690  C  CD    . PRO A  1  623  ? 252.944 330.973 185.084 1.00 0.00 ? 623  PRO A CD    1 
ATOM   4691  N  N     . GLY A  1  624  ? 251.383 327.418 185.111 1.00 0.00 ? 624  GLY A N     1 
ATOM   4692  C  CA    . GLY A  1  624  ? 250.855 326.102 184.791 1.00 0.00 ? 624  GLY A CA    1 
ATOM   4693  C  C     . GLY A  1  624  ? 249.514 325.792 185.425 1.00 0.00 ? 624  GLY A C     1 
ATOM   4694  O  O     . GLY A  1  624  ? 248.940 324.726 185.197 1.00 0.00 ? 624  GLY A O     1 
ATOM   4695  N  N     . ASP A  1  625  ? 249.028 326.725 186.235 1.00 0.00 ? 625  ASP A N     1 
ATOM   4696  C  CA    . ASP A  1  625  ? 247.740 326.596 186.912 1.00 0.00 ? 625  ASP A CA    1 
ATOM   4697  C  C     . ASP A  1  625  ? 247.528 325.309 187.718 1.00 0.00 ? 625  ASP A C     1 
ATOM   4698  O  O     . ASP A  1  625  ? 246.731 325.305 188.656 1.00 0.00 ? 625  ASP A O     1 
ATOM   4699  C  CB    . ASP A  1  625  ? 246.585 326.795 185.922 1.00 0.00 ? 625  ASP A CB    1 
ATOM   4700  C  CG    . ASP A  1  625  ? 245.756 328.025 186.234 1.00 0.00 ? 625  ASP A CG    1 
ATOM   4701  O  OD1   . ASP A  1  625  ? 246.340 329.048 186.649 1.00 0.00 ? 625  ASP A OD1   1 
ATOM   4702  O  OD2   . ASP A  1  625  ? 244.520 327.969 186.063 1.00 0.00 ? 625  ASP A OD2   1 
ATOM   4703  N  N     . THR A  1  626  ? 248.219 324.223 187.376 1.00 0.00 ? 626  THR A N     1 
ATOM   4704  C  CA    . THR A  1  626  ? 248.007 322.976 188.145 1.00 0.00 ? 626  THR A CA    1 
ATOM   4705  C  C     . THR A  1  626  ? 248.059 323.165 189.671 1.00 0.00 ? 626  THR A C     1 
ATOM   4706  O  O     . THR A  1  626  ? 247.042 323.052 190.323 1.00 0.00 ? 626  THR A O     1 
ATOM   4707  C  CB    . THR A  1  626  ? 249.053 321.878 187.780 1.00 0.00 ? 626  THR A CB    1 
ATOM   4708  O  OG1   . THR A  1  626  ? 250.348 322.237 188.282 1.00 0.00 ? 626  THR A OG1   1 
ATOM   4709  C  CG2   . THR A  1  626  ? 249.124 321.677 186.268 1.00 0.00 ? 626  THR A CG2   1 
ATOM   4710  N  N     . LYS A  1  627  ? 249.238 323.436 190.229 1.00 0.00 ? 627  LYS A N     1 
ATOM   4711  C  CA    . LYS A  1  627  ? 249.422 323.626 191.675 1.00 0.00 ? 627  LYS A CA    1 
ATOM   4712  C  C     . LYS A  1  627  ? 248.448 324.607 192.303 1.00 0.00 ? 627  LYS A C     1 
ATOM   4713  O  O     . LYS A  1  627  ? 248.287 325.701 191.788 1.00 0.00 ? 627  LYS A O     1 
ATOM   4714  C  CB    . LYS A  1  627  ? 250.842 324.121 191.952 1.00 0.00 ? 627  LYS A CB    1 
ATOM   4715  C  CG    . LYS A  1  627  ? 251.960 323.128 191.575 1.00 0.00 ? 627  LYS A CG    1 
ATOM   4716  C  CD    . LYS A  1  627  ? 253.320 323.487 192.204 1.00 0.00 ? 627  LYS A CD    1 
ATOM   4717  C  CE    . LYS A  1  627  ? 254.010 324.648 191.503 1.00 0.00 ? 627  LYS A CE    1 
ATOM   4718  N  NZ    . LYS A  1  627  ? 254.347 324.289 190.101 1.00 0.00 ? 627  LYS A NZ    1 
ATOM   4719  N  N     . VAL A  1  628  ? 247.836 324.222 193.425 1.00 0.00 ? 628  VAL A N     1 
ATOM   4720  C  CA    . VAL A  1  628  ? 246.849 325.046 194.146 1.00 0.00 ? 628  VAL A CA    1 
ATOM   4721  C  C     . VAL A  1  628  ? 247.425 325.897 195.251 1.00 0.00 ? 628  VAL A C     1 
ATOM   4722  O  O     . VAL A  1  628  ? 248.072 325.384 196.145 1.00 0.00 ? 628  VAL A O     1 
ATOM   4723  C  CB    . VAL A  1  628  ? 245.759 324.201 194.809 1.00 0.00 ? 628  VAL A CB    1 
ATOM   4724  C  CG1   . VAL A  1  628  ? 245.044 324.992 195.885 1.00 0.00 ? 628  VAL A CG1   1 
ATOM   4725  C  CG2   . VAL A  1  628  ? 244.779 323.707 193.788 1.00 0.00 ? 628  VAL A CG2   1 
ATOM   4726  N  N     . VAL A  1  629  ? 247.094 327.181 195.238 1.00 0.00 ? 629  VAL A N     1 
ATOM   4727  C  CA    . VAL A  1  629  ? 247.601 328.172 196.191 1.00 0.00 ? 629  VAL A CA    1 
ATOM   4728  C  C     . VAL A  1  629  ? 246.425 328.917 196.794 1.00 0.00 ? 629  VAL A C     1 
ATOM   4729  O  O     . VAL A  1  629  ? 245.615 329.447 196.067 1.00 0.00 ? 629  VAL A O     1 
ATOM   4730  C  CB    . VAL A  1  629  ? 248.556 329.185 195.582 1.00 0.00 ? 629  VAL A CB    1 
ATOM   4731  C  CG1   . VAL A  1  629  ? 249.144 330.009 196.693 1.00 0.00 ? 629  VAL A CG1   1 
ATOM   4732  C  CG2   . VAL A  1  629  ? 249.665 328.490 194.855 1.00 0.00 ? 629  VAL A CG2   1 
ATOM   4733  N  N     . VAL A  1  630  ? 246.315 328.966 198.112 1.00 0.00 ? 630  VAL A N     1 
ATOM   4734  C  CA    . VAL A  1  630  ? 245.248 329.752 198.729 1.00 0.00 ? 630  VAL A CA    1 
ATOM   4735  C  C     . VAL A  1  630  ? 245.876 330.662 199.747 1.00 0.00 ? 630  VAL A C     1 
ATOM   4736  O  O     . VAL A  1  630  ? 246.925 330.359 200.291 1.00 0.00 ? 630  VAL A O     1 
ATOM   4737  C  CB    . VAL A  1  630  ? 244.115 328.878 199.425 1.00 0.00 ? 630  VAL A CB    1 
ATOM   4738  C  CG1   . VAL A  1  630  ? 243.697 327.712 198.575 1.00 0.00 ? 630  VAL A CG1   1 
ATOM   4739  C  CG2   . VAL A  1  630  ? 244.536 328.354 200.790 1.00 0.00 ? 630  VAL A CG2   1 
ATOM   4740  N  N     . GLU A  1  631  ? 245.333 331.865 199.841 1.00 0.00 ? 631  GLU A N     1 
ATOM   4741  C  CA    . GLU A  1  631  ? 245.960 332.940 200.576 1.00 0.00 ? 631  GLU A CA    1 
ATOM   4742  C  C     . GLU A  1  631  ? 244.889 333.787 201.237 1.00 0.00 ? 631  GLU A C     1 
ATOM   4743  O  O     . GLU A  1  631  ? 243.928 334.179 200.589 1.00 0.00 ? 631  GLU A O     1 
ATOM   4744  C  CB    . GLU A  1  631  ? 246.791 333.796 199.627 1.00 0.00 ? 631  GLU A CB    1 
ATOM   4745  C  CG    . GLU A  1  631  ? 247.540 334.956 200.254 1.00 0.00 ? 631  GLU A CG    1 
ATOM   4746  C  CD    . GLU A  1  631  ? 248.426 334.562 201.446 1.00 0.00 ? 631  GLU A CD    1 
ATOM   4747  O  OE1   . GLU A  1  631  ? 248.617 333.341 201.687 1.00 0.00 ? 631  GLU A OE1   1 
ATOM   4748  O  OE2   . GLU A  1  631  ? 248.969 335.480 202.118 1.00 0.00 ? 631  GLU A OE2   1 
ATOM   4749  N  N     . ASN A  1  632  ? 245.041 334.047 202.527 1.00 0.00 ? 632  ASN A N     1 
ATOM   4750  C  CA    . ASN A  1  632  ? 244.088 334.867 203.256 1.00 0.00 ? 632  ASN A CA    1 
ATOM   4751  C  C     . ASN A  1  632  ? 242.619 334.479 203.062 1.00 0.00 ? 632  ASN A C     1 
ATOM   4752  O  O     . ASN A  1  632  ? 241.750 335.334 203.044 1.00 0.00 ? 632  ASN A O     1 
ATOM   4753  C  CB    . ASN A  1  632  ? 244.314 336.323 202.842 1.00 0.00 ? 632  ASN A CB    1 
ATOM   4754  C  CG    . ASN A  1  632  ? 243.521 337.296 203.667 1.00 0.00 ? 632  ASN A CG    1 
ATOM   4755  O  OD1   . ASN A  1  632  ? 243.391 337.132 204.884 1.00 0.00 ? 632  ASN A OD1   1 
ATOM   4756  N  ND2   . ASN A  1  632  ? 242.950 338.305 203.006 1.00 0.00 ? 632  ASN A ND2   1 
ATOM   4757  N  N     . GLY A  1  633  ? 242.336 333.188 202.925 1.00 0.00 ? 633  GLY A N     1 
ATOM   4758  C  CA    . GLY A  1  633  ? 240.967 332.723 202.720 1.00 0.00 ? 633  GLY A CA    1 
ATOM   4759  C  C     . GLY A  1  633  ? 240.384 332.898 201.318 1.00 0.00 ? 633  GLY A C     1 
ATOM   4760  O  O     . GLY A  1  633  ? 239.154 332.878 201.131 1.00 0.00 ? 633  GLY A O     1 
ATOM   4761  N  N     . GLU A  1  634  ? 241.264 333.050 200.329 1.00 0.00 ? 634  GLU A N     1 
ATOM   4762  C  CA    . GLU A  1  634  ? 240.836 333.149 198.951 1.00 0.00 ? 634  GLU A CA    1 
ATOM   4763  C  C     . GLU A  1  634  ? 241.663 332.252 198.085 1.00 0.00 ? 634  GLU A C     1 
ATOM   4764  O  O     . GLU A  1  634  ? 242.870 332.166 198.240 1.00 0.00 ? 634  GLU A O     1 
ATOM   4765  C  CB    . GLU A  1  634  ? 240.924 334.591 198.415 1.00 0.00 ? 634  GLU A CB    1 
ATOM   4766  C  CG    . GLU A  1  634  ? 240.056 334.797 197.117 1.00 0.00 ? 634  GLU A CG    1 
ATOM   4767  C  CD    . GLU A  1  634  ? 240.291 336.116 196.304 1.00 0.00 ? 634  GLU A CD    1 
ATOM   4768  O  OE1   . GLU A  1  634  ? 240.856 337.099 196.865 1.00 0.00 ? 634  GLU A OE1   1 
ATOM   4769  O  OE2   . GLU A  1  634  ? 239.892 336.137 195.095 1.00 0.00 ? 634  GLU A OE2   1 
ATOM   4770  N  N     . LEU A  1  635  ? 240.980 331.494 197.248 1.00 0.00 ? 635  LEU A N     1 
ATOM   4771  C  CA    . LEU A  1  635  ? 241.628 330.566 196.339 1.00 0.00 ? 635  LEU A CA    1 
ATOM   4772  C  C     . LEU A  1  635  ? 242.218 331.409 195.171 1.00 0.00 ? 635  LEU A C     1 
ATOM   4773  O  O     . LEU A  1  635  ? 241.493 332.072 194.424 1.00 0.00 ? 635  LEU A O     1 
ATOM   4774  C  CB    . LEU A  1  635  ? 240.662 329.453 195.909 1.00 0.00 ? 635  LEU A CB    1 
ATOM   4775  C  CG    . LEU A  1  635  ? 241.147 328.440 194.889 1.00 0.00 ? 635  LEU A CG    1 
ATOM   4776  C  CD1   . LEU A  1  635  ? 242.291 327.792 195.472 1.00 0.00 ? 635  LEU A CD1   1 
ATOM   4777  C  CD2   . LEU A  1  635  ? 240.098 327.401 194.721 1.00 0.00 ? 635  LEU A CD2   1 
ATOM   4778  N  N     . ILE A  1  636  ? 243.546 331.478 195.126 1.00 0.00 ? 636  ILE A N     1 
ATOM   4779  C  CA    . ILE A  1  636  ? 244.287 332.163 194.079 1.00 0.00 ? 636  ILE A CA    1 
ATOM   4780  C  C     . ILE A  1  636  ? 244.397 331.424 192.769 1.00 0.00 ? 636  ILE A C     1 
ATOM   4781  O  O     . ILE A  1  636  ? 244.130 332.009 191.739 1.00 0.00 ? 636  ILE A O     1 
ATOM   4782  C  CB    . ILE A  1  636  ? 245.691 332.487 194.575 1.00 0.00 ? 636  ILE A CB    1 
ATOM   4783  C  CG1   . ILE A  1  636  ? 245.581 333.665 195.534 1.00 0.00 ? 636  ILE A CG1   1 
ATOM   4784  C  CG2   . ILE A  1  636  ? 246.552 332.939 193.485 1.00 0.00 ? 636  ILE A CG2   1 
ATOM   4785  C  CD1   . ILE A  1  636  ? 246.857 334.050 196.175 1.00 0.00 ? 636  ILE A CD1   1 
ATOM   4786  N  N     . MET A  1  637  ? 244.770 330.155 192.797 1.00 0.00 ? 637  MET A N     1 
ATOM   4787  C  CA    . MET A  1  637  ? 244.905 329.384 191.569 1.00 0.00 ? 637  MET A CA    1 
ATOM   4788  C  C     . MET A  1  637  ? 244.841 327.903 191.806 1.00 0.00 ? 637  MET A C     1 
ATOM   4789  O  O     . MET A  1  637  ? 245.045 327.453 192.917 1.00 0.00 ? 637  MET A O     1 
ATOM   4790  C  CB    . MET A  1  637  ? 246.227 329.682 190.894 1.00 0.00 ? 637  MET A CB    1 
ATOM   4791  C  CG    . MET A  1  637  ? 247.407 329.314 191.764 1.00 0.00 ? 637  MET A CG    1 
ATOM   4792  S  SD    . MET A  1  637  ? 248.970 329.224 190.867 1.00 0.00 ? 637  MET A SD    1 
ATOM   4793  C  CE    . MET A  1  637  ? 249.982 330.316 191.878 1.00 0.00 ? 637  MET A CE    1 
ATOM   4794  N  N     . GLY A  1  638  ? 244.613 327.134 190.751 1.00 0.00 ? 638  GLY A N     1 
ATOM   4795  C  CA    . GLY A  1  638  ? 244.735 325.692 190.857 1.00 0.00 ? 638  GLY A CA    1 
ATOM   4796  C  C     . GLY A  1  638  ? 243.416 324.966 190.813 1.00 0.00 ? 638  GLY A C     1 
ATOM   4797  O  O     . GLY A  1  638  ? 242.368 325.584 190.745 1.00 0.00 ? 638  GLY A O     1 
ATOM   4798  N  N     . ILE A  1  639  ? 243.449 323.651 190.875 1.00 0.00 ? 639  ILE A N     1 
ATOM   4799  C  CA    . ILE A  1  639  ? 242.221 322.896 190.820 1.00 0.00 ? 639  ILE A CA    1 
ATOM   4800  C  C     . ILE A  1  639  ? 242.142 321.976 192.016 1.00 0.00 ? 639  ILE A C     1 
ATOM   4801  O  O     . ILE A  1  639  ? 243.143 321.392 192.423 1.00 0.00 ? 639  ILE A O     1 
ATOM   4802  C  CB    . ILE A  1  639  ? 242.151 322.098 189.544 1.00 0.00 ? 639  ILE A CB    1 
ATOM   4803  C  CG1   . ILE A  1  639  ? 242.373 323.020 188.363 1.00 0.00 ? 639  ILE A CG1   1 
ATOM   4804  C  CG2   . ILE A  1  639  ? 240.814 321.421 189.407 1.00 0.00 ? 639  ILE A CG2   1 
ATOM   4805  C  CD1   . ILE A  1  639  ? 242.452 322.272 187.057 1.00 0.00 ? 639  ILE A CD1   1 
ATOM   4806  N  N     . LEU A  1  640  ? 240.960 321.872 192.606 1.00 0.00 ? 640  LEU A N     1 
ATOM   4807  C  CA    . LEU A  1  640  ? 240.789 321.092 193.814 1.00 0.00 ? 640  LEU A CA    1 
ATOM   4808  C  C     . LEU A  1  640  ? 240.414 319.658 193.512 1.00 0.00 ? 640  LEU A C     1 
ATOM   4809  O  O     . LEU A  1  640  ? 239.634 319.381 192.621 1.00 0.00 ? 640  LEU A O     1 
ATOM   4810  C  CB    . LEU A  1  640  ? 239.738 321.732 194.693 1.00 0.00 ? 640  LEU A CB    1 
ATOM   4811  C  CG    . LEU A  1  640  ? 240.270 322.822 195.606 1.00 0.00 ? 640  LEU A CG    1 
ATOM   4812  C  CD1   . LEU A  1  640  ? 240.798 323.998 194.853 1.00 0.00 ? 640  LEU A CD1   1 
ATOM   4813  C  CD2   . LEU A  1  640  ? 239.165 323.244 196.514 1.00 0.00 ? 640  LEU A CD2   1 
ATOM   4814  N  N     . CYS A  1  641  ? 240.946 318.741 194.293 1.00 0.00 ? 641  CYS A N     1 
ATOM   4815  C  CA    . CYS A  1  641  ? 240.758 317.336 194.039 1.00 0.00 ? 641  CYS A CA    1 
ATOM   4816  C  C     . CYS A  1  641  ? 240.688 316.584 195.344 1.00 0.00 ? 641  CYS A C     1 
ATOM   4817  O  O     . CYS A  1  641  ? 240.520 317.168 196.393 1.00 0.00 ? 641  CYS A O     1 
ATOM   4818  C  CB    . CYS A  1  641  ? 241.928 316.820 193.258 1.00 0.00 ? 641  CYS A CB    1 
ATOM   4819  S  SG    . CYS A  1  641  ? 243.284 316.716 194.459 1.00 0.00 ? 641  CYS A SG    1 
ATOM   4820  N  N     . LYS A  1  642  ? 240.870 315.280 195.301 1.00 0.00 ? 642  LYS A N     1 
ATOM   4821  C  CA    . LYS A  1  642  ? 240.936 314.539 196.538 1.00 0.00 ? 642  LYS A CA    1 
ATOM   4822  C  C     . LYS A  1  642  ? 242.173 314.914 197.354 1.00 0.00 ? 642  LYS A C     1 
ATOM   4823  O  O     . LYS A  1  642  ? 242.082 315.051 198.556 1.00 0.00 ? 642  LYS A O     1 
ATOM   4824  C  CB    . LYS A  1  642  ? 240.894 313.039 196.267 1.00 0.00 ? 642  LYS A CB    1 
ATOM   4825  C  CG    . LYS A  1  642  ? 241.060 312.210 197.509 1.00 0.00 ? 642  LYS A CG    1 
ATOM   4826  C  CD    . LYS A  1  642  ? 240.639 310.789 197.264 1.00 0.00 ? 642  LYS A CD    1 
ATOM   4827  C  CE    . LYS A  1  642  ? 240.915 309.945 198.490 1.00 0.00 ? 642  LYS A CE    1 
ATOM   4828  N  NZ    . LYS A  1  642  ? 240.265 308.596 198.385 1.00 0.00 ? 642  LYS A NZ    1 
ATOM   4829  N  N     . LYS A  1  643  ? 243.323 315.120 196.722 1.00 0.00 ? 643  LYS A N     1 
ATOM   4830  C  CA    . LYS A  1  643  ? 244.467 315.572 197.507 1.00 0.00 ? 643  LYS A CA    1 
ATOM   4831  C  C     . LYS A  1  643  ? 244.306 316.932 198.165 1.00 0.00 ? 643  LYS A C     1 
ATOM   4832  O  O     . LYS A  1  643  ? 244.943 317.188 199.181 1.00 0.00 ? 643  LYS A O     1 
ATOM   4833  C  CB    . LYS A  1  643  ? 245.727 315.509 196.671 1.00 0.00 ? 643  LYS A CB    1 
ATOM   4834  C  CG    . LYS A  1  643  ? 246.266 314.108 196.718 1.00 0.00 ? 643  LYS A CG    1 
ATOM   4835  C  CD    . LYS A  1  643  ? 247.638 313.891 196.136 1.00 0.00 ? 643  LYS A CD    1 
ATOM   4836  C  CE    . LYS A  1  643  ? 247.786 312.427 195.653 1.00 0.00 ? 643  LYS A CE    1 
ATOM   4837  N  NZ    . LYS A  1  643  ? 248.819 312.183 194.589 1.00 0.00 ? 643  LYS A NZ    1 
ATOM   4838  N  N     . SER A  1  644  ? 243.523 317.830 197.591 1.00 0.00 ? 644  SER A N     1 
ATOM   4839  C  CA    . SER A  1  644  ? 243.251 319.084 198.291 1.00 0.00 ? 644  SER A CA    1 
ATOM   4840  C  C     . SER A  1  644  ? 242.160 318.808 199.301 1.00 0.00 ? 644  SER A C     1 
ATOM   4841  O  O     . SER A  1  644  ? 242.273 319.211 200.417 1.00 0.00 ? 644  SER A O     1 
ATOM   4842  C  CB    . SER A  1  644  ? 242.872 320.252 197.382 1.00 0.00 ? 644  SER A CB    1 
ATOM   4843  O  OG    . SER A  1  644  ? 243.236 320.035 196.034 1.00 0.00 ? 644  SER A OG    1 
ATOM   4844  N  N     . LEU A  1  645  ? 241.010 318.349 198.851 1.00 0.00 ? 645  LEU A N     1 
ATOM   4845  C  CA    . LEU A  1  645  ? 239.855 318.178 199.727 1.00 0.00 ? 645  LEU A CA    1 
ATOM   4846  C  C     . LEU A  1  645  ? 239.673 316.858 200.537 1.00 0.00 ? 645  LEU A C     1 
ATOM   4847  O  O     . LEU A  1  645  ? 238.804 316.780 201.392 1.00 0.00 ? 645  LEU A O     1 
ATOM   4848  C  CB    . LEU A  1  645  ? 238.622 318.457 198.897 1.00 0.00 ? 645  LEU A CB    1 
ATOM   4849  C  CG    . LEU A  1  645  ? 238.671 319.937 198.532 1.00 0.00 ? 645  LEU A CG    1 
ATOM   4850  C  CD1   . LEU A  1  645  ? 237.636 320.235 197.515 1.00 0.00 ? 645  LEU A CD1   1 
ATOM   4851  C  CD2   . LEU A  1  645  ? 238.477 320.800 199.734 1.00 0.00 ? 645  LEU A CD2   1 
ATOM   4852  N  N     . GLY A  1  646  ? 240.443 315.816 200.268 1.00 0.00 ? 646  GLY A N     1 
ATOM   4853  C  CA    . GLY A  1  646  ? 240.115 314.513 200.843 1.00 0.00 ? 646  GLY A CA    1 
ATOM   4854  C  C     . GLY A  1  646  ? 240.598 314.282 202.265 1.00 0.00 ? 646  GLY A C     1 
ATOM   4855  O  O     . GLY A  1  646  ? 240.715 315.219 203.049 1.00 0.00 ? 646  GLY A O     1 
ATOM   4856  N  N     . THR A  1  647  ? 240.819 313.017 202.613 1.00 0.00 ? 647  THR A N     1 
ATOM   4857  C  CA    . THR A  1  647  ? 241.313 312.641 203.936 1.00 0.00 ? 647  THR A CA    1 
ATOM   4858  C  C     . THR A  1  647  ? 242.823 312.850 204.067 1.00 0.00 ? 647  THR A C     1 
ATOM   4859  O  O     . THR A  1  647  ? 243.463 312.196 204.887 1.00 0.00 ? 647  THR A O     1 
ATOM   4860  C  CB    . THR A  1  647  ? 240.986 311.163 204.241 1.00 0.00 ? 647  THR A CB    1 
ATOM   4861  O  OG1   . THR A  1  647  ? 241.554 310.324 203.227 1.00 0.00 ? 647  THR A OG1   1 
ATOM   4862  C  CG2   . THR A  1  647  ? 239.475 310.944 204.282 1.00 0.00 ? 647  THR A CG2   1 
ATOM   4863  N  N     . SER A  1  648  ? 243.385 313.742 203.245 1.00 0.00 ? 648  SER A N     1 
ATOM   4864  C  CA    . SER A  1  648  ? 244.835 313.987 203.147 1.00 0.00 ? 648  SER A CA    1 
ATOM   4865  C  C     . SER A  1  648  ? 245.428 314.650 204.397 1.00 0.00 ? 648  SER A C     1 
ATOM   4866  O  O     . SER A  1  648  ? 244.712 315.299 205.151 1.00 0.00 ? 648  SER A O     1 
ATOM   4867  C  CB    . SER A  1  648  ? 245.117 314.862 201.916 1.00 0.00 ? 648  SER A CB    1 
ATOM   4868  O  OG    . SER A  1  648  ? 246.440 315.387 201.921 1.00 0.00 ? 648  SER A OG    1 
ATOM   4869  N  N     . ALA A  1  649  ? 246.734 314.503 204.613 1.00 0.00 ? 649  ALA A N     1 
ATOM   4870  C  CA    . ALA A  1  649  ? 247.366 315.084 205.792 1.00 0.00 ? 649  ALA A CA    1 
ATOM   4871  C  C     . ALA A  1  649  ? 247.297 316.617 205.775 1.00 0.00 ? 649  ALA A C     1 
ATOM   4872  O  O     . ALA A  1  649  ? 247.205 317.260 206.827 1.00 0.00 ? 649  ALA A O     1 
ATOM   4873  C  CB    . ALA A  1  649  ? 248.809 314.617 205.891 1.00 0.00 ? 649  ALA A CB    1 
ATOM   4874  N  N     . GLY A  1  650  ? 247.329 317.204 204.581 1.00 0.00 ? 650  GLY A N     1 
ATOM   4875  C  CA    . GLY A  1  650  ? 247.349 318.656 204.478 1.00 0.00 ? 650  GLY A CA    1 
ATOM   4876  C  C     . GLY A  1  650  ? 246.185 319.279 203.722 1.00 0.00 ? 650  GLY A C     1 
ATOM   4877  O  O     . GLY A  1  650  ? 246.251 320.425 203.260 1.00 0.00 ? 650  GLY A O     1 
ATOM   4878  N  N     . SER A  1  651  ? 245.092 318.541 203.633 1.00 0.00 ? 651  SER A N     1 
ATOM   4879  C  CA    . SER A  1  651  ? 243.946 319.009 202.883 1.00 0.00 ? 651  SER A CA    1 
ATOM   4880  C  C     . SER A  1  651  ? 243.377 320.290 203.465 1.00 0.00 ? 651  SER A C     1 
ATOM   4881  O  O     . SER A  1  651  ? 243.625 320.577 204.611 1.00 0.00 ? 651  SER A O     1 
ATOM   4882  C  CB    . SER A  1  651  ? 242.882 317.939 202.877 1.00 0.00 ? 651  SER A CB    1 
ATOM   4883  O  OG    . SER A  1  651  ? 242.873 317.286 204.108 1.00 0.00 ? 651  SER A OG    1 
ATOM   4884  N  N     . LEU A  1  652  ? 242.637 321.053 202.668 1.00 0.00 ? 652  LEU A N     1 
ATOM   4885  C  CA    . LEU A  1  652  ? 241.924 322.248 203.117 1.00 0.00 ? 652  LEU A CA    1 
ATOM   4886  C  C     . LEU A  1  652  ? 241.105 321.998 204.346 1.00 0.00 ? 652  LEU A C     1 
ATOM   4887  O  O     . LEU A  1  652  ? 240.995 322.872 205.202 1.00 0.00 ? 652  LEU A O     1 
ATOM   4888  C  CB    . LEU A  1  652  ? 241.001 322.758 202.041 1.00 0.00 ? 652  LEU A CB    1 
ATOM   4889  C  CG    . LEU A  1  652  ? 241.796 323.557 201.048 1.00 0.00 ? 652  LEU A CG    1 
ATOM   4890  C  CD1   . LEU A  1  652  ? 240.969 323.779 199.820 1.00 0.00 ? 652  LEU A CD1   1 
ATOM   4891  C  CD2   . LEU A  1  652  ? 242.150 324.852 201.694 1.00 0.00 ? 652  LEU A CD2   1 
ATOM   4892  N  N     . VAL A  1  653  ? 240.436 320.845 204.359 1.00 0.00 ? 653  VAL A N     1 
ATOM   4893  C  CA    . VAL A  1  653  ? 239.624 320.413 205.490 1.00 0.00 ? 653  VAL A CA    1 
ATOM   4894  C  C     . VAL A  1  653  ? 240.427 320.233 206.792 1.00 0.00 ? 653  VAL A C     1 
ATOM   4895  O  O     . VAL A  1  653  ? 239.973 320.666 207.837 1.00 0.00 ? 653  VAL A O     1 
ATOM   4896  C  CB    . VAL A  1  653  ? 238.875 319.141 205.125 1.00 0.00 ? 653  VAL A CB    1 
ATOM   4897  C  CG1   . VAL A  1  653  ? 237.841 319.466 204.077 1.00 0.00 ? 653  VAL A CG1   1 
ATOM   4898  C  CG2   . VAL A  1  653  ? 239.842 318.117 204.603 1.00 0.00 ? 653  VAL A CG2   1 
ATOM   4899  N  N     . HIS A  1  654  ? 241.631 319.676 206.735 1.00 0.00 ? 654  HIS A N     1 
ATOM   4900  C  CA    . HIS A  1  654  ? 242.423 319.521 207.936 1.00 0.00 ? 654  HIS A CA    1 
ATOM   4901  C  C     . HIS A  1  654  ? 242.816 320.839 208.513 1.00 0.00 ? 654  HIS A C     1 
ATOM   4902  O  O     . HIS A  1  654  ? 242.620 321.066 209.679 1.00 0.00 ? 654  HIS A O     1 
ATOM   4903  C  CB    . HIS A  1  654  ? 243.681 318.721 207.662 1.00 0.00 ? 654  HIS A CB    1 
ATOM   4904  C  CG    . HIS A  1  654  ? 244.398 318.309 208.900 1.00 0.00 ? 654  HIS A CG    1 
ATOM   4905  N  ND1   . HIS A  1  654  ? 245.648 317.736 208.879 1.00 0.00 ? 654  HIS A ND1   1 
ATOM   4906  C  CD2   . HIS A  1  654  ? 244.095 318.496 210.208 1.00 0.00 ? 654  HIS A CD2   1 
ATOM   4907  C  CE1   . HIS A  1  654  ? 246.065 317.542 210.118 1.00 0.00 ? 654  HIS A CE1   1 
ATOM   4908  N  NE2   . HIS A  1  654  ? 245.143 318.000 210.946 1.00 0.00 ? 654  HIS A NE2   1 
ATOM   4909  N  N     . ILE A  1  655  ? 243.267 321.741 207.669 1.00 0.00 ? 655  ILE A N     1 
ATOM   4910  C  CA    . ILE A  1  655  ? 243.665 323.081 208.072 1.00 0.00 ? 655  ILE A CA    1 
ATOM   4911  C  C     . ILE A  1  655  ? 242.529 323.895 208.643 1.00 0.00 ? 655  ILE A C     1 
ATOM   4912  O  O     . ILE A  1  655  ? 242.722 324.646 209.603 1.00 0.00 ? 655  ILE A O     1 
ATOM   4913  C  CB    . ILE A  1  655  ? 244.313 323.788 206.914 1.00 0.00 ? 655  ILE A CB    1 
ATOM   4914  C  CG1   . ILE A  1  655  ? 245.617 323.049 206.648 1.00 0.00 ? 655  ILE A CG1   1 
ATOM   4915  C  CG2   . ILE A  1  655  ? 244.623 325.213 207.260 1.00 0.00 ? 655  ILE A CG2   1 
ATOM   4916  C  CD1   . ILE A  1  655  ? 246.297 323.455 205.422 1.00 0.00 ? 655  ILE A CD1   1 
ATOM   4917  N  N     . SER A  1  656  ? 241.340 323.684 208.102 1.00 0.00 ? 656  SER A N     1 
ATOM   4918  C  CA    . SER A  1  656  ? 240.166 324.367 208.585 1.00 0.00 ? 656  SER A CA    1 
ATOM   4919  C  C     . SER A  1  656  ? 239.803 324.024 210.015 1.00 0.00 ? 656  SER A C     1 
ATOM   4920  O  O     . SER A  1  656  ? 239.555 324.926 210.807 1.00 0.00 ? 656  SER A O     1 
ATOM   4921  C  CB    . SER A  1  656  ? 238.984 323.974 207.728 1.00 0.00 ? 656  SER A CB    1 
ATOM   4922  O  OG    . SER A  1  656  ? 239.234 324.290 206.382 1.00 0.00 ? 656  SER A OG    1 
ATOM   4923  N  N     . TYR A  1  657  ? 239.835 322.742 210.351 1.00 0.00 ? 657  TYR A N     1 
ATOM   4924  C  CA    . TYR A  1  657  ? 239.585 322.240 211.707 1.00 0.00 ? 657  TYR A CA    1 
ATOM   4925  C  C     . TYR A  1  657  ? 240.508 322.966 212.685 1.00 0.00 ? 657  TYR A C     1 
ATOM   4926  O  O     . TYR A  1  657  ? 240.041 323.563 213.648 1.00 0.00 ? 657  TYR A O     1 
ATOM   4927  C  CB    . TYR A  1  657  ? 239.766 320.738 211.713 1.00 0.00 ? 657  TYR A CB    1 
ATOM   4928  C  CG    . TYR A  1  657  ? 239.608 320.023 212.984 1.00 0.00 ? 657  TYR A CG    1 
ATOM   4929  C  CD1   . TYR A  1  657  ? 238.344 319.780 213.494 1.00 0.00 ? 657  TYR A CD1   1 
ATOM   4930  C  CD2   . TYR A  1  657  ? 240.680 319.511 213.638 1.00 0.00 ? 657  TYR A CD2   1 
ATOM   4931  C  CE1   . TYR A  1  657  ? 238.155 319.041 214.664 1.00 0.00 ? 657  TYR A CE1   1 
ATOM   4932  C  CE2   . TYR A  1  657  ? 240.523 318.768 214.816 1.00 0.00 ? 657  TYR A CE2   1 
ATOM   4933  C  CZ    . TYR A  1  657  ? 239.258 318.522 215.342 1.00 0.00 ? 657  TYR A CZ    1 
ATOM   4934  O  OH    . TYR A  1  657  ? 239.129 317.768 216.522 1.00 0.00 ? 657  TYR A OH    1 
ATOM   4935  N  N     . LEU A  1  658  ? 241.792 323.032 212.338 1.00 0.00 ? 658  LEU A N     1 
ATOM   4936  C  CA    . LEU A  1  658  ? 242.842 323.680 213.139 1.00 0.00 ? 658  LEU A CA    1 
ATOM   4937  C  C     . LEU A  1  658  ? 242.711 325.183 213.264 1.00 0.00 ? 658  LEU A C     1 
ATOM   4938  O  O     . LEU A  1  658  ? 242.867 325.745 214.348 1.00 0.00 ? 658  LEU A O     1 
ATOM   4939  C  CB    . LEU A  1  658  ? 244.208 323.394 212.529 1.00 0.00 ? 658  LEU A CB    1 
ATOM   4940  C  CG    . LEU A  1  658  ? 244.531 321.918 212.541 1.00 0.00 ? 658  LEU A CG    1 
ATOM   4941  C  CD1   . LEU A  1  658  ? 245.881 321.689 211.961 1.00 0.00 ? 658  LEU A CD1   1 
ATOM   4942  C  CD2   . LEU A  1  658  ? 244.488 321.498 213.990 1.00 0.00 ? 658  LEU A CD2   1 
ATOM   4943  N  N     . GLU A  1  659  ? 242.485 325.846 212.151 1.00 0.00 ? 659  GLU A N     1 
ATOM   4944  C  CA    . GLU A  1  659  ? 242.458 327.288 212.189 1.00 0.00 ? 659  GLU A CA    1 
ATOM   4945  C  C     . GLU A  1  659  ? 241.121 327.875 212.667 1.00 0.00 ? 659  GLU A C     1 
ATOM   4946  O  O     . GLU A  1  659  ? 241.091 328.738 213.544 1.00 0.00 ? 659  GLU A O     1 
ATOM   4947  C  CB    . GLU A  1  659  ? 242.825 327.809 210.820 1.00 0.00 ? 659  GLU A CB    1 
ATOM   4948  C  CG    . GLU A  1  659  ? 244.241 327.402 210.464 1.00 0.00 ? 659  GLU A CG    1 
ATOM   4949  C  CD    . GLU A  1  659  ? 245.266 327.998 211.431 1.00 0.00 ? 659  GLU A CD    1 
ATOM   4950  O  OE1   . GLU A  1  659  ? 245.305 329.255 211.547 1.00 0.00 ? 659  GLU A OE1   1 
ATOM   4951  O  OE2   . GLU A  1  659  ? 246.009 327.209 212.082 1.00 0.00 ? 659  GLU A OE2   1 
ATOM   4952  N  N     . MET A  1  660  ? 240.022 327.435 212.071 1.00 0.00 ? 660  MET A N     1 
ATOM   4953  C  CA    . MET A  1  660  ? 238.728 328.018 212.411 1.00 0.00 ? 660  MET A CA    1 
ATOM   4954  C  C     . MET A  1  660  ? 238.057 327.416 213.664 1.00 0.00 ? 660  MET A C     1 
ATOM   4955  O  O     . MET A  1  660  ? 237.359 328.136 214.384 1.00 0.00 ? 660  MET A O     1 
ATOM   4956  C  CB    . MET A  1  660  ? 237.804 327.953 211.186 1.00 0.00 ? 660  MET A CB    1 
ATOM   4957  C  CG    . MET A  1  660  ? 238.358 328.787 210.009 1.00 0.00 ? 660  MET A CG    1 
ATOM   4958  S  SD    . MET A  1  660  ? 238.780 330.508 210.500 1.00 0.00 ? 660  MET A SD    1 
ATOM   4959  C  CE    . MET A  1  660  ? 237.171 331.186 210.986 1.00 0.00 ? 660  MET A CE    1 
ATOM   4960  N  N     . GLY A  1  661  ? 238.245 326.123 213.923 1.00 0.00 ? 661  GLY A N     1 
ATOM   4961  C  CA    . GLY A  1  661  ? 237.597 325.484 215.059 1.00 0.00 ? 661  GLY A CA    1 
ATOM   4962  C  C     . GLY A  1  661  ? 236.482 324.625 214.517 1.00 0.00 ? 661  GLY A C     1 
ATOM   4963  O  O     . GLY A  1  661  ? 235.908 324.968 213.488 1.00 0.00 ? 661  GLY A O     1 
ATOM   4964  N  N     . HIS A  1  662  ? 236.126 323.559 215.229 1.00 0.00 ? 662  HIS A N     1 
ATOM   4965  C  CA    . HIS A  1  662  ? 235.372 322.452 214.617 1.00 0.00 ? 662  HIS A CA    1 
ATOM   4966  C  C     . HIS A  1  662  ? 233.983 322.871 214.082 1.00 0.00 ? 662  HIS A C     1 
ATOM   4967  O  O     . HIS A  1  662  ? 233.552 322.402 212.999 1.00 0.00 ? 662  HIS A O     1 
ATOM   4968  C  CB    . HIS A  1  662  ? 235.226 321.268 215.580 1.00 0.00 ? 662  HIS A CB    1 
ATOM   4969  C  CG    . HIS A  1  662  ? 234.386 321.563 216.777 1.00 0.00 ? 662  HIS A CG    1 
ATOM   4970  N  ND1   . HIS A  1  662  ? 234.915 321.995 217.972 1.00 0.00 ? 662  HIS A ND1   1 
ATOM   4971  C  CD2   . HIS A  1  662  ? 233.044 321.506 216.955 1.00 0.00 ? 662  HIS A CD2   1 
ATOM   4972  C  CE1   . HIS A  1  662  ? 233.937 322.185 218.841 1.00 0.00 ? 662  HIS A CE1   1 
ATOM   4973  N  NE2   . HIS A  1  662  ? 232.791 321.887 218.250 1.00 0.00 ? 662  HIS A NE2   1 
ATOM   4974  N  N     . ASP A  1  663  ? 233.292 323.737 214.834 1.00 0.00 ? 663  ASP A N     1 
ATOM   4975  C  CA    . ASP A  1  663  ? 231.976 324.264 214.417 1.00 0.00 ? 663  ASP A CA    1 
ATOM   4976  C  C     . ASP A  1  663  ? 232.053 324.986 213.014 1.00 0.00 ? 663  ASP A C     1 
ATOM   4977  O  O     . ASP A  1  663  ? 231.252 324.719 212.097 1.00 0.00 ? 663  ASP A O     1 
ATOM   4978  C  CB    . ASP A  1  663  ? 231.352 325.182 215.502 1.00 0.00 ? 663  ASP A CB    1 
ATOM   4979  C  CG    . ASP A  1  663  ? 229.808 325.367 215.322 1.00 0.00 ? 663  ASP A CG    1 
ATOM   4980  O  OD1   . ASP A  1  663  ? 229.119 324.427 214.791 1.00 0.00 ? 663  ASP A OD1   1 
ATOM   4981  O  OD2   . ASP A  1  663  ? 229.307 326.464 215.709 1.00 0.00 ? 663  ASP A OD2   1 
ATOM   4982  N  N     . ILE A  1  664  ? 233.025 325.870 212.836 1.00 0.00 ? 664  ILE A N     1 
ATOM   4983  C  CA    . ILE A  1  664  ? 233.174 326.568 211.573 1.00 0.00 ? 664  ILE A CA    1 
ATOM   4984  C  C     . ILE A  1  664  ? 233.549 325.628 210.473 1.00 0.00 ? 664  ILE A C     1 
ATOM   4985  O  O     . ILE A  1  664  ? 233.141 325.849 209.347 1.00 0.00 ? 664  ILE A O     1 
ATOM   4986  C  CB    . ILE A  1  664  ? 234.210 327.642 211.664 1.00 0.00 ? 664  ILE A CB    1 
ATOM   4987  C  CG1   . ILE A  1  664  ? 233.806 328.556 212.797 1.00 0.00 ? 664  ILE A CG1   1 
ATOM   4988  C  CG2   . ILE A  1  664  ? 234.288 328.430 210.382 1.00 0.00 ? 664  ILE A CG2   1 
ATOM   4989  C  CD1   . ILE A  1  664  ? 234.807 329.645 213.098 1.00 0.00 ? 664  ILE A CD1   1 
ATOM   4990  N  N     . THR A  1  665  ? 234.318 324.591 210.784 1.00 0.00 ? 665  THR A N     1 
ATOM   4991  C  CA    . THR A  1  665  ? 234.621 323.542 209.800 1.00 0.00 ? 665  THR A CA    1 
ATOM   4992  C  C     . THR A  1  665  ? 233.407 322.734 209.352 1.00 0.00 ? 665  THR A C     1 
ATOM   4993  O  O     . THR A  1  665  ? 233.275 322.382 208.174 1.00 0.00 ? 665  THR A O     1 
ATOM   4994  C  CB    . THR A  1  665  ? 235.625 322.573 210.317 1.00 0.00 ? 665  THR A CB    1 
ATOM   4995  O  OG1   . THR A  1  665  ? 236.797 323.304 210.617 1.00 0.00 ? 665  THR A OG1   1 
ATOM   4996  C  CG2   . THR A  1  665  ? 235.999 321.591 209.250 1.00 0.00 ? 665  THR A CG2   1 
ATOM   4997  N  N     . ARG A  1  666  ? 232.475 322.496 210.258 1.00 0.00 ? 666  ARG A N     1 
ATOM   4998  C  CA    . ARG A  1  666  ? 231.272 321.812 209.836 1.00 0.00 ? 666  ARG A CA    1 
ATOM   4999  C  C     . ARG A  1  666  ? 230.415 322.582 208.853 1.00 0.00 ? 666  ARG A C     1 
ATOM   5000  O  O     . ARG A  1  666  ? 229.871 322.001 207.927 1.00 0.00 ? 666  ARG A O     1 
ATOM   5001  C  CB    . ARG A  1  666  ? 230.429 321.475 211.061 1.00 0.00 ? 666  ARG A CB    1 
ATOM   5002  C  CG    . ARG A  1  666  ? 231.048 320.375 211.830 1.00 0.00 ? 666  ARG A CG    1 
ATOM   5003  C  CD    . ARG A  1  666  ? 231.451 319.251 210.827 1.00 0.00 ? 666  ARG A CD    1 
ATOM   5004  N  NE    . ARG A  1  666  ? 231.880 317.944 211.345 1.00 0.00 ? 666  ARG A NE    1 
ATOM   5005  C  CZ    . ARG A  1  666  ? 232.271 316.937 210.559 1.00 0.00 ? 666  ARG A CZ    1 
ATOM   5006  N  NH1   . ARG A  1  666  ? 232.381 317.145 209.245 1.00 0.00 ? 666  ARG A NH1   1 
ATOM   5007  N  NH2   . ARG A  1  666  ? 232.573 315.740 211.066 1.00 0.00 ? 666  ARG A NH2   1 
ATOM   5008  N  N     . LEU A  1  667  ? 230.323 323.885 209.049 1.00 0.00 ? 667  LEU A N     1 
ATOM   5009  C  CA    . LEU A  1  667  ? 229.645 324.790 208.147 1.00 0.00 ? 667  LEU A CA    1 
ATOM   5010  C  C     . LEU A  1  667  ? 230.322 324.829 206.795 1.00 0.00 ? 667  LEU A C     1 
ATOM   5011  O  O     . LEU A  1  667  ? 229.650 324.966 205.785 1.00 0.00 ? 667  LEU A O     1 
ATOM   5012  C  CB    . LEU A  1  667  ? 229.635 326.182 208.773 1.00 0.00 ? 667  LEU A CB    1 
ATOM   5013  C  CG    . LEU A  1  667  ? 228.695 326.311 209.979 1.00 0.00 ? 667  LEU A CG    1 
ATOM   5014  C  CD1   . LEU A  1  667  ? 228.882 327.612 210.778 1.00 0.00 ? 667  LEU A CD1   1 
ATOM   5015  C  CD2   . LEU A  1  667  ? 227.252 326.198 209.492 1.00 0.00 ? 667  LEU A CD2   1 
ATOM   5016  N  N     . PHE A  1  668  ? 231.657 324.730 206.800 1.00 0.00 ? 668  PHE A N     1 
ATOM   5017  C  CA    . PHE A  1  668  ? 232.505 324.569 205.608 1.00 0.00 ? 668  PHE A CA    1 
ATOM   5018  C  C     . PHE A  1  668  ? 232.202 323.302 204.759 1.00 0.00 ? 668  PHE A C     1 
ATOM   5019  O  O     . PHE A  1  668  ? 232.167 323.391 203.528 1.00 0.00 ? 668  PHE A O     1 
ATOM   5020  C  CB    . PHE A  1  668  ? 233.958 324.664 206.036 1.00 0.00 ? 668  PHE A CB    1 
ATOM   5021  C  CG    . PHE A  1  668  ? 234.914 324.276 204.992 1.00 0.00 ? 668  PHE A CG    1 
ATOM   5022  C  CD1   . PHE A  1  668  ? 234.771 324.790 203.713 1.00 0.00 ? 668  PHE A CD1   1 
ATOM   5023  C  CD2   . PHE A  1  668  ? 236.056 323.569 205.301 1.00 0.00 ? 668  PHE A CD2   1 
ATOM   5024  C  CE1   . PHE A  1  668  ? 235.673 324.485 202.710 1.00 0.00 ? 668  PHE A CE1   1 
ATOM   5025  C  CE2   . PHE A  1  668  ? 236.989 323.281 204.308 1.00 0.00 ? 668  PHE A CE2   1 
ATOM   5026  C  CZ    . PHE A  1  668  ? 236.801 323.742 203.012 1.00 0.00 ? 668  PHE A CZ    1 
ATOM   5027  N  N     . TYR A  1  669  ? 232.014 322.144 205.407 1.00 0.00 ? 669  TYR A N     1 
ATOM   5028  C  CA    . TYR A  1  669  ? 231.563 320.910 204.720 1.00 0.00 ? 669  TYR A CA    1 
ATOM   5029  C  C     . TYR A  1  669  ? 230.191 320.969 204.070 1.00 0.00 ? 669  TYR A C     1 
ATOM   5030  O  O     . TYR A  1  669  ? 229.949 320.295 203.089 1.00 0.00 ? 669  TYR A O     1 
ATOM   5031  C  CB    . TYR A  1  669  ? 231.454 319.729 205.667 1.00 0.00 ? 669  TYR A CB    1 
ATOM   5032  C  CG    . TYR A  1  669  ? 232.675 318.965 205.890 1.00 0.00 ? 669  TYR A CG    1 
ATOM   5033  C  CD1   . TYR A  1  669  ? 233.766 319.479 206.495 1.00 0.00 ? 669  TYR A CD1   1 
ATOM   5034  C  CD2   . TYR A  1  669  ? 232.660 317.640 205.609 1.00 0.00 ? 669  TYR A CD2   1 
ATOM   5035  C  CE1   . TYR A  1  669  ? 234.844 318.681 206.694 1.00 0.00 ? 669  TYR A CE1   1 
ATOM   5036  C  CE2   . TYR A  1  669  ? 233.715 316.871 205.753 1.00 0.00 ? 669  TYR A CE2   1 
ATOM   5037  C  CZ    . TYR A  1  669  ? 234.797 317.372 206.299 1.00 0.00 ? 669  TYR A CZ    1 
ATOM   5038  O  OH    . TYR A  1  669  ? 235.824 316.523 206.465 1.00 0.00 ? 669  TYR A OH    1 
ATOM   5039  N  N     . SER A  1  670  ? 229.239 321.518 204.806 1.00 0.00 ? 670  SER A N     1 
ATOM   5040  C  CA    . SER A  1  670  ? 227.889 321.780 204.360 1.00 0.00 ? 670  SER A CA    1 
ATOM   5041  C  C     . SER A  1  670  ? 227.971 322.785 203.234 1.00 0.00 ? 670  SER A C     1 
ATOM   5042  O  O     . SER A  1  670  ? 227.310 322.647 202.234 1.00 0.00 ? 670  SER A O     1 
ATOM   5043  C  CB    . SER A  1  670  ? 227.033 322.314 205.494 1.00 0.00 ? 670  SER A CB    1 
ATOM   5044  O  OG    . SER A  1  670  ? 226.875 321.340 206.504 1.00 0.00 ? 670  SER A OG    1 
ATOM   5045  N  N     . ASN A  1  671  ? 228.730 323.856 203.429 1.00 0.00 ? 671  ASN A N     1 
ATOM   5046  C  CA    . ASN A  1  671  ? 228.776 324.858 202.386 1.00 0.00 ? 671  ASN A CA    1 
ATOM   5047  C  C     . ASN A  1  671  ? 229.332 324.310 201.121 1.00 0.00 ? 671  ASN A C     1 
ATOM   5048  O  O     . ASN A  1  671  ? 228.667 324.387 200.107 1.00 0.00 ? 671  ASN A O     1 
ATOM   5049  C  CB    . ASN A  1  671  ? 229.580 326.082 202.776 1.00 0.00 ? 671  ASN A CB    1 
ATOM   5050  C  CG    . ASN A  1  671  ? 228.848 326.931 203.737 1.00 0.00 ? 671  ASN A CG    1 
ATOM   5051  O  OD1   . ASN A  1  671  ? 227.634 326.811 203.846 1.00 0.00 ? 671  ASN A OD1   1 
ATOM   5052  N  ND2   . ASN A  1  671  ? 229.538 327.870 204.370 1.00 0.00 ? 671  ASN A ND2   1 
ATOM   5053  N  N     . ILE A  1  672  ? 230.477 323.661 201.172 1.00 0.00 ? 672  ILE A N     1 
ATOM   5054  C  CA    . ILE A  1  672  ? 231.049 323.170 199.944 1.00 0.00 ? 672  ILE A CA    1 
ATOM   5055  C  C     . ILE A  1  672  ? 230.080 322.309 199.214 1.00 0.00 ? 672  ILE A C     1 
ATOM   5056  O  O     . ILE A  1  672  ? 229.887 322.532 198.047 1.00 0.00 ? 672  ILE A O     1 
ATOM   5057  C  CB    . ILE A  1  672  ? 232.346 322.411 200.236 1.00 0.00 ? 672  ILE A CB    1 
ATOM   5058  C  CG1   . ILE A  1  672  ? 232.975 321.905 198.985 1.00 0.00 ? 672  ILE A CG1   1 
ATOM   5059  C  CG2   . ILE A  1  672  ? 232.107 321.129 200.955 1.00 0.00 ? 672  ILE A CG2   1 
ATOM   5060  C  CD1   . ILE A  1  672  ? 234.299 321.384 199.291 1.00 0.00 ? 672  ILE A CD1   1 
ATOM   5061  N  N     . GLN A  1  673  ? 229.407 321.404 199.904 1.00 0.00 ? 673  GLN A N     1 
ATOM   5062  C  CA    . GLN A  1  673  ? 228.443 320.517 199.280 1.00 0.00 ? 673  GLN A CA    1 
ATOM   5063  C  C     . GLN A  1  673  ? 227.159 321.057 198.765 1.00 0.00 ? 673  GLN A C     1 
ATOM   5064  O  O     . GLN A  1  673  ? 226.772 320.658 197.733 1.00 0.00 ? 673  GLN A O     1 
ATOM   5065  C  CB    . GLN A  1  673  ? 228.113 319.454 200.274 1.00 0.00 ? 673  GLN A CB    1 
ATOM   5066  C  CG    . GLN A  1  673  ? 229.272 318.624 200.560 1.00 0.00 ? 673  GLN A CG    1 
ATOM   5067  C  CD    . GLN A  1  673  ? 228.874 317.618 201.537 1.00 0.00 ? 673  GLN A CD    1 
ATOM   5068  O  OE1   . GLN A  1  673  ? 227.756 317.698 202.088 1.00 0.00 ? 673  GLN A OE1   1 
ATOM   5069  N  NE2   . GLN A  1  673  ? 229.784 316.683 201.845 1.00 0.00 ? 673  GLN A NE2   1 
ATOM   5070  N  N     . THR A  1  674  ? 226.465 321.905 199.484 1.00 0.00 ? 674  THR A N     1 
ATOM   5071  C  CA    . THR A  1  674  ? 225.227 322.435 198.930 1.00 0.00 ? 674  THR A CA    1 
ATOM   5072  C  C     . THR A  1  674  ? 225.556 323.293 197.679 1.00 0.00 ? 674  THR A C     1 
ATOM   5073  O  O     . THR A  1  674  ? 224.792 323.328 196.728 1.00 0.00 ? 674  THR A O     1 
ATOM   5074  C  CB    . THR A  1  674  ? 224.348 323.141 199.984 1.00 0.00 ? 674  THR A CB    1 
ATOM   5075  O  OG1   . THR A  1  674  ? 225.120 324.074 200.746 1.00 0.00 ? 674  THR A OG1   1 
ATOM   5076  C  CG2   . THR A  1  674  ? 223.828 322.126 200.953 1.00 0.00 ? 674  THR A CG2   1 
ATOM   5077  N  N     . VAL A  1  675  ? 226.594 324.111 197.746 1.00 0.00 ? 675  VAL A N     1 
ATOM   5078  C  CA    . VAL A  1  675  ? 226.872 325.013 196.663 1.00 0.00 ? 675  VAL A CA    1 
ATOM   5079  C  C     . VAL A  1  675  ? 227.482 324.353 195.451 1.00 0.00 ? 675  VAL A C     1 
ATOM   5080  O  O     . VAL A  1  675  ? 226.952 324.491 194.390 1.00 0.00 ? 675  VAL A O     1 
ATOM   5081  C  CB    . VAL A  1  675  ? 227.855 326.038 197.103 1.00 0.00 ? 675  VAL A CB    1 
ATOM   5082  C  CG1   . VAL A  1  675  ? 228.228 326.873 195.966 1.00 0.00 ? 675  VAL A CG1   1 
ATOM   5083  C  CG2   . VAL A  1  675  ? 227.280 326.867 198.206 1.00 0.00 ? 675  VAL A CG2   1 
ATOM   5084  N  N     . ILE A  1  676  ? 228.537 323.558 195.610 1.00 0.00 ? 676  ILE A N     1 
ATOM   5085  C  CA    . ILE A  1  676  ? 229.137 322.863 194.458 1.00 0.00 ? 676  ILE A CA    1 
ATOM   5086  C  C     . ILE A  1  676  ? 228.142 321.935 193.811 1.00 0.00 ? 676  ILE A C     1 
ATOM   5087  O  O     . ILE A  1  676  ? 227.951 321.983 192.599 1.00 0.00 ? 676  ILE A O     1 
ATOM   5088  C  CB    . ILE A  1  676  ? 230.415 322.029 194.836 1.00 0.00 ? 676  ILE A CB    1 
ATOM   5089  C  CG1   . ILE A  1  676  ? 231.597 322.898 195.319 1.00 0.00 ? 676  ILE A CG1   1 
ATOM   5090  C  CG2   . ILE A  1  676  ? 230.849 321.191 193.679 1.00 0.00 ? 676  ILE A CG2   1 
ATOM   5091  C  CD1   . ILE A  1  676  ? 232.254 323.750 194.315 1.00 0.00 ? 676  ILE A CD1   1 
ATOM   5092  N  N     . ASN A  1  677  ? 227.361 321.277 194.656 1.00 0.00 ? 677  ASN A N     1 
ATOM   5093  C  CA    . ASN A  1  677  ? 226.293 320.364 194.235 1.00 0.00 ? 677  ASN A CA    1 
ATOM   5094  C  C     . ASN A  1  677  ? 225.138 320.879 193.409 1.00 0.00 ? 677  ASN A C     1 
ATOM   5095  O  O     . ASN A  1  677  ? 224.627 320.231 192.486 1.00 0.00 ? 677  ASN A O     1 
ATOM   5096  C  CB    . ASN A  1  677  ? 225.698 319.800 195.525 1.00 0.00 ? 677  ASN A CB    1 
ATOM   5097  C  CG    . ASN A  1  677  ? 224.823 318.624 195.339 1.00 0.00 ? 677  ASN A CG    1 
ATOM   5098  O  OD1   . ASN A  1  677  ? 225.111 317.740 194.564 1.00 0.00 ? 677  ASN A OD1   1 
ATOM   5099  N  ND2   . ASN A  1  677  ? 223.768 318.560 196.132 1.00 0.00 ? 677  ASN A ND2   1 
ATOM   5100  N  N     . ASN A  1  678  ? 224.741 322.059 193.776 1.00 0.00 ? 678  ASN A N     1 
ATOM   5101  C  CA    . ASN A  1  678  ? 223.758 322.826 193.104 1.00 0.00 ? 678  ASN A CA    1 
ATOM   5102  C  C     . ASN A  1  678  ? 224.198 323.209 191.645 1.00 0.00 ? 678  ASN A C     1 
ATOM   5103  O  O     . ASN A  1  678  ? 223.430 323.101 190.682 1.00 0.00 ? 678  ASN A O     1 
ATOM   5104  C  CB    . ASN A  1  678  ? 223.465 323.974 194.085 1.00 0.00 ? 678  ASN A CB    1 
ATOM   5105  C  CG    . ASN A  1  678  ? 222.254 324.772 193.751 1.00 0.00 ? 678  ASN A CG    1 
ATOM   5106  O  OD1   . ASN A  1  678  ? 221.405 324.350 192.965 1.00 0.00 ? 678  ASN A OD1   1 
ATOM   5107  N  ND2   . ASN A  1  678  ? 222.098 325.892 194.440 1.00 0.00 ? 678  ASN A ND2   1 
ATOM   5108  N  N     . TRP A  1  679  ? 225.450 323.623 191.502 1.00 0.00 ? 679  TRP A N     1 
ATOM   5109  C  CA    . TRP A  1  679  ? 226.055 323.881 190.208 1.00 0.00 ? 679  TRP A CA    1 
ATOM   5110  C  C     . TRP A  1  679  ? 226.055 322.704 189.311 1.00 0.00 ? 679  TRP A C     1 
ATOM   5111  O  O     . TRP A  1  679  ? 225.616 322.798 188.178 1.00 0.00 ? 679  TRP A O     1 
ATOM   5112  C  CB    . TRP A  1  679  ? 227.521 324.257 190.407 1.00 0.00 ? 679  TRP A CB    1 
ATOM   5113  C  CG    . TRP A  1  679  ? 228.216 324.809 189.200 1.00 0.00 ? 679  TRP A CG    1 
ATOM   5114  C  CD1   . TRP A  1  679  ? 228.007 326.013 188.572 1.00 0.00 ? 679  TRP A CD1   1 
ATOM   5115  C  CD2   . TRP A  1  679  ? 229.070 324.057 188.329 1.00 0.00 ? 679  TRP A CD2   1 
ATOM   5116  N  NE1   . TRP A  1  679  ? 228.795 326.098 187.450 1.00 0.00 ? 679  TRP A NE1   1 
ATOM   5117  C  CE2   . TRP A  1  679  ? 229.440 324.899 187.276 1.00 0.00 ? 679  TRP A CE2   1 
ATOM   5118  C  CE3   . TRP A  1  679  ? 229.609 322.767 188.380 1.00 0.00 ? 679  TRP A CE3   1 
ATOM   5119  C  CZ2   . TRP A  1  679  ? 230.303 324.487 186.281 1.00 0.00 ? 679  TRP A CZ2   1 
ATOM   5120  C  CZ3   . TRP A  1  679  ? 230.456 322.365 187.383 1.00 0.00 ? 679  TRP A CZ3   1 
ATOM   5121  C  CH2   . TRP A  1  679  ? 230.800 323.215 186.357 1.00 0.00 ? 679  TRP A CH2   1 
ATOM   5122  N  N     . LEU A  1  680  ? 226.471 321.580 189.876 1.00 0.00 ? 680  LEU A N     1 
ATOM   5123  C  CA    . LEU A  1  680  ? 226.585 320.292 189.179 1.00 0.00 ? 680  LEU A CA    1 
ATOM   5124  C  C     . LEU A  1  680  ? 225.300 319.882 188.490 1.00 0.00 ? 680  LEU A C     1 
ATOM   5125  O  O     . LEU A  1  680  ? 225.254 319.104 187.517 1.00 0.00 ? 680  LEU A O     1 
ATOM   5126  C  CB    . LEU A  1  680  ? 227.009 319.217 190.130 1.00 0.00 ? 680  LEU A CB    1 
ATOM   5127  C  CG    . LEU A  1  680  ? 227.220 317.946 189.346 1.00 0.00 ? 680  LEU A CG    1 
ATOM   5128  C  CD1   . LEU A  1  680  ? 228.188 318.070 188.168 1.00 0.00 ? 680  LEU A CD1   1 
ATOM   5129  C  CD2   . LEU A  1  680  ? 227.716 316.960 190.357 1.00 0.00 ? 680  LEU A CD2   1 
ATOM   5130  N  N     . LEU A  1  681  ? 224.236 320.269 189.148 1.00 0.00 ? 681  LEU A N     1 
ATOM   5131  C  CA    . LEU A  1  681  ? 222.907 320.074 188.651 1.00 0.00 ? 681  LEU A CA    1 
ATOM   5132  C  C     . LEU A  1  681  ? 222.663 320.717 187.272 1.00 0.00 ? 681  LEU A C     1 
ATOM   5133  O  O     . LEU A  1  681  ? 221.943 320.119 186.472 1.00 0.00 ? 681  LEU A O     1 
ATOM   5134  C  CB    . LEU A  1  681  ? 221.984 320.605 189.706 1.00 0.00 ? 681  LEU A CB    1 
ATOM   5135  C  CG    . LEU A  1  681  ? 220.539 320.699 189.423 1.00 0.00 ? 681  LEU A CG    1 
ATOM   5136  C  CD1   . LEU A  1  681  ? 220.050 319.282 189.189 1.00 0.00 ? 681  LEU A CD1   1 
ATOM   5137  C  CD2   . LEU A  1  681  ? 220.078 321.238 190.767 1.00 0.00 ? 681  LEU A CD2   1 
ATOM   5138  N  N     . ILE A  1  682  ? 223.131 321.966 187.059 1.00 0.00 ? 682  ILE A N     1 
ATOM   5139  C  CA    . ILE A  1  682  ? 223.064 322.677 185.747 1.00 0.00 ? 682  ILE A CA    1 
ATOM   5140  C  C     . ILE A  1  682  ? 224.128 322.201 184.769 1.00 0.00 ? 682  ILE A C     1 
ATOM   5141  O  O     . ILE A  1  682  ? 223.885 322.088 183.579 1.00 0.00 ? 682  ILE A O     1 
ATOM   5142  C  CB    . ILE A  1  682  ? 223.134 324.253 185.802 1.00 0.00 ? 682  ILE A CB    1 
ATOM   5143  C  CG1   . ILE A  1  682  ? 224.551 324.806 186.110 1.00 0.00 ? 682  ILE A CG1   1 
ATOM   5144  C  CG2   . ILE A  1  682  ? 221.970 324.841 186.637 1.00 0.00 ? 682  ILE A CG2   1 
ATOM   5145  C  CD1   . ILE A  1  682  ? 224.746 326.360 185.808 1.00 0.00 ? 682  ILE A CD1   1 
ATOM   5146  N  N     . GLU A  1  683  ? 225.310 321.918 185.289 1.00 0.00 ? 683  GLU A N     1 
ATOM   5147  C  CA    . GLU A  1  683  ? 226.426 321.463 184.485 1.00 0.00 ? 683  GLU A CA    1 
ATOM   5148  C  C     . GLU A  1  683  ? 226.240 320.003 183.996 1.00 0.00 ? 683  GLU A C     1 
ATOM   5149  O  O     . GLU A  1  683  ? 226.369 319.739 182.799 1.00 0.00 ? 683  GLU A O     1 
ATOM   5150  C  CB    . GLU A  1  683  ? 227.696 321.559 185.330 1.00 0.00 ? 683  GLU A CB    1 
ATOM   5151  C  CG    . GLU A  1  683  ? 228.890 320.876 184.733 1.00 0.00 ? 683  GLU A CG    1 
ATOM   5152  C  CD    . GLU A  1  683  ? 229.425 321.668 183.548 1.00 0.00 ? 683  GLU A CD    1 
ATOM   5153  O  OE1   . GLU A  1  683  ? 229.266 322.921 183.633 1.00 0.00 ? 683  GLU A OE1   1 
ATOM   5154  O  OE2   . GLU A  1  683  ? 229.967 321.071 182.557 1.00 0.00 ? 683  GLU A OE2   1 
ATOM   5155  N  N     . GLY A  1  684  ? 225.923 319.073 184.906 1.00 0.00 ? 684  GLY A N     1 
ATOM   5156  C  CA    . GLY A  1  684  ? 225.689 317.669 184.584 1.00 0.00 ? 684  GLY A CA    1 
ATOM   5157  C  C     . GLY A  1  684  ? 226.934 316.817 184.493 1.00 0.00 ? 684  GLY A C     1 
ATOM   5158  O  O     . GLY A  1  684  ? 228.042 317.339 184.348 1.00 0.00 ? 684  GLY A O     1 
ATOM   5159  N  N     . HIS A  1  685  ? 226.736 315.497 184.559 1.00 0.00 ? 685  HIS A N     1 
ATOM   5160  C  CA    . HIS A  1  685  ? 227.820 314.497 184.540 1.00 0.00 ? 685  HIS A CA    1 
ATOM   5161  C  C     . HIS A  1  685  ? 227.276 313.145 184.093 1.00 0.00 ? 685  HIS A C     1 
ATOM   5162  O  O     . HIS A  1  685  ? 226.100 312.900 184.224 1.00 0.00 ? 685  HIS A O     1 
ATOM   5163  C  CB    . HIS A  1  685  ? 228.485 314.397 185.932 1.00 0.00 ? 685  HIS A CB    1 
ATOM   5164  C  CG    . HIS A  1  685  ? 229.438 313.250 186.070 1.00 0.00 ? 685  HIS A CG    1 
ATOM   5165  N  ND1   . HIS A  1  685  ? 230.240 312.819 185.033 1.00 0.00 ? 685  HIS A ND1   1 
ATOM   5166  C  CD2   . HIS A  1  685  ? 229.746 312.467 187.134 1.00 0.00 ? 685  HIS A CD2   1 
ATOM   5167  C  CE1   . HIS A  1  685  ? 230.975 311.799 185.443 1.00 0.00 ? 685  HIS A CE1   1 
ATOM   5168  N  NE2   . HIS A  1  685  ? 230.698 311.566 186.716 1.00 0.00 ? 685  HIS A NE2   1 
ATOM   5169  N  N     . THR A  1  686  ? 228.094 312.295 183.494 1.00 0.00 ? 686  THR A N     1 
ATOM   5170  C  CA    . THR A  1  686  ? 227.605 310.992 183.041 1.00 0.00 ? 686  THR A CA    1 
ATOM   5171  C  C     . THR A  1  686  ? 228.695 310.006 182.611 1.00 0.00 ? 686  THR A C     1 
ATOM   5172  O  O     . THR A  1  686  ? 229.882 310.317 182.619 1.00 0.00 ? 686  THR A O     1 
ATOM   5173  C  CB    . THR A  1  686  ? 226.693 311.116 181.851 1.00 0.00 ? 686  THR A CB    1 
ATOM   5174  O  OG1   . THR A  1  686  ? 226.144 309.824 181.556 1.00 0.00 ? 686  THR A OG1   1 
ATOM   5175  C  CG2   . THR A  1  686  ? 227.521 311.583 180.679 1.00 0.00 ? 686  THR A CG2   1 
ATOM   5176  N  N     . ILE A  1  687  ? 228.290 308.811 182.202 1.00 0.00 ? 687  ILE A N     1 
ATOM   5177  C  CA    . ILE A  1  687  ? 229.215 307.924 181.509 1.00 0.00 ? 687  ILE A CA    1 
ATOM   5178  C  C     . ILE A  1  687  ? 228.464 306.862 180.686 1.00 0.00 ? 687  ILE A C     1 
ATOM   5179  O  O     . ILE A  1  687  ? 227.639 306.110 181.211 1.00 0.00 ? 687  ILE A O     1 
ATOM   5180  C  CB    . ILE A  1  687  ? 230.195 307.280 182.512 1.00 0.00 ? 687  ILE A CB    1 
ATOM   5181  C  CG1   . ILE A  1  687  ? 231.204 306.376 181.806 1.00 0.00 ? 687  ILE A CG1   1 
ATOM   5182  C  CG2   . ILE A  1  687  ? 229.464 306.518 183.605 1.00 0.00 ? 687  ILE A CG2   1 
ATOM   5183  C  CD1   . ILE A  1  687  ? 231.849 305.370 182.793 1.00 0.00 ? 687  ILE A CD1   1 
ATOM   5184  N  N     . GLY A  1  688  ? 228.755 306.841 179.382 1.00 0.00 ? 688  GLY A N     1 
ATOM   5185  C  CA    . GLY A  1  688  ? 228.112 305.980 178.403 1.00 0.00 ? 688  GLY A CA    1 
ATOM   5186  C  C     . GLY A  1  688  ? 229.186 305.269 177.608 1.00 0.00 ? 688  GLY A C     1 
ATOM   5187  O  O     . GLY A  1  688  ? 230.334 305.218 178.010 1.00 0.00 ? 688  GLY A O     1 
ATOM   5188  N  N     . ILE A  1  689  ? 228.807 304.667 176.504 1.00 0.00 ? 689  ILE A N     1 
ATOM   5189  C  CA    . ILE A  1  689  ? 229.771 303.966 175.680 1.00 0.00 ? 689  ILE A CA    1 
ATOM   5190  C  C     . ILE A  1  689  ? 230.776 304.954 174.991 1.00 0.00 ? 689  ILE A C     1 
ATOM   5191  O  O     . ILE A  1  689  ? 231.908 304.576 174.632 1.00 0.00 ? 689  ILE A O     1 
ATOM   5192  C  CB    . ILE A  1  689  ? 229.009 303.047 174.677 1.00 0.00 ? 689  ILE A CB    1 
ATOM   5193  C  CG1   . ILE A  1  689  ? 228.138 302.079 175.464 1.00 0.00 ? 689  ILE A CG1   1 
ATOM   5194  C  CG2   . ILE A  1  689  ? 229.959 302.189 173.802 1.00 0.00 ? 689  ILE A CG2   1 
ATOM   5195  C  CD1   . ILE A  1  689  ? 228.923 301.325 176.453 1.00 0.00 ? 689  ILE A CD1   1 
ATOM   5196  N  N     . GLY A  1  690  ? 230.379 306.222 174.876 1.00 0.00 ? 690  GLY A N     1 
ATOM   5197  C  CA    . GLY A  1  690  ? 231.225 307.319 174.385 1.00 0.00 ? 690  GLY A CA    1 
ATOM   5198  C  C     . GLY A  1  690  ? 232.450 307.674 175.246 1.00 0.00 ? 690  GLY A C     1 
ATOM   5199  O  O     . GLY A  1  690  ? 233.429 308.305 174.821 1.00 0.00 ? 690  GLY A O     1 
ATOM   5200  N  N     . ASP A  1  691  ? 232.399 307.206 176.480 1.00 0.00 ? 691  ASP A N     1 
ATOM   5201  C  CA    . ASP A  1  691  ? 233.467 307.394 177.450 1.00 0.00 ? 691  ASP A CA    1 
ATOM   5202  C  C     . ASP A  1  691  ? 234.252 306.086 177.641 1.00 0.00 ? 691  ASP A C     1 
ATOM   5203  O  O     . ASP A  1  691  ? 234.996 305.905 178.617 1.00 0.00 ? 691  ASP A O     1 
ATOM   5204  C  CB    . ASP A  1  691  ? 232.805 307.842 178.771 1.00 0.00 ? 691  ASP A CB    1 
ATOM   5205  C  CG    . ASP A  1  691  ? 233.213 309.243 179.204 1.00 0.00 ? 691  ASP A CG    1 
ATOM   5206  O  OD1   . ASP A  1  691  ? 234.408 309.389 179.586 1.00 0.00 ? 691  ASP A OD1   1 
ATOM   5207  O  OD2   . ASP A  1  691  ? 232.367 310.180 179.102 1.00 0.00 ? 691  ASP A OD2   1 
ATOM   5208  N  N     . SER A  1  692  ? 234.111 305.200 176.654 1.00 0.00 ? 692  SER A N     1 
ATOM   5209  C  CA    . SER A  1  692  ? 234.716 303.873 176.688 1.00 0.00 ? 692  SER A CA    1 
ATOM   5210  C  C     . SER A  1  692  ? 235.374 303.419 175.396 1.00 0.00 ? 692  SER A C     1 
ATOM   5211  O  O     . SER A  1  692  ? 235.857 302.295 175.316 1.00 0.00 ? 692  SER A O     1 
ATOM   5212  C  CB    . SER A  1  692  ? 233.659 302.841 177.049 1.00 0.00 ? 692  SER A CB    1 
ATOM   5213  O  OG    . SER A  1  692  ? 233.037 303.177 178.270 1.00 0.00 ? 692  SER A OG    1 
ATOM   5214  N  N     . ILE A  1  693  ? 235.370 304.259 174.374 1.00 0.00 ? 693  ILE A N     1 
ATOM   5215  C  CA    . ILE A  1  693  ? 235.983 303.875 173.114 1.00 0.00 ? 693  ILE A CA    1 
ATOM   5216  C  C     . ILE A  1  693  ? 237.075 304.876 172.805 1.00 0.00 ? 693  ILE A C     1 
ATOM   5217  O  O     . ILE A  1  693  ? 237.029 306.022 173.255 1.00 0.00 ? 693  ILE A O     1 
ATOM   5218  C  CB    . ILE A  1  693  ? 234.960 303.819 171.950 1.00 0.00 ? 693  ILE A CB    1 
ATOM   5219  C  CG1   . ILE A  1  693  ? 234.216 305.159 171.826 1.00 0.00 ? 693  ILE A CG1   1 
ATOM   5220  C  CG2   . ILE A  1  693  ? 233.970 302.702 172.177 1.00 0.00 ? 693  ILE A CG2   1 
ATOM   5221  C  CD1   . ILE A  1  693  ? 234.824 306.149 170.814 1.00 0.00 ? 693  ILE A CD1   1 
ATOM   5222  N  N     . ALA A  1  694  ? 238.058 304.445 172.037 1.00 0.00 ? 694  ALA A N     1 
ATOM   5223  C  CA    . ALA A  1  694  ? 239.086 305.350 171.575 1.00 0.00 ? 694  ALA A CA    1 
ATOM   5224  C  C     . ALA A  1  694  ? 239.076 305.290 170.058 1.00 0.00 ? 694  ALA A C     1 
ATOM   5225  O  O     . ALA A  1  694  ? 238.245 304.592 169.471 1.00 0.00 ? 694  ALA A O     1 
ATOM   5226  C  CB    . ALA A  1  694  ? 240.436 304.972 172.138 1.00 0.00 ? 694  ALA A CB    1 
ATOM   5227  N  N     . ASP A  1  695  ? 239.972 306.040 169.425 1.00 0.00 ? 695  ASP A N     1 
ATOM   5228  C  CA    . ASP A  1  695  ? 240.045 306.074 167.966 1.00 0.00 ? 695  ASP A CA    1 
ATOM   5229  C  C     . ASP A  1  695  ? 240.683 304.822 167.360 1.00 0.00 ? 695  ASP A C     1 
ATOM   5230  O  O     . ASP A  1  695  ? 241.293 303.996 168.049 1.00 0.00 ? 695  ASP A O     1 
ATOM   5231  C  CB    . ASP A  1  695  ? 240.815 307.313 167.488 1.00 0.00 ? 695  ASP A CB    1 
ATOM   5232  C  CG    . ASP A  1  695  ? 242.308 307.213 167.757 1.00 0.00 ? 695  ASP A CG    1 
ATOM   5233  O  OD1   . ASP A  1  695  ? 242.679 306.737 168.851 1.00 0.00 ? 695  ASP A OD1   1 
ATOM   5234  O  OD2   . ASP A  1  695  ? 243.109 307.606 166.879 1.00 0.00 ? 695  ASP A OD2   1 
ATOM   5235  N  N     . SER A  1  696  ? 240.521 304.723 166.047 1.00 0.00 ? 696  SER A N     1 
ATOM   5236  C  CA    . SER A  1  696  ? 241.081 303.666 165.212 1.00 0.00 ? 696  SER A CA    1 
ATOM   5237  C  C     . SER A  1  696  ? 242.599 303.488 165.367 1.00 0.00 ? 696  SER A C     1 
ATOM   5238  O  O     . SER A  1  696  ? 243.095 302.368 165.521 1.00 0.00 ? 696  SER A O     1 
ATOM   5239  C  CB    . SER A  1  696  ? 240.732 303.932 163.739 1.00 0.00 ? 696  SER A CB    1 
ATOM   5240  O  OG    . SER A  1  696  ? 241.227 305.191 163.303 1.00 0.00 ? 696  SER A OG    1 
ATOM   5241  N  N     . LYS A  1  697  ? 243.323 304.606 165.337 1.00 0.00 ? 697  LYS A N     1 
ATOM   5242  C  CA    . LYS A  1  697  ? 244.782 304.611 165.402 1.00 0.00 ? 697  LYS A CA    1 
ATOM   5243  C  C     . LYS A  1  697  ? 245.346 304.057 166.724 1.00 0.00 ? 697  LYS A C     1 
ATOM   5244  O  O     . LYS A  1  697  ? 246.311 303.285 166.710 1.00 0.00 ? 697  LYS A O     1 
ATOM   5245  C  CB    . LYS A  1  697  ? 245.254 306.049 165.188 1.00 0.00 ? 697  LYS A CB    1 
ATOM   5246  C  CG    . LYS A  1  697  ? 245.030 306.547 163.764 1.00 0.00 ? 697  LYS A CG    1 
ATOM   5247  C  CD    . LYS A  1  697  ? 246.135 306.148 162.806 1.00 0.00 ? 697  LYS A CD    1 
ATOM   5248  C  CE    . LYS A  1  697  ? 247.422 306.888 163.126 1.00 0.00 ? 697  LYS A CE    1 
ATOM   5249  N  NZ    . LYS A  1  697  ? 248.510 306.534 162.177 1.00 0.00 ? 697  LYS A NZ    1 
ATOM   5250  N  N     . THR A  1  698  ? 244.761 304.454 167.853 1.00 0.00 ? 698  THR A N     1 
ATOM   5251  C  CA    . THR A  1  698  ? 245.143 303.921 169.172 1.00 0.00 ? 698  THR A CA    1 
ATOM   5252  C  C     . THR A  1  698  ? 244.830 302.433 169.241 1.00 0.00 ? 698  THR A C     1 
ATOM   5253  O  O     . THR A  1  698  ? 245.627 301.629 169.724 1.00 0.00 ? 698  THR A O     1 
ATOM   5254  C  CB    . THR A  1  698  ? 244.437 304.622 170.345 1.00 0.00 ? 698  THR A CB    1 
ATOM   5255  O  OG1   . THR A  1  698  ? 244.780 306.011 170.342 1.00 0.00 ? 698  THR A OG1   1 
ATOM   5256  C  CG2   . THR A  1  698  ? 244.886 304.010 171.672 1.00 0.00 ? 698  THR A CG2   1 
ATOM   5257  N  N     . TYR A  1  699  ? 243.656 302.085 168.731 1.00 0.00 ? 699  TYR A N     1 
ATOM   5258  C  CA    . TYR A  1  699  ? 243.190 300.711 168.687 1.00 0.00 ? 699  TYR A CA    1 
ATOM   5259  C  C     . TYR A  1  699  ? 244.155 299.874 167.849 1.00 0.00 ? 699  TYR A C     1 
ATOM   5260  O  O     . TYR A  1  699  ? 244.477 298.748 168.215 1.00 0.00 ? 699  TYR A O     1 
ATOM   5261  C  CB    . TYR A  1  699  ? 241.765 300.650 168.121 1.00 0.00 ? 699  TYR A CB    1 
ATOM   5262  C  CG    . TYR A  1  699  ? 241.176 299.256 168.013 1.00 0.00 ? 699  TYR A CG    1 
ATOM   5263  C  CD1   . TYR A  1  699  ? 240.558 298.650 169.112 1.00 0.00 ? 699  TYR A CD1   1 
ATOM   5264  C  CD2   . TYR A  1  699  ? 241.212 298.552 166.809 1.00 0.00 ? 699  TYR A CD2   1 
ATOM   5265  C  CE1   . TYR A  1  699  ? 240.022 297.373 169.024 1.00 0.00 ? 699  TYR A CE1   1 
ATOM   5266  C  CE2   . TYR A  1  699  ? 240.668 297.281 166.707 1.00 0.00 ? 699  TYR A CE2   1 
ATOM   5267  C  CZ    . TYR A  1  699  ? 240.077 296.695 167.819 1.00 0.00 ? 699  TYR A CZ    1 
ATOM   5268  O  OH    . TYR A  1  699  ? 239.526 295.434 167.717 1.00 0.00 ? 699  TYR A OH    1 
ATOM   5269  N  N     . GLN A  1  700  ? 244.647 300.437 166.756 1.00 0.00 ? 700  GLN A N     1 
ATOM   5270  C  CA    . GLN A  1  700  ? 245.671 299.765 165.970 1.00 0.00 ? 700  GLN A CA    1 
ATOM   5271  C  C     . GLN A  1  700  ? 246.986 299.634 166.724 1.00 0.00 ? 700  GLN A C     1 
ATOM   5272  O  O     . GLN A  1  700  ? 247.651 298.600 166.661 1.00 0.00 ? 700  GLN A O     1 
ATOM   5273  C  CB    . GLN A  1  700  ? 245.922 300.525 164.674 1.00 0.00 ? 700  GLN A CB    1 
ATOM   5274  C  CG    . GLN A  1  700  ? 246.698 299.732 163.646 1.00 0.00 ? 700  GLN A CG    1 
ATOM   5275  C  CD    . GLN A  1  700  ? 246.648 300.374 162.281 1.00 0.00 ? 700  GLN A CD    1 
ATOM   5276  O  OE1   . GLN A  1  700  ? 245.914 301.343 162.070 1.00 0.00 ? 700  GLN A OE1   1 
ATOM   5277  N  NE2   . GLN A  1  700  ? 247.442 299.848 161.343 1.00 0.00 ? 700  GLN A NE2   1 
ATOM   5278  N  N     . ASP A  1  701  ? 247.363 300.690 167.425 1.00 0.00 ? 701  ASP A N     1 
ATOM   5279  C  CA    . ASP A  1  701  ? 248.598 300.694 168.189 1.00 0.00 ? 701  ASP A CA    1 
ATOM   5280  C  C     . ASP A  1  701  ? 248.560 299.635 169.312 1.00 0.00 ? 701  ASP A C     1 
ATOM   5281  O  O     . ASP A  1  701  ? 249.536 298.918 169.513 1.00 0.00 ? 701  ASP A O     1 
ATOM   5282  C  CB    . ASP A  1  701  ? 248.866 302.101 168.736 1.00 0.00 ? 701  ASP A CB    1 
ATOM   5283  C  CG    . ASP A  1  701  ? 250.181 302.200 169.496 1.00 0.00 ? 701  ASP A CG    1 
ATOM   5284  O  OD1   . ASP A  1  701  ? 251.137 301.490 169.102 1.00 0.00 ? 701  ASP A OD1   1 
ATOM   5285  O  OD2   . ASP A  1  701  ? 250.262 303.008 170.456 1.00 0.00 ? 701  ASP A OD2   1 
ATOM   5286  N  N     . ILE A  1  702  ? 247.437 299.522 170.021 1.00 0.00 ? 702  ILE A N     1 
ATOM   5287  C  CA    . ILE A  1  702  ? 247.252 298.476 171.037 1.00 0.00 ? 702  ILE A CA    1 
ATOM   5288  C  C     . ILE A  1  702  ? 247.410 297.054 170.520 1.00 0.00 ? 702  ILE A C     1 
ATOM   5289  O  O     . ILE A  1  702  ? 248.104 296.247 171.128 1.00 0.00 ? 702  ILE A O     1 
ATOM   5290  C  CB    . ILE A  1  702  ? 245.853 298.571 171.675 1.00 0.00 ? 702  ILE A CB    1 
ATOM   5291  C  CG1   . ILE A  1  702  ? 245.762 299.799 172.571 1.00 0.00 ? 702  ILE A CG1   1 
ATOM   5292  C  CG2   . ILE A  1  702  ? 245.530 297.333 172.480 1.00 0.00 ? 702  ILE A CG2   1 
ATOM   5293  C  CD1   . ILE A  1  702  ? 244.365 300.060 173.074 1.00 0.00 ? 702  ILE A CD1   1 
ATOM   5294  N  N     . GLN A  1  703  ? 246.835 296.763 169.366 1.00 0.00 ? 703  GLN A N     1 
ATOM   5295  C  CA    . GLN A  1  703  ? 246.915 295.422 168.804 1.00 0.00 ? 703  GLN A CA    1 
ATOM   5296  C  C     . GLN A  1  703  ? 248.324 295.155 168.336 1.00 0.00 ? 703  GLN A C     1 
ATOM   5297  O  O     . GLN A  1  703  ? 248.869 294.078 168.567 1.00 0.00 ? 703  GLN A O     1 
ATOM   5298  C  CB    . GLN A  1  703  ? 245.941 295.230 167.642 1.00 0.00 ? 703  GLN A CB    1 
ATOM   5299  C  CG    . GLN A  1  703  ? 244.489 295.085 168.062 1.00 0.00 ? 703  GLN A CG    1 
ATOM   5300  C  CD    . GLN A  1  703  ? 243.526 295.153 166.884 1.00 0.00 ? 703  GLN A CD    1 
ATOM   5301  O  OE1   . GLN A  1  703  ? 243.832 295.743 165.839 1.00 0.00 ? 703  GLN A OE1   1 
ATOM   5302  N  NE2   . GLN A  1  703  ? 242.358 294.537 167.047 1.00 0.00 ? 703  GLN A NE2   1 
ATOM   5303  N  N     . ASN A  1  704  ? 248.933 296.163 167.731 1.00 0.00 ? 704  ASN A N     1 
ATOM   5304  C  CA    . ASN A  1  704  ? 250.296 296.018 167.279 1.00 0.00 ? 704  ASN A CA    1 
ATOM   5305  C  C     . ASN A  1  704  ? 251.270 295.835 168.447 1.00 0.00 ? 704  ASN A C     1 
ATOM   5306  O  O     . ASN A  1  704  ? 252.197 295.025 168.354 1.00 0.00 ? 704  ASN A O     1 
ATOM   5307  C  CB    . ASN A  1  704  ? 250.669 297.260 166.463 1.00 0.00 ? 704  ASN A CB    1 
ATOM   5308  C  CG    . ASN A  1  704  ? 251.993 297.135 165.780 1.00 0.00 ? 704  ASN A CG    1 
ATOM   5309  O  OD1   . ASN A  1  704  ? 252.543 296.042 165.659 1.00 0.00 ? 704  ASN A OD1   1 
ATOM   5310  N  ND2   . ASN A  1  704  ? 252.524 298.260 165.320 1.00 0.00 ? 704  ASN A ND2   1 
ATOM   5311  N  N     . THR A  1  705  ? 251.019 296.498 169.574 1.00 0.00 ? 705  THR A N     1 
ATOM   5312  C  CA    . THR A  1  705  ? 251.889 296.324 170.733 1.00 0.00 ? 705  THR A CA    1 
ATOM   5313  C  C     . THR A  1  705  ? 251.746 294.949 171.307 1.00 0.00 ? 705  THR A C     1 
ATOM   5314  O  O     . THR A  1  705  ? 252.718 294.325 171.697 1.00 0.00 ? 705  THR A O     1 
ATOM   5315  C  CB    . THR A  1  705  ? 251.593 297.325 171.833 1.00 0.00 ? 705  THR A CB    1 
ATOM   5316  O  OG1   . THR A  1  705  ? 251.820 298.640 171.334 1.00 0.00 ? 705  THR A OG1   1 
ATOM   5317  C  CG2   . THR A  1  705  ? 252.521 297.100 172.994 1.00 0.00 ? 705  THR A CG2   1 
ATOM   5318  N  N     . ILE A  1  706  ? 250.525 294.452 171.297 1.00 0.00 ? 706  ILE A N     1 
ATOM   5319  C  CA    . ILE A  1  706  ? 250.280 293.096 171.731 1.00 0.00 ? 706  ILE A CA    1 
ATOM   5320  C  C     . ILE A  1  706  ? 250.808 292.061 170.746 1.00 0.00 ? 706  ILE A C     1 
ATOM   5321  O  O     . ILE A  1  706  ? 251.423 291.080 171.160 1.00 0.00 ? 706  ILE A O     1 
ATOM   5322  C  CB    . ILE A  1  706  ? 248.800 292.856 171.976 1.00 0.00 ? 706  ILE A CB    1 
ATOM   5323  C  CG1   . ILE A  1  706  ? 248.340 293.703 173.159 1.00 0.00 ? 706  ILE A CG1   1 
ATOM   5324  C  CG2   . ILE A  1  706  ? 248.536 291.383 172.258 1.00 0.00 ? 706  ILE A CG2   1 
ATOM   5325  C  CD1   . ILE A  1  706  ? 246.839 293.689 173.364 1.00 0.00 ? 706  ILE A CD1   1 
ATOM   5326  N  N     . LYS A  1  707  ? 250.605 292.273 169.448 1.00 0.00 ? 707  LYS A N     1 
ATOM   5327  C  CA    . LYS A  1  707  ? 251.154 291.326 168.486 1.00 0.00 ? 707  LYS A CA    1 
ATOM   5328  C  C     . LYS A  1  707  ? 252.669 291.225 168.540 1.00 0.00 ? 707  LYS A C     1 
ATOM   5329  O  O     . LYS A  1  707  ? 253.208 290.118 168.456 1.00 0.00 ? 707  LYS A O     1 
ATOM   5330  C  CB    . LYS A  1  707  ? 250.752 291.722 167.067 1.00 0.00 ? 707  LYS A CB    1 
ATOM   5331  C  CG    . LYS A  1  707  ? 249.290 291.534 166.715 1.00 0.00 ? 707  LYS A CG    1 
ATOM   5332  C  CD    . LYS A  1  707  ? 249.054 291.945 165.251 1.00 0.00 ? 707  LYS A CD    1 
ATOM   5333  C  CE    . LYS A  1  707  ? 247.649 291.584 164.742 1.00 0.00 ? 707  LYS A CE    1 
ATOM   5334  N  NZ    . LYS A  1  707  ? 246.561 292.407 165.379 1.00 0.00 ? 707  LYS A NZ    1 
ATOM   5335  N  N     . LYS A  1  708  ? 253.364 292.351 168.688 1.00 0.00 ? 708  LYS A N     1 
ATOM   5336  C  CA    . LYS A  1  708  ? 254.802 292.293 168.960 1.00 0.00 ? 708  LYS A CA    1 
ATOM   5337  C  C     . LYS A  1  708  ? 255.184 291.546 170.242 1.00 0.00 ? 708  LYS A C     1 
ATOM   5338  O  O     . LYS A  1  708  ? 256.110 290.735 170.236 1.00 0.00 ? 708  LYS A O     1 
ATOM   5339  C  CB    . LYS A  1  708  ? 255.395 293.703 168.979 1.00 0.00 ? 708  LYS A CB    1 
ATOM   5340  C  CG    . LYS A  1  708  ? 255.657 294.262 167.582 1.00 0.00 ? 708  LYS A CG    1 
ATOM   5341  C  CD    . LYS A  1  708  ? 256.200 295.679 167.638 1.00 0.00 ? 708  LYS A CD    1 
ATOM   5342  C  CE    . LYS A  1  708  ? 257.476 295.760 168.458 1.00 0.00 ? 708  LYS A CE    1 
ATOM   5343  N  NZ    . LYS A  1  708  ? 258.537 294.878 167.918 1.00 0.00 ? 708  LYS A NZ    1 
ATOM   5344  N  N     . ALA A  1  709  ? 254.475 291.801 171.333 1.00 0.00 ? 709  ALA A N     1 
ATOM   5345  C  CA    . ALA A  1  709  ? 254.795 291.118 172.583 1.00 0.00 ? 709  ALA A CA    1 
ATOM   5346  C  C     . ALA A  1  709  ? 254.535 289.611 172.571 1.00 0.00 ? 709  ALA A C     1 
ATOM   5347  O  O     . ALA A  1  709  ? 255.340 288.841 173.080 1.00 0.00 ? 709  ALA A O     1 
ATOM   5348  C  CB    . ALA A  1  709  ? 254.024 291.762 173.733 1.00 0.00 ? 709  ALA A CB    1 
ATOM   5349  N  N     . LYS A  1  710  ? 253.449 289.181 171.944 1.00 0.00 ? 710  LYS A N     1 
ATOM   5350  C  CA    . LYS A  1  710  ? 253.215 287.755 171.779 1.00 0.00 ? 710  LYS A CA    1 
ATOM   5351  C  C     . LYS A  1  710  ? 254.267 287.049 170.953 1.00 0.00 ? 710  LYS A C     1 
ATOM   5352  O  O     . LYS A  1  710  ? 254.642 285.930 171.272 1.00 0.00 ? 710  LYS A O     1 
ATOM   5353  C  CB    . LYS A  1  710  ? 251.847 287.478 171.176 1.00 0.00 ? 710  LYS A CB    1 
ATOM   5354  C  CG    . LYS A  1  710  ? 250.664 287.766 172.079 1.00 0.00 ? 710  LYS A CG    1 
ATOM   5355  C  CD    . LYS A  1  710  ? 249.414 287.556 171.264 1.00 0.00 ? 710  LYS A CD    1 
ATOM   5356  C  CE    . LYS A  1  710  ? 249.202 286.063 171.037 1.00 0.00 ? 710  LYS A CE    1 
ATOM   5357  N  NZ    . LYS A  1  710  ? 247.911 285.785 170.350 1.00 0.00 ? 710  LYS A NZ    1 
ATOM   5358  N  N     . GLN A  1  711  ? 254.741 287.694 169.895 1.00 0.00 ? 711  GLN A N     1 
ATOM   5359  C  CA    . GLN A  1  711  ? 255.803 287.111 169.085 1.00 0.00 ? 711  GLN A CA    1 
ATOM   5360  C  C     . GLN A  1  711  ? 257.082 287.007 169.911 1.00 0.00 ? 711  GLN A C     1 
ATOM   5361  O  O     . GLN A  1  711  ? 257.825 286.027 169.809 1.00 0.00 ? 711  GLN A O     1 
ATOM   5362  C  CB    . GLN A  1  711  ? 256.036 287.928 167.815 1.00 0.00 ? 711  GLN A CB    1 
ATOM   5363  C  CG    . GLN A  1  711  ? 256.882 287.207 166.783 1.00 0.00 ? 711  GLN A CG    1 
ATOM   5364  C  CD    . GLN A  1  711  ? 257.117 288.045 165.546 1.00 0.00 ? 711  GLN A CD    1 
ATOM   5365  O  OE1   . GLN A  1  711  ? 256.166 288.457 164.880 1.00 0.00 ? 711  GLN A OE1   1 
ATOM   5366  N  NE2   . GLN A  1  711  ? 258.387 288.283 165.214 1.00 0.00 ? 711  GLN A NE2   1 
ATOM   5367  N  N     . ASP A  1  712  ? 257.326 288.030 170.722 1.00 0.00 ? 712  ASP A N     1 
ATOM   5368  C  CA    . ASP A  1  712  ? 258.436 288.043 171.668 1.00 0.00 ? 712  ASP A CA    1 
ATOM   5369  C  C     . ASP A  1  712  ? 258.343 286.952 172.740 1.00 0.00 ? 712  ASP A C     1 
ATOM   5370  O  O     . ASP A  1  712  ? 259.364 286.462 173.203 1.00 0.00 ? 712  ASP A O     1 
ATOM   5371  C  CB    . ASP A  1  712  ? 258.541 289.417 172.328 1.00 0.00 ? 712  ASP A CB    1 
ATOM   5372  C  CG    . ASP A  1  712  ? 259.367 290.400 171.501 1.00 0.00 ? 712  ASP A CG    1 
ATOM   5373  O  OD1   . ASP A  1  712  ? 260.069 289.952 170.560 1.00 0.00 ? 712  ASP A OD1   1 
ATOM   5374  O  OD2   . ASP A  1  712  ? 259.307 291.620 171.789 1.00 0.00 ? 712  ASP A OD2   1 
ATOM   5375  N  N     . VAL A  1  713  ? 257.140 286.575 173.156 1.00 0.00 ? 713  VAL A N     1 
ATOM   5376  C  CA    . VAL A  1  713  ? 257.017 285.452 174.084 1.00 0.00 ? 713  VAL A CA    1 
ATOM   5377  C  C     . VAL A  1  713  ? 257.310 284.118 173.415 1.00 0.00 ? 713  VAL A C     1 
ATOM   5378  O  O     . VAL A  1  713  ? 258.045 283.308 173.961 1.00 0.00 ? 713  VAL A O     1 
ATOM   5379  C  CB    . VAL A  1  713  ? 255.595 285.359 174.704 1.00 0.00 ? 713  VAL A CB    1 
ATOM   5380  C  CG1   . VAL A  1  713  ? 255.438 284.065 175.493 1.00 0.00 ? 713  VAL A CG1   1 
ATOM   5381  C  CG2   . VAL A  1  713  ? 255.299 286.551 175.593 1.00 0.00 ? 713  VAL A CG2   1 
ATOM   5382  N  N     . ILE A  1  714  ? 256.767 283.914 172.219 1.00 0.00 ? 714  ILE A N     1 
ATOM   5383  C  CA    . ILE A  1  714  ? 257.078 282.743 171.396 1.00 0.00 ? 714  ILE A CA    1 
ATOM   5384  C  C     . ILE A  1  714  ? 258.576 282.622 171.123 1.00 0.00 ? 714  ILE A C     1 
ATOM   5385  O  O     . ILE A  1  714  ? 259.154 281.529 171.088 1.00 0.00 ? 714  ILE A O     1 
ATOM   5386  C  CB    . ILE A  1  714  ? 256.305 282.799 170.056 1.00 0.00 ? 714  ILE A CB    1 
ATOM   5387  C  CG1   . ILE A  1  714  ? 254.795 282.760 170.313 1.00 0.00 ? 714  ILE A CG1   1 
ATOM   5388  C  CG2   . ILE A  1  714  ? 256.720 281.664 169.127 1.00 0.00 ? 714  ILE A CG2   1 
ATOM   5389  C  CD1   . ILE A  1  714  ? 254.312 281.474 170.951 1.00 0.00 ? 714  ILE A CD1   1 
ATOM   5390  N  N     . GLU A  1  715  ? 259.199 283.773 170.944 1.00 0.00 ? 715  GLU A N     1 
ATOM   5391  C  CA    . GLU A  1  715  ? 260.634 283.878 170.783 1.00 0.00 ? 715  GLU A CA    1 
ATOM   5392  C  C     . GLU A  1  715  ? 261.415 283.394 172.018 1.00 0.00 ? 715  GLU A C     1 
ATOM   5393  O  O     . GLU A  1  715  ? 262.409 282.692 171.880 1.00 0.00 ? 715  GLU A O     1 
ATOM   5394  C  CB    . GLU A  1  715  ? 260.967 285.330 170.444 1.00 0.00 ? 715  GLU A CB    1 
ATOM   5395  C  CG    . GLU A  1  715  ? 262.364 285.616 169.989 1.00 0.00 ? 715  GLU A CG    1 
ATOM   5396  C  CD    . GLU A  1  715  ? 262.408 286.909 169.211 1.00 0.00 ? 715  GLU A CD    1 
ATOM   5397  O  OE1   . GLU A  1  715  ? 262.666 287.964 169.830 1.00 0.00 ? 715  GLU A OE1   1 
ATOM   5398  O  OE2   . GLU A  1  715  ? 262.155 286.868 167.985 1.00 0.00 ? 715  GLU A OE2   1 
ATOM   5399  N  N     . VAL A  1  716  ? 260.949 283.749 173.215 1.00 0.00 ? 716  VAL A N     1 
ATOM   5400  C  CA    . VAL A  1  716  ? 261.566 283.313 174.470 1.00 0.00 ? 716  VAL A CA    1 
ATOM   5401  C  C     . VAL A  1  716  ? 261.300 281.863 174.763 1.00 0.00 ? 716  VAL A C     1 
ATOM   5402  O  O     . VAL A  1  716  ? 262.114 281.188 175.367 1.00 0.00 ? 716  VAL A O     1 
ATOM   5403  C  CB    . VAL A  1  716  ? 261.057 284.128 175.662 1.00 0.00 ? 716  VAL A CB    1 
ATOM   5404  C  CG1   . VAL A  1  716  ? 261.567 283.545 176.967 1.00 0.00 ? 716  VAL A CG1   1 
ATOM   5405  C  CG2   . VAL A  1  716  ? 261.522 285.559 175.543 1.00 0.00 ? 716  VAL A CG2   1 
ATOM   5406  N  N     . ILE A  1  717  ? 260.152 281.379 174.322 1.00 0.00 ? 717  ILE A N     1 
ATOM   5407  C  CA    . ILE A  1  717  ? 259.845 279.964 174.426 1.00 0.00 ? 717  ILE A CA    1 
ATOM   5408  C  C     . ILE A  1  717  ? 260.732 279.174 173.478 1.00 0.00 ? 717  ILE A C     1 
ATOM   5409  O  O     . ILE A  1  717  ? 261.255 278.129 173.853 1.00 0.00 ? 717  ILE A O     1 
ATOM   5410  C  CB    . ILE A  1  717  ? 258.364 279.672 174.121 1.00 0.00 ? 717  ILE A CB    1 
ATOM   5411  C  CG1   . ILE A  1  717  ? 257.460 280.275 175.200 1.00 0.00 ? 717  ILE A CG1   1 
ATOM   5412  C  CG2   . ILE A  1  717  ? 258.127 278.190 174.047 1.00 0.00 ? 717  ILE A CG2   1 
ATOM   5413  C  CD1   . ILE A  1  717  ? 255.983 280.218 174.868 1.00 0.00 ? 717  ILE A CD1   1 
ATOM   5414  N  N     . GLU A  1  718  ? 260.922 279.679 172.262 1.00 0.00 ? 718  GLU A N     1 
ATOM   5415  C  CA    . GLU A  1  718  ? 261.878 279.078 171.325 1.00 0.00 ? 718  GLU A CA    1 
ATOM   5416  C  C     . GLU A  1  718  ? 263.331 278.987 171.850 1.00 0.00 ? 718  GLU A C     1 
ATOM   5417  O  O     . GLU A  1  718  ? 263.981 277.952 171.693 1.00 0.00 ? 718  GLU A O     1 
ATOM   5418  C  CB    . GLU A  1  718  ? 261.847 279.862 170.004 1.00 0.00 ? 718  GLU A CB    1 
ATOM   5419  C  CG    . GLU A  1  718  ? 262.715 279.292 168.878 1.00 0.00 ? 718  GLU A CG    1 
ATOM   5420  C  CD    . GLU A  1  718  ? 262.566 280.063 167.563 1.00 0.00 ? 718  GLU A CD    1 
ATOM   5421  O  OE1   . GLU A  1  718  ? 261.413 280.395 167.200 1.00 0.00 ? 718  GLU A OE1   1 
ATOM   5422  O  OE2   . GLU A  1  718  ? 263.602 280.335 166.904 1.00 0.00 ? 718  GLU A OE2   1 
ATOM   5423  N  N     . LYS A  1  719  ? 263.828 280.050 172.474 1.00 0.00 ? 719  LYS A N     1 
ATOM   5424  C  CA    . LYS A  1  719  ? 265.109 280.037 173.194 1.00 0.00 ? 719  LYS A CA    1 
ATOM   5425  C  C     . LYS A  1  719  ? 265.187 279.026 174.337 1.00 0.00 ? 719  LYS A C     1 
ATOM   5426  O  O     . LYS A  1  719  ? 266.224 278.408 174.545 1.00 0.00 ? 719  LYS A O     1 
ATOM   5427  C  CB    . LYS A  1  719  ? 265.437 281.429 173.733 1.00 0.00 ? 719  LYS A CB    1 
ATOM   5428  C  CG    . LYS A  1  719  ? 265.979 282.385 172.683 1.00 0.00 ? 719  LYS A CG    1 
ATOM   5429  C  CD    . LYS A  1  719  ? 266.384 283.704 173.307 1.00 0.00 ? 719  LYS A CD    1 
ATOM   5430  C  CE    . LYS A  1  719  ? 267.494 283.516 174.323 1.00 0.00 ? 719  LYS A CE    1 
ATOM   5431  N  NZ    . LYS A  1  719  ? 268.088 284.828 174.696 1.00 0.00 ? 719  LYS A NZ    1 
ATOM   5432  N  N     . ALA A  1  720  ? 264.118 278.923 175.114 1.00 0.00 ? 720  ALA A N     1 
ATOM   5433  C  CA    . ALA A  1  720  ? 264.031 277.982 176.230 1.00 0.00 ? 720  ALA A CA    1 
ATOM   5434  C  C     . ALA A  1  720  ? 264.061 276.521 175.819 1.00 0.00 ? 720  ALA A C     1 
ATOM   5435  O  O     . ALA A  1  720  ? 264.679 275.711 176.495 1.00 0.00 ? 720  ALA A O     1 
ATOM   5436  C  CB    . ALA A  1  720  ? 262.784 278.250 177.020 1.00 0.00 ? 720  ALA A CB    1 
ATOM   5437  N  N     . HIS A  1  721  ? 263.342 276.167 174.763 1.00 0.00 ? 721  HIS A N     1 
ATOM   5438  C  CA    . HIS A  1  721  ? 263.345 274.785 174.296 1.00 0.00 ? 721  HIS A CA    1 
ATOM   5439  C  C     . HIS A  1  721  ? 264.693 274.369 173.680 1.00 0.00 ? 721  HIS A C     1 
ATOM   5440  O  O     . HIS A  1  721  ? 265.041 273.190 173.673 1.00 0.00 ? 721  HIS A O     1 
ATOM   5441  C  CB    . HIS A  1  721  ? 262.206 274.554 173.300 1.00 0.00 ? 721  HIS A CB    1 
ATOM   5442  C  CG    . HIS A  1  721  ? 260.846 274.555 173.930 1.00 0.00 ? 721  HIS A CG    1 
ATOM   5443  N  ND1   . HIS A  1  721  ? 259.682 274.427 173.198 1.00 0.00 ? 721  HIS A ND1   1 
ATOM   5444  C  CD2   . HIS A  1  721  ? 260.463 274.654 175.225 1.00 0.00 ? 721  HIS A CD2   1 
ATOM   5445  C  CE1   . HIS A  1  721  ? 258.645 274.445 174.016 1.00 0.00 ? 721  HIS A CE1   1 
ATOM   5446  N  NE2   . HIS A  1  721  ? 259.091 274.584 175.252 1.00 0.00 ? 721  HIS A NE2   1 
ATOM   5447  N  N     . ASN A  1  722  ? 265.451 275.336 173.170 1.00 0.00 ? 722  ASN A N     1 
ATOM   5448  C  CA    . ASN A  1  722  ? 266.799 275.078 172.653 1.00 0.00 ? 722  ASN A CA    1 
ATOM   5449  C  C     . ASN A  1  722  ? 267.814 274.674 173.711 1.00 0.00 ? 722  ASN A C     1 
ATOM   5450  O  O     . ASN A  1  722  ? 268.893 274.198 173.373 1.00 0.00 ? 722  ASN A O     1 
ATOM   5451  C  CB    . ASN A  1  722  ? 267.332 276.313 171.928 1.00 0.00 ? 722  ASN A CB    1 
ATOM   5452  C  CG    . ASN A  1  722  ? 266.744 276.475 170.542 1.00 0.00 ? 722  ASN A CG    1 
ATOM   5453  O  OD1   . ASN A  1  722  ? 266.313 275.502 169.920 1.00 0.00 ? 722  ASN A OD1   1 
ATOM   5454  N  ND2   . ASN A  1  722  ? 266.725 277.713 170.048 1.00 0.00 ? 722  ASN A ND2   1 
ATOM   5455  N  N     . ASN A  1  723  ? 267.468 274.889 174.976 1.00 0.00 ? 723  ASN A N     1 
ATOM   5456  C  CA    . ASN A  1  723  ? 268.364 274.627 176.101 1.00 0.00 ? 723  ASN A CA    1 
ATOM   5457  C  C     . ASN A  1  723  ? 269.639 275.464 176.036 1.00 0.00 ? 723  ASN A C     1 
ATOM   5458  O  O     . ASN A  1  723  ? 270.726 274.941 175.792 1.00 0.00 ? 723  ASN A O     1 
ATOM   5459  C  CB    . ASN A  1  723  ? 268.710 273.135 176.169 1.00 0.00 ? 723  ASN A CB    1 
ATOM   5460  C  CG    . ASN A  1  723  ? 269.386 272.750 177.472 1.00 0.00 ? 723  ASN A CG    1 
ATOM   5461  O  OD1   . ASN A  1  723  ? 269.028 273.247 178.542 1.00 0.00 ? 723  ASN A OD1   1 
ATOM   5462  N  ND2   . ASN A  1  723  ? 270.373 271.857 177.390 1.00 0.00 ? 723  ASN A ND2   1 
ATOM   5463  N  N     . GLU A  1  724  ? 269.505 276.762 176.285 1.00 0.00 ? 724  GLU A N     1 
ATOM   5464  C  CA    . GLU A  1  724  ? 270.636 277.670 176.175 1.00 0.00 ? 724  GLU A CA    1 
ATOM   5465  C  C     . GLU A  1  724  ? 270.309 279.041 176.736 1.00 0.00 ? 724  GLU A C     1 
ATOM   5466  O  O     . GLU A  1  724  ? 271.069 279.991 176.558 1.00 0.00 ? 724  GLU A O     1 
ATOM   5467  C  CB    . GLU A  1  724  ? 271.048 277.794 174.715 1.00 0.00 ? 724  GLU A CB    1 
ATOM   5468  C  CG    . GLU A  1  724  ? 269.980 278.446 173.853 1.00 0.00 ? 724  GLU A CG    1 
ATOM   5469  C  CD    . GLU A  1  724  ? 270.343 278.462 172.377 1.00 0.00 ? 724  GLU A CD    1 
ATOM   5470  O  OE1   . GLU A  1  724  ? 271.513 278.156 172.040 1.00 0.00 ? 724  GLU A OE1   1 
ATOM   5471  O  OE2   . GLU A  1  724  ? 269.447 278.776 171.559 1.00 0.00 ? 724  GLU A OE2   1 
ATOM   5472  N  N     . LEU A  1  725  ? 269.164 279.133 177.402 1.00 0.00 ? 725  LEU A N     1 
ATOM   5473  C  CA    . LEU A  1  725  ? 268.663 280.395 177.939 1.00 0.00 ? 725  LEU A CA    1 
ATOM   5474  C  C     . LEU A  1  725  ? 269.610 281.088 178.928 1.00 0.00 ? 725  LEU A C     1 
ATOM   5475  O  O     . LEU A  1  725  ? 269.646 282.321 178.987 1.00 0.00 ? 725  LEU A O     1 
ATOM   5476  C  CB    . LEU A  1  725  ? 267.307 280.168 178.609 1.00 0.00 ? 725  LEU A CB    1 
ATOM   5477  C  CG    . LEU A  1  725  ? 266.702 281.400 179.276 1.00 0.00 ? 725  LEU A CG    1 
ATOM   5478  C  CD1   . LEU A  1  725  ? 266.508 282.515 178.262 1.00 0.00 ? 725  LEU A CD1   1 
ATOM   5479  C  CD2   . LEU A  1  725  ? 265.396 281.042 179.949 1.00 0.00 ? 725  LEU A CD2   1 
ATOM   5480  N  N     . GLU A  1  726  ? 270.348 280.291 179.706 1.00 0.00 ? 726  GLU A N     1 
ATOM   5481  C  CA    . GLU A  1  726  ? 271.244 280.777 180.766 1.00 0.00 ? 726  GLU A CA    1 
ATOM   5482  C  C     . GLU A  1  726  ? 270.417 281.354 181.910 1.00 0.00 ? 726  GLU A C     1 
ATOM   5483  O  O     . GLU A  1  726  ? 269.887 282.461 181.799 1.00 0.00 ? 726  GLU A O     1 
ATOM   5484  C  CB    . GLU A  1  726  ? 272.235 281.824 180.241 1.00 0.00 ? 726  GLU A CB    1 
ATOM   5485  C  CG    . GLU A  1  726  ? 273.271 281.283 179.275 1.00 0.00 ? 726  GLU A CG    1 
ATOM   5486  C  CD    . GLU A  1  726  ? 274.391 282.275 179.010 1.00 0.00 ? 726  GLU A CD    1 
ATOM   5487  O  OE1   . GLU A  1  726  ? 274.242 283.453 179.401 1.00 0.00 ? 726  GLU A OE1   1 
ATOM   5488  O  OE2   . GLU A  1  726  ? 275.413 281.879 178.409 1.00 0.00 ? 726  GLU A OE2   1 
ATOM   5489  N  N     . PRO A  1  727  ? 270.325 280.618 183.028 1.00 0.00 ? 727  PRO A N     1 
ATOM   5490  C  CA    . PRO A  1  727  ? 269.372 280.998 184.076 1.00 0.00 ? 727  PRO A CA    1 
ATOM   5491  C  C     . PRO A  1  727  ? 269.764 282.257 184.836 1.00 0.00 ? 727  PRO A C     1 
ATOM   5492  O  O     . PRO A  1  727  ? 270.902 282.716 184.754 1.00 0.00 ? 727  PRO A O     1 
ATOM   5493  C  CB    . PRO A  1  727  ? 269.384 279.783 185.006 1.00 0.00 ? 727  PRO A CB    1 
ATOM   5494  C  CG    . PRO A  1  727  ? 270.755 279.228 184.854 1.00 0.00 ? 727  PRO A CG    1 
ATOM   5495  C  CD    . PRO A  1  727  ? 271.108 279.428 183.404 1.00 0.00 ? 727  PRO A CD    1 
ATOM   5496  N  N     . THR A  1  728  ? 268.809 282.796 185.583 1.00 0.00 ? 728  THR A N     1 
ATOM   5497  C  CA    . THR A  1  728  ? 269.050 283.946 186.435 1.00 0.00 ? 728  THR A CA    1 
ATOM   5498  C  C     . THR A  1  728  ? 269.452 283.459 187.822 1.00 0.00 ? 728  THR A C     1 
ATOM   5499  O  O     . THR A  1  728  ? 269.043 282.378 188.247 1.00 0.00 ? 728  THR A O     1 
ATOM   5500  C  CB    . THR A  1  728  ? 267.806 284.872 186.527 1.00 0.00 ? 728  THR A CB    1 
ATOM   5501  O  OG1   . THR A  1  728  ? 266.615 284.085 186.646 1.00 0.00 ? 728  THR A OG1   1 
ATOM   5502  C  CG2   . THR A  1  728  ? 267.706 285.762 185.297 1.00 0.00 ? 728  THR A CG2   1 
ATOM   5503  N  N     . PRO A  1  729  ? 270.278 284.250 188.522 1.00 0.00 ? 729  PRO A N     1 
ATOM   5504  C  CA    . PRO A  1  729  ? 270.815 283.972 189.859 1.00 0.00 ? 729  PRO A CA    1 
ATOM   5505  C  C     . PRO A  1  729  ? 269.794 283.477 190.880 1.00 0.00 ? 729  PRO A C     1 
ATOM   5506  O  O     . PRO A  1  729  ? 268.708 284.045 191.004 1.00 0.00 ? 729  PRO A O     1 
ATOM   5507  C  CB    . PRO A  1  729  ? 271.371 285.329 190.281 1.00 0.00 ? 729  PRO A CB    1 
ATOM   5508  C  CG    . PRO A  1  729  ? 271.795 285.926 189.003 1.00 0.00 ? 729  PRO A CG    1 
ATOM   5509  C  CD    . PRO A  1  729  ? 270.762 285.543 188.010 1.00 0.00 ? 729  PRO A CD    1 
ATOM   5510  N  N     . GLY A  1  730  ? 270.155 282.415 191.595 1.00 0.00 ? 730  GLY A N     1 
ATOM   5511  C  CA    . GLY A  1  730  ? 269.329 281.884 192.665 1.00 0.00 ? 730  GLY A CA    1 
ATOM   5512  C  C     . GLY A  1  730  ? 268.020 281.269 192.215 1.00 0.00 ? 730  GLY A C     1 
ATOM   5513  O  O     . GLY A  1  730  ? 267.126 281.036 193.027 1.00 0.00 ? 730  GLY A O     1 
ATOM   5514  N  N     . ASN A  1  731  ? 267.894 281.020 190.917 1.00 0.00 ? 731  ASN A N     1 
ATOM   5515  C  CA    . ASN A  1  731  ? 266.657 280.476 190.381 1.00 0.00 ? 731  ASN A CA    1 
ATOM   5516  C  C     . ASN A  1  731  ? 266.873 279.271 189.480 1.00 0.00 ? 731  ASN A C     1 
ATOM   5517  O  O     . ASN A  1  731  ? 267.901 279.155 188.817 1.00 0.00 ? 731  ASN A O     1 
ATOM   5518  C  CB    . ASN A  1  731  ? 265.910 281.561 189.619 1.00 0.00 ? 731  ASN A CB    1 
ATOM   5519  C  CG    . ASN A  1  731  ? 265.381 282.636 190.528 1.00 0.00 ? 731  ASN A CG    1 
ATOM   5520  O  OD1   . ASN A  1  731  ? 264.330 282.480 191.143 1.00 0.00 ? 731  ASN A OD1   1 
ATOM   5521  N  ND2   . ASN A  1  731  ? 266.113 283.736 190.630 1.00 0.00 ? 731  ASN A ND2   1 
ATOM   5522  N  N     . THR A  1  732  ? 265.894 278.377 189.454 1.00 0.00 ? 732  THR A N     1 
ATOM   5523  C  CA    . THR A  1  732  ? 265.876 277.309 188.465 1.00 0.00 ? 732  THR A CA    1 
ATOM   5524  C  C     . THR A  1  732  ? 265.560 277.906 187.105 1.00 0.00 ? 732  THR A C     1 
ATOM   5525  O  O     . THR A  1  732  ? 265.090 279.040 187.014 1.00 0.00 ? 732  THR A O     1 
ATOM   5526  C  CB    . THR A  1  732  ? 264.847 276.225 188.804 1.00 0.00 ? 732  THR A CB    1 
ATOM   5527  O  OG1   . THR A  1  732  ? 263.525 276.733 188.579 1.00 0.00 ? 732  THR A OG1   1 
ATOM   5528  C  CG2   . THR A  1  732  ? 264.984 275.804 190.257 1.00 0.00 ? 732  THR A CG2   1 
ATOM   5529  N  N     . LEU A  1  733  ? 265.802 277.145 186.045 1.00 0.00 ? 733  LEU A N     1 
ATOM   5530  C  CA    . LEU A  1  733  ? 265.655 277.686 184.706 1.00 0.00 ? 733  LEU A CA    1 
ATOM   5531  C  C     . LEU A  1  733  ? 264.189 277.990 184.354 1.00 0.00 ? 733  LEU A C     1 
ATOM   5532  O  O     . LEU A  1  733  ? 263.923 278.969 183.659 1.00 0.00 ? 733  LEU A O     1 
ATOM   5533  C  CB    . LEU A  1  733  ? 266.277 276.733 183.683 1.00 0.00 ? 733  LEU A CB    1 
ATOM   5534  C  CG    . LEU A  1  733  ? 266.410 277.241 182.249 1.00 0.00 ? 733  LEU A CG    1 
ATOM   5535  C  CD1   . LEU A  1  733  ? 267.015 278.634 182.240 1.00 0.00 ? 733  LEU A CD1   1 
ATOM   5536  C  CD2   . LEU A  1  733  ? 267.265 276.289 181.435 1.00 0.00 ? 733  LEU A CD2   1 
ATOM   5537  N  N     . ARG A  1  734  ? 263.239 277.189 184.838 1.00 0.00 ? 734  ARG A N     1 
ATOM   5538  C  CA    . ARG A  1  734  ? 261.824 277.552 184.671 1.00 0.00 ? 734  ARG A CA    1 
ATOM   5539  C  C     . ARG A  1  734  ? 261.479 278.877 185.320 1.00 0.00 ? 734  ARG A C     1 
ATOM   5540  O  O     . ARG A  1  734  ? 260.804 279.709 184.721 1.00 0.00 ? 734  ARG A O     1 
ATOM   5541  C  CB    . ARG A  1  734  ? 260.830 276.527 185.215 1.00 0.00 ? 734  ARG A CB    1 
ATOM   5542  C  CG    . ARG A  1  734  ? 260.756 275.195 184.524 1.00 0.00 ? 734  ARG A CG    1 
ATOM   5543  C  CD    . ARG A  1  734  ? 260.361 274.161 185.549 1.00 0.00 ? 734  ARG A CD    1 
ATOM   5544  N  NE    . ARG A  1  734  ? 261.250 274.076 186.693 1.00 0.00 ? 734  ARG A NE    1 
ATOM   5545  C  CZ    . ARG A  1  734  ? 261.307 273.024 187.502 1.00 0.00 ? 734  ARG A CZ    1 
ATOM   5546  N  NH1   . ARG A  1  734  ? 260.436 272.041 187.327 1.00 0.00 ? 734  ARG A NH1   1 
ATOM   5547  N  NH2   . ARG A  1  734  ? 262.291 272.887 188.373 1.00 0.00 ? 734  ARG A NH2   1 
ATOM   5548  N  N     . GLN A  1  735  ? 261.977 279.079 186.532 1.00 0.00 ? 735  GLN A N     1 
ATOM   5549  C  CA    . GLN A  1  735  ? 261.790 280.351 187.204 1.00 0.00 ? 735  GLN A CA    1 
ATOM   5550  C  C     . GLN A  1  735  ? 262.412 281.463 186.393 1.00 0.00 ? 735  GLN A C     1 
ATOM   5551  O  O     . GLN A  1  735  ? 261.839 282.542 186.319 1.00 0.00 ? 735  GLN A O     1 
ATOM   5552  C  CB    . GLN A  1  735  ? 262.385 280.313 188.604 1.00 0.00 ? 735  GLN A CB    1 
ATOM   5553  C  CG    . GLN A  1  735  ? 261.624 279.426 189.565 1.00 0.00 ? 735  GLN A CG    1 
ATOM   5554  C  CD    . GLN A  1  735  ? 262.349 279.254 190.886 1.00 0.00 ? 735  GLN A CD    1 
ATOM   5555  O  OE1   . GLN A  1  735  ? 263.552 279.503 190.987 1.00 0.00 ? 735  GLN A OE1   1 
ATOM   5556  N  NE2   . GLN A  1  735  ? 261.613 278.842 191.915 1.00 0.00 ? 735  GLN A NE2   1 
ATOM   5557  N  N     . THR A  1  736  ? 263.581 281.239 185.814 1.00 0.00 ? 736  THR A N     1 
ATOM   5558  C  CA    . THR A  1  736  ? 264.188 282.285 185.005 1.00 0.00 ? 736  THR A CA    1 
ATOM   5559  C  C     . THR A  1  736  ? 263.260 282.600 183.840 1.00 0.00 ? 736  THR A C     1 
ATOM   5560  O  O     . THR A  1  736  ? 263.014 283.759 183.507 1.00 0.00 ? 736  THR A O     1 
ATOM   5561  C  CB    . THR A  1  736  ? 265.540 281.861 184.445 1.00 0.00 ? 736  THR A CB    1 
ATOM   5562  O  OG1   . THR A  1  736  ? 266.425 281.536 185.521 1.00 0.00 ? 736  THR A OG1   1 
ATOM   5563  C  CG2   . THR A  1  736  ? 266.138 282.979 183.609 1.00 0.00 ? 736  THR A CG2   1 
ATOM   5564  N  N     . PHE A  1  737  ? 262.763 281.535 183.224 1.00 0.00 ? 737  PHE A N     1 
ATOM   5565  C  CA    . PHE A  1  737  ? 261.828 281.621 182.114 1.00 0.00 ? 737  PHE A CA    1 
ATOM   5566  C  C     . PHE A  1  737  ? 260.521 282.295 182.552 1.00 0.00 ? 737  PHE A C     1 
ATOM   5567  O  O     . PHE A  1  737  ? 260.098 283.284 181.960 1.00 0.00 ? 737  PHE A O     1 
ATOM   5568  C  CB    . PHE A  1  737  ? 261.594 280.212 181.547 1.00 0.00 ? 737  PHE A CB    1 
ATOM   5569  C  CG    . PHE A  1  737  ? 260.396 280.084 180.654 1.00 0.00 ? 737  PHE A CG    1 
ATOM   5570  C  CD1   . PHE A  1  737  ? 260.458 280.505 179.342 1.00 0.00 ? 737  PHE A CD1   1 
ATOM   5571  C  CD2   . PHE A  1  737  ? 259.240 279.486 181.099 1.00 0.00 ? 737  PHE A CD2   1 
ATOM   5572  C  CE1   . PHE A  1  737  ? 259.375 280.372 178.505 1.00 0.00 ? 737  PHE A CE1   1 
ATOM   5573  C  CE2   . PHE A  1  737  ? 258.157 279.355 180.263 1.00 0.00 ? 737  PHE A CE2   1 
ATOM   5574  C  CZ    . PHE A  1  737  ? 258.226 279.798 178.968 1.00 0.00 ? 737  PHE A CZ    1 
ATOM   5575  N  N     . GLU A  1  738  ? 259.941 281.818 183.648 1.00 0.00 ? 738  GLU A N     1 
ATOM   5576  C  CA    . GLU A  1  738  ? 258.688 282.368 184.165 1.00 0.00 ? 738  GLU A CA    1 
ATOM   5577  C  C     . GLU A  1  738  ? 258.812 283.817 184.588 1.00 0.00 ? 738  GLU A C     1 
ATOM   5578  O  O     . GLU A  1  738  ? 257.912 284.610 184.357 1.00 0.00 ? 738  GLU A O     1 
ATOM   5579  C  CB    . GLU A  1  738  ? 258.188 281.535 185.345 1.00 0.00 ? 738  GLU A CB    1 
ATOM   5580  C  CG    . GLU A  1  738  ? 257.032 282.162 186.116 1.00 0.00 ? 738  GLU A CG    1 
ATOM   5581  C  CD    . GLU A  1  738  ? 255.661 281.926 185.471 1.00 0.00 ? 738  GLU A CD    1 
ATOM   5582  O  OE1   . GLU A  1  738  ? 255.550 281.036 184.586 1.00 0.00 ? 738  GLU A OE1   1 
ATOM   5583  O  OE2   . GLU A  1  738  ? 254.696 282.635 185.861 1.00 0.00 ? 738  GLU A OE2   1 
ATOM   5584  N  N     . ASN A  1  739  ? 259.933 284.164 185.191 1.00 0.00 ? 739  ASN A N     1 
ATOM   5585  C  CA    . ASN A  1  739  ? 260.190 285.541 185.579 1.00 0.00 ? 739  ASN A CA    1 
ATOM   5586  C  C     . ASN A  1  739  ? 260.286 286.423 184.330 1.00 0.00 ? 739  ASN A C     1 
ATOM   5587  O  O     . ASN A  1  739  ? 259.830 287.571 184.331 1.00 0.00 ? 739  ASN A O     1 
ATOM   5588  C  CB    . ASN A  1  739  ? 261.472 285.636 186.411 1.00 0.00 ? 739  ASN A CB    1 
ATOM   5589  C  CG    . ASN A  1  739  ? 261.657 286.997 187.063 1.00 0.00 ? 739  ASN A CG    1 
ATOM   5590  O  OD1   . ASN A  1  739  ? 260.946 287.954 186.753 1.00 0.00 ? 739  ASN A OD1   1 
ATOM   5591  N  ND2   . ASN A  1  739  ? 262.618 287.087 187.980 1.00 0.00 ? 739  ASN A ND2   1 
ATOM   5592  N  N     . GLN A  1  740  ? 260.900 285.896 183.271 1.00 0.00 ? 740  GLN A N     1 
ATOM   5593  C  CA    . GLN A  1  740  ? 261.024 286.633 182.014 1.00 0.00 ? 740  GLN A CA    1 
ATOM   5594  C  C     . GLN A  1  740  ? 259.717 286.835 181.223 1.00 0.00 ? 740  GLN A C     1 
ATOM   5595  O  O     . GLN A  1  740  ? 259.451 287.948 180.759 1.00 0.00 ? 740  GLN A O     1 
ATOM   5596  C  CB    . GLN A  1  740  ? 262.024 285.930 181.109 1.00 0.00 ? 740  GLN A CB    1 
ATOM   5597  C  CG    . GLN A  1  740  ? 262.354 286.703 179.870 1.00 0.00 ? 740  GLN A CG    1 
ATOM   5598  C  CD    . GLN A  1  740  ? 263.740 286.384 179.397 1.00 0.00 ? 740  GLN A CD    1 
ATOM   5599  O  OE1   . GLN A  1  740  ? 264.697 286.469 180.164 1.00 0.00 ? 740  GLN A OE1   1 
ATOM   5600  N  NE2   . GLN A  1  740  ? 263.864 286.002 178.134 1.00 0.00 ? 740  GLN A NE2   1 
ATOM   5601  N  N     . VAL A  1  741  ? 258.922 285.783 181.023 1.00 0.00 ? 741  VAL A N     1 
ATOM   5602  C  CA    . VAL A  1  741  ? 257.633 285.978 180.354 1.00 0.00 ? 741  VAL A CA    1 
ATOM   5603  C  C     . VAL A  1  741  ? 256.725 286.894 181.163 1.00 0.00 ? 741  VAL A C     1 
ATOM   5604  O  O     . VAL A  1  741  ? 256.071 287.768 180.603 1.00 0.00 ? 741  VAL A O     1 
ATOM   5605  C  CB    . VAL A  1  741  ? 256.875 284.655 180.046 1.00 0.00 ? 741  VAL A CB    1 
ATOM   5606  C  CG1   . VAL A  1  741  ? 257.684 283.753 179.132 1.00 0.00 ? 741  VAL A CG1   1 
ATOM   5607  C  CG2   . VAL A  1  741  ? 256.452 283.944 181.309 1.00 0.00 ? 741  VAL A CG2   1 
ATOM   5608  N  N     . ASN A  1  742  ? 256.732 286.735 182.482 1.00 0.00 ? 742  ASN A N     1 
ATOM   5609  C  CA    . ASN A  1  742  ? 255.961 287.607 183.354 1.00 0.00 ? 742  ASN A CA    1 
ATOM   5610  C  C     . ASN A  1  742  ? 256.424 289.055 183.212 1.00 0.00 ? 742  ASN A C     1 
ATOM   5611  O  O     . ASN A  1  742  ? 255.606 289.962 183.264 1.00 0.00 ? 742  ASN A O     1 
ATOM   5612  C  CB    . ASN A  1  742  ? 256.041 287.131 184.810 1.00 0.00 ? 742  ASN A CB    1 
ATOM   5613  C  CG    . ASN A  1  742  ? 255.158 287.944 185.742 1.00 0.00 ? 742  ASN A CG    1 
ATOM   5614  O  OD1   . ASN A  1  742  ? 253.965 288.096 185.497 1.00 0.00 ? 742  ASN A OD1   1 
ATOM   5615  N  ND2   . ASN A  1  742  ? 255.732 288.451 186.821 1.00 0.00 ? 742  ASN A ND2   1 
ATOM   5616  N  N     . ARG A  1  743  ? 257.723 289.290 183.073 1.00 0.00 ? 743  ARG A N     1 
ATOM   5617  C  CA    . ARG A  1  743  ? 258.178 290.649 182.824 1.00 0.00 ? 743  ARG A CA    1 
ATOM   5618  C  C     . ARG A  1  743  ? 257.654 291.196 181.497 1.00 0.00 ? 743  ARG A C     1 
ATOM   5619  O  O     . ARG A  1  743  ? 257.221 292.343 181.428 1.00 0.00 ? 743  ARG A O     1 
ATOM   5620  C  CB    . ARG A  1  743  ? 259.702 290.724 182.799 1.00 0.00 ? 743  ARG A CB    1 
ATOM   5621  C  CG    . ARG A  1  743  ? 260.234 292.152 182.709 1.00 0.00 ? 743  ARG A CG    1 
ATOM   5622  C  CD    . ARG A  1  743  ? 261.688 292.281 183.151 1.00 0.00 ? 743  ARG A CD    1 
ATOM   5623  N  NE    . ARG A  1  743  ? 261.864 292.274 184.595 1.00 0.00 ? 743  ARG A NE    1 
ATOM   5624  C  CZ    . ARG A  1  743  ? 262.034 291.181 185.336 1.00 0.00 ? 743  ARG A CZ    1 
ATOM   5625  N  NH1   . ARG A  1  743  ? 262.139 289.992 184.748 1.00 0.00 ? 743  ARG A NH1   1 
ATOM   5626  N  NH2   . ARG A  1  743  ? 261.940 291.251 186.655 1.00 0.00 ? 743  ARG A NH2   1 
ATOM   5627  N  N     . ILE A  1  744  ? 257.687 290.376 180.448 1.00 0.00 ? 744  ILE A N     1 
ATOM   5628  C  CA    . ILE A  1  744  ? 257.172 290.792 179.138 1.00 0.00 ? 744  ILE A CA    1 
ATOM   5629  C  C     . ILE A  1  744  ? 255.680 291.100 179.050 1.00 0.00 ? 744  ILE A C     1 
ATOM   5630  O  O     . ILE A  1  744  ? 255.276 292.083 178.427 1.00 0.00 ? 744  ILE A O     1 
ATOM   5631  C  CB    . ILE A  1  744  ? 257.491 289.716 178.087 1.00 0.00 ? 744  ILE A CB    1 
ATOM   5632  C  CG1   . ILE A  1  744  ? 259.000 289.635 177.891 1.00 0.00 ? 744  ILE A CG1   1 
ATOM   5633  C  CG2   . ILE A  1  744  ? 256.834 290.029 176.765 1.00 0.00 ? 744  ILE A CG2   1 
ATOM   5634  C  CD1   . ILE A  1  744  ? 259.453 288.402 177.170 1.00 0.00 ? 744  ILE A CD1   1 
ATOM   5635  N  N     . LEU A  1  745  ? 254.862 290.277 179.684 1.00 0.00 ? 745  LEU A N     1 
ATOM   5636  C  CA    . LEU A  1  745  ? 253.428 290.524 179.698 1.00 0.00 ? 745  LEU A CA    1 
ATOM   5637  C  C     . LEU A  1  745  ? 252.992 291.707 180.548 1.00 0.00 ? 745  LEU A C     1 
ATOM   5638  O  O     . LEU A  1  745  ? 252.097 292.461 180.177 1.00 0.00 ? 745  LEU A O     1 
ATOM   5639  C  CB    . LEU A  1  745  ? 252.703 289.285 180.216 1.00 0.00 ? 745  LEU A CB    1 
ATOM   5640  C  CG    . LEU A  1  745  ? 252.240 288.232 179.235 1.00 0.00 ? 745  LEU A CG    1 
ATOM   5641  C  CD1   . LEU A  1  745  ? 253.330 287.891 178.264 1.00 0.00 ? 745  LEU A CD1   1 
ATOM   5642  C  CD2   . LEU A  1  745  ? 251.866 287.037 180.047 1.00 0.00 ? 745  LEU A CD2   1 
ATOM   5643  N  N     . ASN A  1  746  ? 253.734 291.961 181.608 1.00 0.00 ? 746  ASN A N     1 
ATOM   5644  C  CA    . ASN A  1  746  ? 253.455 293.096 182.449 1.00 0.00 ? 746  ASN A CA    1 
ATOM   5645  C  C     . ASN A  1  746  ? 253.851 294.364 181.743 1.00 0.00 ? 746  ASN A C     1 
ATOM   5646  O  O     . ASN A  1  746  ? 253.087 295.326 181.719 1.00 0.00 ? 746  ASN A O     1 
ATOM   5647  C  CB    . ASN A  1  746  ? 254.178 292.945 183.787 1.00 0.00 ? 746  ASN A CB    1 
ATOM   5648  C  CG    . ASN A  1  746  ? 253.638 293.877 184.841 1.00 0.00 ? 746  ASN A CG    1 
ATOM   5649  O  OD1   . ASN A  1  746  ? 252.430 293.900 185.091 1.00 0.00 ? 746  ASN A OD1   1 
ATOM   5650  N  ND2   . ASN A  1  746  ? 254.519 294.661 185.462 1.00 0.00 ? 746  ASN A ND2   1 
ATOM   5651  N  N     . ASP A  1  747  ? 255.019 294.330 181.111 1.00 0.00 ? 747  ASP A N     1 
ATOM   5652  C  CA    . ASP A  1  747  ? 255.492 295.443 180.306 1.00 0.00 ? 747  ASP A CA    1 
ATOM   5653  C  C     . ASP A  1  747  ? 254.521 295.666 179.151 1.00 0.00 ? 747  ASP A C     1 
ATOM   5654  O  O     . ASP A  1  747  ? 254.299 296.803 178.724 1.00 0.00 ? 747  ASP A O     1 
ATOM   5655  C  CB    . ASP A  1  747  ? 256.911 295.183 179.803 1.00 0.00 ? 747  ASP A CB    1 
ATOM   5656  C  CG    . ASP A  1  747  ? 257.428 296.302 178.915 1.00 0.00 ? 747  ASP A CG    1 
ATOM   5657  O  OD1   . ASP A  1  747  ? 257.069 297.472 179.177 1.00 0.00 ? 747  ASP A OD1   1 
ATOM   5658  O  OD2   . ASP A  1  747  ? 258.201 296.015 177.972 1.00 0.00 ? 747  ASP A OD2   1 
ATOM   5659  N  N     . ALA A  1  748  ? 253.986 294.583 178.599 1.00 0.00 ? 748  ALA A N     1 
ATOM   5660  C  CA    . ALA A  1  748  ? 253.006 294.722 177.530 1.00 0.00 ? 748  ALA A CA    1 
ATOM   5661  C  C     . ALA A  1  748  ? 251.741 295.460 178.025 1.00 0.00 ? 748  ALA A C     1 
ATOM   5662  O  O     . ALA A  1  748  ? 251.244 296.363 177.352 1.00 0.00 ? 748  ALA A O     1 
ATOM   5663  C  CB    . ALA A  1  748  ? 252.643 293.357 176.951 1.00 0.00 ? 748  ALA A CB    1 
ATOM   5664  N  N     . ARG A  1  749  ? 251.233 295.097 179.203 1.00 0.00 ? 749  ARG A N     1 
ATOM   5665  C  CA    . ARG A  1  749  ? 250.046 295.763 179.751 1.00 0.00 ? 749  ARG A CA    1 
ATOM   5666  C  C     . ARG A  1  749  ? 250.266 297.229 180.066 1.00 0.00 ? 749  ARG A C     1 
ATOM   5667  O  O     . ARG A  1  749  ? 249.427 298.083 179.781 1.00 0.00 ? 749  ARG A O     1 
ATOM   5668  C  CB    . ARG A  1  749  ? 249.553 295.120 181.038 1.00 0.00 ? 749  ARG A CB    1 
ATOM   5669  C  CG    . ARG A  1  749  ? 248.388 295.945 181.621 1.00 0.00 ? 749  ARG A CG    1 
ATOM   5670  C  CD    . ARG A  1  749  ? 247.699 295.292 182.789 1.00 0.00 ? 749  ARG A CD    1 
ATOM   5671  N  NE    . ARG A  1  749  ? 248.615 295.066 183.893 1.00 0.00 ? 749  ARG A NE    1 
ATOM   5672  C  CZ    . ARG A  1  749  ? 248.260 294.482 185.027 1.00 0.00 ? 749  ARG A CZ    1 
ATOM   5673  N  NH1   . ARG A  1  749  ? 247.009 294.054 185.178 1.00 0.00 ? 749  ARG A NH1   1 
ATOM   5674  N  NH2   . ARG A  1  749  ? 249.156 294.313 185.995 1.00 0.00 ? 749  ARG A NH2   1 
ATOM   5675  N  N     . ASP A  1  750  ? 251.403 297.503 180.680 1.00 0.00 ? 750  ASP A N     1 
ATOM   5676  C  CA    . ASP A  1  750  ? 251.778 298.858 181.017 1.00 0.00 ? 750  ASP A CA    1 
ATOM   5677  C  C     . ASP A  1  750  ? 252.037 299.738 179.792 1.00 0.00 ? 750  ASP A C     1 
ATOM   5678  O  O     . ASP A  1  750  ? 251.655 300.905 179.799 1.00 0.00 ? 750  ASP A O     1 
ATOM   5679  C  CB    . ASP A  1  750  ? 253.012 298.827 181.913 1.00 0.00 ? 750  ASP A CB    1 
ATOM   5680  C  CG    . ASP A  1  750  ? 253.138 300.061 182.762 1.00 0.00 ? 750  ASP A CG    1 
ATOM   5681  O  OD1   . ASP A  1  750  ? 252.103 300.707 183.027 1.00 0.00 ? 750  ASP A OD1   1 
ATOM   5682  O  OD2   . ASP A  1  750  ? 254.272 300.394 183.155 1.00 0.00 ? 750  ASP A OD2   1 
ATOM   5683  N  N     . LYS A  1  751  ? 252.678 299.209 178.751 1.00 0.00 ? 751  LYS A N     1 
ATOM   5684  C  CA    . LYS A  1  751  ? 252.869 300.011 177.542 1.00 0.00 ? 751  LYS A CA    1 
ATOM   5685  C  C     . LYS A  1  751  ? 251.520 300.423 176.943 1.00 0.00 ? 751  LYS A C     1 
ATOM   5686  O  O     . LYS A  1  751  ? 251.289 301.608 176.727 1.00 0.00 ? 751  LYS A O     1 
ATOM   5687  C  CB    . LYS A  1  751  ? 253.729 299.305 176.492 1.00 0.00 ? 751  LYS A CB    1 
ATOM   5688  C  CG    . LYS A  1  751  ? 253.975 300.200 175.273 1.00 0.00 ? 751  LYS A CG    1 
ATOM   5689  C  CD    . LYS A  1  751  ? 254.953 299.614 174.262 1.00 0.00 ? 751  LYS A CD    1 
ATOM   5690  C  CE    . LYS A  1  751  ? 256.409 299.741 174.714 1.00 0.00 ? 751  LYS A CE    1 
ATOM   5691  N  NZ    . LYS A  1  751  ? 257.276 298.657 174.148 1.00 0.00 ? 751  LYS A NZ    1 
ATOM   5692  N  N     . THR A  1  752  ? 250.616 299.476 176.710 1.00 0.00 ? 752  THR A N     1 
ATOM   5693  C  CA    . THR A  1  752  ? 249.306 299.847 176.170 1.00 0.00 ? 752  THR A CA    1 
ATOM   5694  C  C     . THR A  1  752  ? 248.434 300.608 177.166 1.00 0.00 ? 752  THR A C     1 
ATOM   5695  O  O     . THR A  1  752  ? 247.644 301.468 176.776 1.00 0.00 ? 752  THR A O     1 
ATOM   5696  C  CB    . THR A  1  752  ? 248.518 298.612 175.713 1.00 0.00 ? 752  THR A CB    1 
ATOM   5697  O  OG1   . THR A  1  752  ? 248.410 297.697 176.803 1.00 0.00 ? 752  THR A OG1   1 
ATOM   5698  C  CG2   . THR A  1  752  ? 249.227 297.915 174.605 1.00 0.00 ? 752  THR A CG2   1 
ATOM   5699  N  N     . GLY A  1  753  ? 248.623 300.343 178.450 1.00 0.00 ? 753  GLY A N     1 
ATOM   5700  C  CA    . GLY A  1  753  ? 247.996 301.156 179.470 1.00 0.00 ? 753  GLY A CA    1 
ATOM   5701  C  C     . GLY A  1  753  ? 248.420 302.606 179.381 1.00 0.00 ? 753  GLY A C     1 
ATOM   5702  O  O     . GLY A  1  753  ? 247.580 303.488 179.486 1.00 0.00 ? 753  GLY A O     1 
ATOM   5703  N  N     . SER A  1  754  ? 249.712 302.868 179.225 1.00 0.00 ? 754  SER A N     1 
ATOM   5704  C  CA    . SER A  1  754  ? 250.163 304.240 179.044 1.00 0.00 ? 754  SER A CA    1 
ATOM   5705  C  C     . SER A  1  754  ? 249.727 304.835 177.712 1.00 0.00 ? 754  SER A C     1 
ATOM   5706  O  O     . SER A  1  754  ? 249.486 306.030 177.627 1.00 0.00 ? 754  SER A O     1 
ATOM   5707  C  CB    . SER A  1  754  ? 251.689 304.339 179.171 1.00 0.00 ? 754  SER A CB    1 
ATOM   5708  O  OG    . SER A  1  754  ? 252.150 303.796 180.400 1.00 0.00 ? 754  SER A OG    1 
ATOM   5709  N  N     . SER A  1  755  ? 249.577 304.003 176.687 1.00 0.00 ? 755  SER A N     1 
ATOM   5710  C  CA    . SER A  1  755  ? 248.974 304.468 175.439 1.00 0.00 ? 755  SER A CA    1 
ATOM   5711  C  C     . SER A  1  755  ? 247.512 304.869 175.548 1.00 0.00 ? 755  SER A C     1 
ATOM   5712  O  O     . SER A  1  755  ? 247.128 305.906 175.002 1.00 0.00 ? 755  SER A O     1 
ATOM   5713  C  CB    . SER A  1  755  ? 249.146 303.431 174.321 1.00 0.00 ? 755  SER A CB    1 
ATOM   5714  O  OG    . SER A  1  755  ? 250.478 303.435 173.818 1.00 0.00 ? 755  SER A OG    1 
ATOM   5715  N  N     . ALA A  1  756  ? 246.680 304.068 176.207 1.00 0.00 ? 756  ALA A N     1 
ATOM   5716  C  CA    . ALA A  1  756  ? 245.286 304.470 176.362 1.00 0.00 ? 756  ALA A CA    1 
ATOM   5717  C  C     . ALA A  1  756  ? 245.072 305.758 177.191 1.00 0.00 ? 756  ALA A C     1 
ATOM   5718  O  O     . ALA A  1  756  ? 244.225 306.566 176.821 1.00 0.00 ? 756  ALA A O     1 
ATOM   5719  C  CB    . ALA A  1  756  ? 244.481 303.319 176.966 1.00 0.00 ? 756  ALA A CB    1 
ATOM   5720  N  N     . GLN A  1  757  ? 245.826 305.975 178.276 1.00 0.00 ? 757  GLN A N     1 
ATOM   5721  C  CA    . GLN A  1  757  ? 245.621 307.181 179.081 1.00 0.00 ? 757  GLN A CA    1 
ATOM   5722  C  C     . GLN A  1  757  ? 245.970 308.417 178.244 1.00 0.00 ? 757  GLN A C     1 
ATOM   5723  O  O     . GLN A  1  757  ? 245.298 309.429 178.342 1.00 0.00 ? 757  GLN A O     1 
ATOM   5724  C  CB    . GLN A  1  757  ? 246.438 307.159 180.387 1.00 0.00 ? 757  GLN A CB    1 
ATOM   5725  C  CG    . GLN A  1  757  ? 246.138 308.408 181.271 1.00 0.00 ? 757  GLN A CG    1 
ATOM   5726  C  CD    . GLN A  1  757  ? 246.733 308.398 182.724 1.00 0.00 ? 757  GLN A CD    1 
ATOM   5727  O  OE1   . GLN A  1  757  ? 246.233 307.710 183.625 1.00 0.00 ? 757  GLN A OE1   1 
ATOM   5728  N  NE2   . GLN A  1  757  ? 247.702 309.287 182.966 1.00 0.00 ? 757  GLN A NE2   1 
ATOM   5729  N  N     . LYS A  1  758  ? 247.007 308.320 177.406 1.00 0.00 ? 758  LYS A N     1 
ATOM   5730  C  CA    . LYS A  1  758  ? 247.350 309.408 176.459 1.00 0.00 ? 758  LYS A CA    1 
ATOM   5731  C  C     . LYS A  1  758  ? 246.216 309.689 175.467 1.00 0.00 ? 758  LYS A C     1 
ATOM   5732  O  O     . LYS A  1  758  ? 245.899 310.843 175.172 1.00 0.00 ? 758  LYS A O     1 
ATOM   5733  C  CB    . LYS A  1  758  ? 248.657 309.098 175.701 1.00 0.00 ? 758  LYS A CB    1 
ATOM   5734  C  CG    . LYS A  1  758  ? 249.928 309.201 176.569 1.00 0.00 ? 758  LYS A CG    1 
ATOM   5735  C  CD    . LYS A  1  758  ? 251.219 308.827 175.817 1.00 0.00 ? 758  LYS A CD    1 
ATOM   5736  C  CE    . LYS A  1  758  ? 251.226 307.329 175.471 1.00 0.00 ? 758  LYS A CE    1 
ATOM   5737  N  NZ    . LYS A  1  758  ? 252.462 306.816 174.807 1.00 0.00 ? 758  LYS A NZ    1 
ATOM   5738  N  N     . SER A  1  759  ? 245.617 308.616 174.961 1.00 0.00 ? 759  SER A N     1 
ATOM   5739  C  CA    . SER A  1  759  ? 244.674 308.690 173.853 1.00 0.00 ? 759  SER A CA    1 
ATOM   5740  C  C     . SER A  1  759  ? 243.333 309.292 174.271 1.00 0.00 ? 759  SER A C     1 
ATOM   5741  O  O     . SER A  1  759  ? 242.539 309.713 173.421 1.00 0.00 ? 759  SER A O     1 
ATOM   5742  C  CB    . SER A  1  759  ? 244.433 307.296 173.270 1.00 0.00 ? 759  SER A CB    1 
ATOM   5743  O  OG    . SER A  1  759  ? 243.663 307.366 172.082 1.00 0.00 ? 759  SER A OG    1 
ATOM   5744  N  N     . LEU A  1  760  ? 243.083 309.334 175.580 1.00 0.00 ? 760  LEU A N     1 
ATOM   5745  C  CA    . LEU A  1  760  ? 241.832 309.891 176.093 1.00 0.00 ? 760  LEU A CA    1 
ATOM   5746  C  C     . LEU A  1  760  ? 241.740 311.367 175.779 1.00 0.00 ? 760  LEU A C     1 
ATOM   5747  O  O     . LEU A  1  760  ? 242.722 312.102 175.896 1.00 0.00 ? 760  LEU A O     1 
ATOM   5748  C  CB    . LEU A  1  760  ? 241.698 309.688 177.606 1.00 0.00 ? 760  LEU A CB    1 
ATOM   5749  C  CG    . LEU A  1  760  ? 241.579 308.278 178.184 1.00 0.00 ? 760  LEU A CG    1 
ATOM   5750  C  CD1   . LEU A  1  760  ? 241.407 308.352 179.689 1.00 0.00 ? 760  LEU A CD1   1 
ATOM   5751  C  CD2   . LEU A  1  760  ? 240.413 307.550 177.560 1.00 0.00 ? 760  LEU A CD2   1 
ATOM   5752  N  N     . SER A  1  761  ? 240.545 311.788 175.373 1.00 0.00 ? 761  SER A N     1 
ATOM   5753  C  CA    . SER A  1  761  ? 240.281 313.189 175.085 1.00 0.00 ? 761  SER A CA    1 
ATOM   5754  C  C     . SER A  1  761  ? 240.087 313.941 176.399 1.00 0.00 ? 761  SER A C     1 
ATOM   5755  O  O     . SER A  1  761  ? 240.063 313.340 177.478 1.00 0.00 ? 761  SER A O     1 
ATOM   5756  C  CB    . SER A  1  761  ? 239.047 313.343 174.175 1.00 0.00 ? 761  SER A CB    1 
ATOM   5757  O  OG    . SER A  1  761  ? 237.828 313.088 174.871 1.00 0.00 ? 761  SER A OG    1 
ATOM   5758  N  N     . GLU A  1  762  ? 239.958 315.257 176.309 1.00 0.00 ? 762  GLU A N     1 
ATOM   5759  C  CA    . GLU A  1  762  ? 239.793 316.054 177.507 1.00 0.00 ? 762  GLU A CA    1 
ATOM   5760  C  C     . GLU A  1  762  ? 238.429 315.762 178.120 1.00 0.00 ? 762  GLU A C     1 
ATOM   5761  O  O     . GLU A  1  762  ? 238.251 315.786 179.339 1.00 0.00 ? 762  GLU A O     1 
ATOM   5762  C  CB    . GLU A  1  762  ? 239.950 317.544 177.177 1.00 0.00 ? 762  GLU A CB    1 
ATOM   5763  C  CG    . GLU A  1  762  ? 239.974 318.485 178.401 1.00 0.00 ? 762  GLU A CG    1 
ATOM   5764  C  CD    . GLU A  1  762  ? 241.131 318.198 179.379 1.00 0.00 ? 762  GLU A CD    1 
ATOM   5765  O  OE1   . GLU A  1  762  ? 242.221 317.745 178.930 1.00 0.00 ? 762  GLU A OE1   1 
ATOM   5766  O  OE2   . GLU A  1  762  ? 240.929 318.428 180.603 1.00 0.00 ? 762  GLU A OE2   1 
ATOM   5767  N  N     . TYR A  1  763  ? 237.471 315.440 177.268 1.00 0.00 ? 763  TYR A N     1 
ATOM   5768  C  CA    . TYR A  1  763  ? 236.102 315.377 177.732 1.00 0.00 ? 763  TYR A CA    1 
ATOM   5769  C  C     . TYR A  1  763  ? 235.693 314.015 178.329 1.00 0.00 ? 763  TYR A C     1 
ATOM   5770  O  O     . TYR A  1  763  ? 234.573 313.868 178.820 1.00 0.00 ? 763  TYR A O     1 
ATOM   5771  C  CB    . TYR A  1  763  ? 235.176 315.812 176.590 1.00 0.00 ? 763  TYR A CB    1 
ATOM   5772  C  CG    . TYR A  1  763  ? 235.343 317.293 176.282 1.00 0.00 ? 763  TYR A CG    1 
ATOM   5773  C  CD1   . TYR A  1  763  ? 234.760 318.269 177.118 1.00 0.00 ? 763  TYR A CD1   1 
ATOM   5774  C  CD2   . TYR A  1  763  ? 236.086 317.721 175.175 1.00 0.00 ? 763  TYR A CD2   1 
ATOM   5775  C  CE1   . TYR A  1  763  ? 234.909 319.634 176.867 1.00 0.00 ? 763  TYR A CE1   1 
ATOM   5776  C  CE2   . TYR A  1  763  ? 236.244 319.088 174.905 1.00 0.00 ? 763  TYR A CE2   1 
ATOM   5777  C  CZ    . TYR A  1  763  ? 235.649 320.044 175.760 1.00 0.00 ? 763  TYR A CZ    1 
ATOM   5778  O  OH    . TYR A  1  763  ? 235.795 321.402 175.514 1.00 0.00 ? 763  TYR A OH    1 
ATOM   5779  N  N     . ASN A  1  764  ? 236.596 313.040 178.351 1.00 0.00 ? 764  ASN A N     1 
ATOM   5780  C  CA    . ASN A  1  764  ? 236.234 311.751 178.928 1.00 0.00 ? 764  ASN A CA    1 
ATOM   5781  C  C     . ASN A  1  764  ? 235.871 311.831 180.369 1.00 0.00 ? 764  ASN A C     1 
ATOM   5782  O  O     . ASN A  1  764  ? 236.754 311.883 181.211 1.00 0.00 ? 764  ASN A O     1 
ATOM   5783  C  CB    . ASN A  1  764  ? 237.357 310.731 178.814 1.00 0.00 ? 764  ASN A CB    1 
ATOM   5784  C  CG    . ASN A  1  764  ? 237.337 310.005 177.498 1.00 0.00 ? 764  ASN A CG    1 
ATOM   5785  O  OD1   . ASN A  1  764  ? 238.388 309.758 176.890 1.00 0.00 ? 764  ASN A OD1   1 
ATOM   5786  N  ND2   . ASN A  1  764  ? 236.130 309.670 177.028 1.00 0.00 ? 764  ASN A ND2   1 
ATOM   5787  N  N     . ASN A  1  765  ? 234.570 311.774 180.631 1.00 0.00 ? 765  ASN A N     1 
ATOM   5788  C  CA    . ASN A  1  765  ? 234.004 311.685 181.979 1.00 0.00 ? 765  ASN A CA    1 
ATOM   5789  C  C     . ASN A  1  765  ? 234.664 310.621 182.834 1.00 0.00 ? 765  ASN A C     1 
ATOM   5790  O  O     . ASN A  1  765  ? 234.755 310.766 184.043 1.00 0.00 ? 765  ASN A O     1 
ATOM   5791  C  CB    . ASN A  1  765  ? 232.520 311.457 181.927 1.00 0.00 ? 765  ASN A CB    1 
ATOM   5792  C  CG    . ASN A  1  765  ? 231.818 312.561 181.204 1.00 0.00 ? 765  ASN A CG    1 
ATOM   5793  O  OD1   . ASN A  1  765  ? 231.448 313.577 181.799 1.00 0.00 ? 765  ASN A OD1   1 
ATOM   5794  N  ND2   . ASN A  1  765  ? 231.577 312.352 179.907 1.00 0.00 ? 765  ASN A ND2   1 
ATOM   5795  N  N     . PHE A  1  766  ? 235.019 309.508 182.217 1.00 0.00 ? 766  PHE A N     1 
ATOM   5796  C  CA    . PHE A  1  766  ? 235.776 308.487 182.885 1.00 0.00 ? 766  PHE A CA    1 
ATOM   5797  C  C     . PHE A  1  766  ? 237.095 309.034 183.385 1.00 0.00 ? 766  PHE A C     1 
ATOM   5798  O  O     . PHE A  1  766  ? 237.448 308.745 184.495 1.00 0.00 ? 766  PHE A O     1 
ATOM   5799  C  CB    . PHE A  1  766  ? 236.014 307.333 181.951 1.00 0.00 ? 766  PHE A CB    1 
ATOM   5800  C  CG    . PHE A  1  766  ? 236.113 306.029 182.647 1.00 0.00 ? 766  PHE A CG    1 
ATOM   5801  C  CD1   . PHE A  1  766  ? 236.689 305.963 183.917 1.00 0.00 ? 766  PHE A CD1   1 
ATOM   5802  C  CD2   . PHE A  1  766  ? 235.607 304.874 182.056 1.00 0.00 ? 766  PHE A CD2   1 
ATOM   5803  C  CE1   . PHE A  1  766  ? 236.801 304.792 184.580 1.00 0.00 ? 766  PHE A CE1   1 
ATOM   5804  C  CE2   . PHE A  1  766  ? 235.685 303.682 182.714 1.00 0.00 ? 766  PHE A CE2   1 
ATOM   5805  C  CZ    . PHE A  1  766  ? 236.297 303.641 183.994 1.00 0.00 ? 766  PHE A CZ    1 
ATOM   5806  N  N     . LYS A  1  767  ? 237.816 309.822 182.589 1.00 0.00 ? 767  LYS A N     1 
ATOM   5807  C  CA    . LYS A  1  767  ? 239.055 310.449 183.046 1.00 0.00 ? 767  LYS A CA    1 
ATOM   5808  C  C     . LYS A  1  767  ? 238.730 311.467 184.115 1.00 0.00 ? 767  LYS A C     1 
ATOM   5809  O  O     . LYS A  1  767  ? 239.547 311.664 184.973 1.00 0.00 ? 767  LYS A O     1 
ATOM   5810  C  CB    . LYS A  1  767  ? 239.840 311.124 181.932 1.00 0.00 ? 767  LYS A CB    1 
ATOM   5811  C  CG    . LYS A  1  767  ? 241.251 311.551 182.408 1.00 0.00 ? 767  LYS A CG    1 
ATOM   5812  C  CD    . LYS A  1  767  ? 242.235 312.100 181.319 1.00 0.00 ? 767  LYS A CD    1 
ATOM   5813  C  CE    . LYS A  1  767  ? 241.770 313.519 180.838 1.00 0.00 ? 767  LYS A CE    1 
ATOM   5814  N  NZ    . LYS A  1  767  ? 242.726 314.269 179.949 1.00 0.00 ? 767  LYS A NZ    1 
ATOM   5815  N  N     . SER A  1  768  ? 237.603 312.177 184.031 1.00 0.00 ? 768  SER A N     1 
ATOM   5816  C  CA    . SER A  1  768  ? 237.198 313.122 185.096 1.00 0.00 ? 768  SER A CA    1 
ATOM   5817  C  C     . SER A  1  768  ? 236.891 312.516 186.444 1.00 0.00 ? 768  SER A C     1 
ATOM   5818  O  O     . SER A  1  768  ? 237.130 313.146 187.445 1.00 0.00 ? 768  SER A O     1 
ATOM   5819  C  CB    . SER A  1  768  ? 235.958 313.897 184.700 1.00 0.00 ? 768  SER A CB    1 
ATOM   5820  O  OG    . SER A  1  768  ? 236.327 315.006 183.919 1.00 0.00 ? 768  SER A OG    1 
ATOM   5821  N  N     . MET A  1  769  ? 236.373 311.303 186.485 1.00 0.00 ? 769  MET A N     1 
ATOM   5822  C  CA    . MET A  1  769  ? 236.206 310.608 187.762 1.00 0.00 ? 769  MET A CA    1 
ATOM   5823  C  C     . MET A  1  769  ? 237.530 310.136 188.347 1.00 0.00 ? 769  MET A C     1 
ATOM   5824  O  O     . MET A  1  769  ? 237.701 310.236 189.535 1.00 0.00 ? 769  MET A O     1 
ATOM   5825  C  CB    . MET A  1  769  ? 235.231 309.478 187.592 1.00 0.00 ? 769  MET A CB    1 
ATOM   5826  C  CG    . MET A  1  769  ? 233.877 310.086 187.458 1.00 0.00 ? 769  MET A CG    1 
ATOM   5827  S  SD    . MET A  1  769  ? 232.522 308.936 187.377 1.00 0.00 ? 769  MET A SD    1 
ATOM   5828  C  CE    . MET A  1  769  ? 232.657 308.307 185.699 1.00 0.00 ? 769  MET A CE    1 
ATOM   5829  N  N     . VAL A  1  770  ? 238.423 309.581 187.533 1.00 0.00 ? 770  VAL A N     1 
ATOM   5830  C  CA    . VAL A  1  770  ? 239.768 309.129 187.916 1.00 0.00 ? 770  VAL A CA    1 
ATOM   5831  C  C     . VAL A  1  770  ? 240.635 310.249 188.442 1.00 0.00 ? 770  VAL A C     1 
ATOM   5832  O  O     . VAL A  1  770  ? 241.330 310.044 189.425 1.00 0.00 ? 770  VAL A O     1 
ATOM   5833  C  CB    . VAL A  1  770  ? 240.455 308.471 186.757 1.00 0.00 ? 770  VAL A CB    1 
ATOM   5834  C  CG1   . VAL A  1  770  ? 241.945 308.481 186.905 1.00 0.00 ? 770  VAL A CG1   1 
ATOM   5835  C  CG2   . VAL A  1  770  ? 239.890 307.100 186.599 1.00 0.00 ? 770  VAL A CG2   1 
ATOM   5836  N  N     . VAL A  1  771  ? 240.692 311.370 187.726 1.00 0.00 ? 771  VAL A N     1 
ATOM   5837  C  CA    . VAL A  1  771  ? 241.504 312.505 188.135 1.00 0.00 ? 771  VAL A CA    1 
ATOM   5838  C  C     . VAL A  1  771  ? 241.081 313.198 189.435 1.00 0.00 ? 771  VAL A C     1 
ATOM   5839  O  O     . VAL A  1  771  ? 241.959 313.523 190.257 1.00 0.00 ? 771  VAL A O     1 
ATOM   5840  C  CB    . VAL A  1  771  ? 241.507 313.568 187.026 1.00 0.00 ? 771  VAL A CB    1 
ATOM   5841  C  CG1   . VAL A  1  771  ? 242.172 314.818 187.486 1.00 0.00 ? 771  VAL A CG1   1 
ATOM   5842  C  CG2   . VAL A  1  771  ? 242.162 313.036 185.792 1.00 0.00 ? 771  VAL A CG2   1 
ATOM   5843  N  N     . SER A  1  772  ? 239.784 313.435 189.659 1.00 0.00 ? 772  SER A N     1 
ATOM   5844  C  CA    . SER A  1  772  ? 239.397 314.011 190.965 1.00 0.00 ? 772  SER A CA    1 
ATOM   5845  C  C     . SER A  1  772  ? 239.778 313.031 192.073 1.00 0.00 ? 772  SER A C     1 
ATOM   5846  O  O     . SER A  1  772  ? 239.905 313.406 193.232 1.00 0.00 ? 772  SER A O     1 
ATOM   5847  C  CB    . SER A  1  772  ? 237.917 314.337 191.110 1.00 0.00 ? 772  SER A CB    1 
ATOM   5848  O  OG    . SER A  1  772  ? 237.183 313.146 191.230 1.00 0.00 ? 772  SER A OG    1 
ATOM   5849  N  N     . GLY A  1  773  ? 239.879 311.757 191.716 1.00 0.00 ? 773  GLY A N     1 
ATOM   5850  C  CA    . GLY A  1  773  ? 240.220 310.729 192.672 1.00 0.00 ? 773  GLY A CA    1 
ATOM   5851  C  C     . GLY A  1  773  ? 238.953 310.294 193.348 1.00 0.00 ? 773  GLY A C     1 
ATOM   5852  O  O     . GLY A  1  773  ? 239.015 309.713 194.419 1.00 0.00 ? 773  GLY A O     1 
ATOM   5853  N  N     . ALA A  1  774  ? 237.808 310.605 192.742 1.00 0.00 ? 774  ALA A N     1 
ATOM   5854  C  CA    . ALA A  1  774  ? 236.526 310.297 193.363 1.00 0.00 ? 774  ALA A CA    1 
ATOM   5855  C  C     . ALA A  1  774  ? 236.353 308.785 193.523 1.00 0.00 ? 774  ALA A C     1 
ATOM   5856  O  O     . ALA A  1  774  ? 236.181 308.281 194.648 1.00 0.00 ? 774  ALA A O     1 
ATOM   5857  C  CB    . ALA A  1  774  ? 235.396 310.861 192.550 1.00 0.00 ? 774  ALA A CB    1 
ATOM   5858  N  N     . LYS A  1  775  ? 236.483 308.060 192.417 1.00 0.00 ? 775  LYS A N     1 
ATOM   5859  C  CA    . LYS A  1  775  ? 236.215 306.636 192.405 1.00 0.00 ? 775  LYS A CA    1 
ATOM   5860  C  C     . LYS A  1  775  ? 236.933 306.018 191.221 1.00 0.00 ? 775  LYS A C     1 
ATOM   5861  O  O     . LYS A  1  775  ? 236.883 306.556 190.124 1.00 0.00 ? 775  LYS A O     1 
ATOM   5862  C  CB    . LYS A  1  775  ? 234.707 306.398 192.333 1.00 0.00 ? 775  LYS A CB    1 
ATOM   5863  C  CG    . LYS A  1  775  ? 234.295 304.961 192.543 1.00 0.00 ? 775  LYS A CG    1 
ATOM   5864  C  CD    . LYS A  1  775  ? 232.908 304.792 193.172 1.00 0.00 ? 775  LYS A CD    1 
ATOM   5865  C  CE    . LYS A  1  775  ? 232.908 305.093 194.656 1.00 0.00 ? 775  LYS A CE    1 
ATOM   5866  N  NZ    . LYS A  1  775  ? 233.899 304.286 195.416 1.00 0.00 ? 775  LYS A NZ    1 
ATOM   5867  N  N     . GLY A  1  776  ? 237.629 304.910 191.439 1.00 0.00 ? 776  GLY A N     1 
ATOM   5868  C  CA    . GLY A  1  776  ? 238.281 304.240 190.328 1.00 0.00 ? 776  GLY A CA    1 
ATOM   5869  C  C     . GLY A  1  776  ? 239.661 304.803 190.033 1.00 0.00 ? 776  GLY A C     1 
ATOM   5870  O  O     . GLY A  1  776  ? 240.103 305.716 190.726 1.00 0.00 ? 776  GLY A O     1 
ATOM   5871  N  N     . SER A  1  777  ? 240.345 304.274 189.015 1.00 0.00 ? 777  SER A N     1 
ATOM   5872  C  CA    . SER A  1  777  ? 241.759 304.596 188.810 1.00 0.00 ? 777  SER A CA    1 
ATOM   5873  C  C     . SER A  1  777  ? 242.372 304.308 187.449 1.00 0.00 ? 777  SER A C     1 
ATOM   5874  O  O     . SER A  1  777  ? 241.696 303.931 186.508 1.00 0.00 ? 777  SER A O     1 
ATOM   5875  C  CB    . SER A  1  777  ? 242.551 303.841 189.847 1.00 0.00 ? 777  SER A CB    1 
ATOM   5876  O  OG    . SER A  1  777  ? 242.083 302.510 189.855 1.00 0.00 ? 777  SER A OG    1 
ATOM   5877  N  N     . LYS A  1  778  ? 243.677 304.478 187.353 1.00 0.00 ? 778  LYS A N     1 
ATOM   5878  C  CA    . LYS A  1  778  ? 244.305 304.332 186.061 1.00 0.00 ? 778  LYS A CA    1 
ATOM   5879  C  C     . LYS A  1  778  ? 244.166 302.920 185.512 1.00 0.00 ? 778  LYS A C     1 
ATOM   5880  O  O     . LYS A  1  778  ? 243.768 302.748 184.367 1.00 0.00 ? 778  LYS A O     1 
ATOM   5881  C  CB    . LYS A  1  778  ? 245.790 304.714 186.097 1.00 0.00 ? 778  LYS A CB    1 
ATOM   5882  C  CG    . LYS A  1  778  ? 246.462 304.456 184.735 1.00 0.00 ? 778  LYS A CG    1 
ATOM   5883  C  CD    . LYS A  1  778  ? 247.901 304.905 184.631 1.00 0.00 ? 778  LYS A CD    1 
ATOM   5884  C  CE    . LYS A  1  778  ? 248.389 304.734 183.188 1.00 0.00 ? 778  LYS A CE    1 
ATOM   5885  N  NZ    . LYS A  1  778  ? 249.788 305.221 182.942 1.00 0.00 ? 778  LYS A NZ    1 
ATOM   5886  N  N     . ILE A  1  779  ? 244.364 301.915 186.354 1.00 0.00 ? 779  ILE A N     1 
ATOM   5887  C  CA    . ILE A  1  779  ? 244.243 300.530 185.915 1.00 0.00 ? 779  ILE A CA    1 
ATOM   5888  C  C     . ILE A  1  779  ? 242.926 300.124 185.294 1.00 0.00 ? 779  ILE A C     1 
ATOM   5889  O  O     . ILE A  1  779  ? 242.908 299.324 184.378 1.00 0.00 ? 779  ILE A O     1 
ATOM   5890  C  CB    . ILE A  1  779  ? 244.476 299.629 187.118 1.00 0.00 ? 779  ILE A CB    1 
ATOM   5891  C  CG1   . ILE A  1  779  ? 245.878 299.891 187.644 1.00 0.00 ? 779  ILE A CG1   1 
ATOM   5892  C  CG2   . ILE A  1  779  ? 244.232 298.174 186.802 1.00 0.00 ? 779  ILE A CG2   1 
ATOM   5893  C  CD1   . ILE A  1  779  ? 246.945 299.712 186.576 1.00 0.00 ? 779  ILE A CD1   1 
ATOM   5894  N  N     . ASN A  1  780  ? 241.838 300.703 185.765 1.00 0.00 ? 780  ASN A N     1 
ATOM   5895  C  CA    . ASN A  1  780  ? 240.511 300.512 185.205 1.00 0.00 ? 780  ASN A CA    1 
ATOM   5896  C  C     . ASN A  1  780  ? 240.384 300.969 183.777 1.00 0.00 ? 780  ASN A C     1 
ATOM   5897  O  O     . ASN A  1  780  ? 239.716 300.324 182.992 1.00 0.00 ? 780  ASN A O     1 
ATOM   5898  C  CB    . ASN A  1  780  ? 239.514 301.184 186.089 1.00 0.00 ? 780  ASN A CB    1 
ATOM   5899  C  CG    . ASN A  1  780  ? 239.480 300.518 187.436 1.00 0.00 ? 780  ASN A CG    1 
ATOM   5900  O  OD1   . ASN A  1  780  ? 239.698 301.135 188.490 1.00 0.00 ? 780  ASN A OD1   1 
ATOM   5901  N  ND2   . ASN A  1  780  ? 239.325 299.209 187.402 1.00 0.00 ? 780  ASN A ND2   1 
ATOM   5902  N  N     . ILE A  1  781  ? 240.972 302.125 183.481 1.00 0.00 ? 781  ILE A N     1 
ATOM   5903  C  CA    . ILE A  1  781  ? 241.065 302.676 182.130 1.00 0.00 ? 781  ILE A CA    1 
ATOM   5904  C  C     . ILE A  1  781  ? 241.854 301.731 181.250 1.00 0.00 ? 781  ILE A C     1 
ATOM   5905  O  O     . ILE A  1  781  ? 241.555 301.556 180.081 1.00 0.00 ? 781  ILE A O     1 
ATOM   5906  C  CB    . ILE A  1  781  ? 241.707 304.056 182.111 1.00 0.00 ? 781  ILE A CB    1 
ATOM   5907  C  CG1   . ILE A  1  781  ? 240.929 305.039 182.977 1.00 0.00 ? 781  ILE A CG1   1 
ATOM   5908  C  CG2   . ILE A  1  781  ? 241.639 304.601 180.703 1.00 0.00 ? 781  ILE A CG2   1 
ATOM   5909  C  CD1   . ILE A  1  781  ? 239.554 305.171 182.567 1.00 0.00 ? 781  ILE A CD1   1 
ATOM   5910  N  N     . SER A  1  782  ? 242.912 301.192 181.816 1.00 0.00 ? 782  SER A N     1 
ATOM   5911  C  CA    . SER A  1  782  ? 243.732 300.187 181.165 1.00 0.00 ? 782  SER A CA    1 
ATOM   5912  C  C     . SER A  1  782  ? 242.873 298.979 180.765 1.00 0.00 ? 782  SER A C     1 
ATOM   5913  O  O     . SER A  1  782  ? 242.933 298.498 179.638 1.00 0.00 ? 782  SER A O     1 
ATOM   5914  C  CB    . SER A  1  782  ? 244.870 299.751 182.087 1.00 0.00 ? 782  SER A CB    1 
ATOM   5915  O  OG    . SER A  1  782  ? 245.641 300.868 182.501 1.00 0.00 ? 782  SER A OG    1 
ATOM   5916  N  N     . GLN A  1  783  ? 242.092 298.472 181.701 1.00 0.00 ? 783  GLN A N     1 
ATOM   5917  C  CA    . GLN A  1  783  ? 241.319 297.275 181.472 1.00 0.00 ? 783  GLN A CA    1 
ATOM   5918  C  C     . GLN A  1  783  ? 240.130 297.458 180.533 1.00 0.00 ? 783  GLN A C     1 
ATOM   5919  O  O     . GLN A  1  783  ? 239.873 296.562 179.733 1.00 0.00 ? 783  GLN A O     1 
ATOM   5920  C  CB    . GLN A  1  783  ? 240.830 296.784 182.798 1.00 0.00 ? 783  GLN A CB    1 
ATOM   5921  C  CG    . GLN A  1  783  ? 241.943 296.438 183.674 1.00 0.00 ? 783  GLN A CG    1 
ATOM   5922  C  CD    . GLN A  1  783  ? 241.480 295.520 184.740 1.00 0.00 ? 783  GLN A CD    1 
ATOM   5923  O  OE1   . GLN A  1  783  ? 240.388 295.691 185.284 1.00 0.00 ? 783  GLN A OE1   1 
ATOM   5924  N  NE2   . GLN A  1  783  ? 242.279 294.516 185.046 1.00 0.00 ? 783  GLN A NE2   1 
ATOM   5925  N  N     . VAL A  1  784  ? 239.362 298.549 180.677 1.00 0.00 ? 784  VAL A N     1 
ATOM   5926  C  CA    . VAL A  1  784  ? 238.220 298.861 179.768 1.00 0.00 ? 784  VAL A CA    1 
ATOM   5927  C  C     . VAL A  1  784  ? 238.634 299.253 178.331 1.00 0.00 ? 784  VAL A C     1 
ATOM   5928  O  O     . VAL A  1  784  ? 237.935 298.885 177.386 1.00 0.00 ? 784  VAL A O     1 
ATOM   5929  C  CB    . VAL A  1  784  ? 237.225 299.924 180.340 1.00 0.00 ? 784  VAL A CB    1 
ATOM   5930  C  CG1   . VAL A  1  784  ? 236.727 299.526 181.719 1.00 0.00 ? 784  VAL A CG1   1 
ATOM   5931  C  CG2   . VAL A  1  784  ? 237.793 301.296 180.328 1.00 0.00 ? 784  VAL A CG2   1 
ATOM   5932  N  N     . ILE A  1  785  ? 239.627 300.130 178.180 1.00 0.00 ? 785  ILE A N     1 
ATOM   5933  C  CA    . ILE A  1  785  ? 240.074 300.615 176.864 1.00 0.00 ? 785  ILE A CA    1 
ATOM   5934  C  C     . ILE A  1  785  ? 241.132 299.698 176.190 1.00 0.00 ? 785  ILE A C     1 
ATOM   5935  O  O     . ILE A  1  785  ? 241.098 299.456 174.988 1.00 0.00 ? 785  ILE A O     1 
ATOM   5936  C  CB    . ILE A  1  785  ? 240.670 302.050 176.956 1.00 0.00 ? 785  ILE A CB    1 
ATOM   5937  C  CG1   . ILE A  1  785  ? 239.818 302.974 177.832 1.00 0.00 ? 785  ILE A CG1   1 
ATOM   5938  C  CG2   . ILE A  1  785  ? 240.861 302.645 175.549 1.00 0.00 ? 785  ILE A CG2   1 
ATOM   5939  C  CD1   . ILE A  1  785  ? 238.408 303.162 177.346 1.00 0.00 ? 785  ILE A CD1   1 
ATOM   5940  N  N     . ALA A  1  786  ? 242.108 299.238 176.960 1.00 0.00 ? 786  ALA A N     1 
ATOM   5941  C  CA    . ALA A  1  786  ? 243.246 298.549 176.385 1.00 0.00 ? 786  ALA A CA    1 
ATOM   5942  C  C     . ALA A  1  786  ? 243.086 297.069 176.447 1.00 0.00 ? 786  ALA A C     1 
ATOM   5943  O  O     . ALA A  1  786  ? 242.290 296.495 175.730 1.00 0.00 ? 786  ALA A O     1 
ATOM   5944  C  CB    . ALA A  1  786  ? 244.511 298.942 177.094 1.00 0.00 ? 786  ALA A CB    1 
ATOM   5945  N  N     . VAL A  1  787  ? 243.900 296.441 177.280 1.00 0.00 ? 787  VAL A N     1 
ATOM   5946  C  CA    . VAL A  1  787  ? 243.950 294.987 177.324 1.00 0.00 ? 787  VAL A CA    1 
ATOM   5947  C  C     . VAL A  1  787  ? 244.097 294.563 178.775 1.00 0.00 ? 787  VAL A C     1 
ATOM   5948  O  O     . VAL A  1  787  ? 244.832 295.189 179.533 1.00 0.00 ? 787  VAL A O     1 
ATOM   5949  C  CB    . VAL A  1  787  ? 245.087 294.434 176.470 1.00 0.00 ? 787  VAL A CB    1 
ATOM   5950  C  CG1   . VAL A  1  787  ? 246.413 295.004 176.915 1.00 0.00 ? 787  VAL A CG1   1 
ATOM   5951  C  CG2   . VAL A  1  787  ? 245.117 292.947 176.545 1.00 0.00 ? 787  VAL A CG2   1 
ATOM   5952  N  N     . VAL A  1  788  ? 243.379 293.520 179.170 1.00 0.00 ? 788  VAL A N     1 
ATOM   5953  C  CA    . VAL A  1  788  ? 243.213 293.203 180.576 1.00 0.00 ? 788  VAL A CA    1 
ATOM   5954  C  C     . VAL A  1  788  ? 244.481 292.661 181.213 1.00 0.00 ? 788  VAL A C     1 
ATOM   5955  O  O     . VAL A  1  788  ? 244.846 293.064 182.324 1.00 0.00 ? 788  VAL A O     1 
ATOM   5956  C  CB    . VAL A  1  788  ? 242.089 292.223 180.765 1.00 0.00 ? 788  VAL A CB    1 
ATOM   5957  C  CG1   . VAL A  1  788  ? 242.197 291.572 182.115 1.00 0.00 ? 788  VAL A CG1   1 
ATOM   5958  C  CG2   . VAL A  1  788  ? 240.773 292.960 180.620 1.00 0.00 ? 788  VAL A CG2   1 
ATOM   5959  N  N     . GLY A  1  789  ? 245.155 291.763 180.498 1.00 0.00 ? 789  GLY A N     1 
ATOM   5960  C  CA    . GLY A  1  789  ? 246.482 291.316 180.889 1.00 0.00 ? 789  GLY A CA    1 
ATOM   5961  C  C     . GLY A  1  789  ? 246.575 289.930 181.499 1.00 0.00 ? 789  GLY A C     1 
ATOM   5962  O  O     . GLY A  1  789  ? 245.604 289.179 181.494 1.00 0.00 ? 789  GLY A O     1 
ATOM   5963  N  N     . GLN A  1  790  ? 247.741 289.577 182.024 1.00 0.00 ? 790  GLN A N     1 
ATOM   5964  C  CA    . GLN A  1  790  ? 247.890 288.277 182.663 1.00 0.00 ? 790  GLN A CA    1 
ATOM   5965  C  C     . GLN A  1  790  ? 247.036 288.191 183.935 1.00 0.00 ? 790  GLN A C     1 
ATOM   5966  O  O     . GLN A  1  790  ? 247.148 289.024 184.816 1.00 0.00 ? 790  GLN A O     1 
ATOM   5967  C  CB    . GLN A  1  790  ? 249.380 288.020 182.964 1.00 0.00 ? 790  GLN A CB    1 
ATOM   5968  C  CG    . GLN A  1  790  ? 249.747 286.724 183.752 1.00 0.00 ? 790  GLN A CG    1 
ATOM   5969  C  CD    . GLN A  1  790  ? 249.481 285.413 182.993 1.00 0.00 ? 790  GLN A CD    1 
ATOM   5970  O  OE1   . GLN A  1  790  ? 249.959 285.208 181.878 1.00 0.00 ? 790  GLN A OE1   1 
ATOM   5971  N  NE2   . GLN A  1  790  ? 248.748 284.509 183.621 1.00 0.00 ? 790  GLN A NE2   1 
ATOM   5972  N  N     . GLN A  1  791  ? 246.166 287.193 184.012 1.00 0.00 ? 791  GLN A N     1 
ATOM   5973  C  CA    . GLN A  1  791  ? 245.480 286.858 185.251 1.00 0.00 ? 791  GLN A CA    1 
ATOM   5974  C  C     . GLN A  1  791  ? 246.470 286.050 186.056 1.00 0.00 ? 791  GLN A C     1 
ATOM   5975  O  O     . GLN A  1  791  ? 247.478 285.633 185.497 1.00 0.00 ? 791  GLN A O     1 
ATOM   5976  C  CB    . GLN A  1  791  ? 244.223 286.049 184.978 1.00 0.00 ? 791  GLN A CB    1 
ATOM   5977  C  CG    . GLN A  1  791  ? 243.266 286.806 184.129 1.00 0.00 ? 791  GLN A CG    1 
ATOM   5978  C  CD    . GLN A  1  791  ? 242.957 288.133 184.775 1.00 0.00 ? 791  GLN A CD    1 
ATOM   5979  O  OE1   . GLN A  1  791  ? 242.490 288.172 185.923 1.00 0.00 ? 791  GLN A OE1   1 
ATOM   5980  N  NE2   . GLN A  1  791  ? 243.294 289.236 184.086 1.00 0.00 ? 791  GLN A NE2   1 
ATOM   5981  N  N     . ASN A  1  792  ? 246.246 285.859 187.352 1.00 0.00 ? 792  ASN A N     1 
ATOM   5982  C  CA    . ASN A  1  792  ? 247.065 284.904 188.109 1.00 0.00 ? 792  ASN A CA    1 
ATOM   5983  C  C     . ASN A  1  792  ? 246.294 284.382 189.310 1.00 0.00 ? 792  ASN A C     1 
ATOM   5984  O  O     . ASN A  1  792  ? 245.280 284.942 189.648 1.00 0.00 ? 792  ASN A O     1 
ATOM   5985  C  CB    . ASN A  1  792  ? 248.411 285.522 188.538 1.00 0.00 ? 792  ASN A CB    1 
ATOM   5986  C  CG    . ASN A  1  792  ? 248.331 287.013 188.816 1.00 0.00 ? 792  ASN A CG    1 
ATOM   5987  O  OD1   . ASN A  1  792  ? 247.240 287.575 188.929 1.00 0.00 ? 792  ASN A OD1   1 
ATOM   5988  N  ND2   . ASN A  1  792  ? 249.498 287.665 188.936 1.00 0.00 ? 792  ASN A ND2   1 
ATOM   5989  N  N     . VAL A  1  793  ? 246.749 283.314 189.950 1.00 0.00 ? 793  VAL A N     1 
ATOM   5990  C  CA    . VAL A  1  793  ? 246.127 282.859 191.194 1.00 0.00 ? 793  VAL A CA    1 
ATOM   5991  C  C     . VAL A  1  793  ? 247.232 282.420 192.147 1.00 0.00 ? 793  VAL A C     1 
ATOM   5992  O  O     . VAL A  1  793  ? 248.170 281.740 191.733 1.00 0.00 ? 793  VAL A O     1 
ATOM   5993  C  CB    . VAL A  1  793  ? 245.153 281.670 190.980 1.00 0.00 ? 793  VAL A CB    1 
ATOM   5994  C  CG1   . VAL A  1  793  ? 244.040 282.039 190.041 1.00 0.00 ? 793  VAL A CG1   1 
ATOM   5995  C  CG2   . VAL A  1  793  ? 245.876 280.484 190.398 1.00 0.00 ? 793  VAL A CG2   1 
ATOM   5996  N  N     . GLU A  1  794  ? 247.142 282.779 193.420 1.00 0.00 ? 794  GLU A N     1 
ATOM   5997  C  CA    . GLU A  1  794  ? 248.281 282.545 194.317 1.00 0.00 ? 794  GLU A CA    1 
ATOM   5998  C  C     . GLU A  1  794  ? 249.601 283.153 193.812 1.00 0.00 ? 794  GLU A C     1 
ATOM   5999  O  O     . GLU A  1  794  ? 250.686 282.596 194.041 1.00 0.00 ? 794  GLU A O     1 
ATOM   6000  C  CB    . GLU A  1  794  ? 248.493 281.044 194.529 1.00 0.00 ? 794  GLU A CB    1 
ATOM   6001  C  CG    . GLU A  1  794  ? 247.352 280.352 195.207 1.00 0.00 ? 794  GLU A CG    1 
ATOM   6002  C  CD    . GLU A  1  794  ? 247.632 278.884 195.425 1.00 0.00 ? 794  GLU A CD    1 
ATOM   6003  O  OE1   . GLU A  1  794  ? 248.577 278.363 194.770 1.00 0.00 ? 794  GLU A OE1   1 
ATOM   6004  O  OE2   . GLU A  1  794  ? 246.909 278.268 196.249 1.00 0.00 ? 794  GLU A OE2   1 
ATOM   6005  N  N     . GLY A  1  795  ? 249.510 284.268 193.093 1.00 0.00 ? 795  GLY A N     1 
ATOM   6006  C  CA    . GLY A  1  795  ? 250.703 284.972 192.672 1.00 0.00 ? 795  GLY A CA    1 
ATOM   6007  C  C     . GLY A  1  795  ? 251.423 284.351 191.495 1.00 0.00 ? 795  GLY A C     1 
ATOM   6008  O  O     . GLY A  1  795  ? 252.527 284.759 191.167 1.00 0.00 ? 795  GLY A O     1 
ATOM   6009  N  N     . LYS A  1  796  ? 250.828 283.337 190.886 1.00 0.00 ? 796  LYS A N     1 
ATOM   6010  C  CA    . LYS A  1  796  ? 251.436 282.671 189.746 1.00 0.00 ? 796  LYS A CA    1 
ATOM   6011  C  C     . LYS A  1  796  ? 250.415 282.564 188.598 1.00 0.00 ? 796  LYS A C     1 
ATOM   6012  O  O     . LYS A  1  796  ? 249.221 282.735 188.818 1.00 0.00 ? 796  LYS A O     1 
ATOM   6013  C  CB    . LYS A  1  796  ? 251.920 281.288 190.157 1.00 0.00 ? 796  LYS A CB    1 
ATOM   6014  C  CG    . LYS A  1  796  ? 252.846 281.267 191.360 1.00 0.00 ? 796  LYS A CG    1 
ATOM   6015  C  CD    . LYS A  1  796  ? 253.268 279.825 191.685 1.00 0.00 ? 796  LYS A CD    1 
ATOM   6016  C  CE    . LYS A  1  796  ? 254.153 279.729 192.939 1.00 0.00 ? 796  LYS A CE    1 
ATOM   6017  N  NZ    . LYS A  1  796  ? 254.500 278.303 193.254 1.00 0.00 ? 796  LYS A NZ    1 
ATOM   6018  N  N     . ARG A  1  797  ? 250.866 282.282 187.380 1.00 0.00 ? 797  ARG A N     1 
ATOM   6019  C  CA    . ARG A  1  797  ? 249.949 282.119 186.242 1.00 0.00 ? 797  ARG A CA    1 
ATOM   6020  C  C     . ARG A  1  797  ? 249.100 280.849 186.390 1.00 0.00 ? 797  ARG A C     1 
ATOM   6021  O  O     . ARG A  1  797  ? 249.512 279.920 187.072 1.00 0.00 ? 797  ARG A O     1 
ATOM   6022  C  CB    . ARG A  1  797  ? 250.734 282.117 184.932 1.00 0.00 ? 797  ARG A CB    1 
ATOM   6023  C  CG    . ARG A  1  797  ? 251.463 283.441 184.688 1.00 0.00 ? 797  ARG A CG    1 
ATOM   6024  C  CD    . ARG A  1  797  ? 252.575 283.332 183.638 1.00 0.00 ? 797  ARG A CD    1 
ATOM   6025  N  NE    . ARG A  1  797  ? 252.076 283.051 182.291 1.00 0.00 ? 797  ARG A NE    1 
ATOM   6026  C  CZ    . ARG A  1  797  ? 252.671 282.241 181.419 1.00 0.00 ? 797  ARG A CZ    1 
ATOM   6027  N  NH1   . ARG A  1  797  ? 253.800 281.628 181.757 1.00 0.00 ? 797  ARG A NH1   1 
ATOM   6028  N  NH2   . ARG A  1  797  ? 252.135 282.048 180.211 1.00 0.00 ? 797  ARG A NH2   1 
ATOM   6029  N  N     . ILE A  1  798  ? 247.916 280.838 185.776 1.00 0.00 ? 798  ILE A N     1 
ATOM   6030  C  CA    . ILE A  1  798  ? 246.892 279.803 185.981 1.00 0.00 ? 798  ILE A CA    1 
ATOM   6031  C  C     . ILE A  1  798  ? 247.464 278.396 185.969 1.00 0.00 ? 798  ILE A C     1 
ATOM   6032  O  O     . ILE A  1  798  ? 248.015 277.989 184.952 1.00 0.00 ? 798  ILE A O     1 
ATOM   6033  C  CB    . ILE A  1  798  ? 245.825 279.853 184.884 1.00 0.00 ? 798  ILE A CB    1 
ATOM   6034  C  CG1   . ILE A  1  798  ? 245.255 281.248 184.738 1.00 0.00 ? 798  ILE A CG1   1 
ATOM   6035  C  CG2   . ILE A  1  798  ? 244.719 278.892 185.192 1.00 0.00 ? 798  ILE A CG2   1 
ATOM   6036  C  CD1   . ILE A  1  798  ? 244.581 281.674 185.941 1.00 0.00 ? 798  ILE A CD1   1 
ATOM   6037  N  N     . PRO A  1  799  ? 247.293 277.629 187.062 1.00 0.00 ? 799  PRO A N     1 
ATOM   6038  C  CA    . PRO A  1  799  ? 247.978 276.330 187.229 1.00 0.00 ? 799  PRO A CA    1 
ATOM   6039  C  C     . PRO A  1  799  ? 247.591 275.278 186.191 1.00 0.00 ? 799  PRO A C     1 
ATOM   6040  O  O     . PRO A  1  799  ? 246.584 275.461 185.540 1.00 0.00 ? 799  PRO A O     1 
ATOM   6041  C  CB    . PRO A  1  799  ? 247.505 275.878 188.606 1.00 0.00 ? 799  PRO A CB    1 
ATOM   6042  C  CG    . PRO A  1  799  ? 246.178 276.511 188.746 1.00 0.00 ? 799  PRO A CG    1 
ATOM   6043  C  CD    . PRO A  1  799  ? 246.301 277.860 188.125 1.00 0.00 ? 799  PRO A CD    1 
ATOM   6044  N  N     . PHE A  1  800  ? 248.365 274.220 186.009 1.00 0.00 ? 800  PHE A N     1 
ATOM   6045  C  CA    . PHE A  1  800  ? 247.905 273.142 185.139 1.00 0.00 ? 800  PHE A CA    1 
ATOM   6046  C  C     . PHE A  1  800  ? 246.971 272.199 185.898 1.00 0.00 ? 800  PHE A C     1 
ATOM   6047  O  O     . PHE A  1  800  ? 247.419 271.353 186.651 1.00 0.00 ? 800  PHE A O     1 
ATOM   6048  C  CB    . PHE A  1  800  ? 249.091 272.373 184.551 1.00 0.00 ? 800  PHE A CB    1 
ATOM   6049  C  CG    . PHE A  1  800  ? 249.990 273.223 183.692 1.00 0.00 ? 800  PHE A CG    1 
ATOM   6050  C  CD1   . PHE A  1  800  ? 249.467 273.985 182.661 1.00 0.00 ? 800  PHE A CD1   1 
ATOM   6051  C  CD2   . PHE A  1  800  ? 251.352 273.292 183.950 1.00 0.00 ? 800  PHE A CD2   1 
ATOM   6052  C  CE1   . PHE A  1  800  ? 250.283 274.777 181.889 1.00 0.00 ? 800  PHE A CE1   1 
ATOM   6053  C  CE2   . PHE A  1  800  ? 252.176 274.085 183.180 1.00 0.00 ? 800  PHE A CE2   1 
ATOM   6054  C  CZ    . PHE A  1  800  ? 251.641 274.827 182.147 1.00 0.00 ? 800  PHE A CZ    1 
ATOM   6055  N  N     . GLY A  1  801  ? 245.671 272.360 185.700 1.00 0.00 ? 801  GLY A N     1 
ATOM   6056  C  CA    . GLY A  1  801  ? 244.683 271.562 186.400 1.00 0.00 ? 801  GLY A CA    1 
ATOM   6057  C  C     . GLY A  1  801  ? 244.612 270.117 185.955 1.00 0.00 ? 801  GLY A C     1 
ATOM   6058  O  O     . GLY A  1  801  ? 244.730 269.201 186.777 1.00 0.00 ? 801  GLY A O     1 
ATOM   6059  N  N     . PHE A  1  802  ? 244.375 269.925 184.654 1.00 0.00 ? 802  PHE A N     1 
ATOM   6060  C  CA    . PHE A  1  802  ? 244.424 268.612 184.007 1.00 0.00 ? 802  PHE A CA    1 
ATOM   6061  C  C     . PHE A  1  802  ? 245.866 268.204 183.843 1.00 0.00 ? 802  PHE A C     1 
ATOM   6062  O  O     . PHE A  1  802  ? 246.754 268.935 184.253 1.00 0.00 ? 802  PHE A O     1 
ATOM   6063  C  CB    . PHE A  1  802  ? 243.790 268.635 182.630 1.00 0.00 ? 802  PHE A CB    1 
ATOM   6064  C  CG    . PHE A  1  802  ? 242.371 269.039 182.624 1.00 0.00 ? 802  PHE A CG    1 
ATOM   6065  C  CD1   . PHE A  1  802  ? 241.408 268.172 183.045 1.00 0.00 ? 802  PHE A CD1   1 
ATOM   6066  C  CD2   . PHE A  1  802  ? 241.994 270.280 182.147 1.00 0.00 ? 802  PHE A CD2   1 
ATOM   6067  C  CE1   . PHE A  1  802  ? 240.097 268.554 183.008 1.00 0.00 ? 802  PHE A CE1   1 
ATOM   6068  C  CE2   . PHE A  1  802  ? 240.681 270.663 182.114 1.00 0.00 ? 802  PHE A CE2   1 
ATOM   6069  C  CZ    . PHE A  1  802  ? 239.733 269.810 182.547 1.00 0.00 ? 802  PHE A CZ    1 
ATOM   6070  N  N     . LYS A  1  803  ? 246.125 267.062 183.219 1.00 0.00 ? 803  LYS A N     1 
ATOM   6071  C  CA    . LYS A  1  803  ? 247.507 266.694 182.944 1.00 0.00 ? 803  LYS A CA    1 
ATOM   6072  C  C     . LYS A  1  803  ? 248.236 267.734 182.071 1.00 0.00 ? 803  LYS A C     1 
ATOM   6073  O  O     . LYS A  1  803  ? 247.960 267.867 180.869 1.00 0.00 ? 803  LYS A O     1 
ATOM   6074  C  CB    . LYS A  1  803  ? 247.548 265.319 182.306 1.00 0.00 ? 803  LYS A CB    1 
ATOM   6075  C  CG    . LYS A  1  803  ? 247.402 264.191 183.301 1.00 0.00 ? 803  LYS A CG    1 
ATOM   6076  C  CD    . LYS A  1  803  ? 247.075 262.896 182.560 1.00 0.00 ? 803  LYS A CD    1 
ATOM   6077  C  CE    . LYS A  1  803  ? 246.928 261.708 183.517 1.00 0.00 ? 803  LYS A CE    1 
ATOM   6078  N  NZ    . LYS A  1  803  ? 245.904 261.907 184.599 1.00 0.00 ? 803  LYS A NZ    1 
ATOM   6079  N  N     . HIS A  1  804  ? 249.120 268.496 182.718 1.00 0.00 ? 804  HIS A N     1 
ATOM   6080  C  CA    . HIS A  1  804  ? 249.939 269.538 182.089 1.00 0.00 ? 804  HIS A CA    1 
ATOM   6081  C  C     . HIS A  1  804  ? 249.186 270.630 181.306 1.00 0.00 ? 804  HIS A C     1 
ATOM   6082  O  O     . HIS A  1  804  ? 249.775 271.326 180.494 1.00 0.00 ? 804  HIS A O     1 
ATOM   6083  C  CB    . HIS A  1  804  ? 250.965 268.869 181.159 1.00 0.00 ? 804  HIS A CB    1 
ATOM   6084  C  CG    . HIS A  1  804  ? 251.938 267.987 181.877 1.00 0.00 ? 804  HIS A CG    1 
ATOM   6085  N  ND1   . HIS A  1  804  ? 251.560 266.835 182.530 1.00 0.00 ? 804  HIS A ND1   1 
ATOM   6086  C  CD2   . HIS A  1  804  ? 253.273 268.110 182.069 1.00 0.00 ? 804  HIS A CD2   1 
ATOM   6087  C  CE1   . HIS A  1  804  ? 252.621 266.286 183.098 1.00 0.00 ? 804  HIS A CE1   1 
ATOM   6088  N  NE2   . HIS A  1  804  ? 253.672 267.040 182.834 1.00 0.00 ? 804  HIS A NE2   1 
ATOM   6089  N  N     . ARG A  1  805  ? 247.908 270.826 181.592 1.00 0.00 ? 805  ARG A N     1 
ATOM   6090  C  CA    . ARG A  1  805  ? 247.083 271.768 180.843 1.00 0.00 ? 805  ARG A CA    1 
ATOM   6091  C  C     . ARG A  1  805  ? 246.107 272.548 181.688 1.00 0.00 ? 805  ARG A C     1 
ATOM   6092  O  O     . ARG A  1  805  ? 245.662 272.063 182.729 1.00 0.00 ? 805  ARG A O     1 
ATOM   6093  C  CB    . ARG A  1  805  ? 246.282 271.035 179.812 1.00 0.00 ? 805  ARG A CB    1 
ATOM   6094  C  CG    . ARG A  1  805  ? 247.040 270.579 178.700 1.00 0.00 ? 805  ARG A CG    1 
ATOM   6095  C  CD    . ARG A  1  805  ? 246.055 270.220 177.679 1.00 0.00 ? 805  ARG A CD    1 
ATOM   6096  N  NE    . ARG A  1  805  ? 245.217 269.129 178.133 1.00 0.00 ? 805  ARG A NE    1 
ATOM   6097  C  CZ    . ARG A  1  805  ? 244.306 268.569 177.363 1.00 0.00 ? 805  ARG A CZ    1 
ATOM   6098  N  NH1   . ARG A  1  805  ? 244.163 268.997 176.114 1.00 0.00 ? 805  ARG A NH1   1 
ATOM   6099  N  NH2   . ARG A  1  805  ? 243.568 267.583 177.840 1.00 0.00 ? 805  ARG A NH2   1 
ATOM   6100  N  N     . THR A  1  806  ? 245.719 273.740 181.243 1.00 0.00 ? 806  THR A N     1 
ATOM   6101  C  CA    . THR A  1  806  ? 244.682 274.409 182.005 1.00 0.00 ? 806  THR A CA    1 
ATOM   6102  C  C     . THR A  1  806  ? 243.304 273.937 181.570 1.00 0.00 ? 806  THR A C     1 
ATOM   6103  O  O     . THR A  1  806  ? 242.463 273.669 182.414 1.00 0.00 ? 806  THR A O     1 
ATOM   6104  C  CB    . THR A  1  806  ? 244.746 275.960 181.929 1.00 0.00 ? 806  THR A CB    1 
ATOM   6105  O  OG1   . THR A  1  806  ? 244.902 276.385 180.577 1.00 0.00 ? 806  THR A OG1   1 
ATOM   6106  C  CG2   . THR A  1  806  ? 245.881 276.486 182.723 1.00 0.00 ? 806  THR A CG2   1 
ATOM   6107  N  N     . LEU A  1  807  ? 243.066 273.751 180.287 1.00 0.00 ? 807  LEU A N     1 
ATOM   6108  C  CA    . LEU A  1  807  ? 241.709 273.437 179.866 1.00 0.00 ? 807  LEU A CA    1 
ATOM   6109  C  C     . LEU A  1  807  ? 241.874 272.427 178.776 1.00 0.00 ? 807  LEU A C     1 
ATOM   6110  O  O     . LEU A  1  807  ? 242.926 272.385 178.186 1.00 0.00 ? 807  LEU A O     1 
ATOM   6111  C  CB    . LEU A  1  807  ? 240.995 274.683 179.359 1.00 0.00 ? 807  LEU A CB    1 
ATOM   6112  C  CG    . LEU A  1  807  ? 240.564 275.771 180.337 1.00 0.00 ? 807  LEU A CG    1 
ATOM   6113  C  CD1   . LEU A  1  807  ? 240.022 276.919 179.561 1.00 0.00 ? 807  LEU A CD1   1 
ATOM   6114  C  CD2   . LEU A  1  807  ? 239.524 275.290 181.301 1.00 0.00 ? 807  LEU A CD2   1 
ATOM   6115  N  N     . PRO A  1  808  ? 240.862 271.607 178.480 1.00 0.00 ? 808  PRO A N     1 
ATOM   6116  C  CA    . PRO A  1  808  ? 241.140 270.679 177.389 1.00 0.00 ? 808  PRO A CA    1 
ATOM   6117  C  C     . PRO A  1  808  ? 241.208 271.394 176.050 1.00 0.00 ? 808  PRO A C     1 
ATOM   6118  O  O     . PRO A  1  808  ? 241.563 270.779 175.082 1.00 0.00 ? 808  PRO A O     1 
ATOM   6119  C  CB    . PRO A  1  808  ? 239.968 269.725 177.455 1.00 0.00 ? 808  PRO A CB    1 
ATOM   6120  C  CG    . PRO A  1  808  ? 238.895 270.566 177.949 1.00 0.00 ? 808  PRO A CG    1 
ATOM   6121  C  CD    . PRO A  1  808  ? 239.472 271.495 178.940 1.00 0.00 ? 808  PRO A CD    1 
ATOM   6122  N  N     . HIS A  1  809  ? 240.933 272.684 175.999 1.00 0.00 ? 809  HIS A N     1 
ATOM   6123  C  CA    . HIS A  1  809  ? 240.960 273.398 174.732 1.00 0.00 ? 809  HIS A CA    1 
ATOM   6124  C  C     . HIS A  1  809  ? 242.364 273.695 174.204 1.00 0.00 ? 809  HIS A C     1 
ATOM   6125  O  O     . HIS A  1  809  ? 242.502 274.188 173.086 1.00 0.00 ? 809  HIS A O     1 
ATOM   6126  C  CB    . HIS A  1  809  ? 240.167 274.685 174.893 1.00 0.00 ? 809  HIS A CB    1 
ATOM   6127  C  CG    . HIS A  1  809  ? 238.835 274.463 175.539 1.00 0.00 ? 809  HIS A CG    1 
ATOM   6128  N  ND1   . HIS A  1  809  ? 237.706 274.112 174.828 1.00 0.00 ? 809  HIS A ND1   1 
ATOM   6129  C  CD2   . HIS A  1  809  ? 238.472 274.456 176.843 1.00 0.00 ? 809  HIS A CD2   1 
ATOM   6130  C  CE1   . HIS A  1  809  ? 236.697 273.940 175.663 1.00 0.00 ? 809  HIS A CE1   1 
ATOM   6131  N  NE2   . HIS A  1  809  ? 237.136 274.140 176.892 1.00 0.00 ? 809  HIS A NE2   1 
ATOM   6132  N  N     . PHE A  1  810  ? 243.394 273.346 174.975 1.00 0.00 ? 810  PHE A N     1 
ATOM   6133  C  CA    . PHE A  1  810  ? 244.776 273.653 174.608 1.00 0.00 ? 810  PHE A CA    1 
ATOM   6134  C  C     . PHE A  1  810  ? 245.606 272.388 174.413 1.00 0.00 ? 810  PHE A C     1 
ATOM   6135  O  O     . PHE A  1  810  ? 245.119 271.292 174.688 1.00 0.00 ? 810  PHE A O     1 
ATOM   6136  C  CB    . PHE A  1  810  ? 245.408 274.530 175.678 1.00 0.00 ? 810  PHE A CB    1 
ATOM   6137  C  CG    . PHE A  1  810  ? 244.658 275.791 175.928 1.00 0.00 ? 810  PHE A CG    1 
ATOM   6138  C  CD1   . PHE A  1  810  ? 244.710 276.831 175.027 1.00 0.00 ? 810  PHE A CD1   1 
ATOM   6139  C  CD2   . PHE A  1  810  ? 243.875 275.931 177.028 1.00 0.00 ? 810  PHE A CD2   1 
ATOM   6140  C  CE1   . PHE A  1  810  ? 244.003 278.005 175.231 1.00 0.00 ? 810  PHE A CE1   1 
ATOM   6141  C  CE2   . PHE A  1  810  ? 243.171 277.093 177.226 1.00 0.00 ? 810  PHE A CE2   1 
ATOM   6142  C  CZ    . PHE A  1  810  ? 243.240 278.131 176.321 1.00 0.00 ? 810  PHE A CZ    1 
ATOM   6143  N  N     . ILE A  1  811  ? 246.843 272.556 173.923 1.00 0.00 ? 811  ILE A N     1 
ATOM   6144  C  CA    . ILE A  1  811  ? 247.854 271.478 173.782 1.00 0.00 ? 811  ILE A CA    1 
ATOM   6145  C  C     . ILE A  1  811  ? 248.572 271.179 175.104 1.00 0.00 ? 811  ILE A C     1 
ATOM   6146  O  O     . ILE A  1  811  ? 248.657 272.063 175.960 1.00 0.00 ? 811  ILE A O     1 
ATOM   6147  C  CB    . ILE A  1  811  ? 248.925 271.854 172.743 1.00 0.00 ? 811  ILE A CB    1 
ATOM   6148  C  CG1   . ILE A  1  811  ? 248.255 272.289 171.455 1.00 0.00 ? 811  ILE A CG1   1 
ATOM   6149  C  CG2   . ILE A  1  811  ? 249.838 270.695 172.465 1.00 0.00 ? 811  ILE A CG2   1 
ATOM   6150  C  CD1   . ILE A  1  811  ? 247.327 271.234 170.915 1.00 0.00 ? 811  ILE A CD1   1 
ATOM   6151  N  N     . LYS A  1  812  ? 249.091 269.969 175.303 1.00 0.00 ? 812  LYS A N     1 
ATOM   6152  C  CA    . LYS A  1  812  ? 249.801 269.735 176.551 1.00 0.00 ? 812  LYS A CA    1 
ATOM   6153  C  C     . LYS A  1  812  ? 251.081 270.544 176.575 1.00 0.00 ? 812  LYS A C     1 
ATOM   6154  O  O     . LYS A  1  812  ? 251.775 270.635 175.563 1.00 0.00 ? 812  LYS A O     1 
ATOM   6155  C  CB    . LYS A  1  812  ? 250.111 268.266 176.756 1.00 0.00 ? 812  LYS A CB    1 
ATOM   6156  C  CG    . LYS A  1  812  ? 248.991 267.476 177.352 1.00 0.00 ? 812  LYS A CG    1 
ATOM   6157  C  CD    . LYS A  1  812  ? 249.479 266.086 177.670 1.00 0.00 ? 812  LYS A CD    1 
ATOM   6158  C  CE    . LYS A  1  812  ? 248.433 265.265 178.411 1.00 0.00 ? 812  LYS A CE    1 
ATOM   6159  N  NZ    . LYS A  1  812  ? 248.873 263.822 178.579 1.00 0.00 ? 812  LYS A NZ    1 
ATOM   6160  N  N     . ASP A  1  813  ? 251.382 271.134 177.733 1.00 0.00 ? 813  ASP A N     1 
ATOM   6161  C  CA    . ASP A  1  813  ? 252.559 271.983 177.897 1.00 0.00 ? 813  ASP A CA    1 
ATOM   6162  C  C     . ASP A  1  813  ? 252.536 273.095 176.867 1.00 0.00 ? 813  ASP A C     1 
ATOM   6163  O  O     . ASP A  1  813  ? 253.154 272.985 175.801 1.00 0.00 ? 813  ASP A O     1 
ATOM   6164  C  CB    . ASP A  1  813  ? 253.851 271.179 177.759 1.00 0.00 ? 813  ASP A CB    1 
ATOM   6165  C  CG    . ASP A  1  813  ? 255.089 271.961 178.204 1.00 0.00 ? 813  ASP A CG    1 
ATOM   6166  O  OD1   . ASP A  1  813  ? 255.019 272.542 179.316 1.00 0.00 ? 813  ASP A OD1   1 
ATOM   6167  O  OD2   . ASP A  1  813  ? 256.104 271.984 177.439 1.00 0.00 ? 813  ASP A OD2   1 
ATOM   6168  N  N     . ASP A  1  814  ? 251.803 274.153 177.154 1.00 0.00 ? 814  ASP A N     1 
ATOM   6169  C  CA    . ASP A  1  814  ? 251.768 275.258 176.222 1.00 0.00 ? 814  ASP A CA    1 
ATOM   6170  C  C     . ASP A  1  814  ? 251.916 276.532 176.983 1.00 0.00 ? 814  ASP A C     1 
ATOM   6171  O  O     . ASP A  1  814  ? 250.933 277.118 177.412 1.00 0.00 ? 814  ASP A O     1 
ATOM   6172  C  CB    . ASP A  1  814  ? 250.485 275.287 175.406 1.00 0.00 ? 814  ASP A CB    1 
ATOM   6173  C  CG    . ASP A  1  814  ? 250.579 276.258 174.240 1.00 0.00 ? 814  ASP A CG    1 
ATOM   6174  O  OD1   . ASP A  1  814  ? 251.171 275.885 173.194 1.00 0.00 ? 814  ASP A OD1   1 
ATOM   6175  O  OD2   . ASP A  1  814  ? 250.091 277.404 174.385 1.00 0.00 ? 814  ASP A OD2   1 
ATOM   6176  N  N     . TYR A  1  815  ? 253.157 276.953 177.144 1.00 0.00 ? 815  TYR A N     1 
ATOM   6177  C  CA    . TYR A  1  815  ? 253.458 278.107 177.956 1.00 0.00 ? 815  TYR A CA    1 
ATOM   6178  C  C     . TYR A  1  815  ? 253.102 279.464 177.393 1.00 0.00 ? 815  TYR A C     1 
ATOM   6179  O  O     . TYR A  1  815  ? 253.360 280.459 178.053 1.00 0.00 ? 815  TYR A O     1 
ATOM   6180  C  CB    . TYR A  1  815  ? 254.924 278.098 178.267 1.00 0.00 ? 815  TYR A CB    1 
ATOM   6181  C  CG    . TYR A  1  815  ? 255.276 277.004 179.207 1.00 0.00 ? 815  TYR A CG    1 
ATOM   6182  C  CD1   . TYR A  1  815  ? 254.399 276.625 180.221 1.00 0.00 ? 815  TYR A CD1   1 
ATOM   6183  C  CD2   . TYR A  1  815  ? 256.487 276.340 179.080 1.00 0.00 ? 815  TYR A CD2   1 
ATOM   6184  C  CE1   . TYR A  1  815  ? 254.733 275.618 181.093 1.00 0.00 ? 815  TYR A CE1   1 
ATOM   6185  C  CE2   . TYR A  1  815  ? 256.836 275.334 179.937 1.00 0.00 ? 815  TYR A CE2   1 
ATOM   6186  C  CZ    . TYR A  1  815  ? 255.960 274.970 180.944 1.00 0.00 ? 815  TYR A CZ    1 
ATOM   6187  O  OH    . TYR A  1  815  ? 256.332 273.953 181.794 1.00 0.00 ? 815  TYR A OH    1 
ATOM   6188  N  N     . GLY A  1  816  ? 252.524 279.518 176.195 1.00 0.00 ? 816  GLY A N     1 
ATOM   6189  C  CA    . GLY A  1  816  ? 252.120 280.784 175.600 1.00 0.00 ? 816  GLY A CA    1 
ATOM   6190  C  C     . GLY A  1  816  ? 251.317 281.637 176.568 1.00 0.00 ? 816  GLY A C     1 
ATOM   6191  O  O     . GLY A  1  816  ? 250.871 281.148 177.595 1.00 0.00 ? 816  GLY A O     1 
ATOM   6192  N  N     . PRO A  1  817  ? 251.141 282.926 176.267 1.00 0.00 ? 817  PRO A N     1 
ATOM   6193  C  CA    . PRO A  1  817  ? 250.394 283.822 177.163 1.00 0.00 ? 817  PRO A CA    1 
ATOM   6194  C  C     . PRO A  1  817  ? 248.939 283.415 177.364 1.00 0.00 ? 817  PRO A C     1 
ATOM   6195  O  O     . PRO A  1  817  ? 248.531 283.158 178.505 1.00 0.00 ? 817  PRO A O     1 
ATOM   6196  C  CB    . PRO A  1  817  ? 250.474 285.180 176.460 1.00 0.00 ? 817  PRO A CB    1 
ATOM   6197  C  CG    . PRO A  1  817  ? 250.845 284.893 175.065 1.00 0.00 ? 817  PRO A CG    1 
ATOM   6198  C  CD    . PRO A  1  817  ? 251.629 283.613 175.063 1.00 0.00 ? 817  PRO A CD    1 
ATOM   6199  N  N     . GLU A  1  818  ? 248.190 283.349 176.259 1.00 0.00 ? 818  GLU A N     1 
ATOM   6200  C  CA    . GLU A  1  818  ? 246.748 283.068 176.273 1.00 0.00 ? 818  GLU A CA    1 
ATOM   6201  C  C     . GLU A  1  818  ? 246.462 281.697 176.885 1.00 0.00 ? 818  GLU A C     1 
ATOM   6202  O  O     . GLU A  1  818  ? 245.622 281.555 177.762 1.00 0.00 ? 818  GLU A O     1 
ATOM   6203  C  CB    . GLU A  1  818  ? 246.159 283.128 174.858 1.00 0.00 ? 818  GLU A CB    1 
ATOM   6204  C  CG    . GLU A  1  818  ? 246.804 282.185 173.860 1.00 0.00 ? 818  GLU A CG    1 
ATOM   6205  C  CD    . GLU A  1  818  ? 248.275 282.512 173.517 1.00 0.00 ? 818  GLU A CD    1 
ATOM   6206  O  OE1   . GLU A  1  818  ? 248.508 283.463 172.703 1.00 0.00 ? 818  GLU A OE1   1 
ATOM   6207  O  OE2   . GLU A  1  818  ? 249.176 281.758 173.999 1.00 0.00 ? 818  GLU A OE2   1 
ATOM   6208  N  N     . SER A  1  819  ? 247.189 280.684 176.451 1.00 0.00 ? 819  SER A N     1 
ATOM   6209  C  CA    . SER A  1  819  ? 246.935 279.334 176.919 1.00 0.00 ? 819  SER A CA    1 
ATOM   6210  C  C     . SER A  1  819  ? 247.108 279.158 178.402 1.00 0.00 ? 819  SER A C     1 
ATOM   6211  O  O     . SER A  1  819  ? 246.667 278.148 178.943 1.00 0.00 ? 819  SER A O     1 
ATOM   6212  C  CB    . SER A  1  819  ? 247.883 278.352 176.227 1.00 0.00 ? 819  SER A CB    1 
ATOM   6213  O  OG    . SER A  1  819  ? 247.769 278.406 174.815 1.00 0.00 ? 819  SER A OG    1 
ATOM   6214  N  N     . ARG A  1  820  ? 247.817 280.073 179.049 1.00 0.00 ? 820  ARG A N     1 
ATOM   6215  C  CA    . ARG A  1  820  ? 247.990 279.930 180.468 1.00 0.00 ? 820  ARG A CA    1 
ATOM   6216  C  C     . ARG A  1  820  ? 247.546 281.175 181.202 1.00 0.00 ? 820  ARG A C     1 
ATOM   6217  O  O     . ARG A  1  820  ? 248.084 281.489 182.242 1.00 0.00 ? 820  ARG A O     1 
ATOM   6218  C  CB    . ARG A  1  820  ? 249.436 279.565 180.758 1.00 0.00 ? 820  ARG A CB    1 
ATOM   6219  C  CG    . ARG A  1  820  ? 249.693 278.969 182.110 1.00 0.00 ? 820  ARG A CG    1 
ATOM   6220  C  CD    . ARG A  1  820  ? 251.114 278.500 182.118 1.00 0.00 ? 820  ARG A CD    1 
ATOM   6221  N  NE    . ARG A  1  820  ? 251.707 278.505 183.449 1.00 0.00 ? 820  ARG A NE    1 
ATOM   6222  C  CZ    . ARG A  1  820  ? 251.403 277.659 184.428 1.00 0.00 ? 820  ARG A CZ    1 
ATOM   6223  N  NH1   . ARG A  1  820  ? 250.545 276.666 184.218 1.00 0.00 ? 820  ARG A NH1   1 
ATOM   6224  N  NH2   . ARG A  1  820  ? 252.017 277.776 185.606 1.00 0.00 ? 820  ARG A NH2   1 
ATOM   6225  N  N     . GLY A  1  821  ? 246.574 281.901 180.670 1.00 0.00 ? 821  GLY A N     1 
ATOM   6226  C  CA    . GLY A  1  821  ? 245.889 282.870 181.511 1.00 0.00 ? 821  GLY A CA    1 
ATOM   6227  C  C     . GLY A  1  821  ? 246.108 284.357 181.292 1.00 0.00 ? 821  GLY A C     1 
ATOM   6228  O  O     . GLY A  1  821  ? 245.862 285.162 182.186 1.00 0.00 ? 821  GLY A O     1 
ATOM   6229  N  N     . PHE A  1  822  ? 246.606 284.721 180.120 1.00 0.00 ? 822  PHE A N     1 
ATOM   6230  C  CA    . PHE A  1  822  ? 246.642 286.110 179.688 1.00 0.00 ? 822  PHE A CA    1 
ATOM   6231  C  C     . PHE A  1  822  ? 245.373 286.497 178.913 1.00 0.00 ? 822  PHE A C     1 
ATOM   6232  O  O     . PHE A  1  822  ? 245.031 285.880 177.913 1.00 0.00 ? 822  PHE A O     1 
ATOM   6233  C  CB    . PHE A  1  822  ? 247.876 286.361 178.832 1.00 0.00 ? 822  PHE A CB    1 
ATOM   6234  C  CG    . PHE A  1  822  ? 248.000 287.771 178.372 1.00 0.00 ? 822  PHE A CG    1 
ATOM   6235  C  CD1   . PHE A  1  822  ? 248.460 288.740 179.213 1.00 0.00 ? 822  PHE A CD1   1 
ATOM   6236  C  CD2   . PHE A  1  822  ? 247.629 288.133 177.094 1.00 0.00 ? 822  PHE A CD2   1 
ATOM   6237  C  CE1   . PHE A  1  822  ? 248.564 290.033 178.778 1.00 0.00 ? 822  PHE A CE1   1 
ATOM   6238  C  CE2   . PHE A  1  822  ? 247.734 289.435 176.662 1.00 0.00 ? 822  PHE A CE2   1 
ATOM   6239  C  CZ    . PHE A  1  822  ? 248.199 290.377 177.506 1.00 0.00 ? 822  PHE A CZ    1 
ATOM   6240  N  N     . VAL A  1  823  ? 244.680 287.529 179.368 1.00 0.00 ? 823  VAL A N     1 
ATOM   6241  C  CA    . VAL A  1  823  ? 243.473 288.016 178.692 1.00 0.00 ? 823  VAL A CA    1 
ATOM   6242  C  C     . VAL A  1  823  ? 243.795 289.122 177.652 1.00 0.00 ? 823  VAL A C     1 
ATOM   6243  O  O     . VAL A  1  823  ? 244.027 290.268 178.020 1.00 0.00 ? 823  VAL A O     1 
ATOM   6244  C  CB    . VAL A  1  823  ? 242.459 288.575 179.731 1.00 0.00 ? 823  VAL A CB    1 
ATOM   6245  C  CG1   . VAL A  1  823  ? 241.195 289.063 179.067 1.00 0.00 ? 823  VAL A CG1   1 
ATOM   6246  C  CG2   . VAL A  1  823  ? 242.121 287.544 180.776 1.00 0.00 ? 823  VAL A CG2   1 
ATOM   6247  N  N     . GLU A  1  824  ? 243.779 288.785 176.361 1.00 0.00 ? 824  GLU A N     1 
ATOM   6248  C  CA    . GLU A  1  824  ? 244.116 289.715 175.278 1.00 0.00 ? 824  GLU A CA    1 
ATOM   6249  C  C     . GLU A  1  824  ? 243.117 290.811 175.063 1.00 0.00 ? 824  GLU A C     1 
ATOM   6250  O  O     . GLU A  1  824  ? 243.388 291.748 174.312 1.00 0.00 ? 824  GLU A O     1 
ATOM   6251  C  CB    . GLU A  1  824  ? 244.237 288.970 173.976 1.00 0.00 ? 824  GLU A CB    1 
ATOM   6252  C  CG    . GLU A  1  824  ? 245.358 288.006 173.998 1.00 0.00 ? 824  GLU A CG    1 
ATOM   6253  C  CD    . GLU A  1  824  ? 245.680 287.422 172.619 1.00 0.00 ? 824  GLU A CD    1 
ATOM   6254  O  OE1   . GLU A  1  824  ? 244.847 287.589 171.675 1.00 0.00 ? 824  GLU A OE1   1 
ATOM   6255  O  OE2   . GLU A  1  824  ? 246.766 286.791 172.499 1.00 0.00 ? 824  GLU A OE2   1 
ATOM   6256  N  N     . ASN A  1  825  ? 241.943 290.669 175.668 1.00 0.00 ? 825  ASN A N     1 
ATOM   6257  C  CA    . ASN A  1  825  ? 240.852 291.581 175.369 1.00 0.00 ? 825  ASN A CA    1 
ATOM   6258  C  C     . ASN A  1  825  ? 240.576 292.616 176.425 1.00 0.00 ? 825  ASN A C     1 
ATOM   6259  O  O     . ASN A  1  825  ? 241.126 292.562 177.506 1.00 0.00 ? 825  ASN A O     1 
ATOM   6260  C  CB    . ASN A  1  825  ? 239.613 290.778 175.070 1.00 0.00 ? 825  ASN A CB    1 
ATOM   6261  C  CG    . ASN A  1  825  ? 239.701 290.164 173.709 1.00 0.00 ? 825  ASN A CG    1 
ATOM   6262  O  OD1   . ASN A  1  825  ? 239.699 290.877 172.700 1.00 0.00 ? 825  ASN A OD1   1 
ATOM   6263  N  ND2   . ASN A  1  825  ? 239.899 288.856 173.661 1.00 0.00 ? 825  ASN A ND2   1 
ATOM   6264  N  N     . SER A  1  826  ? 239.755 293.593 176.089 1.00 0.00 ? 826  SER A N     1 
ATOM   6265  C  CA    . SER A  1  826  ? 239.359 294.597 177.059 1.00 0.00 ? 826  SER A CA    1 
ATOM   6266  C  C     . SER A  1  826  ? 237.949 294.328 177.485 1.00 0.00 ? 826  SER A C     1 
ATOM   6267  O  O     . SER A  1  826  ? 237.241 293.634 176.783 1.00 0.00 ? 826  SER A O     1 
ATOM   6268  C  CB    . SER A  1  826  ? 239.459 295.974 176.452 1.00 0.00 ? 826  SER A CB    1 
ATOM   6269  O  OG    . SER A  1  826  ? 238.570 296.084 175.357 1.00 0.00 ? 826  SER A OG    1 
ATOM   6270  N  N     . TYR A  1  827  ? 237.501 294.865 178.603 1.00 0.00 ? 827  TYR A N     1 
ATOM   6271  C  CA    . TYR A  1  827  ? 236.132 294.604 178.942 1.00 0.00 ? 827  TYR A CA    1 
ATOM   6272  C  C     . TYR A  1  827  ? 235.222 295.107 177.900 1.00 0.00 ? 827  TYR A C     1 
ATOM   6273  O  O     . TYR A  1  827  ? 234.170 294.558 177.762 1.00 0.00 ? 827  TYR A O     1 
ATOM   6274  C  CB    . TYR A  1  827  ? 235.733 295.251 180.225 1.00 0.00 ? 827  TYR A CB    1 
ATOM   6275  C  CG    . TYR A  1  827  ? 236.294 294.570 181.407 1.00 0.00 ? 827  TYR A CG    1 
ATOM   6276  C  CD1   . TYR A  1  827  ? 236.361 293.186 181.465 1.00 0.00 ? 827  TYR A CD1   1 
ATOM   6277  C  CD2   . TYR A  1  827  ? 236.762 295.307 182.465 1.00 0.00 ? 827  TYR A CD2   1 
ATOM   6278  C  CE1   . TYR A  1  827  ? 236.872 292.575 182.553 1.00 0.00 ? 827  TYR A CE1   1 
ATOM   6279  C  CE2   . TYR A  1  827  ? 237.265 294.712 183.530 1.00 0.00 ? 827  TYR A CE2   1 
ATOM   6280  C  CZ    . TYR A  1  827  ? 237.318 293.355 183.574 1.00 0.00 ? 827  TYR A CZ    1 
ATOM   6281  O  OH    . TYR A  1  827  ? 237.837 292.801 184.688 1.00 0.00 ? 827  TYR A OH    1 
ATOM   6282  N  N     . LEU A  1  828  ? 235.607 296.120 177.139 1.00 0.00 ? 828  LEU A N     1 
ATOM   6283  C  CA    . LEU A  1  828  ? 234.679 296.627 176.137 1.00 0.00 ? 828  LEU A CA    1 
ATOM   6284  C  C     . LEU A  1  828  ? 234.467 295.699 174.923 1.00 0.00 ? 828  LEU A C     1 
ATOM   6285  O  O     . LEU A  1  828  ? 233.346 295.543 174.467 1.00 0.00 ? 828  LEU A O     1 
ATOM   6286  C  CB    . LEU A  1  828  ? 235.129 298.005 175.663 1.00 0.00 ? 828  LEU A CB    1 
ATOM   6287  C  CG    . LEU A  1  828  ? 234.175 298.564 174.609 1.00 0.00 ? 828  LEU A CG    1 
ATOM   6288  C  CD1   . LEU A  1  828  ? 233.697 299.969 174.989 1.00 0.00 ? 828  LEU A CD1   1 
ATOM   6289  C  CD2   . LEU A  1  828  ? 234.830 298.519 173.210 1.00 0.00 ? 828  LEU A CD2   1 
ATOM   6290  N  N     . ALA A  1  829  ? 235.525 295.083 174.415 1.00 0.00 ? 829  ALA A N     1 
ATOM   6291  C  CA    . ALA A  1  829  ? 235.391 294.126 173.321 1.00 0.00 ? 829  ALA A CA    1 
ATOM   6292  C  C     . ALA A  1  829  ? 234.804 292.797 173.787 1.00 0.00 ? 829  ALA A C     1 
ATOM   6293  O  O     . ALA A  1  829  ? 234.391 291.991 172.949 1.00 0.00 ? 829  ALA A O     1 
ATOM   6294  C  CB    . ALA A  1  829  ? 236.748 293.886 172.638 1.00 0.00 ? 829  ALA A CB    1 
ATOM   6295  N  N     . GLY A  1  830  ? 234.825 292.540 175.099 1.00 0.00 ? 830  GLY A N     1 
ATOM   6296  C  CA    . GLY A  1  830  ? 234.358 291.274 175.649 1.00 0.00 ? 830  GLY A CA    1 
ATOM   6297  C  C     . GLY A  1  830  ? 235.461 290.219 175.700 1.00 0.00 ? 830  GLY A C     1 
ATOM   6298  O  O     . GLY A  1  830  ? 236.365 290.203 174.856 1.00 0.00 ? 830  GLY A O     1 
ATOM   6299  N  N     . LEU A  1  831  ? 235.394 289.328 176.685 1.00 0.00 ? 831  LEU A N     1 
ATOM   6300  C  CA    . LEU A  1  831  ? 236.414 288.292 176.881 1.00 0.00 ? 831  LEU A CA    1 
ATOM   6301  C  C     . LEU A  1  831  ? 236.114 287.024 176.019 1.00 0.00 ? 831  LEU A C     1 
ATOM   6302  O  O     . LEU A  1  831  ? 234.964 286.732 175.767 1.00 0.00 ? 831  LEU A O     1 
ATOM   6303  C  CB    . LEU A  1  831  ? 236.510 287.978 178.381 1.00 0.00 ? 831  LEU A CB    1 
ATOM   6304  C  CG    . LEU A  1  831  ? 237.435 288.919 179.176 1.00 0.00 ? 831  LEU A CG    1 
ATOM   6305  C  CD1   . LEU A  1  831  ? 237.101 290.355 178.976 1.00 0.00 ? 831  LEU A CD1   1 
ATOM   6306  C  CD2   . LEU A  1  831  ? 237.404 288.644 180.646 1.00 0.00 ? 831  LEU A CD2   1 
ATOM   6307  N  N     . THR A  1  832  ? 237.113 286.312 175.494 1.00 0.00 ? 832  THR A N     1 
ATOM   6308  C  CA    . THR A  1  832  ? 236.832 285.043 174.803 1.00 0.00 ? 832  THR A CA    1 
ATOM   6309  C  C     . THR A  1  832  ? 236.607 283.946 175.820 1.00 0.00 ? 832  THR A C     1 
ATOM   6310  O  O     . THR A  1  832  ? 237.046 284.086 176.947 1.00 0.00 ? 832  THR A O     1 
ATOM   6311  C  CB    . THR A  1  832  ? 237.978 284.624 173.802 1.00 0.00 ? 832  THR A CB    1 
ATOM   6312  O  OG1   . THR A  1  832  ? 239.256 284.500 174.462 1.00 0.00 ? 832  THR A OG1   1 
ATOM   6313  C  CG2   . THR A  1  832  ? 238.077 285.609 172.621 1.00 0.00 ? 832  THR A CG2   1 
ATOM   6314  N  N     . PRO A  1  833  ? 235.993 282.818 175.418 1.00 0.00 ? 833  PRO A N     1 
ATOM   6315  C  CA    . PRO A  1  833  ? 235.550 281.850 176.429 1.00 0.00 ? 833  PRO A CA    1 
ATOM   6316  C  C     . PRO A  1  833  ? 236.603 281.342 177.409 1.00 0.00 ? 833  PRO A C     1 
ATOM   6317  O  O     . PRO A  1  833  ? 236.318 281.257 178.591 1.00 0.00 ? 833  PRO A O     1 
ATOM   6318  C  CB    . PRO A  1  833  ? 235.047 280.670 175.581 1.00 0.00 ? 833  PRO A CB    1 
ATOM   6319  C  CG    . PRO A  1  833  ? 234.698 281.218 174.306 1.00 0.00 ? 833  PRO A CG    1 
ATOM   6320  C  CD    . PRO A  1  833  ? 235.664 282.347 174.061 1.00 0.00 ? 833  PRO A CD    1 
ATOM   6321  N  N     . THR A  1  834  ? 237.782 280.994 176.956 1.00 0.00 ? 834  THR A N     1 
ATOM   6322  C  CA    . THR A  1  834  ? 238.778 280.564 177.896 1.00 0.00 ? 834  THR A CA    1 
ATOM   6323  C  C     . THR A  1  834  ? 239.127 281.713 178.828 1.00 0.00 ? 834  THR A C     1 
ATOM   6324  O  O     . THR A  1  834  ? 239.098 281.547 180.018 1.00 0.00 ? 834  THR A O     1 
ATOM   6325  C  CB    . THR A  1  834  ? 239.960 280.068 177.205 1.00 0.00 ? 834  THR A CB    1 
ATOM   6326  O  OG1   . THR A  1  834  ? 240.448 281.085 176.328 1.00 0.00 ? 834  THR A OG1   1 
ATOM   6327  C  CG2   . THR A  1  834  ? 239.524 278.886 176.414 1.00 0.00 ? 834  THR A CG2   1 
ATOM   6328  N  N     . GLU A  1  835  ? 239.333 282.905 178.296 1.00 0.00 ? 835  GLU A N     1 
ATOM   6329  C  CA    . GLU A  1  835  ? 239.686 284.035 179.114 1.00 0.00 ? 835  GLU A CA    1 
ATOM   6330  C  C     . GLU A  1  835  ? 238.641 284.262 180.091 1.00 0.00 ? 835  GLU A C     1 
ATOM   6331  O  O     . GLU A  1  835  ? 238.959 284.556 181.186 1.00 0.00 ? 835  GLU A O     1 
ATOM   6332  C  CB    . GLU A  1  835  ? 239.711 285.304 178.319 1.00 0.00 ? 835  GLU A CB    1 
ATOM   6333  C  CG    . GLU A  1  835  ? 240.722 285.464 177.225 1.00 0.00 ? 835  GLU A CG    1 
ATOM   6334  C  CD    . GLU A  1  835  ? 240.393 286.761 176.481 1.00 0.00 ? 835  GLU A CD    1 
ATOM   6335  O  OE1   . GLU A  1  835  ? 239.257 286.834 175.939 1.00 0.00 ? 835  GLU A OE1   1 
ATOM   6336  O  OE2   . GLU A  1  835  ? 241.234 287.697 176.443 1.00 0.00 ? 835  GLU A OE2   1 
ATOM   6337  N  N     . PHE A  1  836  ? 237.396 284.046 179.743 1.00 0.00 ? 836  PHE A N     1 
ATOM   6338  C  CA    . PHE A  1  836  ? 236.372 284.263 180.740 1.00 0.00 ? 836  PHE A CA    1 
ATOM   6339  C  C     . PHE A  1  836  ? 236.499 283.359 181.954 1.00 0.00 ? 836  PHE A C     1 
ATOM   6340  O  O     . PHE A  1  836  ? 236.436 283.877 183.069 1.00 0.00 ? 836  PHE A O     1 
ATOM   6341  C  CB    . PHE A  1  836  ? 235.005 284.072 180.125 1.00 0.00 ? 836  PHE A CB    1 
ATOM   6342  C  CG    . PHE A  1  836  ? 233.910 284.399 181.045 1.00 0.00 ? 836  PHE A CG    1 
ATOM   6343  C  CD1   . PHE A  1  836  ? 233.506 285.713 181.203 1.00 0.00 ? 836  PHE A CD1   1 
ATOM   6344  C  CD2   . PHE A  1  836  ? 233.272 283.387 181.772 1.00 0.00 ? 836  PHE A CD2   1 
ATOM   6345  C  CE1   . PHE A  1  836  ? 232.468 286.032 182.078 1.00 0.00 ? 836  PHE A CE1   1 
ATOM   6346  C  CE2   . PHE A  1  836  ? 232.223 283.685 182.657 1.00 0.00 ? 836  PHE A CE2   1 
ATOM   6347  C  CZ    . PHE A  1  836  ? 231.818 285.011 182.813 1.00 0.00 ? 836  PHE A CZ    1 
ATOM   6348  N  N     . PHE A  1  837  ? 236.689 282.048 181.746 1.00 0.00 ? 837  PHE A N     1 
ATOM   6349  C  CA    . PHE A  1  837  ? 236.916 281.081 182.831 1.00 0.00 ? 837  PHE A CA    1 
ATOM   6350  C  C     . PHE A  1  837  ? 238.254 281.356 183.583 1.00 0.00 ? 837  PHE A C     1 
ATOM   6351  O  O     . PHE A  1  837  ? 238.344 281.111 184.764 1.00 0.00 ? 837  PHE A O     1 
ATOM   6352  C  CB    . PHE A  1  837  ? 236.853 279.662 182.332 1.00 0.00 ? 837  PHE A CB    1 
ATOM   6353  C  CG    . PHE A  1  837  ? 236.692 278.658 183.435 1.00 0.00 ? 837  PHE A CG    1 
ATOM   6354  C  CD1   . PHE A  1  837  ? 237.750 278.235 184.212 1.00 0.00 ? 837  PHE A CD1   1 
ATOM   6355  C  CD2   . PHE A  1  837  ? 235.451 278.135 183.703 1.00 0.00 ? 837  PHE A CD2   1 
ATOM   6356  C  CE1   . PHE A  1  837  ? 237.565 277.295 185.228 1.00 0.00 ? 837  PHE A CE1   1 
ATOM   6357  C  CE2   . PHE A  1  837  ? 235.272 277.202 184.713 1.00 0.00 ? 837  PHE A CE2   1 
ATOM   6358  C  CZ    . PHE A  1  837  ? 236.326 276.791 185.473 1.00 0.00 ? 837  PHE A CZ    1 
ATOM   6359  N  N     . PHE A  1  838  ? 239.338 281.680 182.911 1.00 0.00 ? 838  PHE A N     1 
ATOM   6360  C  CA    . PHE A  1  838  ? 240.512 282.070 183.669 1.00 0.00 ? 838  PHE A CA    1 
ATOM   6361  C  C     . PHE A  1  838  ? 240.230 283.388 184.427 1.00 0.00 ? 838  PHE A C     1 
ATOM   6362  O  O     . PHE A  1  838  ? 240.805 283.633 185.465 1.00 0.00 ? 838  PHE A O     1 
ATOM   6363  C  CB    . PHE A  1  838  ? 241.695 282.222 182.765 1.00 0.00 ? 838  PHE A CB    1 
ATOM   6364  C  CG    . PHE A  1  838  ? 242.064 280.972 182.089 1.00 0.00 ? 838  PHE A CG    1 
ATOM   6365  C  CD1   . PHE A  1  838  ? 241.823 279.760 182.699 1.00 0.00 ? 838  PHE A CD1   1 
ATOM   6366  C  CD2   . PHE A  1  838  ? 242.615 280.991 180.818 1.00 0.00 ? 838  PHE A CD2   1 
ATOM   6367  C  CE1   . PHE A  1  838  ? 242.165 278.581 182.061 1.00 0.00 ? 838  PHE A CE1   1 
ATOM   6368  C  CE2   . PHE A  1  838  ? 242.951 279.815 180.170 1.00 0.00 ? 838  PHE A CE2   1 
ATOM   6369  C  CZ    . PHE A  1  838  ? 242.732 278.612 180.793 1.00 0.00 ? 838  PHE A CZ    1 
ATOM   6370  N  N     . HIS A  1  839  ? 239.422 284.282 183.872 1.00 0.00 ? 839  HIS A N     1 
ATOM   6371  C  CA    . HIS A  1  839  ? 238.935 285.417 184.633 1.00 0.00 ? 839  HIS A CA    1 
ATOM   6372  C  C     . HIS A  1  839  ? 237.996 285.071 185.757 1.00 0.00 ? 839  HIS A C     1 
ATOM   6373  O  O     . HIS A  1  839  ? 237.996 285.733 186.758 1.00 0.00 ? 839  HIS A O     1 
ATOM   6374  C  CB    . HIS A  1  839  ? 238.274 286.396 183.742 1.00 0.00 ? 839  HIS A CB    1 
ATOM   6375  C  CG    . HIS A  1  839  ? 238.283 287.763 184.304 1.00 0.00 ? 839  HIS A CG    1 
ATOM   6376  N  ND1   . HIS A  1  839  ? 237.688 288.059 185.511 1.00 0.00 ? 839  HIS A ND1   1 
ATOM   6377  C  CD2   . HIS A  1  839  ? 238.904 288.892 183.900 1.00 0.00 ? 839  HIS A CD2   1 
ATOM   6378  C  CE1   . HIS A  1  839  ? 237.865 289.335 185.781 1.00 0.00 ? 839  HIS A CE1   1 
ATOM   6379  N  NE2   . HIS A  1  839  ? 238.605 289.862 184.822 1.00 0.00 ? 839  HIS A NE2   1 
ATOM   6380  N  N     . ALA A  1  840  ? 237.135 284.099 185.581 1.00 0.00 ? 840  ALA A N     1 
ATOM   6381  C  CA    . ALA A  1  840  ? 236.324 283.689 186.720 1.00 0.00 ? 840  ALA A CA    1 
ATOM   6382  C  C     . ALA A  1  840  ? 237.195 283.132 187.854 1.00 0.00 ? 840  ALA A C     1 
ATOM   6383  O  O     . ALA A  1  840  ? 236.870 283.409 188.990 1.00 0.00 ? 840  ALA A O     1 
ATOM   6384  C  CB    . ALA A  1  840  ? 235.278 282.664 186.323 1.00 0.00 ? 840  ALA A CB    1 
ATOM   6385  N  N     . MET A  1  841  ? 238.286 282.395 187.548 1.00 0.00 ? 841  MET A N     1 
ATOM   6386  C  CA    . MET A  1  841  ? 239.331 281.973 188.538 1.00 0.00 ? 841  MET A CA    1 
ATOM   6387  C  C     . MET A  1  841  ? 240.019 283.127 189.251 1.00 0.00 ? 841  MET A C     1 
ATOM   6388  O  O     . MET A  1  841  ? 240.287 283.064 190.452 1.00 0.00 ? 841  MET A O     1 
ATOM   6389  C  CB    . MET A  1  841  ? 240.404 281.097 187.920 1.00 0.00 ? 841  MET A CB    1 
ATOM   6390  C  CG    . MET A  1  841  ? 239.850 279.838 187.391 1.00 0.00 ? 841  MET A CG    1 
ATOM   6391  S  SD    . MET A  1  841  ? 241.001 278.746 186.564 1.00 0.00 ? 841  MET A SD    1 
ATOM   6392  C  CE    . MET A  1  841  ? 241.864 278.116 187.990 1.00 0.00 ? 841  MET A CE    1 
ATOM   6393  N  N     . GLY A  1  842  ? 240.352 284.163 188.506 1.00 0.00 ? 842  GLY A N     1 
ATOM   6394  C  CA    . GLY A  1  842  ? 240.875 285.340 189.148 1.00 0.00 ? 842  GLY A CA    1 
ATOM   6395  C  C     . GLY A  1  842  ? 239.788 285.966 190.007 1.00 0.00 ? 842  GLY A C     1 
ATOM   6396  O  O     . GLY A  1  842  ? 240.146 286.483 191.044 1.00 0.00 ? 842  GLY A O     1 
ATOM   6397  N  N     . GLY A  1  843  ? 238.497 285.854 189.655 1.00 0.00 ? 843  GLY A N     1 
ATOM   6398  C  CA    . GLY A  1  843  ? 237.415 286.312 190.538 1.00 0.00 ? 843  GLY A CA    1 
ATOM   6399  C  C     . GLY A  1  843  ? 237.222 285.700 191.927 1.00 0.00 ? 843  GLY A C     1 
ATOM   6400  O  O     . GLY A  1  843  ? 236.886 286.415 192.867 1.00 0.00 ? 843  GLY A O     1 
ATOM   6401  N  N     . ARG A  1  844  ? 237.441 284.396 192.064 1.00 0.00 ? 844  ARG A N     1 
ATOM   6402  C  CA    . ARG A  1  844  ? 237.411 283.695 193.354 1.00 0.00 ? 844  ARG A CA    1 
ATOM   6403  C  C     . ARG A  1  844  ? 238.416 284.065 194.383 1.00 0.00 ? 844  ARG A C     1 
ATOM   6404  O  O     . ARG A  1  844  ? 238.084 284.074 195.561 1.00 0.00 ? 844  ARG A O     1 
ATOM   6405  C  CB    . ARG A  1  844  ? 237.521 282.208 193.250 1.00 0.00 ? 844  ARG A CB    1 
ATOM   6406  C  CG    . ARG A  1  844  ? 236.388 281.447 192.812 1.00 0.00 ? 844  ARG A CG    1 
ATOM   6407  C  CD    . ARG A  1  844  ? 235.384 281.448 193.941 1.00 0.00 ? 844  ARG A CD    1 
ATOM   6408  N  NE    . ARG A  1  844  ? 234.530 280.319 193.670 1.00 0.00 ? 844  ARG A NE    1 
ATOM   6409  C  CZ    . ARG A  1  844  ? 233.690 280.268 192.660 1.00 0.00 ? 844  ARG A CZ    1 
ATOM   6410  N  NH1   . ARG A  1  844  ? 233.553 281.344 191.870 1.00 0.00 ? 844  ARG A NH1   1 
ATOM   6411  N  NH2   . ARG A  1  844  ? 232.968 279.158 192.464 1.00 0.00 ? 844  ARG A NH2   1 
ATOM   6412  N  N     . GLU A  1  845  ? 239.671 284.205 193.982 1.00 0.00 ? 845  GLU A N     1 
ATOM   6413  C  CA    . GLU A  1  845  ? 240.703 284.470 194.973 1.00 0.00 ? 845  GLU A CA    1 
ATOM   6414  C  C     . GLU A  1  845  ? 240.268 285.708 195.796 1.00 0.00 ? 845  GLU A C     1 
ATOM   6415  O  O     . GLU A  1  845  ? 240.400 285.699 197.024 1.00 0.00 ? 845  GLU A O     1 
ATOM   6416  C  CB    . GLU A  1  845  ? 242.087 284.670 194.346 1.00 0.00 ? 845  GLU A CB    1 
ATOM   6417  C  CG    . GLU A  1  845  ? 243.109 285.397 195.280 1.00 0.00 ? 845  GLU A CG    1 
ATOM   6418  C  CD    . GLU A  1  845  ? 243.041 286.926 195.270 1.00 0.00 ? 845  GLU A CD    1 
ATOM   6419  O  OE1   . GLU A  1  845  ? 242.974 287.511 194.155 1.00 0.00 ? 845  GLU A OE1   1 
ATOM   6420  O  OE2   . GLU A  1  845  ? 243.083 287.524 196.385 1.00 0.00 ? 845  GLU A OE2   1 
ATOM   6421  N  N     . GLY A  1  846  ? 239.749 286.758 195.155 1.00 0.00 ? 846  GLY A N     1 
ATOM   6422  C  CA    . GLY A  1  846  ? 239.262 287.904 195.907 1.00 0.00 ? 846  GLY A CA    1 
ATOM   6423  C  C     . GLY A  1  846  ? 238.012 287.689 196.766 1.00 0.00 ? 846  GLY A C     1 
ATOM   6424  O  O     . GLY A  1  846  ? 237.992 288.136 197.906 1.00 0.00 ? 846  GLY A O     1 
ATOM   6425  N  N     . LEU A  1  847  ? 237.010 286.957 196.295 1.00 0.00 ? 847  LEU A N     1 
ATOM   6426  C  CA    . LEU A  1  847  ? 235.815 286.682 197.120 1.00 0.00 ? 847  LEU A CA    1 
ATOM   6427  C  C     . LEU A  1  847  ? 236.143 285.879 198.384 1.00 0.00 ? 847  LEU A C     1 
ATOM   6428  O  O     . LEU A  1  847  ? 235.652 286.220 199.451 1.00 0.00 ? 847  LEU A O     1 
ATOM   6429  C  CB    . LEU A  1  847  ? 234.734 285.962 196.325 1.00 0.00 ? 847  LEU A CB    1 
ATOM   6430  C  CG    . LEU A  1  847  ? 233.999 286.806 195.284 1.00 0.00 ? 847  LEU A CG    1 
ATOM   6431  C  CD1   . LEU A  1  847  ? 233.103 285.963 194.388 1.00 0.00 ? 847  LEU A CD1   1 
ATOM   6432  C  CD2   . LEU A  1  847  ? 233.189 287.864 195.972 1.00 0.00 ? 847  LEU A CD2   1 
ATOM   6433  N  N     . ILE A  1  848  ? 236.982 284.845 198.257 1.00 0.00 ? 848  ILE A N     1 
ATOM   6434  C  CA    . ILE A  1  848  ? 237.426 283.998 199.375 1.00 0.00 ? 848  ILE A CA    1 
ATOM   6435  C  C     . ILE A  1  848  ? 238.279 284.734 200.416 1.00 0.00 ? 848  ILE A C     1 
ATOM   6436  O  O     . ILE A  1  848  ? 238.116 284.563 201.643 1.00 0.00 ? 848  ILE A O     1 
ATOM   6437  C  CB    . ILE A  1  848  ? 238.310 282.890 198.879 1.00 0.00 ? 848  ILE A CB    1 
ATOM   6438  C  CG1   . ILE A  1  848  ? 237.538 281.990 197.974 1.00 0.00 ? 848  ILE A CG1   1 
ATOM   6439  C  CG2   . ILE A  1  848  ? 238.850 282.089 200.010 1.00 0.00 ? 848  ILE A CG2   1 
ATOM   6440  C  CD1   . ILE A  1  848  ? 238.447 281.082 197.265 1.00 0.00 ? 848  ILE A CD1   1 
ATOM   6441  N  N     . ASP A  1  849  ? 239.197 285.544 199.900 1.00 0.00 ? 849  ASP A N     1 
ATOM   6442  C  CA    . ASP A  1  849  ? 240.084 286.399 200.681 1.00 0.00 ? 849  ASP A CA    1 
ATOM   6443  C  C     . ASP A  1  849  ? 239.218 287.293 201.560 1.00 0.00 ? 849  ASP A C     1 
ATOM   6444  O  O     . ASP A  1  849  ? 239.544 287.526 202.717 1.00 0.00 ? 849  ASP A O     1 
ATOM   6445  C  CB    . ASP A  1  849  ? 241.013 287.195 199.757 1.00 0.00 ? 849  ASP A CB    1 
ATOM   6446  C  CG    . ASP A  1  849  ? 241.406 288.534 200.321 1.00 0.00 ? 849  ASP A CG    1 
ATOM   6447  O  OD1   . ASP A  1  849  ? 242.390 288.590 201.101 1.00 0.00 ? 849  ASP A OD1   1 
ATOM   6448  O  OD2   . ASP A  1  849  ? 240.743 289.528 199.961 1.00 0.00 ? 849  ASP A OD2   1 
ATOM   6449  N  N     . THR A  1  850  ? 238.089 287.747 201.025 1.00 0.00 ? 850  THR A N     1 
ATOM   6450  C  CA    . THR A  1  850  ? 237.195 288.645 201.752 1.00 0.00 ? 850  THR A CA    1 
ATOM   6451  C  C     . THR A  1  850  ? 236.587 287.942 202.955 1.00 0.00 ? 850  THR A C     1 
ATOM   6452  O  O     . THR A  1  850  ? 236.562 288.500 204.049 1.00 0.00 ? 850  THR A O     1 
ATOM   6453  C  CB    . THR A  1  850  ? 236.039 289.165 200.892 1.00 0.00 ? 850  THR A CB    1 
ATOM   6454  O  OG1   . THR A  1  850  ? 236.541 289.700 199.664 1.00 0.00 ? 850  THR A OG1   1 
ATOM   6455  C  CG2   . THR A  1  850  ? 235.292 290.252 201.637 1.00 0.00 ? 850  THR A CG2   1 
ATOM   6456  N  N     . ALA A  1  851  ? 236.073 286.739 202.745 1.00 0.00 ? 851  ALA A N     1 
ATOM   6457  C  CA    . ALA A  1  851  ? 235.403 285.979 203.796 1.00 0.00 ? 851  ALA A CA    1 
ATOM   6458  C  C     . ALA A  1  851  ? 236.373 285.579 204.911 1.00 0.00 ? 851  ALA A C     1 
ATOM   6459  O  O     . ALA A  1  851  ? 236.001 285.602 206.084 1.00 0.00 ? 851  ALA A O     1 
ATOM   6460  C  CB    . ALA A  1  851  ? 234.736 284.766 203.228 1.00 0.00 ? 851  ALA A CB    1 
ATOM   6461  N  N     . VAL A  1  852  ? 237.606 285.215 204.566 1.00 0.00 ? 852  VAL A N     1 
ATOM   6462  C  CA    . VAL A  1  852  ? 238.590 284.901 205.605 1.00 0.00 ? 852  VAL A CA    1 
ATOM   6463  C  C     . VAL A  1  852  ? 239.019 286.119 206.430 1.00 0.00 ? 852  VAL A C     1 
ATOM   6464  O  O     . VAL A  1  852  ? 239.008 286.061 207.662 1.00 0.00 ? 852  VAL A O     1 
ATOM   6465  C  CB    . VAL A  1  852  ? 239.867 284.282 205.001 1.00 0.00 ? 852  VAL A CB    1 
ATOM   6466  C  CG1   . VAL A  1  852  ? 240.881 283.977 206.100 1.00 0.00 ? 852  VAL A CG1   1 
ATOM   6467  C  CG2   . VAL A  1  852  ? 239.529 283.039 204.197 1.00 0.00 ? 852  VAL A CG2   1 
ATOM   6468  N  N     . LYS A  1  853  ? 239.379 287.216 205.766 1.00 0.00 ? 853  LYS A N     1 
ATOM   6469  C  CA    . LYS A  1  853  ? 240.002 288.350 206.453 1.00 0.00 ? 853  LYS A CA    1 
ATOM   6470  C  C     . LYS A  1  853  ? 239.064 288.923 207.509 1.00 0.00 ? 853  LYS A C     1 
ATOM   6471  O  O     . LYS A  1  853  ? 239.501 289.369 208.566 1.00 0.00 ? 853  LYS A O     1 
ATOM   6472  C  CB    . LYS A  1  853  ? 240.417 289.471 205.484 1.00 0.00 ? 853  LYS A CB    1 
ATOM   6473  C  CG    . LYS A  1  853  ? 241.922 289.486 205.131 1.00 0.00 ? 853  LYS A CG    1 
ATOM   6474  C  CD    . LYS A  1  853  ? 242.278 290.500 204.044 1.00 0.00 ? 853  LYS A CD    1 
ATOM   6475  C  CE    . LYS A  1  853  ? 241.047 290.993 203.300 1.00 0.00 ? 853  LYS A CE    1 
ATOM   6476  N  NZ    . LYS A  1  853  ? 241.379 292.081 202.326 1.00 0.00 ? 853  LYS A NZ    1 
ATOM   6477  N  N     . THR A  1  854  ? 237.769 288.892 207.216 1.00 0.00 ? 854  THR A N     1 
ATOM   6478  C  CA    . THR A  1  854  ? 236.746 289.371 208.145 1.00 0.00 ? 854  THR A CA    1 
ATOM   6479  C  C     . THR A  1  854  ? 236.717 288.612 209.474 1.00 0.00 ? 854  THR A C     1 
ATOM   6480  O  O     . THR A  1  854  ? 236.604 289.230 210.535 1.00 0.00 ? 854  THR A O     1 
ATOM   6481  C  CB    . THR A  1  854  ? 235.341 289.296 207.520 1.00 0.00 ? 854  THR A CB    1 
ATOM   6482  O  OG1   . THR A  1  854  ? 235.130 287.995 206.959 1.00 0.00 ? 854  THR A OG1   1 
ATOM   6483  C  CG2   . THR A  1  854  ? 235.176 290.367 206.444 1.00 0.00 ? 854  THR A CG2   1 
ATOM   6484  N  N     . ALA A  1  855  ? 236.845 287.286 209.417 1.00 0.00 ? 855  ALA A N     1 
ATOM   6485  C  CA    . ALA A  1  855  ? 236.912 286.451 210.623 1.00 0.00 ? 855  ALA A CA    1 
ATOM   6486  C  C     . ALA A  1  855  ? 238.198 286.623 211.433 1.00 0.00 ? 855  ALA A C     1 
ATOM   6487  O  O     . ALA A  1  855  ? 238.158 286.735 212.655 1.00 0.00 ? 855  ALA A O     1 
ATOM   6488  C  CB    . ALA A  1  855  ? 236.740 284.992 210.247 1.00 0.00 ? 855  ALA A CB    1 
ATOM   6489  N  N     . GLU A  1  856  ? 239.337 286.589 210.764 1.00 0.00 ? 856  GLU A N     1 
ATOM   6490  C  CA    . GLU A  1  856  ? 240.622 286.688 211.439 1.00 0.00 ? 856  GLU A CA    1 
ATOM   6491  C  C     . GLU A  1  856  ? 240.875 288.020 212.137 1.00 0.00 ? 856  GLU A C     1 
ATOM   6492  O  O     . GLU A  1  856  ? 241.288 288.047 213.297 1.00 0.00 ? 856  GLU A O     1 
ATOM   6493  C  CB    . GLU A  1  856  ? 241.740 286.434 210.431 1.00 0.00 ? 856  GLU A CB    1 
ATOM   6494  C  CG    . GLU A  1  856  ? 243.125 286.528 211.022 1.00 0.00 ? 856  GLU A CG    1 
ATOM   6495  C  CD    . GLU A  1  856  ? 243.517 285.286 211.781 1.00 0.00 ? 856  GLU A CD    1 
ATOM   6496  O  OE1   . GLU A  1  856  ? 242.964 284.200 211.483 1.00 0.00 ? 856  GLU A OE1   1 
ATOM   6497  O  OE2   . GLU A  1  856  ? 244.363 285.415 212.690 1.00 0.00 ? 856  GLU A OE2   1 
ATOM   6498  N  N     . THR A  1  857  ? 240.568 289.116 211.448 1.00 0.00 ? 857  THR A N     1 
ATOM   6499  C  CA    . THR A  1  857  ? 240.806 290.466 211.965 1.00 0.00 ? 857  THR A CA    1 
ATOM   6500  C  C     . THR A  1  857  ? 239.845 290.823 213.094 1.00 0.00 ? 857  THR A C     1 
ATOM   6501  O  O     . THR A  1  857  ? 240.190 291.586 214.004 1.00 0.00 ? 857  THR A O     1 
ATOM   6502  C  CB    . THR A  1  857  ? 240.685 291.524 210.865 1.00 0.00 ? 857  THR A CB    1 
ATOM   6503  O  OG1   . THR A  1  857  ? 239.361 291.500 210.313 1.00 0.00 ? 857  THR A OG1   1 
ATOM   6504  C  CG2   . THR A  1  857  ? 241.736 291.285 209.787 1.00 0.00 ? 857  THR A CG2   1 
ATOM   6505  N  N     . GLY A  1  858  ? 238.635 290.285 213.023 1.00 0.00 ? 858  GLY A N     1 
ATOM   6506  C  CA    . GLY A  1  858  ? 237.665 290.474 214.080 1.00 0.00 ? 858  GLY A CA    1 
ATOM   6507  C  C     . GLY A  1  858  ? 238.272 289.890 215.349 1.00 0.00 ? 858  GLY A C     1 
ATOM   6508  O  O     . GLY A  1  858  ? 238.091 290.458 216.420 1.00 0.00 ? 858  GLY A O     1 
ATOM   6509  N  N     . TYR A  1  859  ? 238.938 288.735 215.240 1.00 0.00 ? 859  TYR A N     1 
ATOM   6510  C  CA    . TYR A  1  859  ? 239.567 288.077 216.385 1.00 0.00 ? 859  TYR A CA    1 
ATOM   6511  C  C     . TYR A  1  859  ? 240.835 288.765 216.869 1.00 0.00 ? 859  TYR A C     1 
ATOM   6512  O  O     . TYR A  1  859  ? 241.055 288.865 218.065 1.00 0.00 ? 859  TYR A O     1 
ATOM   6513  C  CB    . TYR A  1  859  ? 239.920 286.647 216.017 1.00 0.00 ? 859  TYR A CB    1 
ATOM   6514  C  CG    . TYR A  1  859  ? 240.592 285.878 217.122 1.00 0.00 ? 859  TYR A CG    1 
ATOM   6515  C  CD1   . TYR A  1  859  ? 240.273 286.117 218.446 1.00 0.00 ? 859  TYR A CD1   1 
ATOM   6516  C  CD2   . TYR A  1  859  ? 241.537 284.899 216.839 1.00 0.00 ? 859  TYR A CD2   1 
ATOM   6517  C  CE1   . TYR A  1  859  ? 240.882 285.423 219.469 1.00 0.00 ? 859  TYR A CE1   1 
ATOM   6518  C  CE2   . TYR A  1  859  ? 242.148 284.186 217.859 1.00 0.00 ? 859  TYR A CE2   1 
ATOM   6519  C  CZ    . TYR A  1  859  ? 241.815 284.456 219.175 1.00 0.00 ? 859  TYR A CZ    1 
ATOM   6520  O  OH    . TYR A  1  859  ? 242.404 283.759 220.206 1.00 0.00 ? 859  TYR A OH    1 
ATOM   6521  N  N     . ILE A  1  860  ? 241.709 289.162 215.950 1.00 0.00 ? 860  ILE A N     1 
ATOM   6522  C  CA    . ILE A  1  860  ? 242.909 289.905 216.326 1.00 0.00 ? 860  ILE A CA    1 
ATOM   6523  C  C     . ILE A  1  860  ? 242.613 291.216 217.022 1.00 0.00 ? 860  ILE A C     1 
ATOM   6524  O  O     . ILE A  1  860  ? 243.274 291.564 217.983 1.00 0.00 ? 860  ILE A O     1 
ATOM   6525  C  CB    . ILE A  1  860  ? 243.807 290.182 215.130 1.00 0.00 ? 860  ILE A CB    1 
ATOM   6526  C  CG1   . ILE A  1  860  ? 244.407 288.869 214.643 1.00 0.00 ? 860  ILE A CG1   1 
ATOM   6527  C  CG2   . ILE A  1  860  ? 244.943 291.111 215.517 1.00 0.00 ? 860  ILE A CG2   1 
ATOM   6528  C  CD1   . ILE A  1  860  ? 245.113 288.981 213.306 1.00 0.00 ? 860  ILE A CD1   1 
ATOM   6529  N  N     . GLN A  1  861  ? 241.646 291.969 216.524 1.00 0.00 ? 861  GLN A N     1 
ATOM   6530  C  CA    . GLN A  1  861  ? 241.284 293.190 217.207 1.00 0.00 ? 861  GLN A CA    1 
ATOM   6531  C  C     . GLN A  1  861  ? 240.752 292.974 218.633 1.00 0.00 ? 861  GLN A C     1 
ATOM   6532  O  O     . GLN A  1  861  ? 241.201 293.654 219.517 1.00 0.00 ? 861  GLN A O     1 
ATOM   6533  C  CB    . GLN A  1  861  ? 240.307 293.985 216.363 1.00 0.00 ? 861  GLN A CB    1 
ATOM   6534  C  CG    . GLN A  1  861  ? 239.997 295.323 216.967 1.00 0.00 ? 861  GLN A CG    1 
ATOM   6535  C  CD    . GLN A  1  861  ? 239.258 296.255 216.010 1.00 0.00 ? 861  GLN A CD    1 
ATOM   6536  O  OE1   . GLN A  1  861  ? 239.293 296.072 214.782 1.00 0.00 ? 861  GLN A OE1   1 
ATOM   6537  N  NE2   . GLN A  1  861  ? 238.647 297.307 216.566 1.00 0.00 ? 861  GLN A NE2   1 
ATOM   6538  N  N     . ARG A  1  862  ? 239.817 292.058 218.865 1.00 0.00 ? 862  ARG A N     1 
ATOM   6539  C  CA    . ARG A  1  862  ? 239.261 291.814 220.211 1.00 0.00 ? 862  ARG A CA    1 
ATOM   6540  C  C     . ARG A  1  862  ? 240.272 291.450 221.258 1.00 0.00 ? 862  ARG A C     1 
ATOM   6541  O  O     . ARG A  1  862  ? 240.089 291.780 222.395 1.00 0.00 ? 862  ARG A O     1 
ATOM   6542  C  CB    . ARG A  1  862  ? 238.223 290.701 220.206 1.00 0.00 ? 862  ARG A CB    1 
ATOM   6543  C  CG    . ARG A  1  862  ? 236.753 291.162 220.069 1.00 0.00 ? 862  ARG A CG    1 
ATOM   6544  C  CD    . ARG A  1  862  ? 235.763 289.987 220.293 1.00 0.00 ? 862  ARG A CD    1 
ATOM   6545  N  NE    . ARG A  1  862  ? 235.854 289.450 221.666 1.00 0.00 ? 862  ARG A NE    1 
ATOM   6546  C  CZ    . ARG A  1  862  ? 236.464 288.320 222.033 1.00 0.00 ? 862  ARG A CZ    1 
ATOM   6547  N  NH1   . ARG A  1  862  ? 237.062 287.557 221.132 1.00 0.00 ? 862  ARG A NH1   1 
ATOM   6548  N  NH2   . ARG A  1  862  ? 236.508 287.973 223.319 1.00 0.00 ? 862  ARG A NH2   1 
ATOM   6549  N  N     . ARG A  1  863  ? 241.225 290.609 220.904 1.00 0.00 ? 863  ARG A N     1 
ATOM   6550  C  CA    . ARG A  1  863  ? 242.313 290.198 221.795 1.00 0.00 ? 863  ARG A CA    1 
ATOM   6551  C  C     . ARG A  1  863  ? 243.237 291.345 222.236 1.00 0.00 ? 863  ARG A C     1 
ATOM   6552  O  O     . ARG A  1  863  ? 243.734 291.378 223.353 1.00 0.00 ? 863  ARG A O     1 
ATOM   6553  C  CB    . ARG A  1  863  ? 243.134 289.145 221.081 1.00 0.00 ? 863  ARG A CB    1 
ATOM   6554  C  CG    . ARG A  1  863  ? 244.513 288.983 221.605 1.00 0.00 ? 863  ARG A CG    1 
ATOM   6555  C  CD    . ARG A  1  863  ? 245.246 288.030 220.715 1.00 0.00 ? 863  ARG A CD    1 
ATOM   6556  N  NE    . ARG A  1  863  ? 244.655 286.707 220.688 1.00 0.00 ? 863  ARG A NE    1 
ATOM   6557  C  CZ    . ARG A  1  863  ? 245.214 285.693 220.045 1.00 0.00 ? 863  ARG A CZ    1 
ATOM   6558  N  NH1   . ARG A  1  863  ? 246.336 285.903 219.370 1.00 0.00 ? 863  ARG A NH1   1 
ATOM   6559  N  NH2   . ARG A  1  863  ? 244.706 284.471 220.129 1.00 0.00 ? 863  ARG A NH2   1 
ATOM   6560  N  N     . LEU A  1  864  ? 243.546 292.213 221.286 1.00 0.00 ? 864  LEU A N     1 
ATOM   6561  C  CA    . LEU A  1  864  ? 244.376 293.396 221.473 1.00 0.00 ? 864  LEU A CA    1 
ATOM   6562  C  C     . LEU A  1  864  ? 243.780 294.449 222.449 1.00 0.00 ? 864  LEU A C     1 
ATOM   6563  O  O     . LEU A  1  864  ? 244.480 294.909 223.317 1.00 0.00 ? 864  LEU A O     1 
ATOM   6564  C  CB    . LEU A  1  864  ? 244.637 294.017 220.111 1.00 0.00 ? 864  LEU A CB    1 
ATOM   6565  C  CG    . LEU A  1  864  ? 246.100 294.307 219.839 1.00 0.00 ? 864  LEU A CG    1 
ATOM   6566  C  CD1   . LEU A  1  864  ? 246.209 294.929 218.485 1.00 0.00 ? 864  LEU A CD1   1 
ATOM   6567  C  CD2   . LEU A  1  864  ? 246.728 295.170 220.919 1.00 0.00 ? 864  LEU A CD2   1 
ATOM   6568  N  N     . ILE A  1  865  ? 242.508 294.834 222.264 1.00 0.00 ? 865  ILE A N     1 
ATOM   6569  C  CA    . ILE A  1  865  ? 241.725 295.760 223.114 1.00 0.00 ? 865  ILE A CA    1 
ATOM   6570  C  C     . ILE A  1  865  ? 241.638 295.196 224.480 1.00 0.00 ? 865  ILE A C     1 
ATOM   6571  O  O     . ILE A  1  865  ? 241.581 295.930 225.420 1.00 0.00 ? 865  ILE A O     1 
ATOM   6572  C  CB    . ILE A  1  865  ? 240.304 296.047 222.582 1.00 0.00 ? 865  ILE A CB    1 
ATOM   6573  C  CG1   . ILE A  1  865  ? 239.487 294.753 222.460 1.00 0.00 ? 865  ILE A CG1   1 
ATOM   6574  C  CG2   . ILE A  1  865  ? 240.355 296.789 221.221 1.00 0.00 ? 865  ILE A CG2   1 
ATOM   6575  C  CD1   . ILE A  1  865  ? 237.957 294.891 222.262 1.00 0.00 ? 865  ILE A CD1   1 
ATOM   6576  N  N     . LYS A  1  866  ? 241.353 293.918 224.562 1.00 0.00 ? 866  LYS A N     1 
ATOM   6577  C  CA    . LYS A  1  866  ? 241.244 293.220 225.817 1.00 0.00 ? 866  LYS A CA    1 
ATOM   6578  C  C     . LYS A  1  866  ? 242.507 293.290 226.687 1.00 0.00 ? 866  LYS A C     1 
ATOM   6579  O  O     . LYS A  1  866  ? 242.413 293.223 227.896 1.00 0.00 ? 866  LYS A O     1 
ATOM   6580  C  CB    . LYS A  1  866  ? 240.938 291.759 225.538 1.00 0.00 ? 866  LYS A CB    1 
ATOM   6581  C  CG    . LYS A  1  866  ? 240.628 290.966 226.757 1.00 0.00 ? 866  LYS A CG    1 
ATOM   6582  C  CD    . LYS A  1  866  ? 239.337 291.462 227.347 1.00 0.00 ? 866  LYS A CD    1 
ATOM   6583  C  CE    . LYS A  1  866  ? 239.320 291.227 228.844 1.00 0.00 ? 866  LYS A CE    1 
ATOM   6584  N  NZ    . LYS A  1  866  ? 238.471 292.244 229.573 1.00 0.00 ? 866  LYS A NZ    1 
ATOM   6585  N  N     . SER A  1  867  ? 243.690 293.389 226.090 1.00 0.00 ? 867  SER A N     1 
ATOM   6586  C  CA    . SER A  1  867  ? 244.920 293.625 226.867 1.00 0.00 ? 867  SER A CA    1 
ATOM   6587  C  C     . SER A  1  867  ? 245.120 294.998 227.475 1.00 0.00 ? 867  SER A C     1 
ATOM   6588  O  O     . SER A  1  867  ? 245.239 295.169 228.672 1.00 0.00 ? 867  SER A O     1 
ATOM   6589  C  CB    . SER A  1  867  ? 246.102 293.430 225.941 1.00 0.00 ? 867  SER A CB    1 
ATOM   6590  O  OG    . SER A  1  867  ? 246.091 292.130 225.402 1.00 0.00 ? 867  SER A OG    1 
ATOM   6591  N  N     . MET A  1  868  ? 245.084 295.970 226.580 1.00 0.00 ? 868  MET A N     1 
ATOM   6592  C  CA    . MET A  1  868  ? 245.403 297.378 226.799 1.00 0.00 ? 868  MET A CA    1 
ATOM   6593  C  C     . MET A  1  868  ? 244.305 298.178 227.459 1.00 0.00 ? 868  MET A C     1 
ATOM   6594  O  O     . MET A  1  868  ? 244.480 299.368 227.636 1.00 0.00 ? 868  MET A O     1 
ATOM   6595  C  CB    . MET A  1  868  ? 245.705 298.066 225.445 1.00 0.00 ? 868  MET A CB    1 
ATOM   6596  C  CG    . MET A  1  868  ? 246.881 297.504 224.607 1.00 0.00 ? 868  MET A CG    1 
ATOM   6597  S  SD    . MET A  1  868  ? 248.446 297.584 225.468 1.00 0.00 ? 868  MET A SD    1 
ATOM   6598  C  CE    . MET A  1  868  ? 248.565 299.353 225.596 1.00 0.00 ? 868  MET A CE    1 
ATOM   6599  N  N     . GLU A  1  869  ? 243.137 297.594 227.691 1.00 0.00 ? 869  GLU A N     1 
ATOM   6600  C  CA    . GLU A  1  869  ? 241.982 298.431 227.989 1.00 0.00 ? 869  GLU A CA    1 
ATOM   6601  C  C     . GLU A  1  869  ? 242.193 299.278 229.230 1.00 0.00 ? 869  GLU A C     1 
ATOM   6602  O  O     . GLU A  1  869  ? 241.847 300.458 229.224 1.00 0.00 ? 869  GLU A O     1 
ATOM   6603  C  CB    . GLU A  1  869  ? 240.707 297.593 228.125 1.00 0.00 ? 869  GLU A CB    1 
ATOM   6604  C  CG    . GLU A  1  869  ? 240.702 296.607 229.267 1.00 0.00 ? 869  GLU A CG    1 
ATOM   6605  C  CD    . GLU A  1  869  ? 239.446 295.736 229.289 1.00 0.00 ? 869  GLU A CD    1 
ATOM   6606  O  OE1   . GLU A  1  869  ? 238.474 296.054 228.544 1.00 0.00 ? 869  GLU A OE1   1 
ATOM   6607  O  OE2   . GLU A  1  869  ? 239.447 294.736 230.057 1.00 0.00 ? 869  GLU A OE2   1 
ATOM   6608  N  N     . SER A  1  870  ? 242.823 298.712 230.258 1.00 0.00 ? 870  SER A N     1 
ATOM   6609  C  CA    . SER A  1  870  ? 242.918 299.394 231.541 1.00 0.00 ? 870  SER A CA    1 
ATOM   6610  C  C     . SER A  1  870  ? 244.061 300.413 231.657 1.00 0.00 ? 870  SER A C     1 
ATOM   6611  O  O     . SER A  1  870  ? 244.133 301.099 232.672 1.00 0.00 ? 870  SER A O     1 
ATOM   6612  C  CB    . SER A  1  870  ? 243.026 298.357 232.674 1.00 0.00 ? 870  SER A CB    1 
ATOM   6613  O  OG    . SER A  1  870  ? 244.221 297.604 232.566 1.00 0.00 ? 870  SER A OG    1 
ATOM   6614  N  N     . VAL A  1  871  ? 244.901 300.559 230.624 1.00 0.00 ? 871  VAL A N     1 
ATOM   6615  C  CA    . VAL A  1  871  ? 245.998 301.544 230.610 1.00 0.00 ? 871  VAL A CA    1 
ATOM   6616  C  C     . VAL A  1  871  ? 245.390 302.903 230.432 1.00 0.00 ? 871  VAL A C     1 
ATOM   6617  O  O     . VAL A  1  871  ? 244.383 302.999 229.758 1.00 0.00 ? 871  VAL A O     1 
ATOM   6618  C  CB    . VAL A  1  871  ? 246.991 301.298 229.473 1.00 0.00 ? 871  VAL A CB    1 
ATOM   6619  C  CG1   . VAL A  1  871  ? 248.016 302.393 229.399 1.00 0.00 ? 871  VAL A CG1   1 
ATOM   6620  C  CG2   . VAL A  1  871  ? 247.618 299.924 229.599 1.00 0.00 ? 871  VAL A CG2   1 
ATOM   6621  N  N     . MET A  1  872  ? 245.922 303.939 231.070 1.00 0.00 ? 872  MET A N     1 
ATOM   6622  C  CA    . MET A  1  872  ? 245.329 305.278 230.970 1.00 0.00 ? 872  MET A CA    1 
ATOM   6623  C  C     . MET A  1  872  ? 246.197 306.369 231.569 1.00 0.00 ? 872  MET A C     1 
ATOM   6624  O  O     . MET A  1  872  ? 246.910 306.154 232.548 1.00 0.00 ? 872  MET A O     1 
ATOM   6625  C  CB    . MET A  1  872  ? 243.979 305.288 231.664 1.00 0.00 ? 872  MET A CB    1 
ATOM   6626  C  CG    . MET A  1  872  ? 244.058 304.817 233.135 1.00 0.00 ? 872  MET A CG    1 
ATOM   6627  S  SD    . MET A  1  872  ? 242.405 304.680 233.846 1.00 0.00 ? 872  MET A SD    1 
ATOM   6628  C  CE    . MET A  1  872  ? 241.821 306.376 233.601 1.00 0.00 ? 872  MET A CE    1 
ATOM   6629  N  N     . VAL A  1  873  ? 246.101 307.573 231.046 1.00 0.00 ? 873  VAL A N     1 
ATOM   6630  C  CA    . VAL A  1  873  ? 247.012 308.571 231.544 1.00 0.00 ? 873  VAL A CA    1 
ATOM   6631  C  C     . VAL A  1  873  ? 246.526 309.170 232.858 1.00 0.00 ? 873  VAL A C     1 
ATOM   6632  O  O     . VAL A  1  873  ? 245.419 309.672 232.935 1.00 0.00 ? 873  VAL A O     1 
ATOM   6633  C  CB    . VAL A  1  873  ? 247.230 309.622 230.482 1.00 0.00 ? 873  VAL A CB    1 
ATOM   6634  C  CG1   . VAL A  1  873  ? 246.005 309.787 229.644 1.00 0.00 ? 873  VAL A CG1   1 
ATOM   6635  C  CG2   . VAL A  1  873  ? 247.729 310.884 231.066 1.00 0.00 ? 873  VAL A CG2   1 
ATOM   6636  N  N     . LYS A  1  874  ? 247.331 309.098 233.915 1.00 0.00 ? 874  LYS A N     1 
ATOM   6637  C  CA    . LYS A  1  874  ? 246.873 309.590 235.223 1.00 0.00 ? 874  LYS A CA    1 
ATOM   6638  C  C     . LYS A  1  874  ? 247.104 311.068 235.373 1.00 0.00 ? 874  LYS A C     1 
ATOM   6639  O  O     . LYS A  1  874  ? 247.751 311.665 234.531 1.00 0.00 ? 874  LYS A O     1 
ATOM   6640  C  CB    . LYS A  1  874  ? 247.561 308.860 236.365 1.00 0.00 ? 874  LYS A CB    1 
ATOM   6641  C  CG    . LYS A  1  874  ? 247.230 307.408 236.359 1.00 0.00 ? 874  LYS A CG    1 
ATOM   6642  C  CD    . LYS A  1  874  ? 245.745 307.236 236.588 1.00 0.00 ? 874  LYS A CD    1 
ATOM   6643  C  CE    . LYS A  1  874  ? 245.409 305.775 236.648 1.00 0.00 ? 874  LYS A CE    1 
ATOM   6644  N  NZ    . LYS A  1  874  ? 243.983 305.539 236.915 1.00 0.00 ? 874  LYS A NZ    1 
ATOM   6645  N  N     . TYR A  1  875  ? 246.597 311.664 236.448 1.00 0.00 ? 875  TYR A N     1 
ATOM   6646  C  CA    . TYR A  1  875  ? 246.692 313.121 236.605 1.00 0.00 ? 875  TYR A CA    1 
ATOM   6647  C  C     . TYR A  1  875  ? 248.104 313.682 236.912 1.00 0.00 ? 875  TYR A C     1 
ATOM   6648  O  O     . TYR A  1  875  ? 248.322 314.888 236.803 1.00 0.00 ? 875  TYR A O     1 
ATOM   6649  C  CB    . TYR A  1  875  ? 245.715 313.590 237.680 1.00 0.00 ? 875  TYR A CB    1 
ATOM   6650  C  CG    . TYR A  1  875  ? 244.321 313.828 237.181 1.00 0.00 ? 875  TYR A CG    1 
ATOM   6651  C  CD1   . TYR A  1  875  ? 244.018 314.936 236.465 1.00 0.00 ? 875  TYR A CD1   1 
ATOM   6652  C  CD2   . TYR A  1  875  ? 243.313 312.928 237.443 1.00 0.00 ? 875  TYR A CD2   1 
ATOM   6653  C  CE1   . TYR A  1  875  ? 242.753 315.146 236.025 1.00 0.00 ? 875  TYR A CE1   1 
ATOM   6654  C  CE2   . TYR A  1  875  ? 242.036 313.136 237.012 1.00 0.00 ? 875  TYR A CE2   1 
ATOM   6655  C  CZ    . TYR A  1  875  ? 241.760 314.250 236.292 1.00 0.00 ? 875  TYR A CZ    1 
ATOM   6656  O  OH    . TYR A  1  875  ? 240.495 314.512 235.816 1.00 0.00 ? 875  TYR A OH    1 
ATOM   6657  N  N     . ASP A  1  876  ? 249.066 312.835 237.260 1.00 0.00 ? 876  ASP A N     1 
ATOM   6658  C  CA    . ASP A  1  876  ? 250.462 313.279 237.237 1.00 0.00 ? 876  ASP A CA    1 
ATOM   6659  C  C     . ASP A  1  876  ? 251.091 312.939 235.878 1.00 0.00 ? 876  ASP A C     1 
ATOM   6660  O  O     . ASP A  1  876  ? 252.314 313.008 235.725 1.00 0.00 ? 876  ASP A O     1 
ATOM   6661  C  CB    . ASP A  1  876  ? 251.298 312.643 238.360 1.00 0.00 ? 876  ASP A CB    1 
ATOM   6662  C  CG    . ASP A  1  876  ? 251.606 311.138 238.098 1.00 0.00 ? 876  ASP A CG    1 
ATOM   6663  O  OD1   . ASP A  1  876  ? 250.800 310.522 237.323 1.00 0.00 ? 876  ASP A OD1   1 
ATOM   6664  O  OD2   . ASP A  1  876  ? 252.643 310.607 238.644 1.00 0.00 ? 876  ASP A OD2   1 
ATOM   6665  N  N     . ALA A  1  877  ? 250.268 312.455 234.951 1.00 0.00 ? 877  ALA A N     1 
ATOM   6666  C  CA    . ALA A  1  877  ? 250.654 312.305 233.544 1.00 0.00 ? 877  ALA A CA    1 
ATOM   6667  C  C     . ALA A  1  877  ? 251.673 311.239 233.266 1.00 0.00 ? 877  ALA A C     1 
ATOM   6668  O  O     . ALA A  1  877  ? 252.400 311.320 232.282 1.00 0.00 ? 877  ALA A O     1 
ATOM   6669  C  CB    . ALA A  1  877  ? 251.160 313.634 232.995 1.00 0.00 ? 877  ALA A CB    1 
ATOM   6670  N  N     . THR A  1  878  ? 251.757 310.267 234.151 1.00 0.00 ? 878  THR A N     1 
ATOM   6671  C  CA    . THR A  1  878  ? 252.505 309.063 233.856 1.00 0.00 ? 878  THR A CA    1 
ATOM   6672  C  C     . THR A  1  878  ? 251.460 308.051 233.409 1.00 0.00 ? 878  THR A C     1 
ATOM   6673  O  O     . THR A  1  878  ? 250.346 308.062 233.915 1.00 0.00 ? 878  THR A O     1 
ATOM   6674  C  CB    . THR A  1  878  ? 253.316 308.605 235.077 1.00 0.00 ? 878  THR A CB    1 
ATOM   6675  O  OG1   . THR A  1  878  ? 252.496 307.832 235.965 1.00 0.00 ? 878  THR A OG1   1 
ATOM   6676  C  CG2   . THR A  1  878  ? 253.892 309.840 235.820 1.00 0.00 ? 878  THR A CG2   1 
ATOM   6677  N  N     . VAL A  1  879  ? 251.759 307.195 232.452 1.00 0.00 ? 879  VAL A N     1 
ATOM   6678  C  CA    . VAL A  1  879  ? 250.699 306.334 231.966 1.00 0.00 ? 879  VAL A CA    1 
ATOM   6679  C  C     . VAL A  1  879  ? 250.726 304.981 232.711 1.00 0.00 ? 879  VAL A C     1 
ATOM   6680  O  O     . VAL A  1  879  ? 251.713 304.262 232.636 1.00 0.00 ? 879  VAL A O     1 
ATOM   6681  C  CB    . VAL A  1  879  ? 250.842 306.132 230.466 1.00 0.00 ? 879  VAL A CB    1 
ATOM   6682  C  CG1   . VAL A  1  879  ? 249.680 305.380 229.931 1.00 0.00 ? 879  VAL A CG1   1 
ATOM   6683  C  CG2   . VAL A  1  879  ? 250.925 307.439 229.793 1.00 0.00 ? 879  VAL A CG2   1 
ATOM   6684  N  N     . ARG A  1  880  ? 249.666 304.623 233.440 1.00 0.00 ? 880  ARG A N     1 
ATOM   6685  C  CA    . ARG A  1  880  ? 249.697 303.397 234.242 1.00 0.00 ? 880  ARG A CA    1 
ATOM   6686  C  C     . ARG A  1  880  ? 248.484 302.521 234.090 1.00 0.00 ? 880  ARG A C     1 
ATOM   6687  O  O     . ARG A  1  880  ? 247.374 303.028 234.015 1.00 0.00 ? 880  ARG A O     1 
ATOM   6688  C  CB    . ARG A  1  880  ? 249.806 303.722 235.721 1.00 0.00 ? 880  ARG A CB    1 
ATOM   6689  C  CG    . ARG A  1  880  ? 250.902 304.625 236.119 1.00 0.00 ? 880  ARG A CG    1 
ATOM   6690  C  CD    . ARG A  1  880  ? 250.492 305.269 237.388 1.00 0.00 ? 880  ARG A CD    1 
ATOM   6691  N  NE    . ARG A  1  880  ? 251.369 306.372 237.704 1.00 0.00 ? 880  ARG A NE    1 
ATOM   6692  C  CZ    . ARG A  1  880  ? 252.064 306.454 238.824 1.00 0.00 ? 880  ARG A CZ    1 
ATOM   6693  N  NH1   . ARG A  1  880  ? 251.958 305.486 239.730 1.00 0.00 ? 880  ARG A NH1   1 
ATOM   6694  N  NH2   . ARG A  1  880  ? 252.840 307.508 239.038 1.00 0.00 ? 880  ARG A NH2   1 
ATOM   6695  N  N     . ASN A  1  881  ? 248.677 301.209 234.184 1.00 0.00 ? 881  ASN A N     1 
ATOM   6696  C  CA    . ASN A  1  881  ? 247.565 300.270 234.113 1.00 0.00 ? 881  ASN A CA    1 
ATOM   6697  C  C     . ASN A  1  881  ? 246.767 300.085 235.397 1.00 0.00 ? 881  ASN A C     1 
ATOM   6698  O  O     . ASN A  1  881  ? 246.802 300.916 236.297 1.00 0.00 ? 881  ASN A O     1 
ATOM   6699  C  CB    . ASN A  1  881  ? 248.048 298.900 233.665 1.00 0.00 ? 881  ASN A CB    1 
ATOM   6700  C  CG    . ASN A  1  881  ? 248.947 298.245 234.672 1.00 0.00 ? 881  ASN A CG    1 
ATOM   6701  O  OD1   . ASN A  1  881  ? 248.977 298.600 235.854 1.00 0.00 ? 881  ASN A OD1   1 
ATOM   6702  N  ND2   . ASN A  1  881  ? 249.703 297.264 234.208 1.00 0.00 ? 881  ASN A ND2   1 
ATOM   6703  N  N     . SER A  1  882  ? 246.038 298.978 235.462 1.00 0.00 ? 882  SER A N     1 
ATOM   6704  C  CA    . SER A  1  882  ? 245.109 298.726 236.561 1.00 0.00 ? 882  SER A CA    1 
ATOM   6705  C  C     . SER A  1  882  ? 245.736 298.544 237.966 1.00 0.00 ? 882  SER A C     1 
ATOM   6706  O  O     . SER A  1  882  ? 245.215 299.038 238.970 1.00 0.00 ? 882  SER A O     1 
ATOM   6707  C  CB    . SER A  1  882  ? 244.271 297.477 236.231 1.00 0.00 ? 882  SER A CB    1 
ATOM   6708  O  OG    . SER A  1  882  ? 245.092 296.313 236.071 1.00 0.00 ? 882  SER A OG    1 
ATOM   6709  N  N     . ILE A  1  883  ? 246.835 297.815 238.047 1.00 0.00 ? 883  ILE A N     1 
ATOM   6710  C  CA    . ILE A  1  883  ? 247.462 297.588 239.339 1.00 0.00 ? 883  ILE A CA    1 
ATOM   6711  C  C     . ILE A  1  883  ? 248.419 298.733 239.672 1.00 0.00 ? 883  ILE A C     1 
ATOM   6712  O  O     . ILE A  1  883  ? 249.200 298.679 240.623 1.00 0.00 ? 883  ILE A O     1 
ATOM   6713  C  CB    . ILE A  1  883  ? 248.152 296.240 239.329 1.00 0.00 ? 883  ILE A CB    1 
ATOM   6714  C  CG1   . ILE A  1  883  ? 249.332 296.239 238.350 1.00 0.00 ? 883  ILE A CG1   1 
ATOM   6715  C  CG2   . ILE A  1  883  ? 247.115 295.177 238.938 1.00 0.00 ? 883  ILE A CG2   1 
ATOM   6716  C  CD1   . ILE A  1  883  ? 250.067 294.903 238.277 1.00 0.00 ? 883  ILE A CD1   1 
ATOM   6717  N  N     . ASN A  1  884  ? 248.281 299.786 238.882 1.00 0.00 ? 884  ASN A N     1 
ATOM   6718  C  CA    . ASN A  1  884  ? 248.987 301.046 239.037 1.00 0.00 ? 884  ASN A CA    1 
ATOM   6719  C  C     . ASN A  1  884  ? 250.489 301.042 238.742 1.00 0.00 ? 884  ASN A C     1 
ATOM   6720  O  O     . ASN A  1  884  ? 251.231 301.918 239.199 1.00 0.00 ? 884  ASN A O     1 
ATOM   6721  C  CB    . ASN A  1  884  ? 248.766 301.602 240.427 1.00 0.00 ? 884  ASN A CB    1 
ATOM   6722  C  CG    . ASN A  1  884  ? 248.852 303.085 240.429 1.00 0.00 ? 884  ASN A CG    1 
ATOM   6723  O  OD1   . ASN A  1  884  ? 248.772 303.709 239.370 1.00 0.00 ? 884  ASN A OD1   1 
ATOM   6724  N  ND2   . ASN A  1  884  ? 249.056 303.672 241.594 1.00 0.00 ? 884  ASN A ND2   1 
ATOM   6725  N  N     . GLN A  1  885  ? 250.925 300.084 237.936 1.00 0.00 ? 885  GLN A N     1 
ATOM   6726  C  CA    . GLN A  1  885  ? 252.289 300.054 237.451 1.00 0.00 ? 885  GLN A CA    1 
ATOM   6727  C  C     . GLN A  1  885  ? 252.513 301.093 236.388 1.00 0.00 ? 885  GLN A C     1 
ATOM   6728  O  O     . GLN A  1  885  ? 251.607 301.352 235.632 1.00 0.00 ? 885  GLN A O     1 
ATOM   6729  C  CB    . GLN A  1  885  ? 252.577 298.686 236.911 1.00 0.00 ? 885  GLN A CB    1 
ATOM   6730  C  CG    . GLN A  1  885  ? 252.527 297.691 238.026 1.00 0.00 ? 885  GLN A CG    1 
ATOM   6731  C  CD    . GLN A  1  885  ? 252.969 296.317 237.597 1.00 0.00 ? 885  GLN A CD    1 
ATOM   6732  O  OE1   . GLN A  1  885  ? 253.526 295.546 238.407 1.00 0.00 ? 885  GLN A OE1   1 
ATOM   6733  N  NE2   . GLN A  1  885  ? 252.736 295.990 236.307 1.00 0.00 ? 885  GLN A NE2   1 
ATOM   6734  N  N     . VAL A  1  886  ? 253.692 301.708 236.324 1.00 0.00 ? 886  VAL A N     1 
ATOM   6735  C  CA    . VAL A  1  886  ? 253.940 302.702 235.274 1.00 0.00 ? 886  VAL A CA    1 
ATOM   6736  C  C     . VAL A  1  886  ? 254.323 302.060 233.952 1.00 0.00 ? 886  VAL A C     1 
ATOM   6737  O  O     . VAL A  1  886  ? 255.191 301.191 233.890 1.00 0.00 ? 886  VAL A O     1 
ATOM   6738  C  CB    . VAL A  1  886  ? 255.024 303.712 235.627 1.00 0.00 ? 886  VAL A CB    1 
ATOM   6739  C  CG1   . VAL A  1  886  ? 255.069 304.762 234.555 1.00 0.00 ? 886  VAL A CG1   1 
ATOM   6740  C  CG2   . VAL A  1  886  ? 254.738 304.367 236.956 1.00 0.00 ? 886  VAL A CG2   1 
ATOM   6741  N  N     . VAL A  1  887  ? 253.612 302.476 232.906 1.00 0.00 ? 887  VAL A N     1 
ATOM   6742  C  CA    . VAL A  1  887  ? 253.877 302.111 231.514 1.00 0.00 ? 887  VAL A CA    1 
ATOM   6743  C  C     . VAL A  1  887  ? 254.911 303.062 230.863 1.00 0.00 ? 887  VAL A C     1 
ATOM   6744  O  O     . VAL A  1  887  ? 255.924 302.646 230.295 1.00 0.00 ? 887  VAL A O     1 
ATOM   6745  C  CB    . VAL A  1  887  ? 252.543 302.105 230.708 1.00 0.00 ? 887  VAL A CB    1 
ATOM   6746  C  CG1   . VAL A  1  887  ? 252.740 301.613 229.282 1.00 0.00 ? 887  VAL A CG1   1 
ATOM   6747  C  CG2   . VAL A  1  887  ? 251.495 301.295 231.440 1.00 0.00 ? 887  VAL A CG2   1 
ATOM   6748  N  N     . GLN A  1  888  ? 254.639 304.353 230.956 1.00 0.00 ? 888  GLN A N     1 
ATOM   6749  C  CA    . GLN A  1  888  ? 255.520 305.375 230.419 1.00 0.00 ? 888  GLN A CA    1 
ATOM   6750  C  C     . GLN A  1  888  ? 255.613 306.510 231.447 1.00 0.00 ? 888  GLN A C     1 
ATOM   6751  O  O     . GLN A  1  888  ? 254.685 306.702 232.225 1.00 0.00 ? 888  GLN A O     1 
ATOM   6752  C  CB    . GLN A  1  888  ? 254.986 305.864 229.070 1.00 0.00 ? 888  GLN A CB    1 
ATOM   6753  C  CG    . GLN A  1  888  ? 254.789 304.782 228.007 1.00 0.00 ? 888  GLN A CG    1 
ATOM   6754  C  CD    . GLN A  1  888  ? 254.347 305.357 226.667 1.00 0.00 ? 888  GLN A CD    1 
ATOM   6755  O  OE1   . GLN A  1  888  ? 253.364 306.077 226.579 1.00 0.00 ? 888  GLN A OE1   1 
ATOM   6756  N  NE2   . GLN A  1  888  ? 255.092 305.064 225.625 1.00 0.00 ? 888  GLN A NE2   1 
ATOM   6757  N  N     . LEU A  1  889  ? 256.722 307.230 231.504 1.00 0.00 ? 889  LEU A N     1 
ATOM   6758  C  CA    . LEU A  1  889  ? 256.758 308.393 232.379 1.00 0.00 ? 889  LEU A CA    1 
ATOM   6759  C  C     . LEU A  1  889  ? 256.017 309.554 231.795 1.00 0.00 ? 889  LEU A C     1 
ATOM   6760  O  O     . LEU A  1  889  ? 255.601 310.445 232.521 1.00 0.00 ? 889  LEU A O     1 
ATOM   6761  C  CB    . LEU A  1  889  ? 258.165 308.838 232.674 1.00 0.00 ? 889  LEU A CB    1 
ATOM   6762  C  CG    . LEU A  1  889  ? 258.780 308.181 233.883 1.00 0.00 ? 889  LEU A CG    1 
ATOM   6763  C  CD1   . LEU A  1  889  ? 258.756 306.664 233.761 1.00 0.00 ? 889  LEU A CD1   1 
ATOM   6764  C  CD2   . LEU A  1  889  ? 260.201 308.693 233.929 1.00 0.00 ? 889  LEU A CD2   1 
ATOM   6765  N  N     . ARG A  1  890  ? 255.903 309.592 230.479 1.00 0.00 ? 890  ARG A N     1 
ATOM   6766  C  CA    . ARG A  1  890  ? 255.121 310.641 229.847 1.00 0.00 ? 890  ARG A CA    1 
ATOM   6767  C  C     . ARG A  1  890  ? 254.531 309.961 228.713 1.00 0.00 ? 890  ARG A C     1 
ATOM   6768  O  O     . ARG A  1  890  ? 255.201 309.129 228.110 1.00 0.00 ? 890  ARG A O     1 
ATOM   6769  C  CB    . ARG A  1  890  ? 255.925 311.840 229.334 1.00 0.00 ? 890  ARG A CB    1 
ATOM   6770  C  CG    . ARG A  1  890  ? 256.348 312.874 230.335 1.00 0.00 ? 890  ARG A CG    1 
ATOM   6771  C  CD    . ARG A  1  890  ? 255.270 313.307 231.246 1.00 0.00 ? 890  ARG A CD    1 
ATOM   6772  N  NE    . ARG A  1  890  ? 255.973 313.927 232.355 1.00 0.00 ? 890  ARG A NE    1 
ATOM   6773  C  CZ    . ARG A  1  890  ? 255.538 313.955 233.608 1.00 0.00 ? 890  ARG A CZ    1 
ATOM   6774  N  NH1   . ARG A  1  890  ? 254.382 313.375 233.902 1.00 0.00 ? 890  ARG A NH1   1 
ATOM   6775  N  NH2   . ARG A  1  890  ? 256.256 314.545 234.568 1.00 0.00 ? 890  ARG A NH2   1 
ATOM   6776  N  N     . TYR A  1  891  ? 253.285 310.296 228.416 1.00 0.00 ? 891  TYR A N     1 
ATOM   6777  C  CA    . TYR A  1  891  ? 252.594 309.615 227.352 1.00 0.00 ? 891  TYR A CA    1 
ATOM   6778  C  C     . TYR A  1  891  ? 253.136 309.899 225.960 1.00 0.00 ? 891  TYR A C     1 
ATOM   6779  O  O     . TYR A  1  891  ? 253.095 311.017 225.463 1.00 0.00 ? 891  TYR A O     1 
ATOM   6780  C  CB    . TYR A  1  891  ? 251.143 309.957 227.369 1.00 0.00 ? 891  TYR A CB    1 
ATOM   6781  C  CG    . TYR A  1  891  ? 250.453 309.374 226.195 1.00 0.00 ? 891  TYR A CG    1 
ATOM   6782  C  CD1   . TYR A  1  891  ? 250.431 308.012 225.978 1.00 0.00 ? 891  TYR A CD1   1 
ATOM   6783  C  CD2   . TYR A  1  891  ? 249.810 310.209 225.297 1.00 0.00 ? 891  TYR A CD2   1 
ATOM   6784  C  CE1   . TYR A  1  891  ? 249.776 307.515 224.888 1.00 0.00 ? 891  TYR A CE1   1 
ATOM   6785  C  CE2   . TYR A  1  891  ? 249.143 309.742 224.218 1.00 0.00 ? 891  TYR A CE2   1 
ATOM   6786  C  CZ    . TYR A  1  891  ? 249.114 308.389 223.993 1.00 0.00 ? 891  TYR A CZ    1 
ATOM   6787  O  OH    . TYR A  1  891  ? 248.423 307.945 222.864 1.00 0.00 ? 891  TYR A OH    1 
ATOM   6788  N  N     . GLY A  1  892  ? 253.609 308.836 225.334 1.00 0.00 ? 892  GLY A N     1 
ATOM   6789  C  CA    . GLY A  1  892  ? 254.140 308.868 223.998 1.00 0.00 ? 892  GLY A CA    1 
ATOM   6790  C  C     . GLY A  1  892  ? 255.477 309.503 223.983 1.00 0.00 ? 892  GLY A C     1 
ATOM   6791  O  O     . GLY A  1  892  ? 255.921 309.849 222.908 1.00 0.00 ? 892  GLY A O     1 
ATOM   6792  N  N     . GLU A  1  893  ? 256.085 309.604 225.169 1.00 0.00 ? 893  GLU A N     1 
ATOM   6793  C  CA    . GLU A  1  893  ? 257.401 310.199 225.426 1.00 0.00 ? 893  GLU A CA    1 
ATOM   6794  C  C     . GLU A  1  893  ? 257.536 311.728 225.239 1.00 0.00 ? 893  GLU A C     1 
ATOM   6795  O  O     . GLU A  1  893  ? 258.623 312.236 224.988 1.00 0.00 ? 893  GLU A O     1 
ATOM   6796  C  CB    . GLU A  1  893  ? 258.441 309.506 224.562 1.00 0.00 ? 893  GLU A CB    1 
ATOM   6797  C  CG    . GLU A  1  893  ? 258.612 308.062 224.870 1.00 0.00 ? 893  GLU A CG    1 
ATOM   6798  C  CD    . GLU A  1  893  ? 259.307 307.316 223.731 1.00 0.00 ? 893  GLU A CD    1 
ATOM   6799  O  OE1   . GLU A  1  893  ? 259.465 307.930 222.634 1.00 0.00 ? 893  GLU A OE1   1 
ATOM   6800  O  OE2   . GLU A  1  893  ? 259.675 306.123 223.937 1.00 0.00 ? 893  GLU A OE2   1 
ATOM   6801  N  N     . ASP A  1  894  ? 256.455 312.471 225.397 1.00 0.00 ? 894  ASP A N     1 
ATOM   6802  C  CA    . ASP A  1  894  ? 256.520 313.898 225.183 1.00 0.00 ? 894  ASP A CA    1 
ATOM   6803  C  C     . ASP A  1  894  ? 255.271 314.507 225.759 1.00 0.00 ? 894  ASP A C     1 
ATOM   6804  O  O     . ASP A  1  894  ? 255.175 315.710 225.940 1.00 0.00 ? 894  ASP A O     1 
ATOM   6805  C  CB    . ASP A  1  894  ? 256.622 314.210 223.694 1.00 0.00 ? 894  ASP A CB    1 
ATOM   6806  C  CG    . ASP A  1  894  ? 255.357 313.790 222.913 1.00 0.00 ? 894  ASP A CG    1 
ATOM   6807  O  OD1   . ASP A  1  894  ? 254.278 313.555 223.534 1.00 0.00 ? 894  ASP A OD1   1 
ATOM   6808  O  OD2   . ASP A  1  894  ? 255.446 313.711 221.652 1.00 0.00 ? 894  ASP A OD2   1 
ATOM   6809  N  N     . GLY A  1  895  ? 254.263 313.668 225.936 1.00 0.00 ? 895  GLY A N     1 
ATOM   6810  C  CA    . GLY A  1  895  ? 253.041 314.104 226.574 1.00 0.00 ? 895  GLY A CA    1 
ATOM   6811  C  C     . GLY A  1  895  ? 252.178 314.946 225.668 1.00 0.00 ? 895  GLY A C     1 
ATOM   6812  O  O     . GLY A  1  895  ? 251.450 315.811 226.163 1.00 0.00 ? 895  GLY A O     1 
ATOM   6813  N  N     . LEU A  1  896  ? 252.293 314.746 224.353 1.00 0.00 ? 896  LEU A N     1 
ATOM   6814  C  CA    . LEU A  1  896  ? 251.428 315.446 223.410 1.00 0.00 ? 896  LEU A CA    1 
ATOM   6815  C  C     . LEU A  1  896  ? 250.216 314.607 222.992 1.00 0.00 ? 896  LEU A C     1 
ATOM   6816  O  O     . LEU A  1  896  ? 250.180 313.402 223.181 1.00 0.00 ? 896  LEU A O     1 
ATOM   6817  C  CB    . LEU A  1  896  ? 252.217 315.876 222.182 1.00 0.00 ? 896  LEU A CB    1 
ATOM   6818  C  CG    . LEU A  1  896  ? 253.416 316.730 222.570 1.00 0.00 ? 896  LEU A CG    1 
ATOM   6819  C  CD1   . LEU A  1  896  ? 254.168 317.119 221.325 1.00 0.00 ? 896  LEU A CD1   1 
ATOM   6820  C  CD2   . LEU A  1  896  ? 252.989 317.953 223.347 1.00 0.00 ? 896  LEU A CD2   1 
ATOM   6821  N  N     . ALA A  1  897  ? 249.201 315.271 222.460 1.00 0.00 ? 897  ALA A N     1 
ATOM   6822  C  CA    . ALA A  1  897  ? 248.038 314.603 221.873 1.00 0.00 ? 897  ALA A CA    1 
ATOM   6823  C  C     . ALA A  1  897  ? 248.261 314.182 220.410 1.00 0.00 ? 897  ALA A C     1 
ATOM   6824  O  O     . ALA A  1  897  ? 248.836 314.933 219.609 1.00 0.00 ? 897  ALA A O     1 
ATOM   6825  C  CB    . ALA A  1  897  ? 246.804 315.516 221.969 1.00 0.00 ? 897  ALA A CB    1 
ATOM   6826  N  N     . GLY A  1  898  ? 247.807 312.982 220.062 1.00 0.00 ? 898  GLY A N     1 
ATOM   6827  C  CA    . GLY A  1  898  ? 247.868 312.523 218.679 1.00 0.00 ? 898  GLY A CA    1 
ATOM   6828  C  C     . GLY A  1  898  ? 247.029 313.213 217.600 1.00 0.00 ? 898  GLY A C     1 
ATOM   6829  O  O     . GLY A  1  898  ? 247.260 313.019 216.402 1.00 0.00 ? 898  GLY A O     1 
ATOM   6830  N  N     . GLU A  1  899  ? 246.037 313.999 217.981 1.00 0.00 ? 899  GLU A N     1 
ATOM   6831  C  CA    . GLU A  1  899  ? 245.227 314.605 216.941 1.00 0.00 ? 899  GLU A CA    1 
ATOM   6832  C  C     . GLU A  1  899  ? 245.675 316.024 216.626 1.00 0.00 ? 899  GLU A C     1 
ATOM   6833  O  O     . GLU A  1  899  ? 245.181 316.671 215.686 1.00 0.00 ? 899  GLU A O     1 
ATOM   6834  C  CB    . GLU A  1  899  ? 243.765 314.560 217.355 1.00 0.00 ? 899  GLU A CB    1 
ATOM   6835  C  CG    . GLU A  1  899  ? 243.485 315.097 218.757 1.00 0.00 ? 899  GLU A CG    1 
ATOM   6836  C  CD    . GLU A  1  899  ? 241.967 315.233 219.078 1.00 0.00 ? 899  GLU A CD    1 
ATOM   6837  O  OE1   . GLU A  1  899  ? 241.129 315.399 218.126 1.00 0.00 ? 899  GLU A OE1   1 
ATOM   6838  O  OE2   . GLU A  1  899  ? 241.641 315.171 220.304 1.00 0.00 ? 899  GLU A OE2   1 
ATOM   6839  N  N     . SER A  1  900  ? 246.655 316.481 217.398 1.00 0.00 ? 900  SER A N     1 
ATOM   6840  C  CA    . SER A  1  900  ? 247.145 317.842 217.266 1.00 0.00 ? 900  SER A CA    1 
ATOM   6841  C  C     . SER A  1  900  ? 248.552 317.928 216.713 1.00 0.00 ? 900  SER A C     1 
ATOM   6842  O  O     . SER A  1  900  ? 249.144 319.011 216.677 1.00 0.00 ? 900  SER A O     1 
ATOM   6843  C  CB    . SER A  1  900  ? 247.064 318.572 218.618 1.00 0.00 ? 900  SER A CB    1 
ATOM   6844  O  OG    . SER A  1  900  ? 245.710 318.743 219.020 1.00 0.00 ? 900  SER A OG    1 
ATOM   6845  N  N     . VAL A  1  901  ? 249.075 316.804 216.245 1.00 0.00 ? 901  VAL A N     1 
ATOM   6846  C  CA    . VAL A  1  901  ? 250.417 316.777 215.706 1.00 0.00 ? 901  VAL A CA    1 
ATOM   6847  C  C     . VAL A  1  901  ? 250.318 316.997 214.195 1.00 0.00 ? 901  VAL A C     1 
ATOM   6848  O  O     . VAL A  1  901  ? 249.255 316.901 213.620 1.00 0.00 ? 901  VAL A O     1 
ATOM   6849  C  CB    . VAL A  1  901  ? 251.133 315.488 216.025 1.00 0.00 ? 901  VAL A CB    1 
ATOM   6850  C  CG1   . VAL A  1  901  ? 251.065 315.266 217.545 1.00 0.00 ? 901  VAL A CG1   1 
ATOM   6851  C  CG2   . VAL A  1  901  ? 250.454 314.335 215.356 1.00 0.00 ? 901  VAL A CG2   1 
ATOM   6852  N  N     . GLU A  1  902  ? 251.437 317.364 213.581 1.00 0.00 ? 902  GLU A N     1 
ATOM   6853  C  CA    . GLU A  1  902  ? 251.593 317.538 212.132 1.00 0.00 ? 902  GLU A CA    1 
ATOM   6854  C  C     . GLU A  1  902  ? 252.974 317.175 211.572 1.00 0.00 ? 902  GLU A C     1 
ATOM   6855  O  O     . GLU A  1  902  ? 253.954 317.193 212.289 1.00 0.00 ? 902  GLU A O     1 
ATOM   6856  C  CB    . GLU A  1  902  ? 251.237 318.977 211.755 1.00 0.00 ? 902  GLU A CB    1 
ATOM   6857  C  CG    . GLU A  1  902  ? 249.769 319.249 211.530 1.00 0.00 ? 902  GLU A CG    1 
ATOM   6858  C  CD    . GLU A  1  902  ? 249.533 320.522 210.658 1.00 0.00 ? 902  GLU A CD    1 
ATOM   6859  O  OE1   . GLU A  1  902  ? 249.734 320.500 209.418 1.00 0.00 ? 902  GLU A OE1   1 
ATOM   6860  O  OE2   . GLU A  1  902  ? 248.935 321.500 211.181 1.00 0.00 ? 902  GLU A OE2   1 
ATOM   6861  N  N     . PHE A  1  903  ? 253.043 316.836 210.289 1.00 0.00 ? 903  PHE A N     1 
ATOM   6862  C  CA    . PHE A  1  903  ? 254.340 316.545 209.691 1.00 0.00 ? 903  PHE A CA    1 
ATOM   6863  C  C     . PHE A  1  903  ? 255.153 317.792 209.467 1.00 0.00 ? 903  PHE A C     1 
ATOM   6864  O  O     . PHE A  1  903  ? 254.650 318.750 208.911 1.00 0.00 ? 903  PHE A O     1 
ATOM   6865  C  CB    . PHE A  1  903  ? 254.142 315.850 208.363 1.00 0.00 ? 903  PHE A CB    1 
ATOM   6866  C  CG    . PHE A  1  903  ? 253.553 314.492 208.480 1.00 0.00 ? 903  PHE A CG    1 
ATOM   6867  C  CD1   . PHE A  1  903  ? 253.690 313.753 209.652 1.00 0.00 ? 903  PHE A CD1   1 
ATOM   6868  C  CD2   . PHE A  1  903  ? 252.872 313.945 207.413 1.00 0.00 ? 903  PHE A CD2   1 
ATOM   6869  C  CE1   . PHE A  1  903  ? 253.152 312.488 209.749 1.00 0.00 ? 903  PHE A CE1   1 
ATOM   6870  C  CE2   . PHE A  1  903  ? 252.329 312.688 207.495 1.00 0.00 ? 903  PHE A CE2   1 
ATOM   6871  C  CZ    . PHE A  1  903  ? 252.464 311.951 208.668 1.00 0.00 ? 903  PHE A CZ    1 
ATOM   6872  N  N     . GLN A  1  904  ? 256.413 317.770 209.867 1.00 0.00 ? 904  GLN A N     1 
ATOM   6873  C  CA    . GLN A  1  904  ? 257.257 318.949 209.762 1.00 0.00 ? 904  GLN A CA    1 
ATOM   6874  C  C     . GLN A  1  904  ? 258.660 318.669 209.311 1.00 0.00 ? 904  GLN A C     1 
ATOM   6875  O  O     . GLN A  1  904  ? 259.206 317.599 209.548 1.00 0.00 ? 904  GLN A O     1 
ATOM   6876  C  CB    . GLN A  1  904  ? 257.321 319.662 211.091 1.00 0.00 ? 904  GLN A CB    1 
ATOM   6877  C  CG    . GLN A  1  904  ? 256.029 320.271 211.466 1.00 0.00 ? 904  GLN A CG    1 
ATOM   6878  C  CD    . GLN A  1  904  ? 256.159 321.019 212.745 1.00 0.00 ? 904  GLN A CD    1 
ATOM   6879  O  OE1   . GLN A  1  904  ? 256.877 322.022 212.810 1.00 0.00 ? 904  GLN A OE1   1 
ATOM   6880  N  NE2   . GLN A  1  904  ? 255.432 320.573 213.775 1.00 0.00 ? 904  GLN A NE2   1 
ATOM   6881  N  N     . ASN A  1  905  ? 259.282 319.683 208.740 1.00 0.00 ? 905  ASN A N     1 
ATOM   6882  C  CA    . ASN A  1  905  ? 260.581 319.461 208.172 1.00 0.00 ? 905  ASN A CA    1 
ATOM   6883  C  C     . ASN A  1  905  ? 261.618 320.025 209.122 1.00 0.00 ? 905  ASN A C     1 
ATOM   6884  O  O     . ASN A  1  905  ? 261.414 321.082 209.700 1.00 0.00 ? 905  ASN A O     1 
ATOM   6885  C  CB    . ASN A  1  905  ? 260.663 320.109 206.783 1.00 0.00 ? 905  ASN A CB    1 
ATOM   6886  C  CG    . ASN A  1  905  ? 261.964 319.789 206.060 1.00 0.00 ? 905  ASN A CG    1 
ATOM   6887  O  OD1   . ASN A  1  905  ? 262.087 318.723 205.449 1.00 0.00 ? 905  ASN A OD1   1 
ATOM   6888  N  ND2   . ASN A  1  905  ? 262.937 320.711 206.114 1.00 0.00 ? 905  ASN A ND2   1 
ATOM   6889  N  N     . LEU A  1  906  ? 262.713 319.308 209.327 1.00 0.00 ? 906  LEU A N     1 
ATOM   6890  C  CA    . LEU A  1  906  ? 263.749 319.771 210.237 1.00 0.00 ? 906  LEU A CA    1 
ATOM   6891  C  C     . LEU A  1  906  ? 264.835 320.466 209.432 1.00 0.00 ? 906  LEU A C     1 
ATOM   6892  O  O     . LEU A  1  906  ? 265.555 319.837 208.656 1.00 0.00 ? 906  LEU A O     1 
ATOM   6893  C  CB    . LEU A  1  906  ? 264.317 318.610 211.038 1.00 0.00 ? 906  LEU A CB    1 
ATOM   6894  C  CG    . LEU A  1  906  ? 263.408 318.077 212.137 1.00 0.00 ? 906  LEU A CG    1 
ATOM   6895  C  CD1   . LEU A  1  906  ? 263.942 316.761 212.688 1.00 0.00 ? 906  LEU A CD1   1 
ATOM   6896  C  CD2   . LEU A  1  906  ? 263.300 319.099 213.221 1.00 0.00 ? 906  LEU A CD2   1 
ATOM   6897  N  N     . ALA A  1  907  ? 264.917 321.778 209.612 1.00 0.00 ? 907  ALA A N     1 
ATOM   6898  C  CA    . ALA A  1  907  ? 265.805 322.629 208.829 1.00 0.00 ? 907  ALA A CA    1 
ATOM   6899  C  C     . ALA A  1  907  ? 267.273 322.283 208.987 1.00 0.00 ? 907  ALA A C     1 
ATOM   6900  O  O     . ALA A  1  907  ? 268.071 322.474 208.071 1.00 0.00 ? 907  ALA A O     1 
ATOM   6901  C  CB    . ALA A  1  907  ? 265.581 324.085 209.216 1.00 0.00 ? 907  ALA A CB    1 
ATOM   6902  N  N     . THR A  1  908  ? 267.634 321.819 210.171 1.00 0.00 ? 908  THR A N     1 
ATOM   6903  C  CA    . THR A  1  908  ? 269.035 321.657 210.500 1.00 0.00 ? 908  THR A CA    1 
ATOM   6904  C  C     . THR A  1  908  ? 269.687 320.394 209.933 1.00 0.00 ? 908  THR A C     1 
ATOM   6905  O  O     . THR A  1  908  ? 270.894 320.222 210.068 1.00 0.00 ? 908  THR A O     1 
ATOM   6906  C  CB    . THR A  1  908  ? 269.202 321.721 211.986 1.00 0.00 ? 908  THR A CB    1 
ATOM   6907  O  OG1   . THR A  1  908  ? 267.899 321.760 212.573 1.00 0.00 ? 908  THR A OG1   1 
ATOM   6908  C  CG2   . THR A  1  908  ? 269.887 323.002 212.337 1.00 0.00 ? 908  THR A CG2   1 
ATOM   6909  N  N     . LEU A  1  909  ? 268.899 319.473 209.389 1.00 0.00 ? 909  LEU A N     1 
ATOM   6910  C  CA    . LEU A  1  909  ? 269.464 318.356 208.617 1.00 0.00 ? 909  LEU A CA    1 
ATOM   6911  C  C     . LEU A  1  909  ? 269.977 318.739 207.201 1.00 0.00 ? 909  LEU A C     1 
ATOM   6912  O  O     . LEU A  1  909  ? 270.293 317.861 206.385 1.00 0.00 ? 909  LEU A O     1 
ATOM   6913  C  CB    . LEU A  1  909  ? 268.461 317.222 208.506 1.00 0.00 ? 909  LEU A CB    1 
ATOM   6914  C  CG    . LEU A  1  909  ? 268.242 316.525 209.837 1.00 0.00 ? 909  LEU A CG    1 
ATOM   6915  C  CD1   . LEU A  1  909  ? 267.144 315.510 209.679 1.00 0.00 ? 909  LEU A CD1   1 
ATOM   6916  C  CD2   . LEU A  1  909  ? 269.517 315.858 210.295 1.00 0.00 ? 909  LEU A CD2   1 
ATOM   6917  N  N     . LYS A  1  910  ? 269.986 320.039 206.902 1.00 0.00 ? 910  LYS A N     1 
ATOM   6918  C  CA    . LYS A  1  910  ? 270.524 320.586 205.648 1.00 0.00 ? 910  LYS A CA    1 
ATOM   6919  C  C     . LYS A  1  910  ? 271.936 320.106 205.333 1.00 0.00 ? 910  LYS A C     1 
ATOM   6920  O  O     . LYS A  1  910  ? 272.857 320.309 206.124 1.00 0.00 ? 910  LYS A O     1 
ATOM   6921  C  CB    . LYS A  1  910  ? 270.520 322.118 205.690 1.00 0.00 ? 910  LYS A CB    1 
ATOM   6922  C  CG    . LYS A  1  910  ? 271.107 322.790 204.449 1.00 0.00 ? 910  LYS A CG    1 
ATOM   6923  C  CD    . LYS A  1  910  ? 270.173 322.690 203.248 1.00 0.00 ? 910  LYS A CD    1 
ATOM   6924  C  CE    . LYS A  1  910  ? 270.830 323.201 201.967 1.00 0.00 ? 910  LYS A CE    1 
ATOM   6925  N  NZ    . LYS A  1  910  ? 269.916 323.066 200.792 1.00 0.00 ? 910  LYS A NZ    1 
ATOM   6926  N  N     . PRO A  1  911  ? 272.118 319.500 204.153 1.00 0.00 ? 911  PRO A N     1 
ATOM   6927  C  CA    . PRO A  1  911  ? 273.423 318.971 203.726 1.00 0.00 ? 911  PRO A CA    1 
ATOM   6928  C  C     . PRO A  1  911  ? 274.499 320.044 203.534 1.00 0.00 ? 911  PRO A C     1 
ATOM   6929  O  O     . PRO A  1  911  ? 274.181 321.230 203.409 1.00 0.00 ? 911  PRO A O     1 
ATOM   6930  C  CB    . PRO A  1  911  ? 273.107 318.282 202.389 1.00 0.00 ? 911  PRO A CB    1 
ATOM   6931  C  CG    . PRO A  1  911  ? 271.837 318.932 201.907 1.00 0.00 ? 911  PRO A CG    1 
ATOM   6932  C  CD    . PRO A  1  911  ? 271.058 319.234 203.165 1.00 0.00 ? 911  PRO A CD    1 
ATOM   6933  N  N     . SER A  1  912  ? 275.756 319.602 203.524 1.00 0.00 ? 912  SER A N     1 
ATOM   6934  C  CA    . SER A  1  912  ? 276.942 320.463 203.493 1.00 0.00 ? 912  SER A CA    1 
ATOM   6935  C  C     . SER A  1  912  ? 277.063 321.380 204.702 1.00 0.00 ? 912  SER A C     1 
ATOM   6936  O  O     . SER A  1  912  ? 276.176 322.186 204.998 1.00 0.00 ? 912  SER A O     1 
ATOM   6937  C  CB    . SER A  1  912  ? 276.980 321.311 202.212 1.00 0.00 ? 912  SER A CB    1 
ATOM   6938  O  OG    . SER A  1  912  ? 278.241 321.952 202.054 1.00 0.00 ? 912  SER A OG    1 
ATOM   6939  N  N     . ASN A  1  913  ? 278.188 321.245 205.389 1.00 0.00 ? 913  ASN A N     1 
ATOM   6940  C  CA    . ASN A  1  913  ? 278.473 322.041 206.562 1.00 0.00 ? 913  ASN A CA    1 
ATOM   6941  C  C     . ASN A  1  913  ? 278.652 323.496 206.153 1.00 0.00 ? 913  ASN A C     1 
ATOM   6942  O  O     . ASN A  1  913  ? 278.218 324.414 206.846 1.00 0.00 ? 913  ASN A O     1 
ATOM   6943  C  CB    . ASN A  1  913  ? 279.720 321.530 207.267 1.00 0.00 ? 913  ASN A CB    1 
ATOM   6944  C  CG    . ASN A  1  913  ? 279.886 322.119 208.635 1.00 0.00 ? 913  ASN A CG    1 
ATOM   6945  O  OD1   . ASN A  1  913  ? 279.024 321.956 209.497 1.00 0.00 ? 913  ASN A OD1   1 
ATOM   6946  N  ND2   . ASN A  1  913  ? 280.973 322.850 208.837 1.00 0.00 ? 913  ASN A ND2   1 
ATOM   6947  N  N     . LYS A  1  914  ? 279.293 323.694 205.006 1.00 0.00 ? 914  LYS A N     1 
ATOM   6948  C  CA    . LYS A  1  914  ? 279.462 325.026 204.438 1.00 0.00 ? 914  LYS A CA    1 
ATOM   6949  C  C     . LYS A  1  914  ? 278.136 325.688 204.080 1.00 0.00 ? 914  LYS A C     1 
ATOM   6950  O  O     . LYS A  1  914  ? 277.931 326.870 204.349 1.00 0.00 ? 914  LYS A O     1 
ATOM   6951  C  CB    . LYS A  1  914  ? 280.332 324.941 203.188 1.00 0.00 ? 914  LYS A CB    1 
ATOM   6952  C  CG    . LYS A  1  914  ? 281.786 324.643 203.468 1.00 0.00 ? 914  LYS A CG    1 
ATOM   6953  C  CD    . LYS A  1  914  ? 282.617 324.766 202.208 1.00 0.00 ? 914  LYS A CD    1 
ATOM   6954  C  CE    . LYS A  1  914  ? 284.065 324.367 202.461 1.00 0.00 ? 914  LYS A CE    1 
ATOM   6955  N  NZ    . LYS A  1  914  ? 284.817 325.361 203.280 1.00 0.00 ? 914  LYS A NZ    1 
ATOM   6956  N  N     . ALA A  1  915  ? 277.236 324.921 203.481 1.00 0.00 ? 915  ALA A N     1 
ATOM   6957  C  CA    . ALA A  1  915  ? 275.900 325.402 203.145 1.00 0.00 ? 915  ALA A CA    1 
ATOM   6958  C  C     . ALA A  1  915  ? 275.055 325.803 204.355 1.00 0.00 ? 915  ALA A C     1 
ATOM   6959  O  O     . ALA A  1  915  ? 274.382 326.834 204.342 1.00 0.00 ? 915  ALA A O     1 
ATOM   6960  C  CB    . ALA A  1  915  ? 275.166 324.352 202.333 1.00 0.00 ? 915  ALA A CB    1 
ATOM   6961  N  N     . PHE A  1  916  ? 275.124 324.999 205.410 1.00 0.00 ? 916  PHE A N     1 
ATOM   6962  C  CA    . PHE A  1  916  ? 274.486 325.321 206.685 1.00 0.00 ? 916  PHE A CA    1 
ATOM   6963  C  C     . PHE A  1  916  ? 275.053 326.622 207.242 1.00 0.00 ? 916  PHE A C     1 
ATOM   6964  O  O     . PHE A  1  916  ? 274.303 327.522 207.620 1.00 0.00 ? 916  PHE A O     1 
ATOM   6965  C  CB    . PHE A  1  916  ? 274.658 324.149 207.667 1.00 0.00 ? 916  PHE A CB    1 
ATOM   6966  C  CG    . PHE A  1  916  ? 274.385 324.492 209.104 1.00 0.00 ? 916  PHE A CG    1 
ATOM   6967  C  CD1   . PHE A  1  916  ? 273.097 324.439 209.596 1.00 0.00 ? 916  PHE A CD1   1 
ATOM   6968  C  CD2   . PHE A  1  916  ? 275.408 324.818 209.969 1.00 0.00 ? 916  PHE A CD2   1 
ATOM   6969  C  CE1   . PHE A  1  916  ? 272.833 324.736 210.911 1.00 0.00 ? 916  PHE A CE1   1 
ATOM   6970  C  CE2   . PHE A  1  916  ? 275.145 325.113 211.291 1.00 0.00 ? 916  PHE A CE2   1 
ATOM   6971  C  CZ    . PHE A  1  916  ? 273.858 325.070 211.758 1.00 0.00 ? 916  PHE A CZ    1 
ATOM   6972  N  N     . GLU A  1  917  ? 276.372 326.727 207.271 1.00 0.00 ? 917  GLU A N     1 
ATOM   6973  C  CA    . GLU A  1  917  ? 277.035 327.916 207.787 1.00 0.00 ? 917  GLU A CA    1 
ATOM   6974  C  C     . GLU A  1  917  ? 276.582 329.176 207.056 1.00 0.00 ? 917  GLU A C     1 
ATOM   6975  O  O     . GLU A  1  917  ? 276.204 330.154 207.686 1.00 0.00 ? 917  GLU A O     1 
ATOM   6976  C  CB    . GLU A  1  917  ? 278.553 327.787 207.659 1.00 0.00 ? 917  GLU A CB    1 
ATOM   6977  C  CG    . GLU A  1  917  ? 279.329 328.917 208.330 1.00 0.00 ? 917  GLU A CG    1 
ATOM   6978  C  CD    . GLU A  1  917  ? 280.832 328.801 208.122 1.00 0.00 ? 917  GLU A CD    1 
ATOM   6979  O  OE1   . GLU A  1  917  ? 281.280 327.740 207.632 1.00 0.00 ? 917  GLU A OE1   1 
ATOM   6980  O  OE2   . GLU A  1  917  ? 281.558 329.776 208.427 1.00 0.00 ? 917  GLU A OE2   1 
ATOM   6981  N  N     . LYS A  1  918  ? 276.571 329.126 205.727 1.00 0.00 ? 918  LYS A N     1 
ATOM   6982  C  CA    . LYS A  1  918  ? 276.103 330.247 204.914 1.00 0.00 ? 918  LYS A CA    1 
ATOM   6983  C  C     . LYS A  1  918  ? 274.657 330.658 205.186 1.00 0.00 ? 918  LYS A C     1 
ATOM   6984  O  O     . LYS A  1  918  ? 274.379 331.833 205.424 1.00 0.00 ? 918  LYS A O     1 
ATOM   6985  C  CB    . LYS A  1  918  ? 276.235 329.903 203.426 1.00 0.00 ? 918  LYS A CB    1 
ATOM   6986  C  CG    . LYS A  1  918  ? 277.658 329.734 202.910 1.00 0.00 ? 918  LYS A CG    1 
ATOM   6987  C  CD    . LYS A  1  918  ? 278.399 331.056 202.748 1.00 0.00 ? 918  LYS A CD    1 
ATOM   6988  C  CE    . LYS A  1  918  ? 279.829 330.816 202.271 1.00 0.00 ? 918  LYS A CE    1 
ATOM   6989  N  NZ    . LYS A  1  918  ? 280.541 332.083 201.966 1.00 0.00 ? 918  LYS A NZ    1 
ATOM   6990  N  N     . LYS A  1  919  ? 273.733 329.709 205.145 1.00 0.00 ? 919  LYS A N     1 
ATOM   6991  C  CA    . LYS A  1  919  ? 272.324 330.062 205.276 1.00 0.00 ? 919  LYS A CA    1 
ATOM   6992  C  C     . LYS A  1  919  ? 271.901 330.508 206.675 1.00 0.00 ? 919  LYS A C     1 
ATOM   6993  O  O     . LYS A  1  919  ? 271.079 331.413 206.817 1.00 0.00 ? 919  LYS A O     1 
ATOM   6994  C  CB    . LYS A  1  919  ? 271.470 328.859 204.862 1.00 0.00 ? 919  LYS A CB    1 
ATOM   6995  C  CG    . LYS A  1  919  ? 271.408 328.617 203.352 1.00 0.00 ? 919  LYS A CG    1 
ATOM   6996  C  CD    . LYS A  1  919  ? 270.515 329.621 202.638 1.00 0.00 ? 919  LYS A CD    1 
ATOM   6997  C  CE    . LYS A  1  919  ? 269.041 329.254 202.809 1.00 0.00 ? 919  LYS A CE    1 
ATOM   6998  N  NZ    . LYS A  1  919  ? 268.131 330.231 202.143 1.00 0.00 ? 919  LYS A NZ    1 
ATOM   6999  N  N     . PHE A  1  920  ? 272.499 329.916 207.704 1.00 0.00 ? 920  PHE A N     1 
ATOM   7000  C  CA    . PHE A  1  920  ? 272.160 330.245 209.092 1.00 0.00 ? 920  PHE A CA    1 
ATOM   7001  C  C     . PHE A  1  920  ? 272.944 331.356 209.792 1.00 0.00 ? 920  PHE A C     1 
ATOM   7002  O  O     . PHE A  1  920  ? 272.389 332.054 210.633 1.00 0.00 ? 920  PHE A O     1 
ATOM   7003  C  CB    . PHE A  1  920  ? 272.258 328.982 209.943 1.00 0.00 ? 920  PHE A CB    1 
ATOM   7004  C  CG    . PHE A  1  920  ? 271.127 328.037 209.730 1.00 0.00 ? 920  PHE A CG    1 
ATOM   7005  C  CD1   . PHE A  1  920  ? 271.093 327.217 208.619 1.00 0.00 ? 920  PHE A CD1   1 
ATOM   7006  C  CD2   . PHE A  1  920  ? 270.077 327.992 210.616 1.00 0.00 ? 920  PHE A CD2   1 
ATOM   7007  C  CE1   . PHE A  1  920  ? 270.041 326.344 208.408 1.00 0.00 ? 920  PHE A CE1   1 
ATOM   7008  C  CE2   . PHE A  1  920  ? 269.024 327.117 210.412 1.00 0.00 ? 920  PHE A CE2   1 
ATOM   7009  C  CZ    . PHE A  1  920  ? 269.009 326.294 209.304 1.00 0.00 ? 920  PHE A CZ    1 
ATOM   7010  N  N     . ARG A  1  921  ? 274.231 331.501 209.486 1.00 0.00 ? 921  ARG A N     1 
ATOM   7011  C  CA    . ARG A  1  921  ? 275.076 332.432 210.238 1.00 0.00 ? 921  ARG A CA    1 
ATOM   7012  C  C     . ARG A  1  921  ? 274.721 333.891 209.976 1.00 0.00 ? 921  ARG A C     1 
ATOM   7013  O  O     . ARG A  1  921  ? 274.605 334.323 208.830 1.00 0.00 ? 921  ARG A O     1 
ATOM   7014  C  CB    . ARG A  1  921  ? 276.551 332.194 209.916 1.00 0.00 ? 921  ARG A CB    1 
ATOM   7015  C  CG    . ARG A  1  921  ? 277.521 332.998 210.757 1.00 0.00 ? 921  ARG A CG    1 
ATOM   7016  C  CD    . ARG A  1  921  ? 278.921 332.907 210.182 1.00 0.00 ? 921  ARG A CD    1 
ATOM   7017  N  NE    . ARG A  1  921  ? 279.652 331.760 210.711 1.00 0.00 ? 921  ARG A NE    1 
ATOM   7018  C  CZ    . ARG A  1  921  ? 280.197 331.712 211.923 1.00 0.00 ? 921  ARG A CZ    1 
ATOM   7019  N  NH1   . ARG A  1  921  ? 280.098 332.750 212.739 1.00 0.00 ? 921  ARG A NH1   1 
ATOM   7020  N  NH2   . ARG A  1  921  ? 280.852 330.628 212.315 1.00 0.00 ? 921  ARG A NH2   1 
ATOM   7021  N  N     . PHE A  1  922  ? 274.528 334.635 211.058 1.00 0.00 ? 922  PHE A N     1 
ATOM   7022  C  CA    . PHE A  1  922  ? 274.388 336.083 210.996 1.00 0.00 ? 922  PHE A CA    1 
ATOM   7023  C  C     . PHE A  1  922  ? 275.734 336.812 210.922 1.00 0.00 ? 922  PHE A C     1 
ATOM   7024  O  O     . PHE A  1  922  ? 276.324 337.135 211.949 1.00 0.00 ? 922  PHE A O     1 
ATOM   7025  C  CB    . PHE A  1  922  ? 273.604 336.567 212.207 1.00 0.00 ? 922  PHE A CB    1 
ATOM   7026  C  CG    . PHE A  1  922  ? 272.973 337.892 212.008 1.00 0.00 ? 922  PHE A CG    1 
ATOM   7027  C  CD1   . PHE A  1  922  ? 271.815 338.011 211.267 1.00 0.00 ? 922  PHE A CD1   1 
ATOM   7028  C  CD2   . PHE A  1  922  ? 273.542 339.026 212.552 1.00 0.00 ? 922  PHE A CD2   1 
ATOM   7029  C  CE1   . PHE A  1  922  ? 271.228 339.240 211.075 1.00 0.00 ? 922  PHE A CE1   1 
ATOM   7030  C  CE2   . PHE A  1  922  ? 272.961 340.262 212.367 1.00 0.00 ? 922  PHE A CE2   1 
ATOM   7031  C  CZ    . PHE A  1  922  ? 271.801 340.370 211.625 1.00 0.00 ? 922  PHE A CZ    1 
ATOM   7032  N  N     . ASP A  1  923  ? 276.202 337.088 209.709 1.00 0.00 ? 923  ASP A N     1 
ATOM   7033  C  CA    . ASP A  1  923  ? 277.482 337.773 209.495 1.00 0.00 ? 923  ASP A CA    1 
ATOM   7034  C  C     . ASP A  1  923  ? 277.587 339.141 210.197 1.00 0.00 ? 923  ASP A C     1 
ATOM   7035  O  O     . ASP A  1  923  ? 276.585 339.837 210.368 1.00 0.00 ? 923  ASP A O     1 
ATOM   7036  C  CB    . ASP A  1  923  ? 277.730 337.930 207.990 1.00 0.00 ? 923  ASP A CB    1 
ATOM   7037  C  CG    . ASP A  1  923  ? 278.968 338.751 207.680 1.00 0.00 ? 923  ASP A CG    1 
ATOM   7038  O  OD1   . ASP A  1  923  ? 280.090 338.236 207.880 1.00 0.00 ? 923  ASP A OD1   1 
ATOM   7039  O  OD2   . ASP A  1  923  ? 278.815 339.911 207.236 1.00 0.00 ? 923  ASP A OD2   1 
ATOM   7040  N  N     . TYR A  1  924  ? 278.802 339.511 210.611 1.00 0.00 ? 924  TYR A N     1 
ATOM   7041  C  CA    . TYR A  1  924  ? 279.071 340.837 211.172 1.00 0.00 ? 924  TYR A CA    1 
ATOM   7042  C  C     . TYR A  1  924  ? 280.040 341.660 210.336 1.00 0.00 ? 924  TYR A C     1 
ATOM   7043  O  O     . TYR A  1  924  ? 280.088 342.882 210.477 1.00 0.00 ? 924  TYR A O     1 
ATOM   7044  C  CB    . TYR A  1  924  ? 279.642 340.730 212.583 1.00 0.00 ? 924  TYR A CB    1 
ATOM   7045  C  CG    . TYR A  1  924  ? 278.600 340.636 213.650 1.00 0.00 ? 924  TYR A CG    1 
ATOM   7046  C  CD1   . TYR A  1  924  ? 277.856 341.750 214.013 1.00 0.00 ? 924  TYR A CD1   1 
ATOM   7047  C  CD2   . TYR A  1  924  ? 278.363 339.440 214.298 1.00 0.00 ? 924  TYR A CD2   1 
ATOM   7048  C  CE1   . TYR A  1  924  ? 276.893 341.670 214.989 1.00 0.00 ? 924  TYR A CE1   1 
ATOM   7049  C  CE2   . TYR A  1  924  ? 277.405 339.343 215.274 1.00 0.00 ? 924  TYR A CE2   1 
ATOM   7050  C  CZ    . TYR A  1  924  ? 276.669 340.460 215.620 1.00 0.00 ? 924  TYR A CZ    1 
ATOM   7051  O  OH    . TYR A  1  924  ? 275.716 340.362 216.609 1.00 0.00 ? 924  TYR A OH    1 
ATOM   7052  N  N     . THR A  1  925  ? 280.821 341.000 209.485 1.00 0.00 ? 925  THR A N     1 
ATOM   7053  C  CA    . THR A  1  925  ? 281.805 341.705 208.661 1.00 0.00 ? 925  THR A CA    1 
ATOM   7054  C  C     . THR A  1  925  ? 281.106 342.607 207.639 1.00 0.00 ? 925  THR A C     1 
ATOM   7055  O  O     . THR A  1  925  ? 281.718 343.526 207.089 1.00 0.00 ? 925  THR A O     1 
ATOM   7056  C  CB    . THR A  1  925  ? 282.749 340.722 207.928 1.00 0.00 ? 925  THR A CB    1 
ATOM   7057  O  OG1   . THR A  1  925  ? 281.983 339.841 207.098 1.00 0.00 ? 925  THR A OG1   1 
ATOM   7058  C  CG2   . THR A  1  925  ? 283.551 339.898 208.926 1.00 0.00 ? 925  THR A CG2   1 
ATOM   7059  N  N     . ASN A  1  926  ? 279.819 342.339 207.420 1.00 0.00 ? 926  ASN A N     1 
ATOM   7060  C  CA    . ASN A  1  926  ? 278.955 343.105 206.518 1.00 0.00 ? 926  ASN A CA    1 
ATOM   7061  C  C     . ASN A  1  926  ? 279.528 343.287 205.117 1.00 0.00 ? 926  ASN A C     1 
ATOM   7062  O  O     . ASN A  1  926  ? 280.324 344.196 204.868 1.00 0.00 ? 926  ASN A O     1 
ATOM   7063  C  CB    . ASN A  1  926  ? 278.641 344.472 207.125 1.00 0.00 ? 926  ASN A CB    1 
ATOM   7064  C  CG    . ASN A  1  926  ? 277.936 344.361 208.457 1.00 0.00 ? 926  ASN A CG    1 
ATOM   7065  O  OD1   . ASN A  1  926  ? 276.722 344.178 208.515 1.00 0.00 ? 926  ASN A OD1   1 
ATOM   7066  N  ND2   . ASN A  1  926  ? 278.693 344.483 209.540 1.00 0.00 ? 926  ASN A ND2   1 
ATOM   7067  N  N     . GLU A  1  927  ? 279.093 342.428 204.203 1.00 0.00 ? 927  GLU A N     1 
ATOM   7068  C  CA    . GLU A  1  927  ? 279.473 342.548 202.805 1.00 0.00 ? 927  GLU A CA    1 
ATOM   7069  C  C     . GLU A  1  927  ? 278.824 343.801 202.223 1.00 0.00 ? 927  GLU A C     1 
ATOM   7070  O  O     . GLU A  1  927  ? 277.677 344.114 202.547 1.00 0.00 ? 927  GLU A O     1 
ATOM   7071  C  CB    . GLU A  1  927  ? 279.059 341.298 202.021 1.00 0.00 ? 927  GLU A CB    1 
ATOM   7072  C  CG    . GLU A  1  927  ? 279.856 340.044 202.376 1.00 0.00 ? 927  GLU A CG    1 
ATOM   7073  C  CD    . GLU A  1  927  ? 279.489 338.848 201.514 1.00 0.00 ? 927  GLU A CD    1 
ATOM   7074  O  OE1   . GLU A  1  927  ? 278.591 338.981 200.658 1.00 0.00 ? 927  GLU A OE1   1 
ATOM   7075  O  OE2   . GLU A  1  927  ? 280.099 337.770 201.690 1.00 0.00 ? 927  GLU A OE2   1 
ATOM   7076  N  N     . ARG A  1  928  ? 279.562 344.522 201.381 1.00 0.00 ? 928  ARG A N     1 
ATOM   7077  C  CA    . ARG A  1  928  ? 279.101 345.810 200.859 1.00 0.00 ? 928  ARG A CA    1 
ATOM   7078  C  C     . ARG A  1  928  ? 277.804 345.674 200.064 1.00 0.00 ? 928  ARG A C     1 
ATOM   7079  O  O     . ARG A  1  928  ? 277.780 345.838 198.842 1.00 0.00 ? 928  ARG A O     1 
ATOM   7080  C  CB    . ARG A  1  928  ? 280.185 346.460 199.995 1.00 0.00 ? 928  ARG A CB    1 
ATOM   7081  C  CG    . ARG A  1  928  ? 279.973 347.953 199.756 1.00 0.00 ? 928  ARG A CG    1 
ATOM   7082  C  CD    . ARG A  1  928  ? 281.120 348.560 198.965 1.00 0.00 ? 928  ARG A CD    1 
ATOM   7083  N  NE    . ARG A  1  928  ? 281.205 348.019 197.611 1.00 0.00 ? 928  ARG A NE    1 
ATOM   7084  C  CZ    . ARG A  1  928  ? 282.158 348.332 196.739 1.00 0.00 ? 928  ARG A CZ    1 
ATOM   7085  N  NH1   . ARG A  1  928  ? 283.119 349.180 197.077 1.00 0.00 ? 928  ARG A NH1   1 
ATOM   7086  N  NH2   . ARG A  1  928  ? 282.158 347.787 195.529 1.00 0.00 ? 928  ARG A NH2   1 
ATOM   7087  N  N     . ALA A  1  929  ? 276.728 345.371 200.782 1.00 0.00 ? 929  ALA A N     1 
ATOM   7088  C  CA    . ALA A  1  929  ? 275.421 345.130 200.193 1.00 0.00 ? 929  ALA A CA    1 
ATOM   7089  C  C     . ALA A  1  929  ? 274.384 345.869 201.023 1.00 0.00 ? 929  ALA A C     1 
ATOM   7090  O  O     . ALA A  1  929  ? 273.366 345.295 201.420 1.00 0.00 ? 929  ALA A O     1 
ATOM   7091  C  CB    . ALA A  1  929  ? 275.113 343.641 200.139 1.00 0.00 ? 929  ALA A CB    1 
ATOM   7092  N  N     . LEU A  1  930  ? 274.658 347.137 201.307 1.00 0.00 ? 930  LEU A N     1 
ATOM   7093  C  CA    . LEU A  1  930  ? 273.769 347.941 202.132 1.00 0.00 ? 930  LEU A CA    1 
ATOM   7094  C  C     . LEU A  1  930  ? 274.115 347.652 203.588 1.00 0.00 ? 930  LEU A C     1 
ATOM   7095  O  O     . LEU A  1  930  ? 273.573 346.724 204.189 1.00 0.00 ? 930  LEU A O     1 
ATOM   7096  C  CB    . LEU A  1  930  ? 272.308 347.592 201.852 1.00 0.00 ? 930  LEU A CB    1 
ATOM   7097  C  CG    . LEU A  1  930  ? 271.412 348.744 201.394 1.00 0.00 ? 930  LEU A CG    1 
ATOM   7098  C  CD1   . LEU A  1  930  ? 271.883 349.293 200.056 1.00 0.00 ? 930  LEU A CD1   1 
ATOM   7099  C  CD2   . LEU A  1  930  ? 269.960 348.297 201.314 1.00 0.00 ? 930  LEU A CD2   1 
ATOM   7100  N  N     . ARG A  1  931  ? 275.030 348.446 204.139 1.00 0.00 ? 931  ARG A N     1 
ATOM   7101  C  CA    . ARG A  1  931  ? 275.496 348.291 205.518 1.00 0.00 ? 931  ARG A CA    1 
ATOM   7102  C  C     . ARG A  1  931  ? 274.380 348.088 206.541 1.00 0.00 ? 931  ARG A C     1 
ATOM   7103  O  O     . ARG A  1  931  ? 273.902 349.047 207.147 1.00 0.00 ? 931  ARG A O     1 
ATOM   7104  C  CB    . ARG A  1  931  ? 276.361 349.488 205.924 1.00 0.00 ? 931  ARG A CB    1 
ATOM   7105  C  CG    . ARG A  1  931  ? 277.842 349.170 206.045 1.00 0.00 ? 931  ARG A CG    1 
ATOM   7106  C  CD    . ARG A  1  931  ? 278.069 347.693 206.322 1.00 0.00 ? 931  ARG A CD    1 
ATOM   7107  N  NE    . ARG A  1  931  ? 277.808 346.869 205.145 1.00 0.00 ? 931  ARG A NE    1 
ATOM   7108  C  CZ    . ARG A  1  931  ? 277.330 345.630 205.191 1.00 0.00 ? 931  ARG A CZ    1 
ATOM   7109  N  NH1   . ARG A  1  931  ? 277.058 345.066 206.360 1.00 0.00 ? 931  ARG A NH1   1 
ATOM   7110  N  NH2   . ARG A  1  931  ? 277.123 344.955 204.069 1.00 0.00 ? 931  ARG A NH2   1 
ATOM   7111  N  N     . ARG A  1  932  ? 273.987 346.829 206.728 1.00 0.00 ? 932  ARG A N     1 
ATOM   7112  C  CA    . ARG A  1  932  ? 272.934 346.456 207.671 1.00 0.00 ? 932  ARG A CA    1 
ATOM   7113  C  C     . ARG A  1  932  ? 271.686 347.316 207.510 1.00 0.00 ? 932  ARG A C     1 
ATOM   7114  O  O     . ARG A  1  932  ? 270.676 347.096 208.178 1.00 0.00 ? 932  ARG A O     1 
ATOM   7115  C  CB    . ARG A  1  932  ? 273.448 346.537 209.111 1.00 0.00 ? 932  ARG A CB    1 
ATOM   7116  C  CG    . ARG A  1  932  ? 274.466 345.465 209.467 1.00 0.00 ? 932  ARG A CG    1 
ATOM   7117  C  CD    . ARG A  1  932  ? 273.894 344.472 210.465 1.00 0.00 ? 932  ARG A CD    1 
ATOM   7118  N  NE    . ARG A  1  932  ? 274.455 343.135 210.288 1.00 0.00 ? 932  ARG A NE    1 
ATOM   7119  C  CZ    . ARG A  1  932  ? 273.964 342.224 209.454 1.00 0.00 ? 932  ARG A CZ    1 
ATOM   7120  N  NH1   . ARG A  1  932  ? 274.539 341.033 209.358 1.00 0.00 ? 932  ARG A NH1   1 
ATOM   7121  N  NH2   . ARG A  1  932  ? 272.898 342.503 208.716 1.00 0.00 ? 932  ARG A NH2   1 
ATOM   7122  N  N     . THR A  1  933  ? 271.766 348.297 206.617 1.00 0.00 ? 933  THR A N     1 
ATOM   7123  C  CA    . THR A  1  933  ? 270.650 349.200 206.372 1.00 0.00 ? 933  THR A CA    1 
ATOM   7124  C  C     . THR A  1  933  ? 269.735 348.544 205.340 1.00 0.00 ? 933  THR A C     1 
ATOM   7125  O  O     . THR A  1  933  ? 268.611 348.989 205.115 1.00 0.00 ? 933  THR A O     1 
ATOM   7126  C  CB    . THR A  1  933  ? 271.118 350.602 205.890 1.00 0.00 ? 933  THR A CB    1 
ATOM   7127  O  OG1   . THR A  1  933  ? 271.977 350.470 204.752 1.00 0.00 ? 933  THR A OG1   1 
ATOM   7128  C  CG2   . THR A  1  933  ? 271.879 351.327 206.997 1.00 0.00 ? 933  THR A CG2   1 
ATOM   7129  N  N     . LEU A  1  934  ? 270.229 347.475 204.722 1.00 0.00 ? 934  LEU A N     1 
ATOM   7130  C  CA    . LEU A  1  934  ? 269.390 346.586 203.938 1.00 0.00 ? 934  LEU A CA    1 
ATOM   7131  C  C     . LEU A  1  934  ? 268.682 345.643 204.898 1.00 0.00 ? 934  LEU A C     1 
ATOM   7132  O  O     . LEU A  1  934  ? 269.171 345.415 206.002 1.00 0.00 ? 934  LEU A O     1 
ATOM   7133  C  CB    . LEU A  1  934  ? 270.225 345.801 202.928 1.00 0.00 ? 934  LEU A CB    1 
ATOM   7134  C  CG    . LEU A  1  934  ? 269.449 345.066 201.834 1.00 0.00 ? 934  LEU A CG    1 
ATOM   7135  C  CD1   . LEU A  1  934  ? 268.716 346.051 200.934 1.00 0.00 ? 934  LEU A CD1   1 
ATOM   7136  C  CD2   . LEU A  1  934  ? 270.377 344.170 201.031 1.00 0.00 ? 934  LEU A CD2   1 
ATOM   7137  N  N     . GLN A  1  935  ? 267.557 345.079 204.466 1.00 0.00 ? 935  GLN A N     1 
ATOM   7138  C  CA    . GLN A  1  935  ? 266.656 344.334 205.347 1.00 0.00 ? 935  GLN A CA    1 
ATOM   7139  C  C     . GLN A  1  935  ? 266.356 345.049 206.669 1.00 0.00 ? 935  GLN A C     1 
ATOM   7140  O  O     . GLN A  1  935  ? 265.372 345.775 206.776 1.00 0.00 ? 935  GLN A O     1 
ATOM   7141  C  CB    . GLN A  1  935  ? 267.248 342.960 205.637 1.00 0.00 ? 935  GLN A CB    1 
ATOM   7142  C  CG    . GLN A  1  935  ? 267.513 342.147 204.392 1.00 0.00 ? 935  GLN A CG    1 
ATOM   7143  C  CD    . GLN A  1  935  ? 267.940 340.732 204.712 1.00 0.00 ? 935  GLN A CD    1 
ATOM   7144  O  OE1   . GLN A  1  935  ? 267.662 339.798 203.958 1.00 0.00 ? 935  GLN A OE1   1 
ATOM   7145  N  NE2   . GLN A  1  935  ? 268.641 340.567 205.828 1.00 0.00 ? 935  GLN A NE2   1 
ATOM   7146  N  N     . GLU A  1  936  ? 267.211 344.840 207.666 1.00 0.00 ? 936  GLU A N     1 
ATOM   7147  C  CA    . GLU A  1  936  ? 267.077 345.488 208.975 1.00 0.00 ? 936  GLU A CA    1 
ATOM   7148  C  C     . GLU A  1  936  ? 267.109 347.020 208.922 1.00 0.00 ? 936  GLU A C     1 
ATOM   7149  O  O     . GLU A  1  936  ? 267.671 347.611 207.999 1.00 0.00 ? 936  GLU A O     1 
ATOM   7150  C  CB    . GLU A  1  936  ? 268.177 344.992 209.915 1.00 0.00 ? 936  GLU A CB    1 
ATOM   7151  C  CG    . GLU A  1  936  ? 268.167 343.492 210.134 1.00 0.00 ? 936  GLU A CG    1 
ATOM   7152  C  CD    . GLU A  1  936  ? 269.003 342.748 209.111 1.00 0.00 ? 936  GLU A CD    1 
ATOM   7153  O  OE1   . GLU A  1  936  ? 269.481 343.386 208.148 1.00 0.00 ? 936  GLU A OE1   1 
ATOM   7154  O  OE2   . GLU A  1  936  ? 269.183 341.522 209.269 1.00 0.00 ? 936  GLU A OE2   1 
ATOM   7155  N  N     . ASP A  1  937  ? 266.491 347.646 209.920 1.00 0.00 ? 937  ASP A N     1 
ATOM   7156  C  CA    . ASP A  1  937  ? 266.395 349.103 209.998 1.00 0.00 ? 937  ASP A CA    1 
ATOM   7157  C  C     . ASP A  1  937  ? 267.432 349.708 210.953 1.00 0.00 ? 937  ASP A C     1 
ATOM   7158  O  O     . ASP A  1  937  ? 268.568 349.971 210.558 1.00 0.00 ? 937  ASP A O     1 
ATOM   7159  C  CB    . ASP A  1  937  ? 264.982 349.508 210.426 1.00 0.00 ? 937  ASP A CB    1 
ATOM   7160  C  CG    . ASP A  1  937  ? 264.706 350.979 210.218 1.00 0.00 ? 937  ASP A CG    1 
ATOM   7161  O  OD1   . ASP A  1  937  ? 265.519 351.661 209.549 1.00 0.00 ? 937  ASP A OD1   1 
ATOM   7162  O  OD2   . ASP A  1  937  ? 263.666 351.450 210.728 1.00 0.00 ? 937  ASP A OD2   1 
ATOM   7163  N  N     . LEU A  1  938  ? 267.038 349.924 212.208 1.00 0.00 ? 938  LEU A N     1 
ATOM   7164  C  CA    . LEU A  1  938  ? 267.894 350.600 213.186 1.00 0.00 ? 938  LEU A CA    1 
ATOM   7165  C  C     . LEU A  1  938  ? 269.020 349.695 213.675 1.00 0.00 ? 938  LEU A C     1 
ATOM   7166  O  O     . LEU A  1  938  ? 269.841 350.101 214.496 1.00 0.00 ? 938  LEU A O     1 
ATOM   7167  C  CB    . LEU A  1  938  ? 267.070 351.084 214.384 1.00 0.00 ? 938  LEU A CB    1 
ATOM   7168  C  CG    . LEU A  1  938  ? 265.978 352.130 214.155 1.00 0.00 ? 938  LEU A CG    1 
ATOM   7169  C  CD1   . LEU A  1  938  ? 265.175 352.342 215.427 1.00 0.00 ? 938  LEU A CD1   1 
ATOM   7170  C  CD2   . LEU A  1  938  ? 266.562 353.447 213.683 1.00 0.00 ? 938  LEU A CD2   1 
ATOM   7171  N  N     . VAL A  1  939  ? 269.043 348.465 213.176 1.00 0.00 ? 939  VAL A N     1 
ATOM   7172  C  CA    . VAL A  1  939  ? 269.988 347.461 213.644 1.00 0.00 ? 939  VAL A CA    1 
ATOM   7173  C  C     . VAL A  1  939  ? 271.407 347.818 213.182 1.00 0.00 ? 939  VAL A C     1 
ATOM   7174  O  O     . VAL A  1  939  ? 272.399 347.356 213.752 1.00 0.00 ? 939  VAL A O     1 
ATOM   7175  C  CB    . VAL A  1  939  ? 269.572 346.051 213.136 1.00 0.00 ? 939  VAL A CB    1 
ATOM   7176  C  CG1   . VAL A  1  939  ? 270.530 344.966 213.614 1.00 0.00 ? 939  VAL A CG1   1 
ATOM   7177  C  CG2   . VAL A  1  939  ? 268.149 345.730 213.580 1.00 0.00 ? 939  VAL A CG2   1 
ATOM   7178  N  N     . LYS A  1  940  ? 271.501 348.674 212.169 1.00 0.00 ? 940  LYS A N     1 
ATOM   7179  C  CA    . LYS A  1  940  ? 272.784 349.256 211.786 1.00 0.00 ? 940  LYS A CA    1 
ATOM   7180  C  C     . LYS A  1  940  ? 273.452 349.975 212.963 1.00 0.00 ? 940  LYS A C     1 
ATOM   7181  O  O     . LYS A  1  940  ? 274.662 350.202 212.952 1.00 0.00 ? 940  LYS A O     1 
ATOM   7182  C  CB    . LYS A  1  940  ? 272.653 350.171 210.555 1.00 0.00 ? 940  LYS A CB    1 
ATOM   7183  C  CG    . LYS A  1  940  ? 272.278 351.640 210.748 1.00 0.00 ? 940  LYS A CG    1 
ATOM   7184  C  CD    . LYS A  1  940  ? 270.900 351.835 211.348 1.00 0.00 ? 940  LYS A CD    1 
ATOM   7185  C  CE    . LYS A  1  940  ? 270.557 353.315 211.408 1.00 0.00 ? 940  LYS A CE    1 
ATOM   7186  N  NZ    . LYS A  1  940  ? 269.317 353.579 212.172 1.00 0.00 ? 940  LYS A NZ    1 
ATOM   7187  N  N     . ASP A  1  941  ? 272.663 350.335 213.971 1.00 0.00 ? 941  ASP A N     1 
ATOM   7188  C  CA    . ASP A  1  941  ? 273.199 351.021 215.142 1.00 0.00 ? 941  ASP A CA    1 
ATOM   7189  C  C     . ASP A  1  941  ? 273.777 350.054 216.176 1.00 0.00 ? 941  ASP A C     1 
ATOM   7190  O  O     . ASP A  1  941  ? 274.559 350.465 217.035 1.00 0.00 ? 941  ASP A O     1 
ATOM   7191  C  CB    . ASP A  1  941  ? 272.114 351.879 215.797 1.00 0.00 ? 941  ASP A CB    1 
ATOM   7192  C  CG    . ASP A  1  941  ? 271.549 352.924 214.859 1.00 0.00 ? 941  ASP A CG    1 
ATOM   7193  O  OD1   . ASP A  1  941  ? 272.349 353.671 214.251 1.00 0.00 ? 941  ASP A OD1   1 
ATOM   7194  O  OD2   . ASP A  1  941  ? 270.305 352.988 214.723 1.00 0.00 ? 941  ASP A OD2   1 
ATOM   7195  N  N     . VAL A  1  942  ? 273.414 348.775 216.095 1.00 0.00 ? 942  VAL A N     1 
ATOM   7196  C  CA    . VAL A  1  942  ? 273.882 347.808 217.090 1.00 0.00 ? 942  VAL A CA    1 
ATOM   7197  C  C     . VAL A  1  942  ? 274.951 346.893 216.502 1.00 0.00 ? 942  VAL A C     1 
ATOM   7198  O  O     . VAL A  1  942  ? 275.238 345.824 217.044 1.00 0.00 ? 942  VAL A O     1 
ATOM   7199  C  CB    . VAL A  1  942  ? 272.738 346.947 217.650 1.00 0.00 ? 942  VAL A CB    1 
ATOM   7200  C  CG1   . VAL A  1  942  ? 271.678 347.831 218.283 1.00 0.00 ? 942  VAL A CG1   1 
ATOM   7201  C  CG2   . VAL A  1  942  ? 272.135 346.098 216.561 1.00 0.00 ? 942  VAL A CG2   1 
ATOM   7202  N  N     . LEU A  1  943  ? 275.530 347.319 215.385 1.00 0.00 ? 943  LEU A N     1 
ATOM   7203  C  CA    . LEU A  1  943  ? 276.648 346.607 214.775 1.00 0.00 ? 943  LEU A CA    1 
ATOM   7204  C  C     . LEU A  1  943  ? 277.928 346.773 215.580 1.00 0.00 ? 943  LEU A C     1 
ATOM   7205  O  O     . LEU A  1  943  ? 278.874 346.004 215.424 1.00 0.00 ? 943  LEU A O     1 
ATOM   7206  C  CB    . LEU A  1  943  ? 276.876 347.093 213.346 1.00 0.00 ? 943  LEU A CB    1 
ATOM   7207  C  CG    . LEU A  1  943  ? 275.670 346.964 212.419 1.00 0.00 ? 943  LEU A CG    1 
ATOM   7208  C  CD1   . LEU A  1  943  ? 276.004 347.545 211.056 1.00 0.00 ? 943  LEU A CD1   1 
ATOM   7209  C  CD2   . LEU A  1  943  ? 275.234 345.505 212.310 1.00 0.00 ? 943  LEU A CD2   1 
ATOM   7210  N  N     . SER A  1  944  ? 277.959 347.790 216.432 1.00 0.00 ? 944  SER A N     1 
ATOM   7211  C  CA    . SER A  1  944  ? 279.160 348.099 217.190 1.00 0.00 ? 944  SER A CA    1 
ATOM   7212  C  C     . SER A  1  944  ? 279.149 347.388 218.542 1.00 0.00 ? 944  SER A C     1 
ATOM   7213  O  O     . SER A  1  944  ? 280.097 347.508 219.319 1.00 0.00 ? 944  SER A O     1 
ATOM   7214  C  CB    . SER A  1  944  ? 279.285 349.612 217.385 1.00 0.00 ? 944  SER A CB    1 
ATOM   7215  O  OG    . SER A  1  944  ? 279.245 350.293 216.142 1.00 0.00 ? 944  SER A OG    1 
ATOM   7216  N  N     . ASN A  1  945  ? 278.076 346.649 218.816 1.00 0.00 ? 945  ASN A N     1 
ATOM   7217  C  CA    . ASN A  1  945  ? 277.921 345.949 220.094 1.00 0.00 ? 945  ASN A CA    1 
ATOM   7218  C  C     . ASN A  1  945  ? 278.697 344.631 220.189 1.00 0.00 ? 945  ASN A C     1 
ATOM   7219  O  O     . ASN A  1  945  ? 278.519 343.715 219.380 1.00 0.00 ? 945  ASN A O     1 
ATOM   7220  C  CB    . ASN A  1  945  ? 276.437 345.680 220.372 1.00 0.00 ? 945  ASN A CB    1 
ATOM   7221  C  CG    . ASN A  1  945  ? 276.177 345.210 221.801 1.00 0.00 ? 945  ASN A CG    1 
ATOM   7222  O  OD1   . ASN A  1  945  ? 276.903 344.381 222.349 1.00 0.00 ? 945  ASN A OD1   1 
ATOM   7223  N  ND2   . ASN A  1  945  ? 275.122 345.740 222.405 1.00 0.00 ? 945  ASN A ND2   1 
ATOM   7224  N  N     . ALA A  1  946  ? 279.530 344.548 221.222 1.00 0.00 ? 946  ALA A N     1 
ATOM   7225  C  CA    . ALA A  1  946  ? 280.347 343.375 221.524 1.00 0.00 ? 946  ALA A CA    1 
ATOM   7226  C  C     . ALA A  1  946  ? 279.518 342.244 222.130 1.00 0.00 ? 946  ALA A C     1 
ATOM   7227  O  O     . ALA A  1  946  ? 279.632 341.083 221.734 1.00 0.00 ? 946  ALA A O     1 
ATOM   7228  C  CB    . ALA A  1  946  ? 281.484 343.755 222.460 1.00 0.00 ? 946  ALA A CB    1 
ATOM   7229  N  N     . HIS A  1  947  ? 278.669 342.613 223.083 1.00 0.00 ? 947  HIS A N     1 
ATOM   7230  C  CA    . HIS A  1  947  ? 277.788 341.684 223.785 1.00 0.00 ? 947  HIS A CA    1 
ATOM   7231  C  C     . HIS A  1  947  ? 276.816 340.978 222.851 1.00 0.00 ? 947  HIS A C     1 
ATOM   7232  O  O     . HIS A  1  947  ? 276.599 339.770 222.960 1.00 0.00 ? 947  HIS A O     1 
ATOM   7233  C  CB    . HIS A  1  947  ? 277.006 342.420 224.872 1.00 0.00 ? 947  HIS A CB    1 
ATOM   7234  C  CG    . HIS A  1  947  ? 275.998 341.563 225.572 1.00 0.00 ? 947  HIS A CG    1 
ATOM   7235  N  ND1   . HIS A  1  947  ? 276.354 340.506 226.379 1.00 0.00 ? 947  HIS A ND1   1 
ATOM   7236  C  CD2   . HIS A  1  947  ? 274.645 341.595 225.566 1.00 0.00 ? 947  HIS A CD2   1 
ATOM   7237  C  CE1   . HIS A  1  947  ? 275.263 339.930 226.853 1.00 0.00 ? 947  HIS A CE1   1 
ATOM   7238  N  NE2   . HIS A  1  947  ? 274.212 340.572 226.374 1.00 0.00 ? 947  HIS A NE2   1 
ATOM   7239  N  N     . ILE A  1  948  ? 276.227 341.735 221.940 1.00 0.00 ? 948  ILE A N     1 
ATOM   7240  C  CA    . ILE A  1  948  ? 275.273 341.173 220.999 1.00 0.00 ? 948  ILE A CA    1 
ATOM   7241  C  C     . ILE A  1  948  ? 275.992 340.209 220.061 1.00 0.00 ? 948  ILE A C     1 
ATOM   7242  O  O     . ILE A  1  948  ? 275.467 339.141 219.725 1.00 0.00 ? 948  ILE A O     1 
ATOM   7243  C  CB    . ILE A  1  948  ? 274.556 342.263 220.177 1.00 0.00 ? 948  ILE A CB    1 
ATOM   7244  C  CG1   . ILE A  1  948  ? 273.643 343.099 221.074 1.00 0.00 ? 948  ILE A CG1   1 
ATOM   7245  C  CG2   . ILE A  1  948  ? 273.734 341.639 219.058 1.00 0.00 ? 948  ILE A CG2   1 
ATOM   7246  C  CD1   . ILE A  1  948  ? 272.994 344.261 220.354 1.00 0.00 ? 948  ILE A CD1   1 
ATOM   7247  N  N     . GLN A  1  949  ? 277.216 340.563 219.680 1.00 0.00 ? 949  GLN A N     1 
ATOM   7248  C  CA    . GLN A  1  949  ? 278.038 339.650 218.897 1.00 0.00 ? 949  GLN A CA    1 
ATOM   7249  C  C     . GLN A  1  949  ? 278.383 338.347 219.603 1.00 0.00 ? 949  GLN A C     1 
ATOM   7250  O  O     . GLN A  1  949  ? 278.372 337.284 218.985 1.00 0.00 ? 949  GLN A O     1 
ATOM   7251  C  CB    . GLN A  1  949  ? 279.362 340.321 218.518 1.00 0.00 ? 949  GLN A CB    1 
ATOM   7252  C  CG    . GLN A  1  949  ? 279.319 341.234 217.330 1.00 0.00 ? 949  GLN A CG    1 
ATOM   7253  C  CD    . GLN A  1  949  ? 280.612 341.977 217.143 1.00 0.00 ? 949  GLN A CD    1 
ATOM   7254  O  OE1   . GLN A  1  949  ? 281.569 341.776 217.891 1.00 0.00 ? 949  GLN A OE1   1 
ATOM   7255  N  NE2   . GLN A  1  949  ? 280.659 342.840 216.138 1.00 0.00 ? 949  GLN A NE2   1 
ATOM   7256  N  N     . ASN A  1  950  ? 278.698 338.420 220.889 1.00 0.00 ? 950  ASN A N     1 
ATOM   7257  C  CA    . ASN A  1  950  ? 279.030 337.210 221.618 1.00 0.00 ? 950  ASN A CA    1 
ATOM   7258  C  C     . ASN A  1  950  ? 277.824 336.292 221.912 1.00 0.00 ? 950  ASN A C     1 
ATOM   7259  O  O     . ASN A  1  950  ? 277.935 335.064 221.849 1.00 0.00 ? 950  ASN A O     1 
ATOM   7260  C  CB    . ASN A  1  950  ? 279.733 337.591 222.928 1.00 0.00 ? 950  ASN A CB    1 
ATOM   7261  C  CG    . ASN A  1  950  ? 280.080 336.388 223.775 1.00 0.00 ? 950  ASN A CG    1 
ATOM   7262  O  OD1   . ASN A  1  950  ? 280.870 335.540 223.365 1.00 0.00 ? 950  ASN A OD1   1 
ATOM   7263  N  ND2   . ASN A  1  950  ? 279.483 336.302 224.961 1.00 0.00 ? 950  ASN A ND2   1 
ATOM   7264  N  N     . GLU A  1  951  ? 276.678 336.898 222.210 1.00 0.00 ? 951  GLU A N     1 
ATOM   7265  C  CA    . GLU A  1  951  ? 275.436 336.160 222.441 1.00 0.00 ? 951  GLU A CA    1 
ATOM   7266  C  C     . GLU A  1  951  ? 274.847 335.403 221.244 1.00 0.00 ? 951  GLU A C     1 
ATOM   7267  O  O     . GLU A  1  951  ? 274.306 334.309 221.393 1.00 0.00 ? 951  GLU A O     1 
ATOM   7268  C  CB    . GLU A  1  951  ? 274.386 337.138 222.969 1.00 0.00 ? 951  GLU A CB    1 
ATOM   7269  C  CG    . GLU A  1  951  ? 273.047 336.510 223.280 1.00 0.00 ? 951  GLU A CG    1 
ATOM   7270  C  CD    . GLU A  1  951  ? 273.121 335.556 224.452 1.00 0.00 ? 951  GLU A CD    1 
ATOM   7271  O  OE1   . GLU A  1  951  ? 274.011 335.741 225.312 1.00 0.00 ? 951  GLU A OE1   1 
ATOM   7272  O  OE2   . GLU A  1  951  ? 272.294 334.620 224.509 1.00 0.00 ? 951  GLU A OE2   1 
ATOM   7273  N  N     . LEU A  1  952  ? 274.966 335.991 220.062 1.00 0.00 ? 952  LEU A N     1 
ATOM   7274  C  CA    . LEU A  1  952  ? 274.546 335.347 218.826 1.00 0.00 ? 952  LEU A CA    1 
ATOM   7275  C  C     . LEU A  1  952  ? 275.534 334.272 218.404 1.00 0.00 ? 952  LEU A C     1 
ATOM   7276  O  O     . LEU A  1  952  ? 275.173 333.230 217.866 1.00 0.00 ? 952  LEU A O     1 
ATOM   7277  C  CB    . LEU A  1  952  ? 274.350 336.368 217.696 1.00 0.00 ? 952  LEU A CB    1 
ATOM   7278  C  CG    . LEU A  1  952  ? 273.156 337.327 217.805 1.00 0.00 ? 952  LEU A CG    1 
ATOM   7279  C  CD1   . LEU A  1  952  ? 273.262 338.434 216.774 1.00 0.00 ? 952  LEU A CD1   1 
ATOM   7280  C  CD2   . LEU A  1  952  ? 271.833 336.568 217.649 1.00 0.00 ? 952  LEU A CD2   1 
ATOM   7281  N  N     . GLU A  1  953  ? 276.802 334.557 218.641 1.00 0.00 ? 953  GLU A N     1 
ATOM   7282  C  CA    . GLU A  1  953  ? 277.893 333.630 218.470 1.00 0.00 ? 953  GLU A CA    1 
ATOM   7283  C  C     . GLU A  1  953  ? 277.713 332.427 219.412 1.00 0.00 ? 953  GLU A C     1 
ATOM   7284  O  O     . GLU A  1  953  ? 278.046 331.302 219.068 1.00 0.00 ? 953  GLU A O     1 
ATOM   7285  C  CB    . GLU A  1  953  ? 279.205 334.339 218.706 1.00 0.00 ? 953  GLU A CB    1 
ATOM   7286  C  CG    . GLU A  1  953  ? 280.422 333.627 218.210 1.00 0.00 ? 953  GLU A CG    1 
ATOM   7287  C  CD    . GLU A  1  953  ? 280.344 333.574 216.686 1.00 0.00 ? 953  GLU A CD    1 
ATOM   7288  O  OE1   . GLU A  1  953  ? 280.373 332.468 216.109 1.00 0.00 ? 953  GLU A OE1   1 
ATOM   7289  O  OE2   . GLU A  1  953  ? 280.112 334.624 216.063 1.00 0.00 ? 953  GLU A OE2   1 
ATOM   7290  N  N     . ARG A  1  954  ? 277.123 332.702 220.575 1.00 0.00 ? 954  ARG A N     1 
ATOM   7291  C  CA    . ARG A  1  954  ? 276.666 331.667 221.488 1.00 0.00 ? 954  ARG A CA    1 
ATOM   7292  C  C     . ARG A  1  954  ? 275.458 330.865 220.956 1.00 0.00 ? 954  ARG A C     1 
ATOM   7293  O  O     . ARG A  1  954  ? 275.363 329.646 221.138 1.00 0.00 ? 954  ARG A O     1 
ATOM   7294  C  CB    . ARG A  1  954  ? 276.270 332.299 222.823 1.00 0.00 ? 954  ARG A CB    1 
ATOM   7295  C  CG    . ARG A  1  954  ? 277.339 332.367 223.889 1.00 0.00 ? 954  ARG A CG    1 
ATOM   7296  C  CD    . ARG A  1  954  ? 278.313 331.202 223.858 1.00 0.00 ? 954  ARG A CD    1 
ATOM   7297  N  NE    . ARG A  1  954  ? 279.423 331.480 224.762 1.00 0.00 ? 954  ARG A NE    1 
ATOM   7298  C  CZ    . ARG A  1  954  ? 280.391 332.354 224.500 1.00 0.00 ? 954  ARG A CZ    1 
ATOM   7299  N  NH1   . ARG A  1  954  ? 280.397 333.013 223.346 1.00 0.00 ? 954  ARG A NH1   1 
ATOM   7300  N  NH2   . ARG A  1  954  ? 281.339 332.590 225.399 1.00 0.00 ? 954  ARG A NH2   1 
ATOM   7301  N  N     . GLU A  1  955  ? 274.552 331.559 220.278 1.00 0.00 ? 955  GLU A N     1 
ATOM   7302  C  CA    . GLU A  1  955  ? 273.402 330.960 219.599 1.00 0.00 ? 955  GLU A CA    1 
ATOM   7303  C  C     . GLU A  1  955  ? 273.797 329.972 218.510 1.00 0.00 ? 955  GLU A C     1 
ATOM   7304  O  O     . GLU A  1  955  ? 273.284 328.858 218.439 1.00 0.00 ? 955  GLU A O     1 
ATOM   7305  C  CB    . GLU A  1  955  ? 272.525 332.051 218.986 1.00 0.00 ? 955  GLU A CB    1 
ATOM   7306  C  CG    . GLU A  1  955  ? 271.253 331.530 218.348 1.00 0.00 ? 955  GLU A CG    1 
ATOM   7307  C  CD    . GLU A  1  955  ? 270.679 332.506 217.340 1.00 0.00 ? 955  GLU A CD    1 
ATOM   7308  O  OE1   . GLU A  1  955  ? 271.451 333.013 216.504 1.00 0.00 ? 955  GLU A OE1   1 
ATOM   7309  O  OE2   . GLU A  1  955  ? 269.457 332.772 217.387 1.00 0.00 ? 955  GLU A OE2   1 
ATOM   7310  N  N     . PHE A  1  956  ? 274.737 330.405 217.681 1.00 0.00 ? 956  PHE A N     1 
ATOM   7311  C  CA    . PHE A  1  956  ? 275.298 329.598 216.611 1.00 0.00 ? 956  PHE A CA    1 
ATOM   7312  C  C     . PHE A  1  956  ? 276.065 328.409 217.182 1.00 0.00 ? 956  PHE A C     1 
ATOM   7313  O  O     . PHE A  1  956  ? 276.064 327.335 216.585 1.00 0.00 ? 956  PHE A O     1 
ATOM   7314  C  CB    . PHE A  1  956  ? 276.216 330.446 215.738 1.00 0.00 ? 956  PHE A CB    1 
ATOM   7315  C  CG    . PHE A  1  956  ? 276.674 329.751 214.497 1.00 0.00 ? 956  PHE A CG    1 
ATOM   7316  C  CD1   . PHE A  1  956  ? 275.751 329.327 213.555 1.00 0.00 ? 956  PHE A CD1   1 
ATOM   7317  C  CD2   . PHE A  1  956  ? 278.015 329.496 214.278 1.00 0.00 ? 956  PHE A CD2   1 
ATOM   7318  C  CE1   . PHE A  1  956  ? 276.159 328.687 212.406 1.00 0.00 ? 956  PHE A CE1   1 
ATOM   7319  C  CE2   . PHE A  1  956  ? 278.432 328.846 213.132 1.00 0.00 ? 956  PHE A CE2   1 
ATOM   7320  C  CZ    . PHE A  1  956  ? 277.502 328.442 212.194 1.00 0.00 ? 956  PHE A CZ    1 
ATOM   7321  N  N     . GLU A  1  957  ? 276.748 328.611 218.305 1.00 0.00 ? 957  GLU A N     1 
ATOM   7322  C  CA    . GLU A  1  957  ? 277.379 327.507 219.039 1.00 0.00 ? 957  GLU A CA    1 
ATOM   7323  C  C     . GLU A  1  957  ? 276.379 326.426 219.502 1.00 0.00 ? 957  GLU A C     1 
ATOM   7324  O  O     . GLU A  1  957  ? 276.684 325.233 219.416 1.00 0.00 ? 957  GLU A O     1 
ATOM   7325  C  CB    . GLU A  1  957  ? 278.159 328.026 220.244 1.00 0.00 ? 957  GLU A CB    1 
ATOM   7326  C  CG    . GLU A  1  957  ? 278.979 326.933 220.930 1.00 0.00 ? 957  GLU A CG    1 
ATOM   7327  C  CD    . GLU A  1  957  ? 280.116 327.480 221.775 1.00 0.00 ? 957  GLU A CD    1 
ATOM   7328  O  OE1   . GLU A  1  957  ? 279.860 327.903 222.924 1.00 0.00 ? 957  GLU A OE1   1 
ATOM   7329  O  OE2   . GLU A  1  957  ? 281.270 327.493 221.288 1.00 0.00 ? 957  GLU A OE2   1 
ATOM   7330  N  N     . ARG A  1  958  ? 275.212 326.820 220.010 1.00 0.00 ? 958  ARG A N     1 
ATOM   7331  C  CA    . ARG A  1  958  ? 274.156 325.839 220.303 1.00 0.00 ? 958  ARG A CA    1 
ATOM   7332  C  C     . ARG A  1  958  ? 273.661 325.136 219.042 1.00 0.00 ? 958  ARG A C     1 
ATOM   7333  O  O     . ARG A  1  958  ? 273.505 323.921 219.040 1.00 0.00 ? 958  ARG A O     1 
ATOM   7334  C  CB    . ARG A  1  958  ? 272.961 326.471 221.032 1.00 0.00 ? 958  ARG A CB    1 
ATOM   7335  C  CG    . ARG A  1  958  ? 273.236 326.876 222.463 1.00 0.00 ? 958  ARG A CG    1 
ATOM   7336  C  CD    . ARG A  1  958  ? 272.034 327.543 223.119 1.00 0.00 ? 958  ARG A CD    1 
ATOM   7337  N  NE    . ARG A  1  958  ? 271.711 328.807 222.455 1.00 0.00 ? 958  ARG A NE    1 
ATOM   7338  C  CZ    . ARG A  1  958  ? 271.770 330.004 223.040 1.00 0.00 ? 958  ARG A CZ    1 
ATOM   7339  N  NH1   . ARG A  1  958  ? 272.176 330.113 224.301 1.00 0.00 ? 958  ARG A NH1   1 
ATOM   7340  N  NH2   . ARG A  1  958  ? 271.437 331.099 222.359 1.00 0.00 ? 958  ARG A NH2   1 
ATOM   7341  N  N     . MET A  1  959  ? 273.454 325.879 217.963 1.00 0.00 ? 959  MET A N     1 
ATOM   7342  C  CA    . MET A  1  959  ? 273.034 325.264 216.711 1.00 0.00 ? 959  MET A CA    1 
ATOM   7343  C  C     . MET A  1  959  ? 274.011 324.242 216.148 1.00 0.00 ? 959  MET A C     1 
ATOM   7344  O  O     . MET A  1  959  ? 273.571 323.309 215.503 1.00 0.00 ? 959  MET A O     1 
ATOM   7345  C  CB    . MET A  1  959  ? 272.760 326.338 215.665 1.00 0.00 ? 959  MET A CB    1 
ATOM   7346  C  CG    . MET A  1  959  ? 271.545 327.193 215.984 1.00 0.00 ? 959  MET A CG    1 
ATOM   7347  S  SD    . MET A  1  959  ? 269.996 326.273 215.977 1.00 0.00 ? 959  MET A SD    1 
ATOM   7348  C  CE    . MET A  1  959  ? 269.842 325.866 214.252 1.00 0.00 ? 959  MET A CE    1 
ATOM   7349  N  N     . ARG A  1  960  ? 275.316 324.412 216.312 1.00 0.00 ? 960  ARG A N     1 
ATOM   7350  C  CA    . ARG A  1  960  ? 276.202 323.347 215.843 1.00 0.00 ? 960  ARG A CA    1 
ATOM   7351  C  C     . ARG A  1  960  ? 276.116 322.094 216.711 1.00 0.00 ? 960  ARG A C     1 
ATOM   7352  O  O     . ARG A  1  960  ? 276.292 320.982 216.213 1.00 0.00 ? 960  ARG A O     1 
ATOM   7353  C  CB    . ARG A  1  960  ? 277.646 323.802 215.798 1.00 0.00 ? 960  ARG A CB    1 
ATOM   7354  C  CG    . ARG A  1  960  ? 277.980 324.673 214.625 1.00 0.00 ? 960  ARG A CG    1 
ATOM   7355  C  CD    . ARG A  1  960  ? 279.426 325.030 214.748 1.00 0.00 ? 960  ARG A CD    1 
ATOM   7356  N  NE    . ARG A  1  960  ? 279.627 325.861 215.925 1.00 0.00 ? 960  ARG A NE    1 
ATOM   7357  C  CZ    . ARG A  1  960  ? 280.499 325.585 216.885 1.00 0.00 ? 960  ARG A CZ    1 
ATOM   7358  N  NH1   . ARG A  1  960  ? 281.207 324.461 216.827 1.00 0.00 ? 960  ARG A NH1   1 
ATOM   7359  N  NH2   . ARG A  1  960  ? 280.649 326.421 217.905 1.00 0.00 ? 960  ARG A NH2   1 
ATOM   7360  N  N     . GLU A  1  961  ? 275.941 322.284 218.018 1.00 0.00 ? 961  GLU A N     1 
ATOM   7361  C  CA    . GLU A  1  961  ? 275.764 321.169 218.954 1.00 0.00 ? 961  GLU A CA    1 
ATOM   7362  C  C     . GLU A  1  961  ? 274.411 320.448 218.768 1.00 0.00 ? 961  GLU A C     1 
ATOM   7363  O  O     . GLU A  1  961  ? 274.341 319.232 218.891 1.00 0.00 ? 961  GLU A O     1 
ATOM   7364  C  CB    . GLU A  1  961  ? 275.929 321.625 220.396 1.00 0.00 ? 961  GLU A CB    1 
ATOM   7365  C  CG    . GLU A  1  961  ? 276.074 320.452 221.341 1.00 0.00 ? 961  GLU A CG    1 
ATOM   7366  C  CD    . GLU A  1  961  ? 276.258 320.876 222.783 1.00 0.00 ? 961  GLU A CD    1 
ATOM   7367  O  OE1   . GLU A  1  961  ? 277.354 321.399 223.112 1.00 0.00 ? 961  GLU A OE1   1 
ATOM   7368  O  OE2   . GLU A  1  961  ? 275.310 320.666 223.581 1.00 0.00 ? 961  GLU A OE2   1 
ATOM   7369  N  N     . ASP A  1  962  ? 273.337 321.202 218.542 1.00 0.00 ? 962  ASP A N     1 
ATOM   7370  C  CA    . ASP A  1  962  ? 272.025 320.625 218.234 1.00 0.00 ? 962  ASP A CA    1 
ATOM   7371  C  C     . ASP A  1  962  ? 272.065 319.876 216.941 1.00 0.00 ? 962  ASP A C     1 
ATOM   7372  O  O     . ASP A  1  962  ? 271.504 318.807 216.838 1.00 0.00 ? 962  ASP A O     1 
ATOM   7373  C  CB    . ASP A  1  962  ? 270.919 321.662 218.187 1.00 0.00 ? 962  ASP A CB    1 
ATOM   7374  C  CG    . ASP A  1  962  ? 270.608 322.219 219.545 1.00 0.00 ? 962  ASP A CG    1 
ATOM   7375  O  OD1   . ASP A  1  962  ? 270.879 321.487 220.521 1.00 0.00 ? 962  ASP A OD1   1 
ATOM   7376  O  OD2   . ASP A  1  962  ? 270.040 323.333 219.640 1.00 0.00 ? 962  ASP A OD2   1 
ATOM   7377  N  N     . ARG A  1  963  ? 272.699 320.455 215.943 1.00 0.00 ? 963  ARG A N     1 
ATOM   7378  C  CA    . ARG A  1  963  ? 272.814 319.803 214.664 1.00 0.00 ? 963  ARG A CA    1 
ATOM   7379  C  C     . ARG A  1  963  ? 273.564 318.501 214.905 1.00 0.00 ? 963  ARG A C     1 
ATOM   7380  O  O     . ARG A  1  963  ? 273.206 317.499 214.325 1.00 0.00 ? 963  ARG A O     1 
ATOM   7381  C  CB    . ARG A  1  963  ? 273.541 320.683 213.666 1.00 0.00 ? 963  ARG A CB    1 
ATOM   7382  C  CG    . ARG A  1  963  ? 273.999 319.978 212.421 1.00 0.00 ? 963  ARG A CG    1 
ATOM   7383  C  CD    . ARG A  1  963  ? 274.599 320.981 211.472 1.00 0.00 ? 963  ARG A CD    1 
ATOM   7384  N  NE    . ARG A  1  963  ? 275.360 320.333 210.420 1.00 0.00 ? 963  ARG A NE    1 
ATOM   7385  C  CZ    . ARG A  1  963  ? 274.864 320.051 209.221 1.00 0.00 ? 963  ARG A CZ    1 
ATOM   7386  N  NH1   . ARG A  1  963  ? 273.603 320.349 208.944 1.00 0.00 ? 963  ARG A NH1   1 
ATOM   7387  N  NH2   . ARG A  1  963  ? 275.648 319.576 208.267 1.00 0.00 ? 963  ARG A NH2   1 
ATOM   7388  N  N     . GLU A  1  964  ? 274.573 318.488 215.776 1.00 0.00 ? 964  GLU A N     1 
ATOM   7389  C  CA    . GLU A  1  964  ? 275.293 317.239 216.051 1.00 0.00 ? 964  GLU A CA    1 
ATOM   7390  C  C     . GLU A  1  964  ? 274.455 316.159 216.763 1.00 0.00 ? 964  GLU A C     1 
ATOM   7391  O  O     . GLU A  1  964  ? 274.572 314.988 216.414 1.00 0.00 ? 964  GLU A O     1 
ATOM   7392  C  CB    . GLU A  1  964  ? 276.524 317.543 216.907 1.00 0.00 ? 964  GLU A CB    1 
ATOM   7393  C  CG    . GLU A  1  964  ? 277.670 316.568 216.766 1.00 0.00 ? 964  GLU A CG    1 
ATOM   7394  C  CD    . GLU A  1  964  ? 278.188 316.438 215.348 1.00 0.00 ? 964  GLU A CD    1 
ATOM   7395  O  OE1   . GLU A  1  964  ? 278.970 317.307 214.906 1.00 0.00 ? 964  GLU A OE1   1 
ATOM   7396  O  OE2   . GLU A  1  964  ? 277.836 315.440 214.682 1.00 0.00 ? 964  GLU A OE2   1 
ATOM   7397  N  N     . VAL A  1  965  ? 273.660 316.517 217.773 1.00 0.00 ? 965  VAL A N     1 
ATOM   7398  C  CA    . VAL A  1  965  ? 272.756 315.561 218.434 1.00 0.00 ? 965  VAL A CA    1 
ATOM   7399  C  C     . VAL A  1  965  ? 271.649 315.024 217.524 1.00 0.00 ? 965  VAL A C     1 
ATOM   7400  O  O     . VAL A  1  965  ? 271.326 313.838 217.539 1.00 0.00 ? 965  VAL A O     1 
ATOM   7401  C  CB    . VAL A  1  965  ? 272.096 316.211 219.677 1.00 0.00 ? 965  VAL A CB    1 
ATOM   7402  C  CG1   . VAL A  1  965  ? 270.850 315.471 220.099 1.00 0.00 ? 965  VAL A CG1   1 
ATOM   7403  C  CG2   . VAL A  1  965  ? 273.092 316.310 220.823 1.00 0.00 ? 965  VAL A CG2   1 
ATOM   7404  N  N     . LEU A  1  966  ? 271.075 315.930 216.739 1.00 0.00 ? 966  LEU A N     1 
ATOM   7405  C  CA    . LEU A  1  966  ? 270.023 315.617 215.776 1.00 0.00 ? 966  LEU A CA    1 
ATOM   7406  C  C     . LEU A  1  966  ? 270.497 314.638 214.679 1.00 0.00 ? 966  LEU A C     1 
ATOM   7407  O  O     . LEU A  1  966  ? 269.724 313.821 214.194 1.00 0.00 ? 966  LEU A O     1 
ATOM   7408  C  CB    . LEU A  1  966  ? 269.492 316.932 215.193 1.00 0.00 ? 966  LEU A CB    1 
ATOM   7409  C  CG    . LEU A  1  966  ? 268.270 316.941 214.299 1.00 0.00 ? 966  LEU A CG    1 
ATOM   7410  C  CD1   . LEU A  1  966  ? 267.216 316.271 215.102 1.00 0.00 ? 966  LEU A CD1   1 
ATOM   7411  C  CD2   . LEU A  1  966  ? 267.849 318.355 213.998 1.00 0.00 ? 966  LEU A CD2   1 
ATOM   7412  N  N     . ARG A  1  967  ? 271.756 314.751 214.267 1.00 0.00 ? 967  ARG A N     1 
ATOM   7413  C  CA    . ARG A  1  967  ? 272.376 313.759 213.392 1.00 0.00 ? 967  ARG A CA    1 
ATOM   7414  C  C     . ARG A  1  967  ? 272.514 312.394 214.049 1.00 0.00 ? 967  ARG A C     1 
ATOM   7415  O  O     . ARG A  1  967  ? 272.461 311.385 213.366 1.00 0.00 ? 967  ARG A O     1 
ATOM   7416  C  CB    . ARG A  1  967  ? 273.727 314.255 212.874 1.00 0.00 ? 967  ARG A CB    1 
ATOM   7417  C  CG    . ARG A  1  967  ? 273.585 315.496 212.002 1.00 0.00 ? 967  ARG A CG    1 
ATOM   7418  C  CD    . ARG A  1  967  ? 274.762 315.712 211.074 1.00 0.00 ? 967  ARG A CD    1 
ATOM   7419  N  NE    . ARG A  1  967  ? 275.892 316.180 211.870 1.00 0.00 ? 967  ARG A NE    1 
ATOM   7420  C  CZ    . ARG A  1  967  ? 277.050 316.609 211.381 1.00 0.00 ? 967  ARG A CZ    1 
ATOM   7421  N  NH1   . ARG A  1  967  ? 277.241 316.659 210.067 1.00 0.00 ? 967  ARG A NH1   1 
ATOM   7422  N  NH2   . ARG A  1  967  ? 278.028 316.965 212.213 1.00 0.00 ? 967  ARG A NH2   1 
ATOM   7423  N  N     . VAL A  1  968  ? 272.670 312.353 215.367 1.00 0.00 ? 968  VAL A N     1 
ATOM   7424  C  CA    . VAL A  1  968  ? 272.696 311.069 216.065 1.00 0.00 ? 968  VAL A CA    1 
ATOM   7425  C  C     . VAL A  1  968  ? 271.328 310.426 216.215 1.00 0.00 ? 968  VAL A C     1 
ATOM   7426  O  O     . VAL A  1  968  ? 271.202 309.215 216.030 1.00 0.00 ? 968  VAL A O     1 
ATOM   7427  C  CB    . VAL A  1  968  ? 273.309 311.208 217.471 1.00 0.00 ? 968  VAL A CB    1 
ATOM   7428  C  CG1   . VAL A  1  968  ? 273.423 309.854 218.143 1.00 0.00 ? 968  VAL A CG1   1 
ATOM   7429  C  CG2   . VAL A  1  968  ? 274.664 311.906 217.397 1.00 0.00 ? 968  VAL A CG2   1 
ATOM   7430  N  N     . ILE A  1  969  ? 270.311 311.241 216.501 1.00 0.00 ? 969  ILE A N     1 
ATOM   7431  C  CA    . ILE A  1  969  ? 268.913 310.787 216.604 1.00 0.00 ? 969  ILE A CA    1 
ATOM   7432  C  C     . ILE A  1  969  ? 268.333 310.190 215.312 1.00 0.00 ? 969  ILE A C     1 
ATOM   7433  O  O     . ILE A  1  969  ? 267.645 309.172 215.339 1.00 0.00 ? 969  ILE A O     1 
ATOM   7434  C  CB    . ILE A  1  969  ? 267.990 311.939 217.007 1.00 0.00 ? 969  ILE A CB    1 
ATOM   7435  C  CG1   . ILE A  1  969  ? 268.373 312.505 218.360 1.00 0.00 ? 969  ILE A CG1   1 
ATOM   7436  C  CG2   . ILE A  1  969  ? 266.555 311.495 217.035 1.00 0.00 ? 969  ILE A CG2   1 
ATOM   7437  C  CD1   . ILE A  1  969  ? 267.605 313.776 218.677 1.00 0.00 ? 969  ILE A CD1   1 
ATOM   7438  N  N     . PHE A  1  970  ? 268.608 310.830 214.184 1.00 0.00 ? 970  PHE A N     1 
ATOM   7439  C  CA    . PHE A  1  970  ? 268.068 310.387 212.907 1.00 0.00 ? 970  PHE A CA    1 
ATOM   7440  C  C     . PHE A  1  970  ? 269.163 309.992 211.946 1.00 0.00 ? 970  PHE A C     1 
ATOM   7441  O  O     . PHE A  1  970  ? 269.403 310.701 210.979 1.00 0.00 ? 970  PHE A O     1 
ATOM   7442  C  CB    . PHE A  1  970  ? 267.243 311.499 212.279 1.00 0.00 ? 970  PHE A CB    1 
ATOM   7443  C  CG    . PHE A  1  970  ? 266.035 311.862 213.065 1.00 0.00 ? 970  PHE A CG    1 
ATOM   7444  C  CD1   . PHE A  1  970  ? 265.036 310.939 213.277 1.00 0.00 ? 970  PHE A CD1   1 
ATOM   7445  C  CD2   . PHE A  1  970  ? 265.894 313.125 213.601 1.00 0.00 ? 970  PHE A CD2   1 
ATOM   7446  C  CE1   . PHE A  1  970  ? 263.917 311.277 214.002 1.00 0.00 ? 970  PHE A CE1   1 
ATOM   7447  C  CE2   . PHE A  1  970  ? 264.780 313.466 214.325 1.00 0.00 ? 970  PHE A CE2   1 
ATOM   7448  C  CZ    . PHE A  1  970  ? 263.795 312.543 214.528 1.00 0.00 ? 970  PHE A CZ    1 
ATOM   7449  N  N     . PRO A  1  971  ? 269.804 308.839 212.180 1.00 0.00 ? 971  PRO A N     1 
ATOM   7450  C  CA    . PRO A  1  971  ? 270.975 308.473 211.377 1.00 0.00 ? 971  PRO A CA    1 
ATOM   7451  C  C     . PRO A  1  971  ? 270.639 308.281 209.903 1.00 0.00 ? 971  PRO A C     1 
ATOM   7452  O  O     . PRO A  1  971  ? 271.466 308.565 209.036 1.00 0.00 ? 971  PRO A O     1 
ATOM   7453  C  CB    . PRO A  1  971  ? 271.427 307.155 212.005 1.00 0.00 ? 971  PRO A CB    1 
ATOM   7454  C  CG    . PRO A  1  971  ? 270.178 306.581 212.587 1.00 0.00 ? 971  PRO A CG    1 
ATOM   7455  C  CD    . PRO A  1  971  ? 269.401 307.762 213.097 1.00 0.00 ? 971  PRO A CD    1 
ATOM   7456  N  N     . THR A  1  972  ? 269.422 307.828 209.634 1.00 0.00 ? 972  THR A N     1 
ATOM   7457  C  CA    . THR A  1  972  ? 268.956 307.606 208.273 1.00 0.00 ? 972  THR A CA    1 
ATOM   7458  C  C     . THR A  1  972  ? 268.893 308.887 207.447 1.00 0.00 ? 972  THR A C     1 
ATOM   7459  O  O     . THR A  1  972  ? 269.143 308.870 206.245 1.00 0.00 ? 972  THR A O     1 
ATOM   7460  C  CB    . THR A  1  972  ? 267.569 306.955 208.281 1.00 0.00 ? 972  THR A CB    1 
ATOM   7461  O  OG1   . THR A  1  972  ? 266.632 307.855 208.887 1.00 0.00 ? 972  THR A OG1   1 
ATOM   7462  C  CG2   . THR A  1  972  ? 267.600 305.652 209.075 1.00 0.00 ? 972  THR A CG2   1 
ATOM   7463  N  N     . GLY A  1  973  ? 268.551 309.996 208.088 1.00 0.00 ? 973  GLY A N     1 
ATOM   7464  C  CA    . GLY A  1  973  ? 268.551 311.272 207.399 1.00 0.00 ? 973  GLY A CA    1 
ATOM   7465  C  C     . GLY A  1  973  ? 267.187 311.706 206.893 1.00 0.00 ? 973  GLY A C     1 
ATOM   7466  O  O     . GLY A  1  973  ? 267.079 312.378 205.867 1.00 0.00 ? 973  GLY A O     1 
ATOM   7467  N  N     . ASP A  1  974  ? 266.136 311.296 207.592 1.00 0.00 ? 974  ASP A N     1 
ATOM   7468  C  CA    . ASP A  1  974  ? 264.795 311.794 207.292 1.00 0.00 ? 974  ASP A CA    1 
ATOM   7469  C  C     . ASP A  1  974  ? 264.467 313.067 208.067 1.00 0.00 ? 974  ASP A C     1 
ATOM   7470  O  O     . ASP A  1  974  ? 264.739 313.170 209.264 1.00 0.00 ? 974  ASP A O     1 
ATOM   7471  C  CB    . ASP A  1  974  ? 263.739 310.734 207.589 1.00 0.00 ? 974  ASP A CB    1 
ATOM   7472  C  CG    . ASP A  1  974  ? 262.329 311.205 207.247 1.00 0.00 ? 974  ASP A CG    1 
ATOM   7473  O  OD1   . ASP A  1  974  ? 262.093 311.584 206.071 1.00 0.00 ? 974  ASP A OD1   1 
ATOM   7474  O  OD2   . ASP A  1  974  ? 261.470 311.215 208.163 1.00 0.00 ? 974  ASP A OD2   1 
ATOM   7475  N  N     . SER A  1  975  ? 263.879 314.036 207.378 1.00 0.00 ? 975  SER A N     1 
ATOM   7476  C  CA    . SER A  1  975  ? 263.546 315.306 208.009 1.00 0.00 ? 975  SER A CA    1 
ATOM   7477  C  C     . SER A  1  975  ? 262.077 315.385 208.439 1.00 0.00 ? 975  SER A C     1 
ATOM   7478  O  O     . SER A  1  975  ? 261.650 316.379 209.024 1.00 0.00 ? 975  SER A O     1 
ATOM   7479  C  CB    . SER A  1  975  ? 263.873 316.454 207.060 1.00 0.00 ? 975  SER A CB    1 
ATOM   7480  O  OG    . SER A  1  975  ? 265.046 316.171 206.320 1.00 0.00 ? 975  SER A OG    1 
ATOM   7481  N  N     . LYS A  1  976  ? 261.309 314.337 208.146 1.00 0.00 ? 976  LYS A N     1 
ATOM   7482  C  CA    . LYS A  1  976  ? 259.878 314.305 208.457 1.00 0.00 ? 976  LYS A CA    1 
ATOM   7483  C  C     . LYS A  1  976  ? 259.552 313.802 209.854 1.00 0.00 ? 976  LYS A C     1 
ATOM   7484  O  O     . LYS A  1  976  ? 259.722 312.622 210.120 1.00 0.00 ? 976  LYS A O     1 
ATOM   7485  C  CB    . LYS A  1  976  ? 259.116 313.411 207.466 1.00 0.00 ? 976  LYS A CB    1 
ATOM   7486  C  CG    . LYS A  1  976  ? 259.218 313.777 205.998 1.00 0.00 ? 976  LYS A CG    1 
ATOM   7487  C  CD    . LYS A  1  976  ? 258.657 315.162 205.743 1.00 0.00 ? 976  LYS A CD    1 
ATOM   7488  C  CE    . LYS A  1  976  ? 258.749 315.525 204.266 1.00 0.00 ? 976  LYS A CE    1 
ATOM   7489  N  NZ    . LYS A  1  976  ? 257.883 314.632 203.414 1.00 0.00 ? 976  LYS A NZ    1 
ATOM   7490  N  N     . VAL A  1  977  ? 259.120 314.669 210.762 1.00 0.00 ? 977  VAL A N     1 
ATOM   7491  C  CA    . VAL A  1  977  ? 258.843 314.211 212.119 1.00 0.00 ? 977  VAL A CA    1 
ATOM   7492  C  C     . VAL A  1  977  ? 257.464 314.700 212.482 1.00 0.00 ? 977  VAL A C     1 
ATOM   7493  O  O     . VAL A  1  977  ? 257.012 315.678 211.898 1.00 0.00 ? 977  VAL A O     1 
ATOM   7494  C  CB    . VAL A  1  977  ? 259.815 314.777 213.148 1.00 0.00 ? 977  VAL A CB    1 
ATOM   7495  C  CG1   . VAL A  1  977  ? 261.211 314.252 212.880 1.00 0.00 ? 977  VAL A CG1   1 
ATOM   7496  C  CG2   . VAL A  1  977  ? 259.825 316.288 213.073 1.00 0.00 ? 977  VAL A CG2   1 
ATOM   7497  N  N     . VAL A  1  978  ? 256.745 314.003 213.359 1.00 0.00 ? 978  VAL A N     1 
ATOM   7498  C  CA    . VAL A  1  978  ? 255.500 314.578 213.886 1.00 0.00 ? 978  VAL A CA    1 
ATOM   7499  C  C     . VAL A  1  978  ? 255.774 315.549 215.043 1.00 0.00 ? 978  VAL A C     1 
ATOM   7500  O  O     . VAL A  1  978  ? 256.414 315.163 216.015 1.00 0.00 ? 978  VAL A O     1 
ATOM   7501  C  CB    . VAL A  1  978  ? 254.520 313.501 214.341 1.00 0.00 ? 978  VAL A CB    1 
ATOM   7502  C  CG1   . VAL A  1  978  ? 253.843 312.897 213.144 1.00 0.00 ? 978  VAL A CG1   1 
ATOM   7503  C  CG2   . VAL A  1  978  ? 255.225 312.432 215.133 1.00 0.00 ? 978  VAL A CG2   1 
ATOM   7504  N  N     . LEU A  1  979  ? 255.298 316.791 214.954 1.00 0.00 ? 979  LEU A N     1 
ATOM   7505  C  CA    . LEU A  1  979  ? 255.492 317.754 216.039 1.00 0.00 ? 979  LEU A CA    1 
ATOM   7506  C  C     . LEU A  1  979  ? 254.293 318.679 216.105 1.00 0.00 ? 979  LEU A C     1 
ATOM   7507  O  O     . LEU A  1  979  ? 253.695 318.932 215.090 1.00 0.00 ? 979  LEU A O     1 
ATOM   7508  C  CB    . LEU A  1  979  ? 256.744 318.553 215.751 1.00 0.00 ? 979  LEU A CB    1 
ATOM   7509  C  CG    . LEU A  1  979  ? 258.023 317.797 216.037 1.00 0.00 ? 979  LEU A CG    1 
ATOM   7510  C  CD1   . LEU A  1  979  ? 259.166 318.657 215.649 1.00 0.00 ? 979  LEU A CD1   1 
ATOM   7511  C  CD2   . LEU A  1  979  ? 258.061 317.436 217.500 1.00 0.00 ? 979  LEU A CD2   1 
ATOM   7512  N  N     . PRO A  1  980  ? 254.045 319.346 217.228 1.00 0.00 ? 980  PRO A N     1 
ATOM   7513  C  CA    . PRO A  1  980  ? 252.865 320.222 217.231 1.00 0.00 ? 980  PRO A CA    1 
ATOM   7514  C  C     . PRO A  1  980  ? 253.073 321.577 216.544 1.00 0.00 ? 980  PRO A C     1 
ATOM   7515  O  O     . PRO A  1  980  ? 254.200 321.890 216.193 1.00 0.00 ? 980  PRO A O     1 
ATOM   7516  C  CB    . PRO A  1  980  ? 252.564 320.376 218.721 1.00 0.00 ? 980  PRO A CB    1 
ATOM   7517  C  CG    . PRO A  1  980  ? 253.876 320.284 219.358 1.00 0.00 ? 980  PRO A CG    1 
ATOM   7518  C  CD    . PRO A  1  980  ? 254.643 319.239 218.562 1.00 0.00 ? 980  PRO A CD    1 
ATOM   7519  N  N     . CYS A  1  981  ? 251.984 322.333 216.357 1.00 0.00 ? 981  CYS A N     1 
ATOM   7520  C  CA    . CYS A  1  981  ? 251.940 323.729 215.846 1.00 0.00 ? 981  CYS A CA    1 
ATOM   7521  C  C     . CYS A  1  981  ? 252.177 323.988 214.361 1.00 0.00 ? 981  CYS A C     1 
ATOM   7522  O  O     . CYS A  1  981  ? 251.416 324.745 213.761 1.00 0.00 ? 981  CYS A O     1 
ATOM   7523  C  CB    . CYS A  1  981  ? 252.934 324.598 216.602 1.00 0.00 ? 981  CYS A CB    1 
ATOM   7524  S  SG    . CYS A  1  981  ? 252.690 324.552 218.348 1.00 0.00 ? 981  CYS A SG    1 
ATOM   7525  N  N     . ASN A  1  982  ? 253.207 323.358 213.787 1.00 0.00 ? 982  ASN A N     1 
ATOM   7526  C  CA    . ASN A  1  982  ? 253.705 323.646 212.431 1.00 0.00 ? 982  ASN A CA    1 
ATOM   7527  C  C     . ASN A  1  982  ? 254.203 325.084 212.267 1.00 0.00 ? 982  ASN A C     1 
ATOM   7528  O  O     . ASN A  1  982  ? 253.587 325.893 211.581 1.00 0.00 ? 982  ASN A O     1 
ATOM   7529  C  CB    . ASN A  1  982  ? 252.622 323.357 211.394 1.00 0.00 ? 982  ASN A CB    1 
ATOM   7530  C  CG    . ASN A  1  982  ? 253.147 323.395 209.984 1.00 0.00 ? 982  ASN A CG    1 
ATOM   7531  O  OD1   . ASN A  1  982  ? 254.271 323.826 209.742 1.00 0.00 ? 982  ASN A OD1   1 
ATOM   7532  N  ND2   . ASN A  1  982  ? 252.331 322.958 209.039 1.00 0.00 ? 982  ASN A ND2   1 
ATOM   7533  N  N     . LEU A  1  983  ? 255.363 325.370 212.838 1.00 0.00 ? 983  LEU A N     1 
ATOM   7534  C  CA    . LEU A  1  983  ? 255.815 326.735 213.015 1.00 0.00 ? 983  LEU A CA    1 
ATOM   7535  C  C     . LEU A  1  983  ? 255.831 327.581 211.770 1.00 0.00 ? 983  LEU A C     1 
ATOM   7536  O  O     . LEU A  1  983  ? 255.498 328.760 211.814 1.00 0.00 ? 983  LEU A O     1 
ATOM   7537  C  CB    . LEU A  1  983  ? 257.223 326.714 213.548 1.00 0.00 ? 983  LEU A CB    1 
ATOM   7538  C  CG    . LEU A  1  983  ? 257.234 326.080 214.906 1.00 0.00 ? 983  LEU A CG    1 
ATOM   7539  C  CD1   . LEU A  1  983  ? 258.668 325.905 215.311 1.00 0.00 ? 983  LEU A CD1   1 
ATOM   7540  C  CD2   . LEU A  1  983  ? 256.497 326.982 215.838 1.00 0.00 ? 983  LEU A CD2   1 
ATOM   7541  N  N     . LEU A  1  984  ? 256.191 326.959 210.656 1.00 0.00 ? 984  LEU A N     1 
ATOM   7542  C  CA    . LEU A  1  984  ? 256.243 327.625 209.367 1.00 0.00 ? 984  LEU A CA    1 
ATOM   7543  C  C     . LEU A  1  984  ? 254.874 328.147 208.851 1.00 0.00 ? 984  LEU A C     1 
ATOM   7544  O  O     . LEU A  1  984  ? 254.805 329.267 208.357 1.00 0.00 ? 984  LEU A O     1 
ATOM   7545  C  CB    . LEU A  1  984  ? 256.939 326.680 208.380 1.00 0.00 ? 984  LEU A CB    1 
ATOM   7546  C  CG    . LEU A  1  984  ? 257.116 327.044 206.918 1.00 0.00 ? 984  LEU A CG    1 
ATOM   7547  C  CD1   . LEU A  1  984  ? 257.909 328.324 206.805 1.00 0.00 ? 984  LEU A CD1   1 
ATOM   7548  C  CD2   . LEU A  1  984  ? 257.868 325.911 206.257 1.00 0.00 ? 984  LEU A CD2   1 
ATOM   7549  N  N     . ARG A  1  985  ? 253.794 327.375 208.969 1.00 0.00 ? 985  ARG A N     1 
ATOM   7550  C  CA    . ARG A  1  985  ? 252.465 327.851 208.540 1.00 0.00 ? 985  ARG A CA    1 
ATOM   7551  C  C     . ARG A  1  985  ? 252.013 329.030 209.395 1.00 0.00 ? 985  ARG A C     1 
ATOM   7552  O  O     . ARG A  1  985  ? 251.399 329.961 208.900 1.00 0.00 ? 985  ARG A O     1 
ATOM   7553  C  CB    . ARG A  1  985  ? 251.443 326.688 208.542 1.00 0.00 ? 985  ARG A CB    1 
ATOM   7554  C  CG    . ARG A  1  985  ? 249.953 327.019 208.187 1.00 0.00 ? 985  ARG A CG    1 
ATOM   7555  C  CD    . ARG A  1  985  ? 249.186 325.750 207.960 1.00 0.00 ? 985  ARG A CD    1 
ATOM   7556  N  NE    . ARG A  1  985  ? 249.366 324.866 209.113 1.00 0.00 ? 985  ARG A NE    1 
ATOM   7557  C  CZ    . ARG A  1  985  ? 248.946 325.104 210.359 1.00 0.00 ? 985  ARG A CZ    1 
ATOM   7558  N  NH1   . ARG A  1  985  ? 248.238 326.190 210.635 1.00 0.00 ? 985  ARG A NH1   1 
ATOM   7559  N  NH2   . ARG A  1  985  ? 249.231 324.255 211.344 1.00 0.00 ? 985  ARG A NH2   1 
ATOM   7560  N  N     . MET A  1  986  ? 252.330 328.989 210.670 1.00 0.00 ? 986  MET A N     1 
ATOM   7561  C  CA    . MET A  1  986  ? 252.075 330.117 211.546 1.00 0.00 ? 986  MET A CA    1 
ATOM   7562  C  C     . MET A  1  986  ? 252.796 331.419 211.153 1.00 0.00 ? 986  MET A C     1 
ATOM   7563  O  O     . MET A  1  986  ? 252.207 332.508 211.189 1.00 0.00 ? 986  MET A O     1 
ATOM   7564  C  CB    . MET A  1  986  ? 252.436 329.751 212.949 1.00 0.00 ? 986  MET A CB    1 
ATOM   7565  C  CG    . MET A  1  986  ? 251.724 328.567 213.381 1.00 0.00 ? 986  MET A CG    1 
ATOM   7566  S  SD    . MET A  1  986  ? 252.118 328.271 215.094 1.00 0.00 ? 986  MET A SD    1 
ATOM   7567  C  CE    . MET A  1  986  ? 251.074 329.538 215.838 1.00 0.00 ? 986  MET A CE    1 
ATOM   7568  N  N     . ILE A  1  987  ? 254.056 331.310 210.749 1.00 0.00 ? 987  ILE A N     1 
ATOM   7569  C  CA    . ILE A  1  987  ? 254.782 332.476 210.300 1.00 0.00 ? 987  ILE A CA    1 
ATOM   7570  C  C     . ILE A  1  987  ? 254.064 333.032 209.105 1.00 0.00 ? 987  ILE A C     1 
ATOM   7571  O  O     . ILE A  1  987  ? 253.843 334.222 209.044 1.00 0.00 ? 987  ILE A O     1 
ATOM   7572  C  CB    . ILE A  1  987  ? 256.177 332.097 209.888 1.00 0.00 ? 987  ILE A CB    1 
ATOM   7573  C  CG1   . ILE A  1  987  ? 257.007 331.751 211.106 1.00 0.00 ? 987  ILE A CG1   1 
ATOM   7574  C  CG2   . ILE A  1  987  ? 256.807 333.175 209.065 1.00 0.00 ? 987  ILE A CG2   1 
ATOM   7575  C  CD1   . ILE A  1  987  ? 258.238 330.990 210.754 1.00 0.00 ? 987  ILE A CD1   1 
ATOM   7576  N  N     . TRP A  1  988  ? 253.615 332.172 208.205 1.00 0.00 ? 988  TRP A N     1 
ATOM   7577  C  CA    . TRP A  1  988  ? 252.809 332.624 207.080 1.00 0.00 ? 988  TRP A CA    1 
ATOM   7578  C  C     . TRP A  1  988  ? 251.488 333.258 207.516 1.00 0.00 ? 988  TRP A C     1 
ATOM   7579  O  O     . TRP A  1  988  ? 251.084 334.251 206.937 1.00 0.00 ? 988  TRP A O     1 
ATOM   7580  C  CB    . TRP A  1  988  ? 252.561 331.480 206.098 1.00 0.00 ? 988  TRP A CB    1 
ATOM   7581  C  CG    . TRP A  1  988  ? 252.222 331.967 204.729 1.00 0.00 ? 988  TRP A CG    1 
ATOM   7582  C  CD1   . TRP A  1  988  ? 251.181 332.785 204.400 1.00 0.00 ? 988  TRP A CD1   1 
ATOM   7583  C  CD2   . TRP A  1  988  ? 252.960 331.759 203.523 1.00 0.00 ? 988  TRP A CD2   1 
ATOM   7584  N  NE1   . TRP A  1  988  ? 251.187 333.052 203.058 1.00 0.00 ? 988  TRP A NE1   1 
ATOM   7585  C  CE2   . TRP A  1  988  ? 252.273 332.444 202.492 1.00 0.00 ? 988  TRP A CE2   1 
ATOM   7586  C  CE3   . TRP A  1  988  ? 254.119 331.050 203.208 1.00 0.00 ? 988  TRP A CE3   1 
ATOM   7587  C  CZ2   . TRP A  1  988  ? 252.712 332.442 201.164 1.00 0.00 ? 988  TRP A CZ2   1 
ATOM   7588  C  CZ3   . TRP A  1  988  ? 254.551 331.042 201.889 1.00 0.00 ? 988  TRP A CZ3   1 
ATOM   7589  C  CH2   . TRP A  1  988  ? 253.847 331.737 200.882 1.00 0.00 ? 988  TRP A CH2   1 
ATOM   7590  N  N     . ASN A  1  989  ? 250.802 332.706 208.506 1.00 0.00 ? 989  ASN A N     1 
ATOM   7591  C  CA    . ASN A  1  989  ? 249.613 333.388 208.979 1.00 0.00 ? 989  ASN A CA    1 
ATOM   7592  C  C     . ASN A  1  989  ? 250.001 334.716 209.534 1.00 0.00 ? 989  ASN A C     1 
ATOM   7593  O  O     . ASN A  1  989  ? 249.307 335.687 209.333 1.00 0.00 ? 989  ASN A O     1 
ATOM   7594  C  CB    . ASN A  1  989  ? 248.905 332.604 210.069 1.00 0.00 ? 989  ASN A CB    1 
ATOM   7595  C  CG    . ASN A  1  989  ? 247.983 331.563 209.523 1.00 0.00 ? 989  ASN A CG    1 
ATOM   7596  O  OD1   . ASN A  1  989  ? 248.039 330.386 209.889 1.00 0.00 ? 989  ASN A OD1   1 
ATOM   7597  N  ND2   . ASN A  1  989  ? 247.102 331.994 208.642 1.00 0.00 ? 989  ASN A ND2   1 
ATOM   7598  N  N     . ALA A  1  990  ? 251.111 334.756 210.250 1.00 0.00 ? 990  ALA A N     1 
ATOM   7599  C  CA    . ALA A  1  990  ? 251.596 336.007 210.780 1.00 0.00 ? 990  ALA A CA    1 
ATOM   7600  C  C     . ALA A  1  990  ? 251.949 337.075 209.730 1.00 0.00 ? 990  ALA A C     1 
ATOM   7601  O  O     . ALA A  1  990  ? 251.473 338.192 209.833 1.00 0.00 ? 990  ALA A O     1 
ATOM   7602  C  CB    . ALA A  1  990  ? 252.794 335.723 211.653 1.00 0.00 ? 990  ALA A CB    1 
ATOM   7603  N  N     . GLN A  1  991  ? 252.675 336.707 208.678 1.00 0.00 ? 991  GLN A N     1 
ATOM   7604  C  CA    . GLN A  1  991  ? 253.009 337.626 207.584 1.00 0.00 ? 991  GLN A CA    1 
ATOM   7605  C  C     . GLN A  1  991  ? 251.838 338.169 206.822 1.00 0.00 ? 991  GLN A C     1 
ATOM   7606  O  O     . GLN A  1  991  ? 251.783 339.338 206.502 1.00 0.00 ? 991  GLN A O     1 
ATOM   7607  C  CB    . GLN A  1  991  ? 253.888 336.931 206.544 1.00 0.00 ? 991  GLN A CB    1 
ATOM   7608  C  CG    . GLN A  1  991  ? 255.298 336.566 206.942 1.00 0.00 ? 991  GLN A CG    1 
ATOM   7609  C  CD    . GLN A  1  991  ? 256.096 336.019 205.755 1.00 0.00 ? 991  GLN A CD    1 
ATOM   7610  O  OE1   . GLN A  1  991  ? 255.555 335.311 204.896 1.00 0.00 ? 991  GLN A OE1   1 
ATOM   7611  N  NE2   . GLN A  1  991  ? 257.384 336.345 205.705 1.00 0.00 ? 991  GLN A NE2   1 
ATOM   7612  N  N     . LYS A  1  992  ? 250.905 337.295 206.529 1.00 0.00 ? 992  LYS A N     1 
ATOM   7613  C  CA    . LYS A  1  992  ? 249.734 337.616 205.743 1.00 0.00 ? 992  LYS A CA    1 
ATOM   7614  C  C     . LYS A  1  992  ? 248.750 338.611 206.356 1.00 0.00 ? 992  LYS A C     1 
ATOM   7615  O  O     . LYS A  1  992  ? 248.224 339.481 205.662 1.00 0.00 ? 992  LYS A O     1 
ATOM   7616  C  CB    . LYS A  1  992  ? 249.015 336.321 205.416 1.00 0.00 ? 992  LYS A CB    1 
ATOM   7617  C  CG    . LYS A  1  992  ? 247.678 336.498 204.782 1.00 0.00 ? 992  LYS A CG    1 
ATOM   7618  C  CD    . LYS A  1  992  ? 246.883 335.238 204.992 1.00 0.00 ? 992  LYS A CD    1 
ATOM   7619  C  CE    . LYS A  1  992  ? 246.366 335.124 206.411 1.00 0.00 ? 992  LYS A CE    1 
ATOM   7620  N  NZ    . LYS A  1  992  ? 245.516 333.930 206.537 1.00 0.00 ? 992  LYS A NZ    1 
ATOM   7621  N  N     . ILE A  1  993  ? 248.538 338.508 207.660 1.00 0.00 ? 993  ILE A N     1 
ATOM   7622  C  CA    . ILE A  1  993  ? 247.605 339.388 208.363 1.00 0.00 ? 993  ILE A CA    1 
ATOM   7623  C  C     . ILE A  1  993  ? 248.180 340.780 208.658 1.00 0.00 ? 993  ILE A C     1 
ATOM   7624  O  O     . ILE A  1  993  ? 247.478 341.777 208.515 1.00 0.00 ? 993  ILE A O     1 
ATOM   7625  C  CB    . ILE A  1  993  ? 247.081 338.684 209.667 1.00 0.00 ? 993  ILE A CB    1 
ATOM   7626  C  CG1   . ILE A  1  993  ? 245.689 339.198 210.067 1.00 0.00 ? 993  ILE A CG1   1 
ATOM   7627  C  CG2   . ILE A  1  993  ? 248.118 338.694 210.792 1.00 0.00 ? 993  ILE A CG2   1 
ATOM   7628  C  CD1   . ILE A  1  993  ? 245.065 338.428 211.195 1.00 0.00 ? 993  ILE A CD1   1 
ATOM   7629  N  N     . PHE A  1  994  ? 249.425 340.867 209.091 1.00 0.00 ? 994  PHE A N     1 
ATOM   7630  C  CA    . PHE A  1  994  ? 249.969 342.153 209.478 1.00 0.00 ? 994  PHE A CA    1 
ATOM   7631  C  C     . PHE A  1  994  ? 250.310 342.959 208.220 1.00 0.00 ? 994  PHE A C     1 
ATOM   7632  O  O     . PHE A  1  994  ? 250.762 344.096 208.319 1.00 0.00 ? 994  PHE A O     1 
ATOM   7633  C  CB    . PHE A  1  994  ? 251.198 341.949 210.349 1.00 0.00