data_5IYB
# 
_entry.id   5IYB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.285 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5IYB         
WWPDB D_1000219638 
EMDB  EMD-8136     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB . EMD-8136 'associated EM volume' 
EMDB . EMD-3307 'other EM volume'      
EMDB . EMD-8135 'other EM volume'      
EMDB . EMD-8132 'other EM volume'      
EMDB . EMD-8133 'other EM volume'      
EMDB . EMD-8134 'other EM volume'      
EMDB . EMD-8137 'other EM volume'      
EMDB . EMD-8138 'other EM volume'      
EMDB . EMD-8131 'other EM volume'      
PDB  . 5IVW     unspecified            
PDB  . 5IY6     unspecified            
PDB  . 5IYA     unspecified            
PDB  . 5IY7     unspecified            
PDB  . 5IY8     unspecified            
PDB  . 5IY9     unspecified            
PDB  . 5IYC     unspecified            
PDB  . 5IYD     unspecified            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5IYB 
_pdbx_database_status.recvd_initial_deposition_date   2016-03-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'He, Y.'      1 
'Yan, C.'     2 
'Fang, J.'    3 
'Inouye, C.'  4 
'Tjian, R.'   5 
'Ivanov, I.'  6 
'Nogales, E.' 7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            533 
_citation.language                  ? 
_citation.page_first                359 
_citation.page_last                 365 
_citation.title                     'Near-atomic resolution visualization of human transcription promoter opening.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature17970 
_citation.pdbx_database_id_PubMed   27193682 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'He, Y.'      1 
primary 'Yan, C.'     2 
primary 'Fang, J.'    3 
primary 'Inouye, C.'  4 
primary 'Tjian, R.'   5 
primary 'Ivanov, I.'  6 
primary 'Nogales, E.' 7 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase II subunit RPB1'      217420.047 1  2.7.7.6,2.7.7.48 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase II subunit RPB2'      134071.453 1  2.7.7.6          ? ? ? 
3  polymer     nat 'DNA-directed RNA polymerase II subunit RPB3'      31478.148  1  ?                ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase II subunit RPB4'      16331.255  1  ?                ? ? ? 
5  polymer     nat 'DNA-directed RNA polymerase II subunit RPB5'      24584.223  1  ?                ? ? ? 
6  polymer     nat 'DNA-directed RNA polymerase II subunit RPB6'      14491.026  1  ?                ? ? ? 
7  polymer     nat 'DNA-directed RNA polymerase II subunit RPB7'      19314.283  1  ?                ? ? ? 
8  polymer     nat 'DNA-directed RNA polymerase II subunit RPB8'      17162.273  1  ?                ? ? ? 
9  polymer     nat 'DNA-directed RNA polymerase II subunit RPB9'      14541.221  1  ?                ? ? ? 
10 polymer     nat 'DNA-directed RNA polymerase II subunit RPB10'     7655.123   1  ?                ? ? ? 
11 polymer     nat 'DNA-directed RNA polymerase II subunit RPB11-a'   13310.284  1  ?                ? ? ? 
12 polymer     nat 'DNA-directed RNA polymerase II subunit RPB12'     7018.244   1  ?                ? ? ? 
13 polymer     man 'Transcription initiation factor IIB'              34877.949  1  ?                ? ? ? 
14 polymer     man 'Transcription initiation factor IIA subunit 1'    41544.551  1  ?                ? ? ? 
15 polymer     man 'Transcription initiation factor IIA subunit 2'    12469.091  1  ?                ? ? ? 
16 polymer     man 'TATA-box-binding protein'                         37729.938  1  ?                ? ? ? 
17 polymer     man 'General transcription factor IIE subunit 1'       49516.094  1  ?                ? ? ? 
18 polymer     man 'Transcription initiation factor IIE subunit beta' 33106.824  1  ?                ? ? ? 
19 polymer     man 'General transcription factor IIF subunit 1'       58343.578  1  ?                ? ? ? 
20 polymer     man 'General transcription factor IIF subunit 2'       28427.309  1  3.6.4.12         ? ? ? 
21 polymer     man 'Transcription elongation factor A protein 1'      34022.723  1  ?                ? ? ? 
22 polymer     syn SCP-X                                              23372.928  1  ?                ? ? ? 
23 polymer     syn SCP-Y                                              22908.580  1  ?                ? ? ? 
24 non-polymer syn 'MAGNESIUM ION'                                    24.305     2  ?                ? ? ? 
25 non-polymer syn 'ZINC ION'                                         65.409     11 ?                ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  
;RNA polymerase II subunit B1, DNA-directed RNA polymerase II subunit A, DNA-directed RNA polymerase III largest subunit, RNA-directed RNA polymerase II subunit RPB1
;
2  
;DNA-directed RNA polymerase II 140 kDa polypeptide, DNA-directed RNA polymerase II subunit B, RNA polymerase II subunit 2, RNA polymerase II subunit B2
;
3  
;RNA polymerase II subunit B3, DNA-directed RNA polymerase II 33 kDa polypeptide, RPB33, DNA-directed RNA polymerase II subunit C, RPB31
;
4  'RNA polymerase II subunit B4, DNA-directed RNA polymerase II subunit D, RNA polymerase II 16 kDa subunit, RPB16' 
5  
;RNA polymerases I,II,and III subunit ABC1, DNA-directed RNA DNA-directed RNA polymerases I, II, and III subunit RPABC1, polymerase II 23 kDa polypeptide, DNA-directed RNA polymerase II subunit E, XAP4
;
6  
;DNA-directed RNA polymerases I, II, and III subunit RPABC2, RNA polymerases I,II,and III subunit ABC2, DNA-directed RNA polymerase II subunit F, DNA-directed RNA polymerases I,and III 14.4 kDa polypeptide, RPABC14.4, RPB14.4, RPC15
;
7  'RNA polymerase II subunit B7, DNA-directed RNA polymerase II subunit G, RNA polymerase II 19 kDa subunit, RPB19' 
8  
;DNA-directed RNA polymerases I, II, and III subunit RPABC3, RNA polymerases I,II,and III subunit ABC3, DNA-directed RNA polymerase II subunit H, DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide, RPB17, hRPB8
;
9  'RNA polymerase II subunit B9, DNA-directed RNA polymerase II subunit I, RNA polymerase II 14.5 kDa subunit, RPB14.5' 
10 
;DNA-directed RNA polymerases I, II, and III subunit RPABC5, RNA polymerases I,II,and III subunit ABC5, DNA-directed RNA polymerase III subunit L, RNA polymerase II 7.6 kDa subunit, RPB7.6
;
11 'RPB11a, DNA-directed RNA polymerase II subunit J-1, RNA polymerase II 13.3 kDa subunit' 
12 
;DNA-directed RNA polymerases I, II, and III subunit RPABC4, RNA polymerases I,II,and III subunit ABC4, ABC10-alpha, DNA-directed RNA polymerase II subunit K, RNA polymerase II 7.0 kDa subunit, RPB7.0, RPB10alpha
;
13 'General transcription factor TFIIB, S300-II' 
14 'General transcription factor IIA subunit 1, TFIIAL, Transcription initiation factor TFIIA 42 kDa subunit, TFIIA-42' 
15 
'General transcription factor IIA subunit 2, TFIIA p12 subunit, TFIIAS, Transcription initiation factor IIA gamma chain, TFIIA-gamma' 
16 'TATA sequence-binding protein, TATA-binding factor, TATA-box factor, Transcription initiation factor TFIID TBP subunit' 
17 'General transcription factor IIE 56 kDa subunit, Transcription initiation factor IIE subunit alpha, TFIIE-alpha' 
18 'TFIIE-beta, General transcription factor IIE subunit 2' 
19 
;General transcription factor IIF 74 kDa subunit, Transcription initiation factor IIF subunit alpha, TFIIF-alpha, Transcription initiation factor RAP74
;
20 
;ATP-dependent helicase GTF2F2, General transcription factor IIF 30 kDa subunit, Transcription initiation factor IIF subunit beta, TFIIF-beta, Transcription initiation factor RAP30
;
21 'Transcription elongation factor S-II protein 1, Transcription elongation factor TFIIS.o' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no 
;MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTE
CPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEM
DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDN
ELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNID
RLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEV
MNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGIL
CKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPF
GFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVR
NSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLL
FNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLG
VPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMD
DDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSN
DIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPW
NQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAY
EPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSP
SYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYT
PTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN
;
;MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTE
CPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEM
DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDN
ELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNID
RLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEV
MNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGIL
CKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPF
GFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVR
NSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLL
FNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLG
VPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMD
DDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSN
DIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPW
NQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAY
EPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSP
SYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYT
PTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN
;
A ? 
2  'polypeptide(L)'        no no 
;MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEE
PPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTY
CLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNF
IGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLL
AFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAA
IADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHI
DQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSA
VDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDEL
ESTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQ
IFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCN
LCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
;
;MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEE
PPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTY
CLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNF
IGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLL
AFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAA
IADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHI
DQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSA
VDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDEL
ESTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQ
IFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCN
LCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
;
B ? 
3  'polypeptide(L)'        no no 
;MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLISDDIVD
KLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELR
LRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
;
;MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLISDDIVD
KLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELR
LRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
;
C ? 
4  'polypeptide(L)'        no no 
;MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETI
ASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
;
;MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETI
ASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
;
D ? 
5  'polypeptide(L)'        no no 
;MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEP
KVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELL
ARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
;
;MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEP
KVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELL
ARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
;
E ? 
6  'polypeptide(L)'        no no 
;MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVM
VELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
;
;MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVM
VELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
;
F ? 
7  'polypeptide(L)'        no no 
;MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPF
KGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAI
GSLMDDYLGLVS
;
;MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPF
KGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAI
GSLMDDYLGLVS
;
G ? 
8  'polypeptide(L)'        no no 
;MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDD
RPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
;
;MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDD
RPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
;
H ? 
9  'polypeptide(L)'        no no 
;MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPR
TEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE
;
;MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPR
TEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE
;
I ? 
10 'polypeptide(L)'        no no MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK 
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK J ? 
11 'polypeptide(L)'        no no 
;MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPD
YSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
;
;MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPD
YSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
;
K ? 
12 'polypeptide(L)'        no no MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR 
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR L ? 
13 'polypeptide(L)'        no no 
;MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDL
STMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIA
SACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL
;
;MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDL
STMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIA
SACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL
;
M ? 
14 'polypeptide(L)'        no no 
;MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQ
HHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSG
QLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTV
AAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDV
SDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
;
;MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQ
HHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSG
QLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTV
AAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDV
SDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
;
N ? 
15 'polypeptide(L)'        no no 
;MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVE
FREVTELIKVDKVKIVACDGKNTGSNTTE
;
;MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVE
FREVTELIKVDKVKIVACDGKNTGSNTTE
;
O ? 
16 'polypeptide(L)'        no no 
;MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSG
IVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV
VQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAE
IYEAFENIYPILKGFRKTT
;
;MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSG
IVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV
VQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAE
IYEAFENIYPILKGFRKTT
;
P ? 
17 'polypeptide(L)'        no no 
;MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVET
AADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTE
VEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDHAATTAGAASLAGGHHREAWA
TKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIWLRESTVQGAYGSEDMKEGGIDMDAFQEREEGHAGPDDNEE
VMRALLIHEKKTSSAMAGSVGAAAPVTAANGSDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAG
RPFSYSEVSQRPELVAQMTPEEKEAYIAMGQRMFEDLFE
;
;MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVET
AADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTE
VEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDHAATTAGAASLAGGHHREAWA
TKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIWLRESTVQGAYGSEDMKEGGIDMDAFQEREEGHAGPDDNEE
VMRALLIHEKKTSSAMAGSVGAAAPVTAANGSDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAG
RPFSYSEVSQRPELVAQMTPEEKEAYIAMGQRMFEDLFE
;
Q ? 
18 'polypeptide(L)'        no no 
;MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAK
IVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVRDKKALLRLLDQHDQ
RGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQ
GISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK
;
;MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAK
IVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVRDKKALLRLLDQHDQ
RGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQ
GISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK
;
R ? 
19 'polypeptide(L)'        no no 
;MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEAR
RKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEA
EEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPL
AKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEED
KEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSST
LRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTK
KTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
;
;MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEAR
RKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEA
EEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPL
AKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEED
KEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSST
LRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTK
KTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
;
S ? 
20 'polypeptide(L)'        no no 
;MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPRE
HPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQ
YNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYR
HYQGEEKSD
;
;MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPRE
HPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQ
YNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYR
HYQGEEKSD
;
T ? 
21 'polypeptide(L)'        no no 
;MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGP
STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIA
IGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL
TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC
;
;MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGP
STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIA
IGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL
TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC
;
U ? 
22 polydeoxyribonucleotide no no 
;(DG)(DA)(DA)(DG)(DG)(DG)(DC)(DG)(DC)(DC)(DT)(DA)(DT)(DA)(DA)(DA)(DA)(DG)(DG)(DG)
(DG)(DG)(DT)(DG)(DG)(DG)(DG)(DG)(DC)(DG)(DC)(DG)(DA)(DA)(DT)(DT)(DT)(DT)(DT)(DT)
(DT)(DT)(DT)(DT)(DC)(DG)(DC)(DG)(DA)(DT)(DC)(DG)(DA)(DA)(DC)(DA)(DC)(DT)(DC)(DG)
(DA)(DG)(DC)(DC)(DG)(DA)(DG)(DC)(DA)(DG)(DA)(DC)(DG)(DT)(DG)
;
GAAGGGCGCCTATAAAAGGGGGTGGGGGCGCGAATTTTTTTTTTCGCGATCGAACACTCGAGCCGAGCAGACGTG X ? 
23 polydeoxyribonucleotide no no 
;(DC)(DA)(DC)(DG)(DT)(DC)(DT)(DG)(DC)(DT)(DC)(DG)(DG)(DC)(DT)(DC)(DG)(DA)(DG)(DT)
(DG)(DT)(DT)(DC)(DG)(DA)(DT)(DC)(DG)(DC)(DG)(DA)(DC)(DT)(DG)(DA)(DG)(DG)(DA)(DC)
(DG)(DA)(DA)(DC)(DG)(DC)(DG)(DC)(DC)(DC)(DC)(DC)(DA)(DC)(DC)(DC)(DC)(DC)(DT)(DT)
(DT)(DT)(DA)(DT)(DA)(DG)(DG)(DC)(DG)(DC)(DC)(DC)(DT)(DT)(DC)
;
CACGTCTGCTCGGCTCGAGTGTTCGATCGCGACTGAGGACGAACGCGCCCCCACCCCCTTTTATAGGCGCCCTTC Y ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    HIS n 
1  3    GLY n 
1  4    GLY n 
1  5    GLY n 
1  6    PRO n 
1  7    PRO n 
1  8    SER n 
1  9    GLY n 
1  10   ASP n 
1  11   SER n 
1  12   ALA n 
1  13   CYS n 
1  14   PRO n 
1  15   LEU n 
1  16   ARG n 
1  17   THR n 
1  18   ILE n 
1  19   LYS n 
1  20   ARG n 
1  21   VAL n 
1  22   GLN n 
1  23   PHE n 
1  24   GLY n 
1  25   VAL n 
1  26   LEU n 
1  27   SER n 
1  28   PRO n 
1  29   ASP n 
1  30   GLU n 
1  31   LEU n 
1  32   LYS n 
1  33   ARG n 
1  34   MET n 
1  35   SER n 
1  36   VAL n 
1  37   THR n 
1  38   GLU n 
1  39   GLY n 
1  40   GLY n 
1  41   ILE n 
1  42   LYS n 
1  43   TYR n 
1  44   PRO n 
1  45   GLU n 
1  46   THR n 
1  47   THR n 
1  48   GLU n 
1  49   GLY n 
1  50   GLY n 
1  51   ARG n 
1  52   PRO n 
1  53   LYS n 
1  54   LEU n 
1  55   GLY n 
1  56   GLY n 
1  57   LEU n 
1  58   MET n 
1  59   ASP n 
1  60   PRO n 
1  61   ARG n 
1  62   GLN n 
1  63   GLY n 
1  64   VAL n 
1  65   ILE n 
1  66   GLU n 
1  67   ARG n 
1  68   THR n 
1  69   GLY n 
1  70   ARG n 
1  71   CYS n 
1  72   GLN n 
1  73   THR n 
1  74   CYS n 
1  75   ALA n 
1  76   GLY n 
1  77   ASN n 
1  78   MET n 
1  79   THR n 
1  80   GLU n 
1  81   CYS n 
1  82   PRO n 
1  83   GLY n 
1  84   HIS n 
1  85   PHE n 
1  86   GLY n 
1  87   HIS n 
1  88   ILE n 
1  89   GLU n 
1  90   LEU n 
1  91   ALA n 
1  92   LYS n 
1  93   PRO n 
1  94   VAL n 
1  95   PHE n 
1  96   HIS n 
1  97   VAL n 
1  98   GLY n 
1  99   PHE n 
1  100  LEU n 
1  101  VAL n 
1  102  LYS n 
1  103  THR n 
1  104  MET n 
1  105  LYS n 
1  106  VAL n 
1  107  LEU n 
1  108  ARG n 
1  109  CYS n 
1  110  VAL n 
1  111  CYS n 
1  112  PHE n 
1  113  PHE n 
1  114  CYS n 
1  115  SER n 
1  116  LYS n 
1  117  LEU n 
1  118  LEU n 
1  119  VAL n 
1  120  ASP n 
1  121  SER n 
1  122  ASN n 
1  123  ASN n 
1  124  PRO n 
1  125  LYS n 
1  126  ILE n 
1  127  LYS n 
1  128  ASP n 
1  129  ILE n 
1  130  LEU n 
1  131  ALA n 
1  132  LYS n 
1  133  SER n 
1  134  LYS n 
1  135  GLY n 
1  136  GLN n 
1  137  PRO n 
1  138  LYS n 
1  139  LYS n 
1  140  ARG n 
1  141  LEU n 
1  142  THR n 
1  143  HIS n 
1  144  VAL n 
1  145  TYR n 
1  146  ASP n 
1  147  LEU n 
1  148  CYS n 
1  149  LYS n 
1  150  GLY n 
1  151  LYS n 
1  152  ASN n 
1  153  ILE n 
1  154  CYS n 
1  155  GLU n 
1  156  GLY n 
1  157  GLY n 
1  158  GLU n 
1  159  GLU n 
1  160  MET n 
1  161  ASP n 
1  162  ASN n 
1  163  LYS n 
1  164  PHE n 
1  165  GLY n 
1  166  VAL n 
1  167  GLU n 
1  168  GLN n 
1  169  PRO n 
1  170  GLU n 
1  171  GLY n 
1  172  ASP n 
1  173  GLU n 
1  174  ASP n 
1  175  LEU n 
1  176  THR n 
1  177  LYS n 
1  178  GLU n 
1  179  LYS n 
1  180  GLY n 
1  181  HIS n 
1  182  GLY n 
1  183  GLY n 
1  184  CYS n 
1  185  GLY n 
1  186  ARG n 
1  187  TYR n 
1  188  GLN n 
1  189  PRO n 
1  190  ARG n 
1  191  ILE n 
1  192  ARG n 
1  193  ARG n 
1  194  SER n 
1  195  GLY n 
1  196  LEU n 
1  197  GLU n 
1  198  LEU n 
1  199  TYR n 
1  200  ALA n 
1  201  GLU n 
1  202  TRP n 
1  203  LYS n 
1  204  HIS n 
1  205  VAL n 
1  206  ASN n 
1  207  GLU n 
1  208  ASP n 
1  209  SER n 
1  210  GLN n 
1  211  GLU n 
1  212  LYS n 
1  213  LYS n 
1  214  ILE n 
1  215  LEU n 
1  216  LEU n 
1  217  SER n 
1  218  PRO n 
1  219  GLU n 
1  220  ARG n 
1  221  VAL n 
1  222  HIS n 
1  223  GLU n 
1  224  ILE n 
1  225  PHE n 
1  226  LYS n 
1  227  ARG n 
1  228  ILE n 
1  229  SER n 
1  230  ASP n 
1  231  GLU n 
1  232  GLU n 
1  233  CYS n 
1  234  PHE n 
1  235  VAL n 
1  236  LEU n 
1  237  GLY n 
1  238  MET n 
1  239  GLU n 
1  240  PRO n 
1  241  ARG n 
1  242  TYR n 
1  243  ALA n 
1  244  ARG n 
1  245  PRO n 
1  246  GLU n 
1  247  TRP n 
1  248  MET n 
1  249  ILE n 
1  250  VAL n 
1  251  THR n 
1  252  VAL n 
1  253  LEU n 
1  254  PRO n 
1  255  VAL n 
1  256  PRO n 
1  257  PRO n 
1  258  LEU n 
1  259  SER n 
1  260  VAL n 
1  261  ARG n 
1  262  PRO n 
1  263  ALA n 
1  264  VAL n 
1  265  VAL n 
1  266  MET n 
1  267  GLN n 
1  268  GLY n 
1  269  SER n 
1  270  ALA n 
1  271  ARG n 
1  272  ASN n 
1  273  GLN n 
1  274  ASP n 
1  275  ASP n 
1  276  LEU n 
1  277  THR n 
1  278  HIS n 
1  279  LYS n 
1  280  LEU n 
1  281  ALA n 
1  282  ASP n 
1  283  ILE n 
1  284  VAL n 
1  285  LYS n 
1  286  ILE n 
1  287  ASN n 
1  288  ASN n 
1  289  GLN n 
1  290  LEU n 
1  291  ARG n 
1  292  ARG n 
1  293  ASN n 
1  294  GLU n 
1  295  GLN n 
1  296  ASN n 
1  297  GLY n 
1  298  ALA n 
1  299  ALA n 
1  300  ALA n 
1  301  HIS n 
1  302  VAL n 
1  303  ILE n 
1  304  ALA n 
1  305  GLU n 
1  306  ASP n 
1  307  VAL n 
1  308  LYS n 
1  309  LEU n 
1  310  LEU n 
1  311  GLN n 
1  312  PHE n 
1  313  HIS n 
1  314  VAL n 
1  315  ALA n 
1  316  THR n 
1  317  MET n 
1  318  VAL n 
1  319  ASP n 
1  320  ASN n 
1  321  GLU n 
1  322  LEU n 
1  323  PRO n 
1  324  GLY n 
1  325  LEU n 
1  326  PRO n 
1  327  ARG n 
1  328  ALA n 
1  329  MET n 
1  330  GLN n 
1  331  LYS n 
1  332  SER n 
1  333  GLY n 
1  334  ARG n 
1  335  PRO n 
1  336  LEU n 
1  337  LYS n 
1  338  SER n 
1  339  LEU n 
1  340  LYS n 
1  341  GLN n 
1  342  ARG n 
1  343  LEU n 
1  344  LYS n 
1  345  GLY n 
1  346  LYS n 
1  347  GLU n 
1  348  GLY n 
1  349  ARG n 
1  350  VAL n 
1  351  ARG n 
1  352  GLY n 
1  353  ASN n 
1  354  LEU n 
1  355  MET n 
1  356  GLY n 
1  357  LYS n 
1  358  ARG n 
1  359  VAL n 
1  360  ASP n 
1  361  PHE n 
1  362  SER n 
1  363  ALA n 
1  364  ARG n 
1  365  THR n 
1  366  VAL n 
1  367  ILE n 
1  368  THR n 
1  369  PRO n 
1  370  ASP n 
1  371  PRO n 
1  372  ASN n 
1  373  LEU n 
1  374  SER n 
1  375  ILE n 
1  376  ASP n 
1  377  GLN n 
1  378  VAL n 
1  379  GLY n 
1  380  VAL n 
1  381  PRO n 
1  382  ARG n 
1  383  SER n 
1  384  ILE n 
1  385  ALA n 
1  386  ALA n 
1  387  ASN n 
1  388  MET n 
1  389  THR n 
1  390  PHE n 
1  391  ALA n 
1  392  GLU n 
1  393  ILE n 
1  394  VAL n 
1  395  THR n 
1  396  PRO n 
1  397  PHE n 
1  398  ASN n 
1  399  ILE n 
1  400  ASP n 
1  401  ARG n 
1  402  LEU n 
1  403  GLN n 
1  404  GLU n 
1  405  LEU n 
1  406  VAL n 
1  407  ARG n 
1  408  ARG n 
1  409  GLY n 
1  410  ASN n 
1  411  SER n 
1  412  GLN n 
1  413  TYR n 
1  414  PRO n 
1  415  GLY n 
1  416  ALA n 
1  417  LYS n 
1  418  TYR n 
1  419  ILE n 
1  420  ILE n 
1  421  ARG n 
1  422  ASP n 
1  423  ASN n 
1  424  GLY n 
1  425  ASP n 
1  426  ARG n 
1  427  ILE n 
1  428  ASP n 
1  429  LEU n 
1  430  ARG n 
1  431  PHE n 
1  432  HIS n 
1  433  PRO n 
1  434  LYS n 
1  435  PRO n 
1  436  SER n 
1  437  ASP n 
1  438  LEU n 
1  439  HIS n 
1  440  LEU n 
1  441  GLN n 
1  442  THR n 
1  443  GLY n 
1  444  TYR n 
1  445  LYS n 
1  446  VAL n 
1  447  GLU n 
1  448  ARG n 
1  449  HIS n 
1  450  MET n 
1  451  CYS n 
1  452  ASP n 
1  453  GLY n 
1  454  ASP n 
1  455  ILE n 
1  456  VAL n 
1  457  ILE n 
1  458  PHE n 
1  459  ASN n 
1  460  ARG n 
1  461  GLN n 
1  462  PRO n 
1  463  THR n 
1  464  LEU n 
1  465  HIS n 
1  466  LYS n 
1  467  MET n 
1  468  SER n 
1  469  MET n 
1  470  MET n 
1  471  GLY n 
1  472  HIS n 
1  473  ARG n 
1  474  VAL n 
1  475  ARG n 
1  476  ILE n 
1  477  LEU n 
1  478  PRO n 
1  479  TRP n 
1  480  SER n 
1  481  THR n 
1  482  PHE n 
1  483  ARG n 
1  484  LEU n 
1  485  ASN n 
1  486  LEU n 
1  487  SER n 
1  488  VAL n 
1  489  THR n 
1  490  THR n 
1  491  PRO n 
1  492  TYR n 
1  493  ASN n 
1  494  ALA n 
1  495  ASP n 
1  496  PHE n 
1  497  ASP n 
1  498  GLY n 
1  499  ASP n 
1  500  GLU n 
1  501  MET n 
1  502  ASN n 
1  503  LEU n 
1  504  HIS n 
1  505  LEU n 
1  506  PRO n 
1  507  GLN n 
1  508  SER n 
1  509  LEU n 
1  510  GLU n 
1  511  THR n 
1  512  ARG n 
1  513  ALA n 
1  514  GLU n 
1  515  ILE n 
1  516  GLN n 
1  517  GLU n 
1  518  LEU n 
1  519  ALA n 
1  520  MET n 
1  521  VAL n 
1  522  PRO n 
1  523  ARG n 
1  524  MET n 
1  525  ILE n 
1  526  VAL n 
1  527  THR n 
1  528  PRO n 
1  529  GLN n 
1  530  SER n 
1  531  ASN n 
1  532  ARG n 
1  533  PRO n 
1  534  VAL n 
1  535  MET n 
1  536  GLY n 
1  537  ILE n 
1  538  VAL n 
1  539  GLN n 
1  540  ASP n 
1  541  THR n 
1  542  LEU n 
1  543  THR n 
1  544  ALA n 
1  545  VAL n 
1  546  ARG n 
1  547  LYS n 
1  548  PHE n 
1  549  THR n 
1  550  LYS n 
1  551  ARG n 
1  552  ASP n 
1  553  VAL n 
1  554  PHE n 
1  555  LEU n 
1  556  GLU n 
1  557  ARG n 
1  558  GLY n 
1  559  GLU n 
1  560  VAL n 
1  561  MET n 
1  562  ASN n 
1  563  LEU n 
1  564  LEU n 
1  565  MET n 
1  566  PHE n 
1  567  LEU n 
1  568  SER n 
1  569  THR n 
1  570  TRP n 
1  571  ASP n 
1  572  GLY n 
1  573  LYS n 
1  574  VAL n 
1  575  PRO n 
1  576  GLN n 
1  577  PRO n 
1  578  ALA n 
1  579  ILE n 
1  580  LEU n 
1  581  LYS n 
1  582  PRO n 
1  583  ARG n 
1  584  PRO n 
1  585  LEU n 
1  586  TRP n 
1  587  THR n 
1  588  GLY n 
1  589  LYS n 
1  590  GLN n 
1  591  ILE n 
1  592  PHE n 
1  593  SER n 
1  594  LEU n 
1  595  ILE n 
1  596  ILE n 
1  597  PRO n 
1  598  GLY n 
1  599  HIS n 
1  600  ILE n 
1  601  ASN n 
1  602  CYS n 
1  603  ILE n 
1  604  ARG n 
1  605  THR n 
1  606  HIS n 
1  607  SER n 
1  608  THR n 
1  609  HIS n 
1  610  PRO n 
1  611  ASP n 
1  612  ASP n 
1  613  GLU n 
1  614  ASP n 
1  615  SER n 
1  616  GLY n 
1  617  PRO n 
1  618  TYR n 
1  619  LYS n 
1  620  HIS n 
1  621  ILE n 
1  622  SER n 
1  623  PRO n 
1  624  GLY n 
1  625  ASP n 
1  626  THR n 
1  627  LYS n 
1  628  VAL n 
1  629  VAL n 
1  630  VAL n 
1  631  GLU n 
1  632  ASN n 
1  633  GLY n 
1  634  GLU n 
1  635  LEU n 
1  636  ILE n 
1  637  MET n 
1  638  GLY n 
1  639  ILE n 
1  640  LEU n 
1  641  CYS n 
1  642  LYS n 
1  643  LYS n 
1  644  SER n 
1  645  LEU n 
1  646  GLY n 
1  647  THR n 
1  648  SER n 
1  649  ALA n 
1  650  GLY n 
1  651  SER n 
1  652  LEU n 
1  653  VAL n 
1  654  HIS n 
1  655  ILE n 
1  656  SER n 
1  657  TYR n 
1  658  LEU n 
1  659  GLU n 
1  660  MET n 
1  661  GLY n 
1  662  HIS n 
1  663  ASP n 
1  664  ILE n 
1  665  THR n 
1  666  ARG n 
1  667  LEU n 
1  668  PHE n 
1  669  TYR n 
1  670  SER n 
1  671  ASN n 
1  672  ILE n 
1  673  GLN n 
1  674  THR n 
1  675  VAL n 
1  676  ILE n 
1  677  ASN n 
1  678  ASN n 
1  679  TRP n 
1  680  LEU n 
1  681  LEU n 
1  682  ILE n 
1  683  GLU n 
1  684  GLY n 
1  685  HIS n 
1  686  THR n 
1  687  ILE n 
1  688  GLY n 
1  689  ILE n 
1  690  GLY n 
1  691  ASP n 
1  692  SER n 
1  693  ILE n 
1  694  ALA n 
1  695  ASP n 
1  696  SER n 
1  697  LYS n 
1  698  THR n 
1  699  TYR n 
1  700  GLN n 
1  701  ASP n 
1  702  ILE n 
1  703  GLN n 
1  704  ASN n 
1  705  THR n 
1  706  ILE n 
1  707  LYS n 
1  708  LYS n 
1  709  ALA n 
1  710  LYS n 
1  711  GLN n 
1  712  ASP n 
1  713  VAL n 
1  714  ILE n 
1  715  GLU n 
1  716  VAL n 
1  717  ILE n 
1  718  GLU n 
1  719  LYS n 
1  720  ALA n 
1  721  HIS n 
1  722  ASN n 
1  723  ASN n 
1  724  GLU n 
1  725  LEU n 
1  726  GLU n 
1  727  PRO n 
1  728  THR n 
1  729  PRO n 
1  730  GLY n 
1  731  ASN n 
1  732  THR n 
1  733  LEU n 
1  734  ARG n 
1  735  GLN n 
1  736  THR n 
1  737  PHE n 
1  738  GLU n 
1  739  ASN n 
1  740  GLN n 
1  741  VAL n 
1  742  ASN n 
1  743  ARG n 
1  744  ILE n 
1  745  LEU n 
1  746  ASN n 
1  747  ASP n 
1  748  ALA n 
1  749  ARG n 
1  750  ASP n 
1  751  LYS n 
1  752  THR n 
1  753  GLY n 
1  754  SER n 
1  755  SER n 
1  756  ALA n 
1  757  GLN n 
1  758  LYS n 
1  759  SER n 
1  760  LEU n 
1  761  SER n 
1  762  GLU n 
1  763  TYR n 
1  764  ASN n 
1  765  ASN n 
1  766  PHE n 
1  767  LYS n 
1  768  SER n 
1  769  MET n 
1  770  VAL n 
1  771  VAL n 
1  772  SER n 
1  773  GLY n 
1  774  ALA n 
1  775  LYS n 
1  776  GLY n 
1  777  SER n 
1  778  LYS n 
1  779  ILE n 
1  780  ASN n 
1  781  ILE n 
1  782  SER n 
1  783  GLN n 
1  784  VAL n 
1  785  ILE n 
1  786  ALA n 
1  787  VAL n 
1  788  VAL n 
1  789  GLY n 
1  790  GLN n 
1  791  GLN n 
1  792  ASN n 
1  793  VAL n 
1  794  GLU n 
1  795  GLY n 
1  796  LYS n 
1  797  ARG n 
1  798  ILE n 
1  799  PRO n 
1  800  PHE n 
1  801  GLY n 
1  802  PHE n 
1  803  LYS n 
1  804  HIS n 
1  805  ARG n 
1  806  THR n 
1  807  LEU n 
1  808  PRO n 
1  809  HIS n 
1  810  PHE n 
1  811  ILE n 
1  812  LYS n 
1  813  ASP n 
1  814  ASP n 
1  815  TYR n 
1  816  GLY n 
1  817  PRO n 
1  818  GLU n 
1  819  SER n 
1  820  ARG n 
1  821  GLY n 
1  822  PHE n 
1  823  VAL n 
1  824  GLU n 
1  825  ASN n 
1  826  SER n 
1  827  TYR n 
1  828  LEU n 
1  829  ALA n 
1  830  GLY n 
1  831  LEU n 
1  832  THR n 
1  833  PRO n 
1  834  THR n 
1  835  GLU n 
1  836  PHE n 
1  837  PHE n 
1  838  PHE n 
1  839  HIS n 
1  840  ALA n 
1  841  MET n 
1  842  GLY n 
1  843  GLY n 
1  844  ARG n 
1  845  GLU n 
1  846  GLY n 
1  847  LEU n 
1  848  ILE n 
1  849  ASP n 
1  850  THR n 
1  851  ALA n 
1  852  VAL n 
1  853  LYS n 
1  854  THR n 
1  855  ALA n 
1  856  GLU n 
1  857  THR n 
1  858  GLY n 
1  859  TYR n 
1  860  ILE n 
1  861  GLN n 
1  862  ARG n 
1  863  ARG n 
1  864  LEU n 
1  865  ILE n 
1  866  LYS n 
1  867  SER n 
1  868  MET n 
1  869  GLU n 
1  870  SER n 
1  871  VAL n 
1  872  MET n 
1  873  VAL n 
1  874  LYS n 
1  875  TYR n 
1  876  ASP n 
1  877  ALA n 
1  878  THR n 
1  879  VAL n 
1  880  ARG n 
1  881  ASN n 
1  882  SER n 
1  883  ILE n 
1  884  ASN n 
1  885  GLN n 
1  886  VAL n 
1  887  VAL n 
1  888  GLN n 
1  889  LEU n 
1  890  ARG n 
1  891  TYR n 
1  892  GLY n 
1  893  GLU n 
1  894  ASP n 
1  895  GLY n 
1  896  LEU n 
1  897  ALA n 
1  898  GLY n 
1  899  GLU n 
1  900  SER n 
1  901  VAL n 
1  902  GLU n 
1  903  PHE n 
1  904  GLN n 
1  905  ASN n 
1  906  LEU n 
1  907  ALA n 
1  908  THR n 
1  909  LEU n 
1  910  LYS n 
1  911  PRO n 
1  912  SER n 
1  913  ASN n 
1  914  LYS n 
1  915  ALA n 
1  916  PHE n 
1  917  GLU n 
1  918  LYS n 
1  919  LYS n 
1  920  PHE n 
1  921  ARG n 
1  922  PHE n 
1  923  ASP n 
1  924  TYR n 
1  925  THR n 
1  926  ASN n 
1  927  GLU n 
1  928  ARG n 
1  929  ALA n 
1  930  LEU n 
1  931  ARG n 
1  932  ARG n 
1  933  THR n 
1  934  LEU n 
1  935  GLN n 
1  936  GLU n 
1  937  ASP n 
1  938  LEU n 
1  939  VAL n 
1  940  LYS n 
1  941  ASP n 
1  942  VAL n 
1  943  LEU n 
1  944  SER n 
1  945  ASN n 
1  946  ALA n 
1  947  HIS n 
1  948  ILE n 
1  949  GLN n 
1  950  ASN n 
1  951  GLU n 
1  952  LEU n 
1  953  GLU n 
1  954  ARG n 
1  955  GLU n 
1  956  PHE n 
1  957  GLU n 
1  958  ARG n 
1  959  MET n 
1  960  ARG n 
1  961  GLU n 
1  962  ASP n 
1  963  ARG n 
1  964  GLU n 
1  965  VAL n 
1  966  LEU n 
1  967  ARG n 
1  968  VAL n 
1  969  ILE n 
1  970  PHE n 
1  971  PRO n 
1  972  THR n 
1  973  GLY n 
1  974  ASP n 
1  975  SER n 
1  976  LYS n 
1  977  VAL n 
1  978  VAL n 
1  979  LEU n 
1  980  PRO n 
1  981  CYS n 
1  982  ASN n 
1  983  LEU n 
1  984  LEU n 
1  985  ARG n 
1  986  MET n 
1  987  ILE n 
1  988  TRP n 
1  989  ASN n 
1  990  ALA n 
1  991  GLN n 
1  992  LYS n 
1  993  ILE n 
1  994  PHE n 
1  995  HIS n 
1  996  ILE n 
1  997  ASN n 
1  998  PRO n 
1  999  ARG n 
1  1000 LEU n 
1  1001 PRO n 
1  1002 SER n 
1  1003 ASP n 
1  1004 LEU n 
1  1005 HIS n 
1  1006 PRO n 
1  1007 ILE n 
1  1008 LYS n 
1  1009 VAL n 
1  1010 VAL n 
1  1011 GLU n 
1  1012 GLY n 
1  1013 VAL n 
1  1014 LYS n 
1  1015 GLU n 
1  1016 LEU n 
1  1017 SER n 
1  1018 LYS n 
1  1019 LYS n 
1  1020 LEU n 
1  1021 VAL n 
1  1022 ILE n 
1  1023 VAL n 
1  1024 ASN n 
1  1025 GLY n 
1  1026 ASP n 
1  1027 ASP n 
1  1028 PRO n 
1  1029 LEU n 
1  1030 SER n 
1  1031 ARG n 
1  1032 GLN n 
1  1033 ALA n 
1  1034 GLN n 
1  1035 GLU n 
1  1036 ASN n 
1  1037 ALA n 
1  1038 THR n 
1  1039 LEU n 
1  1040 LEU n 
1  1041 PHE n 
1  1042 ASN n 
1  1043 ILE n 
1  1044 HIS n 
1  1045 LEU n 
1  1046 ARG n 
1  1047 SER n 
1  1048 THR n 
1  1049 LEU n 
1  1050 CYS n 
1  1051 SER n 
1  1052 ARG n 
1  1053 ARG n 
1  1054 MET n 
1  1055 ALA n 
1  1056 GLU n 
1  1057 GLU n 
1  1058 PHE n 
1  1059 ARG n 
1  1060 LEU n 
1  1061 SER n 
1  1062 GLY n 
1  1063 GLU n 
1  1064 ALA n 
1  1065 PHE n 
1  1066 ASP n 
1  1067 TRP n 
1  1068 LEU n 
1  1069 LEU n 
1  1070 GLY n 
1  1071 GLU n 
1  1072 ILE n 
1  1073 GLU n 
1  1074 SER n 
1  1075 LYS n 
1  1076 PHE n 
1  1077 ASN n 
1  1078 GLN n 
1  1079 ALA n 
1  1080 ILE n 
1  1081 ALA n 
1  1082 HIS n 
1  1083 PRO n 
1  1084 GLY n 
1  1085 GLU n 
1  1086 MET n 
1  1087 VAL n 
1  1088 GLY n 
1  1089 ALA n 
1  1090 LEU n 
1  1091 ALA n 
1  1092 ALA n 
1  1093 GLN n 
1  1094 SER n 
1  1095 LEU n 
1  1096 GLY n 
1  1097 GLU n 
1  1098 PRO n 
1  1099 ALA n 
1  1100 THR n 
1  1101 GLN n 
1  1102 MET n 
1  1103 THR n 
1  1104 LEU n 
1  1105 ASN n 
1  1106 THR n 
1  1107 PHE n 
1  1108 HIS n 
1  1109 TYR n 
1  1110 ALA n 
1  1111 GLY n 
1  1112 VAL n 
1  1113 SER n 
1  1114 ALA n 
1  1115 LYS n 
1  1116 ASN n 
1  1117 VAL n 
1  1118 THR n 
1  1119 LEU n 
1  1120 GLY n 
1  1121 VAL n 
1  1122 PRO n 
1  1123 ARG n 
1  1124 LEU n 
1  1125 LYS n 
1  1126 GLU n 
1  1127 LEU n 
1  1128 ILE n 
1  1129 ASN n 
1  1130 ILE n 
1  1131 SER n 
1  1132 LYS n 
1  1133 LYS n 
1  1134 PRO n 
1  1135 LYS n 
1  1136 THR n 
1  1137 PRO n 
1  1138 SER n 
1  1139 LEU n 
1  1140 THR n 
1  1141 VAL n 
1  1142 PHE n 
1  1143 LEU n 
1  1144 LEU n 
1  1145 GLY n 
1  1146 GLN n 
1  1147 SER n 
1  1148 ALA n 
1  1149 ARG n 
1  1150 ASP n 
1  1151 ALA n 
1  1152 GLU n 
1  1153 ARG n 
1  1154 ALA n 
1  1155 LYS n 
1  1156 ASP n 
1  1157 ILE n 
1  1158 LEU n 
1  1159 CYS n 
1  1160 ARG n 
1  1161 LEU n 
1  1162 GLU n 
1  1163 HIS n 
1  1164 THR n 
1  1165 THR n 
1  1166 LEU n 
1  1167 ARG n 
1  1168 LYS n 
1  1169 VAL n 
1  1170 THR n 
1  1171 ALA n 
1  1172 ASN n 
1  1173 THR n 
1  1174 ALA n 
1  1175 ILE n 
1  1176 TYR n 
1  1177 TYR n 
1  1178 ASP n 
1  1179 PRO n 
1  1180 ASN n 
1  1181 PRO n 
1  1182 GLN n 
1  1183 SER n 
1  1184 THR n 
1  1185 VAL n 
1  1186 VAL n 
1  1187 ALA n 
1  1188 GLU n 
1  1189 ASP n 
1  1190 GLN n 
1  1191 GLU n 
1  1192 TRP n 
1  1193 VAL n 
1  1194 ASN n 
1  1195 VAL n 
1  1196 TYR n 
1  1197 TYR n 
1  1198 GLU n 
1  1199 MET n 
1  1200 PRO n 
1  1201 ASP n 
1  1202 PHE n 
1  1203 ASP n 
1  1204 VAL n 
1  1205 ALA n 
1  1206 ARG n 
1  1207 ILE n 
1  1208 SER n 
1  1209 PRO n 
1  1210 TRP n 
1  1211 LEU n 
1  1212 LEU n 
1  1213 ARG n 
1  1214 VAL n 
1  1215 GLU n 
1  1216 LEU n 
1  1217 ASP n 
1  1218 ARG n 
1  1219 LYS n 
1  1220 HIS n 
1  1221 MET n 
1  1222 THR n 
1  1223 ASP n 
1  1224 ARG n 
1  1225 LYS n 
1  1226 LEU n 
1  1227 THR n 
1  1228 MET n 
1  1229 GLU n 
1  1230 GLN n 
1  1231 ILE n 
1  1232 ALA n 
1  1233 GLU n 
1  1234 LYS n 
1  1235 ILE n 
1  1236 ASN n 
1  1237 ALA n 
1  1238 GLY n 
1  1239 PHE n 
1  1240 GLY n 
1  1241 ASP n 
1  1242 ASP n 
1  1243 LEU n 
1  1244 ASN n 
1  1245 CYS n 
1  1246 ILE n 
1  1247 PHE n 
1  1248 ASN n 
1  1249 ASP n 
1  1250 ASP n 
1  1251 ASN n 
1  1252 ALA n 
1  1253 GLU n 
1  1254 LYS n 
1  1255 LEU n 
1  1256 VAL n 
1  1257 LEU n 
1  1258 ARG n 
1  1259 ILE n 
1  1260 ARG n 
1  1261 ILE n 
1  1262 MET n 
1  1263 ASN n 
1  1264 SER n 
1  1265 ASP n 
1  1266 GLU n 
1  1267 ASN n 
1  1268 LYS n 
1  1269 MET n 
1  1270 GLN n 
1  1271 GLU n 
1  1272 GLU n 
1  1273 GLU n 
1  1274 GLU n 
1  1275 VAL n 
1  1276 VAL n 
1  1277 ASP n 
1  1278 LYS n 
1  1279 MET n 
1  1280 ASP n 
1  1281 ASP n 
1  1282 ASP n 
1  1283 VAL n 
1  1284 PHE n 
1  1285 LEU n 
1  1286 ARG n 
1  1287 CYS n 
1  1288 ILE n 
1  1289 GLU n 
1  1290 SER n 
1  1291 ASN n 
1  1292 MET n 
1  1293 LEU n 
1  1294 THR n 
1  1295 ASP n 
1  1296 MET n 
1  1297 THR n 
1  1298 LEU n 
1  1299 GLN n 
1  1300 GLY n 
1  1301 ILE n 
1  1302 GLU n 
1  1303 GLN n 
1  1304 ILE n 
1  1305 SER n 
1  1306 LYS n 
1  1307 VAL n 
1  1308 TYR n 
1  1309 MET n 
1  1310 HIS n 
1  1311 LEU n 
1  1312 PRO n 
1  1313 GLN n 
1  1314 THR n 
1  1315 ASP n 
1  1316 ASN n 
1  1317 LYS n 
1  1318 LYS n 
1  1319 LYS n 
1  1320 ILE n 
1  1321 ILE n 
1  1322 ILE n 
1  1323 THR n 
1  1324 GLU n 
1  1325 ASP n 
1  1326 GLY n 
1  1327 GLU n 
1  1328 PHE n 
1  1329 LYS n 
1  1330 ALA n 
1  1331 LEU n 
1  1332 GLN n 
1  1333 GLU n 
1  1334 TRP n 
1  1335 ILE n 
1  1336 LEU n 
1  1337 GLU n 
1  1338 THR n 
1  1339 ASP n 
1  1340 GLY n 
1  1341 VAL n 
1  1342 SER n 
1  1343 LEU n 
1  1344 MET n 
1  1345 ARG n 
1  1346 VAL n 
1  1347 LEU n 
1  1348 SER n 
1  1349 GLU n 
1  1350 LYS n 
1  1351 ASP n 
1  1352 VAL n 
1  1353 ASP n 
1  1354 PRO n 
1  1355 VAL n 
1  1356 ARG n 
1  1357 THR n 
1  1358 THR n 
1  1359 SER n 
1  1360 ASN n 
1  1361 ASP n 
1  1362 ILE n 
1  1363 VAL n 
1  1364 GLU n 
1  1365 ILE n 
1  1366 PHE n 
1  1367 THR n 
1  1368 VAL n 
1  1369 LEU n 
1  1370 GLY n 
1  1371 ILE n 
1  1372 GLU n 
1  1373 ALA n 
1  1374 VAL n 
1  1375 ARG n 
1  1376 LYS n 
1  1377 ALA n 
1  1378 LEU n 
1  1379 GLU n 
1  1380 ARG n 
1  1381 GLU n 
1  1382 LEU n 
1  1383 TYR n 
1  1384 HIS n 
1  1385 VAL n 
1  1386 ILE n 
1  1387 SER n 
1  1388 PHE n 
1  1389 ASP n 
1  1390 GLY n 
1  1391 SER n 
1  1392 TYR n 
1  1393 VAL n 
1  1394 ASN n 
1  1395 TYR n 
1  1396 ARG n 
1  1397 HIS n 
1  1398 LEU n 
1  1399 ALA n 
1  1400 LEU n 
1  1401 LEU n 
1  1402 CYS n 
1  1403 ASP n 
1  1404 THR n 
1  1405 MET n 
1  1406 THR n 
1  1407 CYS n 
1  1408 ARG n 
1  1409 GLY n 
1  1410 HIS n 
1  1411 LEU n 
1  1412 MET n 
1  1413 ALA n 
1  1414 ILE n 
1  1415 THR n 
1  1416 ARG n 
1  1417 HIS n 
1  1418 GLY n 
1  1419 VAL n 
1  1420 ASN n 
1  1421 ARG n 
1  1422 GLN n 
1  1423 ASP n 
1  1424 THR n 
1  1425 GLY n 
1  1426 PRO n 
1  1427 LEU n 
1  1428 MET n 
1  1429 LYS n 
1  1430 CYS n 
1  1431 SER n 
1  1432 PHE n 
1  1433 GLU n 
1  1434 GLU n 
1  1435 THR n 
1  1436 VAL n 
1  1437 ASP n 
1  1438 VAL n 
1  1439 LEU n 
1  1440 MET n 
1  1441 GLU n 
1  1442 ALA n 
1  1443 ALA n 
1  1444 ALA n 
1  1445 HIS n 
1  1446 GLY n 
1  1447 GLU n 
1  1448 SER n 
1  1449 ASP n 
1  1450 PRO n 
1  1451 MET n 
1  1452 LYS n 
1  1453 GLY n 
1  1454 VAL n 
1  1455 SER n 
1  1456 GLU n 
1  1457 ASN n 
1  1458 ILE n 
1  1459 MET n 
1  1460 LEU n 
1  1461 GLY n 
1  1462 GLN n 
1  1463 LEU n 
1  1464 ALA n 
1  1465 PRO n 
1  1466 ALA n 
1  1467 GLY n 
1  1468 THR n 
1  1469 GLY n 
1  1470 CYS n 
1  1471 PHE n 
1  1472 ASP n 
1  1473 LEU n 
1  1474 LEU n 
1  1475 LEU n 
1  1476 ASP n 
1  1477 ALA n 
1  1478 GLU n 
1  1479 LYS n 
1  1480 CYS n 
1  1481 LYS n 
1  1482 TYR n 
1  1483 GLY n 
1  1484 MET n 
1  1485 GLU n 
1  1486 ILE n 
1  1487 PRO n 
1  1488 THR n 
1  1489 ASN n 
1  1490 ILE n 
1  1491 PRO n 
1  1492 GLY n 
1  1493 LEU n 
1  1494 GLY n 
1  1495 ALA n 
1  1496 ALA n 
1  1497 GLY n 
1  1498 PRO n 
1  1499 THR n 
1  1500 GLY n 
1  1501 MET n 
1  1502 PHE n 
1  1503 PHE n 
1  1504 GLY n 
1  1505 SER n 
1  1506 ALA n 
1  1507 PRO n 
1  1508 SER n 
1  1509 PRO n 
1  1510 MET n 
1  1511 GLY n 
1  1512 GLY n 
1  1513 ILE n 
1  1514 SER n 
1  1515 PRO n 
1  1516 ALA n 
1  1517 MET n 
1  1518 THR n 
1  1519 PRO n 
1  1520 TRP n 
1  1521 ASN n 
1  1522 GLN n 
1  1523 GLY n 
1  1524 ALA n 
1  1525 THR n 
1  1526 PRO n 
1  1527 ALA n 
1  1528 TYR n 
1  1529 GLY n 
1  1530 ALA n 
1  1531 TRP n 
1  1532 SER n 
1  1533 PRO n 
1  1534 SER n 
1  1535 VAL n 
1  1536 GLY n 
1  1537 SER n 
1  1538 GLY n 
1  1539 MET n 
1  1540 THR n 
1  1541 PRO n 
1  1542 GLY n 
1  1543 ALA n 
1  1544 ALA n 
1  1545 GLY n 
1  1546 PHE n 
1  1547 SER n 
1  1548 PRO n 
1  1549 SER n 
1  1550 ALA n 
1  1551 ALA n 
1  1552 SER n 
1  1553 ASP n 
1  1554 ALA n 
1  1555 SER n 
1  1556 GLY n 
1  1557 PHE n 
1  1558 SER n 
1  1559 PRO n 
1  1560 GLY n 
1  1561 TYR n 
1  1562 SER n 
1  1563 PRO n 
1  1564 ALA n 
1  1565 TRP n 
1  1566 SER n 
1  1567 PRO n 
1  1568 THR n 
1  1569 PRO n 
1  1570 GLY n 
1  1571 SER n 
1  1572 PRO n 
1  1573 GLY n 
1  1574 SER n 
1  1575 PRO n 
1  1576 GLY n 
1  1577 PRO n 
1  1578 SER n 
1  1579 SER n 
1  1580 PRO n 
1  1581 TYR n 
1  1582 ILE n 
1  1583 PRO n 
1  1584 SER n 
1  1585 PRO n 
1  1586 GLY n 
1  1587 GLY n 
1  1588 ALA n 
1  1589 MET n 
1  1590 SER n 
1  1591 PRO n 
1  1592 SER n 
1  1593 TYR n 
1  1594 SER n 
1  1595 PRO n 
1  1596 THR n 
1  1597 SER n 
1  1598 PRO n 
1  1599 ALA n 
1  1600 TYR n 
1  1601 GLU n 
1  1602 PRO n 
1  1603 ARG n 
1  1604 SER n 
1  1605 PRO n 
1  1606 GLY n 
1  1607 GLY n 
1  1608 TYR n 
1  1609 THR n 
1  1610 PRO n 
1  1611 GLN n 
1  1612 SER n 
1  1613 PRO n 
1  1614 SER n 
1  1615 TYR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 THR n 
1  1619 SER n 
1  1620 PRO n 
1  1621 SER n 
1  1622 TYR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 THR n 
1  1626 SER n 
1  1627 PRO n 
1  1628 SER n 
1  1629 TYR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 THR n 
1  1633 SER n 
1  1634 PRO n 
1  1635 ASN n 
1  1636 TYR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 THR n 
1  1640 SER n 
1  1641 PRO n 
1  1642 SER n 
1  1643 TYR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 THR n 
1  1647 SER n 
1  1648 PRO n 
1  1649 SER n 
1  1650 TYR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 THR n 
1  1654 SER n 
1  1655 PRO n 
1  1656 SER n 
1  1657 TYR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 THR n 
1  1661 SER n 
1  1662 PRO n 
1  1663 SER n 
1  1664 TYR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 THR n 
1  1668 SER n 
1  1669 PRO n 
1  1670 SER n 
1  1671 TYR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 THR n 
1  1675 SER n 
1  1676 PRO n 
1  1677 SER n 
1  1678 TYR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 THR n 
1  1682 SER n 
1  1683 PRO n 
1  1684 SER n 
1  1685 TYR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 THR n 
1  1689 SER n 
1  1690 PRO n 
1  1691 SER n 
1  1692 TYR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 THR n 
1  1696 SER n 
1  1697 PRO n 
1  1698 SER n 
1  1699 TYR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 THR n 
1  1703 SER n 
1  1704 PRO n 
1  1705 SER n 
1  1706 TYR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 THR n 
1  1710 SER n 
1  1711 PRO n 
1  1712 SER n 
1  1713 TYR n 
1  1714 SER n 
1  1715 PRO n 
1  1716 THR n 
1  1717 SER n 
1  1718 PRO n 
1  1719 SER n 
1  1720 TYR n 
1  1721 SER n 
1  1722 PRO n 
1  1723 THR n 
1  1724 SER n 
1  1725 PRO n 
1  1726 SER n 
1  1727 TYR n 
1  1728 SER n 
1  1729 PRO n 
1  1730 THR n 
1  1731 SER n 
1  1732 PRO n 
1  1733 SER n 
1  1734 TYR n 
1  1735 SER n 
1  1736 PRO n 
1  1737 THR n 
1  1738 SER n 
1  1739 PRO n 
1  1740 SER n 
1  1741 TYR n 
1  1742 SER n 
1  1743 PRO n 
1  1744 THR n 
1  1745 SER n 
1  1746 PRO n 
1  1747 ASN n 
1  1748 TYR n 
1  1749 SER n 
1  1750 PRO n 
1  1751 THR n 
1  1752 SER n 
1  1753 PRO n 
1  1754 ASN n 
1  1755 TYR n 
1  1756 THR n 
1  1757 PRO n 
1  1758 THR n 
1  1759 SER n 
1  1760 PRO n 
1  1761 SER n 
1  1762 TYR n 
1  1763 SER n 
1  1764 PRO n 
1  1765 THR n 
1  1766 SER n 
1  1767 PRO n 
1  1768 SER n 
1  1769 TYR n 
1  1770 SER n 
1  1771 PRO n 
1  1772 THR n 
1  1773 SER n 
1  1774 PRO n 
1  1775 ASN n 
1  1776 TYR n 
1  1777 THR n 
1  1778 PRO n 
1  1779 THR n 
1  1780 SER n 
1  1781 PRO n 
1  1782 ASN n 
1  1783 TYR n 
1  1784 SER n 
1  1785 PRO n 
1  1786 THR n 
1  1787 SER n 
1  1788 PRO n 
1  1789 SER n 
1  1790 TYR n 
1  1791 SER n 
1  1792 PRO n 
1  1793 THR n 
1  1794 SER n 
1  1795 PRO n 
1  1796 SER n 
1  1797 TYR n 
1  1798 SER n 
1  1799 PRO n 
1  1800 THR n 
1  1801 SER n 
1  1802 PRO n 
1  1803 SER n 
1  1804 TYR n 
1  1805 SER n 
1  1806 PRO n 
1  1807 SER n 
1  1808 SER n 
1  1809 PRO n 
1  1810 ARG n 
1  1811 TYR n 
1  1812 THR n 
1  1813 PRO n 
1  1814 GLN n 
1  1815 SER n 
1  1816 PRO n 
1  1817 THR n 
1  1818 TYR n 
1  1819 THR n 
1  1820 PRO n 
1  1821 SER n 
1  1822 SER n 
1  1823 PRO n 
1  1824 SER n 
1  1825 TYR n 
1  1826 SER n 
1  1827 PRO n 
1  1828 SER n 
1  1829 SER n 
1  1830 PRO n 
1  1831 SER n 
1  1832 TYR n 
1  1833 SER n 
1  1834 PRO n 
1  1835 ALA n 
1  1836 SER n 
1  1837 PRO n 
1  1838 LYS n 
1  1839 TYR n 
1  1840 THR n 
1  1841 PRO n 
1  1842 THR n 
1  1843 SER n 
1  1844 PRO n 
1  1845 SER n 
1  1846 TYR n 
1  1847 SER n 
1  1848 PRO n 
1  1849 SER n 
1  1850 SER n 
1  1851 PRO n 
1  1852 GLU n 
1  1853 TYR n 
1  1854 THR n 
1  1855 PRO n 
1  1856 THR n 
1  1857 SER n 
1  1858 PRO n 
1  1859 LYS n 
1  1860 TYR n 
1  1861 SER n 
1  1862 PRO n 
1  1863 THR n 
1  1864 SER n 
1  1865 PRO n 
1  1866 LYS n 
1  1867 TYR n 
1  1868 SER n 
1  1869 PRO n 
1  1870 THR n 
1  1871 SER n 
1  1872 PRO n 
1  1873 LYS n 
1  1874 TYR n 
1  1875 SER n 
1  1876 PRO n 
1  1877 THR n 
1  1878 SER n 
1  1879 PRO n 
1  1880 THR n 
1  1881 TYR n 
1  1882 SER n 
1  1883 PRO n 
1  1884 THR n 
1  1885 THR n 
1  1886 PRO n 
1  1887 LYS n 
1  1888 TYR n 
1  1889 SER n 
1  1890 PRO n 
1  1891 THR n 
1  1892 SER n 
1  1893 PRO n 
1  1894 THR n 
1  1895 TYR n 
1  1896 SER n 
1  1897 PRO n 
1  1898 THR n 
1  1899 SER n 
1  1900 PRO n 
1  1901 VAL n 
1  1902 TYR n 
1  1903 THR n 
1  1904 PRO n 
1  1905 THR n 
1  1906 SER n 
1  1907 PRO n 
1  1908 LYS n 
1  1909 TYR n 
1  1910 SER n 
1  1911 PRO n 
1  1912 THR n 
1  1913 SER n 
1  1914 PRO n 
1  1915 THR n 
1  1916 TYR n 
1  1917 SER n 
1  1918 PRO n 
1  1919 THR n 
1  1920 SER n 
1  1921 PRO n 
1  1922 LYS n 
1  1923 TYR n 
1  1924 SER n 
1  1925 PRO n 
1  1926 THR n 
1  1927 SER n 
1  1928 PRO n 
1  1929 THR n 
1  1930 TYR n 
1  1931 SER n 
1  1932 PRO n 
1  1933 THR n 
1  1934 SER n 
1  1935 PRO n 
1  1936 LYS n 
1  1937 GLY n 
1  1938 SER n 
1  1939 THR n 
1  1940 TYR n 
1  1941 SER n 
1  1942 PRO n 
1  1943 THR n 
1  1944 SER n 
1  1945 PRO n 
1  1946 GLY n 
1  1947 TYR n 
1  1948 SER n 
1  1949 PRO n 
1  1950 THR n 
1  1951 SER n 
1  1952 PRO n 
1  1953 THR n 
1  1954 TYR n 
1  1955 SER n 
1  1956 LEU n 
1  1957 THR n 
1  1958 SER n 
1  1959 PRO n 
1  1960 ALA n 
1  1961 ILE n 
1  1962 SER n 
1  1963 PRO n 
1  1964 ASP n 
1  1965 ASP n 
1  1966 SER n 
1  1967 ASP n 
1  1968 GLU n 
1  1969 GLU n 
1  1970 ASN n 
2  1    MET n 
2  2    TYR n 
2  3    ASP n 
2  4    ALA n 
2  5    ASP n 
2  6    GLU n 
2  7    ASP n 
2  8    MET n 
2  9    GLN n 
2  10   TYR n 
2  11   ASP n 
2  12   GLU n 
2  13   ASP n 
2  14   ASP n 
2  15   ASP n 
2  16   GLU n 
2  17   ILE n 
2  18   THR n 
2  19   PRO n 
2  20   ASP n 
2  21   LEU n 
2  22   TRP n 
2  23   GLN n 
2  24   GLU n 
2  25   ALA n 
2  26   CYS n 
2  27   TRP n 
2  28   ILE n 
2  29   VAL n 
2  30   ILE n 
2  31   SER n 
2  32   SER n 
2  33   TYR n 
2  34   PHE n 
2  35   ASP n 
2  36   GLU n 
2  37   LYS n 
2  38   GLY n 
2  39   LEU n 
2  40   VAL n 
2  41   ARG n 
2  42   GLN n 
2  43   GLN n 
2  44   LEU n 
2  45   ASP n 
2  46   SER n 
2  47   PHE n 
2  48   ASP n 
2  49   GLU n 
2  50   PHE n 
2  51   ILE n 
2  52   GLN n 
2  53   MET n 
2  54   SER n 
2  55   VAL n 
2  56   GLN n 
2  57   ARG n 
2  58   ILE n 
2  59   VAL n 
2  60   GLU n 
2  61   ASP n 
2  62   ALA n 
2  63   PRO n 
2  64   PRO n 
2  65   ILE n 
2  66   ASP n 
2  67   LEU n 
2  68   GLN n 
2  69   ALA n 
2  70   GLU n 
2  71   ALA n 
2  72   GLN n 
2  73   HIS n 
2  74   ALA n 
2  75   SER n 
2  76   GLY n 
2  77   GLU n 
2  78   VAL n 
2  79   GLU n 
2  80   GLU n 
2  81   PRO n 
2  82   PRO n 
2  83   ARG n 
2  84   TYR n 
2  85   LEU n 
2  86   LEU n 
2  87   LYS n 
2  88   PHE n 
2  89   GLU n 
2  90   GLN n 
2  91   ILE n 
2  92   TYR n 
2  93   LEU n 
2  94   SER n 
2  95   LYS n 
2  96   PRO n 
2  97   THR n 
2  98   HIS n 
2  99   TRP n 
2  100  GLU n 
2  101  ARG n 
2  102  ASP n 
2  103  GLY n 
2  104  ALA n 
2  105  PRO n 
2  106  SER n 
2  107  PRO n 
2  108  MET n 
2  109  MET n 
2  110  PRO n 
2  111  ASN n 
2  112  GLU n 
2  113  ALA n 
2  114  ARG n 
2  115  LEU n 
2  116  ARG n 
2  117  ASN n 
2  118  LEU n 
2  119  THR n 
2  120  TYR n 
2  121  SER n 
2  122  ALA n 
2  123  PRO n 
2  124  LEU n 
2  125  TYR n 
2  126  VAL n 
2  127  ASP n 
2  128  ILE n 
2  129  THR n 
2  130  LYS n 
2  131  THR n 
2  132  VAL n 
2  133  ILE n 
2  134  LYS n 
2  135  GLU n 
2  136  GLY n 
2  137  GLU n 
2  138  GLU n 
2  139  GLN n 
2  140  LEU n 
2  141  GLN n 
2  142  THR n 
2  143  GLN n 
2  144  HIS n 
2  145  GLN n 
2  146  LYS n 
2  147  THR n 
2  148  PHE n 
2  149  ILE n 
2  150  GLY n 
2  151  LYS n 
2  152  ILE n 
2  153  PRO n 
2  154  ILE n 
2  155  MET n 
2  156  LEU n 
2  157  ARG n 
2  158  SER n 
2  159  THR n 
2  160  TYR n 
2  161  CYS n 
2  162  LEU n 
2  163  LEU n 
2  164  ASN n 
2  165  GLY n 
2  166  LEU n 
2  167  THR n 
2  168  ASP n 
2  169  ARG n 
2  170  ASP n 
2  171  LEU n 
2  172  CYS n 
2  173  GLU n 
2  174  LEU n 
2  175  ASN n 
2  176  GLU n 
2  177  CYS n 
2  178  PRO n 
2  179  LEU n 
2  180  ASP n 
2  181  PRO n 
2  182  GLY n 
2  183  GLY n 
2  184  TYR n 
2  185  PHE n 
2  186  ILE n 
2  187  ILE n 
2  188  ASN n 
2  189  GLY n 
2  190  SER n 
2  191  GLU n 
2  192  LYS n 
2  193  VAL n 
2  194  LEU n 
2  195  ILE n 
2  196  ALA n 
2  197  GLN n 
2  198  GLU n 
2  199  LYS n 
2  200  MET n 
2  201  ALA n 
2  202  THR n 
2  203  ASN n 
2  204  THR n 
2  205  VAL n 
2  206  TYR n 
2  207  VAL n 
2  208  PHE n 
2  209  ALA n 
2  210  LYS n 
2  211  LYS n 
2  212  ASP n 
2  213  SER n 
2  214  LYS n 
2  215  TYR n 
2  216  ALA n 
2  217  TYR n 
2  218  THR n 
2  219  GLY n 
2  220  GLU n 
2  221  CYS n 
2  222  ARG n 
2  223  SER n 
2  224  CYS n 
2  225  LEU n 
2  226  GLU n 
2  227  ASN n 
2  228  SER n 
2  229  SER n 
2  230  ARG n 
2  231  PRO n 
2  232  THR n 
2  233  SER n 
2  234  THR n 
2  235  ILE n 
2  236  TRP n 
2  237  VAL n 
2  238  SER n 
2  239  MET n 
2  240  LEU n 
2  241  ALA n 
2  242  ARG n 
2  243  GLY n 
2  244  GLY n 
2  245  GLN n 
2  246  GLY n 
2  247  ALA n 
2  248  LYS n 
2  249  LYS n 
2  250  SER n 
2  251  ALA n 
2  252  ILE n 
2  253  GLY n 
2  254  GLN n 
2  255  ARG n 
2  256  ILE n 
2  257  VAL n 
2  258  ALA n 
2  259  THR n 
2  260  LEU n 
2  261  PRO n 
2  262  TYR n 
2  263  ILE n 
2  264  LYS n 
2  265  GLN n 
2  266  GLU n 
2  267  VAL n 
2  268  PRO n 
2  269  ILE n 
2  270  ILE n 
2  271  ILE n 
2  272  VAL n 
2  273  PHE n 
2  274  ARG n 
2  275  ALA n 
2  276  LEU n 
2  277  GLY n 
2  278  PHE n 
2  279  VAL n 
2  280  SER n 
2  281  ASP n 
2  282  ARG n 
2  283  ASP n 
2  284  ILE n 
2  285  LEU n 
2  286  GLU n 
2  287  HIS n 
2  288  ILE n 
2  289  ILE n 
2  290  TYR n 
2  291  ASP n 
2  292  PHE n 
2  293  GLU n 
2  294  ASP n 
2  295  PRO n 
2  296  GLU n 
2  297  MET n 
2  298  MET n 
2  299  GLU n 
2  300  MET n 
2  301  VAL n 
2  302  LYS n 
2  303  PRO n 
2  304  SER n 
2  305  LEU n 
2  306  ASP n 
2  307  GLU n 
2  308  ALA n 
2  309  PHE n 
2  310  VAL n 
2  311  ILE n 
2  312  GLN n 
2  313  GLU n 
2  314  GLN n 
2  315  ASN n 
2  316  VAL n 
2  317  ALA n 
2  318  LEU n 
2  319  ASN n 
2  320  PHE n 
2  321  ILE n 
2  322  GLY n 
2  323  SER n 
2  324  ARG n 
2  325  GLY n 
2  326  ALA n 
2  327  LYS n 
2  328  PRO n 
2  329  GLY n 
2  330  VAL n 
2  331  THR n 
2  332  LYS n 
2  333  GLU n 
2  334  LYS n 
2  335  ARG n 
2  336  ILE n 
2  337  LYS n 
2  338  TYR n 
2  339  ALA n 
2  340  LYS n 
2  341  GLU n 
2  342  VAL n 
2  343  LEU n 
2  344  GLN n 
2  345  LYS n 
2  346  GLU n 
2  347  MET n 
2  348  LEU n 
2  349  PRO n 
2  350  HIS n 
2  351  VAL n 
2  352  GLY n 
2  353  VAL n 
2  354  SER n 
2  355  ASP n 
2  356  PHE n 
2  357  CYS n 
2  358  GLU n 
2  359  THR n 
2  360  LYS n 
2  361  LYS n 
2  362  ALA n 
2  363  TYR n 
2  364  PHE n 
2  365  LEU n 
2  366  GLY n 
2  367  TYR n 
2  368  MET n 
2  369  VAL n 
2  370  HIS n 
2  371  ARG n 
2  372  LEU n 
2  373  LEU n 
2  374  LEU n 
2  375  ALA n 
2  376  ALA n 
2  377  LEU n 
2  378  GLY n 
2  379  ARG n 
2  380  ARG n 
2  381  GLU n 
2  382  LEU n 
2  383  ASP n 
2  384  ASP n 
2  385  ARG n 
2  386  ASP n 
2  387  HIS n 
2  388  TYR n 
2  389  GLY n 
2  390  ASN n 
2  391  LYS n 
2  392  ARG n 
2  393  LEU n 
2  394  ASP n 
2  395  LEU n 
2  396  ALA n 
2  397  GLY n 
2  398  PRO n 
2  399  LEU n 
2  400  LEU n 
2  401  ALA n 
2  402  PHE n 
2  403  LEU n 
2  404  PHE n 
2  405  ARG n 
2  406  GLY n 
2  407  MET n 
2  408  PHE n 
2  409  LYS n 
2  410  ASN n 
2  411  LEU n 
2  412  LEU n 
2  413  LYS n 
2  414  GLU n 
2  415  VAL n 
2  416  ARG n 
2  417  ILE n 
2  418  TYR n 
2  419  ALA n 
2  420  GLN n 
2  421  LYS n 
2  422  PHE n 
2  423  ILE n 
2  424  ASP n 
2  425  ARG n 
2  426  GLY n 
2  427  LYS n 
2  428  ASP n 
2  429  PHE n 
2  430  ASN n 
2  431  LEU n 
2  432  GLU n 
2  433  LEU n 
2  434  ALA n 
2  435  ILE n 
2  436  LYS n 
2  437  THR n 
2  438  ARG n 
2  439  ILE n 
2  440  ILE n 
2  441  SER n 
2  442  ASP n 
2  443  GLY n 
2  444  LEU n 
2  445  LYS n 
2  446  TYR n 
2  447  SER n 
2  448  LEU n 
2  449  ALA n 
2  450  THR n 
2  451  GLY n 
2  452  ASN n 
2  453  TRP n 
2  454  GLY n 
2  455  ASP n 
2  456  GLN n 
2  457  LYS n 
2  458  LYS n 
2  459  ALA n 
2  460  HIS n 
2  461  GLN n 
2  462  ALA n 
2  463  ARG n 
2  464  ALA n 
2  465  GLY n 
2  466  VAL n 
2  467  SER n 
2  468  GLN n 
2  469  VAL n 
2  470  LEU n 
2  471  ASN n 
2  472  ARG n 
2  473  LEU n 
2  474  THR n 
2  475  PHE n 
2  476  ALA n 
2  477  SER n 
2  478  THR n 
2  479  LEU n 
2  480  SER n 
2  481  HIS n 
2  482  LEU n 
2  483  ARG n 
2  484  ARG n 
2  485  LEU n 
2  486  ASN n 
2  487  SER n 
2  488  PRO n 
2  489  ILE n 
2  490  GLY n 
2  491  ARG n 
2  492  ASP n 
2  493  GLY n 
2  494  LYS n 
2  495  LEU n 
2  496  ALA n 
2  497  LYS n 
2  498  PRO n 
2  499  ARG n 
2  500  GLN n 
2  501  LEU n 
2  502  HIS n 
2  503  ASN n 
2  504  THR n 
2  505  LEU n 
2  506  TRP n 
2  507  GLY n 
2  508  MET n 
2  509  VAL n 
2  510  CYS n 
2  511  PRO n 
2  512  ALA n 
2  513  GLU n 
2  514  THR n 
2  515  PRO n 
2  516  GLU n 
2  517  GLY n 
2  518  HIS n 
2  519  ALA n 
2  520  VAL n 
2  521  GLY n 
2  522  LEU n 
2  523  VAL n 
2  524  LYS n 
2  525  ASN n 
2  526  LEU n 
2  527  ALA n 
2  528  LEU n 
2  529  MET n 
2  530  ALA n 
2  531  TYR n 
2  532  ILE n 
2  533  SER n 
2  534  VAL n 
2  535  GLY n 
2  536  SER n 
2  537  GLN n 
2  538  PRO n 
2  539  SER n 
2  540  PRO n 
2  541  ILE n 
2  542  LEU n 
2  543  GLU n 
2  544  PHE n 
2  545  LEU n 
2  546  GLU n 
2  547  GLU n 
2  548  TRP n 
2  549  SER n 
2  550  MET n 
2  551  GLU n 
2  552  ASN n 
2  553  LEU n 
2  554  GLU n 
2  555  GLU n 
2  556  ILE n 
2  557  SER n 
2  558  PRO n 
2  559  ALA n 
2  560  ALA n 
2  561  ILE n 
2  562  ALA n 
2  563  ASP n 
2  564  ALA n 
2  565  THR n 
2  566  LYS n 
2  567  ILE n 
2  568  PHE n 
2  569  VAL n 
2  570  ASN n 
2  571  GLY n 
2  572  CYS n 
2  573  TRP n 
2  574  VAL n 
2  575  GLY n 
2  576  ILE n 
2  577  HIS n 
2  578  LYS n 
2  579  ASP n 
2  580  PRO n 
2  581  GLU n 
2  582  GLN n 
2  583  LEU n 
2  584  MET n 
2  585  ASN n 
2  586  THR n 
2  587  LEU n 
2  588  ARG n 
2  589  LYS n 
2  590  LEU n 
2  591  ARG n 
2  592  ARG n 
2  593  GLN n 
2  594  MET n 
2  595  ASP n 
2  596  ILE n 
2  597  ILE n 
2  598  VAL n 
2  599  SER n 
2  600  GLU n 
2  601  VAL n 
2  602  SER n 
2  603  MET n 
2  604  ILE n 
2  605  ARG n 
2  606  ASP n 
2  607  ILE n 
2  608  ARG n 
2  609  GLU n 
2  610  ARG n 
2  611  GLU n 
2  612  ILE n 
2  613  ARG n 
2  614  ILE n 
2  615  TYR n 
2  616  THR n 
2  617  ASP n 
2  618  ALA n 
2  619  GLY n 
2  620  ARG n 
2  621  ILE n 
2  622  CYS n 
2  623  ARG n 
2  624  PRO n 
2  625  LEU n 
2  626  LEU n 
2  627  ILE n 
2  628  VAL n 
2  629  GLU n 
2  630  LYS n 
2  631  GLN n 
2  632  LYS n 
2  633  LEU n 
2  634  LEU n 
2  635  LEU n 
2  636  LYS n 
2  637  LYS n 
2  638  ARG n 
2  639  HIS n 
2  640  ILE n 
2  641  ASP n 
2  642  GLN n 
2  643  LEU n 
2  644  LYS n 
2  645  GLU n 
2  646  ARG n 
2  647  GLU n 
2  648  TYR n 
2  649  ASN n 
2  650  ASN n 
2  651  TYR n 
2  652  SER n 
2  653  TRP n 
2  654  GLN n 
2  655  ASP n 
2  656  LEU n 
2  657  VAL n 
2  658  ALA n 
2  659  SER n 
2  660  GLY n 
2  661  VAL n 
2  662  VAL n 
2  663  GLU n 
2  664  TYR n 
2  665  ILE n 
2  666  ASP n 
2  667  THR n 
2  668  LEU n 
2  669  GLU n 
2  670  GLU n 
2  671  GLU n 
2  672  THR n 
2  673  VAL n 
2  674  MET n 
2  675  LEU n 
2  676  ALA n 
2  677  MET n 
2  678  THR n 
2  679  PRO n 
2  680  ASP n 
2  681  ASP n 
2  682  LEU n 
2  683  GLN n 
2  684  GLU n 
2  685  LYS n 
2  686  GLU n 
2  687  VAL n 
2  688  ALA n 
2  689  TYR n 
2  690  CYS n 
2  691  SER n 
2  692  THR n 
2  693  TYR n 
2  694  THR n 
2  695  HIS n 
2  696  CYS n 
2  697  GLU n 
2  698  ILE n 
2  699  HIS n 
2  700  PRO n 
2  701  SER n 
2  702  MET n 
2  703  ILE n 
2  704  LEU n 
2  705  GLY n 
2  706  VAL n 
2  707  CYS n 
2  708  ALA n 
2  709  SER n 
2  710  ILE n 
2  711  ILE n 
2  712  PRO n 
2  713  PHE n 
2  714  PRO n 
2  715  ASP n 
2  716  HIS n 
2  717  ASN n 
2  718  GLN n 
2  719  SER n 
2  720  PRO n 
2  721  ARG n 
2  722  ASN n 
2  723  THR n 
2  724  TYR n 
2  725  GLN n 
2  726  SER n 
2  727  ALA n 
2  728  MET n 
2  729  GLY n 
2  730  LYS n 
2  731  GLN n 
2  732  ALA n 
2  733  MET n 
2  734  GLY n 
2  735  VAL n 
2  736  TYR n 
2  737  ILE n 
2  738  THR n 
2  739  ASN n 
2  740  PHE n 
2  741  HIS n 
2  742  VAL n 
2  743  ARG n 
2  744  MET n 
2  745  ASP n 
2  746  THR n 
2  747  LEU n 
2  748  ALA n 
2  749  HIS n 
2  750  VAL n 
2  751  LEU n 
2  752  TYR n 
2  753  TYR n 
2  754  PRO n 
2  755  GLN n 
2  756  LYS n 
2  757  PRO n 
2  758  LEU n 
2  759  VAL n 
2  760  THR n 
2  761  THR n 
2  762  ARG n 
2  763  SER n 
2  764  MET n 
2  765  GLU n 
2  766  TYR n 
2  767  LEU n 
2  768  ARG n 
2  769  PHE n 
2  770  ARG n 
2  771  GLU n 
2  772  LEU n 
2  773  PRO n 
2  774  ALA n 
2  775  GLY n 
2  776  ILE n 
2  777  ASN n 
2  778  SER n 
2  779  ILE n 
2  780  VAL n 
2  781  ALA n 
2  782  ILE n 
2  783  ALA n 
2  784  SER n 
2  785  TYR n 
2  786  THR n 
2  787  GLY n 
2  788  TYR n 
2  789  ASN n 
2  790  GLN n 
2  791  GLU n 
2  792  ASP n 
2  793  SER n 
2  794  VAL n 
2  795  ILE n 
2  796  MET n 
2  797  ASN n 
2  798  ARG n 
2  799  SER n 
2  800  ALA n 
2  801  VAL n 
2  802  ASP n 
2  803  ARG n 
2  804  GLY n 
2  805  PHE n 
2  806  PHE n 
2  807  ARG n 
2  808  SER n 
2  809  VAL n 
2  810  PHE n 
2  811  TYR n 
2  812  ARG n 
2  813  SER n 
2  814  TYR n 
2  815  LYS n 
2  816  GLU n 
2  817  GLN n 
2  818  GLU n 
2  819  SER n 
2  820  LYS n 
2  821  LYS n 
2  822  GLY n 
2  823  PHE n 
2  824  ASP n 
2  825  GLN n 
2  826  GLU n 
2  827  GLU n 
2  828  VAL n 
2  829  PHE n 
2  830  GLU n 
2  831  LYS n 
2  832  PRO n 
2  833  THR n 
2  834  ARG n 
2  835  GLU n 
2  836  THR n 
2  837  CYS n 
2  838  GLN n 
2  839  GLY n 
2  840  MET n 
2  841  ARG n 
2  842  HIS n 
2  843  ALA n 
2  844  ILE n 
2  845  TYR n 
2  846  ASP n 
2  847  LYS n 
2  848  LEU n 
2  849  ASP n 
2  850  ASP n 
2  851  ASP n 
2  852  GLY n 
2  853  LEU n 
2  854  ILE n 
2  855  ALA n 
2  856  PRO n 
2  857  GLY n 
2  858  VAL n 
2  859  ARG n 
2  860  VAL n 
2  861  SER n 
2  862  GLY n 
2  863  ASP n 
2  864  ASP n 
2  865  VAL n 
2  866  ILE n 
2  867  ILE n 
2  868  GLY n 
2  869  LYS n 
2  870  THR n 
2  871  VAL n 
2  872  THR n 
2  873  LEU n 
2  874  PRO n 
2  875  GLU n 
2  876  ASN n 
2  877  GLU n 
2  878  ASP n 
2  879  GLU n 
2  880  LEU n 
2  881  GLU n 
2  882  SER n 
2  883  THR n 
2  884  ASN n 
2  885  ARG n 
2  886  ARG n 
2  887  TYR n 
2  888  THR n 
2  889  LYS n 
2  890  ARG n 
2  891  ASP n 
2  892  CYS n 
2  893  SER n 
2  894  THR n 
2  895  PHE n 
2  896  LEU n 
2  897  ARG n 
2  898  THR n 
2  899  SER n 
2  900  GLU n 
2  901  THR n 
2  902  GLY n 
2  903  ILE n 
2  904  VAL n 
2  905  ASP n 
2  906  GLN n 
2  907  VAL n 
2  908  MET n 
2  909  VAL n 
2  910  THR n 
2  911  LEU n 
2  912  ASN n 
2  913  GLN n 
2  914  GLU n 
2  915  GLY n 
2  916  TYR n 
2  917  LYS n 
2  918  PHE n 
2  919  CYS n 
2  920  LYS n 
2  921  ILE n 
2  922  ARG n 
2  923  VAL n 
2  924  ARG n 
2  925  SER n 
2  926  VAL n 
2  927  ARG n 
2  928  ILE n 
2  929  PRO n 
2  930  GLN n 
2  931  ILE n 
2  932  GLY n 
2  933  ASP n 
2  934  LYS n 
2  935  PHE n 
2  936  ALA n 
2  937  SER n 
2  938  ARG n 
2  939  HIS n 
2  940  GLY n 
2  941  GLN n 
2  942  LYS n 
2  943  GLY n 
2  944  THR n 
2  945  CYS n 
2  946  GLY n 
2  947  ILE n 
2  948  GLN n 
2  949  TYR n 
2  950  ARG n 
2  951  GLN n 
2  952  GLU n 
2  953  ASP n 
2  954  MET n 
2  955  PRO n 
2  956  PHE n 
2  957  THR n 
2  958  CYS n 
2  959  GLU n 
2  960  GLY n 
2  961  ILE n 
2  962  THR n 
2  963  PRO n 
2  964  ASP n 
2  965  ILE n 
2  966  ILE n 
2  967  ILE n 
2  968  ASN n 
2  969  PRO n 
2  970  HIS n 
2  971  ALA n 
2  972  ILE n 
2  973  PRO n 
2  974  SER n 
2  975  ARG n 
2  976  MET n 
2  977  THR n 
2  978  ILE n 
2  979  GLY n 
2  980  HIS n 
2  981  LEU n 
2  982  ILE n 
2  983  GLU n 
2  984  CYS n 
2  985  LEU n 
2  986  GLN n 
2  987  GLY n 
2  988  LYS n 
2  989  VAL n 
2  990  SER n 
2  991  ALA n 
2  992  ASN n 
2  993  LYS n 
2  994  GLY n 
2  995  GLU n 
2  996  ILE n 
2  997  GLY n 
2  998  ASP n 
2  999  ALA n 
2  1000 THR n 
2  1001 PRO n 
2  1002 PHE n 
2  1003 ASN n 
2  1004 ASP n 
2  1005 ALA n 
2  1006 VAL n 
2  1007 ASN n 
2  1008 VAL n 
2  1009 GLN n 
2  1010 LYS n 
2  1011 ILE n 
2  1012 SER n 
2  1013 ASN n 
2  1014 LEU n 
2  1015 LEU n 
2  1016 SER n 
2  1017 ASP n 
2  1018 TYR n 
2  1019 GLY n 
2  1020 TYR n 
2  1021 HIS n 
2  1022 LEU n 
2  1023 ARG n 
2  1024 GLY n 
2  1025 ASN n 
2  1026 GLU n 
2  1027 VAL n 
2  1028 LEU n 
2  1029 TYR n 
2  1030 ASN n 
2  1031 GLY n 
2  1032 PHE n 
2  1033 THR n 
2  1034 GLY n 
2  1035 ARG n 
2  1036 LYS n 
2  1037 ILE n 
2  1038 THR n 
2  1039 SER n 
2  1040 GLN n 
2  1041 ILE n 
2  1042 PHE n 
2  1043 ILE n 
2  1044 GLY n 
2  1045 PRO n 
2  1046 THR n 
2  1047 TYR n 
2  1048 TYR n 
2  1049 GLN n 
2  1050 ARG n 
2  1051 LEU n 
2  1052 LYS n 
2  1053 HIS n 
2  1054 MET n 
2  1055 VAL n 
2  1056 ASP n 
2  1057 ASP n 
2  1058 LYS n 
2  1059 ILE n 
2  1060 HIS n 
2  1061 SER n 
2  1062 ARG n 
2  1063 ALA n 
2  1064 ARG n 
2  1065 GLY n 
2  1066 PRO n 
2  1067 ILE n 
2  1068 GLN n 
2  1069 ILE n 
2  1070 LEU n 
2  1071 ASN n 
2  1072 ARG n 
2  1073 GLN n 
2  1074 PRO n 
2  1075 MET n 
2  1076 GLU n 
2  1077 GLY n 
2  1078 ARG n 
2  1079 SER n 
2  1080 ARG n 
2  1081 ASP n 
2  1082 GLY n 
2  1083 GLY n 
2  1084 LEU n 
2  1085 ARG n 
2  1086 PHE n 
2  1087 GLY n 
2  1088 GLU n 
2  1089 MET n 
2  1090 GLU n 
2  1091 ARG n 
2  1092 ASP n 
2  1093 CYS n 
2  1094 GLN n 
2  1095 ILE n 
2  1096 ALA n 
2  1097 HIS n 
2  1098 GLY n 
2  1099 ALA n 
2  1100 ALA n 
2  1101 GLN n 
2  1102 PHE n 
2  1103 LEU n 
2  1104 ARG n 
2  1105 GLU n 
2  1106 ARG n 
2  1107 LEU n 
2  1108 PHE n 
2  1109 GLU n 
2  1110 ALA n 
2  1111 SER n 
2  1112 ASP n 
2  1113 PRO n 
2  1114 TYR n 
2  1115 GLN n 
2  1116 VAL n 
2  1117 HIS n 
2  1118 VAL n 
2  1119 CYS n 
2  1120 ASN n 
2  1121 LEU n 
2  1122 CYS n 
2  1123 GLY n 
2  1124 ILE n 
2  1125 MET n 
2  1126 ALA n 
2  1127 ILE n 
2  1128 ALA n 
2  1129 ASN n 
2  1130 THR n 
2  1131 ARG n 
2  1132 THR n 
2  1133 HIS n 
2  1134 THR n 
2  1135 TYR n 
2  1136 GLU n 
2  1137 CYS n 
2  1138 ARG n 
2  1139 GLY n 
2  1140 CYS n 
2  1141 ARG n 
2  1142 ASN n 
2  1143 LYS n 
2  1144 THR n 
2  1145 GLN n 
2  1146 ILE n 
2  1147 SER n 
2  1148 LEU n 
2  1149 VAL n 
2  1150 ARG n 
2  1151 MET n 
2  1152 PRO n 
2  1153 TYR n 
2  1154 ALA n 
2  1155 CYS n 
2  1156 LYS n 
2  1157 LEU n 
2  1158 LEU n 
2  1159 PHE n 
2  1160 GLN n 
2  1161 GLU n 
2  1162 LEU n 
2  1163 MET n 
2  1164 SER n 
2  1165 MET n 
2  1166 SER n 
2  1167 ILE n 
2  1168 ALA n 
2  1169 PRO n 
2  1170 ARG n 
2  1171 MET n 
2  1172 MET n 
2  1173 SER n 
2  1174 VAL n 
3  1    MET n 
3  2    PRO n 
3  3    TYR n 
3  4    ALA n 
3  5    ASN n 
3  6    GLN n 
3  7    PRO n 
3  8    THR n 
3  9    VAL n 
3  10   ARG n 
3  11   ILE n 
3  12   THR n 
3  13   GLU n 
3  14   LEU n 
3  15   THR n 
3  16   ASP n 
3  17   GLU n 
3  18   ASN n 
3  19   VAL n 
3  20   LYS n 
3  21   PHE n 
3  22   ILE n 
3  23   ILE n 
3  24   GLU n 
3  25   ASN n 
3  26   THR n 
3  27   ASP n 
3  28   LEU n 
3  29   ALA n 
3  30   VAL n 
3  31   ALA n 
3  32   ASN n 
3  33   SER n 
3  34   ILE n 
3  35   ARG n 
3  36   ARG n 
3  37   VAL n 
3  38   PHE n 
3  39   ILE n 
3  40   ALA n 
3  41   GLU n 
3  42   VAL n 
3  43   PRO n 
3  44   ILE n 
3  45   ILE n 
3  46   ALA n 
3  47   ILE n 
3  48   ASP n 
3  49   TRP n 
3  50   VAL n 
3  51   GLN n 
3  52   ILE n 
3  53   ASP n 
3  54   ALA n 
3  55   ASN n 
3  56   SER n 
3  57   SER n 
3  58   VAL n 
3  59   LEU n 
3  60   HIS n 
3  61   ASP n 
3  62   GLU n 
3  63   PHE n 
3  64   ILE n 
3  65   ALA n 
3  66   HIS n 
3  67   ARG n 
3  68   LEU n 
3  69   GLY n 
3  70   LEU n 
3  71   ILE n 
3  72   PRO n 
3  73   LEU n 
3  74   ILE n 
3  75   SER n 
3  76   ASP n 
3  77   ASP n 
3  78   ILE n 
3  79   VAL n 
3  80   ASP n 
3  81   LYS n 
3  82   LEU n 
3  83   GLN n 
3  84   TYR n 
3  85   SER n 
3  86   ARG n 
3  87   ASP n 
3  88   CYS n 
3  89   THR n 
3  90   CYS n 
3  91   GLU n 
3  92   GLU n 
3  93   PHE n 
3  94   CYS n 
3  95   PRO n 
3  96   GLU n 
3  97   CYS n 
3  98   SER n 
3  99   VAL n 
3  100  GLU n 
3  101  PHE n 
3  102  THR n 
3  103  LEU n 
3  104  ASP n 
3  105  VAL n 
3  106  ARG n 
3  107  CYS n 
3  108  ASN n 
3  109  GLU n 
3  110  ASP n 
3  111  GLN n 
3  112  THR n 
3  113  ARG n 
3  114  HIS n 
3  115  VAL n 
3  116  THR n 
3  117  SER n 
3  118  ARG n 
3  119  ASP n 
3  120  LEU n 
3  121  ILE n 
3  122  SER n 
3  123  ASN n 
3  124  SER n 
3  125  PRO n 
3  126  ARG n 
3  127  VAL n 
3  128  ILE n 
3  129  PRO n 
3  130  VAL n 
3  131  THR n 
3  132  SER n 
3  133  ARG n 
3  134  ASN n 
3  135  ARG n 
3  136  ASP n 
3  137  ASN n 
3  138  ASP n 
3  139  PRO n 
3  140  ASN n 
3  141  ASP n 
3  142  TYR n 
3  143  VAL n 
3  144  GLU n 
3  145  GLN n 
3  146  ASP n 
3  147  ASP n 
3  148  ILE n 
3  149  LEU n 
3  150  ILE n 
3  151  VAL n 
3  152  LYS n 
3  153  LEU n 
3  154  ARG n 
3  155  LYS n 
3  156  GLY n 
3  157  GLN n 
3  158  GLU n 
3  159  LEU n 
3  160  ARG n 
3  161  LEU n 
3  162  ARG n 
3  163  ALA n 
3  164  TYR n 
3  165  ALA n 
3  166  LYS n 
3  167  LYS n 
3  168  GLY n 
3  169  PHE n 
3  170  GLY n 
3  171  LYS n 
3  172  GLU n 
3  173  HIS n 
3  174  ALA n 
3  175  LYS n 
3  176  TRP n 
3  177  ASN n 
3  178  PRO n 
3  179  THR n 
3  180  ALA n 
3  181  GLY n 
3  182  VAL n 
3  183  ALA n 
3  184  PHE n 
3  185  GLU n 
3  186  TYR n 
3  187  ASP n 
3  188  PRO n 
3  189  ASP n 
3  190  ASN n 
3  191  ALA n 
3  192  LEU n 
3  193  ARG n 
3  194  HIS n 
3  195  THR n 
3  196  VAL n 
3  197  TYR n 
3  198  PRO n 
3  199  LYS n 
3  200  PRO n 
3  201  GLU n 
3  202  GLU n 
3  203  TRP n 
3  204  PRO n 
3  205  LYS n 
3  206  SER n 
3  207  GLU n 
3  208  TYR n 
3  209  SER n 
3  210  GLU n 
3  211  LEU n 
3  212  ASP n 
3  213  GLU n 
3  214  ASP n 
3  215  GLU n 
3  216  SER n 
3  217  GLN n 
3  218  ALA n 
3  219  PRO n 
3  220  TYR n 
3  221  ASP n 
3  222  PRO n 
3  223  ASN n 
3  224  GLY n 
3  225  LYS n 
3  226  PRO n 
3  227  GLU n 
3  228  ARG n 
3  229  PHE n 
3  230  TYR n 
3  231  TYR n 
3  232  ASN n 
3  233  VAL n 
3  234  GLU n 
3  235  SER n 
3  236  CYS n 
3  237  GLY n 
3  238  SER n 
3  239  LEU n 
3  240  ARG n 
3  241  PRO n 
3  242  GLU n 
3  243  THR n 
3  244  ILE n 
3  245  VAL n 
3  246  LEU n 
3  247  SER n 
3  248  ALA n 
3  249  LEU n 
3  250  SER n 
3  251  GLY n 
3  252  LEU n 
3  253  LYS n 
3  254  LYS n 
3  255  LYS n 
3  256  LEU n 
3  257  SER n 
3  258  ASP n 
3  259  LEU n 
3  260  GLN n 
3  261  THR n 
3  262  GLN n 
3  263  LEU n 
3  264  SER n 
3  265  HIS n 
3  266  GLU n 
3  267  ILE n 
3  268  GLN n 
3  269  SER n 
3  270  ASP n 
3  271  VAL n 
3  272  LEU n 
3  273  THR n 
3  274  ILE n 
3  275  ASN n 
4  1    MET n 
4  2    ALA n 
4  3    ALA n 
4  4    GLY n 
4  5    GLY n 
4  6    SER n 
4  7    ASP n 
4  8    PRO n 
4  9    ARG n 
4  10   ALA n 
4  11   GLY n 
4  12   ASP n 
4  13   VAL n 
4  14   GLU n 
4  15   GLU n 
4  16   ASP n 
4  17   ALA n 
4  18   SER n 
4  19   GLN n 
4  20   LEU n 
4  21   ILE n 
4  22   PHE n 
4  23   PRO n 
4  24   LYS n 
4  25   GLU n 
4  26   PHE n 
4  27   GLU n 
4  28   THR n 
4  29   ALA n 
4  30   GLU n 
4  31   THR n 
4  32   LEU n 
4  33   LEU n 
4  34   ASN n 
4  35   SER n 
4  36   GLU n 
4  37   VAL n 
4  38   HIS n 
4  39   MET n 
4  40   LEU n 
4  41   LEU n 
4  42   GLU n 
4  43   HIS n 
4  44   ARG n 
4  45   LYS n 
4  46   GLN n 
4  47   GLN n 
4  48   ASN n 
4  49   GLU n 
4  50   SER n 
4  51   ALA n 
4  52   GLU n 
4  53   ASP n 
4  54   GLU n 
4  55   GLN n 
4  56   GLU n 
4  57   LEU n 
4  58   SER n 
4  59   GLU n 
4  60   VAL n 
4  61   PHE n 
4  62   MET n 
4  63   LYS n 
4  64   THR n 
4  65   LEU n 
4  66   ASN n 
4  67   TYR n 
4  68   THR n 
4  69   ALA n 
4  70   ARG n 
4  71   PHE n 
4  72   SER n 
4  73   ARG n 
4  74   PHE n 
4  75   LYS n 
4  76   ASN n 
4  77   ARG n 
4  78   GLU n 
4  79   THR n 
4  80   ILE n 
4  81   ALA n 
4  82   SER n 
4  83   VAL n 
4  84   ARG n 
4  85   SER n 
4  86   LEU n 
4  87   LEU n 
4  88   LEU n 
4  89   GLN n 
4  90   LYS n 
4  91   LYS n 
4  92   LEU n 
4  93   HIS n 
4  94   LYS n 
4  95   PHE n 
4  96   GLU n 
4  97   LEU n 
4  98   ALA n 
4  99   CYS n 
4  100  LEU n 
4  101  ALA n 
4  102  ASN n 
4  103  LEU n 
4  104  CYS n 
4  105  PRO n 
4  106  GLU n 
4  107  THR n 
4  108  ALA n 
4  109  GLU n 
4  110  GLU n 
4  111  SER n 
4  112  LYS n 
4  113  ALA n 
4  114  LEU n 
4  115  ILE n 
4  116  PRO n 
4  117  SER n 
4  118  LEU n 
4  119  GLU n 
4  120  GLY n 
4  121  ARG n 
4  122  PHE n 
4  123  GLU n 
4  124  ASP n 
4  125  GLU n 
4  126  GLU n 
4  127  LEU n 
4  128  GLN n 
4  129  GLN n 
4  130  ILE n 
4  131  LEU n 
4  132  ASP n 
4  133  ASP n 
4  134  ILE n 
4  135  GLN n 
4  136  THR n 
4  137  LYS n 
4  138  ARG n 
4  139  SER n 
4  140  PHE n 
4  141  GLN n 
4  142  TYR n 
5  1    MET n 
5  2    ASP n 
5  3    ASP n 
5  4    GLU n 
5  5    GLU n 
5  6    GLU n 
5  7    THR n 
5  8    TYR n 
5  9    ARG n 
5  10   LEU n 
5  11   TRP n 
5  12   LYS n 
5  13   ILE n 
5  14   ARG n 
5  15   LYS n 
5  16   THR n 
5  17   ILE n 
5  18   MET n 
5  19   GLN n 
5  20   LEU n 
5  21   CYS n 
5  22   HIS n 
5  23   ASP n 
5  24   ARG n 
5  25   GLY n 
5  26   TYR n 
5  27   LEU n 
5  28   VAL n 
5  29   THR n 
5  30   GLN n 
5  31   ASP n 
5  32   GLU n 
5  33   LEU n 
5  34   ASP n 
5  35   GLN n 
5  36   THR n 
5  37   LEU n 
5  38   GLU n 
5  39   GLU n 
5  40   PHE n 
5  41   LYS n 
5  42   ALA n 
5  43   GLN n 
5  44   SER n 
5  45   GLY n 
5  46   ASP n 
5  47   LYS n 
5  48   PRO n 
5  49   SER n 
5  50   GLU n 
5  51   GLY n 
5  52   ARG n 
5  53   PRO n 
5  54   ARG n 
5  55   ARG n 
5  56   THR n 
5  57   ASP n 
5  58   LEU n 
5  59   THR n 
5  60   VAL n 
5  61   LEU n 
5  62   VAL n 
5  63   ALA n 
5  64   HIS n 
5  65   ASN n 
5  66   ASP n 
5  67   ASP n 
5  68   PRO n 
5  69   THR n 
5  70   ASP n 
5  71   GLN n 
5  72   MET n 
5  73   PHE n 
5  74   VAL n 
5  75   PHE n 
5  76   PHE n 
5  77   PRO n 
5  78   GLU n 
5  79   GLU n 
5  80   PRO n 
5  81   LYS n 
5  82   VAL n 
5  83   GLY n 
5  84   ILE n 
5  85   LYS n 
5  86   THR n 
5  87   ILE n 
5  88   LYS n 
5  89   VAL n 
5  90   TYR n 
5  91   CYS n 
5  92   GLN n 
5  93   ARG n 
5  94   MET n 
5  95   GLN n 
5  96   GLU n 
5  97   GLU n 
5  98   ASN n 
5  99   ILE n 
5  100  THR n 
5  101  ARG n 
5  102  ALA n 
5  103  LEU n 
5  104  ILE n 
5  105  VAL n 
5  106  VAL n 
5  107  GLN n 
5  108  GLN n 
5  109  GLY n 
5  110  MET n 
5  111  THR n 
5  112  PRO n 
5  113  SER n 
5  114  ALA n 
5  115  LYS n 
5  116  GLN n 
5  117  SER n 
5  118  LEU n 
5  119  VAL n 
5  120  ASP n 
5  121  MET n 
5  122  ALA n 
5  123  PRO n 
5  124  LYS n 
5  125  TYR n 
5  126  ILE n 
5  127  LEU n 
5  128  GLU n 
5  129  GLN n 
5  130  PHE n 
5  131  LEU n 
5  132  GLN n 
5  133  GLN n 
5  134  GLU n 
5  135  LEU n 
5  136  LEU n 
5  137  ILE n 
5  138  ASN n 
5  139  ILE n 
5  140  THR n 
5  141  GLU n 
5  142  HIS n 
5  143  GLU n 
5  144  LEU n 
5  145  VAL n 
5  146  PRO n 
5  147  GLU n 
5  148  HIS n 
5  149  VAL n 
5  150  VAL n 
5  151  MET n 
5  152  THR n 
5  153  LYS n 
5  154  GLU n 
5  155  GLU n 
5  156  VAL n 
5  157  THR n 
5  158  GLU n 
5  159  LEU n 
5  160  LEU n 
5  161  ALA n 
5  162  ARG n 
5  163  TYR n 
5  164  LYS n 
5  165  LEU n 
5  166  ARG n 
5  167  GLU n 
5  168  ASN n 
5  169  GLN n 
5  170  LEU n 
5  171  PRO n 
5  172  ARG n 
5  173  ILE n 
5  174  GLN n 
5  175  ALA n 
5  176  GLY n 
5  177  ASP n 
5  178  PRO n 
5  179  VAL n 
5  180  ALA n 
5  181  ARG n 
5  182  TYR n 
5  183  PHE n 
5  184  GLY n 
5  185  ILE n 
5  186  LYS n 
5  187  ARG n 
5  188  GLY n 
5  189  GLN n 
5  190  VAL n 
5  191  VAL n 
5  192  LYS n 
5  193  ILE n 
5  194  ILE n 
5  195  ARG n 
5  196  PRO n 
5  197  SER n 
5  198  GLU n 
5  199  THR n 
5  200  ALA n 
5  201  GLY n 
5  202  ARG n 
5  203  TYR n 
5  204  ILE n 
5  205  THR n 
5  206  TYR n 
5  207  ARG n 
5  208  LEU n 
5  209  VAL n 
5  210  GLN n 
6  1    MET n 
6  2    SER n 
6  3    ASP n 
6  4    ASN n 
6  5    GLU n 
6  6    ASP n 
6  7    ASN n 
6  8    PHE n 
6  9    ASP n 
6  10   GLY n 
6  11   ASP n 
6  12   ASP n 
6  13   PHE n 
6  14   ASP n 
6  15   ASP n 
6  16   VAL n 
6  17   GLU n 
6  18   GLU n 
6  19   ASP n 
6  20   GLU n 
6  21   GLY n 
6  22   LEU n 
6  23   ASP n 
6  24   ASP n 
6  25   LEU n 
6  26   GLU n 
6  27   ASN n 
6  28   ALA n 
6  29   GLU n 
6  30   GLU n 
6  31   GLU n 
6  32   GLY n 
6  33   GLN n 
6  34   GLU n 
6  35   ASN n 
6  36   VAL n 
6  37   GLU n 
6  38   ILE n 
6  39   LEU n 
6  40   PRO n 
6  41   SER n 
6  42   GLY n 
6  43   GLU n 
6  44   ARG n 
6  45   PRO n 
6  46   GLN n 
6  47   ALA n 
6  48   ASN n 
6  49   GLN n 
6  50   LYS n 
6  51   ARG n 
6  52   ILE n 
6  53   THR n 
6  54   THR n 
6  55   PRO n 
6  56   TYR n 
6  57   MET n 
6  58   THR n 
6  59   LYS n 
6  60   TYR n 
6  61   GLU n 
6  62   ARG n 
6  63   ALA n 
6  64   ARG n 
6  65   VAL n 
6  66   LEU n 
6  67   GLY n 
6  68   THR n 
6  69   ARG n 
6  70   ALA n 
6  71   LEU n 
6  72   GLN n 
6  73   ILE n 
6  74   ALA n 
6  75   MET n 
6  76   CYS n 
6  77   ALA n 
6  78   PRO n 
6  79   VAL n 
6  80   MET n 
6  81   VAL n 
6  82   GLU n 
6  83   LEU n 
6  84   GLU n 
6  85   GLY n 
6  86   GLU n 
6  87   THR n 
6  88   ASP n 
6  89   PRO n 
6  90   LEU n 
6  91   LEU n 
6  92   ILE n 
6  93   ALA n 
6  94   MET n 
6  95   LYS n 
6  96   GLU n 
6  97   LEU n 
6  98   LYS n 
6  99   ALA n 
6  100  ARG n 
6  101  LYS n 
6  102  ILE n 
6  103  PRO n 
6  104  ILE n 
6  105  ILE n 
6  106  ILE n 
6  107  ARG n 
6  108  ARG n 
6  109  TYR n 
6  110  LEU n 
6  111  PRO n 
6  112  ASP n 
6  113  GLY n 
6  114  SER n 
6  115  TYR n 
6  116  GLU n 
6  117  ASP n 
6  118  TRP n 
6  119  GLY n 
6  120  VAL n 
6  121  ASP n 
6  122  GLU n 
6  123  LEU n 
6  124  ILE n 
6  125  ILE n 
6  126  THR n 
6  127  ASP n 
7  1    MET n 
7  2    PHE n 
7  3    TYR n 
7  4    HIS n 
7  5    ILE n 
7  6    SER n 
7  7    LEU n 
7  8    GLU n 
7  9    HIS n 
7  10   GLU n 
7  11   ILE n 
7  12   LEU n 
7  13   LEU n 
7  14   HIS n 
7  15   PRO n 
7  16   ARG n 
7  17   TYR n 
7  18   PHE n 
7  19   GLY n 
7  20   PRO n 
7  21   ASN n 
7  22   LEU n 
7  23   LEU n 
7  24   ASN n 
7  25   THR n 
7  26   VAL n 
7  27   LYS n 
7  28   GLN n 
7  29   LYS n 
7  30   LEU n 
7  31   PHE n 
7  32   THR n 
7  33   GLU n 
7  34   VAL n 
7  35   GLU n 
7  36   GLY n 
7  37   THR n 
7  38   CYS n 
7  39   THR n 
7  40   GLY n 
7  41   LYS n 
7  42   TYR n 
7  43   GLY n 
7  44   PHE n 
7  45   VAL n 
7  46   ILE n 
7  47   ALA n 
7  48   VAL n 
7  49   THR n 
7  50   THR n 
7  51   ILE n 
7  52   ASP n 
7  53   ASN n 
7  54   ILE n 
7  55   GLY n 
7  56   ALA n 
7  57   GLY n 
7  58   VAL n 
7  59   ILE n 
7  60   GLN n 
7  61   PRO n 
7  62   GLY n 
7  63   ARG n 
7  64   GLY n 
7  65   PHE n 
7  66   VAL n 
7  67   LEU n 
7  68   TYR n 
7  69   PRO n 
7  70   VAL n 
7  71   LYS n 
7  72   TYR n 
7  73   LYS n 
7  74   ALA n 
7  75   ILE n 
7  76   VAL n 
7  77   PHE n 
7  78   ARG n 
7  79   PRO n 
7  80   PHE n 
7  81   LYS n 
7  82   GLY n 
7  83   GLU n 
7  84   VAL n 
7  85   VAL n 
7  86   ASP n 
7  87   ALA n 
7  88   VAL n 
7  89   VAL n 
7  90   THR n 
7  91   GLN n 
7  92   VAL n 
7  93   ASN n 
7  94   LYS n 
7  95   VAL n 
7  96   GLY n 
7  97   LEU n 
7  98   PHE n 
7  99   THR n 
7  100  GLU n 
7  101  ILE n 
7  102  GLY n 
7  103  PRO n 
7  104  MET n 
7  105  SER n 
7  106  CYS n 
7  107  PHE n 
7  108  ILE n 
7  109  SER n 
7  110  ARG n 
7  111  HIS n 
7  112  SER n 
7  113  ILE n 
7  114  PRO n 
7  115  SER n 
7  116  GLU n 
7  117  MET n 
7  118  GLU n 
7  119  PHE n 
7  120  ASP n 
7  121  PRO n 
7  122  ASN n 
7  123  SER n 
7  124  ASN n 
7  125  PRO n 
7  126  PRO n 
7  127  CYS n 
7  128  TYR n 
7  129  LYS n 
7  130  THR n 
7  131  MET n 
7  132  ASP n 
7  133  GLU n 
7  134  ASP n 
7  135  ILE n 
7  136  VAL n 
7  137  ILE n 
7  138  GLN n 
7  139  GLN n 
7  140  ASP n 
7  141  ASP n 
7  142  GLU n 
7  143  ILE n 
7  144  ARG n 
7  145  LEU n 
7  146  LYS n 
7  147  ILE n 
7  148  VAL n 
7  149  GLY n 
7  150  THR n 
7  151  ARG n 
7  152  VAL n 
7  153  ASP n 
7  154  LYS n 
7  155  ASN n 
7  156  ASP n 
7  157  ILE n 
7  158  PHE n 
7  159  ALA n 
7  160  ILE n 
7  161  GLY n 
7  162  SER n 
7  163  LEU n 
7  164  MET n 
7  165  ASP n 
7  166  ASP n 
7  167  TYR n 
7  168  LEU n 
7  169  GLY n 
7  170  LEU n 
7  171  VAL n 
7  172  SER n 
8  1    MET n 
8  2    ALA n 
8  3    GLY n 
8  4    ILE n 
8  5    LEU n 
8  6    PHE n 
8  7    GLU n 
8  8    ASP n 
8  9    ILE n 
8  10   PHE n 
8  11   ASP n 
8  12   VAL n 
8  13   LYS n 
8  14   ASP n 
8  15   ILE n 
8  16   ASP n 
8  17   PRO n 
8  18   GLU n 
8  19   GLY n 
8  20   LYS n 
8  21   LYS n 
8  22   PHE n 
8  23   ASP n 
8  24   ARG n 
8  25   VAL n 
8  26   SER n 
8  27   ARG n 
8  28   LEU n 
8  29   HIS n 
8  30   CYS n 
8  31   GLU n 
8  32   SER n 
8  33   GLU n 
8  34   SER n 
8  35   PHE n 
8  36   LYS n 
8  37   MET n 
8  38   ASP n 
8  39   LEU n 
8  40   ILE n 
8  41   LEU n 
8  42   ASP n 
8  43   VAL n 
8  44   ASN n 
8  45   ILE n 
8  46   GLN n 
8  47   ILE n 
8  48   TYR n 
8  49   PRO n 
8  50   VAL n 
8  51   ASP n 
8  52   LEU n 
8  53   GLY n 
8  54   ASP n 
8  55   LYS n 
8  56   PHE n 
8  57   ARG n 
8  58   LEU n 
8  59   VAL n 
8  60   ILE n 
8  61   ALA n 
8  62   SER n 
8  63   THR n 
8  64   LEU n 
8  65   TYR n 
8  66   GLU n 
8  67   ASP n 
8  68   GLY n 
8  69   THR n 
8  70   LEU n 
8  71   ASP n 
8  72   ASP n 
8  73   GLY n 
8  74   GLU n 
8  75   TYR n 
8  76   ASN n 
8  77   PRO n 
8  78   THR n 
8  79   ASP n 
8  80   ASP n 
8  81   ARG n 
8  82   PRO n 
8  83   SER n 
8  84   ARG n 
8  85   ALA n 
8  86   ASP n 
8  87   GLN n 
8  88   PHE n 
8  89   GLU n 
8  90   TYR n 
8  91   VAL n 
8  92   MET n 
8  93   TYR n 
8  94   GLY n 
8  95   LYS n 
8  96   VAL n 
8  97   TYR n 
8  98   ARG n 
8  99   ILE n 
8  100  GLU n 
8  101  GLY n 
8  102  ASP n 
8  103  GLU n 
8  104  THR n 
8  105  SER n 
8  106  THR n 
8  107  GLU n 
8  108  ALA n 
8  109  ALA n 
8  110  THR n 
8  111  ARG n 
8  112  LEU n 
8  113  SER n 
8  114  ALA n 
8  115  TYR n 
8  116  VAL n 
8  117  SER n 
8  118  TYR n 
8  119  GLY n 
8  120  GLY n 
8  121  LEU n 
8  122  LEU n 
8  123  MET n 
8  124  ARG n 
8  125  LEU n 
8  126  GLN n 
8  127  GLY n 
8  128  ASP n 
8  129  ALA n 
8  130  ASN n 
8  131  ASN n 
8  132  LEU n 
8  133  HIS n 
8  134  GLY n 
8  135  PHE n 
8  136  GLU n 
8  137  VAL n 
8  138  ASP n 
8  139  SER n 
8  140  ARG n 
8  141  VAL n 
8  142  TYR n 
8  143  LEU n 
8  144  LEU n 
8  145  MET n 
8  146  LYS n 
8  147  LYS n 
8  148  LEU n 
8  149  ALA n 
8  150  PHE n 
9  1    MET n 
9  2    GLU n 
9  3    PRO n 
9  4    ASP n 
9  5    GLY n 
9  6    THR n 
9  7    TYR n 
9  8    GLU n 
9  9    PRO n 
9  10   GLY n 
9  11   PHE n 
9  12   VAL n 
9  13   GLY n 
9  14   ILE n 
9  15   ARG n 
9  16   PHE n 
9  17   CYS n 
9  18   GLN n 
9  19   GLU n 
9  20   CYS n 
9  21   ASN n 
9  22   ASN n 
9  23   MET n 
9  24   LEU n 
9  25   TYR n 
9  26   PRO n 
9  27   LYS n 
9  28   GLU n 
9  29   ASP n 
9  30   LYS n 
9  31   GLU n 
9  32   ASN n 
9  33   ARG n 
9  34   ILE n 
9  35   LEU n 
9  36   LEU n 
9  37   TYR n 
9  38   ALA n 
9  39   CYS n 
9  40   ARG n 
9  41   ASN n 
9  42   CYS n 
9  43   ASP n 
9  44   TYR n 
9  45   GLN n 
9  46   GLN n 
9  47   GLU n 
9  48   ALA n 
9  49   ASP n 
9  50   ASN n 
9  51   SER n 
9  52   CYS n 
9  53   ILE n 
9  54   TYR n 
9  55   VAL n 
9  56   ASN n 
9  57   LYS n 
9  58   ILE n 
9  59   THR n 
9  60   HIS n 
9  61   GLU n 
9  62   VAL n 
9  63   ASP n 
9  64   GLU n 
9  65   LEU n 
9  66   THR n 
9  67   GLN n 
9  68   ILE n 
9  69   ILE n 
9  70   ALA n 
9  71   ASP n 
9  72   VAL n 
9  73   SER n 
9  74   GLN n 
9  75   ASP n 
9  76   PRO n 
9  77   THR n 
9  78   LEU n 
9  79   PRO n 
9  80   ARG n 
9  81   THR n 
9  82   GLU n 
9  83   ASP n 
9  84   HIS n 
9  85   PRO n 
9  86   CYS n 
9  87   GLN n 
9  88   LYS n 
9  89   CYS n 
9  90   GLY n 
9  91   HIS n 
9  92   LYS n 
9  93   GLU n 
9  94   ALA n 
9  95   VAL n 
9  96   PHE n 
9  97   PHE n 
9  98   GLN n 
9  99   SER n 
9  100  HIS n 
9  101  SER n 
9  102  ALA n 
9  103  ARG n 
9  104  ALA n 
9  105  GLU n 
9  106  ASP n 
9  107  ALA n 
9  108  MET n 
9  109  ARG n 
9  110  LEU n 
9  111  TYR n 
9  112  TYR n 
9  113  VAL n 
9  114  CYS n 
9  115  THR n 
9  116  ALA n 
9  117  PRO n 
9  118  HIS n 
9  119  CYS n 
9  120  GLY n 
9  121  HIS n 
9  122  ARG n 
9  123  TRP n 
9  124  THR n 
9  125  GLU n 
10 1    MET n 
10 2    ILE n 
10 3    ILE n 
10 4    PRO n 
10 5    VAL n 
10 6    ARG n 
10 7    CYS n 
10 8    PHE n 
10 9    THR n 
10 10   CYS n 
10 11   GLY n 
10 12   LYS n 
10 13   ILE n 
10 14   VAL n 
10 15   GLY n 
10 16   ASN n 
10 17   LYS n 
10 18   TRP n 
10 19   GLU n 
10 20   ALA n 
10 21   TYR n 
10 22   LEU n 
10 23   GLY n 
10 24   LEU n 
10 25   LEU n 
10 26   GLN n 
10 27   ALA n 
10 28   GLU n 
10 29   TYR n 
10 30   THR n 
10 31   GLU n 
10 32   GLY n 
10 33   ASP n 
10 34   ALA n 
10 35   LEU n 
10 36   ASP n 
10 37   ALA n 
10 38   LEU n 
10 39   GLY n 
10 40   LEU n 
10 41   LYS n 
10 42   ARG n 
10 43   TYR n 
10 44   CYS n 
10 45   CYS n 
10 46   ARG n 
10 47   ARG n 
10 48   MET n 
10 49   LEU n 
10 50   LEU n 
10 51   ALA n 
10 52   HIS n 
10 53   VAL n 
10 54   ASP n 
10 55   LEU n 
10 56   ILE n 
10 57   GLU n 
10 58   LYS n 
10 59   LEU n 
10 60   LEU n 
10 61   ASN n 
10 62   TYR n 
10 63   ALA n 
10 64   PRO n 
10 65   LEU n 
10 66   GLU n 
10 67   LYS n 
11 1    MET n 
11 2    ASN n 
11 3    ALA n 
11 4    PRO n 
11 5    PRO n 
11 6    ALA n 
11 7    PHE n 
11 8    GLU n 
11 9    SER n 
11 10   PHE n 
11 11   LEU n 
11 12   LEU n 
11 13   PHE n 
11 14   GLU n 
11 15   GLY n 
11 16   GLU n 
11 17   LYS n 
11 18   LYS n 
11 19   ILE n 
11 20   THR n 
11 21   ILE n 
11 22   ASN n 
11 23   LYS n 
11 24   ASP n 
11 25   THR n 
11 26   LYS n 
11 27   VAL n 
11 28   PRO n 
11 29   ASN n 
11 30   ALA n 
11 31   CYS n 
11 32   LEU n 
11 33   PHE n 
11 34   THR n 
11 35   ILE n 
11 36   ASN n 
11 37   LYS n 
11 38   GLU n 
11 39   ASP n 
11 40   HIS n 
11 41   THR n 
11 42   LEU n 
11 43   GLY n 
11 44   ASN n 
11 45   ILE n 
11 46   ILE n 
11 47   LYS n 
11 48   SER n 
11 49   GLN n 
11 50   LEU n 
11 51   LEU n 
11 52   LYS n 
11 53   ASP n 
11 54   PRO n 
11 55   GLN n 
11 56   VAL n 
11 57   LEU n 
11 58   PHE n 
11 59   ALA n 
11 60   GLY n 
11 61   TYR n 
11 62   LYS n 
11 63   VAL n 
11 64   PRO n 
11 65   HIS n 
11 66   PRO n 
11 67   LEU n 
11 68   GLU n 
11 69   HIS n 
11 70   LYS n 
11 71   ILE n 
11 72   ILE n 
11 73   ILE n 
11 74   ARG n 
11 75   VAL n 
11 76   GLN n 
11 77   THR n 
11 78   THR n 
11 79   PRO n 
11 80   ASP n 
11 81   TYR n 
11 82   SER n 
11 83   PRO n 
11 84   GLN n 
11 85   GLU n 
11 86   ALA n 
11 87   PHE n 
11 88   THR n 
11 89   ASN n 
11 90   ALA n 
11 91   ILE n 
11 92   THR n 
11 93   ASP n 
11 94   LEU n 
11 95   ILE n 
11 96   SER n 
11 97   GLU n 
11 98   LEU n 
11 99   SER n 
11 100  LEU n 
11 101  LEU n 
11 102  GLU n 
11 103  GLU n 
11 104  ARG n 
11 105  PHE n 
11 106  ARG n 
11 107  VAL n 
11 108  ALA n 
11 109  ILE n 
11 110  LYS n 
11 111  ASP n 
11 112  LYS n 
11 113  GLN n 
11 114  GLU n 
11 115  GLY n 
11 116  ILE n 
11 117  GLU n 
12 1    MET n 
12 2    ASP n 
12 3    THR n 
12 4    GLN n 
12 5    LYS n 
12 6    ASP n 
12 7    VAL n 
12 8    GLN n 
12 9    PRO n 
12 10   PRO n 
12 11   LYS n 
12 12   GLN n 
12 13   GLN n 
12 14   PRO n 
12 15   MET n 
12 16   ILE n 
12 17   TYR n 
12 18   ILE n 
12 19   CYS n 
12 20   GLY n 
12 21   GLU n 
12 22   CYS n 
12 23   HIS n 
12 24   THR n 
12 25   GLU n 
12 26   ASN n 
12 27   GLU n 
12 28   ILE n 
12 29   LYS n 
12 30   SER n 
12 31   ARG n 
12 32   ASP n 
12 33   PRO n 
12 34   ILE n 
12 35   ARG n 
12 36   CYS n 
12 37   ARG n 
12 38   GLU n 
12 39   CYS n 
12 40   GLY n 
12 41   TYR n 
12 42   ARG n 
12 43   ILE n 
12 44   MET n 
12 45   TYR n 
12 46   LYS n 
12 47   LYS n 
12 48   ARG n 
12 49   THR n 
12 50   LYS n 
12 51   ARG n 
12 52   LEU n 
12 53   VAL n 
12 54   VAL n 
12 55   PHE n 
12 56   ASP n 
12 57   ALA n 
12 58   ARG n 
13 1    MET n 
13 2    ALA n 
13 3    SER n 
13 4    THR n 
13 5    SER n 
13 6    ARG n 
13 7    LEU n 
13 8    ASP n 
13 9    ALA n 
13 10   LEU n 
13 11   PRO n 
13 12   ARG n 
13 13   VAL n 
13 14   THR n 
13 15   CYS n 
13 16   PRO n 
13 17   ASN n 
13 18   HIS n 
13 19   PRO n 
13 20   ASP n 
13 21   ALA n 
13 22   ILE n 
13 23   LEU n 
13 24   VAL n 
13 25   GLU n 
13 26   ASP n 
13 27   TYR n 
13 28   ARG n 
13 29   ALA n 
13 30   GLY n 
13 31   ASP n 
13 32   MET n 
13 33   ILE n 
13 34   CYS n 
13 35   PRO n 
13 36   GLU n 
13 37   CYS n 
13 38   GLY n 
13 39   LEU n 
13 40   VAL n 
13 41   VAL n 
13 42   GLY n 
13 43   ASP n 
13 44   ARG n 
13 45   VAL n 
13 46   ILE n 
13 47   ASP n 
13 48   VAL n 
13 49   GLY n 
13 50   SER n 
13 51   GLU n 
13 52   TRP n 
13 53   ARG n 
13 54   THR n 
13 55   PHE n 
13 56   SER n 
13 57   ASN n 
13 58   ASP n 
13 59   LYS n 
13 60   ALA n 
13 61   THR n 
13 62   LYS n 
13 63   ASP n 
13 64   PRO n 
13 65   SER n 
13 66   ARG n 
13 67   VAL n 
13 68   GLY n 
13 69   ASP n 
13 70   SER n 
13 71   GLN n 
13 72   ASN n 
13 73   PRO n 
13 74   LEU n 
13 75   LEU n 
13 76   SER n 
13 77   ASP n 
13 78   GLY n 
13 79   ASP n 
13 80   LEU n 
13 81   SER n 
13 82   THR n 
13 83   MET n 
13 84   ILE n 
13 85   GLY n 
13 86   LYS n 
13 87   GLY n 
13 88   THR n 
13 89   GLY n 
13 90   ALA n 
13 91   ALA n 
13 92   SER n 
13 93   PHE n 
13 94   ASP n 
13 95   GLU n 
13 96   PHE n 
13 97   GLY n 
13 98   ASN n 
13 99   SER n 
13 100  LYS n 
13 101  TYR n 
13 102  GLN n 
13 103  ASN n 
13 104  ARG n 
13 105  ARG n 
13 106  THR n 
13 107  MET n 
13 108  SER n 
13 109  SER n 
13 110  SER n 
13 111  ASP n 
13 112  ARG n 
13 113  ALA n 
13 114  MET n 
13 115  MET n 
13 116  ASN n 
13 117  ALA n 
13 118  PHE n 
13 119  LYS n 
13 120  GLU n 
13 121  ILE n 
13 122  THR n 
13 123  THR n 
13 124  MET n 
13 125  ALA n 
13 126  ASP n 
13 127  ARG n 
13 128  ILE n 
13 129  ASN n 
13 130  LEU n 
13 131  PRO n 
13 132  ARG n 
13 133  ASN n 
13 134  ILE n 
13 135  VAL n 
13 136  ASP n 
13 137  ARG n 
13 138  THR n 
13 139  ASN n 
13 140  ASN n 
13 141  LEU n 
13 142  PHE n 
13 143  LYS n 
13 144  GLN n 
13 145  VAL n 
13 146  TYR n 
13 147  GLU n 
13 148  GLN n 
13 149  LYS n 
13 150  SER n 
13 151  LEU n 
13 152  LYS n 
13 153  GLY n 
13 154  ARG n 
13 155  ALA n 
13 156  ASN n 
13 157  ASP n 
13 158  ALA n 
13 159  ILE n 
13 160  ALA n 
13 161  SER n 
13 162  ALA n 
13 163  CYS n 
13 164  LEU n 
13 165  TYR n 
13 166  ILE n 
13 167  ALA n 
13 168  CYS n 
13 169  ARG n 
13 170  GLN n 
13 171  GLU n 
13 172  GLY n 
13 173  VAL n 
13 174  PRO n 
13 175  ARG n 
13 176  THR n 
13 177  PHE n 
13 178  LYS n 
13 179  GLU n 
13 180  ILE n 
13 181  CYS n 
13 182  ALA n 
13 183  VAL n 
13 184  SER n 
13 185  ARG n 
13 186  ILE n 
13 187  SER n 
13 188  LYS n 
13 189  LYS n 
13 190  GLU n 
13 191  ILE n 
13 192  GLY n 
13 193  ARG n 
13 194  CYS n 
13 195  PHE n 
13 196  LYS n 
13 197  LEU n 
13 198  ILE n 
13 199  LEU n 
13 200  LYS n 
13 201  ALA n 
13 202  LEU n 
13 203  GLU n 
13 204  THR n 
13 205  SER n 
13 206  VAL n 
13 207  ASP n 
13 208  LEU n 
13 209  ILE n 
13 210  THR n 
13 211  THR n 
13 212  GLY n 
13 213  ASP n 
13 214  PHE n 
13 215  MET n 
13 216  SER n 
13 217  ARG n 
13 218  PHE n 
13 219  CYS n 
13 220  SER n 
13 221  ASN n 
13 222  LEU n 
13 223  CYS n 
13 224  LEU n 
13 225  PRO n 
13 226  LYS n 
13 227  GLN n 
13 228  VAL n 
13 229  GLN n 
13 230  MET n 
13 231  ALA n 
13 232  ALA n 
13 233  THR n 
13 234  HIS n 
13 235  ILE n 
13 236  ALA n 
13 237  ARG n 
13 238  LYS n 
13 239  ALA n 
13 240  VAL n 
13 241  GLU n 
13 242  LEU n 
13 243  ASP n 
13 244  LEU n 
13 245  VAL n 
13 246  PRO n 
13 247  GLY n 
13 248  ARG n 
13 249  SER n 
13 250  PRO n 
13 251  ILE n 
13 252  SER n 
13 253  VAL n 
13 254  ALA n 
13 255  ALA n 
13 256  ALA n 
13 257  ALA n 
13 258  ILE n 
13 259  TYR n 
13 260  MET n 
13 261  ALA n 
13 262  SER n 
13 263  GLN n 
13 264  ALA n 
13 265  SER n 
13 266  ALA n 
13 267  GLU n 
13 268  LYS n 
13 269  ARG n 
13 270  THR n 
13 271  GLN n 
13 272  LYS n 
13 273  GLU n 
13 274  ILE n 
13 275  GLY n 
13 276  ASP n 
13 277  ILE n 
13 278  ALA n 
13 279  GLY n 
13 280  VAL n 
13 281  ALA n 
13 282  ASP n 
13 283  VAL n 
13 284  THR n 
13 285  ILE n 
13 286  ARG n 
13 287  GLN n 
13 288  SER n 
13 289  TYR n 
13 290  ARG n 
13 291  LEU n 
13 292  ILE n 
13 293  TYR n 
13 294  PRO n 
13 295  ARG n 
13 296  ALA n 
13 297  PRO n 
13 298  ASP n 
13 299  LEU n 
13 300  PHE n 
13 301  PRO n 
13 302  THR n 
13 303  ASP n 
13 304  PHE n 
13 305  LYS n 
13 306  PHE n 
13 307  ASP n 
13 308  THR n 
13 309  PRO n 
13 310  VAL n 
13 311  ASP n 
13 312  LYS n 
13 313  LEU n 
13 314  PRO n 
13 315  GLN n 
13 316  LEU n 
14 1    MET n 
14 2    ALA n 
14 3    ASN n 
14 4    SER n 
14 5    ALA n 
14 6    ASN n 
14 7    THR n 
14 8    ASN n 
14 9    THR n 
14 10   VAL n 
14 11   PRO n 
14 12   LYS n 
14 13   LEU n 
14 14   TYR n 
14 15   ARG n 
14 16   SER n 
14 17   VAL n 
14 18   ILE n 
14 19   GLU n 
14 20   ASP n 
14 21   VAL n 
14 22   ILE n 
14 23   ASN n 
14 24   ASP n 
14 25   VAL n 
14 26   ARG n 
14 27   ASP n 
14 28   ILE n 
14 29   PHE n 
14 30   LEU n 
14 31   ASP n 
14 32   ASP n 
14 33   GLY n 
14 34   VAL n 
14 35   ASP n 
14 36   GLU n 
14 37   GLN n 
14 38   VAL n 
14 39   LEU n 
14 40   MET n 
14 41   GLU n 
14 42   LEU n 
14 43   LYS n 
14 44   THR n 
14 45   LEU n 
14 46   TRP n 
14 47   GLU n 
14 48   ASN n 
14 49   LYS n 
14 50   LEU n 
14 51   MET n 
14 52   GLN n 
14 53   SER n 
14 54   ARG n 
14 55   ALA n 
14 56   VAL n 
14 57   ASP n 
14 58   GLY n 
14 59   PHE n 
14 60   HIS n 
14 61   SER n 
14 62   GLU n 
14 63   GLU n 
14 64   GLN n 
14 65   GLN n 
14 66   LEU n 
14 67   LEU n 
14 68   LEU n 
14 69   GLN n 
14 70   VAL n 
14 71   GLN n 
14 72   GLN n 
14 73   GLN n 
14 74   HIS n 
14 75   GLN n 
14 76   PRO n 
14 77   GLN n 
14 78   GLN n 
14 79   GLN n 
14 80   GLN n 
14 81   HIS n 
14 82   HIS n 
14 83   HIS n 
14 84   HIS n 
14 85   HIS n 
14 86   HIS n 
14 87   HIS n 
14 88   GLN n 
14 89   GLN n 
14 90   ALA n 
14 91   GLN n 
14 92   PRO n 
14 93   GLN n 
14 94   GLN n 
14 95   THR n 
14 96   VAL n 
14 97   PRO n 
14 98   GLN n 
14 99   GLN n 
14 100  ALA n 
14 101  GLN n 
14 102  THR n 
14 103  GLN n 
14 104  GLN n 
14 105  VAL n 
14 106  LEU n 
14 107  ILE n 
14 108  PRO n 
14 109  ALA n 
14 110  SER n 
14 111  GLN n 
14 112  GLN n 
14 113  ALA n 
14 114  THR n 
14 115  ALA n 
14 116  PRO n 
14 117  GLN n 
14 118  VAL n 
14 119  ILE n 
14 120  VAL n 
14 121  PRO n 
14 122  ASP n 
14 123  SER n 
14 124  LYS n 
14 125  LEU n 
14 126  ILE n 
14 127  GLN n 
14 128  HIS n 
14 129  MET n 
14 130  ASN n 
14 131  ALA n 
14 132  SER n 
14 133  ASN n 
14 134  MET n 
14 135  SER n 
14 136  ALA n 
14 137  ALA n 
14 138  ALA n 
14 139  THR n 
14 140  ALA n 
14 141  ALA n 
14 142  THR n 
14 143  LEU n 
14 144  ALA n 
14 145  LEU n 
14 146  PRO n 
14 147  ALA n 
14 148  GLY n 
14 149  VAL n 
14 150  THR n 
14 151  PRO n 
14 152  VAL n 
14 153  GLN n 
14 154  GLN n 
14 155  ILE n 
14 156  LEU n 
14 157  THR n 
14 158  ASN n 
14 159  SER n 
14 160  GLY n 
14 161  GLN n 
14 162  LEU n 
14 163  LEU n 
14 164  GLN n 
14 165  VAL n 
14 166  VAL n 
14 167  ARG n 
14 168  ALA n 
14 169  ALA n 
14 170  ASN n 
14 171  GLY n 
14 172  ALA n 
14 173  GLN n 
14 174  TYR n 
14 175  ILE n 
14 176  PHE n 
14 177  GLN n 
14 178  PRO n 
14 179  GLN n 
14 180  GLN n 
14 181  SER n 
14 182  VAL n 
14 183  VAL n 
14 184  LEU n 
14 185  GLN n 
14 186  GLN n 
14 187  GLN n 
14 188  VAL n 
14 189  ILE n 
14 190  PRO n 
14 191  GLN n 
14 192  MET n 
14 193  GLN n 
14 194  PRO n 
14 195  GLY n 
14 196  GLY n 
14 197  VAL n 
14 198  GLN n 
14 199  ALA n 
14 200  PRO n 
14 201  VAL n 
14 202  ILE n 
14 203  GLN n 
14 204  GLN n 
14 205  VAL n 
14 206  LEU n 
14 207  ALA n 
14 208  PRO n 
14 209  LEU n 
14 210  PRO n 
14 211  GLY n 
14 212  GLY n 
14 213  ILE n 
14 214  SER n 
14 215  PRO n 
14 216  GLN n 
14 217  THR n 
14 218  GLY n 
14 219  VAL n 
14 220  ILE n 
14 221  ILE n 
14 222  GLN n 
14 223  PRO n 
14 224  GLN n 
14 225  GLN n 
14 226  ILE n 
14 227  LEU n 
14 228  PHE n 
14 229  THR n 
14 230  GLY n 
14 231  ASN n 
14 232  LYS n 
14 233  THR n 
14 234  GLN n 
14 235  VAL n 
14 236  ILE n 
14 237  PRO n 
14 238  THR n 
14 239  THR n 
14 240  VAL n 
14 241  ALA n 
14 242  ALA n 
14 243  PRO n 
14 244  THR n 
14 245  PRO n 
14 246  ALA n 
14 247  GLN n 
14 248  ALA n 
14 249  GLN n 
14 250  ILE n 
14 251  THR n 
14 252  ALA n 
14 253  THR n 
14 254  GLY n 
14 255  GLN n 
14 256  GLN n 
14 257  GLN n 
14 258  PRO n 
14 259  GLN n 
14 260  ALA n 
14 261  GLN n 
14 262  PRO n 
14 263  ALA n 
14 264  GLN n 
14 265  THR n 
14 266  GLN n 
14 267  ALA n 
14 268  PRO n 
14 269  LEU n 
14 270  VAL n 
14 271  LEU n 
14 272  GLN n 
14 273  VAL n 
14 274  ASP n 
14 275  GLY n 
14 276  THR n 
14 277  GLY n 
14 278  ASP n 
14 279  THR n 
14 280  SER n 
14 281  SER n 
14 282  GLU n 
14 283  GLU n 
14 284  ASP n 
14 285  GLU n 
14 286  ASP n 
14 287  GLU n 
14 288  GLU n 
14 289  GLU n 
14 290  ASP n 
14 291  TYR n 
14 292  ASP n 
14 293  ASP n 
14 294  ASP n 
14 295  GLU n 
14 296  GLU n 
14 297  GLU n 
14 298  ASP n 
14 299  LYS n 
14 300  GLU n 
14 301  LYS n 
14 302  ASP n 
14 303  GLY n 
14 304  ALA n 
14 305  GLU n 
14 306  ASP n 
14 307  GLY n 
14 308  GLN n 
14 309  VAL n 
14 310  GLU n 
14 311  GLU n 
14 312  GLU n 
14 313  PRO n 
14 314  LEU n 
14 315  ASN n 
14 316  SER n 
14 317  GLU n 
14 318  ASP n 
14 319  ASP n 
14 320  VAL n 
14 321  SER n 
14 322  ASP n 
14 323  GLU n 
14 324  GLU n 
14 325  GLY n 
14 326  GLN n 
14 327  GLU n 
14 328  LEU n 
14 329  PHE n 
14 330  ASP n 
14 331  THR n 
14 332  GLU n 
14 333  ASN n 
14 334  VAL n 
14 335  VAL n 
14 336  VAL n 
14 337  CYS n 
14 338  GLN n 
14 339  TYR n 
14 340  ASP n 
14 341  LYS n 
14 342  ILE n 
14 343  HIS n 
14 344  ARG n 
14 345  SER n 
14 346  LYS n 
14 347  ASN n 
14 348  LYS n 
14 349  TRP n 
14 350  LYS n 
14 351  PHE n 
14 352  HIS n 
14 353  LEU n 
14 354  LYS n 
14 355  ASP n 
14 356  GLY n 
14 357  ILE n 
14 358  MET n 
14 359  ASN n 
14 360  LEU n 
14 361  ASN n 
14 362  GLY n 
14 363  ARG n 
14 364  ASP n 
14 365  TYR n 
14 366  ILE n 
14 367  PHE n 
14 368  SER n 
14 369  LYS n 
14 370  ALA n 
14 371  ILE n 
14 372  GLY n 
14 373  ASP n 
14 374  ALA n 
14 375  GLU n 
14 376  TRP n 
15 1    MET n 
15 2    ALA n 
15 3    TYR n 
15 4    GLN n 
15 5    LEU n 
15 6    TYR n 
15 7    ARG n 
15 8    ASN n 
15 9    THR n 
15 10   THR n 
15 11   LEU n 
15 12   GLY n 
15 13   ASN n 
15 14   SER n 
15 15   LEU n 
15 16   GLN n 
15 17   GLU n 
15 18   SER n 
15 19   LEU n 
15 20   ASP n 
15 21   GLU n 
15 22   LEU n 
15 23   ILE n 
15 24   GLN n 
15 25   SER n 
15 26   GLN n 
15 27   GLN n 
15 28   ILE n 
15 29   THR n 
15 30   PRO n 
15 31   GLN n 
15 32   LEU n 
15 33   ALA n 
15 34   LEU n 
15 35   GLN n 
15 36   VAL n 
15 37   LEU n 
15 38   LEU n 
15 39   GLN n 
15 40   PHE n 
15 41   ASP n 
15 42   LYS n 
15 43   ALA n 
15 44   ILE n 
15 45   ASN n 
15 46   ALA n 
15 47   ALA n 
15 48   LEU n 
15 49   ALA n 
15 50   GLN n 
15 51   ARG n 
15 52   VAL n 
15 53   ARG n 
15 54   ASN n 
15 55   ARG n 
15 56   VAL n 
15 57   ASN n 
15 58   PHE n 
15 59   ARG n 
15 60   GLY n 
15 61   SER n 
15 62   LEU n 
15 63   ASN n 
15 64   THR n 
15 65   TYR n 
15 66   ARG n 
15 67   PHE n 
15 68   CYS n 
15 69   ASP n 
15 70   ASN n 
15 71   VAL n 
15 72   TRP n 
15 73   THR n 
15 74   PHE n 
15 75   VAL n 
15 76   LEU n 
15 77   ASN n 
15 78   ASP n 
15 79   VAL n 
15 80   GLU n 
15 81   PHE n 
15 82   ARG n 
15 83   GLU n 
15 84   VAL n 
15 85   THR n 
15 86   GLU n 
15 87   LEU n 
15 88   ILE n 
15 89   LYS n 
15 90   VAL n 
15 91   ASP n 
15 92   LYS n 
15 93   VAL n 
15 94   LYS n 
15 95   ILE n 
15 96   VAL n 
15 97   ALA n 
15 98   CYS n 
15 99   ASP n 
15 100  GLY n 
15 101  LYS n 
15 102  ASN n 
15 103  THR n 
15 104  GLY n 
15 105  SER n 
15 106  ASN n 
15 107  THR n 
15 108  THR n 
15 109  GLU n 
16 1    MET n 
16 2    ASP n 
16 3    GLN n 
16 4    ASN n 
16 5    ASN n 
16 6    SER n 
16 7    LEU n 
16 8    PRO n 
16 9    PRO n 
16 10   TYR n 
16 11   ALA n 
16 12   GLN n 
16 13   GLY n 
16 14   LEU n 
16 15   ALA n 
16 16   SER n 
16 17   PRO n 
16 18   GLN n 
16 19   GLY n 
16 20   ALA n 
16 21   MET n 
16 22   THR n 
16 23   PRO n 
16 24   GLY n 
16 25   ILE n 
16 26   PRO n 
16 27   ILE n 
16 28   PHE n 
16 29   SER n 
16 30   PRO n 
16 31   MET n 
16 32   MET n 
16 33   PRO n 
16 34   TYR n 
16 35   GLY n 
16 36   THR n 
16 37   GLY n 
16 38   LEU n 
16 39   THR n 
16 40   PRO n 
16 41   GLN n 
16 42   PRO n 
16 43   ILE n 
16 44   GLN n 
16 45   ASN n 
16 46   THR n 
16 47   ASN n 
16 48   SER n 
16 49   LEU n 
16 50   SER n 
16 51   ILE n 
16 52   LEU n 
16 53   GLU n 
16 54   GLU n 
16 55   GLN n 
16 56   GLN n 
16 57   ARG n 
16 58   GLN n 
16 59   GLN n 
16 60   GLN n 
16 61   GLN n 
16 62   GLN n 
16 63   GLN n 
16 64   GLN n 
16 65   GLN n 
16 66   GLN n 
16 67   GLN n 
16 68   GLN n 
16 69   GLN n 
16 70   GLN n 
16 71   GLN n 
16 72   GLN n 
16 73   GLN n 
16 74   GLN n 
16 75   GLN n 
16 76   GLN n 
16 77   GLN n 
16 78   GLN n 
16 79   GLN n 
16 80   GLN n 
16 81   GLN n 
16 82   GLN n 
16 83   GLN n 
16 84   GLN n 
16 85   GLN n 
16 86   GLN n 
16 87   GLN n 
16 88   GLN n 
16 89   GLN n 
16 90   GLN n 
16 91   GLN n 
16 92   GLN n 
16 93   GLN n 
16 94   GLN n 
16 95   GLN n 
16 96   ALA n 
16 97   VAL n 
16 98   ALA n 
16 99   ALA n 
16 100  ALA n 
16 101  ALA n 
16 102  VAL n 
16 103  GLN n 
16 104  GLN n 
16 105  SER n 
16 106  THR n 
16 107  SER n 
16 108  GLN n 
16 109  GLN n 
16 110  ALA n 
16 111  THR n 
16 112  GLN n 
16 113  GLY n 
16 114  THR n 
16 115  SER n 
16 116  GLY n 
16 117  GLN n 
16 118  ALA n 
16 119  PRO n 
16 120  GLN n 
16 121  LEU n 
16 122  PHE n 
16 123  HIS n 
16 124  SER n 
16 125  GLN n 
16 126  THR n 
16 127  LEU n 
16 128  THR n 
16 129  THR n 
16 130  ALA n 
16 131  PRO n 
16 132  LEU n 
16 133  PRO n 
16 134  GLY n 
16 135  THR n 
16 136  THR n 
16 137  PRO n 
16 138  LEU n 
16 139  TYR n 
16 140  PRO n 
16 141  SER n 
16 142  PRO n 
16 143  MET n 
16 144  THR n 
16 145  PRO n 
16 146  MET n 
16 147  THR n 
16 148  PRO n 
16 149  ILE n 
16 150  THR n 
16 151  PRO n 
16 152  ALA n 
16 153  THR n 
16 154  PRO n 
16 155  ALA n 
16 156  SER n 
16 157  GLU n 
16 158  SER n 
16 159  SER n 
16 160  GLY n 
16 161  ILE n 
16 162  VAL n 
16 163  PRO n 
16 164  GLN n 
16 165  LEU n 
16 166  GLN n 
16 167  ASN n 
16 168  ILE n 
16 169  VAL n 
16 170  SER n 
16 171  THR n 
16 172  VAL n 
16 173  ASN n 
16 174  LEU n 
16 175  GLY n 
16 176  CYS n 
16 177  LYS n 
16 178  LEU n 
16 179  ASP n 
16 180  LEU n 
16 181  LYS n 
16 182  THR n 
16 183  ILE n 
16 184  ALA n 
16 185  LEU n 
16 186  ARG n 
16 187  ALA n 
16 188  ARG n 
16 189  ASN n 
16 190  ALA n 
16 191  GLU n 
16 192  TYR n 
16 193  ASN n 
16 194  PRO n 
16 195  LYS n 
16 196  ARG n 
16 197  PHE n 
16 198  ALA n 
16 199  ALA n 
16 200  VAL n 
16 201  ILE n 
16 202  MET n 
16 203  ARG n 
16 204  ILE n 
16 205  ARG n 
16 206  GLU n 
16 207  PRO n 
16 208  ARG n 
16 209  THR n 
16 210  THR n 
16 211  ALA n 
16 212  LEU n 
16 213  ILE n 
16 214  PHE n 
16 215  SER n 
16 216  SER n 
16 217  GLY n 
16 218  LYS n 
16 219  MET n 
16 220  VAL n 
16 221  CYS n 
16 222  THR n 
16 223  GLY n 
16 224  ALA n 
16 225  LYS n 
16 226  SER n 
16 227  GLU n 
16 228  GLU n 
16 229  GLN n 
16 230  SER n 
16 231  ARG n 
16 232  LEU n 
16 233  ALA n 
16 234  ALA n 
16 235  ARG n 
16 236  LYS n 
16 237  TYR n 
16 238  ALA n 
16 239  ARG n 
16 240  VAL n 
16 241  VAL n 
16 242  GLN n 
16 243  LYS n 
16 244  LEU n 
16 245  GLY n 
16 246  PHE n 
16 247  PRO n 
16 248  ALA n 
16 249  LYS n 
16 250  PHE n 
16 251  LEU n 
16 252  ASP n 
16 253  PHE n 
16 254  LYS n 
16 255  ILE n 
16 256  GLN n 
16 257  ASN n 
16 258  MET n 
16 259  VAL n 
16 260  GLY n 
16 261  SER n 
16 262  CYS n 
16 263  ASP n 
16 264  VAL n 
16 265  LYS n 
16 266  PHE n 
16 267  PRO n 
16 268  ILE n 
16 269  ARG n 
16 270  LEU n 
16 271  GLU n 
16 272  GLY n 
16 273  LEU n 
16 274  VAL n 
16 275  LEU n 
16 276  THR n 
16 277  HIS n 
16 278  GLN n 
16 279  GLN n 
16 280  PHE n 
16 281  SER n 
16 282  SER n 
16 283  TYR n 
16 284  GLU n 
16 285  PRO n 
16 286  GLU n 
16 287  LEU n 
16 288  PHE n 
16 289  PRO n 
16 290  GLY n 
16 291  LEU n 
16 292  ILE n 
16 293  TYR n 
16 294  ARG n 
16 295  MET n 
16 296  ILE n 
16 297  LYS n 
16 298  PRO n 
16 299  ARG n 
16 300  ILE n 
16 301  VAL n 
16 302  LEU n 
16 303  LEU n 
16 304  ILE n 
16 305  PHE n 
16 306  VAL n 
16 307  SER n 
16 308  GLY n 
16 309  LYS n 
16 310  VAL n 
16 311  VAL n 
16 312  LEU n 
16 313  THR n 
16 314  GLY n 
16 315  ALA n 
16 316  LYS n 
16 317  VAL n 
16 318  ARG n 
16 319  ALA n 
16 320  GLU n 
16 321  ILE n 
16 322  TYR n 
16 323  GLU n 
16 324  ALA n 
16 325  PHE n 
16 326  GLU n 
16 327  ASN n 
16 328  ILE n 
16 329  TYR n 
16 330  PRO n 
16 331  ILE n 
16 332  LEU n 
16 333  LYS n 
16 334  GLY n 
16 335  PHE n 
16 336  ARG n 
16 337  LYS n 
16 338  THR n 
16 339  THR n 
17 1    MET n 
17 2    ALA n 
17 3    ASP n 
17 4    PRO n 
17 5    ASP n 
17 6    VAL n 
17 7    LEU n 
17 8    THR n 
17 9    GLU n 
17 10   VAL n 
17 11   PRO n 
17 12   ALA n 
17 13   ALA n 
17 14   LEU n 
17 15   LYS n 
17 16   ARG n 
17 17   LEU n 
17 18   ALA n 
17 19   LYS n 
17 20   TYR n 
17 21   VAL n 
17 22   ILE n 
17 23   ARG n 
17 24   GLY n 
17 25   PHE n 
17 26   TYR n 
17 27   GLY n 
17 28   ILE n 
17 29   GLU n 
17 30   HIS n 
17 31   ALA n 
17 32   LEU n 
17 33   ALA n 
17 34   LEU n 
17 35   ASP n 
17 36   ILE n 
17 37   LEU n 
17 38   ILE n 
17 39   ARG n 
17 40   ASN n 
17 41   SER n 
17 42   CYS n 
17 43   VAL n 
17 44   LYS n 
17 45   GLU n 
17 46   GLU n 
17 47   ASP n 
17 48   MET n 
17 49   LEU n 
17 50   GLU n 
17 51   LEU n 
17 52   LEU n 
17 53   LYS n 
17 54   PHE n 
17 55   ASP n 
17 56   ARG n 
17 57   LYS n 
17 58   GLN n 
17 59   LEU n 
17 60   ARG n 
17 61   SER n 
17 62   VAL n 
17 63   LEU n 
17 64   ASN n 
17 65   ASN n 
17 66   LEU n 
17 67   LYS n 
17 68   GLY n 
17 69   ASP n 
17 70   LYS n 
17 71   PHE n 
17 72   ILE n 
17 73   LYS n 
17 74   CYS n 
17 75   ARG n 
17 76   MET n 
17 77   ARG n 
17 78   VAL n 
17 79   GLU n 
17 80   THR n 
17 81   ALA n 
17 82   ALA n 
17 83   ASP n 
17 84   GLY n 
17 85   LYS n 
17 86   THR n 
17 87   THR n 
17 88   ARG n 
17 89   HIS n 
17 90   ASN n 
17 91   TYR n 
17 92   TYR n 
17 93   PHE n 
17 94   ILE n 
17 95   ASN n 
17 96   TYR n 
17 97   ARG n 
17 98   THR n 
17 99   LEU n 
17 100  VAL n 
17 101  ASN n 
17 102  VAL n 
17 103  VAL n 
17 104  LYS n 
17 105  TYR n 
17 106  LYS n 
17 107  LEU n 
17 108  ASP n 
17 109  HIS n 
17 110  MET n 
17 111  ARG n 
17 112  ARG n 
17 113  ARG n 
17 114  ILE n 
17 115  GLU n 
17 116  THR n 
17 117  ASP n 
17 118  GLU n 
17 119  ARG n 
17 120  ASP n 
17 121  SER n 
17 122  THR n 
17 123  ASN n 
17 124  ARG n 
17 125  ALA n 
17 126  SER n 
17 127  PHE n 
17 128  LYS n 
17 129  CYS n 
17 130  PRO n 
17 131  VAL n 
17 132  CYS n 
17 133  SER n 
17 134  SER n 
17 135  THR n 
17 136  PHE n 
17 137  THR n 
17 138  ASP n 
17 139  LEU n 
17 140  GLU n 
17 141  ALA n 
17 142  ASN n 
17 143  GLN n 
17 144  LEU n 
17 145  PHE n 
17 146  ASP n 
17 147  PRO n 
17 148  MET n 
17 149  THR n 
17 150  GLY n 
17 151  THR n 
17 152  PHE n 
17 153  ARG n 
17 154  CYS n 
17 155  THR n 
17 156  PHE n 
17 157  CYS n 
17 158  HIS n 
17 159  THR n 
17 160  GLU n 
17 161  VAL n 
17 162  GLU n 
17 163  GLU n 
17 164  ASP n 
17 165  GLU n 
17 166  SER n 
17 167  ALA n 
17 168  MET n 
17 169  PRO n 
17 170  LYS n 
17 171  LYS n 
17 172  ASP n 
17 173  ALA n 
17 174  ARG n 
17 175  THR n 
17 176  LEU n 
17 177  LEU n 
17 178  ALA n 
17 179  ARG n 
17 180  PHE n 
17 181  ASN n 
17 182  GLU n 
17 183  GLN n 
17 184  ILE n 
17 185  GLU n 
17 186  PRO n 
17 187  ILE n 
17 188  TYR n 
17 189  ALA n 
17 190  LEU n 
17 191  LEU n 
17 192  ARG n 
17 193  GLU n 
17 194  THR n 
17 195  GLU n 
17 196  ASP n 
17 197  VAL n 
17 198  ASN n 
17 199  LEU n 
17 200  ALA n 
17 201  TYR n 
17 202  GLU n 
17 203  ILE n 
17 204  LEU n 
17 205  GLU n 
17 206  PRO n 
17 207  GLU n 
17 208  PRO n 
17 209  THR n 
17 210  GLU n 
17 211  ILE n 
17 212  PRO n 
17 213  ALA n 
17 214  LEU n 
17 215  LYS n 
17 216  GLN n 
17 217  SER n 
17 218  LYS n 
17 219  ASP n 
17 220  HIS n 
17 221  ALA n 
17 222  ALA n 
17 223  THR n 
17 224  THR n 
17 225  ALA n 
17 226  GLY n 
17 227  ALA n 
17 228  ALA n 
17 229  SER n 
17 230  LEU n 
17 231  ALA n 
17 232  GLY n 
17 233  GLY n 
17 234  HIS n 
17 235  HIS n 
17 236  ARG n 
17 237  GLU n 
17 238  ALA n 
17 239  TRP n 
17 240  ALA n 
17 241  THR n 
17 242  LYS n 
17 243  GLY n 
17 244  PRO n 
17 245  SER n 
17 246  TYR n 
17 247  GLU n 
17 248  ASP n 
17 249  LEU n 
17 250  TYR n 
17 251  THR n 
17 252  GLN n 
17 253  ASN n 
17 254  VAL n 
17 255  VAL n 
17 256  ILE n 
17 257  ASN n 
17 258  MET n 
17 259  ASP n 
17 260  ASP n 
17 261  GLN n 
17 262  GLU n 
17 263  ASP n 
17 264  LEU n 
17 265  HIS n 
17 266  ARG n 
17 267  ALA n 
17 268  SER n 
17 269  LEU n 
17 270  GLU n 
17 271  GLY n 
17 272  LYS n 
17 273  SER n 
17 274  ALA n 
17 275  LYS n 
17 276  GLU n 
17 277  ARG n 
17 278  PRO n 
17 279  ILE n 
17 280  TRP n 
17 281  LEU n 
17 282  ARG n 
17 283  GLU n 
17 284  SER n 
17 285  THR n 
17 286  VAL n 
17 287  GLN n 
17 288  GLY n 
17 289  ALA n 
17 290  TYR n 
17 291  GLY n 
17 292  SER n 
17 293  GLU n 
17 294  ASP n 
17 295  MET n 
17 296  LYS n 
17 297  GLU n 
17 298  GLY n 
17 299  GLY n 
17 300  ILE n 
17 301  ASP n 
17 302  MET n 
17 303  ASP n 
17 304  ALA n 
17 305  PHE n 
17 306  GLN n 
17 307  GLU n 
17 308  ARG n 
17 309  GLU n 
17 310  GLU n 
17 311  GLY n 
17 312  HIS n 
17 313  ALA n 
17 314  GLY n 
17 315  PRO n 
17 316  ASP n 
17 317  ASP n 
17 318  ASN n 
17 319  GLU n 
17 320  GLU n 
17 321  VAL n 
17 322  MET n 
17 323  ARG n 
17 324  ALA n 
17 325  LEU n 
17 326  LEU n 
17 327  ILE n 
17 328  HIS n 
17 329  GLU n 
17 330  LYS n 
17 331  LYS n 
17 332  THR n 
17 333  SER n 
17 334  SER n 
17 335  ALA n 
17 336  MET n 
17 337  ALA n 
17 338  GLY n 
17 339  SER n 
17 340  VAL n 
17 341  GLY n 
17 342  ALA n 
17 343  ALA n 
17 344  ALA n 
17 345  PRO n 
17 346  VAL n 
17 347  THR n 
17 348  ALA n 
17 349  ALA n 
17 350  ASN n 
17 351  GLY n 
17 352  SER n 
17 353  ASP n 
17 354  SER n 
17 355  GLU n 
17 356  SER n 
17 357  GLU n 
17 358  THR n 
17 359  SER n 
17 360  GLU n 
17 361  SER n 
17 362  ASP n 
17 363  ASP n 
17 364  ASP n 
17 365  SER n 
17 366  PRO n 
17 367  PRO n 
17 368  ARG n 
17 369  PRO n 
17 370  ALA n 
17 371  ALA n 
17 372  VAL n 
17 373  ALA n 
17 374  VAL n 
17 375  HIS n 
17 376  LYS n 
17 377  ARG n 
17 378  GLU n 
17 379  GLU n 
17 380  ASP n 
17 381  GLU n 
17 382  GLU n 
17 383  GLU n 
17 384  ASP n 
17 385  ASP n 
17 386  GLU n 
17 387  PHE n 
17 388  GLU n 
17 389  GLU n 
17 390  VAL n 
17 391  ALA n 
17 392  ASP n 
17 393  ASP n 
17 394  PRO n 
17 395  ILE n 
17 396  VAL n 
17 397  MET n 
17 398  VAL n 
17 399  ALA n 
17 400  GLY n 
17 401  ARG n 
17 402  PRO n 
17 403  PHE n 
17 404  SER n 
17 405  TYR n 
17 406  SER n 
17 407  GLU n 
17 408  VAL n 
17 409  SER n 
17 410  GLN n 
17 411  ARG n 
17 412  PRO n 
17 413  GLU n 
17 414  LEU n 
17 415  VAL n 
17 416  ALA n 
17 417  GLN n 
17 418  MET n 
17 419  THR n 
17 420  PRO n 
17 421  GLU n 
17 422  GLU n 
17 423  LYS n 
17 424  GLU n 
17 425  ALA n 
17 426  TYR n 
17 427  ILE n 
17 428  ALA n 
17 429  MET n 
17 430  GLY n 
17 431  GLN n 
17 432  ARG n 
17 433  MET n 
17 434  PHE n 
17 435  GLU n 
17 436  ASP n 
17 437  LEU n 
17 438  PHE n 
17 439  GLU n 
18 1    MET n 
18 2    ASP n 
18 3    PRO n 
18 4    SER n 
18 5    LEU n 
18 6    LEU n 
18 7    ARG n 
18 8    GLU n 
18 9    ARG n 
18 10   GLU n 
18 11   LEU n 
18 12   PHE n 
18 13   LYS n 
18 14   LYS n 
18 15   ARG n 
18 16   ALA n 
18 17   LEU n 
18 18   SER n 
18 19   THR n 
18 20   PRO n 
18 21   VAL n 
18 22   VAL n 
18 23   GLU n 
18 24   LYS n 
18 25   ARG n 
18 26   SER n 
18 27   ALA n 
18 28   SER n 
18 29   SER n 
18 30   GLU n 
18 31   SER n 
18 32   SER n 
18 33   SER n 
18 34   SER n 
18 35   SER n 
18 36   SER n 
18 37   LYS n 
18 38   LYS n 
18 39   LYS n 
18 40   LYS n 
18 41   THR n 
18 42   LYS n 
18 43   VAL n 
18 44   GLU n 
18 45   HIS n 
18 46   GLY n 
18 47   GLY n 
18 48   SER n 
18 49   SER n 
18 50   GLY n 
18 51   SER n 
18 52   LYS n 
18 53   GLN n 
18 54   ASN n 
18 55   SER n 
18 56   ASP n 
18 57   HIS n 
18 58   SER n 
18 59   ASN n 
18 60   GLY n 
18 61   SER n 
18 62   PHE n 
18 63   ASN n 
18 64   LEU n 
18 65   LYS n 
18 66   ALA n 
18 67   LEU n 
18 68   SER n 
18 69   GLY n 
18 70   SER n 
18 71   SER n 
18 72   GLY n 
18 73   TYR n 
18 74   LYS n 
18 75   PHE n 
18 76   GLY n 
18 77   VAL n 
18 78   LEU n 
18 79   ALA n 
18 80   LYS n 
18 81   ILE n 
18 82   VAL n 
18 83   ASN n 
18 84   TYR n 
18 85   MET n 
18 86   LYS n 
18 87   THR n 
18 88   ARG n 
18 89   HIS n 
18 90   GLN n 
18 91   ARG n 
18 92   GLY n 
18 93   ASP n 
18 94   THR n 
18 95   HIS n 
18 96   PRO n 
18 97   LEU n 
18 98   THR n 
18 99   LEU n 
18 100  ASP n 
18 101  GLU n 
18 102  ILE n 
18 103  LEU n 
18 104  ASP n 
18 105  GLU n 
18 106  THR n 
18 107  GLN n 
18 108  HIS n 
18 109  LEU n 
18 110  ASP n 
18 111  ILE n 
18 112  GLY n 
18 113  LEU n 
18 114  LYS n 
18 115  GLN n 
18 116  LYS n 
18 117  GLN n 
18 118  TRP n 
18 119  LEU n 
18 120  MET n 
18 121  THR n 
18 122  GLU n 
18 123  ALA n 
18 124  LEU n 
18 125  VAL n 
18 126  ASN n 
18 127  ASN n 
18 128  PRO n 
18 129  LYS n 
18 130  ILE n 
18 131  GLU n 
18 132  VAL n 
18 133  ILE n 
18 134  ASP n 
18 135  GLY n 
18 136  LYS n 
18 137  TYR n 
18 138  ALA n 
18 139  PHE n 
18 140  LYS n 
18 141  PRO n 
18 142  LYS n 
18 143  TYR n 
18 144  ASN n 
18 145  VAL n 
18 146  ARG n 
18 147  ASP n 
18 148  LYS n 
18 149  LYS n 
18 150  ALA n 
18 151  LEU n 
18 152  LEU n 
18 153  ARG n 
18 154  LEU n 
18 155  LEU n 
18 156  ASP n 
18 157  GLN n 
18 158  HIS n 
18 159  ASP n 
18 160  GLN n 
18 161  ARG n 
18 162  GLY n 
18 163  LEU n 
18 164  GLY n 
18 165  GLY n 
18 166  ILE n 
18 167  LEU n 
18 168  LEU n 
18 169  GLU n 
18 170  ASP n 
18 171  ILE n 
18 172  GLU n 
18 173  GLU n 
18 174  ALA n 
18 175  LEU n 
18 176  PRO n 
18 177  ASN n 
18 178  SER n 
18 179  GLN n 
18 180  LYS n 
18 181  ALA n 
18 182  VAL n 
18 183  LYS n 
18 184  ALA n 
18 185  LEU n 
18 186  GLY n 
18 187  ASP n 
18 188  GLN n 
18 189  ILE n 
18 190  LEU n 
18 191  PHE n 
18 192  VAL n 
18 193  ASN n 
18 194  ARG n 
18 195  PRO n 
18 196  ASP n 
18 197  LYS n 
18 198  LYS n 
18 199  LYS n 
18 200  ILE n 
18 201  LEU n 
18 202  PHE n 
18 203  PHE n 
18 204  ASN n 
18 205  ASP n 
18 206  LYS n 
18 207  SER n 
18 208  CYS n 
18 209  GLN n 
18 210  PHE n 
18 211  SER n 
18 212  VAL n 
18 213  ASP n 
18 214  GLU n 
18 215  GLU n 
18 216  PHE n 
18 217  GLN n 
18 218  LYS n 
18 219  LEU n 
18 220  TRP n 
18 221  ARG n 
18 222  SER n 
18 223  VAL n 
18 224  THR n 
18 225  VAL n 
18 226  ASP n 
18 227  SER n 
18 228  MET n 
18 229  ASP n 
18 230  GLU n 
18 231  GLU n 
18 232  LYS n 
18 233  ILE n 
18 234  GLU n 
18 235  GLU n 
18 236  TYR n 
18 237  LEU n 
18 238  LYS n 
18 239  ARG n 
18 240  GLN n 
18 241  GLY n 
18 242  ILE n 
18 243  SER n 
18 244  SER n 
18 245  MET n 
18 246  GLN n 
18 247  GLU n 
18 248  SER n 
18 249  GLY n 
18 250  PRO n 
18 251  LYS n 
18 252  LYS n 
18 253  VAL n 
18 254  ALA n 
18 255  PRO n 
18 256  ILE n 
18 257  GLN n 
18 258  ARG n 
18 259  ARG n 
18 260  LYS n 
18 261  LYS n 
18 262  PRO n 
18 263  ALA n 
18 264  SER n 
18 265  GLN n 
18 266  LYS n 
18 267  LYS n 
18 268  ARG n 
18 269  ARG n 
18 270  PHE n 
18 271  LYS n 
18 272  THR n 
18 273  HIS n 
18 274  ASN n 
18 275  GLU n 
18 276  HIS n 
18 277  LEU n 
18 278  ALA n 
18 279  GLY n 
18 280  VAL n 
18 281  LEU n 
18 282  LYS n 
18 283  ASP n 
18 284  TYR n 
18 285  SER n 
18 286  ASP n 
18 287  ILE n 
18 288  THR n 
18 289  SER n 
18 290  SER n 
18 291  LYS n 
19 1    MET n 
19 2    ALA n 
19 3    ALA n 
19 4    LEU n 
19 5    GLY n 
19 6    PRO n 
19 7    SER n 
19 8    SER n 
19 9    GLN n 
19 10   ASN n 
19 11   VAL n 
19 12   THR n 
19 13   GLU n 
19 14   TYR n 
19 15   VAL n 
19 16   VAL n 
19 17   ARG n 
19 18   VAL n 
19 19   PRO n 
19 20   LYS n 
19 21   ASN n 
19 22   THR n 
19 23   THR n 
19 24   LYS n 
19 25   LYS n 
19 26   TYR n 
19 27   ASN n 
19 28   ILE n 
19 29   MET n 
19 30   ALA n 
19 31   PHE n 
19 32   ASN n 
19 33   ALA n 
19 34   ALA n 
19 35   ASP n 
19 36   LYS n 
19 37   VAL n 
19 38   ASN n 
19 39   PHE n 
19 40   ALA n 
19 41   THR n 
19 42   TRP n 
19 43   ASN n 
19 44   GLN n 
19 45   ALA n 
19 46   ARG n 
19 47   LEU n 
19 48   GLU n 
19 49   ARG n 
19 50   ASP n 
19 51   LEU n 
19 52   SER n 
19 53   ASN n 
19 54   LYS n 
19 55   LYS n 
19 56   ILE n 
19 57   TYR n 
19 58   GLN n 
19 59   GLU n 
19 60   GLU n 
19 61   GLU n 
19 62   MET n 
19 63   PRO n 
19 64   GLU n 
19 65   SER n 
19 66   GLY n 
19 67   ALA n 
19 68   GLY n 
19 69   SER n 
19 70   GLU n 
19 71   PHE n 
19 72   ASN n 
19 73   ARG n 
19 74   LYS n 
19 75   LEU n 
19 76   ARG n 
19 77   GLU n 
19 78   GLU n 
19 79   ALA n 
19 80   ARG n 
19 81   ARG n 
19 82   LYS n 
19 83   LYS n 
19 84   TYR n 
19 85   GLY n 
19 86   ILE n 
19 87   VAL n 
19 88   LEU n 
19 89   LYS n 
19 90   GLU n 
19 91   PHE n 
19 92   ARG n 
19 93   PRO n 
19 94   GLU n 
19 95   ASP n 
19 96   GLN n 
19 97   PRO n 
19 98   TRP n 
19 99   LEU n 
19 100  LEU n 
19 101  ARG n 
19 102  VAL n 
19 103  ASN n 
19 104  GLY n 
19 105  LYS n 
19 106  SER n 
19 107  GLY n 
19 108  ARG n 
19 109  LYS n 
19 110  PHE n 
19 111  LYS n 
19 112  GLY n 
19 113  ILE n 
19 114  LYS n 
19 115  LYS n 
19 116  GLY n 
19 117  GLY n 
19 118  VAL n 
19 119  THR n 
19 120  GLU n 
19 121  ASN n 
19 122  THR n 
19 123  SER n 
19 124  TYR n 
19 125  TYR n 
19 126  ILE n 
19 127  PHE n 
19 128  THR n 
19 129  GLN n 
19 130  CYS n 
19 131  PRO n 
19 132  ASP n 
19 133  GLY n 
19 134  ALA n 
19 135  PHE n 
19 136  GLU n 
19 137  ALA n 
19 138  PHE n 
19 139  PRO n 
19 140  VAL n 
19 141  HIS n 
19 142  ASN n 
19 143  TRP n 
19 144  TYR n 
19 145  ASN n 
19 146  PHE n 
19 147  THR n 
19 148  PRO n 
19 149  LEU n 
19 150  ALA n 
19 151  ARG n 
19 152  HIS n 
19 153  ARG n 
19 154  THR n 
19 155  LEU n 
19 156  THR n 
19 157  ALA n 
19 158  GLU n 
19 159  GLU n 
19 160  ALA n 
19 161  GLU n 
19 162  GLU n 
19 163  GLU n 
19 164  TRP n 
19 165  GLU n 
19 166  ARG n 
19 167  ARG n 
19 168  ASN n 
19 169  LYS n 
19 170  VAL n 
19 171  LEU n 
19 172  ASN n 
19 173  HIS n 
19 174  PHE n 
19 175  SER n 
19 176  ILE n 
19 177  MET n 
19 178  GLN n 
19 179  GLN n 
19 180  ARG n 
19 181  ARG n 
19 182  LEU n 
19 183  LYS n 
19 184  ASP n 
19 185  GLN n 
19 186  ASP n 
19 187  GLN n 
19 188  ASP n 
19 189  GLU n 
19 190  ASP n 
19 191  GLU n 
19 192  GLU n 
19 193  GLU n 
19 194  LYS n 
19 195  GLU n 
19 196  LYS n 
19 197  ARG n 
19 198  GLY n 
19 199  ARG n 
19 200  ARG n 
19 201  LYS n 
19 202  ALA n 
19 203  SER n 
19 204  GLU n 
19 205  LEU n 
19 206  ARG n 
19 207  ILE n 
19 208  HIS n 
19 209  ASP n 
19 210  LEU n 
19 211  GLU n 
19 212  ASP n 
19 213  ASP n 
19 214  LEU n 
19 215  GLU n 
19 216  MET n 
19 217  SER n 
19 218  SER n 
19 219  ASP n 
19 220  ALA n 
19 221  SER n 
19 222  ASP n 
19 223  ALA n 
19 224  SER n 
19 225  GLY n 
19 226  GLU n 
19 227  GLU n 
19 228  GLY n 
19 229  GLY n 
19 230  ARG n 
19 231  VAL n 
19 232  PRO n 
19 233  LYS n 
19 234  ALA n 
19 235  LYS n 
19 236  LYS n 
19 237  LYS n 
19 238  ALA n 
19 239  PRO n 
19 240  LEU n 
19 241  ALA n 
19 242  LYS n 
19 243  GLY n 
19 244  GLY n 
19 245  ARG n 
19 246  LYS n 
19 247  LYS n 
19 248  LYS n 
19 249  LYS n 
19 250  LYS n 
19 251  LYS n 
19 252  GLY n 
19 253  SER n 
19 254  ASP n 
19 255  ASP n 
19 256  GLU n 
19 257  ALA n 
19 258  PHE n 
19 259  GLU n 
19 260  ASP n 
19 261  SER n 
19 262  ASP n 
19 263  ASP n 
19 264  GLY n 
19 265  ASP n 
19 266  PHE n 
19 267  GLU n 
19 268  GLY n 
19 269  GLN n 
19 270  GLU n 
19 271  VAL n 
19 272  ASP n 
19 273  TYR n 
19 274  MET n 
19 275  SER n 
19 276  ASP n 
19 277  GLY n 
19 278  SER n 
19 279  SER n 
19 280  SER n 
19 281  SER n 
19 282  GLN n 
19 283  GLU n 
19 284  GLU n 
19 285  PRO n 
19 286  GLU n 
19 287  SER n 
19 288  LYS n 
19 289  ALA n 
19 290  LYS n 
19 291  ALA n 
19 292  PRO n 
19 293  GLN n 
19 294  GLN n 
19 295  GLU n 
19 296  GLU n 
19 297  GLY n 
19 298  PRO n 
19 299  LYS n 
19 300  GLY n 
19 301  VAL n 
19 302  ASP n 
19 303  GLU n 
19 304  GLN n 
19 305  SER n 
19 306  ASP n 
19 307  SER n 
19 308  SER n 
19 309  GLU n 
19 310  GLU n 
19 311  SER n 
19 312  GLU n 
19 313  GLU n 
19 314  GLU n 
19 315  LYS n 
19 316  PRO n 
19 317  PRO n 
19 318  GLU n 
19 319  GLU n 
19 320  ASP n 
19 321  LYS n 
19 322  GLU n 
19 323  GLU n 
19 324  GLU n 
19 325  GLU n 
19 326  GLU n 
19 327  LYS n 
19 328  LYS n 
19 329  ALA n 
19 330  PRO n 
19 331  THR n 
19 332  PRO n 
19 333  GLN n 
19 334  GLU n 
19 335  LYS n 
19 336  LYS n 
19 337  ARG n 
19 338  ARG n 
19 339  LYS n 
19 340  ASP n 
19 341  SER n 
19 342  SER n 
19 343  GLU n 
19 344  GLU n 
19 345  SER n 
19 346  ASP n 
19 347  SER n 
19 348  SER n 
19 349  GLU n 
19 350  GLU n 
19 351  SER n 
19 352  ASP n 
19 353  ILE n 
19 354  ASP n 
19 355  SER n 
19 356  GLU n 
19 357  ALA n 
19 358  SER n 
19 359  SER n 
19 360  ALA n 
19 361  LEU n 
19 362  PHE n 
19 363  MET n 
19 364  ALA n 
19 365  LYS n 
19 366  LYS n 
19 367  LYS n 
19 368  THR n 
19 369  PRO n 
19 370  PRO n 
19 371  LYS n 
19 372  ARG n 
19 373  GLU n 
19 374  ARG n 
19 375  LYS n 
19 376  PRO n 
19 377  SER n 
19 378  GLY n 
19 379  GLY n 
19 380  SER n 
19 381  SER n 
19 382  ARG n 
19 383  GLY n 
19 384  ASN n 
19 385  SER n 
19 386  ARG n 
19 387  PRO n 
19 388  GLY n 
19 389  THR n 
19 390  PRO n 
19 391  SER n 
19 392  ALA n 
19 393  GLU n 
19 394  GLY n 
19 395  GLY n 
19 396  SER n 
19 397  THR n 
19 398  SER n 
19 399  SER n 
19 400  THR n 
19 401  LEU n 
19 402  ARG n 
19 403  ALA n 
19 404  ALA n 
19 405  ALA n 
19 406  SER n 
19 407  LYS n 
19 408  LEU n 
19 409  GLU n 
19 410  GLN n 
19 411  GLY n 
19 412  LYS n 
19 413  ARG n 
19 414  VAL n 
19 415  SER n 
19 416  GLU n 
19 417  MET n 
19 418  PRO n 
19 419  ALA n 
19 420  ALA n 
19 421  LYS n 
19 422  ARG n 
19 423  LEU n 
19 424  ARG n 
19 425  LEU n 
19 426  ASP n 
19 427  THR n 
19 428  GLY n 
19 429  PRO n 
19 430  GLN n 
19 431  SER n 
19 432  LEU n 
19 433  SER n 
19 434  GLY n 
19 435  LYS n 
19 436  SER n 
19 437  THR n 
19 438  PRO n 
19 439  GLN n 
19 440  PRO n 
19 441  PRO n 
19 442  SER n 
19 443  GLY n 
19 444  LYS n 
19 445  THR n 
19 446  THR n 
19 447  PRO n 
19 448  ASN n 
19 449  SER n 
19 450  GLY n 
19 451  ASP n 
19 452  VAL n 
19 453  GLN n 
19 454  VAL n 
19 455  THR n 
19 456  GLU n 
19 457  ASP n 
19 458  ALA n 
19 459  VAL n 
19 460  ARG n 
19 461  ARG n 
19 462  TYR n 
19 463  LEU n 
19 464  THR n 
19 465  ARG n 
19 466  LYS n 
19 467  PRO n 
19 468  MET n 
19 469  THR n 
19 470  THR n 
19 471  LYS n 
19 472  ASP n 
19 473  LEU n 
19 474  LEU n 
19 475  LYS n 
19 476  LYS n 
19 477  PHE n 
19 478  GLN n 
19 479  THR n 
19 480  LYS n 
19 481  LYS n 
19 482  THR n 
19 483  GLY n 
19 484  LEU n 
19 485  SER n 
19 486  SER n 
19 487  GLU n 
19 488  GLN n 
19 489  THR n 
19 490  VAL n 
19 491  ASN n 
19 492  VAL n 
19 493  LEU n 
19 494  ALA n 
19 495  GLN n 
19 496  ILE n 
19 497  LEU n 
19 498  LYS n 
19 499  ARG n 
19 500  LEU n 
19 501  ASN n 
19 502  PRO n 
19 503  GLU n 
19 504  ARG n 
19 505  LYS n 
19 506  MET n 
19 507  ILE n 
19 508  ASN n 
19 509  ASP n 
19 510  LYS n 
19 511  MET n 
19 512  HIS n 
19 513  PHE n 
19 514  SER n 
19 515  LEU n 
19 516  LYS n 
19 517  GLU n 
20 1    MET n 
20 2    ALA n 
20 3    GLU n 
20 4    ARG n 
20 5    GLY n 
20 6    GLU n 
20 7    LEU n 
20 8    ASP n 
20 9    LEU n 
20 10   THR n 
20 11   GLY n 
20 12   ALA n 
20 13   LYS n 
20 14   GLN n 
20 15   ASN n 
20 16   THR n 
20 17   GLY n 
20 18   VAL n 
20 19   TRP n 
20 20   LEU n 
20 21   VAL n 
20 22   LYS n 
20 23   VAL n 
20 24   PRO n 
20 25   LYS n 
20 26   TYR n 
20 27   LEU n 
20 28   SER n 
20 29   GLN n 
20 30   GLN n 
20 31   TRP n 
20 32   ALA n 
20 33   LYS n 
20 34   ALA n 
20 35   SER n 
20 36   GLY n 
20 37   ARG n 
20 38   GLY n 
20 39   GLU n 
20 40   VAL n 
20 41   GLY n 
20 42   LYS n 
20 43   LEU n 
20 44   ARG n 
20 45   ILE n 
20 46   ALA n 
20 47   LYS n 
20 48   THR n 
20 49   GLN n 
20 50   GLY n 
20 51   ARG n 
20 52   THR n 
20 53   GLU n 
20 54   VAL n 
20 55   SER n 
20 56   PHE n 
20 57   THR n 
20 58   LEU n 
20 59   ASN n 
20 60   GLU n 
20 61   ASP n 
20 62   LEU n 
20 63   ALA n 
20 64   ASN n 
20 65   ILE n 
20 66   HIS n 
20 67   ASP n 
20 68   ILE n 
20 69   GLY n 
20 70   GLY n 
20 71   LYS n 
20 72   PRO n 
20 73   ALA n 
20 74   SER n 
20 75   VAL n 
20 76   SER n 
20 77   ALA n 
20 78   PRO n 
20 79   ARG n 
20 80   GLU n 
20 81   HIS n 
20 82   PRO n 
20 83   PHE n 
20 84   VAL n 
20 85   LEU n 
20 86   GLN n 
20 87   SER n 
20 88   VAL n 
20 89   GLY n 
20 90   GLY n 
20 91   GLN n 
20 92   THR n 
20 93   LEU n 
20 94   THR n 
20 95   VAL n 
20 96   PHE n 
20 97   THR n 
20 98   GLU n 
20 99   SER n 
20 100  SER n 
20 101  SER n 
20 102  ASP n 
20 103  LYS n 
20 104  LEU n 
20 105  SER n 
20 106  LEU n 
20 107  GLU n 
20 108  GLY n 
20 109  ILE n 
20 110  VAL n 
20 111  VAL n 
20 112  GLN n 
20 113  ARG n 
20 114  ALA n 
20 115  GLU n 
20 116  CYS n 
20 117  ARG n 
20 118  PRO n 
20 119  ALA n 
20 120  ALA n 
20 121  SER n 
20 122  GLU n 
20 123  ASN n 
20 124  TYR n 
20 125  MET n 
20 126  ARG n 
20 127  LEU n 
20 128  LYS n 
20 129  ARG n 
20 130  LEU n 
20 131  GLN n 
20 132  ILE n 
20 133  GLU n 
20 134  GLU n 
20 135  SER n 
20 136  SER n 
20 137  LYS n 
20 138  PRO n 
20 139  VAL n 
20 140  ARG n 
20 141  LEU n 
20 142  SER n 
20 143  GLN n 
20 144  GLN n 
20 145  LEU n 
20 146  ASP n 
20 147  LYS n 
20 148  VAL n 
20 149  VAL n 
20 150  THR n 
20 151  THR n 
20 152  ASN n 
20 153  TYR n 
20 154  LYS n 
20 155  PRO n 
20 156  VAL n 
20 157  ALA n 
20 158  ASN n 
20 159  HIS n 
20 160  GLN n 
20 161  TYR n 
20 162  ASN n 
20 163  ILE n 
20 164  GLU n 
20 165  TYR n 
20 166  GLU n 
20 167  ARG n 
20 168  LYS n 
20 169  LYS n 
20 170  LYS n 
20 171  GLU n 
20 172  ASP n 
20 173  GLY n 
20 174  LYS n 
20 175  ARG n 
20 176  ALA n 
20 177  ARG n 
20 178  ALA n 
20 179  ASP n 
20 180  LYS n 
20 181  GLN n 
20 182  HIS n 
20 183  VAL n 
20 184  LEU n 
20 185  ASP n 
20 186  MET n 
20 187  LEU n 
20 188  PHE n 
20 189  SER n 
20 190  ALA n 
20 191  PHE n 
20 192  GLU n 
20 193  LYS n 
20 194  HIS n 
20 195  GLN n 
20 196  TYR n 
20 197  TYR n 
20 198  ASN n 
20 199  LEU n 
20 200  LYS n 
20 201  ASP n 
20 202  LEU n 
20 203  VAL n 
20 204  ASP n 
20 205  ILE n 
20 206  THR n 
20 207  LYS n 
20 208  GLN n 
20 209  PRO n 
20 210  VAL n 
20 211  VAL n 
20 212  TYR n 
20 213  LEU n 
20 214  LYS n 
20 215  GLU n 
20 216  ILE n 
20 217  LEU n 
20 218  LYS n 
20 219  GLU n 
20 220  ILE n 
20 221  GLY n 
20 222  VAL n 
20 223  GLN n 
20 224  ASN n 
20 225  VAL n 
20 226  LYS n 
20 227  GLY n 
20 228  ILE n 
20 229  HIS n 
20 230  LYS n 
20 231  ASN n 
20 232  THR n 
20 233  TRP n 
20 234  GLU n 
20 235  LEU n 
20 236  LYS n 
20 237  PRO n 
20 238  GLU n 
20 239  TYR n 
20 240  ARG n 
20 241  HIS n 
20 242  TYR n 
20 243  GLN n 
20 244  GLY n 
20 245  GLU n 
20 246  GLU n 
20 247  LYS n 
20 248  SER n 
20 249  ASP n 
21 1    MET n 
21 2    GLU n 
21 3    ASP n 
21 4    GLU n 
21 5    VAL n 
21 6    VAL n 
21 7    ARG n 
21 8    PHE n 
21 9    ALA n 
21 10   LYS n 
21 11   LYS n 
21 12   MET n 
21 13   ASP n 
21 14   LYS n 
21 15   MET n 
21 16   VAL n 
21 17   GLN n 
21 18   LYS n 
21 19   LYS n 
21 20   ASN n 
21 21   ALA n 
21 22   ALA n 
21 23   GLY n 
21 24   ALA n 
21 25   LEU n 
21 26   ASP n 
21 27   LEU n 
21 28   LEU n 
21 29   LYS n 
21 30   GLU n 
21 31   LEU n 
21 32   LYS n 
21 33   ASN n 
21 34   ILE n 
21 35   PRO n 
21 36   MET n 
21 37   THR n 
21 38   LEU n 
21 39   GLU n 
21 40   LEU n 
21 41   LEU n 
21 42   GLN n 
21 43   SER n 
21 44   THR n 
21 45   ARG n 
21 46   ILE n 
21 47   GLY n 
21 48   MET n 
21 49   SER n 
21 50   VAL n 
21 51   ASN n 
21 52   ALA n 
21 53   ILE n 
21 54   ARG n 
21 55   LYS n 
21 56   GLN n 
21 57   SER n 
21 58   THR n 
21 59   ASP n 
21 60   GLU n 
21 61   GLU n 
21 62   VAL n 
21 63   THR n 
21 64   SER n 
21 65   LEU n 
21 66   ALA n 
21 67   LYS n 
21 68   SER n 
21 69   LEU n 
21 70   ILE n 
21 71   LYS n 
21 72   SER n 
21 73   TRP n 
21 74   LYS n 
21 75   LYS n 
21 76   LEU n 
21 77   LEU n 
21 78   ASP n 
21 79   GLY n 
21 80   PRO n 
21 81   SER n 
21 82   THR n 
21 83   GLU n 
21 84   LYS n 
21 85   ASP n 
21 86   LEU n 
21 87   ASP n 
21 88   GLU n 
21 89   LYS n 
21 90   LYS n 
21 91   LYS n 
21 92   GLU n 
21 93   PRO n 
21 94   ALA n 
21 95   ILE n 
21 96   THR n 
21 97   SER n 
21 98   GLN n 
21 99   ASN n 
21 100  SER n 
21 101  PRO n 
21 102  GLU n 
21 103  ALA n 
21 104  ARG n 
21 105  GLU n 
21 106  GLU n 
21 107  SER n 
21 108  THR n 
21 109  SER n 
21 110  SER n 
21 111  GLY n 
21 112  ASN n 
21 113  VAL n 
21 114  SER n 
21 115  ASN n 
21 116  ARG n 
21 117  LYS n 
21 118  ASP n 
21 119  GLU n 
21 120  THR n 
21 121  ASN n 
21 122  ALA n 
21 123  ARG n 
21 124  ASP n 
21 125  THR n 
21 126  TYR n 
21 127  VAL n 
21 128  SER n 
21 129  SER n 
21 130  PHE n 
21 131  PRO n 
21 132  ARG n 
21 133  ALA n 
21 134  PRO n 
21 135  SER n 
21 136  THR n 
21 137  SER n 
21 138  ASP n 
21 139  SER n 
21 140  VAL n 
21 141  ARG n 
21 142  LEU n 
21 143  LYS n 
21 144  CYS n 
21 145  ARG n 
21 146  GLU n 
21 147  MET n 
21 148  LEU n 
21 149  ALA n 
21 150  ALA n 
21 151  ALA n 
21 152  LEU n 
21 153  ARG n 
21 154  THR n 
21 155  GLY n 
21 156  ASP n 
21 157  ASP n 
21 158  TYR n 
21 159  ILE n 
21 160  ALA n 
21 161  ILE n 
21 162  GLY n 
21 163  ALA n 
21 164  ASP n 
21 165  GLU n 
21 166  GLU n 
21 167  GLU n 
21 168  LEU n 
21 169  GLY n 
21 170  SER n 
21 171  GLN n 
21 172  ILE n 
21 173  GLU n 
21 174  GLU n 
21 175  ALA n 
21 176  ILE n 
21 177  TYR n 
21 178  GLN n 
21 179  GLU n 
21 180  ILE n 
21 181  ARG n 
21 182  ASN n 
21 183  THR n 
21 184  ASP n 
21 185  MET n 
21 186  LYS n 
21 187  TYR n 
21 188  LYS n 
21 189  ASN n 
21 190  ARG n 
21 191  VAL n 
21 192  ARG n 
21 193  SER n 
21 194  ARG n 
21 195  ILE n 
21 196  SER n 
21 197  ASN n 
21 198  LEU n 
21 199  LYS n 
21 200  ASP n 
21 201  ALA n 
21 202  LYS n 
21 203  ASN n 
21 204  PRO n 
21 205  ASN n 
21 206  LEU n 
21 207  ARG n 
21 208  LYS n 
21 209  ASN n 
21 210  VAL n 
21 211  LEU n 
21 212  CYS n 
21 213  GLY n 
21 214  ASN n 
21 215  ILE n 
21 216  PRO n 
21 217  PRO n 
21 218  ASP n 
21 219  LEU n 
21 220  PHE n 
21 221  ALA n 
21 222  ARG n 
21 223  MET n 
21 224  THR n 
21 225  ALA n 
21 226  GLU n 
21 227  GLU n 
21 228  MET n 
21 229  ALA n 
21 230  SER n 
21 231  ASP n 
21 232  GLU n 
21 233  LEU n 
21 234  LYS n 
21 235  GLU n 
21 236  MET n 
21 237  ARG n 
21 238  LYS n 
21 239  ASN n 
21 240  LEU n 
21 241  THR n 
21 242  LYS n 
21 243  GLU n 
21 244  ALA n 
21 245  ILE n 
21 246  ARG n 
21 247  GLU n 
21 248  HIS n 
21 249  GLN n 
21 250  MET n 
21 251  ALA n 
21 252  LYS n 
21 253  THR n 
21 254  GLY n 
21 255  GLY n 
21 256  THR n 
21 257  GLN n 
21 258  THR n 
21 259  ASP n 
21 260  LEU n 
21 261  PHE n 
21 262  THR n 
21 263  CYS n 
21 264  GLY n 
21 265  LYS n 
21 266  CYS n 
21 267  LYS n 
21 268  LYS n 
21 269  LYS n 
21 270  ASN n 
21 271  CYS n 
21 272  THR n 
21 273  TYR n 
21 274  THR n 
21 275  GLN n 
21 276  VAL n 
21 277  GLN n 
21 278  THR n 
21 279  ARG n 
21 280  SER n 
21 281  ALA n 
21 282  ASP n 
21 283  GLU n 
21 284  PRO n 
21 285  MET n 
21 286  THR n 
21 287  THR n 
21 288  PHE n 
21 289  VAL n 
21 290  VAL n 
21 291  CYS n 
21 292  ASN n 
21 293  GLU n 
21 294  CYS n 
21 295  GLY n 
21 296  ASN n 
21 297  ARG n 
21 298  TRP n 
21 299  LYS n 
21 300  PHE n 
21 301  CYS n 
22 1    DG  n 
22 2    DA  n 
22 3    DA  n 
22 4    DG  n 
22 5    DG  n 
22 6    DG  n 
22 7    DC  n 
22 8    DG  n 
22 9    DC  n 
22 10   DC  n 
22 11   DT  n 
22 12   DA  n 
22 13   DT  n 
22 14   DA  n 
22 15   DA  n 
22 16   DA  n 
22 17   DA  n 
22 18   DG  n 
22 19   DG  n 
22 20   DG  n 
22 21   DG  n 
22 22   DG  n 
22 23   DT  n 
22 24   DG  n 
22 25   DG  n 
22 26   DG  n 
22 27   DG  n 
22 28   DG  n 
22 29   DC  n 
22 30   DG  n 
22 31   DC  n 
22 32   DG  n 
22 33   DA  n 
22 34   DA  n 
22 35   DT  n 
22 36   DT  n 
22 37   DT  n 
22 38   DT  n 
22 39   DT  n 
22 40   DT  n 
22 41   DT  n 
22 42   DT  n 
22 43   DT  n 
22 44   DT  n 
22 45   DC  n 
22 46   DG  n 
22 47   DC  n 
22 48   DG  n 
22 49   DA  n 
22 50   DT  n 
22 51   DC  n 
22 52   DG  n 
22 53   DA  n 
22 54   DA  n 
22 55   DC  n 
22 56   DA  n 
22 57   DC  n 
22 58   DT  n 
22 59   DC  n 
22 60   DG  n 
22 61   DA  n 
22 62   DG  n 
22 63   DC  n 
22 64   DC  n 
22 65   DG  n 
22 66   DA  n 
22 67   DG  n 
22 68   DC  n 
22 69   DA  n 
22 70   DG  n 
22 71   DA  n 
22 72   DC  n 
22 73   DG  n 
22 74   DT  n 
22 75   DG  n 
23 1    DC  n 
23 2    DA  n 
23 3    DC  n 
23 4    DG  n 
23 5    DT  n 
23 6    DC  n 
23 7    DT  n 
23 8    DG  n 
23 9    DC  n 
23 10   DT  n 
23 11   DC  n 
23 12   DG  n 
23 13   DG  n 
23 14   DC  n 
23 15   DT  n 
23 16   DC  n 
23 17   DG  n 
23 18   DA  n 
23 19   DG  n 
23 20   DT  n 
23 21   DG  n 
23 22   DT  n 
23 23   DT  n 
23 24   DC  n 
23 25   DG  n 
23 26   DA  n 
23 27   DT  n 
23 28   DC  n 
23 29   DG  n 
23 30   DC  n 
23 31   DG  n 
23 32   DA  n 
23 33   DC  n 
23 34   DT  n 
23 35   DG  n 
23 36   DA  n 
23 37   DG  n 
23 38   DG  n 
23 39   DA  n 
23 40   DC  n 
23 41   DG  n 
23 42   DA  n 
23 43   DA  n 
23 44   DC  n 
23 45   DG  n 
23 46   DC  n 
23 47   DG  n 
23 48   DC  n 
23 49   DC  n 
23 50   DC  n 
23 51   DC  n 
23 52   DC  n 
23 53   DA  n 
23 54   DC  n 
23 55   DC  n 
23 56   DC  n 
23 57   DC  n 
23 58   DC  n 
23 59   DT  n 
23 60   DT  n 
23 61   DT  n 
23 62   DT  n 
23 63   DA  n 
23 64   DT  n 
23 65   DA  n 
23 66   DG  n 
23 67   DG  n 
23 68   DC  n 
23 69   DG  n 
23 70   DC  n 
23 71   DC  n 
23 72   DC  n 
23 73   DT  n 
23 74   DT  n 
23 75   DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
13 1 sample 'Biological sequence' 1 316 Human ? 'GTF2B, TF2B, TFIIB'       ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample 'Biological sequence' 1 376 Human ? 'GTF2A1, TF2A1'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample 'Biological sequence' 1 109 Human ? 'GTF2A2, TF2A2'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample 'Biological sequence' 1 339 Human ? 'TBP, GTF2D1, TF2D, TFIID' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample 'Biological sequence' 1 439 Human ? 'GTF2E1, TF2E1'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample 'Biological sequence' 1 291 Human ? 'GTF2E2, TF2E2'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample 'Biological sequence' 1 517 Human ? 'GTF2F1, RAP74'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample 'Biological sequence' 1 249 Human ? 'GTF2F2, RAP30'            ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample 'Biological sequence' 1 301 Human ? 'TCEA1, GTF2S, TFIIS'      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 1970 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 1 1174 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1 275  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1 142  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 210  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 127  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 172  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 150  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1 125  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 67   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 117  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 58   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
22 1 sample 1 75 'Homo sapiens' Human 9606 ? 
23 1 sample 1 75 'Homo sapiens' Human 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP RPB1_HUMAN  P24928 ? 1  
;MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTE
CPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEM
DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDN
ELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNID
RLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEV
MNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGIL
CKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPF
GFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVR
NSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLL
FNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLG
VPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMD
DDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSN
DIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPW
NQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAY
EPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSP
SYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYT
PTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN
;
1 
2  UNP RPB2_HUMAN  P30876 ? 2  
;MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEE
PPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTY
CLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNF
IGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLL
AFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAA
IADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHI
DQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSA
VDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDEL
ESTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQ
IFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCN
LCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV
;
1 
3  UNP RPB3_HUMAN  P19387 ? 3  
;MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLISDDIVD
KLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELR
LRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
;
1 
4  UNP RPB4_HUMAN  O15514 ? 4  
;MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETI
ASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
;
1 
5  UNP RPAB1_HUMAN P19388 ? 5  
;MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEP
KVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELL
ARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
;
1 
6  UNP RPAB2_HUMAN P61218 ? 6  
;MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVM
VELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
;
1 
7  UNP RPB7_HUMAN  P62487 ? 7  
;MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPF
KGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAI
GSLMDDYLGLVS
;
1 
8  UNP RPAB3_HUMAN P52434 ? 8  
;MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDD
RPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
;
1 
9  UNP RPB9_HUMAN  P36954 ? 9  
;MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPR
TEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE
;
1 
10 UNP RPAB5_HUMAN P62875 ? 10 MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK 1 
11 UNP RPB11_HUMAN P52435 ? 11 
;MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPD
YSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
;
1 
12 UNP RPAB4_HUMAN P53803 ? 12 MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR 1 
13 UNP TF2B_HUMAN  Q00403 ? 13 
;MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDL
STMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIA
SACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL
;
1 
14 UNP TF2AA_HUMAN P52655 ? 14 
;MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQ
HHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSG
QLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTV
AAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDV
SDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
;
1 
15 UNP T2AG_HUMAN  P52657 ? 15 
;MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVE
FREVTELIKVDKVKIVACDGKNTGSNTTE
;
1 
16 UNP TBP_HUMAN   P20226 ? 16 
;MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSG
IVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV
VQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAE
IYEAFENIYPILKGFRKTT
;
1 
17 UNP T2EA_HUMAN  P29083 ? 17 
;MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVET
AADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTE
VEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDHAATTAGAASLAGGHHREAWA
TKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIWLRESTVQGAYGSEDMKEGGIDMDAFQEREEGHAGPDDNEE
VMRALLIHEKKTSSAMAGSVGAAAPVTAANGSDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAG
RPFSYSEVSQRPELVAQMTPEEKEAYIAMGQRMFEDLFE
;
1 
18 UNP T2EB_HUMAN  P29084 ? 18 
;MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAK
IVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVRDKKALLRLLDQHDQ
RGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQ
GISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK
;
1 
19 UNP T2FA_HUMAN  P35269 ? 19 
;MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEAR
RKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEA
EEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPL
AKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEED
KEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSST
LRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTK
KTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
;
1 
20 UNP T2FB_HUMAN  P13984 ? 20 
;MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPRE
HPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQ
YNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYR
HYQGEEKSD
;
1 
21 UNP TCEA1_HUMAN P23193 ? 21 
;MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGP
STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIA
IGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL
TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC
;
1 
22 PDB 5IYB        5IYB   ? 22 ? 1 
23 PDB 5IYB        5IYB   ? 23 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  5IYB A 1 ? 1970 ? P24928 1  ? 1970 ? 1  1970 
2  2  5IYB B 1 ? 1174 ? P30876 1  ? 1174 ? 1  1174 
3  3  5IYB C 1 ? 275  ? P19387 1  ? 275  ? 1  275  
4  4  5IYB D 1 ? 142  ? O15514 1  ? 142  ? 1  142  
5  5  5IYB E 1 ? 210  ? P19388 1  ? 210  ? 1  210  
6  6  5IYB F 1 ? 127  ? P61218 1  ? 127  ? 1  127  
7  7  5IYB G 1 ? 172  ? P62487 1  ? 172  ? 1  172  
8  8  5IYB H 1 ? 150  ? P52434 1  ? 150  ? 1  150  
9  9  5IYB I 1 ? 125  ? P36954 1  ? 125  ? 1  125  
10 10 5IYB J 1 ? 67   ? P62875 1  ? 67   ? 1  67   
11 11 5IYB K 1 ? 117  ? P52435 1  ? 117  ? 1  117  
12 12 5IYB L 1 ? 58   ? P53803 1  ? 58   ? 1  58   
13 13 5IYB M 1 ? 316  ? Q00403 1  ? 316  ? 1  316  
14 14 5IYB N 1 ? 376  ? P52655 1  ? 376  ? 1  376  
15 15 5IYB O 1 ? 109  ? P52657 1  ? 109  ? 1  109  
16 16 5IYB P 1 ? 339  ? P20226 1  ? 339  ? 1  339  
17 17 5IYB Q 1 ? 439  ? P29083 1  ? 439  ? 1  439  
18 18 5IYB R 1 ? 291  ? P29084 1  ? 291  ? 1  291  
19 19 5IYB S 1 ? 517  ? P35269 1  ? 517  ? 1  517  
20 20 5IYB T 1 ? 249  ? P13984 1  ? 249  ? 1  249  
21 21 5IYB U 1 ? 301  ? P23193 1  ? 301  ? 1  301  
22 22 5IYB X 1 ? 75   ? 5IYB   0  ? 74   ? 0  74   
23 23 5IYB Y 1 ? 75   ? 5IYB   19 ? 93   ? 19 93   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5IYB 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5IYB 
_struct.title                        'Human core-PIC in the open state' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase II subunit RPB1, DNA-directed RNA polymerase II subunit RPB2, DNA-directed RNA polymerase II subunit RPB3, DNA-directed RNA polymerase II subunit RPB4, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerase II subunit RPB7, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase II subunit RPB9, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerase II subunit RPB11-a, DNA-directed RNA polymerases I, II, and III subunit RPABC4, Transcription initiation factor IIB, Transcription initiation factor IIA subunit 1, Transcription initiation factor IIA subunit 2, TATA-box-binding protein, General transcription factor IIE subunit 1, Transcription initiation factor IIE subunit beta, General transcription factor IIF subunit 1, General transcription factor IIF subunit 2, Transcription elongation factor A protein 1/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        5IYB 
_struct_keywords.text            'initiation, RNA polymerase II, human, TRANSCRIPTION, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION, TRANSFERASE/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 25 ? 
AA N N 25 ? 
BA N N 25 ? 
CA N N 25 ? 
DA N N 25 ? 
EA N N 25 ? 
FA N N 25 ? 
GA N N 25 ? 
HA N N 25 ? 
IA N N 24 ? 
JA N N 25 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER A 27   ? SER A 35   ? SER A 27   SER A 35   1 ? 9  
HELX_P HELX_P2   AA2 PHE A 99   ? VAL A 110  ? PHE A 99   VAL A 110  1 ? 12 
HELX_P HELX_P3   AA3 ASN A 123  ? LYS A 132  ? ASN A 123  LYS A 132  1 ? 10 
HELX_P HELX_P4   AA4 GLN A 136  ? LYS A 151  ? GLN A 136  LYS A 151  1 ? 16 
HELX_P HELX_P5   AA5 SER A 217  ? ARG A 227  ? SER A 217  ARG A 227  1 ? 11 
HELX_P HELX_P6   AA6 SER A 229  ? LEU A 236  ? SER A 229  LEU A 236  1 ? 8  
HELX_P HELX_P7   AA7 ARG A 244  ? TRP A 247  ? ARG A 244  TRP A 247  5 ? 4  
HELX_P HELX_P8   AA8 ASP A 274  ? ASN A 296  ? ASP A 274  ASN A 296  1 ? 23 
HELX_P HELX_P9   AA9 ALA A 300  ? ASP A 319  ? ALA A 300  ASP A 319  1 ? 20 
HELX_P HELX_P10  AB1 SER A 338  ? LYS A 344  ? SER A 338  LYS A 344  1 ? 7  
HELX_P HELX_P11  AB2 ARG A 382  ? MET A 388  ? ARG A 382  MET A 388  1 ? 7  
HELX_P HELX_P12  AB3 ASN A 398  ? ARG A 408  ? ASN A 398  ARG A 408  1 ? 11 
HELX_P HELX_P13  AB4 LYS A 434  ? LEU A 438  ? LYS A 434  LEU A 438  5 ? 5  
HELX_P HELX_P14  AB5 HIS A 465  ? MET A 467  ? HIS A 465  MET A 467  5 ? 3  
HELX_P HELX_P15  AB6 VAL A 488  ? ASN A 493  ? VAL A 488  ASN A 493  1 ? 6  
HELX_P HELX_P16  AB7 SER A 508  ? LEU A 518  ? SER A 508  LEU A 518  1 ? 11 
HELX_P HELX_P17  AB8 MET A 520  ? ILE A 525  ? MET A 520  ILE A 525  5 ? 6  
HELX_P HELX_P18  AB9 VAL A 538  ? LYS A 550  ? VAL A 538  LYS A 550  1 ? 13 
HELX_P HELX_P19  AC1 GLU A 556  ? LEU A 567  ? GLU A 556  LEU A 567  1 ? 12 
HELX_P HELX_P20  AC2 GLY A 588  ? ILE A 596  ? GLY A 588  ILE A 596  1 ? 9  
HELX_P HELX_P21  AC3 CYS A 641  ? GLY A 646  ? CYS A 641  GLY A 646  1 ? 6  
HELX_P HELX_P22  AC4 SER A 651  ? MET A 660  ? SER A 651  MET A 660  1 ? 10 
HELX_P HELX_P23  AC5 GLY A 661  ? GLY A 684  ? GLY A 661  GLY A 684  1 ? 24 
HELX_P HELX_P24  AC6 ASP A 695  ? ASN A 722  ? ASP A 695  ASN A 722  1 ? 28 
HELX_P HELX_P25  AC7 THR A 732  ? LEU A 760  ? THR A 732  LEU A 760  1 ? 29 
HELX_P HELX_P26  AC8 ASN A 764  ? SER A 772  ? ASN A 764  SER A 772  1 ? 9  
HELX_P HELX_P27  AC9 SER A 777  ? ALA A 786  ? SER A 777  ALA A 786  1 ? 10 
HELX_P HELX_P28  AD1 PRO A 817  ? ARG A 820  ? PRO A 817  ARG A 820  5 ? 4  
HELX_P HELX_P29  AD2 THR A 832  ? GLU A 869  ? THR A 832  GLU A 869  1 ? 38 
HELX_P HELX_P30  AD3 ARG A 890  ? ASP A 894  ? ARG A 890  ASP A 894  5 ? 5  
HELX_P HELX_P31  AD4 ALA A 907  ? LYS A 910  ? ALA A 907  LYS A 910  5 ? 4  
HELX_P HELX_P32  AD5 SER A 912  ? ARG A 921  ? SER A 912  ARG A 921  1 ? 10 
HELX_P HELX_P33  AD6 LEU A 938  ? LEU A 943  ? LEU A 938  LEU A 943  1 ? 6  
HELX_P HELX_P34  AD7 ASN A 945  ? PHE A 970  ? ASN A 945  PHE A 970  1 ? 26 
HELX_P HELX_P35  AD8 ASN A 982  ? HIS A 995  ? ASN A 982  HIS A 995  1 ? 14 
HELX_P HELX_P36  AD9 HIS A 1005 ? LEU A 1020 ? HIS A 1005 LEU A 1020 1 ? 16 
HELX_P HELX_P37  AE1 ASP A 1027 ? ALA A 1037 ? ASP A 1027 ALA A 1037 1 ? 11 
HELX_P HELX_P38  AE2 THR A 1038 ? LEU A 1049 ? THR A 1038 LEU A 1049 1 ? 12 
HELX_P HELX_P39  AE3 CYS A 1050 ? GLU A 1057 ? CYS A 1050 GLU A 1057 1 ? 8  
HELX_P HELX_P40  AE4 SER A 1061 ? ILE A 1080 ? SER A 1061 ILE A 1080 1 ? 20 
HELX_P HELX_P41  AE5 MET A 1086 ? THR A 1100 ? MET A 1086 THR A 1100 1 ? 15 
HELX_P HELX_P42  AE6 GLY A 1120 ? ASN A 1129 ? GLY A 1120 ASN A 1129 1 ? 10 
HELX_P HELX_P43  AE7 LEU A 1144 ? ARG A 1149 ? LEU A 1144 ARG A 1149 5 ? 6  
HELX_P HELX_P44  AE8 ASP A 1150 ? GLU A 1162 ? ASP A 1150 GLU A 1162 1 ? 13 
HELX_P HELX_P45  AE9 THR A 1165 ? VAL A 1169 ? THR A 1165 VAL A 1169 1 ? 5  
HELX_P HELX_P46  AF1 ASN A 1180 ? THR A 1184 ? ASN A 1180 THR A 1184 5 ? 5  
HELX_P HELX_P47  AF2 VAL A 1186 ? GLU A 1188 ? VAL A 1186 GLU A 1188 5 ? 3  
HELX_P HELX_P48  AF3 ASP A 1189 ? TYR A 1196 ? ASP A 1189 TYR A 1196 1 ? 8  
HELX_P HELX_P49  AF4 PHE A 1202 ? ARG A 1206 ? PHE A 1202 ARG A 1206 5 ? 5  
HELX_P HELX_P50  AF5 ASP A 1217 ? ARG A 1224 ? ASP A 1217 ARG A 1224 1 ? 8  
HELX_P HELX_P51  AF6 THR A 1227 ? GLY A 1240 ? THR A 1227 GLY A 1240 1 ? 14 
HELX_P HELX_P52  AF7 SER A 1264 ? LYS A 1268 ? SER A 1264 LYS A 1268 5 ? 5  
HELX_P HELX_P53  AF8 ASP A 1280 ? MET A 1296 ? ASP A 1280 MET A 1296 1 ? 17 
HELX_P HELX_P54  AF9 SER A 1342 ? GLU A 1349 ? SER A 1342 GLU A 1349 1 ? 8  
HELX_P HELX_P55  AG1 ILE A 1362 ? GLY A 1370 ? ILE A 1362 GLY A 1370 1 ? 9  
HELX_P HELX_P56  AG2 GLY A 1370 ? ASP A 1389 ? GLY A 1370 ASP A 1389 1 ? 20 
HELX_P HELX_P57  AG3 ASN A 1394 ? CYS A 1407 ? ASN A 1394 CYS A 1407 1 ? 14 
HELX_P HELX_P58  AG4 GLY A 1418 ? GLN A 1422 ? GLY A 1418 GLN A 1422 5 ? 5  
HELX_P HELX_P59  AG5 GLY A 1425 ? SER A 1431 ? GLY A 1425 SER A 1431 1 ? 7  
HELX_P HELX_P60  AG6 THR A 1435 ? GLY A 1446 ? THR A 1435 GLY A 1446 1 ? 12 
HELX_P HELX_P61  AG7 GLY A 1453 ? GLY A 1461 ? GLY A 1453 GLY A 1461 1 ? 9  
HELX_P HELX_P62  AG8 GLY A 1467 ? PHE A 1471 ? GLY A 1467 PHE A 1471 5 ? 5  
HELX_P HELX_P63  AG9 ASP A 1476 ? MET A 1484 ? ASP A 1476 MET A 1484 1 ? 9  
HELX_P HELX_P64  AH1 TRP B 22   ? GLU B 24   ? TRP B 22   GLU B 24   5 ? 3  
HELX_P HELX_P65  AH2 ALA B 25   ? LYS B 37   ? ALA B 25   LYS B 37   1 ? 13 
HELX_P HELX_P66  AH3 VAL B 40   ? MET B 53   ? VAL B 40   MET B 53   1 ? 14 
HELX_P HELX_P67  AH4 MET B 53   ? ASP B 61   ? MET B 53   ASP B 61   1 ? 9  
HELX_P HELX_P68  AH5 MET B 109  ? ASN B 117  ? MET B 109  ASN B 117  1 ? 9  
HELX_P HELX_P69  AH6 CYS B 161  ? LEU B 166  ? CYS B 161  LEU B 166  5 ? 6  
HELX_P HELX_P70  AH7 THR B 167  ? LEU B 174  ? THR B 167  LEU B 174  1 ? 8  
HELX_P HELX_P71  AH8 ILE B 269  ? LEU B 276  ? ILE B 269  LEU B 276  1 ? 8  
HELX_P HELX_P72  AH9 SER B 280  ? TYR B 290  ? SER B 280  TYR B 290  1 ? 11 
HELX_P HELX_P73  AI1 ASP B 294  ? PHE B 309  ? ASP B 294  PHE B 309  1 ? 16 
HELX_P HELX_P74  AI2 VAL B 310  ? GLN B 312  ? VAL B 310  GLN B 312  5 ? 3  
HELX_P HELX_P75  AI3 GLU B 313  ? ALA B 326  ? GLU B 313  ALA B 326  1 ? 14 
HELX_P HELX_P76  AI4 THR B 331  ? GLU B 346  ? THR B 331  GLU B 346  1 ? 16 
HELX_P HELX_P77  AI5 LEU B 348  ? GLY B 352  ? LEU B 348  GLY B 352  5 ? 5  
HELX_P HELX_P78  AI6 SER B 354  ? PHE B 356  ? SER B 354  PHE B 356  5 ? 3  
HELX_P HELX_P79  AI7 CYS B 357  ? LEU B 377  ? CYS B 357  LEU B 377  1 ? 21 
HELX_P HELX_P80  AI8 HIS B 387  ? GLY B 389  ? HIS B 387  GLY B 389  5 ? 3  
HELX_P HELX_P81  AI9 LEU B 395  ? GLY B 426  ? LEU B 395  GLY B 426  1 ? 32 
HELX_P HELX_P82  AJ1 LYS B 436  ? GLY B 451  ? LYS B 436  GLY B 451  1 ? 16 
HELX_P HELX_P83  AJ2 HIS B 460  ? ALA B 464  ? HIS B 460  ALA B 464  5 ? 5  
HELX_P HELX_P84  AJ3 THR B 474  ? ARG B 483  ? THR B 474  ARG B 483  1 ? 10 
HELX_P HELX_P85  AJ4 HIS B 502  ? TRP B 506  ? HIS B 502  TRP B 506  5 ? 5  
HELX_P HELX_P86  AJ5 PRO B 538  ? SER B 549  ? PRO B 538  SER B 549  1 ? 12 
HELX_P HELX_P87  AJ6 GLU B 554  ? ILE B 556  ? GLU B 554  ILE B 556  5 ? 3  
HELX_P HELX_P88  AJ7 SER B 557  ? ILE B 561  ? SER B 557  ILE B 561  5 ? 5  
HELX_P HELX_P89  AJ8 ASP B 579  ? GLN B 593  ? ASP B 579  GLN B 593  1 ? 15 
HELX_P HELX_P90  AJ9 ILE B 597  ? VAL B 601  ? ILE B 597  VAL B 601  5 ? 5  
HELX_P HELX_P91  AK1 ILE B 607  ? GLU B 609  ? ILE B 607  GLU B 609  5 ? 3  
HELX_P HELX_P92  AK2 LYS B 636  ? GLU B 645  ? LYS B 636  GLU B 645  1 ? 10 
HELX_P HELX_P93  AK3 ARG B 646  ? TYR B 648  ? ARG B 646  TYR B 648  5 ? 3  
HELX_P HELX_P94  AK4 SER B 652  ? SER B 659  ? SER B 652  SER B 659  1 ? 8  
HELX_P HELX_P95  AK5 THR B 667  ? GLU B 671  ? THR B 667  GLU B 671  1 ? 5  
HELX_P HELX_P96  AK6 THR B 678  ? LYS B 685  ? THR B 678  LYS B 685  1 ? 8  
HELX_P HELX_P97  AK7 HIS B 699  ? LEU B 704  ? HIS B 699  LEU B 704  5 ? 6  
HELX_P HELX_P98  AK8 VAL B 706  ? ILE B 711  ? VAL B 706  ILE B 711  1 ? 6  
HELX_P HELX_P99  AK9 PHE B 713  ? GLN B 718  ? PHE B 713  GLN B 718  5 ? 6  
HELX_P HELX_P100 AL1 SER B 719  ? ALA B 732  ? SER B 719  ALA B 732  1 ? 14 
HELX_P HELX_P101 AL2 THR B 738  ? VAL B 742  ? THR B 738  VAL B 742  5 ? 5  
HELX_P HELX_P102 AL3 THR B 761  ? LEU B 767  ? THR B 761  LEU B 767  5 ? 7  
HELX_P HELX_P103 AL4 ARG B 798  ? ARG B 803  ? ARG B 798  ARG B 803  1 ? 6  
HELX_P HELX_P104 AL5 HIS B 970  ? MET B 976  ? HIS B 970  MET B 976  1 ? 7  
HELX_P HELX_P105 AL6 ILE B 978  ? GLY B 994  ? ILE B 978  GLY B 994  1 ? 17 
HELX_P HELX_P106 AL7 VAL B 1006 ? TYR B 1018 ? VAL B 1006 TYR B 1018 1 ? 13 
HELX_P HELX_P107 AL8 MET B 1054 ? ILE B 1059 ? MET B 1054 ILE B 1059 1 ? 6  
HELX_P HELX_P108 AL9 GLY B 1077 ? ASP B 1081 ? GLY B 1077 ASP B 1081 5 ? 5  
HELX_P HELX_P109 AM1 GLY B 1087 ? GLY B 1098 ? GLY B 1087 GLY B 1098 1 ? 12 
HELX_P HELX_P110 AM2 ALA B 1099 ? LEU B 1107 ? ALA B 1099 LEU B 1107 1 ? 9  
HELX_P HELX_P111 AM3 PRO B 1152 ? SER B 1164 ? PRO B 1152 SER B 1164 1 ? 13 
HELX_P HELX_P112 AM4 ASP C 27   ? GLU C 41   ? ASP C 27   GLU C 41   1 ? 15 
HELX_P HELX_P113 AM5 HIS C 60   ? ILE C 71   ? HIS C 60   ILE C 71   1 ? 12 
HELX_P HELX_P114 AM6 ILE C 78   ? LEU C 82   ? ILE C 78   LEU C 82   5 ? 5  
HELX_P HELX_P115 AM7 LYS C 199  ? TRP C 203  ? LYS C 199  TRP C 203  5 ? 5  
HELX_P HELX_P116 AM8 ARG C 240  ? ILE C 267  ? ARG C 240  ILE C 267  1 ? 28 
HELX_P HELX_P117 AM9 ASP D 16   ? LEU D 20   ? ASP D 16   LEU D 20   5 ? 5  
HELX_P HELX_P118 AN1 LEU D 33   ? SER D 50   ? LEU D 33   SER D 50   1 ? 18 
HELX_P HELX_P119 AN2 SER D 58   ? PHE D 71   ? SER D 58   PHE D 71   1 ? 14 
HELX_P HELX_P120 AN3 ASN D 76   ? GLN D 89   ? ASN D 76   GLN D 89   1 ? 14 
HELX_P HELX_P121 AN4 HIS D 93   ? CYS D 104  ? HIS D 93   CYS D 104  1 ? 12 
HELX_P HELX_P122 AN5 THR D 107  ? ILE D 115  ? THR D 107  ILE D 115  1 ? 9  
HELX_P HELX_P123 AN6 PRO D 116  ? GLY D 120  ? PRO D 116  GLY D 120  5 ? 5  
HELX_P HELX_P124 AN7 GLU D 123  ? ARG D 138  ? GLU D 123  ARG D 138  1 ? 16 
HELX_P HELX_P125 AN8 ASP E 3    ? ARG E 24   ? ASP E 3    ARG E 24   1 ? 22 
HELX_P HELX_P126 AN9 THR E 29   ? GLN E 35   ? THR E 29   GLN E 35   1 ? 7  
HELX_P HELX_P127 AO1 THR E 36   ? SER E 44   ? THR E 36   SER E 44   1 ? 9  
HELX_P HELX_P128 AO2 GLY E 83   ? GLU E 97   ? GLY E 83   GLU E 97   1 ? 15 
HELX_P HELX_P129 AO3 THR E 111  ? ALA E 122  ? THR E 111  ALA E 122  1 ? 12 
HELX_P HELX_P130 AO4 GLN E 133  ? LEU E 136  ? GLN E 133  LEU E 136  5 ? 4  
HELX_P HELX_P131 AO5 ASN E 138  ? HIS E 142  ? ASN E 138  HIS E 142  5 ? 5  
HELX_P HELX_P132 AO6 THR E 152  ? LYS E 164  ? THR E 152  LYS E 164  1 ? 13 
HELX_P HELX_P133 AO7 ARG E 166  ? LEU E 170  ? ARG E 166  LEU E 170  5 ? 5  
HELX_P HELX_P134 AO8 ASP E 177  ? GLY E 184  ? ASP E 177  GLY E 184  1 ? 8  
HELX_P HELX_P135 AO9 THR F 58   ? MET F 75   ? THR F 58   MET F 75   1 ? 18 
HELX_P HELX_P136 AP1 ASP F 88   ? ALA F 99   ? ASP F 88   ALA F 99   1 ? 12 
HELX_P HELX_P137 AP2 HIS G 14   ? PHE G 18   ? HIS G 14   PHE G 18   5 ? 5  
HELX_P HELX_P138 AP3 ASN G 21   ? GLU G 35   ? ASN G 21   GLU G 35   1 ? 15 
HELX_P HELX_P139 AP4 HIS G 111  ? ILE G 113  ? HIS G 111  ILE G 113  5 ? 3  
HELX_P HELX_P140 AP5 ASP H 128  ? LEU H 132  ? ASP H 128  LEU H 132  5 ? 5  
HELX_P HELX_P141 AP6 ILE I 69   ? ASP I 75   ? ILE I 69   ASP I 75   5 ? 7  
HELX_P HELX_P142 AP7 LYS J 17   ? GLU J 28   ? LYS J 17   GLU J 28   1 ? 12 
HELX_P HELX_P143 AP8 THR J 30   ? GLY J 39   ? THR J 30   GLY J 39   1 ? 10 
HELX_P HELX_P144 AP9 ARG J 42   ? ALA J 51   ? ARG J 42   ALA J 51   1 ? 10 
HELX_P HELX_P145 AQ1 LEU J 55   ? TYR J 62   ? LEU J 55   TYR J 62   1 ? 8  
HELX_P HELX_P146 AQ2 PRO K 5    ? PHE K 10   ? PRO K 5    PHE K 10   5 ? 6  
HELX_P HELX_P147 AQ3 ASP K 39   ? ASP K 53   ? ASP K 39   ASP K 53   1 ? 15 
HELX_P HELX_P148 AQ4 SER K 82   ? ASP K 111  ? SER K 82   ASP K 111  1 ? 30 
HELX_P HELX_P149 AQ5 TYR M 27   ? GLY M 30   ? TYR M 27   GLY M 30   5 ? 4  
HELX_P HELX_P150 AQ6 ASP M 47   ? PHE M 55   ? ASP M 47   PHE M 55   5 ? 9  
HELX_P HELX_P151 AQ7 ASN M 72   ? SER M 76   ? ASN M 72   SER M 76   5 ? 5  
HELX_P HELX_P152 AQ8 SER M 108  ? SER M 110  ? SER M 108  SER M 110  5 ? 3  
HELX_P HELX_P153 AQ9 ASP M 111  ? ILE M 128  ? ASP M 111  ILE M 128  1 ? 18 
HELX_P HELX_P154 AR1 PRO M 131  ? LYS M 149  ? PRO M 131  LYS M 149  1 ? 19 
HELX_P HELX_P155 AR2 ALA M 155  ? GLU M 171  ? ALA M 155  GLU M 171  1 ? 17 
HELX_P HELX_P156 AR3 THR M 176  ? SER M 184  ? THR M 176  SER M 184  1 ? 9  
HELX_P HELX_P157 AR4 SER M 187  ? LEU M 202  ? SER M 187  LEU M 202  1 ? 16 
HELX_P HELX_P158 AR5 THR M 211  ? LEU M 222  ? THR M 211  LEU M 222  1 ? 12 
HELX_P HELX_P159 AR6 PRO M 225  ? ASP M 243  ? PRO M 225  ASP M 243  1 ? 19 
HELX_P HELX_P160 AR7 SER M 249  ? ALA M 264  ? SER M 249  ALA M 264  1 ? 16 
HELX_P HELX_P161 AR8 THR M 270  ? GLY M 279  ? THR M 270  GLY M 279  1 ? 10 
HELX_P HELX_P162 AR9 ALA M 281  ? TYR M 293  ? ALA M 281  TYR M 293  1 ? 13 
HELX_P HELX_P163 AS1 PRO M 294  ? PHE M 300  ? PRO M 294  PHE M 300  5 ? 7  
HELX_P HELX_P164 AS2 PRO M 309  ? LEU M 313  ? PRO M 309  LEU M 313  5 ? 5  
HELX_P HELX_P165 AS3 VAL N 10   ? GLY N 33   ? VAL N 10   GLY N 33   1 ? 24 
HELX_P HELX_P166 AS4 ASP N 35   ? MET N 51   ? ASP N 35   MET N 51   1 ? 17 
HELX_P HELX_P167 AS5 LEU N 314  ? ASP N 318  ? LEU N 314  ASP N 318  5 ? 5  
HELX_P HELX_P168 AS6 GLY N 325  ? ASP N 330  ? GLY N 325  ASP N 330  1 ? 6  
HELX_P HELX_P169 AS7 GLN O 4    ? ASN O 8    ? GLN O 4    ASN O 8    5 ? 5  
HELX_P HELX_P170 AS8 THR O 9    ? SER O 25   ? THR O 9    SER O 25   1 ? 17 
HELX_P HELX_P171 AS9 THR O 29   ? VAL O 52   ? THR O 29   VAL O 52   1 ? 24 
HELX_P HELX_P172 AT1 ASP P 179  ? ALA P 187  ? ASP P 179  ALA P 187  1 ? 9  
HELX_P HELX_P173 AT2 SER P 226  ? GLY P 245  ? SER P 226  GLY P 245  1 ? 20 
HELX_P HELX_P174 AT3 ARG P 269  ? HIS P 277  ? ARG P 269  HIS P 277  1 ? 9  
HELX_P HELX_P175 AT4 VAL P 317  ? GLY P 334  ? VAL P 317  GLY P 334  1 ? 18 
HELX_P HELX_P176 AT5 ALA Q 12   ? PHE Q 25   ? ALA Q 12   PHE Q 25   1 ? 14 
HELX_P HELX_P177 AT6 GLY Q 27   ? ARG Q 39   ? GLY Q 27   ARG Q 39   1 ? 13 
HELX_P HELX_P178 AT7 LYS Q 44   ? LYS Q 53   ? LYS Q 44   LYS Q 53   1 ? 10 
HELX_P HELX_P179 AT8 ASP Q 55   ? ASP Q 69   ? ASP Q 55   ASP Q 69   1 ? 15 
HELX_P HELX_P180 AT9 VAL Q 103  ? GLU Q 118  ? VAL Q 103  GLU Q 118  1 ? 16 
HELX_P HELX_P181 AU1 THR Q 137  ? ASN Q 142  ? THR Q 137  ASN Q 142  1 ? 6  
HELX_P HELX_P182 AU2 ASP Q 172  ? TYR Q 201  ? ASP Q 172  TYR Q 201  1 ? 30 
HELX_P HELX_P183 AU3 GLU Q 202  ? LEU Q 204  ? GLU Q 202  LEU Q 204  5 ? 3  
HELX_P HELX_P184 AU4 GLY R 76   ? GLY R 92   ? GLY R 76   GLY R 92   1 ? 17 
HELX_P HELX_P185 AU5 THR R 98   ? GLN R 107  ? THR R 98   GLN R 107  1 ? 10 
HELX_P HELX_P186 AU6 HIS R 108  ? ILE R 111  ? HIS R 108  ILE R 111  5 ? 4  
HELX_P HELX_P187 AU7 GLY R 112  ? THR R 121  ? GLY R 112  THR R 121  1 ? 10 
HELX_P HELX_P188 AU8 GLU R 122  ? ASN R 127  ? GLU R 122  ASN R 127  1 ? 6  
HELX_P HELX_P189 AU9 ARG R 146  ? ALA R 150  ? ARG R 146  ALA R 150  5 ? 5  
HELX_P HELX_P190 AV1 LEU R 151  ? GLN R 157  ? LEU R 151  GLN R 157  1 ? 7  
HELX_P HELX_P191 AV2 LEU R 167  ? ALA R 174  ? LEU R 167  ALA R 174  1 ? 8  
HELX_P HELX_P192 AV3 PRO R 176  ? LEU R 185  ? PRO R 176  LEU R 185  1 ? 10 
HELX_P HELX_P193 AV4 PHE R 216  ? VAL R 223  ? PHE R 216  VAL R 223  1 ? 8  
HELX_P HELX_P194 AV5 ASP R 229  ? ARG R 239  ? ASP R 229  ARG R 239  1 ? 11 
HELX_P HELX_P195 AV6 GLY S 5    ? GLN S 9    ? GLY S 5    GLN S 9    5 ? 5  
HELX_P HELX_P196 AV7 ALA S 34   ? LYS S 36   ? ALA S 34   LYS S 36   5 ? 3  
HELX_P HELX_P197 AV8 ASN S 38   ? TRP S 42   ? ASN S 38   TRP S 42   5 ? 5  
HELX_P HELX_P198 AV9 ALA S 160  ? ARG S 167  ? ALA S 160  ARG S 167  1 ? 8  
HELX_P HELX_P199 AW1 HIS S 173  ? GLN S 179  ? HIS S 173  GLN S 179  1 ? 7  
HELX_P HELX_P200 AW2 LEU T 9    ? GLN T 14   ? LEU T 9    GLN T 14   1 ? 6  
HELX_P HELX_P201 AW3 LYS T 25   ? SER T 35   ? LYS T 25   SER T 35   1 ? 11 
HELX_P HELX_P202 AW4 GLU T 122  ? LYS T 137  ? GLU T 122  LYS T 137  1 ? 16 
HELX_P HELX_P203 AW5 ASN T 158  ? LYS T 169  ? ASN T 158  LYS T 169  1 ? 12 
HELX_P HELX_P204 AW6 LYS T 180  ? GLU T 192  ? LYS T 180  GLU T 192  1 ? 13 
HELX_P HELX_P205 AW7 LEU T 199  ? LYS T 207  ? LEU T 199  LYS T 207  1 ? 9  
HELX_P HELX_P206 AW8 PRO T 209  ? ILE T 220  ? PRO T 209  ILE T 220  1 ? 12 
HELX_P HELX_P207 AW9 ASP U 138  ? ARG U 153  ? ASP U 138  ARG U 153  1 ? 16 
HELX_P HELX_P208 AX1 ASP U 156  ? GLY U 162  ? ASP U 156  GLY U 162  1 ? 7  
HELX_P HELX_P209 AX2 ASP U 164  ? ARG U 181  ? ASP U 164  ARG U 181  1 ? 18 
HELX_P HELX_P210 AX3 ASP U 184  ? LYS U 199  ? ASP U 184  LYS U 199  1 ? 16 
HELX_P HELX_P211 AX4 ASN U 203  ? CYS U 212  ? ASN U 203  CYS U 212  1 ? 10 
HELX_P HELX_P212 AX5 PRO U 216  ? ALA U 221  ? PRO U 216  ALA U 221  1 ? 6  
HELX_P HELX_P213 AX6 LEU U 233  ? HIS U 248  ? LEU U 233  HIS U 248  1 ? 16 
HELX_P HELX_P214 AX7 ASN U 292  ? GLY U 295  ? ASN U 292  GLY U 295  5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? V DG 1  N1 ? ? ? 1_555 W DC 75 N3 ? ? X DG 0  Y DC 93 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2   hydrog ? ? V DG 1  N2 ? ? ? 1_555 W DC 75 O2 ? ? X DG 0  Y DC 93 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3   hydrog ? ? V DG 1  O6 ? ? ? 1_555 W DC 75 N4 ? ? X DG 0  Y DC 93 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4   hydrog ? ? V DA 2  N1 ? ? ? 1_555 W DT 74 N3 ? ? X DA 1  Y DT 92 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5   hydrog ? ? V DA 2  N6 ? ? ? 1_555 W DT 74 O4 ? ? X DA 1  Y DT 92 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6   hydrog ? ? V DA 3  N1 ? ? ? 1_555 W DT 73 N3 ? ? X DA 2  Y DT 91 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7   hydrog ? ? V DA 3  N6 ? ? ? 1_555 W DT 73 O4 ? ? X DA 2  Y DT 91 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8   hydrog ? ? V DG 4  N1 ? ? ? 1_555 W DC 72 N3 ? ? X DG 3  Y DC 90 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9   hydrog ? ? V DG 4  N2 ? ? ? 1_555 W DC 72 O2 ? ? X DG 3  Y DC 90 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10  hydrog ? ? V DG 4  O6 ? ? ? 1_555 W DC 72 N4 ? ? X DG 3  Y DC 90 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11  hydrog ? ? V DG 5  N1 ? ? ? 1_555 W DC 71 N3 ? ? X DG 4  Y DC 89 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12  hydrog ? ? V DG 5  N2 ? ? ? 1_555 W DC 71 O2 ? ? X DG 4  Y DC 89 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13  hydrog ? ? V DG 5  O6 ? ? ? 1_555 W DC 71 N4 ? ? X DG 4  Y DC 89 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14  hydrog ? ? V DG 5  N2 ? ? ? 1_555 W DC 72 O2 ? ? X DG 4  Y DC 90 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog15  hydrog ? ? V DG 6  N1 ? ? ? 1_555 W DC 70 N3 ? ? X DG 5  Y DC 88 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16  hydrog ? ? V DG 6  N2 ? ? ? 1_555 W DC 70 O2 ? ? X DG 5  Y DC 88 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17  hydrog ? ? V DG 6  O6 ? ? ? 1_555 W DC 70 N4 ? ? X DG 5  Y DC 88 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18  hydrog ? ? V DC 7  N3 ? ? ? 1_555 W DG 69 N1 ? ? X DC 6  Y DG 87 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog19  hydrog ? ? V DC 7  N4 ? ? ? 1_555 W DG 69 O6 ? ? X DC 6  Y DG 87 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20  hydrog ? ? V DC 7  O2 ? ? ? 1_555 W DG 69 N2 ? ? X DC 6  Y DG 87 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21  hydrog ? ? V DG 8  N1 ? ? ? 1_555 W DC 68 N3 ? ? X DG 7  Y DC 86 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22  hydrog ? ? V DG 8  N2 ? ? ? 1_555 W DC 68 O2 ? ? X DG 7  Y DC 86 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23  hydrog ? ? V DG 8  O6 ? ? ? 1_555 W DC 68 N4 ? ? X DG 7  Y DC 86 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24  hydrog ? ? V DC 9  N3 ? ? ? 1_555 W DG 67 N1 ? ? X DC 8  Y DG 85 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25  hydrog ? ? V DC 9  N4 ? ? ? 1_555 W DG 67 O6 ? ? X DC 8  Y DG 85 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26  hydrog ? ? V DC 9  O2 ? ? ? 1_555 W DG 67 N2 ? ? X DC 8  Y DG 85 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27  hydrog ? ? V DC 10 N3 ? ? ? 1_555 W DG 66 N1 ? ? X DC 9  Y DG 84 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28  hydrog ? ? V DC 10 N4 ? ? ? 1_555 W DG 66 O6 ? ? X DC 9  Y DG 84 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29  hydrog ? ? V DC 10 O2 ? ? ? 1_555 W DG 66 N2 ? ? X DC 9  Y DG 84 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30  hydrog ? ? V DT 11 N3 ? ? ? 1_555 W DA 65 N1 ? ? X DT 10 Y DA 83 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog31  hydrog ? ? V DT 11 O4 ? ? ? 1_555 W DA 65 N6 ? ? X DT 10 Y DA 83 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32  hydrog ? ? V DT 11 O2 ? ? ? 1_555 W DG 66 N2 ? ? X DT 10 Y DG 84 1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ? ? 
hydrog33  hydrog ? ? V DA 12 N1 ? ? ? 1_555 W DT 64 N3 ? ? X DA 11 Y DT 82 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34  hydrog ? ? V DA 12 N6 ? ? ? 1_555 W DT 64 O4 ? ? X DA 11 Y DT 82 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog35  hydrog ? ? V DT 13 O4 ? ? ? 1_555 W DA 63 N6 ? ? X DT 12 Y DA 81 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog36  hydrog ? ? V DA 14 N1 ? ? ? 1_555 W DT 61 N3 ? ? X DA 13 Y DT 79 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37  hydrog ? ? V DA 14 N6 ? ? ? 1_555 W DT 61 O4 ? ? X DA 13 Y DT 79 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38  hydrog ? ? V DA 15 N1 ? ? ? 1_555 W DT 60 N3 ? ? X DA 14 Y DT 78 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39  hydrog ? ? V DA 15 N6 ? ? ? 1_555 W DT 60 O4 ? ? X DA 14 Y DT 78 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog40  hydrog ? ? V DA 15 N1 ? ? ? 1_555 W DT 61 N3 ? ? X DA 14 Y DT 79 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41  hydrog ? ? V DA 15 N6 ? ? ? 1_555 W DT 61 O4 ? ? X DA 14 Y DT 79 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42  hydrog ? ? V DA 16 N6 ? ? ? 1_555 W DT 59 O4 ? ? X DA 15 Y DT 77 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog43  hydrog ? ? V DA 16 N6 ? ? ? 1_555 W DT 60 O4 ? ? X DA 15 Y DT 78 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog44  hydrog ? ? V DG 18 N1 ? ? ? 1_555 W DC 58 N3 ? ? X DG 17 Y DC 76 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45  hydrog ? ? V DG 18 N2 ? ? ? 1_555 W DC 58 O2 ? ? X DG 17 Y DC 76 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog46  hydrog ? ? V DG 18 O6 ? ? ? 1_555 W DC 58 N4 ? ? X DG 17 Y DC 76 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog47  hydrog ? ? V DG 19 N1 ? ? ? 1_555 W DC 57 N3 ? ? X DG 18 Y DC 75 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48  hydrog ? ? V DG 19 N2 ? ? ? 1_555 W DC 57 O2 ? ? X DG 18 Y DC 75 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49  hydrog ? ? V DG 19 O6 ? ? ? 1_555 W DC 57 N4 ? ? X DG 18 Y DC 75 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog50  hydrog ? ? V DG 20 N1 ? ? ? 1_555 W DC 56 N3 ? ? X DG 19 Y DC 74 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51  hydrog ? ? V DG 20 N2 ? ? ? 1_555 W DC 56 O2 ? ? X DG 19 Y DC 74 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog52  hydrog ? ? V DG 20 O6 ? ? ? 1_555 W DC 56 N4 ? ? X DG 19 Y DC 74 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53  hydrog ? ? V DG 20 N2 ? ? ? 1_555 W DC 57 O2 ? ? X DG 19 Y DC 75 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog54  hydrog ? ? V DG 21 N1 ? ? ? 1_555 W DC 55 N3 ? ? X DG 20 Y DC 73 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55  hydrog ? ? V DG 21 N2 ? ? ? 1_555 W DC 55 O2 ? ? X DG 20 Y DC 73 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56  hydrog ? ? V DG 21 O6 ? ? ? 1_555 W DC 55 N4 ? ? X DG 20 Y DC 73 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57  hydrog ? ? V DG 22 N1 ? ? ? 1_555 W DC 54 N3 ? ? X DG 21 Y DC 72 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58  hydrog ? ? V DG 22 N2 ? ? ? 1_555 W DC 54 O2 ? ? X DG 21 Y DC 72 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59  hydrog ? ? V DG 22 O6 ? ? ? 1_555 W DC 54 N4 ? ? X DG 21 Y DC 72 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog60  hydrog ? ? V DT 23 O4 ? ? ? 1_555 W DC 52 N4 ? ? X DT 22 Y DC 70 1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ? ? 
hydrog61  hydrog ? ? V DT 23 N3 ? ? ? 1_555 W DA 53 N1 ? ? X DT 22 Y DA 71 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62  hydrog ? ? V DT 23 O4 ? ? ? 1_555 W DA 53 N6 ? ? X DT 22 Y DA 71 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog63  hydrog ? ? V DG 24 N1 ? ? ? 1_555 W DC 52 N3 ? ? X DG 23 Y DC 70 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog64  hydrog ? ? V DG 24 N2 ? ? ? 1_555 W DC 52 O2 ? ? X DG 23 Y DC 70 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog65  hydrog ? ? V DG 24 O6 ? ? ? 1_555 W DC 52 N4 ? ? X DG 23 Y DC 70 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog66  hydrog ? ? V DG 25 N1 ? ? ? 1_555 W DC 51 N3 ? ? X DG 24 Y DC 69 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog67  hydrog ? ? V DG 25 N2 ? ? ? 1_555 W DC 51 O2 ? ? X DG 24 Y DC 69 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68  hydrog ? ? V DG 25 O6 ? ? ? 1_555 W DC 51 N4 ? ? X DG 24 Y DC 69 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69  hydrog ? ? V DG 26 N1 ? ? ? 1_555 W DC 50 N3 ? ? X DG 25 Y DC 68 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70  hydrog ? ? V DG 26 N2 ? ? ? 1_555 W DC 50 O2 ? ? X DG 25 Y DC 68 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog71  hydrog ? ? V DG 26 O6 ? ? ? 1_555 W DC 50 N4 ? ? X DG 25 Y DC 68 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72  hydrog ? ? V DG 27 O6 ? ? ? 1_555 W DC 48 N4 ? ? X DG 26 Y DC 66 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog73  hydrog ? ? V DG 27 N1 ? ? ? 1_555 W DC 49 N3 ? ? X DG 26 Y DC 67 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog74  hydrog ? ? V DG 27 N2 ? ? ? 1_555 W DC 49 O2 ? ? X DG 26 Y DC 67 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog75  hydrog ? ? V DG 27 O6 ? ? ? 1_555 W DC 49 N4 ? ? X DG 26 Y DC 67 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76  hydrog ? ? V DG 28 N1 ? ? ? 1_555 W DC 48 N3 ? ? X DG 27 Y DC 66 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog77  hydrog ? ? V DG 28 N2 ? ? ? 1_555 W DC 48 O2 ? ? X DG 27 Y DC 66 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog78  hydrog ? ? V DG 28 O6 ? ? ? 1_555 W DC 48 N4 ? ? X DG 27 Y DC 66 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog79  hydrog ? ? V DC 29 N4 ? ? ? 1_555 W DG 47 O6 ? ? X DC 28 Y DG 65 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog80  hydrog ? ? V DG 30 N1 ? ? ? 1_555 W DC 46 N3 ? ? X DG 29 Y DC 64 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog81  hydrog ? ? V DG 30 N2 ? ? ? 1_555 W DC 46 O2 ? ? X DG 29 Y DC 64 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog82  hydrog ? ? V DG 30 O6 ? ? ? 1_555 W DC 46 N4 ? ? X DG 29 Y DC 64 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog83  hydrog ? ? V DC 45 O2 ? ? ? 1_555 W DG 31 N2 ? ? X DC 44 Y DG 49 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog84  hydrog ? ? V DG 46 O6 ? ? ? 1_555 W DG 29 N1 ? ? X DG 45 Y DG 47 1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ? ? 
hydrog85  hydrog ? ? V DG 46 N2 ? ? ? 1_555 W DC 30 O2 ? ? X DG 45 Y DC 48 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog86  hydrog ? ? V DC 47 N3 ? ? ? 1_555 W DG 29 N2 ? ? X DC 46 Y DG 47 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog87  hydrog ? ? V DG 48 N2 ? ? ? 1_555 W DC 28 O2 ? ? X DG 47 Y DC 46 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog88  hydrog ? ? V DA 49 N1 ? ? ? 1_555 W DT 27 N3 ? ? X DA 48 Y DT 45 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog89  hydrog ? ? V DT 50 N3 ? ? ? 1_555 W DA 26 N1 ? ? X DT 49 Y DA 44 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog90  hydrog ? ? V DT 50 O4 ? ? ? 1_555 W DA 26 N6 ? ? X DT 49 Y DA 44 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog91  hydrog ? ? V DC 51 N3 ? ? ? 1_555 W DG 25 N1 ? ? X DC 50 Y DG 43 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog92  hydrog ? ? V DC 51 N4 ? ? ? 1_555 W DG 25 O6 ? ? X DC 50 Y DG 43 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog93  hydrog ? ? V DC 51 O2 ? ? ? 1_555 W DG 25 N2 ? ? X DC 50 Y DG 43 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog94  hydrog ? ? V DG 52 N1 ? ? ? 1_555 W DC 24 N3 ? ? X DG 51 Y DC 42 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog95  hydrog ? ? V DG 52 N2 ? ? ? 1_555 W DC 24 O2 ? ? X DG 51 Y DC 42 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog96  hydrog ? ? V DG 52 O6 ? ? ? 1_555 W DC 24 N4 ? ? X DG 51 Y DC 42 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog97  hydrog ? ? V DA 53 N1 ? ? ? 1_555 W DT 23 N3 ? ? X DA 52 Y DT 41 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog98  hydrog ? ? V DA 53 N6 ? ? ? 1_555 W DT 23 O4 ? ? X DA 52 Y DT 41 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog99  hydrog ? ? V DA 54 N1 ? ? ? 1_555 W DT 22 N3 ? ? X DA 53 Y DT 40 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog100 hydrog ? ? V DA 54 N6 ? ? ? 1_555 W DT 22 O4 ? ? X DA 53 Y DT 40 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog101 hydrog ? ? V DC 55 N3 ? ? ? 1_555 W DG 21 N1 ? ? X DC 54 Y DG 39 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog102 hydrog ? ? V DC 55 N4 ? ? ? 1_555 W DG 21 O6 ? ? X DC 54 Y DG 39 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog103 hydrog ? ? V DC 55 O2 ? ? ? 1_555 W DG 21 N2 ? ? X DC 54 Y DG 39 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog104 hydrog ? ? V DA 56 N1 ? ? ? 1_555 W DT 20 N3 ? ? X DA 55 Y DT 38 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog105 hydrog ? ? V DA 56 N6 ? ? ? 1_555 W DT 20 O4 ? ? X DA 55 Y DT 38 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog106 hydrog ? ? V DC 57 N3 ? ? ? 1_555 W DG 19 N1 ? ? X DC 56 Y DG 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog107 hydrog ? ? V DC 57 N4 ? ? ? 1_555 W DG 19 O6 ? ? X DC 56 Y DG 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog108 hydrog ? ? V DC 57 O2 ? ? ? 1_555 W DG 19 N2 ? ? X DC 56 Y DG 37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog109 hydrog ? ? V DT 58 N3 ? ? ? 1_555 W DA 18 N1 ? ? X DT 57 Y DA 36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog110 hydrog ? ? V DT 58 O4 ? ? ? 1_555 W DA 18 N6 ? ? X DT 57 Y DA 36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog111 hydrog ? ? V DC 59 N3 ? ? ? 1_555 W DG 17 N1 ? ? X DC 58 Y DG 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog112 hydrog ? ? V DC 59 N4 ? ? ? 1_555 W DG 17 O6 ? ? X DC 58 Y DG 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog113 hydrog ? ? V DC 59 O2 ? ? ? 1_555 W DG 17 N2 ? ? X DC 58 Y DG 35 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog114 hydrog ? ? V DG 60 N1 ? ? ? 1_555 W DC 16 N3 ? ? X DG 59 Y DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog115 hydrog ? ? V DG 60 N2 ? ? ? 1_555 W DC 16 O2 ? ? X DG 59 Y DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog116 hydrog ? ? V DG 60 O6 ? ? ? 1_555 W DC 16 N4 ? ? X DG 59 Y DC 34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog117 hydrog ? ? V DA 61 N1 ? ? ? 1_555 W DT 15 N3 ? ? X DA 60 Y DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog118 hydrog ? ? V DA 61 N6 ? ? ? 1_555 W DT 15 O4 ? ? X DA 60 Y DT 33 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog119 hydrog ? ? V DG 62 N1 ? ? ? 1_555 W DC 14 N3 ? ? X DG 61 Y DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog120 hydrog ? ? V DG 62 N2 ? ? ? 1_555 W DC 14 O2 ? ? X DG 61 Y DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog121 hydrog ? ? V DG 62 O6 ? ? ? 1_555 W DC 14 N4 ? ? X DG 61 Y DC 32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog122 hydrog ? ? V DC 63 N3 ? ? ? 1_555 W DG 13 N1 ? ? X DC 62 Y DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog123 hydrog ? ? V DC 63 N4 ? ? ? 1_555 W DG 13 O6 ? ? X DC 62 Y DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog124 hydrog ? ? V DC 63 O2 ? ? ? 1_555 W DG 13 N2 ? ? X DC 62 Y DG 31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog125 hydrog ? ? V DC 64 N3 ? ? ? 1_555 W DG 12 N1 ? ? X DC 63 Y DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog126 hydrog ? ? V DC 64 N4 ? ? ? 1_555 W DG 12 O6 ? ? X DC 63 Y DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog127 hydrog ? ? V DC 64 O2 ? ? ? 1_555 W DG 12 N2 ? ? X DC 63 Y DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog128 hydrog ? ? V DG 65 N1 ? ? ? 1_555 W DC 11 N3 ? ? X DG 64 Y DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog129 hydrog ? ? V DG 65 N2 ? ? ? 1_555 W DC 11 O2 ? ? X DG 64 Y DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog130 hydrog ? ? V DG 65 O6 ? ? ? 1_555 W DC 11 N4 ? ? X DG 64 Y DC 29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog131 hydrog ? ? V DA 66 N1 ? ? ? 1_555 W DT 10 N3 ? ? X DA 65 Y DT 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog132 hydrog ? ? V DA 66 N6 ? ? ? 1_555 W DT 10 O4 ? ? X DA 65 Y DT 28 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog133 hydrog ? ? V DG 67 N1 ? ? ? 1_555 W DC 9  N3 ? ? X DG 66 Y DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog134 hydrog ? ? V DG 67 N2 ? ? ? 1_555 W DC 9  O2 ? ? X DG 66 Y DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog135 hydrog ? ? V DG 67 O6 ? ? ? 1_555 W DC 9  N4 ? ? X DG 66 Y DC 27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog136 hydrog ? ? V DC 68 N3 ? ? ? 1_555 W DG 8  N1 ? ? X DC 67 Y DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog137 hydrog ? ? V DC 68 N4 ? ? ? 1_555 W DG 8  O6 ? ? X DC 67 Y DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog138 hydrog ? ? V DC 68 O2 ? ? ? 1_555 W DG 8  N2 ? ? X DC 67 Y DG 26 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog139 hydrog ? ? V DA 69 N1 ? ? ? 1_555 W DT 7  N3 ? ? X DA 68 Y DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog140 hydrog ? ? V DA 69 N6 ? ? ? 1_555 W DT 7  O4 ? ? X DA 68 Y DT 25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog141 hydrog ? ? V DG 70 N1 ? ? ? 1_555 W DC 6  N3 ? ? X DG 69 Y DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog142 hydrog ? ? V DG 70 N2 ? ? ? 1_555 W DC 6  O2 ? ? X DG 69 Y DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog143 hydrog ? ? V DG 70 O6 ? ? ? 1_555 W DC 6  N4 ? ? X DG 69 Y DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog144 hydrog ? ? V DA 71 N1 ? ? ? 1_555 W DT 5  N3 ? ? X DA 70 Y DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog145 hydrog ? ? V DA 71 N6 ? ? ? 1_555 W DT 5  O4 ? ? X DA 70 Y DT 23 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog146 hydrog ? ? V DC 72 N3 ? ? ? 1_555 W DG 4  N1 ? ? X DC 71 Y DG 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog147 hydrog ? ? V DC 72 N4 ? ? ? 1_555 W DG 4  O6 ? ? X DC 71 Y DG 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog148 hydrog ? ? V DC 72 O2 ? ? ? 1_555 W DG 4  N2 ? ? X DC 71 Y DG 22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog149 hydrog ? ? V DG 73 N1 ? ? ? 1_555 W DC 3  N3 ? ? X DG 72 Y DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog150 hydrog ? ? V DG 73 N2 ? ? ? 1_555 W DC 3  O2 ? ? X DG 72 Y DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog151 hydrog ? ? V DG 73 O6 ? ? ? 1_555 W DC 3  N4 ? ? X DG 72 Y DC 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog152 hydrog ? ? V DT 74 N3 ? ? ? 1_555 W DA 2  N1 ? ? X DT 73 Y DA 20 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog153 hydrog ? ? V DG 75 N1 ? ? ? 1_555 W DC 1  N3 ? ? X DG 74 Y DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog154 hydrog ? ? V DG 75 N2 ? ? ? 1_555 W DC 1  O2 ? ? X DG 74 Y DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog155 hydrog ? ? V DG 75 O6 ? ? ? 1_555 W DC 1  N4 ? ? X DG 74 Y DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 461 A . ? GLN 461 A PRO 462 A ? PRO 462 A 1 -2.72 
2 LYS 581 A . ? LYS 581 A PRO 582 A ? PRO 582 A 1 7.56  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 2  ? 
AA3 ? 3  ? 
AA4 ? 8  ? 
AA5 ? 4  ? 
AA6 ? 2  ? 
AA7 ? 10 ? 
AA8 ? 2  ? 
AA9 ? 2  ? 
AB1 ? 2  ? 
AB2 ? 4  ? 
AB3 ? 5  ? 
AB4 ? 3  ? 
AB5 ? 4  ? 
AB6 ? 2  ? 
AB7 ? 3  ? 
AB8 ? 4  ? 
AB9 ? 5  ? 
AC1 ? 3  ? 
AC2 ? 4  ? 
AC3 ? 5  ? 
AC4 ? 4  ? 
AC5 ? 7  ? 
AC6 ? 4  ? 
AC7 ? 4  ? 
AC8 ? 2  ? 
AC9 ? 4  ? 
AD1 ? 5  ? 
AD2 ? 2  ? 
AD3 ? 5  ? 
AD4 ? 4  ? 
AD5 ? 4  ? 
AD6 ? 4  ? 
AD7 ? 7  ? 
AD8 ? 3  ? 
AD9 ? 3  ? 
AE1 ? 4  ? 
AE2 ? 4  ? 
AE3 ? 2  ? 
AE4 ? 8  ? 
AE5 ? 9  ? 
AE6 ? 2  ? 
AE7 ? 2  ? 
AE8 ? 2  ? 
AE9 ? 3  ? 
AF1 ? 15 ? 
AF2 ? 3  ? 
AF3 ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA3 2  3  ? anti-parallel 
AA4 1  2  ? anti-parallel 
AA4 2  3  ? anti-parallel 
AA4 3  4  ? anti-parallel 
AA4 4  5  ? anti-parallel 
AA4 5  6  ? parallel      
AA4 6  7  ? anti-parallel 
AA4 7  8  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA5 3  4  ? anti-parallel 
AA6 1  2  ? anti-parallel 
AA7 1  2  ? anti-parallel 
AA7 2  3  ? anti-parallel 
AA7 3  4  ? anti-parallel 
AA7 4  5  ? anti-parallel 
AA7 5  6  ? anti-parallel 
AA7 6  7  ? anti-parallel 
AA7 7  8  ? anti-parallel 
AA7 8  9  ? anti-parallel 
AA7 9  10 ? anti-parallel 
AA8 1  2  ? anti-parallel 
AA9 1  2  ? anti-parallel 
AB1 1  2  ? anti-parallel 
AB2 1  2  ? anti-parallel 
AB2 2  3  ? anti-parallel 
AB2 3  4  ? anti-parallel 
AB3 1  2  ? anti-parallel 
AB3 2  3  ? anti-parallel 
AB3 3  4  ? anti-parallel 
AB3 4  5  ? anti-parallel 
AB4 1  2  ? anti-parallel 
AB4 2  3  ? anti-parallel 
AB5 1  2  ? anti-parallel 
AB5 2  3  ? anti-parallel 
AB5 3  4  ? anti-parallel 
AB6 1  2  ? anti-parallel 
AB7 1  2  ? anti-parallel 
AB7 2  3  ? anti-parallel 
AB8 1  2  ? anti-parallel 
AB8 2  3  ? parallel      
AB8 3  4  ? anti-parallel 
AB9 1  2  ? anti-parallel 
AB9 2  3  ? anti-parallel 
AB9 3  4  ? anti-parallel 
AB9 4  5  ? anti-parallel 
AC1 1  2  ? anti-parallel 
AC1 2  3  ? anti-parallel 
AC2 1  2  ? anti-parallel 
AC2 2  3  ? anti-parallel 
AC2 3  4  ? parallel      
AC3 1  2  ? anti-parallel 
AC3 2  3  ? anti-parallel 
AC3 3  4  ? parallel      
AC3 4  5  ? anti-parallel 
AC4 1  2  ? anti-parallel 
AC4 2  3  ? anti-parallel 
AC4 3  4  ? anti-parallel 
AC5 1  2  ? anti-parallel 
AC5 2  3  ? anti-parallel 
AC5 3  4  ? anti-parallel 
AC5 4  5  ? parallel      
AC5 5  6  ? anti-parallel 
AC5 6  7  ? parallel      
AC6 1  2  ? anti-parallel 
AC6 2  3  ? anti-parallel 
AC6 3  4  ? anti-parallel 
AC7 1  2  ? anti-parallel 
AC7 2  3  ? anti-parallel 
AC7 3  4  ? parallel      
AC8 1  2  ? anti-parallel 
AC9 1  2  ? anti-parallel 
AC9 2  3  ? anti-parallel 
AC9 3  4  ? anti-parallel 
AD1 1  2  ? anti-parallel 
AD1 2  3  ? anti-parallel 
AD1 3  4  ? anti-parallel 
AD1 4  5  ? anti-parallel 
AD2 1  2  ? anti-parallel 
AD3 1  2  ? anti-parallel 
AD3 2  3  ? anti-parallel 
AD3 3  4  ? anti-parallel 
AD3 4  5  ? anti-parallel 
AD4 1  2  ? anti-parallel 
AD4 2  3  ? anti-parallel 
AD4 3  4  ? anti-parallel 
AD5 1  2  ? anti-parallel 
AD5 2  3  ? parallel      
AD5 3  4  ? parallel      
AD6 1  2  ? anti-parallel 
AD6 2  3  ? anti-parallel 
AD6 3  4  ? parallel      
AD7 1  2  ? anti-parallel 
AD7 2  3  ? anti-parallel 
AD7 3  4  ? parallel      
AD7 4  5  ? anti-parallel 
AD7 5  6  ? anti-parallel 
AD7 6  7  ? anti-parallel 
AD8 1  2  ? anti-parallel 
AD8 2  3  ? anti-parallel 
AD9 1  2  ? anti-parallel 
AD9 2  3  ? anti-parallel 
AE1 1  2  ? anti-parallel 
AE1 2  3  ? anti-parallel 
AE1 3  4  ? anti-parallel 
AE2 1  2  ? anti-parallel 
AE2 2  3  ? anti-parallel 
AE2 3  4  ? anti-parallel 
AE3 1  2  ? anti-parallel 
AE4 1  2  ? anti-parallel 
AE4 2  3  ? anti-parallel 
AE4 3  4  ? parallel      
AE4 4  5  ? anti-parallel 
AE4 5  6  ? anti-parallel 
AE4 6  7  ? parallel      
AE4 7  8  ? anti-parallel 
AE5 1  2  ? anti-parallel 
AE5 2  3  ? anti-parallel 
AE5 3  4  ? anti-parallel 
AE5 4  5  ? anti-parallel 
AE5 5  6  ? anti-parallel 
AE5 6  7  ? anti-parallel 
AE5 7  8  ? anti-parallel 
AE5 8  9  ? anti-parallel 
AE6 1  2  ? anti-parallel 
AE7 1  2  ? anti-parallel 
AE8 1  2  ? anti-parallel 
AE9 1  2  ? anti-parallel 
AE9 2  3  ? anti-parallel 
AF1 1  2  ? anti-parallel 
AF1 2  3  ? anti-parallel 
AF1 3  4  ? anti-parallel 
AF1 4  5  ? parallel      
AF1 5  6  ? anti-parallel 
AF1 6  7  ? anti-parallel 
AF1 7  8  ? anti-parallel 
AF1 8  9  ? anti-parallel 
AF1 9  10 ? anti-parallel 
AF1 10 11 ? anti-parallel 
AF1 11 12 ? parallel      
AF1 12 13 ? anti-parallel 
AF1 13 14 ? anti-parallel 
AF1 14 15 ? parallel      
AF2 1  2  ? anti-parallel 
AF2 2  3  ? anti-parallel 
AF3 1  2  ? anti-parallel 
AF3 2  3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  SER A 1448 ? ASP A 1449 ? SER A 1448 ASP A 1449 
AA1 2  ARG A 20   ? PHE A 23   ? ARG A 20   PHE A 23   
AA1 3  ILE B 1167 ? ARG B 1170 ? ILE B 1167 ARG B 1170 
AA2 1  GLY A 86   ? PHE A 95   ? GLY A 86   PHE A 95   
AA2 2  ILE A 249  ? VAL A 255  ? ILE A 249  VAL A 255  
AA3 1  ARG A 192  ? SER A 194  ? ARG A 192  SER A 194  
AA3 2  GLU A 197  ? GLU A 201  ? GLU A 197  GLU A 201  
AA3 3  LYS A 213  ? LEU A 215  ? LYS A 213  LEU A 215  
AA4 1  HIS B 1060 ? ARG B 1062 ? HIS B 1060 ARG B 1062 
AA4 2  SER A 362  ? PRO A 369  ? SER A 362  PRO A 369  
AA4 3  GLU A 500  ? HIS A 504  ? GLU A 500  HIS A 504  
AA4 4  ILE A 455  ? ASN A 459  ? ILE A 455  ASN A 459  
AA4 5  MET A 469  ? LEU A 477  ? MET A 469  LEU A 477  
AA4 6  GLN A 377  ? PRO A 381  ? GLN A 377  PRO A 381  
AA4 7  PHE A 482  ? LEU A 484  ? PHE A 482  LEU A 484  
AA4 8  SER A 362  ? PRO A 369  ? SER A 362  PRO A 369  
AA5 1  THR A 389  ? ILE A 393  ? THR A 389  ILE A 393  
AA5 2  LYS A 445  ? HIS A 449  ? LYS A 445  HIS A 449  
AA5 3  ALA A 416  ? ILE A 420  ? ALA A 416  ILE A 420  
AA5 4  ARG A 426  ? ASP A 428  ? ARG A 426  ASP A 428  
AA6 1  PHE A 554  ? LEU A 555  ? PHE A 554  LEU A 555  
AA6 2  TRP A 586  ? THR A 587  ? TRP A 586  THR A 587  
AA7 1  ILE A 579  ? LYS A 581  ? ILE A 579  LYS A 581  
AA7 2  TYR H 90   ? ARG H 98   ? TYR H 90   ARG H 98   
AA7 3  VAL H 141  ? LYS H 146  ? VAL H 141  LYS H 146  
AA7 4  LYS H 55   ? ALA H 61   ? LYS H 55   ALA H 61   
AA7 5  ILE H 4    ? ASP H 14   ? ILE H 4    ASP H 14   
AA7 6  VAL H 25   ? SER H 32   ? VAL H 25   SER H 32   
AA7 7  ASP H 38   ? ASN H 44   ? ASP H 38   ASN H 44   
AA7 8  LEU H 121  ? GLN H 126  ? LEU H 121  GLN H 126  
AA7 9  SER H 113  ? TYR H 118  ? SER H 113  TYR H 118  
AA7 10 TYR H 90   ? ARG H 98   ? TYR H 90   ARG H 98   
AA8 1  VAL A 629  ? GLU A 631  ? VAL A 629  GLU A 631  
AA8 2  GLU A 634  ? MET A 637  ? GLU A 634  MET A 637  
AA9 1  GLY A 789  ? GLN A 790  ? GLY A 789  GLN A 790  
AA9 2  PHE A 822  ? VAL A 823  ? PHE A 822  VAL A 823  
AB1 1  GLU A 902  ? ASN A 905  ? GLU A 902  ASN A 905  
AB1 2  LYS A 976  ? LEU A 979  ? LYS A 976  LEU A 979  
AB2 1  TYR A 1308 ? PRO A 1312 ? TYR A 1308 PRO A 1312 
AB2 2  TRP A 1334 ? ASP A 1339 ? TRP A 1334 ASP A 1339 
AB2 3  SER A 1138 ? PHE A 1142 ? SER A 1138 PHE A 1142 
AB2 4  THR A 1358 ? SER A 1359 ? THR A 1358 SER A 1359 
AB3 1  CYS A 1245 ? PHE A 1247 ? CYS A 1245 PHE A 1247 
AB3 2  LEU A 1255 ? ILE A 1259 ? LEU A 1255 ILE A 1259 
AB3 3  TRP A 1210 ? LEU A 1216 ? TRP A 1210 LEU A 1216 
AB3 4  THR A 1170 ? TYR A 1177 ? THR A 1170 TYR A 1177 
AB3 5  CYS I 52   ? ASN I 56   ? CYS I 52   ASN I 56   
AB4 1  ASP A 1472 ? LEU A 1475 ? ASP A 1472 LEU A 1475 
AB4 2  ILE F 104  ? ARG F 108  ? ILE F 104  ARG F 108  
AB4 3  GLU F 116  ? GLY F 119  ? GLU F 116  GLY F 119  
AB5 1  ILE B 65   ? GLN B 68   ? ILE B 65   GLN B 68   
AB5 2  ARG B 83   ? LEU B 93   ? ARG B 83   LEU B 93   
AB5 3  SER B 121  ? THR B 131  ? SER B 121  THR B 131  
AB5 4  THR B 142  ? PRO B 153  ? THR B 142  PRO B 153  
AB6 1  THR B 97   ? TRP B 99   ? THR B 97   TRP B 99   
AB6 2  PRO B 105  ? PRO B 107  ? PRO B 105  PRO B 107  
AB7 1  PHE B 185  ? ILE B 187  ? PHE B 185  ILE B 187  
AB7 2  SER B 190  ? LEU B 194  ? SER B 190  LEU B 194  
AB7 3  SER B 467  ? VAL B 469  ? SER B 467  VAL B 469  
AB8 1  LYS B 391  ? ASP B 394  ? LYS B 391  ASP B 394  
AB8 2  ALA B 196  ? MET B 200  ? ALA B 196  MET B 200  
AB8 3  ARG B 484  ? ASN B 486  ? ARG B 484  ASN B 486  
AB8 4  VAL B 523  ? ASN B 525  ? VAL B 523  ASN B 525  
AB9 1  VAL B 205  ? ALA B 209  ? VAL B 205  ALA B 209  
AB9 2  TYR B 215  ? CYS B 221  ? TYR B 215  CYS B 221  
AB9 3  TRP B 236  ? LEU B 240  ? TRP B 236  LEU B 240  
AB9 4  VAL B 257  ? THR B 259  ? VAL B 257  THR B 259  
AB9 5  VAL B 267  ? PRO B 268  ? VAL B 267  PRO B 268  
AC1 1  TYR B 531  ? ILE B 532  ? TYR B 531  ILE B 532  
AC1 2  ILE B 621  ? GLU B 629  ? ILE B 621  GLU B 629  
AC1 3  VAL B 662  ? ASP B 666  ? VAL B 662  ASP B 666  
AC2 1  LYS B 632  ? LEU B 633  ? LYS B 632  LEU B 633  
AC2 2  ILE B 621  ? GLU B 629  ? ILE B 621  GLU B 629  
AC2 3  HIS B 695  ? CYS B 696  ? HIS B 695  CYS B 696  
AC2 4  LEU B 675  ? ALA B 676  ? LEU B 675  ALA B 676  
AC3 1  GLU B 551  ? ASN B 552  ? GLU B 551  ASN B 552  
AC3 2  CYS B 572  ? HIS B 577  ? CYS B 572  HIS B 577  
AC3 3  THR B 565  ? VAL B 569  ? THR B 565  VAL B 569  
AC3 4  GLU B 611  ? TYR B 615  ? GLU B 611  TYR B 615  
AC3 5  SER B 602  ? ASP B 606  ? SER B 602  ASP B 606  
AC4 1  LEU B 747  ? LEU B 751  ? LEU B 747  LEU B 751  
AC4 2  SER B 808  ? GLN B 817  ? SER B 808  GLN B 817  
AC4 3  LYS B 917  ? ARG B 927  ? LYS B 917  ARG B 927  
AC4 4  ILE B 903  ? LEU B 911  ? ILE B 903  LEU B 911  
AC5 1  GLY B 943  ? THR B 944  ? GLY B 943  THR B 944  
AC5 2  LYS B 934  ? SER B 937  ? LYS B 934  SER B 937  
AC5 3  ILE B 1041 ? ARG B 1050 ? ILE B 1041 ARG B 1050 
AC5 4  ILE B 776  ? ILE B 782  ? ILE B 776  ILE B 782  
AC5 5  ILE B 965  ? ILE B 967  ? ILE B 965  ILE B 967  
AC5 6  VAL B 794  ? ASN B 797  ? VAL B 794  ASN B 797  
AC5 7  ILE B 947  ? TYR B 949  ? ILE B 947  TYR B 949  
AC6 1  GLY B 943  ? THR B 944  ? GLY B 943  THR B 944  
AC6 2  LYS B 934  ? SER B 937  ? LYS B 934  SER B 937  
AC6 3  ILE B 1041 ? ARG B 1050 ? ILE B 1041 ARG B 1050 
AC6 4  ASN B 1025 ? GLU B 1026 ? ASN B 1025 GLU B 1026 
AC7 1  GLU B 826  ? PHE B 829  ? GLU B 826  PHE B 829  
AC7 2  LYS B 869  ? THR B 872  ? LYS B 869  THR B 872  
AC7 3  LYS B 889  ? ASP B 891  ? LYS B 889  ASP B 891  
AC7 4  CYS B 837  ? GLN B 838  ? CYS B 837  GLN B 838  
AC8 1  TYR B 1114 ? CYS B 1119 ? TYR B 1114 CYS B 1119 
AC8 2  ILE B 1146 ? MET B 1151 ? ILE B 1146 MET B 1151 
AC9 1  THR C 8    ? LEU C 14   ? THR C 8    LEU C 14   
AC9 2  ASN C 18   ? GLU C 24   ? ASN C 18   GLU C 24   
AC9 3  PHE C 229  ? SER C 235  ? PHE C 229  SER C 235  
AC9 4  THR C 179  ? TYR C 186  ? THR C 179  TYR C 186  
AD1 1  ILE C 121  ? SER C 122  ? ILE C 121  SER C 122  
AD1 2  VAL C 99   ? ARG C 106  ? VAL C 99   ARG C 106  
AD1 3  GLU C 158  ? PHE C 169  ? GLU C 158  PHE C 169  
AD1 4  PRO C 43   ? ASN C 55   ? PRO C 43   ASN C 55   
AD1 5  VAL L 54   ? ASP L 56   ? VAL L 54   ASP L 56   
AD2 1  ARG C 113  ? VAL C 115  ? ARG C 113  VAL C 115  
AD2 2  VAL C 151  ? LEU C 153  ? VAL C 151  LEU C 153  
AD3 1  GLU D 30   ? LEU D 32   ? GLU D 30   LEU D 32   
AD3 2  PHE G 2    ? LEU G 13   ? PHE G 2    LEU G 13   
AD3 3  VAL G 66   ? PHE G 77   ? VAL G 66   PHE G 77   
AD3 4  GLY G 43   ? ILE G 54   ? GLY G 43   ILE G 54   
AD3 5  CYS G 38   ? THR G 39   ? CYS G 38   THR G 39   
AD4 1  GLU D 30   ? LEU D 32   ? GLU D 30   LEU D 32   
AD4 2  PHE G 2    ? LEU G 13   ? PHE G 2    LEU G 13   
AD4 3  VAL G 66   ? PHE G 77   ? VAL G 66   PHE G 77   
AD4 4  VAL G 58   ? ILE G 59   ? VAL G 58   ILE G 59   
AD5 1  VAL E 60   ? VAL E 62   ? VAL E 60   VAL E 62   
AD5 2  MET E 72   ? PHE E 75   ? MET E 72   PHE E 75   
AD5 3  ALA E 102  ? VAL E 106  ? ALA E 102  VAL E 106  
AD5 4  LEU E 127  ? LEU E 131  ? LEU E 127  LEU E 131  
AD6 1  GLU E 147  ? VAL E 150  ? GLU E 147  VAL E 150  
AD6 2  VAL E 190  ? PRO E 196  ? VAL E 190  PRO E 196  
AD6 3  ARG E 202  ? VAL E 209  ? ARG E 202  VAL E 209  
AD6 4  ARG E 172  ? ILE E 173  ? ARG E 172  ILE E 173  
AD7 1  GLY G 169  ? LEU G 170  ? GLY G 169  LEU G 170  
AD7 2  ASP G 141  ? ASP G 153  ? ASP G 141  ASP G 153  
AD7 3  ASP G 156  ? SER G 162  ? ASP G 156  SER G 162  
AD7 4  MET G 104  ? SER G 109  ? MET G 104  SER G 109  
AD7 5  GLY G 96   ? ILE G 101  ? GLY G 96   ILE G 101  
AD7 6  VAL G 84   ? ASN G 93   ? VAL G 84   ASN G 93   
AD7 7  ASP G 141  ? ASP G 153  ? ASP G 141  ASP G 153  
AD8 1  MET G 117  ? ASP G 120  ? MET G 117  ASP G 120  
AD8 2  CYS G 127  ? THR G 130  ? CYS G 127  THR G 130  
AD8 3  VAL G 136  ? ILE G 137  ? VAL G 136  ILE G 137  
AD9 1  TYR I 25   ? ASP I 29   ? TYR I 25   ASP I 29   
AD9 2  ILE I 34   ? ALA I 38   ? ILE I 34   ALA I 38   
AD9 3  GLN I 45   ? GLU I 47   ? GLN I 45   GLU I 47   
AE1 1  ARG I 80   ? THR I 81   ? ARG I 80   THR I 81   
AE1 2  ALA I 94   ? PHE I 97   ? ALA I 94   PHE I 97   
AE1 3  TYR I 111  ? CYS I 114  ? TYR I 111  CYS I 114  
AE1 4  ARG I 122  ? THR I 124  ? ARG I 122  THR I 124  
AE2 1  ILE K 19   ? LYS K 23   ? ILE K 19   LYS K 23   
AE2 2  ALA K 30   ? ASN K 36   ? ALA K 30   ASN K 36   
AE2 3  LYS K 70   ? THR K 77   ? LYS K 70   THR K 77   
AE2 4  VAL K 56   ? LYS K 62   ? VAL K 56   LYS K 62   
AE3 1  VAL M 24   ? GLU M 25   ? VAL M 24   GLU M 25   
AE3 2  MET M 32   ? ILE M 33   ? MET M 32   ILE M 33   
AE4 1  ARG N 363  ? ILE N 366  ? ARG N 363  ILE N 366  
AE4 2  LYS N 348  ? LEU N 360  ? LYS N 348  LEU N 360  
AE4 3  LYS N 369  ? GLU N 375  ? LYS N 369  GLU N 375  
AE4 4  VAL O 56   ? CYS O 68   ? VAL O 56   CYS O 68   
AE4 5  VAL O 71   ? ARG O 82   ? VAL O 71   ARG O 82   
AE4 6  LEU O 87   ? CYS O 98   ? LEU O 87   CYS O 98   
AE4 7  ASN N 333  ? SER N 345  ? ASN N 333  SER N 345  
AE4 8  LYS N 348  ? LEU N 360  ? LYS N 348  LEU N 360  
AE5 1  ALA P 190  ? GLU P 191  ? ALA P 190  GLU P 191  
AE5 2  VAL P 200  ? ILE P 204  ? VAL P 200  ILE P 204  
AE5 3  THR P 209  ? ILE P 213  ? THR P 209  ILE P 213  
AE5 4  LYS P 218  ? THR P 222  ? LYS P 218  THR P 222  
AE5 5  GLN P 164  ? ASN P 173  ? GLN P 164  ASN P 173  
AE5 6  LEU P 251  ? CYS P 262  ? LEU P 251  CYS P 262  
AE5 7  VAL P 310  ? ALA P 315  ? VAL P 310  ALA P 315  
AE5 8  VAL P 301  ? ILE P 304  ? VAL P 301  ILE P 304  
AE5 9  LEU P 291  ? ARG P 294  ? LEU P 291  ARG P 294  
AE6 1  ILE Q 72   ? MET Q 76   ? ILE Q 72   MET Q 76   
AE6 2  ILE Q 94   ? THR Q 98   ? ILE Q 94   THR Q 98   
AE7 1  PHE Q 127  ? LYS Q 128  ? PHE Q 127  LYS Q 128  
AE7 2  THR Q 135  ? PHE Q 136  ? THR Q 135  PHE Q 136  
AE8 1  GLU R 131  ? ILE R 133  ? GLU R 131  ILE R 133  
AE8 2  LYS R 136  ? ALA R 138  ? LYS R 136  ALA R 138  
AE9 1  GLY R 165  ? ILE R 166  ? GLY R 165  ILE R 166  
AE9 2  LEU R 201  ? ASN R 204  ? LEU R 201  ASN R 204  
AE9 3  ILE R 189  ? VAL R 192  ? ILE R 189  VAL R 192  
AF1 1  ALA S 45   ? ARG S 49   ? ALA S 45   ARG S 49   
AF1 2  TRP S 98   ? VAL S 102  ? TRP S 98   VAL S 102  
AF1 3  LYS S 109  ? LYS S 114  ? LYS S 109  LYS S 114  
AF1 4  ASN S 142  ? PRO S 148  ? ASN S 142  PRO S 148  
AF1 5  LYS S 25   ? ASN S 32   ? LYS S 25   ASN S 32   
AF1 6  GLN T 91   ? GLU T 98   ? GLN T 91   GLU T 98   
AF1 7  SER T 105  ? CYS T 116  ? SER T 105  CYS T 116  
AF1 8  HIS T 81   ? GLN T 86   ? HIS T 81   GLN T 86   
AF1 9  THR T 52   ? LEU T 58   ? THR T 52   LEU T 58   
AF1 10 GLY T 41   ? LYS T 47   ? GLY T 41   LYS T 47   
AF1 11 VAL S 11   ? ARG S 17   ? VAL S 11   ARG S 17   
AF1 12 ALA S 134  ? PRO S 139  ? ALA S 134  PRO S 139  
AF1 13 THR S 122  ? CYS S 130  ? THR S 122  CYS S 130  
AF1 14 GLY T 17   ? PRO T 24   ? GLY T 17   PRO T 24   
AF1 15 SER T 105  ? CYS T 116  ? SER T 105  CYS T 116  
AF2 1  TYR T 197  ? ASN T 198  ? TYR T 197  ASN T 198  
AF2 2  ASN T 231  ? GLU T 234  ? ASN T 231  GLU T 234  
AF2 3  VAL T 222  ? VAL T 225  ? VAL T 222  VAL T 225  
AF3 1  THR U 272  ? THR U 274  ? THR U 272  THR U 274  
AF3 2  PHE U 288  ? CYS U 291  ? PHE U 288  CYS U 291  
AF3 3  ASN U 296  ? LYS U 299  ? ASN U 296  LYS U 299  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  O ASP A 1449 ? O ASP A 1449 N VAL A 21   ? N VAL A 21   
AA1 2  3  N GLN A 22   ? N GLN A 22   O ALA B 1168 ? O ALA B 1168 
AA2 1  2  N ILE A 88   ? N ILE A 88   O LEU A 253  ? O LEU A 253  
AA3 1  2  N SER A 194  ? N SER A 194  O GLU A 197  ? O GLU A 197  
AA3 2  3  N ALA A 200  ? N ALA A 200  O ILE A 214  ? O ILE A 214  
AA4 1  2  O HIS B 1060 ? O HIS B 1060 N ARG A 364  ? N ARG A 364  
AA4 2  3  N ALA A 363  ? N ALA A 363  O LEU A 503  ? O LEU A 503  
AA4 3  4  O HIS A 504  ? O HIS A 504  N ILE A 457  ? N ILE A 457  
AA4 4  5  N VAL A 456  ? N VAL A 456  O HIS A 472  ? O HIS A 472  
AA4 5  6  O ARG A 473  ? O ARG A 473  N VAL A 378  ? N VAL A 378  
AA4 6  7  N GLY A 379  ? N GLY A 379  O ARG A 483  ? O ARG A 483  
AA4 7  8  O PHE A 482  ? O PHE A 482  N VAL A 366  ? N VAL A 366  
AA5 1  2  N GLU A 392  ? N GLU A 392  O VAL A 446  ? O VAL A 446  
AA5 2  3  O LYS A 445  ? O LYS A 445  N ILE A 420  ? N ILE A 420  
AA5 3  4  N ILE A 419  ? N ILE A 419  O ILE A 427  ? O ILE A 427  
AA6 1  2  N LEU A 555  ? N LEU A 555  O TRP A 586  ? O TRP A 586  
AA7 1  2  N LEU A 580  ? N LEU A 580  O VAL H 91   ? O VAL H 91   
AA7 2  3  N MET H 92   ? N MET H 92   O LEU H 143  ? O LEU H 143  
AA7 3  4  O LEU H 144  ? O LEU H 144  N VAL H 59   ? N VAL H 59   
AA7 4  5  O PHE H 56   ? O PHE H 56   N PHE H 10   ? N PHE H 10   
AA7 5  6  N LYS H 13   ? N LYS H 13   O HIS H 29   ? O HIS H 29   
AA7 6  7  N CYS H 30   ? N CYS H 30   O LEU H 39   ? O LEU H 39   
AA7 7  8  N ILE H 40   ? N ILE H 40   O ARG H 124  ? O ARG H 124  
AA7 8  9  O LEU H 121  ? O LEU H 121  N TYR H 118  ? N TYR H 118  
AA7 9  10 O SER H 117  ? O SER H 117  N LYS H 95   ? N LYS H 95   
AA8 1  2  N VAL A 629  ? N VAL A 629  O ILE A 636  ? O ILE A 636  
AA9 1  2  N GLY A 789  ? N GLY A 789  O VAL A 823  ? O VAL A 823  
AB1 1  2  N GLU A 902  ? N GLU A 902  O LEU A 979  ? O LEU A 979  
AB2 1  2  N LEU A 1311 ? N LEU A 1311 O ILE A 1335 ? O ILE A 1335 
AB2 2  3  O LEU A 1336 ? O LEU A 1336 N VAL A 1141 ? N VAL A 1141 
AB2 3  4  N THR A 1140 ? N THR A 1140 O THR A 1358 ? O THR A 1358 
AB3 1  2  N ILE A 1246 ? N ILE A 1246 O ARG A 1258 ? O ARG A 1258 
AB3 2  3  O ILE A 1259 ? O ILE A 1259 N LEU A 1212 ? N LEU A 1212 
AB3 3  4  O ARG A 1213 ? O ARG A 1213 N ALA A 1174 ? N ALA A 1174 
AB3 4  5  N ILE A 1175 ? N ILE A 1175 O TYR I 54   ? O TYR I 54   
AB4 1  2  N LEU A 1474 ? N LEU A 1474 O ILE F 105  ? O ILE F 105  
AB4 2  3  N ILE F 106  ? N ILE F 106  O TRP F 118  ? O TRP F 118  
AB5 1  2  N ILE B 65   ? N ILE B 65   O LEU B 86   ? O LEU B 86   
AB5 2  3  N TYR B 92   ? N TYR B 92   O TYR B 125  ? O TYR B 125  
AB5 3  4  N LEU B 124  ? N LEU B 124  O GLY B 150  ? O GLY B 150  
AB6 1  2  N HIS B 98   ? N HIS B 98   O SER B 106  ? O SER B 106  
AB7 1  2  N PHE B 185  ? N PHE B 185  O LYS B 192  ? O LYS B 192  
AB7 2  3  N VAL B 193  ? N VAL B 193  O GLN B 468  ? O GLN B 468  
AB8 1  2  O ASP B 394  ? O ASP B 394  N GLN B 197  ? N GLN B 197  
AB8 2  3  N ALA B 196  ? N ALA B 196  O ASN B 486  ? O ASN B 486  
AB8 3  4  N LEU B 485  ? N LEU B 485  O LYS B 524  ? O LYS B 524  
AB9 1  2  N PHE B 208  ? N PHE B 208  O THR B 218  ? O THR B 218  
AB9 2  3  N GLY B 219  ? N GLY B 219  O VAL B 237  ? O VAL B 237  
AB9 3  4  N SER B 238  ? N SER B 238  O VAL B 257  ? O VAL B 257  
AB9 4  5  N ALA B 258  ? N ALA B 258  O VAL B 267  ? O VAL B 267  
AC1 1  2  N TYR B 531  ? N TYR B 531  O CYS B 622  ? O CYS B 622  
AC1 2  3  N LEU B 625  ? N LEU B 625  O GLU B 663  ? O GLU B 663  
AC2 1  2  O LYS B 632  ? O LYS B 632  N GLU B 629  ? N GLU B 629  
AC2 2  3  N LEU B 626  ? N LEU B 626  O CYS B 696  ? O CYS B 696  
AC2 3  4  O HIS B 695  ? O HIS B 695  N ALA B 676  ? N ALA B 676  
AC3 1  2  N GLU B 551  ? N GLU B 551  O ILE B 576  ? O ILE B 576  
AC3 2  3  O HIS B 577  ? O HIS B 577  N THR B 565  ? N THR B 565  
AC3 3  4  N LYS B 566  ? N LYS B 566  O ILE B 612  ? O ILE B 612  
AC3 4  5  O GLU B 611  ? O GLU B 611  N ASP B 606  ? N ASP B 606  
AC4 1  2  N ALA B 748  ? N ALA B 748  O TYR B 811  ? O TYR B 811  
AC4 2  3  N PHE B 810  ? N PHE B 810  O SER B 925  ? O SER B 925  
AC4 3  4  O PHE B 918  ? O PHE B 918  N THR B 910  ? N THR B 910  
AC5 1  2  O GLY B 943  ? O GLY B 943  N PHE B 935  ? N PHE B 935  
AC5 2  3  N ALA B 936  ? N ALA B 936  O GLN B 1049 ? O GLN B 1049 
AC5 3  4  O TYR B 1048 ? O TYR B 1048 N ILE B 776  ? N ILE B 776  
AC5 4  5  N ALA B 781  ? N ALA B 781  O ILE B 965  ? O ILE B 965  
AC5 5  6  O ILE B 966  ? O ILE B 966  N ILE B 795  ? N ILE B 795  
AC5 6  7  N MET B 796  ? N MET B 796  O TYR B 949  ? O TYR B 949  
AC6 1  2  O GLY B 943  ? O GLY B 943  N PHE B 935  ? N PHE B 935  
AC6 2  3  N ALA B 936  ? N ALA B 936  O GLN B 1049 ? O GLN B 1049 
AC6 3  4  O ILE B 1041 ? O ILE B 1041 N GLU B 1026 ? N GLU B 1026 
AC7 1  2  N GLU B 826  ? N GLU B 826  O THR B 872  ? O THR B 872  
AC7 2  3  N VAL B 871  ? N VAL B 871  O ARG B 890  ? O ARG B 890  
AC7 3  4  O ASP B 891  ? O ASP B 891  N GLN B 838  ? N GLN B 838  
AC8 1  2  N VAL B 1116 ? N VAL B 1116 O VAL B 1149 ? O VAL B 1149 
AC9 1  2  N GLU C 13   ? N GLU C 13   O LYS C 20   ? O LYS C 20   
AC9 2  3  N PHE C 21   ? N PHE C 21   O TYR C 231  ? O TYR C 231  
AC9 3  4  O TYR C 230  ? O TYR C 230  N GLU C 185  ? N GLU C 185  
AD1 1  2  O ILE C 121  ? O ILE C 121  N THR C 102  ? N THR C 102  
AD1 2  3  N PHE C 101  ? N PHE C 101  O ALA C 163  ? O ALA C 163  
AD1 3  4  O TYR C 164  ? O TYR C 164  N TRP C 49   ? N TRP C 49   
AD1 4  5  N VAL C 50   ? N VAL C 50   O PHE L 55   ? O PHE L 55   
AD2 1  2  N VAL C 115  ? N VAL C 115  O VAL C 151  ? O VAL C 151  
AD3 1  2  N GLU D 30   ? N GLU D 30   O HIS G 4    ? O HIS G 4    
AD3 2  3  N ILE G 5    ? N ILE G 5    O ALA G 74   ? O ALA G 74   
AD3 3  4  O LYS G 71   ? O LYS G 71   N ASN G 53   ? N ASN G 53   
AD3 4  5  O GLY G 43   ? O GLY G 43   N THR G 39   ? N THR G 39   
AD4 1  2  N GLU D 30   ? N GLU D 30   O HIS G 4    ? O HIS G 4    
AD4 2  3  N ILE G 5    ? N ILE G 5    O ALA G 74   ? O ALA G 74   
AD4 3  4  O LEU G 67   ? O LEU G 67   N VAL G 58   ? N VAL G 58   
AD5 1  2  N VAL E 62   ? N VAL E 62   O MET E 72   ? O MET E 72   
AD5 2  3  N PHE E 73   ? N PHE E 73   O LEU E 103  ? O LEU E 103  
AD5 3  4  N ALA E 102  ? N ALA E 102  O GLU E 128  ? O GLU E 128  
AD6 1  2  N VAL E 149  ? N VAL E 149  O LYS E 192  ? O LYS E 192  
AD6 2  3  N VAL E 191  ? N VAL E 191  O ARG E 207  ? O ARG E 207  
AD6 3  4  O LEU E 208  ? O LEU E 208  N ILE E 173  ? N ILE E 173  
AD7 1  2  O GLY G 169  ? O GLY G 169  N ARG G 144  ? N ARG G 144  
AD7 2  3  N GLY G 149  ? N GLY G 149  O ILE G 160  ? O ILE G 160  
AD7 3  4  O GLY G 161  ? O GLY G 161  N PHE G 107  ? N PHE G 107  
AD7 4  5  O ILE G 108  ? O ILE G 108  N LEU G 97   ? N LEU G 97   
AD7 5  6  O PHE G 98   ? O PHE G 98   N GLN G 91   ? N GLN G 91   
AD7 6  7  N ALA G 87   ? N ALA G 87   O ILE G 143  ? O ILE G 143  
AD8 1  2  N GLU G 118  ? N GLU G 118  O LYS G 129  ? O LYS G 129  
AD8 2  3  N TYR G 128  ? N TYR G 128  O ILE G 137  ? O ILE G 137  
AD9 1  2  N TYR I 25   ? N TYR I 25   O ALA I 38   ? O ALA I 38   
AD9 2  3  N TYR I 37   ? N TYR I 37   O GLN I 46   ? O GLN I 46   
AE1 1  2  N THR I 81   ? N THR I 81   O ALA I 94   ? O ALA I 94   
AE1 2  3  N VAL I 95   ? N VAL I 95   O VAL I 113  ? O VAL I 113  
AE1 3  4  N TYR I 112  ? N TYR I 112  O TRP I 123  ? O TRP I 123  
AE2 1  2  N THR K 20   ? N THR K 20   O THR K 34   ? O THR K 34   
AE2 2  3  N PHE K 33   ? N PHE K 33   O ILE K 73   ? O ILE K 73   
AE2 3  4  O GLN K 76   ? O GLN K 76   N PHE K 58   ? N PHE K 58   
AE3 1  2  N VAL M 24   ? N VAL M 24   O ILE M 33   ? O ILE M 33   
AE4 1  2  O TYR N 365  ? O TYR N 365  N MET N 358  ? N MET N 358  
AE4 2  3  N TRP N 349  ? N TRP N 349  O ALA N 374  ? O ALA N 374  
AE4 3  4  N GLU N 375  ? N GLU N 375  O LEU O 62   ? O LEU O 62   
AE4 4  5  N ARG O 66   ? N ARG O 66   O THR O 73   ? O THR O 73   
AE4 5  6  N TRP O 72   ? N TRP O 72   O ALA O 97   ? O ALA O 97   
AE4 6  7  O LYS O 94   ? O LYS O 94   N VAL N 335  ? N VAL N 335  
AE4 7  8  N SER N 345  ? N SER N 345  O LYS N 348  ? O LYS N 348  
AE5 1  2  N GLU P 191  ? N GLU P 191  O ILE P 201  ? O ILE P 201  
AE5 2  3  N MET P 202  ? N MET P 202  O ALA P 211  ? O ALA P 211  
AE5 3  4  N LEU P 212  ? N LEU P 212  O VAL P 220  ? O VAL P 220  
AE5 4  5  O MET P 219  ? O MET P 219  N VAL P 172  ? N VAL P 172  
AE5 5  6  N VAL P 169  ? N VAL P 169  O ASN P 257  ? O ASN P 257  
AE5 6  7  N GLY P 260  ? N GLY P 260  O LEU P 312  ? O LEU P 312  
AE5 7  8  O THR P 313  ? O THR P 313  N VAL P 301  ? N VAL P 301  
AE5 8  9  O LEU P 302  ? O LEU P 302  N TYR P 293  ? N TYR P 293  
AE6 1  2  N LYS Q 73   ? N LYS Q 73   O ARG Q 97   ? O ARG Q 97   
AE7 1  2  N PHE Q 127  ? N PHE Q 127  O PHE Q 136  ? O PHE Q 136  
AE8 1  2  N ILE R 133  ? N ILE R 133  O LYS R 136  ? O LYS R 136  
AE9 1  2  N GLY R 165  ? N GLY R 165  O PHE R 202  ? O PHE R 202  
AE9 2  3  O PHE R 203  ? O PHE R 203  N LEU R 190  ? N LEU R 190  
AF1 1  2  N ARG S 46   ? N ARG S 46   O ARG S 101  ? O ARG S 101  
AF1 2  3  N TRP S 98   ? N TRP S 98   O GLY S 112  ? O GLY S 112  
AF1 3  4  N ILE S 113  ? N ILE S 113  O ASN S 145  ? O ASN S 145  
AF1 4  5  O ASN S 142  ? O ASN S 142  N ILE S 28   ? N ILE S 28   
AF1 5  6  N PHE S 31   ? N PHE S 31   O THR T 92   ? O THR T 92   
AF1 6  7  N LEU T 93   ? N LEU T 93   O VAL T 110  ? O VAL T 110  
AF1 7  8  O ARG T 113  ? O ARG T 113  N GLN T 86   ? N GLN T 86   
AF1 8  9  O HIS T 81   ? O HIS T 81   N PHE T 56   ? N PHE T 56   
AF1 9  10 O THR T 57   ? O THR T 57   N LYS T 42   ? N LYS T 42   
AF1 10 11 O ILE T 45   ? O ILE T 45   N THR S 12   ? N THR S 12   
AF1 11 12 N VAL S 15   ? N VAL S 15   O PHE S 135  ? O PHE S 135  
AF1 12 13 O GLU S 136  ? O GLU S 136  N THR S 128  ? N THR S 128  
AF1 13 14 N SER S 123  ? N SER S 123  O VAL T 23   ? O VAL T 23   
AF1 14 15 N LYS T 22   ? N LYS T 22   O CYS T 116  ? O CYS T 116  
AF2 1  2  N TYR T 197  ? N TYR T 197  O TRP T 233  ? O TRP T 233  
AF2 2  3  O THR T 232  ? O THR T 232  N ASN T 224  ? N ASN T 224  
AF3 1  2  N THR U 274  ? N THR U 274  O PHE U 288  ? O PHE U 288  
AF3 2  3  N CYS U 291  ? N CYS U 291  O ASN U 296  ? O ASN U 296  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG 2001 ? 3 'binding site for residue MG A 2001' 
AC2 Software A ZN 2002 ? 5 'binding site for residue ZN A 2002' 
AC3 Software A ZN 2003 ? 4 'binding site for residue ZN A 2003' 
AC4 Software B ZN 1201 ? 4 'binding site for residue ZN B 1201' 
AC5 Software C ZN 301  ? 4 'binding site for residue ZN C 301'  
AC6 Software I ZN 201  ? 4 'binding site for residue ZN I 201'  
AC7 Software I ZN 202  ? 4 'binding site for residue ZN I 202'  
AC8 Software J ZN 101  ? 4 'binding site for residue ZN J 101'  
AC9 Software L ZN 101  ? 4 'binding site for residue ZN L 101'  
AD1 Software M ZN 401  ? 6 'binding site for residue ZN M 401'  
AD2 Software Q ZN 501  ? 4 'binding site for residue ZN Q 501'  
AD3 Software U MG 401  ? 3 'binding site for residue MG U 401'  
AD4 Software U ZN 402  ? 4 'binding site for residue ZN U 402'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 ASN A 493  ? ASN A 493  . ? 1_555 ? 
2  AC1 3 ASP A 495  ? ASP A 495  . ? 1_555 ? 
3  AC1 3 ASP A 499  ? ASP A 499  . ? 1_555 ? 
4  AC2 5 CYS A 71   ? CYS A 71   . ? 1_555 ? 
5  AC2 5 GLN A 72   ? GLN A 72   . ? 1_555 ? 
6  AC2 5 CYS A 74   ? CYS A 74   . ? 1_555 ? 
7  AC2 5 CYS A 81   ? CYS A 81   . ? 1_555 ? 
8  AC2 5 HIS A 84   ? HIS A 84   . ? 1_555 ? 
9  AC3 4 CYS A 111  ? CYS A 111  . ? 1_555 ? 
10 AC3 4 CYS A 114  ? CYS A 114  . ? 1_555 ? 
11 AC3 4 CYS A 154  ? CYS A 154  . ? 1_555 ? 
12 AC3 4 CYS A 184  ? CYS A 184  . ? 1_555 ? 
13 AC4 4 CYS B 1119 ? CYS B 1119 . ? 1_555 ? 
14 AC4 4 CYS B 1122 ? CYS B 1122 . ? 1_555 ? 
15 AC4 4 CYS B 1137 ? CYS B 1137 . ? 1_555 ? 
16 AC4 4 CYS B 1140 ? CYS B 1140 . ? 1_555 ? 
17 AC5 4 CYS C 88   ? CYS C 88   . ? 1_555 ? 
18 AC5 4 CYS C 90   ? CYS C 90   . ? 1_555 ? 
19 AC5 4 CYS C 94   ? CYS C 94   . ? 1_555 ? 
20 AC5 4 CYS C 97   ? CYS C 97   . ? 1_555 ? 
21 AC6 4 CYS I 17   ? CYS I 17   . ? 1_555 ? 
22 AC6 4 CYS I 20   ? CYS I 20   . ? 1_555 ? 
23 AC6 4 CYS I 39   ? CYS I 39   . ? 1_555 ? 
24 AC6 4 CYS I 42   ? CYS I 42   . ? 1_555 ? 
25 AC7 4 CYS I 86   ? CYS I 86   . ? 1_555 ? 
26 AC7 4 CYS I 89   ? CYS I 89   . ? 1_555 ? 
27 AC7 4 CYS I 114  ? CYS I 114  . ? 1_555 ? 
28 AC7 4 CYS I 119  ? CYS I 119  . ? 1_555 ? 
29 AC8 4 CYS J 7    ? CYS J 7    . ? 1_555 ? 
30 AC8 4 CYS J 10   ? CYS J 10   . ? 1_555 ? 
31 AC8 4 CYS J 44   ? CYS J 44   . ? 1_555 ? 
32 AC8 4 CYS J 45   ? CYS J 45   . ? 1_555 ? 
33 AC9 4 CYS L 19   ? CYS L 19   . ? 1_555 ? 
34 AC9 4 CYS L 22   ? CYS L 22   . ? 1_555 ? 
35 AC9 4 CYS L 36   ? CYS L 36   . ? 1_555 ? 
36 AC9 4 CYS L 39   ? CYS L 39   . ? 1_555 ? 
37 AD1 6 CYS M 15   ? CYS M 15   . ? 1_555 ? 
38 AD1 6 ASN M 17   ? ASN M 17   . ? 1_555 ? 
39 AD1 6 HIS M 18   ? HIS M 18   . ? 1_555 ? 
40 AD1 6 CYS M 34   ? CYS M 34   . ? 1_555 ? 
41 AD1 6 CYS M 37   ? CYS M 37   . ? 1_555 ? 
42 AD1 6 LEU M 39   ? LEU M 39   . ? 1_555 ? 
43 AD2 4 CYS Q 129  ? CYS Q 129  . ? 1_555 ? 
44 AD2 4 CYS Q 132  ? CYS Q 132  . ? 1_555 ? 
45 AD2 4 CYS Q 154  ? CYS Q 154  . ? 1_555 ? 
46 AD2 4 CYS Q 157  ? CYS Q 157  . ? 1_555 ? 
47 AD3 3 ASP A 495  ? ASP A 495  . ? 1_555 ? 
48 AD3 3 GLU B 791  ? GLU B 791  . ? 1_555 ? 
49 AD3 3 ALA U 281  ? ALA U 281  . ? 1_555 ? 
50 AD4 4 CYS U 263  ? CYS U 263  . ? 1_555 ? 
51 AD4 4 CYS U 266  ? CYS U 266  . ? 1_555 ? 
52 AD4 4 CYS U 291  ? CYS U 291  . ? 1_555 ? 
53 AD4 4 CYS U 294  ? CYS U 294  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5IYB 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ASP A  1  10   ? 220.111 275.342 278.414 1.00 0.00 ? 10   ASP A N     1 
ATOM   2     C  CA    . ASP A  1  10   ? 220.885 275.652 279.611 1.00 0.00 ? 10   ASP A CA    1 
ATOM   3     C  C     . ASP A  1  10   ? 221.541 274.385 280.164 1.00 0.00 ? 10   ASP A C     1 
ATOM   4     O  O     . ASP A  1  10   ? 221.062 273.271 279.929 1.00 0.00 ? 10   ASP A O     1 
ATOM   5     C  CB    . ASP A  1  10   ? 219.988 276.309 280.674 1.00 0.00 ? 10   ASP A CB    1 
ATOM   6     C  CG    . ASP A  1  10   ? 220.758 276.748 281.917 1.00 0.00 ? 10   ASP A CG    1 
ATOM   7     O  OD1   . ASP A  1  10   ? 221.977 277.011 281.804 1.00 0.00 ? 10   ASP A OD1   1 
ATOM   8     O  OD2   . ASP A  1  10   ? 220.142 276.835 283.005 1.00 0.00 ? 10   ASP A OD2   1 
ATOM   9     N  N     . SER A  1  11   ? 222.640 274.564 280.894 1.00 0.00 ? 11   SER A N     1 
ATOM   10    C  CA    . SER A  1  11   ? 223.322 273.459 281.564 1.00 0.00 ? 11   SER A CA    1 
ATOM   11    C  C     . SER A  1  11   ? 224.163 273.972 282.731 1.00 0.00 ? 11   SER A C     1 
ATOM   12    O  O     . SER A  1  11   ? 225.369 273.721 282.797 1.00 0.00 ? 11   SER A O     1 
ATOM   13    C  CB    . SER A  1  11   ? 224.195 272.684 280.573 1.00 0.00 ? 11   SER A CB    1 
ATOM   14    O  OG    . SER A  1  11   ? 225.272 273.478 280.108 1.00 0.00 ? 11   SER A OG    1 
ATOM   15    N  N     . ALA A  1  12   ? 223.502 274.671 283.652 1.00 0.00 ? 12   ALA A N     1 
ATOM   16    C  CA    . ALA A  1  12   ? 224.131 275.288 284.823 1.00 0.00 ? 12   ALA A CA    1 
ATOM   17    C  C     . ALA A  1  12   ? 225.444 276.013 284.518 1.00 0.00 ? 12   ALA A C     1 
ATOM   18    O  O     . ALA A  1  12   ? 225.481 277.244 284.471 1.00 0.00 ? 12   ALA A O     1 
ATOM   19    C  CB    . ALA A  1  12   ? 224.361 274.235 285.906 1.00 0.00 ? 12   ALA A CB    1 
ATOM   20    N  N     . CYS A  1  13   ? 226.508 275.240 284.313 1.00 0.00 ? 13   CYS A N     1 
ATOM   21    C  CA    . CYS A  1  13   ? 227.852 275.779 284.115 1.00 0.00 ? 13   CYS A CA    1 
ATOM   22    C  C     . CYS A  1  13   ? 227.934 276.768 282.957 1.00 0.00 ? 13   CYS A C     1 
ATOM   23    O  O     . CYS A  1  13   ? 227.565 276.445 281.832 1.00 0.00 ? 13   CYS A O     1 
ATOM   24    C  CB    . CYS A  1  13   ? 228.837 274.634 283.913 1.00 0.00 ? 13   CYS A CB    1 
ATOM   25    S  SG    . CYS A  1  13   ? 228.997 273.609 285.396 1.00 0.00 ? 13   CYS A SG    1 
ATOM   26    N  N     . PRO A  1  14   ? 228.412 277.988 283.249 1.00 0.00 ? 14   PRO A N     1 
ATOM   27    C  CA    . PRO A  1  14   ? 228.423 279.132 282.330 1.00 0.00 ? 14   PRO A CA    1 
ATOM   28    C  C     . PRO A  1  14   ? 229.327 278.913 281.123 1.00 0.00 ? 14   PRO A C     1 
ATOM   29    O  O     . PRO A  1  14   ? 230.256 278.106 281.182 1.00 0.00 ? 14   PRO A O     1 
ATOM   30    C  CB    . PRO A  1  14   ? 228.948 280.276 283.202 1.00 0.00 ? 14   PRO A CB    1 
ATOM   31    C  CG    . PRO A  1  14   ? 229.793 279.602 284.220 1.00 0.00 ? 14   PRO A CG    1 
ATOM   32    C  CD    . PRO A  1  14   ? 229.118 278.291 284.507 1.00 0.00 ? 14   PRO A CD    1 
ATOM   33    N  N     . LEU A  1  15   ? 229.034 279.612 280.033 1.00 0.00 ? 15   LEU A N     1 
ATOM   34    C  CA    . LEU A  1  15   ? 229.817 279.518 278.806 1.00 0.00 ? 15   LEU A CA    1 
ATOM   35    C  C     . LEU A  1  15   ? 231.176 280.227 278.882 1.00 0.00 ? 15   LEU A C     1 
ATOM   36    O  O     . LEU A  1  15   ? 231.263 281.383 279.295 1.00 0.00 ? 15   LEU A O     1 
ATOM   37    C  CB    . LEU A  1  15   ? 229.008 280.090 277.647 1.00 0.00 ? 15   LEU A CB    1 
ATOM   38    C  CG    . LEU A  1  15   ? 229.690 280.014 276.289 1.00 0.00 ? 15   LEU A CG    1 
ATOM   39    C  CD1   . LEU A  1  15   ? 229.917 278.557 275.916 1.00 0.00 ? 15   LEU A CD1   1 
ATOM   40    C  CD2   . LEU A  1  15   ? 228.869 280.742 275.233 1.00 0.00 ? 15   LEU A CD2   1 
ATOM   41    N  N     . ARG A  1  16   ? 232.227 279.538 278.453 1.00 0.00 ? 16   ARG A N     1 
ATOM   42    C  CA    . ARG A  1  16   ? 233.577 280.096 278.457 1.00 0.00 ? 16   ARG A CA    1 
ATOM   43    C  C     . ARG A  1  16   ? 234.274 279.742 277.156 1.00 0.00 ? 16   ARG A C     1 
ATOM   44    O  O     . ARG A  1  16   ? 233.780 278.916 276.391 1.00 0.00 ? 16   ARG A O     1 
ATOM   45    C  CB    . ARG A  1  16   ? 234.404 279.556 279.623 1.00 0.00 ? 16   ARG A CB    1 
ATOM   46    C  CG    . ARG A  1  16   ? 233.954 279.969 281.002 1.00 0.00 ? 16   ARG A CG    1 
ATOM   47    C  CD    . ARG A  1  16   ? 234.087 281.454 281.214 1.00 0.00 ? 16   ARG A CD    1 
ATOM   48    N  NE    . ARG A  1  16   ? 233.712 281.796 282.580 1.00 0.00 ? 16   ARG A NE    1 
ATOM   49    C  CZ    . ARG A  1  16   ? 232.494 282.187 282.940 1.00 0.00 ? 16   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A  1  16   ? 231.536 282.285 282.025 1.00 0.00 ? 16   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A  1  16   ? 232.236 282.492 284.208 1.00 0.00 ? 16   ARG A NH2   1 
ATOM   52    N  N     . THR A  1  17   ? 235.436 280.342 276.921 1.00 0.00 ? 17   THR A N     1 
ATOM   53    C  CA    . THR A  1  17   ? 236.252 279.991 275.760 1.00 0.00 ? 17   THR A CA    1 
ATOM   54    C  C     . THR A  1  17   ? 237.601 279.481 276.256 1.00 0.00 ? 17   THR A C     1 
ATOM   55    O  O     . THR A  1  17   ? 237.962 279.689 277.417 1.00 0.00 ? 17   THR A O     1 
ATOM   56    C  CB    . THR A  1  17   ? 236.456 281.187 274.785 1.00 0.00 ? 17   THR A CB    1 
ATOM   57    O  OG1   . THR A  1  17   ? 236.848 282.357 275.514 1.00 0.00 ? 17   THR A OG1   1 
ATOM   58    C  CG2   . THR A  1  17   ? 235.173 281.484 274.014 1.00 0.00 ? 17   THR A CG2   1 
ATOM   59    N  N     . ILE A  1  18   ? 238.342 278.802 275.388 1.00 0.00 ? 18   ILE A N     1 
ATOM   60    C  CA    . ILE A  1  18   ? 239.630 278.269 275.787 1.00 0.00 ? 18   ILE A CA    1 
ATOM   61    C  C     . ILE A  1  18   ? 240.674 279.350 275.581 1.00 0.00 ? 18   ILE A C     1 
ATOM   62    O  O     . ILE A  1  18   ? 240.714 279.970 274.532 1.00 0.00 ? 18   ILE A O     1 
ATOM   63    C  CB    . ILE A  1  18   ? 239.996 277.033 274.992 1.00 0.00 ? 18   ILE A CB    1 
ATOM   64    C  CG1   . ILE A  1  18   ? 238.953 275.949 275.201 1.00 0.00 ? 18   ILE A CG1   1 
ATOM   65    C  CG2   . ILE A  1  18   ? 241.335 276.513 275.443 1.00 0.00 ? 18   ILE A CG2   1 
ATOM   66    C  CD1   . ILE A  1  18   ? 238.703 275.648 276.648 1.00 0.00 ? 18   ILE A CD1   1 
ATOM   67    N  N     . LYS A  1  19   ? 241.510 279.596 276.580 1.00 0.00 ? 19   LYS A N     1 
ATOM   68    C  CA    . LYS A  1  19   ? 242.478 280.676 276.464 1.00 0.00 ? 19   LYS A CA    1 
ATOM   69    C  C     . LYS A  1  19   ? 243.902 280.213 276.223 1.00 0.00 ? 19   LYS A C     1 
ATOM   70    O  O     . LYS A  1  19   ? 244.671 280.914 275.573 1.00 0.00 ? 19   LYS A O     1 
ATOM   71    C  CB    . LYS A  1  19   ? 242.447 281.542 277.714 1.00 0.00 ? 19   LYS A CB    1 
ATOM   72    C  CG    . LYS A  1  19   ? 243.333 282.774 277.623 1.00 0.00 ? 19   LYS A CG    1 
ATOM   73    C  CD    . LYS A  1  19   ? 243.218 283.622 278.877 1.00 0.00 ? 19   LYS A CD    1 
ATOM   74    C  CE    . LYS A  1  19   ? 241.831 284.240 278.983 1.00 0.00 ? 19   LYS A CE    1 
ATOM   75    N  NZ    . LYS A  1  19   ? 241.515 285.042 277.756 1.00 0.00 ? 19   LYS A NZ    1 
ATOM   76    N  N     . ARG A  1  20   ? 244.255 279.043 276.748 1.00 0.00 ? 20   ARG A N     1 
ATOM   77    C  CA    . ARG A  1  20   ? 245.540 278.408 276.449 1.00 0.00 ? 20   ARG A CA    1 
ATOM   78    C  C     . ARG A  1  20   ? 245.482 276.923 276.754 1.00 0.00 ? 20   ARG A C     1 
ATOM   79    O  O     . ARG A  1  20   ? 244.637 276.479 277.507 1.00 0.00 ? 20   ARG A O     1 
ATOM   80    C  CB    . ARG A  1  20   ? 246.678 279.085 277.216 1.00 0.00 ? 20   ARG A CB    1 
ATOM   81    C  CG    . ARG A  1  20   ? 246.599 278.925 278.703 1.00 0.00 ? 20   ARG A CG    1 
ATOM   82    C  CD    . ARG A  1  20   ? 247.645 279.778 279.410 1.00 0.00 ? 20   ARG A CD    1 
ATOM   83    N  NE    . ARG A  1  20   ? 247.656 279.534 280.853 1.00 0.00 ? 20   ARG A NE    1 
ATOM   84    C  CZ    . ARG A  1  20   ? 248.265 278.507 281.438 1.00 0.00 ? 20   ARG A CZ    1 
ATOM   85    N  NH1   . ARG A  1  20   ? 248.938 277.632 280.704 1.00 0.00 ? 20   ARG A NH1   1 
ATOM   86    N  NH2   . ARG A  1  20   ? 248.214 278.361 282.757 1.00 0.00 ? 20   ARG A NH2   1 
ATOM   87    N  N     . VAL A  1  21   ? 246.384 276.157 276.164 1.00 0.00 ? 21   VAL A N     1 
ATOM   88    C  CA    . VAL A  1  21   ? 246.379 274.711 276.327 1.00 0.00 ? 21   VAL A CA    1 
ATOM   89    C  C     . VAL A  1  21   ? 247.668 274.188 276.939 1.00 0.00 ? 21   VAL A C     1 
ATOM   90    O  O     . VAL A  1  21   ? 248.720 274.251 276.323 1.00 0.00 ? 21   VAL A O     1 
ATOM   91    C  CB    . VAL A  1  21   ? 246.163 274.012 274.985 1.00 0.00 ? 21   VAL A CB    1 
ATOM   92    C  CG1   . VAL A  1  21   ? 246.185 272.509 275.172 1.00 0.00 ? 21   VAL A CG1   1 
ATOM   93    C  CG2   . VAL A  1  21   ? 244.859 274.469 274.349 1.00 0.00 ? 21   VAL A CG2   1 
ATOM   94    N  N     . GLN A  1  22   ? 247.581 273.647 278.145 1.00 0.00 ? 22   GLN A N     1 
ATOM   95    C  CA    . GLN A  1  22   ? 248.771 273.233 278.870 1.00 0.00 ? 22   GLN A CA    1 
ATOM   96    C  C     . GLN A  1  22   ? 249.068 271.754 278.665 1.00 0.00 ? 22   GLN A C     1 
ATOM   97    O  O     . GLN A  1  22   ? 248.414 270.906 279.258 1.00 0.00 ? 22   GLN A O     1 
ATOM   98    C  CB    . GLN A  1  22   ? 248.591 273.530 280.357 1.00 0.00 ? 22   GLN A CB    1 
ATOM   99    C  CG    . GLN A  1  22   ? 249.879 273.606 281.132 1.00 0.00 ? 22   GLN A CG    1 
ATOM   100   C  CD    . GLN A  1  22   ? 250.798 274.683 280.592 1.00 0.00 ? 22   GLN A CD    1 
ATOM   101   O  OE1   . GLN A  1  22   ? 250.487 275.875 280.656 1.00 0.00 ? 22   GLN A OE1   1 
ATOM   102   N  NE2   . GLN A  1  22   ? 251.940 274.268 280.052 1.00 0.00 ? 22   GLN A NE2   1 
ATOM   103   N  N     . PHE A  1  23   ? 250.067 271.444 277.841 1.00 0.00 ? 23   PHE A N     1 
ATOM   104   C  CA    . PHE A  1  23   ? 250.438 270.053 277.578 1.00 0.00 ? 23   PHE A CA    1 
ATOM   105   C  C     . PHE A  1  23   ? 251.304 269.537 278.710 1.00 0.00 ? 23   PHE A C     1 
ATOM   106   O  O     . PHE A  1  23   ? 251.784 270.321 279.528 1.00 0.00 ? 23   PHE A O     1 
ATOM   107   C  CB    . PHE A  1  23   ? 251.177 269.908 276.248 1.00 0.00 ? 23   PHE A CB    1 
ATOM   108   C  CG    . PHE A  1  23   ? 250.346 270.251 275.046 1.00 0.00 ? 23   PHE A CG    1 
ATOM   109   C  CD1   . PHE A  1  23   ? 250.049 271.568 274.746 1.00 0.00 ? 23   PHE A CD1   1 
ATOM   110   C  CD2   . PHE A  1  23   ? 249.881 269.271 274.204 1.00 0.00 ? 23   PHE A CD2   1 
ATOM   111   C  CE1   . PHE A  1  23   ? 249.294 271.899 273.638 1.00 0.00 ? 23   PHE A CE1   1 
ATOM   112   C  CE2   . PHE A  1  23   ? 249.130 269.600 273.089 1.00 0.00 ? 23   PHE A CE2   1 
ATOM   113   C  CZ    . PHE A  1  23   ? 248.832 270.912 272.812 1.00 0.00 ? 23   PHE A CZ    1 
ATOM   114   N  N     . GLY A  1  24   ? 251.485 268.218 278.765 1.00 0.00 ? 24   GLY A N     1 
ATOM   115   C  CA    . GLY A  1  24   ? 252.272 267.572 279.808 1.00 0.00 ? 24   GLY A CA    1 
ATOM   116   C  C     . GLY A  1  24   ? 251.750 266.191 280.161 1.00 0.00 ? 24   GLY A C     1 
ATOM   117   O  O     . GLY A  1  24   ? 250.548 266.022 280.325 1.00 0.00 ? 24   GLY A O     1 
ATOM   118   N  N     . VAL A  1  25   ? 252.647 265.213 280.284 1.00 0.00 ? 25   VAL A N     1 
ATOM   119   C  CA    . VAL A  1  25   ? 252.255 263.823 280.507 1.00 0.00 ? 25   VAL A CA    1 
ATOM   120   C  C     . VAL A  1  25   ? 251.457 263.671 281.797 1.00 0.00 ? 25   VAL A C     1 
ATOM   121   O  O     . VAL A  1  25   ? 251.717 264.370 282.771 1.00 0.00 ? 25   VAL A O     1 
ATOM   122   C  CB    . VAL A  1  25   ? 253.489 262.906 280.560 1.00 0.00 ? 25   VAL A CB    1 
ATOM   123   C  CG1   . VAL A  1  25   ? 253.086 261.449 280.584 1.00 0.00 ? 25   VAL A CG1   1 
ATOM   124   C  CG2   . VAL A  1  25   ? 254.362 263.168 279.372 1.00 0.00 ? 25   VAL A CG2   1 
ATOM   125   N  N     . LEU A  1  26   ? 250.475 262.771 281.788 1.00 0.00 ? 26   LEU A N     1 
ATOM   126   C  CA    . LEU A  1  26   ? 249.591 262.564 282.932 1.00 0.00 ? 26   LEU A CA    1 
ATOM   127   C  C     . LEU A  1  26   ? 250.241 261.652 283.964 1.00 0.00 ? 26   LEU A C     1 
ATOM   128   O  O     . LEU A  1  26   ? 251.038 260.788 283.613 1.00 0.00 ? 26   LEU A O     1 
ATOM   129   C  CB    . LEU A  1  26   ? 248.254 261.985 282.474 1.00 0.00 ? 26   LEU A CB    1 
ATOM   130   C  CG    . LEU A  1  26   ? 248.293 260.904 281.388 1.00 0.00 ? 26   LEU A CG    1 
ATOM   131   C  CD1   . LEU A  1  26   ? 248.691 259.536 281.935 1.00 0.00 ? 26   LEU A CD1   1 
ATOM   132   C  CD2   . LEU A  1  26   ? 246.956 260.817 280.692 1.00 0.00 ? 26   LEU A CD2   1 
ATOM   133   N  N     . SER A  1  27   ? 249.893 261.834 285.232 1.00 0.00 ? 27   SER A N     1 
ATOM   134   C  CA    . SER A  1  27   ? 250.374 260.940 286.283 1.00 0.00 ? 27   SER A CA    1 
ATOM   135   C  C     . SER A  1  27   ? 249.613 259.617 286.313 1.00 0.00 ? 27   SER A C     1 
ATOM   136   O  O     . SER A  1  27   ? 248.384 259.606 286.276 1.00 0.00 ? 27   SER A O     1 
ATOM   137   C  CB    . SER A  1  27   ? 250.278 261.624 287.649 1.00 0.00 ? 27   SER A CB    1 
ATOM   138   O  OG    . SER A  1  27   ? 250.651 260.736 288.691 1.00 0.00 ? 27   SER A OG    1 
ATOM   139   N  N     . PRO A  1  28   ? 250.342 258.491 286.364 1.00 0.00 ? 28   PRO A N     1 
ATOM   140   C  CA    . PRO A  1  28   ? 249.665 257.198 286.483 1.00 0.00 ? 28   PRO A CA    1 
ATOM   141   C  C     . PRO A  1  28   ? 248.846 257.121 287.771 1.00 0.00 ? 28   PRO A C     1 
ATOM   142   O  O     . PRO A  1  28   ? 247.796 256.479 287.813 1.00 0.00 ? 28   PRO A O     1 
ATOM   143   C  CB    . PRO A  1  28   ? 250.821 256.190 286.500 1.00 0.00 ? 28   PRO A CB    1 
ATOM   144   C  CG    . PRO A  1  28   ? 252.006 256.969 286.965 1.00 0.00 ? 28   PRO A CG    1 
ATOM   145   C  CD    . PRO A  1  28   ? 251.806 258.366 286.448 1.00 0.00 ? 28   PRO A CD    1 
ATOM   146   N  N     . ASP A  1  29   ? 249.336 257.795 288.806 1.00 0.00 ? 29   ASP A N     1 
ATOM   147   C  CA    . ASP A  1  29   ? 248.682 257.855 290.108 1.00 0.00 ? 29   ASP A CA    1 
ATOM   148   C  C     . ASP A  1  29   ? 247.377 258.641 289.951 1.00 0.00 ? 29   ASP A C     1 
ATOM   149   O  O     . ASP A  1  29   ? 246.332 258.271 290.492 1.00 0.00 ? 29   ASP A O     1 
ATOM   150   C  CB    . ASP A  1  29   ? 249.599 258.479 291.166 1.00 0.00 ? 29   ASP A CB    1 
ATOM   151   C  CG    . ASP A  1  29   ? 248.944 258.557 292.544 1.00 0.00 ? 29   ASP A CG    1 
ATOM   152   O  OD1   . ASP A  1  29   ? 248.097 257.690 292.860 1.00 0.00 ? 29   ASP A OD1   1 
ATOM   153   O  OD2   . ASP A  1  29   ? 249.292 259.473 293.321 1.00 0.00 ? 29   ASP A OD2   1 
ATOM   154   N  N     . GLU A  1  30   ? 247.457 259.717 289.174 1.00 0.00 ? 30   GLU A N     1 
ATOM   155   C  CA    . GLU A  1  30   ? 246.283 260.466 288.735 1.00 0.00 ? 30   GLU A CA    1 
ATOM   156   C  C     . GLU A  1  30   ? 245.456 259.688 287.714 1.00 0.00 ? 30   GLU A C     1 
ATOM   157   O  O     . GLU A  1  30   ? 244.226 259.758 287.731 1.00 0.00 ? 30   GLU A O     1 
ATOM   158   C  CB    . GLU A  1  30   ? 246.724 261.807 288.129 1.00 0.00 ? 30   GLU A CB    1 
ATOM   159   C  CG    . GLU A  1  30   ? 245.605 262.724 287.641 1.00 0.00 ? 30   GLU A CG    1 
ATOM   160   C  CD    . GLU A  1  30   ? 244.682 263.186 288.752 1.00 0.00 ? 30   GLU A CD    1 
ATOM   161   O  OE1   . GLU A  1  30   ? 245.112 263.186 289.926 1.00 0.00 ? 30   GLU A OE1   1 
ATOM   162   O  OE2   . GLU A  1  30   ? 243.528 263.559 288.449 1.00 0.00 ? 30   GLU A OE2   1 
ATOM   163   N  N     . LEU A  1  31   ? 246.119 258.958 286.825 1.00 0.00 ? 31   LEU A N     1 
ATOM   164   C  CA    . LEU A  1  31   ? 245.417 258.196 285.798 1.00 0.00 ? 31   LEU A CA    1 
ATOM   165   C  C     . LEU A  1  31   ? 244.521 257.142 286.467 1.00 0.00 ? 31   LEU A C     1 
ATOM   166   O  O     . LEU A  1  31   ? 243.415 256.875 286.003 1.00 0.00 ? 31   LEU A O     1 
ATOM   167   C  CB    . LEU A  1  31   ? 246.392 257.545 284.813 1.00 0.00 ? 31   LEU A CB    1 
ATOM   168   C  CG    . LEU A  1  31   ? 245.739 256.651 283.751 1.00 0.00 ? 31   LEU A CG    1 
ATOM   169   C  CD1   . LEU A  1  31   ? 244.697 257.439 282.962 1.00 0.00 ? 31   LEU A CD1   1 
ATOM   170   C  CD2   . LEU A  1  31   ? 246.769 256.048 282.812 1.00 0.00 ? 31   LEU A CD2   1 
ATOM   171   N  N     . LYS A  1  32   ? 244.992 256.565 287.573 1.00 0.00 ? 32   LYS A N     1 
ATOM   172   C  CA    . LYS A  1  32   ? 244.173 255.647 288.369 1.00 0.00 ? 32   LYS A CA    1 
ATOM   173   C  C     . LYS A  1  32   ? 242.971 256.359 288.993 1.00 0.00 ? 32   LYS A C     1 
ATOM   174   O  O     . LYS A  1  32   ? 241.881 255.794 289.061 1.00 0.00 ? 32   LYS A O     1 
ATOM   175   C  CB    . LYS A  1  32   ? 245.011 254.993 289.469 1.00 0.00 ? 32   LYS A CB    1 
ATOM   176   C  CG    . LYS A  1  32   ? 245.982 253.924 288.988 1.00 0.00 ? 32   LYS A CG    1 
ATOM   177   C  CD    . LYS A  1  32   ? 246.590 253.174 290.167 1.00 0.00 ? 32   LYS A CD    1 
ATOM   178   C  CE    . LYS A  1  32   ? 247.695 253.986 290.828 1.00 0.00 ? 32   LYS A CE    1 
ATOM   179   N  NZ    . LYS A  1  32   ? 248.470 253.193 291.824 1.00 0.00 ? 32   LYS A NZ    1 
ATOM   180   N  N     . ARG A  1  33   ? 243.175 257.592 289.444 1.00 0.00 ? 33   ARG A N     1 
ATOM   181   C  CA    . ARG A  1  33   ? 242.084 258.443 289.935 1.00 0.00 ? 33   ARG A CA    1 
ATOM   182   C  C     . ARG A  1  33   ? 241.043 258.727 288.853 1.00 0.00 ? 33   ARG A C     1 
ATOM   183   O  O     . ARG A  1  33   ? 239.854 258.836 289.143 1.00 0.00 ? 33   ARG A O     1 
ATOM   184   C  CB    . ARG A  1  33   ? 242.594 259.759 290.524 1.00 0.00 ? 33   ARG A CB    1 
ATOM   185   C  CG    . ARG A  1  33   ? 243.126 259.625 291.942 1.00 0.00 ? 33   ARG A CG    1 
ATOM   186   C  CD    . ARG A  1  33   ? 243.355 260.990 292.567 1.00 0.00 ? 33   ARG A CD    1 
ATOM   187   N  NE    . ARG A  1  33   ? 244.461 261.710 291.950 1.00 0.00 ? 33   ARG A NE    1 
ATOM   188   C  CZ    . ARG A  1  33   ? 245.726 261.607 292.345 1.00 0.00 ? 33   ARG A CZ    1 
ATOM   189   N  NH1   . ARG A  1  33   ? 246.038 260.832 293.378 1.00 0.00 ? 33   ARG A NH1   1 
ATOM   190   N  NH2   . ARG A  1  33   ? 246.680 262.268 291.700 1.00 0.00 ? 33   ARG A NH2   1 
ATOM   191   N  N     . MET A  1  34   ? 241.494 258.853 287.611 1.00 0.00 ? 34   MET A N     1 
ATOM   192   C  CA    . MET A  1  34   ? 240.613 259.196 286.500 1.00 0.00 ? 34   MET A CA    1 
ATOM   193   C  C     . MET A  1  34   ? 239.559 258.135 286.208 1.00 0.00 ? 34   MET A C     1 
ATOM   194   O  O     . MET A  1  34   ? 238.376 258.357 286.458 1.00 0.00 ? 34   MET A O     1 
ATOM   195   C  CB    . MET A  1  34   ? 241.449 259.390 285.228 1.00 0.00 ? 34   MET A CB    1 
ATOM   196   C  CG    . MET A  1  34   ? 240.965 260.452 284.263 1.00 0.00 ? 34   MET A CG    1 
ATOM   197   S  SD    . MET A  1  34   ? 241.253 262.103 284.889 1.00 0.00 ? 34   MET A SD    1 
ATOM   198   C  CE    . MET A  1  34   ? 243.040 262.192 284.771 1.00 0.00 ? 34   MET A CE    1 
ATOM   199   N  N     . SER A  1  35   ? 239.976 256.987 285.691 1.00 0.00 ? 35   SER A N     1 
ATOM   200   C  CA    . SER A  1  35   ? 239.030 256.041 285.114 1.00 0.00 ? 35   SER A CA    1 
ATOM   201   C  C     . SER A  1  35   ? 238.105 255.394 286.133 1.00 0.00 ? 35   SER A C     1 
ATOM   202   O  O     . SER A  1  35   ? 238.530 255.029 287.227 1.00 0.00 ? 35   SER A O     1 
ATOM   203   C  CB    . SER A  1  35   ? 239.761 254.943 284.369 1.00 0.00 ? 35   SER A CB    1 
ATOM   204   O  OG    . SER A  1  35   ? 238.878 253.859 284.197 1.00 0.00 ? 35   SER A OG    1 
ATOM   205   N  N     . VAL A  1  36   ? 236.840 255.246 285.758 1.00 0.00 ? 36   VAL A N     1 
ATOM   206   C  CA    . VAL A  1  36   ? 235.855 254.590 286.611 1.00 0.00 ? 36   VAL A CA    1 
ATOM   207   C  C     . VAL A  1  36   ? 235.927 253.056 286.570 1.00 0.00 ? 36   VAL A C     1 
ATOM   208   O  O     . VAL A  1  36   ? 235.373 252.391 287.447 1.00 0.00 ? 36   VAL A O     1 
ATOM   209   C  CB    . VAL A  1  36   ? 234.420 255.032 286.239 1.00 0.00 ? 36   VAL A CB    1 
ATOM   210   C  CG1   . VAL A  1  36   ? 233.937 254.280 285.017 1.00 0.00 ? 36   VAL A CG1   1 
ATOM   211   C  CG2   . VAL A  1  36   ? 233.463 254.820 287.409 1.00 0.00 ? 36   VAL A CG2   1 
ATOM   212   N  N     . THR A  1  37   ? 236.597 252.490 285.569 1.00 0.00 ? 37   THR A N     1 
ATOM   213   C  CA    . THR A  1  37   ? 236.590 251.034 285.414 1.00 0.00 ? 37   THR A CA    1 
ATOM   214   C  C     . THR A  1  37   ? 237.292 250.319 286.576 1.00 0.00 ? 37   THR A C     1 
ATOM   215   O  O     . THR A  1  37   ? 236.928 249.191 286.918 1.00 0.00 ? 37   THR A O     1 
ATOM   216   C  CB    . THR A  1  37   ? 237.240 250.582 284.083 1.00 0.00 ? 37   THR A CB    1 
ATOM   217   O  OG1   . THR A  1  37   ? 237.025 249.178 283.898 1.00 0.00 ? 37   THR A OG1   1 
ATOM   218   C  CG2   . THR A  1  37   ? 238.731 250.867 284.065 1.00 0.00 ? 37   THR A CG2   1 
ATOM   219   N  N     . GLU A  1  38   ? 238.303 250.962 287.159 1.00 0.00 ? 38   GLU A N     1 
ATOM   220   C  CA    . GLU A  1  38   ? 238.943 250.488 288.390 1.00 0.00 ? 38   GLU A CA    1 
ATOM   221   C  C     . GLU A  1  38   ? 239.637 249.138 288.225 1.00 0.00 ? 38   GLU A C     1 
ATOM   222   O  O     . GLU A  1  38   ? 240.866 249.051 288.212 1.00 0.00 ? 38   GLU A O     1 
ATOM   223   C  CB    . GLU A  1  38   ? 237.916 250.396 289.517 1.00 0.00 ? 38   GLU A CB    1 
ATOM   224   C  CG    . GLU A  1  38   ? 237.498 251.735 290.081 1.00 0.00 ? 38   GLU A CG    1 
ATOM   225   C  CD    . GLU A  1  38   ? 236.617 251.588 291.301 1.00 0.00 ? 38   GLU A CD    1 
ATOM   226   O  OE1   . GLU A  1  38   ? 236.276 250.437 291.652 1.00 0.00 ? 38   GLU A OE1   1 
ATOM   227   O  OE2   . GLU A  1  38   ? 236.262 252.622 291.904 1.00 0.00 ? 38   GLU A OE2   1 
ATOM   228   N  N     . GLY A  1  39   ? 238.829 248.089 288.108 1.00 0.00 ? 39   GLY A N     1 
ATOM   229   C  CA    . GLY A  1  39   ? 239.322 246.735 287.938 1.00 0.00 ? 39   GLY A CA    1 
ATOM   230   C  C     . GLY A  1  39   ? 239.851 246.388 286.558 1.00 0.00 ? 39   GLY A C     1 
ATOM   231   O  O     . GLY A  1  39   ? 239.453 246.969 285.546 1.00 0.00 ? 39   GLY A O     1 
ATOM   232   N  N     . GLY A  1  40   ? 240.762 245.420 286.531 1.00 0.00 ? 40   GLY A N     1 
ATOM   233   C  CA    . GLY A  1  40   ? 241.399 244.985 285.304 1.00 0.00 ? 40   GLY A CA    1 
ATOM   234   C  C     . GLY A  1  40   ? 241.451 243.470 285.277 1.00 0.00 ? 40   GLY A C     1 
ATOM   235   O  O     . GLY A  1  40   ? 242.082 242.869 284.407 1.00 0.00 ? 40   GLY A O     1 
ATOM   236   N  N     . ILE A  1  41   ? 240.781 242.858 286.252 1.00 0.00 ? 41   ILE A N     1 
ATOM   237   C  CA    . ILE A  1  41   ? 240.639 241.405 286.333 1.00 0.00 ? 41   ILE A CA    1 
ATOM   238   C  C     . ILE A  1  41   ? 239.850 240.885 285.123 1.00 0.00 ? 41   ILE A C     1 
ATOM   239   O  O     . ILE A  1  41   ? 239.895 239.698 284.789 1.00 0.00 ? 41   ILE A O     1 
ATOM   240   C  CB    . ILE A  1  41   ? 239.945 240.989 287.657 1.00 0.00 ? 41   ILE A CB    1 
ATOM   241   C  CG1   . ILE A  1  41   ? 239.993 239.470 287.857 1.00 0.00 ? 41   ILE A CG1   1 
ATOM   242   C  CG2   . ILE A  1  41   ? 238.517 241.519 287.714 1.00 0.00 ? 41   ILE A CG2   1 
ATOM   243   C  CD1   . ILE A  1  41   ? 239.566 239.025 289.238 1.00 0.00 ? 41   ILE A CD1   1 
ATOM   244   N  N     . LYS A  1  42   ? 239.125 241.800 284.485 1.00 0.00 ? 42   LYS A N     1 
ATOM   245   C  CA    . LYS A  1  42   ? 238.392 241.564 283.241 1.00 0.00 ? 42   LYS A CA    1 
ATOM   246   C  C     . LYS A  1  42   ? 239.159 240.782 282.169 1.00 0.00 ? 42   LYS A C     1 
ATOM   247   O  O     . LYS A  1  42   ? 240.220 241.211 281.712 1.00 0.00 ? 42   LYS A O     1 
ATOM   248   C  CB    . LYS A  1  42   ? 237.963 242.916 282.664 1.00 0.00 ? 42   LYS A CB    1 
ATOM   249   C  CG    . LYS A  1  42   ? 239.080 243.963 282.699 1.00 0.00 ? 42   LYS A CG    1 
ATOM   250   C  CD    . LYS A  1  42   ? 238.581 245.362 282.389 1.00 0.00 ? 42   LYS A CD    1 
ATOM   251   C  CE    . LYS A  1  42   ? 239.737 246.298 282.071 1.00 0.00 ? 42   LYS A CE    1 
ATOM   252   N  NZ    . LYS A  1  42   ? 240.549 245.809 280.929 1.00 0.00 ? 42   LYS A NZ    1 
ATOM   253   N  N     . TYR A  1  43   ? 238.610 239.636 281.771 1.00 0.00 ? 43   TYR A N     1 
ATOM   254   C  CA    . TYR A  1  43   ? 239.066 238.949 280.564 1.00 0.00 ? 43   TYR A CA    1 
ATOM   255   C  C     . TYR A  1  43   ? 238.628 239.728 279.330 1.00 0.00 ? 43   TYR A C     1 
ATOM   256   O  O     . TYR A  1  43   ? 237.594 240.395 279.354 1.00 0.00 ? 43   TYR A O     1 
ATOM   257   C  CB    . TYR A  1  43   ? 238.521 237.515 280.502 1.00 0.00 ? 43   TYR A CB    1 
ATOM   258   C  CG    . TYR A  1  43   ? 239.001 236.727 279.294 1.00 0.00 ? 43   TYR A CG    1 
ATOM   259   C  CD1   . TYR A  1  43   ? 240.195 236.016 279.331 1.00 0.00 ? 43   TYR A CD1   1 
ATOM   260   C  CD2   . TYR A  1  43   ? 238.265 236.706 278.112 1.00 0.00 ? 43   TYR A CD2   1 
ATOM   261   C  CE1   . TYR A  1  43   ? 240.641 235.306 278.227 1.00 0.00 ? 43   TYR A CE1   1 
ATOM   262   C  CE2   . TYR A  1  43   ? 238.704 235.999 277.004 1.00 0.00 ? 43   TYR A CE2   1 
ATOM   263   C  CZ    . TYR A  1  43   ? 239.891 235.299 277.067 1.00 0.00 ? 43   TYR A CZ    1 
ATOM   264   O  OH    . TYR A  1  43   ? 240.325 234.591 275.970 1.00 0.00 ? 43   TYR A OH    1 
ATOM   265   N  N     . PRO A  1  44   ? 239.420 239.657 278.246 1.00 0.00 ? 44   PRO A N     1 
ATOM   266   C  CA    . PRO A  1  44   ? 239.064 240.282 276.966 1.00 0.00 ? 44   PRO A CA    1 
ATOM   267   C  C     . PRO A  1  44   ? 237.818 239.692 276.292 1.00 0.00 ? 44   PRO A C     1 
ATOM   268   O  O     . PRO A  1  44   ? 237.848 239.443 275.086 1.00 0.00 ? 44   PRO A O     1 
ATOM   269   C  CB    . PRO A  1  44   ? 240.300 240.009 276.108 1.00 0.00 ? 44   PRO A CB    1 
ATOM   270   C  CG    . PRO A  1  44   ? 241.402 240.006 277.085 1.00 0.00 ? 44   PRO A CG    1 
ATOM   271   C  CD    . PRO A  1  44   ? 240.838 239.256 278.260 1.00 0.00 ? 44   PRO A CD    1 
ATOM   272   N  N     . GLU A  1  45   ? 236.753 239.454 277.055 1.00 0.00 ? 45   GLU A N     1 
ATOM   273   C  CA    . GLU A  1  45   ? 235.482 239.018 276.485 1.00 0.00 ? 45   GLU A CA    1 
ATOM   274   C  C     . GLU A  1  45   ? 234.913 240.054 275.522 1.00 0.00 ? 45   GLU A C     1 
ATOM   275   O  O     . GLU A  1  45   ? 235.108 241.258 275.699 1.00 0.00 ? 45   GLU A O     1 
ATOM   276   C  CB    . GLU A  1  45   ? 234.467 238.724 277.592 1.00 0.00 ? 45   GLU A CB    1 
ATOM   277   C  CG    . GLU A  1  45   ? 234.717 237.417 278.322 1.00 0.00 ? 45   GLU A CG    1 
ATOM   278   C  CD    . GLU A  1  45   ? 234.602 236.211 277.406 1.00 0.00 ? 45   GLU A CD    1 
ATOM   279   O  OE1   . GLU A  1  45   ? 233.799 236.263 276.449 1.00 0.00 ? 45   GLU A OE1   1 
ATOM   280   O  OE2   . GLU A  1  45   ? 235.317 235.214 277.641 1.00 0.00 ? 45   GLU A OE2   1 
ATOM   281   N  N     . THR A  1  46   ? 234.203 239.581 274.503 1.00 0.00 ? 46   THR A N     1 
ATOM   282   C  CA    . THR A  1  46   ? 233.520 240.482 273.588 1.00 0.00 ? 46   THR A CA    1 
ATOM   283   C  C     . THR A  1  46   ? 232.341 241.115 274.318 1.00 0.00 ? 46   THR A C     1 
ATOM   284   O  O     . THR A  1  46   ? 232.245 242.340 274.420 1.00 0.00 ? 46   THR A O     1 
ATOM   285   C  CB    . THR A  1  46   ? 233.025 239.752 272.324 1.00 0.00 ? 46   THR A CB    1 
ATOM   286   O  OG1   . THR A  1  46   ? 234.112 239.035 271.724 1.00 0.00 ? 46   THR A OG1   1 
ATOM   287   C  CG2   . THR A  1  46   ? 232.451 240.745 271.316 1.00 0.00 ? 46   THR A CG2   1 
ATOM   288   N  N     . THR A  1  47   ? 231.453 240.267 274.831 1.00 0.00 ? 47   THR A N     1 
ATOM   289   C  CA    . THR A  1  47   ? 230.252 240.721 275.526 1.00 0.00 ? 47   THR A CA    1 
ATOM   290   C  C     . THR A  1  47   ? 229.749 239.681 276.519 1.00 0.00 ? 47   THR A C     1 
ATOM   291   O  O     . THR A  1  47   ? 229.525 239.974 277.696 1.00 0.00 ? 47   THR A O     1 
ATOM   292   C  CB    . THR A  1  47   ? 229.107 241.049 274.538 1.00 0.00 ? 47   THR A CB    1 
ATOM   293   O  OG1   . THR A  1  47   ? 229.459 242.193 273.748 1.00 0.00 ? 47   THR A OG1   1 
ATOM   294   C  CG2   . THR A  1  47   ? 227.812 241.337 275.292 1.00 0.00 ? 47   THR A CG2   1 
ATOM   295   N  N     . GLU A  1  48   ? 229.663 238.485 275.944 1.00 0.00 ? 48   GLU A N     1 
ATOM   296   C  CA    . GLU A  1  48   ? 229.228 237.203 276.489 1.00 0.00 ? 48   GLU A CA    1 
ATOM   297   C  C     . GLU A  1  48   ? 228.982 236.953 277.969 1.00 0.00 ? 48   GLU A C     1 
ATOM   298   O  O     . GLU A  1  48   ? 229.764 236.261 278.622 1.00 0.00 ? 48   GLU A O     1 
ATOM   299   C  CB    . GLU A  1  48   ? 230.128 236.072 275.953 1.00 0.00 ? 48   GLU A CB    1 
ATOM   300   C  CG    . GLU A  1  48   ? 231.273 236.517 275.053 1.00 0.00 ? 48   GLU A CG    1 
ATOM   301   C  CD    . GLU A  1  48   ? 230.865 236.610 273.596 1.00 0.00 ? 48   GLU A CD    1 
ATOM   302   O  OE1   . GLU A  1  48   ? 230.066 237.509 273.257 1.00 0.00 ? 48   GLU A OE1   1 
ATOM   303   O  OE2   . GLU A  1  48   ? 231.344 235.786 272.789 1.00 0.00 ? 48   GLU A OE2   1 
ATOM   304   N  N     . GLY A  1  49   ? 227.901 237.504 278.501 1.00 0.00 ? 49   GLY A N     1 
ATOM   305   C  CA    . GLY A  1  49   ? 227.531 237.149 279.866 1.00 0.00 ? 49   GLY A CA    1 
ATOM   306   C  C     . GLY A  1  49   ? 226.192 236.641 279.418 1.00 0.00 ? 49   GLY A C     1 
ATOM   307   O  O     . GLY A  1  49   ? 225.717 235.556 279.754 1.00 0.00 ? 49   GLY A O     1 
ATOM   308   N  N     . GLY A  1  50   ? 225.601 237.512 278.618 1.00 0.00 ? 50   GLY A N     1 
ATOM   309   C  CA    . GLY A  1  50   ? 224.387 237.256 277.868 1.00 0.00 ? 50   GLY A CA    1 
ATOM   310   C  C     . GLY A  1  50   ? 223.964 238.563 277.227 1.00 0.00 ? 50   GLY A C     1 
ATOM   311   O  O     . GLY A  1  50   ? 224.498 238.955 276.187 1.00 0.00 ? 50   GLY A O     1 
ATOM   312   N  N     . ARG A  1  51   ? 223.010 239.246 277.853 1.00 0.00 ? 51   ARG A N     1 
ATOM   313   C  CA    . ARG A  1  51   ? 222.669 240.614 277.465 1.00 0.00 ? 51   ARG A CA    1 
ATOM   314   C  C     . ARG A  1  51   ? 223.648 241.660 278.033 1.00 0.00 ? 51   ARG A C     1 
ATOM   315   O  O     . ARG A  1  51   ? 224.068 242.559 277.301 1.00 0.00 ? 51   ARG A O     1 
ATOM   316   C  CB    . ARG A  1  51   ? 221.235 240.955 277.893 1.00 0.00 ? 51   ARG A CB    1 
ATOM   317   C  CG    . ARG A  1  51   ? 220.775 242.344 277.463 1.00 0.00 ? 51   ARG A CG    1 
ATOM   318   C  CD    . ARG A  1  51   ? 219.420 242.700 278.059 1.00 0.00 ? 51   ARG A CD    1 
ATOM   319   N  NE    . ARG A  1  51   ? 218.348 241.851 277.544 1.00 0.00 ? 51   ARG A NE    1 
ATOM   320   C  CZ    . ARG A  1  51   ? 217.073 241.950 277.906 1.00 0.00 ? 51   ARG A CZ    1 
ATOM   321   N  NH1   . ARG A  1  51   ? 216.701 242.868 278.788 1.00 0.00 ? 51   ARG A NH1   1 
ATOM   322   N  NH2   . ARG A  1  51   ? 216.168 241.127 277.392 1.00 0.00 ? 51   ARG A NH2   1 
ATOM   323   N  N     . PRO A  1  52   ? 224.017 241.555 279.331 1.00 0.00 ? 52   PRO A N     1 
ATOM   324   C  CA    . PRO A  1  52   ? 224.976 242.553 279.824 1.00 0.00 ? 52   PRO A CA    1 
ATOM   325   C  C     . PRO A  1  52   ? 226.319 242.494 279.106 1.00 0.00 ? 52   PRO A C     1 
ATOM   326   O  O     . PRO A  1  52   ? 226.710 241.448 278.587 1.00 0.00 ? 52   PRO A O     1 
ATOM   327   C  CB    . PRO A  1  52   ? 225.147 242.195 281.308 1.00 0.00 ? 52   PRO A CB    1 
ATOM   328   C  CG    . PRO A  1  52   ? 224.546 240.855 281.488 1.00 0.00 ? 52   PRO A CG    1 
ATOM   329   C  CD    . PRO A  1  52   ? 223.535 240.676 280.414 1.00 0.00 ? 52   PRO A CD    1 
ATOM   330   N  N     . LYS A  1  53   ? 227.010 243.627 279.076 1.00 0.00 ? 53   LYS A N     1 
ATOM   331   C  CA    . LYS A  1  53   ? 228.333 243.714 278.474 1.00 0.00 ? 53   LYS A CA    1 
ATOM   332   C  C     . LYS A  1  53   ? 229.407 243.196 279.428 1.00 0.00 ? 53   LYS A C     1 
ATOM   333   O  O     . LYS A  1  53   ? 230.587 243.155 279.078 1.00 0.00 ? 53   LYS A O     1 
ATOM   334   C  CB    . LYS A  1  53   ? 228.638 245.157 278.067 1.00 0.00 ? 53   LYS A CB    1 
ATOM   335   C  CG    . LYS A  1  53   ? 227.510 245.835 277.304 1.00 0.00 ? 53   LYS A CG    1 
ATOM   336   C  CD    . LYS A  1  53   ? 227.162 245.088 276.024 1.00 0.00 ? 53   LYS A CD    1 
ATOM   337   C  CE    . LYS A  1  53   ? 228.308 245.131 275.022 1.00 0.00 ? 53   LYS A CE    1 
ATOM   338   N  NZ    . LYS A  1  53   ? 227.942 244.475 273.734 1.00 0.00 ? 53   LYS A NZ    1 
ATOM   339   N  N     . LEU A  1  54   ? 228.983 242.830 280.638 1.00 0.00 ? 54   LEU A N     1 
ATOM   340   C  CA    . LEU A  1  54   ? 229.871 242.381 281.715 1.00 0.00 ? 54   LEU A CA    1 
ATOM   341   C  C     . LEU A  1  54   ? 230.796 243.502 282.176 1.00 0.00 ? 54   LEU A C     1 
ATOM   342   O  O     . LEU A  1  54   ? 230.692 244.641 281.722 1.00 0.00 ? 54   LEU A O     1 
ATOM   343   C  CB    . LEU A  1  54   ? 230.700 241.164 281.284 1.00 0.00 ? 54   LEU A CB    1 
ATOM   344   C  CG    . LEU A  1  54   ? 229.992 239.809 281.235 1.00 0.00 ? 54   LEU A CG    1 
ATOM   345   C  CD1   . LEU A  1  54   ? 231.013 238.689 281.120 1.00 0.00 ? 54   LEU A CD1   1 
ATOM   346   C  CD2   . LEU A  1  54   ? 229.108 239.610 282.458 1.00 0.00 ? 54   LEU A CD2   1 
ATOM   347   N  N     . GLY A  1  55   ? 231.700 243.176 283.090 1.00 0.00 ? 55   GLY A N     1 
ATOM   348   C  CA    . GLY A  1  55   ? 232.736 244.108 283.479 1.00 0.00 ? 55   GLY A CA    1 
ATOM   349   C  C     . GLY A  1  55   ? 233.974 243.886 282.638 1.00 0.00 ? 55   GLY A C     1 
ATOM   350   O  O     . GLY A  1  55   ? 235.084 244.186 283.071 1.00 0.00 ? 55   GLY A O     1 
ATOM   351   N  N     . GLY A  1  56   ? 233.776 243.363 281.430 1.00 0.00 ? 56   GLY A N     1 
ATOM   352   C  CA    . GLY A  1  56   ? 234.874 242.964 280.563 1.00 0.00 ? 56   GLY A CA    1 
ATOM   353   C  C     . GLY A  1  56   ? 235.628 244.106 279.899 1.00 0.00 ? 56   GLY A C     1 
ATOM   354   O  O     . GLY A  1  56   ? 236.044 245.054 280.565 1.00 0.00 ? 56   GLY A O     1 
ATOM   355   N  N     . LEU A  1  57   ? 235.787 244.026 278.579 1.00 0.00 ? 57   LEU A N     1 
ATOM   356   C  CA    . LEU A  1  57   ? 236.693 244.920 277.859 1.00 0.00 ? 57   LEU A CA    1 
ATOM   357   C  C     . LEU A  1  57   ? 235.933 246.157 277.380 1.00 0.00 ? 57   LEU A C     1 
ATOM   358   O  O     . LEU A  1  57   ? 236.169 247.257 277.875 1.00 0.00 ? 57   LEU A O     1 
ATOM   359   C  CB    . LEU A  1  57   ? 237.356 244.185 276.686 1.00 0.00 ? 57   LEU A CB    1 
ATOM   360   C  CG    . LEU A  1  57   ? 238.643 244.738 276.064 1.00 0.00 ? 57   LEU A CG    1 
ATOM   361   C  CD1   . LEU A  1  57   ? 239.263 243.703 275.148 1.00 0.00 ? 57   LEU A CD1   1 
ATOM   362   C  CD2   . LEU A  1  57   ? 238.393 246.013 275.293 1.00 0.00 ? 57   LEU A CD2   1 
ATOM   363   N  N     . MET A  1  58   ? 235.029 245.988 276.420 1.00 0.00 ? 58   MET A N     1 
ATOM   364   C  CA    . MET A  1  58   ? 234.211 247.111 275.975 1.00 0.00 ? 58   MET A CA    1 
ATOM   365   C  C     . MET A  1  58   ? 233.069 247.351 276.957 1.00 0.00 ? 58   MET A C     1 
ATOM   366   O  O     . MET A  1  58   ? 232.523 246.406 277.522 1.00 0.00 ? 58   MET A O     1 
ATOM   367   C  CB    . MET A  1  58   ? 233.644 246.882 274.573 1.00 0.00 ? 58   MET A CB    1 
ATOM   368   C  CG    . MET A  1  58   ? 232.864 245.591 274.400 1.00 0.00 ? 58   MET A CG    1 
ATOM   369   S  SD    . MET A  1  58   ? 232.245 245.379 272.713 1.00 0.00 ? 58   MET A SD    1 
ATOM   370   C  CE    . MET A  1  58   ? 230.957 246.627 272.654 1.00 0.00 ? 58   MET A CE    1 
ATOM   371   N  N     . ASP A  1  59   ? 232.713 248.623 277.124 1.00 0.00 ? 59   ASP A N     1 
ATOM   372   C  CA    . ASP A  1  59   ? 231.799 249.111 278.166 1.00 0.00 ? 59   ASP A CA    1 
ATOM   373   C  C     . ASP A  1  59   ? 231.628 248.242 279.400 1.00 0.00 ? 59   ASP A C     1 
ATOM   374   O  O     . ASP A  1  59   ? 230.658 247.493 279.512 1.00 0.00 ? 59   ASP A O     1 
ATOM   375   C  CB    . ASP A  1  59   ? 230.407 249.373 277.590 1.00 0.00 ? 59   ASP A CB    1 
ATOM   376   C  CG    . ASP A  1  59   ? 229.447 249.931 278.636 1.00 0.00 ? 59   ASP A CG    1 
ATOM   377   O  OD1   . ASP A  1  59   ? 229.645 251.076 279.088 1.00 0.00 ? 59   ASP A OD1   1 
ATOM   378   O  OD2   . ASP A  1  59   ? 228.494 249.218 279.012 1.00 0.00 ? 59   ASP A OD2   1 
ATOM   379   N  N     . PRO A  1  60   ? 232.580 248.332 280.329 1.00 0.00 ? 60   PRO A N     1 
ATOM   380   C  CA    . PRO A  1  60   ? 232.187 247.897 281.668 1.00 0.00 ? 60   PRO A CA    1 
ATOM   381   C  C     . PRO A  1  60   ? 231.305 248.986 282.285 1.00 0.00 ? 60   PRO A C     1 
ATOM   382   O  O     . PRO A  1  60   ? 230.243 248.672 282.823 1.00 0.00 ? 60   PRO A O     1 
ATOM   383   C  CB    . PRO A  1  60   ? 233.525 247.729 282.395 1.00 0.00 ? 60   PRO A CB    1 
ATOM   384   C  CG    . PRO A  1  60   ? 234.456 248.676 281.690 1.00 0.00 ? 60   PRO A CG    1 
ATOM   385   C  CD    . PRO A  1  60   ? 234.004 248.709 280.246 1.00 0.00 ? 60   PRO A CD    1 
ATOM   386   N  N     . ARG A  1  61   ? 231.731 250.243 282.157 1.00 0.00 ? 61   ARG A N     1 
ATOM   387   C  CA    . ARG A  1  61   ? 231.029 251.408 282.691 1.00 0.00 ? 61   ARG A CA    1 
ATOM   388   C  C     . ARG A  1  61   ? 231.484 252.664 281.961 1.00 0.00 ? 61   ARG A C     1 
ATOM   389   O  O     . ARG A  1  61   ? 232.192 253.484 282.537 1.00 0.00 ? 61   ARG A O     1 
ATOM   390   C  CB    . ARG A  1  61   ? 231.278 251.589 284.196 1.00 0.00 ? 61   ARG A CB    1 
ATOM   391   C  CG    . ARG A  1  61   ? 230.586 250.590 285.114 1.00 0.00 ? 61   ARG A CG    1 
ATOM   392   C  CD    . ARG A  1  61   ? 231.155 250.631 286.520 1.00 0.00 ? 61   ARG A CD    1 
ATOM   393   N  NE    . ARG A  1  61   ? 232.543 250.187 286.576 1.00 0.00 ? 61   ARG A NE    1 
ATOM   394   C  CZ    . ARG A  1  61   ? 233.208 249.983 287.707 1.00 0.00 ? 61   ARG A CZ    1 
ATOM   395   N  NH1   . ARG A  1  61   ? 232.610 250.182 288.874 1.00 0.00 ? 61   ARG A NH1   1 
ATOM   396   N  NH2   . ARG A  1  61   ? 234.468 249.572 287.675 1.00 0.00 ? 61   ARG A NH2   1 
ATOM   397   N  N     . GLN A  1  62   ? 231.098 252.817 280.698 1.00 0.00 ? 62   GLN A N     1 
ATOM   398   C  CA    . GLN A  1  62   ? 231.561 253.965 279.907 1.00 0.00 ? 62   GLN A CA    1 
ATOM   399   C  C     . GLN A  1  62   ? 230.663 254.262 278.690 1.00 0.00 ? 62   GLN A C     1 
ATOM   400   O  O     . GLN A  1  62   ? 229.439 254.154 278.787 1.00 0.00 ? 62   GLN A O     1 
ATOM   401   C  CB    . GLN A  1  62   ? 233.020 253.749 279.486 1.00 0.00 ? 62   GLN A CB    1 
ATOM   402   C  CG    . GLN A  1  62   ? 233.271 252.524 278.634 1.00 0.00 ? 62   GLN A CG    1 
ATOM   403   C  CD    . GLN A  1  62   ? 234.709 252.439 278.168 1.00 0.00 ? 62   GLN A CD    1 
ATOM   404   O  OE1   . GLN A  1  62   ? 235.629 252.858 278.875 1.00 0.00 ? 62   GLN A OE1   1 
ATOM   405   N  NE2   . GLN A  1  62   ? 234.911 251.897 276.969 1.00 0.00 ? 62   GLN A NE2   1 
ATOM   406   N  N     . GLY A  1  63   ? 231.258 254.662 277.565 1.00 0.00 ? 63   GLY A N     1 
ATOM   407   C  CA    . GLY A  1  63   ? 230.496 255.023 276.375 1.00 0.00 ? 63   GLY A CA    1 
ATOM   408   C  C     . GLY A  1  63   ? 229.562 253.929 275.886 1.00 0.00 ? 63   GLY A C     1 
ATOM   409   O  O     . GLY A  1  63   ? 229.700 252.775 276.280 1.00 0.00 ? 63   GLY A O     1 
ATOM   410   N  N     . VAL A  1  64   ? 228.610 254.273 275.026 1.00 0.00 ? 64   VAL A N     1 
ATOM   411   C  CA    . VAL A  1  64   ? 227.591 253.301 274.644 1.00 0.00 ? 64   VAL A CA    1 
ATOM   412   C  C     . VAL A  1  64   ? 227.002 253.569 273.256 1.00 0.00 ? 64   VAL A C     1 
ATOM   413   O  O     . VAL A  1  64   ? 226.969 254.712 272.798 1.00 0.00 ? 64   VAL A O     1 
ATOM   414   C  CB    . VAL A  1  64   ? 226.454 253.263 275.702 1.00 0.00 ? 64   VAL A CB    1 
ATOM   415   C  CG1   . VAL A  1  64   ? 225.567 254.502 275.603 1.00 0.00 ? 64   VAL A CG1   1 
ATOM   416   C  CG2   . VAL A  1  64   ? 225.639 251.973 275.590 1.00 0.00 ? 64   VAL A CG2   1 
ATOM   417   N  N     . ILE A  1  65   ? 226.589 252.496 272.575 1.00 0.00 ? 65   ILE A N     1 
ATOM   418   C  CA    . ILE A  1  65   ? 225.847 252.591 271.313 1.00 0.00 ? 65   ILE A CA    1 
ATOM   419   C  C     . ILE A  1  65   ? 224.483 251.911 271.514 1.00 0.00 ? 65   ILE A C     1 
ATOM   420   O  O     . ILE A  1  65   ? 223.812 252.175 272.515 1.00 0.00 ? 65   ILE A O     1 
ATOM   421   C  CB    . ILE A  1  65   ? 226.620 251.951 270.130 1.00 0.00 ? 65   ILE A CB    1 
ATOM   422   C  CG1   . ILE A  1  65   ? 228.129 252.090 270.340 1.00 0.00 ? 65   ILE A CG1   1 
ATOM   423   C  CG2   . ILE A  1  65   ? 226.234 252.599 268.805 1.00 0.00 ? 65   ILE A CG2   1 
ATOM   424   C  CD1   . ILE A  1  65   ? 228.954 251.289 269.362 1.00 0.00 ? 65   ILE A CD1   1 
ATOM   425   N  N     . GLU A  1  66   ? 224.062 251.071 270.566 1.00 0.00 ? 66   GLU A N     1 
ATOM   426   C  CA    . GLU A  1  66   ? 222.828 250.279 270.696 1.00 0.00 ? 66   GLU A CA    1 
ATOM   427   C  C     . GLU A  1  66   ? 221.550 251.130 270.748 1.00 0.00 ? 66   GLU A C     1 
ATOM   428   O  O     . GLU A  1  66   ? 220.467 250.619 271.045 1.00 0.00 ? 66   GLU A O     1 
ATOM   429   C  CB    . GLU A  1  66   ? 222.911 249.384 271.946 1.00 0.00 ? 66   GLU A CB    1 
ATOM   430   C  CG    . GLU A  1  66   ? 221.989 248.165 271.962 1.00 0.00 ? 66   GLU A CG    1 
ATOM   431   C  CD    . GLU A  1  66   ? 222.269 247.192 270.836 1.00 0.00 ? 66   GLU A CD    1 
ATOM   432   O  OE1   . GLU A  1  66   ? 223.459 246.956 270.533 1.00 0.00 ? 66   GLU A OE1   1 
ATOM   433   O  OE2   . GLU A  1  66   ? 221.295 246.653 270.261 1.00 0.00 ? 66   GLU A OE2   1 
ATOM   434   N  N     . ARG A  1  67   ? 221.678 252.416 270.426 1.00 0.00 ? 67   ARG A N     1 
ATOM   435   C  CA    . ARG A  1  67   ? 220.565 253.363 270.495 1.00 0.00 ? 67   ARG A CA    1 
ATOM   436   C  C     . ARG A  1  67   ? 219.885 253.305 271.872 1.00 0.00 ? 67   ARG A C     1 
ATOM   437   O  O     . ARG A  1  67   ? 218.659 253.384 271.987 1.00 0.00 ? 67   ARG A O     1 
ATOM   438   C  CB    . ARG A  1  67   ? 219.558 253.089 269.377 1.00 0.00 ? 67   ARG A CB    1 
ATOM   439   C  CG    . ARG A  1  67   ? 218.637 254.257 269.071 1.00 0.00 ? 67   ARG A CG    1 
ATOM   440   C  CD    . ARG A  1  67   ? 217.662 253.906 267.963 1.00 0.00 ? 67   ARG A CD    1 
ATOM   441   N  NE    . ARG A  1  67   ? 218.293 253.892 266.646 1.00 0.00 ? 67   ARG A NE    1 
ATOM   442   C  CZ    . ARG A  1  67   ? 217.634 253.691 265.509 1.00 0.00 ? 67   ARG A CZ    1 
ATOM   443   N  NH1   . ARG A  1  67   ? 216.322 253.489 265.528 1.00 0.00 ? 67   ARG A NH1   1 
ATOM   444   N  NH2   . ARG A  1  67   ? 218.284 253.708 264.352 1.00 0.00 ? 67   ARG A NH2   1 
ATOM   445   N  N     . THR A  1  68   ? 220.702 253.152 272.912 1.00 0.00 ? 68   THR A N     1 
ATOM   446   C  CA    . THR A  1  68   ? 220.225 253.152 274.293 1.00 0.00 ? 68   THR A CA    1 
ATOM   447   C  C     . THR A  1  68   ? 220.994 254.199 275.102 1.00 0.00 ? 68   THR A C     1 
ATOM   448   O  O     . THR A  1  68   ? 222.131 254.544 274.770 1.00 0.00 ? 68   THR A O     1 
ATOM   449   C  CB    . THR A  1  68   ? 220.372 251.765 274.954 1.00 0.00 ? 68   THR A CB    1 
ATOM   450   O  OG1   . THR A  1  68   ? 219.788 251.788 276.263 1.00 0.00 ? 68   THR A OG1   1 
ATOM   451   C  CG2   . THR A  1  68   ? 221.840 251.369 275.061 1.00 0.00 ? 68   THR A CG2   1 
ATOM   452   N  N     . GLY A  1  69   ? 220.373 254.701 276.163 1.00 0.00 ? 69   GLY A N     1 
ATOM   453   C  CA    . GLY A  1  69   ? 220.923 255.832 276.889 1.00 0.00 ? 69   GLY A CA    1 
ATOM   454   C  C     . GLY A  1  69   ? 221.565 255.533 278.227 1.00 0.00 ? 69   GLY A C     1 
ATOM   455   O  O     . GLY A  1  69   ? 221.696 256.427 279.063 1.00 0.00 ? 69   GLY A O     1 
ATOM   456   N  N     . ARG A  1  70   ? 221.976 254.291 278.447 1.00 0.00 ? 70   ARG A N     1 
ATOM   457   C  CA    . ARG A  1  70   ? 222.639 253.968 279.701 1.00 0.00 ? 70   ARG A CA    1 
ATOM   458   C  C     . ARG A  1  70   ? 224.122 254.308 279.646 1.00 0.00 ? 70   ARG A C     1 
ATOM   459   O  O     . ARG A  1  70   ? 224.838 253.862 278.752 1.00 0.00 ? 70   ARG A O     1 
ATOM   460   C  CB    . ARG A  1  70   ? 222.465 252.494 280.061 1.00 0.00 ? 70   ARG A CB    1 
ATOM   461   C  CG    . ARG A  1  70   ? 223.211 252.125 281.336 1.00 0.00 ? 70   ARG A CG    1 
ATOM   462   C  CD    . ARG A  1  70   ? 223.196 250.638 281.614 1.00 0.00 ? 70   ARG A CD    1 
ATOM   463   N  NE    . ARG A  1  70   ? 224.008 250.311 282.783 1.00 0.00 ? 70   ARG A NE    1 
ATOM   464   C  CZ    . ARG A  1  70   ? 223.523 250.179 284.015 1.00 0.00 ? 70   ARG A CZ    1 
ATOM   465   N  NH1   . ARG A  1  70   ? 222.227 250.351 284.244 1.00 0.00 ? 70   ARG A NH1   1 
ATOM   466   N  NH2   . ARG A  1  70   ? 224.337 249.891 285.024 1.00 0.00 ? 70   ARG A NH2   1 
ATOM   467   N  N     . CYS A  1  71   ? 224.571 255.112 280.605 1.00 0.00 ? 71   CYS A N     1 
ATOM   468   C  CA    . CYS A  1  71   ? 225.983 255.452 280.733 1.00 0.00 ? 71   CYS A CA    1 
ATOM   469   C  C     . CYS A  1  71   ? 226.267 255.935 282.153 1.00 0.00 ? 71   CYS A C     1 
ATOM   470   O  O     . CYS A  1  71   ? 226.582 257.106 282.366 1.00 0.00 ? 71   CYS A O     1 
ATOM   471   C  CB    . CYS A  1  71   ? 226.385 256.516 279.705 1.00 0.00 ? 71   CYS A CB    1 
ATOM   472   S  SG    . CYS A  1  71   ? 228.138 256.990 279.750 1.00 0.00 ? 71   CYS A SG    1 
ATOM   473   N  N     . GLN A  1  72   ? 226.124 255.030 283.121 1.00 0.00 ? 72   GLN A N     1 
ATOM   474   C  CA    . GLN A  1  72   ? 226.305 255.357 284.535 1.00 0.00 ? 72   GLN A CA    1 
ATOM   475   C  C     . GLN A  1  72   ? 225.292 256.430 284.943 1.00 0.00 ? 72   GLN A C     1 
ATOM   476   O  O     . GLN A  1  72   ? 224.089 256.267 284.726 1.00 0.00 ? 72   GLN A O     1 
ATOM   477   C  CB    . GLN A  1  72   ? 227.738 255.819 284.830 1.00 0.00 ? 72   GLN A CB    1 
ATOM   478   C  CG    . GLN A  1  72   ? 228.812 255.042 284.094 1.00 0.00 ? 72   GLN A CG    1 
ATOM   479   C  CD    . GLN A  1  72   ? 229.767 255.957 283.358 1.00 0.00 ? 72   GLN A CD    1 
ATOM   480   O  OE1   . GLN A  1  72   ? 229.356 256.960 282.776 1.00 0.00 ? 72   GLN A OE1   1 
ATOM   481   N  NE2   . GLN A  1  72   ? 231.049 255.615 283.379 1.00 0.00 ? 72   GLN A NE2   1 
ATOM   482   N  N     . THR A  1  73   ? 225.779 257.528 285.518 1.00 0.00 ? 73   THR A N     1 
ATOM   483   C  CA    . THR A  1  73   ? 224.916 258.658 285.871 1.00 0.00 ? 73   THR A CA    1 
ATOM   484   C  C     . THR A  1  73   ? 224.804 259.641 284.709 1.00 0.00 ? 73   THR A C     1 
ATOM   485   O  O     . THR A  1  73   ? 223.813 260.367 284.586 1.00 0.00 ? 73   THR A O     1 
ATOM   486   C  CB    . THR A  1  73   ? 225.430 259.404 287.134 1.00 0.00 ? 73   THR A CB    1 
ATOM   487   O  OG1   . THR A  1  73   ? 224.478 260.402 287.529 1.00 0.00 ? 73   THR A OG1   1 
ATOM   488   C  CG2   . THR A  1  73   ? 226.784 260.064 286.875 1.00 0.00 ? 73   THR A CG2   1 
ATOM   489   N  N     . CYS A  1  74   ? 225.827 259.644 283.860 1.00 0.00 ? 74   CYS A N     1 
ATOM   490   C  CA    . CYS A  1  74   ? 225.884 260.498 282.682 1.00 0.00 ? 74   CYS A CA    1 
ATOM   491   C  C     . CYS A  1  74   ? 224.629 260.371 281.813 1.00 0.00 ? 74   CYS A C     1 
ATOM   492   O  O     . CYS A  1  74   ? 224.181 261.351 281.215 1.00 0.00 ? 74   CYS A O     1 
ATOM   493   C  CB    . CYS A  1  74   ? 227.137 260.150 281.877 1.00 0.00 ? 74   CYS A CB    1 
ATOM   494   S  SG    . CYS A  1  74   ? 227.514 261.236 280.503 1.00 0.00 ? 74   CYS A SG    1 
ATOM   495   N  N     . ALA A  1  75   ? 224.060 259.167 281.780 1.00 0.00 ? 75   ALA A N     1 
ATOM   496   C  CA    . ALA A  1  75   ? 222.856 258.863 281.007 1.00 0.00 ? 75   ALA A CA    1 
ATOM   497   C  C     . ALA A  1  75   ? 222.928 259.377 279.568 1.00 0.00 ? 75   ALA A C     1 
ATOM   498   O  O     . ALA A  1  75   ? 223.928 259.180 278.875 1.00 0.00 ? 75   ALA A O     1 
ATOM   499   C  CB    . ALA A  1  75   ? 221.630 259.435 281.709 1.00 0.00 ? 75   ALA A CB    1 
ATOM   500   N  N     . GLY A  1  76   ? 221.857 260.033 279.126 1.00 0.00 ? 76   GLY A N     1 
ATOM   501   C  CA    . GLY A  1  76   ? 221.811 260.646 277.807 1.00 0.00 ? 76   GLY A CA    1 
ATOM   502   C  C     . GLY A  1  76   ? 221.568 259.659 276.679 1.00 0.00 ? 76   GLY A C     1 
ATOM   503   O  O     . GLY A  1  76   ? 220.436 259.214 276.466 1.00 0.00 ? 76   GLY A O     1 
ATOM   504   N  N     . ASN A  1  77   ? 222.651 259.315 275.978 1.00 0.00 ? 77   ASN A N     1 
ATOM   505   C  CA    . ASN A  1  77   ? 222.656 258.358 274.866 1.00 0.00 ? 77   ASN A CA    1 
ATOM   506   C  C     . ASN A  1  77   ? 224.057 258.263 274.267 1.00 0.00 ? 77   ASN A C     1 
ATOM   507   O  O     . ASN A  1  77   ? 225.043 258.423 274.981 1.00 0.00 ? 77   ASN A O     1 
ATOM   508   C  CB    . ASN A  1  77   ? 221.630 258.738 273.787 1.00 0.00 ? 77   ASN A CB    1 
ATOM   509   C  CG    . ASN A  1  77   ? 221.964 260.042 273.079 1.00 0.00 ? 77   ASN A CG    1 
ATOM   510   O  OD1   . ASN A  1  77   ? 222.806 260.820 273.534 1.00 0.00 ? 77   ASN A OD1   1 
ATOM   511   N  ND2   . ASN A  1  77   ? 221.300 260.285 271.953 1.00 0.00 ? 77   ASN A ND2   1 
ATOM   512   N  N     . MET A  1  78   ? 224.150 257.986 272.971 1.00 0.00 ? 78   MET A N     1 
ATOM   513   C  CA    . MET A  1  78   ? 225.452 257.896 272.324 1.00 0.00 ? 78   MET A CA    1 
ATOM   514   C  C     . MET A  1  78   ? 225.938 259.262 271.834 1.00 0.00 ? 78   MET A C     1 
ATOM   515   O  O     . MET A  1  78   ? 227.136 259.464 271.649 1.00 0.00 ? 78   MET A O     1 
ATOM   516   C  CB    . MET A  1  78   ? 225.406 256.915 271.153 1.00 0.00 ? 78   MET A CB    1 
ATOM   517   C  CG    . MET A  1  78   ? 224.410 257.281 270.070 1.00 0.00 ? 78   MET A CG    1 
ATOM   518   S  SD    . MET A  1  78   ? 224.473 256.171 268.641 1.00 0.00 ? 78   MET A SD    1 
ATOM   519   C  CE    . MET A  1  78   ? 223.424 254.830 269.183 1.00 0.00 ? 78   MET A CE    1 
ATOM   520   N  N     . THR A  1  79   ? 225.012 260.195 271.620 1.00 0.00 ? 79   THR A N     1 
ATOM   521   C  CA    . THR A  1  79   ? 225.375 261.538 271.159 1.00 0.00 ? 79   THR A CA    1 
ATOM   522   C  C     . THR A  1  79   ? 225.549 262.526 272.302 1.00 0.00 ? 79   THR A C     1 
ATOM   523   O  O     . THR A  1  79   ? 226.075 263.620 272.107 1.00 0.00 ? 79   THR A O     1 
ATOM   524   C  CB    . THR A  1  79   ? 224.330 262.136 270.194 1.00 0.00 ? 79   THR A CB    1 
ATOM   525   O  OG1   . THR A  1  79   ? 223.085 262.306 270.879 1.00 0.00 ? 79   THR A OG1   1 
ATOM   526   C  CG2   . THR A  1  79   ? 224.143 261.248 268.970 1.00 0.00 ? 79   THR A CG2   1 
ATOM   527   N  N     . GLU A  1  80   ? 225.072 262.170 273.486 1.00 0.00 ? 80   GLU A N     1 
ATOM   528   C  CA    . GLU A  1  80   ? 225.253 263.049 274.625 1.00 0.00 ? 80   GLU A CA    1 
ATOM   529   C  C     . GLU A  1  80   ? 226.534 262.694 275.385 1.00 0.00 ? 80   GLU A C     1 
ATOM   530   O  O     . GLU A  1  80   ? 227.207 263.573 275.922 1.00 0.00 ? 80   GLU A O     1 
ATOM   531   C  CB    . GLU A  1  80   ? 224.033 262.998 275.546 1.00 0.00 ? 80   GLU A CB    1 
ATOM   532   C  CG    . GLU A  1  80   ? 224.077 264.028 276.660 1.00 0.00 ? 80   GLU A CG    1 
ATOM   533   C  CD    . GLU A  1  80   ? 224.093 265.462 276.137 1.00 0.00 ? 80   GLU A CD    1 
ATOM   534   O  OE1   . GLU A  1  80   ? 223.648 265.695 274.990 1.00 0.00 ? 80   GLU A OE1   1 
ATOM   535   O  OE2   . GLU A  1  80   ? 224.567 266.355 276.875 1.00 0.00 ? 80   GLU A OE2   1 
ATOM   536   N  N     . CYS A  1  81   ? 226.874 261.409 275.429 1.00 0.00 ? 81   CYS A N     1 
ATOM   537   C  CA    . CYS A  1  81   ? 228.054 260.969 276.169 1.00 0.00 ? 81   CYS A CA    1 
ATOM   538   C  C     . CYS A  1  81   ? 229.354 261.235 275.437 1.00 0.00 ? 81   CYS A C     1 
ATOM   539   O  O     . CYS A  1  81   ? 229.576 260.726 274.343 1.00 0.00 ? 81   CYS A O     1 
ATOM   540   C  CB    . CYS A  1  81   ? 227.985 259.480 276.490 1.00 0.00 ? 81   CYS A CB    1 
ATOM   541   S  SG    . CYS A  1  81   ? 229.482 258.884 277.329 1.00 0.00 ? 81   CYS A SG    1 
ATOM   542   N  N     . PRO A  1  82   ? 230.224 262.032 276.051 1.00 0.00 ? 82   PRO A N     1 
ATOM   543   C  CA    . PRO A  1  82   ? 231.582 262.270 275.560 1.00 0.00 ? 82   PRO A CA    1 
ATOM   544   C  C     . PRO A  1  82   ? 232.497 261.042 275.634 1.00 0.00 ? 82   PRO A C     1 
ATOM   545   O  O     . PRO A  1  82   ? 233.670 261.147 275.281 1.00 0.00 ? 82   PRO A O     1 
ATOM   546   C  CB    . PRO A  1  82   ? 232.090 263.388 276.476 1.00 0.00 ? 82   PRO A CB    1 
ATOM   547   C  CG    . PRO A  1  82   ? 231.287 263.259 277.709 1.00 0.00 ? 82   PRO A CG    1 
ATOM   548   C  CD    . PRO A  1  82   ? 229.930 262.810 277.261 1.00 0.00 ? 82   PRO A CD    1 
ATOM   549   N  N     . GLY A  1  83   ? 231.989 259.915 276.116 1.00 0.00 ? 83   GLY A N     1 
ATOM   550   C  CA    . GLY A  1  83   ? 232.810 258.730 276.291 1.00 0.00 ? 83   GLY A CA    1 
ATOM   551   C  C     . GLY A  1  83   ? 233.663 258.867 277.533 1.00 0.00 ? 83   GLY A C     1 
ATOM   552   O  O     . GLY A  1  83   ? 233.964 259.982 277.948 1.00 0.00 ? 83   GLY A O     1 
ATOM   553   N  N     . HIS A  1  84   ? 234.056 257.746 278.130 1.00 0.00 ? 84   HIS A N     1 
ATOM   554   C  CA    . HIS A  1  84   ? 234.822 257.784 279.375 1.00 0.00 ? 84   HIS A CA    1 
ATOM   555   C  C     . HIS A  1  84   ? 236.025 256.856 279.336 1.00 0.00 ? 84   HIS A C     1 
ATOM   556   O  O     . HIS A  1  84   ? 235.996 255.811 278.690 1.00 0.00 ? 84   HIS A O     1 
ATOM   557   C  CB    . HIS A  1  84   ? 233.931 257.429 280.562 1.00 0.00 ? 84   HIS A CB    1 
ATOM   558   C  CG    . HIS A  1  84   ? 232.708 258.283 280.669 1.00 0.00 ? 84   HIS A CG    1 
ATOM   559   N  ND1   . HIS A  1  84   ? 232.720 259.530 281.255 1.00 0.00 ? 84   HIS A ND1   1 
ATOM   560   C  CD2   . HIS A  1  84   ? 231.434 258.071 280.260 1.00 0.00 ? 84   HIS A CD2   1 
ATOM   561   C  CE1   . HIS A  1  84   ? 231.506 260.050 281.204 1.00 0.00 ? 84   HIS A CE1   1 
ATOM   562   N  NE2   . HIS A  1  84   ? 230.707 259.185 280.607 1.00 0.00 ? 84   HIS A NE2   1 
ATOM   563   N  N     . PHE A  1  85   ? 237.078 257.239 280.046 1.00 0.00 ? 85   PHE A N     1 
ATOM   564   C  CA    . PHE A  1  85   ? 238.333 256.497 280.036 1.00 0.00 ? 85   PHE A CA    1 
ATOM   565   C  C     . PHE A  1  85   ? 238.239 255.211 280.818 1.00 0.00 ? 85   PHE A C     1 
ATOM   566   O  O     . PHE A  1  85   ? 237.536 255.154 281.824 1.00 0.00 ? 85   PHE A O     1 
ATOM   567   C  CB    . PHE A  1  85   ? 239.449 257.332 280.643 1.00 0.00 ? 85   PHE A CB    1 
ATOM   568   C  CG    . PHE A  1  85   ? 239.918 258.430 279.765 1.00 0.00 ? 85   PHE A CG    1 
ATOM   569   C  CD1   . PHE A  1  85   ? 240.043 258.235 278.409 1.00 0.00 ? 85   PHE A CD1   1 
ATOM   570   C  CD2   . PHE A  1  85   ? 240.222 259.669 280.295 1.00 0.00 ? 85   PHE A CD2   1 
ATOM   571   C  CE1   . PHE A  1  85   ? 240.466 259.242 277.597 1.00 0.00 ? 85   PHE A CE1   1 
ATOM   572   C  CE2   . PHE A  1  85   ? 240.647 260.683 279.484 1.00 0.00 ? 85   PHE A CE2   1 
ATOM   573   C  CZ    . PHE A  1  85   ? 240.764 260.465 278.132 1.00 0.00 ? 85   PHE A CZ    1 
ATOM   574   N  N     . GLY A  1  86   ? 238.923 254.166 280.364 1.00 0.00 ? 86   GLY A N     1 
ATOM   575   C  CA    . GLY A  1  86   ? 239.199 253.088 281.289 1.00 0.00 ? 86   GLY A CA    1 
ATOM   576   C  C     . GLY A  1  86   ? 240.671 253.146 281.651 1.00 0.00 ? 86   GLY A C     1 
ATOM   577   O  O     . GLY A  1  86   ? 241.335 254.137 281.344 1.00 0.00 ? 86   GLY A O     1 
ATOM   578   N  N     . HIS A  1  87   ? 241.189 252.100 282.291 1.00 0.00 ? 87   HIS A N     1 
ATOM   579   C  CA    . HIS A  1  87   ? 242.628 251.951 282.473 1.00 0.00 ? 87   HIS A CA    1 
ATOM   580   C  C     . HIS A  1  87   ? 243.046 250.477 282.567 1.00 0.00 ? 87   HIS A C     1 
ATOM   581   O  O     . HIS A  1  87   ? 242.220 249.608 282.840 1.00 0.00 ? 87   HIS A O     1 
ATOM   582   C  CB    . HIS A  1  87   ? 243.080 252.801 283.674 1.00 0.00 ? 87   HIS A CB    1 
ATOM   583   C  CG    . HIS A  1  87   ? 242.889 252.163 285.012 1.00 0.00 ? 87   HIS A CG    1 
ATOM   584   N  ND1   . HIS A  1  87   ? 243.427 250.941 285.355 1.00 0.00 ? 87   HIS A ND1   1 
ATOM   585   C  CD2   . HIS A  1  87   ? 242.220 252.597 286.105 1.00 0.00 ? 87   HIS A CD2   1 
ATOM   586   C  CE1   . HIS A  1  87   ? 243.089 250.647 286.598 1.00 0.00 ? 87   HIS A CE1   1 
ATOM   587   N  NE2   . HIS A  1  87   ? 242.357 251.636 287.075 1.00 0.00 ? 87   HIS A NE2   1 
ATOM   588   N  N     . ILE A  1  88   ? 244.327 250.207 282.326 1.00 0.00 ? 88   ILE A N     1 
ATOM   589   C  CA    . ILE A  1  88   ? 244.947 248.898 282.558 1.00 0.00 ? 88   ILE A CA    1 
ATOM   590   C  C     . ILE A  1  88   ? 246.195 248.948 283.437 1.00 0.00 ? 88   ILE A C     1 
ATOM   591   O  O     . ILE A  1  88   ? 247.067 249.782 283.206 1.00 0.00 ? 88   ILE A O     1 
ATOM   592   C  CB    . ILE A  1  88   ? 245.345 248.210 281.231 1.00 0.00 ? 88   ILE A CB    1 
ATOM   593   C  CG1   . ILE A  1  88   ? 244.120 247.704 280.488 1.00 0.00 ? 88   ILE A CG1   1 
ATOM   594   C  CG2   . ILE A  1  88   ? 246.254 247.031 281.473 1.00 0.00 ? 88   ILE A CG2   1 
ATOM   595   C  CD1   . ILE A  1  88   ? 244.349 247.622 279.009 1.00 0.00 ? 88   ILE A CD1   1 
ATOM   596   N  N     . GLU A  1  89   ? 246.284 248.094 284.454 1.00 0.00 ? 89   GLU A N     1 
ATOM   597   C  CA    . GLU A  1  89   ? 247.473 248.092 285.305 1.00 0.00 ? 89   GLU A CA    1 
ATOM   598   C  C     . GLU A  1  89   ? 248.391 246.962 284.840 1.00 0.00 ? 89   GLU A C     1 
ATOM   599   O  O     . GLU A  1  89   ? 248.011 245.790 284.868 1.00 0.00 ? 89   GLU A O     1 
ATOM   600   C  CB    . GLU A  1  89   ? 247.135 247.896 286.778 1.00 0.00 ? 89   GLU A CB    1 
ATOM   601   C  CG    . GLU A  1  89   ? 248.320 248.188 287.683 1.00 0.00 ? 89   GLU A CG    1 
ATOM   602   C  CD    . GLU A  1  89   ? 248.007 247.986 289.152 1.00 0.00 ? 89   GLU A CD    1 
ATOM   603   O  OE1   . GLU A  1  89   ? 246.932 247.424 289.459 1.00 0.00 ? 89   GLU A OE1   1 
ATOM   604   O  OE2   . GLU A  1  89   ? 248.844 248.379 289.997 1.00 0.00 ? 89   GLU A OE2   1 
ATOM   605   N  N     . LEU A  1  90   ? 249.604 247.311 284.428 1.00 0.00 ? 90   LEU A N     1 
ATOM   606   C  CA    . LEU A  1  90   ? 250.496 246.336 283.813 1.00 0.00 ? 90   LEU A CA    1 
ATOM   607   C  C     . LEU A  1  90   ? 251.167 245.445 284.847 1.00 0.00 ? 90   LEU A C     1 
ATOM   608   O  O     . LEU A  1  90   ? 251.047 245.674 286.048 1.00 0.00 ? 90   LEU A O     1 
ATOM   609   C  CB    . LEU A  1  90   ? 251.550 247.043 282.966 1.00 0.00 ? 90   LEU A CB    1 
ATOM   610   C  CG    . LEU A  1  90   ? 250.982 247.858 281.809 1.00 0.00 ? 90   LEU A CG    1 
ATOM   611   C  CD1   . LEU A  1  90   ? 252.093 248.463 280.986 1.00 0.00 ? 90   LEU A CD1   1 
ATOM   612   C  CD2   . LEU A  1  90   ? 250.117 246.968 280.946 1.00 0.00 ? 90   LEU A CD2   1 
ATOM   613   N  N     . ALA A  1  91   ? 251.876 244.425 284.370 1.00 0.00 ? 91   ALA A N     1 
ATOM   614   C  CA    . ALA A  1  91   ? 252.515 243.449 285.244 1.00 0.00 ? 91   ALA A CA    1 
ATOM   615   C  C     . ALA A  1  91   ? 253.884 243.970 285.632 1.00 0.00 ? 91   ALA A C     1 
ATOM   616   O  O     . ALA A  1  91   ? 254.331 243.814 286.766 1.00 0.00 ? 91   ALA A O     1 
ATOM   617   C  CB    . ALA A  1  91   ? 252.629 242.106 284.561 1.00 0.00 ? 91   ALA A CB    1 
ATOM   618   N  N     . LYS A  1  92   ? 254.546 244.587 284.663 1.00 0.00 ? 92   LYS A N     1 
ATOM   619   C  CA    . LYS A  1  92   ? 255.774 245.322 284.902 1.00 0.00 ? 92   LYS A CA    1 
ATOM   620   C  C     . LYS A  1  92   ? 255.713 246.626 284.111 1.00 0.00 ? 92   LYS A C     1 
ATOM   621   O  O     . LYS A  1  92   ? 254.999 246.712 283.113 1.00 0.00 ? 92   LYS A O     1 
ATOM   622   C  CB    . LYS A  1  92   ? 256.990 244.497 284.490 1.00 0.00 ? 92   LYS A CB    1 
ATOM   623   C  CG    . LYS A  1  92   ? 257.202 243.259 285.320 1.00 0.00 ? 92   LYS A CG    1 
ATOM   624   C  CD    . LYS A  1  92   ? 258.528 242.615 284.998 1.00 0.00 ? 92   LYS A CD    1 
ATOM   625   C  CE    . LYS A  1  92   ? 258.683 241.321 285.764 1.00 0.00 ? 92   LYS A CE    1 
ATOM   626   N  NZ    . LYS A  1  92   ? 258.542 241.560 287.222 1.00 0.00 ? 92   LYS A NZ    1 
ATOM   627   N  N     . PRO A  1  93   ? 256.456 247.651 284.554 1.00 0.00 ? 93   PRO A N     1 
ATOM   628   C  CA    . PRO A  1  93   ? 256.491 248.904 283.788 1.00 0.00 ? 93   PRO A CA    1 
ATOM   629   C  C     . PRO A  1  93   ? 257.266 248.739 282.479 1.00 0.00 ? 93   PRO A C     1 
ATOM   630   O  O     . PRO A  1  93   ? 258.249 248.005 282.455 1.00 0.00 ? 93   PRO A O     1 
ATOM   631   C  CB    . PRO A  1  93   ? 257.201 249.874 284.735 1.00 0.00 ? 93   PRO A CB    1 
ATOM   632   C  CG    . PRO A  1  93   ? 257.989 249.001 285.661 1.00 0.00 ? 93   PRO A CG    1 
ATOM   633   C  CD    . PRO A  1  93   ? 257.186 247.750 285.831 1.00 0.00 ? 93   PRO A CD    1 
ATOM   634   N  N     . VAL A  1  94   ? 256.848 249.423 281.418 1.00 0.00 ? 94   VAL A N     1 
ATOM   635   C  CA    . VAL A  1  94   ? 257.528 249.297 280.128 1.00 0.00 ? 94   VAL A CA    1 
ATOM   636   C  C     . VAL A  1  94   ? 257.700 250.640 279.435 1.00 0.00 ? 94   VAL A C     1 
ATOM   637   O  O     . VAL A  1  94   ? 256.958 251.583 279.700 1.00 0.00 ? 94   VAL A O     1 
ATOM   638   C  CB    . VAL A  1  94   ? 256.773 248.358 279.171 1.00 0.00 ? 94   VAL A CB    1 
ATOM   639   C  CG1   . VAL A  1  94   ? 256.886 246.916 279.636 1.00 0.00 ? 94   VAL A CG1   1 
ATOM   640   C  CG2   . VAL A  1  94   ? 255.323 248.777 279.062 1.00 0.00 ? 94   VAL A CG2   1 
ATOM   641   N  N     . PHE A  1  95   ? 258.669 250.714 278.524 1.00 0.00 ? 95   PHE A N     1 
ATOM   642   C  CA    . PHE A  1  95   ? 258.973 251.960 277.839 1.00 0.00 ? 95   PHE A CA    1 
ATOM   643   C  C     . PHE A  1  95   ? 257.819 252.375 276.952 1.00 0.00 ? 95   PHE A C     1 
ATOM   644   O  O     . PHE A  1  95   ? 257.108 251.533 276.412 1.00 0.00 ? 95   PHE A O     1 
ATOM   645   C  CB    . PHE A  1  95   ? 260.239 251.833 276.995 1.00 0.00 ? 95   PHE A CB    1 
ATOM   646   C  CG    . PHE A  1  95   ? 261.464 251.526 277.788 1.00 0.00 ? 95   PHE A CG    1 
ATOM   647   C  CD1   . PHE A  1  95   ? 262.071 252.502 278.551 1.00 0.00 ? 95   PHE A CD1   1 
ATOM   648   C  CD2   . PHE A  1  95   ? 262.030 250.267 277.746 1.00 0.00 ? 95   PHE A CD2   1 
ATOM   649   C  CE1   . PHE A  1  95   ? 263.208 252.221 279.278 1.00 0.00 ? 95   PHE A CE1   1 
ATOM   650   C  CE2   . PHE A  1  95   ? 263.171 249.983 278.461 1.00 0.00 ? 95   PHE A CE2   1 
ATOM   651   C  CZ    . PHE A  1  95   ? 263.757 250.957 279.232 1.00 0.00 ? 95   PHE A CZ    1 
ATOM   652   N  N     . HIS A  1  96   ? 257.621 253.680 276.827 1.00 0.00 ? 96   HIS A N     1 
ATOM   653   C  CA    . HIS A  1  96   ? 256.666 254.213 275.872 1.00 0.00 ? 96   HIS A CA    1 
ATOM   654   C  C     . HIS A  1  96   ? 257.358 254.698 274.601 1.00 0.00 ? 96   HIS A C     1 
ATOM   655   O  O     . HIS A  1  96   ? 258.174 255.617 274.648 1.00 0.00 ? 96   HIS A O     1 
ATOM   656   C  CB    . HIS A  1  96   ? 255.864 255.340 276.495 1.00 0.00 ? 96   HIS A CB    1 
ATOM   657   C  CG    . HIS A  1  96   ? 254.785 255.846 275.603 1.00 0.00 ? 96   HIS A CG    1 
ATOM   658   N  ND1   . HIS A  1  96   ? 254.915 256.997 274.859 1.00 0.00 ? 96   HIS A ND1   1 
ATOM   659   C  CD2   . HIS A  1  96   ? 253.570 255.333 275.299 1.00 0.00 ? 96   HIS A CD2   1 
ATOM   660   C  CE1   . HIS A  1  96   ? 253.816 257.185 274.152 1.00 0.00 ? 96   HIS A CE1   1 
ATOM   661   N  NE2   . HIS A  1  96   ? 252.984 256.189 274.402 1.00 0.00 ? 96   HIS A NE2   1 
ATOM   662   N  N     . VAL A  1  97   ? 257.013 254.087 273.470 1.00 0.00 ? 97   VAL A N     1 
ATOM   663   C  CA    . VAL A  1  97   ? 257.735 254.279 272.210 1.00 0.00 ? 97   VAL A CA    1 
ATOM   664   C  C     . VAL A  1  97   ? 257.871 255.739 271.753 1.00 0.00 ? 97   VAL A C     1 
ATOM   665   O  O     . VAL A  1  97   ? 258.899 256.117 271.193 1.00 0.00 ? 97   VAL A O     1 
ATOM   666   C  CB    . VAL A  1  97   ? 257.081 253.454 271.068 1.00 0.00 ? 97   VAL A CB    1 
ATOM   667   C  CG1   . VAL A  1  97   ? 255.678 253.952 270.768 1.00 0.00 ? 97   VAL A CG1   1 
ATOM   668   C  CG2   . VAL A  1  97   ? 257.948 253.482 269.812 1.00 0.00 ? 97   VAL A CG2   1 
ATOM   669   N  N     . GLY A  1  98   ? 256.855 256.561 271.995 1.00 0.00 ? 98   GLY A N     1 
ATOM   670   C  CA    . GLY A  1  98   ? 256.907 257.950 271.573 1.00 0.00 ? 98   GLY A CA    1 
ATOM   671   C  C     . GLY A  1  98   ? 257.972 258.717 272.332 1.00 0.00 ? 98   GLY A C     1 
ATOM   672   O  O     . GLY A  1  98   ? 258.656 259.579 271.779 1.00 0.00 ? 98   GLY A O     1 
ATOM   673   N  N     . PHE A  1  99   ? 258.097 258.399 273.615 1.00 0.00 ? 99   PHE A N     1 
ATOM   674   C  CA    . PHE A  1  99   ? 259.121 258.975 274.482 1.00 0.00 ? 99   PHE A CA    1 
ATOM   675   C  C     . PHE A  1  99   ? 260.497 258.316 274.374 1.00 0.00 ? 99   PHE A C     1 
ATOM   676   O  O     . PHE A  1  99   ? 261.468 258.845 274.910 1.00 0.00 ? 99   PHE A O     1 
ATOM   677   C  CB    . PHE A  1  99   ? 258.647 258.961 275.932 1.00 0.00 ? 99   PHE A CB    1 
ATOM   678   C  CG    . PHE A  1  99   ? 257.420 259.788 276.162 1.00 0.00 ? 99   PHE A CG    1 
ATOM   679   C  CD1   . PHE A  1  99   ? 257.373 261.102 275.729 1.00 0.00 ? 99   PHE A CD1   1 
ATOM   680   C  CD2   . PHE A  1  99   ? 256.318 259.261 276.810 1.00 0.00 ? 99   PHE A CD2   1 
ATOM   681   C  CE1   . PHE A  1  99   ? 256.253 261.871 275.928 1.00 0.00 ? 99   PHE A CE1   1 
ATOM   682   C  CE2   . PHE A  1  99   ? 255.195 260.030 277.018 1.00 0.00 ? 99   PHE A CE2   1 
ATOM   683   C  CZ    . PHE A  1  99   ? 255.163 261.336 276.574 1.00 0.00 ? 99   PHE A CZ    1 
ATOM   684   N  N     . LEU A  1  100  ? 260.574 257.164 273.709 1.00 0.00 ? 100  LEU A N     1 
ATOM   685   C  CA    . LEU A  1  100  ? 261.760 256.306 273.765 1.00 0.00 ? 100  LEU A CA    1 
ATOM   686   C  C     . LEU A  1  100  ? 263.079 257.028 273.484 1.00 0.00 ? 100  LEU A C     1 
ATOM   687   O  O     . LEU A  1  100  ? 264.078 256.775 274.159 1.00 0.00 ? 100  LEU A O     1 
ATOM   688   C  CB    . LEU A  1  100  ? 261.615 255.152 272.772 1.00 0.00 ? 100  LEU A CB    1 
ATOM   689   C  CG    . LEU A  1  100  ? 262.699 254.082 272.842 1.00 0.00 ? 100  LEU A CG    1 
ATOM   690   C  CD1   . LEU A  1  100  ? 262.649 253.399 274.192 1.00 0.00 ? 100  LEU A CD1   1 
ATOM   691   C  CD2   . LEU A  1  100  ? 262.533 253.076 271.714 1.00 0.00 ? 100  LEU A CD2   1 
ATOM   692   N  N     . VAL A  1  101  ? 263.094 257.900 272.482 1.00 0.00 ? 101  VAL A N     1 
ATOM   693   C  CA    . VAL A  1  101  ? 264.270 258.729 272.203 1.00 0.00 ? 101  VAL A CA    1 
ATOM   694   C  C     . VAL A  1  101  ? 264.598 259.734 273.330 1.00 0.00 ? 101  VAL A C     1 
ATOM   695   O  O     . VAL A  1  101  ? 265.744 259.829 273.773 1.00 0.00 ? 101  VAL A O     1 
ATOM   696   C  CB    . VAL A  1  101  ? 264.100 259.486 270.869 1.00 0.00 ? 101  VAL A CB    1 
ATOM   697   C  CG1   . VAL A  1  101  ? 265.319 260.346 270.581 1.00 0.00 ? 101  VAL A CG1   1 
ATOM   698   C  CG2   . VAL A  1  101  ? 263.862 258.499 269.736 1.00 0.00 ? 101  VAL A CG2   1 
ATOM   699   N  N     . LYS A  1  102  ? 263.579 260.461 273.790 1.00 0.00 ? 102  LYS A N     1 
ATOM   700   C  CA    . LYS A  1  102  ? 263.709 261.494 274.830 1.00 0.00 ? 102  LYS A CA    1 
ATOM   701   C  C     . LYS A  1  102  ? 264.146 260.998 276.204 1.00 0.00 ? 102  LYS A C     1 
ATOM   702   O  O     . LYS A  1  102  ? 264.953 261.643 276.865 1.00 0.00 ? 102  LYS A O     1 
ATOM   703   C  CB    . LYS A  1  102  ? 262.389 262.245 274.987 1.00 0.00 ? 102  LYS A CB    1 
ATOM   704   C  CG    . LYS A  1  102  ? 261.911 262.905 273.717 1.00 0.00 ? 102  LYS A CG    1 
ATOM   705   C  CD    . LYS A  1  102  ? 262.857 263.998 273.272 1.00 0.00 ? 102  LYS A CD    1 
ATOM   706   C  CE    . LYS A  1  102  ? 262.464 264.484 271.900 1.00 0.00 ? 102  LYS A CE    1 
ATOM   707   N  NZ    . LYS A  1  102  ? 261.237 265.308 271.995 1.00 0.00 ? 102  LYS A NZ    1 
ATOM   708   N  N     . THR A  1  103  ? 263.597 259.871 276.636 1.00 0.00 ? 103  THR A N     1 
ATOM   709   C  CA    . THR A  1  103  ? 264.064 259.202 277.847 1.00 0.00 ? 103  THR A CA    1 
ATOM   710   C  C     . THR A  1  103  ? 265.539 258.847 277.766 1.00 0.00 ? 103  THR A C     1 
ATOM   711   O  O     . THR A  1  103  ? 266.278 259.015 278.737 1.00 0.00 ? 103  THR A O     1 
ATOM   712   C  CB    . THR A  1  103  ? 263.275 257.920 278.129 1.00 0.00 ? 103  THR A CB    1 
ATOM   713   O  OG1   . THR A  1  103  ? 263.386 257.034 277.010 1.00 0.00 ? 103  THR A OG1   1 
ATOM   714   C  CG2   . THR A  1  103  ? 261.815 258.241 278.388 1.00 0.00 ? 103  THR A CG2   1 
ATOM   715   N  N     . MET A  1  104  ? 265.967 258.355 276.612 1.00 0.00 ? 104  MET A N     1 
ATOM   716   C  CA    . MET A  1  104  ? 267.367 258.020 276.411 1.00 0.00 ? 104  MET A CA    1 
ATOM   717   C  C     . MET A  1  104  ? 268.245 259.270 276.522 1.00 0.00 ? 104  MET A C     1 
ATOM   718   O  O     . MET A  1  104  ? 269.339 259.205 277.074 1.00 0.00 ? 104  MET A O     1 
ATOM   719   C  CB    . MET A  1  104  ? 267.571 257.331 275.064 1.00 0.00 ? 104  MET A CB    1 
ATOM   720   C  CG    . MET A  1  104  ? 268.960 256.755 274.886 1.00 0.00 ? 104  MET A CG    1 
ATOM   721   S  SD    . MET A  1  104  ? 269.057 255.681 273.450 1.00 0.00 ? 104  MET A SD    1 
ATOM   722   C  CE    . MET A  1  104  ? 268.907 256.888 272.132 1.00 0.00 ? 104  MET A CE    1 
ATOM   723   N  N     . LYS A  1  105  ? 267.777 260.401 276.000 1.00 0.00 ? 105  LYS A N     1 
ATOM   724   C  CA    . LYS A  1  105  ? 268.495 261.663 276.178 1.00 0.00 ? 105  LYS A CA    1 
ATOM   725   C  C     . LYS A  1  105  ? 268.566 262.080 277.644 1.00 0.00 ? 105  LYS A C     1 
ATOM   726   O  O     . LYS A  1  105  ? 269.585 262.587 278.094 1.00 0.00 ? 105  LYS A O     1 
ATOM   727   C  CB    . LYS A  1  105  ? 267.846 262.789 275.375 1.00 0.00 ? 105  LYS A CB    1 
ATOM   728   C  CG    . LYS A  1  105  ? 268.063 262.723 273.880 1.00 0.00 ? 105  LYS A CG    1 
ATOM   729   C  CD    . LYS A  1  105  ? 267.646 264.035 273.239 1.00 0.00 ? 105  LYS A CD    1 
ATOM   730   C  CE    . LYS A  1  105  ? 267.899 264.036 271.747 1.00 0.00 ? 105  LYS A CE    1 
ATOM   731   N  NZ    . LYS A  1  105  ? 267.560 265.358 271.161 1.00 0.00 ? 105  LYS A NZ    1 
ATOM   732   N  N     . VAL A  1  106  ? 267.477 261.887 278.378 1.00 0.00 ? 106  VAL A N     1 
ATOM   733   C  CA    . VAL A  1  106  ? 267.459 262.135 279.818 1.00 0.00 ? 106  VAL A CA    1 
ATOM   734   C  C     . VAL A  1  106  ? 268.361 261.189 280.592 1.00 0.00 ? 106  VAL A C     1 
ATOM   735   O  O     . VAL A  1  106  ? 269.042 261.598 281.530 1.00 0.00 ? 106  VAL A O     1 
ATOM   736   C  CB    . VAL A  1  106  ? 266.038 262.033 280.385 1.00 0.00 ? 106  VAL A CB    1 
ATOM   737   C  CG1   . VAL A  1  106  ? 266.054 262.087 281.902 1.00 0.00 ? 106  VAL A CG1   1 
ATOM   738   C  CG2   . VAL A  1  106  ? 265.197 263.154 279.841 1.00 0.00 ? 106  VAL A CG2   1 
ATOM   739   N  N     . LEU A  1  107  ? 268.390 259.925 280.186 1.00 0.00 ? 107  LEU A N     1 
ATOM   740   C  CA    . LEU A  1  107  ? 269.257 258.945 280.833 1.00 0.00 ? 107  LEU A CA    1 
ATOM   741   C  C     . LEU A  1  107  ? 270.755 259.207 280.663 1.00 0.00 ? 107  LEU A C     1 
ATOM   742   O  O     . LEU A  1  107  ? 271.526 258.941 281.575 1.00 0.00 ? 107  LEU A O     1 
ATOM   743   C  CB    . LEU A  1  107  ? 268.929 257.550 280.300 1.00 0.00 ? 107  LEU A CB    1 
ATOM   744   C  CG    . LEU A  1  107  ? 269.425 256.374 281.129 1.00 0.00 ? 107  LEU A CG    1 
ATOM   745   C  CD1   . LEU A  1  107  ? 268.795 256.437 282.499 1.00 0.00 ? 107  LEU A CD1   1 
ATOM   746   C  CD2   . LEU A  1  107  ? 269.070 255.070 280.447 1.00 0.00 ? 107  LEU A CD2   1 
ATOM   747   N  N     . ARG A  1  108  ? 271.172 259.716 279.509 1.00 0.00 ? 108  ARG A N     1 
ATOM   748   C  CA    . ARG A  1  108  ? 272.547 260.186 279.336 1.00 0.00 ? 108  ARG A CA    1 
ATOM   749   C  C     . ARG A  1  108  ? 272.908 261.423 280.162 1.00 0.00 ? 108  ARG A C     1 
ATOM   750   O  O     . ARG A  1  108  ? 274.061 261.600 280.534 1.00 0.00 ? 108  ARG A O     1 
ATOM   751   C  CB    . ARG A  1  108  ? 272.803 260.469 277.859 1.00 0.00 ? 108  ARG A CB    1 
ATOM   752   C  CG    . ARG A  1  108  ? 272.893 259.215 277.016 1.00 0.00 ? 108  ARG A CG    1 
ATOM   753   C  CD    . ARG A  1  108  ? 273.092 259.547 275.553 1.00 0.00 ? 108  ARG A CD    1 
ATOM   754   N  NE    . ARG A  1  108  ? 273.136 258.339 274.736 1.00 0.00 ? 108  ARG A NE    1 
ATOM   755   C  CZ    . ARG A  1  108  ? 273.155 258.337 273.409 1.00 0.00 ? 108  ARG A CZ    1 
ATOM   756   N  NH1   . ARG A  1  108  ? 273.113 259.484 272.743 1.00 0.00 ? 108  ARG A NH1   1 
ATOM   757   N  NH2   . ARG A  1  108  ? 273.196 257.189 272.747 1.00 0.00 ? 108  ARG A NH2   1 
ATOM   758   N  N     . CYS A  1  109  ? 271.934 262.290 280.424 1.00 0.00 ? 109  CYS A N     1 
ATOM   759   C  CA    . CYS A  1  109  ? 272.139 263.426 281.325 1.00 0.00 ? 109  CYS A CA    1 
ATOM   760   C  C     . CYS A  1  109  ? 272.207 263.035 282.797 1.00 0.00 ? 109  CYS A C     1 
ATOM   761   O  O     . CYS A  1  109  ? 273.009 263.577 283.554 1.00 0.00 ? 109  CYS A O     1 
ATOM   762   C  CB    . CYS A  1  109  ? 271.045 264.471 281.122 1.00 0.00 ? 109  CYS A CB    1 
ATOM   763   S  SG    . CYS A  1  109  ? 271.108 265.276 279.510 1.00 0.00 ? 109  CYS A SG    1 
ATOM   764   N  N     . VAL A  1  110  ? 271.353 262.106 283.203 1.00 0.00 ? 110  VAL A N     1 
ATOM   765   C  CA    . VAL A  1  110  ? 271.271 261.717 284.603 1.00 0.00 ? 110  VAL A CA    1 
ATOM   766   C  C     . VAL A  1  110  ? 272.289 260.623 284.881 1.00 0.00 ? 110  VAL A C     1 
ATOM   767   O  O     . VAL A  1  110  ? 272.366 259.645 284.145 1.00 0.00 ? 110  VAL A O     1 
ATOM   768   C  CB    . VAL A  1  110  ? 269.853 261.234 284.971 1.00 0.00 ? 110  VAL A CB    1 
ATOM   769   C  CG1   . VAL A  1  110  ? 269.880 260.383 286.228 1.00 0.00 ? 110  VAL A CG1   1 
ATOM   770   C  CG2   . VAL A  1  110  ? 268.915 262.421 285.137 1.00 0.00 ? 110  VAL A CG2   1 
ATOM   771   N  N     . CYS A  1  111  ? 273.076 260.789 285.938 1.00 0.00 ? 111  CYS A N     1 
ATOM   772   C  CA    . CYS A  1  111  ? 274.076 259.789 286.302 1.00 0.00 ? 111  CYS A CA    1 
ATOM   773   C  C     . CYS A  1  111  ? 273.458 258.469 286.751 1.00 0.00 ? 111  CYS A C     1 
ATOM   774   O  O     . CYS A  1  111  ? 272.599 258.436 287.631 1.00 0.00 ? 111  CYS A O     1 
ATOM   775   C  CB    . CYS A  1  111  ? 274.990 260.324 287.408 1.00 0.00 ? 111  CYS A CB    1 
ATOM   776   S  SG    . CYS A  1  111  ? 276.024 259.065 288.205 1.00 0.00 ? 111  CYS A SG    1 
ATOM   777   N  N     . PHE A  1  112  ? 273.909 257.385 286.130 1.00 0.00 ? 112  PHE A N     1 
ATOM   778   C  CA    . PHE A  1  112  ? 273.513 256.034 286.508 1.00 0.00 ? 112  PHE A CA    1 
ATOM   779   C  C     . PHE A  1  112  ? 273.890 255.718 287.955 1.00 0.00 ? 112  PHE A C     1 
ATOM   780   O  O     . PHE A  1  112  ? 275.001 256.026 288.390 1.00 0.00 ? 112  PHE A O     1 
ATOM   781   C  CB    . PHE A  1  112  ? 274.151 255.015 285.566 1.00 0.00 ? 112  PHE A CB    1 
ATOM   782   C  CG    . PHE A  1  112  ? 273.634 253.622 285.744 1.00 0.00 ? 112  PHE A CG    1 
ATOM   783   C  CD1   . PHE A  1  112  ? 272.450 253.226 285.152 1.00 0.00 ? 112  PHE A CD1   1 
ATOM   784   C  CD2   . PHE A  1  112  ? 274.339 252.707 286.505 1.00 0.00 ? 112  PHE A CD2   1 
ATOM   785   C  CE1   . PHE A  1  112  ? 271.976 251.941 285.318 1.00 0.00 ? 112  PHE A CE1   1 
ATOM   786   C  CE2   . PHE A  1  112  ? 273.872 251.422 286.676 1.00 0.00 ? 112  PHE A CE2   1 
ATOM   787   C  CZ    . PHE A  1  112  ? 272.688 251.037 286.080 1.00 0.00 ? 112  PHE A CZ    1 
ATOM   788   N  N     . PHE A  1  113  ? 272.938 255.145 288.690 1.00 0.00 ? 113  PHE A N     1 
ATOM   789   C  CA    . PHE A  1  113  ? 273.113 254.723 290.085 1.00 0.00 ? 113  PHE A CA    1 
ATOM   790   C  C     . PHE A  1  113  ? 273.174 255.898 291.061 1.00 0.00 ? 113  PHE A C     1 
ATOM   791   O  O     . PHE A  1  113  ? 272.570 255.848 292.131 1.00 0.00 ? 113  PHE A O     1 
ATOM   792   C  CB    . PHE A  1  113  ? 274.369 253.846 290.228 1.00 0.00 ? 113  PHE A CB    1 
ATOM   793   C  CG    . PHE A  1  113  ? 274.656 253.414 291.639 1.00 0.00 ? 113  PHE A CG    1 
ATOM   794   C  CD1   . PHE A  1  113  ? 274.012 252.320 292.191 1.00 0.00 ? 113  PHE A CD1   1 
ATOM   795   C  CD2   . PHE A  1  113  ? 275.586 254.095 292.409 1.00 0.00 ? 113  PHE A CD2   1 
ATOM   796   C  CE1   . PHE A  1  113  ? 274.281 251.920 293.489 1.00 0.00 ? 113  PHE A CE1   1 
ATOM   797   C  CE2   . PHE A  1  113  ? 275.859 253.702 293.706 1.00 0.00 ? 113  PHE A CE2   1 
ATOM   798   C  CZ    . PHE A  1  113  ? 275.207 252.612 294.246 1.00 0.00 ? 113  PHE A CZ    1 
ATOM   799   N  N     . CYS A  1  114  ? 273.892 256.954 290.694 1.00 0.00 ? 114  CYS A N     1 
ATOM   800   C  CA    . CYS A  1  114  ? 273.934 258.164 291.509 1.00 0.00 ? 114  CYS A CA    1 
ATOM   801   C  C     . CYS A  1  114  ? 272.614 258.919 291.418 1.00 0.00 ? 114  CYS A C     1 
ATOM   802   O  O     . CYS A  1  114  ? 272.241 259.649 292.338 1.00 0.00 ? 114  CYS A O     1 
ATOM   803   C  CB    . CYS A  1  114  ? 275.094 259.067 291.080 1.00 0.00 ? 114  CYS A CB    1 
ATOM   804   S  SG    . CYS A  1  114  ? 275.466 260.430 292.222 1.00 0.00 ? 114  CYS A SG    1 
ATOM   805   N  N     . SER A  1  115  ? 271.935 258.753 290.283 1.00 0.00 ? 115  SER A N     1 
ATOM   806   C  CA    . SER A  1  115  ? 270.663 259.413 289.979 1.00 0.00 ? 115  SER A CA    1 
ATOM   807   C  C     . SER A  1  115  ? 270.767 260.935 289.832 1.00 0.00 ? 115  SER A C     1 
ATOM   808   O  O     . SER A  1  115  ? 269.943 261.549 289.154 1.00 0.00 ? 115  SER A O     1 
ATOM   809   C  CB    . SER A  1  115  ? 269.618 259.071 291.042 1.00 0.00 ? 115  SER A CB    1 
ATOM   810   O  OG    . SER A  1  115  ? 269.357 257.679 291.060 1.00 0.00 ? 115  SER A OG    1 
ATOM   811   N  N     . LYS A  1  116  ? 271.761 261.544 290.470 1.00 0.00 ? 116  LYS A N     1 
ATOM   812   C  CA    . LYS A  1  116  ? 272.007 262.973 290.311 1.00 0.00 ? 116  LYS A CA    1 
ATOM   813   C  C     . LYS A  1  116  ? 272.394 263.313 288.871 1.00 0.00 ? 116  LYS A C     1 
ATOM   814   O  O     . LYS A  1  116  ? 272.898 262.465 288.141 1.00 0.00 ? 116  LYS A O     1 
ATOM   815   C  CB    . LYS A  1  116  ? 273.097 263.441 291.275 1.00 0.00 ? 116  LYS A CB    1 
ATOM   816   C  CG    . LYS A  1  116  ? 273.090 264.938 291.515 1.00 0.00 ? 116  LYS A CG    1 
ATOM   817   C  CD    . LYS A  1  116  ? 274.230 265.369 292.413 1.00 0.00 ? 116  LYS A CD    1 
ATOM   818   C  CE    . LYS A  1  116  ? 274.376 266.879 292.402 1.00 0.00 ? 116  LYS A CE    1 
ATOM   819   N  NZ    . LYS A  1  116  ? 273.063 267.560 292.554 1.00 0.00 ? 116  LYS A NZ    1 
ATOM   820   N  N     . LEU A  1  117  ? 272.129 264.548 288.457 1.00 0.00 ? 117  LEU A N     1 
ATOM   821   C  CA    . LEU A  1  117  ? 272.647 265.062 287.193 1.00 0.00 ? 117  LEU A CA    1 
ATOM   822   C  C     . LEU A  1  117  ? 274.168 265.127 287.227 1.00 0.00 ? 117  LEU A C     1 
ATOM   823   O  O     . LEU A  1  117  ? 274.752 265.486 288.247 1.00 0.00 ? 117  LEU A O     1 
ATOM   824   C  CB    . LEU A  1  117  ? 272.060 266.439 286.892 1.00 0.00 ? 117  LEU A CB    1 
ATOM   825   C  CG    . LEU A  1  117  ? 271.910 266.779 285.411 1.00 0.00 ? 117  LEU A CG    1 
ATOM   826   C  CD1   . LEU A  1  117  ? 270.674 267.631 285.186 1.00 0.00 ? 117  LEU A CD1   1 
ATOM   827   C  CD2   . LEU A  1  117  ? 273.153 267.491 284.907 1.00 0.00 ? 117  LEU A CD2   1 
ATOM   828   N  N     . LEU A  1  118  ? 274.797 264.772 286.110 1.00 0.00 ? 118  LEU A N     1 
ATOM   829   C  CA    . LEU A  1  118  ? 276.254 264.780 285.988 1.00 0.00 ? 118  LEU A CA    1 
ATOM   830   C  C     . LEU A  1  118  ? 276.920 266.082 286.424 1.00 0.00 ? 118  LEU A C     1 
ATOM   831   O  O     . LEU A  1  118  ? 278.070 266.077 286.862 1.00 0.00 ? 118  LEU A O     1 
ATOM   832   C  CB    . LEU A  1  118  ? 276.663 264.467 284.551 1.00 0.00 ? 118  LEU A CB    1 
ATOM   833   C  CG    . LEU A  1  118  ? 276.350 263.046 284.088 1.00 0.00 ? 118  LEU A CG    1 
ATOM   834   C  CD1   . LEU A  1  118  ? 276.654 262.888 282.612 1.00 0.00 ? 118  LEU A CD1   1 
ATOM   835   C  CD2   . LEU A  1  118  ? 277.132 262.041 284.905 1.00 0.00 ? 118  LEU A CD2   1 
ATOM   836   N  N     . VAL A  1  119  ? 276.208 267.197 286.304 1.00 0.00 ? 119  VAL A N     1 
ATOM   837   C  CA    . VAL A  1  119  ? 276.766 268.478 286.717 1.00 0.00 ? 119  VAL A CA    1 
ATOM   838   C  C     . VAL A  1  119  ? 275.770 269.307 287.529 1.00 0.00 ? 119  VAL A C     1 
ATOM   839   O  O     . VAL A  1  119  ? 274.573 269.333 287.237 1.00 0.00 ? 119  VAL A O     1 
ATOM   840   C  CB    . VAL A  1  119  ? 277.253 269.291 285.496 1.00 0.00 ? 119  VAL A CB    1 
ATOM   841   C  CG1   . VAL A  1  119  ? 276.102 269.615 284.556 1.00 0.00 ? 119  VAL A CG1   1 
ATOM   842   C  CG2   . VAL A  1  119  ? 277.988 270.553 285.940 1.00 0.00 ? 119  VAL A CG2   1 
ATOM   843   N  N     . ASP A  1  120  ? 276.283 269.968 288.565 1.00 0.00 ? 120  ASP A N     1 
ATOM   844   C  CA    . ASP A  1  120  ? 275.467 270.795 289.442 1.00 0.00 ? 120  ASP A CA    1 
ATOM   845   C  C     . ASP A  1  120  ? 275.267 272.174 288.814 1.00 0.00 ? 120  ASP A C     1 
ATOM   846   O  O     . ASP A  1  120  ? 275.937 272.519 287.841 1.00 0.00 ? 120  ASP A O     1 
ATOM   847   C  CB    . ASP A  1  120  ? 276.122 270.910 290.823 1.00 0.00 ? 120  ASP A CB    1 
ATOM   848   C  CG    . ASP A  1  120  ? 275.184 271.476 291.871 1.00 0.00 ? 120  ASP A CG    1 
ATOM   849   O  OD1   . ASP A  1  120  ? 274.364 270.706 292.415 1.00 0.00 ? 120  ASP A OD1   1 
ATOM   850   O  OD2   . ASP A  1  120  ? 275.262 272.690 292.149 1.00 0.00 ? 120  ASP A OD2   1 
ATOM   851   N  N     . SER A  1  121  ? 274.351 272.962 289.373 1.00 0.00 ? 121  SER A N     1 
ATOM   852   C  CA    . SER A  1  121  ? 274.134 274.332 288.914 1.00 0.00 ? 121  SER A CA    1 
ATOM   853   C  C     . SER A  1  121  ? 275.237 275.278 289.385 1.00 0.00 ? 121  SER A C     1 
ATOM   854   O  O     . SER A  1  121  ? 275.212 276.472 289.083 1.00 0.00 ? 121  SER A O     1 
ATOM   855   C  CB    . SER A  1  121  ? 272.772 274.848 289.386 1.00 0.00 ? 121  SER A CB    1 
ATOM   856   O  OG    . SER A  1  121  ? 272.744 275.010 290.793 1.00 0.00 ? 121  SER A OG    1 
ATOM   857   N  N     . ASN A  1  122  ? 276.205 274.737 290.118 1.00 0.00 ? 122  ASN A N     1 
ATOM   858   C  CA    . ASN A  1  122  ? 277.299 275.534 290.656 1.00 0.00 ? 122  ASN A CA    1 
ATOM   859   C  C     . ASN A  1  122  ? 278.299 275.895 289.566 1.00 0.00 ? 122  ASN A C     1 
ATOM   860   O  O     . ASN A  1  122  ? 279.101 276.817 289.714 1.00 0.00 ? 122  ASN A O     1 
ATOM   861   C  CB    . ASN A  1  122  ? 278.007 274.782 291.783 1.00 0.00 ? 122  ASN A CB    1 
ATOM   862   C  CG    . ASN A  1  122  ? 277.253 274.849 293.096 1.00 0.00 ? 122  ASN A CG    1 
ATOM   863   O  OD1   . ASN A  1  122  ? 277.180 273.866 293.834 1.00 0.00 ? 122  ASN A OD1   1 
ATOM   864   N  ND2   . ASN A  1  122  ? 276.684 276.011 293.394 1.00 0.00 ? 122  ASN A ND2   1 
ATOM   865   N  N     . ASN A  1  123  ? 278.237 275.152 288.467 1.00 0.00 ? 123  ASN A N     1 
ATOM   866   C  CA    . ASN A  1  123  ? 279.106 275.384 287.327 1.00 0.00 ? 123  ASN A CA    1 
ATOM   867   C  C     . ASN A  1  123  ? 278.728 276.703 286.655 1.00 0.00 ? 123  ASN A C     1 
ATOM   868   O  O     . ASN A  1  123  ? 277.551 276.953 286.397 1.00 0.00 ? 123  ASN A O     1 
ATOM   869   C  CB    . ASN A  1  123  ? 278.998 274.204 286.350 1.00 0.00 ? 123  ASN A CB    1 
ATOM   870   C  CG    . ASN A  1  123  ? 280.018 274.261 285.223 1.00 0.00 ? 123  ASN A CG    1 
ATOM   871   O  OD1   . ASN A  1  123  ? 280.140 275.263 284.522 1.00 0.00 ? 123  ASN A OD1   1 
ATOM   872   N  ND2   . ASN A  1  123  ? 280.751 273.169 285.039 1.00 0.00 ? 123  ASN A ND2   1 
ATOM   873   N  N     . PRO A  1  124  ? 279.729 277.552 286.374 1.00 0.00 ? 124  PRO A N     1 
ATOM   874   C  CA    . PRO A  1  124  ? 279.540 278.848 285.715 1.00 0.00 ? 124  PRO A CA    1 
ATOM   875   C  C     . PRO A  1  124  ? 278.915 278.715 284.326 1.00 0.00 ? 124  PRO A C     1 
ATOM   876   O  O     . PRO A  1  124  ? 278.135 279.576 283.919 1.00 0.00 ? 124  PRO A O     1 
ATOM   877   C  CB    . PRO A  1  124  ? 280.961 279.424 285.642 1.00 0.00 ? 124  PRO A CB    1 
ATOM   878   C  CG    . PRO A  1  124  ? 281.860 278.251 285.722 1.00 0.00 ? 124  PRO A CG    1 
ATOM   879   C  CD    . PRO A  1  124  ? 281.154 277.267 286.616 1.00 0.00 ? 124  PRO A CD    1 
ATOM   880   N  N     . LYS A  1  125  ? 279.265 277.648 283.614 1.00 0.00 ? 125  LYS A N     1 
ATOM   881   C  CA    . LYS A  1  125  ? 278.665 277.337 282.319 1.00 0.00 ? 125  LYS A CA    1 
ATOM   882   C  C     . LYS A  1  125  ? 277.191 276.925 282.416 1.00 0.00 ? 125  LYS A C     1 
ATOM   883   O  O     . LYS A  1  125  ? 276.404 277.219 281.518 1.00 0.00 ? 125  LYS A O     1 
ATOM   884   C  CB    . LYS A  1  125  ? 279.461 276.224 281.632 1.00 0.00 ? 125  LYS A CB    1 
ATOM   885   C  CG    . LYS A  1  125  ? 280.853 276.638 281.192 1.00 0.00 ? 125  LYS A CG    1 
ATOM   886   C  CD    . LYS A  1  125  ? 281.588 275.483 280.537 1.00 0.00 ? 125  LYS A CD    1 
ATOM   887   C  CE    . LYS A  1  125  ? 282.999 275.884 280.152 1.00 0.00 ? 125  LYS A CE    1 
ATOM   888   N  NZ    . LYS A  1  125  ? 283.046 276.471 278.787 1.00 0.00 ? 125  LYS A NZ    1 
ATOM   889   N  N     . ILE A  1  126  ? 276.820 276.242 283.496 1.00 0.00 ? 126  ILE A N     1 
ATOM   890   C  CA    . ILE A  1  126  ? 275.419 275.889 283.744 1.00 0.00 ? 126  ILE A CA    1 
ATOM   891   C  C     . ILE A  1  126  ? 274.612 277.157 284.053 1.00 0.00 ? 126  ILE A C     1 
ATOM   892   O  O     . ILE A  1  126  ? 273.471 277.311 283.612 1.00 0.00 ? 126  ILE A O     1 
ATOM   893   C  CB    . ILE A  1  126  ? 275.282 274.873 284.898 1.00 0.00 ? 126  ILE A CB    1 
ATOM   894   C  CG1   . ILE A  1  126  ? 275.766 273.491 284.451 1.00 0.00 ? 126  ILE A CG1   1 
ATOM   895   C  CG2   . ILE A  1  126  ? 273.843 274.803 285.390 1.00 0.00 ? 126  ILE A CG2   1 
ATOM   896   C  CD1   . ILE A  1  126  ? 274.915 272.868 283.367 1.00 0.00 ? 126  ILE A CD1   1 
ATOM   897   N  N     . LYS A  1  127  ? 275.232 278.061 284.806 1.00 0.00 ? 127  LYS A N     1 
ATOM   898   C  CA    . LYS A  1  127  ? 274.661 279.364 285.153 1.00 0.00 ? 127  LYS A CA    1 
ATOM   899   C  C     . LYS A  1  127  ? 274.411 280.169 283.879 1.00 0.00 ? 127  LYS A C     1 
ATOM   900   O  O     . LYS A  1  127  ? 273.387 280.839 283.737 1.00 0.00 ? 127  LYS A O     1 
ATOM   901   C  CB    . LYS A  1  127  ? 275.583 280.136 286.103 1.00 0.00 ? 127  LYS A CB    1 
ATOM   902   C  CG    . LYS A  1  127  ? 275.000 281.454 286.595 1.00 0.00 ? 127  LYS A CG    1 
ATOM   903   C  CD    . LYS A  1  127  ? 275.990 282.236 287.446 1.00 0.00 ? 127  LYS A CD    1 
ATOM   904   C  CE    . LYS A  1  127  ? 275.354 283.510 287.981 1.00 0.00 ? 127  LYS A CE    1 
ATOM   905   N  NZ    . LYS A  1  127  ? 276.293 284.298 288.825 1.00 0.00 ? 127  LYS A NZ    1 
ATOM   906   N  N     . ASP A  1  128  ? 275.369 280.089 282.962 1.00 0.00 ? 128  ASP A N     1 
ATOM   907   C  CA    . ASP A  1  128  ? 275.279 280.703 281.641 1.00 0.00 ? 128  ASP A CA    1 
ATOM   908   C  C     . ASP A  1  128  ? 274.177 280.029 280.818 1.00 0.00 ? 128  ASP A C     1 
ATOM   909   O  O     . ASP A  1  128  ? 273.490 280.690 280.038 1.00 0.00 ? 128  ASP A O     1 
ATOM   910   C  CB    . ASP A  1  128  ? 276.627 280.619 280.918 1.00 0.00 ? 128  ASP A CB    1 
ATOM   911   C  CG    . ASP A  1  128  ? 276.705 281.541 279.713 1.00 0.00 ? 128  ASP A CG    1 
ATOM   912   O  OD1   . ASP A  1  128  ? 276.000 282.573 279.705 1.00 0.00 ? 128  ASP A OD1   1 
ATOM   913   O  OD2   . ASP A  1  128  ? 277.479 281.239 278.781 1.00 0.00 ? 128  ASP A OD2   1 
ATOM   914   N  N     . ILE A  1  129  ? 274.019 278.717 280.978 1.00 0.00 ? 129  ILE A N     1 
ATOM   915   C  CA    . ILE A  1  129  ? 272.947 277.997 280.297 1.00 0.00 ? 129  ILE A CA    1 
ATOM   916   C  C     . ILE A  1  129  ? 271.599 278.491 280.831 1.00 0.00 ? 129  ILE A C     1 
ATOM   917   O  O     . ILE A  1  129  ? 270.692 278.784 280.051 1.00 0.00 ? 129  ILE A O     1 
ATOM   918   C  CB    . ILE A  1  129  ? 273.057 276.470 280.492 1.00 0.00 ? 129  ILE A CB    1 
ATOM   919   C  CG1   . ILE A  1  129  ? 274.213 275.905 279.666 1.00 0.00 ? 129  ILE A CG1   1 
ATOM   920   C  CG2   . ILE A  1  129  ? 271.766 275.785 280.085 1.00 0.00 ? 129  ILE A CG2   1 
ATOM   921   C  CD1   . ILE A  1  129  ? 274.681 274.541 280.125 1.00 0.00 ? 129  ILE A CD1   1 
ATOM   922   N  N     . LEU A  1  130  ? 271.459 278.559 282.152 1.00 0.00 ? 130  LEU A N     1 
ATOM   923   C  CA    . LEU A  1  130  ? 270.213 279.020 282.762 1.00 0.00 ? 130  LEU A CA    1 
ATOM   924   C  C     . LEU A  1  130  ? 269.900 280.467 282.360 1.00 0.00 ? 130  LEU A C     1 
ATOM   925   O  O     . LEU A  1  130  ? 268.734 280.841 282.213 1.00 0.00 ? 130  LEU A O     1 
ATOM   926   C  CB    . LEU A  1  130  ? 270.280 278.914 284.289 1.00 0.00 ? 130  LEU A CB    1 
ATOM   927   C  CG    . LEU A  1  130  ? 269.645 277.699 284.973 1.00 0.00 ? 130  LEU A CG    1 
ATOM   928   C  CD1   . LEU A  1  130  ? 270.257 276.401 284.474 1.00 0.00 ? 130  LEU A CD1   1 
ATOM   929   C  CD2   . LEU A  1  130  ? 269.777 277.816 286.486 1.00 0.00 ? 130  LEU A CD2   1 
ATOM   930   N  N     . ALA A  1  131  ? 270.953 281.245 282.125 1.00 0.00 ? 131  ALA A N     1 
ATOM   931   C  CA    . ALA A  1  131  ? 270.806 282.624 281.684 1.00 0.00 ? 131  ALA A CA    1 
ATOM   932   C  C     . ALA A  1  131  ? 270.372 282.599 280.221 1.00 0.00 ? 131  ALA A C     1 
ATOM   933   O  O     . ALA A  1  131  ? 269.393 283.242 279.843 1.00 0.00 ? 131  ALA A O     1 
ATOM   934   C  CB    . ALA A  1  131  ? 272.116 283.377 281.842 1.00 0.00 ? 131  ALA A CB    1 
ATOM   935   N  N     . LYS A  1  132  ? 271.109 281.849 279.403 1.00 0.00 ? 132  LYS A N     1 
ATOM   936   C  CA    . LYS A  1  132  ? 270.784 281.709 277.988 1.00 0.00 ? 132  LYS A CA    1 
ATOM   937   C  C     . LYS A  1  132  ? 269.450 280.982 277.906 1.00 0.00 ? 132  LYS A C     1 
ATOM   938   O  O     . LYS A  1  132  ? 269.355 279.868 277.391 1.00 0.00 ? 132  LYS A O     1 
ATOM   939   C  CB    . LYS A  1  132  ? 271.868 280.918 277.259 1.00 0.00 ? 132  LYS A CB    1 
ATOM   940   C  CG    . LYS A  1  132  ? 272.465 281.640 276.061 1.00 0.00 ? 132  LYS A CG    1 
ATOM   941   C  CD    . LYS A  1  132  ? 273.982 281.671 276.135 1.00 0.00 ? 132  LYS A CD    1 
ATOM   942   C  CE    . LYS A  1  132  ? 274.499 283.092 276.292 1.00 0.00 ? 132  LYS A CE    1 
ATOM   943   N  NZ    . LYS A  1  132  ? 275.877 283.245 275.749 1.00 0.00 ? 132  LYS A NZ    1 
ATOM   944   N  N     . SER A  1  133  ? 268.369 281.637 278.305 1.00 0.00 ? 133  SER A N     1 
ATOM   945   C  CA    . SER A  1  133  ? 267.086 280.996 278.040 1.00 0.00 ? 133  SER A CA    1 
ATOM   946   C  C     . SER A  1  133  ? 266.060 280.652 279.111 1.00 0.00 ? 133  SER A C     1 
ATOM   947   O  O     . SER A  1  133  ? 265.236 279.767 278.874 1.00 0.00 ? 133  SER A O     1 
ATOM   948   C  CB    . SER A  1  133  ? 267.325 279.751 277.169 1.00 0.00 ? 133  SER A CB    1 
ATOM   949   O  OG    . SER A  1  133  ? 266.430 279.716 276.072 1.00 0.00 ? 133  SER A OG    1 
ATOM   950   N  N     . LYS A  1  134  ? 266.045 281.295 280.270 1.00 0.00 ? 134  LYS A N     1 
ATOM   951   C  CA    . LYS A  1  134  ? 264.954 280.873 281.146 1.00 0.00 ? 134  LYS A CA    1 
ATOM   952   C  C     . LYS A  1  134  ? 263.646 280.641 280.389 1.00 0.00 ? 134  LYS A C     1 
ATOM   953   O  O     . LYS A  1  134  ? 262.768 279.910 280.853 1.00 0.00 ? 134  LYS A O     1 
ATOM   954   C  CB    . LYS A  1  134  ? 264.732 281.915 282.244 1.00 0.00 ? 134  LYS A CB    1 
ATOM   955   C  CG    . LYS A  1  134  ? 265.836 281.976 283.285 1.00 0.00 ? 134  LYS A CG    1 
ATOM   956   C  CD    . LYS A  1  134  ? 265.515 283.001 284.361 1.00 0.00 ? 134  LYS A CD    1 
ATOM   957   C  CE    . LYS A  1  134  ? 266.533 282.951 285.489 1.00 0.00 ? 134  LYS A CE    1 
ATOM   958   N  NZ    . LYS A  1  134  ? 266.201 283.909 286.576 1.00 0.00 ? 134  LYS A NZ    1 
ATOM   959   N  N     . GLY A  1  135  ? 263.530 281.258 279.217 1.00 0.00 ? 135  GLY A N     1 
ATOM   960   C  CA    . GLY A  1  135  ? 262.347 281.126 278.385 1.00 0.00 ? 135  GLY A CA    1 
ATOM   961   C  C     . GLY A  1  135  ? 262.347 279.863 277.546 1.00 0.00 ? 135  GLY A C     1 
ATOM   962   O  O     . GLY A  1  135  ? 261.295 279.391 277.108 1.00 0.00 ? 135  GLY A O     1 
ATOM   963   N  N     . GLN A  1  136  ? 263.537 279.322 277.308 1.00 0.00 ? 136  GLN A N     1 
ATOM   964   C  CA    . GLN A  1  136  ? 263.683 278.185 276.410 1.00 0.00 ? 136  GLN A CA    1 
ATOM   965   C  C     . GLN A  1  136  ? 264.290 276.969 277.115 1.00 0.00 ? 136  GLN A C     1 
ATOM   966   O  O     . GLN A  1  136  ? 265.508 276.787 277.104 1.00 0.00 ? 136  GLN A O     1 
ATOM   967   C  CB    . GLN A  1  136  ? 264.547 278.582 275.206 1.00 0.00 ? 136  GLN A CB    1 
ATOM   968   C  CG    . GLN A  1  136  ? 264.542 277.600 274.038 1.00 0.00 ? 136  GLN A CG    1 
ATOM   969   C  CD    . GLN A  1  136  ? 263.141 277.233 273.570 1.00 0.00 ? 136  GLN A CD    1 
ATOM   970   O  OE1   . GLN A  1  136  ? 262.457 276.404 274.178 1.00 0.00 ? 136  GLN A OE1   1 
ATOM   971   N  NE2   . GLN A  1  136  ? 262.704 277.862 272.485 1.00 0.00 ? 136  GLN A NE2   1 
ATOM   972   N  N     . PRO A  1  137  ? 263.435 276.140 277.739 1.00 0.00 ? 137  PRO A N     1 
ATOM   973   C  CA    . PRO A  1  137  ? 263.806 274.873 278.386 1.00 0.00 ? 137  PRO A CA    1 
ATOM   974   C  C     . PRO A  1  137  ? 264.467 273.901 277.395 1.00 0.00 ? 137  PRO A C     1 
ATOM   975   O  O     . PRO A  1  137  ? 265.329 273.113 277.788 1.00 0.00 ? 137  PRO A O     1 
ATOM   976   C  CB    . PRO A  1  137  ? 262.476 274.336 278.930 1.00 0.00 ? 137  PRO A CB    1 
ATOM   977   C  CG    . PRO A  1  137  ? 261.563 275.523 278.967 1.00 0.00 ? 137  PRO A CG    1 
ATOM   978   C  CD    . PRO A  1  137  ? 261.984 276.375 277.814 1.00 0.00 ? 137  PRO A CD    1 
ATOM   979   N  N     . LYS A  1  138  ? 264.043 273.948 276.133 1.00 0.00 ? 138  LYS A N     1 
ATOM   980   C  CA    . LYS A  1  138  ? 264.516 273.035 275.089 1.00 0.00 ? 138  LYS A CA    1 
ATOM   981   C  C     . LYS A  1  138  ? 265.981 273.226 274.728 1.00 0.00 ? 138  LYS A C     1 
ATOM   982   O  O     . LYS A  1  138  ? 266.733 272.251 274.657 1.00 0.00 ? 138  LYS A O     1 
ATOM   983   C  CB    . LYS A  1  138  ? 263.690 273.226 273.812 1.00 0.00 ? 138  LYS A CB    1 
ATOM   984   C  CG    . LYS A  1  138  ? 264.069 272.299 272.671 1.00 0.00 ? 138  LYS A CG    1 
ATOM   985   C  CD    . LYS A  1  138  ? 262.997 272.256 271.595 1.00 0.00 ? 138  LYS A CD    1 
ATOM   986   C  CE    . LYS A  1  138  ? 263.376 271.273 270.502 1.00 0.00 ? 138  LYS A CE    1 
ATOM   987   N  NZ    . LYS A  1  138  ? 262.209 270.862 269.680 1.00 0.00 ? 138  LYS A NZ    1 
ATOM   988   N  N     . LYS A  1  139  ? 266.384 274.472 274.496 1.00 0.00 ? 139  LYS A N     1 
ATOM   989   C  CA    . LYS A  1  139  ? 267.794 274.784 274.290 1.00 0.00 ? 139  LYS A CA    1 
ATOM   990   C  C     . LYS A  1  139  ? 268.613 274.367 275.510 1.00 0.00 ? 139  LYS A C     1 
ATOM   991   O  O     . LYS A  1  139  ? 269.743 273.892 275.377 1.00 0.00 ? 139  LYS A O     1 
ATOM   992   C  CB    . LYS A  1  139  ? 267.973 276.282 274.013 1.00 0.00 ? 139  LYS A CB    1 
ATOM   993   C  CG    . LYS A  1  139  ? 269.333 276.677 273.455 1.00 0.00 ? 139  LYS A CG    1 
ATOM   994   C  CD    . LYS A  1  139  ? 269.313 278.101 272.913 1.00 0.00 ? 139  LYS A CD    1 
ATOM   995   C  CE    . LYS A  1  139  ? 268.577 278.183 271.585 1.00 0.00 ? 139  LYS A CE    1 
ATOM   996   N  NZ    . LYS A  1  139  ? 269.158 277.270 270.566 1.00 0.00 ? 139  LYS A NZ    1 
ATOM   997   N  N     . ARG A  1  140  ? 268.035 274.554 276.694 1.00 0.00 ? 140  ARG A N     1 
ATOM   998   C  CA    . ARG A  1  140  ? 268.629 274.082 277.943 1.00 0.00 ? 140  ARG A CA    1 
ATOM   999   C  C     . ARG A  1  140  ? 268.884 272.574 277.915 1.00 0.00 ? 140  ARG A C     1 
ATOM   1000  O  O     . ARG A  1  140  ? 269.985 272.127 278.229 1.00 0.00 ? 140  ARG A O     1 
ATOM   1001  C  CB    . ARG A  1  140  ? 267.778 274.487 279.155 1.00 0.00 ? 140  ARG A CB    1 
ATOM   1002  C  CG    . ARG A  1  140  ? 268.522 274.301 280.475 1.00 0.00 ? 140  ARG A CG    1 
ATOM   1003  C  CD    . ARG A  1  140  ? 267.674 274.566 281.712 1.00 0.00 ? 140  ARG A CD    1 
ATOM   1004  N  NE    . ARG A  1  140  ? 267.123 275.918 281.719 1.00 0.00 ? 140  ARG A NE    1 
ATOM   1005  C  CZ    . ARG A  1  140  ? 266.065 276.296 282.428 1.00 0.00 ? 140  ARG A CZ    1 
ATOM   1006  N  NH1   . ARG A  1  140  ? 265.457 275.430 283.228 1.00 0.00 ? 140  ARG A NH1   1 
ATOM   1007  N  NH2   . ARG A  1  140  ? 265.577 277.520 282.291 1.00 0.00 ? 140  ARG A NH2   1 
ATOM   1008  N  N     . LEU A  1  141  ? 267.878 271.796 277.527 1.00 0.00 ? 141  LEU A N     1 
ATOM   1009  C  CA    . LEU A  1  141  ? 268.027 270.342 277.459 1.00 0.00 ? 141  LEU A CA    1 
ATOM   1010  C  C     . LEU A  1  141  ? 269.070 269.913 276.428 1.00 0.00 ? 141  LEU A C     1 
ATOM   1011  O  O     . LEU A  1  141  ? 269.843 268.990 276.684 1.00 0.00 ? 141  LEU A O     1 
ATOM   1012  C  CB    . LEU A  1  141  ? 266.680 269.683 277.131 1.00 0.00 ? 141  LEU A CB    1 
ATOM   1013  C  CG    . LEU A  1  141  ? 266.635 268.160 276.944 1.00 0.00 ? 141  LEU A CG    1 
ATOM   1014  C  CD1   . LEU A  1  141  ? 267.149 267.434 278.176 1.00 0.00 ? 141  LEU A CD1   1 
ATOM   1015  C  CD2   . LEU A  1  141  ? 265.225 267.695 276.596 1.00 0.00 ? 141  LEU A CD2   1 
ATOM   1016  N  N     . THR A  1  142  ? 269.088 270.554 275.265 1.00 0.00 ? 142  THR A N     1 
ATOM   1017  C  CA    . THR A  1  142  ? 270.089 270.219 274.254 1.00 0.00 ? 142  THR A CA    1 
ATOM   1018  C  C     . THR A  1  142  ? 271.511 270.606 274.691 1.00 0.00 ? 142  THR A C     1 
ATOM   1019  O  O     . THR A  1  142  ? 272.464 269.869 274.437 1.00 0.00 ? 142  THR A O     1 
ATOM   1020  C  CB    . THR A  1  142  ? 269.774 270.890 272.906 1.00 0.00 ? 142  THR A CB    1 
ATOM   1021  O  OG1   . THR A  1  142  ? 269.748 272.313 273.068 1.00 0.00 ? 142  THR A OG1   1 
ATOM   1022  C  CG2   . THR A  1  142  ? 268.425 270.410 272.377 1.00 0.00 ? 142  THR A CG2   1 
ATOM   1023  N  N     . HIS A  1  143  ? 271.646 271.762 275.343 1.00 0.00 ? 143  HIS A N     1 
ATOM   1024  C  CA    . HIS A  1  143  ? 272.935 272.205 275.887 1.00 0.00 ? 143  HIS A CA    1 
ATOM   1025  C  C     . HIS A  1  143  ? 273.411 271.348 277.057 1.00 0.00 ? 143  HIS A C     1 
ATOM   1026  O  O     . HIS A  1  143  ? 274.603 271.061 277.183 1.00 0.00 ? 143  HIS A O     1 
ATOM   1027  C  CB    . HIS A  1  143  ? 272.869 273.673 276.326 1.00 0.00 ? 143  HIS A CB    1 
ATOM   1028  C  CG    . HIS A  1  143  ? 272.846 274.651 275.191 1.00 0.00 ? 143  HIS A CG    1 
ATOM   1029  N  ND1   . HIS A  1  143  ? 273.054 276.002 275.371 1.00 0.00 ? 143  HIS A ND1   1 
ATOM   1030  C  CD2   . HIS A  1  143  ? 272.663 274.473 273.861 1.00 0.00 ? 143  HIS A CD2   1 
ATOM   1031  C  CE1   . HIS A  1  143  ? 272.987 276.616 274.204 1.00 0.00 ? 143  HIS A CE1   1 
ATOM   1032  N  NE2   . HIS A  1  143  ? 272.752 275.711 273.271 1.00 0.00 ? 143  HIS A NE2   1 
ATOM   1033  N  N     . VAL A  1  144  ? 272.476 270.956 277.916 1.00 0.00 ? 144  VAL A N     1 
ATOM   1034  C  CA    . VAL A  1  144  ? 272.768 270.050 279.022 1.00 0.00 ? 144  VAL A CA    1 
ATOM   1035  C  C     . VAL A  1  144  ? 273.164 268.677 278.494 1.00 0.00 ? 144  VAL A C     1 
ATOM   1036  O  O     . VAL A  1  144  ? 274.105 268.062 278.994 1.00 0.00 ? 144  VAL A O     1 
ATOM   1037  C  CB    . VAL A  1  144  ? 271.567 269.913 279.989 1.00 0.00 ? 144  VAL A CB    1 
ATOM   1038  C  CG1   . VAL A  1  144  ? 271.709 268.676 280.866 1.00 0.00 ? 144  VAL A CG1   1 
ATOM   1039  C  CG2   . VAL A  1  144  ? 271.429 271.161 280.847 1.00 0.00 ? 144  VAL A CG2   1 
ATOM   1040  N  N     . TYR A  1  145  ? 272.459 268.215 277.466 1.00 0.00 ? 145  TYR A N     1 
ATOM   1041  C  CA    . TYR A  1  145  ? 272.758 266.925 276.862 1.00 0.00 ? 145  TYR A CA    1 
ATOM   1042  C  C     . TYR A  1  145  ? 274.173 266.929 276.294 1.00 0.00 ? 145  TYR A C     1 
ATOM   1043  O  O     . TYR A  1  145  ? 274.942 265.997 276.532 1.00 0.00 ? 145  TYR A O     1 
ATOM   1044  C  CB    . TYR A  1  145  ? 271.738 266.610 275.764 1.00 0.00 ? 145  TYR A CB    1 
ATOM   1045  C  CG    . TYR A  1  145  ? 271.992 265.330 275.001 1.00 0.00 ? 145  TYR A CG    1 
ATOM   1046  C  CD1   . TYR A  1  145  ? 271.549 264.110 275.494 1.00 0.00 ? 145  TYR A CD1   1 
ATOM   1047  C  CD2   . TYR A  1  145  ? 272.670 265.338 273.790 1.00 0.00 ? 145  TYR A CD2   1 
ATOM   1048  C  CE1   . TYR A  1  145  ? 271.762 262.938 274.798 1.00 0.00 ? 145  TYR A CE1   1 
ATOM   1049  C  CE2   . TYR A  1  145  ? 272.899 264.168 273.093 1.00 0.00 ? 145  TYR A CE2   1 
ATOM   1050  C  CZ    . TYR A  1  145  ? 272.440 262.972 273.603 1.00 0.00 ? 145  TYR A CZ    1 
ATOM   1051  O  OH    . TYR A  1  145  ? 272.668 261.800 272.922 1.00 0.00 ? 145  TYR A OH    1 
ATOM   1052  N  N     . ASP A  1  146  ? 274.508 267.966 275.531 1.00 0.00 ? 146  ASP A N     1 
ATOM   1053  C  CA    . ASP A  1  146  ? 275.858 268.110 274.990 1.00 0.00 ? 146  ASP A CA    1 
ATOM   1054  C  C     . ASP A  1  146  ? 276.967 268.238 276.040 1.00 0.00 ? 146  ASP A C     1 
ATOM   1055  O  O     . ASP A  1  146  ? 278.053 267.683 275.872 1.00 0.00 ? 146  ASP A O     1 
ATOM   1056  C  CB    . ASP A  1  146  ? 275.919 269.328 274.063 1.00 0.00 ? 146  ASP A CB    1 
ATOM   1057  C  CG    . ASP A  1  146  ? 277.102 269.281 273.114 1.00 0.00 ? 146  ASP A CG    1 
ATOM   1058  O  OD1   . ASP A  1  146  ? 277.180 268.337 272.300 1.00 0.00 ? 146  ASP A OD1   1 
ATOM   1059  O  OD2   . ASP A  1  146  ? 277.958 270.190 273.186 1.00 0.00 ? 146  ASP A OD2   1 
ATOM   1060  N  N     . LEU A  1  147  ? 276.701 268.974 277.118 1.00 0.00 ? 147  LEU A N     1 
ATOM   1061  C  CA    . LEU A  1  147  ? 277.629 269.027 278.245 1.00 0.00 ? 147  LEU A CA    1 
ATOM   1062  C  C     . LEU A  1  147  ? 277.768 267.698 278.987 1.00 0.00 ? 147  LEU A C     1 
ATOM   1063  O  O     . LEU A  1  147  ? 278.869 267.314 279.381 1.00 0.00 ? 147  LEU A O     1 
ATOM   1064  C  CB    . LEU A  1  147  ? 277.203 270.120 279.229 1.00 0.00 ? 147  LEU A CB    1 
ATOM   1065  C  CG    . LEU A  1  147  ? 278.153 270.336 280.407 1.00 0.00 ? 147  LEU A CG    1 
ATOM   1066  C  CD1   . LEU A  1  147  ? 279.544 270.705 279.909 1.00 0.00 ? 147  LEU A CD1   1 
ATOM   1067  C  CD2   . LEU A  1  147  ? 277.619 271.405 281.343 1.00 0.00 ? 147  LEU A CD2   1 
ATOM   1068  N  N     . CYS A  1  148  ? 276.650 266.999 279.166 1.00 0.00 ? 148  CYS A N     1 
ATOM   1069  C  CA    . CYS A  1  148  ? 276.648 265.715 279.867 1.00 0.00 ? 148  CYS A CA    1 
ATOM   1070  C  C     . CYS A  1  148  ? 277.291 264.589 279.060 1.00 0.00 ? 148  CYS A C     1 
ATOM   1071  O  O     . CYS A  1  148  ? 277.897 263.675 279.622 1.00 0.00 ? 148  CYS A O     1 
ATOM   1072  C  CB    . CYS A  1  148  ? 275.215 265.320 280.242 1.00 0.00 ? 148  CYS A CB    1 
ATOM   1073  S  SG    . CYS A  1  148  ? 274.466 266.321 281.557 1.00 0.00 ? 148  CYS A SG    1 
ATOM   1074  N  N     . LYS A  1  149  ? 277.157 264.667 277.740 1.00 0.00 ? 149  LYS A N     1 
ATOM   1075  C  CA    . LYS A  1  149  ? 277.806 263.723 276.840 1.00 0.00 ? 149  LYS A CA    1 
ATOM   1076  C  C     . LYS A  1  149  ? 279.321 263.843 276.962 1.00 0.00 ? 149  LYS A C     1 
ATOM   1077  O  O     . LYS A  1  149  ? 280.043 262.845 276.956 1.00 0.00 ? 149  LYS A O     1 
ATOM   1078  C  CB    . LYS A  1  149  ? 277.347 263.963 275.400 1.00 0.00 ? 149  LYS A CB    1 
ATOM   1079  C  CG    . LYS A  1  149  ? 277.976 263.044 274.371 1.00 0.00 ? 149  LYS A CG    1 
ATOM   1080  C  CD    . LYS A  1  149  ? 277.564 263.436 272.959 1.00 0.00 ? 149  LYS A CD    1 
ATOM   1081  C  CE    . LYS A  1  149  ? 277.987 264.860 272.631 1.00 0.00 ? 149  LYS A CE    1 
ATOM   1082  N  NZ    . LYS A  1  149  ? 277.693 265.219 271.216 1.00 0.00 ? 149  LYS A NZ    1 
ATOM   1083  N  N     . GLY A  1  150  ? 279.790 265.082 277.072 1.00 0.00 ? 150  GLY A N     1 
ATOM   1084  C  CA    . GLY A  1  150  ? 281.173 265.365 277.402 1.00 0.00 ? 150  GLY A CA    1 
ATOM   1085  C  C     . GLY A  1  150  ? 281.592 264.938 278.798 1.00 0.00 ? 150  GLY A C     1 
ATOM   1086  O  O     . GLY A  1  150  ? 282.743 264.559 279.016 1.00 0.00 ? 150  GLY A O     1 
ATOM   1087  N  N     . LYS A  1  151  ? 280.659 264.992 279.747 1.00 0.00 ? 151  LYS A N     1 
ATOM   1088  C  CA    . LYS A  1  151  ? 280.996 264.793 281.155 1.00 0.00 ? 151  LYS A CA    1 
ATOM   1089  C  C     . LYS A  1  151  ? 280.961 263.327 281.581 1.00 0.00 ? 151  LYS A C     1 
ATOM   1090  O  O     . LYS A  1  151  ? 279.945 262.644 281.443 1.00 0.00 ? 151  LYS A O     1 
ATOM   1091  C  CB    . LYS A  1  151  ? 280.057 265.616 282.044 1.00 0.00 ? 151  LYS A CB    1 
ATOM   1092  C  CG    . LYS A  1  151  ? 280.421 267.093 282.110 1.00 0.00 ? 151  LYS A CG    1 
ATOM   1093  C  CD    . LYS A  1  151  ? 279.668 267.814 283.212 1.00 0.00 ? 151  LYS A CD    1 
ATOM   1094  C  CE    . LYS A  1  151  ? 280.146 269.253 283.345 1.00 0.00 ? 151  LYS A CE    1 
ATOM   1095  N  NZ    . LYS A  1  151  ? 281.529 269.343 283.886 1.00 0.00 ? 151  LYS A NZ    1 
ATOM   1096  N  N     . ASN A  1  152  ? 282.140 262.792 281.843 1.00 0.00 ? 152  ASN A N     1 
ATOM   1097  C  CA    . ASN A  1  152  ? 282.193 261.373 282.084 1.00 0.00 ? 152  ASN A CA    1 
ATOM   1098  C  C     . ASN A  1  152  ? 283.061 260.842 283.186 1.00 0.00 ? 152  ASN A C     1 
ATOM   1099  O  O     . ASN A  1  152  ? 284.290 260.913 283.159 1.00 0.00 ? 152  ASN A O     1 
ATOM   1100  C  CB    . ASN A  1  152  ? 282.536 260.641 280.780 1.00 0.00 ? 152  ASN A CB    1 
ATOM   1101  C  CG    . ASN A  1  152  ? 282.281 259.149 280.865 1.00 0.00 ? 152  ASN A CG    1 
ATOM   1102  O  OD1   . ASN A  1  152  ? 281.440 258.694 281.640 1.00 0.00 ? 152  ASN A OD1   1 
ATOM   1103  N  ND2   . ASN A  1  152  ? 283.008 258.378 280.064 1.00 0.00 ? 152  ASN A ND2   1 
ATOM   1104  N  N     . ILE A  1  153  ? 282.362 260.302 284.162 1.00 0.00 ? 153  ILE A N     1 
ATOM   1105  C  CA    . ILE A  1  153  ? 282.970 259.617 285.292 1.00 0.00 ? 153  ILE A CA    1 
ATOM   1106  C  C     . ILE A  1  153  ? 282.463 260.280 286.550 1.00 0.00 ? 153  ILE A C     1 
ATOM   1107  O  O     . ILE A  1  153  ? 283.234 260.647 287.437 1.00 0.00 ? 153  ILE A O     1 
ATOM   1108  C  CB    . ILE A  1  153  ? 284.506 259.704 285.250 1.00 0.00 ? 153  ILE A CB    1 
ATOM   1109  C  CG1   . ILE A  1  153  ? 285.014 259.470 283.826 1.00 0.00 ? 153  ILE A CG1   1 
ATOM   1110  C  CG2   . ILE A  1  153  ? 285.122 258.700 286.212 1.00 0.00 ? 153  ILE A CG2   1 
ATOM   1111  C  CD1   . ILE A  1  153  ? 284.853 258.044 283.347 1.00 0.00 ? 153  ILE A CD1   1 
ATOM   1112  N  N     . CYS A  1  154  ? 281.148 260.429 286.617 1.00 0.00 ? 154  CYS A N     1 
ATOM   1113  C  CA    . CYS A  1  154  ? 280.527 261.086 287.761 1.00 0.00 ? 154  CYS A CA    1 
ATOM   1114  C  C     . CYS A  1  154  ? 281.524 261.162 288.899 1.00 0.00 ? 154  CYS A C     1 
ATOM   1115  O  O     . CYS A  1  154  ? 282.057 260.144 289.341 1.00 0.00 ? 154  CYS A O     1 
ATOM   1116  C  CB    . CYS A  1  154  ? 279.275 260.338 288.221 1.00 0.00 ? 154  CYS A CB    1 
ATOM   1117  S  SG    . CYS A  1  154  ? 278.548 260.979 289.761 1.00 0.00 ? 154  CYS A SG    1 
ATOM   1118  N  N     . GLU A  1  155  ? 281.771 262.374 289.374 1.00 0.00 ? 155  GLU A N     1 
ATOM   1119  C  CA    . GLU A  1  155  ? 282.698 262.567 290.474 1.00 0.00 ? 155  GLU A CA    1 
ATOM   1120  C  C     . GLU A  1  155  ? 282.003 263.156 291.687 1.00 0.00 ? 155  GLU A C     1 
ATOM   1121  O  O     . GLU A  1  155  ? 280.931 262.701 292.088 1.00 0.00 ? 155  GLU A O     1 
ATOM   1122  C  CB    . GLU A  1  155  ? 283.857 263.462 290.036 1.00 0.00 ? 155  GLU A CB    1 
ATOM   1123  C  CG    . GLU A  1  155  ? 284.732 262.845 288.953 1.00 0.00 ? 155  GLU A CG    1 
ATOM   1124  C  CD    . GLU A  1  155  ? 285.316 261.498 289.343 1.00 0.00 ? 155  GLU A CD    1 
ATOM   1125  O  OE1   . GLU A  1  155  ? 285.457 261.222 290.553 1.00 0.00 ? 155  GLU A OE1   1 
ATOM   1126  O  OE2   . GLU A  1  155  ? 285.628 260.702 288.431 1.00 0.00 ? 155  GLU A OE2   1 
ATOM   1127  N  N     . GLY A  1  156  ? 282.618 264.179 292.265 1.00 0.00 ? 156  GLY A N     1 
ATOM   1128  C  CA    . GLY A  1  156  ? 282.185 264.682 293.548 1.00 0.00 ? 156  GLY A CA    1 
ATOM   1129  C  C     . GLY A  1  156  ? 282.855 265.983 293.923 1.00 0.00 ? 156  GLY A C     1 
ATOM   1130  O  O     . GLY A  1  156  ? 283.454 266.095 294.993 1.00 0.00 ? 156  GLY A O     1 
ATOM   1131  N  N     . GLY A  1  157  ? 282.779 266.966 293.030 1.00 0.00 ? 157  GLY A N     1 
ATOM   1132  C  CA    . GLY A  1  157  ? 283.182 268.307 293.397 1.00 0.00 ? 157  GLY A CA    1 
ATOM   1133  C  C     . GLY A  1  157  ? 282.923 269.447 292.430 1.00 0.00 ? 157  GLY A C     1 
ATOM   1134  O  O     . GLY A  1  157  ? 283.127 269.326 291.222 1.00 0.00 ? 157  GLY A O     1 
ATOM   1135  N  N     . GLY A  1  180  ? 281.272 268.265 297.444 1.00 0.00 ? 180  GLY A N     1 
ATOM   1136  C  CA    . GLY A  1  180  ? 281.006 267.036 296.715 1.00 0.00 ? 180  GLY A CA    1 
ATOM   1137  C  C     . GLY A  1  180  ? 279.550 266.820 296.350 1.00 0.00 ? 180  GLY A C     1 
ATOM   1138  O  O     . GLY A  1  180  ? 278.647 267.288 297.044 1.00 0.00 ? 180  GLY A O     1 
ATOM   1139  N  N     . HIS A  1  181  ? 279.338 266.402 295.105 1.00 0.00 ? 181  HIS A N     1 
ATOM   1140  C  CA    . HIS A  1  181  ? 277.997 266.179 294.574 1.00 0.00 ? 181  HIS A CA    1 
ATOM   1141  C  C     . HIS A  1  181  ? 277.801 264.728 294.856 1.00 0.00 ? 181  HIS A C     1 
ATOM   1142  O  O     . HIS A  1  181  ? 277.255 263.961 294.062 1.00 0.00 ? 181  HIS A O     1 
ATOM   1143  C  CB    . HIS A  1  181  ? 277.955 266.445 293.071 1.00 0.00 ? 181  HIS A CB    1 
ATOM   1144  C  CG    . HIS A  1  181  ? 279.294 266.370 292.406 1.00 0.00 ? 181  HIS A CG    1 
ATOM   1145  N  ND1   . HIS A  1  181  ? 279.534 265.577 291.304 1.00 0.00 ? 181  HIS A ND1   1 
ATOM   1146  C  CD2   . HIS A  1  181  ? 280.465 266.989 292.687 1.00 0.00 ? 181  HIS A CD2   1 
ATOM   1147  C  CE1   . HIS A  1  181  ? 280.796 265.711 290.935 1.00 0.00 ? 181  HIS A CE1   1 
ATOM   1148  N  NE2   . HIS A  1  181  ? 281.383 266.562 291.758 1.00 0.00 ? 181  HIS A NE2   1 
ATOM   1149  N  N     . GLY A  1  182  ? 278.151 264.405 296.097 1.00 0.00 ? 182  GLY A N     1 
ATOM   1150  C  CA    . GLY A  1  182  ? 277.975 263.087 296.655 1.00 0.00 ? 182  GLY A CA    1 
ATOM   1151  C  C     . GLY A  1  182  ? 279.140 262.134 296.709 1.00 0.00 ? 182  GLY A C     1 
ATOM   1152  O  O     . GLY A  1  182  ? 280.144 262.341 297.390 1.00 0.00 ? 182  GLY A O     1 
ATOM   1153  N  N     . GLY A  1  183  ? 278.963 261.066 295.953 1.00 0.00 ? 183  GLY A N     1 
ATOM   1154  C  CA    . GLY A  1  183  ? 279.883 259.947 295.868 1.00 0.00 ? 183  GLY A CA    1 
ATOM   1155  C  C     . GLY A  1  183  ? 279.811 259.329 294.484 1.00 0.00 ? 183  GLY A C     1 
ATOM   1156  O  O     . GLY A  1  183  ? 279.880 260.039 293.480 1.00 0.00 ? 183  GLY A O     1 
ATOM   1157  N  N     . CYS A  1  184  ? 279.654 258.008 294.442 1.00 0.00 ? 184  CYS A N     1 
ATOM   1158  C  CA    . CYS A  1  184  ? 279.467 257.258 293.201 1.00 0.00 ? 184  CYS A CA    1 
ATOM   1159  C  C     . CYS A  1  184  ? 280.512 257.542 292.116 1.00 0.00 ? 184  CYS A C     1 
ATOM   1160  O  O     . CYS A  1  184  ? 280.357 258.456 291.304 1.00 0.00 ? 184  CYS A O     1 
ATOM   1161  C  CB    . CYS A  1  184  ? 278.063 257.537 292.652 1.00 0.00 ? 184  CYS A CB    1 
ATOM   1162  S  SG    . CYS A  1  184  ? 277.751 256.944 290.976 1.00 0.00 ? 184  CYS A SG    1 
ATOM   1163  N  N     . GLY A  1  185  ? 281.588 256.761 292.121 1.00 0.00 ? 185  GLY A N     1 
ATOM   1164  C  CA    . GLY A  1  185  ? 282.607 256.868 291.092 1.00 0.00 ? 185  GLY A CA    1 
ATOM   1165  C  C     . GLY A  1  185  ? 282.370 255.891 289.956 1.00 0.00 ? 185  GLY A C     1 
ATOM   1166  O  O     . GLY A  1  185  ? 283.243 255.680 289.113 1.00 0.00 ? 185  GLY A O     1 
ATOM   1167  N  N     . ARG A  1  186  ? 281.183 255.290 289.940 1.00 0.00 ? 186  ARG A N     1 
ATOM   1168  C  CA    . ARG A  1  186  ? 280.831 254.283 288.944 1.00 0.00 ? 186  ARG A CA    1 
ATOM   1169  C  C     . ARG A  1  186  ? 280.902 254.859 287.533 1.00 0.00 ? 186  ARG A C     1 
ATOM   1170  O  O     . ARG A  1  186  ? 280.438 255.971 287.291 1.00 0.00 ? 186  ARG A O     1 
ATOM   1171  C  CB    . ARG A  1  186  ? 279.429 253.732 289.212 1.00 0.00 ? 186  ARG A CB    1 
ATOM   1172  C  CG    . ARG A  1  186  ? 279.258 253.124 290.594 1.00 0.00 ? 186  ARG A CG    1 
ATOM   1173  C  CD    . ARG A  1  186  ? 279.996 251.806 290.729 1.00 0.00 ? 186  ARG A CD    1 
ATOM   1174  N  NE    . ARG A  1  186  ? 279.916 251.288 292.091 1.00 0.00 ? 186  ARG A NE    1 
ATOM   1175  C  CZ    . ARG A  1  186  ? 280.485 250.157 292.494 1.00 0.00 ? 186  ARG A CZ    1 
ATOM   1176  N  NH1   . ARG A  1  186  ? 281.179 249.421 291.639 1.00 0.00 ? 186  ARG A NH1   1 
ATOM   1177  N  NH2   . ARG A  1  186  ? 280.368 249.765 293.757 1.00 0.00 ? 186  ARG A NH2   1 
ATOM   1178  N  N     . TYR A  1  187  ? 281.472 254.096 286.606 1.00 0.00 ? 187  TYR A N     1 
ATOM   1179  C  CA    . TYR A  1  187  ? 281.510 254.499 285.203 1.00 0.00 ? 187  TYR A CA    1 
ATOM   1180  C  C     . TYR A  1  187  ? 280.108 254.578 284.598 1.00 0.00 ? 187  TYR A C     1 
ATOM   1181  O  O     . TYR A  1  187  ? 279.228 253.787 284.935 1.00 0.00 ? 187  TYR A O     1 
ATOM   1182  C  CB    . TYR A  1  187  ? 282.389 253.537 284.395 1.00 0.00 ? 187  TYR A CB    1 
ATOM   1183  C  CG    . TYR A  1  187  ? 282.365 253.780 282.900 1.00 0.00 ? 187  TYR A CG    1 
ATOM   1184  C  CD1   . TYR A  1  187  ? 283.004 254.881 282.341 1.00 0.00 ? 187  TYR A CD1   1 
ATOM   1185  C  CD2   . TYR A  1  187  ? 281.719 252.896 282.045 1.00 0.00 ? 187  TYR A CD2   1 
ATOM   1186  C  CE1   . TYR A  1  187  ? 282.987 255.101 280.972 1.00 0.00 ? 187  TYR A CE1   1 
ATOM   1187  C  CE2   . TYR A  1  187  ? 281.698 253.104 280.677 1.00 0.00 ? 187  TYR A CE2   1 
ATOM   1188  C  CZ    . TYR A  1  187  ? 282.331 254.209 280.145 1.00 0.00 ? 187  TYR A CZ    1 
ATOM   1189  O  OH    . TYR A  1  187  ? 282.309 254.419 278.784 1.00 0.00 ? 187  TYR A OH    1 
ATOM   1190  N  N     . GLN A  1  188  ? 279.913 255.541 283.702 1.00 0.00 ? 188  GLN A N     1 
ATOM   1191  C  CA    . GLN A  1  188  ? 278.612 255.765 283.081 1.00 0.00 ? 188  GLN A CA    1 
ATOM   1192  C  C     . GLN A  1  188  ? 278.442 254.862 281.869 1.00 0.00 ? 188  GLN A C     1 
ATOM   1193  O  O     . GLN A  1  188  ? 279.277 254.873 280.968 1.00 0.00 ? 188  GLN A O     1 
ATOM   1194  C  CB    . GLN A  1  188  ? 278.464 257.230 282.667 1.00 0.00 ? 188  GLN A CB    1 
ATOM   1195  C  CG    . GLN A  1  188  ? 278.241 258.180 283.825 1.00 0.00 ? 188  GLN A CG    1 
ATOM   1196  C  CD    . GLN A  1  188  ? 276.887 257.994 284.472 1.00 0.00 ? 188  GLN A CD    1 
ATOM   1197  O  OE1   . GLN A  1  188  ? 275.859 258.359 283.904 1.00 0.00 ? 188  GLN A OE1   1 
ATOM   1198  N  NE2   . GLN A  1  188  ? 276.878 257.414 285.667 1.00 0.00 ? 188  GLN A NE2   1 
ATOM   1199  N  N     . PRO A  1  189  ? 277.344 254.093 281.824 1.00 0.00 ? 189  PRO A N     1 
ATOM   1200  C  CA    . PRO A  1  189  ? 277.252 253.037 280.811 1.00 0.00 ? 189  PRO A CA    1 
ATOM   1201  C  C     . PRO A  1  189  ? 277.085 253.581 279.395 1.00 0.00 ? 189  PRO A C     1 
ATOM   1202  O  O     . PRO A  1  189  ? 276.378 254.564 279.182 1.00 0.00 ? 189  PRO A O     1 
ATOM   1203  C  CB    . PRO A  1  189  ? 276.008 252.253 281.238 1.00 0.00 ? 189  PRO A CB    1 
ATOM   1204  C  CG    . PRO A  1  189  ? 275.185 253.238 281.995 1.00 0.00 ? 189  PRO A CG    1 
ATOM   1205  C  CD    . PRO A  1  189  ? 276.166 254.121 282.710 1.00 0.00 ? 189  PRO A CD    1 
ATOM   1206  N  N     . ARG A  1  190  ? 277.739 252.932 278.437 1.00 0.00 ? 190  ARG A N     1 
ATOM   1207  C  CA    . ARG A  1  190  ? 277.595 253.285 277.032 1.00 0.00 ? 190  ARG A CA    1 
ATOM   1208  C  C     . ARG A  1  190  ? 276.256 252.802 276.495 1.00 0.00 ? 190  ARG A C     1 
ATOM   1209  O  O     . ARG A  1  190  ? 276.132 251.660 276.053 1.00 0.00 ? 190  ARG A O     1 
ATOM   1210  C  CB    . ARG A  1  190  ? 278.741 252.699 276.205 1.00 0.00 ? 190  ARG A CB    1 
ATOM   1211  C  CG    . ARG A  1  190  ? 278.828 253.269 274.805 1.00 0.00 ? 190  ARG A CG    1 
ATOM   1212  C  CD    . ARG A  1  190  ? 278.878 254.782 274.840 1.00 0.00 ? 190  ARG A CD    1 
ATOM   1213  N  NE    . ARG A  1  190  ? 278.895 255.351 273.498 1.00 0.00 ? 190  ARG A NE    1 
ATOM   1214  C  CZ    . ARG A  1  190  ? 277.801 255.675 272.816 1.00 0.00 ? 190  ARG A CZ    1 
ATOM   1215  N  NH1   . ARG A  1  190  ? 276.603 255.483 273.354 1.00 0.00 ? 190  ARG A NH1   1 
ATOM   1216  N  NH2   . ARG A  1  190  ? 277.903 256.204 271.603 1.00 0.00 ? 190  ARG A NH2   1 
ATOM   1217  N  N     . ILE A  1  191  ? 275.257 253.678 276.534 1.00 0.00 ? 191  ILE A N     1 
ATOM   1218  C  CA    . ILE A  1  191  ? 273.892 253.311 276.174 1.00 0.00 ? 191  ILE A CA    1 
ATOM   1219  C  C     . ILE A  1  191  ? 273.711 253.179 274.670 1.00 0.00 ? 191  ILE A C     1 
ATOM   1220  O  O     . ILE A  1  191  ? 274.158 254.030 273.905 1.00 0.00 ? 191  ILE A O     1 
ATOM   1221  C  CB    . ILE A  1  191  ? 272.874 254.355 276.677 1.00 0.00 ? 191  ILE A CB    1 
ATOM   1222  C  CG1   . ILE A  1  191  ? 273.127 254.706 278.141 1.00 0.00 ? 191  ILE A CG1   1 
ATOM   1223  C  CG2   . ILE A  1  191  ? 271.449 253.860 276.475 1.00 0.00 ? 191  ILE A CG2   1 
ATOM   1224  C  CD1   . ILE A  1  191  ? 272.118 255.679 278.700 1.00 0.00 ? 191  ILE A CD1   1 
ATOM   1225  N  N     . ARG A  1  192  ? 273.043 252.115 274.245 1.00 0.00 ? 192  ARG A N     1 
ATOM   1226  C  CA    . ARG A  1  192  ? 272.679 251.991 272.848 1.00 0.00 ? 192  ARG A CA    1 
ATOM   1227  C  C     . ARG A  1  192  ? 271.203 251.671 272.783 1.00 0.00 ? 192  ARG A C     1 
ATOM   1228  O  O     . ARG A  1  192  ? 270.628 251.147 273.735 1.00 0.00 ? 192  ARG A O     1 
ATOM   1229  C  CB    . ARG A  1  192  ? 273.484 250.895 272.145 1.00 0.00 ? 192  ARG A CB    1 
ATOM   1230  C  CG    . ARG A  1  192  ? 274.994 251.078 272.166 1.00 0.00 ? 192  ARG A CG    1 
ATOM   1231  C  CD    . ARG A  1  192  ? 275.688 249.939 271.418 1.00 0.00 ? 192  ARG A CD    1 
ATOM   1232  N  NE    . ARG A  1  192  ? 277.147 250.041 271.461 1.00 0.00 ? 192  ARG A NE    1 
ATOM   1233  C  CZ    . ARG A  1  192  ? 277.872 250.803 270.647 1.00 0.00 ? 192  ARG A CZ    1 
ATOM   1234  N  NH1   . ARG A  1  192  ? 277.280 251.541 269.717 1.00 0.00 ? 192  ARG A NH1   1 
ATOM   1235  N  NH2   . ARG A  1  192  ? 279.196 250.812 270.748 1.00 0.00 ? 192  ARG A NH2   1 
ATOM   1236  N  N     . ARG A  1  193  ? 270.591 251.982 271.651 1.00 0.00 ? 193  ARG A N     1 
ATOM   1237  C  CA    . ARG A  1  193  ? 269.197 251.642 271.432 1.00 0.00 ? 193  ARG A CA    1 
ATOM   1238  C  C     . ARG A  1  193  ? 269.096 250.466 270.476 1.00 0.00 ? 193  ARG A C     1 
ATOM   1239  O  O     . ARG A  1  193  ? 269.774 250.444 269.450 1.00 0.00 ? 193  ARG A O     1 
ATOM   1240  C  CB    . ARG A  1  193  ? 268.413 252.834 270.894 1.00 0.00 ? 193  ARG A CB    1 
ATOM   1241  C  CG    . ARG A  1  193  ? 266.981 252.478 270.551 1.00 0.00 ? 193  ARG A CG    1 
ATOM   1242  C  CD    . ARG A  1  193  ? 266.246 253.623 269.888 1.00 0.00 ? 193  ARG A CD    1 
ATOM   1243  N  NE    . ARG A  1  193  ? 264.958 253.202 269.345 1.00 0.00 ? 193  ARG A NE    1 
ATOM   1244  C  CZ    . ARG A  1  193  ? 264.317 253.822 268.360 1.00 0.00 ? 193  ARG A CZ    1 
ATOM   1245  N  NH1   . ARG A  1  193  ? 264.820 254.926 267.826 1.00 0.00 ? 193  ARG A NH1   1 
ATOM   1246  N  NH2   . ARG A  1  193  ? 263.187 253.317 267.884 1.00 0.00 ? 193  ARG A NH2   1 
ATOM   1247  N  N     . SER A  1  194  ? 268.259 249.487 270.793 1.00 0.00 ? 194  SER A N     1 
ATOM   1248  C  CA    . SER A  1  194  ? 267.980 248.445 269.814 1.00 0.00 ? 194  SER A CA    1 
ATOM   1249  C  C     . SER A  1  194  ? 266.488 248.270 269.607 1.00 0.00 ? 194  SER A C     1 
ATOM   1250  O  O     . SER A  1  194  ? 265.817 247.620 270.403 1.00 0.00 ? 194  SER A O     1 
ATOM   1251  C  CB    . SER A  1  194  ? 268.595 247.108 270.239 1.00 0.00 ? 194  SER A CB    1 
ATOM   1252  O  OG    . SER A  1  194  ? 269.978 247.227 270.521 1.00 0.00 ? 194  SER A OG    1 
ATOM   1253  N  N     . GLY A  1  195  ? 265.980 248.833 268.516 1.00 0.00 ? 195  GLY A N     1 
ATOM   1254  C  CA    . GLY A  1  195  ? 264.558 248.796 268.234 1.00 0.00 ? 195  GLY A CA    1 
ATOM   1255  C  C     . GLY A  1  195  ? 263.730 249.379 269.361 1.00 0.00 ? 195  GLY A C     1 
ATOM   1256  O  O     . GLY A  1  195  ? 263.432 250.574 269.366 1.00 0.00 ? 195  GLY A O     1 
ATOM   1257  N  N     . LEU A  1  196  ? 263.361 248.531 270.318 1.00 0.00 ? 196  LEU A N     1 
ATOM   1258  C  CA    . LEU A  1  196  ? 262.591 248.966 271.480 1.00 0.00 ? 196  LEU A CA    1 
ATOM   1259  C  C     . LEU A  1  196  ? 263.269 248.638 272.808 1.00 0.00 ? 196  LEU A C     1 
ATOM   1260  O  O     . LEU A  1  196  ? 262.754 248.989 273.871 1.00 0.00 ? 196  LEU A O     1 
ATOM   1261  C  CB    . LEU A  1  196  ? 261.197 248.348 271.464 1.00 0.00 ? 196  LEU A CB    1 
ATOM   1262  C  CG    . LEU A  1  196  ? 260.247 248.876 270.395 1.00 0.00 ? 196  LEU A CG    1 
ATOM   1263  C  CD1   . LEU A  1  196  ? 258.988 248.032 270.372 1.00 0.00 ? 196  LEU A CD1   1 
ATOM   1264  C  CD2   . LEU A  1  196  ? 259.921 250.340 270.636 1.00 0.00 ? 196  LEU A CD2   1 
ATOM   1265  N  N     . GLU A  1  197  ? 264.399 247.938 272.765 1.00 0.00 ? 197  GLU A N     1 
ATOM   1266  C  CA    . GLU A  1  197  ? 265.094 247.625 274.006 1.00 0.00 ? 197  GLU A CA    1 
ATOM   1267  C  C     . GLU A  1  197  ? 266.425 248.366 274.143 1.00 0.00 ? 197  GLU A C     1 
ATOM   1268  O  O     . GLU A  1  197  ? 266.965 248.880 273.162 1.00 0.00 ? 197  GLU A O     1 
ATOM   1269  C  CB    . GLU A  1  197  ? 265.341 246.121 274.066 1.00 0.00 ? 197  GLU A CB    1 
ATOM   1270  C  CG    . GLU A  1  197  ? 266.292 245.664 272.967 1.00 0.00 ? 197  GLU A CG    1 
ATOM   1271  C  CD    . GLU A  1  197  ? 265.870 244.366 272.315 1.00 0.00 ? 197  GLU A CD    1 
ATOM   1272  O  OE1   . GLU A  1  197  ? 264.654 244.175 272.109 1.00 0.00 ? 197  GLU A OE1   1 
ATOM   1273  O  OE2   . GLU A  1  197  ? 266.756 243.547 271.990 1.00 0.00 ? 197  GLU A OE2   1 
ATOM   1274  N  N     . LEU A  1  198  ? 266.943 248.417 275.366 1.00 0.00 ? 198  LEU A N     1 
ATOM   1275  C  CA    . LEU A  1  198  ? 268.165 249.163 275.653 1.00 0.00 ? 198  LEU A CA    1 
ATOM   1276  C  C     . LEU A  1  198  ? 269.354 248.248 275.961 1.00 0.00 ? 198  LEU A C     1 
ATOM   1277  O  O     . LEU A  1  198  ? 269.193 247.276 276.696 1.00 0.00 ? 198  LEU A O     1 
ATOM   1278  C  CB    . LEU A  1  198  ? 267.923 250.110 276.829 1.00 0.00 ? 198  LEU A CB    1 
ATOM   1279  C  CG    . LEU A  1  198  ? 267.484 251.534 276.490 1.00 0.00 ? 198  LEU A CG    1 
ATOM   1280  C  CD1   . LEU A  1  198  ? 266.122 251.523 275.823 1.00 0.00 ? 198  LEU A CD1   1 
ATOM   1281  C  CD2   . LEU A  1  198  ? 267.449 252.386 277.746 1.00 0.00 ? 198  LEU A CD2   1 
ATOM   1282  N  N     . TYR A  1  199  ? 270.537 248.524 275.419 1.00 0.00 ? 199  TYR A N     1 
ATOM   1283  C  CA    . TYR A  1  199  ? 271.689 247.699 275.784 1.00 0.00 ? 199  TYR A CA    1 
ATOM   1284  C  C     . TYR A  1  199  ? 272.756 248.558 276.466 1.00 0.00 ? 199  TYR A C     1 
ATOM   1285  O  O     . TYR A  1  199  ? 272.914 249.728 276.119 1.00 0.00 ? 199  TYR A O     1 
ATOM   1286  C  CB    . TYR A  1  199  ? 272.250 246.985 274.553 1.00 0.00 ? 199  TYR A CB    1 
ATOM   1287  C  CG    . TYR A  1  199  ? 271.530 245.689 274.260 1.00 0.00 ? 199  TYR A CG    1 
ATOM   1288  C  CD1   . TYR A  1  199  ? 270.239 245.693 273.753 1.00 0.00 ? 199  TYR A CD1   1 
ATOM   1289  C  CD2   . TYR A  1  199  ? 272.121 244.463 274.538 1.00 0.00 ? 199  TYR A CD2   1 
ATOM   1290  C  CE1   . TYR A  1  199  ? 269.568 244.516 273.499 1.00 0.00 ? 199  TYR A CE1   1 
ATOM   1291  C  CE2   . TYR A  1  199  ? 271.464 243.278 274.266 1.00 0.00 ? 199  TYR A CE2   1 
ATOM   1292  C  CZ    . TYR A  1  199  ? 270.184 243.312 273.752 1.00 0.00 ? 199  TYR A CZ    1 
ATOM   1293  O  OH    . TYR A  1  199  ? 269.504 242.139 273.517 1.00 0.00 ? 199  TYR A OH    1 
ATOM   1294  N  N     . ALA A  1  200  ? 273.476 247.998 277.438 1.00 0.00 ? 200  ALA A N     1 
ATOM   1295  C  CA    . ALA A  1  200  ? 274.514 248.771 278.124 1.00 0.00 ? 200  ALA A CA    1 
ATOM   1296  C  C     . ALA A  1  200  ? 275.910 248.133 278.107 1.00 0.00 ? 200  ALA A C     1 
ATOM   1297  O  O     . ALA A  1  200  ? 276.044 246.916 277.979 1.00 0.00 ? 200  ALA A O     1 
ATOM   1298  C  CB    . ALA A  1  200  ? 274.089 249.032 279.564 1.00 0.00 ? 200  ALA A CB    1 
ATOM   1299  N  N     . GLU A  1  201  ? 276.938 248.968 278.242 1.00 0.00 ? 201  GLU A N     1 
ATOM   1300  C  CA    . GLU A  1  201  ? 278.333 248.518 278.210 1.00 0.00 ? 201  GLU A CA    1 
ATOM   1301  C  C     . GLU A  1  201  ? 279.134 249.304 279.252 1.00 0.00 ? 201  GLU A C     1 
ATOM   1302  O  O     . GLU A  1  201  ? 278.655 250.316 279.761 1.00 0.00 ? 201  GLU A O     1 
ATOM   1303  C  CB    . GLU A  1  201  ? 278.960 248.646 276.820 1.00 0.00 ? 201  GLU A CB    1 
ATOM   1304  C  CG    . GLU A  1  201  ? 280.118 247.661 276.630 1.00 0.00 ? 201  GLU A CG    1 
ATOM   1305  C  CD    . GLU A  1  201  ? 280.413 247.327 275.184 1.00 0.00 ? 201  GLU A CD    1 
ATOM   1306  O  OE1   . GLU A  1  201  ? 279.653 247.769 274.298 1.00 0.00 ? 201  GLU A OE1   1 
ATOM   1307  O  OE2   . GLU A  1  201  ? 281.411 246.613 274.937 1.00 0.00 ? 201  GLU A OE2   1 
ATOM   1308  N  N     . TRP A  1  202  ? 280.350 248.856 279.556 1.00 0.00 ? 202  TRP A N     1 
ATOM   1309  C  CA    . TRP A  1  202  ? 281.187 249.526 280.554 1.00 0.00 ? 202  TRP A CA    1 
ATOM   1310  C  C     . TRP A  1  202  ? 282.686 249.341 280.277 1.00 0.00 ? 202  TRP A C     1 
ATOM   1311  O  O     . TRP A  1  202  ? 283.191 248.218 280.242 1.00 0.00 ? 202  TRP A O     1 
ATOM   1312  C  CB    . TRP A  1  202  ? 280.851 249.024 281.962 1.00 0.00 ? 202  TRP A CB    1 
ATOM   1313  C  CG    . TRP A  1  202  ? 279.545 249.532 282.508 1.00 0.00 ? 202  TRP A CG    1 
ATOM   1314  C  CD1   . TRP A  1  202  ? 279.320 250.731 283.123 1.00 0.00 ? 202  TRP A CD1   1 
ATOM   1315  C  CD2   . TRP A  1  202  ? 278.284 248.853 282.485 1.00 0.00 ? 202  TRP A CD2   1 
ATOM   1316  N  NE1   . TRP A  1  202  ? 277.999 250.838 283.485 1.00 0.00 ? 202  TRP A NE1   1 
ATOM   1317  C  CE2   . TRP A  1  202  ? 277.341 249.698 283.105 1.00 0.00 ? 202  TRP A CE2   1 
ATOM   1318  C  CE3   . TRP A  1  202  ? 277.860 247.611 282.000 1.00 0.00 ? 202  TRP A CE3   1 
ATOM   1319  C  CZ2   . TRP A  1  202  ? 276.001 249.343 283.252 1.00 0.00 ? 202  TRP A CZ2   1 
ATOM   1320  C  CZ3   . TRP A  1  202  ? 276.530 247.260 282.147 1.00 0.00 ? 202  TRP A CZ3   1 
ATOM   1321  C  CH2   . TRP A  1  202  ? 275.618 248.123 282.767 1.00 0.00 ? 202  TRP A CH2   1 
ATOM   1322  N  N     . LYS A  1  203  ? 283.301 250.446 279.885 1.00 0.00 ? 203  LYS A N     1 
ATOM   1323  C  CA    . LYS A  1  203  ? 284.643 250.354 279.368 1.00 0.00 ? 203  LYS A CA    1 
ATOM   1324  C  C     . LYS A  1  203  ? 285.879 250.937 280.000 1.00 0.00 ? 203  LYS A C     1 
ATOM   1325  O  O     . LYS A  1  203  ? 286.104 252.146 280.047 1.00 0.00 ? 203  LYS A O     1 
ATOM   1326  C  CB    . LYS A  1  203  ? 284.629 250.774 277.889 1.00 0.00 ? 203  LYS A CB    1 
ATOM   1327  C  CG    . LYS A  1  203  ? 284.335 249.637 276.924 1.00 0.00 ? 203  LYS A CG    1 
ATOM   1328  C  CD    . LYS A  1  203  ? 285.432 249.501 275.880 1.00 0.00 ? 203  LYS A CD    1 
ATOM   1329  C  CE    . LYS A  1  203  ? 285.271 248.223 275.073 1.00 0.00 ? 203  LYS A CE    1 
ATOM   1330  N  NZ    . LYS A  1  203  ? 283.838 247.880 274.855 1.00 0.00 ? 203  LYS A NZ    1 
ATOM   1331  N  N     . HIS A  1  204  ? 286.672 250.001 280.483 1.00 0.00 ? 204  HIS A N     1 
ATOM   1332  C  CA    . HIS A  1  204  ? 288.035 250.257 280.929 1.00 0.00 ? 204  HIS A CA    1 
ATOM   1333  C  C     . HIS A  1  204  ? 288.534 250.250 282.368 1.00 0.00 ? 204  HIS A C     1 
ATOM   1334  O  O     . HIS A  1  204  ? 289.168 249.282 282.790 1.00 0.00 ? 204  HIS A O     1 
ATOM   1335  C  CB    . HIS A  1  204  ? 288.536 251.549 280.264 1.00 0.00 ? 204  HIS A CB    1 
ATOM   1336  C  CG    . HIS A  1  204  ? 289.620 251.328 279.255 1.00 0.00 ? 204  HIS A CG    1 
ATOM   1337  N  ND1   . HIS A  1  204  ? 289.756 250.148 278.556 1.00 0.00 ? 204  HIS A ND1   1 
ATOM   1338  C  CD2   . HIS A  1  204  ? 290.619 252.136 278.828 1.00 0.00 ? 204  HIS A CD2   1 
ATOM   1339  C  CE1   . HIS A  1  204  ? 290.792 250.239 277.741 1.00 0.00 ? 204  HIS A CE1   1 
ATOM   1340  N  NE2   . HIS A  1  204  ? 291.333 251.435 277.887 1.00 0.00 ? 204  HIS A NE2   1 
ATOM   1341  N  N     . VAL A  1  205  ? 288.467 251.448 282.925 1.00 0.00 ? 205  VAL A N     1 
ATOM   1342  C  CA    . VAL A  1  205  ? 289.083 251.803 284.186 1.00 0.00 ? 205  VAL A CA    1 
ATOM   1343  C  C     . VAL A  1  205  ? 288.612 251.437 285.572 1.00 0.00 ? 205  VAL A C     1 
ATOM   1344  O  O     . VAL A  1  205  ? 287.647 251.992 286.098 1.00 0.00 ? 205  VAL A O     1 
ATOM   1345  C  CB    . VAL A  1  205  ? 289.354 253.326 284.219 1.00 0.00 ? 205  VAL A CB    1 
ATOM   1346  C  CG1   . VAL A  1  205  ? 290.710 253.637 283.604 1.00 0.00 ? 205  VAL A CG1   1 
ATOM   1347  C  CG2   . VAL A  1  205  ? 288.247 254.078 283.495 1.00 0.00 ? 205  VAL A CG2   1 
ATOM   1348  N  N     . ASN A  1  206  ? 289.326 250.487 286.155 1.00 0.00 ? 206  ASN A N     1 
ATOM   1349  C  CA    . ASN A  1  206  ? 289.144 250.222 287.551 1.00 0.00 ? 206  ASN A CA    1 
ATOM   1350  C  C     . ASN A  1  206  ? 288.437 248.889 287.622 1.00 0.00 ? 206  ASN A C     1 
ATOM   1351  O  O     . ASN A  1  206  ? 288.596 248.170 288.608 1.00 0.00 ? 206  ASN A O     1 
ATOM   1352  C  CB    . ASN A  1  206  ? 288.295 251.312 288.203 1.00 0.00 ? 206  ASN A CB    1 
ATOM   1353  C  CG    . ASN A  1  206  ? 288.954 251.908 289.431 1.00 0.00 ? 206  ASN A CG    1 
ATOM   1354  O  OD1   . ASN A  1  206  ? 289.950 251.384 289.931 1.00 0.00 ? 206  ASN A OD1   1 
ATOM   1355  N  ND2   . ASN A  1  206  ? 288.400 253.009 289.925 1.00 0.00 ? 206  ASN A ND2   1 
ATOM   1356  N  N     . GLU A  1  207  ? 287.651 248.524 286.601 1.00 0.00 ? 207  GLU A N     1 
ATOM   1357  C  CA    . GLU A  1  207  ? 287.043 247.198 286.760 1.00 0.00 ? 207  GLU A CA    1 
ATOM   1358  C  C     . GLU A  1  207  ? 285.919 247.135 287.806 1.00 0.00 ? 207  GLU A C     1 
ATOM   1359  O  O     . GLU A  1  207  ? 284.968 246.373 287.634 1.00 0.00 ? 207  GLU A O     1 
ATOM   1360  C  CB    . GLU A  1  207  ? 288.128 246.164 287.095 1.00 0.00 ? 207  GLU A CB    1 
ATOM   1361  C  CG    . GLU A  1  207  ? 289.063 245.853 285.930 1.00 0.00 ? 207  GLU A CG    1 
ATOM   1362  C  CD    . GLU A  1  207  ? 289.925 244.627 286.171 1.00 0.00 ? 207  GLU A CD    1 
ATOM   1363  O  OE1   . GLU A  1  207  ? 289.902 244.092 287.300 1.00 0.00 ? 207  GLU A OE1   1 
ATOM   1364  O  OE2   . GLU A  1  207  ? 290.630 244.203 285.232 1.00 0.00 ? 207  GLU A OE2   1 
ATOM   1365  N  N     . ASP A  1  208  ? 286.038 247.941 288.866 1.00 0.00 ? 208  ASP A N     1 
ATOM   1366  C  CA    . ASP A  1  208  ? 285.106 248.016 290.011 1.00 0.00 ? 208  ASP A CA    1 
ATOM   1367  C  C     . ASP A  1  208  ? 284.219 246.789 290.284 1.00 0.00 ? 208  ASP A C     1 
ATOM   1368  O  O     . ASP A  1  208  ? 284.272 246.207 291.370 1.00 0.00 ? 208  ASP A O     1 
ATOM   1369  C  CB    . ASP A  1  208  ? 284.209 249.262 289.872 1.00 0.00 ? 208  ASP A CB    1 
ATOM   1370  C  CG    . ASP A  1  208  ? 283.562 249.388 288.498 1.00 0.00 ? 208  ASP A CG    1 
ATOM   1371  O  OD1   . ASP A  1  208  ? 283.099 248.369 287.946 1.00 0.00 ? 208  ASP A OD1   1 
ATOM   1372  O  OD2   . ASP A  1  208  ? 283.506 250.522 287.973 1.00 0.00 ? 208  ASP A OD2   1 
ATOM   1373  N  N     . SER A  1  209  ? 283.416 246.402 289.297 1.00 0.00 ? 209  SER A N     1 
ATOM   1374  C  CA    . SER A  1  209  ? 282.412 245.354 289.451 1.00 0.00 ? 209  SER A CA    1 
ATOM   1375  C  C     . SER A  1  209  ? 281.875 245.002 288.073 1.00 0.00 ? 209  SER A C     1 
ATOM   1376  O  O     . SER A  1  209  ? 281.789 245.876 287.211 1.00 0.00 ? 209  SER A O     1 
ATOM   1377  C  CB    . SER A  1  209  ? 281.273 245.803 290.373 1.00 0.00 ? 209  SER A CB    1 
ATOM   1378  O  OG    . SER A  1  209  ? 280.507 246.839 289.779 1.00 0.00 ? 209  SER A OG    1 
ATOM   1379  N  N     . GLN A  1  210  ? 281.556 243.721 287.870 1.00 0.00 ? 210  GLN A N     1 
ATOM   1380  C  CA    . GLN A  1  210  ? 280.971 243.196 286.625 1.00 0.00 ? 210  GLN A CA    1 
ATOM   1381  C  C     . GLN A  1  210  ? 281.774 243.637 285.385 1.00 0.00 ? 210  GLN A C     1 
ATOM   1382  O  O     . GLN A  1  210  ? 282.926 244.053 285.522 1.00 0.00 ? 210  GLN A O     1 
ATOM   1383  C  CB    . GLN A  1  210  ? 279.483 243.590 286.527 1.00 0.00 ? 210  GLN A CB    1 
ATOM   1384  C  CG    . GLN A  1  210  ? 279.158 245.051 286.229 1.00 0.00 ? 210  GLN A CG    1 
ATOM   1385  C  CD    . GLN A  1  210  ? 277.670 245.306 286.112 1.00 0.00 ? 210  GLN A CD    1 
ATOM   1386  O  OE1   . GLN A  1  210  ? 276.853 244.436 286.415 1.00 0.00 ? 210  GLN A OE1   1 
ATOM   1387  N  NE2   . GLN A  1  210  ? 277.309 246.507 285.675 1.00 0.00 ? 210  GLN A NE2   1 
ATOM   1388  N  N     . GLU A  1  211  ? 281.338 243.372 284.172 1.00 0.00 ? 211  GLU A N     1 
ATOM   1389  C  CA    . GLU A  1  211  ? 282.153 243.798 283.029 1.00 0.00 ? 211  GLU A CA    1 
ATOM   1390  C  C     . GLU A  1  211  ? 281.064 244.413 282.247 1.00 0.00 ? 211  GLU A C     1 
ATOM   1391  O  O     . GLU A  1  211  ? 281.137 245.526 281.726 1.00 0.00 ? 211  GLU A O     1 
ATOM   1392  C  CB    . GLU A  1  211  ? 282.732 242.595 282.293 1.00 0.00 ? 211  GLU A CB    1 
ATOM   1393  C  CG    . GLU A  1  211  ? 283.311 242.923 280.926 1.00 0.00 ? 211  GLU A CG    1 
ATOM   1394  C  CD    . GLU A  1  211  ? 282.871 241.944 279.856 1.00 0.00 ? 211  GLU A CD    1 
ATOM   1395  O  OE1   . GLU A  1  211  ? 282.204 240.945 280.199 1.00 0.00 ? 211  GLU A OE1   1 
ATOM   1396  O  OE2   . GLU A  1  211  ? 283.191 242.173 278.670 1.00 0.00 ? 211  GLU A OE2   1 
ATOM   1397  N  N     . LYS A  1  212  ? 280.029 243.608 282.197 1.00 0.00 ? 212  LYS A N     1 
ATOM   1398  C  CA    . LYS A  1  212  ? 278.740 243.981 281.622 1.00 0.00 ? 212  LYS A CA    1 
ATOM   1399  C  C     . LYS A  1  212  ? 278.659 244.039 280.093 1.00 0.00 ? 212  LYS A C     1 
ATOM   1400  O  O     . LYS A  1  212  ? 279.608 244.419 279.405 1.00 0.00 ? 212  LYS A O     1 
ATOM   1401  C  CB    . LYS A  1  212  ? 278.269 245.315 282.210 1.00 0.00 ? 212  LYS A CB    1 
ATOM   1402  C  CG    . LYS A  1  212  ? 277.149 245.183 283.229 1.00 0.00 ? 212  LYS A CG    1 
ATOM   1403  C  CD    . LYS A  1  212  ? 277.225 243.855 283.964 1.00 0.00 ? 212  LYS A CD    1 
ATOM   1404  C  CE    . LYS A  1  212  ? 276.657 242.724 283.122 1.00 0.00 ? 212  LYS A CE    1 
ATOM   1405  N  NZ    . LYS A  1  212  ? 277.551 241.534 283.114 1.00 0.00 ? 212  LYS A NZ    1 
ATOM   1406  N  N     . LYS A  1  213  ? 277.478 243.665 279.611 1.00 0.00 ? 213  LYS A N     1 
ATOM   1407  C  CA    . LYS A  1  213  ? 277.071 243.620 278.211 1.00 0.00 ? 213  LYS A CA    1 
ATOM   1408  C  C     . LYS A  1  213  ? 275.652 243.139 278.425 1.00 0.00 ? 213  LYS A C     1 
ATOM   1409  O  O     . LYS A  1  213  ? 275.335 241.975 278.183 1.00 0.00 ? 213  LYS A O     1 
ATOM   1410  C  CB    . LYS A  1  213  ? 277.864 242.576 277.430 1.00 0.00 ? 213  LYS A CB    1 
ATOM   1411  C  CG    . LYS A  1  213  ? 277.370 242.356 276.009 1.00 0.00 ? 213  LYS A CG    1 
ATOM   1412  C  CD    . LYS A  1  213  ? 278.230 243.106 275.004 1.00 0.00 ? 213  LYS A CD    1 
ATOM   1413  C  CE    . LYS A  1  213  ? 279.183 242.167 274.283 1.00 0.00 ? 213  LYS A CE    1 
ATOM   1414  N  NZ    . LYS A  1  213  ? 279.941 242.862 273.207 1.00 0.00 ? 213  LYS A NZ    1 
ATOM   1415  N  N     . ILE A  1  214  ? 274.796 244.045 278.886 1.00 0.00 ? 214  ILE A N     1 
ATOM   1416  C  CA    . ILE A  1  214  ? 273.436 243.659 279.273 1.00 0.00 ? 214  ILE A CA    1 
ATOM   1417  C  C     . ILE A  1  214  ? 272.324 244.507 278.673 1.00 0.00 ? 214  ILE A C     1 
ATOM   1418  O  O     . ILE A  1  214  ? 272.559 245.598 278.156 1.00 0.00 ? 214  ILE A O     1 
ATOM   1419  C  CB    . ILE A  1  214  ? 273.247 243.715 280.810 1.00 0.00 ? 214  ILE A CB    1 
ATOM   1420  C  CG1   . ILE A  1  214  ? 273.883 244.984 281.377 1.00 0.00 ? 214  ILE A CG1   1 
ATOM   1421  C  CG2   . ILE A  1  214  ? 273.820 242.480 281.493 1.00 0.00 ? 214  ILE A CG2   1 
ATOM   1422  C  CD1   . ILE A  1  214  ? 273.680 245.149 282.864 1.00 0.00 ? 214  ILE A CD1   1 
ATOM   1423  N  N     . LEU A  1  215  ? 271.105 243.983 278.768 1.00 0.00 ? 215  LEU A N     1 
ATOM   1424  C  CA    . LEU A  1  215  ? 269.874 244.758 278.631 1.00 0.00 ? 215  LEU A CA    1 
ATOM   1425  C  C     . LEU A  1  215  ? 269.516 245.559 279.888 1.00 0.00 ? 215  LEU A C     1 
ATOM   1426  O  O     . LEU A  1  215  ? 269.736 245.106 281.010 1.00 0.00 ? 215  LEU A O     1 
ATOM   1427  C  CB    . LEU A  1  215  ? 268.728 243.817 278.242 1.00 0.00 ? 215  LEU A CB    1 
ATOM   1428  C  CG    . LEU A  1  215  ? 267.299 244.327 278.040 1.00 0.00 ? 215  LEU A CG    1 
ATOM   1429  C  CD1   . LEU A  1  215  ? 266.574 243.391 277.091 1.00 0.00 ? 215  LEU A CD1   1 
ATOM   1430  C  CD2   . LEU A  1  215  ? 266.534 244.405 279.355 1.00 0.00 ? 215  LEU A CD2   1 
ATOM   1431  N  N     . LEU A  1  216  ? 268.970 246.754 279.683 1.00 0.00 ? 216  LEU A N     1 
ATOM   1432  C  CA    . LEU A  1  216  ? 268.502 247.613 280.771 1.00 0.00 ? 216  LEU A CA    1 
ATOM   1433  C  C     . LEU A  1  216  ? 267.024 247.391 281.114 1.00 0.00 ? 216  LEU A C     1 
ATOM   1434  O  O     . LEU A  1  216  ? 266.146 247.639 280.289 1.00 0.00 ? 216  LEU A O     1 
ATOM   1435  C  CB    . LEU A  1  216  ? 268.721 249.084 280.413 1.00 0.00 ? 216  LEU A CB    1 
ATOM   1436  C  CG    . LEU A  1  216  ? 270.166 249.558 280.258 1.00 0.00 ? 216  LEU A CG    1 
ATOM   1437  C  CD1   . LEU A  1  216  ? 270.209 251.047 279.961 1.00 0.00 ? 216  LEU A CD1   1 
ATOM   1438  C  CD2   . LEU A  1  216  ? 270.964 249.238 281.507 1.00 0.00 ? 216  LEU A CD2   1 
ATOM   1439  N  N     . SER A  1  217  ? 266.758 246.922 282.331 1.00 0.00 ? 217  SER A N     1 
ATOM   1440  C  CA    . SER A  1  217  ? 265.385 246.753 282.830 1.00 0.00 ? 217  SER A CA    1 
ATOM   1441  C  C     . SER A  1  217  ? 264.628 248.074 283.018 1.00 0.00 ? 217  SER A C     1 
ATOM   1442  O  O     . SER A  1  217  ? 265.115 248.962 283.719 1.00 0.00 ? 217  SER A O     1 
ATOM   1443  C  CB    . SER A  1  217  ? 265.395 245.999 284.156 1.00 0.00 ? 217  SER A CB    1 
ATOM   1444  O  OG    . SER A  1  217  ? 264.074 245.836 284.645 1.00 0.00 ? 217  SER A OG    1 
ATOM   1445  N  N     . PRO A  1  218  ? 263.432 248.196 282.406 1.00 0.00 ? 218  PRO A N     1 
ATOM   1446  C  CA    . PRO A  1  218  ? 262.616 249.419 282.459 1.00 0.00 ? 218  PRO A CA    1 
ATOM   1447  C  C     . PRO A  1  218  ? 262.152 249.851 283.851 1.00 0.00 ? 218  PRO A C     1 
ATOM   1448  O  O     . PRO A  1  218  ? 262.146 251.053 284.125 1.00 0.00 ? 218  PRO A O     1 
ATOM   1449  C  CB    . PRO A  1  218  ? 261.379 249.050 281.629 1.00 0.00 ? 218  PRO A CB    1 
ATOM   1450  C  CG    . PRO A  1  218  ? 261.828 247.998 280.715 1.00 0.00 ? 218  PRO A CG    1 
ATOM   1451  C  CD    . PRO A  1  218  ? 262.886 247.217 281.452 1.00 0.00 ? 218  PRO A CD    1 
ATOM   1452  N  N     . GLU A  1  219  ? 261.891 248.870 284.718 1.00 0.00 ? 219  GLU A N     1 
ATOM   1453  C  CA    . GLU A  1  219  ? 261.464 249.041 286.105 1.00 0.00 ? 219  GLU A CA    1 
ATOM   1454  C  C     . GLU A  1  219  ? 262.524 249.756 286.880 1.00 0.00 ? 219  GLU A C     1 
ATOM   1455  O  O     . GLU A  1  219  ? 262.215 250.658 287.697 1.00 0.00 ? 219  GLU A O     1 
ATOM   1456  C  CB    . GLU A  1  219  ? 261.366 247.699 286.814 1.00 0.00 ? 219  GLU A CB    1 
ATOM   1457  C  CG    . GLU A  1  219  ? 260.781 247.724 288.223 1.00 0.00 ? 219  GLU A CG    1 
ATOM   1458  C  CD    . GLU A  1  219  ? 261.161 246.470 288.998 1.00 0.00 ? 219  GLU A CD    1 
ATOM   1459  O  OE1   . GLU A  1  219  ? 261.601 245.481 288.363 1.00 0.00 ? 219  GLU A OE1   1 
ATOM   1460  O  OE2   . GLU A  1  219  ? 261.189 246.550 290.251 1.00 0.00 ? 219  GLU A OE2   1 
ATOM   1461  N  N     . ARG A  1  220  ? 263.752 249.288 286.663 1.00 0.00 ? 220  ARG A N     1 
ATOM   1462  C  CA    . ARG A  1  220  ? 264.942 249.831 287.278 1.00 0.00 ? 220  ARG A CA    1 
ATOM   1463  C  C     . ARG A  1  220  ? 265.105 251.211 286.694 1.00 0.00 ? 220  ARG A C     1 
ATOM   1464  O  O     . ARG A  1  220  ? 265.263 252.182 287.434 1.00 0.00 ? 220  ARG A O     1 
ATOM   1465  C  CB    . ARG A  1  220  ? 266.161 248.968 286.955 1.00 0.00 ? 220  ARG A CB    1 
ATOM   1466  C  CG    . ARG A  1  220  ? 267.066 248.701 288.146 1.00 0.00 ? 220  ARG A CG    1 
ATOM   1467  C  CD    . ARG A  1  220  ? 266.317 247.988 289.260 1.00 0.00 ? 220  ARG A CD    1 
ATOM   1468  N  NE    . ARG A  1  220  ? 266.867 246.662 289.528 1.00 0.00 ? 220  ARG A NE    1 
ATOM   1469  C  CZ    . ARG A  1  220  ? 267.011 246.144 290.743 1.00 0.00 ? 220  ARG A CZ    1 
ATOM   1470  N  NH1   . ARG A  1  220  ? 266.645 246.840 291.810 1.00 0.00 ? 220  ARG A NH1   1 
ATOM   1471  N  NH2   . ARG A  1  220  ? 267.521 244.929 290.892 1.00 0.00 ? 220  ARG A NH2   1 
ATOM   1472  N  N     . VAL A  1  221  ? 265.068 251.320 285.367 1.00 0.00 ? 221  VAL A N     1 
ATOM   1473  C  CA    . VAL A  1  221  ? 265.177 252.687 284.814 1.00 0.00 ? 221  VAL A CA    1 
ATOM   1474  C  C     . VAL A  1  221  ? 264.280 253.627 285.615 1.00 0.00 ? 221  VAL A C     1 
ATOM   1475  O  O     . VAL A  1  221  ? 264.697 254.727 285.986 1.00 0.00 ? 221  VAL A O     1 
ATOM   1476  C  CB    . VAL A  1  221  ? 264.847 252.819 283.301 1.00 0.00 ? 221  VAL A CB    1 
ATOM   1477  C  CG1   . VAL A  1  221  ? 264.953 254.289 282.867 1.00 0.00 ? 221  VAL A CG1   1 
ATOM   1478  C  CG2   . VAL A  1  221  ? 265.752 251.917 282.456 1.00 0.00 ? 221  VAL A CG2   1 
ATOM   1479  N  N     . HIS A  1  222  ? 263.082 253.134 285.918 1.00 0.00 ? 222  HIS A N     1 
ATOM   1480  C  CA    . HIS A  1  222  ? 262.069 253.818 286.717 1.00 0.00 ? 222  HIS A CA    1 
ATOM   1481  C  C     . HIS A  1  222  ? 262.650 254.160 288.085 1.00 0.00 ? 222  HIS A C     1 
ATOM   1482  O  O     . HIS A  1  222  ? 262.447 255.263 288.584 1.00 0.00 ? 222  HIS A O     1 
ATOM   1483  C  CB    . HIS A  1  222  ? 260.821 252.951 286.859 1.00 0.00 ? 222  HIS A CB    1 
ATOM   1484  C  CG    . HIS A  1  222  ? 259.567 253.712 287.134 1.00 0.00 ? 222  HIS A CG    1 
ATOM   1485  N  ND1   . HIS A  1  222  ? 258.570 253.215 287.945 1.00 0.00 ? 222  HIS A ND1   1 
ATOM   1486  C  CD2   . HIS A  1  222  ? 259.155 254.936 286.736 1.00 0.00 ? 222  HIS A CD2   1 
ATOM   1487  C  CE1   . HIS A  1  222  ? 257.591 254.097 288.024 1.00 0.00 ? 222  HIS A CE1   1 
ATOM   1488  N  NE2   . HIS A  1  222  ? 257.921 255.150 287.299 1.00 0.00 ? 222  HIS A NE2   1 
ATOM   1489  N  N     . GLU A  1  223  ? 263.345 253.213 288.700 1.00 0.00 ? 223  GLU A N     1 
ATOM   1490  C  CA    . GLU A  1  223  ? 263.963 253.444 290.001 1.00 0.00 ? 223  GLU A CA    1 
ATOM   1491  C  C     . GLU A  1  223  ? 264.968 254.598 289.945 1.00 0.00 ? 223  GLU A C     1 
ATOM   1492  O  O     . GLU A  1  223  ? 265.049 255.396 290.880 1.00 0.00 ? 223  GLU A O     1 
ATOM   1493  C  CB    . GLU A  1  223  ? 264.673 252.182 290.478 1.00 0.00 ? 223  GLU A CB    1 
ATOM   1494  C  CG    . GLU A  1  223  ? 265.356 252.324 291.818 1.00 0.00 ? 223  GLU A CG    1 
ATOM   1495  C  CD    . GLU A  1  223  ? 265.934 251.014 292.291 1.00 0.00 ? 223  GLU A CD    1 
ATOM   1496  O  OE1   . GLU A  1  223  ? 265.915 250.048 291.501 1.00 0.00 ? 223  GLU A OE1   1 
ATOM   1497  O  OE2   . GLU A  1  223  ? 266.416 250.951 293.441 1.00 0.00 ? 223  GLU A OE2   1 
ATOM   1498  N  N     . ILE A  1  224  ? 265.720 254.689 288.855 1.00 0.00 ? 224  ILE A N     1 
ATOM   1499  C  CA    . ILE A  1  224  ? 266.661 255.791 288.672 1.00 0.00 ? 224  ILE A CA    1 
ATOM   1500  C  C     . ILE A  1  224  ? 265.944 257.138 288.564 1.00 0.00 ? 224  ILE A C     1 
ATOM   1501  O  O     . ILE A  1  224  ? 266.365 258.131 289.158 1.00 0.00 ? 224  ILE A O     1 
ATOM   1502  C  CB    . ILE A  1  224  ? 267.519 255.583 287.402 1.00 0.00 ? 224  ILE A CB    1 
ATOM   1503  C  CG1   . ILE A  1  224  ? 268.431 254.364 287.562 1.00 0.00 ? 224  ILE A CG1   1 
ATOM   1504  C  CG2   . ILE A  1  224  ? 268.334 256.826 287.083 1.00 0.00 ? 224  ILE A CG2   1 
ATOM   1505  C  CD1   . ILE A  1  224  ? 269.043 253.884 286.262 1.00 0.00 ? 224  ILE A CD1   1 
ATOM   1506  N  N     . PHE A  1  225  ? 264.852 257.158 287.814 1.00 0.00 ? 225  PHE A N     1 
ATOM   1507  C  CA    . PHE A  1  225  ? 264.005 258.342 287.693 1.00 0.00 ? 225  PHE A CA    1 
ATOM   1508  C  C     . PHE A  1  225  ? 263.281 258.846 288.950 1.00 0.00 ? 225  PHE A C     1 
ATOM   1509  O  O     . PHE A  1  225  ? 263.182 260.059 289.133 1.00 0.00 ? 225  PHE A O     1 
ATOM   1510  C  CB    . PHE A  1  225  ? 262.973 258.117 286.584 1.00 0.00 ? 225  PHE A CB    1 
ATOM   1511  C  CG    . PHE A  1  225  ? 263.564 258.113 285.202 1.00 0.00 ? 225  PHE A CG    1 
ATOM   1512  C  CD1   . PHE A  1  225  ? 264.869 258.524 284.991 1.00 0.00 ? 225  PHE A CD1   1 
ATOM   1513  C  CD2   . PHE A  1  225  ? 262.816 257.702 284.118 1.00 0.00 ? 225  PHE A CD2   1 
ATOM   1514  C  CE1   . PHE A  1  225  ? 265.415 258.527 283.726 1.00 0.00 ? 225  PHE A CE1   1 
ATOM   1515  C  CE2   . PHE A  1  225  ? 263.359 257.699 282.850 1.00 0.00 ? 225  PHE A CE2   1 
ATOM   1516  C  CZ    . PHE A  1  225  ? 264.660 258.112 282.655 1.00 0.00 ? 225  PHE A CZ    1 
ATOM   1517  N  N     . LYS A  1  226  ? 262.776 257.966 289.814 1.00 0.00 ? 226  LYS A N     1 
ATOM   1518  C  CA    . LYS A  1  226  ? 262.085 258.473 291.003 1.00 0.00 ? 226  LYS A CA    1 
ATOM   1519  C  C     . LYS A  1  226  ? 263.011 259.296 291.885 1.00 0.00 ? 226  LYS A C     1 
ATOM   1520  O  O     . LYS A  1  226  ? 262.584 260.260 292.517 1.00 0.00 ? 226  LYS A O     1 
ATOM   1521  C  CB    . LYS A  1  226  ? 261.510 257.352 291.874 1.00 0.00 ? 226  LYS A CB    1 
ATOM   1522  C  CG    . LYS A  1  226  ? 260.142 256.830 291.490 1.00 0.00 ? 226  LYS A CG    1 
ATOM   1523  C  CD    . LYS A  1  226  ? 260.006 255.383 291.949 1.00 0.00 ? 226  LYS A CD    1 
ATOM   1524  C  CE    . LYS A  1  226  ? 260.889 254.444 291.172 1.00 0.00 ? 226  LYS A CE    1 
ATOM   1525  N  NZ    . LYS A  1  226  ? 260.157 253.638 290.179 1.00 0.00 ? 226  LYS A NZ    1 
ATOM   1526  N  N     . ARG A  1  227  ? 264.282 258.917 291.917 1.00 0.00 ? 227  ARG A N     1 
ATOM   1527  C  CA    . ARG A  1  227  ? 265.267 259.632 292.714 1.00 0.00 ? 227  ARG A CA    1 
ATOM   1528  C  C     . ARG A  1  227  ? 265.564 261.035 292.186 1.00 0.00 ? 227  ARG A C     1 
ATOM   1529  O  O     . ARG A  1  227  ? 266.074 261.877 292.925 1.00 0.00 ? 227  ARG A O     1 
ATOM   1530  C  CB    . ARG A  1  227  ? 266.552 258.814 292.811 1.00 0.00 ? 227  ARG A CB    1 
ATOM   1531  C  CG    . ARG A  1  227  ? 266.409 257.578 293.684 1.00 0.00 ? 227  ARG A CG    1 
ATOM   1532  C  CD    . ARG A  1  227  ? 267.640 256.699 293.613 1.00 0.00 ? 227  ARG A CD    1 
ATOM   1533  N  NE    . ARG A  1  227  ? 267.471 255.463 294.368 1.00 0.00 ? 227  ARG A NE    1 
ATOM   1534  C  CZ    . ARG A  1  227  ? 268.410 254.531 294.496 1.00 0.00 ? 227  ARG A CZ    1 
ATOM   1535  N  NH1   . ARG A  1  227  ? 269.600 254.712 293.939 1.00 0.00 ? 227  ARG A NH1   1 
ATOM   1536  N  NH2   . ARG A  1  227  ? 268.145 253.396 295.128 1.00 0.00 ? 227  ARG A NH2   1 
ATOM   1537  N  N     . ILE A  1  228  ? 265.255 261.285 290.914 1.00 0.00 ? 228  ILE A N     1 
ATOM   1538  C  CA    . ILE A  1  228  ? 265.520 262.592 290.311 1.00 0.00 ? 228  ILE A CA    1 
ATOM   1539  C  C     . ILE A  1  228  ? 264.785 263.718 291.033 1.00 0.00 ? 228  ILE A C     1 
ATOM   1540  O  O     . ILE A  1  228  ? 263.566 263.680 291.196 1.00 0.00 ? 228  ILE A O     1 
ATOM   1541  C  CB    . ILE A  1  228  ? 265.129 262.623 288.826 1.00 0.00 ? 228  ILE A CB    1 
ATOM   1542  C  CG1   . ILE A  1  228  ? 265.887 261.545 288.055 1.00 0.00 ? 228  ILE A CG1   1 
ATOM   1543  C  CG2   . ILE A  1  228  ? 265.432 263.984 288.226 1.00 0.00 ? 228  ILE A CG2   1 
ATOM   1544  C  CD1   . ILE A  1  228  ? 265.541 261.502 286.588 1.00 0.00 ? 228  ILE A CD1   1 
ATOM   1545  N  N     . SER A  1  229  ? 265.549 264.725 291.446 1.00 0.00 ? 229  SER A N     1 
ATOM   1546  C  CA    . SER A  1  229  ? 265.018 265.877 292.166 1.00 0.00 ? 229  SER A CA    1 
ATOM   1547  C  C     . SER A  1  229  ? 264.124 266.771 291.319 1.00 0.00 ? 229  SER A C     1 
ATOM   1548  O  O     . SER A  1  229  ? 264.237 266.813 290.095 1.00 0.00 ? 229  SER A O     1 
ATOM   1549  C  CB    . SER A  1  229  ? 266.162 266.715 292.741 1.00 0.00 ? 229  SER A CB    1 
ATOM   1550  O  OG    . SER A  1  229  ? 265.683 267.958 293.224 1.00 0.00 ? 229  SER A OG    1 
ATOM   1551  N  N     . ASP A  1  230  ? 263.223 267.470 291.997 1.00 0.00 ? 230  ASP A N     1 
ATOM   1552  C  CA    . ASP A  1  230  ? 262.367 268.481 291.390 1.00 0.00 ? 230  ASP A CA    1 
ATOM   1553  C  C     . ASP A  1  230  ? 263.192 269.615 290.786 1.00 0.00 ? 230  ASP A C     1 
ATOM   1554  O  O     . ASP A  1  230  ? 262.890 270.118 289.703 1.00 0.00 ? 230  ASP A O     1 
ATOM   1555  C  CB    . ASP A  1  230  ? 261.388 269.029 292.428 1.00 0.00 ? 230  ASP A CB    1 
ATOM   1556  C  CG    . ASP A  1  230  ? 260.347 268.008 292.838 1.00 0.00 ? 230  ASP A CG    1 
ATOM   1557  O  OD1   . ASP A  1  230  ? 259.733 267.390 291.942 1.00 0.00 ? 230  ASP A OD1   1 
ATOM   1558  O  OD2   . ASP A  1  230  ? 260.153 267.812 294.056 1.00 0.00 ? 230  ASP A OD2   1 
ATOM   1559  N  N     . GLU A  1  231  ? 264.232 270.012 291.509 1.00 0.00 ? 231  GLU A N     1 
ATOM   1560  C  CA    . GLU A  1  231  ? 265.184 271.012 291.041 1.00 0.00 ? 231  GLU A CA    1 
ATOM   1561  C  C     . GLU A  1  231  ? 266.011 270.502 289.870 1.00 0.00 ? 231  GLU A C     1 
ATOM   1562  O  O     . GLU A  1  231  ? 266.410 271.267 288.993 1.00 0.00 ? 231  GLU A O     1 
ATOM   1563  C  CB    . GLU A  1  231  ? 266.121 271.425 292.175 1.00 0.00 ? 231  GLU A CB    1 
ATOM   1564  C  CG    . GLU A  1  231  ? 265.674 272.659 292.933 1.00 0.00 ? 231  GLU A CG    1 
ATOM   1565  C  CD    . GLU A  1  231  ? 264.240 272.553 293.411 1.00 0.00 ? 231  GLU A CD    1 
ATOM   1566  O  OE1   . GLU A  1  231  ? 264.008 271.884 294.440 1.00 0.00 ? 231  GLU A OE1   1 
ATOM   1567  O  OE2   . GLU A  1  231  ? 263.349 273.140 292.760 1.00 0.00 ? 231  GLU A OE2   1 
ATOM   1568  N  N     . GLU A  1  232  ? 266.275 269.202 289.877 1.00 0.00 ? 232  GLU A N     1 
ATOM   1569  C  CA    . GLU A  1  232  ? 266.918 268.531 288.755 1.00 0.00 ? 232  GLU A CA    1 
ATOM   1570  C  C     . GLU A  1  232  ? 266.079 268.478 287.476 1.00 0.00 ? 232  GLU A C     1 
ATOM   1571  O  O     . GLU A  1  232  ? 266.608 268.634 286.375 1.00 0.00 ? 232  GLU A O     1 
ATOM   1572  C  CB    . GLU A  1  232  ? 267.258 267.106 289.175 1.00 0.00 ? 232  GLU A CB    1 
ATOM   1573  C  CG    . GLU A  1  232  ? 268.250 266.386 288.306 1.00 0.00 ? 232  GLU A CG    1 
ATOM   1574  C  CD    . GLU A  1  232  ? 268.972 265.313 289.085 1.00 0.00 ? 232  GLU A CD    1 
ATOM   1575  O  OE1   . GLU A  1  232  ? 268.289 264.448 289.675 1.00 0.00 ? 232  GLU A OE1   1 
ATOM   1576  O  OE2   . GLU A  1  232  ? 270.214 265.360 289.153 1.00 0.00 ? 232  GLU A OE2   1 
ATOM   1577  N  N     . CYS A  1  233  ? 264.778 268.252 287.625 1.00 0.00 ? 233  CYS A N     1 
ATOM   1578  C  CA    . CYS A  1  233  ? 263.849 268.299 286.495 1.00 0.00 ? 233  CYS A CA    1 
ATOM   1579  C  C     . CYS A  1  233  ? 263.712 269.678 285.850 1.00 0.00 ? 233  CYS A C     1 
ATOM   1580  O  O     . CYS A  1  233  ? 263.529 269.788 284.637 1.00 0.00 ? 233  CYS A O     1 
ATOM   1581  C  CB    . CYS A  1  233  ? 262.467 267.811 286.938 1.00 0.00 ? 233  CYS A CB    1 
ATOM   1582  S  SG    . CYS A  1  233  ? 262.344 266.019 287.160 1.00 0.00 ? 233  CYS A SG    1 
ATOM   1583  N  N     . PHE A  1  234  ? 263.814 270.722 286.665 1.00 0.00 ? 234  PHE A N     1 
ATOM   1584  C  CA    . PHE A  1  234  ? 263.885 272.093 286.173 1.00 0.00 ? 234  PHE A CA    1 
ATOM   1585  C  C     . PHE A  1  234  ? 265.130 272.337 285.329 1.00 0.00 ? 234  PHE A C     1 
ATOM   1586  O  O     . PHE A  1  234  ? 265.079 273.039 284.321 1.00 0.00 ? 234  PHE A O     1 
ATOM   1587  C  CB    . PHE A  1  234  ? 263.828 273.078 287.341 1.00 0.00 ? 234  PHE A CB    1 
ATOM   1588  C  CG    . PHE A  1  234  ? 264.039 274.511 286.942 1.00 0.00 ? 234  PHE A CG    1 
ATOM   1589  C  CD1   . PHE A  1  234  ? 262.962 275.301 286.577 1.00 0.00 ? 234  PHE A CD1   1 
ATOM   1590  C  CD2   . PHE A  1  234  ? 265.304 275.077 286.962 1.00 0.00 ? 234  PHE A CD2   1 
ATOM   1591  C  CE1   . PHE A  1  234  ? 263.145 276.620 286.212 1.00 0.00 ? 234  PHE A CE1   1 
ATOM   1592  C  CE2   . PHE A  1  234  ? 265.494 276.396 286.601 1.00 0.00 ? 234  PHE A CE2   1 
ATOM   1593  C  CZ    . PHE A  1  234  ? 264.412 277.169 286.227 1.00 0.00 ? 234  PHE A CZ    1 
ATOM   1594  N  N     . VAL A  1  235  ? 266.250 271.765 285.752 1.00 0.00 ? 235  VAL A N     1 
ATOM   1595  C  CA    . VAL A  1  235  ? 267.473 271.828 284.966 1.00 0.00 ? 235  VAL A CA    1 
ATOM   1596  C  C     . VAL A  1  235  ? 267.322 271.076 283.645 1.00 0.00 ? 235  VAL A C     1 
ATOM   1597  O  O     . VAL A  1  235  ? 267.777 271.548 282.606 1.00 0.00 ? 235  VAL A O     1 
ATOM   1598  C  CB    . VAL A  1  235  ? 268.668 271.253 285.752 1.00 0.00 ? 235  VAL A CB    1 
ATOM   1599  C  CG1   . VAL A  1  235  ? 269.909 271.202 284.876 1.00 0.00 ? 235  VAL A CG1   1 
ATOM   1600  C  CG2   . VAL A  1  235  ? 268.929 272.088 286.998 1.00 0.00 ? 235  VAL A CG2   1 
ATOM   1601  N  N     . LEU A  1  236  ? 266.676 269.914 283.680 1.00 0.00 ? 236  LEU A N     1 
ATOM   1602  C  CA    . LEU A  1  236  ? 266.388 269.165 282.455 1.00 0.00 ? 236  LEU A CA    1 
ATOM   1603  C  C     . LEU A  1  236  ? 265.312 269.815 281.581 1.00 0.00 ? 236  LEU A C     1 
ATOM   1604  O  O     . LEU A  1  236  ? 265.021 269.334 280.484 1.00 0.00 ? 236  LEU A O     1 
ATOM   1605  C  CB    . LEU A  1  236  ? 265.968 267.734 282.790 1.00 0.00 ? 236  LEU A CB    1 
ATOM   1606  C  CG    . LEU A  1  236  ? 267.077 266.809 283.291 1.00 0.00 ? 236  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A  1  236  ? 266.491 265.506 283.808 1.00 0.00 ? 236  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A  1  236  ? 268.083 266.549 282.186 1.00 0.00 ? 236  LEU A CD2   1 
ATOM   1609  N  N     . GLY A  1  237  ? 264.714 270.897 282.073 1.00 0.00 ? 237  GLY A N     1 
ATOM   1610  C  CA    . GLY A  1  237  ? 263.764 271.666 281.287 1.00 0.00 ? 237  GLY A CA    1 
ATOM   1611  C  C     . GLY A  1  237  ? 262.325 271.300 281.590 1.00 0.00 ? 237  GLY A C     1 
ATOM   1612  O  O     . GLY A  1  237  ? 261.399 272.023 281.222 1.00 0.00 ? 237  GLY A O     1 
ATOM   1613  N  N     . MET A  1  238  ? 262.139 270.173 282.267 1.00 0.00 ? 238  MET A N     1 
ATOM   1614  C  CA    . MET A  1  238  ? 260.807 269.699 282.610 1.00 0.00 ? 238  MET A CA    1 
ATOM   1615  C  C     . MET A  1  238  ? 260.239 270.452 283.803 1.00 0.00 ? 238  MET A C     1 
ATOM   1616  O  O     . MET A  1  238  ? 260.977 270.897 284.678 1.00 0.00 ? 238  MET A O     1 
ATOM   1617  C  CB    . MET A  1  238  ? 260.844 268.203 282.903 1.00 0.00 ? 238  MET A CB    1 
ATOM   1618  C  CG    . MET A  1  238  ? 261.448 267.399 281.775 1.00 0.00 ? 238  MET A CG    1 
ATOM   1619  S  SD    . MET A  1  238  ? 261.384 265.621 282.041 1.00 0.00 ? 238  MET A SD    1 
ATOM   1620  C  CE    . MET A  1  238  ? 262.409 265.082 280.678 1.00 0.00 ? 238  MET A CE    1 
ATOM   1621  N  N     . GLU A  1  239  ? 258.919 270.573 283.847 1.00 0.00 ? 239  GLU A N     1 
ATOM   1622  C  CA    . GLU A  1  239  ? 258.260 271.280 284.933 1.00 0.00 ? 239  GLU A CA    1 
ATOM   1623  C  C     . GLU A  1  239  ? 257.526 270.316 285.852 1.00 0.00 ? 239  GLU A C     1 
ATOM   1624  O  O     . GLU A  1  239  ? 256.461 269.812 285.503 1.00 0.00 ? 239  GLU A O     1 
ATOM   1625  C  CB    . GLU A  1  239  ? 257.292 272.320 284.382 1.00 0.00 ? 239  GLU A CB    1 
ATOM   1626  C  CG    . GLU A  1  239  ? 256.779 273.287 285.428 1.00 0.00 ? 239  GLU A CG    1 
ATOM   1627  C  CD    . GLU A  1  239  ? 255.917 274.378 284.826 1.00 0.00 ? 239  GLU A CD    1 
ATOM   1628  O  OE1   . GLU A  1  239  ? 255.951 274.551 283.586 1.00 0.00 ? 239  GLU A OE1   1 
ATOM   1629  O  OE2   . GLU A  1  239  ? 255.201 275.057 285.592 1.00 0.00 ? 239  GLU A OE2   1 
ATOM   1630  N  N     . PRO A  1  240  ? 258.103 270.053 287.034 1.00 0.00 ? 240  PRO A N     1 
ATOM   1631  C  CA    . PRO A  1  240  ? 257.658 269.019 287.975 1.00 0.00 ? 240  PRO A CA    1 
ATOM   1632  C  C     . PRO A  1  240  ? 256.153 268.987 288.253 1.00 0.00 ? 240  PRO A C     1 
ATOM   1633  O  O     . PRO A  1  240  ? 255.650 267.931 288.632 1.00 0.00 ? 240  PRO A O     1 
ATOM   1634  C  CB    . PRO A  1  240  ? 258.416 269.376 289.254 1.00 0.00 ? 240  PRO A CB    1 
ATOM   1635  C  CG    . PRO A  1  240  ? 259.669 270.003 288.768 1.00 0.00 ? 240  PRO A CG    1 
ATOM   1636  C  CD    . PRO A  1  240  ? 259.271 270.790 287.547 1.00 0.00 ? 240  PRO A CD    1 
ATOM   1637  N  N     . ARG A  1  241  ? 255.446 270.100 288.070 1.00 0.00 ? 241  ARG A N     1 
ATOM   1638  C  CA    . ARG A  1  241  ? 253.996 270.089 288.267 1.00 0.00 ? 241  ARG A CA    1 
ATOM   1639  C  C     . ARG A  1  241  ? 253.231 269.616 287.034 1.00 0.00 ? 241  ARG A C     1 
ATOM   1640  O  O     . ARG A  1  241  ? 252.019 269.423 287.090 1.00 0.00 ? 241  ARG A O     1 
ATOM   1641  C  CB    . ARG A  1  241  ? 253.485 271.462 288.682 1.00 0.00 ? 241  ARG A CB    1 
ATOM   1642  C  CG    . ARG A  1  241  ? 253.650 272.544 287.656 1.00 0.00 ? 241  ARG A CG    1 
ATOM   1643  C  CD    . ARG A  1  241  ? 252.913 273.773 288.138 1.00 0.00 ? 241  ARG A CD    1 
ATOM   1644  N  NE    . ARG A  1  241  ? 253.145 274.937 287.295 1.00 0.00 ? 241  ARG A NE    1 
ATOM   1645  C  CZ    . ARG A  1  241  ? 252.825 276.180 287.644 1.00 0.00 ? 241  ARG A CZ    1 
ATOM   1646  N  NH1   . ARG A  1  241  ? 252.260 276.417 288.822 1.00 0.00 ? 241  ARG A NH1   1 
ATOM   1647  N  NH2   . ARG A  1  241  ? 253.089 277.190 286.823 1.00 0.00 ? 241  ARG A NH2   1 
ATOM   1648  N  N     . TYR A  1  242  ? 253.934 269.453 285.919 1.00 0.00 ? 242  TYR A N     1 
ATOM   1649  C  CA    . TYR A  1  242  ? 253.330 268.897 284.711 1.00 0.00 ? 242  TYR A CA    1 
ATOM   1650  C  C     . TYR A  1  242  ? 254.126 267.669 284.297 1.00 0.00 ? 242  TYR A C     1 
ATOM   1651  O  O     . TYR A  1  242  ? 254.067 266.644 284.967 1.00 0.00 ? 242  TYR A O     1 
ATOM   1652  C  CB    . TYR A  1  242  ? 253.286 269.907 283.560 1.00 0.00 ? 242  TYR A CB    1 
ATOM   1653  C  CG    . TYR A  1  242  ? 252.619 271.225 283.874 1.00 0.00 ? 242  TYR A CG    1 
ATOM   1654  C  CD1   . TYR A  1  242  ? 251.445 271.279 284.613 1.00 0.00 ? 242  TYR A CD1   1 
ATOM   1655  C  CD2   . TYR A  1  242  ? 253.145 272.418 283.395 1.00 0.00 ? 242  TYR A CD2   1 
ATOM   1656  C  CE1   . TYR A  1  242  ? 250.828 272.489 284.891 1.00 0.00 ? 242  TYR A CE1   1 
ATOM   1657  C  CE2   . TYR A  1  242  ? 252.538 273.631 283.663 1.00 0.00 ? 242  TYR A CE2   1 
ATOM   1658  C  CZ    . TYR A  1  242  ? 251.380 273.664 284.409 1.00 0.00 ? 242  TYR A CZ    1 
ATOM   1659  O  OH    . TYR A  1  242  ? 250.778 274.877 284.671 1.00 0.00 ? 242  TYR A OH    1 
ATOM   1660  N  N     . ALA A  1  243  ? 254.884 267.778 283.210 1.00 0.00 ? 243  ALA A N     1 
ATOM   1661  C  CA    . ALA A  1  243  ? 255.684 266.657 282.723 1.00 0.00 ? 243  ALA A CA    1 
ATOM   1662  C  C     . ALA A  1  243  ? 256.772 266.263 283.721 1.00 0.00 ? 243  ALA A C     1 
ATOM   1663  O  O     . ALA A  1  243  ? 257.426 267.120 284.313 1.00 0.00 ? 243  ALA A O     1 
ATOM   1664  C  CB    . ALA A  1  243  ? 256.301 267.000 281.380 1.00 0.00 ? 243  ALA A CB    1 
ATOM   1665  N  N     . ARG A  1  244  ? 256.975 264.960 283.888 1.00 0.00 ? 244  ARG A N     1 
ATOM   1666  C  CA    . ARG A  1  244  ? 257.943 264.444 284.849 1.00 0.00 ? 244  ARG A CA    1 
ATOM   1667  C  C     . ARG A  1  244  ? 258.468 263.099 284.355 1.00 0.00 ? 244  ARG A C     1 
ATOM   1668  O  O     . ARG A  1  244  ? 257.681 262.196 284.069 1.00 0.00 ? 244  ARG A O     1 
ATOM   1669  C  CB    . ARG A  1  244  ? 257.301 264.321 286.232 1.00 0.00 ? 244  ARG A CB    1 
ATOM   1670  C  CG    . ARG A  1  244  ? 258.276 264.502 287.370 1.00 0.00 ? 244  ARG A CG    1 
ATOM   1671  C  CD    . ARG A  1  244  ? 257.632 264.291 288.721 1.00 0.00 ? 244  ARG A CD    1 
ATOM   1672  N  NE    . ARG A  1  244  ? 258.633 263.946 289.728 1.00 0.00 ? 244  ARG A NE    1 
ATOM   1673  C  CZ    . ARG A  1  244  ? 259.468 264.815 290.289 1.00 0.00 ? 244  ARG A CZ    1 
ATOM   1674  N  NH1   . ARG A  1  244  ? 259.431 266.095 289.944 1.00 0.00 ? 244  ARG A NH1   1 
ATOM   1675  N  NH2   . ARG A  1  244  ? 260.337 264.405 291.204 1.00 0.00 ? 244  ARG A NH2   1 
ATOM   1676  N  N     . PRO A  1  245  ? 259.804 262.943 284.305 1.00 0.00 ? 245  PRO A N     1 
ATOM   1677  C  CA    . PRO A  1  245  ? 260.447 261.872 283.532 1.00 0.00 ? 245  PRO A CA    1 
ATOM   1678  C  C     . PRO A  1  245  ? 260.023 260.457 283.908 1.00 0.00 ? 245  PRO A C     1 
ATOM   1679  O  O     . PRO A  1  245  ? 259.867 259.629 283.012 1.00 0.00 ? 245  PRO A O     1 
ATOM   1680  C  CB    . PRO A  1  245  ? 261.939 262.077 283.818 1.00 0.00 ? 245  PRO A CB    1 
ATOM   1681  C  CG    . PRO A  1  245  ? 261.992 262.749 285.125 1.00 0.00 ? 245  PRO A CG    1 
ATOM   1682  C  CD    . PRO A  1  245  ? 260.747 263.587 285.234 1.00 0.00 ? 245  PRO A CD    1 
ATOM   1683  N  N     . GLU A  1  246  ? 259.848 260.176 285.191 1.00 0.00 ? 246  GLU A N     1 
ATOM   1684  C  CA    . GLU A  1  246  ? 259.474 258.831 285.603 1.00 0.00 ? 246  GLU A CA    1 
ATOM   1685  C  C     . GLU A  1  246  ? 258.136 258.433 284.985 1.00 0.00 ? 246  GLU A C     1 
ATOM   1686  O  O     . GLU A  1  246  ? 257.897 257.258 284.716 1.00 0.00 ? 246  GLU A O     1 
ATOM   1687  C  CB    . GLU A  1  246  ? 259.430 258.728 287.126 1.00 0.00 ? 246  GLU A CB    1 
ATOM   1688  C  CG    . GLU A  1  246  ? 258.276 259.457 287.770 1.00 0.00 ? 246  GLU A CG    1 
ATOM   1689  C  CD    . GLU A  1  246  ? 258.652 260.859 288.204 1.00 0.00 ? 246  GLU A CD    1 
ATOM   1690  O  OE1   . GLU A  1  246  ? 259.387 261.543 287.454 1.00 0.00 ? 246  GLU A OE1   1 
ATOM   1691  O  OE2   . GLU A  1  246  ? 258.220 261.269 289.305 1.00 0.00 ? 246  GLU A OE2   1 
ATOM   1692  N  N     . TRP A  1  247  ? 257.273 259.411 284.742 1.00 0.00 ? 247  TRP A N     1 
ATOM   1693  C  CA    . TRP A  1  247  ? 255.968 259.107 284.183 1.00 0.00 ? 247  TRP A CA    1 
ATOM   1694  C  C     . TRP A  1  247  ? 256.046 258.764 282.699 1.00 0.00 ? 247  TRP A C     1 
ATOM   1695  O  O     . TRP A  1  247  ? 255.099 258.216 282.144 1.00 0.00 ? 247  TRP A O     1 
ATOM   1696  C  CB    . TRP A  1  247  ? 254.987 260.267 284.368 1.00 0.00 ? 247  TRP A CB    1 
ATOM   1697  C  CG    . TRP A  1  247  ? 254.832 260.740 285.766 1.00 0.00 ? 247  TRP A CG    1 
ATOM   1698  C  CD1   . TRP A  1  247  ? 255.113 260.045 286.895 1.00 0.00 ? 247  TRP A CD1   1 
ATOM   1699  C  CD2   . TRP A  1  247  ? 254.254 261.983 286.190 1.00 0.00 ? 247  TRP A CD2   1 
ATOM   1700  N  NE1   . TRP A  1  247  ? 254.807 260.800 288.003 1.00 0.00 ? 247  TRP A NE1   1 
ATOM   1701  C  CE2   . TRP A  1  247  ? 254.269 261.991 287.593 1.00 0.00 ? 247  TRP A CE2   1 
ATOM   1702  C  CE3   . TRP A  1  247  ? 253.747 263.095 285.518 1.00 0.00 ? 247  TRP A CE3   1 
ATOM   1703  C  CZ2   . TRP A  1  247  ? 253.797 263.071 288.339 1.00 0.00 ? 247  TRP A CZ2   1 
ATOM   1704  C  CZ3   . TRP A  1  247  ? 253.276 264.159 286.261 1.00 0.00 ? 247  TRP A CZ3   1 
ATOM   1705  C  CH2   . TRP A  1  247  ? 253.307 264.142 287.653 1.00 0.00 ? 247  TRP A CH2   1 
ATOM   1706  N  N     . MET A  1  248  ? 257.167 259.068 282.055 1.00 0.00 ? 248  MET A N     1 
ATOM   1707  C  CA    . MET A  1  248  ? 257.378 258.618 280.678 1.00 0.00 ? 248  MET A CA    1 
ATOM   1708  C  C     . MET A  1  248  ? 257.478 257.099 280.513 1.00 0.00 ? 248  MET A C     1 
ATOM   1709  O  O     . MET A  1  248  ? 257.304 256.589 279.409 1.00 0.00 ? 248  MET A O     1 
ATOM   1710  C  CB    . MET A  1  248  ? 258.613 259.305 280.077 1.00 0.00 ? 248  MET A CB    1 
ATOM   1711  C  CG    . MET A  1  248  ? 258.534 260.839 280.119 1.00 0.00 ? 248  MET A CG    1 
ATOM   1712  S  SD    . MET A  1  248  ? 259.905 261.739 279.343 1.00 0.00 ? 248  MET A SD    1 
ATOM   1713  C  CE    . MET A  1  248  ? 259.453 263.426 279.726 1.00 0.00 ? 248  MET A CE    1 
ATOM   1714  N  N     . ILE A  1  249  ? 257.726 256.367 281.592 1.00 0.00 ? 249  ILE A N     1 
ATOM   1715  C  CA    . ILE A  1  249  ? 257.627 254.916 281.508 1.00 0.00 ? 249  ILE A CA    1 
ATOM   1716  C  C     . ILE A  1  249  ? 256.217 254.511 281.918 1.00 0.00 ? 249  ILE A C     1 
ATOM   1717  O  O     . ILE A  1  249  ? 255.780 254.826 283.023 1.00 0.00 ? 249  ILE A O     1 
ATOM   1718  C  CB    . ILE A  1  249  ? 258.651 254.207 282.403 1.00 0.00 ? 249  ILE A CB    1 
ATOM   1719  C  CG1   . ILE A  1  249  ? 260.066 254.444 281.884 1.00 0.00 ? 249  ILE A CG1   1 
ATOM   1720  C  CG2   . ILE A  1  249  ? 258.382 252.716 282.441 1.00 0.00 ? 249  ILE A CG2   1 
ATOM   1721  C  CD1   . ILE A  1  249  ? 261.139 253.835 282.758 1.00 0.00 ? 249  ILE A CD1   1 
ATOM   1722  N  N     . VAL A  1  250  ? 255.502 253.809 281.039 1.00 0.00 ? 250  VAL A N     1 
ATOM   1723  C  CA    . VAL A  1  250  ? 254.091 253.539 281.300 1.00 0.00 ? 250  VAL A CA    1 
ATOM   1724  C  C     . VAL A  1  250  ? 253.951 252.408 282.304 1.00 0.00 ? 250  VAL A C     1 
ATOM   1725  O  O     . VAL A  1  250  ? 254.431 251.295 282.087 1.00 0.00 ? 250  VAL A O     1 
ATOM   1726  C  CB    . VAL A  1  250  ? 253.298 253.200 280.004 1.00 0.00 ? 250  VAL A CB    1 
ATOM   1727  C  CG1   . VAL A  1  250  ? 253.102 254.448 279.161 1.00 0.00 ? 250  VAL A CG1   1 
ATOM   1728  C  CG2   . VAL A  1  250  ? 253.976 252.107 279.196 1.00 0.00 ? 250  VAL A CG2   1 
ATOM   1729  N  N     . THR A  1  251  ? 253.309 252.719 283.425 1.00 0.00 ? 251  THR A N     1 
ATOM   1730  C  CA    . THR A  1  251  ? 252.973 251.723 284.430 1.00 0.00 ? 251  THR A CA    1 
ATOM   1731  C  C     . THR A  1  251  ? 251.493 251.392 284.348 1.00 0.00 ? 251  THR A C     1 
ATOM   1732  O  O     . THR A  1  251  ? 251.084 250.237 284.489 1.00 0.00 ? 251  THR A O     1 
ATOM   1733  C  CB    . THR A  1  251  ? 253.311 252.219 285.844 1.00 0.00 ? 251  THR A CB    1 
ATOM   1734  O  OG1   . THR A  1  251  ? 252.739 253.517 286.041 1.00 0.00 ? 251  THR A OG1   1 
ATOM   1735  C  CG2   . THR A  1  251  ? 254.817 252.308 286.032 1.00 0.00 ? 251  THR A CG2   1 
ATOM   1736  N  N     . VAL A  1  252  ? 250.702 252.429 284.099 1.00 0.00 ? 252  VAL A N     1 
ATOM   1737  C  CA    . VAL A  1  252  ? 249.262 252.309 283.957 1.00 0.00 ? 252  VAL A CA    1 
ATOM   1738  C  C     . VAL A  1  252  ? 248.929 252.754 282.552 1.00 0.00 ? 252  VAL A C     1 
ATOM   1739  O  O     . VAL A  1  252  ? 249.494 253.722 282.064 1.00 0.00 ? 252  VAL A O     1 
ATOM   1740  C  CB    . VAL A  1  252  ? 248.502 253.175 284.976 1.00 0.00 ? 252  VAL A CB    1 
ATOM   1741  C  CG1   . VAL A  1  252  ? 247.004 252.996 284.807 1.00 0.00 ? 252  VAL A CG1   1 
ATOM   1742  C  CG2   . VAL A  1  252  ? 248.926 252.824 286.394 1.00 0.00 ? 252  VAL A CG2   1 
ATOM   1743  N  N     . LEU A  1  253  ? 248.019 252.058 281.893 1.00 0.00 ? 253  LEU A N     1 
ATOM   1744  C  CA    . LEU A  1  253  ? 247.807 252.299 280.477 1.00 0.00 ? 253  LEU A CA    1 
ATOM   1745  C  C     . LEU A  1  253  ? 246.392 252.796 280.215 1.00 0.00 ? 253  LEU A C     1 
ATOM   1746  O  O     . LEU A  1  253  ? 245.426 252.096 280.507 1.00 0.00 ? 253  LEU A O     1 
ATOM   1747  C  CB    . LEU A  1  253  ? 248.083 251.015 279.691 1.00 0.00 ? 253  LEU A CB    1 
ATOM   1748  C  CG    . LEU A  1  253  ? 248.249 251.101 278.176 1.00 0.00 ? 253  LEU A CG    1 
ATOM   1749  C  CD1   . LEU A  1  253  ? 249.590 251.711 277.827 1.00 0.00 ? 253  LEU A CD1   1 
ATOM   1750  C  CD2   . LEU A  1  253  ? 248.124 249.714 277.568 1.00 0.00 ? 253  LEU A CD2   1 
ATOM   1751  N  N     . PRO A  1  254  ? 246.261 254.027 279.693 1.00 0.00 ? 254  PRO A N     1 
ATOM   1752  C  CA    . PRO A  1  254  ? 244.927 254.534 279.383 1.00 0.00 ? 254  PRO A CA    1 
ATOM   1753  C  C     . PRO A  1  254  ? 244.208 253.659 278.363 1.00 0.00 ? 254  PRO A C     1 
ATOM   1754  O  O     . PRO A  1  254  ? 244.827 253.245 277.387 1.00 0.00 ? 254  PRO A O     1 
ATOM   1755  C  CB    . PRO A  1  254  ? 245.205 255.931 278.821 1.00 0.00 ? 254  PRO A CB    1 
ATOM   1756  C  CG    . PRO A  1  254  ? 246.551 255.836 278.242 1.00 0.00 ? 254  PRO A CG    1 
ATOM   1757  C  CD    . PRO A  1  254  ? 247.311 254.888 279.131 1.00 0.00 ? 254  PRO A CD    1 
ATOM   1758  N  N     . VAL A  1  255  ? 242.937 253.356 278.608 1.00 0.00 ? 255  VAL A N     1 
ATOM   1759  C  CA    . VAL A  1  255  ? 242.085 252.723 277.610 1.00 0.00 ? 255  VAL A CA    1 
ATOM   1760  C  C     . VAL A  1  255  ? 241.148 253.777 277.013 1.00 0.00 ? 255  VAL A C     1 
ATOM   1761  O  O     . VAL A  1  255  ? 240.284 254.301 277.723 1.00 0.00 ? 255  VAL A O     1 
ATOM   1762  C  CB    . VAL A  1  255  ? 241.264 251.576 278.202 1.00 0.00 ? 255  VAL A CB    1 
ATOM   1763  C  CG1   . VAL A  1  255  ? 240.240 251.081 277.190 1.00 0.00 ? 255  VAL A CG1   1 
ATOM   1764  C  CG2   . VAL A  1  255  ? 242.173 250.453 278.615 1.00 0.00 ? 255  VAL A CG2   1 
ATOM   1765  N  N     . PRO A  1  256  ? 241.321 254.111 275.719 1.00 0.00 ? 256  PRO A N     1 
ATOM   1766  C  CA    . PRO A  1  256  ? 240.442 255.130 275.133 1.00 0.00 ? 256  PRO A CA    1 
ATOM   1767  C  C     . PRO A  1  256  ? 238.988 254.671 275.136 1.00 0.00 ? 256  PRO A C     1 
ATOM   1768  O  O     . PRO A  1  256  ? 238.731 253.486 274.934 1.00 0.00 ? 256  PRO A O     1 
ATOM   1769  C  CB    . PRO A  1  256  ? 240.975 255.280 273.708 1.00 0.00 ? 256  PRO A CB    1 
ATOM   1770  C  CG    . PRO A  1  256  ? 241.682 254.003 273.425 1.00 0.00 ? 256  PRO A CG    1 
ATOM   1771  C  CD    . PRO A  1  256  ? 242.234 253.520 274.727 1.00 0.00 ? 256  PRO A CD    1 
ATOM   1772  N  N     . PRO A  1  257  ? 238.053 255.596 275.390 1.00 0.00 ? 257  PRO A N     1 
ATOM   1773  C  CA    . PRO A  1  257  ? 236.606 255.357 275.434 1.00 0.00 ? 257  PRO A CA    1 
ATOM   1774  C  C     . PRO A  1  257  ? 236.086 254.662 274.186 1.00 0.00 ? 257  PRO A C     1 
ATOM   1775  O  O     . PRO A  1  257  ? 236.608 254.917 273.104 1.00 0.00 ? 257  PRO A O     1 
ATOM   1776  C  CB    . PRO A  1  257  ? 236.021 256.761 275.539 1.00 0.00 ? 257  PRO A CB    1 
ATOM   1777  C  CG    . PRO A  1  257  ? 237.073 257.550 276.205 1.00 0.00 ? 257  PRO A CG    1 
ATOM   1778  C  CD    . PRO A  1  257  ? 238.396 256.963 275.805 1.00 0.00 ? 257  PRO A CD    1 
ATOM   1779  N  N     . LEU A  1  258  ? 235.053 253.836 274.335 1.00 0.00 ? 258  LEU A N     1 
ATOM   1780  C  CA    . LEU A  1  258  ? 234.490 253.105 273.209 1.00 0.00 ? 258  LEU A CA    1 
ATOM   1781  C  C     . LEU A  1  258  ? 234.136 254.031 272.042 1.00 0.00 ? 258  LEU A C     1 
ATOM   1782  O  O     . LEU A  1  258  ? 234.286 253.666 270.878 1.00 0.00 ? 258  LEU A O     1 
ATOM   1783  C  CB    . LEU A  1  258  ? 233.254 252.326 273.662 1.00 0.00 ? 258  LEU A CB    1 
ATOM   1784  C  CG    . LEU A  1  258  ? 233.020 250.994 272.950 1.00 0.00 ? 258  LEU A CG    1 
ATOM   1785  C  CD1   . LEU A  1  258  ? 234.259 250.139 273.047 1.00 0.00 ? 258  LEU A CD1   1 
ATOM   1786  C  CD2   . LEU A  1  258  ? 231.820 250.258 273.526 1.00 0.00 ? 258  LEU A CD2   1 
ATOM   1787  N  N     . SER A  1  259  ? 233.679 255.234 272.363 1.00 0.00 ? 259  SER A N     1 
ATOM   1788  C  CA    . SER A  1  259  ? 233.508 256.289 271.374 1.00 0.00 ? 259  SER A CA    1 
ATOM   1789  C  C     . SER A  1  259  ? 234.755 256.696 270.579 1.00 0.00 ? 259  SER A C     1 
ATOM   1790  O  O     . SER A  1  259  ? 234.633 257.174 269.458 1.00 0.00 ? 259  SER A O     1 
ATOM   1791  C  CB    . SER A  1  259  ? 232.945 257.526 272.070 1.00 0.00 ? 259  SER A CB    1 
ATOM   1792  O  OG    . SER A  1  259  ? 233.787 257.908 273.141 1.00 0.00 ? 259  SER A OG    1 
ATOM   1793  N  N     . VAL A  1  260  ? 235.927 256.447 271.153 1.00 0.00 ? 260  VAL A N     1 
ATOM   1794  C  CA    . VAL A  1  260  ? 237.191 256.734 270.489 1.00 0.00 ? 260  VAL A CA    1 
ATOM   1795  C  C     . VAL A  1  260  ? 237.619 255.526 269.650 1.00 0.00 ? 260  VAL A C     1 
ATOM   1796  O  O     . VAL A  1  260  ? 238.306 255.673 268.640 1.00 0.00 ? 260  VAL A O     1 
ATOM   1797  C  CB    . VAL A  1  260  ? 238.300 257.070 271.501 1.00 0.00 ? 260  VAL A CB    1 
ATOM   1798  C  CG1   . VAL A  1  260  ? 239.646 257.168 270.799 1.00 0.00 ? 260  VAL A CG1   1 
ATOM   1799  C  CG2   . VAL A  1  260  ? 237.977 258.364 272.231 1.00 0.00 ? 260  VAL A CG2   1 
ATOM   1800  N  N     . ARG A  1  261  ? 237.217 254.335 270.083 1.00 0.00 ? 261  ARG A N     1 
ATOM   1801  C  CA    . ARG A  1  261  ? 237.565 253.108 269.375 1.00 0.00 ? 261  ARG A CA    1 
ATOM   1802  C  C     . ARG A  1  261  ? 236.552 252.793 268.281 1.00 0.00 ? 261  ARG A C     1 
ATOM   1803  O  O     . ARG A  1  261  ? 235.659 251.965 268.480 1.00 0.00 ? 261  ARG A O     1 
ATOM   1804  C  CB    . ARG A  1  261  ? 237.665 251.936 270.353 1.00 0.00 ? 261  ARG A CB    1 
ATOM   1805  C  CG    . ARG A  1  261  ? 237.962 252.346 271.786 1.00 0.00 ? 261  ARG A CG    1 
ATOM   1806  C  CD    . ARG A  1  261  ? 238.964 251.404 272.434 1.00 0.00 ? 261  ARG A CD    1 
ATOM   1807  N  NE    . ARG A  1  261  ? 238.512 250.943 273.743 1.00 0.00 ? 261  ARG A NE    1 
ATOM   1808  C  CZ    . ARG A  1  261  ? 237.642 249.955 273.928 1.00 0.00 ? 261  ARG A CZ    1 
ATOM   1809  N  NH1   . ARG A  1  261  ? 237.125 249.320 272.885 1.00 0.00 ? 261  ARG A NH1   1 
ATOM   1810  N  NH2   . ARG A  1  261  ? 237.288 249.602 275.156 1.00 0.00 ? 261  ARG A NH2   1 
ATOM   1811  N  N     . PRO A  1  262  ? 236.711 253.460 267.137 1.00 0.00 ? 262  PRO A N     1 
ATOM   1812  C  CA    . PRO A  1  262  ? 235.840 253.303 265.961 1.00 0.00 ? 262  PRO A CA    1 
ATOM   1813  C  C     . PRO A  1  262  ? 234.354 253.225 266.305 1.00 0.00 ? 262  PRO A C     1 
ATOM   1814  O  O     . PRO A  1  262  ? 233.503 253.499 265.458 1.00 0.00 ? 262  PRO A O     1 
ATOM   1815  C  CB    . PRO A  1  262  ? 236.323 251.990 265.334 1.00 0.00 ? 262  PRO A CB    1 
ATOM   1816  C  CG    . PRO A  1  262  ? 237.739 251.860 265.786 1.00 0.00 ? 262  PRO A CG    1 
ATOM   1817  C  CD    . PRO A  1  262  ? 237.788 252.455 267.165 1.00 0.00 ? 262  PRO A CD    1 
ATOM   1818  N  N     . ALA A  1  263  ? 234.057 252.852 267.545 1.00 0.00 ? 263  ALA A N     1 
ATOM   1819  C  CA    . ALA A  1  263  ? 232.675 252.737 268.009 1.00 0.00 ? 263  ALA A CA    1 
ATOM   1820  C  C     . ALA A  1  263  ? 232.140 251.294 267.724 1.00 0.00 ? 263  ALA A C     1 
ATOM   1821  O  O     . ALA A  1  263  ? 230.946 251.033 267.864 1.00 0.00 ? 263  ALA A O     1 
ATOM   1822  C  CB    . ALA A  1  263  ? 231.797 253.779 267.337 1.00 0.00 ? 263  ALA A CB    1 
ATOM   1823  N  N     . VAL A  1  264  ? 233.045 250.394 267.308 1.00 0.00 ? 264  VAL A N     1 
ATOM   1824  C  CA    . VAL A  1  264  ? 232.844 248.961 267.009 1.00 0.00 ? 264  VAL A CA    1 
ATOM   1825  C  C     . VAL A  1  264  ? 231.854 248.435 265.951 1.00 0.00 ? 264  VAL A C     1 
ATOM   1826  O  O     . VAL A  1  264  ? 232.263 247.781 264.992 1.00 0.00 ? 264  VAL A O     1 
ATOM   1827  C  CB    . VAL A  1  264  ? 232.678 248.111 268.298 1.00 0.00 ? 264  VAL A CB    1 
ATOM   1828  C  CG1   . VAL A  1  264  ? 233.474 248.697 269.456 1.00 0.00 ? 264  VAL A CG1   1 
ATOM   1829  C  CG2   . VAL A  1  264  ? 231.211 247.927 268.655 1.00 0.00 ? 264  VAL A CG2   1 
ATOM   1830  N  N     . VAL A  1  265  ? 230.569 248.715 266.124 1.00 0.00 ? 265  VAL A N     1 
ATOM   1831  C  CA    . VAL A  1  265  ? 229.516 248.159 265.252 1.00 0.00 ? 265  VAL A CA    1 
ATOM   1832  C  C     . VAL A  1  265  ? 229.952 247.908 263.797 1.00 0.00 ? 265  VAL A C     1 
ATOM   1833  O  O     . VAL A  1  265  ? 229.999 246.754 263.367 1.00 0.00 ? 265  VAL A O     1 
ATOM   1834  C  CB    . VAL A  1  265  ? 228.213 249.037 265.259 1.00 0.00 ? 265  VAL A CB    1 
ATOM   1835  C  CG1   . VAL A  1  265  ? 227.388 248.748 266.512 1.00 0.00 ? 265  VAL A CG1   1 
ATOM   1836  C  CG2   . VAL A  1  265  ? 228.505 250.536 265.140 1.00 0.00 ? 265  VAL A CG2   1 
ATOM   1837  N  N     . MET A  1  266  ? 230.281 248.976 263.068 1.00 0.00 ? 266  MET A N     1 
ATOM   1838  C  CA    . MET A  1  266  ? 230.694 248.933 261.656 1.00 0.00 ? 266  MET A CA    1 
ATOM   1839  C  C     . MET A  1  266  ? 229.988 247.847 260.816 1.00 0.00 ? 266  MET A C     1 
ATOM   1840  O  O     . MET A  1  266  ? 230.596 246.861 260.391 1.00 0.00 ? 266  MET A O     1 
ATOM   1841  C  CB    . MET A  1  266  ? 232.222 248.784 261.556 1.00 0.00 ? 266  MET A CB    1 
ATOM   1842  C  CG    . MET A  1  266  ? 232.824 247.558 262.225 1.00 0.00 ? 266  MET A CG    1 
ATOM   1843  S  SD    . MET A  1  266  ? 234.625 247.580 262.239 1.00 0.00 ? 266  MET A SD    1 
ATOM   1844  C  CE    . MET A  1  266  ? 234.931 248.802 263.515 1.00 0.00 ? 266  MET A CE    1 
ATOM   1845  N  N     . GLN A  1  267  ? 228.695 248.067 260.583 1.00 0.00 ? 267  GLN A N     1 
ATOM   1846  C  CA    . GLN A  1  267  ? 227.818 247.165 259.832 1.00 0.00 ? 267  GLN A CA    1 
ATOM   1847  C  C     . GLN A  1  267  ? 227.710 245.817 260.549 1.00 0.00 ? 267  GLN A C     1 
ATOM   1848  O  O     . GLN A  1  267  ? 227.591 245.778 261.777 1.00 0.00 ? 267  GLN A O     1 
ATOM   1849  C  CB    . GLN A  1  267  ? 228.304 246.992 258.383 1.00 0.00 ? 267  GLN A CB    1 
ATOM   1850  C  CG    . GLN A  1  267  ? 227.221 246.557 257.390 1.00 0.00 ? 267  GLN A CG    1 
ATOM   1851  C  CD    . GLN A  1  267  ? 225.976 247.419 257.467 1.00 0.00 ? 267  GLN A CD    1 
ATOM   1852  O  OE1   . GLN A  1  267  ? 226.053 248.647 257.428 1.00 0.00 ? 267  GLN A OE1   1 
ATOM   1853  N  NE2   . GLN A  1  267  ? 224.819 246.777 257.578 1.00 0.00 ? 267  GLN A NE2   1 
ATOM   1854  N  N     . GLY A  1  268  ? 227.761 244.726 259.787 1.00 0.00 ? 268  GLY A N     1 
ATOM   1855  C  CA    . GLY A  1  268  ? 227.610 243.387 260.329 1.00 0.00 ? 268  GLY A CA    1 
ATOM   1856  C  C     . GLY A  1  268  ? 226.347 243.258 261.160 1.00 0.00 ? 268  GLY A C     1 
ATOM   1857  O  O     . GLY A  1  268  ? 225.389 244.013 260.965 1.00 0.00 ? 268  GLY A O     1 
ATOM   1858  N  N     . SER A  1  269  ? 226.282 242.230 261.989 1.00 0.00 ? 269  SER A N     1 
ATOM   1859  C  CA    . SER A  1  269  ? 225.148 242.010 262.873 1.00 0.00 ? 269  SER A CA    1 
ATOM   1860  C  C     . SER A  1  269  ? 225.938 241.820 264.130 1.00 0.00 ? 269  SER A C     1 
ATOM   1861  O  O     . SER A  1  269  ? 225.863 240.789 264.798 1.00 0.00 ? 269  SER A O     1 
ATOM   1862  C  CB    . SER A  1  269  ? 224.406 240.729 262.504 1.00 0.00 ? 269  SER A CB    1 
ATOM   1863  O  OG    . SER A  1  269  ? 224.313 240.582 261.097 1.00 0.00 ? 269  SER A OG    1 
ATOM   1864  N  N     . ALA A  1  270  ? 226.710 242.852 264.441 1.00 0.00 ? 270  ALA A N     1 
ATOM   1865  C  CA    . ALA A  1  270  ? 227.656 242.772 265.547 1.00 0.00 ? 270  ALA A CA    1 
ATOM   1866  C  C     . ALA A  1  270  ? 228.985 242.129 265.073 1.00 0.00 ? 270  ALA A C     1 
ATOM   1867  O  O     . ALA A  1  270  ? 229.876 241.874 265.883 1.00 0.00 ? 270  ALA A O     1 
ATOM   1868  C  CB    . ALA A  1  270  ? 227.061 241.982 266.701 1.00 0.00 ? 270  ALA A CB    1 
ATOM   1869  N  N     . ARG A  1  271  ? 229.105 241.872 263.765 1.00 0.00 ? 271  ARG A N     1 
ATOM   1870  C  CA    . ARG A  1  271  ? 230.288 241.269 263.163 1.00 0.00 ? 271  ARG A CA    1 
ATOM   1871  C  C     . ARG A  1  271  ? 231.318 242.335 262.812 1.00 0.00 ? 271  ARG A C     1 
ATOM   1872  O  O     . ARG A  1  271  ? 231.350 242.858 261.698 1.00 0.00 ? 271  ARG A O     1 
ATOM   1873  C  CB    . ARG A  1  271  ? 229.908 240.472 261.914 1.00 0.00 ? 271  ARG A CB    1 
ATOM   1874  C  CG    . ARG A  1  271  ? 229.675 238.992 262.170 1.00 0.00 ? 271  ARG A CG    1 
ATOM   1875  C  CD    . ARG A  1  271  ? 228.341 238.537 261.601 1.00 0.00 ? 271  ARG A CD    1 
ATOM   1876  N  NE    . ARG A  1  271  ? 228.335 238.552 260.141 1.00 0.00 ? 271  ARG A NE    1 
ATOM   1877  C  CZ    . ARG A  1  271  ? 227.239 238.444 259.397 1.00 0.00 ? 271  ARG A CZ    1 
ATOM   1878  N  NH1   . ARG A  1  271  ? 226.053 238.312 259.975 1.00 0.00 ? 271  ARG A NH1   1 
ATOM   1879  N  NH2   . ARG A  1  271  ? 227.329 238.468 258.074 1.00 0.00 ? 271  ARG A NH2   1 
ATOM   1880  N  N     . ASN A  1  272  ? 232.237 242.649 263.703 1.00 0.00 ? 272  ASN A N     1 
ATOM   1881  C  CA    . ASN A  1  272  ? 233.209 243.629 263.257 1.00 0.00 ? 272  ASN A CA    1 
ATOM   1882  C  C     . ASN A  1  272  ? 233.940 244.402 264.323 1.00 0.00 ? 272  ASN A C     1 
ATOM   1883  O  O     . ASN A  1  272  ? 234.057 245.627 264.241 1.00 0.00 ? 272  ASN A O     1 
ATOM   1884  C  CB    . ASN A  1  272  ? 232.557 244.593 262.255 1.00 0.00 ? 272  ASN A CB    1 
ATOM   1885  C  CG    . ASN A  1  272  ? 231.685 245.633 262.931 1.00 0.00 ? 272  ASN A CG    1 
ATOM   1886  O  OD1   . ASN A  1  272  ? 230.921 245.321 263.845 1.00 0.00 ? 272  ASN A OD1   1 
ATOM   1887  N  ND2   . ASN A  1  272  ? 231.795 246.878 262.483 1.00 0.00 ? 272  ASN A ND2   1 
ATOM   1888  N  N     . GLN A  1  273  ? 234.445 243.710 265.331 1.00 0.00 ? 273  GLN A N     1 
ATOM   1889  C  CA    . GLN A  1  273  ? 235.188 244.472 266.319 1.00 0.00 ? 273  GLN A CA    1 
ATOM   1890  C  C     . GLN A  1  273  ? 236.171 245.424 265.636 1.00 0.00 ? 273  GLN A C     1 
ATOM   1891  O  O     . GLN A  1  273  ? 236.517 245.243 264.469 1.00 0.00 ? 273  GLN A O     1 
ATOM   1892  C  CB    . GLN A  1  273  ? 235.923 243.522 267.270 1.00 0.00 ? 273  GLN A CB    1 
ATOM   1893  C  CG    . GLN A  1  273  ? 236.373 244.161 268.572 1.00 0.00 ? 273  GLN A CG    1 
ATOM   1894  C  CD    . GLN A  1  273  ? 235.203 244.668 269.393 1.00 0.00 ? 273  GLN A CD    1 
ATOM   1895  O  OE1   . GLN A  1  273  ? 235.246 245.768 269.946 1.00 0.00 ? 273  GLN A OE1   1 
ATOM   1896  N  NE2   . GLN A  1  273  ? 234.147 243.861 269.477 1.00 0.00 ? 273  GLN A NE2   1 
ATOM   1897  N  N     . ASP A  1  274  ? 236.600 246.447 266.365 1.00 0.00 ? 274  ASP A N     1 
ATOM   1898  C  CA    . ASP A  1  274  ? 237.652 247.351 265.910 1.00 0.00 ? 274  ASP A CA    1 
ATOM   1899  C  C     . ASP A  1  274  ? 239.043 246.712 266.031 1.00 0.00 ? 274  ASP A C     1 
ATOM   1900  O  O     . ASP A  1  274  ? 239.222 245.737 266.769 1.00 0.00 ? 274  ASP A O     1 
ATOM   1901  C  CB    . ASP A  1  274  ? 237.606 248.640 266.719 1.00 0.00 ? 274  ASP A CB    1 
ATOM   1902  C  CG    . ASP A  1  274  ? 238.706 249.601 266.343 1.00 0.00 ? 274  ASP A CG    1 
ATOM   1903  O  OD1   . ASP A  1  274  ? 238.951 249.768 265.132 1.00 0.00 ? 274  ASP A OD1   1 
ATOM   1904  O  OD2   . ASP A  1  274  ? 239.340 250.167 267.256 1.00 0.00 ? 274  ASP A OD2   1 
ATOM   1905  N  N     . ASP A  1  275  ? 240.029 247.263 265.322 1.00 0.00 ? 275  ASP A N     1 
ATOM   1906  C  CA    . ASP A  1  275  ? 241.374 246.690 265.304 1.00 0.00 ? 275  ASP A CA    1 
ATOM   1907  C  C     . ASP A  1  275  ? 242.291 247.298 266.369 1.00 0.00 ? 275  ASP A C     1 
ATOM   1908  O  O     . ASP A  1  275  ? 243.304 246.709 266.737 1.00 0.00 ? 275  ASP A O     1 
ATOM   1909  C  CB    . ASP A  1  275  ? 242.005 246.855 263.917 1.00 0.00 ? 275  ASP A CB    1 
ATOM   1910  C  CG    . ASP A  1  275  ? 242.353 248.303 263.591 1.00 0.00 ? 275  ASP A CG    1 
ATOM   1911  O  OD1   . ASP A  1  275  ? 241.998 249.212 264.376 1.00 0.00 ? 275  ASP A OD1   1 
ATOM   1912  O  OD2   . ASP A  1  275  ? 243.002 248.533 262.546 1.00 0.00 ? 275  ASP A OD2   1 
ATOM   1913  N  N     . LEU A  1  276  ? 241.948 248.499 266.821 1.00 0.00 ? 276  LEU A N     1 
ATOM   1914  C  CA    . LEU A  1  276  ? 242.611 249.120 267.960 1.00 0.00 ? 276  LEU A CA    1 
ATOM   1915  C  C     . LEU A  1  276  ? 242.135 248.490 269.276 1.00 0.00 ? 276  LEU A C     1 
ATOM   1916  O  O     . LEU A  1  276  ? 242.867 248.473 270.264 1.00 0.00 ? 276  LEU A O     1 
ATOM   1917  C  CB    . LEU A  1  276  ? 242.402 250.635 267.944 1.00 0.00 ? 276  LEU A CB    1 
ATOM   1918  C  CG    . LEU A  1  276  ? 242.895 251.503 269.107 1.00 0.00 ? 276  LEU A CG    1 
ATOM   1919  C  CD1   . LEU A  1  276  ? 243.094 252.919 268.601 1.00 0.00 ? 276  LEU A CD1   1 
ATOM   1920  C  CD2   . LEU A  1  276  ? 241.946 251.526 270.285 1.00 0.00 ? 276  LEU A CD2   1 
ATOM   1921  N  N     . THR A  1  277  ? 240.907 247.980 269.285 1.00 0.00 ? 277  THR A N     1 
ATOM   1922  C  CA    . THR A  1  277  ? 240.509 246.954 270.256 1.00 0.00 ? 277  THR A CA    1 
ATOM   1923  C  C     . THR A  1  277  ? 240.998 245.536 269.990 1.00 0.00 ? 277  THR A C     1 
ATOM   1924  O  O     . THR A  1  277  ? 241.125 244.772 270.931 1.00 0.00 ? 277  THR A O     1 
ATOM   1925  C  CB    . THR A  1  277  ? 238.978 246.887 270.401 1.00 0.00 ? 277  THR A CB    1 
ATOM   1926  O  OG1   . THR A  1  277  ? 238.428 248.194 270.216 1.00 0.00 ? 277  THR A OG1   1 
ATOM   1927  C  CG2   . THR A  1  277  ? 238.608 246.437 271.785 1.00 0.00 ? 277  THR A CG2   1 
ATOM   1928  N  N     . HIS A  1  278  ? 241.249 245.150 268.747 1.00 0.00 ? 278  HIS A N     1 
ATOM   1929  C  CA    . HIS A  1  278  ? 241.856 243.840 268.543 1.00 0.00 ? 278  HIS A CA    1 
ATOM   1930  C  C     . HIS A  1  278  ? 243.227 243.817 269.208 1.00 0.00 ? 278  HIS A C     1 
ATOM   1931  O  O     . HIS A  1  278  ? 243.557 242.910 269.968 1.00 0.00 ? 278  HIS A O     1 
ATOM   1932  C  CB    . HIS A  1  278  ? 242.026 243.510 267.063 1.00 0.00 ? 278  HIS A CB    1 
ATOM   1933  C  CG    . HIS A  1  278  ? 240.857 242.811 266.451 1.00 0.00 ? 278  HIS A CG    1 
ATOM   1934  N  ND1   . HIS A  1  278  ? 240.093 243.376 265.455 1.00 0.00 ? 278  HIS A ND1   1 
ATOM   1935  C  CD2   . HIS A  1  278  ? 240.325 241.590 266.690 1.00 0.00 ? 278  HIS A CD2   1 
ATOM   1936  C  CE1   . HIS A  1  278  ? 239.139 242.531 265.104 1.00 0.00 ? 278  HIS A CE1   1 
ATOM   1937  N  NE2   . HIS A  1  278  ? 239.257 241.441 265.840 1.00 0.00 ? 278  HIS A NE2   1 
ATOM   1938  N  N     . LYS A  1  279  ? 244.019 244.835 268.903 1.00 0.00 ? 279  LYS A N     1 
ATOM   1939  C  CA    . LYS A  1  279  ? 245.337 245.030 269.488 1.00 0.00 ? 279  LYS A CA    1 
ATOM   1940  C  C     . LYS A  1  279  ? 245.326 245.218 271.003 1.00 0.00 ? 279  LYS A C     1 
ATOM   1941  O  O     . LYS A  1  279  ? 246.230 244.769 271.694 1.00 0.00 ? 279  LYS A O     1 
ATOM   1942  C  CB    . LYS A  1  279  ? 246.016 246.227 268.837 1.00 0.00 ? 279  LYS A CB    1 
ATOM   1943  C  CG    . LYS A  1  279  ? 247.428 246.409 269.296 1.00 0.00 ? 279  LYS A CG    1 
ATOM   1944  C  CD    . LYS A  1  279  ? 248.264 245.320 268.669 1.00 0.00 ? 279  LYS A CD    1 
ATOM   1945  C  CE    . LYS A  1  279  ? 249.652 245.306 269.233 1.00 0.00 ? 279  LYS A CE    1 
ATOM   1946  N  NZ    . LYS A  1  279  ? 250.427 244.141 268.733 1.00 0.00 ? 279  LYS A NZ    1 
ATOM   1947  N  N     . LEU A  1  280  ? 244.287 245.868 271.512 1.00 0.00 ? 280  LEU A N     1 
ATOM   1948  C  CA    . LEU A  1  280  ? 244.126 246.071 272.948 1.00 0.00 ? 280  LEU A CA    1 
ATOM   1949  C  C     . LEU A  1  280  ? 243.759 244.802 273.709 1.00 0.00 ? 280  LEU A C     1 
ATOM   1950  O  O     . LEU A  1  280  ? 244.228 244.581 274.820 1.00 0.00 ? 280  LEU A O     1 
ATOM   1951  C  CB    . LEU A  1  280  ? 243.064 247.135 273.210 1.00 0.00 ? 280  LEU A CB    1 
ATOM   1952  C  CG    . LEU A  1  280  ? 242.840 247.456 274.685 1.00 0.00 ? 280  LEU A CG    1 
ATOM   1953  C  CD1   . LEU A  1  280  ? 244.091 248.067 275.268 1.00 0.00 ? 280  LEU A CD1   1 
ATOM   1954  C  CD2   . LEU A  1  280  ? 241.655 248.379 274.870 1.00 0.00 ? 280  LEU A CD2   1 
ATOM   1955  N  N     . ALA A  1  281  ? 242.928 243.962 273.111 1.00 0.00 ? 281  ALA A N     1 
ATOM   1956  C  CA    . ALA A  1  281  ? 242.605 242.671 273.699 1.00 0.00 ? 281  ALA A CA    1 
ATOM   1957  C  C     . ALA A  1  281  ? 243.813 241.754 273.779 1.00 0.00 ? 281  ALA A C     1 
ATOM   1958  O  O     . ALA A  1  281  ? 243.984 241.054 274.767 1.00 0.00 ? 281  ALA A O     1 
ATOM   1959  C  CB    . ALA A  1  281  ? 241.493 241.992 272.913 1.00 0.00 ? 281  ALA A CB    1 
ATOM   1960  N  N     . ASP A  1  282  ? 244.673 241.787 272.769 1.00 0.00 ? 282  ASP A N     1 
ATOM   1961  C  CA    . ASP A  1  282  ? 245.976 241.133 272.876 1.00 0.00 ? 282  ASP A CA    1 
ATOM   1962  C  C     . ASP A  1  282  ? 246.879 241.645 274.006 1.00 0.00 ? 282  ASP A C     1 
ATOM   1963  O  O     . ASP A  1  282  ? 247.487 240.842 274.713 1.00 0.00 ? 282  ASP A O     1 
ATOM   1964  C  CB    . ASP A  1  282  ? 246.731 241.273 271.549 1.00 0.00 ? 282  ASP A CB    1 
ATOM   1965  C  CG    . ASP A  1  282  ? 247.681 240.112 271.284 1.00 0.00 ? 282  ASP A CG    1 
ATOM   1966  O  OD1   . ASP A  1  282  ? 247.918 239.303 272.210 1.00 0.00 ? 282  ASP A OD1   1 
ATOM   1967  O  OD2   . ASP A  1  282  ? 248.190 240.013 270.145 1.00 0.00 ? 282  ASP A OD2   1 
ATOM   1968  N  N     . ILE A  1  283  ? 246.981 242.958 274.180 1.00 0.00 ? 283  ILE A N     1 
ATOM   1969  C  CA    . ILE A  1  283  ? 247.695 243.492 275.336 1.00 0.00 ? 283  ILE A CA    1 
ATOM   1970  C  C     . ILE A  1  283  ? 247.127 242.995 276.659 1.00 0.00 ? 283  ILE A C     1 
ATOM   1971  O  O     . ILE A  1  283  ? 247.880 242.566 277.526 1.00 0.00 ? 283  ILE A O     1 
ATOM   1972  C  CB    . ILE A  1  283  ? 247.719 245.030 275.348 1.00 0.00 ? 283  ILE A CB    1 
ATOM   1973  C  CG1   . ILE A  1  283  ? 248.760 245.533 274.351 1.00 0.00 ? 283  ILE A CG1   1 
ATOM   1974  C  CG2   . ILE A  1  283  ? 248.134 245.551 276.702 1.00 0.00 ? 283  ILE A CG2   1 
ATOM   1975  C  CD1   . ILE A  1  283  ? 248.560 246.958 273.918 1.00 0.00 ? 283  ILE A CD1   1 
ATOM   1976  N  N     . VAL A  1  284  ? 245.807 243.015 276.807 1.00 0.00 ? 284  VAL A N     1 
ATOM   1977  C  CA    . VAL A  1  284  ? 245.186 242.484 278.018 1.00 0.00 ? 284  VAL A CA    1 
ATOM   1978  C  C     . VAL A  1  284  ? 245.471 240.989 278.221 1.00 0.00 ? 284  VAL A C     1 
ATOM   1979  O  O     . VAL A  1  284  ? 245.778 240.570 279.340 1.00 0.00 ? 284  VAL A O     1 
ATOM   1980  C  CB    . VAL A  1  284  ? 243.664 242.717 278.028 1.00 0.00 ? 284  VAL A CB    1 
ATOM   1981  C  CG1   . VAL A  1  284  ? 243.050 242.091 279.269 1.00 0.00 ? 284  VAL A CG1   1 
ATOM   1982  C  CG2   . VAL A  1  284  ? 243.371 244.195 278.049 1.00 0.00 ? 284  VAL A CG2   1 
ATOM   1983  N  N     . LYS A  1  285  ? 245.390 240.189 277.157 1.00 0.00 ? 285  LYS A N     1 
ATOM   1984  C  CA    . LYS A  1  285  ? 245.619 238.744 277.289 1.00 0.00 ? 285  LYS A CA    1 
ATOM   1985  C  C     . LYS A  1  285  ? 247.010 238.382 277.801 1.00 0.00 ? 285  LYS A C     1 
ATOM   1986  O  O     . LYS A  1  285  ? 247.137 237.592 278.734 1.00 0.00 ? 285  LYS A O     1 
ATOM   1987  C  CB    . LYS A  1  285  ? 245.415 238.032 275.942 1.00 0.00 ? 285  LYS A CB    1 
ATOM   1988  C  CG    . LYS A  1  285  ? 244.014 238.084 275.357 1.00 0.00 ? 285  LYS A CG    1 
ATOM   1989  C  CD    . LYS A  1  285  ? 243.966 237.358 274.015 1.00 0.00 ? 285  LYS A CD    1 
ATOM   1990  C  CE    . LYS A  1  285  ? 244.084 235.847 274.180 1.00 0.00 ? 285  LYS A CE    1 
ATOM   1991  N  NZ    . LYS A  1  285  ? 242.814 235.220 274.642 1.00 0.00 ? 285  LYS A NZ    1 
ATOM   1992  N  N     . ILE A  1  286  ? 248.049 238.947 277.193 1.00 0.00 ? 286  ILE A N     1 
ATOM   1993  C  CA    . ILE A  1  286  ? 249.412 238.694 277.654 1.00 0.00 ? 286  ILE A CA    1 
ATOM   1994  C  C     . ILE A  1  286  ? 249.675 239.343 279.014 1.00 0.00 ? 286  ILE A C     1 
ATOM   1995  O  O     . ILE A  1  286  ? 250.372 238.769 279.844 1.00 0.00 ? 286  ILE A O     1 
ATOM   1996  C  CB    . ILE A  1  286  ? 250.472 239.142 276.625 1.00 0.00 ? 286  ILE A CB    1 
ATOM   1997  C  CG1   . ILE A  1  286  ? 250.548 240.656 276.502 1.00 0.00 ? 286  ILE A CG1   1 
ATOM   1998  C  CG2   . ILE A  1  286  ? 250.196 238.507 275.269 1.00 0.00 ? 286  ILE A CG2   1 
ATOM   1999  C  CD1   . ILE A  1  286  ? 251.716 241.097 275.683 1.00 0.00 ? 286  ILE A CD1   1 
ATOM   2000  N  N     . ASN A  1  287  ? 249.141 240.540 279.235 1.00 0.00 ? 287  ASN A N     1 
ATOM   2001  C  CA    . ASN A  1  287  ? 249.314 241.206 280.520 1.00 0.00 ? 287  ASN A CA    1 
ATOM   2002  C  C     . ASN A  1  287  ? 248.650 240.459 281.662 1.00 0.00 ? 287  ASN A C     1 
ATOM   2003  O  O     . ASN A  1  287  ? 249.207 240.364 282.752 1.00 0.00 ? 287  ASN A O     1 
ATOM   2004  C  CB    . ASN A  1  287  ? 248.759 242.622 280.483 1.00 0.00 ? 287  ASN A CB    1 
ATOM   2005  C  CG    . ASN A  1  287  ? 249.004 243.369 281.774 1.00 0.00 ? 287  ASN A CG    1 
ATOM   2006  O  OD1   . ASN A  1  287  ? 250.139 243.706 282.099 1.00 0.00 ? 287  ASN A OD1   1 
ATOM   2007  N  ND2   . ASN A  1  287  ? 247.942 243.605 282.533 1.00 0.00 ? 287  ASN A ND2   1 
ATOM   2008  N  N     . ASN A  1  288  ? 247.454 239.941 281.418 1.00 0.00 ? 288  ASN A N     1 
ATOM   2009  C  CA    . ASN A  1  288  ? 246.790 239.093 282.399 1.00 0.00 ? 288  ASN A CA    1 
ATOM   2010  C  C     . ASN A  1  288  ? 247.516 237.767 282.599 1.00 0.00 ? 288  ASN A C     1 
ATOM   2011  O  O     . ASN A  1  288  ? 247.678 237.301 283.727 1.00 0.00 ? 288  ASN A O     1 
ATOM   2012  C  CB    . ASN A  1  288  ? 245.341 238.832 282.001 1.00 0.00 ? 288  ASN A CB    1 
ATOM   2013  C  CG    . ASN A  1  288  ? 244.542 238.199 283.122 1.00 0.00 ? 288  ASN A CG    1 
ATOM   2014  O  OD1   . ASN A  1  288  ? 244.356 238.800 284.180 1.00 0.00 ? 288  ASN A OD1   1 
ATOM   2015  N  ND2   . ASN A  1  288  ? 244.074 236.976 282.900 1.00 0.00 ? 288  ASN A ND2   1 
ATOM   2016  N  N     . GLN A  1  289  ? 247.961 237.171 281.494 1.00 0.00 ? 289  GLN A N     1 
ATOM   2017  C  CA    . GLN A  1  289  ? 248.746 235.942 281.537 1.00 0.00 ? 289  GLN A CA    1 
ATOM   2018  C  C     . GLN A  1  289  ? 250.071 236.109 282.256 1.00 0.00 ? 289  GLN A C     1 
ATOM   2019  O  O     . GLN A  1  289  ? 250.438 235.272 283.072 1.00 0.00 ? 289  GLN A O     1 
ATOM   2020  C  CB    . GLN A  1  289  ? 249.011 235.428 280.116 1.00 0.00 ? 289  GLN A CB    1 
ATOM   2021  C  CG    . GLN A  1  289  ? 249.466 233.974 280.030 1.00 0.00 ? 289  GLN A CG    1 
ATOM   2022  C  CD    . GLN A  1  289  ? 248.399 232.970 280.432 1.00 0.00 ? 289  GLN A CD    1 
ATOM   2023  O  OE1   . GLN A  1  289  ? 247.264 233.331 280.742 1.00 0.00 ? 289  GLN A OE1   1 
ATOM   2024  N  NE2   . GLN A  1  289  ? 248.767 231.694 280.434 1.00 0.00 ? 289  GLN A NE2   1 
ATOM   2025  N  N     . LEU A  1  290  ? 250.787 237.184 281.955 1.00 0.00 ? 290  LEU A N     1 
ATOM   2026  C  CA    . LEU A  1  290  ? 252.010 237.497 282.679 1.00 0.00 ? 290  LEU A CA    1 
ATOM   2027  C  C     . LEU A  1  290  ? 251.768 237.688 284.182 1.00 0.00 ? 290  LEU A C     1 
ATOM   2028  O  O     . LEU A  1  290  ? 252.581 237.258 284.997 1.00 0.00 ? 290  LEU A O     1 
ATOM   2029  C  CB    . LEU A  1  290  ? 252.651 238.752 282.078 1.00 0.00 ? 290  LEU A CB    1 
ATOM   2030  C  CG    . LEU A  1  290  ? 253.909 239.320 282.724 1.00 0.00 ? 290  LEU A CG    1 
ATOM   2031  C  CD1   . LEU A  1  290  ? 254.931 238.219 282.865 1.00 0.00 ? 290  LEU A CD1   1 
ATOM   2032  C  CD2   . LEU A  1  290  ? 254.466 240.465 281.893 1.00 0.00 ? 290  LEU A CD2   1 
ATOM   2033  N  N     . ARG A  1  291  ? 250.655 238.325 284.547 1.00 0.00 ? 291  ARG A N     1 
ATOM   2034  C  CA    . ARG A  1  291  ? 250.279 238.448 285.958 1.00 0.00 ? 291  ARG A CA    1 
ATOM   2035  C  C     . ARG A  1  291  ? 250.045 237.120 286.668 1.00 0.00 ? 291  ARG A C     1 
ATOM   2036  O  O     . ARG A  1  291  ? 250.545 236.900 287.768 1.00 0.00 ? 291  ARG A O     1 
ATOM   2037  C  CB    . ARG A  1  291  ? 249.021 239.311 286.098 1.00 0.00 ? 291  ARG A CB    1 
ATOM   2038  C  CG    . ARG A  1  291  ? 248.610 239.569 287.544 1.00 0.00 ? 291  ARG A CG    1 
ATOM   2039  C  CD    . ARG A  1  291  ? 249.504 240.561 288.270 1.00 0.00 ? 291  ARG A CD    1 
ATOM   2040  N  NE    . ARG A  1  291  ? 249.268 241.940 287.856 1.00 0.00 ? 291  ARG A NE    1 
ATOM   2041  C  CZ    . ARG A  1  291  ? 250.154 242.922 287.991 1.00 0.00 ? 291  ARG A CZ    1 
ATOM   2042  N  NH1   . ARG A  1  291  ? 251.337 242.682 288.542 1.00 0.00 ? 291  ARG A NH1   1 
ATOM   2043  N  NH2   . ARG A  1  291  ? 249.855 244.148 287.583 1.00 0.00 ? 291  ARG A NH2   1 
ATOM   2044  N  N     . ARG A  1  292  ? 249.276 236.246 286.029 1.00 0.00 ? 292  ARG A N     1 
ATOM   2045  C  CA    . ARG A  1  292  ? 249.014 234.902 286.537 1.00 0.00 ? 292  ARG A CA    1 
ATOM   2046  C  C     . ARG A  1  292  ? 250.318 234.106 286.568 1.00 0.00 ? 292  ARG A C     1 
ATOM   2047  O  O     . ARG A  1  292  ? 250.584 233.344 287.495 1.00 0.00 ? 292  ARG A O     1 
ATOM   2048  C  CB    . ARG A  1  292  ? 247.934 234.209 285.704 1.00 0.00 ? 292  ARG A CB    1 
ATOM   2049  C  CG    . ARG A  1  292  ? 247.848 232.707 285.880 1.00 0.00 ? 292  ARG A CG    1 
ATOM   2050  C  CD    . ARG A  1  292  ? 246.709 232.142 285.046 1.00 0.00 ? 292  ARG A CD    1 
ATOM   2051  N  NE    . ARG A  1  292  ? 246.830 230.706 284.825 1.00 0.00 ? 292  ARG A NE    1 
ATOM   2052  C  CZ    . ARG A  1  292  ? 245.864 229.834 285.099 1.00 0.00 ? 292  ARG A CZ    1 
ATOM   2053  N  NH1   . ARG A  1  292  ? 244.711 230.257 285.603 1.00 0.00 ? 292  ARG A NH1   1 
ATOM   2054  N  NH2   . ARG A  1  292  ? 246.046 228.542 284.868 1.00 0.00 ? 292  ARG A NH2   1 
ATOM   2055  N  N     . ASN A  1  293  ? 251.115 234.315 285.526 1.00 0.00 ? 293  ASN A N     1 
ATOM   2056  C  CA    . ASN A  1  293  ? 252.447 233.734 285.359 1.00 0.00 ? 293  ASN A CA    1 
ATOM   2057  C  C     . ASN A  1  293  ? 253.407 234.116 286.481 1.00 0.00 ? 293  ASN A C     1 
ATOM   2058  O  O     . ASN A  1  293  ? 254.118 233.263 287.012 1.00 0.00 ? 293  ASN A O     1 
ATOM   2059  C  CB    . ASN A  1  293  ? 253.046 234.142 284.010 1.00 0.00 ? 293  ASN A CB    1 
ATOM   2060  C  CG    . ASN A  1  293  ? 254.236 233.286 283.610 1.00 0.00 ? 293  ASN A CG    1 
ATOM   2061  O  OD1   . ASN A  1  293  ? 254.735 232.480 284.396 1.00 0.00 ? 293  ASN A OD1   1 
ATOM   2062  N  ND2   . ASN A  1  293  ? 254.689 233.449 282.373 1.00 0.00 ? 293  ASN A ND2   1 
ATOM   2063  N  N     . GLU A  1  294  ? 253.414 235.390 286.856 1.00 0.00 ? 294  GLU A N     1 
ATOM   2064  C  CA    . GLU A  1  294  ? 254.214 235.811 287.997 1.00 0.00 ? 294  GLU A CA    1 
ATOM   2065  C  C     . GLU A  1  294  ? 253.620 235.244 289.281 1.00 0.00 ? 294  GLU A C     1 
ATOM   2066  O  O     . GLU A  1  294  ? 254.269 234.400 289.894 1.00 0.00 ? 294  GLU A O     1 
ATOM   2067  C  CB    . GLU A  1  294  ? 254.299 237.337 288.060 1.00 0.00 ? 294  GLU A CB    1 
ATOM   2068  C  CG    . GLU A  1  294  ? 255.236 237.869 289.130 1.00 0.00 ? 294  GLU A CG    1 
ATOM   2069  C  CD    . GLU A  1  294  ? 255.715 239.276 288.827 1.00 0.00 ? 294  GLU A CD    1 
ATOM   2070  O  OE1   . GLU A  1  294  ? 254.891 240.105 288.386 1.00 0.00 ? 294  GLU A OE1   1 
ATOM   2071  O  OE2   . GLU A  1  294  ? 256.918 239.551 289.020 1.00 0.00 ? 294  GLU A OE2   1 
ATOM   2072  N  N     . GLN A  1  295  ? 252.473 235.744 289.743 1.00 0.00 ? 295  GLN A N     1 
ATOM   2073  C  CA    . GLN A  1  295  ? 251.634 235.026 290.727 1.00 0.00 ? 295  GLN A CA    1 
ATOM   2074  C  C     . GLN A  1  295  ? 251.951 233.532 290.920 1.00 0.00 ? 295  GLN A C     1 
ATOM   2075  O  O     . GLN A  1  295  ? 252.116 233.062 292.046 1.00 0.00 ? 295  GLN A O     1 
ATOM   2076  C  CB    . GLN A  1  295  ? 250.152 235.171 290.371 1.00 0.00 ? 295  GLN A CB    1 
ATOM   2077  C  CG    . GLN A  1  295  ? 249.224 235.090 291.581 1.00 0.00 ? 295  GLN A CG    1 
ATOM   2078  C  CD    . GLN A  1  295  ? 249.173 236.374 292.385 1.00 0.00 ? 295  GLN A CD    1 
ATOM   2079  O  OE1   . GLN A  1  295  ? 249.128 237.471 291.828 1.00 0.00 ? 295  GLN A OE1   1 
ATOM   2080  N  NE2   . GLN A  1  295  ? 249.185 236.242 293.707 1.00 0.00 ? 295  GLN A NE2   1 
ATOM   2081  N  N     . ASN A  1  296  ? 252.027 232.798 289.810 1.00 0.00 ? 296  ASN A N     1 
ATOM   2082  C  CA    . ASN A  1  296  ? 252.406 231.387 289.834 1.00 0.00 ? 296  ASN A CA    1 
ATOM   2083  C  C     . ASN A  1  296  ? 253.919 231.194 289.780 1.00 0.00 ? 296  ASN A C     1 
ATOM   2084  O  O     . ASN A  1  296  ? 254.656 231.830 290.527 1.00 0.00 ? 296  ASN A O     1 
ATOM   2085  C  CB    . ASN A  1  296  ? 251.748 230.637 288.674 1.00 0.00 ? 296  ASN A CB    1 
ATOM   2086  C  CG    . ASN A  1  296  ? 250.255 230.453 288.869 1.00 0.00 ? 296  ASN A CG    1 
ATOM   2087  O  OD1   . ASN A  1  296  ? 249.779 230.287 289.992 1.00 0.00 ? 296  ASN A OD1   1 
ATOM   2088  N  ND2   . ASN A  1  296  ? 249.508 230.488 287.772 1.00 0.00 ? 296  ASN A ND2   1 
ATOM   2089  N  N     . GLY A  1  297  ? 254.384 230.338 288.876 1.00 0.00 ? 297  GLY A N     1 
ATOM   2090  C  CA    . GLY A  1  297  ? 255.790 229.981 288.838 1.00 0.00 ? 297  GLY A CA    1 
ATOM   2091  C  C     . GLY A  1  297  ? 256.548 230.586 287.675 1.00 0.00 ? 297  GLY A C     1 
ATOM   2092  O  O     . GLY A  1  297  ? 257.044 229.876 286.799 1.00 0.00 ? 297  GLY A O     1 
ATOM   2093  N  N     . ALA A  1  298  ? 256.635 231.911 287.682 1.00 0.00 ? 298  ALA A N     1 
ATOM   2094  C  CA    . ALA A  1  298  ? 257.366 232.662 286.669 1.00 0.00 ? 298  ALA A CA    1 
ATOM   2095  C  C     . ALA A  1  298  ? 258.847 232.303 286.636 1.00 0.00 ? 298  ALA A C     1 
ATOM   2096  O  O     . ALA A  1  298  ? 259.565 232.554 287.601 1.00 0.00 ? 298  ALA A O     1 
ATOM   2097  C  CB    . ALA A  1  298  ? 257.200 234.141 286.920 1.00 0.00 ? 298  ALA A CB    1 
ATOM   2098  N  N     . ALA A  1  299  ? 259.302 231.738 285.521 1.00 0.00 ? 299  ALA A N     1 
ATOM   2099  C  CA    . ALA A  1  299  ? 260.680 231.267 285.412 1.00 0.00 ? 299  ALA A CA    1 
ATOM   2100  C  C     . ALA A  1  299  ? 261.674 232.425 285.401 1.00 0.00 ? 299  ALA A C     1 
ATOM   2101  O  O     . ALA A  1  299  ? 262.050 232.942 286.453 1.00 0.00 ? 299  ALA A O     1 
ATOM   2102  C  CB    . ALA A  1  299  ? 260.848 230.416 284.161 1.00 0.00 ? 299  ALA A CB    1 
ATOM   2103  N  N     . ALA A  1  300  ? 262.093 232.830 284.206 1.00 0.00 ? 300  ALA A N     1 
ATOM   2104  C  CA    . ALA A  1  300  ? 263.036 233.933 284.048 1.00 0.00 ? 300  ALA A CA    1 
ATOM   2105  C  C     . ALA A  1  300  ? 263.076 234.389 282.597 1.00 0.00 ? 300  ALA A C     1 
ATOM   2106  O  O     . ALA A  1  300  ? 262.713 235.521 282.272 1.00 0.00 ? 300  ALA A O     1 
ATOM   2107  C  CB    . ALA A  1  300  ? 264.427 233.520 284.511 1.00 0.00 ? 300  ALA A CB    1 
ATOM   2108  N  N     . HIS A  1  301  ? 263.521 233.482 281.735 1.00 0.00 ? 301  HIS A N     1 
ATOM   2109  C  CA    . HIS A  1  301  ? 263.548 233.696 280.294 1.00 0.00 ? 301  HIS A CA    1 
ATOM   2110  C  C     . HIS A  1  301  ? 262.142 233.951 279.765 1.00 0.00 ? 301  HIS A C     1 
ATOM   2111  O  O     . HIS A  1  301  ? 261.936 234.805 278.902 1.00 0.00 ? 301  HIS A O     1 
ATOM   2112  C  CB    . HIS A  1  301  ? 264.202 232.509 279.570 1.00 0.00 ? 301  HIS A CB    1 
ATOM   2113  C  CG    . HIS A  1  301  ? 263.515 231.196 279.788 1.00 0.00 ? 301  HIS A CG    1 
ATOM   2114  N  ND1   . HIS A  1  301  ? 263.236 230.694 281.041 1.00 0.00 ? 301  HIS A ND1   1 
ATOM   2115  C  CD2   . HIS A  1  301  ? 263.063 230.273 278.906 1.00 0.00 ? 301  HIS A CD2   1 
ATOM   2116  C  CE1   . HIS A  1  301  ? 262.637 229.523 280.922 1.00 0.00 ? 301  HIS A CE1   1 
ATOM   2117  N  NE2   . HIS A  1  301  ? 262.518 229.245 279.636 1.00 0.00 ? 301  HIS A NE2   1 
ATOM   2118  N  N     . VAL A  1  302  ? 261.177 233.205 280.290 1.00 0.00 ? 302  VAL A N     1 
ATOM   2119  C  CA    . VAL A  1  302  ? 259.780 233.413 279.940 1.00 0.00 ? 302  VAL A CA    1 
ATOM   2120  C  C     . VAL A  1  302  ? 259.258 234.777 280.398 1.00 0.00 ? 302  VAL A C     1 
ATOM   2121  O  O     . VAL A  1  302  ? 258.463 235.399 279.694 1.00 0.00 ? 302  VAL A O     1 
ATOM   2122  C  CB    . VAL A  1  302  ? 258.892 232.310 280.549 1.00 0.00 ? 302  VAL A CB    1 
ATOM   2123  C  CG1   . VAL A  1  302  ? 257.525 232.303 279.887 1.00 0.00 ? 302  VAL A CG1   1 
ATOM   2124  C  CG2   . VAL A  1  302  ? 259.559 230.955 280.399 1.00 0.00 ? 302  VAL A CG2   1 
ATOM   2125  N  N     . ILE A  1  303  ? 259.700 235.252 281.560 1.00 0.00 ? 303  ILE A N     1 
ATOM   2126  C  CA    . ILE A  1  303  ? 259.364 236.615 281.970 1.00 0.00 ? 303  ILE A CA    1 
ATOM   2127  C  C     . ILE A  1  303  ? 259.977 237.662 281.050 1.00 0.00 ? 303  ILE A C     1 
ATOM   2128  O  O     . ILE A  1  303  ? 259.331 238.653 280.708 1.00 0.00 ? 303  ILE A O     1 
ATOM   2129  C  CB    . ILE A  1  303  ? 259.822 236.896 283.412 1.00 0.00 ? 303  ILE A CB    1 
ATOM   2130  C  CG1   . ILE A  1  303  ? 259.003 236.063 284.387 1.00 0.00 ? 303  ILE A CG1   1 
ATOM   2131  C  CG2   . ILE A  1  303  ? 259.623 238.359 283.765 1.00 0.00 ? 303  ILE A CG2   1 
ATOM   2132  C  CD1   . ILE A  1  303  ? 257.570 236.507 284.458 1.00 0.00 ? 303  ILE A CD1   1 
ATOM   2133  N  N     . ALA A  1  304  ? 261.215 237.428 280.624 1.00 0.00 ? 304  ALA A N     1 
ATOM   2134  C  CA    . ALA A  1  304  ? 261.897 238.357 279.730 1.00 0.00 ? 304  ALA A CA    1 
ATOM   2135  C  C     . ALA A  1  304  ? 261.216 238.393 278.366 1.00 0.00 ? 304  ALA A C     1 
ATOM   2136  O  O     . ALA A  1  304  ? 261.087 239.447 277.740 1.00 0.00 ? 304  ALA A O     1 
ATOM   2137  C  CB    . ALA A  1  304  ? 263.362 237.976 279.584 1.00 0.00 ? 304  ALA A CB    1 
ATOM   2138  N  N     . GLU A  1  305  ? 260.778 237.220 277.924 1.00 0.00 ? 305  GLU A N     1 
ATOM   2139  C  CA    . GLU A  1  305  ? 259.964 237.071 276.726 1.00 0.00 ? 305  GLU A CA    1 
ATOM   2140  C  C     . GLU A  1  305  ? 258.616 237.783 276.820 1.00 0.00 ? 305  GLU A C     1 
ATOM   2141  O  O     . GLU A  1  305  ? 258.200 238.480 275.893 1.00 0.00 ? 305  GLU A O     1 
ATOM   2142  C  CB    . GLU A  1  305  ? 259.737 235.582 276.442 1.00 0.00 ? 305  GLU A CB    1 
ATOM   2143  C  CG    . GLU A  1  305  ? 258.957 235.287 275.171 1.00 0.00 ? 305  GLU A CG    1 
ATOM   2144  C  CD    . GLU A  1  305  ? 259.835 235.272 273.933 1.00 0.00 ? 305  GLU A CD    1 
ATOM   2145  O  OE1   . GLU A  1  305  ? 261.071 235.400 274.077 1.00 0.00 ? 305  GLU A OE1   1 
ATOM   2146  O  OE2   . GLU A  1  305  ? 259.289 235.126 272.818 1.00 0.00 ? 305  GLU A OE2   1 
ATOM   2147  N  N     . ASP A  1  306  ? 257.950 237.618 277.958 1.00 0.00 ? 306  ASP A N     1 
ATOM   2148  C  CA    . ASP A  1  306  ? 256.666 238.259 278.200 1.00 0.00 ? 306  ASP A CA    1 
ATOM   2149  C  C     . ASP A  1  306  ? 256.768 239.776 278.280 1.00 0.00 ? 306  ASP A C     1 
ATOM   2150  O  O     . ASP A  1  306  ? 255.880 240.489 277.817 1.00 0.00 ? 306  ASP A O     1 
ATOM   2151  C  CB    . ASP A  1  306  ? 256.062 237.711 279.488 1.00 0.00 ? 306  ASP A CB    1 
ATOM   2152  C  CG    . ASP A  1  306  ? 255.027 236.643 279.231 1.00 0.00 ? 306  ASP A CG    1 
ATOM   2153  O  OD1   . ASP A  1  306  ? 255.007 236.095 278.107 1.00 0.00 ? 306  ASP A OD1   1 
ATOM   2154  O  OD2   . ASP A  1  306  ? 254.244 236.339 280.154 1.00 0.00 ? 306  ASP A OD2   1 
ATOM   2155  N  N     . VAL A  1  307  ? 257.855 240.267 278.857 1.00 0.00 ? 307  VAL A N     1 
ATOM   2156  C  CA    . VAL A  1  307  ? 258.114 241.698 278.884 1.00 0.00 ? 307  VAL A CA    1 
ATOM   2157  C  C     . VAL A  1  307  ? 258.342 242.193 277.464 1.00 0.00 ? 307  VAL A C     1 
ATOM   2158  O  O     . VAL A  1  307  ? 257.776 243.206 277.058 1.00 0.00 ? 307  VAL A O     1 
ATOM   2159  C  CB    . VAL A  1  307  ? 259.314 242.054 279.775 1.00 0.00 ? 307  VAL A CB    1 
ATOM   2160  C  CG1   . VAL A  1  307  ? 259.746 243.495 279.543 1.00 0.00 ? 307  VAL A CG1   1 
ATOM   2161  C  CG2   . VAL A  1  307  ? 258.956 241.836 281.234 1.00 0.00 ? 307  VAL A CG2   1 
ATOM   2162  N  N     . LYS A  1  308  ? 259.151 241.465 276.702 1.00 0.00 ? 308  LYS A N     1 
ATOM   2163  C  CA    . LYS A  1  308  ? 259.448 241.849 275.325 1.00 0.00 ? 308  LYS A CA    1 
ATOM   2164  C  C     . LYS A  1  308  ? 258.212 241.826 274.430 1.00 0.00 ? 308  LYS A C     1 
ATOM   2165  O  O     . LYS A  1  308  ? 258.041 242.703 273.582 1.00 0.00 ? 308  LYS A O     1 
ATOM   2166  C  CB    . LYS A  1  308  ? 260.510 240.916 274.738 1.00 0.00 ? 308  LYS A CB    1 
ATOM   2167  C  CG    . LYS A  1  308  ? 261.107 241.380 273.418 1.00 0.00 ? 308  LYS A CG    1 
ATOM   2168  C  CD    . LYS A  1  308  ? 262.233 240.455 272.976 1.00 0.00 ? 308  LYS A CD    1 
ATOM   2169  C  CE    . LYS A  1  308  ? 262.858 240.917 271.673 1.00 0.00 ? 308  LYS A CE    1 
ATOM   2170  N  NZ    . LYS A  1  308  ? 263.524 242.234 271.826 1.00 0.00 ? 308  LYS A NZ    1 
ATOM   2171  N  N     . LEU A  1  309  ? 257.353 240.830 274.621 1.00 0.00 ? 309  LEU A N     1 
ATOM   2172  C  CA    . LEU A  1  309  ? 256.079 240.777 273.914 1.00 0.00 ? 309  LEU A CA    1 
ATOM   2173  C  C     . LEU A  1  309  ? 255.136 241.909 274.331 1.00 0.00 ? 309  LEU A C     1 
ATOM   2174  O  O     . LEU A  1  309  ? 254.474 242.514 273.491 1.00 0.00 ? 309  LEU A O     1 
ATOM   2175  C  CB    . LEU A  1  309  ? 255.406 239.423 274.123 1.00 0.00 ? 309  LEU A CB    1 
ATOM   2176  C  CG    . LEU A  1  309  ? 254.165 239.199 273.260 1.00 0.00 ? 309  LEU A CG    1 
ATOM   2177  C  CD1   . LEU A  1  309  ? 254.559 239.128 271.794 1.00 0.00 ? 309  LEU A CD1   1 
ATOM   2178  C  CD2   . LEU A  1  309  ? 253.451 237.929 273.674 1.00 0.00 ? 309  LEU A CD2   1 
ATOM   2179  N  N     . LEU A  1  310  ? 255.081 242.191 275.629 1.00 0.00 ? 310  LEU A N     1 
ATOM   2180  C  CA    . LEU A  1  310  ? 254.312 243.323 276.145 1.00 0.00 ? 310  LEU A CA    1 
ATOM   2181  C  C     . LEU A  1  310  ? 254.830 244.662 275.641 1.00 0.00 ? 310  LEU A C     1 
ATOM   2182  O  O     . LEU A  1  310  ? 254.050 245.524 275.243 1.00 0.00 ? 310  LEU A O     1 
ATOM   2183  C  CB    . LEU A  1  310  ? 254.306 243.333 277.670 1.00 0.00 ? 310  LEU A CB    1 
ATOM   2184  C  CG    . LEU A  1  310  ? 253.469 244.469 278.262 1.00 0.00 ? 310  LEU A CG    1 
ATOM   2185  C  CD1   . LEU A  1  310  ? 252.021 244.328 277.847 1.00 0.00 ? 310  LEU A CD1   1 
ATOM   2186  C  CD2   . LEU A  1  310  ? 253.587 244.522 279.768 1.00 0.00 ? 310  LEU A CD2   1 
ATOM   2187  N  N     . GLN A  1  311  ? 256.146 244.829 275.662 1.00 0.00 ? 311  GLN A N     1 
ATOM   2188  C  CA    . GLN A  1  311  ? 256.785 246.034 275.151 1.00 0.00 ? 311  GLN A CA    1 
ATOM   2189  C  C     . GLN A  1  311  ? 256.433 246.240 273.686 1.00 0.00 ? 311  GLN A C     1 
ATOM   2190  O  O     . GLN A  1  311  ? 256.172 247.360 273.256 1.00 0.00 ? 311  GLN A O     1 
ATOM   2191  C  CB    . GLN A  1  311  ? 258.303 245.949 275.322 1.00 0.00 ? 311  GLN A CB    1 
ATOM   2192  C  CG    . GLN A  1  311  ? 259.082 247.161 274.825 1.00 0.00 ? 311  GLN A CG    1 
ATOM   2193  C  CD    . GLN A  1  311  ? 258.731 248.439 275.568 1.00 0.00 ? 311  GLN A CD    1 
ATOM   2194  O  OE1   . GLN A  1  311  ? 259.323 248.754 276.599 1.00 0.00 ? 311  GLN A OE1   1 
ATOM   2195  N  NE2   . GLN A  1  311  ? 257.775 249.189 275.037 1.00 0.00 ? 311  GLN A NE2   1 
ATOM   2196  N  N     . PHE A  1  312  ? 256.412 245.155 272.923 1.00 0.00 ? 312  PHE A N     1 
ATOM   2197  C  CA    . PHE A  1  312  ? 256.047 245.230 271.514 1.00 0.00 ? 312  PHE A CA    1 
ATOM   2198  C  C     . PHE A  1  312  ? 254.583 245.597 271.288 1.00 0.00 ? 312  PHE A C     1 
ATOM   2199  O  O     . PHE A  1  312  ? 254.288 246.492 270.503 1.00 0.00 ? 312  PHE A O     1 
ATOM   2200  C  CB    . PHE A  1  312  ? 256.354 243.900 270.832 1.00 0.00 ? 312  PHE A CB    1 
ATOM   2201  C  CG    . PHE A  1  312  ? 256.076 243.885 269.356 1.00 0.00 ? 312  PHE A CG    1 
ATOM   2202  C  CD1   . PHE A  1  312  ? 257.037 244.298 268.451 1.00 0.00 ? 312  PHE A CD1   1 
ATOM   2203  C  CD2   . PHE A  1  312  ? 254.864 243.419 268.871 1.00 0.00 ? 312  PHE A CD2   1 
ATOM   2204  C  CE1   . PHE A  1  312  ? 256.786 244.277 267.091 1.00 0.00 ? 312  PHE A CE1   1 
ATOM   2205  C  CE2   . PHE A  1  312  ? 254.607 243.392 267.515 1.00 0.00 ? 312  PHE A CE2   1 
ATOM   2206  C  CZ    . PHE A  1  312  ? 255.570 243.821 266.623 1.00 0.00 ? 312  PHE A CZ    1 
ATOM   2207  N  N     . HIS A  1  313  ? 253.669 244.912 271.967 1.00 0.00 ? 313  HIS A N     1 
ATOM   2208  C  CA    . HIS A  1  313  ? 252.248 245.183 271.769 1.00 0.00 ? 313  HIS A CA    1 
ATOM   2209  C  C     . HIS A  1  313  ? 251.805 246.582 272.171 1.00 0.00 ? 313  HIS A C     1 
ATOM   2210  O  O     . HIS A  1  313  ? 251.055 247.215 271.434 1.00 0.00 ? 313  HIS A O     1 
ATOM   2211  C  CB    . HIS A  1  313  ? 251.397 244.153 272.503 1.00 0.00 ? 313  HIS A CB    1 
ATOM   2212  C  CG    . HIS A  1  313  ? 251.349 242.822 271.823 1.00 0.00 ? 313  HIS A CG    1 
ATOM   2213  N  ND1   . HIS A  1  313  ? 252.072 242.543 270.684 1.00 0.00 ? 313  HIS A ND1   1 
ATOM   2214  C  CD2   . HIS A  1  313  ? 250.665 241.692 272.120 1.00 0.00 ? 313  HIS A CD2   1 
ATOM   2215  C  CE1   . HIS A  1  313  ? 251.832 241.300 270.306 1.00 0.00 ? 313  HIS A CE1   1 
ATOM   2216  N  NE2   . HIS A  1  313  ? 250.985 240.760 271.163 1.00 0.00 ? 313  HIS A NE2   1 
ATOM   2217  N  N     . VAL A  1  314  ? 252.251 247.073 273.320 1.00 0.00 ? 314  VAL A N     1 
ATOM   2218  C  CA    . VAL A  1  314  ? 251.939 248.451 273.679 1.00 0.00 ? 314  VAL A CA    1 
ATOM   2219  C  C     . VAL A  1  314  ? 252.567 249.469 272.724 1.00 0.00 ? 314  VAL A C     1 
ATOM   2220  O  O     . VAL A  1  314  ? 251.938 250.474 272.402 1.00 0.00 ? 314  VAL A O     1 
ATOM   2221  C  CB    . VAL A  1  314  ? 252.339 248.772 275.133 1.00 0.00 ? 314  VAL A CB    1 
ATOM   2222  C  CG1   . VAL A  1  314  ? 251.668 247.805 276.087 1.00 0.00 ? 314  VAL A CG1   1 
ATOM   2223  C  CG2   . VAL A  1  314  ? 253.847 248.781 275.311 1.00 0.00 ? 314  VAL A CG2   1 
ATOM   2224  N  N     . ALA A  1  315  ? 253.797 249.236 272.282 1.00 0.00 ? 315  ALA A N     1 
ATOM   2225  C  CA    . ALA A  1  315  ? 254.410 250.151 271.328 1.00 0.00 ? 315  ALA A CA    1 
ATOM   2226  C  C     . ALA A  1  315  ? 253.658 250.159 270.000 1.00 0.00 ? 315  ALA A C     1 
ATOM   2227  O  O     . ALA A  1  315  ? 253.294 251.217 269.490 1.00 0.00 ? 315  ALA A O     1 
ATOM   2228  C  CB    . ALA A  1  315  ? 255.860 249.788 271.107 1.00 0.00 ? 315  ALA A CB    1 
ATOM   2229  N  N     . THR A  1  316  ? 253.414 248.972 269.457 1.00 0.00 ? 316  THR A N     1 
ATOM   2230  C  CA    . THR A  1  316  ? 252.704 248.823 268.189 1.00 0.00 ? 316  THR A CA    1 
ATOM   2231  C  C     . THR A  1  316  ? 251.275 249.359 268.241 1.00 0.00 ? 316  THR A C     1 
ATOM   2232  O  O     . THR A  1  316  ? 250.736 249.784 267.221 1.00 0.00 ? 316  THR A O     1 
ATOM   2233  C  CB    . THR A  1  316  ? 252.690 247.366 267.725 1.00 0.00 ? 316  THR A CB    1 
ATOM   2234  O  OG1   . THR A  1  316  ? 252.392 246.521 268.838 1.00 0.00 ? 316  THR A OG1   1 
ATOM   2235  C  CG2   . THR A  1  316  ? 254.057 246.981 267.185 1.00 0.00 ? 316  THR A CG2   1 
ATOM   2236  N  N     . MET A  1  317  ? 250.654 249.324 269.414 1.00 0.00 ? 317  MET A N     1 
ATOM   2237  C  CA    . MET A  1  317  ? 249.386 250.021 269.594 1.00 0.00 ? 317  MET A CA    1 
ATOM   2238  C  C     . MET A  1  317  ? 249.499 251.526 269.411 1.00 0.00 ? 317  MET A C     1 
ATOM   2239  O  O     . MET A  1  317  ? 248.666 252.137 268.746 1.00 0.00 ? 317  MET A O     1 
ATOM   2240  C  CB    . MET A  1  317  ? 248.825 249.759 270.981 1.00 0.00 ? 317  MET A CB    1 
ATOM   2241  C  CG    . MET A  1  317  ? 247.494 250.430 271.200 1.00 0.00 ? 317  MET A CG    1 
ATOM   2242  S  SD    . MET A  1  317  ? 246.917 250.304 272.895 1.00 0.00 ? 317  MET A SD    1 
ATOM   2243  C  CE    . MET A  1  317  ? 245.486 251.379 272.826 1.00 0.00 ? 317  MET A CE    1 
ATOM   2244  N  N     . VAL A  1  318  ? 250.522 252.123 270.009 1.00 0.00 ? 318  VAL A N     1 
ATOM   2245  C  CA    . VAL A  1  318  ? 250.745 253.556 269.877 1.00 0.00 ? 318  VAL A CA    1 
ATOM   2246  C  C     . VAL A  1  318  ? 251.336 253.883 268.503 1.00 0.00 ? 318  VAL A C     1 
ATOM   2247  O  O     . VAL A  1  318  ? 250.912 254.830 267.845 1.00 0.00 ? 318  VAL A O     1 
ATOM   2248  C  CB    . VAL A  1  318  ? 251.654 254.088 270.987 1.00 0.00 ? 318  VAL A CB    1 
ATOM   2249  C  CG1   . VAL A  1  318  ? 251.938 255.558 270.774 1.00 0.00 ? 318  VAL A CG1   1 
ATOM   2250  C  CG2   . VAL A  1  318  ? 250.993 253.880 272.328 1.00 0.00 ? 318  VAL A CG2   1 
ATOM   2251  N  N     . ASP A  1  319  ? 252.309 253.086 268.072 1.00 0.00 ? 319  ASP A N     1 
ATOM   2252  C  CA    . ASP A  1  319  ? 252.915 253.243 266.752 1.00 0.00 ? 319  ASP A CA    1 
ATOM   2253  C  C     . ASP A  1  319  ? 253.315 251.895 266.148 1.00 0.00 ? 319  ASP A C     1 
ATOM   2254  O  O     . ASP A  1  319  ? 254.143 251.178 266.702 1.00 0.00 ? 319  ASP A O     1 
ATOM   2255  C  CB    . ASP A  1  319  ? 254.139 254.160 266.848 1.00 0.00 ? 319  ASP A CB    1 
ATOM   2256  C  CG    . ASP A  1  319  ? 254.800 254.403 265.502 1.00 0.00 ? 319  ASP A CG    1 
ATOM   2257  O  OD1   . ASP A  1  319  ? 254.127 254.228 264.465 1.00 0.00 ? 319  ASP A OD1   1 
ATOM   2258  O  OD2   . ASP A  1  319  ? 255.997 254.770 265.483 1.00 0.00 ? 319  ASP A OD2   1 
ATOM   2259  N  N     . ASN A  1  320  ? 252.765 251.581 264.980 1.00 0.00 ? 320  ASN A N     1 
ATOM   2260  C  CA    . ASN A  1  320  ? 253.005 250.291 264.340 1.00 0.00 ? 320  ASN A CA    1 
ATOM   2261  C  C     . ASN A  1  320  ? 254.000 250.405 263.191 1.00 0.00 ? 320  ASN A C     1 
ATOM   2262  O  O     . ASN A  1  320  ? 254.251 249.440 262.468 1.00 0.00 ? 320  ASN A O     1 
ATOM   2263  C  CB    . ASN A  1  320  ? 251.682 249.705 263.836 1.00 0.00 ? 320  ASN A CB    1 
ATOM   2264  C  CG    . ASN A  1  320  ? 251.804 248.255 263.409 1.00 0.00 ? 320  ASN A CG    1 
ATOM   2265  O  OD1   . ASN A  1  320  ? 252.408 247.438 264.103 1.00 0.00 ? 320  ASN A OD1   1 
ATOM   2266  N  ND2   . ASN A  1  320  ? 251.229 247.930 262.258 1.00 0.00 ? 320  ASN A ND2   1 
ATOM   2267  N  N     . GLU A  1  321  ? 254.585 251.588 263.038 1.00 0.00 ? 321  GLU A N     1 
ATOM   2268  C  CA    . GLU A  1  321  ? 255.533 251.826 261.957 1.00 0.00 ? 321  GLU A CA    1 
ATOM   2269  C  C     . GLU A  1  321  ? 256.920 251.249 262.265 1.00 0.00 ? 321  GLU A C     1 
ATOM   2270  O  O     . GLU A  1  321  ? 257.504 250.586 261.407 1.00 0.00 ? 321  GLU A O     1 
ATOM   2271  C  CB    . GLU A  1  321  ? 255.616 253.328 261.657 1.00 0.00 ? 321  GLU A CB    1 
ATOM   2272  C  CG    . GLU A  1  321  ? 254.287 253.920 261.167 1.00 0.00 ? 321  GLU A CG    1 
ATOM   2273  C  CD    . GLU A  1  321  ? 254.370 255.407 260.841 1.00 0.00 ? 321  GLU A CD    1 
ATOM   2274  O  OE1   . GLU A  1  321  ? 255.451 256.005 261.042 1.00 0.00 ? 321  GLU A OE1   1 
ATOM   2275  O  OE2   . GLU A  1  321  ? 253.353 255.977 260.383 1.00 0.00 ? 321  GLU A OE2   1 
ATOM   2276  N  N     . LEU A  1  322  ? 257.420 251.496 263.481 1.00 0.00 ? 322  LEU A N     1 
ATOM   2277  C  CA    . LEU A  1  322  ? 258.650 250.886 264.029 1.00 0.00 ? 322  LEU A CA    1 
ATOM   2278  C  C     . LEU A  1  322  ? 259.669 250.355 263.024 1.00 0.00 ? 322  LEU A C     1 
ATOM   2279  O  O     . LEU A  1  322  ? 259.748 249.144 262.809 1.00 0.00 ? 322  LEU A O     1 
ATOM   2280  C  CB    . LEU A  1  322  ? 258.289 249.750 264.986 1.00 0.00 ? 322  LEU A CB    1 
ATOM   2281  C  CG    . LEU A  1  322  ? 257.495 250.162 266.220 1.00 0.00 ? 322  LEU A CG    1 
ATOM   2282  C  CD1   . LEU A  1  322  ? 257.314 248.974 267.149 1.00 0.00 ? 322  LEU A CD1   1 
ATOM   2283  C  CD2   . LEU A  1  322  ? 258.212 251.300 266.923 1.00 0.00 ? 322  LEU A CD2   1 
ATOM   2284  N  N     . PRO A  1  323  ? 260.440 251.263 262.403 1.00 0.00 ? 323  PRO A N     1 
ATOM   2285  C  CA    . PRO A  1  323  ? 261.406 251.000 261.327 1.00 0.00 ? 323  PRO A CA    1 
ATOM   2286  C  C     . PRO A  1  323  ? 262.210 249.711 261.499 1.00 0.00 ? 323  PRO A C     1 
ATOM   2287  O  O     . PRO A  1  323  ? 262.353 248.948 260.545 1.00 0.00 ? 323  PRO A O     1 
ATOM   2288  C  CB    . PRO A  1  323  ? 262.329 252.216 261.393 1.00 0.00 ? 323  PRO A CB    1 
ATOM   2289  C  CG    . PRO A  1  323  ? 261.451 253.308 261.876 1.00 0.00 ? 323  PRO A CG    1 
ATOM   2290  C  CD    . PRO A  1  323  ? 260.493 252.669 262.848 1.00 0.00 ? 323  PRO A CD    1 
ATOM   2291  N  N     . GLY A  1  324  ? 262.726 249.484 262.702 1.00 0.00 ? 324  GLY A N     1 
ATOM   2292  C  CA    . GLY A  1  324  ? 263.564 248.328 262.975 1.00 0.00 ? 324  GLY A CA    1 
ATOM   2293  C  C     . GLY A  1  324  ? 262.859 247.052 263.407 1.00 0.00 ? 324  GLY A C     1 
ATOM   2294  O  O     . GLY A  1  324  ? 263.506 246.124 263.896 1.00 0.00 ? 324  GLY A O     1 
ATOM   2295  N  N     . LEU A  1  325  ? 261.541 246.995 263.233 1.00 0.00 ? 325  LEU A N     1 
ATOM   2296  C  CA    . LEU A  1  325  ? 260.764 245.851 263.706 1.00 0.00 ? 325  LEU A CA    1 
ATOM   2297  C  C     . LEU A  1  325  ? 259.663 245.475 262.720 1.00 0.00 ? 325  LEU A C     1 
ATOM   2298  O  O     . LEU A  1  325  ? 259.228 246.313 261.931 1.00 0.00 ? 325  LEU A O     1 
ATOM   2299  C  CB    . LEU A  1  325  ? 260.156 246.160 265.076 1.00 0.00 ? 325  LEU A CB    1 
ATOM   2300  C  CG    . LEU A  1  325  ? 261.126 246.170 266.256 1.00 0.00 ? 325  LEU A CG    1 
ATOM   2301  C  CD1   . LEU A  1  325  ? 260.391 246.528 267.523 1.00 0.00 ? 325  LEU A CD1   1 
ATOM   2302  C  CD2   . LEU A  1  325  ? 261.811 244.822 266.400 1.00 0.00 ? 325  LEU A CD2   1 
ATOM   2303  N  N     . PRO A  1  326  ? 259.209 244.210 262.760 1.00 0.00 ? 326  PRO A N     1 
ATOM   2304  C  CA    . PRO A  1  326  ? 258.025 243.832 261.984 1.00 0.00 ? 326  PRO A CA    1 
ATOM   2305  C  C     . PRO A  1  326  ? 256.785 244.554 262.496 1.00 0.00 ? 326  PRO A C     1 
ATOM   2306  O  O     . PRO A  1  326  ? 256.806 245.068 263.614 1.00 0.00 ? 326  PRO A O     1 
ATOM   2307  C  CB    . PRO A  1  326  ? 257.926 242.321 262.201 1.00 0.00 ? 326  PRO A CB    1 
ATOM   2308  C  CG    . PRO A  1  326  ? 258.633 242.079 263.485 1.00 0.00 ? 326  PRO A CG    1 
ATOM   2309  C  CD    . PRO A  1  326  ? 259.752 243.073 263.521 1.00 0.00 ? 326  PRO A CD    1 
ATOM   2310  N  N     . ARG A  1  327  ? 255.719 244.575 261.704 1.00 0.00 ? 327  ARG A N     1 
ATOM   2311  C  CA    . ARG A  1  327  ? 254.540 245.365 262.034 1.00 0.00 ? 327  ARG A CA    1 
ATOM   2312  C  C     . ARG A  1  327  ? 253.380 244.464 262.455 1.00 0.00 ? 327  ARG A C     1 
ATOM   2313  O  O     . ARG A  1  327  ? 253.192 243.388 261.889 1.00 0.00 ? 327  ARG A O     1 
ATOM   2314  C  CB    . ARG A  1  327  ? 254.134 246.226 260.837 1.00 0.00 ? 327  ARG A CB    1 
ATOM   2315  C  CG    . ARG A  1  327  ? 255.216 247.183 260.363 1.00 0.00 ? 327  ARG A CG    1 
ATOM   2316  C  CD    . ARG A  1  327  ? 254.735 247.998 259.178 1.00 0.00 ? 327  ARG A CD    1 
ATOM   2317  N  NE    . ARG A  1  327  ? 255.672 249.057 258.818 1.00 0.00 ? 327  ARG A NE    1 
ATOM   2318  C  CZ    . ARG A  1  327  ? 255.436 249.979 257.889 1.00 0.00 ? 327  ARG A CZ    1 
ATOM   2319  N  NH1   . ARG A  1  327  ? 254.292 249.971 257.217 1.00 0.00 ? 327  ARG A NH1   1 
ATOM   2320  N  NH2   . ARG A  1  327  ? 256.339 250.918 257.636 1.00 0.00 ? 327  ARG A NH2   1 
ATOM   2321  N  N     . ALA A  1  328  ? 252.615 244.900 263.457 1.00 0.00 ? 328  ALA A N     1 
ATOM   2322  C  CA    . ALA A  1  328  ? 251.414 244.179 263.871 1.00 0.00 ? 328  ALA A CA    1 
ATOM   2323  C  C     . ALA A  1  328  ? 250.451 244.146 262.705 1.00 0.00 ? 328  ALA A C     1 
ATOM   2324  O  O     . ALA A  1  328  ? 250.218 245.165 262.061 1.00 0.00 ? 328  ALA A O     1 
ATOM   2325  C  CB    . ALA A  1  328  ? 250.774 244.831 265.084 1.00 0.00 ? 328  ALA A CB    1 
ATOM   2326  N  N     . MET A  1  329  ? 249.885 242.980 262.428 1.00 0.00 ? 329  MET A N     1 
ATOM   2327  C  CA    . MET A  1  329  ? 249.057 242.836 261.242 1.00 0.00 ? 329  MET A CA    1 
ATOM   2328  C  C     . MET A  1  329  ? 247.666 242.338 261.589 1.00 0.00 ? 329  MET A C     1 
ATOM   2329  O  O     . MET A  1  329  ? 247.438 241.820 262.677 1.00 0.00 ? 329  MET A O     1 
ATOM   2330  C  CB    . MET A  1  329  ? 249.732 241.878 260.255 1.00 0.00 ? 329  MET A CB    1 
ATOM   2331  C  CG    . MET A  1  329  ? 251.058 242.398 259.700 1.00 0.00 ? 329  MET A CG    1 
ATOM   2332  S  SD    . MET A  1  329  ? 251.813 241.360 258.426 1.00 0.00 ? 329  MET A SD    1 
ATOM   2333  C  CE    . MET A  1  329  ? 253.230 242.359 257.962 1.00 0.00 ? 329  MET A CE    1 
ATOM   2334  N  N     . GLN A  1  330  ? 246.741 242.504 260.652 1.00 0.00 ? 330  GLN A N     1 
ATOM   2335  C  CA    . GLN A  1  330  ? 245.404 241.944 260.780 1.00 0.00 ? 330  GLN A CA    1 
ATOM   2336  C  C     . GLN A  1  330  ? 245.425 240.568 260.112 1.00 0.00 ? 330  GLN A C     1 
ATOM   2337  O  O     . GLN A  1  330  ? 246.273 240.309 259.256 1.00 0.00 ? 330  GLN A O     1 
ATOM   2338  C  CB    . GLN A  1  330  ? 244.364 242.873 260.140 1.00 0.00 ? 330  GLN A CB    1 
ATOM   2339  C  CG    . GLN A  1  330  ? 242.918 242.395 260.215 1.00 0.00 ? 330  GLN A CG    1 
ATOM   2340  C  CD    . GLN A  1  330  ? 242.366 242.400 261.626 1.00 0.00 ? 330  GLN A CD    1 
ATOM   2341  O  OE1   . GLN A  1  330  ? 242.092 241.346 262.199 1.00 0.00 ? 330  GLN A OE1   1 
ATOM   2342  N  NE2   . GLN A  1  330  ? 242.188 243.589 262.190 1.00 0.00 ? 330  GLN A NE2   1 
ATOM   2343  N  N     . LYS A  1  331  ? 244.521 239.681 260.521 1.00 0.00 ? 331  LYS A N     1 
ATOM   2344  C  CA    . LYS A  1  331  ? 244.509 238.301 260.034 1.00 0.00 ? 331  LYS A CA    1 
ATOM   2345  C  C     . LYS A  1  331  ? 244.406 238.207 258.515 1.00 0.00 ? 331  LYS A C     1 
ATOM   2346  O  O     . LYS A  1  331  ? 244.832 237.221 257.916 1.00 0.00 ? 331  LYS A O     1 
ATOM   2347  C  CB    . LYS A  1  331  ? 243.365 237.524 260.684 1.00 0.00 ? 331  LYS A CB    1 
ATOM   2348  C  CG    . LYS A  1  331  ? 243.477 237.473 262.194 1.00 0.00 ? 331  LYS A CG    1 
ATOM   2349  C  CD    . LYS A  1  331  ? 242.497 236.498 262.810 1.00 0.00 ? 331  LYS A CD    1 
ATOM   2350  C  CE    . LYS A  1  331  ? 242.716 236.416 264.310 1.00 0.00 ? 331  LYS A CE    1 
ATOM   2351  N  NZ    . LYS A  1  331  ? 241.944 235.314 264.930 1.00 0.00 ? 331  LYS A NZ    1 
ATOM   2352  N  N     . SER A  1  332  ? 243.840 239.240 257.899 1.00 0.00 ? 332  SER A N     1 
ATOM   2353  C  CA    . SER A  1  332  ? 243.708 239.301 256.448 1.00 0.00 ? 332  SER A CA    1 
ATOM   2354  C  C     . SER A  1  332  ? 245.043 239.584 255.760 1.00 0.00 ? 332  SER A C     1 
ATOM   2355  O  O     . SER A  1  332  ? 245.211 239.287 254.576 1.00 0.00 ? 332  SER A O     1 
ATOM   2356  C  CB    . SER A  1  332  ? 242.688 240.370 256.056 1.00 0.00 ? 332  SER A CB    1 
ATOM   2357  O  OG    . SER A  1  332  ? 243.008 241.612 256.657 1.00 0.00 ? 332  SER A OG    1 
ATOM   2358  N  N     . GLY A  1  333  ? 245.987 240.161 256.498 1.00 0.00 ? 333  GLY A N     1 
ATOM   2359  C  CA    . GLY A  1  333  ? 247.305 240.454 255.959 1.00 0.00 ? 333  GLY A CA    1 
ATOM   2360  C  C     . GLY A  1  333  ? 247.688 241.925 255.959 1.00 0.00 ? 333  GLY A C     1 
ATOM   2361  O  O     . GLY A  1  333  ? 248.875 242.262 255.961 1.00 0.00 ? 333  GLY A O     1 
ATOM   2362  N  N     . ARG A  1  334  ? 246.685 242.801 255.949 1.00 0.00 ? 334  ARG A N     1 
ATOM   2363  C  CA    . ARG A  1  334  ? 246.911 244.247 255.930 1.00 0.00 ? 334  ARG A CA    1 
ATOM   2364  C  C     . ARG A  1  334  ? 247.606 244.704 257.213 1.00 0.00 ? 334  ARG A C     1 
ATOM   2365  O  O     . ARG A  1  334  ? 247.508 244.042 258.247 1.00 0.00 ? 334  ARG A O     1 
ATOM   2366  C  CB    . ARG A  1  334  ? 245.587 244.995 255.754 1.00 0.00 ? 334  ARG A CB    1 
ATOM   2367  C  CG    . ARG A  1  334  ? 244.703 244.947 256.985 1.00 0.00 ? 334  ARG A CG    1 
ATOM   2368  C  CD    . ARG A  1  334  ? 243.409 245.715 256.795 1.00 0.00 ? 334  ARG A CD    1 
ATOM   2369  N  NE    . ARG A  1  334  ? 242.425 245.338 257.808 1.00 0.00 ? 334  ARG A NE    1 
ATOM   2370  C  CZ    . ARG A  1  334  ? 242.302 245.930 258.991 1.00 0.00 ? 334  ARG A CZ    1 
ATOM   2371  N  NH1   . ARG A  1  334  ? 243.095 246.943 259.310 1.00 0.00 ? 334  ARG A NH1   1 
ATOM   2372  N  NH2   . ARG A  1  334  ? 241.393 245.505 259.859 1.00 0.00 ? 334  ARG A NH2   1 
ATOM   2373  N  N     . PRO A  1  335  ? 248.320 245.838 257.155 1.00 0.00 ? 335  PRO A N     1 
ATOM   2374  C  CA    . PRO A  1  335  ? 248.927 246.309 258.400 1.00 0.00 ? 335  PRO A CA    1 
ATOM   2375  C  C     . PRO A  1  335  ? 247.877 246.855 259.359 1.00 0.00 ? 335  PRO A C     1 
ATOM   2376  O  O     . PRO A  1  335  ? 246.888 247.419 258.902 1.00 0.00 ? 335  PRO A O     1 
ATOM   2377  C  CB    . PRO A  1  335  ? 249.875 247.413 257.926 1.00 0.00 ? 335  PRO A CB    1 
ATOM   2378  C  CG    . PRO A  1  335  ? 249.238 247.931 256.682 1.00 0.00 ? 335  PRO A CG    1 
ATOM   2379  C  CD    . PRO A  1  335  ? 248.608 246.735 256.021 1.00 0.00 ? 335  PRO A CD    1 
ATOM   2380  N  N     . LEU A  1  336  ? 248.080 246.669 260.659 1.00 0.00 ? 336  LEU A N     1 
ATOM   2381  C  CA    . LEU A  1  336  ? 247.165 247.201 261.663 1.00 0.00 ? 336  LEU A CA    1 
ATOM   2382  C  C     . LEU A  1  336  ? 247.215 248.720 261.673 1.00 0.00 ? 336  LEU A C     1 
ATOM   2383  O  O     . LEU A  1  336  ? 248.291 249.304 261.566 1.00 0.00 ? 336  LEU A O     1 
ATOM   2384  C  CB    . LEU A  1  336  ? 247.504 246.659 263.048 1.00 0.00 ? 336  LEU A CB    1 
ATOM   2385  C  CG    . LEU A  1  336  ? 246.411 246.785 264.105 1.00 0.00 ? 336  LEU A CG    1 
ATOM   2386  C  CD1   . LEU A  1  336  ? 245.375 245.699 263.927 1.00 0.00 ? 336  LEU A CD1   1 
ATOM   2387  C  CD2   . LEU A  1  336  ? 247.024 246.716 265.485 1.00 0.00 ? 336  LEU A CD2   1 
ATOM   2388  N  N     . LYS A  1  337  ? 246.056 249.358 261.815 1.00 0.00 ? 337  LYS A N     1 
ATOM   2389  C  CA    . LYS A  1  337  ? 245.973 250.818 261.758 1.00 0.00 ? 337  LYS A CA    1 
ATOM   2390  C  C     . LYS A  1  337  ? 246.209 251.483 263.109 1.00 0.00 ? 337  LYS A C     1 
ATOM   2391  O  O     . LYS A  1  337  ? 245.262 251.894 263.783 1.00 0.00 ? 337  LYS A O     1 
ATOM   2392  C  CB    . LYS A  1  337  ? 244.622 251.260 261.199 1.00 0.00 ? 337  LYS A CB    1 
ATOM   2393  C  CG    . LYS A  1  337  ? 244.622 252.699 260.720 1.00 0.00 ? 337  LYS A CG    1 
ATOM   2394  C  CD    . LYS A  1  337  ? 243.314 253.078 260.056 1.00 0.00 ? 337  LYS A CD    1 
ATOM   2395  C  CE    . LYS A  1  337  ? 243.396 254.474 259.463 1.00 0.00 ? 337  LYS A CE    1 
ATOM   2396  N  NZ    . LYS A  1  337  ? 242.186 254.810 258.667 1.00 0.00 ? 337  LYS A NZ    1 
ATOM   2397  N  N     . SER A  1  338  ? 247.481 251.588 263.486 1.00 0.00 ? 338  SER A N     1 
ATOM   2398  C  CA    . SER A  1  338  ? 247.899 252.146 264.770 1.00 0.00 ? 338  SER A CA    1 
ATOM   2399  C  C     . SER A  1  338  ? 247.294 253.509 265.078 1.00 0.00 ? 338  SER A C     1 
ATOM   2400  O  O     . SER A  1  338  ? 246.785 254.199 264.195 1.00 0.00 ? 338  SER A O     1 
ATOM   2401  C  CB    . SER A  1  338  ? 249.421 252.261 264.818 1.00 0.00 ? 338  SER A CB    1 
ATOM   2402  O  OG    . SER A  1  338  ? 249.875 253.294 263.956 1.00 0.00 ? 338  SER A OG    1 
ATOM   2403  N  N     . LEU A  1  339  ? 247.373 253.890 266.347 1.00 0.00 ? 339  LEU A N     1 
ATOM   2404  C  CA    . LEU A  1  339  ? 246.831 255.157 266.785 1.00 0.00 ? 339  LEU A CA    1 
ATOM   2405  C  C     . LEU A  1  339  ? 247.611 256.325 266.169 1.00 0.00 ? 339  LEU A C     1 
ATOM   2406  O  O     . LEU A  1  339  ? 247.011 257.286 265.699 1.00 0.00 ? 339  LEU A O     1 
ATOM   2407  C  CB    . LEU A  1  339  ? 246.857 255.231 268.311 1.00 0.00 ? 339  LEU A CB    1 
ATOM   2408  C  CG    . LEU A  1  339  ? 246.214 256.449 268.959 1.00 0.00 ? 339  LEU A CG    1 
ATOM   2409  C  CD1   . LEU A  1  339  ? 244.749 256.423 268.613 1.00 0.00 ? 339  LEU A CD1   1 
ATOM   2410  C  CD2   . LEU A  1  339  ? 246.398 256.457 270.463 1.00 0.00 ? 339  LEU A CD2   1 
ATOM   2411  N  N     . LYS A  1  340  ? 248.936 256.219 266.110 1.00 0.00 ? 340  LYS A N     1 
ATOM   2412  C  CA    . LYS A  1  340  ? 249.762 257.246 265.456 1.00 0.00 ? 340  LYS A CA    1 
ATOM   2413  C  C     . LYS A  1  340  ? 249.415 257.447 263.977 1.00 0.00 ? 340  LYS A C     1 
ATOM   2414  O  O     . LYS A  1  340  ? 249.235 258.575 263.518 1.00 0.00 ? 340  LYS A O     1 
ATOM   2415  C  CB    . LYS A  1  340  ? 251.257 256.955 265.578 1.00 0.00 ? 340  LYS A CB    1 
ATOM   2416  C  CG    . LYS A  1  340  ? 252.085 258.208 265.283 1.00 0.00 ? 340  LYS A CG    1 
ATOM   2417  C  CD    . LYS A  1  340  ? 253.585 258.007 265.327 1.00 0.00 ? 340  LYS A CD    1 
ATOM   2418  C  CE    . LYS A  1  340  ? 254.103 257.479 264.008 1.00 0.00 ? 340  LYS A CE    1 
ATOM   2419  N  NZ    . LYS A  1  340  ? 255.568 257.216 264.056 1.00 0.00 ? 340  LYS A NZ    1 
ATOM   2420  N  N     . GLN A  1  341  ? 249.312 256.343 263.248 1.00 0.00 ? 341  GLN A N     1 
ATOM   2421  C  CA    . GLN A  1  341  ? 248.956 256.354 261.830 1.00 0.00 ? 341  GLN A CA    1 
ATOM   2422  C  C     . GLN A  1  341  ? 247.604 257.038 261.596 1.00 0.00 ? 341  GLN A C     1 
ATOM   2423  O  O     . GLN A  1  341  ? 247.458 257.798 260.636 1.00 0.00 ? 341  GLN A O     1 
ATOM   2424  C  CB    . GLN A  1  341  ? 248.947 254.930 261.263 1.00 0.00 ? 341  GLN A CB    1 
ATOM   2425  C  CG    . GLN A  1  341  ? 248.520 254.839 259.797 1.00 0.00 ? 341  GLN A CG    1 
ATOM   2426  C  CD    . GLN A  1  341  ? 249.610 255.288 258.825 1.00 0.00 ? 341  GLN A CD    1 
ATOM   2427  O  OE1   . GLN A  1  341  ? 250.792 254.978 259.007 1.00 0.00 ? 341  GLN A OE1   1 
ATOM   2428  N  NE2   . GLN A  1  341  ? 249.213 256.019 257.784 1.00 0.00 ? 341  GLN A NE2   1 
ATOM   2429  N  N     . ARG A  1  342  ? 246.610 256.760 262.435 1.00 0.00 ? 342  ARG A N     1 
ATOM   2430  C  CA    . ARG A  1  342  ? 245.302 257.377 262.247 1.00 0.00 ? 342  ARG A CA    1 
ATOM   2431  C  C     . ARG A  1  342  ? 245.427 258.881 262.369 1.00 0.00 ? 342  ARG A C     1 
ATOM   2432  O  O     . ARG A  1  342  ? 244.736 259.630 261.682 1.00 0.00 ? 342  ARG A O     1 
ATOM   2433  C  CB    . ARG A  1  342  ? 244.294 256.898 263.281 1.00 0.00 ? 342  ARG A CB    1 
ATOM   2434  C  CG    . ARG A  1  342  ? 243.839 255.483 263.132 1.00 0.00 ? 342  ARG A CG    1 
ATOM   2435  C  CD    . ARG A  1  342  ? 242.965 255.135 264.302 1.00 0.00 ? 342  ARG A CD    1 
ATOM   2436  N  NE    . ARG A  1  342  ? 242.587 253.736 264.288 1.00 0.00 ? 342  ARG A NE    1 
ATOM   2437  C  CZ    . ARG A  1  342  ? 241.421 253.294 264.730 1.00 0.00 ? 342  ARG A CZ    1 
ATOM   2438  N  NH1   . ARG A  1  342  ? 240.522 254.158 265.182 1.00 0.00 ? 342  ARG A NH1   1 
ATOM   2439  N  NH2   . ARG A  1  342  ? 241.177 251.995 264.772 1.00 0.00 ? 342  ARG A NH2   1 
ATOM   2440  N  N     . LEU A  1  343  ? 246.308 259.309 263.261 1.00 0.00 ? 343  LEU A N     1 
ATOM   2441  C  CA    . LEU A  1  343  ? 246.583 260.722 263.478 1.00 0.00 ? 343  LEU A CA    1 
ATOM   2442  C  C     . LEU A  1  343  ? 247.433 261.408 262.373 1.00 0.00 ? 343  LEU A C     1 
ATOM   2443  O  O     . LEU A  1  343  ? 247.320 262.623 262.169 1.00 0.00 ? 343  LEU A O     1 
ATOM   2444  C  CB    . LEU A  1  343  ? 247.245 260.870 264.846 1.00 0.00 ? 343  LEU A CB    1 
ATOM   2445  C  CG    . LEU A  1  343  ? 246.503 261.770 265.826 1.00 0.00 ? 343  LEU A CG    1 
ATOM   2446  C  CD1   . LEU A  1  343  ? 246.886 261.422 267.228 1.00 0.00 ? 343  LEU A CD1   1 
ATOM   2447  C  CD2   . LEU A  1  343  ? 246.886 263.200 265.550 1.00 0.00 ? 343  LEU A CD2   1 
ATOM   2448  N  N     . LYS A  1  344  ? 248.234 260.621 261.647 1.00 0.00 ? 344  LYS A N     1 
ATOM   2449  C  CA    . LYS A  1  344  ? 249.362 261.099 260.817 1.00 0.00 ? 344  LYS A CA    1 
ATOM   2450  C  C     . LYS A  1  344  ? 249.109 262.296 259.888 1.00 0.00 ? 344  LYS A C     1 
ATOM   2451  O  O     . LYS A  1  344  ? 249.230 263.444 260.308 1.00 0.00 ? 344  LYS A O     1 
ATOM   2452  C  CB    . LYS A  1  344  ? 249.874 259.940 259.957 1.00 0.00 ? 344  LYS A CB    1 
ATOM   2453  C  CG    . LYS A  1  344  ? 251.185 260.202 259.230 1.00 0.00 ? 344  LYS A CG    1 
ATOM   2454  C  CD    . LYS A  1  344  ? 251.618 258.968 258.461 1.00 0.00 ? 344  LYS A CD    1 
ATOM   2455  C  CE    . LYS A  1  344  ? 252.999 259.138 257.861 1.00 0.00 ? 344  LYS A CE    1 
ATOM   2456  N  NZ    . LYS A  1  344  ? 253.520 257.844 257.331 1.00 0.00 ? 344  LYS A NZ    1 
ATOM   2457  N  N     . GLY A  1  345  ? 248.790 262.025 258.625 1.00 0.00 ? 345  GLY A N     1 
ATOM   2458  C  CA    . GLY A  1  345  ? 248.794 263.058 257.600 1.00 0.00 ? 345  GLY A CA    1 
ATOM   2459  C  C     . GLY A  1  345  ? 247.465 263.203 256.885 1.00 0.00 ? 345  GLY A C     1 
ATOM   2460  O  O     . GLY A  1  345  ? 246.453 263.491 257.517 1.00 0.00 ? 345  GLY A O     1 
ATOM   2461  N  N     . LYS A  1  346  ? 247.465 263.027 255.565 1.00 0.00 ? 346  LYS A N     1 
ATOM   2462  C  CA    . LYS A  1  346  ? 246.220 262.989 254.801 1.00 0.00 ? 346  LYS A CA    1 
ATOM   2463  C  C     . LYS A  1  346  ? 245.263 261.941 255.347 1.00 0.00 ? 346  LYS A C     1 
ATOM   2464  O  O     . LYS A  1  346  ? 245.674 260.817 255.642 1.00 0.00 ? 346  LYS A O     1 
ATOM   2465  C  CB    . LYS A  1  346  ? 246.483 262.707 253.329 1.00 0.00 ? 346  LYS A CB    1 
ATOM   2466  C  CG    . LYS A  1  346  ? 245.223 262.809 252.484 1.00 0.00 ? 346  LYS A CG    1 
ATOM   2467  C  CD    . LYS A  1  346  ? 245.497 262.444 251.043 1.00 0.00 ? 346  LYS A CD    1 
ATOM   2468  C  CE    . LYS A  1  346  ? 246.519 263.380 250.426 1.00 0.00 ? 346  LYS A CE    1 
ATOM   2469  N  NZ    . LYS A  1  346  ? 246.617 263.188 248.954 1.00 0.00 ? 346  LYS A NZ    1 
ATOM   2470  N  N     . GLU A  1  347  ? 243.991 262.312 255.461 1.00 0.00 ? 347  GLU A N     1 
ATOM   2471  C  CA    . GLU A  1  347  ? 242.998 261.510 256.173 1.00 0.00 ? 347  GLU A CA    1 
ATOM   2472  C  C     . GLU A  1  347  ? 243.450 261.143 257.581 1.00 0.00 ? 347  GLU A C     1 
ATOM   2473  O  O     . GLU A  1  347  ? 243.111 260.074 258.087 1.00 0.00 ? 347  GLU A O     1 
ATOM   2474  C  CB    . GLU A  1  347  ? 242.687 260.230 255.394 1.00 0.00 ? 347  GLU A CB    1 
ATOM   2475  C  CG    . GLU A  1  347  ? 241.995 260.459 254.072 1.00 0.00 ? 347  GLU A CG    1 
ATOM   2476  C  CD    . GLU A  1  347  ? 240.730 261.281 254.221 1.00 0.00 ? 347  GLU A CD    1 
ATOM   2477  O  OE1   . GLU A  1  347  ? 239.965 261.032 255.182 1.00 0.00 ? 347  GLU A OE1   1 
ATOM   2478  O  OE2   . GLU A  1  347  ? 240.502 262.178 253.374 1.00 0.00 ? 347  GLU A OE2   1 
ATOM   2479  N  N     . GLY A  1  348  ? 244.210 262.033 258.212 1.00 0.00 ? 348  GLY A N     1 
ATOM   2480  C  CA    . GLY A  1  348  ? 244.565 261.890 259.614 1.00 0.00 ? 348  GLY A CA    1 
ATOM   2481  C  C     . GLY A  1  348  ? 243.803 262.890 260.460 1.00 0.00 ? 348  GLY A C     1 
ATOM   2482  O  O     . GLY A  1  348  ? 243.259 263.856 259.925 1.00 0.00 ? 348  GLY A O     1 
ATOM   2483  N  N     . ARG A  1  349  ? 243.766 262.670 261.772 1.00 0.00 ? 349  ARG A N     1 
ATOM   2484  C  CA    . ARG A  1  349  ? 242.884 263.445 262.645 1.00 0.00 ? 349  ARG A CA    1 
ATOM   2485  C  C     . ARG A  1  349  ? 243.119 264.948 262.559 1.00 0.00 ? 349  ARG A C     1 
ATOM   2486  O  O     . ARG A  1  349  ? 242.180 265.731 262.669 1.00 0.00 ? 349  ARG A O     1 
ATOM   2487  C  CB    . ARG A  1  349  ? 243.027 263.022 264.096 1.00 0.00 ? 349  ARG A CB    1 
ATOM   2488  C  CG    . ARG A  1  349  ? 242.026 263.711 264.989 1.00 0.00 ? 349  ARG A CG    1 
ATOM   2489  C  CD    . ARG A  1  349  ? 240.666 263.213 264.632 1.00 0.00 ? 349  ARG A CD    1 
ATOM   2490  N  NE    . ARG A  1  349  ? 240.615 261.790 264.917 1.00 0.00 ? 349  ARG A NE    1 
ATOM   2491  C  CZ    . ARG A  1  349  ? 239.670 260.968 264.487 1.00 0.00 ? 349  ARG A CZ    1 
ATOM   2492  N  NH1   . ARG A  1  349  ? 238.677 261.434 263.742 1.00 0.00 ? 349  ARG A NH1   1 
ATOM   2493  N  NH2   . ARG A  1  349  ? 239.721 259.680 264.812 1.00 0.00 ? 349  ARG A NH2   1 
ATOM   2494  N  N     . VAL A  1  350  ? 244.364 265.375 262.407 1.00 0.00 ? 350  VAL A N     1 
ATOM   2495  C  CA    . VAL A  1  350  ? 244.584 266.805 262.298 1.00 0.00 ? 350  VAL A CA    1 
ATOM   2496  C  C     . VAL A  1  350  ? 244.254 267.286 260.894 1.00 0.00 ? 350  VAL A C     1 
ATOM   2497  O  O     . VAL A  1  350  ? 243.237 267.928 260.679 1.00 0.00 ? 350  VAL A O     1 
ATOM   2498  C  CB    . VAL A  1  350  ? 246.023 267.196 262.656 1.00 0.00 ? 350  VAL A CB    1 
ATOM   2499  C  CG1   . VAL A  1  350  ? 246.242 268.657 262.374 1.00 0.00 ? 350  VAL A CG1   1 
ATOM   2500  C  CG2   . VAL A  1  350  ? 246.284 266.935 264.115 1.00 0.00 ? 350  VAL A CG2   1 
ATOM   2501  N  N     . ARG A  1  351  ? 245.097 266.926 259.936 1.00 0.00 ? 351  ARG A N     1 
ATOM   2502  C  CA    . ARG A  1  351  ? 245.080 267.522 258.603 1.00 0.00 ? 351  ARG A CA    1 
ATOM   2503  C  C     . ARG A  1  351  ? 243.852 267.122 257.784 1.00 0.00 ? 351  ARG A C     1 
ATOM   2504  O  O     . ARG A  1  351  ? 243.164 267.973 257.224 1.00 0.00 ? 351  ARG A O     1 
ATOM   2505  C  CB    . ARG A  1  351  ? 246.359 267.139 257.857 1.00 0.00 ? 351  ARG A CB    1 
ATOM   2506  C  CG    . ARG A  1  351  ? 246.450 267.659 256.448 1.00 0.00 ? 351  ARG A CG    1 
ATOM   2507  C  CD    . ARG A  1  351  ? 247.665 267.083 255.730 1.00 0.00 ? 351  ARG A CD    1 
ATOM   2508  N  NE    . ARG A  1  351  ? 247.765 267.560 254.347 1.00 0.00 ? 351  ARG A NE    1 
ATOM   2509  C  CZ    . ARG A  1  351  ? 247.195 266.977 253.290 1.00 0.00 ? 351  ARG A CZ    1 
ATOM   2510  N  NH1   . ARG A  1  351  ? 246.476 265.871 253.443 1.00 0.00 ? 351  ARG A NH1   1 
ATOM   2511  N  NH2   . ARG A  1  351  ? 247.331 267.511 252.075 1.00 0.00 ? 351  ARG A NH2   1 
ATOM   2512  N  N     . GLY A  1  352  ? 243.610 265.821 257.677 1.00 0.00 ? 352  GLY A N     1 
ATOM   2513  C  CA    . GLY A  1  352  ? 242.502 265.311 256.891 1.00 0.00 ? 352  GLY A CA    1 
ATOM   2514  C  C     . GLY A  1  352  ? 241.137 265.300 257.567 1.00 0.00 ? 352  GLY A C     1 
ATOM   2515  O  O     . GLY A  1  352  ? 240.226 264.621 257.091 1.00 0.00 ? 352  GLY A O     1 
ATOM   2516  N  N     . ASN A  1  353  ? 240.967 266.023 258.670 1.00 0.00 ? 353  ASN A N     1 
ATOM   2517  C  CA    . ASN A  1  353  ? 239.715 265.900 259.406 1.00 0.00 ? 353  ASN A CA    1 
ATOM   2518  C  C     . ASN A  1  353  ? 239.379 267.084 260.306 1.00 0.00 ? 353  ASN A C     1 
ATOM   2519  O  O     . ASN A  1  353  ? 238.303 267.642 260.195 1.00 0.00 ? 353  ASN A O     1 
ATOM   2520  C  CB    . ASN A  1  353  ? 239.746 264.624 260.232 1.00 0.00 ? 353  ASN A CB    1 
ATOM   2521  C  CG    . ASN A  1  353  ? 238.394 264.230 260.742 1.00 0.00 ? 353  ASN A CG    1 
ATOM   2522  O  OD1   . ASN A  1  353  ? 237.582 265.075 261.090 1.00 0.00 ? 353  ASN A OD1   1 
ATOM   2523  N  ND2   . ASN A  1  353  ? 238.144 262.932 260.804 1.00 0.00 ? 353  ASN A ND2   1 
ATOM   2524  N  N     . LEU A  1  354  ? 240.277 267.472 261.201 1.00 0.00 ? 354  LEU A N     1 
ATOM   2525  C  CA    . LEU A  1  354  ? 240.026 268.636 262.055 1.00 0.00 ? 354  LEU A CA    1 
ATOM   2526  C  C     . LEU A  1  354  ? 240.217 269.945 261.268 1.00 0.00 ? 354  LEU A C     1 
ATOM   2527  O  O     . LEU A  1  354  ? 239.352 270.814 261.263 1.00 0.00 ? 354  LEU A O     1 
ATOM   2528  C  CB    . LEU A  1  354  ? 240.942 268.607 263.278 1.00 0.00 ? 354  LEU A CB    1 
ATOM   2529  C  CG    . LEU A  1  354  ? 240.875 269.788 264.234 1.00 0.00 ? 354  LEU A CG    1 
ATOM   2530  C  CD1   . LEU A  1  354  ? 239.468 269.981 264.676 1.00 0.00 ? 354  LEU A CD1   1 
ATOM   2531  C  CD2   . LEU A  1  354  ? 241.728 269.520 265.425 1.00 0.00 ? 354  LEU A CD2   1 
ATOM   2532  N  N     . MET A  1  355  ? 241.355 270.066 260.595 1.00 0.00 ? 355  MET A N     1 
ATOM   2533  C  CA    . MET A  1  355  ? 241.684 271.208 259.748 1.00 0.00 ? 355  MET A CA    1 
ATOM   2534  C  C     . MET A  1  355  ? 240.833 271.307 258.472 1.00 0.00 ? 355  MET A C     1 
ATOM   2535  O  O     . MET A  1  355  ? 240.677 272.381 257.915 1.00 0.00 ? 355  MET A O     1 
ATOM   2536  C  CB    . MET A  1  355  ? 243.161 271.116 259.361 1.00 0.00 ? 355  MET A CB    1 
ATOM   2537  C  CG    . MET A  1  355  ? 243.800 272.340 258.705 1.00 0.00 ? 355  MET A CG    1 
ATOM   2538  S  SD    . MET A  1  355  ? 244.108 273.747 259.806 1.00 0.00 ? 355  MET A SD    1 
ATOM   2539  C  CE    . MET A  1  355  ? 244.979 272.986 261.186 1.00 0.00 ? 355  MET A CE    1 
ATOM   2540  N  N     . GLY A  1  356  ? 240.327 270.180 257.984 1.00 0.00 ? 356  GLY A N     1 
ATOM   2541  C  CA    . GLY A  1  356  ? 239.437 270.174 256.830 1.00 0.00 ? 356  GLY A CA    1 
ATOM   2542  C  C     . GLY A  1  356  ? 238.365 269.091 256.844 1.00 0.00 ? 356  GLY A C     1 
ATOM   2543  O  O     . GLY A  1  356  ? 238.578 267.990 256.346 1.00 0.00 ? 356  GLY A O     1 
ATOM   2544  N  N     . LYS A  1  357  ? 237.198 269.412 257.391 1.00 0.00 ? 357  LYS A N     1 
ATOM   2545  C  CA    . LYS A  1  357  ? 236.098 268.458 257.513 1.00 0.00 ? 357  LYS A CA    1 
ATOM   2546  C  C     . LYS A  1  357  ? 235.058 268.598 256.418 1.00 0.00 ? 357  LYS A C     1 
ATOM   2547  O  O     . LYS A  1  357  ? 234.915 269.678 255.865 1.00 0.00 ? 357  LYS A O     1 
ATOM   2548  C  CB    . LYS A  1  357  ? 235.429 268.659 258.854 1.00 0.00 ? 357  LYS A CB    1 
ATOM   2549  C  CG    . LYS A  1  357  ? 235.116 270.111 259.142 1.00 0.00 ? 357  LYS A CG    1 
ATOM   2550  C  CD    . LYS A  1  357  ? 234.730 270.289 260.601 1.00 0.00 ? 357  LYS A CD    1 
ATOM   2551  C  CE    . LYS A  1  357  ? 235.872 269.939 261.550 1.00 0.00 ? 357  LYS A CE    1 
ATOM   2552  N  NZ    . LYS A  1  357  ? 235.456 270.071 262.957 1.00 0.00 ? 357  LYS A NZ    1 
ATOM   2553  N  N     . ARG A  1  358  ? 234.288 267.552 256.120 1.00 0.00 ? 358  ARG A N     1 
ATOM   2554  C  CA    . ARG A  1  358  ? 233.174 267.772 255.194 1.00 0.00 ? 358  ARG A CA    1 
ATOM   2555  C  C     . ARG A  1  358  ? 231.991 268.425 255.881 1.00 0.00 ? 358  ARG A C     1 
ATOM   2556  O  O     . ARG A  1  358  ? 231.667 268.161 257.027 1.00 0.00 ? 358  ARG A O     1 
ATOM   2557  C  CB    . ARG A  1  358  ? 232.731 266.497 254.481 1.00 0.00 ? 358  ARG A CB    1 
ATOM   2558  C  CG    . ARG A  1  358  ? 232.954 265.204 255.194 1.00 0.00 ? 358  ARG A CG    1 
ATOM   2559  C  CD    . ARG A  1  358  ? 232.765 264.069 254.196 1.00 0.00 ? 358  ARG A CD    1 
ATOM   2560  N  NE    . ARG A  1  358  ? 233.789 264.107 253.157 1.00 0.00 ? 358  ARG A NE    1 
ATOM   2561  C  CZ    . ARG A  1  358  ? 234.967 263.495 253.264 1.00 0.00 ? 358  ARG A CZ    1 
ATOM   2562  N  NH1   . ARG A  1  358  ? 235.262 262.796 254.359 1.00 0.00 ? 358  ARG A NH1   1 
ATOM   2563  N  NH2   . ARG A  1  358  ? 235.859 263.588 252.286 1.00 0.00 ? 358  ARG A NH2   1 
ATOM   2564  N  N     . VAL A  1  359  ? 231.353 269.296 255.124 1.00 0.00 ? 359  VAL A N     1 
ATOM   2565  C  CA    . VAL A  1  359  ? 230.393 270.244 255.637 1.00 0.00 ? 359  VAL A CA    1 
ATOM   2566  C  C     . VAL A  1  359  ? 228.998 269.941 255.177 1.00 0.00 ? 359  VAL A C     1 
ATOM   2567  O  O     . VAL A  1  359  ? 228.775 269.192 254.242 1.00 0.00 ? 359  VAL A O     1 
ATOM   2568  C  CB    . VAL A  1  359  ? 230.732 271.684 255.184 1.00 0.00 ? 359  VAL A CB    1 
ATOM   2569  C  CG1   . VAL A  1  359  ? 232.155 272.030 255.537 1.00 0.00 ? 359  VAL A CG1   1 
ATOM   2570  C  CG2   . VAL A  1  359  ? 230.539 271.837 253.696 1.00 0.00 ? 359  VAL A CG2   1 
ATOM   2571  N  N     . ASP A  1  360  ? 228.046 270.526 255.867 1.00 0.00 ? 360  ASP A N     1 
ATOM   2572  C  CA    . ASP A  1  360  ? 226.672 270.409 255.480 1.00 0.00 ? 360  ASP A CA    1 
ATOM   2573  C  C     . ASP A  1  360  ? 226.265 271.676 254.733 1.00 0.00 ? 360  ASP A C     1 
ATOM   2574  O  O     . ASP A  1  360  ? 226.963 272.675 254.818 1.00 0.00 ? 360  ASP A O     1 
ATOM   2575  C  CB    . ASP A  1  360  ? 225.831 270.180 256.713 1.00 0.00 ? 360  ASP A CB    1 
ATOM   2576  C  CG    . ASP A  1  360  ? 224.387 270.017 256.389 1.00 0.00 ? 360  ASP A CG    1 
ATOM   2577  O  OD1   . ASP A  1  360  ? 224.084 269.578 255.246 1.00 0.00 ? 360  ASP A OD1   1 
ATOM   2578  O  OD2   . ASP A  1  360  ? 223.556 270.344 257.273 1.00 0.00 ? 360  ASP A OD2   1 
ATOM   2579  N  N     . PHE A  1  361  ? 225.140 271.636 254.021 1.00 0.00 ? 361  PHE A N     1 
ATOM   2580  C  CA    . PHE A  1  361  ? 224.652 272.748 253.187 1.00 0.00 ? 361  PHE A CA    1 
ATOM   2581  C  C     . PHE A  1  361  ? 225.536 273.018 251.980 1.00 0.00 ? 361  PHE A C     1 
ATOM   2582  O  O     . PHE A  1  361  ? 226.204 274.029 251.871 1.00 0.00 ? 361  PHE A O     1 
ATOM   2583  C  CB    . PHE A  1  361  ? 224.479 274.023 253.999 1.00 0.00 ? 361  PHE A CB    1 
ATOM   2584  C  CG    . PHE A  1  361  ? 223.403 273.922 255.005 1.00 0.00 ? 361  PHE A CG    1 
ATOM   2585  C  CD1   . PHE A  1  361  ? 222.082 273.886 254.595 1.00 0.00 ? 361  PHE A CD1   1 
ATOM   2586  C  CD2   . PHE A  1  361  ? 223.690 273.864 256.360 1.00 0.00 ? 361  PHE A CD2   1 
ATOM   2587  C  CE1   . PHE A  1  361  ? 221.054 273.773 255.515 1.00 0.00 ? 361  PHE A CE1   1 
ATOM   2588  C  CE2   . PHE A  1  361  ? 222.662 273.766 257.296 1.00 0.00 ? 361  PHE A CE2   1 
ATOM   2589  C  CZ    . PHE A  1  361  ? 221.337 273.720 256.865 1.00 0.00 ? 361  PHE A CZ    1 
ATOM   2590  N  N     . SER A  1  362  ? 225.515 272.098 251.048 1.00 0.00 ? 362  SER A N     1 
ATOM   2591  C  CA    . SER A  1  362  ? 226.428 272.169 249.965 1.00 0.00 ? 362  SER A CA    1 
ATOM   2592  C  C     . SER A  1  362  ? 225.766 271.682 248.714 1.00 0.00 ? 362  SER A C     1 
ATOM   2593  O  O     . SER A  1  362  ? 224.863 270.861 248.788 1.00 0.00 ? 362  SER A O     1 
ATOM   2594  C  CB    . SER A  1  362  ? 227.608 271.281 250.274 1.00 0.00 ? 362  SER A CB    1 
ATOM   2595  O  OG    . SER A  1  362  ? 228.194 271.667 251.486 1.00 0.00 ? 362  SER A OG    1 
ATOM   2596  N  N     . ALA A  1  363  ? 226.215 272.136 247.555 1.00 0.00 ? 363  ALA A N     1 
ATOM   2597  C  CA    . ALA A  1  363  ? 225.624 271.610 246.359 1.00 0.00 ? 363  ALA A CA    1 
ATOM   2598  C  C     . ALA A  1  363  ? 226.754 271.534 245.381 1.00 0.00 ? 363  ALA A C     1 
ATOM   2599  O  O     . ALA A  1  363  ? 227.703 272.281 245.500 1.00 0.00 ? 363  ALA A O     1 
ATOM   2600  C  CB    . ALA A  1  363  ? 224.535 272.516 245.875 1.00 0.00 ? 363  ALA A CB    1 
ATOM   2601  N  N     . ARG A  1  364  ? 226.639 270.672 244.389 1.00 0.00 ? 364  ARG A N     1 
ATOM   2602  C  CA    . ARG A  1  364  ? 227.706 270.475 243.438 1.00 0.00 ? 364  ARG A CA    1 
ATOM   2603  C  C     . ARG A  1  364  ? 227.042 270.100 242.143 1.00 0.00 ? 364  ARG A C     1 
ATOM   2604  O  O     . ARG A  1  364  ? 226.213 269.227 242.167 1.00 0.00 ? 364  ARG A O     1 
ATOM   2605  C  CB    . ARG A  1  364  ? 228.623 269.394 243.950 1.00 0.00 ? 364  ARG A CB    1 
ATOM   2606  C  CG    . ARG A  1  364  ? 229.852 269.110 243.177 1.00 0.00 ? 364  ARG A CG    1 
ATOM   2607  C  CD    . ARG A  1  364  ? 230.573 268.038 243.937 1.00 0.00 ? 364  ARG A CD    1 
ATOM   2608  N  NE    . ARG A  1  364  ? 231.904 267.752 243.439 1.00 0.00 ? 364  ARG A NE    1 
ATOM   2609  C  CZ    . ARG A  1  364  ? 232.320 266.549 243.040 1.00 0.00 ? 364  ARG A CZ    1 
ATOM   2610  N  NH1   . ARG A  1  364  ? 231.487 265.498 243.089 1.00 0.00 ? 364  ARG A NH1   1 
ATOM   2611  N  NH2   . ARG A  1  364  ? 233.589 266.382 242.635 1.00 0.00 ? 364  ARG A NH2   1 
ATOM   2612  N  N     . THR A  1  365  ? 227.378 270.696 241.009 1.00 0.00 ? 365  THR A N     1 
ATOM   2613  C  CA    . THR A  1  365  ? 226.885 270.159 239.724 1.00 0.00 ? 365  THR A CA    1 
ATOM   2614  C  C     . THR A  1  365  ? 227.793 270.569 238.513 1.00 0.00 ? 365  THR A C     1 
ATOM   2615  O  O     . THR A  1  365  ? 228.851 271.202 238.705 1.00 0.00 ? 365  THR A O     1 
ATOM   2616  C  CB    . THR A  1  365  ? 225.386 270.539 239.517 1.00 0.00 ? 365  THR A CB    1 
ATOM   2617  O  OG1   . THR A  1  365  ? 224.913 269.957 238.309 1.00 0.00 ? 365  THR A OG1   1 
ATOM   2618  C  CG2   . THR A  1  365  ? 225.188 271.992 239.423 1.00 0.00 ? 365  THR A CG2   1 
ATOM   2619  N  N     . VAL A  1  366  ? 227.395 270.221 237.284 1.00 0.00 ? 366  VAL A N     1 
ATOM   2620  C  CA    . VAL A  1  366  ? 228.120 270.652 236.088 1.00 0.00 ? 366  VAL A CA    1 
ATOM   2621  C  C     . VAL A  1  366  ? 227.872 272.143 235.825 1.00 0.00 ? 366  VAL A C     1 
ATOM   2622  O  O     . VAL A  1  366  ? 226.932 272.693 236.351 1.00 0.00 ? 366  VAL A O     1 
ATOM   2623  C  CB    . VAL A  1  366  ? 227.677 269.813 234.899 1.00 0.00 ? 366  VAL A CB    1 
ATOM   2624  C  CG1   . VAL A  1  366  ? 228.402 270.218 233.663 1.00 0.00 ? 366  VAL A CG1   1 
ATOM   2625  C  CG2   . VAL A  1  366  ? 227.983 268.390 235.170 1.00 0.00 ? 366  VAL A CG2   1 
ATOM   2626  N  N     . ILE A  1  367  ? 228.749 272.831 235.100 1.00 0.00 ? 367  ILE A N     1 
ATOM   2627  C  CA    . ILE A  1  367  ? 228.498 274.234 234.762 1.00 0.00 ? 367  ILE A CA    1 
ATOM   2628  C  C     . ILE A  1  367  ? 228.228 274.442 233.236 1.00 0.00 ? 367  ILE A C     1 
ATOM   2629  O  O     . ILE A  1  367  ? 228.750 273.701 232.395 1.00 0.00 ? 367  ILE A O     1 
ATOM   2630  C  CB    . ILE A  1  367  ? 229.631 275.101 235.248 1.00 0.00 ? 367  ILE A CB    1 
ATOM   2631  C  CG1   . ILE A  1  367  ? 230.934 274.397 235.118 1.00 0.00 ? 367  ILE A CG1   1 
ATOM   2632  C  CG2   . ILE A  1  367  ? 229.511 275.313 236.676 1.00 0.00 ? 367  ILE A CG2   1 
ATOM   2633  C  CD1   . ILE A  1  367  ? 232.025 275.334 235.343 1.00 0.00 ? 367  ILE A CD1   1 
ATOM   2634  N  N     . THR A  1  368  ? 227.389 275.418 232.879 1.00 0.00 ? 368  THR A N     1 
ATOM   2635  C  CA    . THR A  1  368  ? 227.223 275.828 231.479 1.00 0.00 ? 368  THR A CA    1 
ATOM   2636  C  C     . THR A  1  368  ? 227.219 277.323 231.374 1.00 0.00 ? 368  THR A C     1 
ATOM   2637  O  O     . THR A  1  368  ? 226.781 278.000 232.287 1.00 0.00 ? 368  THR A O     1 
ATOM   2638  C  CB    . THR A  1  368  ? 225.933 275.381 230.847 1.00 0.00 ? 368  THR A CB    1 
ATOM   2639  O  OG1   . THR A  1  368  ? 224.846 275.795 231.662 1.00 0.00 ? 368  THR A OG1   1 
ATOM   2640  C  CG2   . THR A  1  368  ? 225.959 273.904 230.619 1.00 0.00 ? 368  THR A CG2   1 
ATOM   2641  N  N     . PRO A  1  369  ? 227.610 277.849 230.213 1.00 0.00 ? 369  PRO A N     1 
ATOM   2642  C  CA    . PRO A  1  369  ? 227.651 279.303 230.184 1.00 0.00 ? 369  PRO A CA    1 
ATOM   2643  C  C     . PRO A  1  369  ? 226.308 279.969 229.968 1.00 0.00 ? 369  PRO A C     1 
ATOM   2644  O  O     . PRO A  1  369  ? 225.423 279.417 229.316 1.00 0.00 ? 369  PRO A O     1 
ATOM   2645  C  CB    . PRO A  1  369  ? 228.561 279.573 228.996 1.00 0.00 ? 369  PRO A CB    1 
ATOM   2646  C  CG    . PRO A  1  369  ? 228.330 278.449 228.064 1.00 0.00 ? 369  PRO A CG    1 
ATOM   2647  C  CD    . PRO A  1  369  ? 228.047 277.254 228.931 1.00 0.00 ? 369  PRO A CD    1 
ATOM   2648  N  N     . ASP A  1  370  ? 226.169 281.156 230.547 1.00 0.00 ? 370  ASP A N     1 
ATOM   2649  C  CA    . ASP A  1  370  ? 224.925 281.904 230.489 1.00 0.00 ? 370  ASP A CA    1 
ATOM   2650  C  C     . ASP A  1  370  ? 225.195 283.402 230.402 1.00 0.00 ? 370  ASP A C     1 
ATOM   2651  O  O     . ASP A  1  370  ? 225.460 284.046 231.419 1.00 0.00 ? 370  ASP A O     1 
ATOM   2652  C  CB    . ASP A  1  370  ? 224.057 281.589 231.706 1.00 0.00 ? 370  ASP A CB    1 
ATOM   2653  C  CG    . ASP A  1  370  ? 222.594 281.889 231.457 1.00 0.00 ? 370  ASP A CG    1 
ATOM   2654  O  OD1   . ASP A  1  370  ? 222.196 283.053 231.685 1.00 0.00 ? 370  ASP A OD1   1 
ATOM   2655  O  OD2   . ASP A  1  370  ? 221.845 280.982 231.013 1.00 0.00 ? 370  ASP A OD2   1 
ATOM   2656  N  N     . PRO A  1  371  ? 225.163 283.953 229.176 1.00 0.00 ? 371  PRO A N     1 
ATOM   2657  C  CA    . PRO A  1  371  ? 225.444 285.373 228.994 1.00 0.00 ? 371  PRO A CA    1 
ATOM   2658  C  C     . PRO A  1  371  ? 224.443 286.190 229.741 1.00 0.00 ? 371  PRO A C     1 
ATOM   2659  O  O     . PRO A  1  371  ? 224.745 287.296 230.148 1.00 0.00 ? 371  PRO A O     1 
ATOM   2660  C  CB    . PRO A  1  371  ? 225.294 285.587 227.485 1.00 0.00 ? 371  PRO A CB    1 
ATOM   2661  C  CG    . PRO A  1  371  ? 225.469 284.262 226.899 1.00 0.00 ? 371  PRO A CG    1 
ATOM   2662  C  CD    . PRO A  1  371  ? 224.862 283.308 227.892 1.00 0.00 ? 371  PRO A CD    1 
ATOM   2663  N  N     . ASN A  1  372  ? 223.254 285.655 229.939 1.00 0.00 ? 372  ASN A N     1 
ATOM   2664  C  CA    . ASN A  1  372  ? 222.210 286.508 230.452 1.00 0.00 ? 372  ASN A CA    1 
ATOM   2665  C  C     . ASN A  1  372  ? 222.234 286.823 231.917 1.00 0.00 ? 372  ASN A C     1 
ATOM   2666  O  O     . ASN A  1  372  ? 221.391 287.574 232.403 1.00 0.00 ? 372  ASN A O     1 
ATOM   2667  C  CB    . ASN A  1  372  ? 220.887 285.917 230.094 1.00 0.00 ? 372  ASN A CB    1 
ATOM   2668  C  CG    . ASN A  1  372  ? 220.577 286.150 228.672 1.00 0.00 ? 372  ASN A CG    1 
ATOM   2669  O  OD1   . ASN A  1  372  ? 220.054 285.276 227.987 1.00 0.00 ? 372  ASN A OD1   1 
ATOM   2670  N  ND2   . ASN A  1  372  ? 220.946 287.339 228.180 1.00 0.00 ? 372  ASN A ND2   1 
ATOM   2671  N  N     . LEU A  1  373  ? 223.179 286.242 232.633 1.00 0.00 ? 373  LEU A N     1 
ATOM   2672  C  CA    . LEU A  1  373  ? 223.313 286.549 234.041 1.00 0.00 ? 373  LEU A CA    1 
ATOM   2673  C  C     . LEU A  1  373  ? 224.236 287.730 234.212 1.00 0.00 ? 373  LEU A C     1 
ATOM   2674  O  O     . LEU A  1  373  ? 225.070 287.984 233.362 1.00 0.00 ? 373  LEU A O     1 
ATOM   2675  C  CB    . LEU A  1  373  ? 223.822 285.327 234.811 1.00 0.00 ? 373  LEU A CB    1 
ATOM   2676  C  CG    . LEU A  1  373  ? 222.813 284.181 234.825 1.00 0.00 ? 373  LEU A CG    1 
ATOM   2677  C  CD1   . LEU A  1  373  ? 223.307 283.055 235.701 1.00 0.00 ? 373  LEU A CD1   1 
ATOM   2678  C  CD2   . LEU A  1  373  ? 221.425 284.699 235.242 1.00 0.00 ? 373  LEU A CD2   1 
ATOM   2679  N  N     . SER A  1  374  ? 224.066 288.462 235.303 1.00 0.00 ? 374  SER A N     1 
ATOM   2680  C  CA    . SER A  1  374  ? 225.044 289.461 235.702 1.00 0.00 ? 374  SER A CA    1 
ATOM   2681  C  C     . SER A  1  374  ? 226.399 288.799 235.937 1.00 0.00 ? 374  SER A C     1 
ATOM   2682  O  O     . SER A  1  374  ? 226.561 287.622 235.640 1.00 0.00 ? 374  SER A O     1 
ATOM   2683  C  CB    . SER A  1  374  ? 224.571 290.187 236.960 1.00 0.00 ? 374  SER A CB    1 
ATOM   2684  O  OG    . SER A  1  374  ? 225.503 291.183 237.355 1.00 0.00 ? 374  SER A OG    1 
ATOM   2685  N  N     . ILE A  1  375  ? 227.395 289.524 236.438 1.00 0.00 ? 375  ILE A N     1 
ATOM   2686  C  CA    . ILE A  1  375  ? 228.607 288.799 236.787 1.00 0.00 ? 375  ILE A CA    1 
ATOM   2687  C  C     . ILE A  1  375  ? 228.441 288.108 238.113 1.00 0.00 ? 375  ILE A C     1 
ATOM   2688  O  O     . ILE A  1  375  ? 228.620 286.899 238.209 1.00 0.00 ? 375  ILE A O     1 
ATOM   2689  C  CB    . ILE A  1  375  ? 229.828 289.646 236.861 1.00 0.00 ? 375  ILE A CB    1 
ATOM   2690  C  CG1   . ILE A  1  375  ? 229.794 290.681 235.752 1.00 0.00 ? 375  ILE A CG1   1 
ATOM   2691  C  CG2   . ILE A  1  375  ? 231.048 288.764 236.741 1.00 0.00 ? 375  ILE A CG2   1 
ATOM   2692  C  CD1   . ILE A  1  375  ? 229.735 290.096 234.386 1.00 0.00 ? 375  ILE A CD1   1 
ATOM   2693  N  N     . ASP A  1  376  ? 228.083 288.853 239.142 1.00 0.00 ? 376  ASP A N     1 
ATOM   2694  C  CA    . ASP A  1  376  ? 227.953 288.238 240.446 1.00 0.00 ? 376  ASP A CA    1 
ATOM   2695  C  C     . ASP A  1  376  ? 226.642 287.434 240.662 1.00 0.00 ? 376  ASP A C     1 
ATOM   2696  O  O     . ASP A  1  376  ? 226.265 287.167 241.802 1.00 0.00 ? 376  ASP A O     1 
ATOM   2697  C  CB    . ASP A  1  376  ? 228.111 289.304 241.516 1.00 0.00 ? 376  ASP A CB    1 
ATOM   2698  C  CG    . ASP A  1  376  ? 226.921 290.231 241.593 1.00 0.00 ? 376  ASP A CG    1 
ATOM   2699  O  OD1   . ASP A  1  376  ? 226.264 290.460 240.541 1.00 0.00 ? 376  ASP A OD1   1 
ATOM   2700  O  OD2   . ASP A  1  376  ? 226.649 290.736 242.718 1.00 0.00 ? 376  ASP A OD2   1 
ATOM   2701  N  N     . GLN A  1  377  ? 225.937 287.066 239.591 1.00 0.00 ? 377  GLN A N     1 
ATOM   2702  C  CA    . GLN A  1  377  ? 224.857 286.079 239.705 1.00 0.00 ? 377  GLN A CA    1 
ATOM   2703  C  C     . GLN A  1  377  ? 225.307 284.670 239.399 1.00 0.00 ? 377  GLN A C     1 
ATOM   2704  O  O     . GLN A  1  377  ? 226.271 284.478 238.667 1.00 0.00 ? 377  GLN A O     1 
ATOM   2705  C  CB    . GLN A  1  377  ? 223.731 286.405 238.765 1.00 0.00 ? 377  GLN A CB    1 
ATOM   2706  C  CG    . GLN A  1  377  ? 222.812 287.445 239.254 1.00 0.00 ? 377  GLN A CG    1 
ATOM   2707  C  CD    . GLN A  1  377  ? 221.772 287.727 238.209 1.00 0.00 ? 377  GLN A CD    1 
ATOM   2708  O  OE1   . GLN A  1  377  ? 222.103 288.029 237.043 1.00 0.00 ? 377  GLN A OE1   1 
ATOM   2709  N  NE2   . GLN A  1  377  ? 220.498 287.536 238.581 1.00 0.00 ? 377  GLN A NE2   1 
ATOM   2710  N  N     . VAL A  1  378  ? 224.598 283.689 239.949 1.00 0.00 ? 378  VAL A N     1 
ATOM   2711  C  CA    . VAL A  1  378  ? 224.680 282.285 239.549 1.00 0.00 ? 378  VAL A CA    1 
ATOM   2712  C  C     . VAL A  1  378  ? 223.292 281.654 239.422 1.00 0.00 ? 378  VAL A C     1 
ATOM   2713  O  O     . VAL A  1  378  ? 222.421 281.971 240.224 1.00 0.00 ? 378  VAL A O     1 
ATOM   2714  C  CB    . VAL A  1  378  ? 225.578 281.448 240.528 1.00 0.00 ? 378  VAL A CB    1 
ATOM   2715  C  CG1   . VAL A  1  378  ? 224.998 281.404 241.908 1.00 0.00 ? 378  VAL A CG1   1 
ATOM   2716  C  CG2   . VAL A  1  378  ? 225.781 280.046 240.019 1.00 0.00 ? 378  VAL A CG2   1 
ATOM   2717  N  N     . GLY A  1  379  ? 223.019 280.927 238.337 1.00 0.00 ? 379  GLY A N     1 
ATOM   2718  C  CA    . GLY A  1  379  ? 221.755 280.201 238.171 1.00 0.00 ? 379  GLY A CA    1 
ATOM   2719  C  C     . GLY A  1  379  ? 221.787 278.876 238.961 1.00 0.00 ? 379  GLY A C     1 
ATOM   2720  O  O     . GLY A  1  379  ? 222.795 278.190 238.965 1.00 0.00 ? 379  GLY A O     1 
ATOM   2721  N  N     . VAL A  1  380  ? 220.737 278.531 239.690 1.00 0.00 ? 380  VAL A N     1 
ATOM   2722  C  CA    . VAL A  1  380  ? 220.750 277.324 240.499 1.00 0.00 ? 380  VAL A CA    1 
ATOM   2723  C  C     . VAL A  1  380  ? 219.518 276.518 240.076 1.00 0.00 ? 380  VAL A C     1 
ATOM   2724  O  O     . VAL A  1  380  ? 218.439 277.115 239.983 1.00 0.00 ? 380  VAL A O     1 
ATOM   2725  C  CB    . VAL A  1  380  ? 220.699 277.659 241.946 1.00 0.00 ? 380  VAL A CB    1 
ATOM   2726  C  CG1   . VAL A  1  380  ? 220.741 276.387 242.772 1.00 0.00 ? 380  VAL A CG1   1 
ATOM   2727  C  CG2   . VAL A  1  380  ? 221.880 278.455 242.273 1.00 0.00 ? 380  VAL A CG2   1 
ATOM   2728  N  N     . PRO A  1  381  ? 219.648 275.192 239.775 1.00 0.00 ? 381  PRO A N     1 
ATOM   2729  C  CA    . PRO A  1  381  ? 218.520 274.287 239.469 1.00 0.00 ? 381  PRO A CA    1 
ATOM   2730  C  C     . PRO A  1  381  ? 217.392 274.275 240.494 1.00 0.00 ? 381  PRO A C     1 
ATOM   2731  O  O     . PRO A  1  381  ? 217.710 274.311 241.675 1.00 0.00 ? 381  PRO A O     1 
ATOM   2732  C  CB    . PRO A  1  381  ? 219.173 272.922 239.497 1.00 0.00 ? 381  PRO A CB    1 
ATOM   2733  C  CG    . PRO A  1  381  ? 220.507 273.159 239.048 1.00 0.00 ? 381  PRO A CG    1 
ATOM   2734  C  CD    . PRO A  1  381  ? 220.918 274.465 239.682 1.00 0.00 ? 381  PRO A CD    1 
ATOM   2735  N  N     . ARG A  1  382  ? 216.128 274.132 240.109 1.00 0.00 ? 382  ARG A N     1 
ATOM   2736  C  CA    . ARG A  1  382  ? 215.094 274.144 241.144 1.00 0.00 ? 382  ARG A CA    1 
ATOM   2737  C  C     . ARG A  1  382  ? 215.231 273.035 242.165 1.00 0.00 ? 382  ARG A C     1 
ATOM   2738  O  O     . ARG A  1  382  ? 215.079 273.266 243.350 1.00 0.00 ? 382  ARG A O     1 
ATOM   2739  C  CB    . ARG A  1  382  ? 213.682 274.038 240.579 1.00 0.00 ? 382  ARG A CB    1 
ATOM   2740  C  CG    . ARG A  1  382  ? 213.198 275.232 239.823 1.00 0.00 ? 382  ARG A CG    1 
ATOM   2741  C  CD    . ARG A  1  382  ? 211.801 274.957 239.296 1.00 0.00 ? 382  ARG A CD    1 
ATOM   2742  N  NE    . ARG A  1  382  ? 211.188 276.127 238.657 1.00 0.00 ? 382  ARG A NE    1 
ATOM   2743  C  CZ    . ARG A  1  382  ? 210.043 276.094 237.964 1.00 0.00 ? 382  ARG A CZ    1 
ATOM   2744  N  NH1   . ARG A  1  382  ? 209.399 274.928 237.789 1.00 0.00 ? 382  ARG A NH1   1 
ATOM   2745  N  NH2   . ARG A  1  382  ? 209.514 277.226 237.480 1.00 0.00 ? 382  ARG A NH2   1 
ATOM   2746  N  N     . SER A  1  383  ? 215.577 271.841 241.717 1.00 0.00 ? 383  SER A N     1 
ATOM   2747  C  CA    . SER A  1  383  ? 215.818 270.767 242.663 1.00 0.00 ? 383  SER A CA    1 
ATOM   2748  C  C     . SER A  1  383  ? 216.861 271.130 243.704 1.00 0.00 ? 383  SER A C     1 
ATOM   2749  O  O     . SER A  1  383  ? 216.622 270.906 244.878 1.00 0.00 ? 383  SER A O     1 
ATOM   2750  C  CB    . SER A  1  383  ? 216.202 269.468 241.929 1.00 0.00 ? 383  SER A CB    1 
ATOM   2751  O  OG    . SER A  1  383  ? 217.300 269.635 241.054 1.00 0.00 ? 383  SER A OG    1 
ATOM   2752  N  N     . ILE A  1  384  ? 217.979 271.727 243.313 1.00 0.00 ? 384  ILE A N     1 
ATOM   2753  C  CA    . ILE A  1  384  ? 218.995 272.109 244.297 1.00 0.00 ? 384  ILE A CA    1 
ATOM   2754  C  C     . ILE A  1  384  ? 218.490 273.251 245.164 1.00 0.00 ? 384  ILE A C     1 
ATOM   2755  O  O     . ILE A  1  384  ? 218.783 273.296 246.340 1.00 0.00 ? 384  ILE A O     1 
ATOM   2756  C  CB    . ILE A  1  384  ? 220.346 272.465 243.639 1.00 0.00 ? 384  ILE A CB    1 
ATOM   2757  C  CG1   . ILE A  1  384  ? 221.026 271.201 243.101 1.00 0.00 ? 384  ILE A CG1   1 
ATOM   2758  C  CG2   . ILE A  1  384  ? 221.283 272.993 244.666 1.00 0.00 ? 384  ILE A CG2   1 
ATOM   2759  C  CD1   . ILE A  1  384  ? 222.359 271.450 242.451 1.00 0.00 ? 384  ILE A CD1   1 
ATOM   2760  N  N     . ALA A  1  385  ? 217.849 274.242 244.575 1.00 0.00 ? 385  ALA A N     1 
ATOM   2761  C  CA    . ALA A  1  385  ? 217.276 275.307 245.398 1.00 0.00 ? 385  ALA A CA    1 
ATOM   2762  C  C     . ALA A  1  385  ? 216.172 274.885 246.391 1.00 0.00 ? 385  ALA A C     1 
ATOM   2763  O  O     . ALA A  1  385  ? 216.143 275.370 247.506 1.00 0.00 ? 385  ALA A O     1 
ATOM   2764  C  CB    . ALA A  1  385  ? 216.743 276.424 244.501 1.00 0.00 ? 385  ALA A CB    1 
ATOM   2765  N  N     . ALA A  1  386  ? 215.273 273.989 245.991 1.00 0.00 ? 386  ALA A N     1 
ATOM   2766  C  CA    . ALA A  1  386  ? 214.284 273.429 246.921 1.00 0.00 ? 386  ALA A CA    1 
ATOM   2767  C  C     . ALA A  1  386  ? 214.796 272.514 248.031 1.00 0.00 ? 386  ALA A C     1 
ATOM   2768  O  O     . ALA A  1  386  ? 214.240 272.454 249.111 1.00 0.00 ? 386  ALA A O     1 
ATOM   2769  C  CB    . ALA A  1  386  ? 213.211 272.675 246.128 1.00 0.00 ? 386  ALA A CB    1 
ATOM   2770  N  N     . ASN A  1  387  ? 215.830 271.757 247.748 1.00 0.00 ? 387  ASN A N     1 
ATOM   2771  C  CA    . ASN A  1  387  ? 216.347 270.881 248.768 1.00 0.00 ? 387  ASN A CA    1 
ATOM   2772  C  C     . ASN A  1  387  ? 217.153 271.604 249.840 1.00 0.00 ? 387  ASN A C     1 
ATOM   2773  O  O     . ASN A  1  387  ? 217.390 271.074 250.923 1.00 0.00 ? 387  ASN A O     1 
ATOM   2774  C  CB    . ASN A  1  387  ? 217.220 269.819 248.175 1.00 0.00 ? 387  ASN A CB    1 
ATOM   2775  C  CG    . ASN A  1  387  ? 218.069 269.172 249.219 1.00 0.00 ? 387  ASN A CG    1 
ATOM   2776  O  OD1   . ASN A  1  387  ? 219.154 269.664 249.581 1.00 0.00 ? 387  ASN A OD1   1 
ATOM   2777  N  ND2   . ASN A  1  387  ? 217.548 268.076 249.773 1.00 0.00 ? 387  ASN A ND2   1 
ATOM   2778  N  N     . MET A  1  388  ? 217.692 272.762 249.519 1.00 0.00 ? 388  MET A N     1 
ATOM   2779  C  CA    . MET A  1  388  ? 218.537 273.393 250.497 1.00 0.00 ? 388  MET A CA    1 
ATOM   2780  C  C     . MET A  1  388  ? 217.800 274.516 251.121 1.00 0.00 ? 388  MET A C     1 
ATOM   2781  O  O     . MET A  1  388  ? 216.840 275.011 250.572 1.00 0.00 ? 388  MET A O     1 
ATOM   2782  C  CB    . MET A  1  388  ? 219.853 273.869 249.915 1.00 0.00 ? 388  MET A CB    1 
ATOM   2783  C  CG    . MET A  1  388  ? 220.838 272.734 249.742 1.00 0.00 ? 388  MET A CG    1 
ATOM   2784  S  SD    . MET A  1  388  ? 222.456 273.482 249.708 1.00 0.00 ? 388  MET A SD    1 
ATOM   2785  C  CE    . MET A  1  388  ? 222.331 274.553 251.145 1.00 0.00 ? 388  MET A CE    1 
ATOM   2786  N  N     . THR A  1  389  ? 218.257 274.900 252.295 1.00 0.00 ? 389  THR A N     1 
ATOM   2787  C  CA    . THR A  1  389  ? 217.443 275.716 253.138 1.00 0.00 ? 389  THR A CA    1 
ATOM   2788  C  C     . THR A  1  389  ? 218.227 276.800 253.833 1.00 0.00 ? 389  THR A C     1 
ATOM   2789  O  O     . THR A  1  389  ? 219.411 276.665 254.087 1.00 0.00 ? 389  THR A O     1 
ATOM   2790  C  CB    . THR A  1  389  ? 216.710 274.822 254.176 1.00 0.00 ? 389  THR A CB    1 
ATOM   2791  O  OG1   . THR A  1  389  ? 215.835 275.618 254.972 1.00 0.00 ? 389  THR A OG1   1 
ATOM   2792  C  CG2   . THR A  1  389  ? 217.667 274.050 255.090 1.00 0.00 ? 389  THR A CG2   1 
ATOM   2793  N  N     . PHE A  1  390  ? 217.503 277.852 254.178 1.00 0.00 ? 390  PHE A N     1 
ATOM   2794  C  CA    . PHE A  1  390  ? 217.996 279.010 254.894 1.00 0.00 ? 390  PHE A CA    1 
ATOM   2795  C  C     . PHE A  1  390  ? 217.056 279.445 255.988 1.00 0.00 ? 390  PHE A C     1 
ATOM   2796  O  O     . PHE A  1  390  ? 215.847 279.541 255.766 1.00 0.00 ? 390  PHE A O     1 
ATOM   2797  C  CB    . PHE A  1  390  ? 218.217 280.144 253.895 1.00 0.00 ? 390  PHE A CB    1 
ATOM   2798  C  CG    . PHE A  1  390  ? 218.697 281.426 254.507 1.00 0.00 ? 390  PHE A CG    1 
ATOM   2799  C  CD1   . PHE A  1  390  ? 220.019 281.573 254.922 1.00 0.00 ? 390  PHE A CD1   1 
ATOM   2800  C  CD2   . PHE A  1  390  ? 217.851 282.530 254.570 1.00 0.00 ? 390  PHE A CD2   1 
ATOM   2801  C  CE1   . PHE A  1  390  ? 220.467 282.788 255.458 1.00 0.00 ? 390  PHE A CE1   1 
ATOM   2802  C  CE2   . PHE A  1  390  ? 218.289 283.740 255.100 1.00 0.00 ? 390  PHE A CE2   1 
ATOM   2803  C  CZ    . PHE A  1  390  ? 219.597 283.870 255.549 1.00 0.00 ? 390  PHE A CZ    1 
ATOM   2804  N  N     . ALA A  1  391  ? 217.602 279.726 257.167 1.00 0.00 ? 391  ALA A N     1 
ATOM   2805  C  CA    . ALA A  1  391  ? 216.773 280.005 258.342 1.00 0.00 ? 391  ALA A CA    1 
ATOM   2806  C  C     . ALA A  1  391  ? 216.490 281.481 258.540 1.00 0.00 ? 391  ALA A C     1 
ATOM   2807  O  O     . ALA A  1  391  ? 217.371 282.228 258.932 1.00 0.00 ? 391  ALA A O     1 
ATOM   2808  C  CB    . ALA A  1  391  ? 217.421 279.438 259.600 1.00 0.00 ? 391  ALA A CB    1 
ATOM   2809  N  N     . GLU A  1  392  ? 215.277 281.901 258.195 1.00 0.00 ? 392  GLU A N     1 
ATOM   2810  C  CA    . GLU A  1  392  ? 214.835 283.252 258.507 1.00 0.00 ? 392  GLU A CA    1 
ATOM   2811  C  C     . GLU A  1  392  ? 214.146 283.236 259.846 1.00 0.00 ? 392  GLU A C     1 
ATOM   2812  O  O     . GLU A  1  392  ? 213.466 282.276 260.187 1.00 0.00 ? 392  GLU A O     1 
ATOM   2813  C  CB    . GLU A  1  392  ? 213.867 283.839 257.470 1.00 0.00 ? 392  GLU A CB    1 
ATOM   2814  C  CG    . GLU A  1  392  ? 214.472 284.394 256.200 1.00 0.00 ? 392  GLU A CG    1 
ATOM   2815  C  CD    . GLU A  1  392  ? 213.471 285.235 255.426 1.00 0.00 ? 392  GLU A CD    1 
ATOM   2816  O  OE1   . GLU A  1  392  ? 212.915 286.176 256.029 1.00 0.00 ? 392  GLU A OE1   1 
ATOM   2817  O  OE2   . GLU A  1  392  ? 213.247 284.971 254.225 1.00 0.00 ? 392  GLU A OE2   1 
ATOM   2818  N  N     . ILE A  1  393  ? 214.379 284.283 260.624 1.00 0.00 ? 393  ILE A N     1 
ATOM   2819  C  CA    . ILE A  1  393  ? 213.740 284.442 261.913 1.00 0.00 ? 393  ILE A CA    1 
ATOM   2820  C  C     . ILE A  1  393  ? 212.555 285.414 261.756 1.00 0.00 ? 393  ILE A C     1 
ATOM   2821  O  O     . ILE A  1  393  ? 212.678 286.434 261.079 1.00 0.00 ? 393  ILE A O     1 
ATOM   2822  C  CB    . ILE A  1  393  ? 214.766 284.900 262.935 1.00 0.00 ? 393  ILE A CB    1 
ATOM   2823  C  CG1   . ILE A  1  393  ? 214.152 284.960 264.323 1.00 0.00 ? 393  ILE A CG1   1 
ATOM   2824  C  CG2   . ILE A  1  393  ? 215.399 286.203 262.507 1.00 0.00 ? 393  ILE A CG2   1 
ATOM   2825  C  CD1   . ILE A  1  393  ? 215.188 285.107 265.406 1.00 0.00 ? 393  ILE A CD1   1 
ATOM   2826  N  N     . VAL A  1  394  ? 211.405 285.086 262.344 1.00 0.00 ? 394  VAL A N     1 
ATOM   2827  C  CA    . VAL A  1  394  ? 210.175 285.857 262.119 1.00 0.00 ? 394  VAL A CA    1 
ATOM   2828  C  C     . VAL A  1  394  ? 210.144 287.189 262.859 1.00 0.00 ? 394  VAL A C     1 
ATOM   2829  O  O     . VAL A  1  394  ? 210.357 287.242 264.071 1.00 0.00 ? 394  VAL A O     1 
ATOM   2830  C  CB    . VAL A  1  394  ? 208.915 285.050 262.513 1.00 0.00 ? 394  VAL A CB    1 
ATOM   2831  C  CG1   . VAL A  1  394  ? 207.671 285.913 262.431 1.00 0.00 ? 394  VAL A CG1   1 
ATOM   2832  C  CG2   . VAL A  1  394  ? 208.754 283.850 261.616 1.00 0.00 ? 394  VAL A CG2   1 
ATOM   2833  N  N     . THR A  1  395  ? 209.886 288.264 262.111 1.00 0.00 ? 395  THR A N     1 
ATOM   2834  C  CA    . THR A  1  395  ? 209.673 289.602 262.677 1.00 0.00 ? 395  THR A CA    1 
ATOM   2835  C  C     . THR A  1  395  ? 208.220 290.023 262.494 1.00 0.00 ? 395  THR A C     1 
ATOM   2836  O  O     . THR A  1  395  ? 207.512 289.464 261.657 1.00 0.00 ? 395  THR A O     1 
ATOM   2837  C  CB    . THR A  1  395  ? 210.550 290.669 262.001 1.00 0.00 ? 395  THR A CB    1 
ATOM   2838  O  OG1   . THR A  1  395  ? 209.932 291.093 260.777 1.00 0.00 ? 395  THR A OG1   1 
ATOM   2839  C  CG2   . THR A  1  395  ? 211.947 290.133 261.741 1.00 0.00 ? 395  THR A CG2   1 
ATOM   2840  N  N     . PRO A  1  396  ? 207.771 291.023 263.259 1.00 0.00 ? 396  PRO A N     1 
ATOM   2841  C  CA    . PRO A  1  396  ? 206.396 291.502 263.086 1.00 0.00 ? 396  PRO A CA    1 
ATOM   2842  C  C     . PRO A  1  396  ? 206.043 291.970 261.668 1.00 0.00 ? 396  PRO A C     1 
ATOM   2843  O  O     . PRO A  1  396  ? 204.881 291.857 261.275 1.00 0.00 ? 396  PRO A O     1 
ATOM   2844  C  CB    . PRO A  1  396  ? 206.317 292.676 264.066 1.00 0.00 ? 396  PRO A CB    1 
ATOM   2845  C  CG    . PRO A  1  396  ? 207.291 292.324 265.130 1.00 0.00 ? 396  PRO A CG    1 
ATOM   2846  C  CD    . PRO A  1  396  ? 208.426 291.641 264.423 1.00 0.00 ? 396  PRO A CD    1 
ATOM   2847  N  N     . PHE A  1  397  ? 207.012 292.474 260.910 1.00 0.00 ? 397  PHE A N     1 
ATOM   2848  C  CA    . PHE A  1  397  ? 206.690 293.054 259.605 1.00 0.00 ? 397  PHE A CA    1 
ATOM   2849  C  C     . PHE A  1  397  ? 206.945 292.142 258.401 1.00 0.00 ? 397  PHE A C     1 
ATOM   2850  O  O     . PHE A  1  397  ? 206.786 292.575 257.259 1.00 0.00 ? 397  PHE A O     1 
ATOM   2851  C  CB    . PHE A  1  397  ? 207.453 294.370 259.412 1.00 0.00 ? 397  PHE A CB    1 
ATOM   2852  C  CG    . PHE A  1  397  ? 208.916 294.286 259.739 1.00 0.00 ? 397  PHE A CG    1 
ATOM   2853  C  CD1   . PHE A  1  397  ? 209.829 293.876 258.778 1.00 0.00 ? 397  PHE A CD1   1 
ATOM   2854  C  CD2   . PHE A  1  397  ? 209.383 294.634 261.000 1.00 0.00 ? 397  PHE A CD2   1 
ATOM   2855  C  CE1   . PHE A  1  397  ? 211.180 293.805 259.070 1.00 0.00 ? 397  PHE A CE1   1 
ATOM   2856  C  CE2   . PHE A  1  397  ? 210.730 294.565 261.300 1.00 0.00 ? 397  PHE A CE2   1 
ATOM   2857  C  CZ    . PHE A  1  397  ? 211.631 294.152 260.335 1.00 0.00 ? 397  PHE A CZ    1 
ATOM   2858  N  N     . ASN A  1  398  ? 207.337 290.893 258.640 1.00 0.00 ? 398  ASN A N     1 
ATOM   2859  C  CA    . ASN A  1  398  ? 207.522 289.939 257.544 1.00 0.00 ? 398  ASN A CA    1 
ATOM   2860  C  C     . ASN A  1  398  ? 206.727 288.649 257.784 1.00 0.00 ? 398  ASN A C     1 
ATOM   2861  O  O     . ASN A  1  398  ? 206.726 287.728 256.960 1.00 0.00 ? 398  ASN A O     1 
ATOM   2862  C  CB    . ASN A  1  398  ? 209.016 289.653 257.318 1.00 0.00 ? 398  ASN A CB    1 
ATOM   2863  C  CG    . ASN A  1  398  ? 209.667 288.876 258.459 1.00 0.00 ? 398  ASN A CG    1 
ATOM   2864  O  OD1   . ASN A  1  398  ? 209.005 288.397 259.376 1.00 0.00 ? 398  ASN A OD1   1 
ATOM   2865  N  ND2   . ASN A  1  398  ? 210.988 288.755 258.399 1.00 0.00 ? 398  ASN A ND2   1 
ATOM   2866  N  N     . ILE A  1  399  ? 206.064 288.612 258.939 1.00 0.00 ? 399  ILE A N     1 
ATOM   2867  C  CA    . ILE A  1  399  ? 205.306 287.457 259.411 1.00 0.00 ? 399  ILE A CA    1 
ATOM   2868  C  C     . ILE A  1  399  ? 204.243 286.976 258.421 1.00 0.00 ? 399  ILE A C     1 
ATOM   2869  O  O     . ILE A  1  399  ? 204.102 285.777 258.182 1.00 0.00 ? 399  ILE A O     1 
ATOM   2870  C  CB    . ILE A  1  399  ? 204.645 287.743 260.785 1.00 0.00 ? 399  ILE A CB    1 
ATOM   2871  C  CG1   . ILE A  1  399  ? 203.985 286.473 261.323 1.00 0.00 ? 399  ILE A CG1   1 
ATOM   2872  C  CG2   . ILE A  1  399  ? 203.649 288.888 260.705 1.00 0.00 ? 399  ILE A CG2   1 
ATOM   2873  C  CD1   . ILE A  1  399  ? 203.647 286.540 262.788 1.00 0.00 ? 399  ILE A CD1   1 
ATOM   2874  N  N     . ASP A  1  400  ? 203.504 287.914 257.846 1.00 0.00 ? 400  ASP A N     1 
ATOM   2875  C  CA    . ASP A  1  400  ? 202.444 287.607 256.897 1.00 0.00 ? 400  ASP A CA    1 
ATOM   2876  C  C     . ASP A  1  400  ? 202.976 286.896 255.633 1.00 0.00 ? 400  ASP A C     1 
ATOM   2877  O  O     . ASP A  1  400  ? 202.354 285.951 255.144 1.00 0.00 ? 400  ASP A O     1 
ATOM   2878  C  CB    . ASP A  1  400  ? 201.707 288.907 256.552 1.00 0.00 ? 400  ASP A CB    1 
ATOM   2879  C  CG    . ASP A  1  400  ? 200.485 288.686 255.686 1.00 0.00 ? 400  ASP A CG    1 
ATOM   2880  O  OD1   . ASP A  1  400  ? 199.606 287.897 256.105 1.00 0.00 ? 400  ASP A OD1   1 
ATOM   2881  O  OD2   . ASP A  1  400  ? 200.388 289.320 254.610 1.00 0.00 ? 400  ASP A OD2   1 
ATOM   2882  N  N     . ARG A  1  401  ? 204.114 287.339 255.107 1.00 0.00 ? 401  ARG A N     1 
ATOM   2883  C  CA    . ARG A  1  401  ? 204.718 286.676 253.949 1.00 0.00 ? 401  ARG A CA    1 
ATOM   2884  C  C     . ARG A  1  401  ? 205.175 285.256 254.306 1.00 0.00 ? 401  ARG A C     1 
ATOM   2885  O  O     . ARG A  1  401  ? 204.914 284.294 253.581 1.00 0.00 ? 401  ARG A O     1 
ATOM   2886  C  CB    . ARG A  1  401  ? 205.908 287.460 253.398 1.00 0.00 ? 401  ARG A CB    1 
ATOM   2887  C  CG    . ARG A  1  401  ? 206.626 286.709 252.273 1.00 0.00 ? 401  ARG A CG    1 
ATOM   2888  C  CD    . ARG A  1  401  ? 207.716 287.530 251.635 1.00 0.00 ? 401  ARG A CD    1 
ATOM   2889  N  NE    . ARG A  1  401  ? 208.724 287.890 252.623 1.00 0.00 ? 401  ARG A NE    1 
ATOM   2890  C  CZ    . ARG A  1  401  ? 209.700 287.084 253.025 1.00 0.00 ? 401  ARG A CZ    1 
ATOM   2891  N  NH1   . ARG A  1  401  ? 209.795 285.859 252.529 1.00 0.00 ? 401  ARG A NH1   1 
ATOM   2892  N  NH2   . ARG A  1  401  ? 210.585 287.507 253.918 1.00 0.00 ? 401  ARG A NH2   1 
ATOM   2893  N  N     . LEU A  1  402  ? 205.847 285.142 255.444 1.00 0.00 ? 402  LEU A N     1 
ATOM   2894  C  CA    . LEU A  1  402  ? 206.374 283.876 255.945 1.00 0.00 ? 402  LEU A CA    1 
ATOM   2895  C  C     . LEU A  1  402  ? 205.243 282.905 256.280 1.00 0.00 ? 402  LEU A C     1 
ATOM   2896  O  O     . LEU A  1  402  ? 205.370 281.699 256.068 1.00 0.00 ? 402  LEU A O     1 
ATOM   2897  C  CB    . LEU A  1  402  ? 207.266 284.117 257.161 1.00 0.00 ? 402  LEU A CB    1 
ATOM   2898  C  CG    . LEU A  1  402  ? 208.565 284.854 256.833 1.00 0.00 ? 402  LEU A CG    1 
ATOM   2899  C  CD1   . LEU A  1  402  ? 209.450 284.955 258.057 1.00 0.00 ? 402  LEU A CD1   1 
ATOM   2900  C  CD2   . LEU A  1  402  ? 209.290 284.155 255.698 1.00 0.00 ? 402  LEU A CD2   1 
ATOM   2901  N  N     . GLN A  1  403  ? 204.145 283.427 256.813 1.00 0.00 ? 403  GLN A N     1 
ATOM   2902  C  CA    . GLN A  1  403  ? 202.972 282.609 257.105 1.00 0.00 ? 403  GLN A CA    1 
ATOM   2903  C  C     . GLN A  1  403  ? 202.400 282.035 255.805 1.00 0.00 ? 403  GLN A C     1 
ATOM   2904  O  O     . GLN A  1  403  ? 201.937 280.892 255.774 1.00 0.00 ? 403  GLN A O     1 
ATOM   2905  C  CB    . GLN A  1  403  ? 201.910 283.450 257.823 1.00 0.00 ? 403  GLN A CB    1 
ATOM   2906  C  CG    . GLN A  1  403  ? 200.682 282.696 258.316 1.00 0.00 ? 403  GLN A CG    1 
ATOM   2907  C  CD    . GLN A  1  403  ? 201.021 281.577 259.284 1.00 0.00 ? 403  GLN A CD    1 
ATOM   2908  O  OE1   . GLN A  1  403  ? 201.137 281.796 260.495 1.00 0.00 ? 403  GLN A OE1   1 
ATOM   2909  N  NE2   . GLN A  1  403  ? 201.167 280.364 258.755 1.00 0.00 ? 403  GLN A NE2   1 
ATOM   2910  N  N     . GLU A  1  404  ? 202.420 282.837 254.743 1.00 0.00 ? 404  GLU A N     1 
ATOM   2911  C  CA    . GLU A  1  404  ? 202.069 282.374 253.400 1.00 0.00 ? 404  GLU A CA    1 
ATOM   2912  C  C     . GLU A  1  404  ? 203.027 281.244 252.965 1.00 0.00 ? 404  GLU A C     1 
ATOM   2913  O  O     . GLU A  1  404  ? 202.594 280.211 252.453 1.00 0.00 ? 404  GLU A O     1 
ATOM   2914  C  CB    . GLU A  1  404  ? 202.089 283.535 252.404 1.00 0.00 ? 404  GLU A CB    1 
ATOM   2915  C  CG    . GLU A  1  404  ? 200.694 283.983 251.918 1.00 0.00 ? 404  GLU A CG    1 
ATOM   2916  C  CD    . GLU A  1  404  ? 199.951 282.925 251.106 1.00 0.00 ? 404  GLU A CD    1 
ATOM   2917  O  OE1   . GLU A  1  404  ? 198.793 282.601 251.462 1.00 0.00 ? 404  GLU A OE1   1 
ATOM   2918  O  OE2   . GLU A  1  404  ? 200.518 282.437 250.101 1.00 0.00 ? 404  GLU A OE2   1 
ATOM   2919  N  N     . LEU A  1  405  ? 204.327 281.452 253.177 1.00 0.00 ? 405  LEU A N     1 
ATOM   2920  C  CA    . LEU A  1  405  ? 205.350 280.435 252.897 1.00 0.00 ? 405  LEU A CA    1 
ATOM   2921  C  C     . LEU A  1  405  ? 205.163 279.111 253.631 1.00 0.00 ? 405  LEU A C     1 
ATOM   2922  O  O     . LEU A  1  405  ? 205.355 278.048 253.052 1.00 0.00 ? 405  LEU A O     1 
ATOM   2923  C  CB    . LEU A  1  405  ? 206.751 280.960 253.222 1.00 0.00 ? 405  LEU A CB    1 
ATOM   2924  C  CG    . LEU A  1  405  ? 207.524 281.573 252.058 1.00 0.00 ? 405  LEU A CG    1 
ATOM   2925  C  CD1   . LEU A  1  405  ? 206.797 282.763 251.451 1.00 0.00 ? 405  LEU A CD1   1 
ATOM   2926  C  CD2   . LEU A  1  405  ? 208.926 281.931 252.492 1.00 0.00 ? 405  LEU A CD2   1 
ATOM   2927  N  N     . VAL A  1  406  ? 204.776 279.170 254.895 1.00 0.00 ? 406  VAL A N     1 
ATOM   2928  C  CA    . VAL A  1  406  ? 204.450 277.958 255.630 1.00 0.00 ? 406  VAL A CA    1 
ATOM   2929  C  C     . VAL A  1  406  ? 203.253 277.286 254.981 1.00 0.00 ? 406  VAL A C     1 
ATOM   2930  O  O     . VAL A  1  406  ? 203.227 276.068 254.813 1.00 0.00 ? 406  VAL A O     1 
ATOM   2931  C  CB    . VAL A  1  406  ? 204.155 278.243 257.110 1.00 0.00 ? 406  VAL A CB    1 
ATOM   2932  C  CG1   . VAL A  1  406  ? 203.638 276.990 257.789 1.00 0.00 ? 406  VAL A CG1   1 
ATOM   2933  C  CG2   . VAL A  1  406  ? 205.409 278.717 257.811 1.00 0.00 ? 406  VAL A CG2   1 
ATOM   2934  N  N     . ARG A  1  407  ? 202.274 278.093 254.598 1.00 0.00 ? 407  ARG A N     1 
ATOM   2935  C  CA    . ARG A  1  407  ? 201.057 277.615 253.943 1.00 0.00 ? 407  ARG A CA    1 
ATOM   2936  C  C     . ARG A  1  407  ? 201.310 276.935 252.579 1.00 0.00 ? 407  ARG A C     1 
ATOM   2937  O  O     . ARG A  1  407  ? 200.605 275.985 252.230 1.00 0.00 ? 407  ARG A O     1 
ATOM   2938  C  CB    . ARG A  1  407  ? 200.069 278.777 253.822 1.00 0.00 ? 407  ARG A CB    1 
ATOM   2939  C  CG    . ARG A  1  407  ? 198.668 278.399 253.388 1.00 0.00 ? 407  ARG A CG    1 
ATOM   2940  C  CD    . ARG A  1  407  ? 197.860 279.666 253.217 1.00 0.00 ? 407  ARG A CD    1 
ATOM   2941  N  NE    . ARG A  1  407  ? 197.644 280.285 254.522 1.00 0.00 ? 407  ARG A NE    1 
ATOM   2942  C  CZ    . ARG A  1  407  ? 197.819 281.575 254.805 1.00 0.00 ? 407  ARG A CZ    1 
ATOM   2943  N  NH1   . ARG A  1  407  ? 198.306 282.397 253.884 1.00 0.00 ? 407  ARG A NH1   1 
ATOM   2944  N  NH2   . ARG A  1  407  ? 197.395 282.062 255.962 1.00 0.00 ? 407  ARG A NH2   1 
ATOM   2945  N  N     . ARG A  1  408  ? 202.287 277.408 251.806 1.00 0.00 ? 408  ARG A N     1 
ATOM   2946  C  CA    . ARG A  1  408  ? 202.657 276.716 250.562 1.00 0.00 ? 408  ARG A CA    1 
ATOM   2947  C  C     . ARG A  1  408  ? 203.230 275.320 250.828 1.00 0.00 ? 408  ARG A C     1 
ATOM   2948  O  O     . ARG A  1  408  ? 203.320 274.491 249.920 1.00 0.00 ? 408  ARG A O     1 
ATOM   2949  C  CB    . ARG A  1  408  ? 203.676 277.532 249.767 1.00 0.00 ? 408  ARG A CB    1 
ATOM   2950  C  CG    . ARG A  1  408  ? 203.080 278.737 249.101 1.00 0.00 ? 408  ARG A CG    1 
ATOM   2951  C  CD    . ARG A  1  408  ? 204.143 279.678 248.616 1.00 0.00 ? 408  ARG A CD    1 
ATOM   2952  N  NE    . ARG A  1  408  ? 203.574 281.007 248.425 1.00 0.00 ? 408  ARG A NE    1 
ATOM   2953  C  CZ    . ARG A  1  408  ? 204.236 282.042 247.920 1.00 0.00 ? 408  ARG A CZ    1 
ATOM   2954  N  NH1   . ARG A  1  408  ? 205.514 281.906 247.564 1.00 0.00 ? 408  ARG A NH1   1 
ATOM   2955  N  NH2   . ARG A  1  408  ? 203.621 283.217 247.789 1.00 0.00 ? 408  ARG A NH2   1 
ATOM   2956  N  N     . GLY A  1  409  ? 203.624 275.073 252.071 1.00 0.00 ? 409  GLY A N     1 
ATOM   2957  C  CA    . GLY A  1  409  ? 204.115 273.772 252.473 1.00 0.00 ? 409  GLY A CA    1 
ATOM   2958  C  C     . GLY A  1  409  ? 205.473 273.465 251.900 1.00 0.00 ? 409  GLY A C     1 
ATOM   2959  O  O     . GLY A  1  409  ? 206.357 274.311 251.879 1.00 0.00 ? 409  GLY A O     1 
ATOM   2960  N  N     . ASN A  1  410  ? 205.640 272.240 251.430 1.00 0.00 ? 410  ASN A N     1 
ATOM   2961  C  CA    . ASN A  1  410  ? 206.907 271.829 250.859 1.00 0.00 ? 410  ASN A CA    1 
ATOM   2962  C  C     . ASN A  1  410  ? 206.716 271.319 249.431 1.00 0.00 ? 410  ASN A C     1 
ATOM   2963  O  O     . ASN A  1  410  ? 207.623 271.409 248.609 1.00 0.00 ? 410  ASN A O     1 
ATOM   2964  C  CB    . ASN A  1  410  ? 207.559 270.751 251.730 1.00 0.00 ? 410  ASN A CB    1 
ATOM   2965  C  CG    . ASN A  1  410  ? 208.938 270.337 251.224 1.00 0.00 ? 410  ASN A CG    1 
ATOM   2966  O  OD1   . ASN A  1  410  ? 209.709 271.169 250.739 1.00 0.00 ? 410  ASN A OD1   1 
ATOM   2967  N  ND2   . ASN A  1  410  ? 209.256 269.043 251.339 1.00 0.00 ? 410  ASN A ND2   1 
ATOM   2968  N  N     . SER A  1  411  ? 205.525 270.794 249.146 1.00 0.00 ? 411  SER A N     1 
ATOM   2969  C  CA    . SER A  1  411  ? 205.210 270.202 247.841 1.00 0.00 ? 411  SER A CA    1 
ATOM   2970  C  C     . SER A  1  411  ? 205.376 271.127 246.636 1.00 0.00 ? 411  SER A C     1 
ATOM   2971  O  O     . SER A  1  411  ? 205.569 270.645 245.518 1.00 0.00 ? 411  SER A O     1 
ATOM   2972  C  CB    . SER A  1  411  ? 203.789 269.637 247.844 1.00 0.00 ? 411  SER A CB    1 
ATOM   2973  O  OG    . SER A  1  411  ? 203.643 268.624 248.827 1.00 0.00 ? 411  SER A OG    1 
ATOM   2974  N  N     . GLN A  1  412  ? 205.288 272.438 246.839 1.00 0.00 ? 412  GLN A N     1 
ATOM   2975  C  CA    . GLN A  1  412  ? 205.537 273.359 245.732 1.00 0.00 ? 412  GLN A CA    1 
ATOM   2976  C  C     . GLN A  1  412  ? 206.781 274.172 246.057 1.00 0.00 ? 412  GLN A C     1 
ATOM   2977  O  O     . GLN A  1  412  ? 207.142 274.310 247.225 1.00 0.00 ? 412  GLN A O     1 
ATOM   2978  C  CB    . GLN A  1  412  ? 204.355 274.278 245.472 1.00 0.00 ? 412  GLN A CB    1 
ATOM   2979  C  CG    . GLN A  1  412  ? 204.119 275.278 246.574 1.00 0.00 ? 412  GLN A CG    1 
ATOM   2980  C  CD    . GLN A  1  412  ? 203.023 276.254 246.220 1.00 0.00 ? 412  GLN A CD    1 
ATOM   2981  O  OE1   . GLN A  1  412  ? 203.189 277.472 246.371 1.00 0.00 ? 412  GLN A OE1   1 
ATOM   2982  N  NE2   . GLN A  1  412  ? 201.891 275.729 245.727 1.00 0.00 ? 412  GLN A NE2   1 
ATOM   2983  N  N     . TYR A  1  413  ? 207.425 274.718 245.029 1.00 0.00 ? 413  TYR A N     1 
ATOM   2984  C  CA    . TYR A  1  413  ? 208.789 275.212 245.181 1.00 0.00 ? 413  TYR A CA    1 
ATOM   2985  C  C     . TYR A  1  413  ? 209.026 276.324 246.220 1.00 0.00 ? 413  TYR A C     1 
ATOM   2986  O  O     . TYR A  1  413  ? 209.814 276.131 247.144 1.00 0.00 ? 413  TYR A O     1 
ATOM   2987  C  CB    . TYR A  1  413  ? 209.336 275.703 243.839 1.00 0.00 ? 413  TYR A CB    1 
ATOM   2988  C  CG    . TYR A  1  413  ? 210.529 276.606 244.042 1.00 0.00 ? 413  TYR A CG    1 
ATOM   2989  C  CD1   . TYR A  1  413  ? 211.748 276.089 244.469 1.00 0.00 ? 413  TYR A CD1   1 
ATOM   2990  C  CD2   . TYR A  1  413  ? 210.425 277.975 243.872 1.00 0.00 ? 413  TYR A CD2   1 
ATOM   2991  C  CE1   . TYR A  1  413  ? 212.828 276.904 244.683 1.00 0.00 ? 413  TYR A CE1   1 
ATOM   2992  C  CE2   . TYR A  1  413  ? 211.501 278.791 244.091 1.00 0.00 ? 413  TYR A CE2   1 
ATOM   2993  C  CZ    . TYR A  1  413  ? 212.697 278.249 244.486 1.00 0.00 ? 413  TYR A CZ    1 
ATOM   2994  O  OH    . TYR A  1  413  ? 213.765 279.071 244.688 1.00 0.00 ? 413  TYR A OH    1 
ATOM   2995  N  N     . PRO A  1  414  ? 208.364 277.484 246.092 1.00 0.00 ? 414  PRO A N     1 
ATOM   2996  C  CA    . PRO A  1  414  ? 208.832 278.556 246.980 1.00 0.00 ? 414  PRO A CA    1 
ATOM   2997  C  C     . PRO A  1  414  ? 208.255 278.452 248.404 1.00 0.00 ? 414  PRO A C     1 
ATOM   2998  O  O     . PRO A  1  414  ? 207.579 279.385 248.835 1.00 0.00 ? 414  PRO A O     1 
ATOM   2999  C  CB    . PRO A  1  414  ? 208.339 279.807 246.266 1.00 0.00 ? 414  PRO A CB    1 
ATOM   3000  C  CG    . PRO A  1  414  ? 207.013 279.357 245.703 1.00 0.00 ? 414  PRO A CG    1 
ATOM   3001  C  CD    . PRO A  1  414  ? 207.209 277.915 245.283 1.00 0.00 ? 414  PRO A CD    1 
ATOM   3002  N  N     . GLY A  1  415  ? 208.530 277.353 249.116 1.00 0.00 ? 415  GLY A N     1 
ATOM   3003  C  CA    . GLY A  1  415  ? 207.832 277.010 250.352 1.00 0.00 ? 415  GLY A CA    1 
ATOM   3004  C  C     . GLY A  1  415  ? 208.690 277.113 251.585 1.00 0.00 ? 415  GLY A C     1 
ATOM   3005  O  O     . GLY A  1  415  ? 209.551 277.955 251.662 1.00 0.00 ? 415  GLY A O     1 
ATOM   3006  N  N     . ALA A  1  416  ? 208.415 276.263 252.566 1.00 0.00 ? 416  ALA A N     1 
ATOM   3007  C  CA    . ALA A  1  416  ? 209.265 276.133 253.750 1.00 0.00 ? 416  ALA A CA    1 
ATOM   3008  C  C     . ALA A  1  416  ? 209.461 274.655 254.141 1.00 0.00 ? 416  ALA A C     1 
ATOM   3009  O  O     . ALA A  1  416  ? 208.524 273.901 254.010 1.00 0.00 ? 416  ALA A O     1 
ATOM   3010  C  CB    . ALA A  1  416  ? 208.694 276.933 254.948 1.00 0.00 ? 416  ALA A CB    1 
ATOM   3011  N  N     . LYS A  1  417  ? 210.661 274.290 254.636 1.00 0.00 ? 417  LYS A N     1 
ATOM   3012  C  CA    . LYS A  1  417  ? 211.000 272.947 255.067 1.00 0.00 ? 417  LYS A CA    1 
ATOM   3013  C  C     . LYS A  1  417  ? 210.561 272.631 256.460 1.00 0.00 ? 417  LYS A C     1 
ATOM   3014  O  O     . LYS A  1  417  ? 209.760 271.699 256.675 1.00 0.00 ? 417  LYS A O     1 
ATOM   3015  C  CB    . LYS A  1  417  ? 212.526 272.711 254.861 1.00 0.00 ? 417  LYS A CB    1 
ATOM   3016  C  CG    . LYS A  1  417  ? 213.052 273.226 253.410 1.00 0.00 ? 417  LYS A CG    1 
ATOM   3017  C  CD    . LYS A  1  417  ? 214.438 272.565 253.006 1.00 0.00 ? 417  LYS A CD    1 
ATOM   3018  C  CE    . LYS A  1  417  ? 214.108 271.188 252.715 1.00 0.00 ? 417  LYS A CE    1 
ATOM   3019  N  NZ    . LYS A  1  417  ? 213.179 271.347 251.519 1.00 0.00 ? 417  LYS A NZ    1 
ATOM   3020  N  N     . TYR A  1  418  ? 210.897 273.577 257.313 1.00 0.00 ? 418  TYR A N     1 
ATOM   3021  C  CA    . TYR A  1  418  ? 210.688 273.514 258.736 1.00 0.00 ? 418  TYR A CA    1 
ATOM   3022  C  C     . TYR A  1  418  ? 210.319 274.815 259.458 1.00 0.00 ? 418  TYR A C     1 
ATOM   3023  O  O     . TYR A  1  418  ? 210.660 275.909 259.029 1.00 0.00 ? 418  TYR A O     1 
ATOM   3024  C  CB    . TYR A  1  418  ? 211.918 272.986 259.437 1.00 0.00 ? 418  TYR A CB    1 
ATOM   3025  C  CG    . TYR A  1  418  ? 212.498 271.697 258.930 1.00 0.00 ? 418  TYR A CG    1 
ATOM   3026  C  CD1   . TYR A  1  418  ? 212.016 270.467 259.344 1.00 0.00 ? 418  TYR A CD1   1 
ATOM   3027  C  CD2   . TYR A  1  418  ? 213.586 271.713 258.078 1.00 0.00 ? 418  TYR A CD2   1 
ATOM   3028  C  CE1   . TYR A  1  418  ? 212.576 269.286 258.871 1.00 0.00 ? 418  TYR A CE1   1 
ATOM   3029  C  CE2   . TYR A  1  418  ? 214.152 270.546 257.605 1.00 0.00 ? 418  TYR A CE2   1 
ATOM   3030  C  CZ    . TYR A  1  418  ? 213.644 269.335 258.004 1.00 0.00 ? 418  TYR A CZ    1 
ATOM   3031  O  OH    . TYR A  1  418  ? 214.214 268.169 257.552 1.00 0.00 ? 418  TYR A OH    1 
ATOM   3032  N  N     . ILE A  1  419  ? 209.701 274.657 260.617 1.00 0.00 ? 419  ILE A N     1 
ATOM   3033  C  CA    . ILE A  1  419  ? 209.471 275.767 261.527 1.00 0.00 ? 419  ILE A CA    1 
ATOM   3034  C  C     . ILE A  1  419  ? 210.019 275.403 262.934 1.00 0.00 ? 419  ILE A C     1 
ATOM   3035  O  O     . ILE A  1  419  ? 209.734 274.326 263.459 1.00 0.00 ? 419  ILE A O     1 
ATOM   3036  C  CB    . ILE A  1  419  ? 207.993 276.134 261.562 1.00 0.00 ? 419  ILE A CB    1 
ATOM   3037  C  CG1   . ILE A  1  419  ? 207.743 277.302 262.506 1.00 0.00 ? 419  ILE A CG1   1 
ATOM   3038  C  CG2   . ILE A  1  419  ? 207.153 274.960 261.998 1.00 0.00 ? 419  ILE A CG2   1 
ATOM   3039  C  CD1   . ILE A  1  419  ? 206.291 277.660 262.609 1.00 0.00 ? 419  ILE A CD1   1 
ATOM   3040  N  N     . ILE A  1  420  ? 210.804 276.306 263.538 1.00 0.00 ? 420  ILE A N     1 
ATOM   3041  C  CA    . ILE A  1  420  ? 211.449 276.040 264.829 1.00 0.00 ? 420  ILE A CA    1 
ATOM   3042  C  C     . ILE A  1  420  ? 210.879 276.964 265.886 1.00 0.00 ? 420  ILE A C     1 
ATOM   3043  O  O     . ILE A  1  420  ? 210.915 278.189 265.744 1.00 0.00 ? 420  ILE A O     1 
ATOM   3044  C  CB    . ILE A  1  420  ? 212.994 276.260 264.844 1.00 0.00 ? 420  ILE A CB    1 
ATOM   3045  C  CG1   . ILE A  1  420  ? 213.762 275.238 263.996 1.00 0.00 ? 420  ILE A CG1   1 
ATOM   3046  C  CG2   . ILE A  1  420  ? 213.530 276.155 266.266 1.00 0.00 ? 420  ILE A CG2   1 
ATOM   3047  C  CD1   . ILE A  1  420  ? 213.563 275.332 262.507 1.00 0.00 ? 420  ILE A CD1   1 
ATOM   3048  N  N     . ARG A  1  421  ? 210.356 276.359 266.950 1.00 0.00 ? 421  ARG A N     1 
ATOM   3049  C  CA    . ARG A  1  421  ? 209.811 277.107 268.074 1.00 0.00 ? 421  ARG A CA    1 
ATOM   3050  C  C     . ARG A  1  421  ? 210.899 277.643 268.979 1.00 0.00 ? 421  ARG A C     1 
ATOM   3051  O  O     . ARG A  1  421  ? 211.948 277.017 269.160 1.00 0.00 ? 421  ARG A O     1 
ATOM   3052  C  CB    . ARG A  1  421  ? 208.846 276.250 268.889 1.00 0.00 ? 421  ARG A CB    1 
ATOM   3053  C  CG    . ARG A  1  421  ? 207.670 275.745 268.094 1.00 0.00 ? 421  ARG A CG    1 
ATOM   3054  C  CD    . ARG A  1  421  ? 206.660 275.093 268.993 1.00 0.00 ? 421  ARG A CD    1 
ATOM   3055  N  NE    . ARG A  1  421  ? 205.442 274.752 268.268 1.00 0.00 ? 421  ARG A NE    1 
ATOM   3056  C  CZ    . ARG A  1  421  ? 204.598 273.799 268.648 1.00 0.00 ? 421  ARG A CZ    1 
ATOM   3057  N  NH1   . ARG A  1  421  ? 204.838 273.099 269.752 1.00 0.00 ? 421  ARG A NH1   1 
ATOM   3058  N  NH2   . ARG A  1  421  ? 203.500 273.560 267.940 1.00 0.00 ? 421  ARG A NH2   1 
ATOM   3059  N  N     . ASP A  1  422  ? 210.630 278.816 269.540 1.00 0.00 ? 422  ASP A N     1 
ATOM   3060  C  CA    . ASP A  1  422  ? 211.538 279.464 270.469 1.00 0.00 ? 422  ASP A CA    1 
ATOM   3061  C  C     . ASP A  1  422  ? 211.885 278.527 271.614 1.00 0.00 ? 422  ASP A C     1 
ATOM   3062  O  O     . ASP A  1  422  ? 212.991 278.568 272.152 1.00 0.00 ? 422  ASP A O     1 
ATOM   3063  C  CB    . ASP A  1  422  ? 210.904 280.744 271.013 1.00 0.00 ? 422  ASP A CB    1 
ATOM   3064  C  CG    . ASP A  1  422  ? 211.867 281.565 271.837 1.00 0.00 ? 422  ASP A CG    1 
ATOM   3065  O  OD1   . ASP A  1  422  ? 213.065 281.602 271.478 1.00 0.00 ? 422  ASP A OD1   1 
ATOM   3066  O  OD2   . ASP A  1  422  ? 211.427 282.165 272.848 1.00 0.00 ? 422  ASP A OD2   1 
ATOM   3067  N  N     . ASN A  1  423  ? 210.932 277.670 271.960 1.00 0.00 ? 423  ASN A N     1 
ATOM   3068  C  CA    . ASN A  1  423  ? 211.132 276.654 272.977 1.00 0.00 ? 423  ASN A CA    1 
ATOM   3069  C  C     . ASN A  1  423  ? 212.317 275.747 272.654 1.00 0.00 ? 423  ASN A C     1 
ATOM   3070  O  O     . ASN A  1  423  ? 213.009 275.265 273.552 1.00 0.00 ? 423  ASN A O     1 
ATOM   3071  C  CB    . ASN A  1  423  ? 209.862 275.824 273.142 1.00 0.00 ? 423  ASN A CB    1 
ATOM   3072  C  CG    . ASN A  1  423  ? 209.959 274.836 274.284 1.00 0.00 ? 423  ASN A CG    1 
ATOM   3073  O  OD1   . ASN A  1  423  ? 210.678 275.067 275.260 1.00 0.00 ? 423  ASN A OD1   1 
ATOM   3074  N  ND2   . ASN A  1  423  ? 209.225 273.733 274.178 1.00 0.00 ? 423  ASN A ND2   1 
ATOM   3075  N  N     . GLY A  1  424  ? 212.546 275.515 271.367 1.00 0.00 ? 424  GLY A N     1 
ATOM   3076  C  CA    . GLY A  1  424  ? 213.657 274.692 270.927 1.00 0.00 ? 424  GLY A CA    1 
ATOM   3077  C  C     . GLY A  1  424  ? 213.165 273.586 270.024 1.00 0.00 ? 424  GLY A C     1 
ATOM   3078  O  O     . GLY A  1  424  ? 213.949 272.842 269.434 1.00 0.00 ? 424  GLY A O     1 
ATOM   3079  N  N     . ASP A  1  425  ? 211.845 273.487 269.919 1.00 0.00 ? 425  ASP A N     1 
ATOM   3080  C  CA    . ASP A  1  425  ? 211.216 272.477 269.082 1.00 0.00 ? 425  ASP A CA    1 
ATOM   3081  C  C     . ASP A  1  425  ? 211.422 272.779 267.603 1.00 0.00 ? 425  ASP A C     1 
ATOM   3082  O  O     . ASP A  1  425  ? 211.305 273.925 267.167 1.00 0.00 ? 425  ASP A O     1 
ATOM   3083  C  CB    . ASP A  1  425  ? 209.718 272.369 269.390 1.00 0.00 ? 425  ASP A CB    1 
ATOM   3084  C  CG    . ASP A  1  425  ? 209.442 272.023 270.838 1.00 0.00 ? 425  ASP A CG    1 
ATOM   3085  O  OD1   . ASP A  1  425  ? 210.347 271.478 271.506 1.00 0.00 ? 425  ASP A OD1   1 
ATOM   3086  O  OD2   . ASP A  1  425  ? 208.315 272.286 271.304 1.00 0.00 ? 425  ASP A OD2   1 
ATOM   3087  N  N     . ARG A  1  426  ? 211.771 271.742 266.851 1.00 0.00 ? 426  ARG A N     1 
ATOM   3088  C  CA    . ARG A  1  426  ? 211.821 271.815 265.398 1.00 0.00 ? 426  ARG A CA    1 
ATOM   3089  C  C     . ARG A  1  426  ? 210.693 270.937 264.861 1.00 0.00 ? 426  ARG A C     1 
ATOM   3090  O  O     . ARG A  1  426  ? 210.473 269.821 265.330 1.00 0.00 ? 426  ARG A O     1 
ATOM   3091  C  CB    . ARG A  1  426  ? 213.214 271.422 264.887 1.00 0.00 ? 426  ARG A CB    1 
ATOM   3092  C  CG    . ARG A  1  426  ? 213.433 271.488 263.384 1.00 0.00 ? 426  ARG A CG    1 
ATOM   3093  C  CD    . ARG A  1  426  ? 214.930 271.602 263.079 1.00 0.00 ? 426  ARG A CD    1 
ATOM   3094  N  NE    . ARG A  1  426  ? 215.300 271.114 261.758 1.00 0.00 ? 426  ARG A NE    1 
ATOM   3095  C  CZ    . ARG A  1  426  ? 215.648 269.862 261.465 1.00 0.00 ? 426  ARG A CZ    1 
ATOM   3096  N  NH1   . ARG A  1  426  ? 215.823 268.982 262.440 1.00 0.00 ? 426  ARG A NH1   1 
ATOM   3097  N  NH2   . ARG A  1  426  ? 215.716 269.460 260.205 1.00 0.00 ? 426  ARG A NH2   1 
ATOM   3098  N  N     . ILE A  1  427  ? 209.991 271.452 263.862 1.00 0.00 ? 427  ILE A N     1 
ATOM   3099  C  CA    . ILE A  1  427  ? 208.764 270.847 263.362 1.00 0.00 ? 427  ILE A CA    1 
ATOM   3100  C  C     . ILE A  1  427  ? 208.856 270.672 261.866 1.00 0.00 ? 427  ILE A C     1 
ATOM   3101  O  O     . ILE A  1  427  ? 209.226 271.591 261.143 1.00 0.00 ? 427  ILE A O     1 
ATOM   3102  C  CB    . ILE A  1  427  ? 207.535 271.711 263.694 1.00 0.00 ? 427  ILE A CB    1 
ATOM   3103  C  CG1   . ILE A  1  427  ? 207.254 271.661 265.193 1.00 0.00 ? 427  ILE A CG1   1 
ATOM   3104  C  CG2   . ILE A  1  427  ? 206.320 271.249 262.912 1.00 0.00 ? 427  ILE A CG2   1 
ATOM   3105  C  CD1   . ILE A  1  427  ? 206.065 272.492 265.641 1.00 0.00 ? 427  ILE A CD1   1 
ATOM   3106  N  N     . ASP A  1  428  ? 208.525 269.479 261.399 1.00 0.00 ? 428  ASP A N     1 
ATOM   3107  C  CA    . ASP A  1  428  ? 208.499 269.230 259.971 1.00 0.00 ? 428  ASP A CA    1 
ATOM   3108  C  C     . ASP A  1  428  ? 207.232 269.784 259.349 1.00 0.00 ? 428  ASP A C     1 
ATOM   3109  O  O     . ASP A  1  428  ? 206.196 269.852 259.995 1.00 0.00 ? 428  ASP A O     1 
ATOM   3110  C  CB    . ASP A  1  428  ? 208.601 267.730 259.713 1.00 0.00 ? 428  ASP A CB    1 
ATOM   3111  C  CG    . ASP A  1  428  ? 208.769 267.400 258.248 1.00 0.00 ? 428  ASP A CG    1 
ATOM   3112  O  OD1   . ASP A  1  428  ? 207.806 267.631 257.482 1.00 0.00 ? 428  ASP A OD1   1 
ATOM   3113  O  OD2   . ASP A  1  428  ? 209.846 266.884 257.870 1.00 0.00 ? 428  ASP A OD2   1 
ATOM   3114  N  N     . LEU A  1  429  ? 207.333 270.231 258.105 1.00 0.00 ? 429  LEU A N     1 
ATOM   3115  C  CA    . LEU A  1  429  ? 206.184 270.775 257.414 1.00 0.00 ? 429  LEU A CA    1 
ATOM   3116  C  C     . LEU A  1  429  ? 205.690 269.870 256.302 1.00 0.00 ? 429  LEU A C     1 
ATOM   3117  O  O     . LEU A  1  429  ? 205.111 270.349 255.331 1.00 0.00 ? 429  LEU A O     1 
ATOM   3118  C  CB    . LEU A  1  429  ? 206.511 272.142 256.844 1.00 0.00 ? 429  LEU A CB    1 
ATOM   3119  C  CG    . LEU A  1  429  ? 206.790 273.179 257.912 1.00 0.00 ? 429  LEU A CG    1 
ATOM   3120  C  CD1   . LEU A  1  429  ? 207.188 274.497 257.282 1.00 0.00 ? 429  LEU A CD1   1 
ATOM   3121  C  CD2   . LEU A  1  429  ? 205.549 273.335 258.758 1.00 0.00 ? 429  LEU A CD2   1 
ATOM   3122  N  N     . ARG A  1  430  ? 205.895 268.564 256.441 1.00 0.00 ? 430  ARG A N     1 
ATOM   3123  C  CA    . ARG A  1  430  ? 205.313 267.604 255.501 1.00 0.00 ? 430  ARG A CA    1 
ATOM   3124  C  C     . ARG A  1  430  ? 204.320 266.690 256.188 1.00 0.00 ? 430  ARG A C     1 
ATOM   3125  O  O     . ARG A  1  430  ? 203.303 266.323 255.607 1.00 0.00 ? 430  ARG A O     1 
ATOM   3126  C  CB    . ARG A  1  430  ? 206.391 266.757 254.822 1.00 0.00 ? 430  ARG A CB    1 
ATOM   3127  C  CG    . ARG A  1  430  ? 207.423 267.552 254.063 1.00 0.00 ? 430  ARG A CG    1 
ATOM   3128  C  CD    . ARG A  1  430  ? 208.627 266.699 253.713 1.00 0.00 ? 430  ARG A CD    1 
ATOM   3129  N  NE    . ARG A  1  430  ? 209.361 266.323 254.918 1.00 0.00 ? 430  ARG A NE    1 
ATOM   3130  C  CZ    . ARG A  1  430  ? 210.435 265.539 254.939 1.00 0.00 ? 430  ARG A CZ    1 
ATOM   3131  N  NH1   . ARG A  1  430  ? 210.935 265.055 253.805 1.00 0.00 ? 430  ARG A NH1   1 
ATOM   3132  N  NH2   . ARG A  1  430  ? 211.029 265.267 256.097 1.00 0.00 ? 430  ARG A NH2   1 
ATOM   3133  N  N     . PHE A  1  431  ? 204.616 266.302 257.417 1.00 0.00 ? 431  PHE A N     1 
ATOM   3134  C  CA    . PHE A  1  431  ? 203.769 265.328 258.077 1.00 0.00 ? 431  PHE A CA    1 
ATOM   3135  C  C     . PHE A  1  431  ? 202.495 265.923 258.664 1.00 0.00 ? 431  PHE A C     1 
ATOM   3136  O  O     . PHE A  1  431  ? 201.442 265.290 258.624 1.00 0.00 ? 431  PHE A O     1 
ATOM   3137  C  CB    . PHE A  1  431  ? 204.574 264.616 259.153 1.00 0.00 ? 431  PHE A CB    1 
ATOM   3138  C  CG    . PHE A  1  431  ? 205.569 263.656 258.596 1.00 0.00 ? 431  PHE A CG    1 
ATOM   3139  C  CD1   . PHE A  1  431  ? 206.819 264.096 258.193 1.00 0.00 ? 431  PHE A CD1   1 
ATOM   3140  C  CD2   . PHE A  1  431  ? 205.243 262.321 258.423 1.00 0.00 ? 431  PHE A CD2   1 
ATOM   3141  C  CE1   . PHE A  1  431  ? 207.743 263.213 257.654 1.00 0.00 ? 431  PHE A CE1   1 
ATOM   3142  C  CE2   . PHE A  1  431  ? 206.160 261.430 257.886 1.00 0.00 ? 431  PHE A CE2   1 
ATOM   3143  C  CZ    . PHE A  1  431  ? 207.413 261.877 257.500 1.00 0.00 ? 431  PHE A CZ    1 
ATOM   3144  N  N     . HIS A  1  432  ? 202.580 267.149 259.165 1.00 0.00 ? 432  HIS A N     1 
ATOM   3145  C  CA    . HIS A  1  432  ? 201.439 267.775 259.826 1.00 0.00 ? 432  HIS A CA    1 
ATOM   3146  C  C     . HIS A  1  432  ? 200.294 268.066 258.855 1.00 0.00 ? 432  HIS A C     1 
ATOM   3147  O  O     . HIS A  1  432  ? 200.483 268.770 257.864 1.00 0.00 ? 432  HIS A O     1 
ATOM   3148  C  CB    . HIS A  1  432  ? 201.872 269.056 260.523 1.00 0.00 ? 432  HIS A CB    1 
ATOM   3149  C  CG    . HIS A  1  432  ? 200.898 269.523 261.552 1.00 0.00 ? 432  HIS A CG    1 
ATOM   3150  N  ND1   . HIS A  1  432  ? 199.705 270.130 261.227 1.00 0.00 ? 432  HIS A ND1   1 
ATOM   3151  C  CD2   . HIS A  1  432  ? 200.925 269.446 262.904 1.00 0.00 ? 432  HIS A CD2   1 
ATOM   3152  C  CE1   . HIS A  1  432  ? 199.043 270.421 262.335 1.00 0.00 ? 432  HIS A CE1   1 
ATOM   3153  N  NE2   . HIS A  1  432  ? 199.764 270.015 263.366 1.00 0.00 ? 432  HIS A NE2   1 
ATOM   3154  N  N     . PRO A  1  433  ? 199.093 267.535 259.155 1.00 0.00 ? 433  PRO A N     1 
ATOM   3155  C  CA    . PRO A  1  433  ? 197.931 267.532 258.250 1.00 0.00 ? 433  PRO A CA    1 
ATOM   3156  C  C     . PRO A  1  433  ? 197.254 268.887 258.051 1.00 0.00 ? 433  PRO A C     1 
ATOM   3157  O  O     . PRO A  1  433  ? 196.538 269.074 257.064 1.00 0.00 ? 433  PRO A O     1 
ATOM   3158  C  CB    . PRO A  1  433  ? 196.964 266.569 258.945 1.00 0.00 ? 433  PRO A CB    1 
ATOM   3159  C  CG    . PRO A  1  433  ? 197.266 266.749 260.393 1.00 0.00 ? 433  PRO A CG    1 
ATOM   3160  C  CD    . PRO A  1  433  ? 198.765 266.940 260.464 1.00 0.00 ? 433  PRO A CD    1 
ATOM   3161  N  N     . LYS A  1  434  ? 197.486 269.824 258.963 1.00 0.00 ? 434  LYS A N     1 
ATOM   3162  C  CA    . LYS A  1  434  ? 196.865 271.142 258.860 1.00 0.00 ? 434  LYS A CA    1 
ATOM   3163  C  C     . LYS A  1  434  ? 197.833 272.249 259.279 1.00 0.00 ? 434  LYS A C     1 
ATOM   3164  O  O     . LYS A  1  434  ? 197.677 272.832 260.357 1.00 0.00 ? 434  LYS A O     1 
ATOM   3165  C  CB    . LYS A  1  434  ? 195.589 271.208 259.711 1.00 0.00 ? 434  LYS A CB    1 
ATOM   3166  C  CG    . LYS A  1  434  ? 194.726 272.433 259.429 1.00 0.00 ? 434  LYS A CG    1 
ATOM   3167  C  CD    . LYS A  1  434  ? 193.504 272.476 260.325 1.00 0.00 ? 434  LYS A CD    1 
ATOM   3168  C  CE    . LYS A  1  434  ? 192.538 271.364 259.972 1.00 0.00 ? 434  LYS A CE    1 
ATOM   3169  N  NZ    . LYS A  1  434  ? 191.717 271.720 258.781 1.00 0.00 ? 434  LYS A NZ    1 
ATOM   3170  N  N     . PRO A  1  435  ? 198.851 272.524 258.434 1.00 0.00 ? 435  PRO A N     1 
ATOM   3171  C  CA    . PRO A  1  435  ? 199.829 273.598 258.656 1.00 0.00 ? 435  PRO A CA    1 
ATOM   3172  C  C     . PRO A  1  435  ? 199.175 274.921 259.075 1.00 0.00 ? 435  PRO A C     1 
ATOM   3173  O  O     . PRO A  1  435  ? 199.757 275.678 259.858 1.00 0.00 ? 435  PRO A O     1 
ATOM   3174  C  CB    . PRO A  1  435  ? 200.515 273.728 257.293 1.00 0.00 ? 435  PRO A CB    1 
ATOM   3175  C  CG    . PRO A  1  435  ? 200.464 272.348 256.739 1.00 0.00 ? 435  PRO A CG    1 
ATOM   3176  C  CD    . PRO A  1  435  ? 199.134 271.789 257.187 1.00 0.00 ? 435  PRO A CD    1 
ATOM   3177  N  N     . SER A  1  436  ? 197.975 275.179 258.555 1.00 0.00 ? 436  SER A N     1 
ATOM   3178  C  CA    . SER A  1  436  ? 197.184 276.355 258.915 1.00 0.00 ? 436  SER A CA    1 
ATOM   3179  C  C     . SER A  1  436  ? 196.898 276.421 260.418 1.00 0.00 ? 436  SER A C     1 
ATOM   3180  O  O     . SER A  1  436  ? 196.764 277.509 260.985 1.00 0.00 ? 436  SER A O     1 
ATOM   3181  C  CB    . SER A  1  436  ? 195.863 276.375 258.132 1.00 0.00 ? 436  SER A CB    1 
ATOM   3182  O  OG    . SER A  1  436  ? 196.064 276.066 256.762 1.00 0.00 ? 436  SER A OG    1 
ATOM   3183  N  N     . ASP A  1  437  ? 196.820 275.259 261.060 1.00 0.00 ? 437  ASP A N     1 
ATOM   3184  C  CA    . ASP A  1  437  ? 196.555 275.192 262.494 1.00 0.00 ? 437  ASP A CA    1 
ATOM   3185  C  C     . ASP A  1  437  ? 197.828 275.518 263.284 1.00 0.00 ? 437  ASP A C     1 
ATOM   3186  O  O     . ASP A  1  437  ? 197.780 275.776 264.490 1.00 0.00 ? 437  ASP A O     1 
ATOM   3187  C  CB    . ASP A  1  437  ? 196.010 273.806 262.869 1.00 0.00 ? 437  ASP A CB    1 
ATOM   3188  C  CG    . ASP A  1  437  ? 195.634 273.696 264.337 1.00 0.00 ? 437  ASP A CG    1 
ATOM   3189  O  OD1   . ASP A  1  437  ? 194.891 274.571 264.834 1.00 0.00 ? 437  ASP A OD1   1 
ATOM   3190  O  OD2   . ASP A  1  437  ? 196.073 272.724 264.989 1.00 0.00 ? 437  ASP A OD2   1 
ATOM   3191  N  N     . LEU A  1  438  ? 198.963 275.526 262.592 1.00 0.00 ? 438  LEU A N     1 
ATOM   3192  C  CA    . LEU A  1  438  ? 200.239 275.829 263.226 1.00 0.00 ? 438  LEU A CA    1 
ATOM   3193  C  C     . LEU A  1  438  ? 200.579 277.306 263.054 1.00 0.00 ? 438  LEU A C     1 
ATOM   3194  O  O     . LEU A  1  438  ? 201.426 277.677 262.241 1.00 0.00 ? 438  LEU A O     1 
ATOM   3195  C  CB    . LEU A  1  438  ? 201.346 274.949 262.651 1.00 0.00 ? 438  LEU A CB    1 
ATOM   3196  C  CG    . LEU A  1  438  ? 202.664 274.946 263.422 1.00 0.00 ? 438  LEU A CG    1 
ATOM   3197  C  CD1   . LEU A  1  438  ? 202.470 274.396 264.832 1.00 0.00 ? 438  LEU A CD1   1 
ATOM   3198  C  CD2   . LEU A  1  438  ? 203.693 274.130 262.648 1.00 0.00 ? 438  LEU A CD2   1 
ATOM   3199  N  N     . HIS A  1  439  ? 199.886 278.140 263.823 1.00 0.00 ? 439  HIS A N     1 
ATOM   3200  C  CA    . HIS A  1  439  ? 200.018 279.592 263.751 1.00 0.00 ? 439  HIS A CA    1 
ATOM   3201  C  C     . HIS A  1  439  ? 201.402 280.091 264.184 1.00 0.00 ? 439  HIS A C     1 
ATOM   3202  O  O     . HIS A  1  439  ? 201.890 279.731 265.255 1.00 0.00 ? 439  HIS A O     1 
ATOM   3203  C  CB    . HIS A  1  439  ? 198.932 280.240 264.615 1.00 0.00 ? 439  HIS A CB    1 
ATOM   3204  C  CG    . HIS A  1  439  ? 198.829 281.723 264.449 1.00 0.00 ? 439  HIS A CG    1 
ATOM   3205  N  ND1   . HIS A  1  439  ? 198.580 282.322 263.232 1.00 0.00 ? 439  HIS A ND1   1 
ATOM   3206  C  CD2   . HIS A  1  439  ? 198.934 282.730 265.350 1.00 0.00 ? 439  HIS A CD2   1 
ATOM   3207  C  CE1   . HIS A  1  439  ? 198.540 283.633 263.391 1.00 0.00 ? 439  HIS A CE1   1 
ATOM   3208  N  NE2   . HIS A  1  439  ? 198.752 283.906 264.666 1.00 0.00 ? 439  HIS A NE2   1 
ATOM   3209  N  N     . LEU A  1  440  ? 202.028 280.922 263.354 1.00 0.00 ? 440  LEU A N     1 
ATOM   3210  C  CA    . LEU A  1  440  ? 203.349 281.467 263.668 1.00 0.00 ? 440  LEU A CA    1 
ATOM   3211  C  C     . LEU A  1  440  ? 203.258 282.623 264.664 1.00 0.00 ? 440  LEU A C     1 
ATOM   3212  O  O     . LEU A  1  440  ? 202.189 283.203 264.860 1.00 0.00 ? 440  LEU A O     1 
ATOM   3213  C  CB    . LEU A  1  440  ? 204.061 281.935 262.397 1.00 0.00 ? 440  LEU A CB    1 
ATOM   3214  C  CG    . LEU A  1  440  ? 204.862 280.884 261.629 1.00 0.00 ? 440  LEU A CG    1 
ATOM   3215  C  CD1   . LEU A  1  440  ? 203.940 279.842 261.027 1.00 0.00 ? 440  LEU A CD1   1 
ATOM   3216  C  CD2   . LEU A  1  440  ? 205.707 281.529 260.550 1.00 0.00 ? 440  LEU A CD2   1 
ATOM   3217  N  N     . GLN A  1  441  ? 204.380 282.936 265.309 1.00 0.00 ? 441  GLN A N     1 
ATOM   3218  C  CA    . GLN A  1  441  ? 204.472 284.104 266.184 1.00 0.00 ? 441  GLN A CA    1 
ATOM   3219  C  C     . GLN A  1  441  ? 205.924 284.539 266.327 1.00 0.00 ? 441  GLN A C     1 
ATOM   3220  O  O     . GLN A  1  441  ? 206.832 283.715 266.215 1.00 0.00 ? 441  GLN A O     1 
ATOM   3221  C  CB    . GLN A  1  441  ? 203.879 283.802 267.549 1.00 0.00 ? 441  GLN A CB    1 
ATOM   3222  C  CG    . GLN A  1  441  ? 204.605 282.694 268.266 1.00 0.00 ? 441  GLN A CG    1 
ATOM   3223  C  CD    . GLN A  1  441  ? 203.912 282.291 269.544 1.00 0.00 ? 441  GLN A CD    1 
ATOM   3224  O  OE1   . GLN A  1  441  ? 202.721 282.558 269.732 1.00 0.00 ? 441  GLN A OE1   1 
ATOM   3225  N  NE2   . GLN A  1  441  ? 204.654 281.644 270.438 1.00 0.00 ? 441  GLN A NE2   1 
ATOM   3226  N  N     . THR A  1  442  ? 206.133 285.820 266.620 1.00 0.00 ? 442  THR A N     1 
ATOM   3227  C  CA    . THR A  1  442  ? 207.472 286.423 266.630 1.00 0.00 ? 442  THR A CA    1 
ATOM   3228  C  C     . THR A  1  442  ? 208.447 285.724 267.573 1.00 0.00 ? 442  THR A C     1 
ATOM   3229  O  O     . THR A  1  442  ? 208.239 285.689 268.783 1.00 0.00 ? 442  THR A O     1 
ATOM   3230  C  CB    . THR A  1  442  ? 207.418 287.910 267.022 1.00 0.00 ? 442  THR A CB    1 
ATOM   3231  O  OG1   . THR A  1  442  ? 206.636 288.061 268.213 1.00 0.00 ? 442  THR A OG1   1 
ATOM   3232  C  CG2   . THR A  1  442  ? 206.807 288.739 265.898 1.00 0.00 ? 442  THR A CG2   1 
ATOM   3233  N  N     . GLY A  1  443  ? 209.514 285.176 267.002 1.00 0.00 ? 443  GLY A N     1 
ATOM   3234  C  CA    . GLY A  1  443  ? 210.504 284.445 267.769 1.00 0.00 ? 443  GLY A CA    1 
ATOM   3235  C  C     . GLY A  1  443  ? 210.760 283.056 267.219 1.00 0.00 ? 443  GLY A C     1 
ATOM   3236  O  O     . GLY A  1  443  ? 211.784 282.446 267.518 1.00 0.00 ? 443  GLY A O     1 
ATOM   3237  N  N     . TYR A  1  444  ? 209.820 282.551 266.426 1.00 0.00 ? 444  TYR A N     1 
ATOM   3238  C  CA    . TYR A  1  444  ? 210.000 281.297 265.696 1.00 0.00 ? 444  TYR A CA    1 
ATOM   3239  C  C     . TYR A  1  444  ? 210.953 281.497 264.537 1.00 0.00 ? 444  TYR A C     1 
ATOM   3240  O  O     . TYR A  1  444  ? 211.010 282.582 263.965 1.00 0.00 ? 444  TYR A O     1 
ATOM   3241  C  CB    . TYR A  1  444  ? 208.668 280.775 265.152 1.00 0.00 ? 444  TYR A CB    1 
ATOM   3242  C  CG    . TYR A  1  444  ? 207.717 280.226 266.184 1.00 0.00 ? 444  TYR A CG    1 
ATOM   3243  C  CD1   . TYR A  1  444  ? 208.137 279.970 267.480 1.00 0.00 ? 444  TYR A CD1   1 
ATOM   3244  C  CD2   . TYR A  1  444  ? 206.388 279.972 265.861 1.00 0.00 ? 444  TYR A CD2   1 
ATOM   3245  C  CE1   . TYR A  1  444  ? 207.268 279.462 268.429 1.00 0.00 ? 444  TYR A CE1   1 
ATOM   3246  C  CE2   . TYR A  1  444  ? 205.510 279.470 266.802 1.00 0.00 ? 444  TYR A CE2   1 
ATOM   3247  C  CZ    . TYR A  1  444  ? 205.956 279.216 268.085 1.00 0.00 ? 444  TYR A CZ    1 
ATOM   3248  O  OH    . TYR A  1  444  ? 205.093 278.713 269.032 1.00 0.00 ? 444  TYR A OH    1 
ATOM   3249  N  N     . LYS A  1  445  ? 211.703 280.461 264.188 1.00 0.00 ? 445  LYS A N     1 
ATOM   3250  C  CA    . LYS A  1  445  ? 212.549 280.529 263.006 1.00 0.00 ? 445  LYS A CA    1 
ATOM   3251  C  C     . LYS A  1  445  ? 211.912 279.677 261.921 1.00 0.00 ? 445  LYS A C     1 
ATOM   3252  O  O     . LYS A  1  445  ? 211.416 278.589 262.206 1.00 0.00 ? 445  LYS A O     1 
ATOM   3253  C  CB    . LYS A  1  445  ? 213.984 280.082 263.324 1.00 0.00 ? 445  LYS A CB    1 
ATOM   3254  C  CG    . LYS A  1  445  ? 214.595 280.840 264.495 1.00 0.00 ? 445  LYS A CG    1 
ATOM   3255  C  CD    . LYS A  1  445  ? 216.026 280.445 264.796 1.00 0.00 ? 445  LYS A CD    1 
ATOM   3256  C  CE    . LYS A  1  445  ? 216.110 278.988 265.214 1.00 0.00 ? 445  LYS A CE    1 
ATOM   3257  N  NZ    . LYS A  1  445  ? 217.442 278.634 265.793 1.00 0.00 ? 445  LYS A NZ    1 
ATOM   3258  N  N     . VAL A  1  446  ? 211.943 280.155 260.676 1.00 0.00 ? 446  VAL A N     1 
ATOM   3259  C  CA    . VAL A  1  446  ? 211.367 279.394 259.578 1.00 0.00 ? 446  VAL A CA    1 
ATOM   3260  C  C     . VAL A  1  446  ? 212.420 279.033 258.538 1.00 0.00 ? 446  VAL A C     1 
ATOM   3261  O  O     . VAL A  1  446  ? 212.997 279.920 257.907 1.00 0.00 ? 446  VAL A O     1 
ATOM   3262  C  CB    . VAL A  1  446  ? 210.282 280.210 258.848 1.00 0.00 ? 446  VAL A CB    1 
ATOM   3263  C  CG1   . VAL A  1  446  ? 209.708 279.407 257.708 1.00 0.00 ? 446  VAL A CG1   1 
ATOM   3264  C  CG2   . VAL A  1  446  ? 209.189 280.605 259.788 1.00 0.00 ? 446  VAL A CG2   1 
ATOM   3265  N  N     . GLU A  1  447  ? 212.666 277.741 258.343 1.00 0.00 ? 447  GLU A N     1 
ATOM   3266  C  CA    . GLU A  1  447  ? 213.640 277.312 257.349 1.00 0.00 ? 447  GLU A CA    1 
ATOM   3267  C  C     . GLU A  1  447  ? 213.039 277.115 255.977 1.00 0.00 ? 447  GLU A C     1 
ATOM   3268  O  O     . GLU A  1  447  ? 212.460 276.076 255.680 1.00 0.00 ? 447  GLU A O     1 
ATOM   3269  C  CB    . GLU A  1  447  ? 214.434 276.088 257.749 1.00 0.00 ? 447  GLU A CB    1 
ATOM   3270  C  CG    . GLU A  1  447  ? 215.205 276.286 259.018 1.00 0.00 ? 447  GLU A CG    1 
ATOM   3271  C  CD    . GLU A  1  447  ? 216.205 275.162 259.263 1.00 0.00 ? 447  GLU A CD    1 
ATOM   3272  O  OE1   . GLU A  1  447  ? 215.824 273.970 259.156 1.00 0.00 ? 447  GLU A OE1   1 
ATOM   3273  O  OE2   . GLU A  1  447  ? 217.383 275.486 259.570 1.00 0.00 ? 447  GLU A OE2   1 
ATOM   3274  N  N     . ARG A  1  448  ? 213.171 278.140 255.151 1.00 0.00 ? 448  ARG A N     1 
ATOM   3275  C  CA    . ARG A  1  448  ? 212.525 278.202 253.864 1.00 0.00 ? 448  ARG A CA    1 
ATOM   3276  C  C     . ARG A  1  448  ? 213.472 277.791 252.750 1.00 0.00 ? 448  ARG A C     1 
ATOM   3277  O  O     . ARG A  1  448  ? 214.673 277.744 252.951 1.00 0.00 ? 448  ARG A O     1 
ATOM   3278  C  CB    . ARG A  1  448  ? 212.028 279.623 253.648 1.00 0.00 ? 448  ARG A CB    1 
ATOM   3279  C  CG    . ARG A  1  448  ? 213.138 280.628 253.591 1.00 0.00 ? 448  ARG A CG    1 
ATOM   3280  C  CD    . ARG A  1  448  ? 212.782 281.825 252.762 1.00 0.00 ? 448  ARG A CD    1 
ATOM   3281  N  NE    . ARG A  1  448  ? 213.882 282.794 252.730 1.00 0.00 ? 448  ARG A NE    1 
ATOM   3282  C  CZ    . ARG A  1  448  ? 214.961 282.747 251.947 1.00 0.00 ? 448  ARG A CZ    1 
ATOM   3283  N  NH1   . ARG A  1  448  ? 215.129 281.757 251.075 1.00 0.00 ? 448  ARG A NH1   1 
ATOM   3284  N  NH2   . ARG A  1  448  ? 215.869 283.720 252.017 1.00 0.00 ? 448  ARG A NH2   1 
ATOM   3285  N  N     . HIS A  1  449  ? 212.925 277.419 251.594 1.00 0.00 ? 449  HIS A N     1 
ATOM   3286  C  CA    . HIS A  1  449  ? 213.735 277.108 250.418 1.00 0.00 ? 449  HIS A CA    1 
ATOM   3287  C  C     . HIS A  1  449  ? 214.451 278.381 249.950 1.00 0.00 ? 449  HIS A C     1 
ATOM   3288  O  O     . HIS A  1  449  ? 213.880 279.473 250.053 1.00 0.00 ? 449  HIS A O     1 
ATOM   3289  C  CB    . HIS A  1  449  ? 212.857 276.563 249.285 1.00 0.00 ? 449  HIS A CB    1 
ATOM   3290  C  CG    . HIS A  1  449  ? 212.063 275.345 249.645 1.00 0.00 ? 449  HIS A CG    1 
ATOM   3291  N  ND1   . HIS A  1  449  ? 211.797 274.980 250.945 1.00 0.00 ? 449  HIS A ND1   1 
ATOM   3292  C  CD2   . HIS A  1  449  ? 211.425 274.441 248.865 1.00 0.00 ? 449  HIS A CD2   1 
ATOM   3293  C  CE1   . HIS A  1  449  ? 211.059 273.884 250.951 1.00 0.00 ? 449  HIS A CE1   1 
ATOM   3294  N  NE2   . HIS A  1  449  ? 210.816 273.537 249.701 1.00 0.00 ? 449  HIS A NE2   1 
ATOM   3295  N  N     . MET A  1  450  ? 215.672 278.253 249.421 1.00 0.00 ? 450  MET A N     1 
ATOM   3296  C  CA    . MET A  1  450  ? 216.356 279.381 248.787 1.00 0.00 ? 450  MET A CA    1 
ATOM   3297  C  C     . MET A  1  450  ? 215.492 280.043 247.756 1.00 0.00 ? 450  MET A C     1 
ATOM   3298  O  O     . MET A  1  450  ? 214.791 279.345 247.032 1.00 0.00 ? 450  MET A O     1 
ATOM   3299  C  CB    . MET A  1  450  ? 217.565 278.927 248.032 1.00 0.00 ? 450  MET A CB    1 
ATOM   3300  C  CG    . MET A  1  450  ? 218.785 278.766 248.784 1.00 0.00 ? 450  MET A CG    1 
ATOM   3301  S  SD    . MET A  1  450  ? 219.958 278.750 247.428 1.00 0.00 ? 450  MET A SD    1 
ATOM   3302  C  CE    . MET A  1  450  ? 220.065 276.971 247.075 1.00 0.00 ? 450  MET A CE    1 
ATOM   3303  N  N     . CYS A  1  451  ? 215.589 281.354 247.594 1.00 0.00 ? 451  CYS A N     1 
ATOM   3304  C  CA    . CYS A  1  451  ? 214.855 281.979 246.508 1.00 0.00 ? 451  CYS A CA    1 
ATOM   3305  C  C     . CYS A  1  451  ? 215.781 282.952 245.860 1.00 0.00 ? 451  CYS A C     1 
ATOM   3306  O  O     . CYS A  1  451  ? 216.866 283.189 246.368 1.00 0.00 ? 451  CYS A O     1 
ATOM   3307  C  CB    . CYS A  1  451  ? 213.593 282.674 246.995 1.00 0.00 ? 451  CYS A CB    1 
ATOM   3308  S  SG    . CYS A  1  451  ? 213.938 284.125 247.988 1.00 0.00 ? 451  CYS A SG    1 
ATOM   3309  N  N     . ASP A  1  452  ? 215.349 283.488 244.727 1.00 0.00 ? 452  ASP A N     1 
ATOM   3310  C  CA    . ASP A  1  452  ? 216.111 284.454 243.925 1.00 0.00 ? 452  ASP A CA    1 
ATOM   3311  C  C     . ASP A  1  452  ? 216.685 285.666 244.685 1.00 0.00 ? 452  ASP A C     1 
ATOM   3312  O  O     . ASP A  1  452  ? 216.010 286.679 244.874 1.00 0.00 ? 452  ASP A O     1 
ATOM   3313  C  CB    . ASP A  1  452  ? 215.224 284.948 242.779 1.00 0.00 ? 452  ASP A CB    1 
ATOM   3314  C  CG    . ASP A  1  452  ? 215.791 286.166 242.100 1.00 0.00 ? 452  ASP A CG    1 
ATOM   3315  O  OD1   . ASP A  1  452  ? 216.977 286.108 241.698 1.00 0.00 ? 452  ASP A OD1   1 
ATOM   3316  O  OD2   . ASP A  1  452  ? 215.052 287.175 241.969 1.00 0.00 ? 452  ASP A OD2   1 
ATOM   3317  N  N     . GLY A  1  453  ? 217.927 285.557 245.142 1.00 0.00 ? 453  GLY A N     1 
ATOM   3318  C  CA    . GLY A  1  453  ? 218.539 286.664 245.838 1.00 0.00 ? 453  GLY A CA    1 
ATOM   3319  C  C     . GLY A  1  453  ? 219.344 286.291 247.066 1.00 0.00 ? 453  GLY A C     1 
ATOM   3320  O  O     . GLY A  1  453  ? 219.985 287.148 247.653 1.00 0.00 ? 453  GLY A O     1 
ATOM   3321  N  N     . ASP A  1  454  ? 219.290 285.043 247.501 1.00 0.00 ? 454  ASP A N     1 
ATOM   3322  C  CA    . ASP A  1  454  ? 220.173 284.633 248.585 1.00 0.00 ? 454  ASP A CA    1 
ATOM   3323  C  C     . ASP A  1  454  ? 221.593 284.490 248.048 1.00 0.00 ? 454  ASP A C     1 
ATOM   3324  O  O     . ASP A  1  454  ? 221.797 284.225 246.860 1.00 0.00 ? 454  ASP A O     1 
ATOM   3325  C  CB    . ASP A  1  454  ? 219.690 283.344 249.237 1.00 0.00 ? 454  ASP A CB    1 
ATOM   3326  C  CG    . ASP A  1  454  ? 218.302 283.502 249.909 1.00 0.00 ? 454  ASP A CG    1 
ATOM   3327  O  OD1   . ASP A  1  454  ? 218.018 284.605 250.461 1.00 0.00 ? 454  ASP A OD1   1 
ATOM   3328  O  OD2   . ASP A  1  454  ? 217.499 282.515 249.899 1.00 0.00 ? 454  ASP A OD2   1 
ATOM   3329  N  N     . ILE A  1  455  ? 222.562 284.717 248.925 1.00 0.00 ? 455  ILE A N     1 
ATOM   3330  C  CA    . ILE A  1  455  ? 223.996 284.772 248.597 1.00 0.00 ? 455  ILE A CA    1 
ATOM   3331  C  C     . ILE A  1  455  ? 224.749 283.493 248.885 1.00 0.00 ? 455  ILE A C     1 
ATOM   3332  O  O     . ILE A  1  455  ? 224.748 283.018 249.996 1.00 0.00 ? 455  ILE A O     1 
ATOM   3333  C  CB    . ILE A  1  455  ? 224.637 285.875 249.370 1.00 0.00 ? 455  ILE A CB    1 
ATOM   3334  C  CG1   . ILE A  1  455  ? 224.065 287.190 248.863 1.00 0.00 ? 455  ILE A CG1   1 
ATOM   3335  C  CG2   . ILE A  1  455  ? 226.124 285.820 249.229 1.00 0.00 ? 455  ILE A CG2   1 
ATOM   3336  C  CD1   . ILE A  1  455  ? 224.543 288.362 249.638 1.00 0.00 ? 455  ILE A CD1   1 
ATOM   3337  N  N     . VAL A  1  456  ? 225.492 282.974 247.931 1.00 0.00 ? 456  VAL A N     1 
ATOM   3338  C  CA    . VAL A  1  456  ? 226.215 281.745 248.202 1.00 0.00 ? 456  VAL A CA    1 
ATOM   3339  C  C     . VAL A  1  456  ? 227.713 281.780 247.909 1.00 0.00 ? 456  VAL A C     1 
ATOM   3340  O  O     . VAL A  1  456  ? 228.183 282.485 247.052 1.00 0.00 ? 456  VAL A O     1 
ATOM   3341  C  CB    . VAL A  1  456  ? 225.593 280.619 247.388 1.00 0.00 ? 456  VAL A CB    1 
ATOM   3342  C  CG1   . VAL A  1  456  ? 224.178 280.374 247.865 1.00 0.00 ? 456  VAL A CG1   1 
ATOM   3343  C  CG2   . VAL A  1  456  ? 225.602 280.974 245.912 1.00 0.00 ? 456  VAL A CG2   1 
ATOM   3344  N  N     . ILE A  1  457  ? 228.457 280.905 248.540 1.00 0.00 ? 457  ILE A N     1 
ATOM   3345  C  CA    . ILE A  1  457  ? 229.849 280.814 248.201 1.00 0.00 ? 457  ILE A CA    1 
ATOM   3346  C  C     . ILE A  1  457  ? 229.924 279.712 247.160 1.00 0.00 ? 457  ILE A C     1 
ATOM   3347  O  O     . ILE A  1  457  ? 229.377 278.641 247.296 1.00 0.00 ? 457  ILE A O     1 
ATOM   3348  C  CB    . ILE A  1  457  ? 230.730 280.509 249.449 1.00 0.00 ? 457  ILE A CB    1 
ATOM   3349  C  CG1   . ILE A  1  457  ? 231.095 281.812 250.146 1.00 0.00 ? 457  ILE A CG1   1 
ATOM   3350  C  CG2   . ILE A  1  457  ? 232.028 279.837 249.074 1.00 0.00 ? 457  ILE A CG2   1 
ATOM   3351  C  CD1   . ILE A  1  457  ? 232.215 282.569 249.463 1.00 0.00 ? 457  ILE A CD1   1 
ATOM   3352  N  N     . PHE A  1  458  ? 230.559 280.061 246.065 1.00 0.00 ? 458  PHE A N     1 
ATOM   3353  C  CA    . PHE A  1  458  ? 230.707 279.218 244.939 1.00 0.00 ? 458  PHE A CA    1 
ATOM   3354  C  C     . PHE A  1  458  ? 232.171 278.991 244.725 1.00 0.00 ? 458  PHE A C     1 
ATOM   3355  O  O     . PHE A  1  458  ? 232.981 279.880 244.919 1.00 0.00 ? 458  PHE A O     1 
ATOM   3356  C  CB    . PHE A  1  458  ? 230.070 279.936 243.794 1.00 0.00 ? 458  PHE A CB    1 
ATOM   3357  C  CG    . PHE A  1  458  ? 229.688 279.084 242.670 1.00 0.00 ? 458  PHE A CG    1 
ATOM   3358  C  CD1   . PHE A  1  458  ? 228.678 278.175 242.796 1.00 0.00 ? 458  PHE A CD1   1 
ATOM   3359  C  CD2   . PHE A  1  458  ? 230.240 279.309 241.424 1.00 0.00 ? 458  PHE A CD2   1 
ATOM   3360  C  CE1   . PHE A  1  458  ? 228.309 277.441 241.719 1.00 0.00 ? 458  PHE A CE1   1 
ATOM   3361  C  CE2   . PHE A  1  458  ? 229.865 278.594 240.350 1.00 0.00 ? 458  PHE A CE2   1 
ATOM   3362  C  CZ    . PHE A  1  458  ? 228.910 277.661 240.486 1.00 0.00 ? 458  PHE A CZ    1 
ATOM   3363  N  N     . ASN A  1  459  ? 232.533 277.788 244.353 1.00 0.00 ? 459  ASN A N     1 
ATOM   3364  C  CA    . ASN A  1  459  ? 233.908 277.386 244.531 1.00 0.00 ? 459  ASN A CA    1 
ATOM   3365  C  C     . ASN A  1  459  ? 234.405 276.351 243.543 1.00 0.00 ? 459  ASN A C     1 
ATOM   3366  O  O     . ASN A  1  459  ? 233.733 275.356 243.345 1.00 0.00 ? 459  ASN A O     1 
ATOM   3367  C  CB    . ASN A  1  459  ? 234.077 276.862 245.927 1.00 0.00 ? 459  ASN A CB    1 
ATOM   3368  C  CG    . ASN A  1  459  ? 235.404 276.241 246.119 1.00 0.00 ? 459  ASN A CG    1 
ATOM   3369  O  OD1   . ASN A  1  459  ? 236.391 276.641 245.492 1.00 0.00 ? 459  ASN A OD1   1 
ATOM   3370  N  ND2   . ASN A  1  459  ? 235.451 275.233 246.978 1.00 0.00 ? 459  ASN A ND2   1 
ATOM   3371  N  N     . ARG A  1  460  ? 235.599 276.496 242.994 1.00 0.00 ? 460  ARG A N     1 
ATOM   3372  C  CA    . ARG A  1  460  ? 236.111 275.409 242.169 1.00 0.00 ? 460  ARG A CA    1 
ATOM   3373  C  C     . ARG A  1  460  ? 237.419 274.849 242.646 1.00 0.00 ? 460  ARG A C     1 
ATOM   3374  O  O     . ARG A  1  460  ? 238.438 275.522 242.518 1.00 0.00 ? 460  ARG A O     1 
ATOM   3375  C  CB    . ARG A  1  460  ? 236.317 275.854 240.738 1.00 0.00 ? 460  ARG A CB    1 
ATOM   3376  C  CG    . ARG A  1  460  ? 236.817 274.712 239.893 1.00 0.00 ? 460  ARG A CG    1 
ATOM   3377  C  CD    . ARG A  1  460  ? 237.049 275.142 238.480 1.00 0.00 ? 460  ARG A CD    1 
ATOM   3378  N  NE    . ARG A  1  460  ? 238.319 275.840 238.407 1.00 0.00 ? 460  ARG A NE    1 
ATOM   3379  C  CZ    . ARG A  1  460  ? 239.502 275.226 238.386 1.00 0.00 ? 460  ARG A CZ    1 
ATOM   3380  N  NH1   . ARG A  1  460  ? 239.570 273.894 238.441 1.00 0.00 ? 460  ARG A NH1   1 
ATOM   3381  N  NH2   . ARG A  1  460  ? 240.623 275.942 238.300 1.00 0.00 ? 460  ARG A NH2   1 
ATOM   3382  N  N     . GLN A  1  461  ? 237.434 273.601 243.106 1.00 0.00 ? 461  GLN A N     1 
ATOM   3383  C  CA    . GLN A  1  461  ? 238.706 273.016 243.540 1.00 0.00 ? 461  GLN A CA    1 
ATOM   3384  C  C     . GLN A  1  461  ? 239.448 272.437 242.317 1.00 0.00 ? 461  GLN A C     1 
ATOM   3385  O  O     . GLN A  1  461  ? 238.829 272.110 241.302 1.00 0.00 ? 461  GLN A O     1 
ATOM   3386  C  CB    . GLN A  1  461  ? 238.495 271.970 244.667 1.00 0.00 ? 461  GLN A CB    1 
ATOM   3387  C  CG    . GLN A  1  461  ? 237.905 270.623 244.272 1.00 0.00 ? 461  GLN A CG    1 
ATOM   3388  C  CD    . GLN A  1  461  ? 236.463 270.733 243.802 1.00 0.00 ? 461  GLN A CD    1 
ATOM   3389  O  OE1   . GLN A  1  461  ? 235.808 271.769 244.007 1.00 0.00 ? 461  GLN A OE1   1 
ATOM   3390  N  NE2   . GLN A  1  461  ? 235.961 269.667 243.154 1.00 0.00 ? 461  GLN A NE2   1 
ATOM   3391  N  N     . PRO A  1  462  ? 240.788 272.352 242.394 1.00 0.00 ? 462  PRO A N     1 
ATOM   3392  C  CA    . PRO A  1  462  ? 241.623 272.811 243.514 1.00 0.00 ? 462  PRO A CA    1 
ATOM   3393  C  C     . PRO A  1  462  ? 241.692 274.334 243.586 1.00 0.00 ? 462  PRO A C     1 
ATOM   3394  O  O     . PRO A  1  462  ? 241.962 274.974 242.563 1.00 0.00 ? 462  PRO A O     1 
ATOM   3395  C  CB    . PRO A  1  462  ? 243.005 272.218 243.198 1.00 0.00 ? 462  PRO A CB    1 
ATOM   3396  C  CG    . PRO A  1  462  ? 242.777 271.216 242.068 1.00 0.00 ? 462  PRO A CG    1 
ATOM   3397  C  CD    . PRO A  1  462  ? 241.599 271.769 241.312 1.00 0.00 ? 462  PRO A CD    1 
ATOM   3398  N  N     . THR A  1  463  ? 241.474 274.895 244.776 1.00 0.00 ? 463  THR A N     1 
ATOM   3399  C  CA    . THR A  1  463  ? 241.339 276.350 244.931 1.00 0.00 ? 463  THR A CA    1 
ATOM   3400  C  C     . THR A  1  463  ? 242.702 277.055 245.034 1.00 0.00 ? 463  THR A C     1 
ATOM   3401  O  O     . THR A  1  463  ? 243.289 277.200 246.120 1.00 0.00 ? 463  THR A O     1 
ATOM   3402  C  CB    . THR A  1  463  ? 240.496 276.689 246.152 1.00 0.00 ? 463  THR A CB    1 
ATOM   3403  O  OG1   . THR A  1  463  ? 239.585 275.615 246.397 1.00 0.00 ? 463  THR A OG1   1 
ATOM   3404  C  CG2   . THR A  1  463  ? 239.722 277.955 245.918 1.00 0.00 ? 463  THR A CG2   1 
ATOM   3405  N  N     . LEU A  1  464  ? 243.176 277.503 243.874 1.00 0.00 ? 464  LEU A N     1 
ATOM   3406  C  CA    . LEU A  1  464  ? 244.520 278.026 243.692 1.00 0.00 ? 464  LEU A CA    1 
ATOM   3407  C  C     . LEU A  1  464  ? 244.839 279.373 244.332 1.00 0.00 ? 464  LEU A C     1 
ATOM   3408  O  O     . LEU A  1  464  ? 245.949 279.587 244.795 1.00 0.00 ? 464  LEU A O     1 
ATOM   3409  C  CB    . LEU A  1  464  ? 244.802 278.130 242.202 1.00 0.00 ? 464  LEU A CB    1 
ATOM   3410  C  CG    . LEU A  1  464  ? 246.233 277.711 241.891 1.00 0.00 ? 464  LEU A CG    1 
ATOM   3411  C  CD1   . LEU A  1  464  ? 246.591 276.410 242.649 1.00 0.00 ? 464  LEU A CD1   1 
ATOM   3412  C  CD2   . LEU A  1  464  ? 246.418 277.579 240.375 1.00 0.00 ? 464  LEU A CD2   1 
ATOM   3413  N  N     . HIS A  1  465  ? 243.886 280.286 244.353 1.00 0.00 ? 465  HIS A N     1 
ATOM   3414  C  CA    . HIS A  1  465  ? 244.133 281.597 244.916 1.00 0.00 ? 465  HIS A CA    1 
ATOM   3415  C  C     . HIS A  1  465  ? 242.827 282.111 245.449 1.00 0.00 ? 465  HIS A C     1 
ATOM   3416  O  O     . HIS A  1  465  ? 241.813 281.489 245.212 1.00 0.00 ? 465  HIS A O     1 
ATOM   3417  C  CB    . HIS A  1  465  ? 244.723 282.545 243.885 1.00 0.00 ? 465  HIS A CB    1 
ATOM   3418  C  CG    . HIS A  1  465  ? 243.839 282.792 242.698 1.00 0.00 ? 465  HIS A CG    1 
ATOM   3419  N  ND1   . HIS A  1  465  ? 243.702 281.879 241.673 1.00 0.00 ? 465  HIS A ND1   1 
ATOM   3420  C  CD2   . HIS A  1  465  ? 243.074 283.860 242.356 1.00 0.00 ? 465  HIS A CD2   1 
ATOM   3421  C  CE1   . HIS A  1  465  ? 242.887 282.370 240.753 1.00 0.00 ? 465  HIS A CE1   1 
ATOM   3422  N  NE2   . HIS A  1  465  ? 242.488 283.570 241.145 1.00 0.00 ? 465  HIS A NE2   1 
ATOM   3423  N  N     . LYS A  1  466  ? 242.840 283.220 246.189 1.00 0.00 ? 466  LYS A N     1 
ATOM   3424  C  CA    . LYS A  1  466  ? 241.640 283.693 246.906 1.00 0.00 ? 466  LYS A CA    1 
ATOM   3425  C  C     . LYS A  1  466  ? 240.413 284.011 246.057 1.00 0.00 ? 466  LYS A C     1 
ATOM   3426  O  O     . LYS A  1  466  ? 239.289 283.794 246.493 1.00 0.00 ? 466  LYS A O     1 
ATOM   3427  C  CB    . LYS A  1  466  ? 241.953 284.986 247.681 1.00 0.00 ? 466  LYS A CB    1 
ATOM   3428  C  CG    . LYS A  1  466  ? 242.156 286.158 246.725 1.00 0.00 ? 466  LYS A CG    1 
ATOM   3429  C  CD    . LYS A  1  466  ? 242.493 287.524 247.324 1.00 0.00 ? 466  LYS A CD    1 
ATOM   3430  C  CE    . LYS A  1  466  ? 241.363 288.142 248.149 1.00 0.00 ? 466  LYS A CE    1 
ATOM   3431  N  NZ    . LYS A  1  466  ? 241.712 289.517 248.683 1.00 0.00 ? 466  LYS A NZ    1 
ATOM   3432  N  N     . MET A  1  467  ? 240.648 284.448 244.825 1.00 0.00 ? 467  MET A N     1 
ATOM   3433  C  CA    . MET A  1  467  ? 239.623 284.708 243.811 1.00 0.00 ? 467  MET A CA    1 
ATOM   3434  C  C     . MET A  1  467  ? 238.999 283.475 243.168 1.00 0.00 ? 467  MET A C     1 
ATOM   3435  O  O     . MET A  1  467  ? 238.148 283.598 242.320 1.00 0.00 ? 467  MET A O     1 
ATOM   3436  C  CB    . MET A  1  467  ? 240.171 285.715 242.806 1.00 0.00 ? 467  MET A CB    1 
ATOM   3437  C  CG    . MET A  1  467  ? 240.241 287.067 243.587 1.00 0.00 ? 467  MET A CG    1 
ATOM   3438  S  SD    . MET A  1  467  ? 240.506 288.735 242.898 1.00 0.00 ? 467  MET A SD    1 
ATOM   3439  C  CE    . MET A  1  467  ? 240.438 289.754 244.377 1.00 0.00 ? 467  MET A CE    1 
ATOM   3440  N  N     . SER A  1  468  ? 239.542 282.309 243.455 1.00 0.00 ? 468  SER A N     1 
ATOM   3441  C  CA    . SER A  1  468  ? 238.930 281.039 243.093 1.00 0.00 ? 468  SER A CA    1 
ATOM   3442  C  C     . SER A  1  468  ? 237.672 280.662 243.942 1.00 0.00 ? 468  SER A C     1 
ATOM   3443  O  O     . SER A  1  468  ? 236.984 279.716 243.609 1.00 0.00 ? 468  SER A O     1 
ATOM   3444  C  CB    . SER A  1  468  ? 240.001 279.938 243.178 1.00 0.00 ? 468  SER A CB    1 
ATOM   3445  O  OG    . SER A  1  468  ? 239.667 278.763 242.466 1.00 0.00 ? 468  SER A OG    1 
ATOM   3446  N  N     . MET A  1  469  ? 237.353 281.379 245.020 1.00 0.00 ? 469  MET A N     1 
ATOM   3447  C  CA    . MET A  1  469  ? 236.152 281.095 245.841 1.00 0.00 ? 469  MET A CA    1 
ATOM   3448  C  C     . MET A  1  469  ? 235.414 282.368 246.135 1.00 0.00 ? 469  MET A C     1 
ATOM   3449  O  O     . MET A  1  469  ? 235.869 283.076 247.004 1.00 0.00 ? 469  MET A O     1 
ATOM   3450  C  CB    . MET A  1  469  ? 236.604 280.524 247.181 1.00 0.00 ? 469  MET A CB    1 
ATOM   3451  C  CG    . MET A  1  469  ? 235.589 279.866 248.108 1.00 0.00 ? 469  MET A CG    1 
ATOM   3452  S  SD    . MET A  1  469  ? 236.430 278.755 249.327 1.00 0.00 ? 469  MET A SD    1 
ATOM   3453  C  CE    . MET A  1  469  ? 235.051 277.872 250.041 1.00 0.00 ? 469  MET A CE    1 
ATOM   3454  N  N     . MET A  1  470  ? 234.255 282.643 245.525 1.00 0.00 ? 470  MET A N     1 
ATOM   3455  C  CA    . MET A  1  470  ? 233.623 283.993 245.631 1.00 0.00 ? 470  MET A CA    1 
ATOM   3456  C  C     . MET A  1  470  ? 232.098 283.956 245.900 1.00 0.00 ? 470  MET A C     1 
ATOM   3457  O  O     . MET A  1  470  ? 231.444 283.016 245.519 1.00 0.00 ? 470  MET A O     1 
ATOM   3458  C  CB    . MET A  1  470  ? 233.890 284.795 244.362 1.00 0.00 ? 470  MET A CB    1 
ATOM   3459  C  CG    . MET A  1  470  ? 235.337 284.859 244.039 1.00 0.00 ? 470  MET A CG    1 
ATOM   3460  S  SD    . MET A  1  470  ? 235.856 285.814 242.610 1.00 0.00 ? 470  MET A SD    1 
ATOM   3461  C  CE    . MET A  1  470  ? 235.335 284.828 241.185 1.00 0.00 ? 470  MET A CE    1 
ATOM   3462  N  N     . GLY A  1  471  ? 231.527 284.995 246.502 1.00 0.00 ? 471  GLY A N     1 
ATOM   3463  C  CA    . GLY A  1  471  ? 230.095 285.071 246.744 1.00 0.00 ? 471  GLY A CA    1 
ATOM   3464  C  C     . GLY A  1  471  ? 229.284 285.606 245.562 1.00 0.00 ? 471  GLY A C     1 
ATOM   3465  O  O     . GLY A  1  471  ? 229.630 286.560 244.923 1.00 0.00 ? 471  GLY A O     1 
ATOM   3466  N  N     . HIS A  1  472  ? 228.132 284.997 245.333 1.00 0.00 ? 472  HIS A N     1 
ATOM   3467  C  CA    . HIS A  1  472  ? 227.250 285.236 244.195 1.00 0.00 ? 472  HIS A CA    1 
ATOM   3468  C  C     . HIS A  1  472  ? 225.784 285.288 244.644 1.00 0.00 ? 472  HIS A C     1 
ATOM   3469  O  O     . HIS A  1  472  ? 225.422 284.818 245.718 1.00 0.00 ? 472  HIS A O     1 
ATOM   3470  C  CB    . HIS A  1  472  ? 227.315 284.079 243.180 1.00 0.00 ? 472  HIS A CB    1 
ATOM   3471  C  CG    . HIS A  1  472  ? 228.582 283.980 242.386 1.00 0.00 ? 472  HIS A CG    1 
ATOM   3472  N  ND1   . HIS A  1  472  ? 228.635 284.244 241.034 1.00 0.00 ? 472  HIS A ND1   1 
ATOM   3473  C  CD2   . HIS A  1  472  ? 229.810 283.518 242.721 1.00 0.00 ? 472  HIS A CD2   1 
ATOM   3474  C  CE1   . HIS A  1  472  ? 229.858 284.024 240.589 1.00 0.00 ? 472  HIS A CE1   1 
ATOM   3475  N  NE2   . HIS A  1  472  ? 230.590 283.579 241.593 1.00 0.00 ? 472  HIS A NE2   1 
ATOM   3476  N  N     . ARG A  1  473  ? 224.935 285.893 243.828 1.00 0.00 ? 473  ARG A N     1 
ATOM   3477  C  CA    . ARG A  1  473  ? 223.493 285.871 244.079 1.00 0.00 ? 473  ARG A CA    1 
ATOM   3478  C  C     . ARG A  1  473  ? 222.928 284.676 243.299 1.00 0.00 ? 473  ARG A C     1 
ATOM   3479  O  O     . ARG A  1  473  ? 223.332 284.497 242.164 1.00 0.00 ? 473  ARG A O     1 
ATOM   3480  C  CB    . ARG A  1  473  ? 222.899 287.208 243.626 1.00 0.00 ? 473  ARG A CB    1 
ATOM   3481  C  CG    . ARG A  1  473  ? 223.293 288.344 244.579 1.00 0.00 ? 473  ARG A CG    1 
ATOM   3482  C  CD    . ARG A  1  473  ? 222.698 289.673 244.175 1.00 0.00 ? 473  ARG A CD    1 
ATOM   3483  N  NE    . ARG A  1  473  ? 223.399 290.192 242.992 1.00 0.00 ? 473  ARG A NE    1 
ATOM   3484  C  CZ    . ARG A  1  473  ? 222.892 291.066 242.118 1.00 0.00 ? 473  ARG A CZ    1 
ATOM   3485  N  NH1   . ARG A  1  473  ? 221.654 291.551 242.283 1.00 0.00 ? 473  ARG A NH1   1 
ATOM   3486  N  NH2   . ARG A  1  473  ? 223.641 291.491 241.095 1.00 0.00 ? 473  ARG A NH2   1 
ATOM   3487  N  N     . VAL A  1  474  ? 222.078 283.817 243.876 1.00 0.00 ? 474  VAL A N     1 
ATOM   3488  C  CA    . VAL A  1  474  ? 221.500 282.711 243.100 1.00 0.00 ? 474  VAL A CA    1 
ATOM   3489  C  C     . VAL A  1  474  ? 220.402 283.249 242.203 1.00 0.00 ? 474  VAL A C     1 
ATOM   3490  O  O     . VAL A  1  474  ? 219.791 284.195 242.445 1.00 0.00 ? 474  VAL A O     1 
ATOM   3491  C  CB    . VAL A  1  474  ? 220.961 281.538 243.972 1.00 0.00 ? 474  VAL A CB    1 
ATOM   3492  C  CG1   . VAL A  1  474  ? 222.051 281.007 244.860 1.00 0.00 ? 474  VAL A CG1   1 
ATOM   3493  C  CG2   . VAL A  1  474  ? 219.772 281.963 244.790 1.00 0.00 ? 474  VAL A CG2   1 
ATOM   3494  N  N     . ARG A  1  475  ? 220.127 282.505 241.141 1.00 0.00 ? 475  ARG A N     1 
ATOM   3495  C  CA    . ARG A  1  475  ? 219.054 282.853 240.216 1.00 0.00 ? 475  ARG A CA    1 
ATOM   3496  C  C     . ARG A  1  475  ? 218.392 281.531 239.873 1.00 0.00 ? 475  ARG A C     1 
ATOM   3497  O  O     . ARG A  1  475  ? 218.987 280.722 239.161 1.00 0.00 ? 475  ARG A O     1 
ATOM   3498  C  CB    . ARG A  1  475  ? 219.614 283.515 238.959 1.00 0.00 ? 475  ARG A CB    1 
ATOM   3499  C  CG    . ARG A  1  475  ? 218.695 284.559 238.346 1.00 0.00 ? 475  ARG A CG    1 
ATOM   3500  C  CD    . ARG A  1  475  ? 217.547 283.910 237.590 1.00 0.00 ? 475  ARG A CD    1 
ATOM   3501  N  NE    . ARG A  1  475  ? 216.623 284.899 237.043 1.00 0.00 ? 475  ARG A NE    1 
ATOM   3502  C  CZ    . ARG A  1  475  ? 215.377 284.630 236.667 1.00 0.00 ? 475  ARG A CZ    1 
ATOM   3503  N  NH1   . ARG A  1  475  ? 214.901 283.398 236.778 1.00 0.00 ? 475  ARG A NH1   1 
ATOM   3504  N  NH2   . ARG A  1  475  ? 214.607 285.593 236.179 1.00 0.00 ? 475  ARG A NH2   1 
ATOM   3505  N  N     . ILE A  1  476  ? 217.176 281.281 240.358 1.00 0.00 ? 476  ILE A N     1 
ATOM   3506  C  CA    . ILE A  1  476  ? 216.602 279.951 240.054 1.00 0.00 ? 476  ILE A CA    1 
ATOM   3507  C  C     . ILE A  1  476  ? 215.988 279.755 238.666 1.00 0.00 ? 476  ILE A C     1 
ATOM   3508  O  O     . ILE A  1  476  ? 215.098 280.495 238.305 1.00 0.00 ? 476  ILE A O     1 
ATOM   3509  C  CB    . ILE A  1  476  ? 215.582 279.500 241.064 1.00 0.00 ? 476  ILE A CB    1 
ATOM   3510  C  CG1   . ILE A  1  476  ? 216.246 279.214 242.395 1.00 0.00 ? 476  ILE A CG1   1 
ATOM   3511  C  CG2   . ILE A  1  476  ? 214.924 278.228 240.587 1.00 0.00 ? 476  ILE A CG2   1 
ATOM   3512  C  CD1   . ILE A  1  476  ? 216.716 280.449 243.120 1.00 0.00 ? 476  ILE A CD1   1 
ATOM   3513  N  N     . LEU A  1  477  ? 216.440 278.749 237.912 1.00 0.00 ? 477  LEU A N     1 
ATOM   3514  C  CA    . LEU A  1  477  ? 216.001 278.498 236.524 1.00 0.00 ? 477  LEU A CA    1 
ATOM   3515  C  C     . LEU A  1  477  ? 215.957 277.001 236.161 1.00 0.00 ? 477  LEU A C     1 
ATOM   3516  O  O     . LEU A  1  477  ? 216.354 276.187 236.997 1.00 0.00 ? 477  LEU A O     1 
ATOM   3517  C  CB    . LEU A  1  477  ? 216.930 279.328 235.635 1.00 0.00 ? 477  LEU A CB    1 
ATOM   3518  C  CG    . LEU A  1  477  ? 218.314 278.883 235.128 1.00 0.00 ? 477  LEU A CG    1 
ATOM   3519  C  CD1   . LEU A  1  477  ? 218.568 277.455 234.604 1.00 0.00 ? 477  LEU A CD1   1 
ATOM   3520  C  CD2   . LEU A  1  477  ? 218.802 279.944 234.117 1.00 0.00 ? 477  LEU A CD2   1 
ATOM   3521  N  N     . PRO A  1  478  ? 215.390 276.617 234.978 1.00 0.00 ? 478  PRO A N     1 
ATOM   3522  C  CA    . PRO A  1  478  ? 215.189 275.190 234.589 1.00 0.00 ? 478  PRO A CA    1 
ATOM   3523  C  C     . PRO A  1  478  ? 216.433 274.363 234.142 1.00 0.00 ? 478  PRO A C     1 
ATOM   3524  O  O     . PRO A  1  478  ? 217.419 274.921 233.710 1.00 0.00 ? 478  PRO A O     1 
ATOM   3525  C  CB    . PRO A  1  478  ? 214.206 275.298 233.424 1.00 0.00 ? 478  PRO A CB    1 
ATOM   3526  C  CG    . PRO A  1  478  ? 214.433 276.641 232.856 1.00 0.00 ? 478  PRO A CG    1 
ATOM   3527  C  CD    . PRO A  1  478  ? 214.757 277.532 234.010 1.00 0.00 ? 478  PRO A CD    1 
ATOM   3528  N  N     . TRP A  1  479  ? 216.361 273.039 234.236 1.00 0.00 ? 479  TRP A N     1 
ATOM   3529  C  CA    . TRP A  1  479  ? 217.491 272.137 233.925 1.00 0.00 ? 479  TRP A CA    1 
ATOM   3530  C  C     . TRP A  1  479  ? 218.639 272.219 234.962 1.00 0.00 ? 479  TRP A C     1 
ATOM   3531  O  O     . TRP A  1  479  ? 218.743 273.221 235.677 1.00 0.00 ? 479  TRP A O     1 
ATOM   3532  C  CB    . TRP A  1  479  ? 217.992 272.395 232.490 1.00 0.00 ? 479  TRP A CB    1 
ATOM   3533  C  CG    . TRP A  1  479  ? 216.978 271.913 231.510 1.00 0.00 ? 479  TRP A CG    1 
ATOM   3534  C  CD1   . TRP A  1  479  ? 216.764 270.614 231.111 1.00 0.00 ? 479  TRP A CD1   1 
ATOM   3535  C  CD2   . TRP A  1  479  ? 215.984 272.692 230.865 1.00 0.00 ? 479  TRP A CD2   1 
ATOM   3536  N  NE1   . TRP A  1  479  ? 215.710 270.549 230.239 1.00 0.00 ? 479  TRP A NE1   1 
ATOM   3537  C  CE2   . TRP A  1  479  ? 215.209 271.810 230.069 1.00 0.00 ? 479  TRP A CE2   1 
ATOM   3538  C  CE3   . TRP A  1  479  ? 215.681 274.047 230.858 1.00 0.00 ? 479  TRP A CE3   1 
ATOM   3539  C  CZ2   . TRP A  1  479  ? 214.143 272.243 229.283 1.00 0.00 ? 479  TRP A CZ2   1 
ATOM   3540  C  CZ3   . TRP A  1  479  ? 214.612 274.485 230.080 1.00 0.00 ? 479  TRP A CZ3   1 
ATOM   3541  C  CH2   . TRP A  1  479  ? 213.859 273.581 229.296 1.00 0.00 ? 479  TRP A CH2   1 
ATOM   3542  N  N     . SER A  1  480  ? 219.494 271.181 235.044 1.00 0.00 ? 480  SER A N     1 
ATOM   3543  C  CA    . SER A  1  480  ? 220.270 270.925 236.282 1.00 0.00 ? 480  SER A CA    1 
ATOM   3544  C  C     . SER A  1  480  ? 221.772 271.180 236.368 1.00 0.00 ? 480  SER A C     1 
ATOM   3545  O  O     . SER A  1  480  ? 222.497 270.332 236.862 1.00 0.00 ? 480  SER A O     1 
ATOM   3546  C  CB    . SER A  1  480  ? 220.085 269.477 236.687 1.00 0.00 ? 480  SER A CB    1 
ATOM   3547  O  OG    . SER A  1  480  ? 218.736 269.258 236.976 1.00 0.00 ? 480  SER A OG    1 
ATOM   3548  N  N     . THR A  1  481  ? 222.231 272.343 235.933 1.00 0.00 ? 481  THR A N     1 
ATOM   3549  C  CA    . THR A  1  481  ? 223.615 272.727 236.111 1.00 0.00 ? 481  THR A CA    1 
ATOM   3550  C  C     . THR A  1  481  ? 223.618 274.061 236.814 1.00 0.00 ? 481  THR A C     1 
ATOM   3551  O  O     . THR A  1  481  ? 222.599 274.734 236.827 1.00 0.00 ? 481  THR A O     1 
ATOM   3552  C  CB    . THR A  1  481  ? 224.378 272.836 234.777 1.00 0.00 ? 481  THR A CB    1 
ATOM   3553  O  OG1   . THR A  1  481  ? 223.702 273.739 233.910 1.00 0.00 ? 481  THR A OG1   1 
ATOM   3554  C  CG2   . THR A  1  481  ? 224.471 271.493 234.088 1.00 0.00 ? 481  THR A CG2   1 
ATOM   3555  N  N     . PHE A  1  482  ? 224.745 274.431 237.415 1.00 0.00 ? 482  PHE A N     1 
ATOM   3556  C  CA    . PHE A  1  482  ? 224.969 275.796 237.881 1.00 0.00 ? 482  PHE A CA    1 
ATOM   3557  C  C     . PHE A  1  482  ? 225.284 276.654 236.719 1.00 0.00 ? 482  PHE A C     1 
ATOM   3558  O  O     . PHE A  1  482  ? 226.280 276.407 236.093 1.00 0.00 ? 482  PHE A O     1 
ATOM   3559  C  CB    . PHE A  1  482  ? 226.171 275.891 238.804 1.00 0.00 ? 482  PHE A CB    1 
ATOM   3560  C  CG    . PHE A  1  482  ? 225.991 275.220 240.098 1.00 0.00 ? 482  PHE A CG    1 
ATOM   3561  C  CD1   . PHE A  1  482  ? 224.812 275.372 240.801 1.00 0.00 ? 482  PHE A CD1   1 
ATOM   3562  C  CD2   . PHE A  1  482  ? 227.015 274.481 240.639 1.00 0.00 ? 482  PHE A CD2   1 
ATOM   3563  C  CE1   . PHE A  1  482  ? 224.632 274.767 241.979 1.00 0.00 ? 482  PHE A CE1   1 
ATOM   3564  C  CE2   . PHE A  1  482  ? 226.841 273.888 241.818 1.00 0.00 ? 482  PHE A CE2   1 
ATOM   3565  C  CZ    . PHE A  1  482  ? 225.639 274.032 242.497 1.00 0.00 ? 482  PHE A CZ    1 
ATOM   3566  N  N     . ARG A  1  483  ? 224.569 277.738 236.488 1.00 0.00 ? 483  ARG A N     1 
ATOM   3567  C  CA    . ARG A  1  483  ? 224.825 278.501 235.285 1.00 0.00 ? 483  ARG A CA    1 
ATOM   3568  C  C     . ARG A  1  483  ? 225.529 279.741 235.837 1.00 0.00 ? 483  ARG A C     1 
ATOM   3569  O  O     . ARG A  1  483  ? 225.136 280.264 236.874 1.00 0.00 ? 483  ARG A O     1 
ATOM   3570  C  CB    . ARG A  1  483  ? 223.511 278.750 234.506 1.00 0.00 ? 483  ARG A CB    1 
ATOM   3571  C  CG    . ARG A  1  483  ? 222.889 277.401 234.105 1.00 0.00 ? 483  ARG A CG    1 
ATOM   3572  C  CD    . ARG A  1  483  ? 221.644 277.359 233.221 1.00 0.00 ? 483  ARG A CD    1 
ATOM   3573  N  NE    . ARG A  1  483  ? 221.748 278.068 231.927 1.00 0.00 ? 483  ARG A NE    1 
ATOM   3574  C  CZ    . ARG A  1  483  ? 222.113 277.572 230.718 1.00 0.00 ? 483  ARG A CZ    1 
ATOM   3575  N  NH1   . ARG A  1  483  ? 222.650 276.345 230.571 1.00 0.00 ? 483  ARG A NH1   1 
ATOM   3576  N  NH2   . ARG A  1  483  ? 221.943 278.323 229.619 1.00 0.00 ? 483  ARG A NH2   1 
ATOM   3577  N  N     . LEU A  1  484  ? 226.635 280.134 235.206 1.00 0.00 ? 484  LEU A N     1 
ATOM   3578  C  CA    . LEU A  1  484  ? 227.393 281.331 235.596 1.00 0.00 ? 484  LEU A CA    1 
ATOM   3579  C  C     . LEU A  1  484  ? 227.937 282.074 234.414 1.00 0.00 ? 484  LEU A C     1 
ATOM   3580  O  O     . LEU A  1  484  ? 228.499 281.459 233.502 1.00 0.00 ? 484  LEU A O     1 
ATOM   3581  C  CB    . LEU A  1  484  ? 228.512 280.956 236.602 1.00 0.00 ? 484  LEU A CB    1 
ATOM   3582  C  CG    . LEU A  1  484  ? 229.658 279.982 236.245 1.00 0.00 ? 484  LEU A CG    1 
ATOM   3583  C  CD1   . LEU A  1  484  ? 231.072 279.981 237.056 1.00 0.00 ? 484  LEU A CD1   1 
ATOM   3584  C  CD2   . LEU A  1  484  ? 228.981 278.629 236.314 1.00 0.00 ? 484  LEU A CD2   1 
ATOM   3585  N  N     . ASN A  1  485  ? 227.714 283.397 234.444 1.00 0.00 ? 485  ASN A N     1 
ATOM   3586  C  CA    . ASN A  1  485  ? 228.242 284.348 233.452 1.00 0.00 ? 485  ASN A CA    1 
ATOM   3587  C  C     . ASN A  1  485  ? 229.589 283.952 232.919 1.00 0.00 ? 485  ASN A C     1 
ATOM   3588  O  O     . ASN A  1  485  ? 230.471 283.488 233.660 1.00 0.00 ? 485  ASN A O     1 
ATOM   3589  C  CB    . ASN A  1  485  ? 228.380 285.757 234.016 1.00 0.00 ? 485  ASN A CB    1 
ATOM   3590  C  CG    . ASN A  1  485  ? 228.941 286.736 232.997 1.00 0.00 ? 485  ASN A CG    1 
ATOM   3591  O  OD1   . ASN A  1  485  ? 230.011 286.553 232.449 1.00 0.00 ? 485  ASN A OD1   1 
ATOM   3592  N  ND2   . ASN A  1  485  ? 228.209 287.777 232.746 1.00 0.00 ? 485  ASN A ND2   1 
ATOM   3593  N  N     . LEU A  1  486  ? 229.764 284.184 231.629 1.00 0.00 ? 486  LEU A N     1 
ATOM   3594  C  CA    . LEU A  1  486  ? 230.910 283.624 231.007 1.00 0.00 ? 486  LEU A CA    1 
ATOM   3595  C  C     . LEU A  1  486  ? 232.216 284.309 231.459 1.00 0.00 ? 486  LEU A C     1 
ATOM   3596  O  O     . LEU A  1  486  ? 233.238 283.654 231.582 1.00 0.00 ? 486  LEU A O     1 
ATOM   3597  C  CB    . LEU A  1  486  ? 230.731 283.708 229.512 1.00 0.00 ? 486  LEU A CB    1 
ATOM   3598  C  CG    . LEU A  1  486  ? 231.740 282.743 228.920 1.00 0.00 ? 486  LEU A CG    1 
ATOM   3599  C  CD1   . LEU A  1  486  ? 231.264 281.356 228.880 1.00 0.00 ? 486  LEU A CD1   1 
ATOM   3600  C  CD2   . LEU A  1  486  ? 232.203 283.190 227.568 1.00 0.00 ? 486  LEU A CD2   1 
ATOM   3601  N  N     . SER A  1  487  ? 232.197 285.613 231.714 1.00 0.00 ? 487  SER A N     1 
ATOM   3602  C  CA    . SER A  1  487  ? 233.437 286.305 232.108 1.00 0.00 ? 487  SER A CA    1 
ATOM   3603  C  C     . SER A  1  487  ? 234.014 285.830 233.437 1.00 0.00 ? 487  SER A C     1 
ATOM   3604  O  O     . SER A  1  487  ? 235.171 286.110 233.738 1.00 0.00 ? 487  SER A O     1 
ATOM   3605  C  CB    . SER A  1  487  ? 233.254 287.811 232.222 1.00 0.00 ? 487  SER A CB    1 
ATOM   3606  O  OG    . SER A  1  487  ? 232.322 288.061 233.239 1.00 0.00 ? 487  SER A OG    1 
ATOM   3607  N  N     . VAL A  1  488  ? 233.215 285.150 234.261 1.00 0.00 ? 488  VAL A N     1 
ATOM   3608  C  CA    . VAL A  1  488  ? 233.743 284.622 235.530 1.00 0.00 ? 488  VAL A CA    1 
ATOM   3609  C  C     . VAL A  1  488  ? 234.606 283.373 235.341 1.00 0.00 ? 488  VAL A C     1 
ATOM   3610  O  O     . VAL A  1  488  ? 235.219 282.931 236.286 1.00 0.00 ? 488  VAL A O     1 
ATOM   3611  C  CB    . VAL A  1  488  ? 232.622 284.305 236.541 1.00 0.00 ? 488  VAL A CB    1 
ATOM   3612  C  CG1   . VAL A  1  488  ? 233.188 284.336 237.960 1.00 0.00 ? 488  VAL A CG1   1 
ATOM   3613  C  CG2   . VAL A  1  488  ? 231.537 285.347 236.453 1.00 0.00 ? 488  VAL A CG2   1 
ATOM   3614  N  N     . THR A  1  489  ? 234.630 282.793 234.144 1.00 0.00 ? 489  THR A N     1 
ATOM   3615  C  CA    . THR A  1  489  ? 235.483 281.634 233.874 1.00 0.00 ? 489  THR A CA    1 
ATOM   3616  C  C     . THR A  1  489  ? 236.945 281.825 234.258 1.00 0.00 ? 489  THR A C     1 
ATOM   3617  O  O     . THR A  1  489  ? 237.578 280.881 234.766 1.00 0.00 ? 489  THR A O     1 
ATOM   3618  C  CB    . THR A  1  489  ? 235.471 281.228 232.380 1.00 0.00 ? 489  THR A CB    1 
ATOM   3619  O  OG1   . THR A  1  489  ? 236.332 280.096 232.196 1.00 0.00 ? 489  THR A OG1   1 
ATOM   3620  C  CG2   . THR A  1  489  ? 235.999 282.349 231.484 1.00 0.00 ? 489  THR A CG2   1 
ATOM   3621  N  N     . THR A  1  490  ? 237.471 283.032 233.999 1.00 0.00 ? 490  THR A N     1 
ATOM   3622  C  CA    . THR A  1  490  ? 238.906 283.348 234.103 1.00 0.00 ? 490  THR A CA    1 
ATOM   3623  C  C     . THR A  1  490  ? 239.496 283.231 235.511 1.00 0.00 ? 490  THR A C     1 
ATOM   3624  O  O     . THR A  1  490  ? 240.513 282.544 235.694 1.00 0.00 ? 490  THR A O     1 
ATOM   3625  C  CB    . THR A  1  490  ? 239.177 284.757 233.575 1.00 0.00 ? 490  THR A CB    1 
ATOM   3626  O  OG1   . THR A  1  490  ? 238.399 284.965 232.393 1.00 0.00 ? 490  THR A OG1   1 
ATOM   3627  C  CG2   . THR A  1  490  ? 240.649 284.958 233.270 1.00 0.00 ? 490  THR A CG2   1 
ATOM   3628  N  N     . PRO A  1  491  ? 238.887 283.914 236.507 1.00 0.00 ? 491  PRO A N     1 
ATOM   3629  C  CA    . PRO A  1  491  ? 239.444 283.643 237.833 1.00 0.00 ? 491  PRO A CA    1 
ATOM   3630  C  C     . PRO A  1  491  ? 239.293 282.183 238.233 1.00 0.00 ? 491  PRO A C     1 
ATOM   3631  O  O     . PRO A  1  491  ? 240.207 281.601 238.773 1.00 0.00 ? 491  PRO A O     1 
ATOM   3632  C  CB    . PRO A  1  491  ? 238.619 284.546 238.742 1.00 0.00 ? 491  PRO A CB    1 
ATOM   3633  C  CG    . PRO A  1  491  ? 237.357 284.825 237.958 1.00 0.00 ? 491  PRO A CG    1 
ATOM   3634  C  CD    . PRO A  1  491  ? 237.798 284.913 236.559 1.00 0.00 ? 491  PRO A CD    1 
ATOM   3635  N  N     . TYR A  1  492  ? 238.175 281.579 237.903 1.00 0.00 ? 492  TYR A N     1 
ATOM   3636  C  CA    . TYR A  1  492  ? 237.966 280.204 238.253 1.00 0.00 ? 492  TYR A CA    1 
ATOM   3637  C  C     . TYR A  1  492  ? 238.723 279.148 237.452 1.00 0.00 ? 492  TYR A C     1 
ATOM   3638  O  O     . TYR A  1  492  ? 238.898 278.045 237.964 1.00 0.00 ? 492  TYR A O     1 
ATOM   3639  C  CB    . TYR A  1  492  ? 236.493 279.887 238.142 1.00 0.00 ? 492  TYR A CB    1 
ATOM   3640  C  CG    . TYR A  1  492  ? 235.689 280.469 239.262 1.00 0.00 ? 492  TYR A CG    1 
ATOM   3641  C  CD1   . TYR A  1  492  ? 236.286 280.767 240.465 1.00 0.00 ? 492  TYR A CD1   1 
ATOM   3642  C  CD2   . TYR A  1  492  ? 234.323 280.712 239.119 1.00 0.00 ? 492  TYR A CD2   1 
ATOM   3643  C  CE1   . TYR A  1  492  ? 235.563 281.294 241.484 1.00 0.00 ? 492  TYR A CE1   1 
ATOM   3644  C  CE2   . TYR A  1  492  ? 233.598 281.247 240.138 1.00 0.00 ? 492  TYR A CE2   1 
ATOM   3645  C  CZ    . TYR A  1  492  ? 234.228 281.534 241.320 1.00 0.00 ? 492  TYR A CZ    1 
ATOM   3646  O  OH    . TYR A  1  492  ? 233.531 282.066 242.366 1.00 0.00 ? 492  TYR A OH    1 
ATOM   3647  N  N     . ASN A  1  493  ? 239.195 279.472 236.246 1.00 0.00 ? 493  ASN A N     1 
ATOM   3648  C  CA    . ASN A  1  493  ? 239.761 278.486 235.291 1.00 0.00 ? 493  ASN A CA    1 
ATOM   3649  C  C     . ASN A  1  493  ? 238.792 277.433 234.767 1.00 0.00 ? 493  ASN A C     1 
ATOM   3650  O  O     . ASN A  1  493  ? 239.224 276.343 234.340 1.00 0.00 ? 493  ASN A O     1 
ATOM   3651  C  CB    . ASN A  1  493  ? 240.930 277.719 235.892 1.00 0.00 ? 493  ASN A CB    1 
ATOM   3652  C  CG    . ASN A  1  493  ? 242.139 278.563 236.063 1.00 0.00 ? 493  ASN A CG    1 
ATOM   3653  O  OD1   . ASN A  1  493  ? 242.737 279.007 235.083 1.00 0.00 ? 493  ASN A OD1   1 
ATOM   3654  N  ND2   . ASN A  1  493  ? 242.532 278.793 237.317 1.00 0.00 ? 493  ASN A ND2   1 
ATOM   3655  N  N     . ALA A  1  494  ? 237.494 277.735 234.833 1.00 0.00 ? 494  ALA A N     1 
ATOM   3656  C  CA    . ALA A  1  494  ? 236.459 276.815 234.363 1.00 0.00 ? 494  ALA A CA    1 
ATOM   3657  C  C     . ALA A  1  494  ? 236.418 276.793 232.839 1.00 0.00 ? 494  ALA A C     1 
ATOM   3658  O  O     . ALA A  1  494  ? 236.538 277.822 232.182 1.00 0.00 ? 494  ALA A O     1 
ATOM   3659  C  CB    . ALA A  1  494  ? 235.109 277.193 234.920 1.00 0.00 ? 494  ALA A CB    1 
ATOM   3660  N  N     . ASP A  1  495  ? 236.266 275.610 232.277 1.00 0.00 ? 495  ASP A N     1 
ATOM   3661  C  CA    . ASP A  1  495  ? 236.019 275.477 230.862 1.00 0.00 ? 495  ASP A CA    1 
ATOM   3662  C  C     . ASP A  1  495  ? 234.817 274.621 230.733 1.00 0.00 ? 495  ASP A C     1 
ATOM   3663  O  O     . ASP A  1  495  ? 235.012 273.442 230.573 1.00 0.00 ? 495  ASP A O     1 
ATOM   3664  C  CB    . ASP A  1  495  ? 237.160 274.771 230.123 1.00 0.00 ? 495  ASP A CB    1 
ATOM   3665  C  CG    . ASP A  1  495  ? 238.521 275.400 230.356 1.00 0.00 ? 495  ASP A CG    1 
ATOM   3666  O  OD1   . ASP A  1  495  ? 238.624 276.653 230.475 1.00 0.00 ? 495  ASP A OD1   1 
ATOM   3667  O  OD2   . ASP A  1  495  ? 239.507 274.614 230.397 1.00 0.00 ? 495  ASP A OD2   1 
ATOM   3668  N  N     . PHE A  1  496  ? 233.601 275.152 230.819 1.00 0.00 ? 496  PHE A N     1 
ATOM   3669  C  CA    . PHE A  1  496  ? 232.383 274.368 230.580 1.00 0.00 ? 496  PHE A CA    1 
ATOM   3670  C  C     . PHE A  1  496  ? 232.494 273.198 229.563 1.00 0.00 ? 496  PHE A C     1 
ATOM   3671  O  O     . PHE A  1  496  ? 231.596 273.008 228.758 1.00 0.00 ? 496  PHE A O     1 
ATOM   3672  C  CB    . PHE A  1  496  ? 231.272 275.288 230.083 1.00 0.00 ? 496  PHE A CB    1 
ATOM   3673  C  CG    . PHE A  1  496  ? 231.144 276.572 230.837 1.00 0.00 ? 496  PHE A CG    1 
ATOM   3674  C  CD1   . PHE A  1  496  ? 230.435 276.643 232.018 1.00 0.00 ? 496  PHE A CD1   1 
ATOM   3675  C  CD2   . PHE A  1  496  ? 231.720 277.726 230.350 1.00 0.00 ? 496  PHE A CD2   1 
ATOM   3676  C  CE1   . PHE A  1  496  ? 230.304 277.850 232.700 1.00 0.00 ? 496  PHE A CE1   1 
ATOM   3677  C  CE2   . PHE A  1  496  ? 231.619 278.928 231.045 1.00 0.00 ? 496  PHE A CE2   1 
ATOM   3678  C  CZ    . PHE A  1  496  ? 230.903 278.989 232.216 1.00 0.00 ? 496  PHE A CZ    1 
ATOM   3679  N  N     . ASP A  1  497  ? 233.607 272.459 229.584 1.00 0.00 ? 497  ASP A N     1 
ATOM   3680  C  CA    . ASP A  1  497  ? 233.809 271.168 228.920 1.00 0.00 ? 497  ASP A CA    1 
ATOM   3681  C  C     . ASP A  1  497  ? 233.387 270.042 229.864 1.00 0.00 ? 497  ASP A C     1 
ATOM   3682  O  O     . ASP A  1  497  ? 233.721 268.882 229.661 1.00 0.00 ? 497  ASP A O     1 
ATOM   3683  C  CB    . ASP A  1  497  ? 235.274 271.009 228.451 1.00 0.00 ? 497  ASP A CB    1 
ATOM   3684  C  CG    . ASP A  1  497  ? 236.305 270.681 229.603 1.00 0.00 ? 497  ASP A CG    1 
ATOM   3685  O  OD1   . ASP A  1  497  ? 236.279 271.258 230.716 1.00 0.00 ? 497  ASP A OD1   1 
ATOM   3686  O  OD2   . ASP A  1  497  ? 237.222 269.859 229.333 1.00 0.00 ? 497  ASP A OD2   1 
ATOM   3687  N  N     . GLY A  1  498  ? 232.627 270.420 230.893 1.00 0.00 ? 498  GLY A N     1 
ATOM   3688  C  CA    . GLY A  1  498  ? 232.096 269.507 231.878 1.00 0.00 ? 498  GLY A CA    1 
ATOM   3689  C  C     . GLY A  1  498  ? 232.758 269.688 233.229 1.00 0.00 ? 498  GLY A C     1 
ATOM   3690  O  O     . GLY A  1  498  ? 232.793 268.737 234.015 1.00 0.00 ? 498  GLY A O     1 
ATOM   3691  N  N     . ASP A  1  499  ? 233.319 270.867 233.514 1.00 0.00 ? 499  ASP A N     1 
ATOM   3692  C  CA    . ASP A  1  499  ? 233.984 271.065 234.807 1.00 0.00 ? 499  ASP A CA    1 
ATOM   3693  C  C     . ASP A  1  499  ? 232.914 271.153 235.870 1.00 0.00 ? 499  ASP A C     1 
ATOM   3694  O  O     . ASP A  1  499  ? 231.803 271.552 235.565 1.00 0.00 ? 499  ASP A O     1 
ATOM   3695  C  CB    . ASP A  1  499  ? 234.861 272.304 234.802 1.00 0.00 ? 499  ASP A CB    1 
ATOM   3696  C  CG    . ASP A  1  499  ? 235.994 272.202 233.794 1.00 0.00 ? 499  ASP A CG    1 
ATOM   3697  O  OD1   . ASP A  1  499  ? 236.368 271.072 233.402 1.00 0.00 ? 499  ASP A OD1   1 
ATOM   3698  O  OD2   . ASP A  1  499  ? 236.513 273.255 233.367 1.00 0.00 ? 499  ASP A OD2   1 
ATOM   3699  N  N     . GLU A  1  500  ? 233.237 270.786 237.106 1.00 0.00 ? 500  GLU A N     1 
ATOM   3700  C  CA    . GLU A  1  500  ? 232.295 270.807 238.230 1.00 0.00 ? 500  GLU A CA    1 
ATOM   3701  C  C     . GLU A  1  500  ? 232.470 272.153 238.963 1.00 0.00 ? 500  GLU A C     1 
ATOM   3702  O  O     . GLU A  1  500  ? 233.504 272.780 238.848 1.00 0.00 ? 500  GLU A O     1 
ATOM   3703  C  CB    . GLU A  1  500  ? 232.547 269.550 239.100 1.00 0.00 ? 500  GLU A CB    1 
ATOM   3704  C  CG    . GLU A  1  500  ? 231.978 269.407 240.565 1.00 0.00 ? 500  GLU A CG    1 
ATOM   3705  C  CD    . GLU A  1  500  ? 233.053 269.574 241.758 1.00 0.00 ? 500  GLU A CD    1 
ATOM   3706  O  OE1   . GLU A  1  500  ? 233.878 268.643 241.998 1.00 0.00 ? 500  GLU A OE1   1 
ATOM   3707  O  OE2   . GLU A  1  500  ? 232.987 270.573 242.539 1.00 0.00 ? 500  GLU A OE2   1 
ATOM   3708  N  N     . MET A  1  501  ? 231.494 272.547 239.767 1.00 0.00 ? 501  MET A N     1 
ATOM   3709  C  CA    . MET A  1  501  ? 231.676 273.588 240.796 1.00 0.00 ? 501  MET A CA    1 
ATOM   3710  C  C     . MET A  1  501  ? 231.094 273.154 242.122 1.00 0.00 ? 501  MET A C     1 
ATOM   3711  O  O     . MET A  1  501  ? 230.148 272.400 242.157 1.00 0.00 ? 501  MET A O     1 
ATOM   3712  C  CB    . MET A  1  501  ? 230.994 274.896 240.383 1.00 0.00 ? 501  MET A CB    1 
ATOM   3713  C  CG    . MET A  1  501  ? 231.659 275.754 239.308 1.00 0.00 ? 501  MET A CG    1 
ATOM   3714  S  SD    . MET A  1  501  ? 233.070 276.719 239.856 1.00 0.00 ? 501  MET A SD    1 
ATOM   3715  C  CE    . MET A  1  501  ? 233.790 277.061 238.258 1.00 0.00 ? 501  MET A CE    1 
ATOM   3716  N  N     . ASN A  1  502  ? 231.545 273.755 243.206 1.00 0.00 ? 502  ASN A N     1 
ATOM   3717  C  CA    . ASN A  1  502  ? 230.972 273.442 244.480 1.00 0.00 ? 502  ASN A CA    1 
ATOM   3718  C  C     . ASN A  1  502  ? 230.224 274.624 244.963 1.00 0.00 ? 502  ASN A C     1 
ATOM   3719  O  O     . ASN A  1  502  ? 230.736 275.696 244.818 1.00 0.00 ? 502  ASN A O     1 
ATOM   3720  C  CB    . ASN A  1  502  ? 232.071 273.211 245.490 1.00 0.00 ? 502  ASN A CB    1 
ATOM   3721  C  CG    . ASN A  1  502  ? 232.606 271.822 245.459 1.00 0.00 ? 502  ASN A CG    1 
ATOM   3722  O  OD1   . ASN A  1  502  ? 231.886 270.859 245.199 1.00 0.00 ? 502  ASN A OD1   1 
ATOM   3723  N  ND2   . ASN A  1  502  ? 233.883 271.688 245.829 1.00 0.00 ? 502  ASN A ND2   1 
ATOM   3724  N  N     . LEU A  1  503  ? 229.066 274.478 245.593 1.00 0.00 ? 503  LEU A N     1 
ATOM   3725  C  CA    . LEU A  1  503  ? 228.357 275.665 246.063 1.00 0.00 ? 503  LEU A CA    1 
ATOM   3726  C  C     . LEU A  1  503  ? 228.177 275.501 247.577 1.00 0.00 ? 503  LEU A C     1 
ATOM   3727  O  O     . LEU A  1  503  ? 227.947 274.393 248.035 1.00 0.00 ? 503  LEU A O     1 
ATOM   3728  C  CB    . LEU A  1  503  ? 227.060 275.886 245.296 1.00 0.00 ? 503  LEU A CB    1 
ATOM   3729  C  CG    . LEU A  1  503  ? 226.180 277.110 245.608 1.00 0.00 ? 503  LEU A CG    1 
ATOM   3730  C  CD1   . LEU A  1  503  ? 225.432 277.500 244.335 1.00 0.00 ? 503  LEU A CD1   1 
ATOM   3731  C  CD2   . LEU A  1  503  ? 225.155 276.852 246.724 1.00 0.00 ? 503  LEU A CD2   1 
ATOM   3732  N  N     . HIS A  1  504  ? 228.247 276.596 248.351 1.00 0.00 ? 504  HIS A N     1 
ATOM   3733  C  CA    . HIS A  1  504  ? 228.081 276.530 249.813 1.00 0.00 ? 504  HIS A CA    1 
ATOM   3734  C  C     . HIS A  1  504  ? 227.104 277.589 250.284 1.00 0.00 ? 504  HIS A C     1 
ATOM   3735  O  O     . HIS A  1  504  ? 227.268 278.742 249.957 1.00 0.00 ? 504  HIS A O     1 
ATOM   3736  C  CB    . HIS A  1  504  ? 229.380 276.903 250.521 1.00 0.00 ? 504  HIS A CB    1 
ATOM   3737  C  CG    . HIS A  1  504  ? 230.472 275.910 250.376 1.00 0.00 ? 504  HIS A CG    1 
ATOM   3738  N  ND1   . HIS A  1  504  ? 230.850 275.052 251.379 1.00 0.00 ? 504  HIS A ND1   1 
ATOM   3739  C  CD2   . HIS A  1  504  ? 231.400 275.782 249.402 1.00 0.00 ? 504  HIS A CD2   1 
ATOM   3740  C  CE1   . HIS A  1  504  ? 231.889 274.345 250.974 1.00 0.00 ? 504  HIS A CE1   1 
ATOM   3741  N  NE2   . HIS A  1  504  ? 232.251 274.780 249.782 1.00 0.00 ? 504  HIS A NE2   1 
ATOM   3742  N  N     . LEU A  1  505  ? 226.128 277.263 251.105 1.00 0.00 ? 505  LEU A N     1 
ATOM   3743  C  CA    . LEU A  1  505  ? 225.191 278.312 251.490 1.00 0.00 ? 505  LEU A CA    1 
ATOM   3744  C  C     . LEU A  1  505  ? 225.344 278.682 252.951 1.00 0.00 ? 505  LEU A C     1 
ATOM   3745  O  O     . LEU A  1  505  ? 225.027 277.882 253.836 1.00 0.00 ? 505  LEU A O     1 
ATOM   3746  C  CB    . LEU A  1  505  ? 223.740 277.886 251.212 1.00 0.00 ? 505  LEU A CB    1 
ATOM   3747  C  CG    . LEU A  1  505  ? 222.526 278.729 251.665 1.00 0.00 ? 505  LEU A CG    1 
ATOM   3748  C  CD1   . LEU A  1  505  ? 222.369 280.067 250.951 1.00 0.00 ? 505  LEU A CD1   1 
ATOM   3749  C  CD2   . LEU A  1  505  ? 221.263 277.910 251.506 1.00 0.00 ? 505  LEU A CD2   1 
ATOM   3750  N  N     . PRO A  1  506  ? 225.818 279.905 253.206 1.00 0.00 ? 506  PRO A N     1 
ATOM   3751  C  CA    . PRO A  1  506  ? 225.874 280.469 254.556 1.00 0.00 ? 506  PRO A CA    1 
ATOM   3752  C  C     . PRO A  1  506  ? 224.473 280.603 255.191 1.00 0.00 ? 506  PRO A C     1 
ATOM   3753  O  O     . PRO A  1  506  ? 223.480 280.839 254.469 1.00 0.00 ? 506  PRO A O     1 
ATOM   3754  C  CB    . PRO A  1  506  ? 226.515 281.836 254.326 1.00 0.00 ? 506  PRO A CB    1 
ATOM   3755  C  CG    . PRO A  1  506  ? 226.263 282.133 252.883 1.00 0.00 ? 506  PRO A CG    1 
ATOM   3756  C  CD    . PRO A  1  506  ? 226.355 280.829 252.200 1.00 0.00 ? 506  PRO A CD    1 
ATOM   3757  N  N     . GLN A  1  507  ? 224.412 280.526 256.526 1.00 0.00 ? 507  GLN A N     1 
ATOM   3758  C  CA    . GLN A  1  507  ? 223.143 280.332 257.228 1.00 0.00 ? 507  GLN A CA    1 
ATOM   3759  C  C     . GLN A  1  507  ? 222.662 281.528 258.067 1.00 0.00 ? 507  GLN A C     1 
ATOM   3760  O  O     . GLN A  1  507  ? 221.474 281.864 258.053 1.00 0.00 ? 507  GLN A O     1 
ATOM   3761  C  CB    . GLN A  1  507  ? 223.255 279.103 258.132 1.00 0.00 ? 507  GLN A CB    1 
ATOM   3762  C  CG    . GLN A  1  507  ? 223.536 277.793 257.412 1.00 0.00 ? 507  GLN A CG    1 
ATOM   3763  C  CD    . GLN A  1  507  ? 222.435 277.398 256.445 1.00 0.00 ? 507  GLN A CD    1 
ATOM   3764  O  OE1   . GLN A  1  507  ? 221.272 277.242 256.836 1.00 0.00 ? 507  GLN A OE1   1 
ATOM   3765  N  NE2   . GLN A  1  507  ? 222.803 277.193 255.174 1.00 0.00 ? 507  GLN A NE2   1 
ATOM   3766  N  N     . SER A  1  508  ? 223.567 282.158 258.812 1.00 0.00 ? 508  SER A N     1 
ATOM   3767  C  CA    . SER A  1  508  ? 223.192 283.318 259.628 1.00 0.00 ? 508  SER A CA    1 
ATOM   3768  C  C     . SER A  1  508  ? 223.250 284.617 258.831 1.00 0.00 ? 508  SER A C     1 
ATOM   3769  O  O     . SER A  1  508  ? 223.815 284.680 257.748 1.00 0.00 ? 508  SER A O     1 
ATOM   3770  C  CB    . SER A  1  508  ? 224.102 283.458 260.855 1.00 0.00 ? 508  SER A CB    1 
ATOM   3771  O  OG    . SER A  1  508  ? 225.030 284.531 260.679 1.00 0.00 ? 508  SER A OG    1 
ATOM   3772  N  N     . LEU A  1  509  ? 222.653 285.658 259.383 1.00 0.00 ? 509  LEU A N     1 
ATOM   3773  C  CA    . LEU A  1  509  ? 222.796 286.985 258.820 1.00 0.00 ? 509  LEU A CA    1 
ATOM   3774  C  C     . LEU A  1  509  ? 224.198 287.519 258.978 1.00 0.00 ? 509  LEU A C     1 
ATOM   3775  O  O     . LEU A  1  509  ? 224.653 288.256 258.119 1.00 0.00 ? 509  LEU A O     1 
ATOM   3776  C  CB    . LEU A  1  509  ? 221.797 287.961 259.430 1.00 0.00 ? 509  LEU A CB    1 
ATOM   3777  C  CG    . LEU A  1  509  ? 220.379 287.636 258.999 1.00 0.00 ? 509  LEU A CG    1 
ATOM   3778  C  CD1   . LEU A  1  509  ? 219.390 288.432 259.804 1.00 0.00 ? 509  LEU A CD1   1 
ATOM   3779  C  CD2   . LEU A  1  509  ? 220.279 287.967 257.520 1.00 0.00 ? 509  LEU A CD2   1 
ATOM   3780  N  N     . GLU A  1  510  ? 224.910 287.145 260.034 1.00 0.00 ? 510  GLU A N     1 
ATOM   3781  C  CA    . GLU A  1  510  ? 226.286 287.615 260.125 1.00 0.00 ? 510  GLU A CA    1 
ATOM   3782  C  C     . GLU A  1  510  ? 227.195 287.073 259.027 1.00 0.00 ? 510  GLU A C     1 
ATOM   3783  O  O     . GLU A  1  510  ? 228.033 287.820 258.525 1.00 0.00 ? 510  GLU A O     1 
ATOM   3784  C  CB    . GLU A  1  510  ? 226.920 287.358 261.477 1.00 0.00 ? 510  GLU A CB    1 
ATOM   3785  C  CG    . GLU A  1  510  ? 226.351 288.242 262.556 1.00 0.00 ? 510  GLU A CG    1 
ATOM   3786  C  CD    . GLU A  1  510  ? 227.002 288.008 263.916 1.00 0.00 ? 510  GLU A CD    1 
ATOM   3787  O  OE1   . GLU A  1  510  ? 227.411 286.852 264.194 1.00 0.00 ? 510  GLU A OE1   1 
ATOM   3788  O  OE2   . GLU A  1  510  ? 227.087 288.983 264.714 1.00 0.00 ? 510  GLU A OE2   1 
ATOM   3789  N  N     . THR A  1  511  ? 227.084 285.799 258.669 1.00 0.00 ? 511  THR A N     1 
ATOM   3790  C  CA    . THR A  1  511  ? 227.901 285.283 257.569 1.00 0.00 ? 511  THR A CA    1 
ATOM   3791  C  C     . THR A  1  511  ? 227.391 285.816 256.214 1.00 0.00 ? 511  THR A C     1 
ATOM   3792  O  O     . THR A  1  511  ? 228.184 286.078 255.329 1.00 0.00 ? 511  THR A O     1 
ATOM   3793  C  CB    . THR A  1  511  ? 227.973 283.740 257.578 1.00 0.00 ? 511  THR A CB    1 
ATOM   3794  O  OG1   . THR A  1  511  ? 226.659 283.179 257.605 1.00 0.00 ? 511  THR A OG1   1 
ATOM   3795  C  CG2   . THR A  1  511  ? 228.722 283.272 258.810 1.00 0.00 ? 511  THR A CG2   1 
ATOM   3796  N  N     . ARG A  1  512  ? 226.095 286.018 256.053 1.00 0.00 ? 512  ARG A N     1 
ATOM   3797  C  CA    . ARG A  1  512  ? 225.633 286.664 254.834 1.00 0.00 ? 512  ARG A CA    1 
ATOM   3798  C  C     . ARG A  1  512  ? 226.135 288.088 254.674 1.00 0.00 ? 512  ARG A C     1 
ATOM   3799  O  O     . ARG A  1  512  ? 226.474 288.496 253.584 1.00 0.00 ? 512  ARG A O     1 
ATOM   3800  C  CB    . ARG A  1  512  ? 224.118 286.765 254.774 1.00 0.00 ? 512  ARG A CB    1 
ATOM   3801  C  CG    . ARG A  1  512  ? 223.641 287.442 253.480 1.00 0.00 ? 512  ARG A CG    1 
ATOM   3802  C  CD    . ARG A  1  512  ? 222.173 287.630 253.513 1.00 0.00 ? 512  ARG A CD    1 
ATOM   3803  N  NE    . ARG A  1  512  ? 221.484 286.367 253.381 1.00 0.00 ? 512  ARG A NE    1 
ATOM   3804  C  CZ    . ARG A  1  512  ? 220.398 286.204 252.642 1.00 0.00 ? 512  ARG A CZ    1 
ATOM   3805  N  NH1   . ARG A  1  512  ? 219.881 287.255 251.995 1.00 0.00 ? 512  ARG A NH1   1 
ATOM   3806  N  NH2   . ARG A  1  512  ? 219.859 284.987 252.520 1.00 0.00 ? 512  ARG A NH2   1 
ATOM   3807  N  N     . ALA A  1  513  ? 226.156 288.877 255.730 1.00 0.00 ? 513  ALA A N     1 
ATOM   3808  C  CA    . ALA A  1  513  ? 226.690 290.220 255.583 1.00 0.00 ? 513  ALA A CA    1 
ATOM   3809  C  C     . ALA A  1  513  ? 228.173 290.209 255.251 1.00 0.00 ? 513  ALA A C     1 
ATOM   3810  O  O     . ALA A  1  513  ? 228.655 291.006 254.449 1.00 0.00 ? 513  ALA A O     1 
ATOM   3811  C  CB    . ALA A  1  513  ? 226.448 290.997 256.809 1.00 0.00 ? 513  ALA A CB    1 
ATOM   3812  N  N     . GLU A  1  514  ? 228.909 289.362 255.948 1.00 0.00 ? 514  GLU A N     1 
ATOM   3813  C  CA    . GLU A  1  514  ? 230.346 289.235 255.749 1.00 0.00 ? 514  GLU A CA    1 
ATOM   3814  C  C     . GLU A  1  514  ? 230.729 288.780 254.329 1.00 0.00 ? 514  GLU A C     1 
ATOM   3815  O  O     . GLU A  1  514  ? 231.596 289.379 253.700 1.00 0.00 ? 514  GLU A O     1 
ATOM   3816  C  CB    . GLU A  1  514  ? 230.897 288.280 256.805 1.00 0.00 ? 514  GLU A CB    1 
ATOM   3817  C  CG    . GLU A  1  514  ? 232.379 288.253 256.930 1.00 0.00 ? 514  GLU A CG    1 
ATOM   3818  C  CD    . GLU A  1  514  ? 232.795 287.398 258.093 1.00 0.00 ? 514  GLU A CD    1 
ATOM   3819  O  OE1   . GLU A  1  514  ? 232.734 286.159 257.982 1.00 0.00 ? 514  GLU A OE1   1 
ATOM   3820  O  OE2   . GLU A  1  514  ? 233.136 287.970 259.150 1.00 0.00 ? 514  GLU A OE2   1 
ATOM   3821  N  N     . ILE A  1  515  ? 230.000 287.814 253.783 1.00 0.00 ? 515  ILE A N     1 
ATOM   3822  C  CA    . ILE A  1  515  ? 230.227 287.375 252.412 1.00 0.00 ? 515  ILE A CA    1 
ATOM   3823  C  C     . ILE A  1  515  ? 229.874 288.510 251.473 1.00 0.00 ? 515  ILE A C     1 
ATOM   3824  O  O     . ILE A  1  515  ? 230.655 288.852 250.606 1.00 0.00 ? 515  ILE A O     1 
ATOM   3825  C  CB    . ILE A  1  515  ? 229.478 286.078 252.114 1.00 0.00 ? 515  ILE A CB    1 
ATOM   3826  C  CG1   . ILE A  1  515  ? 230.283 284.933 252.738 1.00 0.00 ? 515  ILE A CG1   1 
ATOM   3827  C  CG2   . ILE A  1  515  ? 229.499 285.777 250.674 1.00 0.00 ? 515  ILE A CG2   1 
ATOM   3828  C  CD1   . ILE A  1  515  ? 229.566 283.639 252.903 1.00 0.00 ? 515  ILE A CD1   1 
ATOM   3829  N  N     . GLN A  1  516  ? 228.706 289.088 251.643 1.00 0.00 ? 516  GLN A N     1 
ATOM   3830  C  CA    . GLN A  1  516  ? 228.192 290.162 250.799 1.00 0.00 ? 516  GLN A CA    1 
ATOM   3831  C  C     . GLN A  1  516  ? 229.111 291.362 250.754 1.00 0.00 ? 516  GLN A C     1 
ATOM   3832  O  O     . GLN A  1  516  ? 229.214 292.038 249.747 1.00 0.00 ? 516  GLN A O     1 
ATOM   3833  C  CB    . GLN A  1  516  ? 226.846 290.629 251.275 1.00 0.00 ? 516  GLN A CB    1 
ATOM   3834  C  CG    . GLN A  1  516  ? 226.249 291.628 250.367 1.00 0.00 ? 516  GLN A CG    1 
ATOM   3835  C  CD    . GLN A  1  516  ? 224.836 291.878 250.755 1.00 0.00 ? 516  GLN A CD    1 
ATOM   3836  O  OE1   . GLN A  1  516  ? 224.246 291.070 251.489 1.00 0.00 ? 516  GLN A OE1   1 
ATOM   3837  N  NE2   . GLN A  1  516  ? 224.260 292.993 250.279 1.00 0.00 ? 516  GLN A NE2   1 
ATOM   3838  N  N     . GLU A  1  517  ? 229.719 291.679 251.880 1.00 0.00 ? 517  GLU A N     1 
ATOM   3839  C  CA    . GLU A  1  517  ? 230.616 292.805 251.887 1.00 0.00 ? 517  GLU A CA    1 
ATOM   3840  C  C     . GLU A  1  517  ? 231.982 292.422 251.347 1.00 0.00 ? 517  GLU A C     1 
ATOM   3841  O  O     . GLU A  1  517  ? 232.520 293.133 250.494 1.00 0.00 ? 517  GLU A O     1 
ATOM   3842  C  CB    . GLU A  1  517  ? 230.724 293.350 253.308 1.00 0.00 ? 517  GLU A CB    1 
ATOM   3843  C  CG    . GLU A  1  517  ? 229.437 294.100 253.707 1.00 0.00 ? 517  GLU A CG    1 
ATOM   3844  C  CD    . GLU A  1  517  ? 229.280 295.484 253.058 1.00 0.00 ? 517  GLU A CD    1 
ATOM   3845  O  OE1   . GLU A  1  517  ? 230.126 296.374 253.312 1.00 0.00 ? 517  GLU A OE1   1 
ATOM   3846  O  OE2   . GLU A  1  517  ? 228.311 295.664 252.265 1.00 0.00 ? 517  GLU A OE2   1 
ATOM   3847  N  N     . LEU A  1  518  ? 232.530 291.295 251.791 1.00 0.00 ? 518  LEU A N     1 
ATOM   3848  C  CA    . LEU A  1  518  ? 233.919 290.980 251.452 1.00 0.00 ? 518  LEU A CA    1 
ATOM   3849  C  C     . LEU A  1  518  ? 234.072 290.079 250.223 1.00 0.00 ? 518  LEU A C     1 
ATOM   3850  O  O     . LEU A  1  518  ? 234.700 290.486 249.248 1.00 0.00 ? 518  LEU A O     1 
ATOM   3851  C  CB    . LEU A  1  518  ? 234.637 290.303 252.615 1.00 0.00 ? 518  LEU A CB    1 
ATOM   3852  C  CG    . LEU A  1  518  ? 234.561 290.987 253.956 1.00 0.00 ? 518  LEU A CG    1 
ATOM   3853  C  CD1   . LEU A  1  518  ? 235.314 290.142 254.966 1.00 0.00 ? 518  LEU A CD1   1 
ATOM   3854  C  CD2   . LEU A  1  518  ? 235.151 292.365 253.830 1.00 0.00 ? 518  LEU A CD2   1 
ATOM   3855  N  N     . ALA A  1  519  ? 233.485 288.885 250.254 1.00 0.00 ? 519  ALA A N     1 
ATOM   3856  C  CA    . ALA A  1  519  ? 233.753 287.885 249.233 1.00 0.00 ? 519  ALA A CA    1 
ATOM   3857  C  C     . ALA A  1  519  ? 233.075 288.132 247.888 1.00 0.00 ? 519  ALA A C     1 
ATOM   3858  O  O     . ALA A  1  519  ? 233.452 287.498 246.909 1.00 0.00 ? 519  ALA A O     1 
ATOM   3859  C  CB    . ALA A  1  519  ? 233.379 286.514 249.737 1.00 0.00 ? 519  ALA A CB    1 
ATOM   3860  N  N     . MET A  1  520  ? 232.107 289.038 247.803 1.00 0.00 ? 520  MET A N     1 
ATOM   3861  C  CA    . MET A  1  520  ? 231.303 289.196 246.585 1.00 0.00 ? 520  MET A CA    1 
ATOM   3862  C  C     . MET A  1  520  ? 232.104 289.351 245.280 1.00 0.00 ? 520  MET A C     1 
ATOM   3863  O  O     . MET A  1  520  ? 233.151 289.943 245.299 1.00 0.00 ? 520  MET A O     1 
ATOM   3864  C  CB    . MET A  1  520  ? 230.419 290.406 246.755 1.00 0.00 ? 520  MET A CB    1 
ATOM   3865  C  CG    . MET A  1  520  ? 229.156 290.258 246.025 1.00 0.00 ? 520  MET A CG    1 
ATOM   3866  S  SD    . MET A  1  520  ? 228.339 288.860 246.803 1.00 0.00 ? 520  MET A SD    1 
ATOM   3867  C  CE    . MET A  1  520  ? 226.837 289.646 247.384 1.00 0.00 ? 520  MET A CE    1 
ATOM   3868  N  N     . VAL A  1  521  ? 231.649 288.822 244.147 1.00 0.00 ? 521  VAL A N     1 
ATOM   3869  C  CA    . VAL A  1  521  ? 232.431 289.012 242.912 1.00 0.00 ? 521  VAL A CA    1 
ATOM   3870  C  C     . VAL A  1  521  ? 232.785 290.457 242.463 1.00 0.00 ? 521  VAL A C     1 
ATOM   3871  O  O     . VAL A  1  521  ? 233.925 290.689 242.009 1.00 0.00 ? 521  VAL A O     1 
ATOM   3872  C  CB    . VAL A  1  521  ? 231.731 288.338 241.687 1.00 0.00 ? 521  VAL A CB    1 
ATOM   3873  C  CG1   . VAL A  1  521  ? 232.698 288.125 240.514 1.00 0.00 ? 521  VAL A CG1   1 
ATOM   3874  C  CG2   . VAL A  1  521  ? 230.946 287.094 242.097 1.00 0.00 ? 521  VAL A CG2   1 
ATOM   3875  N  N     . PRO A  1  522  ? 231.853 291.427 242.567 1.00 0.00 ? 522  PRO A N     1 
ATOM   3876  C  CA    . PRO A  1  522  ? 232.196 292.821 242.228 1.00 0.00 ? 522  PRO A CA    1 
ATOM   3877  C  C     . PRO A  1  522  ? 233.398 293.359 243.033 1.00 0.00 ? 522  PRO A C     1 
ATOM   3878  O  O     . PRO A  1  522  ? 234.159 294.156 242.491 1.00 0.00 ? 522  PRO A O     1 
ATOM   3879  C  CB    . PRO A  1  522  ? 230.895 293.582 242.463 1.00 0.00 ? 522  PRO A CB    1 
ATOM   3880  C  CG    . PRO A  1  522  ? 229.831 292.539 242.326 1.00 0.00 ? 522  PRO A CG    1 
ATOM   3881  C  CD    . PRO A  1  522  ? 230.418 291.288 242.855 1.00 0.00 ? 522  PRO A CD    1 
ATOM   3882  N  N     . ARG A  1  523  ? 233.555 292.901 244.283 1.00 0.00 ? 523  ARG A N     1 
ATOM   3883  C  CA    . ARG A  1  523  ? 234.689 293.250 245.148 1.00 0.00 ? 523  ARG A CA    1 
ATOM   3884  C  C     . ARG A  1  523  ? 235.942 292.536 244.673 1.00 0.00 ? 523  ARG A C     1 
ATOM   3885  O  O     . ARG A  1  523  ? 237.049 292.945 244.991 1.00 0.00 ? 523  ARG A O     1 
ATOM   3886  C  CB    . ARG A  1  523  ? 234.427 292.765 246.586 1.00 0.00 ? 523  ARG A CB    1 
ATOM   3887  C  CG    . ARG A  1  523  ? 233.204 293.284 247.345 1.00 0.00 ? 523  ARG A CG    1 
ATOM   3888  C  CD    . ARG A  1  523  ? 233.007 294.746 247.306 1.00 0.00 ? 523  ARG A CD    1 
ATOM   3889  N  NE    . ARG A  1  523  ? 234.224 295.377 247.766 1.00 0.00 ? 523  ARG A NE    1 
ATOM   3890  C  CZ    . ARG A  1  523  ? 234.241 296.513 248.454 1.00 0.00 ? 523  ARG A CZ    1 
ATOM   3891  N  NH1   . ARG A  1  523  ? 233.086 297.093 248.782 1.00 0.00 ? 523  ARG A NH1   1 
ATOM   3892  N  NH2   . ARG A  1  523  ? 235.396 297.121 248.726 1.00 0.00 ? 523  ARG A NH2   1 
ATOM   3893  N  N     . MET A  1  524  ? 235.781 291.382 244.063 1.00 0.00 ? 524  MET A N     1 
ATOM   3894  C  CA    . MET A  1  524  ? 236.928 290.652 243.563 1.00 0.00 ? 524  MET A CA    1 
ATOM   3895  C  C     . MET A  1  524  ? 237.558 291.146 242.252 1.00 0.00 ? 524  MET A C     1 
ATOM   3896  O  O     . MET A  1  524  ? 238.437 290.473 241.747 1.00 0.00 ? 524  MET A O     1 
ATOM   3897  C  CB    . MET A  1  524  ? 236.587 289.175 243.450 1.00 0.00 ? 524  MET A CB    1 
ATOM   3898  C  CG    . MET A  1  524  ? 236.200 288.493 244.797 1.00 0.00 ? 524  MET A CG    1 
ATOM   3899  S  SD    . MET A  1  524  ? 237.564 288.424 245.985 1.00 0.00 ? 524  MET A SD    1 
ATOM   3900  C  CE    . MET A  1  524  ? 237.250 289.870 247.027 1.00 0.00 ? 524  MET A CE    1 
ATOM   3901  N  N     . ILE A  1  525  ? 237.142 292.274 241.667 1.00 0.00 ? 525  ILE A N     1 
ATOM   3902  C  CA    . ILE A  1  525  ? 237.569 292.544 240.270 1.00 0.00 ? 525  ILE A CA    1 
ATOM   3903  C  C     . ILE A  1  525  ? 239.049 292.784 240.069 1.00 0.00 ? 525  ILE A C     1 
ATOM   3904  O  O     . ILE A  1  525  ? 239.645 292.119 239.235 1.00 0.00 ? 525  ILE A O     1 
ATOM   3905  C  CB    . ILE A  1  525  ? 236.851 293.724 239.626 1.00 0.00 ? 525  ILE A CB    1 
ATOM   3906  C  CG1   . ILE A  1  525  ? 235.345 293.462 239.625 1.00 0.00 ? 525  ILE A CG1   1 
ATOM   3907  C  CG2   . ILE A  1  525  ? 237.324 293.867 238.192 1.00 0.00 ? 525  ILE A CG2   1 
ATOM   3908  C  CD1   . ILE A  1  525  ? 234.446 294.601 239.192 1.00 0.00 ? 525  ILE A CD1   1 
ATOM   3909  N  N     . VAL A  1  526  ? 239.672 293.683 240.817 1.00 0.00 ? 526  VAL A N     1 
ATOM   3910  C  CA    . VAL A  1  526  ? 241.124 293.815 240.647 1.00 0.00 ? 526  VAL A CA    1 
ATOM   3911  C  C     . VAL A  1  526  ? 241.880 293.040 241.735 1.00 0.00 ? 526  VAL A C     1 
ATOM   3912  O  O     . VAL A  1  526  ? 241.616 293.181 242.935 1.00 0.00 ? 526  VAL A O     1 
ATOM   3913  C  CB    . VAL A  1  526  ? 241.588 295.277 240.633 1.00 0.00 ? 526  VAL A CB    1 
ATOM   3914  C  CG1   . VAL A  1  526  ? 243.087 295.336 240.488 1.00 0.00 ? 526  VAL A CG1   1 
ATOM   3915  C  CG2   . VAL A  1  526  ? 240.964 296.000 239.469 1.00 0.00 ? 526  VAL A CG2   1 
ATOM   3916  N  N     . THR A  1  527  ? 242.838 292.237 241.282 1.00 0.00 ? 527  THR A N     1 
ATOM   3917  C  CA    . THR A  1  527  ? 243.523 291.271 242.123 1.00 0.00 ? 527  THR A CA    1 
ATOM   3918  C  C     . THR A  1  527  ? 244.694 291.934 242.829 1.00 0.00 ? 527  THR A C     1 
ATOM   3919  O  O     . THR A  1  527  ? 245.416 292.712 242.217 1.00 0.00 ? 527  THR A O     1 
ATOM   3920  C  CB    . THR A  1  527  ? 244.000 290.044 241.279 1.00 0.00 ? 527  THR A CB    1 
ATOM   3921  O  OG1   . THR A  1  527  ? 244.666 289.088 242.114 1.00 0.00 ? 527  THR A OG1   1 
ATOM   3922  C  CG2   . THR A  1  527  ? 244.916 290.471 240.147 1.00 0.00 ? 527  THR A CG2   1 
ATOM   3923  N  N     . PRO A  1  528  ? 244.859 291.653 244.133 1.00 0.00 ? 528  PRO A N     1 
ATOM   3924  C  CA    . PRO A  1  528  ? 245.984 292.167 244.917 1.00 0.00 ? 528  PRO A CA    1 
ATOM   3925  C  C     . PRO A  1  528  ? 247.298 291.440 244.614 1.00 0.00 ? 528  PRO A C     1 
ATOM   3926  O  O     . PRO A  1  528  ? 248.368 291.955 244.919 1.00 0.00 ? 528  PRO A O     1 
ATOM   3927  C  CB    . PRO A  1  528  ? 245.556 291.896 246.343 1.00 0.00 ? 528  PRO A CB    1 
ATOM   3928  C  CG    . PRO A  1  528  ? 244.718 290.662 246.216 1.00 0.00 ? 528  PRO A CG    1 
ATOM   3929  C  CD    . PRO A  1  528  ? 243.986 290.781 244.935 1.00 0.00 ? 528  PRO A CD    1 
ATOM   3930  N  N     . GLN A  1  529  ? 247.217 290.253 244.029 1.00 0.00 ? 529  GLN A N     1 
ATOM   3931  C  CA    . GLN A  1  529  ? 248.407 289.527 243.617 1.00 0.00 ? 529  GLN A CA    1 
ATOM   3932  C  C     . GLN A  1  529  ? 249.306 290.314 242.680 1.00 0.00 ? 529  GLN A C     1 
ATOM   3933  O  O     . GLN A  1  529  ? 250.515 290.355 242.859 1.00 0.00 ? 529  GLN A O     1 
ATOM   3934  C  CB    . GLN A  1  529  ? 248.020 288.249 242.930 1.00 0.00 ? 529  GLN A CB    1 
ATOM   3935  C  CG    . GLN A  1  529  ? 249.150 287.691 242.149 1.00 0.00 ? 529  GLN A CG    1 
ATOM   3936  C  CD    . GLN A  1  529  ? 248.671 286.850 240.995 1.00 0.00 ? 529  GLN A CD    1 
ATOM   3937  O  OE1   . GLN A  1  529  ? 247.458 286.780 240.710 1.00 0.00 ? 529  GLN A OE1   1 
ATOM   3938  N  NE2   . GLN A  1  529  ? 249.621 286.191 240.307 1.00 0.00 ? 529  GLN A NE2   1 
ATOM   3939  N  N     . SER A  1  530  ? 248.713 290.917 241.660 1.00 0.00 ? 530  SER A N     1 
ATOM   3940  C  CA    . SER A  1  530  ? 249.472 291.631 240.636 1.00 0.00 ? 530  SER A CA    1 
ATOM   3941  C  C     . SER A  1  530  ? 248.721 292.865 240.116 1.00 0.00 ? 530  SER A C     1 
ATOM   3942  O  O     . SER A  1  530  ? 248.740 293.151 238.924 1.00 0.00 ? 530  SER A O     1 
ATOM   3943  C  CB    . SER A  1  530  ? 249.830 290.672 239.491 1.00 0.00 ? 530  SER A CB    1 
ATOM   3944  O  OG    . SER A  1  530  ? 248.797 289.726 239.242 1.00 0.00 ? 530  SER A OG    1 
ATOM   3945  N  N     . ASN A  1  531  ? 248.067 293.569 241.038 1.00 0.00 ? 531  ASN A N     1 
ATOM   3946  C  CA    . ASN A  1  531  ? 247.299 294.810 240.822 1.00 0.00 ? 531  ASN A CA    1 
ATOM   3947  C  C     . ASN A  1  531  ? 246.689 295.079 239.435 1.00 0.00 ? 531  ASN A C     1 
ATOM   3948  O  O     . ASN A  1  531  ? 246.719 296.225 238.956 1.00 0.00 ? 531  ASN A O     1 
ATOM   3949  C  CB    . ASN A  1  531  ? 248.144 296.022 241.220 1.00 0.00 ? 531  ASN A CB    1 
ATOM   3950  C  CG    . ASN A  1  531  ? 249.321 296.257 240.307 1.00 0.00 ? 531  ASN A CG    1 
ATOM   3951  O  OD1   . ASN A  1  531  ? 249.971 295.330 239.844 1.00 0.00 ? 531  ASN A OD1   1 
ATOM   3952  N  ND2   . ASN A  1  531  ? 249.608 297.520 240.050 1.00 0.00 ? 531  ASN A ND2   1 
ATOM   3953  N  N     . ARG A  1  532  ? 246.074 294.037 238.859 1.00 0.00 ? 532  ARG A N     1 
ATOM   3954  C  CA    . ARG A  1  532  ? 245.469 294.044 237.519 1.00 0.00 ? 532  ARG A CA    1 
ATOM   3955  C  C     . ARG A  1  532  ? 244.051 293.498 237.622 1.00 0.00 ? 532  ARG A C     1 
ATOM   3956  O  O     . ARG A  1  532  ? 243.720 292.909 238.637 1.00 0.00 ? 532  ARG A O     1 
ATOM   3957  C  CB    . ARG A  1  532  ? 246.295 293.198 236.559 1.00 0.00 ? 532  ARG A CB    1 
ATOM   3958  C  CG    . ARG A  1  532  ? 246.353 291.734 236.946 1.00 0.00 ? 532  ARG A CG    1 
ATOM   3959  C  CD    . ARG A  1  532  ? 247.368 291.004 236.099 1.00 0.00 ? 532  ARG A CD    1 
ATOM   3960  N  NE    . ARG A  1  532  ? 246.927 290.963 234.709 1.00 0.00 ? 532  ARG A NE    1 
ATOM   3961  C  CZ    . ARG A  1  532  ? 247.743 290.907 233.654 1.00 0.00 ? 532  ARG A CZ    1 
ATOM   3962  N  NH1   . ARG A  1  532  ? 249.067 290.885 233.835 1.00 0.00 ? 532  ARG A NH1   1 
ATOM   3963  N  NH2   . ARG A  1  532  ? 247.234 290.859 232.416 1.00 0.00 ? 532  ARG A NH2   1 
ATOM   3964  N  N     . PRO A  1  533  ? 243.197 293.705 236.598 1.00 0.00 ? 533  PRO A N     1 
ATOM   3965  C  CA    . PRO A  1  533  ? 241.868 293.085 236.646 1.00 0.00 ? 533  PRO A CA    1 
ATOM   3966  C  C     . PRO A  1  533  ? 241.928 291.611 236.373 1.00 0.00 ? 533  PRO A C     1 
ATOM   3967  O  O     . PRO A  1  533  ? 242.377 291.192 235.313 1.00 0.00 ? 533  PRO A O     1 
ATOM   3968  C  CB    . PRO A  1  533  ? 241.086 293.789 235.543 1.00 0.00 ? 533  PRO A CB    1 
ATOM   3969  C  CG    . PRO A  1  533  ? 241.832 294.963 235.243 1.00 0.00 ? 533  PRO A CG    1 
ATOM   3970  C  CD    . PRO A  1  533  ? 243.283 294.657 235.493 1.00 0.00 ? 533  PRO A CD    1 
ATOM   3971  N  N     . VAL A  1  534  ? 241.423 290.850 237.333 1.00 0.00 ? 534  VAL A N     1 
ATOM   3972  C  CA    . VAL A  1  534  ? 241.500 289.412 237.353 1.00 0.00 ? 534  VAL A CA    1 
ATOM   3973  C  C     . VAL A  1  534  ? 240.515 288.766 236.380 1.00 0.00 ? 534  VAL A C     1 
ATOM   3974  O  O     . VAL A  1  534  ? 240.532 287.555 236.199 1.00 0.00 ? 534  VAL A O     1 
ATOM   3975  C  CB    . VAL A  1  534  ? 241.247 288.904 238.758 1.00 0.00 ? 534  VAL A CB    1 
ATOM   3976  C  CG1   . VAL A  1  534  ? 239.771 288.796 239.001 1.00 0.00 ? 534  VAL A CG1   1 
ATOM   3977  C  CG2   . VAL A  1  534  ? 241.941 287.575 238.971 1.00 0.00 ? 534  VAL A CG2   1 
ATOM   3978  N  N     . MET A  1  535  ? 239.637 289.559 235.775 1.00 0.00 ? 535  MET A N     1 
ATOM   3979  C  CA    . MET A  1  535  ? 238.681 289.044 234.801 1.00 0.00 ? 535  MET A CA    1 
ATOM   3980  C  C     . MET A  1  535  ? 238.472 290.037 233.658 1.00 0.00 ? 535  MET A C     1 
ATOM   3981  O  O     . MET A  1  535  ? 238.160 291.192 233.888 1.00 0.00 ? 535  MET A O     1 
ATOM   3982  C  CB    . MET A  1  535  ? 237.357 288.738 235.501 1.00 0.00 ? 535  MET A CB    1 
ATOM   3983  C  CG    . MET A  1  535  ? 236.694 289.984 236.113 1.00 0.00 ? 535  MET A CG    1 
ATOM   3984  S  SD    . MET A  1  535  ? 235.213 289.802 237.154 1.00 0.00 ? 535  MET A SD    1 
ATOM   3985  C  CE    . MET A  1  535  ? 235.858 289.331 238.802 1.00 0.00 ? 535  MET A CE    1 
ATOM   3986  N  N     . GLY A  1  536  ? 238.652 289.618 232.418 1.00 0.00 ? 536  GLY A N     1 
ATOM   3987  C  CA    . GLY A  1  536  ? 238.454 290.552 231.313 1.00 0.00 ? 536  GLY A CA    1 
ATOM   3988  C  C     . GLY A  1  536  ? 237.450 289.982 230.334 1.00 0.00 ? 536  GLY A C     1 
ATOM   3989  O  O     . GLY A  1  536  ? 236.992 288.867 230.562 1.00 0.00 ? 536  GLY A O     1 
ATOM   3990  N  N     . ILE A  1  537  ? 237.115 290.692 229.254 1.00 0.00 ? 537  ILE A N     1 
ATOM   3991  C  CA    . ILE A  1  537  ? 236.193 290.129 228.258 1.00 0.00 ? 537  ILE A CA    1 
ATOM   3992  C  C     . ILE A  1  537  ? 236.847 289.049 227.410 1.00 0.00 ? 537  ILE A C     1 
ATOM   3993  O  O     . ILE A  1  537  ? 237.983 289.207 226.981 1.00 0.00 ? 537  ILE A O     1 
ATOM   3994  C  CB    . ILE A  1  537  ? 235.652 291.193 227.361 1.00 0.00 ? 537  ILE A CB    1 
ATOM   3995  C  CG1   . ILE A  1  537  ? 234.871 292.164 228.216 1.00 0.00 ? 537  ILE A CG1   1 
ATOM   3996  C  CG2   . ILE A  1  537  ? 234.746 290.591 226.310 1.00 0.00 ? 537  ILE A CG2   1 
ATOM   3997  C  CD1   . ILE A  1  537  ? 233.958 291.450 229.182 1.00 0.00 ? 537  ILE A CD1   1 
ATOM   3998  N  N     . VAL A  1  538  ? 236.142 287.944 227.167 1.00 0.00 ? 538  VAL A N     1 
ATOM   3999  C  CA    . VAL A  1  538  ? 236.790 286.764 226.580 1.00 0.00 ? 538  VAL A CA    1 
ATOM   4000  C  C     . VAL A  1  538  ? 235.956 286.095 225.459 1.00 0.00 ? 538  VAL A C     1 
ATOM   4001  O  O     . VAL A  1  538  ? 234.793 286.452 225.245 1.00 0.00 ? 538  VAL A O     1 
ATOM   4002  C  CB    . VAL A  1  538  ? 237.095 285.726 227.676 1.00 0.00 ? 538  VAL A CB    1 
ATOM   4003  C  CG1   . VAL A  1  538  ? 238.112 286.281 228.678 1.00 0.00 ? 538  VAL A CG1   1 
ATOM   4004  C  CG2   . VAL A  1  538  ? 235.808 285.314 228.363 1.00 0.00 ? 538  VAL A CG2   1 
ATOM   4005  N  N     . GLN A  1  539  ? 236.581 285.157 224.739 1.00 0.00 ? 539  GLN A N     1 
ATOM   4006  C  CA    . GLN A  1  539  ? 235.945 284.262 223.761 1.00 0.00 ? 539  GLN A CA    1 
ATOM   4007  C  C     . GLN A  1  539  ? 235.165 285.096 222.738 1.00 0.00 ? 539  GLN A C     1 
ATOM   4008  O  O     . GLN A  1  539  ? 235.667 286.104 222.304 1.00 0.00 ? 539  GLN A O     1 
ATOM   4009  C  CB    . GLN A  1  539  ? 235.012 283.245 224.445 1.00 0.00 ? 539  GLN A CB    1 
ATOM   4010  C  CG    . GLN A  1  539  ? 235.718 282.275 225.434 1.00 0.00 ? 539  GLN A CG    1 
ATOM   4011  C  CD    . GLN A  1  539  ? 236.458 281.110 224.782 1.00 0.00 ? 539  GLN A CD    1 
ATOM   4012  O  OE1   . GLN A  1  539  ? 237.212 281.296 223.822 1.00 0.00 ? 539  GLN A OE1   1 
ATOM   4013  N  NE2   . GLN A  1  539  ? 236.263 279.910 225.305 1.00 0.00 ? 539  GLN A NE2   1 
ATOM   4014  N  N     . ASP A  1  540  ? 233.926 284.738 222.398 1.00 0.00 ? 540  ASP A N     1 
ATOM   4015  C  CA    . ASP A  1  540  ? 233.196 285.502 221.355 1.00 0.00 ? 540  ASP A CA    1 
ATOM   4016  C  C     . ASP A  1  540  ? 233.022 286.967 221.556 1.00 0.00 ? 540  ASP A C     1 
ATOM   4017  O  O     . ASP A  1  540  ? 233.185 287.732 220.627 1.00 0.00 ? 540  ASP A O     1 
ATOM   4018  C  CB    . ASP A  1  540  ? 231.757 285.043 221.141 1.00 0.00 ? 540  ASP A CB    1 
ATOM   4019  C  CG    . ASP A  1  540  ? 231.644 283.763 220.377 1.00 0.00 ? 540  ASP A CG    1 
ATOM   4020  O  OD1   . ASP A  1  540  ? 232.270 283.728 219.267 1.00 0.00 ? 540  ASP A OD1   1 
ATOM   4021  O  OD2   . ASP A  1  540  ? 230.806 282.891 220.809 1.00 0.00 ? 540  ASP A OD2   1 
ATOM   4022  N  N     . THR A  1  541  ? 232.651 287.339 222.767 1.00 0.00 ? 541  THR A N     1 
ATOM   4023  C  CA    . THR A  1  541  ? 232.475 288.730 223.129 1.00 0.00 ? 541  THR A CA    1 
ATOM   4024  C  C     . THR A  1  541  ? 233.768 289.428 222.837 1.00 0.00 ? 541  THR A C     1 
ATOM   4025  O  O     . THR A  1  541  ? 233.759 290.606 222.490 1.00 0.00 ? 541  THR A O     1 
ATOM   4026  C  CB    . THR A  1  541  ? 232.056 288.911 224.557 1.00 0.00 ? 541  THR A CB    1 
ATOM   4027  O  OG1   . THR A  1  541  ? 231.011 287.959 224.854 1.00 0.00 ? 541  THR A OG1   1 
ATOM   4028  C  CG2   . THR A  1  541  ? 231.545 290.346 224.762 1.00 0.00 ? 541  THR A CG2   1 
ATOM   4029  N  N     . LEU A  1  542  ? 234.882 288.782 223.145 1.00 0.00 ? 542  LEU A N     1 
ATOM   4030  C  CA    . LEU A  1  542  ? 236.161 289.390 222.820 1.00 0.00 ? 542  LEU A CA    1 
ATOM   4031  C  C     . LEU A  1  542  ? 236.463 289.543 221.308 1.00 0.00 ? 542  LEU A C     1 
ATOM   4032  O  O     . LEU A  1  542  ? 236.972 290.569 220.871 1.00 0.00 ? 542  LEU A O     1 
ATOM   4033  C  CB    . LEU A  1  542  ? 237.280 288.586 223.444 1.00 0.00 ? 542  LEU A CB    1 
ATOM   4034  C  CG    . LEU A  1  542  ? 238.565 289.381 223.404 1.00 0.00 ? 542  LEU A CG    1 
ATOM   4035  C  CD1   . LEU A  1  542  ? 238.394 290.668 224.166 1.00 0.00 ? 542  LEU A CD1   1 
ATOM   4036  C  CD2   . LEU A  1  542  ? 239.681 288.508 223.950 1.00 0.00 ? 542  LEU A CD2   1 
ATOM   4037  N  N     . THR A  1  543  ? 236.104 288.552 220.508 1.00 0.00 ? 543  THR A N     1 
ATOM   4038  C  CA    . THR A  1  543  ? 236.224 288.656 219.072 1.00 0.00 ? 543  THR A CA    1 
ATOM   4039  C  C     . THR A  1  543  ? 235.190 289.545 218.517 1.00 0.00 ? 543  THR A C     1 
ATOM   4040  O  O     . THR A  1  543  ? 235.479 290.344 217.677 1.00 0.00 ? 543  THR A O     1 
ATOM   4041  C  CB    . THR A  1  543  ? 236.140 287.296 218.346 1.00 0.00 ? 543  THR A CB    1 
ATOM   4042  O  OG1   . THR A  1  543  ? 237.254 286.463 218.706 1.00 0.00 ? 543  THR A OG1   1 
ATOM   4043  C  CG2   . THR A  1  543  ? 236.208 287.514 216.844 1.00 0.00 ? 543  THR A CG2   1 
ATOM   4044  N  N     . ALA A  1  544  ? 233.972 289.434 218.997 1.00 0.00 ? 544  ALA A N     1 
ATOM   4045  C  CA    . ALA A  1  544  ? 232.897 290.238 218.434 1.00 0.00 ? 544  ALA A CA    1 
ATOM   4046  C  C     . ALA A  1  544  ? 233.004 291.686 218.690 1.00 0.00 ? 544  ALA A C     1 
ATOM   4047  O  O     . ALA A  1  544  ? 232.543 292.445 217.877 1.00 0.00 ? 544  ALA A O     1 
ATOM   4048  C  CB    . ALA A  1  544  ? 231.558 289.778 218.963 1.00 0.00 ? 544  ALA A CB    1 
ATOM   4049  N  N     . VAL A  1  545  ? 233.544 292.088 219.828 1.00 0.00 ? 545  VAL A N     1 
ATOM   4050  C  CA    . VAL A  1  545  ? 233.845 293.495 220.016 1.00 0.00 ? 545  VAL A CA    1 
ATOM   4051  C  C     . VAL A  1  545  ? 234.866 294.268 219.138 1.00 0.00 ? 545  VAL A C     1 
ATOM   4052  O  O     . VAL A  1  545  ? 234.549 295.368 218.711 1.00 0.00 ? 545  VAL A O     1 
ATOM   4053  C  CB    . VAL A  1  545  ? 234.257 293.686 221.486 1.00 0.00 ? 545  VAL A CB    1 
ATOM   4054  C  CG1   . VAL A  1  545  ? 235.626 293.127 221.757 1.00 0.00 ? 545  VAL A CG1   1 
ATOM   4055  C  CG2   . VAL A  1  545  ? 234.163 295.141 221.850 1.00 0.00 ? 545  VAL A CG2   1 
ATOM   4056  N  N     . ARG A  1  546  ? 236.004 293.671 218.802 1.00 0.00 ? 546  ARG A N     1 
ATOM   4057  C  CA    . ARG A  1  546  ? 236.961 294.347 217.929 1.00 0.00 ? 546  ARG A CA    1 
ATOM   4058  C  C     . ARG A  1  546  ? 236.334 294.528 216.539 1.00 0.00 ? 546  ARG A C     1 
ATOM   4059  O  O     . ARG A  1  546  ? 236.456 295.583 215.916 1.00 0.00 ? 546  ARG A O     1 
ATOM   4060  C  CB    . ARG A  1  546  ? 238.259 293.546 217.826 1.00 0.00 ? 546  ARG A CB    1 
ATOM   4061  C  CG    . ARG A  1  546  ? 238.074 292.127 217.313 1.00 0.00 ? 546  ARG A CG    1 
ATOM   4062  C  CD    . ARG A  1  546  ? 238.931 291.869 216.084 1.00 0.00 ? 546  ARG A CD    1 
ATOM   4063  N  NE    . ARG A  1  546  ? 239.098 293.071 215.272 1.00 0.00 ? 546  ARG A NE    1 
ATOM   4064  C  CZ    . ARG A  1  546  ? 239.362 293.061 213.970 1.00 0.00 ? 546  ARG A CZ    1 
ATOM   4065  N  NH1   . ARG A  1  546  ? 239.490 291.910 213.325 1.00 0.00 ? 546  ARG A NH1   1 
ATOM   4066  N  NH2   . ARG A  1  546  ? 239.498 294.204 213.310 1.00 0.00 ? 546  ARG A NH2   1 
ATOM   4067  N  N     . LYS A  1  547  ? 235.663 293.477 216.076 1.00 0.00 ? 547  LYS A N     1 
ATOM   4068  C  CA    . LYS A  1  547  ? 234.978 293.430 214.808 1.00 0.00 ? 547  LYS A CA    1 
ATOM   4069  C  C     . LYS A  1  547  ? 233.885 294.512 214.845 1.00 0.00 ? 547  LYS A C     1 
ATOM   4070  O  O     . LYS A  1  547  ? 233.637 295.189 213.829 1.00 0.00 ? 547  LYS A O     1 
ATOM   4071  C  CB    . LYS A  1  547  ? 234.451 291.997 214.580 1.00 0.00 ? 547  LYS A CB    1 
ATOM   4072  C  CG    . LYS A  1  547  ? 233.930 291.673 213.205 1.00 0.00 ? 547  LYS A CG    1 
ATOM   4073  C  CD    . LYS A  1  547  ? 233.528 290.206 213.154 1.00 0.00 ? 547  LYS A CD    1 
ATOM   4074  C  CE    . LYS A  1  547  ? 232.879 289.828 211.798 1.00 0.00 ? 547  LYS A CE    1 
ATOM   4075  N  NZ    . LYS A  1  547  ? 232.275 288.441 211.807 1.00 0.00 ? 547  LYS A NZ    1 
ATOM   4076  N  N     . PHE A  1  548  ? 233.232 294.670 215.999 1.00 0.00 ? 548  PHE A N     1 
ATOM   4077  C  CA    . PHE A  1  548  ? 232.187 295.688 216.160 1.00 0.00 ? 548  PHE A CA    1 
ATOM   4078  C  C     . PHE A  1  548  ? 232.722 297.095 216.217 1.00 0.00 ? 548  PHE A C     1 
ATOM   4079  O  O     . PHE A  1  548  ? 232.001 298.017 215.890 1.00 0.00 ? 548  PHE A O     1 
ATOM   4080  C  CB    . PHE A  1  548  ? 231.362 295.432 217.402 1.00 0.00 ? 548  PHE A CB    1 
ATOM   4081  C  CG    . PHE A  1  548  ? 230.199 296.330 217.538 1.00 0.00 ? 548  PHE A CG    1 
ATOM   4082  C  CD1   . PHE A  1  548  ? 229.168 296.282 216.650 1.00 0.00 ? 548  PHE A CD1   1 
ATOM   4083  C  CD2   . PHE A  1  548  ? 230.135 297.221 218.580 1.00 0.00 ? 548  PHE A CD2   1 
ATOM   4084  C  CE1   . PHE A  1  548  ? 228.079 297.128 216.790 1.00 0.00 ? 548  PHE A CE1   1 
ATOM   4085  C  CE2   . PHE A  1  548  ? 229.051 298.069 218.742 1.00 0.00 ? 548  PHE A CE2   1 
ATOM   4086  C  CZ    . PHE A  1  548  ? 228.022 298.028 217.847 1.00 0.00 ? 548  PHE A CZ    1 
ATOM   4087  N  N     . THR A  1  549  ? 233.893 297.291 216.806 1.00 0.00 ? 549  THR A N     1 
ATOM   4088  C  CA    . THR A  1  549  ? 234.416 298.647 216.967 1.00 0.00 ? 549  THR A CA    1 
ATOM   4089  C  C     . THR A  1  549  ? 235.086 299.180 215.684 1.00 0.00 ? 549  THR A C     1 
ATOM   4090  O  O     . THR A  1  549  ? 235.460 300.332 215.650 1.00 0.00 ? 549  THR A O     1 
ATOM   4091  C  CB    . THR A  1  549  ? 235.405 298.782 218.149 1.00 0.00 ? 549  THR A CB    1 
ATOM   4092  O  OG1   . THR A  1  549  ? 236.455 297.802 218.075 1.00 0.00 ? 549  THR A OG1   1 
ATOM   4093  C  CG2   . THR A  1  549  ? 234.658 298.699 219.493 1.00 0.00 ? 549  THR A CG2   1 
ATOM   4094  N  N     . LYS A  1  550  ? 235.308 298.339 214.672 1.00 0.00 ? 550  LYS A N     1 
ATOM   4095  C  CA    . LYS A  1  550  ? 235.899 298.782 213.395 1.00 0.00 ? 550  LYS A CA    1 
ATOM   4096  C  C     . LYS A  1  550  ? 235.100 299.894 212.711 1.00 0.00 ? 550  LYS A C     1 
ATOM   4097  O  O     . LYS A  1  550  ? 233.879 299.788 212.574 1.00 0.00 ? 550  LYS A O     1 
ATOM   4098  C  CB    . LYS A  1  550  ? 236.009 297.617 212.410 1.00 0.00 ? 550  LYS A CB    1 
ATOM   4099  C  CG    . LYS A  1  550  ? 237.003 296.542 212.758 1.00 0.00 ? 550  LYS A CG    1 
ATOM   4100  C  CD    . LYS A  1  550  ? 236.968 295.400 211.741 1.00 0.00 ? 550  LYS A CD    1 
ATOM   4101  C  CE    . LYS A  1  550  ? 237.241 295.893 210.319 1.00 0.00 ? 550  LYS A CE    1 
ATOM   4102  N  NZ    . LYS A  1  550  ? 237.440 294.788 209.327 1.00 0.00 ? 550  LYS A NZ    1 
ATOM   4103  N  N     . ARG A  1  551  ? 235.770 300.927 212.210 1.00 0.00 ? 551  ARG A N     1 
ATOM   4104  C  CA    . ARG A  1  551  ? 235.014 302.077 211.718 1.00 0.00 ? 551  ARG A CA    1 
ATOM   4105  C  C     . ARG A  1  551  ? 234.315 301.834 210.374 1.00 0.00 ? 551  ARG A C     1 
ATOM   4106  O  O     . ARG A  1  551  ? 233.715 302.747 209.813 1.00 0.00 ? 551  ARG A O     1 
ATOM   4107  C  CB    . ARG A  1  551  ? 235.905 303.318 211.629 1.00 0.00 ? 551  ARG A CB    1 
ATOM   4108  C  CG    . ARG A  1  551  ? 236.866 303.354 210.471 1.00 0.00 ? 551  ARG A CG    1 
ATOM   4109  C  CD    . ARG A  1  551  ? 237.695 304.627 210.545 1.00 0.00 ? 551  ARG A CD    1 
ATOM   4110  N  NE    . ARG A  1  551  ? 238.516 304.838 209.357 1.00 0.00 ? 551  ARG A NE    1 
ATOM   4111  C  CZ    . ARG A  1  551  ? 239.627 304.157 209.086 1.00 0.00 ? 551  ARG A CZ    1 
ATOM   4112  N  NH1   . ARG A  1  551  ? 240.031 303.196 209.910 1.00 0.00 ? 551  ARG A NH1   1 
ATOM   4113  N  NH2   . ARG A  1  551  ? 240.330 304.430 207.988 1.00 0.00 ? 551  ARG A NH2   1 
ATOM   4114  N  N     . ASP A  1  552  ? 234.380 300.615 209.855 1.00 0.00 ? 552  ASP A N     1 
ATOM   4115  C  CA    . ASP A  1  552  ? 233.627 300.295 208.646 1.00 0.00 ? 552  ASP A CA    1 
ATOM   4116  C  C     . ASP A  1  552  ? 232.159 299.923 208.933 1.00 0.00 ? 552  ASP A C     1 
ATOM   4117  O  O     . ASP A  1  552  ? 231.335 299.886 208.015 1.00 0.00 ? 552  ASP A O     1 
ATOM   4118  C  CB    . ASP A  1  552  ? 234.296 299.145 207.875 1.00 0.00 ? 552  ASP A CB    1 
ATOM   4119  C  CG    . ASP A  1  552  ? 234.069 297.769 208.527 1.00 0.00 ? 552  ASP A CG    1 
ATOM   4120  O  OD1   . ASP A  1  552  ? 233.913 297.699 209.772 1.00 0.00 ? 552  ASP A OD1   1 
ATOM   4121  O  OD2   . ASP A  1  552  ? 234.044 296.754 207.781 1.00 0.00 ? 552  ASP A OD2   1 
ATOM   4122  N  N     . VAL A  1  553  ? 231.831 299.647 210.195 1.00 0.00 ? 553  VAL A N     1 
ATOM   4123  C  CA    . VAL A  1  553  ? 230.500 299.147 210.556 1.00 0.00 ? 553  VAL A CA    1 
ATOM   4124  C  C     . VAL A  1  553  ? 229.460 300.261 210.713 1.00 0.00 ? 553  VAL A C     1 
ATOM   4125  O  O     . VAL A  1  553  ? 229.664 301.197 211.489 1.00 0.00 ? 553  VAL A O     1 
ATOM   4126  C  CB    . VAL A  1  553  ? 230.557 298.353 211.857 1.00 0.00 ? 553  VAL A CB    1 
ATOM   4127  C  CG1   . VAL A  1  553  ? 229.172 297.947 212.269 1.00 0.00 ? 553  VAL A CG1   1 
ATOM   4128  C  CG2   . VAL A  1  553  ? 231.430 297.136 211.680 1.00 0.00 ? 553  VAL A CG2   1 
ATOM   4129  N  N     . PHE A  1  554  ? 228.348 300.166 209.985 1.00 0.00 ? 554  PHE A N     1 
ATOM   4130  C  CA    . PHE A  1  554  ? 227.255 301.133 210.137 1.00 0.00 ? 554  PHE A CA    1 
ATOM   4131  C  C     . PHE A  1  554  ? 225.949 300.407 210.399 1.00 0.00 ? 554  PHE A C     1 
ATOM   4132  O  O     . PHE A  1  554  ? 225.701 299.336 209.834 1.00 0.00 ? 554  PHE A O     1 
ATOM   4133  C  CB    . PHE A  1  554  ? 227.105 302.036 208.905 1.00 0.00 ? 554  PHE A CB    1 
ATOM   4134  C  CG    . PHE A  1  554  ? 228.365 302.755 208.526 1.00 0.00 ? 554  PHE A CG    1 
ATOM   4135  C  CD1   . PHE A  1  554  ? 228.705 303.941 209.140 1.00 0.00 ? 554  PHE A CD1   1 
ATOM   4136  C  CD2   . PHE A  1  554  ? 229.192 302.258 207.539 1.00 0.00 ? 554  PHE A CD2   1 
ATOM   4137  C  CE1   . PHE A  1  554  ? 229.851 304.601 208.798 1.00 0.00 ? 554  PHE A CE1   1 
ATOM   4138  C  CE2   . PHE A  1  554  ? 230.339 302.916 207.192 1.00 0.00 ? 554  PHE A CE2   1 
ATOM   4139  C  CZ    . PHE A  1  554  ? 230.669 304.090 207.822 1.00 0.00 ? 554  PHE A CZ    1 
ATOM   4140  N  N     . LEU A  1  555  ? 225.137 300.977 211.288 1.00 0.00 ? 555  LEU A N     1 
ATOM   4141  C  CA    . LEU A  1  555  ? 223.874 300.365 211.695 1.00 0.00 ? 555  LEU A CA    1 
ATOM   4142  C  C     . LEU A  1  555  ? 222.687 301.270 211.350 1.00 0.00 ? 555  LEU A C     1 
ATOM   4143  O  O     . LEU A  1  555  ? 222.765 302.475 211.551 1.00 0.00 ? 555  LEU A O     1 
ATOM   4144  C  CB    . LEU A  1  555  ? 223.899 300.048 213.200 1.00 0.00 ? 555  LEU A CB    1 
ATOM   4145  C  CG    . LEU A  1  555  ? 224.638 298.802 213.737 1.00 0.00 ? 555  LEU A CG    1 
ATOM   4146  C  CD1   . LEU A  1  555  ? 226.147 298.922 213.709 1.00 0.00 ? 555  LEU A CD1   1 
ATOM   4147  C  CD2   . LEU A  1  555  ? 224.185 298.505 215.156 1.00 0.00 ? 555  LEU A CD2   1 
ATOM   4148  N  N     . GLU A  1  556  ? 221.590 300.691 210.856 1.00 0.00 ? 556  GLU A N     1 
ATOM   4149  C  CA    . GLU A  1  556  ? 220.378 301.459 210.540 1.00 0.00 ? 556  GLU A CA    1 
ATOM   4150  C  C     . GLU A  1  556  ? 219.662 301.850 211.829 1.00 0.00 ? 556  GLU A C     1 
ATOM   4151  O  O     . GLU A  1  556  ? 220.039 301.376 212.891 1.00 0.00 ? 556  GLU A O     1 
ATOM   4152  C  CB    . GLU A  1  556  ? 219.437 300.666 209.624 1.00 0.00 ? 556  GLU A CB    1 
ATOM   4153  C  CG    . GLU A  1  556  ? 219.970 300.428 208.201 1.00 0.00 ? 556  GLU A CG    1 
ATOM   4154  C  CD    . GLU A  1  556  ? 218.940 299.781 207.255 1.00 0.00 ? 556  GLU A CD    1 
ATOM   4155  O  OE1   . GLU A  1  556  ? 217.902 299.267 207.740 1.00 0.00 ? 556  GLU A OE1   1 
ATOM   4156  O  OE2   . GLU A  1  556  ? 219.168 299.798 206.020 1.00 0.00 ? 556  GLU A OE2   1 
ATOM   4157  N  N     . ARG A  1  557  ? 218.684 302.753 211.761 1.00 0.00 ? 557  ARG A N     1 
ATOM   4158  C  CA    . ARG A  1  557  ? 217.972 303.164 212.974 1.00 0.00 ? 557  ARG A CA    1 
ATOM   4159  C  C     . ARG A  1  557  ? 217.328 301.953 213.649 1.00 0.00 ? 557  ARG A C     1 
ATOM   4160  O  O     . ARG A  1  557  ? 217.297 301.869 214.873 1.00 0.00 ? 557  ARG A O     1 
ATOM   4161  C  CB    . ARG A  1  557  ? 216.917 304.233 212.711 1.00 0.00 ? 557  ARG A CB    1 
ATOM   4162  C  CG    . ARG A  1  557  ? 215.613 303.772 212.096 1.00 0.00 ? 557  ARG A CG    1 
ATOM   4163  C  CD    . ARG A  1  557  ? 214.664 304.967 212.000 1.00 0.00 ? 557  ARG A CD    1 
ATOM   4164  N  NE    . ARG A  1  557  ? 213.409 304.674 211.306 1.00 0.00 ? 557  ARG A NE    1 
ATOM   4165  C  CZ    . ARG A  1  557  ? 212.253 304.438 211.924 1.00 0.00 ? 557  ARG A CZ    1 
ATOM   4166  N  NH1   . ARG A  1  557  ? 212.199 304.445 213.252 1.00 0.00 ? 557  ARG A NH1   1 
ATOM   4167  N  NH2   . ARG A  1  557  ? 211.150 304.207 211.219 1.00 0.00 ? 557  ARG A NH2   1 
ATOM   4168  N  N     . GLY A  1  558  ? 216.778 301.042 212.851 1.00 0.00 ? 558  GLY A N     1 
ATOM   4169  C  CA    . GLY A  1  558  ? 216.140 299.837 213.359 1.00 0.00 ? 558  GLY A CA    1 
ATOM   4170  C  C     . GLY A  1  558  ? 217.017 298.912 214.197 1.00 0.00 ? 558  GLY A C     1 
ATOM   4171  O  O     . GLY A  1  558  ? 216.583 298.407 215.236 1.00 0.00 ? 558  GLY A O     1 
ATOM   4172  N  N     . GLU A  1  559  ? 218.253 298.699 213.756 1.00 0.00 ? 559  GLU A N     1 
ATOM   4173  C  CA    . GLU A  1  559  ? 219.215 297.871 214.485 1.00 0.00 ? 559  GLU A CA    1 
ATOM   4174  C  C     . GLU A  1  559  ? 219.861 298.540 215.697 1.00 0.00 ? 559  GLU A C     1 
ATOM   4175  O  O     . GLU A  1  559  ? 220.250 297.873 216.635 1.00 0.00 ? 559  GLU A O     1 
ATOM   4176  C  CB    . GLU A  1  559  ? 220.341 297.446 213.542 1.00 0.00 ? 559  GLU A CB    1 
ATOM   4177  C  CG    . GLU A  1  559  ? 219.921 296.665 212.293 1.00 0.00 ? 559  GLU A CG    1 
ATOM   4178  C  CD    . GLU A  1  559  ? 218.860 295.592 212.547 1.00 0.00 ? 559  GLU A CD    1 
ATOM   4179  O  OE1   . GLU A  1  559  ? 219.179 294.614 213.271 1.00 0.00 ? 559  GLU A OE1   1 
ATOM   4180  O  OE2   . GLU A  1  559  ? 217.732 295.704 211.983 1.00 0.00 ? 559  GLU A OE2   1 
ATOM   4181  N  N     . VAL A  1  560  ? 220.016 299.852 215.654 1.00 0.00 ? 560  VAL A N     1 
ATOM   4182  C  CA    . VAL A  1  560  ? 220.445 300.637 216.804 1.00 0.00 ? 560  VAL A CA    1 
ATOM   4183  C  C     . VAL A  1  560  ? 219.462 300.596 217.963 1.00 0.00 ? 560  VAL A C     1 
ATOM   4184  O  O     . VAL A  1  560  ? 219.854 300.484 219.111 1.00 0.00 ? 560  VAL A O     1 
ATOM   4185  C  CB    . VAL A  1  560  ? 220.680 302.095 216.397 1.00 0.00 ? 560  VAL A CB    1 
ATOM   4186  C  CG1   . VAL A  1  560  ? 220.884 302.979 217.620 1.00 0.00 ? 560  VAL A CG1   1 
ATOM   4187  C  CG2   . VAL A  1  560  ? 221.872 302.187 215.444 1.00 0.00 ? 560  VAL A CG2   1 
ATOM   4188  N  N     . MET A  1  561  ? 218.179 300.701 217.658 1.00 0.00 ? 561  MET A N     1 
ATOM   4189  C  CA    . MET A  1  561  ? 217.144 300.492 218.659 1.00 0.00 ? 561  MET A CA    1 
ATOM   4190  C  C     . MET A  1  561  ? 217.204 299.146 219.338 1.00 0.00 ? 561  MET A C     1 
ATOM   4191  O  O     . MET A  1  561  ? 216.963 299.049 220.536 1.00 0.00 ? 561  MET A O     1 
ATOM   4192  C  CB    . MET A  1  561  ? 215.766 300.684 218.068 1.00 0.00 ? 561  MET A CB    1 
ATOM   4193  C  CG    . MET A  1  561  ? 215.563 302.091 217.653 1.00 0.00 ? 561  MET A CG    1 
ATOM   4194  S  SD    . MET A  1  561  ? 214.045 302.333 216.764 1.00 0.00 ? 561  MET A SD    1 
ATOM   4195  C  CE    . MET A  1  561  ? 214.217 304.060 216.265 1.00 0.00 ? 561  MET A CE    1 
ATOM   4196  N  N     . ASN A  1  562  ? 217.516 298.107 218.580 1.00 0.00 ? 562  ASN A N     1 
ATOM   4197  C  CA    . ASN A  1  562  ? 217.583 296.763 219.131 1.00 0.00 ? 562  ASN A CA    1 
ATOM   4198  C  C     . ASN A  1  562  ? 218.710 296.597 220.147 1.00 0.00 ? 562  ASN A C     1 
ATOM   4199  O  O     . ASN A  1  562  ? 218.503 296.047 221.212 1.00 0.00 ? 562  ASN A O     1 
ATOM   4200  C  CB    . ASN A  1  562  ? 217.799 295.766 217.991 1.00 0.00 ? 562  ASN A CB    1 
ATOM   4201  C  CG    . ASN A  1  562  ? 217.716 294.319 218.443 1.00 0.00 ? 562  ASN A CG    1 
ATOM   4202  O  OD1   . ASN A  1  562  ? 217.194 294.005 219.528 1.00 0.00 ? 562  ASN A OD1   1 
ATOM   4203  N  ND2   . ASN A  1  562  ? 218.300 293.423 217.634 1.00 0.00 ? 562  ASN A ND2   1 
ATOM   4204  N  N     . LEU A  1  563  ? 219.889 297.106 219.836 1.00 0.00 ? 563  LEU A N     1 
ATOM   4205  C  CA    . LEU A  1  563  ? 220.988 297.106 220.785 1.00 0.00 ? 563  LEU A CA    1 
ATOM   4206  C  C     . LEU A  1  563  ? 220.720 297.958 222.018 1.00 0.00 ? 563  LEU A C     1 
ATOM   4207  O  O     . LEU A  1  563  ? 220.958 297.531 223.134 1.00 0.00 ? 563  LEU A O     1 
ATOM   4208  C  CB    . LEU A  1  563  ? 222.261 297.615 220.122 1.00 0.00 ? 563  LEU A CB    1 
ATOM   4209  C  CG    . LEU A  1  563  ? 222.758 296.751 218.984 1.00 0.00 ? 563  LEU A CG    1 
ATOM   4210  C  CD1   . LEU A  1  563  ? 224.147 297.163 218.594 1.00 0.00 ? 563  LEU A CD1   1 
ATOM   4211  C  CD2   . LEU A  1  563  ? 222.687 295.308 219.367 1.00 0.00 ? 563  LEU A CD2   1 
ATOM   4212  N  N     . LEU A  1  564  ? 220.160 299.136 221.809 1.00 0.00 ? 564  LEU A N     1 
ATOM   4213  C  CA    . LEU A  1  564  ? 219.819 300.040 222.896 1.00 0.00 ? 564  LEU A CA    1 
ATOM   4214  C  C     . LEU A  1  564  ? 218.871 299.368 223.844 1.00 0.00 ? 564  LEU A C     1 
ATOM   4215  O  O     . LEU A  1  564  ? 218.934 299.584 225.048 1.00 0.00 ? 564  LEU A O     1 
ATOM   4216  C  CB    . LEU A  1  564  ? 219.214 301.341 222.363 1.00 0.00 ? 564  LEU A CB    1 
ATOM   4217  C  CG    . LEU A  1  564  ? 220.244 302.287 221.756 1.00 0.00 ? 564  LEU A CG    1 
ATOM   4218  C  CD1   . LEU A  1  564  ? 219.622 303.470 221.038 1.00 0.00 ? 564  LEU A CD1   1 
ATOM   4219  C  CD2   . LEU A  1  564  ? 221.123 302.769 222.879 1.00 0.00 ? 564  LEU A CD2   1 
ATOM   4220  N  N     . MET A  1  565  ? 218.005 298.529 223.294 1.00 0.00 ? 565  MET A N     1 
ATOM   4221  C  CA    . MET A  1  565  ? 217.030 297.790 224.080 1.00 0.00 ? 565  MET A CA    1 
ATOM   4222  C  C     . MET A  1  565  ? 217.571 296.841 225.140 1.00 0.00 ? 565  MET A C     1 
ATOM   4223  O  O     . MET A  1  565  ? 217.021 296.773 226.234 1.00 0.00 ? 565  MET A O     1 
ATOM   4224  C  CB    . MET A  1  565  ? 216.213 296.943 223.089 1.00 0.00 ? 565  MET A CB    1 
ATOM   4225  C  CG    . MET A  1  565  ? 215.065 296.235 223.670 1.00 0.00 ? 565  MET A CG    1 
ATOM   4226  S  SD    . MET A  1  565  ? 213.885 297.476 224.066 1.00 0.00 ? 565  MET A SD    1 
ATOM   4227  C  CE    . MET A  1  565  ? 212.692 296.529 225.032 1.00 0.00 ? 565  MET A CE    1 
ATOM   4228  N  N     . PHE A  1  566  ? 218.687 296.179 224.842 1.00 0.00 ? 566  PHE A N     1 
ATOM   4229  C  CA    . PHE A  1  566  ? 219.419 295.344 225.796 1.00 0.00 ? 566  PHE A CA    1 
ATOM   4230  C  C     . PHE A  1  566  ? 220.130 296.072 226.919 1.00 0.00 ? 566  PHE A C     1 
ATOM   4231  O  O     . PHE A  1  566  ? 220.154 295.568 228.035 1.00 0.00 ? 566  PHE A O     1 
ATOM   4232  C  CB    . PHE A  1  566  ? 220.385 294.478 225.016 1.00 0.00 ? 566  PHE A CB    1 
ATOM   4233  C  CG    . PHE A  1  566  ? 219.687 293.416 224.255 1.00 0.00 ? 566  PHE A CG    1 
ATOM   4234  C  CD1   . PHE A  1  566  ? 219.215 292.289 224.890 1.00 0.00 ? 566  PHE A CD1   1 
ATOM   4235  C  CD2   . PHE A  1  566  ? 219.377 293.605 222.922 1.00 0.00 ? 566  PHE A CD2   1 
ATOM   4236  C  CE1   . PHE A  1  566  ? 218.527 291.321 224.175 1.00 0.00 ? 566  PHE A CE1   1 
ATOM   4237  C  CE2   . PHE A  1  566  ? 218.675 292.652 222.209 1.00 0.00 ? 566  PHE A CE2   1 
ATOM   4238  C  CZ    . PHE A  1  566  ? 218.250 291.515 222.832 1.00 0.00 ? 566  PHE A CZ    1 
ATOM   4239  N  N     . LEU A  1  567  ? 220.680 297.256 226.629 1.00 0.00 ? 567  LEU A N     1 
ATOM   4240  C  CA    . LEU A  1  567  ? 221.469 298.043 227.593 1.00 0.00 ? 567  LEU A CA    1 
ATOM   4241  C  C     . LEU A  1  567  ? 220.644 298.361 228.836 1.00 0.00 ? 567  LEU A C     1 
ATOM   4242  O  O     . LEU A  1  567  ? 219.462 298.691 228.742 1.00 0.00 ? 567  LEU A O     1 
ATOM   4243  C  CB    . LEU A  1  567  ? 221.972 299.342 226.946 1.00 0.00 ? 567  LEU A CB    1 
ATOM   4244  C  CG    . LEU A  1  567  ? 223.314 299.954 227.341 1.00 0.00 ? 567  LEU A CG    1 
ATOM   4245  C  CD1   . LEU A  1  567  ? 223.588 301.123 226.452 1.00 0.00 ? 567  LEU A CD1   1 
ATOM   4246  C  CD2   . LEU A  1  567  ? 223.303 300.428 228.757 1.00 0.00 ? 567  LEU A CD2   1 
ATOM   4247  N  N     . SER A  1  568  ? 221.267 298.233 230.003 1.00 0.00 ? 568  SER A N     1 
ATOM   4248  C  CA    . SER A  1  568  ? 220.568 298.442 231.259 1.00 0.00 ? 568  SER A CA    1 
ATOM   4249  C  C     . SER A  1  568  ? 220.493 299.909 231.676 1.00 0.00 ? 568  SER A C     1 
ATOM   4250  O  O     . SER A  1  568  ? 219.411 300.437 231.950 1.00 0.00 ? 568  SER A O     1 
ATOM   4251  C  CB    . SER A  1  568  ? 221.245 297.651 232.370 1.00 0.00 ? 568  SER A CB    1 
ATOM   4252  O  OG    . SER A  1  568  ? 222.523 298.192 232.647 1.00 0.00 ? 568  SER A OG    1 
ATOM   4253  N  N     . THR A  1  569  ? 221.647 300.562 231.728 1.00 0.00 ? 569  THR A N     1 
ATOM   4254  C  CA    . THR A  1  569  ? 221.715 301.905 232.280 1.00 0.00 ? 569  THR A CA    1 
ATOM   4255  C  C     . THR A  1  569  ? 221.560 303.013 231.246 1.00 0.00 ? 569  THR A C     1 
ATOM   4256  O  O     . THR A  1  569  ? 222.084 304.113 231.437 1.00 0.00 ? 569  THR A O     1 
ATOM   4257  C  CB    . THR A  1  569  ? 223.036 302.104 233.026 1.00 0.00 ? 569  THR A CB    1 
ATOM   4258  O  OG1   . THR A  1  569  ? 224.129 301.772 232.163 1.00 0.00 ? 569  THR A OG1   1 
ATOM   4259  C  CG2   . THR A  1  569  ? 223.079 301.203 234.260 1.00 0.00 ? 569  THR A CG2   1 
ATOM   4260  N  N     . TRP A  1  570  ? 220.830 302.736 230.167 1.00 0.00 ? 570  TRP A N     1 
ATOM   4261  C  CA    . TRP A  1  570  ? 220.630 303.732 229.120 1.00 0.00 ? 570  TRP A CA    1 
ATOM   4262  C  C     . TRP A  1  570  ? 219.915 304.986 229.665 1.00 0.00 ? 570  TRP A C     1 
ATOM   4263  O  O     . TRP A  1  570  ? 219.053 304.893 230.537 1.00 0.00 ? 570  TRP A O     1 
ATOM   4264  C  CB    . TRP A  1  570  ? 219.833 303.135 227.970 1.00 0.00 ? 570  TRP A CB    1 
ATOM   4265  C  CG    . TRP A  1  570  ? 219.677 304.092 226.857 1.00 0.00 ? 570  TRP A CG    1 
ATOM   4266  C  CD1   . TRP A  1  570  ? 220.649 304.877 226.322 1.00 0.00 ? 570  TRP A CD1   1 
ATOM   4267  C  CD2   . TRP A  1  570  ? 218.475 304.402 226.154 1.00 0.00 ? 570  TRP A CD2   1 
ATOM   4268  N  NE1   . TRP A  1  570  ? 220.135 305.647 225.313 1.00 0.00 ? 570  TRP A NE1   1 
ATOM   4269  C  CE2   . TRP A  1  570  ? 218.799 305.376 225.191 1.00 0.00 ? 570  TRP A CE2   1 
ATOM   4270  C  CE3   . TRP A  1  570  ? 217.160 303.949 226.237 1.00 0.00 ? 570  TRP A CE3   1 
ATOM   4271  C  CZ2   . TRP A  1  570  ? 217.859 305.900 224.320 1.00 0.00 ? 570  TRP A CZ2   1 
ATOM   4272  C  CZ3   . TRP A  1  570  ? 216.228 304.470 225.375 1.00 0.00 ? 570  TRP A CZ3   1 
ATOM   4273  C  CH2   . TRP A  1  570  ? 216.579 305.438 224.428 1.00 0.00 ? 570  TRP A CH2   1 
ATOM   4274  N  N     . ASP A  1  571  ? 220.269 306.160 229.157 1.00 0.00 ? 571  ASP A N     1 
ATOM   4275  C  CA    . ASP A  1  571  ? 219.683 307.385 229.685 1.00 0.00 ? 571  ASP A CA    1 
ATOM   4276  C  C     . ASP A  1  571  ? 218.276 307.649 229.148 1.00 0.00 ? 571  ASP A C     1 
ATOM   4277  O  O     . ASP A  1  571  ? 217.500 308.382 229.768 1.00 0.00 ? 571  ASP A O     1 
ATOM   4278  C  CB    . ASP A  1  571  ? 220.578 308.593 229.376 1.00 0.00 ? 571  ASP A CB    1 
ATOM   4279  C  CG    . ASP A  1  571  ? 220.732 308.851 227.883 1.00 0.00 ? 571  ASP A CG    1 
ATOM   4280  O  OD1   . ASP A  1  571  ? 220.828 307.869 227.111 1.00 0.00 ? 571  ASP A OD1   1 
ATOM   4281  O  OD2   . ASP A  1  571  ? 220.753 310.045 227.494 1.00 0.00 ? 571  ASP A OD2   1 
ATOM   4282  N  N     . GLY A  1  572  ? 217.947 307.054 228.001 1.00 0.00 ? 572  GLY A N     1 
ATOM   4283  C  CA    . GLY A  1  572  ? 216.658 307.285 227.369 1.00 0.00 ? 572  GLY A CA    1 
ATOM   4284  C  C     . GLY A  1  572  ? 216.750 308.217 226.171 1.00 0.00 ? 572  GLY A C     1 
ATOM   4285  O  O     . GLY A  1  572  ? 215.789 308.376 225.415 1.00 0.00 ? 572  GLY A O     1 
ATOM   4286  N  N     . LYS A  1  573  ? 217.913 308.837 225.995 1.00 0.00 ? 573  LYS A N     1 
ATOM   4287  C  CA    . LYS A  1  573  ? 218.161 309.691 224.839 1.00 0.00 ? 573  LYS A CA    1 
ATOM   4288  C  C     . LYS A  1  573  ? 218.997 308.940 223.803 1.00 0.00 ? 573  LYS A C     1 
ATOM   4289  O  O     . LYS A  1  573  ? 220.113 308.520 224.089 1.00 0.00 ? 573  LYS A O     1 
ATOM   4290  C  CB    . LYS A  1  573  ? 218.872 310.972 225.275 1.00 0.00 ? 573  LYS A CB    1 
ATOM   4291  C  CG    . LYS A  1  573  ? 218.133 311.752 226.353 1.00 0.00 ? 573  LYS A CG    1 
ATOM   4292  C  CD    . LYS A  1  573  ? 218.929 312.976 226.773 1.00 0.00 ? 573  LYS A CD    1 
ATOM   4293  C  CE    . LYS A  1  573  ? 218.057 313.999 227.487 1.00 0.00 ? 573  LYS A CE    1 
ATOM   4294  N  NZ    . LYS A  1  573  ? 217.165 314.747 226.557 1.00 0.00 ? 573  LYS A NZ    1 
ATOM   4295  N  N     . VAL A  1  574  ? 218.467 308.784 222.596 1.00 0.00 ? 574  VAL A N     1 
ATOM   4296  C  CA    . VAL A  1  574  ? 219.208 308.120 221.527 1.00 0.00 ? 574  VAL A CA    1 
ATOM   4297  C  C     . VAL A  1  574  ? 220.210 309.096 220.906 1.00 0.00 ? 574  VAL A C     1 
ATOM   4298  O  O     . VAL A  1  574  ? 219.822 310.168 220.441 1.00 0.00 ? 574  VAL A O     1 
ATOM   4299  C  CB    . VAL A  1  574  ? 218.267 307.586 220.438 1.00 0.00 ? 574  VAL A CB    1 
ATOM   4300  C  CG1   . VAL A  1  574  ? 219.063 306.943 219.321 1.00 0.00 ? 574  VAL A CG1   1 
ATOM   4301  C  CG2   . VAL A  1  574  ? 217.293 306.592 221.023 1.00 0.00 ? 574  VAL A CG2   1 
ATOM   4302  N  N     . PRO A  1  575  ? 221.501 308.724 220.890 1.00 0.00 ? 575  PRO A N     1 
ATOM   4303  C  CA    . PRO A  1  575  ? 222.592 309.600 220.449 1.00 0.00 ? 575  PRO A CA    1 
ATOM   4304  C  C     . PRO A  1  575  ? 222.518 309.975 218.976 1.00 0.00 ? 575  PRO A C     1 
ATOM   4305  O  O     . PRO A  1  575  ? 222.048 309.183 218.156 1.00 0.00 ? 575  PRO A O     1 
ATOM   4306  C  CB    . PRO A  1  575  ? 223.840 308.764 220.721 1.00 0.00 ? 575  PRO A CB    1 
ATOM   4307  C  CG    . PRO A  1  575  ? 223.374 307.378 220.588 1.00 0.00 ? 575  PRO A CG    1 
ATOM   4308  C  CD    . PRO A  1  575  ? 221.982 307.365 221.165 1.00 0.00 ? 575  PRO A CD    1 
ATOM   4309  N  N     . GLN A  1  576  ? 222.990 311.185 218.670 1.00 0.00 ? 576  GLN A N     1 
ATOM   4310  C  CA    . GLN A  1  576  ? 222.996 311.748 217.319 1.00 0.00 ? 576  GLN A CA    1 
ATOM   4311  C  C     . GLN A  1  576  ? 223.840 310.948 216.336 1.00 0.00 ? 576  GLN A C     1 
ATOM   4312  O  O     . GLN A  1  576  ? 225.063 310.903 216.464 1.00 0.00 ? 576  GLN A O     1 
ATOM   4313  C  CB    . GLN A  1  576  ? 223.498 313.190 217.364 1.00 0.00 ? 576  GLN A CB    1 
ATOM   4314  C  CG    . GLN A  1  576  ? 223.353 313.923 216.060 1.00 0.00 ? 576  GLN A CG    1 
ATOM   4315  C  CD    . GLN A  1  576  ? 221.915 314.291 215.778 1.00 0.00 ? 576  GLN A CD    1 
ATOM   4316  O  OE1   . GLN A  1  576  ? 221.383 313.987 214.715 1.00 0.00 ? 576  GLN A OE1   1 
ATOM   4317  N  NE2   . GLN A  1  576  ? 221.274 314.947 216.734 1.00 0.00 ? 576  GLN A NE2   1 
ATOM   4318  N  N     . PRO A  1  577  ? 223.193 310.378 215.311 1.00 0.00 ? 577  PRO A N     1 
ATOM   4319  C  CA    . PRO A  1  577  ? 223.845 309.464 214.370 1.00 0.00 ? 577  PRO A CA    1 
ATOM   4320  C  C     . PRO A  1  577  ? 225.049 310.096 213.689 1.00 0.00 ? 577  PRO A C     1 
ATOM   4321  O  O     . PRO A  1  577  ? 224.989 311.259 213.334 1.00 0.00 ? 577  PRO A O     1 
ATOM   4322  C  CB    . PRO A  1  577  ? 222.750 309.159 213.343 1.00 0.00 ? 577  PRO A CB    1 
ATOM   4323  C  CG    . PRO A  1  577  ? 221.647 310.116 213.601 1.00 0.00 ? 577  PRO A CG    1 
ATOM   4324  C  CD    . PRO A  1  577  ? 221.778 310.609 214.991 1.00 0.00 ? 577  PRO A CD    1 
ATOM   4325  N  N     . ALA A  1  578  ? 226.122 309.333 213.521 1.00 0.00 ? 578  ALA A N     1 
ATOM   4326  C  CA    . ALA A  1  578  ? 227.338 309.807 212.874 1.00 0.00 ? 578  ALA A CA    1 
ATOM   4327  C  C     . ALA A  1  578  ? 227.121 310.225 211.420 1.00 0.00 ? 578  ALA A C     1 
ATOM   4328  O  O     . ALA A  1  578  ? 227.866 311.048 210.882 1.00 0.00 ? 578  ALA A O     1 
ATOM   4329  C  CB    . ALA A  1  578  ? 228.406 308.742 212.950 1.00 0.00 ? 578  ALA A CB    1 
ATOM   4330  N  N     . ILE A  1  579  ? 226.106 309.658 210.781 1.00 0.00 ? 579  ILE A N     1 
ATOM   4331  C  CA    . ILE A  1  579  ? 225.735 310.069 209.434 1.00 0.00 ? 579  ILE A CA    1 
ATOM   4332  C  C     . ILE A  1  579  ? 224.277 310.513 209.412 1.00 0.00 ? 579  ILE A C     1 
ATOM   4333  O  O     . ILE A  1  579  ? 223.392 309.736 209.727 1.00 0.00 ? 579  ILE A O     1 
ATOM   4334  C  CB    . ILE A  1  579  ? 225.962 308.925 208.430 1.00 0.00 ? 579  ILE A CB    1 
ATOM   4335  C  CG1   . ILE A  1  579  ? 227.430 308.501 208.444 1.00 0.00 ? 579  ILE A CG1   1 
ATOM   4336  C  CG2   . ILE A  1  579  ? 225.537 309.333 207.039 1.00 0.00 ? 579  ILE A CG2   1 
ATOM   4337  C  CD1   . ILE A  1  579  ? 227.776 307.470 207.409 1.00 0.00 ? 579  ILE A CD1   1 
ATOM   4338  N  N     . LEU A  1  580  ? 224.013 311.761 209.055 1.00 0.00 ? 580  LEU A N     1 
ATOM   4339  C  CA    . LEU A  1  580  ? 222.629 312.218 209.027 1.00 0.00 ? 580  LEU A CA    1 
ATOM   4340  C  C     . LEU A  1  580  ? 221.936 311.847 207.731 1.00 0.00 ? 580  LEU A C     1 
ATOM   4341  O  O     . LEU A  1  580  ? 220.792 311.419 207.748 1.00 0.00 ? 580  LEU A O     1 
ATOM   4342  C  CB    . LEU A  1  580  ? 222.547 313.730 209.253 1.00 0.00 ? 580  LEU A CB    1 
ATOM   4343  C  CG    . LEU A  1  580  ? 222.888 314.175 210.676 1.00 0.00 ? 580  LEU A CG    1 
ATOM   4344  C  CD1   . LEU A  1  580  ? 222.710 315.661 210.856 1.00 0.00 ? 580  LEU A CD1   1 
ATOM   4345  C  CD2   . LEU A  1  580  ? 221.995 313.433 211.631 1.00 0.00 ? 580  LEU A CD2   1 
ATOM   4346  N  N     . LYS A  1  581  ? 222.637 311.969 206.611 1.00 0.00 ? 581  LYS A N     1 
ATOM   4347  C  CA    . LYS A  1  581  ? 222.045 311.665 205.316 1.00 0.00 ? 581  LYS A CA    1 
ATOM   4348  C  C     . LYS A  1  581  ? 223.125 311.137 204.389 1.00 0.00 ? 581  LYS A C     1 
ATOM   4349  O  O     . LYS A  1  581  ? 224.296 311.444 204.593 1.00 0.00 ? 581  LYS A O     1 
ATOM   4350  C  CB    . LYS A  1  581  ? 221.393 312.901 204.712 1.00 0.00 ? 581  LYS A CB    1 
ATOM   4351  C  CG    . LYS A  1  581  ? 222.391 313.977 204.376 1.00 0.00 ? 581  LYS A CG    1 
ATOM   4352  C  CD    . LYS A  1  581  ? 221.713 315.217 203.821 1.00 0.00 ? 581  LYS A CD    1 
ATOM   4353  C  CE    . LYS A  1  581  ? 220.940 314.914 202.546 1.00 0.00 ? 581  LYS A CE    1 
ATOM   4354  N  NZ    . LYS A  1  581  ? 220.422 316.174 201.923 1.00 0.00 ? 581  LYS A NZ    1 
ATOM   4355  N  N     . PRO A  1  582  ? 222.751 310.381 203.334 1.00 0.00 ? 582  PRO A N     1 
ATOM   4356  C  CA    . PRO A  1  582  ? 221.443 310.029 202.753 1.00 0.00 ? 582  PRO A CA    1 
ATOM   4357  C  C     . PRO A  1  582  ? 220.475 309.325 203.694 1.00 0.00 ? 582  PRO A C     1 
ATOM   4358  O  O     . PRO A  1  582  ? 219.266 309.532 203.608 1.00 0.00 ? 582  PRO A O     1 
ATOM   4359  C  CB    . PRO A  1  582  ? 221.813 309.070 201.612 1.00 0.00 ? 582  PRO A CB    1 
ATOM   4360  C  CG    . PRO A  1  582  ? 223.226 309.359 201.301 1.00 0.00 ? 582  PRO A CG    1 
ATOM   4361  C  CD    . PRO A  1  582  ? 223.849 309.709 202.617 1.00 0.00 ? 582  PRO A CD    1 
ATOM   4362  N  N     . ARG A  1  583  ? 221.009 308.499 204.581 1.00 0.00 ? 583  ARG A N     1 
ATOM   4363  C  CA    . ARG A  1  583  ? 220.179 307.746 205.508 1.00 0.00 ? 583  ARG A CA    1 
ATOM   4364  C  C     . ARG A  1  583  ? 220.825 307.720 206.881 1.00 0.00 ? 583  ARG A C     1 
ATOM   4365  O  O     . ARG A  1  583  ? 222.042 307.619 206.992 1.00 0.00 ? 583  ARG A O     1 
ATOM   4366  C  CB    . ARG A  1  583  ? 219.960 306.325 204.982 1.00 0.00 ? 583  ARG A CB    1 
ATOM   4367  C  CG    . ARG A  1  583  ? 219.126 306.265 203.700 1.00 0.00 ? 583  ARG A CG    1 
ATOM   4368  C  CD    . ARG A  1  583  ? 218.942 304.838 203.212 1.00 0.00 ? 583  ARG A CD    1 
ATOM   4369  N  NE    . ARG A  1  583  ? 218.311 304.008 204.240 1.00 0.00 ? 583  ARG A NE    1 
ATOM   4370  C  CZ    . ARG A  1  583  ? 218.216 302.680 204.192 1.00 0.00 ? 583  ARG A CZ    1 
ATOM   4371  N  NH1   . ARG A  1  583  ? 218.683 302.016 203.138 1.00 0.00 ? 583  ARG A NH1   1 
ATOM   4372  N  NH2   . ARG A  1  583  ? 217.646 302.015 205.195 1.00 0.00 ? 583  ARG A NH2   1 
ATOM   4373  N  N     . PRO A  1  584  ? 220.009 307.792 207.938 1.00 0.00 ? 584  PRO A N     1 
ATOM   4374  C  CA    . PRO A  1  584  ? 220.567 307.874 209.292 1.00 0.00 ? 584  PRO A CA    1 
ATOM   4375  C  C     . PRO A  1  584  ? 221.346 306.614 209.707 1.00 0.00 ? 584  PRO A C     1 
ATOM   4376  O  O     . PRO A  1  584  ? 220.843 305.504 209.581 1.00 0.00 ? 584  PRO A O     1 
ATOM   4377  C  CB    . PRO A  1  584  ? 219.327 308.092 210.165 1.00 0.00 ? 584  PRO A CB    1 
ATOM   4378  C  CG    . PRO A  1  584  ? 218.173 307.600 209.344 1.00 0.00 ? 584  PRO A CG    1 
ATOM   4379  C  CD    . PRO A  1  584  ? 218.539 307.876 207.927 1.00 0.00 ? 584  PRO A CD    1 
ATOM   4380  N  N     . LEU A  1  585  ? 222.584 306.813 210.162 1.00 0.00 ? 585  LEU A N     1 
ATOM   4381  C  CA    . LEU A  1  585  ? 223.505 305.727 210.506 1.00 0.00 ? 585  LEU A CA    1 
ATOM   4382  C  C     . LEU A  1  585  ? 224.329 306.008 211.771 1.00 0.00 ? 585  LEU A C     1 
ATOM   4383  O  O     . LEU A  1  585  ? 224.823 307.113 211.960 1.00 0.00 ? 585  LEU A O     1 
ATOM   4384  C  CB    . LEU A  1  585  ? 224.459 305.471 209.344 1.00 0.00 ? 585  LEU A CB    1 
ATOM   4385  C  CG    . LEU A  1  585  ? 223.827 304.909 208.078 1.00 0.00 ? 585  LEU A CG    1 
ATOM   4386  C  CD1   . LEU A  1  585  ? 224.803 304.987 206.924 1.00 0.00 ? 585  LEU A CD1   1 
ATOM   4387  C  CD2   . LEU A  1  585  ? 223.426 303.477 208.325 1.00 0.00 ? 585  LEU A CD2   1 
ATOM   4388  N  N     . TRP A  1  586  ? 224.502 304.989 212.609 1.00 0.00 ? 586  TRP A N     1 
ATOM   4389  C  CA    . TRP A  1  586  ? 225.349 305.073 213.797 1.00 0.00 ? 586  TRP A CA    1 
ATOM   4390  C  C     . TRP A  1  586  ? 226.557 304.211 213.584 1.00 0.00 ? 586  TRP A C     1 
ATOM   4391  O  O     . TRP A  1  586  ? 226.445 303.082 213.093 1.00 0.00 ? 586  TRP A O     1 
ATOM   4392  C  CB    . TRP A  1  586  ? 224.640 304.591 215.049 1.00 0.00 ? 586  TRP A CB    1 
ATOM   4393  C  CG    . TRP A  1  586  ? 223.593 305.459 215.556 1.00 0.00 ? 586  TRP A CG    1 
ATOM   4394  C  CD1   . TRP A  1  586  ? 223.607 306.147 216.722 1.00 0.00 ? 586  TRP A CD1   1 
ATOM   4395  C  CD2   . TRP A  1  586  ? 222.351 305.754 214.923 1.00 0.00 ? 586  TRP A CD2   1 
ATOM   4396  N  NE1   . TRP A  1  586  ? 222.440 306.848 216.868 1.00 0.00 ? 586  TRP A NE1   1 
ATOM   4397  C  CE2   . TRP A  1  586  ? 221.653 306.627 215.769 1.00 0.00 ? 586  TRP A CE2   1 
ATOM   4398  C  CE3   . TRP A  1  586  ? 221.754 305.358 213.722 1.00 0.00 ? 586  TRP A CE3   1 
ATOM   4399  C  CZ2   . TRP A  1  586  ? 220.391 307.119 215.448 1.00 0.00 ? 586  TRP A CZ2   1 
ATOM   4400  C  CZ3   . TRP A  1  586  ? 220.503 305.846 213.404 1.00 0.00 ? 586  TRP A CZ3   1 
ATOM   4401  C  CH2   . TRP A  1  586  ? 219.833 306.716 214.262 1.00 0.00 ? 586  TRP A CH2   1 
ATOM   4402  N  N     . THR A  1  587  ? 227.709 304.721 213.989 1.00 0.00 ? 587  THR A N     1 
ATOM   4403  C  CA    . THR A  1  587  ? 228.938 303.981 213.814 1.00 0.00 ? 587  THR A CA    1 
ATOM   4404  C  C     . THR A  1  587  ? 229.096 302.970 214.933 1.00 0.00 ? 587  THR A C     1 
ATOM   4405  O  O     . THR A  1  587  ? 228.461 303.078 215.975 1.00 0.00 ? 587  THR A O     1 
ATOM   4406  C  CB    . THR A  1  587  ? 230.121 304.916 213.784 1.00 0.00 ? 587  THR A CB    1 
ATOM   4407  O  OG1   . THR A  1  587  ? 229.761 306.131 214.461 1.00 0.00 ? 587  THR A OG1   1 
ATOM   4408  C  CG2   . THR A  1  587  ? 230.493 305.221 212.345 1.00 0.00 ? 587  THR A CG2   1 
ATOM   4409  N  N     . GLY A  1  588  ? 229.946 301.982 214.730 1.00 0.00 ? 588  GLY A N     1 
ATOM   4410  C  CA    . GLY A  1  588  ? 230.152 301.004 215.769 1.00 0.00 ? 588  GLY A CA    1 
ATOM   4411  C  C     . GLY A  1  588  ? 230.709 301.558 217.065 1.00 0.00 ? 588  GLY A C     1 
ATOM   4412  O  O     . GLY A  1  588  ? 230.169 301.296 218.125 1.00 0.00 ? 588  GLY A O     1 
ATOM   4413  N  N     . LYS A  1  589  ? 231.709 302.420 216.963 1.00 0.00 ? 589  LYS A N     1 
ATOM   4414  C  CA    . LYS A  1  589  ? 232.321 303.055 218.128 1.00 0.00 ? 589  LYS A CA    1 
ATOM   4415  C  C     . LYS A  1  589  ? 231.366 303.926 218.933 1.00 0.00 ? 589  LYS A C     1 
ATOM   4416  O  O     . LYS A  1  589  ? 231.405 303.959 220.153 1.00 0.00 ? 589  LYS A O     1 
ATOM   4417  C  CB    . LYS A  1  589  ? 233.494 303.935 217.675 1.00 0.00 ? 589  LYS A CB    1 
ATOM   4418  C  CG    . LYS A  1  589  ? 234.493 303.273 216.751 1.00 0.00 ? 589  LYS A CG    1 
ATOM   4419  C  CD    . LYS A  1  589  ? 235.704 304.157 216.600 1.00 0.00 ? 589  LYS A CD    1 
ATOM   4420  C  CE    . LYS A  1  589  ? 236.411 303.908 215.284 1.00 0.00 ? 589  LYS A CE    1 
ATOM   4421  N  NZ    . LYS A  1  589  ? 237.000 302.565 215.188 1.00 0.00 ? 589  LYS A NZ    1 
ATOM   4422  N  N     . GLN A  1  590  ? 230.498 304.618 218.229 1.00 0.00 ? 590  GLN A N     1 
ATOM   4423  C  CA    . GLN A  1  590  ? 229.488 305.461 218.833 1.00 0.00 ? 590  GLN A CA    1 
ATOM   4424  C  C     . GLN A  1  590  ? 228.544 304.714 219.761 1.00 0.00 ? 590  GLN A C     1 
ATOM   4425  O  O     . GLN A  1  590  ? 228.356 305.116 220.902 1.00 0.00 ? 590  GLN A O     1 
ATOM   4426  C  CB    . GLN A  1  590  ? 228.727 306.173 217.747 1.00 0.00 ? 590  GLN A CB    1 
ATOM   4427  C  CG    . GLN A  1  590  ? 227.704 307.111 218.235 1.00 0.00 ? 590  GLN A CG    1 
ATOM   4428  C  CD    . GLN A  1  590  ? 227.225 307.890 217.088 1.00 0.00 ? 590  GLN A CD    1 
ATOM   4429  O  OE1   . GLN A  1  590  ? 227.087 307.340 215.987 1.00 0.00 ? 590  GLN A OE1   1 
ATOM   4430  N  NE2   . GLN A  1  590  ? 227.090 309.204 217.273 1.00 0.00 ? 590  GLN A NE2   1 
ATOM   4431  N  N     . ILE A  1  591  ? 227.946 303.633 219.287 1.00 0.00 ? 591  ILE A N     1 
ATOM   4432  C  CA    . ILE A  1  591  ? 227.021 302.890 220.134 1.00 0.00 ? 591  ILE A CA    1 
ATOM   4433  C  C     . ILE A  1  591  ? 227.765 302.272 221.312 1.00 0.00 ? 591  ILE A C     1 
ATOM   4434  O  O     . ILE A  1  591  ? 227.222 302.201 222.427 1.00 0.00 ? 591  ILE A O     1 
ATOM   4435  C  CB    . ILE A  1  591  ? 226.320 301.762 219.363 1.00 0.00 ? 591  ILE A CB    1 
ATOM   4436  C  CG1   . ILE A  1  591  ? 225.437 302.367 218.304 1.00 0.00 ? 591  ILE A CG1   1 
ATOM   4437  C  CG2   . ILE A  1  591  ? 225.391 301.003 220.256 1.00 0.00 ? 591  ILE A CG2   1 
ATOM   4438  C  CD1   . ILE A  1  591  ? 224.482 303.392 218.884 1.00 0.00 ? 591  ILE A CD1   1 
ATOM   4439  N  N     . PHE A  1  592  ? 229.012 301.849 221.079 1.00 0.00 ? 592  PHE A N     1 
ATOM   4440  C  CA    . PHE A  1  592  ? 229.882 301.370 222.155 1.00 0.00 ? 592  PHE A CA    1 
ATOM   4441  C  C     . PHE A  1  592  ? 230.105 302.470 223.217 1.00 0.00 ? 592  PHE A C     1 
ATOM   4442  O  O     . PHE A  1  592  ? 230.165 302.156 224.394 1.00 0.00 ? 592  PHE A O     1 
ATOM   4443  C  CB    . PHE A  1  592  ? 231.220 300.866 221.612 1.00 0.00 ? 592  PHE A CB    1 
ATOM   4444  C  CG    . PHE A  1  592  ? 232.082 300.257 222.663 1.00 0.00 ? 592  PHE A CG    1 
ATOM   4445  C  CD1   . PHE A  1  592  ? 231.975 298.901 222.948 1.00 0.00 ? 592  PHE A CD1   1 
ATOM   4446  C  CD2   . PHE A  1  592  ? 232.971 301.029 223.400 1.00 0.00 ? 592  PHE A CD2   1 
ATOM   4447  C  CE1   . PHE A  1  592  ? 232.761 298.307 223.950 1.00 0.00 ? 592  PHE A CE1   1 
ATOM   4448  C  CE2   . PHE A  1  592  ? 233.756 300.447 224.404 1.00 0.00 ? 592  PHE A CE2   1 
ATOM   4449  C  CZ    . PHE A  1  592  ? 233.644 299.083 224.681 1.00 0.00 ? 592  PHE A CZ    1 
ATOM   4450  N  N     . SER A  1  593  ? 230.198 303.747 222.826 1.00 0.00 ? 593  SER A N     1 
ATOM   4451  C  CA    . SER A  1  593  ? 230.414 304.799 223.827 1.00 0.00 ? 593  SER A CA    1 
ATOM   4452  C  C     . SER A  1  593  ? 229.282 304.862 224.832 1.00 0.00 ? 593  SER A C     1 
ATOM   4453  O  O     . SER A  1  593  ? 229.460 305.393 225.924 1.00 0.00 ? 593  SER A O     1 
ATOM   4454  C  CB    . SER A  1  593  ? 230.595 306.184 223.190 1.00 0.00 ? 593  SER A CB    1 
ATOM   4455  O  OG    . SER A  1  593  ? 231.778 306.266 222.409 1.00 0.00 ? 593  SER A OG    1 
ATOM   4456  N  N     . LEU A  1  594  ? 228.100 304.383 224.468 1.00 0.00 ? 594  LEU A N     1 
ATOM   4457  C  CA    . LEU A  1  594  ? 227.048 304.294 225.470 1.00 0.00 ? 594  LEU A CA    1 
ATOM   4458  C  C     . LEU A  1  594  ? 227.325 303.219 226.548 1.00 0.00 ? 594  LEU A C     1 
ATOM   4459  O  O     . LEU A  1  594  ? 227.057 303.467 227.726 1.00 0.00 ? 594  LEU A O     1 
ATOM   4460  C  CB    . LEU A  1  594  ? 225.676 304.077 224.821 1.00 0.00 ? 594  LEU A CB    1 
ATOM   4461  C  CG    . LEU A  1  594  ? 225.295 305.193 223.853 1.00 0.00 ? 594  LEU A CG    1 
ATOM   4462  C  CD1   . LEU A  1  594  ? 223.953 304.927 223.231 1.00 0.00 ? 594  LEU A CD1   1 
ATOM   4463  C  CD2   . LEU A  1  594  ? 225.277 306.525 224.583 1.00 0.00 ? 594  LEU A CD2   1 
ATOM   4464  N  N     . ILE A  1  595  ? 227.850 302.045 226.177 1.00 0.00 ? 595  ILE A N     1 
ATOM   4465  C  CA    . ILE A  1  595  ? 228.061 301.004 227.195 1.00 0.00 ? 595  ILE A CA    1 
ATOM   4466  C  C     . ILE A  1  595  ? 229.140 301.278 228.252 1.00 0.00 ? 595  ILE A C     1 
ATOM   4467  O  O     . ILE A  1  595  ? 229.165 300.570 229.251 1.00 0.00 ? 595  ILE A O     1 
ATOM   4468  C  CB    . ILE A  1  595  ? 228.267 299.580 226.536 1.00 0.00 ? 595  ILE A CB    1 
ATOM   4469  C  CG1   . ILE A  1  595  ? 229.575 299.309 225.816 1.00 0.00 ? 595  ILE A CG1   1 
ATOM   4470  C  CG2   . ILE A  1  595  ? 227.078 299.186 225.722 1.00 0.00 ? 595  ILE A CG2   1 
ATOM   4471  C  CD1   . ILE A  1  595  ? 230.815 299.375 226.655 1.00 0.00 ? 595  ILE A CD1   1 
ATOM   4472  N  N     . ILE A  1  596  ? 230.059 302.229 228.030 1.00 0.00 ? 596  ILE A N     1 
ATOM   4473  C  CA    . ILE A  1  596  ? 231.017 302.633 229.093 1.00 0.00 ? 596  ILE A CA    1 
ATOM   4474  C  C     . ILE A  1  596  ? 230.549 303.857 229.906 1.00 0.00 ? 596  ILE A C     1 
ATOM   4475  O  O     . ILE A  1  596  ? 229.989 304.817 229.336 1.00 0.00 ? 596  ILE A O     1 
ATOM   4476  C  CB    . ILE A  1  596  ? 232.427 302.947 228.539 1.00 0.00 ? 596  ILE A CB    1 
ATOM   4477  C  CG1   . ILE A  1  596  ? 232.360 303.833 227.304 1.00 0.00 ? 596  ILE A CG1   1 
ATOM   4478  C  CG2   . ILE A  1  596  ? 233.175 301.667 228.261 1.00 0.00 ? 596  ILE A CG2   1 
ATOM   4479  C  CD1   . ILE A  1  596  ? 233.713 304.213 226.791 1.00 0.00 ? 596  ILE A CD1   1 
ATOM   4480  N  N     . PRO A  1  597  ? 230.804 303.838 231.239 1.00 0.00 ? 597  PRO A N     1 
ATOM   4481  C  CA    . PRO A  1  597  ? 230.401 304.908 232.178 1.00 0.00 ? 597  PRO A CA    1 
ATOM   4482  C  C     . PRO A  1  597  ? 231.015 306.276 231.899 1.00 0.00 ? 597  PRO A C     1 
ATOM   4483  O  O     . PRO A  1  597  ? 232.182 306.496 232.254 1.00 0.00 ? 597  PRO A O     1 
ATOM   4484  C  CB    . PRO A  1  597  ? 230.878 304.390 233.534 1.00 0.00 ? 597  PRO A CB    1 
ATOM   4485  C  CG    . PRO A  1  597  ? 231.914 303.372 233.213 1.00 0.00 ? 597  PRO A CG    1 
ATOM   4486  C  CD    . PRO A  1  597  ? 231.519 302.745 231.923 1.00 0.00 ? 597  PRO A CD    1 
ATOM   4487  N  N     . GLY A  1  598  ? 230.200 307.173 231.327 1.00 0.00 ? 598  GLY A N     1 
ATOM   4488  C  CA    . GLY A  1  598  ? 230.603 308.494 230.849 1.00 0.00 ? 598  GLY A CA    1 
ATOM   4489  C  C     . GLY A  1  598  ? 231.507 309.303 231.768 1.00 0.00 ? 598  GLY A C     1 
ATOM   4490  O  O     . GLY A  1  598  ? 231.124 310.359 232.302 1.00 0.00 ? 598  GLY A O     1 
ATOM   4491  N  N     . HIS A  1  599  ? 232.732 308.809 231.924 1.00 0.00 ? 599  HIS A N     1 
ATOM   4492  C  CA    . HIS A  1  599  ? 233.665 309.359 232.883 1.00 0.00 ? 599  HIS A CA    1 
ATOM   4493  C  C     . HIS A  1  599  ? 235.073 308.782 232.716 1.00 0.00 ? 599  HIS A C     1 
ATOM   4494  O  O     . HIS A  1  599  ? 236.049 309.493 232.933 1.00 0.00 ? 599  HIS A O     1 
ATOM   4495  C  CB    . HIS A  1  599  ? 233.160 309.106 234.305 1.00 0.00 ? 599  HIS A CB    1 
ATOM   4496  C  CG    . HIS A  1  599  ? 233.897 309.883 235.354 1.00 0.00 ? 599  HIS A CG    1 
ATOM   4497  N  ND1   . HIS A  1  599  ? 234.061 311.252 235.294 1.00 0.00 ? 599  HIS A ND1   1 
ATOM   4498  C  CD2   . HIS A  1  599  ? 234.547 309.476 236.473 1.00 0.00 ? 599  HIS A CD2   1 
ATOM   4499  C  CE1   . HIS A  1  599  ? 234.763 311.657 236.340 1.00 0.00 ? 599  HIS A CE1   1 
ATOM   4500  N  NE2   . HIS A  1  599  ? 235.073 310.599 237.069 1.00 0.00 ? 599  HIS A NE2   1 
ATOM   4501  N  N     . ILE A  1  600  ? 235.188 307.508 232.342 1.00 0.00 ? 600  ILE A N     1 
ATOM   4502  C  CA    . ILE A  1  600  ? 236.499 306.866 232.273 1.00 0.00 ? 600  ILE A CA    1 
ATOM   4503  C  C     . ILE A  1  600  ? 237.301 307.598 231.225 1.00 0.00 ? 600  ILE A C     1 
ATOM   4504  O  O     . ILE A  1  600  ? 236.734 308.124 230.279 1.00 0.00 ? 600  ILE A O     1 
ATOM   4505  C  CB    . ILE A  1  600  ? 236.407 305.383 231.919 1.00 0.00 ? 600  ILE A CB    1 
ATOM   4506  C  CG1   . ILE A  1  600  ? 235.697 305.182 230.584 1.00 0.00 ? 600  ILE A CG1   1 
ATOM   4507  C  CG2   . ILE A  1  600  ? 235.647 304.640 232.974 1.00 0.00 ? 600  ILE A CG2   1 
ATOM   4508  C  CD1   . ILE A  1  600  ? 235.694 303.741 230.111 1.00 0.00 ? 600  ILE A CD1   1 
ATOM   4509  N  N     . ASN A  1  601  ? 238.614 307.661 231.403 1.00 0.00 ? 601  ASN A N     1 
ATOM   4510  C  CA    . ASN A  1  601  ? 239.440 308.561 230.591 1.00 0.00 ? 601  ASN A CA    1 
ATOM   4511  C  C     . ASN A  1  601  ? 240.740 308.013 230.013 1.00 0.00 ? 601  ASN A C     1 
ATOM   4512  O  O     . ASN A  1  601  ? 241.703 308.762 229.822 1.00 0.00 ? 601  ASN A O     1 
ATOM   4513  C  CB    . ASN A  1  601  ? 239.773 309.786 231.420 1.00 0.00 ? 601  ASN A CB    1 
ATOM   4514  C  CG    . ASN A  1  601  ? 238.653 310.785 231.433 1.00 0.00 ? 601  ASN A CG    1 
ATOM   4515  O  OD1   . ASN A  1  601  ? 238.027 311.051 230.399 1.00 0.00 ? 601  ASN A OD1   1 
ATOM   4516  N  ND2   . ASN A  1  601  ? 238.384 311.351 232.601 1.00 0.00 ? 601  ASN A ND2   1 
ATOM   4517  N  N     . CYS A  1  602  ? 240.755 306.716 229.733 1.00 0.00 ? 602  CYS A N     1 
ATOM   4518  C  CA    . CYS A  1  602  ? 241.924 306.038 229.189 1.00 0.00 ? 602  CYS A CA    1 
ATOM   4519  C  C     . CYS A  1  602  ? 242.473 306.630 227.913 1.00 0.00 ? 602  CYS A C     1 
ATOM   4520  O  O     . CYS A  1  602  ? 241.737 306.876 226.963 1.00 0.00 ? 602  CYS A O     1 
ATOM   4521  C  CB    . CYS A  1  602  ? 241.618 304.584 228.891 1.00 0.00 ? 602  CYS A CB    1 
ATOM   4522  S  SG    . CYS A  1  602  ? 242.936 303.901 227.869 1.00 0.00 ? 602  CYS A SG    1 
ATOM   4523  N  N     . ILE A  1  603  ? 243.784 306.816 227.890 1.00 0.00 ? 603  ILE A N     1 
ATOM   4524  C  CA    . ILE A  1  603  ? 244.510 307.149 226.670 1.00 0.00 ? 603  ILE A CA    1 
ATOM   4525  C  C     . ILE A  1  603  ? 245.434 305.962 226.425 1.00 0.00 ? 603  ILE A C     1 
ATOM   4526  O  O     . ILE A  1  603  ? 245.638 305.139 227.319 1.00 0.00 ? 603  ILE A O     1 
ATOM   4527  C  CB    . ILE A  1  603  ? 245.309 308.488 226.814 1.00 0.00 ? 603  ILE A CB    1 
ATOM   4528  C  CG1   . ILE A  1  603  ? 244.390 309.619 227.277 1.00 0.00 ? 603  ILE A CG1   1 
ATOM   4529  C  CG2   . ILE A  1  603  ? 246.062 308.888 225.526 1.00 0.00 ? 603  ILE A CG2   1 
ATOM   4530  C  CD1   . ILE A  1  603  ? 245.146 310.854 227.602 1.00 0.00 ? 603  ILE A CD1   1 
ATOM   4531  N  N     . ARG A  1  604  ? 245.969 305.872 225.217 1.00 0.00 ? 604  ARG A N     1 
ATOM   4532  C  CA    . ARG A  1  604  ? 246.862 304.794 224.832 1.00 0.00 ? 604  ARG A CA    1 
ATOM   4533  C  C     . ARG A  1  604  ? 246.103 303.486 225.024 1.00 0.00 ? 604  ARG A C     1 
ATOM   4534  O  O     . ARG A  1  604  ? 244.891 303.466 224.863 1.00 0.00 ? 604  ARG A O     1 
ATOM   4535  C  CB    . ARG A  1  604  ? 248.179 304.843 225.634 1.00 0.00 ? 604  ARG A CB    1 
ATOM   4536  C  CG    . ARG A  1  604  ? 249.339 304.044 225.015 1.00 0.00 ? 604  ARG A CG    1 
ATOM   4537  C  CD    . ARG A  1  604  ? 250.621 304.144 225.817 1.00 0.00 ? 604  ARG A CD    1 
ATOM   4538  N  NE    . ARG A  1  604  ? 251.435 305.293 225.417 1.00 0.00 ? 604  ARG A NE    1 
ATOM   4539  C  CZ    . ARG A  1  604  ? 251.408 306.480 226.021 1.00 0.00 ? 604  ARG A CZ    1 
ATOM   4540  N  NH1   . ARG A  1  604  ? 250.593 306.674 227.056 1.00 0.00 ? 604  ARG A NH1   1 
ATOM   4541  N  NH2   . ARG A  1  604  ? 252.193 307.472 225.595 1.00 0.00 ? 604  ARG A NH2   1 
ATOM   4542  N  N     . THR A  1  605  ? 246.801 302.440 225.453 1.00 0.00 ? 605  THR A N     1 
ATOM   4543  C  CA    . THR A  1  605  ? 246.352 301.062 225.299 1.00 0.00 ? 605  THR A CA    1 
ATOM   4544  C  C     . THR A  1  605  ? 245.730 300.900 223.912 1.00 0.00 ? 605  THR A C     1 
ATOM   4545  O  O     . THR A  1  605  ? 244.590 301.275 223.663 1.00 0.00 ? 605  THR A O     1 
ATOM   4546  C  CB    . THR A  1  605  ? 245.368 300.644 226.403 1.00 0.00 ? 605  THR A CB    1 
ATOM   4547  O  OG1   . THR A  1  605  ? 244.298 301.588 226.446 1.00 0.00 ? 605  THR A OG1   1 
ATOM   4548  C  CG2   . THR A  1  605  ? 246.070 300.603 227.765 1.00 0.00 ? 605  THR A CG2   1 
ATOM   4549  N  N     . HIS A  1  606  ? 246.508 300.309 223.016 1.00 0.00 ? 606  HIS A N     1 
ATOM   4550  C  CA    . HIS A  1  606  ? 246.191 300.286 221.603 1.00 0.00 ? 606  HIS A CA    1 
ATOM   4551  C  C     . HIS A  1  606  ? 246.904 299.157 220.893 1.00 0.00 ? 606  HIS A C     1 
ATOM   4552  O  O     . HIS A  1  606  ? 246.457 298.663 219.852 1.00 0.00 ? 606  HIS A O     1 
ATOM   4553  C  CB    . HIS A  1  606  ? 246.645 301.579 221.015 1.00 0.00 ? 606  HIS A CB    1 
ATOM   4554  C  CG    . HIS A  1  606  ? 248.120 301.759 221.134 1.00 0.00 ? 606  HIS A CG    1 
ATOM   4555  N  ND1   . HIS A  1  606  ? 249.011 301.230 220.224 1.00 0.00 ? 606  HIS A ND1   1 
ATOM   4556  C  CD2   . HIS A  1  606  ? 248.869 302.344 222.096 1.00 0.00 ? 606  HIS A CD2   1 
ATOM   4557  C  CE1   . HIS A  1  606  ? 250.245 301.522 220.596 1.00 0.00 ? 606  HIS A CE1   1 
ATOM   4558  N  NE2   . HIS A  1  606  ? 250.186 302.198 221.729 1.00 0.00 ? 606  HIS A NE2   1 
ATOM   4559  N  N     . SER A  1  607  ? 248.024 298.768 221.503 1.00 0.00 ? 607  SER A N     1 
ATOM   4560  C  CA    . SER A  1  607  ? 249.024 297.856 220.945 1.00 0.00 ? 607  SER A CA    1 
ATOM   4561  C  C     . SER A  1  607  ? 248.447 296.556 220.367 1.00 0.00 ? 607  SER A C     1 
ATOM   4562  O  O     . SER A  1  607  ? 248.613 295.469 220.945 1.00 0.00 ? 607  SER A O     1 
ATOM   4563  C  CB    . SER A  1  607  ? 250.072 297.513 222.022 1.00 0.00 ? 607  SER A CB    1 
ATOM   4564  O  OG    . SER A  1  607  ? 250.588 298.680 222.646 1.00 0.00 ? 607  SER A OG    1 
ATOM   4565  N  N     . THR A  1  608  ? 247.762 296.680 219.232 1.00 0.00 ? 608  THR A N     1 
ATOM   4566  C  CA    . THR A  1  608  ? 247.562 295.559 218.325 1.00 0.00 ? 608  THR A CA    1 
ATOM   4567  C  C     . THR A  1  608  ? 248.833 295.491 217.481 1.00 0.00 ? 608  THR A C     1 
ATOM   4568  O  O     . THR A  1  608  ? 249.669 296.392 217.579 1.00 0.00 ? 608  THR A O     1 
ATOM   4569  C  CB    . THR A  1  608  ? 246.317 295.743 217.447 1.00 0.00 ? 608  THR A CB    1 
ATOM   4570  O  OG1   . THR A  1  608  ? 246.479 296.906 216.636 1.00 0.00 ? 608  THR A OG1   1 
ATOM   4571  C  CG2   . THR A  1  608  ? 245.065 295.910 218.311 1.00 0.00 ? 608  THR A CG2   1 
ATOM   4572  N  N     . HIS A  1  609  ? 249.028 294.421 216.713 1.00 0.00 ? 609  HIS A N     1 
ATOM   4573  C  CA    . HIS A  1  609  ? 250.188 294.366 215.814 1.00 0.00 ? 609  HIS A CA    1 
ATOM   4574  C  C     . HIS A  1  609  ? 250.229 295.641 214.934 1.00 0.00 ? 609  HIS A C     1 
ATOM   4575  O  O     . HIS A  1  609  ? 251.290 296.261 214.794 1.00 0.00 ? 609  HIS A O     1 
ATOM   4576  C  CB    . HIS A  1  609  ? 250.175 293.081 214.960 1.00 0.00 ? 609  HIS A CB    1 
ATOM   4577  C  CG    . HIS A  1  609  ? 251.447 292.833 214.197 1.00 0.00 ? 609  HIS A CG    1 
ATOM   4578  N  ND1   . HIS A  1  609  ? 251.592 293.152 212.862 1.00 0.00 ? 609  HIS A ND1   1 
ATOM   4579  C  CD2   . HIS A  1  609  ? 252.627 292.287 214.580 1.00 0.00 ? 609  HIS A CD2   1 
ATOM   4580  C  CE1   . HIS A  1  609  ? 252.807 292.821 212.459 1.00 0.00 ? 609  HIS A CE1   1 
ATOM   4581  N  NE2   . HIS A  1  609  ? 253.455 292.293 213.482 1.00 0.00 ? 609  HIS A NE2   1 
ATOM   4582  N  N     . PRO A  1  610  ? 249.079 295.951 214.338 1.00 0.00 ? 610  PRO A N     1 
ATOM   4583  C  CA    . PRO A  1  610  ? 248.868 297.081 213.420 1.00 0.00 ? 610  PRO A CA    1 
ATOM   4584  C  C     . PRO A  1  610  ? 249.727 298.329 213.615 1.00 0.00 ? 610  PRO A C     1 
ATOM   4585  O  O     . PRO A  1  610  ? 250.761 298.298 214.283 1.00 0.00 ? 610  PRO A O     1 
ATOM   4586  C  CB    . PRO A  1  610  ? 247.393 297.433 213.644 1.00 0.00 ? 610  PRO A CB    1 
ATOM   4587  C  CG    . PRO A  1  610  ? 246.769 296.152 214.080 1.00 0.00 ? 610  PRO A CG    1 
ATOM   4588  C  CD    . PRO A  1  610  ? 247.813 295.447 214.898 1.00 0.00 ? 610  PRO A CD    1 
ATOM   4589  N  N     . ASP A  1  611  ? 249.269 299.419 212.999 1.00 0.00 ? 611  ASP A N     1 
ATOM   4590  C  CA    . ASP A  1  611  ? 249.936 300.718 213.042 1.00 0.00 ? 611  ASP A CA    1 
ATOM   4591  C  C     . ASP A  1  611  ? 251.405 300.615 212.652 1.00 0.00 ? 611  ASP A C     1 
ATOM   4592  O  O     . ASP A  1  611  ? 251.783 300.890 211.513 1.00 0.00 ? 611  ASP A O     1 
ATOM   4593  C  CB    . ASP A  1  611  ? 249.791 301.362 214.424 1.00 0.00 ? 611  ASP A CB    1 
ATOM   4594  C  CG    . ASP A  1  611  ? 248.993 302.650 214.386 1.00 0.00 ? 611  ASP A CG    1 
ATOM   4595  O  OD1   . ASP A  1  611  ? 248.216 302.842 213.428 1.00 0.00 ? 611  ASP A OD1   1 
ATOM   4596  O  OD2   . ASP A  1  611  ? 249.144 303.472 215.315 1.00 0.00 ? 611  ASP A OD2   1 
ATOM   4597  N  N     . ASP A  1  612  ? 252.225 300.215 213.614 1.00 0.00 ? 612  ASP A N     1 
ATOM   4598  C  CA    . ASP A  1  612  ? 253.654 300.064 213.416 1.00 0.00 ? 612  ASP A CA    1 
ATOM   4599  C  C     . ASP A  1  612  ? 254.331 299.865 214.761 1.00 0.00 ? 612  ASP A C     1 
ATOM   4600  O  O     . ASP A  1  612  ? 253.734 300.122 215.807 1.00 0.00 ? 612  ASP A O     1 
ATOM   4601  C  CB    . ASP A  1  612  ? 254.217 301.292 212.683 1.00 0.00 ? 612  ASP A CB    1 
ATOM   4602  C  CG    . ASP A  1  612  ? 255.703 301.186 212.395 1.00 0.00 ? 612  ASP A CG    1 
ATOM   4603  O  OD1   . ASP A  1  612  ? 256.086 300.346 211.557 1.00 0.00 ? 612  ASP A OD1   1 
ATOM   4604  O  OD2   . ASP A  1  612  ? 256.485 301.949 212.998 1.00 0.00 ? 612  ASP A OD2   1 
ATOM   4605  N  N     . GLU A  1  613  ? 255.564 299.383 214.676 1.00 0.00 ? 613  GLU A N     1 
ATOM   4606  C  CA    . GLU A  1  613  ? 256.394 299.131 215.827 1.00 0.00 ? 613  GLU A CA    1 
ATOM   4607  C  C     . GLU A  1  613  ? 257.336 300.305 216.010 1.00 0.00 ? 613  GLU A C     1 
ATOM   4608  O  O     . GLU A  1  613  ? 258.285 300.484 215.241 1.00 0.00 ? 613  GLU A O     1 
ATOM   4609  C  CB    . GLU A  1  613  ? 257.190 297.838 215.644 1.00 0.00 ? 613  GLU A CB    1 
ATOM   4610  C  CG    . GLU A  1  613  ? 257.937 297.387 216.888 1.00 0.00 ? 613  GLU A CG    1 
ATOM   4611  C  CD    . GLU A  1  613  ? 257.551 295.987 217.323 1.00 0.00 ? 613  GLU A CD    1 
ATOM   4612  O  OE1   . GLU A  1  613  ? 257.443 295.100 216.450 1.00 0.00 ? 613  GLU A OE1   1 
ATOM   4613  O  OE2   . GLU A  1  613  ? 257.356 295.772 218.538 1.00 0.00 ? 613  GLU A OE2   1 
ATOM   4614  N  N     . ASP A  1  614  ? 256.999 301.120 217.004 1.00 0.00 ? 614  ASP A N     1 
ATOM   4615  C  CA    . ASP A  1  614  ? 257.755 302.293 217.455 1.00 0.00 ? 614  ASP A CA    1 
ATOM   4616  C  C     . ASP A  1  614  ? 257.832 303.643 216.713 1.00 0.00 ? 614  ASP A C     1 
ATOM   4617  O  O     . ASP A  1  614  ? 258.268 304.599 217.355 1.00 0.00 ? 614  ASP A O     1 
ATOM   4618  C  CB    . ASP A  1  614  ? 259.152 301.901 217.983 1.00 0.00 ? 614  ASP A CB    1 
ATOM   4619  C  CG    . ASP A  1  614  ? 259.737 302.944 218.914 1.00 0.00 ? 614  ASP A CG    1 
ATOM   4620  O  OD1   . ASP A  1  614  ? 259.095 303.255 219.940 1.00 0.00 ? 614  ASP A OD1   1 
ATOM   4621  O  OD2   . ASP A  1  614  ? 260.840 303.453 218.621 1.00 0.00 ? 614  ASP A OD2   1 
ATOM   4622  N  N     . SER A  1  615  ? 257.459 303.826 215.441 1.00 0.00 ? 615  SER A N     1 
ATOM   4623  C  CA    . SER A  1  615  ? 257.659 305.218 215.068 1.00 0.00 ? 615  SER A CA    1 
ATOM   4624  C  C     . SER A  1  615  ? 256.905 305.556 213.791 1.00 0.00 ? 615  SER A C     1 
ATOM   4625  O  O     . SER A  1  615  ? 256.904 306.708 213.353 1.00 0.00 ? 615  SER A O     1 
ATOM   4626  C  CB    . SER A  1  615  ? 259.152 305.520 214.889 1.00 0.00 ? 615  SER A CB    1 
ATOM   4627  O  OG    . SER A  1  615  ? 259.819 305.601 216.138 1.00 0.00 ? 615  SER A OG    1 
ATOM   4628  N  N     . GLY A  1  616  ? 256.282 304.552 213.180 1.00 0.00 ? 616  GLY A N     1 
ATOM   4629  C  CA    . GLY A  1  616  ? 255.631 304.791 211.913 1.00 0.00 ? 616  GLY A CA    1 
ATOM   4630  C  C     . GLY A  1  616  ? 254.488 305.781 211.958 1.00 0.00 ? 616  GLY A C     1 
ATOM   4631  O  O     . GLY A  1  616  ? 254.486 306.713 211.157 1.00 0.00 ? 616  GLY A O     1 
ATOM   4632  N  N     . PRO A  1  617  ? 253.504 305.589 212.859 1.00 0.00 ? 617  PRO A N     1 
ATOM   4633  C  CA    . PRO A  1  617  ? 252.472 306.628 212.927 1.00 0.00 ? 617  PRO A CA    1 
ATOM   4634  C  C     . PRO A  1  617  ? 252.991 308.056 213.176 1.00 0.00 ? 617  PRO A C     1 
ATOM   4635  O  O     . PRO A  1  617  ? 252.319 309.010 212.769 1.00 0.00 ? 617  PRO A O     1 
ATOM   4636  C  CB    . PRO A  1  617  ? 251.599 306.170 214.103 1.00 0.00 ? 617  PRO A CB    1 
ATOM   4637  C  CG    . PRO A  1  617  ? 251.736 304.697 214.101 1.00 0.00 ? 617  PRO A CG    1 
ATOM   4638  C  CD    . PRO A  1  617  ? 253.168 304.432 213.703 1.00 0.00 ? 617  PRO A CD    1 
ATOM   4639  N  N     . TYR A  1  618  ? 254.147 308.203 213.831 1.00 0.00 ? 618  TYR A N     1 
ATOM   4640  C  CA    . TYR A  1  618  ? 254.696 309.536 214.113 1.00 0.00 ? 618  TYR A CA    1 
ATOM   4641  C  C     . TYR A  1  618  ? 255.317 310.219 212.901 1.00 0.00 ? 618  TYR A C     1 
ATOM   4642  O  O     . TYR A  1  618  ? 255.704 311.387 212.962 1.00 0.00 ? 618  TYR A O     1 
ATOM   4643  C  CB    . TYR A  1  618  ? 255.724 309.441 215.241 1.00 0.00 ? 618  TYR A CB    1 
ATOM   4644  C  CG    . TYR A  1  618  ? 255.160 308.787 216.479 1.00 0.00 ? 618  TYR A CG    1 
ATOM   4645  C  CD1   . TYR A  1  618  ? 253.888 309.112 216.935 1.00 0.00 ? 618  TYR A CD1   1 
ATOM   4646  C  CD2   . TYR A  1  618  ? 255.872 307.811 217.161 1.00 0.00 ? 618  TYR A CD2   1 
ATOM   4647  C  CE1   . TYR A  1  618  ? 253.364 308.529 218.068 1.00 0.00 ? 618  TYR A CE1   1 
ATOM   4648  C  CE2   . TYR A  1  618  ? 255.344 307.203 218.286 1.00 0.00 ? 618  TYR A CE2   1 
ATOM   4649  C  CZ    . TYR A  1  618  ? 254.092 307.571 218.737 1.00 0.00 ? 618  TYR A CZ    1 
ATOM   4650  O  OH    . TYR A  1  618  ? 253.555 306.957 219.843 1.00 0.00 ? 618  TYR A OH    1 
ATOM   4651  N  N     . LYS A  1  619  ? 255.462 309.405 211.858 1.00 0.00 ? 619  LYS A N     1 
ATOM   4652  C  CA    . LYS A  1  619  ? 255.981 309.823 210.580 1.00 0.00 ? 619  LYS A CA    1 
ATOM   4653  C  C     . LYS A  1  619  ? 254.808 310.551 209.978 1.00 0.00 ? 619  LYS A C     1 
ATOM   4654  O  O     . LYS A  1  619  ? 254.072 310.003 209.151 1.00 0.00 ? 619  LYS A O     1 
ATOM   4655  C  CB    . LYS A  1  619  ? 256.358 308.616 209.725 1.00 0.00 ? 619  LYS A CB    1 
ATOM   4656  C  CG    . LYS A  1  619  ? 257.815 308.594 209.290 1.00 0.00 ? 619  LYS A CG    1 
ATOM   4657  C  CD    . LYS A  1  619  ? 258.648 307.698 210.192 1.00 0.00 ? 619  LYS A CD    1 
ATOM   4658  C  CE    . LYS A  1  619  ? 259.721 308.492 210.919 1.00 0.00 ? 619  LYS A CE    1 
ATOM   4659  N  NZ    . LYS A  1  619  ? 260.141 309.694 210.147 1.00 0.00 ? 619  LYS A NZ    1 
ATOM   4660  N  N     . HIS A  1  620  ? 254.626 311.763 210.496 1.00 0.00 ? 620  HIS A N     1 
ATOM   4661  C  CA    . HIS A  1  620  ? 253.595 312.739 210.133 1.00 0.00 ? 620  HIS A CA    1 
ATOM   4662  C  C     . HIS A  1  620  ? 252.150 312.622 210.652 1.00 0.00 ? 620  HIS A C     1 
ATOM   4663  O  O     . HIS A  1  620  ? 251.393 313.564 210.420 1.00 0.00 ? 620  HIS A O     1 
ATOM   4664  C  CB    . HIS A  1  620  ? 253.623 313.129 208.637 1.00 0.00 ? 620  HIS A CB    1 
ATOM   4665  C  CG    . HIS A  1  620  ? 254.966 313.588 208.158 1.00 0.00 ? 620  HIS A CG    1 
ATOM   4666  N  ND1   . HIS A  1  620  ? 255.967 313.984 209.018 1.00 0.00 ? 620  HIS A ND1   1 
ATOM   4667  C  CD2   . HIS A  1  620  ? 255.471 313.715 206.909 1.00 0.00 ? 620  HIS A CD2   1 
ATOM   4668  C  CE1   . HIS A  1  620  ? 257.032 314.334 208.319 1.00 0.00 ? 620  HIS A CE1   1 
ATOM   4669  N  NE2   . HIS A  1  620  ? 256.757 314.180 207.037 1.00 0.00 ? 620  HIS A NE2   1 
ATOM   4670  N  N     . ILE A  1  621  ? 251.812 311.500 211.275 1.00 0.00 ? 621  ILE A N     1 
ATOM   4671  C  CA    . ILE A  1  621  ? 250.514 311.278 211.915 1.00 0.00 ? 621  ILE A CA    1 
ATOM   4672  C  C     . ILE A  1  621  ? 249.179 311.231 211.151 1.00 0.00 ? 621  ILE A C     1 
ATOM   4673  O  O     . ILE A  1  621  ? 248.384 312.167 211.236 1.00 0.00 ? 621  ILE A O     1 
ATOM   4674  C  CB    . ILE A  1  621  ? 250.331 312.251 213.102 1.00 0.00 ? 621  ILE A CB    1 
ATOM   4675  C  CG1   . ILE A  1  621  ? 251.534 312.177 214.043 1.00 0.00 ? 621  ILE A CG1   1 
ATOM   4676  C  CG2   . ILE A  1  621  ? 249.042 311.945 213.849 1.00 0.00 ? 621  ILE A CG2   1 
ATOM   4677  C  CD1   . ILE A  1  621  ? 251.425 311.090 215.090 1.00 0.00 ? 621  ILE A CD1   1 
ATOM   4678  N  N     . SER A  1  622  ? 248.931 310.153 210.411 1.00 0.00 ? 622  SER A N     1 
ATOM   4679  C  CA    . SER A  1  622  ? 247.622 309.967 209.802 1.00 0.00 ? 622  SER A CA    1 
ATOM   4680  C  C     . SER A  1  622  ? 247.056 309.464 211.111 1.00 0.00 ? 622  SER A C     1 
ATOM   4681  O  O     . SER A  1  622  ? 247.004 308.260 211.361 1.00 0.00 ? 622  SER A O     1 
ATOM   4682  C  CB    . SER A  1  622  ? 247.653 308.855 208.762 1.00 0.00 ? 622  SER A CB    1 
ATOM   4683  O  OG    . SER A  1  622  ? 248.733 309.030 207.861 1.00 0.00 ? 622  SER A OG    1 
ATOM   4684  N  N     . PRO A  1  623  ? 246.511 310.375 211.908 1.00 0.00 ? 623  PRO A N     1 
ATOM   4685  C  CA    . PRO A  1  623  ? 245.886 309.996 213.180 1.00 0.00 ? 623  PRO A CA    1 
ATOM   4686  C  C     . PRO A  1  623  ? 246.228 308.570 213.617 1.00 0.00 ? 623  PRO A C     1 
ATOM   4687  O  O     . PRO A  1  623  ? 247.247 308.393 214.285 1.00 0.00 ? 623  PRO A O     1 
ATOM   4688  C  CB    . PRO A  1  623  ? 244.390 310.104 212.875 1.00 0.00 ? 623  PRO A CB    1 
ATOM   4689  C  CG    . PRO A  1  623  ? 244.306 311.132 211.799 1.00 0.00 ? 623  PRO A CG    1 
ATOM   4690  C  CD    . PRO A  1  623  ? 245.541 310.951 210.961 1.00 0.00 ? 623  PRO A CD    1 
ATOM   4691  N  N     . GLY A  1  624  ? 245.414 307.575 213.261 1.00 0.00 ? 624  GLY A N     1 
ATOM   4692  C  CA    . GLY A  1  624  ? 245.728 306.222 213.691 1.00 0.00 ? 624  GLY A CA    1 
ATOM   4693  C  C     . GLY A  1  624  ? 245.036 304.950 213.213 1.00 0.00 ? 624  GLY A C     1 
ATOM   4694  O  O     . GLY A  1  624  ? 245.691 303.908 213.186 1.00 0.00 ? 624  GLY A O     1 
ATOM   4695  N  N     . ASP A  1  625  ? 243.757 304.979 212.839 1.00 0.00 ? 625  ASP A N     1 
ATOM   4696  C  CA    . ASP A  1  625  ? 243.137 303.726 212.450 1.00 0.00 ? 625  ASP A CA    1 
ATOM   4697  C  C     . ASP A  1  625  ? 243.466 302.507 213.296 1.00 0.00 ? 625  ASP A C     1 
ATOM   4698  O  O     . ASP A  1  625  ? 242.902 301.441 213.052 1.00 0.00 ? 625  ASP A O     1 
ATOM   4699  C  CB    . ASP A  1  625  ? 243.446 303.424 210.979 1.00 0.00 ? 625  ASP A CB    1 
ATOM   4700  C  CG    . ASP A  1  625  ? 242.206 303.446 210.107 1.00 0.00 ? 625  ASP A CG    1 
ATOM   4701  O  OD1   . ASP A  1  625  ? 241.162 303.952 210.570 1.00 0.00 ? 625  ASP A OD1   1 
ATOM   4702  O  OD2   . ASP A  1  625  ? 242.275 302.958 208.960 1.00 0.00 ? 625  ASP A OD2   1 
ATOM   4703  N  N     . THR A  1  626  ? 244.354 302.613 214.281 1.00 0.00 ? 626  THR A N     1 
ATOM   4704  C  CA    . THR A  1  626  ? 244.598 301.382 215.026 1.00 0.00 ? 626  THR A CA    1 
ATOM   4705  C  C     . THR A  1  626  ? 244.870 301.680 216.494 1.00 0.00 ? 626  THR A C     1 
ATOM   4706  O  O     . THR A  1  626  ? 245.096 300.752 217.267 1.00 0.00 ? 626  THR A O     1 
ATOM   4707  C  CB    . THR A  1  626  ? 245.825 300.578 214.508 1.00 0.00 ? 626  THR A CB    1 
ATOM   4708  O  OG1   . THR A  1  626  ? 247.043 301.266 214.836 1.00 0.00 ? 626  THR A OG1   1 
ATOM   4709  C  CG2   . THR A  1  626  ? 245.745 300.292 213.003 1.00 0.00 ? 626  THR A CG2   1 
ATOM   4710  N  N     . LYS A  1  627  ? 244.917 302.959 216.872 1.00 0.00 ? 627  LYS A N     1 
ATOM   4711  C  CA    . LYS A  1  627  ? 245.202 303.317 218.262 1.00 0.00 ? 627  LYS A CA    1 
ATOM   4712  C  C     . LYS A  1  627  ? 243.986 303.870 218.965 1.00 0.00 ? 627  LYS A C     1 
ATOM   4713  O  O     . LYS A  1  627  ? 243.349 304.769 218.465 1.00 0.00 ? 627  LYS A O     1 
ATOM   4714  C  CB    . LYS A  1  627  ? 246.361 304.303 218.333 1.00 0.00 ? 627  LYS A CB    1 
ATOM   4715  C  CG    . LYS A  1  627  ? 247.602 303.738 217.657 1.00 0.00 ? 627  LYS A CG    1 
ATOM   4716  C  CD    . LYS A  1  627  ? 248.891 304.403 218.105 1.00 0.00 ? 627  LYS A CD    1 
ATOM   4717  C  CE    . LYS A  1  627  ? 250.085 303.715 217.450 1.00 0.00 ? 627  LYS A CE    1 
ATOM   4718  N  NZ    . LYS A  1  627  ? 251.371 304.270 217.940 1.00 0.00 ? 627  LYS A NZ    1 
ATOM   4719  N  N     . VAL A  1  628  ? 243.679 303.305 220.130 1.00 0.00 ? 628  VAL A N     1 
ATOM   4720  C  CA    . VAL A  1  628  ? 242.467 303.620 220.889 1.00 0.00 ? 628  VAL A CA    1 
ATOM   4721  C  C     . VAL A  1  628  ? 242.646 304.826 221.772 1.00 0.00 ? 628  VAL A C     1 
ATOM   4722  O  O     . VAL A  1  628  ? 243.712 305.063 222.304 1.00 0.00 ? 628  VAL A O     1 
ATOM   4723  C  CB    . VAL A  1  628  ? 242.014 302.445 221.776 1.00 0.00 ? 628  VAL A CB    1 
ATOM   4724  C  CG1   . VAL A  1  628  ? 240.664 302.720 222.419 1.00 0.00 ? 628  VAL A CG1   1 
ATOM   4725  C  CG2   . VAL A  1  628  ? 241.949 301.177 220.972 1.00 0.00 ? 628  VAL A CG2   1 
ATOM   4726  N  N     . VAL A  1  629  ? 241.565 305.568 221.927 1.00 0.00 ? 629  VAL A N     1 
ATOM   4727  C  CA    . VAL A  1  629  ? 241.518 306.853 222.595 1.00 0.00 ? 629  VAL A CA    1 
ATOM   4728  C  C     . VAL A  1  629  ? 240.146 306.905 223.242 1.00 0.00 ? 629  VAL A C     1 
ATOM   4729  O  O     . VAL A  1  629  ? 239.141 306.686 222.561 1.00 0.00 ? 629  VAL A O     1 
ATOM   4730  C  CB    . VAL A  1  629  ? 241.710 308.069 221.652 1.00 0.00 ? 629  VAL A CB    1 
ATOM   4731  C  CG1   . VAL A  1  629  ? 241.645 309.361 222.456 1.00 0.00 ? 629  VAL A CG1   1 
ATOM   4732  C  CG2   . VAL A  1  629  ? 243.034 307.998 220.906 1.00 0.00 ? 629  VAL A CG2   1 
ATOM   4733  N  N     . VAL A  1  630  ? 240.094 307.170 224.546 1.00 0.00 ? 630  VAL A N     1 
ATOM   4734  C  CA    . VAL A  1  630  ? 238.814 307.357 225.218 1.00 0.00 ? 630  VAL A CA    1 
ATOM   4735  C  C     . VAL A  1  630  ? 238.918 308.668 225.968 1.00 0.00 ? 630  VAL A C     1 
ATOM   4736  O  O     . VAL A  1  630  ? 239.860 308.912 226.705 1.00 0.00 ? 630  VAL A O     1 
ATOM   4737  C  CB    . VAL A  1  630  ? 238.504 306.228 226.237 1.00 0.00 ? 630  VAL A CB    1 
ATOM   4738  C  CG1   . VAL A  1  630  ? 237.160 306.449 226.873 1.00 0.00 ? 630  VAL A CG1   1 
ATOM   4739  C  CG2   . VAL A  1  630  ? 238.530 304.876 225.590 1.00 0.00 ? 630  VAL A CG2   1 
ATOM   4740  N  N     . GLU A  1  631  ? 237.913 309.506 225.773 1.00 0.00 ? 631  GLU A N     1 
ATOM   4741  C  CA    . GLU A  1  631  ? 237.806 310.811 226.402 1.00 0.00 ? 631  GLU A CA    1 
ATOM   4742  C  C     . GLU A  1  631  ? 236.397 311.029 226.876 1.00 0.00 ? 631  GLU A C     1 
ATOM   4743  O  O     . GLU A  1  631  ? 235.459 310.664 226.164 1.00 0.00 ? 631  GLU A O     1 
ATOM   4744  C  CB    . GLU A  1  631  ? 238.169 311.909 225.411 1.00 0.00 ? 631  GLU A CB    1 
ATOM   4745  C  CG    . GLU A  1  631  ? 238.454 313.248 226.041 1.00 0.00 ? 631  GLU A CG    1 
ATOM   4746  C  CD    . GLU A  1  631  ? 239.385 314.099 225.191 1.00 0.00 ? 631  GLU A CD    1 
ATOM   4747  O  OE1   . GLU A  1  631  ? 239.781 313.605 224.108 1.00 0.00 ? 631  GLU A OE1   1 
ATOM   4748  O  OE2   . GLU A  1  631  ? 239.712 315.251 225.595 1.00 0.00 ? 631  GLU A OE2   1 
ATOM   4749  N  N     . ASN A  1  632  ? 236.227 311.601 228.062 1.00 0.00 ? 632  ASN A N     1 
ATOM   4750  C  CA    . ASN A  1  632  ? 234.884 311.919 228.531 1.00 0.00 ? 632  ASN A CA    1 
ATOM   4751  C  C     . ASN A  1  632  ? 233.906 310.744 228.443 1.00 0.00 ? 632  ASN A C     1 
ATOM   4752  O  O     . ASN A  1  632  ? 232.705 310.928 228.224 1.00 0.00 ? 632  ASN A O     1 
ATOM   4753  C  CB    . ASN A  1  632  ? 234.360 313.110 227.725 1.00 0.00 ? 632  ASN A CB    1 
ATOM   4754  C  CG    . ASN A  1  632  ? 233.134 313.729 228.333 1.00 0.00 ? 632  ASN A CG    1 
ATOM   4755  O  OD1   . ASN A  1  632  ? 233.039 313.901 229.550 1.00 0.00 ? 632  ASN A OD1   1 
ATOM   4756  N  ND2   . ASN A  1  632  ? 232.166 314.051 227.486 1.00 0.00 ? 632  ASN A ND2   1 
ATOM   4757  N  N     . GLY A  1  633  ? 234.432 309.532 228.568 1.00 0.00 ? 633  GLY A N     1 
ATOM   4758  C  CA    . GLY A  1  633  ? 233.600 308.356 228.475 1.00 0.00 ? 633  GLY A CA    1 
ATOM   4759  C  C     . GLY A  1  633  ? 233.015 308.154 227.090 1.00 0.00 ? 633  GLY A C     1 
ATOM   4760  O  O     . GLY A  1  633  ? 231.842 307.817 226.985 1.00 0.00 ? 633  GLY A O     1 
ATOM   4761  N  N     . GLU A  1  634  ? 233.792 308.408 226.037 1.00 0.00 ? 634  GLU A N     1 
ATOM   4762  C  CA    . GLU A  1  634  ? 233.358 308.131 224.666 1.00 0.00 ? 634  GLU A CA    1 
ATOM   4763  C  C     . GLU A  1  634  ? 234.506 307.561 223.860 1.00 0.00 ? 634  GLU A C     1 
ATOM   4764  O  O     . GLU A  1  634  ? 235.562 308.173 223.824 1.00 0.00 ? 634  GLU A O     1 
ATOM   4765  C  CB    . GLU A  1  634  ? 232.868 309.408 224.027 1.00 0.00 ? 634  GLU A CB    1 
ATOM   4766  C  CG    . GLU A  1  634  ? 231.557 309.880 224.602 1.00 0.00 ? 634  GLU A CG    1 
ATOM   4767  C  CD    . GLU A  1  634  ? 230.970 311.036 223.824 1.00 0.00 ? 634  GLU A CD    1 
ATOM   4768  O  OE1   . GLU A  1  634  ? 231.697 311.580 222.953 1.00 0.00 ? 634  GLU A OE1   1 
ATOM   4769  O  OE2   . GLU A  1  634  ? 229.794 311.400 224.090 1.00 0.00 ? 634  GLU A OE2   1 
ATOM   4770  N  N     . LEU A  1  635  ? 234.301 306.451 223.149 1.00 0.00 ? 635  LEU A N     1 
ATOM   4771  C  CA    . LEU A  1  635  ? 235.405 305.866 222.391 1.00 0.00 ? 635  LEU A CA    1 
ATOM   4772  C  C     . LEU A  1  635  ? 235.586 306.757 221.190 1.00 0.00 ? 635  LEU A C     1 
ATOM   4773  O  O     . LEU A  1  635  ? 234.775 306.688 220.276 1.00 0.00 ? 635  LEU A O     1 
ATOM   4774  C  CB    . LEU A  1  635  ? 235.076 304.437 221.969 1.00 0.00 ? 635  LEU A CB    1 
ATOM   4775  C  CG    . LEU A  1  635  ? 236.070 303.589 221.164 1.00 0.00 ? 635  LEU A CG    1 
ATOM   4776  C  CD1   . LEU A  1  635  ? 237.308 303.366 221.973 1.00 0.00 ? 635  LEU A CD1   1 
ATOM   4777  C  CD2   . LEU A  1  635  ? 235.511 302.231 220.730 1.00 0.00 ? 635  LEU A CD2   1 
ATOM   4778  N  N     . ILE A  1  636  ? 236.701 307.492 221.121 1.00 0.00 ? 636  ILE A N     1 
ATOM   4779  C  CA    . ILE A  1  636  ? 236.945 308.417 220.000 1.00 0.00 ? 636  ILE A CA    1 
ATOM   4780  C  C     . ILE A  1  636  ? 237.471 307.801 218.718 1.00 0.00 ? 636  ILE A C     1 
ATOM   4781  O  O     . ILE A  1  636  ? 236.929 308.074 217.652 1.00 0.00 ? 636  ILE A O     1 
ATOM   4782  C  CB    . ILE A  1  636  ? 237.914 309.555 220.411 1.00 0.00 ? 636  ILE A CB    1 
ATOM   4783  C  CG1   . ILE A  1  636  ? 237.174 310.625 221.200 1.00 0.00 ? 636  ILE A CG1   1 
ATOM   4784  C  CG2   . ILE A  1  636  ? 238.477 310.255 219.211 1.00 0.00 ? 636  ILE A CG2   1 
ATOM   4785  C  CD1   . ILE A  1  636  ? 238.093 311.568 221.916 1.00 0.00 ? 636  ILE A CD1   1 
ATOM   4786  N  N     . MET A  1  637  ? 238.464 306.931 218.805 1.00 0.00 ? 637  MET A N     1 
ATOM   4787  C  CA    . MET A  1  637  ? 239.006 306.335 217.597 1.00 0.00 ? 637  MET A CA    1 
ATOM   4788  C  C     . MET A  1  637  ? 239.712 305.037 217.926 1.00 0.00 ? 637  MET A C     1 
ATOM   4789  O  O     . MET A  1  637  ? 240.170 304.870 219.041 1.00 0.00 ? 637  MET A O     1 
ATOM   4790  C  CB    . MET A  1  637  ? 239.974 307.307 216.956 1.00 0.00 ? 637  MET A CB    1 
ATOM   4791  C  CG    . MET A  1  637  ? 241.187 307.496 217.828 1.00 0.00 ? 637  MET A CG    1 
ATOM   4792  S  SD    . MET A  1  637  ? 242.410 308.706 217.307 1.00 0.00 ? 637  MET A SD    1 
ATOM   4793  C  CE    . MET A  1  637  ? 243.919 307.749 217.325 1.00 0.00 ? 637  MET A CE    1 
ATOM   4794  N  N     . GLY A  1  638  ? 239.805 304.105 216.981 1.00 0.00 ? 638  GLY A N     1 
ATOM   4795  C  CA    . GLY A  1  638  ? 240.528 302.865 217.234 1.00 0.00 ? 638  GLY A CA    1 
ATOM   4796  C  C     . GLY A  1  638  ? 239.647 301.734 217.756 1.00 0.00 ? 638  GLY A C     1 
ATOM   4797  O  O     . GLY A  1  638  ? 238.688 301.977 218.486 1.00 0.00 ? 638  GLY A O     1 
ATOM   4798  N  N     . ILE A  1  639  ? 239.993 300.499 217.395 1.00 0.00 ? 639  ILE A N     1 
ATOM   4799  C  CA    . ILE A  1  639  ? 239.202 299.303 217.700 1.00 0.00 ? 639  ILE A CA    1 
ATOM   4800  C  C     . ILE A  1  639  ? 239.645 298.648 218.994 1.00 0.00 ? 639  ILE A C     1 
ATOM   4801  O  O     . ILE A  1  639  ? 240.748 298.907 219.440 1.00 0.00 ? 639  ILE A O     1 
ATOM   4802  C  CB    . ILE A  1  639  ? 239.351 298.297 216.596 1.00 0.00 ? 639  ILE A CB    1 
ATOM   4803  C  CG1   . ILE A  1  639  ? 240.852 297.967 216.436 1.00 0.00 ? 639  ILE A CG1   1 
ATOM   4804  C  CG2   . ILE A  1  639  ? 238.769 298.881 215.329 1.00 0.00 ? 639  ILE A CG2   1 
ATOM   4805  C  CD1   . ILE A  1  639  ? 241.214 296.673 215.655 1.00 0.00 ? 639  ILE A CD1   1 
ATOM   4806  N  N     . LEU A  1  640  ? 238.838 297.776 219.592 1.00 0.00 ? 640  LEU A N     1 
ATOM   4807  C  CA    . LEU A  1  640  ? 239.219 297.202 220.888 1.00 0.00 ? 640  LEU A CA    1 
ATOM   4808  C  C     . LEU A  1  640  ? 239.804 295.788 220.841 1.00 0.00 ? 640  LEU A C     1 
ATOM   4809  O  O     . LEU A  1  640  ? 239.517 295.032 219.934 1.00 0.00 ? 640  LEU A O     1 
ATOM   4810  C  CB    . LEU A  1  640  ? 238.033 297.151 221.793 1.00 0.00 ? 640  LEU A CB    1 
ATOM   4811  C  CG    . LEU A  1  640  ? 237.289 298.427 222.017 1.00 0.00 ? 640  LEU A CG    1 
ATOM   4812  C  CD1   . LEU A  1  640  ? 236.287 298.017 223.013 1.00 0.00 ? 640  LEU A CD1   1 
ATOM   4813  C  CD2   . LEU A  1  640  ? 238.190 299.498 222.584 1.00 0.00 ? 640  LEU A CD2   1 
ATOM   4814  N  N     . CYS A  1  641  ? 240.595 295.393 221.833 1.00 0.00 ? 641  CYS A N     1 
ATOM   4815  C  CA    . CYS A  1  641  ? 241.190 294.048 221.802 1.00 0.00 ? 641  CYS A CA    1 
ATOM   4816  C  C     . CYS A  1  641  ? 241.486 293.474 223.187 1.00 0.00 ? 641  CYS A C     1 
ATOM   4817  O  O     . CYS A  1  641  ? 240.766 293.697 224.129 1.00 0.00 ? 641  CYS A O     1 
ATOM   4818  C  CB    . CYS A  1  641  ? 242.480 294.084 221.001 1.00 0.00 ? 641  CYS A CB    1 
ATOM   4819  S  SG    . CYS A  1  641  ? 243.756 295.000 221.870 1.00 0.00 ? 641  CYS A SG    1 
ATOM   4820  N  N     . LYS A  1  642  ? 242.530 292.685 223.314 1.00 0.00 ? 642  LYS A N     1 
ATOM   4821  C  CA    . LYS A  1  642  ? 242.947 292.326 224.644 1.00 0.00 ? 642  LYS A CA    1 
ATOM   4822  C  C     . LYS A  1  642  ? 243.691 293.467 225.319 1.00 0.00 ? 642  LYS A C     1 
ATOM   4823  O  O     . LYS A  1  642  ? 243.570 293.658 226.519 1.00 0.00 ? 642  LYS A O     1 
ATOM   4824  C  CB    . LYS A  1  642  ? 243.859 291.116 224.597 1.00 0.00 ? 642  LYS A CB    1 
ATOM   4825  C  CG    . LYS A  1  642  ? 243.938 290.364 225.878 1.00 0.00 ? 642  LYS A CG    1 
ATOM   4826  C  CD    . LYS A  1  642  ? 244.774 289.124 225.689 1.00 0.00 ? 642  LYS A CD    1 
ATOM   4827  C  CE    . LYS A  1  642  ? 244.714 288.227 226.931 1.00 0.00 ? 642  LYS A CE    1 
ATOM   4828  N  NZ    . LYS A  1  642  ? 245.220 286.822 226.716 1.00 0.00 ? 642  LYS A NZ    1 
ATOM   4829  N  N     . LYS A  1  643  ? 244.456 294.225 224.535 1.00 0.00 ? 643  LYS A N     1 
ATOM   4830  C  CA    . LYS A  1  643  ? 245.236 295.364 225.038 1.00 0.00 ? 643  LYS A CA    1 
ATOM   4831  C  C     . LYS A  1  643  ? 244.425 296.506 225.651 1.00 0.00 ? 643  LYS A C     1 
ATOM   4832  O  O     . LYS A  1  643  ? 244.855 297.146 226.611 1.00 0.00 ? 643  LYS A O     1 
ATOM   4833  C  CB    . LYS A  1  643  ? 246.153 295.899 223.942 1.00 0.00 ? 643  LYS A CB    1 
ATOM   4834  C  CG    . LYS A  1  643  ? 247.126 296.948 224.437 1.00 0.00 ? 643  LYS A CG    1 
ATOM   4835  C  CD    . LYS A  1  643  ? 247.966 296.488 225.603 1.00 0.00 ? 643  LYS A CD    1 
ATOM   4836  C  CE    . LYS A  1  643  ? 249.057 297.506 225.905 1.00 0.00 ? 643  LYS A CE    1 
ATOM   4837  N  NZ    . LYS A  1  643  ? 249.906 297.136 227.074 1.00 0.00 ? 643  LYS A NZ    1 
ATOM   4838  N  N     . SER A  1  644  ? 243.282 296.799 225.060 1.00 0.00 ? 644  SER A N     1 
ATOM   4839  C  CA    . SER A  1  644  ? 242.377 297.782 225.622 1.00 0.00 ? 644  SER A CA    1 
ATOM   4840  C  C     . SER A  1  644  ? 241.414 297.103 226.595 1.00 0.00 ? 644  SER A C     1 
ATOM   4841  O  O     . SER A  1  644  ? 241.372 297.404 227.763 1.00 0.00 ? 644  SER A O     1 
ATOM   4842  C  CB    . SER A  1  644  ? 241.652 298.525 224.502 1.00 0.00 ? 644  SER A CB    1 
ATOM   4843  O  OG    . SER A  1  644  ? 241.182 297.642 223.504 1.00 0.00 ? 644  SER A OG    1 
ATOM   4844  N  N     . LEU A  1  645  ? 240.589 296.235 226.063 1.00 0.00 ? 645  LEU A N     1 
ATOM   4845  C  CA    . LEU A  1  645  ? 239.495 295.590 226.777 1.00 0.00 ? 645  LEU A CA    1 
ATOM   4846  C  C     . LEU A  1  645  ? 239.762 294.425 227.749 1.00 0.00 ? 645  LEU A C     1 
ATOM   4847  O  O     . LEU A  1  645  ? 238.864 294.039 228.496 1.00 0.00 ? 645  LEU A O     1 
ATOM   4848  C  CB    . LEU A  1  645  ? 238.513 295.122 225.723 1.00 0.00 ? 645  LEU A CB    1 
ATOM   4849  C  CG    . LEU A  1  645  ? 237.080 295.000 226.120 1.00 0.00 ? 645  LEU A CG    1 
ATOM   4850  C  CD1   . LEU A  1  645  ? 236.657 296.383 226.445 1.00 0.00 ? 645  LEU A CD1   1 
ATOM   4851  C  CD2   . LEU A  1  645  ? 236.410 294.568 224.856 1.00 0.00 ? 645  LEU A CD2   1 
ATOM   4852  N  N     . GLY A  1  646  ? 240.956 293.841 227.735 1.00 0.00 ? 646  GLY A N     1 
ATOM   4853  C  CA    . GLY A  1  646  ? 241.174 292.597 228.466 1.00 0.00 ? 646  GLY A CA    1 
ATOM   4854  C  C     . GLY A  1  646  ? 241.769 292.724 229.851 1.00 0.00 ? 646  GLY A C     1 
ATOM   4855  O  O     . GLY A  1  646  ? 241.761 293.800 230.427 1.00 0.00 ? 646  GLY A O     1 
ATOM   4856  N  N     . THR A  1  647  ? 242.292 291.623 230.383 1.00 0.00 ? 647  THR A N     1 
ATOM   4857  C  CA    . THR A  1  647  ? 242.818 291.597 231.747 1.00 0.00 ? 647  THR A CA    1 
ATOM   4858  C  C     . THR A  1  647  ? 244.071 292.422 231.979 1.00 0.00 ? 647  THR A C     1 
ATOM   4859  O  O     . THR A  1  647  ? 244.658 292.324 233.041 1.00 0.00 ? 647  THR A O     1 
ATOM   4860  C  CB    . THR A  1  647  ? 243.186 290.172 232.204 1.00 0.00 ? 647  THR A CB    1 
ATOM   4861  O  OG1   . THR A  1  647  ? 244.316 289.710 231.460 1.00 0.00 ? 647  THR A OG1   1 
ATOM   4862  C  CG2   . THR A  1  647  ? 242.017 289.208 232.046 1.00 0.00 ? 647  THR A CG2   1 
ATOM   4863  N  N     . SER A  1  648  ? 244.479 293.245 231.021 1.00 0.00 ? 648  SER A N     1 
ATOM   4864  C  CA    . SER A  1  648  ? 245.748 293.976 231.147 1.00 0.00 ? 648  SER A CA    1 
ATOM   4865  C  C     . SER A  1  648  ? 245.637 295.185 232.092 1.00 0.00 ? 648  SER A C     1 
ATOM   4866  O  O     . SER A  1  648  ? 244.698 295.990 231.999 1.00 0.00 ? 648  SER A O     1 
ATOM   4867  C  CB    . SER A  1  648  ? 246.241 294.439 229.764 1.00 0.00 ? 648  SER A CB    1 
ATOM   4868  O  OG    . SER A  1  648  ? 246.500 293.348 228.890 1.00 0.00 ? 648  SER A OG    1 
ATOM   4869  N  N     . ALA A  1  649  ? 246.622 295.322 232.978 1.00 0.00 ? 649  ALA A N     1 
ATOM   4870  C  CA    . ALA A  1  649  ? 246.553 296.331 234.031 1.00 0.00 ? 649  ALA A CA    1 
ATOM   4871  C  C     . ALA A  1  649  ? 246.717 297.746 233.487 1.00 0.00 ? 649  ALA A C     1 
ATOM   4872  O  O     . ALA A  1  649  ? 247.811 298.303 233.536 1.00 0.00 ? 649  ALA A O     1 
ATOM   4873  C  CB    . ALA A  1  649  ? 247.605 296.060 235.075 1.00 0.00 ? 649  ALA A CB    1 
ATOM   4874  N  N     . GLY A  1  650  ? 245.632 298.312 232.959 1.00 0.00 ? 650  GLY A N     1 
ATOM   4875  C  CA    . GLY A  1  650  ? 245.646 299.639 232.344 1.00 0.00 ? 650  GLY A CA    1 
ATOM   4876  C  C     . GLY A  1  650  ? 244.516 299.758 231.334 1.00 0.00 ? 650  GLY A C     1 
ATOM   4877  O  O     . GLY A  1  650  ? 244.492 300.658 230.486 1.00 0.00 ? 650  GLY A O     1 
ATOM   4878  N  N     . SER A  1  651  ? 243.555 298.849 231.495 1.00 0.00 ? 651  SER A N     1 
ATOM   4879  C  CA    . SER A  1  651  ? 242.447 298.598 230.574 1.00 0.00 ? 651  SER A CA    1 
ATOM   4880  C  C     . SER A  1  651  ? 241.264 299.580 230.719 1.00 0.00 ? 651  SER A C     1 
ATOM   4881  O  O     . SER A  1  651  ? 241.312 300.465 231.563 1.00 0.00 ? 651  SER A O     1 
ATOM   4882  C  CB    . SER A  1  651  ? 241.976 297.162 230.804 1.00 0.00 ? 651  SER A CB    1 
ATOM   4883  O  OG    . SER A  1  651  ? 243.088 296.287 230.820 1.00 0.00 ? 651  SER A OG    1 
ATOM   4884  N  N     . LEU A  1  652  ? 240.232 299.456 229.875 1.00 0.00 ? 652  LEU A N     1 
ATOM   4885  C  CA    . LEU A  1  652  ? 238.927 300.075 230.177 1.00 0.00 ? 652  LEU A CA    1 
ATOM   4886  C  C     . LEU A  1  652  ? 238.320 299.553 231.472 1.00 0.00 ? 652  LEU A C     1 
ATOM   4887  O  O     . LEU A  1  652  ? 237.798 300.334 232.274 1.00 0.00 ? 652  LEU A O     1 
ATOM   4888  C  CB    . LEU A  1  652  ? 237.897 299.878 229.065 1.00 0.00 ? 652  LEU A CB    1 
ATOM   4889  C  CG    . LEU A  1  652  ? 238.267 300.406 227.693 1.00 0.00 ? 652  LEU A CG    1 
ATOM   4890  C  CD1   . LEU A  1  652  ? 237.136 300.122 226.701 1.00 0.00 ? 652  LEU A CD1   1 
ATOM   4891  C  CD2   . LEU A  1  652  ? 238.570 301.897 227.804 1.00 0.00 ? 652  LEU A CD2   1 
ATOM   4892  N  N     . VAL A  1  653  ? 238.325 298.232 231.653 1.00 0.00 ? 653  VAL A N     1 
ATOM   4893  C  CA    . VAL A  1  653  ? 237.806 297.646 232.887 1.00 0.00 ? 653  VAL A CA    1 
ATOM   4894  C  C     . VAL A  1  653  ? 238.575 298.066 234.150 1.00 0.00 ? 653  VAL A C     1 
ATOM   4895  O  O     . VAL A  1  653  ? 237.951 298.434 235.151 1.00 0.00 ? 653  VAL A O     1 
ATOM   4896  C  CB    . VAL A  1  653  ? 237.780 296.113 232.796 1.00 0.00 ? 653  VAL A CB    1 
ATOM   4897  C  CG1   . VAL A  1  653  ? 236.628 295.680 231.932 1.00 0.00 ? 653  VAL A CG1   1 
ATOM   4898  C  CG2   . VAL A  1  653  ? 239.073 295.601 232.230 1.00 0.00 ? 653  VAL A CG2   1 
ATOM   4899  N  N     . HIS A  1  654  ? 239.906 298.102 234.090 1.00 0.00 ? 654  HIS A N     1 
ATOM   4900  C  CA    . HIS A  1  654  ? 240.674 298.504 235.268 1.00 0.00 ? 654  HIS A CA    1 
ATOM   4901  C  C     . HIS A  1  654  ? 240.497 299.983 235.593 1.00 0.00 ? 654  HIS A C     1 
ATOM   4902  O  O     . HIS A  1  654  ? 240.221 300.333 236.740 1.00 0.00 ? 654  HIS A O     1 
ATOM   4903  C  CB    . HIS A  1  654  ? 242.167 298.217 235.075 1.00 0.00 ? 654  HIS A CB    1 
ATOM   4904  C  CG    . HIS A  1  654  ? 242.981 298.324 236.333 1.00 0.00 ? 654  HIS A CG    1 
ATOM   4905  N  ND1   . HIS A  1  654  ? 244.345 298.126 236.353 1.00 0.00 ? 654  HIS A ND1   1 
ATOM   4906  C  CD2   . HIS A  1  654  ? 242.627 298.622 237.607 1.00 0.00 ? 654  HIS A CD2   1 
ATOM   4907  C  CE1   . HIS A  1  654  ? 244.795 298.292 237.584 1.00 0.00 ? 654  HIS A CE1   1 
ATOM   4908  N  NE2   . HIS A  1  654  ? 243.774 298.597 238.364 1.00 0.00 ? 654  HIS A NE2   1 
ATOM   4909  N  N     . ILE A  1  655  ? 240.640 300.848 234.596 1.00 0.00 ? 655  ILE A N     1 
ATOM   4910  C  CA    . ILE A  1  655  ? 240.497 302.272 234.837 1.00 0.00 ? 655  ILE A CA    1 
ATOM   4911  C  C     . ILE A  1  655  ? 239.100 302.600 235.339 1.00 0.00 ? 655  ILE A C     1 
ATOM   4912  O  O     . ILE A  1  655  ? 238.933 303.479 236.192 1.00 0.00 ? 655  ILE A O     1 
ATOM   4913  C  CB    . ILE A  1  655  ? 240.821 303.103 233.603 1.00 0.00 ? 655  ILE A CB    1 
ATOM   4914  C  CG1   . ILE A  1  655  ? 242.277 302.867 233.210 1.00 0.00 ? 655  ILE A CG1   1 
ATOM   4915  C  CG2   . ILE A  1  655  ? 240.608 304.595 233.895 1.00 0.00 ? 655  ILE A CG2   1 
ATOM   4916  C  CD1   . ILE A  1  655  ? 242.654 303.414 231.863 1.00 0.00 ? 655  ILE A CD1   1 
ATOM   4917  N  N     . SER A  1  656  ? 238.101 301.878 234.832 1.00 0.00 ? 656  SER A N     1 
ATOM   4918  C  CA    . SER A  1  656  ? 236.718 302.084 235.261 1.00 0.00 ? 656  SER A CA    1 
ATOM   4919  C  C     . SER A  1  656  ? 236.474 301.687 236.694 1.00 0.00 ? 656  SER A C     1 
ATOM   4920  O  O     . SER A  1  656  ? 235.791 302.400 237.443 1.00 0.00 ? 656  SER A O     1 
ATOM   4921  C  CB    . SER A  1  656  ? 235.762 301.295 234.388 1.00 0.00 ? 656  SER A CB    1 
ATOM   4922  O  OG    . SER A  1  656  ? 234.442 301.737 234.610 1.00 0.00 ? 656  SER A OG    1 
ATOM   4923  N  N     . TYR A  1  657  ? 237.037 300.536 237.053 1.00 0.00 ? 657  TYR A N     1 
ATOM   4924  C  CA    . TYR A  1  657  ? 237.040 300.046 238.428 1.00 0.00 ? 657  TYR A CA    1 
ATOM   4925  C  C     . TYR A  1  657  ? 237.661 301.040 239.417 1.00 0.00 ? 657  TYR A C     1 
ATOM   4926  O  O     . TYR A  1  657  ? 237.107 301.260 240.498 1.00 0.00 ? 657  TYR A O     1 
ATOM   4927  C  CB    . TYR A  1  657  ? 237.761 298.713 238.505 1.00 0.00 ? 657  TYR A CB    1 
ATOM   4928  C  CG    . TYR A  1  657  ? 237.630 298.057 239.844 1.00 0.00 ? 657  TYR A CG    1 
ATOM   4929  C  CD1   . TYR A  1  657  ? 236.492 297.328 240.171 1.00 0.00 ? 657  TYR A CD1   1 
ATOM   4930  C  CD2   . TYR A  1  657  ? 238.644 298.164 240.784 1.00 0.00 ? 657  TYR A CD2   1 
ATOM   4931  C  CE1   . TYR A  1  657  ? 236.364 296.726 241.403 1.00 0.00 ? 657  TYR A CE1   1 
ATOM   4932  C  CE2   . TYR A  1  657  ? 238.535 297.556 242.014 1.00 0.00 ? 657  TYR A CE2   1 
ATOM   4933  C  CZ    . TYR A  1  657  ? 237.392 296.837 242.322 1.00 0.00 ? 657  TYR A CZ    1 
ATOM   4934  O  OH    . TYR A  1  657  ? 237.293 296.222 243.552 1.00 0.00 ? 657  TYR A OH    1 
ATOM   4935  N  N     . LEU A  1  658  ? 238.819 301.608 239.094 1.00 0.00 ? 658  LEU A N     1 
ATOM   4936  C  CA    . LEU A  1  658  ? 239.404 302.569 240.013 1.00 0.00 ? 658  LEU A CA    1 
ATOM   4937  C  C     . LEU A  1  658  ? 238.562 303.822 240.031 1.00 0.00 ? 658  LEU A C     1 
ATOM   4938  O  O     . LEU A  1  658  ? 238.381 304.436 241.088 1.00 0.00 ? 658  LEU A O     1 
ATOM   4939  C  CB    . LEU A  1  658  ? 240.830 302.915 239.632 1.00 0.00 ? 658  LEU A CB    1 
ATOM   4940  C  CG    . LEU A  1  658  ? 241.745 301.717 239.802 1.00 0.00 ? 658  LEU A CG    1 
ATOM   4941  C  CD1   . LEU A  1  658  ? 243.159 302.044 239.347 1.00 0.00 ? 658  LEU A CD1   1 
ATOM   4942  C  CD2   . LEU A  1  658  ? 241.725 301.308 241.264 1.00 0.00 ? 658  LEU A CD2   1 
ATOM   4943  N  N     . GLU A  1  659  ? 238.074 304.216 238.855 1.00 0.00 ? 659  GLU A N     1 
ATOM   4944  C  CA    . GLU A  1  659  ? 237.335 305.465 238.745 1.00 0.00 ? 659  GLU A CA    1 
ATOM   4945  C  C     . GLU A  1  659  ? 235.860 305.384 239.158 1.00 0.00 ? 659  GLU A C     1 
ATOM   4946  O  O     . GLU A  1  659  ? 235.419 306.147 240.015 1.00 0.00 ? 659  GLU A O     1 
ATOM   4947  C  CB    . GLU A  1  659  ? 237.450 306.024 237.337 1.00 0.00 ? 659  GLU A CB    1 
ATOM   4948  C  CG    . GLU A  1  659  ? 237.302 307.521 237.365 1.00 0.00 ? 659  GLU A CG    1 
ATOM   4949  C  CD    . GLU A  1  659  ? 238.595 308.180 237.840 1.00 0.00 ? 659  GLU A CD    1 
ATOM   4950  O  OE1   . GLU A  1  659  ? 238.765 308.337 239.078 1.00 0.00 ? 659  GLU A OE1   1 
ATOM   4951  O  OE2   . GLU A  1  659  ? 239.438 308.537 236.982 1.00 0.00 ? 659  GLU A OE2   1 
ATOM   4952  N  N     . MET A  1  660  ? 235.094 304.475 238.563 1.00 0.00 ? 660  MET A N     1 
ATOM   4953  C  CA    . MET A  1  660  ? 233.648 304.453 238.828 1.00 0.00 ? 660  MET A CA    1 
ATOM   4954  C  C     . MET A  1  660  ? 233.266 303.653 240.062 1.00 0.00 ? 660  MET A C     1 
ATOM   4955  O  O     . MET A  1  660  ? 232.247 303.928 240.694 1.00 0.00 ? 660  MET A O     1 
ATOM   4956  C  CB    . MET A  1  660  ? 232.864 303.932 237.619 1.00 0.00 ? 660  MET A CB    1 
ATOM   4957  C  CG    . MET A  1  660  ? 233.121 304.689 236.328 1.00 0.00 ? 660  MET A CG    1 
ATOM   4958  S  SD    . MET A  1  660  ? 232.925 306.496 236.506 1.00 0.00 ? 660  MET A SD    1 
ATOM   4959  C  CE    . MET A  1  660  ? 231.227 306.652 237.064 1.00 0.00 ? 660  MET A CE    1 
ATOM   4960  N  N     . GLY A  1  661  ? 234.053 302.642 240.390 1.00 0.00 ? 661  GLY A N     1 
ATOM   4961  C  CA    . GLY A  1  661  ? 233.746 301.830 241.544 1.00 0.00 ? 661  GLY A CA    1 
ATOM   4962  C  C     . GLY A  1  661  ? 233.032 300.568 241.120 1.00 0.00 ? 661  GLY A C     1 
ATOM   4963  O  O     . GLY A  1  661  ? 232.274 300.559 240.143 1.00 0.00 ? 661  GLY A O     1 
ATOM   4964  N  N     . HIS A  1  662  ? 233.225 299.523 241.914 1.00 0.00 ? 662  HIS A N     1 
ATOM   4965  C  CA    . HIS A  1  662  ? 232.852 298.170 241.533 1.00 0.00 ? 662  HIS A CA    1 
ATOM   4966  C  C     . HIS A  1  662  ? 231.402 297.990 241.080 1.00 0.00 ? 662  HIS A C     1 
ATOM   4967  O  O     . HIS A  1  662  ? 231.164 297.231 240.149 1.00 0.00 ? 662  HIS A O     1 
ATOM   4968  C  CB    . HIS A  1  662  ? 233.161 297.188 242.675 1.00 0.00 ? 662  HIS A CB    1 
ATOM   4969  C  CG    . HIS A  1  662  ? 232.289 297.355 243.879 1.00 0.00 ? 662  HIS A CG    1 
ATOM   4970  N  ND1   . HIS A  1  662  ? 231.090 296.690 244.028 1.00 0.00 ? 662  HIS A ND1   1 
ATOM   4971  C  CD2   . HIS A  1  662  ? 232.475 298.055 245.024 1.00 0.00 ? 662  HIS A CD2   1 
ATOM   4972  C  CE1   . HIS A  1  662  ? 230.554 297.006 245.194 1.00 0.00 ? 662  HIS A CE1   1 
ATOM   4973  N  NE2   . HIS A  1  662  ? 231.376 297.832 245.819 1.00 0.00 ? 662  HIS A NE2   1 
ATOM   4974  N  N     . ASP A  1  663  ? 230.435 298.640 241.719 1.00 0.00 ? 663  ASP A N     1 
ATOM   4975  C  CA    . ASP A  1  663  ? 229.050 298.435 241.309 1.00 0.00 ? 663  ASP A CA    1 
ATOM   4976  C  C     . ASP A  1  663  ? 228.834 298.960 239.847 1.00 0.00 ? 663  ASP A C     1 
ATOM   4977  O  O     . ASP A  1  663  ? 228.120 298.330 239.050 1.00 0.00 ? 663  ASP A O     1 
ATOM   4978  C  CB    . ASP A  1  663  ? 228.059 299.043 242.288 1.00 0.00 ? 663  ASP A CB    1 
ATOM   4979  C  CG    . ASP A  1  663  ? 226.609 298.730 241.900 1.00 0.00 ? 663  ASP A CG    1 
ATOM   4980  O  OD1   . ASP A  1  663  ? 226.354 297.634 241.321 1.00 0.00 ? 663  ASP A OD1   1 
ATOM   4981  O  OD2   . ASP A  1  663  ? 225.722 299.565 242.185 1.00 0.00 ? 663  ASP A OD2   1 
ATOM   4982  N  N     . ILE A  1  664  ? 229.346 300.143 239.514 1.00 0.00 ? 664  ILE A N     1 
ATOM   4983  C  CA    . ILE A  1  664  ? 229.256 300.615 238.121 1.00 0.00 ? 664  ILE A CA    1 
ATOM   4984  C  C     . ILE A  1  664  ? 230.058 299.733 237.135 1.00 0.00 ? 664  ILE A C     1 
ATOM   4985  O  O     . ILE A  1  664  ? 229.584 299.450 236.036 1.00 0.00 ? 664  ILE A O     1 
ATOM   4986  C  CB    . ILE A  1  664  ? 229.732 302.083 237.984 1.00 0.00 ? 664  ILE A CB    1 
ATOM   4987  C  CG1   . ILE A  1  664  ? 228.812 303.006 238.773 1.00 0.00 ? 664  ILE A CG1   1 
ATOM   4988  C  CG2   . ILE A  1  664  ? 229.745 302.523 236.529 1.00 0.00 ? 664  ILE A CG2   1 
ATOM   4989  C  CD1   . ILE A  1  664  ? 229.280 304.430 238.801 1.00 0.00 ? 664  ILE A CD1   1 
ATOM   4990  N  N     . THR A  1  665  ? 231.230 299.246 237.545 1.00 0.00 ? 665  THR A N     1 
ATOM   4991  C  CA    . THR A  1  665  ? 231.979 298.295 236.716 1.00 0.00 ? 665  THR A CA    1 
ATOM   4992  C  C     . THR A  1  665  ? 231.186 297.018 236.521 1.00 0.00 ? 665  THR A C     1 
ATOM   4993  O  O     . THR A  1  665  ? 231.267 296.378 235.485 1.00 0.00 ? 665  THR A O     1 
ATOM   4994  C  CB    . THR A  1  665  ? 233.355 297.954 237.310 1.00 0.00 ? 665  THR A CB    1 
ATOM   4995  O  OG1   . THR A  1  665  ? 234.097 299.162 237.497 1.00 0.00 ? 665  THR A OG1   1 
ATOM   4996  C  CG2   . THR A  1  665  ? 234.152 297.060 236.359 1.00 0.00 ? 665  THR A CG2   1 
ATOM   4997  N  N     . ARG A  1  666  ? 230.386 296.692 237.532 1.00 0.00 ? 666  ARG A N     1 
ATOM   4998  C  CA    . ARG A  1  666  ? 229.536 295.513 237.506 1.00 0.00 ? 666  ARG A CA    1 
ATOM   4999  C  C     . ARG A  1  666  ? 228.515 295.636 236.382 1.00 0.00 ? 666  ARG A C     1 
ATOM   5000  O  O     . ARG A  1  666  ? 228.393 294.737 235.551 1.00 0.00 ? 666  ARG A O     1 
ATOM   5001  C  CB    . ARG A  1  666  ? 228.825 295.332 238.848 1.00 0.00 ? 666  ARG A CB    1 
ATOM   5002  C  CG    . ARG A  1  666  ? 228.900 293.920 239.405 1.00 0.00 ? 666  ARG A CG    1 
ATOM   5003  C  CD    . ARG A  1  666  ? 229.877 293.065 238.614 1.00 0.00 ? 666  ARG A CD    1 
ATOM   5004  N  NE    . ARG A  1  666  ? 230.956 292.550 239.452 1.00 0.00 ? 666  ARG A NE    1 
ATOM   5005  C  CZ    . ARG A  1  666  ? 231.960 291.805 239.002 1.00 0.00 ? 666  ARG A CZ    1 
ATOM   5006  N  NH1   . ARG A  1  666  ? 232.028 291.486 237.717 1.00 0.00 ? 666  ARG A NH1   1 
ATOM   5007  N  NH2   . ARG A  1  666  ? 232.899 291.380 239.836 1.00 0.00 ? 666  ARG A NH2   1 
ATOM   5008  N  N     . LEU A  1  667  ? 227.779 296.746 236.352 1.00 0.00 ? 667  LEU A N     1 
ATOM   5009  C  CA    . LEU A  1  667  ? 226.790 296.931 235.292 1.00 0.00 ? 667  LEU A CA    1 
ATOM   5010  C  C     . LEU A  1  667  ? 227.461 297.083 233.914 1.00 0.00 ? 667  LEU A C     1 
ATOM   5011  O  O     . LEU A  1  667  ? 226.924 296.621 232.895 1.00 0.00 ? 667  LEU A O     1 
ATOM   5012  C  CB    . LEU A  1  667  ? 225.870 298.128 235.572 1.00 0.00 ? 667  LEU A CB    1 
ATOM   5013  C  CG    . LEU A  1  667  ? 224.874 297.868 236.708 1.00 0.00 ? 667  LEU A CG    1 
ATOM   5014  C  CD1   . LEU A  1  667  ? 224.159 299.150 237.163 1.00 0.00 ? 667  LEU A CD1   1 
ATOM   5015  C  CD2   . LEU A  1  667  ? 223.891 296.770 236.314 1.00 0.00 ? 667  LEU A CD2   1 
ATOM   5016  N  N     . PHE A  1  668  ? 228.651 297.685 233.894 1.00 0.00 ? 668  PHE A N     1 
ATOM   5017  C  CA    . PHE A  1  668  ? 229.420 297.786 232.662 1.00 0.00 ? 668  PHE A CA    1 
ATOM   5018  C  C     . PHE A  1  668  ? 229.798 296.374 232.119 1.00 0.00 ? 668  PHE A C     1 
ATOM   5019  O  O     . PHE A  1  668  ? 229.572 296.119 230.935 1.00 0.00 ? 668  PHE A O     1 
ATOM   5020  C  CB    . PHE A  1  668  ? 230.616 298.753 232.873 1.00 0.00 ? 668  PHE A CB    1 
ATOM   5021  C  CG    . PHE A  1  668  ? 231.728 298.624 231.864 1.00 0.00 ? 668  PHE A CG    1 
ATOM   5022  C  CD1   . PHE A  1  668  ? 231.464 298.423 230.524 1.00 0.00 ? 668  PHE A CD1   1 
ATOM   5023  C  CD2   . PHE A  1  668  ? 233.037 298.829 232.243 1.00 0.00 ? 668  PHE A CD2   1 
ATOM   5024  C  CE1   . PHE A  1  668  ? 232.492 298.317 229.600 1.00 0.00 ? 668  PHE A CE1   1 
ATOM   5025  C  CE2   . PHE A  1  668  ? 234.075 298.747 231.320 1.00 0.00 ? 668  PHE A CE2   1 
ATOM   5026  C  CZ    . PHE A  1  668  ? 233.800 298.494 229.997 1.00 0.00 ? 668  PHE A CZ    1 
ATOM   5027  N  N     . TYR A  1  669  ? 230.280 295.436 232.938 1.00 0.00 ? 669  TYR A N     1 
ATOM   5028  C  CA    . TYR A  1  669  ? 230.542 294.087 232.401 1.00 0.00 ? 669  TYR A CA    1 
ATOM   5029  C  C     . TYR A  1  669  ? 229.368 293.367 231.797 1.00 0.00 ? 669  TYR A C     1 
ATOM   5030  O  O     . TYR A  1  669  ? 229.510 292.711 230.797 1.00 0.00 ? 669  TYR A O     1 
ATOM   5031  C  CB    . TYR A  1  669  ? 231.068 293.155 233.453 1.00 0.00 ? 669  TYR A CB    1 
ATOM   5032  C  CG    . TYR A  1  669  ? 232.541 293.110 233.603 1.00 0.00 ? 669  TYR A CG    1 
ATOM   5033  C  CD1   . TYR A  1  669  ? 233.256 294.210 234.041 1.00 0.00 ? 669  TYR A CD1   1 
ATOM   5034  C  CD2   . TYR A  1  669  ? 233.215 291.923 233.375 1.00 0.00 ? 669  TYR A CD2   1 
ATOM   5035  C  CE1   . TYR A  1  669  ? 234.612 294.133 234.210 1.00 0.00 ? 669  TYR A CE1   1 
ATOM   5036  C  CE2   . TYR A  1  669  ? 234.560 291.836 233.512 1.00 0.00 ? 669  TYR A CE2   1 
ATOM   5037  C  CZ    . TYR A  1  669  ? 235.259 292.933 233.939 1.00 0.00 ? 669  TYR A CZ    1 
ATOM   5038  O  OH    . TYR A  1  669  ? 236.611 292.807 234.100 1.00 0.00 ? 669  TYR A OH    1 
ATOM   5039  N  N     . SER A  1  670  ? 228.243 293.370 232.476 1.00 0.00 ? 670  SER A N     1 
ATOM   5040  C  CA    . SER A  1  670  ? 227.062 292.716 231.942 1.00 0.00 ? 670  SER A CA    1 
ATOM   5041  C  C     . SER A  1  670  ? 226.624 293.410 230.662 1.00 0.00 ? 670  SER A C     1 
ATOM   5042  O  O     . SER A  1  670  ? 226.373 292.738 229.671 1.00 0.00 ? 670  SER A O     1 
ATOM   5043  C  CB    . SER A  1  670  ? 225.941 292.617 232.966 1.00 0.00 ? 670  SER A CB    1 
ATOM   5044  O  OG    . SER A  1  670  ? 226.358 291.770 234.020 1.00 0.00 ? 670  SER A OG    1 
ATOM   5045  N  N     . ASN A  1  671  ? 226.572 294.740 230.665 1.00 0.00 ? 671  ASN A N     1 
ATOM   5046  C  CA    . ASN A  1  671  ? 226.130 295.484 229.489 1.00 0.00 ? 671  ASN A CA    1 
ATOM   5047  C  C     . ASN A  1  671  ? 227.007 295.292 228.279 1.00 0.00 ? 671  ASN A C     1 
ATOM   5048  O  O     . ASN A  1  671  ? 226.489 295.135 227.178 1.00 0.00 ? 671  ASN A O     1 
ATOM   5049  C  CB    . ASN A  1  671  ? 226.035 296.968 229.786 1.00 0.00 ? 671  ASN A CB    1 
ATOM   5050  C  CG    . ASN A  1  671  ? 224.761 297.331 230.504 1.00 0.00 ? 671  ASN A CG    1 
ATOM   5051  O  OD1   . ASN A  1  671  ? 223.669 297.273 229.916 1.00 0.00 ? 671  ASN A OD1   1 
ATOM   5052  N  ND2   . ASN A  1  671  ? 224.878 297.697 231.782 1.00 0.00 ? 671  ASN A ND2   1 
ATOM   5053  N  N     . ILE A  1  672  ? 228.318 295.330 228.451 1.00 0.00 ? 672  ILE A N     1 
ATOM   5054  C  CA    . ILE A  1  672  ? 229.209 295.158 227.313 1.00 0.00 ? 672  ILE A CA    1 
ATOM   5055  C  C     . ILE A  1  672  ? 228.937 293.808 226.640 1.00 0.00 ? 672  ILE A C     1 
ATOM   5056  O  O     . ILE A  1  672  ? 228.806 293.776 225.439 1.00 0.00 ? 672  ILE A O     1 
ATOM   5057  C  CB    . ILE A  1  672  ? 230.719 295.300 227.701 1.00 0.00 ? 672  ILE A CB    1 
ATOM   5058  C  CG1   . ILE A  1  672  ? 231.582 295.360 226.452 1.00 0.00 ? 672  ILE A CG1   1 
ATOM   5059  C  CG2   . ILE A  1  672  ? 231.234 294.164 228.563 1.00 0.00 ? 672  ILE A CG2   1 
ATOM   5060  C  CD1   . ILE A  1  672  ? 233.001 295.649 226.767 1.00 0.00 ? 672  ILE A CD1   1 
ATOM   5061  N  N     . GLN A  1  673  ? 228.788 292.719 227.381 1.00 0.00 ? 673  GLN A N     1 
ATOM   5062  C  CA    . GLN A  1  673  ? 228.515 291.448 226.749 1.00 0.00 ? 673  GLN A CA    1 
ATOM   5063  C  C     . GLN A  1  673  ? 227.186 291.429 226.043 1.00 0.00 ? 673  GLN A C     1 
ATOM   5064  O  O     . GLN A  1  673  ? 227.129 291.028 224.894 1.00 0.00 ? 673  GLN A O     1 
ATOM   5065  C  CB    . GLN A  1  673  ? 228.489 290.360 227.780 1.00 0.00 ? 673  GLN A CB    1 
ATOM   5066  C  CG    . GLN A  1  673  ? 229.786 290.048 228.383 1.00 0.00 ? 673  GLN A CG    1 
ATOM   5067  C  CD    . GLN A  1  673  ? 229.611 288.985 229.439 1.00 0.00 ? 673  GLN A CD    1 
ATOM   5068  O  OE1   . GLN A  1  673  ? 228.773 288.087 229.283 1.00 0.00 ? 673  GLN A OE1   1 
ATOM   5069  N  NE2   . GLN A  1  673  ? 230.363 289.099 230.549 1.00 0.00 ? 673  GLN A NE2   1 
ATOM   5070  N  N     . THR A  1  674  ? 226.130 291.912 226.684 1.00 0.00 ? 674  THR A N     1 
ATOM   5071  C  CA    . THR A  1  674  ? 224.768 291.892 226.090 1.00 0.00 ? 674  THR A CA    1 
ATOM   5072  C  C     . THR A  1  674  ? 224.644 292.700 224.771 1.00 0.00 ? 674  THR A C     1 
ATOM   5073  O  O     . THR A  1  674  ? 224.069 292.210 223.785 1.00 0.00 ? 674  THR A O     1 
ATOM   5074  C  CB    . THR A  1  674  ? 223.674 292.356 227.110 1.00 0.00 ? 674  THR A CB    1 
ATOM   5075  O  OG1   . THR A  1  674  ? 223.840 291.641 228.346 1.00 0.00 ? 674  THR A OG1   1 
ATOM   5076  C  CG2   . THR A  1  674  ? 222.304 291.979 226.601 1.00 0.00 ? 674  THR A CG2   1 
ATOM   5077  N  N     . VAL A  1  675  ? 225.123 293.939 224.751 1.00 0.00 ? 675  VAL A N     1 
ATOM   5078  C  CA    . VAL A  1  675  ? 225.059 294.696 223.516 1.00 0.00 ? 675  VAL A CA    1 
ATOM   5079  C  C     . VAL A  1  675  ? 225.937 293.989 222.471 1.00 0.00 ? 675  VAL A C     1 
ATOM   5080  O  O     . VAL A  1  675  ? 225.507 293.823 221.343 1.00 0.00 ? 675  VAL A O     1 
ATOM   5081  C  CB    . VAL A  1  675  ? 225.488 296.145 223.757 1.00 0.00 ? 675  VAL A CB    1 
ATOM   5082  C  CG1   . VAL A  1  675  ? 224.729 296.682 224.947 1.00 0.00 ? 675  VAL A CG1   1 
ATOM   5083  C  CG2   . VAL A  1  675  ? 226.978 296.254 224.026 1.00 0.00 ? 675  VAL A CG2   1 
ATOM   5084  N  N     . ILE A  1  676  ? 227.162 293.595 222.838 1.00 0.00 ? 676  ILE A N     1 
ATOM   5085  C  CA    . ILE A  1  676  ? 228.093 292.927 221.918 1.00 0.00 ? 676  ILE A CA    1 
ATOM   5086  C  C     . ILE A  1  676  ? 227.662 291.500 221.522 1.00 0.00 ? 676  ILE A C     1 
ATOM   5087  O  O     . ILE A  1  676  ? 227.913 291.123 220.401 1.00 0.00 ? 676  ILE A O     1 
ATOM   5088  C  CB    . ILE A  1  676  ? 229.521 292.934 222.444 1.00 0.00 ? 676  ILE A CB    1 
ATOM   5089  C  CG1   . ILE A  1  676  ? 230.033 294.400 222.570 1.00 0.00 ? 676  ILE A CG1   1 
ATOM   5090  C  CG2   . ILE A  1  676  ? 230.415 292.063 221.553 1.00 0.00 ? 676  ILE A CG2   1 
ATOM   5091  C  CD1   . ILE A  1  676  ? 230.052 295.202 221.311 1.00 0.00 ? 676  ILE A CD1   1 
ATOM   5092  N  N     . ASN A  1  677  ? 227.100 290.676 222.412 1.00 0.00 ? 677  ASN A N     1 
ATOM   5093  C  CA    . ASN A  1  677  ? 226.543 289.388 221.920 1.00 0.00 ? 677  ASN A CA    1 
ATOM   5094  C  C     . ASN A  1  677  ? 225.409 289.526 220.928 1.00 0.00 ? 677  ASN A C     1 
ATOM   5095  O  O     . ASN A  1  677  ? 225.342 288.752 219.975 1.00 0.00 ? 677  ASN A O     1 
ATOM   5096  C  CB    . ASN A  1  677  ? 226.031 288.403 222.988 1.00 0.00 ? 677  ASN A CB    1 
ATOM   5097  C  CG    . ASN A  1  677  ? 227.135 287.590 223.642 1.00 0.00 ? 677  ASN A CG    1 
ATOM   5098  O  OD1   . ASN A  1  677  ? 227.252 286.426 223.310 1.00 0.00 ? 677  ASN A OD1   1 
ATOM   5099  N  ND2   . ASN A  1  677  ? 227.853 288.129 224.626 1.00 0.00 ? 677  ASN A ND2   1 
ATOM   5100  N  N     . ASN A  1  678  ? 224.477 290.438 221.180 1.00 0.00 ? 678  ASN A N     1 
ATOM   5101  C  CA    . ASN A  1  678  ? 223.385 290.666 220.239 1.00 0.00 ? 678  ASN A CA    1 
ATOM   5102  C  C     . ASN A  1  678  ? 223.765 291.228 218.891 1.00 0.00 ? 678  ASN A C     1 
ATOM   5103  O  O     . ASN A  1  678  ? 223.224 290.818 217.867 1.00 0.00 ? 678  ASN A O     1 
ATOM   5104  C  CB    . ASN A  1  678  ? 222.346 291.569 220.854 1.00 0.00 ? 678  ASN A CB    1 
ATOM   5105  C  CG    . ASN A  1  678  ? 221.486 290.837 221.818 1.00 0.00 ? 678  ASN A CG    1 
ATOM   5106  O  OD1   . ASN A  1  678  ? 220.690 289.969 221.427 1.00 0.00 ? 678  ASN A OD1   1 
ATOM   5107  N  ND2   . ASN A  1  678  ? 221.622 291.170 223.095 1.00 0.00 ? 678  ASN A ND2   1 
ATOM   5108  N  N     . TRP A  1  679  ? 224.698 292.161 218.874 1.00 0.00 ? 679  TRP A N     1 
ATOM   5109  C  CA    . TRP A  1  679  ? 225.167 292.586 217.598 1.00 0.00 ? 679  TRP A CA    1 
ATOM   5110  C  C     . TRP A  1  679  ? 225.831 291.438 216.872 1.00 0.00 ? 679  TRP A C     1 
ATOM   5111  O  O     . TRP A  1  679  ? 225.553 291.226 215.707 1.00 0.00 ? 679  TRP A O     1 
ATOM   5112  C  CB    . TRP A  1  679  ? 226.136 293.737 217.711 1.00 0.00 ? 679  TRP A CB    1 
ATOM   5113  C  CG    . TRP A  1  679  ? 226.418 294.143 216.373 1.00 0.00 ? 679  TRP A CG    1 
ATOM   5114  C  CD1   . TRP A  1  679  ? 225.588 294.789 215.515 1.00 0.00 ? 679  TRP A CD1   1 
ATOM   5115  C  CD2   . TRP A  1  679  ? 227.576 293.773 215.620 1.00 0.00 ? 679  TRP A CD2   1 
ATOM   5116  N  NE1   . TRP A  1  679  ? 226.202 294.921 214.289 1.00 0.00 ? 679  TRP A NE1   1 
ATOM   5117  C  CE2   . TRP A  1  679  ? 227.419 294.291 214.334 1.00 0.00 ? 679  TRP A CE2   1 
ATOM   5118  C  CE3   . TRP A  1  679  ? 228.746 293.082 215.928 1.00 0.00 ? 679  TRP A CE3   1 
ATOM   5119  C  CZ2   . TRP A  1  679  ? 228.383 294.137 213.360 1.00 0.00 ? 679  TRP A CZ2   1 
ATOM   5120  C  CZ3   . TRP A  1  679  ? 229.695 292.929 214.959 1.00 0.00 ? 679  TRP A CZ3   1 
ATOM   5121  C  CH2   . TRP A  1  679  ? 229.520 293.459 213.700 1.00 0.00 ? 679  TRP A CH2   1 
ATOM   5122  N  N     . LEU A  1  680  ? 226.558 290.593 217.580 1.00 0.00 ? 680  LEU A N     1 
ATOM   5123  C  CA    . LEU A  1  680  ? 227.185 289.456 216.945 1.00 0.00 ? 680  LEU A CA    1 
ATOM   5124  C  C     . LEU A  1  680  ? 226.139 288.617 216.360 1.00 0.00 ? 680  LEU A C     1 
ATOM   5125  O  O     . LEU A  1  680  ? 226.310 288.170 215.263 1.00 0.00 ? 680  LEU A O     1 
ATOM   5126  C  CB    . LEU A  1  680  ? 227.977 288.631 217.937 1.00 0.00 ? 680  LEU A CB    1 
ATOM   5127  C  CG    . LEU A  1  680  ? 228.765 287.409 217.487 1.00 0.00 ? 680  LEU A CG    1 
ATOM   5128  C  CD1   . LEU A  1  680  ? 229.827 287.747 216.473 1.00 0.00 ? 680  LEU A CD1   1 
ATOM   5129  C  CD2   . LEU A  1  680  ? 229.408 286.799 218.695 1.00 0.00 ? 680  LEU A CD2   1 
ATOM   5130  N  N     . LEU A  1  681  ? 225.005 288.529 217.035 1.00 0.00 ? 681  LEU A N     1 
ATOM   5131  C  CA    . LEU A  1  681  ? 223.864 287.754 216.568 1.00 0.00 ? 681  LEU A CA    1 
ATOM   5132  C  C     . LEU A  1  681  ? 223.417 288.117 215.112 1.00 0.00 ? 681  LEU A C     1 
ATOM   5133  O  O     . LEU A  1  681  ? 223.043 287.218 214.342 1.00 0.00 ? 681  LEU A O     1 
ATOM   5134  C  CB    . LEU A  1  681  ? 222.714 287.910 217.553 1.00 0.00 ? 681  LEU A CB    1 
ATOM   5135  C  CG    . LEU A  1  681  ? 221.373 287.401 217.057 1.00 0.00 ? 681  LEU A CG    1 
ATOM   5136  C  CD1   . LEU A  1  681  ? 221.573 285.874 216.846 1.00 0.00 ? 681  LEU A CD1   1 
ATOM   5137  C  CD2   . LEU A  1  681  ? 220.157 287.756 217.952 1.00 0.00 ? 681  LEU A CD2   1 
ATOM   5138  N  N     . ILE A  1  682  ? 223.393 289.391 214.724 1.00 0.00 ? 682  ILE A N     1 
ATOM   5139  C  CA    . ILE A  1  682  ? 223.158 289.711 213.292 1.00 0.00 ? 682  ILE A CA    1 
ATOM   5140  C  C     . ILE A  1  682  ? 224.409 289.427 212.434 1.00 0.00 ? 682  ILE A C     1 
ATOM   5141  O  O     . ILE A  1  682  ? 224.285 288.994 211.297 1.00 0.00 ? 682  ILE A O     1 
ATOM   5142  C  CB    . ILE A  1  682  ? 222.649 291.165 213.017 1.00 0.00 ? 682  ILE A CB    1 
ATOM   5143  C  CG1   . ILE A  1  682  ? 223.665 292.246 213.394 1.00 0.00 ? 682  ILE A CG1   1 
ATOM   5144  C  CG2   . ILE A  1  682  ? 221.272 291.380 213.642 1.00 0.00 ? 682  ILE A CG2   1 
ATOM   5145  C  CD1   . ILE A  1  682  ? 223.272 293.624 212.901 1.00 0.00 ? 682  ILE A CD1   1 
ATOM   5146  N  N     . GLU A  1  683  ? 225.598 289.710 212.963 1.00 0.00 ? 683  GLU A N     1 
ATOM   5147  C  CA    . GLU A  1  683  ? 226.857 289.577 212.218 1.00 0.00 ? 683  GLU A CA    1 
ATOM   5148  C  C     . GLU A  1  683  ? 227.374 288.129 211.959 1.00 0.00 ? 683  GLU A C     1 
ATOM   5149  O  O     . GLU A  1  683  ? 227.707 287.763 210.818 1.00 0.00 ? 683  GLU A O     1 
ATOM   5150  C  CB    . GLU A  1  683  ? 227.943 290.356 212.991 1.00 0.00 ? 683  GLU A CB    1 
ATOM   5151  C  CG    . GLU A  1  683  ? 229.336 290.396 212.353 1.00 0.00 ? 683  GLU A CG    1 
ATOM   5152  C  CD    . GLU A  1  683  ? 229.384 291.225 211.062 1.00 0.00 ? 683  GLU A CD    1 
ATOM   5153  O  OE1   . GLU A  1  683  ? 228.664 292.260 210.972 1.00 0.00 ? 683  GLU A OE1   1 
ATOM   5154  O  OE2   . GLU A  1  683  ? 230.136 290.826 210.133 1.00 0.00 ? 683  GLU A OE2   1 
ATOM   5155  N  N     . GLY A  1  684  ? 227.435 287.323 213.014 1.00 0.00 ? 684  GLY A N     1 
ATOM   5156  C  CA    . GLY A  1  684  ? 227.995 285.977 212.972 1.00 0.00 ? 684  GLY A CA    1 
ATOM   5157  C  C     . GLY A  1  684  ? 229.518 285.869 213.029 1.00 0.00 ? 684  GLY A C     1 
ATOM   5158  O  O     . GLY A  1  684  ? 230.254 286.780 212.650 1.00 0.00 ? 684  GLY A O     1 
ATOM   5159  N  N     . HIS A  1  685  ? 230.007 284.727 213.479 1.00 0.00 ? 685  HIS A N     1 
ATOM   5160  C  CA    . HIS A  1  685  ? 231.431 284.458 213.398 1.00 0.00 ? 685  HIS A CA    1 
ATOM   5161  C  C     . HIS A  1  685  ? 231.658 282.951 213.208 1.00 0.00 ? 685  HIS A C     1 
ATOM   5162  O  O     . HIS A  1  685  ? 230.919 282.120 213.733 1.00 0.00 ? 685  HIS A O     1 
ATOM   5163  C  CB    . HIS A  1  685  ? 232.147 284.983 214.640 1.00 0.00 ? 685  HIS A CB    1 
ATOM   5164  C  CG    . HIS A  1  685  ? 233.591 284.591 214.709 1.00 0.00 ? 685  HIS A CG    1 
ATOM   5165  N  ND1   . HIS A  1  685  ? 234.471 284.802 213.668 1.00 0.00 ? 685  HIS A ND1   1 
ATOM   5166  C  CD2   . HIS A  1  685  ? 234.300 283.955 215.677 1.00 0.00 ? 685  HIS A CD2   1 
ATOM   5167  C  CE1   . HIS A  1  685  ? 235.665 284.345 214.005 1.00 0.00 ? 685  HIS A CE1   1 
ATOM   5168  N  NE2   . HIS A  1  685  ? 235.587 283.819 215.215 1.00 0.00 ? 685  HIS A NE2   1 
ATOM   5169  N  N     . THR A  1  686  ? 232.666 282.600 212.430 1.00 0.00 ? 686  THR A N     1 
ATOM   5170  C  CA    . THR A  1  686  ? 232.803 281.237 211.963 1.00 0.00 ? 686  THR A CA    1 
ATOM   5171  C  C     . THR A  1  686  ? 234.248 280.940 211.705 1.00 0.00 ? 686  THR A C     1 
ATOM   5172  O  O     . THR A  1  686  ? 235.068 281.831 211.781 1.00 0.00 ? 686  THR A O     1 
ATOM   5173  C  CB    . THR A  1  686  ? 232.027 281.016 210.686 1.00 0.00 ? 686  THR A CB    1 
ATOM   5174  O  OG1   . THR A  1  686  ? 232.437 279.786 210.073 1.00 0.00 ? 686  THR A OG1   1 
ATOM   5175  C  CG2   . THR A  1  686  ? 232.321 282.143 209.738 1.00 0.00 ? 686  THR A CG2   1 
ATOM   5176  N  N     . ILE A  1  687  ? 234.550 279.685 211.389 1.00 0.00 ? 687  ILE A N     1 
ATOM   5177  C  CA    . ILE A  1  687  ? 235.880 279.261 210.941 1.00 0.00 ? 687  ILE A CA    1 
ATOM   5178  C  C     . ILE A  1  687  ? 235.817 277.891 210.237 1.00 0.00 ? 687  ILE A C     1 
ATOM   5179  O  O     . ILE A  1  687  ? 235.575 276.843 210.846 1.00 0.00 ? 687  ILE A O     1 
ATOM   5180  C  CB    . ILE A  1  687  ? 236.878 279.214 212.096 1.00 0.00 ? 687  ILE A CB    1 
ATOM   5181  C  CG1   . ILE A  1  687  ? 238.124 278.470 211.667 1.00 0.00 ? 687  ILE A CG1   1 
ATOM   5182  C  CG2   . ILE A  1  687  ? 236.327 278.490 213.257 1.00 0.00 ? 687  ILE A CG2   1 
ATOM   5183  C  CD1   . ILE A  1  687  ? 239.205 278.523 212.709 1.00 0.00 ? 687  ILE A CD1   1 
ATOM   5184  N  N     . GLY A  1  688  ? 235.999 277.929 208.923 1.00 0.00 ? 688  GLY A N     1 
ATOM   5185  C  CA    . GLY A  1  688  ? 235.975 276.739 208.104 1.00 0.00 ? 688  GLY A CA    1 
ATOM   5186  C  C     . GLY A  1  688  ? 237.392 276.384 207.730 1.00 0.00 ? 688  GLY A C     1 
ATOM   5187  O  O     . GLY A  1  688  ? 238.337 276.914 208.306 1.00 0.00 ? 688  GLY A O     1 
ATOM   5188  N  N     . ILE A  1  689  ? 237.532 275.437 206.810 1.00 0.00 ? 689  ILE A N     1 
ATOM   5189  C  CA    . ILE A  1  689  ? 238.825 275.103 206.243 1.00 0.00 ? 689  ILE A CA    1 
ATOM   5190  C  C     . ILE A  1  689  ? 239.339 276.311 205.451 1.00 0.00 ? 689  ILE A C     1 
ATOM   5191  O  O     . ILE A  1  689  ? 240.553 276.539 205.407 1.00 0.00 ? 689  ILE A O     1 
ATOM   5192  C  CB    . ILE A  1  689  ? 238.812 273.841 205.348 1.00 0.00 ? 689  ILE A CB    1 
ATOM   5193  C  CG1   . ILE A  1  689  ? 238.073 274.118 204.043 1.00 0.00 ? 689  ILE A CG1   1 
ATOM   5194  C  CG2   . ILE A  1  689  ? 238.196 272.668 206.060 1.00 0.00 ? 689  ILE A CG2   1 
ATOM   5195  C  CD1   . ILE A  1  689  ? 238.541 273.230 202.899 1.00 0.00 ? 689  ILE A CD1   1 
ATOM   5196  N  N     . GLY A  1  690  ? 238.418 277.110 204.891 1.00 0.00 ? 690  GLY A N     1 
ATOM   5197  C  CA    . GLY A  1  690  ? 238.773 278.309 204.143 1.00 0.00 ? 690  GLY A CA    1 
ATOM   5198  C  C     . GLY A  1  690  ? 239.734 279.260 204.830 1.00 0.00 ? 690  GLY A C     1 
ATOM   5199  O  O     . GLY A  1  690  ? 240.628 279.831 204.202 1.00 0.00 ? 690  GLY A O     1 
ATOM   5200  N  N     . ASP A  1  691  ? 239.555 279.457 206.116 1.00 0.00 ? 691  ASP A N     1 
ATOM   5201  C  CA    . ASP A  1  691  ? 240.443 280.347 206.841 1.00 0.00 ? 691  ASP A CA    1 
ATOM   5202  C  C     . ASP A  1  691  ? 241.878 279.796 206.917 1.00 0.00 ? 691  ASP A C     1 
ATOM   5203  O  O     . ASP A  1  691  ? 242.824 280.573 207.010 1.00 0.00 ? 691  ASP A O     1 
ATOM   5204  C  CB    . ASP A  1  691  ? 239.919 280.618 208.260 1.00 0.00 ? 691  ASP A CB    1 
ATOM   5205  C  CG    . ASP A  1  691  ? 238.524 281.229 208.261 1.00 0.00 ? 691  ASP A CG    1 
ATOM   5206  O  OD1   . ASP A  1  691  ? 238.403 282.452 208.003 1.00 0.00 ? 691  ASP A OD1   1 
ATOM   5207  O  OD2   . ASP A  1  691  ? 237.556 280.500 208.571 1.00 0.00 ? 691  ASP A OD2   1 
ATOM   5208  N  N     . SER A  1  692  ? 242.031 278.468 206.843 1.00 0.00 ? 692  SER A N     1 
ATOM   5209  C  CA    . SER A  1  692  ? 243.357 277.814 206.748 1.00 0.00 ? 692  SER A CA    1 
ATOM   5210  C  C     . SER A  1  692  ? 244.086 277.578 205.406 1.00 0.00 ? 692  SER A C     1 
ATOM   5211  O  O     . SER A  1  692  ? 245.296 277.285 205.411 1.00 0.00 ? 692  SER A O     1 
ATOM   5212  C  CB    . SER A  1  692  ? 243.234 276.432 207.394 1.00 0.00 ? 692  SER A CB    1 
ATOM   5213  O  OG    . SER A  1  692  ? 242.136 275.723 206.846 1.00 0.00 ? 692  SER A OG    1 
ATOM   5214  N  N     . ILE A  1  693  ? 243.384 277.697 204.279 1.00 0.00 ? 693  ILE A N     1 
ATOM   5215  C  CA    . ILE A  1  693  ? 244.007 277.517 202.961 1.00 0.00 ? 693  ILE A CA    1 
ATOM   5216  C  C     . ILE A  1  693  ? 244.490 278.877 202.388 1.00 0.00 ? 693  ILE A C     1 
ATOM   5217  O  O     . ILE A  1  693  ? 243.888 279.926 202.646 1.00 0.00 ? 693  ILE A O     1 
ATOM   5218  C  CB    . ILE A  1  693  ? 243.022 276.802 201.983 1.00 0.00 ? 693  ILE A CB    1 
ATOM   5219  C  CG1   . ILE A  1  693  ? 243.770 276.181 200.820 1.00 0.00 ? 693  ILE A CG1   1 
ATOM   5220  C  CG2   . ILE A  1  693  ? 241.931 277.729 201.479 1.00 0.00 ? 693  ILE A CG2   1 
ATOM   5221  C  CD1   . ILE A  1  693  ? 242.873 275.402 199.927 1.00 0.00 ? 693  ILE A CD1   1 
ATOM   5222  N  N     . ALA A  1  694  ? 245.567 278.869 201.611 1.00 0.00 ? 694  ALA A N     1 
ATOM   5223  C  CA    . ALA A  1  694  ? 246.049 280.107 201.005 1.00 0.00 ? 694  ALA A CA    1 
ATOM   5224  C  C     . ALA A  1  694  ? 246.195 279.906 199.502 1.00 0.00 ? 694  ALA A C     1 
ATOM   5225  O  O     . ALA A  1  694  ? 245.591 278.991 198.941 1.00 0.00 ? 694  ALA A O     1 
ATOM   5226  C  CB    . ALA A  1  694  ? 247.361 280.544 201.631 1.00 0.00 ? 694  ALA A CB    1 
ATOM   5227  N  N     . ASP A  1  695  ? 246.994 280.743 198.844 1.00 0.00 ? 695  ASP A N     1 
ATOM   5228  C  CA    . ASP A  1  695  ? 247.081 280.693 197.382 1.00 0.00 ? 695  ASP A CA    1 
ATOM   5229  C  C     . ASP A  1  695  ? 248.284 279.900 196.862 1.00 0.00 ? 695  ASP A C     1 
ATOM   5230  O  O     . ASP A  1  695  ? 249.252 279.641 197.585 1.00 0.00 ? 695  ASP A O     1 
ATOM   5231  C  CB    . ASP A  1  695  ? 247.112 282.119 196.802 1.00 0.00 ? 695  ASP A CB    1 
ATOM   5232  C  CG    . ASP A  1  695  ? 248.299 282.934 197.302 1.00 0.00 ? 695  ASP A CG    1 
ATOM   5233  O  OD1   . ASP A  1  695  ? 248.393 283.131 198.535 1.00 0.00 ? 695  ASP A OD1   1 
ATOM   5234  O  OD2   . ASP A  1  695  ? 249.119 283.389 196.466 1.00 0.00 ? 695  ASP A OD2   1 
ATOM   5235  N  N     . SER A  1  696  ? 248.188 279.533 195.587 1.00 0.00 ? 696  SER A N     1 
ATOM   5236  C  CA    . SER A  1  696  ? 249.188 278.747 194.866 1.00 0.00 ? 696  SER A CA    1 
ATOM   5237  C  C     . SER A  1  696  ? 250.603 279.325 194.930 1.00 0.00 ? 696  SER A C     1 
ATOM   5238  O  O     . SER A  1  696  ? 251.581 278.597 195.147 1.00 0.00 ? 696  SER A O     1 
ATOM   5239  C  CB    . SER A  1  696  ? 248.764 278.594 193.401 1.00 0.00 ? 696  SER A CB    1 
ATOM   5240  O  OG    . SER A  1  696  ? 248.161 279.783 192.921 1.00 0.00 ? 696  SER A OG    1 
ATOM   5241  N  N     . LYS A  1  697  ? 250.695 280.638 194.753 1.00 0.00 ? 697  LYS A N     1 
ATOM   5242  C  CA    . LYS A  1  697  ? 251.965 281.349 194.825 1.00 0.00 ? 697  LYS A CA    1 
ATOM   5243  C  C     . LYS A  1  697  ? 252.626 281.254 196.199 1.00 0.00 ? 697  LYS A C     1 
ATOM   5244  O  O     . LYS A  1  697  ? 253.844 281.064 196.295 1.00 0.00 ? 697  LYS A O     1 
ATOM   5245  C  CB    . LYS A  1  697  ? 251.758 282.815 194.441 1.00 0.00 ? 697  LYS A CB    1 
ATOM   5246  C  CG    . LYS A  1  697  ? 253.049 283.546 194.126 1.00 0.00 ? 697  LYS A CG    1 
ATOM   5247  C  CD    . LYS A  1  697  ? 252.795 285.000 193.775 1.00 0.00 ? 697  LYS A CD    1 
ATOM   5248  C  CE    . LYS A  1  697  ? 254.098 285.729 193.486 1.00 0.00 ? 697  LYS A CE    1 
ATOM   5249  N  NZ    . LYS A  1  697  ? 253.882 287.187 193.289 1.00 0.00 ? 697  LYS A NZ    1 
ATOM   5250  N  N     . THR A  1  698  ? 251.830 281.388 197.253 1.00 0.00 ? 698  THR A N     1 
ATOM   5251  C  CA    . THR A  1  698  ? 252.327 281.181 198.609 1.00 0.00 ? 698  THR A CA    1 
ATOM   5252  C  C     . THR A  1  698  ? 252.939 279.788 198.818 1.00 0.00 ? 698  THR A C     1 
ATOM   5253  O  O     . THR A  1  698  ? 254.029 279.676 199.387 1.00 0.00 ? 698  THR A O     1 
ATOM   5254  C  CB    . THR A  1  698  ? 251.214 281.396 199.656 1.00 0.00 ? 698  THR A CB    1 
ATOM   5255  O  OG1   . THR A  1  698  ? 250.639 282.696 199.488 1.00 0.00 ? 698  THR A OG1   1 
ATOM   5256  C  CG2   . THR A  1  698  ? 251.776 281.281 201.066 1.00 0.00 ? 698  THR A CG2   1 
ATOM   5257  N  N     . TYR A  1  699  ? 252.269 278.736 198.351 1.00 0.00 ? 699  TYR A N     1 
ATOM   5258  C  CA    . TYR A  1  699  ? 252.827 277.383 198.477 1.00 0.00 ? 699  TYR A CA    1 
ATOM   5259  C  C     . TYR A  1  699  ? 254.117 277.156 197.712 1.00 0.00 ? 699  TYR A C     1 
ATOM   5260  O  O     . TYR A  1  699  ? 255.022 276.492 198.214 1.00 0.00 ? 699  TYR A O     1 
ATOM   5261  C  CB    . TYR A  1  699  ? 251.822 276.334 197.993 1.00 0.00 ? 699  TYR A CB    1 
ATOM   5262  C  CG    . TYR A  1  699  ? 250.518 276.334 198.731 1.00 0.00 ? 699  TYR A CG    1 
ATOM   5263  C  CD1   . TYR A  1  699  ? 250.479 276.139 200.104 1.00 0.00 ? 699  TYR A CD1   1 
ATOM   5264  C  CD2   . TYR A  1  699  ? 249.322 276.559 198.063 1.00 0.00 ? 699  TYR A CD2   1 
ATOM   5265  C  CE1   . TYR A  1  699  ? 249.284 276.112 200.784 1.00 0.00 ? 699  TYR A CE1   1 
ATOM   5266  C  CE2   . TYR A  1  699  ? 248.121 276.569 198.739 1.00 0.00 ? 699  TYR A CE2   1 
ATOM   5267  C  CZ    . TYR A  1  699  ? 248.105 276.338 200.100 1.00 0.00 ? 699  TYR A CZ    1 
ATOM   5268  O  OH    . TYR A  1  699  ? 246.910 276.377 200.784 1.00 0.00 ? 699  TYR A OH    1 
ATOM   5269  N  N     . GLN A  1  700  ? 254.212 277.716 196.513 1.00 0.00 ? 700  GLN A N     1 
ATOM   5270  C  CA    . GLN A  1  700  ? 255.445 277.623 195.742 1.00 0.00 ? 700  GLN A CA    1 
ATOM   5271  C  C     . GLN A  1  700  ? 256.592 278.358 196.426 1.00 0.00 ? 700  GLN A C     1 
ATOM   5272  O  O     . GLN A  1  700  ? 257.735 277.893 196.420 1.00 0.00 ? 700  GLN A O     1 
ATOM   5273  C  CB    . GLN A  1  700  ? 255.221 278.164 194.332 1.00 0.00 ? 700  GLN A CB    1 
ATOM   5274  C  CG    . GLN A  1  700  ? 254.355 277.252 193.482 1.00 0.00 ? 700  GLN A CG    1 
ATOM   5275  C  CD    . GLN A  1  700  ? 254.070 277.827 192.111 1.00 0.00 ? 700  GLN A CD    1 
ATOM   5276  O  OE1   . GLN A  1  700  ? 253.348 278.815 191.977 1.00 0.00 ? 700  GLN A OE1   1 
ATOM   5277  N  NE2   . GLN A  1  700  ? 254.636 277.205 191.080 1.00 0.00 ? 700  GLN A NE2   1 
ATOM   5278  N  N     . ASP A  1  701  ? 256.270 279.497 197.032 1.00 0.00 ? 701  ASP A N     1 
ATOM   5279  C  CA    . ASP A  1  701  ? 257.250 280.308 197.748 1.00 0.00 ? 701  ASP A CA    1 
ATOM   5280  C  C     . ASP A  1  701  ? 257.736 279.615 199.030 1.00 0.00 ? 701  ASP A C     1 
ATOM   5281  O  O     . ASP A  1  701  ? 258.938 279.581 199.310 1.00 0.00 ? 701  ASP A O     1 
ATOM   5282  C  CB    . ASP A  1  701  ? 256.659 281.690 198.060 1.00 0.00 ? 701  ASP A CB    1 
ATOM   5283  C  CG    . ASP A  1  701  ? 257.662 282.619 198.728 1.00 0.00 ? 701  ASP A CG    1 
ATOM   5284  O  OD1   . ASP A  1  701  ? 257.883 282.490 199.952 1.00 0.00 ? 701  ASP A OD1   1 
ATOM   5285  O  OD2   . ASP A  1  701  ? 258.220 283.491 198.026 1.00 0.00 ? 701  ASP A OD2   1 
ATOM   5286  N  N     . ILE A  1  702  ? 256.795 279.039 199.778 1.00 0.00 ? 702  ILE A N     1 
ATOM   5287  C  CA    . ILE A  1  702  ? 257.090 278.273 200.991 1.00 0.00 ? 702  ILE A CA    1 
ATOM   5288  C  C     . ILE A  1  702  ? 257.915 277.027 200.686 1.00 0.00 ? 702  ILE A C     1 
ATOM   5289  O  O     . ILE A  1  702  ? 258.933 276.770 201.338 1.00 0.00 ? 702  ILE A O     1 
ATOM   5290  C  CB    . ILE A  1  702  ? 255.813 277.867 201.730 1.00 0.00 ? 702  ILE A CB    1 
ATOM   5291  C  CG1   . ILE A  1  702  ? 255.223 279.081 202.434 1.00 0.00 ? 702  ILE A CG1   1 
ATOM   5292  C  CG2   . ILE A  1  702  ? 256.109 276.825 202.778 1.00 0.00 ? 702  ILE A CG2   1 
ATOM   5293  C  CD1   . ILE A  1  702  ? 253.857 278.833 203.005 1.00 0.00 ? 702  ILE A CD1   1 
ATOM   5294  N  N     . GLN A  1  703  ? 257.479 276.258 199.696 1.00 0.00 ? 703  GLN A N     1 
ATOM   5295  C  CA    . GLN A  1  703  ? 258.193 275.053 199.283 1.00 0.00 ? 703  GLN A CA    1 
ATOM   5296  C  C     . GLN A  1  703  ? 259.594 275.426 198.794 1.00 0.00 ? 703  GLN A C     1 
ATOM   5297  O  O     . GLN A  1  703  ? 260.555 274.701 199.048 1.00 0.00 ? 703  GLN A O     1 
ATOM   5298  C  CB    . GLN A  1  703  ? 257.418 274.296 198.201 1.00 0.00 ? 703  GLN A CB    1 
ATOM   5299  C  CG    . GLN A  1  703  ? 256.154 273.614 198.719 1.00 0.00 ? 703  GLN A CG    1 
ATOM   5300  C  CD    . GLN A  1  703  ? 255.276 273.072 197.603 1.00 0.00 ? 703  GLN A CD    1 
ATOM   5301  O  OE1   . GLN A  1  703  ? 255.442 273.427 196.434 1.00 0.00 ? 703  GLN A OE1   1 
ATOM   5302  N  NE2   . GLN A  1  703  ? 254.330 272.211 197.964 1.00 0.00 ? 703  GLN A NE2   1 
ATOM   5303  N  N     . ASN A  1  704  ? 259.710 276.553 198.099 1.00 0.00 ? 704  ASN A N     1 
ATOM   5304  C  CA    . ASN A  1  704  ? 261.011 277.018 197.634 1.00 0.00 ? 704  ASN A CA    1 
ATOM   5305  C  C     . ASN A  1  704  ? 261.878 277.428 198.843 1.00 0.00 ? 704  ASN A C     1 
ATOM   5306  O  O     . ASN A  1  704  ? 263.098 277.244 198.832 1.00 0.00 ? 704  ASN A O     1 
ATOM   5307  C  CB    . ASN A  1  704  ? 260.825 278.181 196.647 1.00 0.00 ? 704  ASN A CB    1 
ATOM   5308  C  CG    . ASN A  1  704  ? 262.132 278.666 196.041 1.00 0.00 ? 704  ASN A CG    1 
ATOM   5309  O  OD1   . ASN A  1  704  ? 263.172 278.009 196.142 1.00 0.00 ? 704  ASN A OD1   1 
ATOM   5310  N  ND2   . ASN A  1  704  ? 262.075 279.816 195.376 1.00 0.00 ? 704  ASN A ND2   1 
ATOM   5311  N  N     . THR A  1  705  ? 261.234 277.945 199.893 1.00 0.00 ? 705  THR A N     1 
ATOM   5312  C  CA    . THR A  1  705  ? 261.891 278.274 201.171 1.00 0.00 ? 705  THR A CA    1 
ATOM   5313  C  C     . THR A  1  705  ? 262.365 277.024 201.903 1.00 0.00 ? 705  THR A C     1 
ATOM   5314  O  O     . THR A  1  705  ? 263.439 277.001 202.499 1.00 0.00 ? 705  THR A O     1 
ATOM   5315  C  CB    . THR A  1  705  ? 260.990 279.078 202.105 1.00 0.00 ? 705  THR A CB    1 
ATOM   5316  O  OG1   . THR A  1  705  ? 260.558 280.264 201.434 1.00 0.00 ? 705  THR A OG1   1 
ATOM   5317  C  CG2   . THR A  1  705  ? 261.759 279.480 203.351 1.00 0.00 ? 705  THR A CG2   1 
ATOM   5318  N  N     . ILE A  1  706  ? 261.536 275.996 201.879 1.00 0.00 ? 706  ILE A N     1 
ATOM   5319  C  CA    . ILE A  1  706  ? 261.894 274.716 202.459 1.00 0.00 ? 706  ILE A CA    1 
ATOM   5320  C  C     . ILE A  1  706  ? 263.042 274.069 201.677 1.00 0.00 ? 706  ILE A C     1 
ATOM   5321  O  O     . ILE A  1  706  ? 263.979 273.543 202.283 1.00 0.00 ? 706  ILE A O     1 
ATOM   5322  C  CB    . ILE A  1  706  ? 260.687 273.774 202.500 1.00 0.00 ? 706  ILE A CB    1 
ATOM   5323  C  CG1   . ILE A  1  706  ? 259.626 274.358 203.419 1.00 0.00 ? 706  ILE A CG1   1 
ATOM   5324  C  CG2   . ILE A  1  706  ? 261.083 272.404 203.021 1.00 0.00 ? 706  ILE A CG2   1 
ATOM   5325  C  CD1   . ILE A  1  706  ? 260.152 274.648 204.801 1.00 0.00 ? 706  ILE A CD1   1 
ATOM   5326  N  N     . LYS A  1  707  ? 262.987 274.117 200.346 1.00 0.00 ? 707  LYS A N     1 
ATOM   5327  C  CA    . LYS A  1  707  ? 264.078 273.577 199.528 1.00 0.00 ? 707  LYS A CA    1 
ATOM   5328  C  C     . LYS A  1  707  ? 265.413 274.284 199.756 1.00 0.00 ? 707  LYS A C     1 
ATOM   5329  O  O     . LYS A  1  707  ? 266.466 273.640 199.734 1.00 0.00 ? 707  LYS A O     1 
ATOM   5330  C  CB    . LYS A  1  707  ? 263.743 273.674 198.031 1.00 0.00 ? 707  LYS A CB    1 
ATOM   5331  C  CG    . LYS A  1  707  ? 262.600 272.810 197.523 1.00 0.00 ? 707  LYS A CG    1 
ATOM   5332  C  CD    . LYS A  1  707  ? 262.921 271.323 197.610 1.00 0.00 ? 707  LYS A CD    1 
ATOM   5333  C  CE    . LYS A  1  707  ? 261.677 270.476 197.355 1.00 0.00 ? 707  LYS A CE    1 
ATOM   5334  N  NZ    . LYS A  1  707  ? 261.392 270.306 195.899 1.00 0.00 ? 707  LYS A NZ    1 
ATOM   5335  N  N     . LYS A  1  708  ? 265.389 275.601 199.951 1.00 0.00 ? 708  LYS A N     1 
ATOM   5336  C  CA    . LYS A  1  708  ? 266.611 276.293 200.346 1.00 0.00 ? 708  LYS A CA    1 
ATOM   5337  C  C     . LYS A  1  708  ? 267.180 275.896 201.711 1.00 0.00 ? 708  LYS A C     1 
ATOM   5338  O  O     . LYS A  1  708  ? 268.379 275.650 201.831 1.00 0.00 ? 708  LYS A O     1 
ATOM   5339  C  CB    . LYS A  1  708  ? 266.366 277.804 200.342 1.00 0.00 ? 708  LYS A CB    1 
ATOM   5340  C  CG    . LYS A  1  708  ? 266.375 278.435 198.959 1.00 0.00 ? 708  LYS A CG    1 
ATOM   5341  C  CD    . LYS A  1  708  ? 265.804 279.846 198.999 1.00 0.00 ? 708  LYS A CD    1 
ATOM   5342  C  CE    . LYS A  1  708  ? 266.612 280.758 199.910 1.00 0.00 ? 708  LYS A CE    1 
ATOM   5343  N  NZ    . LYS A  1  708  ? 266.042 282.137 199.947 1.00 0.00 ? 708  LYS A NZ    1 
ATOM   5344  N  N     . ALA A  1  709  ? 266.325 275.792 202.727 1.00 0.00 ? 709  ALA A N     1 
ATOM   5345  C  CA    . ALA A  1  709  ? 266.776 275.358 204.052 1.00 0.00 ? 709  ALA A CA    1 
ATOM   5346  C  C     . ALA A  1  709  ? 267.325 273.939 204.110 1.00 0.00 ? 709  ALA A C     1 
ATOM   5347  O  O     . ALA A  1  709  ? 268.320 273.670 204.782 1.00 0.00 ? 709  ALA A O     1 
ATOM   5348  C  CB    . ALA A  1  709  ? 265.643 275.499 205.052 1.00 0.00 ? 709  ALA A CB    1 
ATOM   5349  N  N     . LYS A  1  710  ? 266.678 273.038 203.386 1.00 0.00 ? 710  LYS A N     1 
ATOM   5350  C  CA    . LYS A  1  710  ? 267.140 271.663 203.298 1.00 0.00 ? 710  LYS A CA    1 
ATOM   5351  C  C     . LYS A  1  710  ? 268.480 271.506 202.590 1.00 0.00 ? 710  LYS A C     1 
ATOM   5352  O  O     . LYS A  1  710  ? 269.309 270.680 202.981 1.00 0.00 ? 710  LYS A O     1 
ATOM   5353  C  CB    . LYS A  1  710  ? 266.089 270.814 202.592 1.00 0.00 ? 710  LYS A CB    1 
ATOM   5354  C  CG    . LYS A  1  710  ? 264.833 270.600 203.390 1.00 0.00 ? 710  LYS A CG    1 
ATOM   5355  C  CD    . LYS A  1  710  ? 263.912 269.700 202.611 1.00 0.00 ? 710  LYS A CD    1 
ATOM   5356  C  CE    . LYS A  1  710  ? 264.472 268.287 202.582 1.00 0.00 ? 710  LYS A CE    1 
ATOM   5357  N  NZ    . LYS A  1  710  ? 263.532 267.335 201.939 1.00 0.00 ? 710  LYS A NZ    1 
ATOM   5358  N  N     . GLN A  1  711  ? 268.680 272.309 201.549 1.00 0.00 ? 711  GLN A N     1 
ATOM   5359  C  CA    . GLN A  1  711  ? 269.942 272.359 200.822 1.00 0.00 ? 711  GLN A CA    1 
ATOM   5360  C  C     . GLN A  1  711  ? 271.069 272.883 201.712 1.00 0.00 ? 711  GLN A C     1 
ATOM   5361  O  O     . GLN A  1  711  ? 272.188 272.365 201.686 1.00 0.00 ? 711  GLN A O     1 
ATOM   5362  C  CB    . GLN A  1  711  ? 269.785 273.218 199.563 1.00 0.00 ? 711  GLN A CB    1 
ATOM   5363  C  CG    . GLN A  1  711  ? 270.924 273.098 198.559 1.00 0.00 ? 711  GLN A CG    1 
ATOM   5364  C  CD    . GLN A  1  711  ? 270.542 273.620 197.181 1.00 0.00 ? 711  GLN A CD    1 
ATOM   5365  O  OE1   . GLN A  1  711  ? 270.072 274.752 197.038 1.00 0.00 ? 711  GLN A OE1   1 
ATOM   5366  N  NE2   . GLN A  1  711  ? 270.749 272.796 196.158 1.00 0.00 ? 711  GLN A NE2   1 
ATOM   5367  N  N     . ASP A  1  712  ? 270.769 273.924 202.482 1.00 0.00 ? 712  ASP A N     1 
ATOM   5368  C  CA    . ASP A  1  712  ? 271.699 274.450 203.484 1.00 0.00 ? 712  ASP A CA    1 
ATOM   5369  C  C     . ASP A  1  712  ? 272.087 273.454 204.580 1.00 0.00 ? 712  ASP A C     1 
ATOM   5370  O  O     . ASP A  1  712  ? 273.232 273.457 205.041 1.00 0.00 ? 712  ASP A O     1 
ATOM   5371  C  CB    . ASP A  1  712  ? 271.122 275.715 204.128 1.00 0.00 ? 712  ASP A CB    1 
ATOM   5372  C  CG    . ASP A  1  712  ? 270.873 276.822 203.118 1.00 0.00 ? 712  ASP A CG    1 
ATOM   5373  O  OD1   . ASP A  1  712  ? 271.579 276.858 202.079 1.00 0.00 ? 712  ASP A OD1   1 
ATOM   5374  O  OD2   . ASP A  1  712  ? 269.973 277.656 203.364 1.00 0.00 ? 712  ASP A OD2   1 
ATOM   5375  N  N     . VAL A  1  713  ? 271.151 272.603 204.995 1.00 0.00 ? 713  VAL A N     1 
ATOM   5376  C  CA    . VAL A  1  713  ? 271.481 271.574 205.975 1.00 0.00 ? 713  VAL A CA    1 
ATOM   5377  C  C     . VAL A  1  713  ? 272.417 270.546 205.358 1.00 0.00 ? 713  VAL A C     1 
ATOM   5378  O  O     . VAL A  1  713  ? 273.362 270.099 206.004 1.00 0.00 ? 713  VAL A O     1 
ATOM   5379  C  CB    . VAL A  1  713  ? 270.236 270.877 206.509 1.00 0.00 ? 713  VAL A CB    1 
ATOM   5380  C  CG1   . VAL A  1  713  ? 270.627 269.683 207.351 1.00 0.00 ? 713  VAL A CG1   1 
ATOM   5381  C  CG2   . VAL A  1  713  ? 269.492 271.826 207.356 1.00 0.00 ? 713  VAL A CG2   1 
ATOM   5382  N  N     . ILE A  1  714  ? 272.163 270.164 204.112 1.00 0.00 ? 714  ILE A N     1 
ATOM   5383  C  CA    . ILE A  1  714  ? 273.098 269.296 203.416 1.00 0.00 ? 714  ILE A CA    1 
ATOM   5384  C  C     . ILE A  1  714  ? 274.457 270.010 203.321 1.00 0.00 ? 714  ILE A C     1 
ATOM   5385  O  O     . ILE A  1  714  ? 275.506 269.387 203.477 1.00 0.00 ? 714  ILE A O     1 
ATOM   5386  C  CB    . ILE A  1  714  ? 272.569 268.890 202.008 1.00 0.00 ? 714  ILE A CB    1 
ATOM   5387  C  CG1   . ILE A  1  714  ? 271.262 268.104 202.137 1.00 0.00 ? 714  ILE A CG1   1 
ATOM   5388  C  CG2   . ILE A  1  714  ? 273.579 268.025 201.262 1.00 0.00 ? 714  ILE A CG2   1 
ATOM   5389  C  CD1   . ILE A  1  714  ? 271.360 266.891 203.046 1.00 0.00 ? 714  ILE A CD1   1 
ATOM   5390  N  N     . GLU A  1  715  ? 274.435 271.311 203.044 1.00 0.00 ? 715  GLU A N     1 
ATOM   5391  C  CA    . GLU A  1  715  ? 275.656 272.109 203.015 1.00 0.00 ? 715  GLU A CA    1 
ATOM   5392  C  C     . GLU A  1  715  ? 276.431 272.112 204.345 1.00 0.00 ? 715  GLU A C     1 
ATOM   5393  O  O     . GLU A  1  715  ? 277.663 272.033 204.360 1.00 0.00 ? 715  GLU A O     1 
ATOM   5394  C  CB    . GLU A  1  715  ? 275.314 273.538 202.609 1.00 0.00 ? 715  GLU A CB    1 
ATOM   5395  C  CG    . GLU A  1  715  ? 276.518 274.395 202.314 1.00 0.00 ? 715  GLU A CG    1 
ATOM   5396  C  CD    . GLU A  1  715  ? 276.105 275.696 201.674 1.00 0.00 ? 715  GLU A CD    1 
ATOM   5397  O  OE1   . GLU A  1  715  ? 275.722 275.650 200.486 1.00 0.00 ? 715  GLU A OE1   1 
ATOM   5398  O  OE2   . GLU A  1  715  ? 276.348 276.768 202.266 1.00 0.00 ? 715  GLU A OE2   1 
ATOM   5399  N  N     . VAL A  1  716  ? 275.716 272.187 205.468 1.00 0.00 ? 716  VAL A N     1 
ATOM   5400  C  CA    . VAL A  1  716  ? 276.387 272.102 206.766 1.00 0.00 ? 716  VAL A CA    1 
ATOM   5401  C  C     . VAL A  1  716  ? 276.955 270.707 207.008 1.00 0.00 ? 716  VAL A C     1 
ATOM   5402  O  O     . VAL A  1  716  ? 278.075 270.569 207.481 1.00 0.00 ? 716  VAL A O     1 
ATOM   5403  C  CB    . VAL A  1  716  ? 275.453 272.490 207.915 1.00 0.00 ? 716  VAL A CB    1 
ATOM   5404  C  CG1   . VAL A  1  716  ? 276.147 272.268 209.244 1.00 0.00 ? 716  VAL A CG1   1 
ATOM   5405  C  CG2   . VAL A  1  716  ? 275.080 273.949 207.788 1.00 0.00 ? 716  VAL A CG2   1 
ATOM   5406  N  N     . ILE A  1  717  ? 276.214 269.680 206.612 1.00 0.00 ? 717  ILE A N     1 
ATOM   5407  C  CA    . ILE A  1  717  ? 276.664 268.297 206.759 1.00 0.00 ? 717  ILE A CA    1 
ATOM   5408  C  C     . ILE A  1  717  ? 277.895 268.039 205.870 1.00 0.00 ? 717  ILE A C     1 
ATOM   5409  O  O     . ILE A  1  717  ? 278.877 267.440 206.319 1.00 0.00 ? 717  ILE A O     1 
ATOM   5410  C  CB    . ILE A  1  717  ? 275.535 267.291 206.461 1.00 0.00 ? 717  ILE A CB    1 
ATOM   5411  C  CG1   . ILE A  1  717  ? 274.491 267.352 207.573 1.00 0.00 ? 717  ILE A CG1   1 
ATOM   5412  C  CG2   . ILE A  1  717  ? 276.071 265.878 206.384 1.00 0.00 ? 717  ILE A CG2   1 
ATOM   5413  C  CD1   . ILE A  1  717  ? 273.227 266.599 207.265 1.00 0.00 ? 717  ILE A CD1   1 
ATOM   5414  N  N     . GLU A  1  718  ? 277.852 268.483 204.617 1.00 0.00 ? 718  GLU A N     1 
ATOM   5415  C  CA    . GLU A  1  718  ? 279.006 268.322 203.737 1.00 0.00 ? 718  GLU A CA    1 
ATOM   5416  C  C     . GLU A  1  718  ? 280.242 269.035 204.282 1.00 0.00 ? 718  GLU A C     1 
ATOM   5417  O  O     . GLU A  1  718  ? 281.345 268.487 204.246 1.00 0.00 ? 718  GLU A O     1 
ATOM   5418  C  CB    . GLU A  1  718  ? 278.681 268.876 202.345 1.00 0.00 ? 718  GLU A CB    1 
ATOM   5419  C  CG    . GLU A  1  718  ? 279.658 268.487 201.232 1.00 0.00 ? 718  GLU A CG    1 
ATOM   5420  C  CD    . GLU A  1  718  ? 279.611 267.015 200.861 1.00 0.00 ? 718  GLU A CD    1 
ATOM   5421  O  OE1   . GLU A  1  718  ? 278.512 266.529 200.518 1.00 0.00 ? 718  GLU A OE1   1 
ATOM   5422  O  OE2   . GLU A  1  718  ? 280.678 266.354 200.892 1.00 0.00 ? 718  GLU A OE2   1 
ATOM   5423  N  N     . LYS A  1  719  ? 280.053 270.248 204.793 1.00 0.00 ? 719  LYS A N     1 
ATOM   5424  C  CA    . LYS A  1  719  ? 281.123 270.991 205.457 1.00 0.00 ? 719  LYS A CA    1 
ATOM   5425  C  C     . LYS A  1  719  ? 281.629 270.301 206.729 1.00 0.00 ? 719  LYS A C     1 
ATOM   5426  O  O     . LYS A  1  719  ? 282.819 270.326 207.039 1.00 0.00 ? 719  LYS A O     1 
ATOM   5427  C  CB    . LYS A  1  719  ? 280.655 272.410 205.777 1.00 0.00 ? 719  LYS A CB    1 
ATOM   5428  C  CG    . LYS A  1  719  ? 280.654 273.332 204.566 1.00 0.00 ? 719  LYS A CG    1 
ATOM   5429  C  CD    . LYS A  1  719  ? 280.100 274.707 204.905 1.00 0.00 ? 719  LYS A CD    1 
ATOM   5430  C  CE    . LYS A  1  719  ? 280.185 275.651 203.714 1.00 0.00 ? 719  LYS A CE    1 
ATOM   5431  N  NZ    . LYS A  1  719  ? 281.589 276.055 203.416 1.00 0.00 ? 719  LYS A NZ    1 
ATOM   5432  N  N     . ALA A  1  720  ? 280.703 269.702 207.465 1.00 0.00 ? 720  ALA A N     1 
ATOM   5433  C  CA    . ALA A  1  720  ? 281.017 268.940 208.673 1.00 0.00 ? 720  ALA A CA    1 
ATOM   5434  C  C     . ALA A  1  720  ? 281.793 267.650 208.482 1.00 0.00 ? 720  ALA A C     1 
ATOM   5435  O  O     . ALA A  1  720  ? 282.723 267.378 209.231 1.00 0.00 ? 720  ALA A O     1 
ATOM   5436  C  CB    . ALA A  1  720  ? 279.737 268.633 209.419 1.00 0.00 ? 720  ALA A CB    1 
ATOM   5437  N  N     . HIS A  1  721  ? 281.414 266.849 207.495 1.00 0.00 ? 721  HIS A N     1 
ATOM   5438  C  CA    . HIS A  1  721  ? 282.154 265.623 207.209 1.00 0.00 ? 721  HIS A CA    1 
ATOM   5439  C  C     . HIS A  1  721  ? 283.584 265.832 206.708 1.00 0.00 ? 721  HIS A C     1 
ATOM   5440  O  O     . HIS A  1  721  ? 284.467 265.018 206.989 1.00 0.00 ? 721  HIS A O     1 
ATOM   5441  C  CB    . HIS A  1  721  ? 281.381 264.769 206.201 1.00 0.00 ? 721  HIS A CB    1 
ATOM   5442  C  CG    . HIS A  1  721  ? 280.066 264.263 206.713 1.00 0.00 ? 721  HIS A CG    1 
ATOM   5443  N  ND1   . HIS A  1  721  ? 279.720 264.302 208.047 1.00 0.00 ? 721  HIS A ND1   1 
ATOM   5444  C  CD2   . HIS A  1  721  ? 279.027 263.677 206.073 1.00 0.00 ? 721  HIS A CD2   1 
ATOM   5445  C  CE1   . HIS A  1  721  ? 278.519 263.773 208.204 1.00 0.00 ? 721  HIS A CE1   1 
ATOM   5446  N  NE2   . HIS A  1  721  ? 278.077 263.384 207.022 1.00 0.00 ? 721  HIS A NE2   1 
ATOM   5447  N  N     . ASN A  1  722  ? 283.821 266.914 205.977 1.00 0.00 ? 722  ASN A N     1 
ATOM   5448  C  CA    . ASN A  1  722  ? 285.174 267.254 205.545 1.00 0.00 ? 722  ASN A CA    1 
ATOM   5449  C  C     . ASN A  1  722  ? 286.092 267.689 206.685 1.00 0.00 ? 722  ASN A C     1 
ATOM   5450  O  O     . ASN A  1  722  ? 287.292 267.867 206.479 1.00 0.00 ? 722  ASN A O     1 
ATOM   5451  C  CB    . ASN A  1  722  ? 285.118 268.344 204.482 1.00 0.00 ? 722  ASN A CB    1 
ATOM   5452  C  CG    . ASN A  1  722  ? 284.640 267.818 203.150 1.00 0.00 ? 722  ASN A CG    1 
ATOM   5453  O  OD1   . ASN A  1  722  ? 285.400 267.184 202.415 1.00 0.00 ? 722  ASN A OD1   1 
ATOM   5454  N  ND2   . ASN A  1  722  ? 283.370 268.066 202.833 1.00 0.00 ? 722  ASN A ND2   1 
ATOM   5455  N  N     . ASN A  1  723  ? 285.513 267.873 207.870 1.00 0.00 ? 723  ASN A N     1 
ATOM   5456  C  CA    . ASN A  1  723  ? 286.245 268.301 209.060 1.00 0.00 ? 723  ASN A CA    1 
ATOM   5457  C  C     . ASN A  1  723  ? 286.781 269.724 208.922 1.00 0.00 ? 723  ASN A C     1 
ATOM   5458  O  O     . ASN A  1  723  ? 287.910 270.020 209.310 1.00 0.00 ? 723  ASN A O     1 
ATOM   5459  C  CB    . ASN A  1  723  ? 287.382 267.319 209.366 1.00 0.00 ? 723  ASN A CB    1 
ATOM   5460  C  CG    . ASN A  1  723  ? 287.935 267.487 210.763 1.00 0.00 ? 723  ASN A CG    1 
ATOM   5461  O  OD1   . ASN A  1  723  ? 287.185 267.673 211.723 1.00 0.00 ? 723  ASN A OD1   1 
ATOM   5462  N  ND2   . ASN A  1  723  ? 289.258 267.420 210.887 1.00 0.00 ? 723  ASN A ND2   1 
ATOM   5463  N  N     . GLU A  1  724  ? 285.965 270.598 208.345 1.00 0.00 ? 724  GLU A N     1 
ATOM   5464  C  CA    . GLU A  1  724  ? 286.362 271.981 208.109 1.00 0.00 ? 724  GLU A CA    1 
ATOM   5465  C  C     . GLU A  1  724  ? 285.378 272.982 208.709 1.00 0.00 ? 724  GLU A C     1 
ATOM   5466  O  O     . GLU A  1  724  ? 285.447 274.177 208.422 1.00 0.00 ? 724  GLU A O     1 
ATOM   5467  C  CB    . GLU A  1  724  ? 286.513 272.232 206.609 1.00 0.00 ? 724  GLU A CB    1 
ATOM   5468  C  CG    . GLU A  1  724  ? 285.201 272.173 205.843 1.00 0.00 ? 724  GLU A CG    1 
ATOM   5469  C  CD    . GLU A  1  724  ? 285.356 272.572 204.388 1.00 0.00 ? 724  GLU A CD    1 
ATOM   5470  O  OE1   . GLU A  1  724  ? 286.473 272.989 204.003 1.00 0.00 ? 724  GLU A OE1   1 
ATOM   5471  O  OE2   . GLU A  1  724  ? 284.364 272.461 203.632 1.00 0.00 ? 724  GLU A OE2   1 
ATOM   5472  N  N     . LEU A  1  725  ? 284.457 272.492 209.534 1.00 0.00 ? 725  LEU A N     1 
ATOM   5473  C  CA    . LEU A  1  725  ? 283.401 273.338 210.090 1.00 0.00 ? 725  LEU A CA    1 
ATOM   5474  C  C     . LEU A  1  725  ? 283.907 274.441 211.026 1.00 0.00 ? 725  LEU A C     1 
ATOM   5475  O  O     . LEU A  1  725  ? 283.299 275.513 211.098 1.00 0.00 ? 725  LEU A O     1 
ATOM   5476  C  CB    . LEU A  1  725  ? 282.378 272.478 210.835 1.00 0.00 ? 725  LEU A CB    1 
ATOM   5477  C  CG    . LEU A  1  725  ? 281.176 273.248 211.380 1.00 0.00 ? 725  LEU A CG    1 
ATOM   5478  C  CD1   . LEU A  1  725  ? 280.406 273.904 210.250 1.00 0.00 ? 725  LEU A CD1   1 
ATOM   5479  C  CD2   . LEU A  1  725  ? 280.281 272.335 212.181 1.00 0.00 ? 725  LEU A CD2   1 
ATOM   5480  N  N     . GLU A  1  726  ? 285.017 274.180 211.716 1.00 0.00 ? 726  GLU A N     1 
ATOM   5481  C  CA    . GLU A  1  726  ? 285.592 275.119 212.688 1.00 0.00 ? 726  GLU A CA    1 
ATOM   5482  C  C     . GLU A  1  726  ? 284.639 275.452 213.843 1.00 0.00 ? 726  GLU A C     1 
ATOM   5483  O  O     . GLU A  1  726  ? 283.806 276.352 213.720 1.00 0.00 ? 726  GLU A O     1 
ATOM   5484  C  CB    . GLU A  1  726  ? 286.012 276.418 211.990 1.00 0.00 ? 726  GLU A CB    1 
ATOM   5485  C  CG    . GLU A  1  726  ? 287.155 276.270 211.006 1.00 0.00 ? 726  GLU A CG    1 
ATOM   5486  C  CD    . GLU A  1  726  ? 287.529 277.592 210.356 1.00 0.00 ? 726  GLU A CD    1 
ATOM   5487  O  OE1   . GLU A  1  726  ? 286.782 278.578 210.548 1.00 0.00 ? 726  GLU A OE1   1 
ATOM   5488  O  OE2   . GLU A  1  726  ? 288.564 277.643 209.655 1.00 0.00 ? 726  GLU A OE2   1 
ATOM   5489  N  N     . PRO A  1  727  ? 284.773 274.732 214.972 1.00 0.00 ? 727  PRO A N     1 
ATOM   5490  C  CA    . PRO A  1  727  ? 283.937 274.893 216.170 1.00 0.00 ? 727  PRO A CA    1 
ATOM   5491  C  C     . PRO A  1  727  ? 283.799 276.338 216.646 1.00 0.00 ? 727  PRO A C     1 
ATOM   5492  O  O     . PRO A  1  727  ? 284.778 277.082 216.613 1.00 0.00 ? 727  PRO A O     1 
ATOM   5493  C  CB    . PRO A  1  727  ? 284.677 274.063 217.220 1.00 0.00 ? 727  PRO A CB    1 
ATOM   5494  C  CG    . PRO A  1  727  ? 285.364 273.013 216.435 1.00 0.00 ? 727  PRO A CG    1 
ATOM   5495  C  CD    . PRO A  1  727  ? 285.780 273.671 215.148 1.00 0.00 ? 727  PRO A CD    1 
ATOM   5496  N  N     . THR A  1  728  ? 282.602 276.720 217.088 1.00 0.00 ? 728  THR A N     1 
ATOM   5497  C  CA    . THR A  1  728  ? 282.411 278.012 217.746 1.00 0.00 ? 728  THR A CA    1 
ATOM   5498  C  C     . THR A  1  728  ? 283.148 278.028 219.082 1.00 0.00 ? 728  THR A C     1 
ATOM   5499  O  O     . THR A  1  728  ? 283.128 277.037 219.816 1.00 0.00 ? 728  THR A O     1 
ATOM   5500  C  CB    . THR A  1  728  ? 280.917 278.345 217.988 1.00 0.00 ? 728  THR A CB    1 
ATOM   5501  O  OG1   . THR A  1  728  ? 280.319 277.333 218.808 1.00 0.00 ? 728  THR A OG1   1 
ATOM   5502  C  CG2   . THR A  1  728  ? 280.167 278.452 216.672 1.00 0.00 ? 728  THR A CG2   1 
ATOM   5503  N  N     . PRO A  1  729  ? 283.801 279.158 219.397 1.00 0.00 ? 729  PRO A N     1 
ATOM   5504  C  CA    . PRO A  1  729  ? 284.622 279.406 220.591 1.00 0.00 ? 729  PRO A CA    1 
ATOM   5505  C  C     . PRO A  1  729  ? 284.061 278.939 221.944 1.00 0.00 ? 729  PRO A C     1 
ATOM   5506  O  O     . PRO A  1  729  ? 284.828 278.893 222.907 1.00 0.00 ? 729  PRO A O     1 
ATOM   5507  C  CB    . PRO A  1  729  ? 284.760 280.928 220.590 1.00 0.00 ? 729  PRO A CB    1 
ATOM   5508  C  CG    . PRO A  1  729  ? 284.743 281.293 219.152 1.00 0.00 ? 729  PRO A CG    1 
ATOM   5509  C  CD    . PRO A  1  729  ? 283.841 280.302 218.464 1.00 0.00 ? 729  PRO A CD    1 
ATOM   5510  N  N     . GLY A  1  730  ? 282.784 278.579 222.024 1.00 0.00 ? 730  GLY A N     1 
ATOM   5511  C  CA    . GLY A  1  730  ? 282.217 278.184 223.301 1.00 0.00 ? 730  GLY A CA    1 
ATOM   5512  C  C     . GLY A  1  730  ? 281.447 276.881 223.258 1.00 0.00 ? 730  GLY A C     1 
ATOM   5513  O  O     . GLY A  1  730  ? 280.603 276.618 224.115 1.00 0.00 ? 730  GLY A O     1 
ATOM   5514  N  N     . ASN A  1  731  ? 281.739 276.068 222.248 1.00 0.00 ? 731  ASN A N     1 
ATOM   5515  C  CA    . ASN A  1  731  ? 281.129 274.751 222.110 1.00 0.00 ? 731  ASN A CA    1 
ATOM   5516  C  C     . ASN A  1  731  ? 282.102 273.730 221.525 1.00 0.00 ? 731  ASN A C     1 
ATOM   5517  O  O     . ASN A  1  731  ? 283.171 274.088 221.027 1.00 0.00 ? 731  ASN A O     1 
ATOM   5518  C  CB    . ASN A  1  731  ? 279.874 274.833 221.239 1.00 0.00 ? 731  ASN A CB    1 
ATOM   5519  C  CG    . ASN A  1  731  ? 278.697 275.449 221.968 1.00 0.00 ? 731  ASN A CG    1 
ATOM   5520  O  OD1   . ASN A  1  731  ? 277.983 276.289 221.420 1.00 0.00 ? 731  ASN A OD1   1 
ATOM   5521  N  ND2   . ASN A  1  731  ? 278.486 275.031 223.212 1.00 0.00 ? 731  ASN A ND2   1 
ATOM   5522  N  N     . THR A  1  732  ? 281.732 272.457 221.601 1.00 0.00 ? 732  THR A N     1 
ATOM   5523  C  CA    . THR A  1  732  ? 282.435 271.405 220.872 1.00 0.00 ? 732  THR A CA    1 
ATOM   5524  C  C     . THR A  1  732  ? 281.923 271.329 219.430 1.00 0.00 ? 732  THR A C     1 
ATOM   5525  O  O     . THR A  1  732  ? 280.924 271.964 219.094 1.00 0.00 ? 732  THR A O     1 
ATOM   5526  C  CB    . THR A  1  732  ? 282.264 270.041 221.557 1.00 0.00 ? 732  THR A CB    1 
ATOM   5527  O  OG1   . THR A  1  732  ? 280.906 269.602 221.413 1.00 0.00 ? 732  THR A OG1   1 
ATOM   5528  C  CG2   . THR A  1  732  ? 282.587 270.156 223.036 1.00 0.00 ? 732  THR A CG2   1 
ATOM   5529  N  N     . LEU A  1  733  ? 282.595 270.548 218.585 1.00 0.00 ? 733  LEU A N     1 
ATOM   5530  C  CA    . LEU A  1  733  ? 282.198 270.414 217.182 1.00 0.00 ? 733  LEU A CA    1 
ATOM   5531  C  C     . LEU A  1  733  ? 280.788 269.856 216.999 1.00 0.00 ? 733  LEU A C     1 
ATOM   5532  O  O     . LEU A  1  733  ? 280.038 270.325 216.148 1.00 0.00 ? 733  LEU A O     1 
ATOM   5533  C  CB    . LEU A  1  733  ? 283.189 269.531 216.423 1.00 0.00 ? 733  LEU A CB    1 
ATOM   5534  C  CG    . LEU A  1  733  ? 282.880 269.315 214.940 1.00 0.00 ? 733  LEU A CG    1 
ATOM   5535  C  CD1   . LEU A  1  733  ? 282.832 270.641 214.193 1.00 0.00 ? 733  LEU A CD1   1 
ATOM   5536  C  CD2   . LEU A  1  733  ? 283.895 268.377 214.312 1.00 0.00 ? 733  LEU A CD2   1 
ATOM   5537  N  N     . ARG A  1  734  ? 280.432 268.850 217.787 1.00 0.00 ? 734  ARG A N     1 
ATOM   5538  C  CA    . ARG A  1  734  ? 279.076 268.310 217.777 1.00 0.00 ? 734  ARG A CA    1 
ATOM   5539  C  C     . ARG A  1  734  ? 278.027 269.335 218.196 1.00 0.00 ? 734  ARG A C     1 
ATOM   5540  O  O     . ARG A  1  734  ? 276.975 269.449 217.571 1.00 0.00 ? 734  ARG A O     1 
ATOM   5541  C  CB    . ARG A  1  734  ? 279.005 267.085 218.679 1.00 0.00 ? 734  ARG A CB    1 
ATOM   5542  C  CG    . ARG A  1  734  ? 277.699 266.317 218.620 1.00 0.00 ? 734  ARG A CG    1 
ATOM   5543  C  CD    . ARG A  1  734  ? 277.899 265.007 219.356 1.00 0.00 ? 734  ARG A CD    1 
ATOM   5544  N  NE    . ARG A  1  734  ? 278.537 264.029 218.476 1.00 0.00 ? 734  ARG A NE    1 
ATOM   5545  C  CZ    . ARG A  1  734  ? 278.723 262.748 218.770 1.00 0.00 ? 734  ARG A CZ    1 
ATOM   5546  N  NH1   . ARG A  1  734  ? 278.347 262.276 219.951 1.00 0.00 ? 734  ARG A NH1   1 
ATOM   5547  N  NH2   . ARG A  1  734  ? 279.222 261.926 217.858 1.00 0.00 ? 734  ARG A NH2   1 
ATOM   5548  N  N     . GLN A  1  735  ? 278.319 270.076 219.257 1.00 0.00 ? 735  GLN A N     1 
ATOM   5549  C  CA    . GLN A  1  735  ? 277.408 271.101 219.750 1.00 0.00 ? 735  GLN A CA    1 
ATOM   5550  C  C     . GLN A  1  735  ? 277.226 272.264 218.778 1.00 0.00 ? 735  GLN A C     1 
ATOM   5551  O  O     . GLN A  1  735  ? 276.137 272.821 218.673 1.00 0.00 ? 735  GLN A O     1 
ATOM   5552  C  CB    . GLN A  1  735  ? 277.924 271.642 221.081 1.00 0.00 ? 735  GLN A CB    1 
ATOM   5553  C  CG    . GLN A  1  735  ? 277.821 270.670 222.237 1.00 0.00 ? 735  GLN A CG    1 
ATOM   5554  C  CD    . GLN A  1  735  ? 278.452 271.215 223.507 1.00 0.00 ? 735  GLN A CD    1 
ATOM   5555  O  OE1   . GLN A  1  735  ? 278.994 272.323 223.518 1.00 0.00 ? 735  GLN A OE1   1 
ATOM   5556  N  NE2   . GLN A  1  735  ? 278.373 270.444 224.587 1.00 0.00 ? 735  GLN A NE2   1 
ATOM   5557  N  N     . THR A  1  736  ? 278.294 272.635 218.080 1.00 0.00 ? 736  THR A N     1 
ATOM   5558  C  CA    . THR A  1  736  ? 278.231 273.695 217.079 1.00 0.00 ? 736  THR A CA    1 
ATOM   5559  C  C     . THR A  1  736  ? 277.357 273.303 215.904 1.00 0.00 ? 736  THR A C     1 
ATOM   5560  O  O     . THR A  1  736  ? 276.572 274.105 215.407 1.00 0.00 ? 736  THR A O     1 
ATOM   5561  C  CB    . THR A  1  736  ? 279.627 274.060 216.546 1.00 0.00 ? 736  THR A CB    1 
ATOM   5562  O  OG1   . THR A  1  736  ? 280.450 274.501 217.631 1.00 0.00 ? 736  THR A OG1   1 
ATOM   5563  C  CG2   . THR A  1  736  ? 279.533 275.178 215.521 1.00 0.00 ? 736  THR A CG2   1 
ATOM   5564  N  N     . PHE A  1  737  ? 277.509 272.065 215.457 1.00 0.00 ? 737  PHE A N     1 
ATOM   5565  C  CA    . PHE A  1  737  ? 276.685 271.549 214.385 1.00 0.00 ? 737  PHE A CA    1 
ATOM   5566  C  C     . PHE A  1  737  ? 275.224 271.546 214.801 1.00 0.00 ? 737  PHE A C     1 
ATOM   5567  O  O     . PHE A  1  737  ? 274.360 271.998 214.055 1.00 0.00 ? 737  PHE A O     1 
ATOM   5568  C  CB    . PHE A  1  737  ? 277.139 270.143 214.007 1.00 0.00 ? 737  PHE A CB    1 
ATOM   5569  C  CG    . PHE A  1  737  ? 276.239 269.457 213.036 1.00 0.00 ? 737  PHE A CG    1 
ATOM   5570  C  CD1   . PHE A  1  737  ? 276.410 269.645 211.676 1.00 0.00 ? 737  PHE A CD1   1 
ATOM   5571  C  CD2   . PHE A  1  737  ? 275.237 268.608 213.469 1.00 0.00 ? 737  PHE A CD2   1 
ATOM   5572  C  CE1   . PHE A  1  737  ? 275.591 269.010 210.762 1.00 0.00 ? 737  PHE A CE1   1 
ATOM   5573  C  CE2   . PHE A  1  737  ? 274.407 267.972 212.563 1.00 0.00 ? 737  PHE A CE2   1 
ATOM   5574  C  CZ    . PHE A  1  737  ? 274.584 268.172 211.207 1.00 0.00 ? 737  PHE A CZ    1 
ATOM   5575  N  N     . GLU A  1  738  ? 274.950 271.018 215.991 1.00 0.00 ? 738  GLU A N     1 
ATOM   5576  C  CA    . GLU A  1  738  ? 273.578 270.925 216.493 1.00 0.00 ? 738  GLU A CA    1 
ATOM   5577  C  C     . GLU A  1  738  ? 272.939 272.280 216.755 1.00 0.00 ? 738  GLU A C     1 
ATOM   5578  O  O     . GLU A  1  738  ? 271.751 272.479 216.517 1.00 0.00 ? 738  GLU A O     1 
ATOM   5579  C  CB    . GLU A  1  738  ? 273.566 270.098 217.777 1.00 0.00 ? 738  GLU A CB    1 
ATOM   5580  C  CG    . GLU A  1  738  ? 272.226 269.970 218.508 1.00 0.00 ? 738  GLU A CG    1 
ATOM   5581  C  CD    . GLU A  1  738  ? 271.069 269.515 217.618 1.00 0.00 ? 738  GLU A CD    1 
ATOM   5582  O  OE1   . GLU A  1  738  ? 270.847 268.282 217.498 1.00 0.00 ? 738  GLU A OE1   1 
ATOM   5583  O  OE2   . GLU A  1  738  ? 270.323 270.390 217.118 1.00 0.00 ? 738  GLU A OE2   1 
ATOM   5584  N  N     . ASN A  1  739  ? 273.744 273.224 217.219 1.00 0.00 ? 739  ASN A N     1 
ATOM   5585  C  CA    . ASN A  1  739  ? 273.286 274.592 217.329 1.00 0.00 ? 739  ASN A CA    1 
ATOM   5586  C  C     . ASN A  1  739  ? 272.993 275.189 215.957 1.00 0.00 ? 739  ASN A C     1 
ATOM   5587  O  O     . ASN A  1  739  ? 271.959 275.815 215.755 1.00 0.00 ? 739  ASN A O     1 
ATOM   5588  C  CB    . ASN A  1  739  ? 274.325 275.425 218.087 1.00 0.00 ? 739  ASN A CB    1 
ATOM   5589  C  CG    . ASN A  1  739  ? 274.018 276.899 218.069 1.00 0.00 ? 739  ASN A CG    1 
ATOM   5590  O  OD1   . ASN A  1  739  ? 274.831 277.710 217.627 1.00 0.00 ? 739  ASN A OD1   1 
ATOM   5591  N  ND2   . ASN A  1  739  ? 272.837 277.260 218.552 1.00 0.00 ? 739  ASN A ND2   1 
ATOM   5592  N  N     . GLN A  1  740  ? 273.891 274.951 215.005 1.00 0.00 ? 740  GLN A N     1 
ATOM   5593  C  CA    . GLN A  1  740  ? 273.806 275.575 213.686 1.00 0.00 ? 740  GLN A CA    1 
ATOM   5594  C  C     . GLN A  1  740  ? 272.638 275.100 212.811 1.00 0.00 ? 740  GLN A C     1 
ATOM   5595  O  O     . GLN A  1  740  ? 271.969 275.918 212.177 1.00 0.00 ? 740  GLN A O     1 
ATOM   5596  C  CB    . GLN A  1  740  ? 275.126 275.358 212.941 1.00 0.00 ? 740  GLN A CB    1 
ATOM   5597  C  CG    . GLN A  1  740  ? 275.135 275.826 211.499 1.00 0.00 ? 740  GLN A CG    1 
ATOM   5598  C  CD    . GLN A  1  740  ? 275.174 277.332 211.369 1.00 0.00 ? 740  GLN A CD    1 
ATOM   5599  O  OE1   . GLN A  1  740  ? 274.259 277.938 210.811 1.00 0.00 ? 740  GLN A OE1   1 
ATOM   5600  N  NE2   . GLN A  1  740  ? 276.242 277.946 211.867 1.00 0.00 ? 740  GLN A NE2   1 
ATOM   5601  N  N     . VAL A  1  741  ? 272.395 273.790 212.767 1.00 0.00 ? 741  VAL A N     1 
ATOM   5602  C  CA    . VAL A  1  741  ? 271.218 273.270 212.070 1.00 0.00 ? 741  VAL A CA    1 
ATOM   5603  C  C     . VAL A  1  741  ? 269.929 273.720 212.735 1.00 0.00 ? 741  VAL A C     1 
ATOM   5604  O  O     . VAL A  1  741  ? 268.953 274.023 212.045 1.00 0.00 ? 741  VAL A O     1 
ATOM   5605  C  CB    . VAL A  1  741  ? 271.216 271.729 211.937 1.00 0.00 ? 741  VAL A CB    1 
ATOM   5606  C  CG1   . VAL A  1  741  ? 272.388 271.259 211.112 1.00 0.00 ? 741  VAL A CG1   1 
ATOM   5607  C  CG2   . VAL A  1  741  ? 271.173 271.052 213.289 1.00 0.00 ? 741  VAL A CG2   1 
ATOM   5608  N  N     . ASN A  1  742  ? 269.904 273.738 214.067 1.00 0.00 ? 742  ASN A N     1 
ATOM   5609  C  CA    . ASN A  1  742  ? 268.732 274.247 214.760 1.00 0.00 ? 742  ASN A CA    1 
ATOM   5610  C  C     . ASN A  1  742  ? 268.483 275.716 214.462 1.00 0.00 ? 742  ASN A C     1 
ATOM   5611  O  O     . ASN A  1  742  ? 267.334 276.137 214.354 1.00 0.00 ? 742  ASN A O     1 
ATOM   5612  C  CB    . ASN A  1  742  ? 268.853 274.044 216.270 1.00 0.00 ? 742  ASN A CB    1 
ATOM   5613  C  CG    . ASN A  1  742  ? 267.701 274.688 217.035 1.00 0.00 ? 742  ASN A CG    1 
ATOM   5614  O  OD1   . ASN A  1  742  ? 266.558 274.229 216.983 1.00 0.00 ? 742  ASN A OD1   1 
ATOM   5615  N  ND2   . ASN A  1  742  ? 268.004 275.771 217.742 1.00 0.00 ? 742  ASN A ND2   1 
ATOM   5616  N  N     . ARG A  1  743  ? 269.546 276.511 214.382 1.00 0.00 ? 743  ARG A N     1 
ATOM   5617  C  CA    . ARG A  1  743  ? 269.390 277.905 213.991 1.00 0.00 ? 743  ARG A CA    1 
ATOM   5618  C  C     . ARG A  1  743  ? 268.777 278.005 212.585 1.00 0.00 ? 743  ARG A C     1 
ATOM   5619  O  O     . ARG A  1  743  ? 267.851 278.783 212.373 1.00 0.00 ? 743  ARG A O     1 
ATOM   5620  C  CB    . ARG A  1  743  ? 270.697 278.690 214.112 1.00 0.00 ? 743  ARG A CB    1 
ATOM   5621  C  CG    . ARG A  1  743  ? 270.501 280.176 213.822 1.00 0.00 ? 743  ARG A CG    1 
ATOM   5622  C  CD    . ARG A  1  743  ? 271.788 280.975 213.892 1.00 0.00 ? 743  ARG A CD    1 
ATOM   5623  N  NE    . ARG A  1  743  ? 272.778 280.584 212.902 1.00 0.00 ? 743  ARG A NE    1 
ATOM   5624  C  CZ    . ARG A  1  743  ? 272.751 280.976 211.632 1.00 0.00 ? 743  ARG A CZ    1 
ATOM   5625  N  NH1   . ARG A  1  743  ? 271.800 281.808 211.218 1.00 0.00 ? 743  ARG A NH1   1 
ATOM   5626  N  NH2   . ARG A  1  743  ? 273.638 280.496 210.765 1.00 0.00 ? 743  ARG A NH2   1 
ATOM   5627  N  N     . ILE A  1  744  ? 269.301 277.249 211.623 1.00 0.00 ? 744  ILE A N     1 
ATOM   5628  C  CA    . ILE A  1  744  ? 268.745 277.295 210.267 1.00 0.00 ? 744  ILE A CA    1 
ATOM   5629  C  C     . ILE A  1  744  ? 267.296 276.796 210.137 1.00 0.00 ? 744  ILE A C     1 
ATOM   5630  O  O     . ILE A  1  744  ? 266.482 277.465 209.503 1.00 0.00 ? 744  ILE A O     1 
ATOM   5631  C  CB    . ILE A  1  744  ? 269.607 276.482 209.296 1.00 0.00 ? 744  ILE A CB    1 
ATOM   5632  C  CG1   . ILE A  1  744  ? 270.990 277.112 209.174 1.00 0.00 ? 744  ILE A CG1   1 
ATOM   5633  C  CG2   . ILE A  1  744  ? 268.951 276.400 207.929 1.00 0.00 ? 744  ILE A CG2   1 
ATOM   5634  C  CD1   . ILE A  1  744  ? 272.016 276.212 208.546 1.00 0.00 ? 744  ILE A CD1   1 
ATOM   5635  N  N     . LEU A  1  745  ? 266.972 275.640 210.721 1.00 0.00 ? 745  LEU A N     1 
ATOM   5636  C  CA    . LEU A  1  745  ? 265.594 275.085 210.677 1.00 0.00 ? 745  LEU A CA    1 
ATOM   5637  C  C     . LEU A  1  745  ? 264.538 275.910 211.420 1.00 0.00 ? 745  LEU A C     1 
ATOM   5638  O  O     . LEU A  1  745  ? 263.357 275.870 211.069 1.00 0.00 ? 745  LEU A O     1 
ATOM   5639  C  CB    . LEU A  1  745  ? 265.541 273.642 211.178 1.00 0.00 ? 745  LEU A CB    1 
ATOM   5640  C  CG    . LEU A  1  745  ? 265.801 272.581 210.106 1.00 0.00 ? 745  LEU A CG    1 
ATOM   5641  C  CD1   . LEU A  1  745  ? 266.941 272.977 209.245 1.00 0.00 ? 745  LEU A CD1   1 
ATOM   5642  C  CD2   . LEU A  1  745  ? 266.064 271.220 210.716 1.00 0.00 ? 745  LEU A CD2   1 
ATOM   5643  N  N     . ASN A  1  746  ? 264.952 276.584 212.486 1.00 0.00 ? 746  ASN A N     1 
ATOM   5644  C  CA    . ASN A  1  746  ? 264.112 277.566 213.160 1.00 0.00 ? 746  ASN A CA    1 
ATOM   5645  C  C     . ASN A  1  746  ? 263.932 278.804 212.281 1.00 0.00 ? 746  ASN A C     1 
ATOM   5646  O  O     . ASN A  1  746  ? 262.840 279.356 212.184 1.00 0.00 ? 746  ASN A O     1 
ATOM   5647  C  CB    . ASN A  1  746  ? 264.688 277.956 214.514 1.00 0.00 ? 746  ASN A CB    1 
ATOM   5648  C  CG    . ASN A  1  746  ? 263.777 278.888 215.275 1.00 0.00 ? 746  ASN A CG    1 
ATOM   5649  O  OD1   . ASN A  1  746  ? 262.601 278.584 215.483 1.00 0.00 ? 746  ASN A OD1   1 
ATOM   5650  N  ND2   . ASN A  1  746  ? 264.303 280.037 215.684 1.00 0.00 ? 746  ASN A ND2   1 
ATOM   5651  N  N     . ASP A  1  747  ? 265.028 279.239 211.669 1.00 0.00 ? 747  ASP A N     1 
ATOM   5652  C  CA    . ASP A  1  747  ? 265.038 280.394 210.786 1.00 0.00 ? 747  ASP A CA    1 
ATOM   5653  C  C     . ASP A  1  747  ? 264.122 280.108 209.595 1.00 0.00 ? 747  ASP A C     1 
ATOM   5654  O  O     . ASP A  1  747  ? 263.365 280.979 209.166 1.00 0.00 ? 747  ASP A O     1 
ATOM   5655  C  CB    . ASP A  1  747  ? 266.466 280.731 210.330 1.00 0.00 ? 747  ASP A CB    1 
ATOM   5656  C  CG    . ASP A  1  747  ? 266.511 281.732 209.169 1.00 0.00 ? 747  ASP A CG    1 
ATOM   5657  O  OD1   . ASP A  1  747  ? 265.770 282.742 209.214 1.00 0.00 ? 747  ASP A OD1   1 
ATOM   5658  O  OD2   . ASP A  1  747  ? 267.312 281.529 208.226 1.00 0.00 ? 747  ASP A OD2   1 
ATOM   5659  N  N     . ALA A  1  748  ? 264.198 278.898 209.054 1.00 0.00 ? 748  ALA A N     1 
ATOM   5660  C  CA    . ALA A  1  748  ? 263.301 278.487 207.971 1.00 0.00 ? 748  ALA A CA    1 
ATOM   5661  C  C     . ALA A  1  748  ? 261.802 278.566 208.313 1.00 0.00 ? 748  ALA A C     1 
ATOM   5662  O  O     . ALA A  1  748  ? 261.027 279.113 207.527 1.00 0.00 ? 748  ALA A O     1 
ATOM   5663  C  CB    . ALA A  1  748  ? 263.644 277.088 207.534 1.00 0.00 ? 748  ALA A CB    1 
ATOM   5664  N  N     . ARG A  1  749  ? 261.395 278.007 209.454 1.00 0.00 ? 749  ARG A N     1 
ATOM   5665  C  CA    . ARG A  1  749  ? 259.985 278.019 209.906 1.00 0.00 ? 749  ARG A CA    1 
ATOM   5666  C  C     . ARG A  1  749  ? 259.467 279.442 210.105 1.00 0.00 ? 749  ARG A C     1 
ATOM   5667  O  O     . ARG A  1  749  ? 258.334 279.770 209.746 1.00 0.00 ? 749  ARG A O     1 
ATOM   5668  C  CB    . ARG A  1  749  ? 259.766 277.237 211.199 1.00 0.00 ? 749  ARG A CB    1 
ATOM   5669  C  CG    . ARG A  1  749  ? 258.332 277.404 211.726 1.00 0.00 ? 749  ARG A CG    1 
ATOM   5670  C  CD    . ARG A  1  749  ? 258.050 276.598 212.986 1.00 0.00 ? 749  ARG A CD    1 
ATOM   5671  N  NE    . ARG A  1  749  ? 258.851 277.022 214.127 1.00 0.00 ? 749  ARG A NE    1 
ATOM   5672  C  CZ    . ARG A  1  749  ? 258.913 276.362 215.277 1.00 0.00 ? 749  ARG A CZ    1 
ATOM   5673  N  NH1   . ARG A  1  749  ? 258.209 275.245 215.434 1.00 0.00 ? 749  ARG A NH1   1 
ATOM   5674  N  NH2   . ARG A  1  749  ? 259.765 276.750 216.216 1.00 0.00 ? 749  ARG A NH2   1 
ATOM   5675  N  N     . ASP A  1  750  ? 260.299 280.260 210.737 1.00 0.00 ? 750  ASP A N     1 
ATOM   5676  C  CA    . ASP A  1  750  ? 259.993 281.659 210.971 1.00 0.00 ? 750  ASP A CA    1 
ATOM   5677  C  C     . ASP A  1  750  ? 259.826 282.433 209.643 1.00 0.00 ? 750  ASP A C     1 
ATOM   5678  O  O     . ASP A  1  750  ? 258.965 283.307 209.567 1.00 0.00 ? 750  ASP A O     1 
ATOM   5679  C  CB    . ASP A  1  750  ? 261.082 282.283 211.839 1.00 0.00 ? 750  ASP A CB    1 
ATOM   5680  C  CG    . ASP A  1  750  ? 260.584 283.480 212.625 1.00 0.00 ? 750  ASP A CG    1 
ATOM   5681  O  OD1   . ASP A  1  750  ? 259.395 283.475 213.031 1.00 0.00 ? 750  ASP A OD1   1 
ATOM   5682  O  OD2   . ASP A  1  750  ? 261.383 284.421 212.847 1.00 0.00 ? 750  ASP A OD2   1 
ATOM   5683  N  N     . LYS A  1  751  ? 260.635 282.165 208.617 1.00 0.00 ? 751  LYS A N     1 
ATOM   5684  C  CA    . LYS A  1  751  ? 260.457 282.886 207.350 1.00 0.00 ? 751  LYS A CA    1 
ATOM   5685  C  C     . LYS A  1  751  ? 259.127 282.499 206.675 1.00 0.00 ? 751  LYS A C     1 
ATOM   5686  O  O     . LYS A  1  751  ? 258.363 283.374 206.264 1.00 0.00 ? 751  LYS A O     1 
ATOM   5687  C  CB    . LYS A  1  751  ? 261.605 282.649 206.364 1.00 0.00 ? 751  LYS A CB    1 
ATOM   5688  C  CG    . LYS A  1  751  ? 262.856 283.473 206.604 1.00 0.00 ? 751  LYS A CG    1 
ATOM   5689  C  CD    . LYS A  1  751  ? 263.989 282.980 205.712 1.00 0.00 ? 751  LYS A CD    1 
ATOM   5690  C  CE    . LYS A  1  751  ? 265.249 283.830 205.840 1.00 0.00 ? 751  LYS A CE    1 
ATOM   5691  N  NZ    . LYS A  1  751  ? 266.458 283.129 205.300 1.00 0.00 ? 751  LYS A NZ    1 
ATOM   5692  N  N     . THR A  1  752  ? 258.863 281.200 206.539 1.00 0.00 ? 752  THR A N     1 
ATOM   5693  C  CA    . THR A  1  752  ? 257.591 280.719 205.979 1.00 0.00 ? 752  THR A CA    1 
ATOM   5694  C  C     . THR A  1  752  ? 256.366 281.051 206.827 1.00 0.00 ? 752  THR A C     1 
ATOM   5695  O  O     . THR A  1  752  ? 255.288 281.294 206.298 1.00 0.00 ? 752  THR A O     1 
ATOM   5696  C  CB    . THR A  1  752  ? 257.602 279.176 205.773 1.00 0.00 ? 752  THR A CB    1 
ATOM   5697  O  OG1   . THR A  1  752  ? 257.899 278.520 207.011 1.00 0.00 ? 752  THR A OG1   1 
ATOM   5698  C  CG2   . THR A  1  752  ? 258.643 278.771 204.770 1.00 0.00 ? 752  THR A CG2   1 
ATOM   5699  N  N     . GLY A  1  753  ? 256.550 281.067 208.140 1.00 0.00 ? 753  GLY A N     1 
ATOM   5700  C  CA    . GLY A  1  753  ? 255.527 281.519 209.058 1.00 0.00 ? 753  GLY A CA    1 
ATOM   5701  C  C     . GLY A  1  753  ? 255.164 282.976 208.876 1.00 0.00 ? 753  GLY A C     1 
ATOM   5702  O  O     . GLY A  1  753  ? 253.988 283.338 208.907 1.00 0.00 ? 753  GLY A O     1 
ATOM   5703  N  N     . SER A  1  754  ? 256.176 283.821 208.713 1.00 0.00 ? 754  SER A N     1 
ATOM   5704  C  CA    . SER A  1  754  ? 255.963 285.255 208.525 1.00 0.00 ? 754  SER A CA    1 
ATOM   5705  C  C     . SER A  1  754  ? 255.293 285.509 207.179 1.00 0.00 ? 754  SER A C     1 
ATOM   5706  O  O     . SER A  1  754  ? 254.416 286.366 207.047 1.00 0.00 ? 754  SER A O     1 
ATOM   5707  C  CB    . SER A  1  754  ? 257.296 286.015 208.591 1.00 0.00 ? 754  SER A CB    1 
ATOM   5708  O  OG    . SER A  1  754  ? 258.013 285.725 209.781 1.00 0.00 ? 754  SER A OG    1 
ATOM   5709  N  N     . SER A  1  755  ? 255.687 284.695 206.206 1.00 0.00 ? 755  SER A N     1 
ATOM   5710  C  CA    . SER A  1  755  ? 255.140 284.716 204.857 1.00 0.00 ? 755  SER A CA    1 
ATOM   5711  C  C     . SER A  1  755  ? 253.646 284.384 204.754 1.00 0.00 ? 755  SER A C     1 
ATOM   5712  O  O     . SER A  1  755  ? 252.912 285.060 204.035 1.00 0.00 ? 755  SER A O     1 
ATOM   5713  C  CB    . SER A  1  755  ? 255.940 283.728 203.986 1.00 0.00 ? 755  SER A CB    1 
ATOM   5714  O  OG    . SER A  1  755  ? 255.807 284.005 202.601 1.00 0.00 ? 755  SER A OG    1 
ATOM   5715  N  N     . ALA A  1  756  ? 253.185 283.368 205.472 1.00 0.00 ? 756  ALA A N     1 
ATOM   5716  C  CA    . ALA A  1  756  ? 251.755 283.097 205.504 1.00 0.00 ? 756  ALA A CA    1 
ATOM   5717  C  C     . ALA A  1  756  ? 250.914 284.137 206.224 1.00 0.00 ? 756  ALA A C     1 
ATOM   5718  O  O     . ALA A  1  756  ? 249.806 284.408 205.793 1.00 0.00 ? 756  ALA A O     1 
ATOM   5719  C  CB    . ALA A  1  756  ? 251.511 281.741 206.126 1.00 0.00 ? 756  ALA A CB    1 
ATOM   5720  N  N     . GLN A  1  757  ? 251.398 284.704 207.321 1.00 0.00 ? 757  GLN A N     1 
ATOM   5721  C  CA    . GLN A  1  757  ? 250.575 285.687 208.018 1.00 0.00 ? 757  GLN A CA    1 
ATOM   5722  C  C     . GLN A  1  757  ? 250.321 286.894 207.118 1.00 0.00 ? 757  GLN A C     1 
ATOM   5723  O  O     . GLN A  1  757  ? 249.231 287.468 207.114 1.00 0.00 ? 757  GLN A O     1 
ATOM   5724  C  CB    . GLN A  1  757  ? 251.166 286.135 209.358 1.00 0.00 ? 757  GLN A CB    1 
ATOM   5725  C  CG    . GLN A  1  757  ? 250.136 287.010 210.112 1.00 0.00 ? 757  GLN A CG    1 
ATOM   5726  C  CD    . GLN A  1  757  ? 250.590 287.530 211.468 1.00 0.00 ? 757  GLN A CD    1 
ATOM   5727  O  OE1   . GLN A  1  757  ? 251.611 287.107 211.999 1.00 0.00 ? 757  GLN A OE1   1 
ATOM   5728  N  NE2   . GLN A  1  757  ? 249.833 288.480 212.021 1.00 0.00 ? 757  GLN A NE2   1 
ATOM   5729  N  N     . LYS A  1  758  ? 251.342 287.251 206.343 1.00 0.00 ? 758  LYS A N     1 
ATOM   5730  C  CA    . LYS A  1  758  ? 251.275 288.326 205.348 1.00 0.00 ? 758  LYS A CA    1 
ATOM   5731  C  C     . LYS A  1  758  ? 250.392 287.989 204.146 1.00 0.00 ? 758  LYS A C     1 
ATOM   5732  O  O     . LYS A  1  758  ? 249.655 288.842 203.647 1.00 0.00 ? 758  LYS A O     1 
ATOM   5733  C  CB    . LYS A  1  758  ? 252.693 288.647 204.855 1.00 0.00 ? 758  LYS A CB    1 
ATOM   5734  C  CG    . LYS A  1  758  ? 252.839 289.884 203.982 1.00 0.00 ? 758  LYS A CG    1 
ATOM   5735  C  CD    . LYS A  1  758  ? 252.863 291.161 204.806 1.00 0.00 ? 758  LYS A CD    1 
ATOM   5736  C  CE    . LYS A  1  758  ? 253.311 292.350 203.956 1.00 0.00 ? 758  LYS A CE    1 
ATOM   5737  N  NZ    . LYS A  1  758  ? 254.716 292.189 203.455 1.00 0.00 ? 758  LYS A NZ    1 
ATOM   5738  N  N     . SER A  1  759  ? 250.463 286.745 203.684 1.00 0.00 ? 759  SER A N     1 
ATOM   5739  C  CA    . SER A  1  759  ? 249.730 286.333 202.494 1.00 0.00 ? 759  SER A CA    1 
ATOM   5740  C  C     . SER A  1  759  ? 248.231 286.272 202.764 1.00 0.00 ? 759  SER A C     1 
ATOM   5741  O  O     . SER A  1  759  ? 247.428 286.335 201.840 1.00 0.00 ? 759  SER A O     1 
ATOM   5742  C  CB    . SER A  1  759  ? 250.228 284.966 202.013 1.00 0.00 ? 759  SER A CB    1 
ATOM   5743  O  OG    . SER A  1  759  ? 251.487 285.071 201.370 1.00 0.00 ? 759  SER A OG    1 
ATOM   5744  N  N     . LEU A  1  760  ? 247.861 286.179 204.034 1.00 0.00 ? 760  LEU A N     1 
ATOM   5745  C  CA    . LEU A  1  760  ? 246.456 286.126 204.412 1.00 0.00 ? 760  LEU A CA    1 
ATOM   5746  C  C     . LEU A  1  760  ? 245.774 287.475 204.223 1.00 0.00 ? 760  LEU A C     1 
ATOM   5747  O  O     . LEU A  1  760  ? 246.428 288.519 204.253 1.00 0.00 ? 760  LEU A O     1 
ATOM   5748  C  CB    . LEU A  1  760  ? 246.303 285.665 205.863 1.00 0.00 ? 760  LEU A CB    1 
ATOM   5749  C  CG    . LEU A  1  760  ? 245.838 284.224 206.092 1.00 0.00 ? 760  LEU A CG    1 
ATOM   5750  C  CD1   . LEU A  1  760  ? 246.908 283.223 205.715 1.00 0.00 ? 760  LEU A CD1   1 
ATOM   5751  C  CD2   . LEU A  1  760  ? 245.390 284.023 207.533 1.00 0.00 ? 760  LEU A CD2   1 
ATOM   5752  N  N     . SER A  1  761  ? 244.456 287.439 204.023 1.00 0.00 ? 761  SER A N     1 
ATOM   5753  C  CA    . SER A  1  761  ? 243.668 288.650 203.790 1.00 0.00 ? 761  SER A CA    1 
ATOM   5754  C  C     . SER A  1  761  ? 242.980 289.119 205.071 1.00 0.00 ? 761  SER A C     1 
ATOM   5755  O  O     . SER A  1  761  ? 243.288 288.653 206.168 1.00 0.00 ? 761  SER A O     1 
ATOM   5756  C  CB    . SER A  1  761  ? 242.612 288.424 202.704 1.00 0.00 ? 761  SER A CB    1 
ATOM   5757  O  OG    . SER A  1  761  ? 241.483 287.736 203.222 1.00 0.00 ? 761  SER A OG    1 
ATOM   5758  N  N     . GLU A  1  762  ? 242.052 290.056 204.914 1.00 0.00 ? 762  GLU A N     1 
ATOM   5759  C  CA    . GLU A  1  762  ? 241.348 290.646 206.043 1.00 0.00 ? 762  GLU A CA    1 
ATOM   5760  C  C     . GLU A  1  762  ? 240.157 289.817 206.516 1.00 0.00 ? 762  GLU A C     1 
ATOM   5761  O  O     . GLU A  1  762  ? 239.750 289.892 207.679 1.00 0.00 ? 762  GLU A O     1 
ATOM   5762  C  CB    . GLU A  1  762  ? 240.885 292.059 205.669 1.00 0.00 ? 762  GLU A CB    1 
ATOM   5763  C  CG    . GLU A  1  762  ? 240.275 292.857 206.811 1.00 0.00 ? 762  GLU A CG    1 
ATOM   5764  C  CD    . GLU A  1  762  ? 241.272 293.163 207.917 1.00 0.00 ? 762  GLU A CD    1 
ATOM   5765  O  OE1   . GLU A  1  762  ? 242.502 293.049 207.681 1.00 0.00 ? 762  GLU A OE1   1 
ATOM   5766  O  OE2   . GLU A  1  762  ? 240.814 293.521 209.026 1.00 0.00 ? 762  GLU A OE2   1 
ATOM   5767  N  N     . TYR A  1  763  ? 239.595 289.026 205.617 1.00 0.00 ? 763  TYR A N     1 
ATOM   5768  C  CA    . TYR A  1  763  ? 238.359 288.323 205.933 1.00 0.00 ? 763  TYR A CA    1 
ATOM   5769  C  C     . TYR A  1  763  ? 238.575 286.995 206.691 1.00 0.00 ? 763  TYR A C     1 
ATOM   5770  O  O     . TYR A  1  763  ? 237.635 286.468 207.291 1.00 0.00 ? 763  TYR A O     1 
ATOM   5771  C  CB    . TYR A  1  763  ? 237.556 288.108 204.640 1.00 0.00 ? 763  TYR A CB    1 
ATOM   5772  C  CG    . TYR A  1  763  ? 237.161 289.424 203.994 1.00 0.00 ? 763  TYR A CG    1 
ATOM   5773  C  CD1   . TYR A  1  763  ? 236.092 290.169 204.487 1.00 0.00 ? 763  TYR A CD1   1 
ATOM   5774  C  CD2   . TYR A  1  763  ? 237.864 289.931 202.900 1.00 0.00 ? 763  TYR A CD2   1 
ATOM   5775  C  CE1   . TYR A  1  763  ? 235.730 291.384 203.908 1.00 0.00 ? 763  TYR A CE1   1 
ATOM   5776  C  CE2   . TYR A  1  763  ? 237.510 291.144 202.311 1.00 0.00 ? 763  TYR A CE2   1 
ATOM   5777  C  CZ    . TYR A  1  763  ? 236.440 291.866 202.818 1.00 0.00 ? 763  TYR A CZ    1 
ATOM   5778  O  OH    . TYR A  1  763  ? 236.086 293.068 202.233 1.00 0.00 ? 763  TYR A OH    1 
ATOM   5779  N  N     . ASN A  1  764  ? 239.810 286.487 206.705 1.00 0.00 ? 764  ASN A N     1 
ATOM   5780  C  CA    . ASN A  1  764  ? 240.131 285.243 207.408 1.00 0.00 ? 764  ASN A CA    1 
ATOM   5781  C  C     . ASN A  1  764  ? 239.790 285.273 208.856 1.00 0.00 ? 764  ASN A C     1 
ATOM   5782  O  O     . ASN A  1  764  ? 240.531 285.835 209.647 1.00 0.00 ? 764  ASN A O     1 
ATOM   5783  C  CB    . ASN A  1  764  ? 241.608 284.907 207.312 1.00 0.00 ? 764  ASN A CB    1 
ATOM   5784  C  CG    . ASN A  1  764  ? 242.008 284.468 205.937 1.00 0.00 ? 764  ASN A CG    1 
ATOM   5785  O  OD1   . ASN A  1  764  ? 242.924 285.042 205.332 1.00 0.00 ? 764  ASN A OD1   1 
ATOM   5786  N  ND2   . ASN A  1  764  ? 241.324 283.443 205.417 1.00 0.00 ? 764  ASN A ND2   1 
ATOM   5787  N  N     . ASN A  1  765  ? 238.688 284.615 209.190 1.00 0.00 ? 765  ASN A N     1 
ATOM   5788  C  CA    . ASN A  1  765  ? 238.171 284.501 210.556 1.00 0.00 ? 765  ASN A CA    1 
ATOM   5789  C  C     . ASN A  1  765  ? 239.190 284.064 211.593 1.00 0.00 ? 765  ASN A C     1 
ATOM   5790  O  O     . ASN A  1  765  ? 239.116 284.434 212.763 1.00 0.00 ? 765  ASN A O     1 
ATOM   5791  C  CB    . ASN A  1  765  ? 237.083 283.444 210.587 1.00 0.00 ? 765  ASN A CB    1 
ATOM   5792  C  CG    . ASN A  1  765  ? 235.894 283.788 209.742 1.00 0.00 ? 765  ASN A CG    1 
ATOM   5793  O  OD1   . ASN A  1  765  ? 234.992 284.482 210.206 1.00 0.00 ? 765  ASN A OD1   1 
ATOM   5794  N  ND2   . ASN A  1  765  ? 235.869 283.298 208.493 1.00 0.00 ? 765  ASN A ND2   1 
ATOM   5795  N  N     . PHE A  1  766  ? 240.150 283.280 211.114 1.00 0.00 ? 766  PHE A N     1 
ATOM   5796  C  CA    . PHE A  1  766  ? 241.326 282.847 211.845 1.00 0.00 ? 766  PHE A CA    1 
ATOM   5797  C  C     . PHE A  1  766  ? 242.144 284.061 212.284 1.00 0.00 ? 766  PHE A C     1 
ATOM   5798  O  O     . PHE A  1  766  ? 242.664 284.095 213.390 1.00 0.00 ? 766  PHE A O     1 
ATOM   5799  C  CB    . PHE A  1  766  ? 242.126 281.913 210.953 1.00 0.00 ? 766  PHE A CB    1 
ATOM   5800  C  CG    . PHE A  1  766  ? 242.943 280.943 211.696 1.00 0.00 ? 766  PHE A CG    1 
ATOM   5801  C  CD1   . PHE A  1  766  ? 244.015 281.352 212.454 1.00 0.00 ? 766  PHE A CD1   1 
ATOM   5802  C  CD2   . PHE A  1  766  ? 242.616 279.598 211.646 1.00 0.00 ? 766  PHE A CD2   1 
ATOM   5803  C  CE1   . PHE A  1  766  ? 244.756 280.426 213.151 1.00 0.00 ? 766  PHE A CE1   1 
ATOM   5804  C  CE2   . PHE A  1  766  ? 243.350 278.666 212.337 1.00 0.00 ? 766  PHE A CE2   1 
ATOM   5805  C  CZ    . PHE A  1  766  ? 244.425 279.080 213.094 1.00 0.00 ? 766  PHE A CZ    1 
ATOM   5806  N  N     . LYS A  1  767  ? 242.346 285.007 211.373 1.00 0.00 ? 767  LYS A N     1 
ATOM   5807  C  CA    . LYS A  1  767  ? 243.018 286.256 211.714 1.00 0.00 ? 767  LYS A CA    1 
ATOM   5808  C  C     . LYS A  1  767  ? 242.139 287.039 212.693 1.00 0.00 ? 767  LYS A C     1 
ATOM   5809  O  O     . LYS A  1  767  ? 242.658 287.714 213.561 1.00 0.00 ? 767  LYS A O     1 
ATOM   5810  C  CB    . LYS A  1  767  ? 243.397 287.110 210.507 1.00 0.00 ? 767  LYS A CB    1 
ATOM   5811  C  CG    . LYS A  1  767  ? 244.324 288.274 210.917 1.00 0.00 ? 767  LYS A CG    1 
ATOM   5812  C  CD    . LYS A  1  767  ? 245.038 288.904 209.715 1.00 0.00 ? 767  LYS A CD    1 
ATOM   5813  C  CE    . LYS A  1  767  ? 245.862 290.161 210.095 1.00 0.00 ? 767  LYS A CE    1 
ATOM   5814  N  NZ    . LYS A  1  767  ? 246.732 290.689 208.972 1.00 0.00 ? 767  LYS A NZ    1 
ATOM   5815  N  N     . SER A  1  768  ? 240.818 287.019 212.523 1.00 0.00 ? 768  SER A N     1 
ATOM   5816  C  CA    . SER A  1  768  ? 239.971 287.686 213.514 1.00 0.00 ? 768  SER A CA    1 
ATOM   5817  C  C     . SER A  1  768  ? 240.055 287.091 214.909 1.00 0.00 ? 768  SER A C     1 
ATOM   5818  O  O     . SER A  1  768  ? 239.976 287.846 215.862 1.00 0.00 ? 768  SER A O     1 
ATOM   5819  C  CB    . SER A  1  768  ? 238.487 287.649 213.113 1.00 0.00 ? 768  SER A CB    1 
ATOM   5820  O  OG    . SER A  1  768  ? 238.155 288.542 212.070 1.00 0.00 ? 768  SER A OG    1 
ATOM   5821  N  N     . MET A  1  769  ? 240.155 285.775 215.061 1.00 0.00 ? 769  MET A N     1 
ATOM   5822  C  CA    . MET A  1  769  ? 240.383 285.209 216.399 1.00 0.00 ? 769  MET A CA    1 
ATOM   5823  C  C     . MET A  1  769  ? 241.776 285.488 216.989 1.00 0.00 ? 769  MET A C     1 
ATOM   5824  O  O     . MET A  1  769  ? 241.888 285.710 218.185 1.00 0.00 ? 769  MET A O     1 
ATOM   5825  C  CB    . MET A  1  769  ? 240.058 283.704 216.466 1.00 0.00 ? 769  MET A CB    1 
ATOM   5826  C  CG    . MET A  1  769  ? 238.534 283.444 216.502 1.00 0.00 ? 769  MET A CG    1 
ATOM   5827  S  SD    . MET A  1  769  ? 237.945 281.753 216.737 1.00 0.00 ? 769  MET A SD    1 
ATOM   5828  C  CE    . MET A  1  769  ? 238.215 281.075 215.121 1.00 0.00 ? 769  MET A CE    1 
ATOM   5829  N  N     . VAL A  1  770  ? 242.836 285.432 216.188 1.00 0.00 ? 770  VAL A N     1 
ATOM   5830  C  CA    . VAL A  1  770  ? 244.175 285.749 216.702 1.00 0.00 ? 770  VAL A CA    1 
ATOM   5831  C  C     . VAL A  1  770  ? 244.384 287.200 217.121 1.00 0.00 ? 770  VAL A C     1 
ATOM   5832  O  O     . VAL A  1  770  ? 244.899 287.464 218.204 1.00 0.00 ? 770  VAL A O     1 
ATOM   5833  C  CB    . VAL A  1  770  ? 245.239 285.427 215.684 1.00 0.00 ? 770  VAL A CB    1 
ATOM   5834  C  CG1   . VAL A  1  770  ? 246.548 286.082 216.071 1.00 0.00 ? 770  VAL A CG1   1 
ATOM   5835  C  CG2   . VAL A  1  770  ? 245.421 283.954 215.631 1.00 0.00 ? 770  VAL A CG2   1 
ATOM   5836  N  N     . VAL A  1  771  ? 243.999 288.119 216.237 1.00 0.00 ? 771  VAL A N     1 
ATOM   5837  C  CA    . VAL A  1  771  ? 244.126 289.571 216.406 1.00 0.00 ? 771  VAL A CA    1 
ATOM   5838  C  C     . VAL A  1  771  ? 243.346 290.216 217.557 1.00 0.00 ? 771  VAL A C     1 
ATOM   5839  O  O     . VAL A  1  771  ? 243.860 291.084 218.257 1.00 0.00 ? 771  VAL A O     1 
ATOM   5840  C  CB    . VAL A  1  771  ? 243.725 290.267 215.091 1.00 0.00 ? 771  VAL A CB    1 
ATOM   5841  C  CG1   . VAL A  1  771  ? 243.450 291.749 215.288 1.00 0.00 ? 771  VAL A CG1   1 
ATOM   5842  C  CG2   . VAL A  1  771  ? 244.808 290.036 214.031 1.00 0.00 ? 771  VAL A CG2   1 
ATOM   5843  N  N     . SER A  1  772  ? 242.122 289.786 217.783 1.00 0.00 ? 772  SER A N     1 
ATOM   5844  C  CA    . SER A  1  772  ? 241.411 290.289 218.938 1.00 0.00 ? 772  SER A CA    1 
ATOM   5845  C  C     . SER A  1  772  ? 242.080 289.868 220.218 1.00 0.00 ? 772  SER A C     1 
ATOM   5846  O  O     . SER A  1  772  ? 241.862 290.482 221.250 1.00 0.00 ? 772  SER A O     1 
ATOM   5847  C  CB    . SER A  1  772  ? 240.001 289.760 219.004 1.00 0.00 ? 772  SER A CB    1 
ATOM   5848  O  OG    . SER A  1  772  ? 240.048 288.388 219.330 1.00 0.00 ? 772  SER A OG    1 
ATOM   5849  N  N     . GLY A  1  773  ? 242.860 288.797 220.166 1.00 0.00 ? 773  GLY A N     1 
ATOM   5850  C  CA    . GLY A  1  773  ? 243.446 288.221 221.367 1.00 0.00 ? 773  GLY A CA    1 
ATOM   5851  C  C     . GLY A  1  773  ? 242.521 287.197 222.020 1.00 0.00 ? 773  GLY A C     1 
ATOM   5852  O  O     . GLY A  1  773  ? 242.653 286.881 223.210 1.00 0.00 ? 773  GLY A O     1 
ATOM   5853  N  N     . ALA A  1  774  ? 241.579 286.676 221.235 1.00 0.00 ? 774  ALA A N     1 
ATOM   5854  C  CA    . ALA A  1  774  ? 240.609 285.718 221.735 1.00 0.00 ? 774  ALA A CA    1 
ATOM   5855  C  C     . ALA A  1  774  ? 241.223 284.336 222.028 1.00 0.00 ? 774  ALA A C     1 
ATOM   5856  O  O     . ALA A  1  774  ? 241.187 283.890 223.173 1.00 0.00 ? 774  ALA A O     1 
ATOM   5857  C  CB    . ALA A  1  774  ? 239.475 285.581 220.754 1.00 0.00 ? 774  ALA A CB    1 
ATOM   5858  N  N     . LYS A  1  775  ? 241.792 283.673 221.018 1.00 0.00 ? 775  LYS A N     1 
ATOM   5859  C  CA    . LYS A  1  775  ? 242.416 282.347 221.162 1.00 0.00 ? 775  LYS A CA    1 
ATOM   5860  C  C     . LYS A  1  775  ? 243.499 282.176 220.140 1.00 0.00 ? 775  LYS A C     1 
ATOM   5861  O  O     . LYS A  1  775  ? 243.421 282.732 219.051 1.00 0.00 ? 775  LYS A O     1 
ATOM   5862  C  CB    . LYS A  1  775  ? 241.422 281.200 220.970 1.00 0.00 ? 775  LYS A CB    1 
ATOM   5863  C  CG    . LYS A  1  775  ? 240.356 281.063 222.024 1.00 0.00 ? 775  LYS A CG    1 
ATOM   5864  C  CD    . LYS A  1  775  ? 240.969 280.725 223.374 1.00 0.00 ? 775  LYS A CD    1 
ATOM   5865  C  CE    . LYS A  1  775  ? 241.596 279.337 223.383 1.00 0.00 ? 775  LYS A CE    1 
ATOM   5866  N  NZ    . LYS A  1  775  ? 242.272 279.009 224.685 1.00 0.00 ? 775  LYS A NZ    1 
ATOM   5867  N  N     . GLY A  1  776  ? 244.499 281.371 220.466 1.00 0.00 ? 776  GLY A N     1 
ATOM   5868  C  CA    . GLY A  1  776  ? 245.509 281.024 219.480 1.00 0.00 ? 776  GLY A CA    1 
ATOM   5869  C  C     . GLY A  1  776  ? 246.635 282.036 219.386 1.00 0.00 ? 776  GLY A C     1 
ATOM   5870  O  O     . GLY A  1  776  ? 246.734 282.948 220.210 1.00 0.00 ? 776  GLY A O     1 
ATOM   5871  N  N     . SER A  1  777  ? 247.497 281.870 218.390 1.00 0.00 ? 777  SER A N     1 
ATOM   5872  C  CA    . SER A  1  777  ? 248.584 282.815 218.193 1.00 0.00 ? 777  SER A CA    1 
ATOM   5873  C  C     . SER A  1  777  ? 249.187 282.769 216.804 1.00 0.00 ? 777  SER A C     1 
ATOM   5874  O  O     . SER A  1  777  ? 248.806 281.936 215.984 1.00 0.00 ? 777  SER A O     1 
ATOM   5875  C  CB    . SER A  1  777  ? 249.666 282.534 219.200 1.00 0.00 ? 777  SER A CB    1 
ATOM   5876  O  OG    . SER A  1  777  ? 250.300 281.339 218.809 1.00 0.00 ? 777  SER A OG    1 
ATOM   5877  N  N     . LYS A  1  778  ? 250.159 283.643 216.558 1.00 0.00 ? 778  LYS A N     1 
ATOM   5878  C  CA    . LYS A  1  778  ? 250.770 283.685 215.247 1.00 0.00 ? 778  LYS A CA    1 
ATOM   5879  C  C     . LYS A  1  778  ? 251.299 282.281 214.934 1.00 0.00 ? 778  LYS A C     1 
ATOM   5880  O  O     . LYS A  1  778  ? 251.095 281.779 213.828 1.00 0.00 ? 778  LYS A O     1 
ATOM   5881  C  CB    . LYS A  1  778  ? 251.886 284.743 215.169 1.00 0.00 ? 778  LYS A CB    1 
ATOM   5882  C  CG    . LYS A  1  778  ? 252.575 284.761 213.788 1.00 0.00 ? 778  LYS A CG    1 
ATOM   5883  C  CD    . LYS A  1  778  ? 253.807 285.676 213.688 1.00 0.00 ? 778  LYS A CD    1 
ATOM   5884  C  CE    . LYS A  1  778  ? 254.337 285.686 212.231 1.00 0.00 ? 778  LYS A CE    1 
ATOM   5885  N  NZ    . LYS A  1  778  ? 255.642 286.392 212.038 1.00 0.00 ? 778  LYS A NZ    1 
ATOM   5886  N  N     . ILE A  1  779  ? 251.969 281.654 215.903 1.00 0.00 ? 779  ILE A N     1 
ATOM   5887  C  CA    . ILE A  1  779  ? 252.608 280.360 215.671 1.00 0.00 ? 779  ILE A CA    1 
ATOM   5888  C  C     . ILE A  1  779  ? 251.565 279.279 215.332 1.00 0.00 ? 779  ILE A C     1 
ATOM   5889  O  O     . ILE A  1  779  ? 251.856 278.348 214.598 1.00 0.00 ? 779  ILE A O     1 
ATOM   5890  C  CB    . ILE A  1  779  ? 253.467 279.884 216.844 1.00 0.00 ? 779  ILE A CB    1 
ATOM   5891  C  CG1   . ILE A  1  779  ? 254.173 278.600 216.444 1.00 0.00 ? 779  ILE A CG1   1 
ATOM   5892  C  CG2   . ILE A  1  779  ? 252.649 279.658 218.084 1.00 0.00 ? 779  ILE A CG2   1 
ATOM   5893  C  CD1   . ILE A  1  779  ? 255.240 278.843 215.404 1.00 0.00 ? 779  ILE A CD1   1 
ATOM   5894  N  N     . ASN A  1  780  ? 250.362 279.394 215.893 1.00 0.00 ? 780  ASN A N     1 
ATOM   5895  C  CA    . ASN A  1  780  ? 249.235 278.528 215.534 1.00 0.00 ? 780  ASN A CA    1 
ATOM   5896  C  C     . ASN A  1  780  ? 248.891 278.618 214.051 1.00 0.00 ? 780  ASN A C     1 
ATOM   5897  O  O     . ASN A  1  780  ? 248.619 277.603 213.425 1.00 0.00 ? 780  ASN A O     1 
ATOM   5898  C  CB    . ASN A  1  780  ? 248.028 278.868 216.391 1.00 0.00 ? 780  ASN A CB    1 
ATOM   5899  C  CG    . ASN A  1  780  ? 248.045 278.139 217.735 1.00 0.00 ? 780  ASN A CG    1 
ATOM   5900  O  OD1   . ASN A  1  780  ? 247.764 278.720 218.796 1.00 0.00 ? 780  ASN A OD1   1 
ATOM   5901  N  ND2   . ASN A  1  780  ? 248.333 276.843 217.687 1.00 0.00 ? 780  ASN A ND2   1 
ATOM   5902  N  N     . ILE A  1  781  ? 248.842 279.838 213.513 1.00 0.00 ? 781  ILE A N     1 
ATOM   5903  C  CA    . ILE A  1  781  ? 248.567 280.073 212.091 1.00 0.00 ? 781  ILE A CA    1 
ATOM   5904  C  C     . ILE A  1  781  ? 249.668 279.454 211.256 1.00 0.00 ? 781  ILE A C     1 
ATOM   5905  O  O     . ILE A  1  781  ? 249.420 278.816 210.267 1.00 0.00 ? 781  ILE A O     1 
ATOM   5906  C  CB    . ILE A  1  781  ? 248.494 281.545 211.698 1.00 0.00 ? 781  ILE A CB    1 
ATOM   5907  C  CG1   . ILE A  1  781  ? 247.361 282.257 212.409 1.00 0.00 ? 781  ILE A CG1   1 
ATOM   5908  C  CG2   . ILE A  1  781  ? 248.237 281.659 210.222 1.00 0.00 ? 781  ILE A CG2   1 
ATOM   5909  C  CD1   . ILE A  1  781  ? 247.335 283.736 212.133 1.00 0.00 ? 781  ILE A CD1   1 
ATOM   5910  N  N     . SER A  1  782  ? 250.894 279.636 211.698 1.00 0.00 ? 782  SER A N     1 
ATOM   5911  C  CA    . SER A  1  782  ? 252.038 279.075 211.026 1.00 0.00 ? 782  SER A CA    1 
ATOM   5912  C  C     . SER A  1  782  ? 251.880 277.581 210.877 1.00 0.00 ? 782  SER A C     1 
ATOM   5913  O  O     . SER A  1  782  ? 252.095 277.051 209.797 1.00 0.00 ? 782  SER A O     1 
ATOM   5914  C  CB    . SER A  1  782  ? 253.310 279.349 211.839 1.00 0.00 ? 782  SER A CB    1 
ATOM   5915  O  OG    . SER A  1  782  ? 253.491 280.735 212.098 1.00 0.00 ? 782  SER A OG    1 
ATOM   5916  N  N     . GLN A  1  783  ? 251.487 276.912 211.956 1.00 0.00 ? 783  GLN A N     1 
ATOM   5917  C  CA    . GLN A  1  783  ? 251.359 275.454 211.998 1.00 0.00 ? 783  GLN A CA    1 
ATOM   5918  C  C     . GLN A  1  783  ? 250.222 274.868 211.178 1.00 0.00 ? 783  GLN A C     1 
ATOM   5919  O  O     . GLN A  1  783  ? 250.393 273.821 210.593 1.00 0.00 ? 783  GLN A O     1 
ATOM   5920  C  CB    . GLN A  1  783  ? 251.216 275.050 213.452 1.00 0.00 ? 783  GLN A CB    1 
ATOM   5921  C  CG    . GLN A  1  783  ? 252.451 275.480 214.225 1.00 0.00 ? 783  GLN A CG    1 
ATOM   5922  C  CD    . GLN A  1  783  ? 252.698 274.734 215.498 1.00 0.00 ? 783  GLN A CD    1 
ATOM   5923  O  OE1   . GLN A  1  783  ? 251.755 274.269 216.178 1.00 0.00 ? 783  GLN A OE1   1 
ATOM   5924  N  NE2   . GLN A  1  783  ? 253.979 274.670 215.886 1.00 0.00 ? 783  GLN A NE2   1 
ATOM   5925  N  N     . VAL A  1  784  ? 249.053 275.497 211.142 1.00 0.00 ? 784  VAL A N     1 
ATOM   5926  C  CA    . VAL A  1  784  ? 247.981 274.904 210.341 1.00 0.00 ? 784  VAL A CA    1 
ATOM   5927  C  C     . VAL A  1  784  ? 248.259 275.058 208.849 1.00 0.00 ? 784  VAL A C     1 
ATOM   5928  O  O     . VAL A  1  784  ? 248.204 274.070 208.134 1.00 0.00 ? 784  VAL A O     1 
ATOM   5929  C  CB    . VAL A  1  784  ? 246.555 275.459 210.667 1.00 0.00 ? 784  VAL A CB    1 
ATOM   5930  C  CG1   . VAL A  1  784  ? 246.263 275.277 212.122 1.00 0.00 ? 784  VAL A CG1   1 
ATOM   5931  C  CG2   . VAL A  1  784  ? 246.409 276.902 210.360 1.00 0.00 ? 784  VAL A CG2   1 
ATOM   5932  N  N     . ILE A  1  785  ? 248.587 276.277 208.389 1.00 0.00 ? 785  ILE A N     1 
ATOM   5933  C  CA    . ILE A  1  785  ? 248.845 276.552 206.962 1.00 0.00 ? 785  ILE A CA    1 
ATOM   5934  C  C     . ILE A  1  785  ? 250.305 276.408 206.477 1.00 0.00 ? 785  ILE A C     1 
ATOM   5935  O  O     . ILE A  1  785  ? 250.548 275.723 205.492 1.00 0.00 ? 785  ILE A O     1 
ATOM   5936  C  CB    . ILE A  1  785  ? 248.311 277.975 206.537 1.00 0.00 ? 785  ILE A CB    1 
ATOM   5937  C  CG1   . ILE A  1  785  ? 248.784 278.313 205.145 1.00 0.00 ? 785  ILE A CG1   1 
ATOM   5938  C  CG2   . ILE A  1  785  ? 248.640 279.068 207.493 1.00 0.00 ? 785  ILE A CG2   1 
ATOM   5939  C  CD1   . ILE A  1  785  ? 248.191 277.377 204.101 1.00 0.00 ? 785  ILE A CD1   1 
ATOM   5940  N  N     . ALA A  1  786  ? 251.277 277.036 207.121 1.00 0.00 ? 786  ALA A N     1 
ATOM   5941  C  CA    . ALA A  1  786  ? 252.614 277.018 206.537 1.00 0.00 ? 786  ALA A CA    1 
ATOM   5942  C  C     . ALA A  1  786  ? 253.394 275.708 206.785 1.00 0.00 ? 786  ALA A C     1 
ATOM   5943  O  O     . ALA A  1  786  ? 253.459 274.866 205.895 1.00 0.00 ? 786  ALA A O     1 
ATOM   5944  C  CB    . ALA A  1  786  ? 253.398 278.187 207.037 1.00 0.00 ? 786  ALA A CB    1 
ATOM   5945  N  N     . VAL A  1  787  ? 253.972 275.516 207.970 1.00 0.00 ? 787  VAL A N     1 
ATOM   5946  C  CA    . VAL A  1  787  ? 254.800 274.326 208.225 1.00 0.00 ? 787  VAL A CA    1 
ATOM   5947  C  C     . VAL A  1  787  ? 255.015 274.108 209.717 1.00 0.00 ? 787  VAL A C     1 
ATOM   5948  O  O     . VAL A  1  787  ? 255.259 275.062 210.438 1.00 0.00 ? 787  VAL A O     1 
ATOM   5949  C  CB    . VAL A  1  787  ? 256.171 274.420 207.490 1.00 0.00 ? 787  VAL A CB    1 
ATOM   5950  C  CG1   . VAL A  1  787  ? 256.940 275.659 207.882 1.00 0.00 ? 787  VAL A CG1   1 
ATOM   5951  C  CG2   . VAL A  1  787  ? 256.998 273.174 207.728 1.00 0.00 ? 787  VAL A CG2   1 
ATOM   5952  N  N     . VAL A  1  788  ? 254.927 272.859 210.177 1.00 0.00 ? 788  VAL A N     1 
ATOM   5953  C  CA    . VAL A  1  788  ? 254.943 272.562 211.619 1.00 0.00 ? 788  VAL A CA    1 
ATOM   5954  C  C     . VAL A  1  788  ? 256.325 272.702 212.275 1.00 0.00 ? 788  VAL A C     1 
ATOM   5955  O  O     . VAL A  1  788  ? 256.433 273.178 213.418 1.00 0.00 ? 788  VAL A O     1 
ATOM   5956  C  CB    . VAL A  1  788  ? 254.424 271.127 211.922 1.00 0.00 ? 788  VAL A CB    1 
ATOM   5957  C  CG1   . VAL A  1  788  ? 254.419 270.835 213.425 1.00 0.00 ? 788  VAL A CG1   1 
ATOM   5958  C  CG2   . VAL A  1  788  ? 253.047 270.932 211.359 1.00 0.00 ? 788  VAL A CG2   1 
ATOM   5959  N  N     . GLY A  1  789  ? 257.385 272.305 211.580 1.00 0.00 ? 789  GLY A N     1 
ATOM   5960  C  CA    . GLY A  1  789  ? 258.715 272.539 212.112 1.00 0.00 ? 789  GLY A CA    1 
ATOM   5961  C  C     . GLY A  1  789  ? 259.313 271.394 212.919 1.00 0.00 ? 789  GLY A C     1 
ATOM   5962  O  O     . GLY A  1  789  ? 258.788 270.278 212.968 1.00 0.00 ? 789  GLY A O     1 
ATOM   5963  N  N     . GLN A  1  790  ? 260.433 271.704 213.559 1.00 0.00 ? 790  GLN A N     1 
ATOM   5964  C  CA    . GLN A  1  790  ? 261.241 270.757 214.313 1.00 0.00 ? 790  GLN A CA    1 
ATOM   5965  C  C     . GLN A  1  790  ? 260.630 270.374 215.664 1.00 0.00 ? 790  GLN A C     1 
ATOM   5966  O  O     . GLN A  1  790  ? 260.645 271.178 216.604 1.00 0.00 ? 790  GLN A O     1 
ATOM   5967  C  CB    . GLN A  1  790  ? 262.623 271.373 214.524 1.00 0.00 ? 790  GLN A CB    1 
ATOM   5968  C  CG    . GLN A  1  790  ? 263.576 270.547 215.302 1.00 0.00 ? 790  GLN A CG    1 
ATOM   5969  C  CD    . GLN A  1  790  ? 264.031 269.379 214.501 1.00 0.00 ? 790  GLN A CD    1 
ATOM   5970  O  OE1   . GLN A  1  790  ? 264.956 269.481 213.702 1.00 0.00 ? 790  GLN A OE1   1 
ATOM   5971  N  NE2   . GLN A  1  790  ? 263.361 268.259 214.677 1.00 0.00 ? 790  GLN A NE2   1 
ATOM   5972  N  N     . GLN A  1  791  ? 260.134 269.137 215.766 1.00 0.00 ? 791  GLN A N     1 
ATOM   5973  C  CA    . GLN A  1  791  ? 259.643 268.573 217.031 1.00 0.00 ? 791  GLN A CA    1 
ATOM   5974  C  C     . GLN A  1  791  ? 260.765 268.533 218.031 1.00 0.00 ? 791  GLN A C     1 
ATOM   5975  O  O     . GLN A  1  791  ? 261.928 268.605 217.650 1.00 0.00 ? 791  GLN A O     1 
ATOM   5976  C  CB    . GLN A  1  791  ? 259.099 267.159 216.849 1.00 0.00 ? 791  GLN A CB    1 
ATOM   5977  C  CG    . GLN A  1  791  ? 257.996 267.072 215.853 1.00 0.00 ? 791  GLN A CG    1 
ATOM   5978  C  CD    . GLN A  1  791  ? 257.005 268.179 216.068 1.00 0.00 ? 791  GLN A CD    1 
ATOM   5979  O  OE1   . GLN A  1  791  ? 256.437 268.316 217.154 1.00 0.00 ? 791  GLN A OE1   1 
ATOM   5980  N  NE2   . GLN A  1  791  ? 256.794 268.992 215.038 1.00 0.00 ? 791  GLN A NE2   1 
ATOM   5981  N  N     . ASN A  1  792  ? 260.444 268.418 219.308 1.00 0.00 ? 792  ASN A N     1 
ATOM   5982  C  CA    . ASN A  1  792  ? 261.511 268.427 220.284 1.00 0.00 ? 792  ASN A CA    1 
ATOM   5983  C  C     . ASN A  1  792  ? 261.250 267.506 221.450 1.00 0.00 ? 792  ASN A C     1 
ATOM   5984  O  O     . ASN A  1  792  ? 260.104 267.237 221.759 1.00 0.00 ? 792  ASN A O     1 
ATOM   5985  C  CB    . ASN A  1  792  ? 261.708 269.843 220.790 1.00 0.00 ? 792  ASN A CB    1 
ATOM   5986  C  CG    . ASN A  1  792  ? 263.013 270.012 221.499 1.00 0.00 ? 792  ASN A CG    1 
ATOM   5987  O  OD1   . ASN A  1  792  ? 263.184 269.519 222.621 1.00 0.00 ? 792  ASN A OD1   1 
ATOM   5988  N  ND2   . ASN A  1  792  ? 263.941 270.746 220.873 1.00 0.00 ? 792  ASN A ND2   1 
ATOM   5989  N  N     . VAL A  1  793  ? 262.304 267.033 222.108 1.00 0.00 ? 793  VAL A N     1 
ATOM   5990  C  CA    . VAL A  1  793  ? 262.157 266.408 223.432 1.00 0.00 ? 793  VAL A CA    1 
ATOM   5991  C  C     . VAL A  1  793  ? 263.308 266.746 224.375 1.00 0.00 ? 793  VAL A C     1 
ATOM   5992  O  O     . VAL A  1  793  ? 264.471 266.628 224.003 1.00 0.00 ? 793  VAL A O     1 
ATOM   5993  C  CB    . VAL A  1  793  ? 262.061 264.870 223.355 1.00 0.00 ? 793  VAL A CB    1 
ATOM   5994  C  CG1   . VAL A  1  793  ? 260.702 264.446 222.853 1.00 0.00 ? 793  VAL A CG1   1 
ATOM   5995  C  CG2   . VAL A  1  793  ? 263.171 264.297 222.501 1.00 0.00 ? 793  VAL A CG2   1 
ATOM   5996  N  N     . GLU A  1  794  ? 262.983 267.153 225.598 1.00 0.00 ? 794  GLU A N     1 
ATOM   5997  C  CA    . GLU A  1  794  ? 263.997 267.457 226.606 1.00 0.00 ? 794  GLU A CA    1 
ATOM   5998  C  C     . GLU A  1  794  ? 264.948 268.580 226.169 1.00 0.00 ? 794  GLU A C     1 
ATOM   5999  O  O     . GLU A  1  794  ? 266.077 268.667 226.664 1.00 0.00 ? 794  GLU A O     1 
ATOM   6000  C  CB    . GLU A  1  794  ? 264.811 266.202 226.948 1.00 0.00 ? 794  GLU A CB    1 
ATOM   6001  C  CG    . GLU A  1  794  ? 263.991 264.988 227.358 1.00 0.00 ? 794  GLU A CG    1 
ATOM   6002  C  CD    . GLU A  1  794  ? 264.841 263.919 228.029 1.00 0.00 ? 794  GLU A CD    1 
ATOM   6003  O  OE1   . GLU A  1  794  ? 265.885 263.532 227.447 1.00 0.00 ? 794  GLU A OE1   1 
ATOM   6004  O  OE2   . GLU A  1  794  ? 264.468 263.480 229.143 1.00 0.00 ? 794  GLU A OE2   1 
ATOM   6005  N  N     . GLY A  1  795  ? 264.512 269.417 225.226 1.00 0.00 ? 795  GLY A N     1 
ATOM   6006  C  CA    . GLY A  1  795  ? 265.338 270.522 224.753 1.00 0.00 ? 795  GLY A CA    1 
ATOM   6007  C  C     . GLY A  1  795  ? 266.240 270.315 223.544 1.00 0.00 ? 795  GLY A C     1 
ATOM   6008  O  O     . GLY A  1  795  ? 266.994 271.222 223.188 1.00 0.00 ? 795  GLY A O     1 
ATOM   6009  N  N     . LYS A  1  796  ? 266.182 269.134 222.928 1.00 0.00 ? 796  LYS A N     1 
ATOM   6010  C  CA    . LYS A  1  796  ? 266.958 268.830 221.716 1.00 0.00 ? 796  LYS A CA    1 
ATOM   6011  C  C     . LYS A  1  796  ? 266.158 267.984 220.703 1.00 0.00 ? 796  LYS A C     1 
ATOM   6012  O  O     . LYS A  1  796  ? 265.081 267.497 221.022 1.00 0.00 ? 796  LYS A O     1 
ATOM   6013  C  CB    . LYS A  1  796  ? 268.266 268.148 222.110 1.00 0.00 ? 796  LYS A CB    1 
ATOM   6014  C  CG    . LYS A  1  796  ? 268.106 267.000 223.089 1.00 0.00 ? 796  LYS A CG    1 
ATOM   6015  C  CD    . LYS A  1  796  ? 269.419 266.732 223.826 1.00 0.00 ? 796  LYS A CD    1 
ATOM   6016  C  CE    . LYS A  1  796  ? 270.556 266.396 222.854 1.00 0.00 ? 796  LYS A CE    1 
ATOM   6017  N  NZ    . LYS A  1  796  ? 271.814 265.981 223.549 1.00 0.00 ? 796  LYS A NZ    1 
ATOM   6018  N  N     . ARG A  1  797  ? 266.649 267.868 219.470 1.00 0.00 ? 797  ARG A N     1 
ATOM   6019  C  CA    . ARG A  1  797  ? 266.002 267.055 218.427 1.00 0.00 ? 797  ARG A CA    1 
ATOM   6020  C  C     . ARG A  1  797  ? 265.861 265.576 218.815 1.00 0.00 ? 797  ARG A C     1 
ATOM   6021  O  O     . ARG A  1  797  ? 266.592 265.084 219.681 1.00 0.00 ? 797  ARG A O     1 
ATOM   6022  C  CB    . ARG A  1  797  ? 266.780 267.180 217.127 1.00 0.00 ? 797  ARG A CB    1 
ATOM   6023  C  CG    . ARG A  1  797  ? 266.983 268.614 216.709 1.00 0.00 ? 797  ARG A CG    1 
ATOM   6024  C  CD    . ARG A  1  797  ? 268.104 268.731 215.704 1.00 0.00 ? 797  ARG A CD    1 
ATOM   6025  N  NE    . ARG A  1  797  ? 267.692 268.374 214.360 1.00 0.00 ? 797  ARG A NE    1 
ATOM   6026  C  CZ    . ARG A  1  797  ? 268.496 267.802 213.481 1.00 0.00 ? 797  ARG A CZ    1 
ATOM   6027  N  NH1   . ARG A  1  797  ? 269.746 267.503 213.816 1.00 0.00 ? 797  ARG A NH1   1 
ATOM   6028  N  NH2   . ARG A  1  797  ? 268.040 267.523 212.272 1.00 0.00 ? 797  ARG A NH2   1 
ATOM   6029  N  N     . ILE A  1  798  ? 264.893 264.897 218.196 1.00 0.00 ? 798  ILE A N     1 
ATOM   6030  C  CA    . ILE A  1  798  ? 264.574 263.475 218.440 1.00 0.00 ? 798  ILE A CA    1 
ATOM   6031  C  C     . ILE A  1  798  ? 265.803 262.610 218.695 1.00 0.00 ? 798  ILE A C     1 
ATOM   6032  O  O     . ILE A  1  798  ? 266.767 262.706 217.955 1.00 0.00 ? 798  ILE A O     1 
ATOM   6033  C  CB    . ILE A  1  798  ? 263.775 262.908 217.244 1.00 0.00 ? 798  ILE A CB    1 
ATOM   6034  C  CG1   . ILE A  1  798  ? 262.486 263.715 217.032 1.00 0.00 ? 798  ILE A CG1   1 
ATOM   6035  C  CG2   . ILE A  1  798  ? 263.420 261.465 217.445 1.00 0.00 ? 798  ILE A CG2   1 
ATOM   6036  C  CD1   . ILE A  1  798  ? 261.564 263.744 218.252 1.00 0.00 ? 798  ILE A CD1   1 
ATOM   6037  N  N     . PRO A  1  799  ? 265.783 261.786 219.760 1.00 0.00 ? 799  PRO A N     1 
ATOM   6038  C  CA    . PRO A  1  799  ? 266.927 260.956 220.202 1.00 0.00 ? 799  PRO A CA    1 
ATOM   6039  C  C     . PRO A  1  799  ? 267.212 259.748 219.317 1.00 0.00 ? 799  PRO A C     1 
ATOM   6040  O  O     . PRO A  1  799  ? 266.314 259.332 218.609 1.00 0.00 ? 799  PRO A O     1 
ATOM   6041  C  CB    . PRO A  1  799  ? 266.481 260.460 221.577 1.00 0.00 ? 799  PRO A CB    1 
ATOM   6042  C  CG    . PRO A  1  799  ? 264.997 260.358 221.450 1.00 0.00 ? 799  PRO A CG    1 
ATOM   6043  C  CD    . PRO A  1  799  ? 264.603 261.567 220.615 1.00 0.00 ? 799  PRO A CD    1 
ATOM   6044  N  N     . PHE A  1  800  ? 268.401 259.168 219.353 1.00 0.00 ? 800  PHE A N     1 
ATOM   6045  C  CA    . PHE A  1  800  ? 268.574 257.928 218.595 1.00 0.00 ? 800  PHE A CA    1 
ATOM   6046  C  C     . PHE A  1  800  ? 268.097 256.684 219.356 1.00 0.00 ? 800  PHE A C     1 
ATOM   6047  O  O     . PHE A  1  800  ? 268.914 255.954 219.937 1.00 0.00 ? 800  PHE A O     1 
ATOM   6048  C  CB    . PHE A  1  800  ? 270.014 257.768 218.158 1.00 0.00 ? 800  PHE A CB    1 
ATOM   6049  C  CG    . PHE A  1  800  ? 270.413 258.767 217.158 1.00 0.00 ? 800  PHE A CG    1 
ATOM   6050  C  CD1   . PHE A  1  800  ? 270.025 258.616 215.851 1.00 0.00 ? 800  PHE A CD1   1 
ATOM   6051  C  CD2   . PHE A  1  800  ? 271.145 259.871 217.514 1.00 0.00 ? 800  PHE A CD2   1 
ATOM   6052  C  CE1   . PHE A  1  800  ? 270.363 259.535 214.909 1.00 0.00 ? 800  PHE A CE1   1 
ATOM   6053  C  CE2   . PHE A  1  800  ? 271.496 260.797 216.570 1.00 0.00 ? 800  PHE A CE2   1 
ATOM   6054  C  CZ    . PHE A  1  800  ? 271.100 260.618 215.263 1.00 0.00 ? 800  PHE A CZ    1 
ATOM   6055  N  N     . GLY A  1  801  ? 266.779 256.443 219.334 1.00 0.00 ? 801  GLY A N     1 
ATOM   6056  C  CA    . GLY A  1  801  ? 266.156 255.398 220.132 1.00 0.00 ? 801  GLY A CA    1 
ATOM   6057  C  C     . GLY A  1  801  ? 266.803 254.078 219.816 1.00 0.00 ? 801  GLY A C     1 
ATOM   6058  O  O     . GLY A  1  801  ? 267.207 253.345 220.718 1.00 0.00 ? 801  GLY A O     1 
ATOM   6059  N  N     . PHE A  1  802  ? 266.920 253.803 218.522 1.00 0.00 ? 802  PHE A N     1 
ATOM   6060  C  CA    . PHE A  1  802  ? 267.704 252.685 218.010 1.00 0.00 ? 802  PHE A CA    1 
ATOM   6061  C  C     . PHE A  1  802  ? 269.197 253.053 217.933 1.00 0.00 ? 802  PHE A C     1 
ATOM   6062  O  O     . PHE A  1  802  ? 269.561 254.221 218.092 1.00 0.00 ? 802  PHE A O     1 
ATOM   6063  C  CB    . PHE A  1  802  ? 267.209 252.283 216.622 1.00 0.00 ? 802  PHE A CB    1 
ATOM   6064  C  CG    . PHE A  1  802  ? 265.810 251.792 216.600 1.00 0.00 ? 802  PHE A CG    1 
ATOM   6065  C  CD1   . PHE A  1  802  ? 265.534 250.458 216.800 1.00 0.00 ? 802  PHE A CD1   1 
ATOM   6066  C  CD2   . PHE A  1  802  ? 264.764 252.667 216.360 1.00 0.00 ? 802  PHE A CD2   1 
ATOM   6067  C  CE1   . PHE A  1  802  ? 264.223 249.996 216.766 1.00 0.00 ? 802  PHE A CE1   1 
ATOM   6068  C  CE2   . PHE A  1  802  ? 263.452 252.225 216.327 1.00 0.00 ? 802  PHE A CE2   1 
ATOM   6069  C  CZ    . PHE A  1  802  ? 263.177 250.880 216.527 1.00 0.00 ? 802  PHE A CZ    1 
ATOM   6070  N  N     . LYS A  1  803  ? 270.059 252.060 217.709 1.00 0.00 ? 803  LYS A N     1 
ATOM   6071  C  CA    . LYS A  1  803  ? 271.468 252.323 217.406 1.00 0.00 ? 803  LYS A CA    1 
ATOM   6072  C  C     . LYS A  1  803  ? 271.679 253.272 216.218 1.00 0.00 ? 803  LYS A C     1 
ATOM   6073  O  O     . LYS A  1  803  ? 271.486 252.885 215.067 1.00 0.00 ? 803  LYS A O     1 
ATOM   6074  C  CB    . LYS A  1  803  ? 272.205 251.008 217.149 1.00 0.00 ? 803  LYS A CB    1 
ATOM   6075  C  CG    . LYS A  1  803  ? 272.587 250.284 218.430 1.00 0.00 ? 803  LYS A CG    1 
ATOM   6076  C  CD    . LYS A  1  803  ? 273.417 249.031 218.152 1.00 0.00 ? 803  LYS A CD    1 
ATOM   6077  C  CE    . LYS A  1  803  ? 273.643 248.227 219.435 1.00 0.00 ? 803  LYS A CE    1 
ATOM   6078  N  NZ    . LYS A  1  803  ? 272.397 248.071 220.268 1.00 0.00 ? 803  LYS A NZ    1 
ATOM   6079  N  N     . HIS A  1  804  ? 272.068 254.511 216.513 1.00 0.00 ? 804  HIS A N     1 
ATOM   6080  C  CA    . HIS A  1  804  ? 272.377 255.514 215.499 1.00 0.00 ? 804  HIS A CA    1 
ATOM   6081  C  C     . HIS A  1  804  ? 271.246 255.793 214.489 1.00 0.00 ? 804  HIS A C     1 
ATOM   6082  O  O     . HIS A  1  804  ? 271.510 256.192 213.354 1.00 0.00 ? 804  HIS A O     1 
ATOM   6083  C  CB    . HIS A  1  804  ? 273.655 255.105 214.743 1.00 0.00 ? 804  HIS A CB    1 
ATOM   6084  C  CG    . HIS A  1  804  ? 274.868 254.932 215.615 1.00 0.00 ? 804  HIS A CG    1 
ATOM   6085  N  ND1   . HIS A  1  804  ? 275.760 255.956 215.861 1.00 0.00 ? 804  HIS A ND1   1 
ATOM   6086  C  CD2   . HIS A  1  804  ? 275.355 253.849 216.268 1.00 0.00 ? 804  HIS A CD2   1 
ATOM   6087  C  CE1   . HIS A  1  804  ? 276.730 255.518 216.645 1.00 0.00 ? 804  HIS A CE1   1 
ATOM   6088  N  NE2   . HIS A  1  804  ? 276.509 254.242 216.907 1.00 0.00 ? 804  HIS A NE2   1 
ATOM   6089  N  N     . ARG A  1  805  ? 269.998 255.573 214.896 1.00 0.00 ? 805  ARG A N     1 
ATOM   6090  C  CA    . ARG A  1  805  ? 268.815 255.908 214.084 1.00 0.00 ? 805  ARG A CA    1 
ATOM   6091  C  C     . ARG A  1  805  ? 267.648 256.331 214.988 1.00 0.00 ? 805  ARG A C     1 
ATOM   6092  O  O     . ARG A  1  805  ? 267.628 255.966 216.162 1.00 0.00 ? 805  ARG A O     1 
ATOM   6093  C  CB    . ARG A  1  805  ? 268.400 254.728 213.223 1.00 0.00 ? 805  ARG A CB    1 
ATOM   6094  C  CG    . ARG A  1  805  ? 269.393 254.371 212.167 1.00 0.00 ? 805  ARG A CG    1 
ATOM   6095  C  CD    . ARG A  1  805  ? 268.766 253.474 211.155 1.00 0.00 ? 805  ARG A CD    1 
ATOM   6096  N  NE    . ARG A  1  805  ? 268.427 252.182 211.729 1.00 0.00 ? 805  ARG A NE    1 
ATOM   6097  C  CZ    . ARG A  1  805  ? 267.721 251.259 211.089 1.00 0.00 ? 805  ARG A CZ    1 
ATOM   6098  N  NH1   . ARG A  1  805  ? 267.290 251.496 209.858 1.00 0.00 ? 805  ARG A NH1   1 
ATOM   6099  N  NH2   . ARG A  1  805  ? 267.443 250.106 211.680 1.00 0.00 ? 805  ARG A NH2   1 
ATOM   6100  N  N     . THR A  1  806  ? 266.692 257.113 214.482 1.00 0.00 ? 806  THR A N     1 
ATOM   6101  C  CA    . THR A  1  806  ? 265.473 257.353 215.267 1.00 0.00 ? 806  THR A CA    1 
ATOM   6102  C  C     . THR A  1  806  ? 264.322 256.399 214.912 1.00 0.00 ? 806  THR A C     1 
ATOM   6103  O  O     . THR A  1  806  ? 263.514 256.070 215.764 1.00 0.00 ? 806  THR A O     1 
ATOM   6104  C  CB    . THR A  1  806  ? 264.944 258.784 215.144 1.00 0.00 ? 806  THR A CB    1 
ATOM   6105  O  OG1   . THR A  1  806  ? 264.681 259.085 213.779 1.00 0.00 ? 806  THR A OG1   1 
ATOM   6106  C  CG2   . THR A  1  806  ? 265.936 259.750 215.672 1.00 0.00 ? 806  THR A CG2   1 
ATOM   6107  N  N     . LEU A  1  807  ? 264.227 255.941 213.680 1.00 0.00 ? 807  LEU A N     1 
ATOM   6108  C  CA    . LEU A  1  807  ? 263.154 255.034 213.350 1.00 0.00 ? 807  LEU A CA    1 
ATOM   6109  C  C     . LEU A  1  807  ? 263.829 254.041 212.473 1.00 0.00 ? 807  LEU A C     1 
ATOM   6110  O  O     . LEU A  1  807  ? 264.883 254.362 211.966 1.00 0.00 ? 807  LEU A O     1 
ATOM   6111  C  CB    . LEU A  1  807  ? 262.017 255.759 212.643 1.00 0.00 ? 807  LEU A CB    1 
ATOM   6112  C  CG    . LEU A  1  807  ? 261.096 256.666 213.454 1.00 0.00 ? 807  LEU A CG    1 
ATOM   6113  C  CD1   . LEU A  1  807  ? 260.096 257.330 212.571 1.00 0.00 ? 807  LEU A CD1   1 
ATOM   6114  C  CD2   . LEU A  1  807  ? 260.369 255.828 214.451 1.00 0.00 ? 807  LEU A CD2   1 
ATOM   6115  N  N     . PRO A  1  808  ? 263.274 252.828 212.301 1.00 0.00 ? 808  PRO A N     1 
ATOM   6116  C  CA    . PRO A  1  808  ? 264.014 251.896 211.436 1.00 0.00 ? 808  PRO A CA    1 
ATOM   6117  C  C     . PRO A  1  808  ? 264.008 252.321 209.965 1.00 0.00 ? 808  PRO A C     1 
ATOM   6118  O  O     . PRO A  1  808  ? 264.824 251.870 209.179 1.00 0.00 ? 808  PRO A O     1 
ATOM   6119  C  CB    . PRO A  1  808  ? 263.281 250.567 211.637 1.00 0.00 ? 808  PRO A CB    1 
ATOM   6120  C  CG    . PRO A  1  808  ? 261.923 250.953 212.058 1.00 0.00 ? 808  PRO A CG    1 
ATOM   6121  C  CD    . PRO A  1  808  ? 262.065 252.211 212.865 1.00 0.00 ? 808  PRO A CD    1 
ATOM   6122  N  N     . HIS A  1  809  ? 263.149 253.261 209.623 1.00 0.00 ? 809  HIS A N     1 
ATOM   6123  C  CA    . HIS A  1  809  ? 262.989 253.678 208.247 1.00 0.00 ? 809  HIS A CA    1 
ATOM   6124  C  C     . HIS A  1  809  ? 264.128 254.509 207.687 1.00 0.00 ? 809  HIS A C     1 
ATOM   6125  O  O     . HIS A  1  809  ? 264.251 254.655 206.467 1.00 0.00 ? 809  HIS A O     1 
ATOM   6126  C  CB    . HIS A  1  809  ? 261.693 254.466 208.146 1.00 0.00 ? 809  HIS A CB    1 
ATOM   6127  C  CG    . HIS A  1  809  ? 260.509 253.698 208.634 1.00 0.00 ? 809  HIS A CG    1 
ATOM   6128  N  ND1   . HIS A  1  809  ? 259.862 252.762 207.854 1.00 0.00 ? 809  HIS A ND1   1 
ATOM   6129  C  CD2   . HIS A  1  809  ? 259.894 253.668 209.842 1.00 0.00 ? 809  HIS A CD2   1 
ATOM   6130  C  CE1   . HIS A  1  809  ? 258.874 252.225 208.545 1.00 0.00 ? 809  HIS A CE1   1 
ATOM   6131  N  NE2   . HIS A  1  809  ? 258.877 252.746 209.758 1.00 0.00 ? 809  HIS A NE2   1 
ATOM   6132  N  N     . PHE A  1  810  ? 264.981 255.032 208.554 1.00 0.00 ? 810  PHE A N     1 
ATOM   6133  C  CA    . PHE A  1  810  ? 266.020 255.920 208.067 1.00 0.00 ? 810  PHE A CA    1 
ATOM   6134  C  C     . PHE A  1  810  ? 267.324 255.172 207.916 1.00 0.00 ? 810  PHE A C     1 
ATOM   6135  O  O     . PHE A  1  810  ? 267.480 254.078 208.462 1.00 0.00 ? 810  PHE A O     1 
ATOM   6136  C  CB    . PHE A  1  810  ? 266.212 257.095 209.009 1.00 0.00 ? 810  PHE A CB    1 
ATOM   6137  C  CG    . PHE A  1  810  ? 265.010 257.941 209.159 1.00 0.00 ? 810  PHE A CG    1 
ATOM   6138  C  CD1   . PHE A  1  810  ? 264.583 258.736 208.130 1.00 0.00 ? 810  PHE A CD1   1 
ATOM   6139  C  CD2   . PHE A  1  810  ? 264.291 257.927 210.329 1.00 0.00 ? 810  PHE A CD2   1 
ATOM   6140  C  CE1   . PHE A  1  810  ? 263.457 259.521 208.278 1.00 0.00 ? 810  PHE A CE1   1 
ATOM   6141  C  CE2   . PHE A  1  810  ? 263.175 258.699 210.478 1.00 0.00 ? 810  PHE A CE2   1 
ATOM   6142  C  CZ    . PHE A  1  810  ? 262.756 259.501 209.459 1.00 0.00 ? 810  PHE A CZ    1 
ATOM   6143  N  N     . ILE A  1  811  ? 268.259 255.785 207.191 1.00 0.00 ? 811  ILE A N     1 
ATOM   6144  C  CA    . ILE A  1  811  ? 269.610 255.264 207.056 1.00 0.00 ? 811  ILE A CA    1 
ATOM   6145  C  C     . ILE A  1  811  ? 270.357 255.579 208.338 1.00 0.00 ? 811  ILE A C     1 
ATOM   6146  O  O     . ILE A  1  811  ? 269.959 256.479 209.087 1.00 0.00 ? 811  ILE A O     1 
ATOM   6147  C  CB    . ILE A  1  811  ? 270.349 255.874 205.859 1.00 0.00 ? 811  ILE A CB    1 
ATOM   6148  C  CG1   . ILE A  1  811  ? 271.439 254.919 205.397 1.00 0.00 ? 811  ILE A CG1   1 
ATOM   6149  C  CG2   . ILE A  1  811  ? 270.942 257.242 206.203 1.00 0.00 ? 811  ILE A CG2   1 
ATOM   6150  C  CD1   . ILE A  1  811  ? 270.889 253.644 204.803 1.00 0.00 ? 811  ILE A CD1   1 
ATOM   6151  N  N     . LYS A  1  812  ? 271.418 254.834 208.622 1.00 0.00 ? 812  LYS A N     1 
ATOM   6152  C  CA    . LYS A  1  812  ? 272.157 255.097 209.851 1.00 0.00 ? 812  LYS A CA    1 
ATOM   6153  C  C     . LYS A  1  812  ? 272.913 256.411 209.777 1.00 0.00 ? 812  LYS A C     1 
ATOM   6154  O  O     . LYS A  1  812  ? 273.410 256.806 208.713 1.00 0.00 ? 812  LYS A O     1 
ATOM   6155  C  CB    . LYS A  1  812  ? 273.121 253.956 210.183 1.00 0.00 ? 812  LYS A CB    1 
ATOM   6156  C  CG    . LYS A  1  812  ? 272.465 252.876 210.980 1.00 0.00 ? 812  LYS A CG    1 
ATOM   6157  C  CD    . LYS A  1  812  ? 273.418 251.820 211.426 1.00 0.00 ? 812  LYS A CD    1 
ATOM   6158  C  CE    . LYS A  1  812  ? 272.650 250.797 212.234 1.00 0.00 ? 812  LYS A CE    1 
ATOM   6159  N  NZ    . LYS A  1  812  ? 273.379 249.521 212.443 1.00 0.00 ? 812  LYS A NZ    1 
ATOM   6160  N  N     . ASP A  1  813  ? 272.969 257.079 210.924 1.00 0.00 ? 813  ASP A N     1 
ATOM   6161  C  CA    . ASP A  1  813  ? 273.688 258.323 211.055 1.00 0.00 ? 813  ASP A CA    1 
ATOM   6162  C  C     . ASP A  1  813  ? 273.225 259.313 210.005 1.00 0.00 ? 813  ASP A C     1 
ATOM   6163  O  O     . ASP A  1  813  ? 274.008 259.762 209.158 1.00 0.00 ? 813  ASP A O     1 
ATOM   6164  C  CB    . ASP A  1  813  ? 275.183 258.093 210.939 1.00 0.00 ? 813  ASP A CB    1 
ATOM   6165  C  CG    . ASP A  1  813  ? 275.985 259.189 211.611 1.00 0.00 ? 813  ASP A CG    1 
ATOM   6166  O  OD1   . ASP A  1  813  ? 275.608 259.582 212.743 1.00 0.00 ? 813  ASP A OD1   1 
ATOM   6167  O  OD2   . ASP A  1  813  ? 276.974 259.668 210.998 1.00 0.00 ? 813  ASP A OD2   1 
ATOM   6168  N  N     . ASP A  1  814  ? 271.934 259.617 210.035 1.00 0.00 ? 814  ASP A N     1 
ATOM   6169  C  CA    . ASP A  1  814  ? 271.386 260.623 209.139 1.00 0.00 ? 814  ASP A CA    1 
ATOM   6170  C  C     . ASP A  1  814  ? 271.021 261.843 209.946 1.00 0.00 ? 814  ASP A C     1 
ATOM   6171  O  O     . ASP A  1  814  ? 270.068 261.821 210.714 1.00 0.00 ? 814  ASP A O     1 
ATOM   6172  C  CB    . ASP A  1  814  ? 270.171 260.113 208.378 1.00 0.00 ? 814  ASP A CB    1 
ATOM   6173  C  CG    . ASP A  1  814  ? 269.779 261.050 207.265 1.00 0.00 ? 814  ASP A CG    1 
ATOM   6174  O  OD1   . ASP A  1  814  ? 270.438 261.027 206.202 1.00 0.00 ? 814  ASP A OD1   1 
ATOM   6175  O  OD2   . ASP A  1  814  ? 268.833 261.833 207.461 1.00 0.00 ? 814  ASP A OD2   1 
ATOM   6176  N  N     . TYR A  1  815  ? 271.788 262.908 209.770 1.00 0.00 ? 815  TYR A N     1 
ATOM   6177  C  CA    . TYR A  1  815  ? 271.604 264.091 210.583 1.00 0.00 ? 815  TYR A CA    1 
ATOM   6178  C  C     . TYR A  1  815  ? 270.800 265.178 209.917 1.00 0.00 ? 815  TYR A C     1 
ATOM   6179  O  O     . TYR A  1  815  ? 270.712 266.281 210.431 1.00 0.00 ? 815  TYR A O     1 
ATOM   6180  C  CB    . TYR A  1  815  ? 272.952 264.628 210.991 1.00 0.00 ? 815  TYR A CB    1 
ATOM   6181  C  CG    . TYR A  1  815  ? 273.459 263.952 212.221 1.00 0.00 ? 815  TYR A CG    1 
ATOM   6182  C  CD1   . TYR A  1  815  ? 272.585 263.334 213.079 1.00 0.00 ? 815  TYR A CD1   1 
ATOM   6183  C  CD2   . TYR A  1  815  ? 274.809 263.922 212.515 1.00 0.00 ? 815  TYR A CD2   1 
ATOM   6184  C  CE1   . TYR A  1  815  ? 273.027 262.724 214.192 1.00 0.00 ? 815  TYR A CE1   1 
ATOM   6185  C  CE2   . TYR A  1  815  ? 275.261 263.305 213.643 1.00 0.00 ? 815  TYR A CE2   1 
ATOM   6186  C  CZ    . TYR A  1  815  ? 274.358 262.699 214.483 1.00 0.00 ? 815  TYR A CZ    1 
ATOM   6187  O  OH    . TYR A  1  815  ? 274.772 262.066 215.634 1.00 0.00 ? 815  TYR A OH    1 
ATOM   6188  N  N     . GLY A  1  816  ? 270.210 264.859 208.775 1.00 0.00 ? 816  GLY A N     1 
ATOM   6189  C  CA    . GLY A  1  816  ? 269.363 265.793 208.063 1.00 0.00 ? 816  GLY A CA    1 
ATOM   6190  C  C     . GLY A  1  816  ? 268.155 266.174 208.887 1.00 0.00 ? 816  GLY A C     1 
ATOM   6191  O  O     . GLY A  1  816  ? 268.081 265.844 210.056 1.00 0.00 ? 816  GLY A O     1 
ATOM   6192  N  N     . PRO A  1  817  ? 267.208 266.894 208.284 1.00 0.00 ? 817  PRO A N     1 
ATOM   6193  C  CA    . PRO A  1  817  ? 266.007 267.393 208.970 1.00 0.00 ? 817  PRO A CA    1 
ATOM   6194  C  C     . PRO A  1  817  ? 264.940 266.328 209.280 1.00 0.00 ? 817  PRO A C     1 
ATOM   6195  O  O     . PRO A  1  817  ? 264.627 266.147 210.468 1.00 0.00 ? 817  PRO A O     1 
ATOM   6196  C  CB    . PRO A  1  817  ? 265.455 268.442 208.009 1.00 0.00 ? 817  PRO A CB    1 
ATOM   6197  C  CG    . PRO A  1  817  ? 266.003 268.087 206.686 1.00 0.00 ? 817  PRO A CG    1 
ATOM   6198  C  CD    . PRO A  1  817  ? 267.287 267.339 206.885 1.00 0.00 ? 817  PRO A CD    1 
ATOM   6199  N  N     . GLU A  1  818  ? 264.365 265.678 208.263 1.00 0.00 ? 818  GLU A N     1 
ATOM   6200  C  CA    . GLU A  1  818  ? 263.286 264.707 208.496 1.00 0.00 ? 818  GLU A CA    1 
ATOM   6201  C  C     . GLU A  1  818  ? 263.694 263.578 209.441 1.00 0.00 ? 818  GLU A C     1 
ATOM   6202  O  O     . GLU A  1  818  ? 262.925 263.185 210.313 1.00 0.00 ? 818  GLU A O     1 
ATOM   6203  C  CB    . GLU A  1  818  ? 262.790 264.081 207.193 1.00 0.00 ? 818  GLU A CB    1 
ATOM   6204  C  CG    . GLU A  1  818  ? 263.873 263.499 206.355 1.00 0.00 ? 818  GLU A CG    1 
ATOM   6205  C  CD    . GLU A  1  818  ? 264.331 264.465 205.294 1.00 0.00 ? 818  GLU A CD    1 
ATOM   6206  O  OE1   . GLU A  1  818  ? 264.806 265.562 205.680 1.00 0.00 ? 818  GLU A OE1   1 
ATOM   6207  O  OE2   . GLU A  1  818  ? 264.223 264.132 204.085 1.00 0.00 ? 818  GLU A OE2   1 
ATOM   6208  N  N     . SER A  1  819  ? 264.886 263.032 209.253 1.00 0.00 ? 819  SER A N     1 
ATOM   6209  C  CA    . SER A  1  819  ? 265.321 261.905 210.061 1.00 0.00 ? 819  SER A CA    1 
ATOM   6210  C  C     . SER A  1  819  ? 265.447 262.215 211.544 1.00 0.00 ? 819  SER A C     1 
ATOM   6211  O  O     . SER A  1  819  ? 265.257 261.331 212.365 1.00 0.00 ? 819  SER A O     1 
ATOM   6212  C  CB    . SER A  1  819  ? 266.656 261.415 209.553 1.00 0.00 ? 819  SER A CB    1 
ATOM   6213  O  OG    . SER A  1  819  ? 267.561 262.503 209.457 1.00 0.00 ? 819  SER A OG    1 
ATOM   6214  N  N     . ARG A  1  820  ? 265.832 263.445 211.880 1.00 0.00 ? 820  ARG A N     1 
ATOM   6215  C  CA    . ARG A  1  820  ? 265.914 263.884 213.268 1.00 0.00 ? 820  ARG A CA    1 
ATOM   6216  C  C     . ARG A  1  820  ? 264.691 264.667 213.672 1.00 0.00 ? 820  ARG A C     1 
ATOM   6217  O  O     . ARG A  1  820  ? 264.732 265.445 214.608 1.00 0.00 ? 820  ARG A O     1 
ATOM   6218  C  CB    . ARG A  1  820  ? 267.161 264.701 213.528 1.00 0.00 ? 820  ARG A CB    1 
ATOM   6219  C  CG    . ARG A  1  820  ? 268.449 263.937 213.279 1.00 0.00 ? 820  ARG A CG    1 
ATOM   6220  C  CD    . ARG A  1  820  ? 268.735 262.778 214.246 1.00 0.00 ? 820  ARG A CD    1 
ATOM   6221  N  NE    . ARG A  1  820  ? 268.728 263.096 215.682 1.00 0.00 ? 820  ARG A NE    1 
ATOM   6222  C  CZ    . ARG A  1  820  ? 269.536 263.968 216.301 1.00 0.00 ? 820  ARG A CZ    1 
ATOM   6223  N  NH1   . ARG A  1  820  ? 270.458 264.649 215.633 1.00 0.00 ? 820  ARG A NH1   1 
ATOM   6224  N  NH2   . ARG A  1  820  ? 269.372 264.231 217.588 1.00 0.00 ? 820  ARG A NH2   1 
ATOM   6225  N  N     . GLY A  1  821  ? 263.610 264.509 212.934 1.00 0.00 ? 821  GLY A N     1 
ATOM   6226  C  CA    . GLY A  1  821  ? 262.329 264.819 213.521 1.00 0.00 ? 821  GLY A CA    1 
ATOM   6227  C  C     . GLY A  1  821  ? 261.784 266.176 213.193 1.00 0.00 ? 821  GLY A C     1 
ATOM   6228  O  O     . GLY A  1  821  ? 261.122 266.780 214.037 1.00 0.00 ? 821  GLY A O     1 
ATOM   6229  N  N     . PHE A  1  822  ? 262.125 266.684 212.012 1.00 0.00 ? 822  PHE A N     1 
ATOM   6230  C  CA    . PHE A  1  822  ? 261.509 267.891 211.453 1.00 0.00 ? 822  PHE A CA    1 
ATOM   6231  C  C     . PHE A  1  822  ? 260.225 267.506 210.710 1.00 0.00 ? 822  PHE A C     1 
ATOM   6232  O  O     . PHE A  1  822  ? 260.190 266.496 210.006 1.00 0.00 ? 822  PHE A O     1 
ATOM   6233  C  CB    . PHE A  1  822  ? 262.485 268.598 210.519 1.00 0.00 ? 822  PHE A CB    1 
ATOM   6234  C  CG    . PHE A  1  822  ? 261.948 269.847 209.897 1.00 0.00 ? 822  PHE A CG    1 
ATOM   6235  C  CD1   . PHE A  1  822  ? 261.258 269.790 208.695 1.00 0.00 ? 822  PHE A CD1   1 
ATOM   6236  C  CD2   . PHE A  1  822  ? 262.145 271.075 210.492 1.00 0.00 ? 822  PHE A CD2   1 
ATOM   6237  C  CE1   . PHE A  1  822  ? 260.769 270.933 208.104 1.00 0.00 ? 822  PHE A CE1   1 
ATOM   6238  C  CE2   . PHE A  1  822  ? 261.666 272.235 209.897 1.00 0.00 ? 822  PHE A CE2   1 
ATOM   6239  C  CZ    . PHE A  1  822  ? 260.973 272.160 208.705 1.00 0.00 ? 822  PHE A CZ    1 
ATOM   6240  N  N     . VAL A  1  823  ? 259.157 268.271 210.899 1.00 0.00 ? 823  VAL A N     1 
ATOM   6241  C  CA    . VAL A  1  823  ? 257.916 268.014 210.168 1.00 0.00 ? 823  VAL A CA    1 
ATOM   6242  C  C     . VAL A  1  823  ? 257.780 269.011 209.000 1.00 0.00 ? 823  VAL A C     1 
ATOM   6243  O  O     . VAL A  1  823  ? 257.533 270.198 209.203 1.00 0.00 ? 823  VAL A O     1 
ATOM   6244  C  CB    . VAL A  1  823  ? 256.691 268.065 211.110 1.00 0.00 ? 823  VAL A CB    1 
ATOM   6245  C  CG1   . VAL A  1  823  ? 255.422 267.766 210.352 1.00 0.00 ? 823  VAL A CG1   1 
ATOM   6246  C  CG2   . VAL A  1  823  ? 256.865 267.063 212.233 1.00 0.00 ? 823  VAL A CG2   1 
ATOM   6247  N  N     . GLU A  1  824  ? 257.979 268.528 207.779 1.00 0.00 ? 824  GLU A N     1 
ATOM   6248  C  CA    . GLU A  1  824  ? 257.964 269.401 206.613 1.00 0.00 ? 824  GLU A CA    1 
ATOM   6249  C  C     . GLU A  1  824  ? 256.585 269.890 206.174 1.00 0.00 ? 824  GLU A C     1 
ATOM   6250  O  O     . GLU A  1  824  ? 256.478 270.923 205.515 1.00 0.00 ? 824  GLU A O     1 
ATOM   6251  C  CB    . GLU A  1  824  ? 258.656 268.703 205.436 1.00 0.00 ? 824  GLU A CB    1 
ATOM   6252  C  CG    . GLU A  1  824  ? 260.181 268.646 205.592 1.00 0.00 ? 824  GLU A CG    1 
ATOM   6253  C  CD    . GLU A  1  824  ? 260.949 268.186 204.335 1.00 0.00 ? 824  GLU A CD    1 
ATOM   6254  O  OE1   . GLU A  1  824  ? 260.342 267.981 203.244 1.00 0.00 ? 824  GLU A OE1   1 
ATOM   6255  O  OE2   . GLU A  1  824  ? 262.188 268.030 204.464 1.00 0.00 ? 824  GLU A OE2   1 
ATOM   6256  N  N     . ASN A  1  825  ? 255.533 269.163 206.516 1.00 0.00 ? 825  ASN A N     1 
ATOM   6257  C  CA    . ASN A  1  825  ? 254.202 269.553 206.059 1.00 0.00 ? 825  ASN A CA    1 
ATOM   6258  C  C     . ASN A  1  825  ? 253.439 270.291 207.138 1.00 0.00 ? 825  ASN A C     1 
ATOM   6259  O  O     . ASN A  1  825  ? 253.959 270.484 208.230 1.00 0.00 ? 825  ASN A O     1 
ATOM   6260  C  CB    . ASN A  1  825  ? 253.427 268.329 205.594 1.00 0.00 ? 825  ASN A CB    1 
ATOM   6261  C  CG    . ASN A  1  825  ? 254.110 267.637 204.428 1.00 0.00 ? 825  ASN A CG    1 
ATOM   6262  O  OD1   . ASN A  1  825  ? 254.458 268.283 203.425 1.00 0.00 ? 825  ASN A OD1   1 
ATOM   6263  N  ND2   . ASN A  1  825  ? 254.331 266.322 204.557 1.00 0.00 ? 825  ASN A ND2   1 
ATOM   6264  N  N     . SER A  1  826  ? 252.207 270.696 206.845 1.00 0.00 ? 826  SER A N     1 
ATOM   6265  C  CA    . SER A  1  826  ? 251.395 271.411 207.836 1.00 0.00 ? 826  SER A CA    1 
ATOM   6266  C  C     . SER A  1  826  ? 250.073 270.695 208.121 1.00 0.00 ? 826  SER A C     1 
ATOM   6267  O  O     . SER A  1  826  ? 249.589 269.923 207.291 1.00 0.00 ? 826  SER A O     1 
ATOM   6268  C  CB    . SER A  1  826  ? 251.115 272.836 207.361 1.00 0.00 ? 826  SER A CB    1 
ATOM   6269  O  OG    . SER A  1  826  ? 250.313 272.833 206.193 1.00 0.00 ? 826  SER A OG    1 
ATOM   6270  N  N     . TYR A  1  827  ? 249.483 270.952 209.288 1.00 0.00 ? 827  TYR A N     1 
ATOM   6271  C  CA    . TYR A  1  827  ? 248.214 270.313 209.647 1.00 0.00 ? 827  TYR A CA    1 
ATOM   6272  C  C     . TYR A  1  827  ? 247.108 270.569 208.641 1.00 0.00 ? 827  TYR A C     1 
ATOM   6273  O  O     . TYR A  1  827  ? 246.006 270.099 208.828 1.00 0.00 ? 827  TYR A O     1 
ATOM   6274  C  CB    . TYR A  1  827  ? 247.651 270.768 210.996 1.00 0.00 ? 827  TYR A CB    1 
ATOM   6275  C  CG    . TYR A  1  827  ? 248.505 270.608 212.205 1.00 0.00 ? 827  TYR A CG    1 
ATOM   6276  C  CD1   . TYR A  1  827  ? 249.180 269.437 212.472 1.00 0.00 ? 827  TYR A CD1   1 
ATOM   6277  C  CD2   . TYR A  1  827  ? 248.591 271.633 213.112 1.00 0.00 ? 827  TYR A CD2   1 
ATOM   6278  C  CE1   . TYR A  1  827  ? 249.939 269.318 213.604 1.00 0.00 ? 827  TYR A CE1   1 
ATOM   6279  C  CE2   . TYR A  1  827  ? 249.340 271.532 214.221 1.00 0.00 ? 827  TYR A CE2   1 
ATOM   6280  C  CZ    . TYR A  1  827  ? 250.009 270.380 214.477 1.00 0.00 ? 827  TYR A CZ    1 
ATOM   6281  O  OH    . TYR A  1  827  ? 250.751 270.334 215.628 1.00 0.00 ? 827  TYR A OH    1 
ATOM   6282  N  N     . LEU A  1  828  ? 247.319 271.381 207.631 1.00 0.00 ? 828  LEU A N     1 
ATOM   6283  C  CA    . LEU A  1  828  ? 246.243 271.497 206.683 1.00 0.00 ? 828  LEU A CA    1 
ATOM   6284  C  C     . LEU A  1  828  ? 246.469 270.466 205.599 1.00 0.00 ? 828  LEU A C     1 
ATOM   6285  O  O     . LEU A  1  828  ? 245.519 269.984 205.001 1.00 0.00 ? 828  LEU A O     1 
ATOM   6286  C  CB    . LEU A  1  828  ? 246.143 272.900 206.104 1.00 0.00 ? 828  LEU A CB    1 
ATOM   6287  C  CG    . LEU A  1  828  ? 245.055 273.060 205.040 1.00 0.00 ? 828  LEU A CG    1 
ATOM   6288  C  CD1   . LEU A  1  828  ? 243.644 272.832 205.638 1.00 0.00 ? 828  LEU A CD1   1 
ATOM   6289  C  CD2   . LEU A  1  828  ? 245.194 274.421 204.331 1.00 0.00 ? 828  LEU A CD2   1 
ATOM   6290  N  N     . ALA A  1  829  ? 247.729 270.128 205.345 1.00 0.00 ? 829  ALA A N     1 
ATOM   6291  C  CA    . ALA A  1  829  ? 248.060 269.201 204.264 1.00 0.00 ? 829  ALA A CA    1 
ATOM   6292  C  C     . ALA A  1  829  ? 248.394 267.783 204.734 1.00 0.00 ? 829  ALA A C     1 
ATOM   6293  O  O     . ALA A  1  829  ? 248.891 266.987 203.939 1.00 0.00 ? 829  ALA A O     1 
ATOM   6294  C  CB    . ALA A  1  829  ? 249.220 269.745 203.443 1.00 0.00 ? 829  ALA A CB    1 
ATOM   6295  N  N     . GLY A  1  830  ? 248.126 267.456 206.000 1.00 0.00 ? 830  GLY A N     1 
ATOM   6296  C  CA    . GLY A  1  830  ? 248.467 266.145 206.532 1.00 0.00 ? 830  GLY A CA    1 
ATOM   6297  C  C     . GLY A  1  830  ? 249.956 266.056 206.869 1.00 0.00 ? 830  GLY A C     1 
ATOM   6298  O  O     . GLY A  1  830  ? 250.744 266.925 206.472 1.00 0.00 ? 830  GLY A O     1 
ATOM   6299  N  N     . LEU A  1  831  ? 250.342 265.022 207.618 1.00 0.00 ? 831  LEU A N     1 
ATOM   6300  C  CA    . LEU A  1  831  ? 251.736 264.768 208.002 1.00 0.00 ? 831  LEU A CA    1 
ATOM   6301  C  C     . LEU A  1  831  ? 252.161 263.426 207.447 1.00 0.00 ? 831  LEU A C     1 
ATOM   6302  O  O     . LEU A  1  831  ? 251.313 262.566 207.247 1.00 0.00 ? 831  LEU A O     1 
ATOM   6303  C  CB    . LEU A  1  831  ? 251.896 264.774 209.509 1.00 0.00 ? 831  LEU A CB    1 
ATOM   6304  C  CG    . LEU A  1  831  ? 252.198 266.126 210.135 1.00 0.00 ? 831  LEU A CG    1 
ATOM   6305  C  CD1   . LEU A  1  831  ? 251.069 267.116 209.967 1.00 0.00 ? 831  LEU A CD1   1 
ATOM   6306  C  CD2   . LEU A  1  831  ? 252.501 265.948 211.588 1.00 0.00 ? 831  LEU A CD2   1 
ATOM   6307  N  N     . THR A  1  832  ? 253.440 263.228 207.146 1.00 0.00 ? 832  THR A N     1 
ATOM   6308  C  CA    . THR A  1  832  ? 253.892 261.881 206.758 1.00 0.00 ? 832  THR A CA    1 
ATOM   6309  C  C     . THR A  1  832  ? 254.060 261.005 208.018 1.00 0.00 ? 832  THR A C     1 
ATOM   6310  O  O     . THR A  1  832  ? 254.213 261.540 209.121 1.00 0.00 ? 832  THR A O     1 
ATOM   6311  C  CB    . THR A  1  832  ? 255.215 261.927 205.957 1.00 0.00 ? 832  THR A CB    1 
ATOM   6312  O  OG1   . THR A  1  832  ? 256.280 262.386 206.802 1.00 0.00 ? 832  THR A OG1   1 
ATOM   6313  C  CG2   . THR A  1  832  ? 255.069 262.833 204.730 1.00 0.00 ? 832  THR A CG2   1 
ATOM   6314  N  N     . PRO A  1  833  ? 254.044 259.666 207.863 1.00 0.00 ? 833  PRO A N     1 
ATOM   6315  C  CA    . PRO A  1  833  ? 254.154 258.739 209.000 1.00 0.00 ? 833  PRO A CA    1 
ATOM   6316  C  C     . PRO A  1  833  ? 255.281 259.048 210.012 1.00 0.00 ? 833  PRO A C     1 
ATOM   6317  O  O     . PRO A  1  833  ? 255.045 258.997 211.217 1.00 0.00 ? 833  PRO A O     1 
ATOM   6318  C  CB    . PRO A  1  833  ? 254.361 257.377 208.323 1.00 0.00 ? 833  PRO A CB    1 
ATOM   6319  C  CG    . PRO A  1  833  ? 253.657 257.511 207.038 1.00 0.00 ? 833  PRO A CG    1 
ATOM   6320  C  CD    . PRO A  1  833  ? 253.884 258.936 206.596 1.00 0.00 ? 833  PRO A CD    1 
ATOM   6321  N  N     . THR A  1  834  ? 256.455 259.433 209.550 1.00 0.00 ? 834  THR A N     1 
ATOM   6322  C  CA    . THR A  1  834  ? 257.511 259.761 210.482 1.00 0.00 ? 834  THR A CA    1 
ATOM   6323  C  C     . THR A  1  834  ? 257.133 260.986 211.269 1.00 0.00 ? 834  THR A C     1 
ATOM   6324  O  O     . THR A  1  834  ? 257.294 261.038 212.485 1.00 0.00 ? 834  THR A O     1 
ATOM   6325  C  CB    . THR A  1  834  ? 258.823 260.111 209.794 1.00 0.00 ? 834  THR A CB    1 
ATOM   6326  O  OG1   . THR A  1  834  ? 258.611 261.156 208.829 1.00 0.00 ? 834  THR A OG1   1 
ATOM   6327  C  CG2   . THR A  1  834  ? 259.458 258.863 209.180 1.00 0.00 ? 834  THR A CG2   1 
ATOM   6328  N  N     . GLU A  1  835  ? 256.645 261.987 210.557 1.00 0.00 ? 835  GLU A N     1 
ATOM   6329  C  CA    . GLU A  1  835  ? 256.201 263.225 211.176 1.00 0.00 ? 835  GLU A CA    1 
ATOM   6330  C  C     . GLU A  1  835  ? 255.083 263.004 212.182 1.00 0.00 ? 835  GLU A C     1 
ATOM   6331  O  O     . GLU A  1  835  ? 255.123 263.561 213.282 1.00 0.00 ? 835  GLU A O     1 
ATOM   6332  C  CB    . GLU A  1  835  ? 255.708 264.164 210.081 1.00 0.00 ? 835  GLU A CB    1 
ATOM   6333  C  CG    . GLU A  1  835  ? 256.793 264.620 209.122 1.00 0.00 ? 835  GLU A CG    1 
ATOM   6334  C  CD    . GLU A  1  835  ? 256.215 265.428 207.958 1.00 0.00 ? 835  GLU A CD    1 
ATOM   6335  O  OE1   . GLU A  1  835  ? 254.961 265.384 207.789 1.00 0.00 ? 835  GLU A OE1   1 
ATOM   6336  O  OE2   . GLU A  1  835  ? 257.003 266.081 207.210 1.00 0.00 ? 835  GLU A OE2   1 
ATOM   6337  N  N     . PHE A  1  836  ? 254.119 262.154 211.821 1.00 0.00 ? 836  PHE A N     1 
ATOM   6338  C  CA    . PHE A  1  836  ? 253.045 261.826 212.735 1.00 0.00 ? 836  PHE A CA    1 
ATOM   6339  C  C     . PHE A  1  836  ? 253.625 261.193 213.970 1.00 0.00 ? 836  PHE A C     1 
ATOM   6340  O  O     . PHE A  1  836  ? 253.282 261.611 215.056 1.00 0.00 ? 836  PHE A O     1 
ATOM   6341  C  CB    . PHE A  1  836  ? 252.031 260.883 212.095 1.00 0.00 ? 836  PHE A CB    1 
ATOM   6342  C  CG    . PHE A  1  836  ? 250.885 260.508 213.007 1.00 0.00 ? 836  PHE A CG    1 
ATOM   6343  C  CD1   . PHE A  1  836  ? 249.773 261.318 213.092 1.00 0.00 ? 836  PHE A CD1   1 
ATOM   6344  C  CD2   . PHE A  1  836  ? 250.922 259.367 213.796 1.00 0.00 ? 836  PHE A CD2   1 
ATOM   6345  C  CE1   . PHE A  1  836  ? 248.722 260.989 213.920 1.00 0.00 ? 836  PHE A CE1   1 
ATOM   6346  C  CE2   . PHE A  1  836  ? 249.863 259.042 214.637 1.00 0.00 ? 836  PHE A CE2   1 
ATOM   6347  C  CZ    . PHE A  1  836  ? 248.770 259.855 214.692 1.00 0.00 ? 836  PHE A CZ    1 
ATOM   6348  N  N     . PHE A  1  837  ? 254.531 260.224 213.828 1.00 0.00 ? 837  PHE A N     1 
ATOM   6349  C  CA    . PHE A  1  837  ? 255.125 259.607 215.022 1.00 0.00 ? 837  PHE A CA    1 
ATOM   6350  C  C     . PHE A  1  837  ? 256.033 260.563 215.809 1.00 0.00 ? 837  PHE A C     1 
ATOM   6351  O  O     . PHE A  1  837  ? 256.040 260.548 217.033 1.00 0.00 ? 837  PHE A O     1 
ATOM   6352  C  CB    . PHE A  1  837  ? 255.881 258.350 214.688 1.00 0.00 ? 837  PHE A CB    1 
ATOM   6353  C  CG    . PHE A  1  837  ? 256.067 257.457 215.865 1.00 0.00 ? 837  PHE A CG    1 
ATOM   6354  C  CD1   . PHE A  1  837  ? 255.103 256.529 216.214 1.00 0.00 ? 837  PHE A CD1   1 
ATOM   6355  C  CD2   . PHE A  1  837  ? 257.196 257.571 216.655 1.00 0.00 ? 837  PHE A CD2   1 
ATOM   6356  C  CE1   . PHE A  1  837  ? 255.271 255.706 217.328 1.00 0.00 ? 837  PHE A CE1   1 
ATOM   6357  C  CE2   . PHE A  1  837  ? 257.371 256.757 217.756 1.00 0.00 ? 837  PHE A CE2   1 
ATOM   6358  C  CZ    . PHE A  1  837  ? 256.402 255.823 218.097 1.00 0.00 ? 837  PHE A CZ    1 
ATOM   6359  N  N     . PHE A  1  838  ? 256.882 261.307 215.113 1.00 0.00 ? 838  PHE A N     1 
ATOM   6360  C  CA    . PHE A  1  838  ? 257.665 262.338 215.774 1.00 0.00 ? 838  PHE A CA    1 
ATOM   6361  C  C     . PHE A  1  838  ? 256.838 263.441 216.381 1.00 0.00 ? 838  PHE A C     1 
ATOM   6362  O  O     . PHE A  1  838  ? 257.119 263.881 217.497 1.00 0.00 ? 838  PHE A O     1 
ATOM   6363  C  CB    . PHE A  1  838  ? 258.694 262.933 214.840 1.00 0.00 ? 838  PHE A CB    1 
ATOM   6364  C  CG    . PHE A  1  838  ? 259.722 261.961 214.417 1.00 0.00 ? 838  PHE A CG    1 
ATOM   6365  C  CD1   . PHE A  1  838  ? 260.204 261.043 215.331 1.00 0.00 ? 838  PHE A CD1   1 
ATOM   6366  C  CD2   . PHE A  1  838  ? 260.225 261.965 213.139 1.00 0.00 ? 838  PHE A CD2   1 
ATOM   6367  C  CE1   . PHE A  1  838  ? 261.152 260.151 214.981 1.00 0.00 ? 838  PHE A CE1   1 
ATOM   6368  C  CE2   . PHE A  1  838  ? 261.173 261.062 212.783 1.00 0.00 ? 838  PHE A CE2   1 
ATOM   6369  C  CZ    . PHE A  1  838  ? 261.642 260.155 213.714 1.00 0.00 ? 838  PHE A CZ    1 
ATOM   6370  N  N     . HIS A  1  839  ? 255.772 263.841 215.709 1.00 0.00 ? 839  HIS A N     1 
ATOM   6371  C  CA    . HIS A  1  839  ? 254.858 264.763 216.359 1.00 0.00 ? 839  HIS A CA    1 
ATOM   6372  C  C     . HIS A  1  839  ? 254.260 264.199 217.631 1.00 0.00 ? 839  HIS A C     1 
ATOM   6373  O  O     . HIS A  1  839  ? 254.132 264.907 218.619 1.00 0.00 ? 839  HIS A O     1 
ATOM   6374  C  CB    . HIS A  1  839  ? 253.705 265.117 215.438 1.00 0.00 ? 839  HIS A CB    1 
ATOM   6375  C  CG    . HIS A  1  839  ? 252.957 266.321 215.880 1.00 0.00 ? 839  HIS A CG    1 
ATOM   6376  N  ND1   . HIS A  1  839  ? 253.269 266.994 217.041 1.00 0.00 ? 839  HIS A ND1   1 
ATOM   6377  C  CD2   . HIS A  1  839  ? 251.853 266.916 215.381 1.00 0.00 ? 839  HIS A CD2   1 
ATOM   6378  C  CE1   . HIS A  1  839  ? 252.418 267.989 217.208 1.00 0.00 ? 839  HIS A CE1   1 
ATOM   6379  N  NE2   . HIS A  1  839  ? 251.548 267.962 216.215 1.00 0.00 ? 839  HIS A NE2   1 
ATOM   6380  N  N     . ALA A  1  840  ? 253.923 262.921 217.601 1.00 0.00 ? 840  ALA A N     1 
ATOM   6381  C  CA    . ALA A  1  840  ? 253.428 262.245 218.765 1.00 0.00 ? 840  ALA A CA    1 
ATOM   6382  C  C     . ALA A  1  840  ? 254.436 262.212 219.915 1.00 0.00 ? 840  ALA A C     1 
ATOM   6383  O  O     . ALA A  1  840  ? 254.007 262.315 221.057 1.00 0.00 ? 840  ALA A O     1 
ATOM   6384  C  CB    . ALA A  1  840  ? 252.993 260.855 218.403 1.00 0.00 ? 840  ALA A CB    1 
ATOM   6385  N  N     . MET A  1  841  ? 255.743 262.067 219.662 1.00 0.00 ? 841  MET A N     1 
ATOM   6386  C  CA    . MET A  1  841  ? 256.718 262.191 220.766 1.00 0.00 ? 841  MET A CA    1 
ATOM   6387  C  C     . MET A  1  841  ? 256.673 263.531 221.484 1.00 0.00 ? 841  MET A C     1 
ATOM   6388  O  O     . MET A  1  841  ? 256.674 263.583 222.715 1.00 0.00 ? 841  MET A O     1 
ATOM   6389  C  CB    . MET A  1  841  ? 258.152 261.944 220.338 1.00 0.00 ? 841  MET A CB    1 
ATOM   6390  C  CG    . MET A  1  841  ? 258.422 260.547 219.841 1.00 0.00 ? 841  MET A CG    1 
ATOM   6391  S  SD    . MET A  1  841  ? 260.172 260.181 219.437 1.00 0.00 ? 841  MET A SD    1 
ATOM   6392  C  CE    . MET A  1  841  ? 260.061 258.414 219.261 1.00 0.00 ? 841  MET A CE    1 
ATOM   6393  N  N     . GLY A  1  842  ? 256.651 264.613 220.714 1.00 0.00 ? 842  GLY A N     1 
ATOM   6394  C  CA    . GLY A  1  842  ? 256.594 265.950 221.281 1.00 0.00 ? 842  GLY A CA    1 
ATOM   6395  C  C     . GLY A  1  842  ? 255.284 266.338 221.954 1.00 0.00 ? 842  GLY A C     1 
ATOM   6396  O  O     . GLY A  1  842  ? 255.294 267.168 222.860 1.00 0.00 ? 842  GLY A O     1 
ATOM   6397  N  N     . GLY A  1  843  ? 254.161 265.802 221.486 1.00 0.00 ? 843  GLY A N     1 
ATOM   6398  C  CA    . GLY A  1  843  ? 252.887 266.009 222.144 1.00 0.00 ? 843  GLY A CA    1 
ATOM   6399  C  C     . GLY A  1  843  ? 252.858 265.367 223.516 1.00 0.00 ? 843  GLY A C     1 
ATOM   6400  O  O     . GLY A  1  843  ? 252.328 265.959 224.445 1.00 0.00 ? 843  GLY A O     1 
ATOM   6401  N  N     . ARG A  1  844  ? 253.472 264.190 223.651 1.00 0.00 ? 844  ARG A N     1 
ATOM   6402  C  CA    . ARG A  1  844  ? 253.608 263.494 224.942 1.00 0.00 ? 844  ARG A CA    1 
ATOM   6403  C  C     . ARG A  1  844  ? 254.366 264.210 226.012 1.00 0.00 ? 844  ARG A C     1 
ATOM   6404  O  O     . ARG A  1  844  ? 254.013 264.118 227.181 1.00 0.00 ? 844  ARG A O     1 
ATOM   6405  C  CB    . ARG A  1  844  ? 254.219 262.126 224.764 1.00 0.00 ? 844  ARG A CB    1 
ATOM   6406  C  CG    . ARG A  1  844  ? 254.132 261.231 226.003 1.00 0.00 ? 844  ARG A CG    1 
ATOM   6407  C  CD    . ARG A  1  844  ? 252.753 260.780 226.316 1.00 0.00 ? 844  ARG A CD    1 
ATOM   6408  N  NE    . ARG A  1  844  ? 252.228 259.876 225.317 1.00 0.00 ? 844  ARG A NE    1 
ATOM   6409  C  CZ    . ARG A  1  844  ? 252.399 258.570 225.308 1.00 0.00 ? 844  ARG A CZ    1 
ATOM   6410  N  NH1   . ARG A  1  844  ? 251.857 257.860 224.329 1.00 0.00 ? 844  ARG A NH1   1 
ATOM   6411  N  NH2   . ARG A  1  844  ? 253.067 257.979 226.288 1.00 0.00 ? 844  ARG A NH2   1 
ATOM   6412  N  N     . GLU A  1  845  ? 255.449 264.866 225.647 1.00 0.00 ? 845  GLU A N     1 
ATOM   6413  C  CA    . GLU A  1  845  ? 256.207 265.602 226.638 1.00 0.00 ? 845  GLU A CA    1 
ATOM   6414  C  C     . GLU A  1  845  ? 255.268 266.619 227.289 1.00 0.00 ? 845  GLU A C     1 
ATOM   6415  O  O     . GLU A  1  845  ? 255.376 266.880 228.480 1.00 0.00 ? 845  GLU A O     1 
ATOM   6416  C  CB    . GLU A  1  845  ? 257.422 266.287 226.044 1.00 0.00 ? 845  GLU A CB    1 
ATOM   6417  C  CG    . GLU A  1  845  ? 258.334 266.824 227.131 1.00 0.00 ? 845  GLU A CG    1 
ATOM   6418  C  CD    . GLU A  1  845  ? 259.566 267.525 226.581 1.00 0.00 ? 845  GLU A CD    1 
ATOM   6419  O  OE1   . GLU A  1  845  ? 259.831 267.389 225.355 1.00 0.00 ? 845  GLU A OE1   1 
ATOM   6420  O  OE2   . GLU A  1  845  ? 260.259 268.215 227.379 1.00 0.00 ? 845  GLU A OE2   1 
ATOM   6421  N  N     . GLY A  1  846  ? 254.333 267.176 226.524 1.00 0.00 ? 846  GLY A N     1 
ATOM   6422  C  CA    . GLY A  1  846  ? 253.356 268.052 227.136 1.00 0.00 ? 846  GLY A CA    1 
ATOM   6423  C  C     . GLY A  1  846  ? 252.403 267.353 228.101 1.00 0.00 ? 846  GLY A C     1 
ATOM   6424  O  O     . GLY A  1  846  ? 252.044 267.946 229.111 1.00 0.00 ? 846  GLY A O     1 
ATOM   6425  N  N     . LEU A  1  847  ? 251.967 266.129 227.818 1.00 0.00 ? 847  LEU A N     1 
ATOM   6426  C  CA    . LEU A  1  847  ? 251.163 265.380 228.799 1.00 0.00 ? 847  LEU A CA    1 
ATOM   6427  C  C     . LEU A  1  847  ? 251.859 265.004 230.113 1.00 0.00 ? 847  LEU A C     1 
ATOM   6428  O  O     . LEU A  1  847  ? 251.229 265.015 231.160 1.00 0.00 ? 847  LEU A O     1 
ATOM   6429  C  CB    . LEU A  1  847  ? 250.601 264.101 228.181 1.00 0.00 ? 847  LEU A CB    1 
ATOM   6430  C  CG    . LEU A  1  847  ? 249.645 264.361 227.041 1.00 0.00 ? 847  LEU A CG    1 
ATOM   6431  C  CD1   . LEU A  1  847  ? 249.203 263.074 226.411 1.00 0.00 ? 847  LEU A CD1   1 
ATOM   6432  C  CD2   . LEU A  1  847  ? 248.494 265.095 227.658 1.00 0.00 ? 847  LEU A CD2   1 
ATOM   6433  N  N     . ILE A  1  848  ? 253.128 264.622 230.066 1.00 0.00 ? 848  ILE A N     1 
ATOM   6434  C  CA    . ILE A  1  848  ? 253.833 264.297 231.295 1.00 0.00 ? 848  ILE A CA    1 
ATOM   6435  C  C     . ILE A  1  848  ? 254.072 265.504 232.192 1.00 0.00 ? 848  ILE A C     1 
ATOM   6436  O  O     . ILE A  1  848  ? 253.870 265.434 233.404 1.00 0.00 ? 848  ILE A O     1 
ATOM   6437  C  CB    . ILE A  1  848  ? 255.174 263.623 230.994 1.00 0.00 ? 848  ILE A CB    1 
ATOM   6438  C  CG1   . ILE A  1  848  ? 254.920 262.295 230.300 1.00 0.00 ? 848  ILE A CG1   1 
ATOM   6439  C  CG2   . ILE A  1  848  ? 255.961 263.376 232.266 1.00 0.00 ? 848  ILE A CG2   1 
ATOM   6440  C  CD1   . ILE A  1  848  ? 256.130 261.702 229.651 1.00 0.00 ? 848  ILE A CD1   1 
ATOM   6441  N  N     . ASP A  1  849  ? 254.441 266.629 231.590 1.00 0.00 ? 849  ASP A N     1 
ATOM   6442  C  CA    . ASP A  1  849  ? 254.609 267.887 232.320 1.00 0.00 ? 849  ASP A CA    1 
ATOM   6443  C  C     . ASP A  1  849  ? 253.337 268.342 233.044 1.00 0.00 ? 849  ASP A C     1 
ATOM   6444  O  O     . ASP A  1  849  ? 253.395 268.781 234.191 1.00 0.00 ? 849  ASP A O     1 
ATOM   6445  C  CB    . ASP A  1  849  ? 255.109 268.982 231.369 1.00 0.00 ? 849  ASP A CB    1 
ATOM   6446  C  CG    . ASP A  1  849  ? 254.308 270.276 231.474 1.00 0.00 ? 849  ASP A CG    1 
ATOM   6447  O  OD1   . ASP A  1  849  ? 254.608 271.092 232.381 1.00 0.00 ? 849  ASP A OD1   1 
ATOM   6448  O  OD2   . ASP A  1  849  ? 253.405 270.489 230.629 1.00 0.00 ? 849  ASP A OD2   1 
ATOM   6449  N  N     . THR A  1  850  ? 252.195 268.230 232.370 1.00 0.00 ? 850  THR A N     1 
ATOM   6450  C  CA    . THR A  1  850  ? 250.897 268.570 232.959 1.00 0.00 ? 850  THR A CA    1 
ATOM   6451  C  C     . THR A  1  850  ? 250.529 267.680 234.153 1.00 0.00 ? 850  THR A C     1 
ATOM   6452  O  O     . THR A  1  850  ? 250.010 268.179 235.157 1.00 0.00 ? 850  THR A O     1 
ATOM   6453  C  CB    . THR A  1  850  ? 249.750 268.469 231.909 1.00 0.00 ? 850  THR A CB    1 
ATOM   6454  O  OG1   . THR A  1  850  ? 250.107 269.164 230.705 1.00 0.00 ? 850  THR A OG1   1 
ATOM   6455  C  CG2   . THR A  1  850  ? 248.458 269.046 232.470 1.00 0.00 ? 850  THR A CG2   1 
ATOM   6456  N  N     . ALA A  1  851  ? 250.751 266.371 234.033 1.00 0.00 ? 851  ALA A N     1 
ATOM   6457  C  CA    . ALA A  1  851  ? 250.510 265.456 235.147 1.00 0.00 ? 851  ALA A CA    1 
ATOM   6458  C  C     . ALA A  1  851  ? 251.402 265.706 236.380 1.00 0.00 ? 851  ALA A C     1 
ATOM   6459  O  O     . ALA A  1  851  ? 250.910 265.718 237.510 1.00 0.00 ? 851  ALA A O     1 
ATOM   6460  C  CB    . ALA A  1  851  ? 250.673 264.026 234.681 1.00 0.00 ? 851  ALA A CB    1 
ATOM   6461  N  N     . VAL A  1  852  ? 252.706 265.892 236.183 1.00 0.00 ? 852  VAL A N     1 
ATOM   6462  C  CA    . VAL A  1  852  ? 253.607 266.112 237.323 1.00 0.00 ? 852  VAL A CA    1 
ATOM   6463  C  C     . VAL A  1  852  ? 253.386 267.457 238.029 1.00 0.00 ? 852  VAL A C     1 
ATOM   6464  O  O     . VAL A  1  852  ? 253.407 267.530 239.263 1.00 0.00 ? 852  VAL A O     1 
ATOM   6465  C  CB    . VAL A  1  852  ? 255.093 265.998 236.889 1.00 0.00 ? 852  VAL A CB    1 
ATOM   6466  C  CG1   . VAL A  1  852  ? 256.029 266.544 237.962 1.00 0.00 ? 852  VAL A CG1   1 
ATOM   6467  C  CG2   . VAL A  1  852  ? 255.438 264.551 236.579 1.00 0.00 ? 852  VAL A CG2   1 
ATOM   6468  N  N     . LYS A  1  853  ? 253.116 268.499 237.240 1.00 0.00 ? 853  LYS A N     1 
ATOM   6469  C  CA    . LYS A  1  853  ? 253.129 269.897 237.699 1.00 0.00 ? 853  LYS A CA    1 
ATOM   6470  C  C     . LYS A  1  853  ? 252.083 270.169 238.777 1.00 0.00 ? 853  LYS A C     1 
ATOM   6471  O  O     . LYS A  1  853  ? 252.317 270.937 239.712 1.00 0.00 ? 853  LYS A O     1 
ATOM   6472  C  CB    . LYS A  1  853  ? 252.904 270.849 236.517 1.00 0.00 ? 853  LYS A CB    1 
ATOM   6473  C  CG    . LYS A  1  853  ? 252.841 272.335 236.886 1.00 0.00 ? 853  LYS A CG    1 
ATOM   6474  C  CD    . LYS A  1  853  ? 252.782 273.203 235.632 1.00 0.00 ? 853  LYS A CD    1 
ATOM   6475  C  CE    . LYS A  1  853  ? 254.037 273.034 234.781 1.00 0.00 ? 853  LYS A CE    1 
ATOM   6476  N  NZ    . LYS A  1  853  ? 254.290 274.196 233.892 1.00 0.00 ? 853  LYS A NZ    1 
ATOM   6477  N  N     . THR A  1  854  ? 250.936 269.516 238.641 1.00 0.00 ? 854  THR A N     1 
ATOM   6478  C  CA    . THR A  1  854  ? 249.803 269.717 239.530 1.00 0.00 ? 854  THR A CA    1 
ATOM   6479  C  C     . THR A  1  854  ? 250.133 269.279 240.948 1.00 0.00 ? 854  THR A C     1 
ATOM   6480  O  O     . THR A  1  854  ? 249.687 269.898 241.914 1.00 0.00 ? 854  THR A O     1 
ATOM   6481  C  CB    . THR A  1  854  ? 248.576 268.937 239.054 1.00 0.00 ? 854  THR A CB    1 
ATOM   6482  O  OG1   . THR A  1  854  ? 248.862 267.533 239.077 1.00 0.00 ? 854  THR A OG1   1 
ATOM   6483  C  CG2   . THR A  1  854  ? 248.190 269.369 237.644 1.00 0.00 ? 854  THR A CG2   1 
ATOM   6484  N  N     . ALA A  1  855  ? 250.931 268.222 241.064 1.00 0.00 ? 855  ALA A N     1 
ATOM   6485  C  CA    . ALA A  1  855  ? 251.387 267.735 242.368 1.00 0.00 ? 855  ALA A CA    1 
ATOM   6486  C  C     . ALA A  1  855  ? 252.399 268.651 243.071 1.00 0.00 ? 855  ALA A C     1 
ATOM   6487  O  O     . ALA A  1  855  ? 252.185 269.016 244.226 1.00 0.00 ? 855  ALA A O     1 
ATOM   6488  C  CB    . ALA A  1  855  ? 251.975 266.336 242.216 1.00 0.00 ? 855  ALA A CB    1 
ATOM   6489  N  N     . GLU A  1  856  ? 253.495 269.012 242.410 1.00 0.00 ? 856  GLU A N     1 
ATOM   6490  C  CA    . GLU A  1  856  ? 254.530 269.824 243.068 1.00 0.00 ? 856  GLU A CA    1 
ATOM   6491  C  C     . GLU A  1  856  ? 254.103 271.243 243.447 1.00 0.00 ? 856  GLU A C     1 
ATOM   6492  O  O     . GLU A  1  856  ? 254.529 271.777 244.473 1.00 0.00 ? 856  GLU A O     1 
ATOM   6493  C  CB    . GLU A  1  856  ? 255.787 269.925 242.197 1.00 0.00 ? 856  GLU A CB    1 
ATOM   6494  C  CG    . GLU A  1  856  ? 256.762 268.792 242.376 1.00 0.00 ? 856  GLU A CG    1 
ATOM   6495  C  CD    . GLU A  1  856  ? 257.649 269.026 243.588 1.00 0.00 ? 856  GLU A CD    1 
ATOM   6496  O  OE1   . GLU A  1  856  ? 257.252 268.594 244.693 1.00 0.00 ? 856  GLU A OE1   1 
ATOM   6497  O  OE2   . GLU A  1  856  ? 258.721 269.657 243.443 1.00 0.00 ? 856  GLU A OE2   1 
ATOM   6498  N  N     . THR A  1  857  ? 253.267 271.852 242.620 1.00 0.00 ? 857  THR A N     1 
ATOM   6499  C  CA    . THR A  1  857  ? 252.757 273.185 242.895 1.00 0.00 ? 857  THR A CA    1 
ATOM   6500  C  C     . THR A  1  857  ? 251.772 273.100 244.049 1.00 0.00 ? 857  THR A C     1 
ATOM   6501  O  O     . THR A  1  857  ? 251.702 273.999 244.886 1.00 0.00 ? 857  THR A O     1 
ATOM   6502  C  CB    . THR A  1  857  ? 252.099 273.800 241.666 1.00 0.00 ? 857  THR A CB    1 
ATOM   6503  O  OG1   . THR A  1  857  ? 251.062 272.928 241.200 1.00 0.00 ? 857  THR A OG1   1 
ATOM   6504  C  CG2   . THR A  1  857  ? 253.140 274.005 240.563 1.00 0.00 ? 857  THR A CG2   1 
ATOM   6505  N  N     . GLY A  1  858  ? 250.990 272.029 244.072 1.00 0.00 ? 858  GLY A N     1 
ATOM   6506  C  CA    . GLY A  1  858  ? 250.042 271.812 245.144 1.00 0.00 ? 858  GLY A CA    1 
ATOM   6507  C  C     . GLY A  1  858  ? 250.823 271.722 246.449 1.00 0.00 ? 858  GLY A C     1 
ATOM   6508  O  O     . GLY A  1  858  ? 250.399 272.272 247.468 1.00 0.00 ? 858  GLY A O     1 
ATOM   6509  N  N     . TYR A  1  859  ? 251.970 271.040 246.420 1.00 0.00 ? 859  TYR A N     1 
ATOM   6510  C  CA    . TYR A  1  859  ? 252.804 270.903 247.617 1.00 0.00 ? 859  TYR A CA    1 
ATOM   6511  C  C     . TYR A  1  859  ? 253.625 272.130 248.014 1.00 0.00 ? 859  TYR A C     1 
ATOM   6512  O  O     . TYR A  1  859  ? 253.695 272.473 249.190 1.00 0.00 ? 859  TYR A O     1 
ATOM   6513  C  CB    . TYR A  1  859  ? 253.797 269.755 247.421 1.00 0.00 ? 859  TYR A CB    1 
ATOM   6514  C  CG    . TYR A  1  859  ? 254.565 269.406 248.671 1.00 0.00 ? 859  TYR A CG    1 
ATOM   6515  C  CD1   . TYR A  1  859  ? 253.982 269.517 249.922 1.00 0.00 ? 859  TYR A CD1   1 
ATOM   6516  C  CD2   . TYR A  1  859  ? 255.901 269.045 248.605 1.00 0.00 ? 859  TYR A CD2   1 
ATOM   6517  C  CE1   . TYR A  1  859  ? 254.693 269.233 251.070 1.00 0.00 ? 859  TYR A CE1   1 
ATOM   6518  C  CE2   . TYR A  1  859  ? 256.619 268.755 249.751 1.00 0.00 ? 859  TYR A CE2   1 
ATOM   6519  C  CZ    . TYR A  1  859  ? 256.008 268.855 250.978 1.00 0.00 ? 859  TYR A CZ    1 
ATOM   6520  O  OH    . TYR A  1  859  ? 256.707 268.559 252.122 1.00 0.00 ? 859  TYR A OH    1 
ATOM   6521  N  N     . ILE A  1  860  ? 254.231 272.801 247.040 1.00 0.00 ? 860  ILE A N     1 
ATOM   6522  C  CA    . ILE A  1  860  ? 254.985 274.023 247.310 1.00 0.00 ? 860  ILE A CA    1 
ATOM   6523  C  C     . ILE A  1  860  ? 254.082 275.127 247.862 1.00 0.00 ? 860  ILE A C     1 
ATOM   6524  O  O     . ILE A  1  860  ? 254.466 275.841 248.771 1.00 0.00 ? 860  ILE A O     1 
ATOM   6525  C  CB    . ILE A  1  860  ? 255.809 274.493 246.081 1.00 0.00 ? 860  ILE A CB    1 
ATOM   6526  C  CG1   . ILE A  1  860  ? 257.134 275.026 246.586 1.00 0.00 ? 860  ILE A CG1   1 
ATOM   6527  C  CG2   . ILE A  1  860  ? 255.088 275.507 245.216 1.00 0.00 ? 860  ILE A CG2   1 
ATOM   6528  C  CD1   . ILE A  1  860  ? 258.041 273.918 247.075 1.00 0.00 ? 860  ILE A CD1   1 
ATOM   6529  N  N     . GLN A  1  861  ? 252.891 275.270 247.298 1.00 0.00 ? 861  GLN A N     1 
ATOM   6530  C  CA    . GLN A  1  861  ? 251.913 276.230 247.782 1.00 0.00 ? 861  GLN A CA    1 
ATOM   6531  C  C     . GLN A  1  861  ? 251.580 275.967 249.241 1.00 0.00 ? 861  GLN A C     1 
ATOM   6532  O  O     . GLN A  1  861  ? 251.511 276.893 250.035 1.00 0.00 ? 861  GLN A O     1 
ATOM   6533  C  CB    . GLN A  1  861  ? 250.644 276.206 246.944 1.00 0.00 ? 861  GLN A CB    1 
ATOM   6534  C  CG    . GLN A  1  861  ? 249.647 277.252 247.403 1.00 0.00 ? 861  GLN A CG    1 
ATOM   6535  C  CD    . GLN A  1  861  ? 248.579 277.538 246.367 1.00 0.00 ? 861  GLN A CD    1 
ATOM   6536  O  OE1   . GLN A  1  861  ? 248.682 277.108 245.206 1.00 0.00 ? 861  GLN A OE1   1 
ATOM   6537  N  NE2   . GLN A  1  861  ? 247.566 278.309 246.765 1.00 0.00 ? 861  GLN A NE2   1 
ATOM   6538  N  N     . ARG A  1  862  ? 251.348 274.708 249.581 1.00 0.00 ? 862  ARG A N     1 
ATOM   6539  C  CA    . ARG A  1  862  ? 250.932 274.326 250.929 1.00 0.00 ? 862  ARG A CA    1 
ATOM   6540  C  C     . ARG A  1  862  ? 251.964 274.676 251.988 1.00 0.00 ? 862  ARG A C     1 
ATOM   6541  O  O     . ARG A  1  862  ? 251.617 275.162 253.053 1.00 0.00 ? 862  ARG A O     1 
ATOM   6542  C  CB    . ARG A  1  862  ? 250.659 272.830 251.025 1.00 0.00 ? 862  ARG A CB    1 
ATOM   6543  C  CG    . ARG A  1  862  ? 250.014 272.482 252.349 1.00 0.00 ? 862  ARG A CG    1 
ATOM   6544  C  CD    . ARG A  1  862  ? 249.647 271.022 252.489 1.00 0.00 ? 862  ARG A CD    1 
ATOM   6545  N  NE    . ARG A  1  862  ? 248.976 270.822 253.761 1.00 0.00 ? 862  ARG A NE    1 
ATOM   6546  C  CZ    . ARG A  1  862  ? 249.570 270.769 254.949 1.00 0.00 ? 862  ARG A CZ    1 
ATOM   6547  N  NH1   . ARG A  1  862  ? 250.889 270.809 255.029 1.00 0.00 ? 862  ARG A NH1   1 
ATOM   6548  N  NH2   . ARG A  1  862  ? 248.862 270.894 256.049 1.00 0.00 ? 862  ARG A NH2   1 
ATOM   6549  N  N     . ARG A  1  863  ? 253.231 274.424 251.696 1.00 0.00 ? 863  ARG A N     1 
ATOM   6550  C  CA    . ARG A  1  863  ? 254.322 274.776 252.595 1.00 0.00 ? 863  ARG A CA    1 
ATOM   6551  C  C     . ARG A  1  863  ? 254.372 276.267 252.864 1.00 0.00 ? 863  ARG A C     1 
ATOM   6552  O  O     . ARG A  1  863  ? 254.526 276.665 254.002 1.00 0.00 ? 863  ARG A O     1 
ATOM   6553  C  CB    . ARG A  1  863  ? 255.640 274.308 252.017 1.00 0.00 ? 863  ARG A CB    1 
ATOM   6554  C  CG    . ARG A  1  863  ? 255.786 272.821 252.079 1.00 0.00 ? 863  ARG A CG    1 
ATOM   6555  C  CD    . ARG A  1  863  ? 256.866 272.353 251.147 1.00 0.00 ? 863  ARG A CD    1 
ATOM   6556  N  NE    . ARG A  1  863  ? 258.194 272.711 251.610 1.00 0.00 ? 863  ARG A NE    1 
ATOM   6557  C  CZ    . ARG A  1  863  ? 259.311 272.240 251.071 1.00 0.00 ? 863  ARG A CZ    1 
ATOM   6558  N  NH1   . ARG A  1  863  ? 259.243 271.409 250.039 1.00 0.00 ? 863  ARG A NH1   1 
ATOM   6559  N  NH2   . ARG A  1  863  ? 260.491 272.577 251.575 1.00 0.00 ? 863  ARG A NH2   1 
ATOM   6560  N  N     . LEU A  1  864  ? 254.212 277.097 251.840 1.00 0.00 ? 864  LEU A N     1 
ATOM   6561  C  CA    . LEU A  1  864  ? 254.178 278.542 252.051 1.00 0.00 ? 864  LEU A CA    1 
ATOM   6562  C  C     . LEU A  1  864  ? 253.075 279.053 252.961 1.00 0.00 ? 864  LEU A C     1 
ATOM   6563  O  O     . LEU A  1  864  ? 253.393 279.735 253.917 1.00 0.00 ? 864  LEU A O     1 
ATOM   6564  C  CB    . LEU A  1  864  ? 254.059 279.286 250.731 1.00 0.00 ? 864  LEU A CB    1 
ATOM   6565  C  CG    . LEU A  1  864  ? 255.354 279.325 249.959 1.00 0.00 ? 864  LEU A CG    1 
ATOM   6566  C  CD1   . LEU A  1  864  ? 255.107 279.743 248.535 1.00 0.00 ? 864  LEU A CD1   1 
ATOM   6567  C  CD2   . LEU A  1  864  ? 256.258 280.275 250.664 1.00 0.00 ? 864  LEU A CD2   1 
ATOM   6568  N  N     . ILE A  1  865  ? 251.822 278.659 252.759 1.00 0.00 ? 865  ILE A N     1 
ATOM   6569  C  CA    . ILE A  1  865  ? 250.723 279.164 253.596 1.00 0.00 ? 865  ILE A CA    1 
ATOM   6570  C  C     . ILE A  1  865  ? 250.898 278.698 255.012 1.00 0.00 ? 865  ILE A C     1 
ATOM   6571  O  O     . ILE A  1  865  ? 250.633 279.466 255.912 1.00 0.00 ? 865  ILE A O     1 
ATOM   6572  C  CB    . ILE A  1  865  ? 249.308 278.828 253.087 1.00 0.00 ? 865  ILE A CB    1 
ATOM   6573  C  CG1   . ILE A  1  865  ? 249.149 277.337 252.818 1.00 0.00 ? 865  ILE A CG1   1 
ATOM   6574  C  CG2   . ILE A  1  865  ? 249.007 279.563 251.812 1.00 0.00 ? 865  ILE A CG2   1 
ATOM   6575  C  CD1   . ILE A  1  865  ? 248.518 276.562 253.956 1.00 0.00 ? 865  ILE A CD1   1 
ATOM   6576  N  N     . LYS A  1  866  ? 251.215 277.436 255.237 1.00 0.00 ? 866  LYS A N     1 
ATOM   6577  C  CA    . LYS A  1  866  ? 251.399 276.954 256.603 1.00 0.00 ? 866  LYS A CA    1 
ATOM   6578  C  C     . LYS A  1  866  ? 252.494 277.767 257.355 1.00 0.00 ? 866  LYS A C     1 
ATOM   6579  O  O     . LYS A  1  866  ? 252.441 277.862 258.573 1.00 0.00 ? 866  LYS A O     1 
ATOM   6580  C  CB    . LYS A  1  866  ? 251.764 275.475 256.600 1.00 0.00 ? 866  LYS A CB    1 
ATOM   6581  C  CG    . LYS A  1  866  ? 250.671 274.492 256.132 1.00 0.00 ? 866  LYS A CG    1 
ATOM   6582  C  CD    . LYS A  1  866  ? 249.320 274.593 256.829 1.00 0.00 ? 866  LYS A CD    1 
ATOM   6583  C  CE    . LYS A  1  866  ? 249.370 274.396 258.315 1.00 0.00 ? 866  LYS A CE    1 
ATOM   6584  N  NZ    . LYS A  1  866  ? 248.059 274.829 258.862 1.00 0.00 ? 866  LYS A NZ    1 
ATOM   6585  N  N     . SER A  1  867  ? 253.503 278.287 256.644 1.00 0.00 ? 867  SER A N     1 
ATOM   6586  C  CA    . SER A  1  867  ? 254.542 279.194 257.207 1.00 0.00 ? 867  SER A CA    1 
ATOM   6587  C  C     . SER A  1  867  ? 254.105 280.624 257.500 1.00 0.00 ? 867  SER A C     1 
ATOM   6588  O  O     . SER A  1  867  ? 254.380 281.173 258.561 1.00 0.00 ? 867  SER A O     1 
ATOM   6589  C  CB    . SER A  1  867  ? 255.738 279.315 256.283 1.00 0.00 ? 867  SER A CB    1 
ATOM   6590  O  OG    . SER A  1  867  ? 256.282 278.055 256.003 1.00 0.00 ? 867  SER A OG    1 
ATOM   6591  N  N     . MET A  1  868  ? 253.470 281.240 256.516 1.00 0.00 ? 868  MET A N     1 
ATOM   6592  C  CA    . MET A  1  868  ? 253.113 282.647 256.566 1.00 0.00 ? 868  MET A CA    1 
ATOM   6593  C  C     . MET A  1  868  ? 251.833 282.877 257.336 1.00 0.00 ? 868  MET A C     1 
ATOM   6594  O  O     . MET A  1  868  ? 251.618 283.975 257.811 1.00 0.00 ? 868  MET A O     1 
ATOM   6595  C  CB    . MET A  1  868  ? 252.869 283.180 255.148 1.00 0.00 ? 868  MET A CB    1 
ATOM   6596  C  CG    . MET A  1  868  ? 254.001 283.057 254.150 1.00 0.00 ? 868  MET A CG    1 
ATOM   6597  S  SD    . MET A  1  868  ? 255.388 284.112 254.499 1.00 0.00 ? 868  MET A SD    1 
ATOM   6598  C  CE    . MET A  1  868  ? 254.900 285.607 253.643 1.00 0.00 ? 868  MET A CE    1 
ATOM   6599  N  N     . GLU A  1  869  ? 251.006 281.843 257.483 1.00 0.00 ? 869  GLU A N     1 
ATOM   6600  C  CA    . GLU A  1  869  ? 249.593 282.019 257.825 1.00 0.00 ? 869  GLU A CA    1 
ATOM   6601  C  C     . GLU A  1  869  ? 249.326 282.961 258.987 1.00 0.00 ? 869  GLU A C     1 
ATOM   6602  O  O     . GLU A  1  869  ? 248.332 283.680 258.998 1.00 0.00 ? 869  GLU A O     1 
ATOM   6603  C  CB    . GLU A  1  869  ? 248.951 280.678 258.151 1.00 0.00 ? 869  GLU A CB    1 
ATOM   6604  C  CG    . GLU A  1  869  ? 249.572 279.976 259.340 1.00 0.00 ? 869  GLU A CG    1 
ATOM   6605  C  CD    . GLU A  1  869  ? 248.811 278.706 259.725 1.00 0.00 ? 869  GLU A CD    1 
ATOM   6606  O  OE1   . GLU A  1  869  ? 247.652 278.533 259.245 1.00 0.00 ? 869  GLU A OE1   1 
ATOM   6607  O  OE2   . GLU A  1  869  ? 249.374 277.891 260.509 1.00 0.00 ? 869  GLU A OE2   1 
ATOM   6608  N  N     . SER A  1  870  ? 250.240 282.982 259.944 1.00 0.00 ? 870  SER A N     1 
ATOM   6609  C  CA    . SER A  1  870  ? 250.022 283.705 261.192 1.00 0.00 ? 870  SER A CA    1 
ATOM   6610  C  C     . SER A  1  870  ? 250.311 285.219 261.124 1.00 0.00 ? 870  SER A C     1 
ATOM   6611  O  O     . SER A  1  870  ? 250.058 285.949 262.085 1.00 0.00 ? 870  SER A O     1 
ATOM   6612  C  CB    . SER A  1  870  ? 250.870 283.039 262.287 1.00 0.00 ? 870  SER A CB    1 
ATOM   6613  O  OG    . SER A  1  870  ? 252.240 282.921 261.899 1.00 0.00 ? 870  SER A OG    1 
ATOM   6614  N  N     . VAL A  1  871  ? 250.777 285.676 259.966 1.00 0.00 ? 871  VAL A N     1 
ATOM   6615  C  CA    . VAL A  1  871  ? 251.218 287.050 259.742 1.00 0.00 ? 871  VAL A CA    1 
ATOM   6616  C  C     . VAL A  1  871  ? 250.093 287.941 259.247 1.00 0.00 ? 871  VAL A C     1 
ATOM   6617  O  O     . VAL A  1  871  ? 249.440 287.618 258.268 1.00 0.00 ? 871  VAL A O     1 
ATOM   6618  C  CB    . VAL A  1  871  ? 252.348 287.082 258.707 1.00 0.00 ? 871  VAL A CB    1 
ATOM   6619  C  CG1   . VAL A  1  871  ? 252.614 288.474 258.228 1.00 0.00 ? 871  VAL A CG1   1 
ATOM   6620  C  CG2   . VAL A  1  871  ? 253.592 286.420 259.258 1.00 0.00 ? 871  VAL A CG2   1 
ATOM   6621  N  N     . MET A  1  872  ? 249.861 289.061 259.916 1.00 0.00 ? 872  MET A N     1 
ATOM   6622  C  CA    . MET A  1  872  ? 248.786 289.965 259.533 1.00 0.00 ? 872  MET A CA    1 
ATOM   6623  C  C     . MET A  1  872  ? 249.123 291.387 259.929 1.00 0.00 ? 872  MET A C     1 
ATOM   6624  O  O     . MET A  1  872  ? 250.004 291.612 260.755 1.00 0.00 ? 872  MET A O     1 
ATOM   6625  C  CB    . MET A  1  872  ? 247.497 289.581 260.209 1.00 0.00 ? 872  MET A CB    1 
ATOM   6626  C  CG    . MET A  1  872  ? 247.548 289.970 261.653 1.00 0.00 ? 872  MET A CG    1 
ATOM   6627  S  SD    . MET A  1  872  ? 246.158 289.394 262.614 1.00 0.00 ? 872  MET A SD    1 
ATOM   6628  C  CE    . MET A  1  872  ? 244.830 289.983 261.564 1.00 0.00 ? 872  MET A CE    1 
ATOM   6629  N  N     . VAL A  1  873  ? 248.383 292.349 259.388 1.00 0.00 ? 873  VAL A N     1 
ATOM   6630  C  CA    . VAL A  1  873  ? 248.577 293.744 259.747 1.00 0.00 ? 873  VAL A CA    1 
ATOM   6631  C  C     . VAL A  1  873  ? 247.984 293.974 261.125 1.00 0.00 ? 873  VAL A C     1 
ATOM   6632  O  O     . VAL A  1  873  ? 246.924 293.470 261.434 1.00 0.00 ? 873  VAL A O     1 
ATOM   6633  C  CB    . VAL A  1  873  ? 247.905 294.687 258.753 1.00 0.00 ? 873  VAL A CB    1 
ATOM   6634  C  CG1   . VAL A  1  873  ? 248.527 296.031 258.851 1.00 0.00 ? 873  VAL A CG1   1 
ATOM   6635  C  CG2   . VAL A  1  873  ? 248.051 294.185 257.349 1.00 0.00 ? 873  VAL A CG2   1 
ATOM   6636  N  N     . LYS A  1  874  ? 248.655 294.714 261.978 1.00 0.00 ? 874  LYS A N     1 
ATOM   6637  C  CA    . LYS A  1  874  ? 248.082 294.970 263.285 1.00 0.00 ? 874  LYS A CA    1 
ATOM   6638  C  C     . LYS A  1  874  ? 247.537 296.381 263.269 1.00 0.00 ? 874  LYS A C     1 
ATOM   6639  O  O     . LYS A  1  874  ? 247.747 297.080 262.288 1.00 0.00 ? 874  LYS A O     1 
ATOM   6640  C  CB    . LYS A  1  874  ? 249.116 294.752 264.378 1.00 0.00 ? 874  LYS A CB    1 
ATOM   6641  C  CG    . LYS A  1  874  ? 249.547 293.298 264.462 1.00 0.00 ? 874  LYS A CG    1 
ATOM   6642  C  CD    . LYS A  1  874  ? 248.371 292.476 264.924 1.00 0.00 ? 874  LYS A CD    1 
ATOM   6643  C  CE    . LYS A  1  874  ? 248.740 291.043 265.187 1.00 0.00 ? 874  LYS A CE    1 
ATOM   6644  N  NZ    . LYS A  1  874  ? 247.527 290.328 265.676 1.00 0.00 ? 874  LYS A NZ    1 
ATOM   6645  N  N     . TYR A  1  875  ? 246.777 296.786 264.291 1.00 0.00 ? 875  TYR A N     1 
ATOM   6646  C  CA    . TYR A  1  875  ? 246.087 298.094 264.255 1.00 0.00 ? 875  TYR A CA    1 
ATOM   6647  C  C     . TYR A  1  875  ? 246.978 299.342 264.356 1.00 0.00 ? 875  TYR A C     1 
ATOM   6648  O  O     . TYR A  1  875  ? 246.546 300.451 264.036 1.00 0.00 ? 875  TYR A O     1 
ATOM   6649  C  CB    . TYR A  1  875  ? 245.037 298.158 265.351 1.00 0.00 ? 875  TYR A CB    1 
ATOM   6650  C  CG    . TYR A  1  875  ? 243.747 297.528 264.953 1.00 0.00 ? 875  TYR A CG    1 
ATOM   6651  C  CD1   . TYR A  1  875  ? 242.834 298.223 264.167 1.00 0.00 ? 875  TYR A CD1   1 
ATOM   6652  C  CD2   . TYR A  1  875  ? 243.445 296.237 265.356 1.00 0.00 ? 875  TYR A CD2   1 
ATOM   6653  C  CE1   . TYR A  1  875  ? 241.647 297.657 263.796 1.00 0.00 ? 875  TYR A CE1   1 
ATOM   6654  C  CE2   . TYR A  1  875  ? 242.260 295.652 265.001 1.00 0.00 ? 875  TYR A CE2   1 
ATOM   6655  C  CZ    . TYR A  1  875  ? 241.355 296.363 264.209 1.00 0.00 ? 875  TYR A CZ    1 
ATOM   6656  O  OH    . TYR A  1  875  ? 240.161 295.776 263.827 1.00 0.00 ? 875  TYR A OH    1 
ATOM   6657  N  N     . ASP A  1  876  ? 248.211 299.163 264.804 1.00 0.00 ? 876  ASP A N     1 
ATOM   6658  C  CA    . ASP A  1  876  ? 249.191 300.223 264.709 1.00 0.00 ? 876  ASP A CA    1 
ATOM   6659  C  C     . ASP A  1  876  ? 249.922 300.138 263.374 1.00 0.00 ? 876  ASP A C     1 
ATOM   6660  O  O     . ASP A  1  876  ? 250.775 300.974 263.080 1.00 0.00 ? 876  ASP A O     1 
ATOM   6661  C  CB    . ASP A  1  876  ? 250.184 300.116 265.836 1.00 0.00 ? 876  ASP A CB    1 
ATOM   6662  C  CG    . ASP A  1  876  ? 250.987 298.843 265.753 1.00 0.00 ? 876  ASP A CG    1 
ATOM   6663  O  OD1   . ASP A  1  876  ? 250.532 297.911 265.031 1.00 0.00 ? 876  ASP A OD1   1 
ATOM   6664  O  OD2   . ASP A  1  876  ? 252.075 298.788 266.384 1.00 0.00 ? 876  ASP A OD2   1 
ATOM   6665  N  N     . ALA A  1  877  ? 249.606 299.082 262.620 1.00 0.00 ? 877  ALA A N     1 
ATOM   6666  C  CA    . ALA A  1  877  ? 250.043 298.834 261.235 1.00 0.00 ? 877  ALA A CA    1 
ATOM   6667  C  C     . ALA A  1  877  ? 251.373 298.101 261.077 1.00 0.00 ? 877  ALA A C     1 
ATOM   6668  O  O     . ALA A  1  877  ? 251.802 297.874 259.949 1.00 0.00 ? 877  ALA A O     1 
ATOM   6669  C  CB    . ALA A  1  877  ? 250.072 300.139 260.431 1.00 0.00 ? 877  ALA A CB    1 
ATOM   6670  N  N     . THR A  1  878  ? 252.035 297.725 262.164 1.00 0.00 ? 878  THR A N     1 
ATOM   6671  C  CA    . THR A  1  878  ? 253.221 296.906 261.977 1.00 0.00 ? 878  THR A CA    1 
ATOM   6672  C  C     . THR A  1  878  ? 252.770 295.468 261.848 1.00 0.00 ? 878  THR A C     1 
ATOM   6673  O  O     . THR A  1  878  ? 252.091 294.949 262.716 1.00 0.00 ? 878  THR A O     1 
ATOM   6674  C  CB    . THR A  1  878  ? 254.230 297.010 263.111 1.00 0.00 ? 878  THR A CB    1 
ATOM   6675  O  OG1   . THR A  1  878  ? 253.828 296.167 264.192 1.00 0.00 ? 878  THR A OG1   1 
ATOM   6676  C  CG2   . THR A  1  878  ? 254.377 298.441 263.574 1.00 0.00 ? 878  THR A CG2   1 
ATOM   6677  N  N     . VAL A  1  879  ? 253.153 294.831 260.752 1.00 0.00 ? 879  VAL A N     1 
ATOM   6678  C  CA    . VAL A  1  879  ? 252.811 293.449 260.464 1.00 0.00 ? 879  VAL A CA    1 
ATOM   6679  C  C     . VAL A  1  879  ? 253.591 292.464 261.343 1.00 0.00 ? 879  VAL A C     1 
ATOM   6680  O  O     . VAL A  1  879  ? 254.803 292.420 261.295 1.00 0.00 ? 879  VAL A O     1 
ATOM   6681  C  CB    . VAL A  1  879  ? 253.077 293.186 258.977 1.00 0.00 ? 879  VAL A CB    1 
ATOM   6682  C  CG1   . VAL A  1  879  ? 252.875 291.759 258.635 1.00 0.00 ? 879  VAL A CG1   1 
ATOM   6683  C  CG2   . VAL A  1  879  ? 252.176 294.059 258.144 1.00 0.00 ? 879  VAL A CG2   1 
ATOM   6684  N  N     . ARG A  1  880  ? 252.893 291.666 262.137 1.00 0.00 ? 880  ARG A N     1 
ATOM   6685  C  CA    . ARG A  1  880  ? 253.546 290.767 263.083 1.00 0.00 ? 880  ARG A CA    1 
ATOM   6686  C  C     . ARG A  1  880  ? 253.008 289.374 262.904 1.00 0.00 ? 880  ARG A C     1 
ATOM   6687  O  O     . ARG A  1  880  ? 251.906 289.248 262.391 1.00 0.00 ? 880  ARG A O     1 
ATOM   6688  C  CB    . ARG A  1  880  ? 253.276 291.204 264.506 1.00 0.00 ? 880  ARG A CB    1 
ATOM   6689  C  CG    . ARG A  1  880  ? 253.601 292.616 264.795 1.00 0.00 ? 880  ARG A CG    1 
ATOM   6690  C  CD    . ARG A  1  880  ? 253.180 292.919 266.184 1.00 0.00 ? 880  ARG A CD    1 
ATOM   6691  N  NE    . ARG A  1  880  ? 253.277 294.336 266.441 1.00 0.00 ? 880  ARG A NE    1 
ATOM   6692  C  CZ    . ARG A  1  880  ? 253.749 294.847 267.561 1.00 0.00 ? 880  ARG A CZ    1 
ATOM   6693  N  NH1   . ARG A  1  880  ? 254.151 294.038 268.531 1.00 0.00 ? 880  ARG A NH1   1 
ATOM   6694  N  NH2   . ARG A  1  880  ? 253.783 296.162 267.724 1.00 0.00 ? 880  ARG A NH2   1 
ATOM   6695  N  N     . ASN A  1  881  ? 253.709 288.337 263.380 1.00 0.00 ? 881  ASN A N     1 
ATOM   6696  C  CA    . ASN A  1  881  ? 253.158 286.968 263.315 1.00 0.00 ? 881  ASN A CA    1 
ATOM   6697  C  C     . ASN A  1  881  ? 252.281 286.586 264.523 1.00 0.00 ? 881  ASN A C     1 
ATOM   6698  O  O     . ASN A  1  881  ? 251.677 287.452 265.159 1.00 0.00 ? 881  ASN A O     1 
ATOM   6699  C  CB    . ASN A  1  881  ? 254.273 285.933 263.145 1.00 0.00 ? 881  ASN A CB    1 
ATOM   6700  C  CG    . ASN A  1  881  ? 255.241 285.913 264.308 1.00 0.00 ? 881  ASN A CG    1 
ATOM   6701  O  OD1   . ASN A  1  881  ? 254.958 286.446 265.378 1.00 0.00 ? 881  ASN A OD1   1 
ATOM   6702  N  ND2   . ASN A  1  881  ? 256.388 285.270 264.111 1.00 0.00 ? 881  ASN A ND2   1 
ATOM   6703  N  N     . SER A  1  882  ? 252.190 285.291 264.815 1.00 0.00 ? 882  SER A N     1 
ATOM   6704  C  CA    . SER A  1  882  ? 251.335 284.804 265.910 1.00 0.00 ? 882  SER A CA    1 
ATOM   6705  C  C     . SER A  1  882  ? 251.867 285.094 267.320 1.00 0.00 ? 882  SER A C     1 
ATOM   6706  O  O     . SER A  1  882  ? 251.110 285.490 268.217 1.00 0.00 ? 882  SER A O     1 
ATOM   6707  C  CB    . SER A  1  882  ? 251.121 283.294 265.780 1.00 0.00 ? 882  SER A CB    1 
ATOM   6708  O  OG    . SER A  1  882  ? 252.365 282.604 265.849 1.00 0.00 ? 882  SER A OG    1 
ATOM   6709  N  N     . ILE A  1  883  ? 253.169 284.881 267.503 1.00 0.00 ? 883  ILE A N     1 
ATOM   6710  C  CA    . ILE A  1  883  ? 253.833 285.146 268.777 1.00 0.00 ? 883  ILE A CA    1 
ATOM   6711  C  C     . ILE A  1  883  ? 254.121 286.637 268.934 1.00 0.00 ? 883  ILE A C     1 
ATOM   6712  O  O     . ILE A  1  883  ? 254.846 287.043 269.835 1.00 0.00 ? 883  ILE A O     1 
ATOM   6713  C  CB    . ILE A  1  883  ? 255.140 284.330 268.908 1.00 0.00 ? 883  ILE A CB    1 
ATOM   6714  C  CG1   . ILE A  1  883  ? 256.114 284.672 267.776 1.00 0.00 ? 883  ILE A CG1   1 
ATOM   6715  C  CG2   . ILE A  1  883  ? 254.832 282.832 268.931 1.00 0.00 ? 883  ILE A CG2   1 
ATOM   6716  C  CD1   . ILE A  1  883  ? 257.382 283.846 267.797 1.00 0.00 ? 883  ILE A CD1   1 
ATOM   6717  N  N     . ASN A  1  884  ? 253.546 287.423 268.028 1.00 0.00 ? 884  ASN A N     1 
ATOM   6718  C  CA    . ASN A  1  884  ? 253.557 288.883 268.057 1.00 0.00 ? 884  ASN A CA    1 
ATOM   6719  C  C     . ASN A  1  884  ? 254.884 289.587 267.685 1.00 0.00 ? 884  ASN A C     1 
ATOM   6720  O  O     . ASN A  1  884  ? 254.984 290.812 267.807 1.00 0.00 ? 884  ASN A O     1 
ATOM   6721  C  CB    . ASN A  1  884  ? 253.102 289.350 269.443 1.00 0.00 ? 884  ASN A CB    1 
ATOM   6722  C  CG    . ASN A  1  884  ? 252.553 290.758 269.431 1.00 0.00 ? 884  ASN A CG    1 
ATOM   6723  O  OD1   . ASN A  1  884  ? 251.841 291.156 268.504 1.00 0.00 ? 884  ASN A OD1   1 
ATOM   6724  N  ND2   . ASN A  1  884  ? 252.908 291.538 270.451 1.00 0.00 ? 884  ASN A ND2   1 
ATOM   6725  N  N     . GLN A  1  885  ? 255.871 288.842 267.184 1.00 0.00 ? 885  GLN A N     1 
ATOM   6726  C  CA    . GLN A  1  885  ? 257.123 289.439 266.690 1.00 0.00 ? 885  GLN A CA    1 
ATOM   6727  C  C     . GLN A  1  885  ? 256.915 290.304 265.439 1.00 0.00 ? 885  GLN A C     1 
ATOM   6728  O  O     . GLN A  1  885  ? 256.101 289.962 264.595 1.00 0.00 ? 885  GLN A O     1 
ATOM   6729  C  CB    . GLN A  1  885  ? 258.139 288.349 266.382 1.00 0.00 ? 885  GLN A CB    1 
ATOM   6730  C  CG    . GLN A  1  885  ? 258.602 287.588 267.600 1.00 0.00 ? 885  GLN A CG    1 
ATOM   6731  C  CD    . GLN A  1  885  ? 259.485 286.410 267.235 1.00 0.00 ? 885  GLN A CD    1 
ATOM   6732  O  OE1   . GLN A  1  885  ? 259.313 285.798 266.169 1.00 0.00 ? 885  GLN A OE1   1 
ATOM   6733  N  NE2   . GLN A  1  885  ? 260.466 286.107 268.102 1.00 0.00 ? 885  GLN A NE2   1 
ATOM   6734  N  N     . VAL A  1  886  ? 257.658 291.403 265.301 1.00 0.00 ? 886  VAL A N     1 
ATOM   6735  C  CA    . VAL A  1  886  ? 257.474 292.323 264.171 1.00 0.00 ? 886  VAL A CA    1 
ATOM   6736  C  C     . VAL A  1  886  ? 258.129 291.800 262.914 1.00 0.00 ? 886  VAL A C     1 
ATOM   6737  O  O     . VAL A  1  886  ? 259.283 291.437 262.932 1.00 0.00 ? 886  VAL A O     1 
ATOM   6738  C  CB    . VAL A  1  886  ? 258.044 293.714 264.459 1.00 0.00 ? 886  VAL A CB    1 
ATOM   6739  C  CG1   . VAL A  1  886  ? 257.852 294.624 263.250 1.00 0.00 ? 886  VAL A CG1   1 
ATOM   6740  C  CG2   . VAL A  1  886  ? 257.387 294.308 265.680 1.00 0.00 ? 886  VAL A CG2   1 
ATOM   6741  N  N     . VAL A  1  887  ? 257.381 291.727 261.825 1.00 0.00 ? 887  VAL A N     1 
ATOM   6742  C  CA    . VAL A  1  887  ? 257.941 291.328 260.542 1.00 0.00 ? 887  VAL A CA    1 
ATOM   6743  C  C     . VAL A  1  887  ? 258.408 292.547 259.739 1.00 0.00 ? 887  VAL A C     1 
ATOM   6744  O  O     . VAL A  1  887  ? 259.561 292.594 259.294 1.00 0.00 ? 887  VAL A O     1 
ATOM   6745  C  CB    . VAL A  1  887  ? 256.922 290.491 259.730 1.00 0.00 ? 887  VAL A CB    1 
ATOM   6746  C  CG1   . VAL A  1  887  ? 257.495 290.109 258.383 1.00 0.00 ? 887  VAL A CG1   1 
ATOM   6747  C  CG2   . VAL A  1  887  ? 256.482 289.249 260.521 1.00 0.00 ? 887  VAL A CG2   1 
ATOM   6748  N  N     . GLN A  1  888  ? 257.497 293.514 259.562 1.00 0.00 ? 888  GLN A N     1 
ATOM   6749  C  CA    . GLN A  1  888  ? 257.759 294.815 258.916 1.00 0.00 ? 888  GLN A CA    1 
ATOM   6750  C  C     . GLN A  1  888  ? 257.133 295.949 259.749 1.00 0.00 ? 888  GLN A C     1 
ATOM   6751  O  O     . GLN A  1  888  ? 256.281 295.699 260.586 1.00 0.00 ? 888  GLN A O     1 
ATOM   6752  C  CB    . GLN A  1  888  ? 257.238 294.819 257.478 1.00 0.00 ? 888  GLN A CB    1 
ATOM   6753  C  CG    . GLN A  1  888  ? 257.919 293.765 256.617 1.00 0.00 ? 888  GLN A CG    1 
ATOM   6754  C  CD    . GLN A  1  888  ? 257.457 293.764 255.165 1.00 0.00 ? 888  GLN A CD    1 
ATOM   6755  O  OE1   . GLN A  1  888  ? 256.276 293.946 254.870 1.00 0.00 ? 888  GLN A OE1   1 
ATOM   6756  N  NE2   . GLN A  1  888  ? 258.391 293.548 254.248 1.00 0.00 ? 888  GLN A NE2   1 
ATOM   6757  N  N     . LEU A  1  889  ? 257.586 297.182 259.571 1.00 0.00 ? 889  LEU A N     1 
ATOM   6758  C  CA    . LEU A  1  889  ? 257.056 298.270 260.391 1.00 0.00 ? 889  LEU A CA    1 
ATOM   6759  C  C     . LEU A  1  889  ? 255.850 298.969 259.780 1.00 0.00 ? 889  LEU A C     1 
ATOM   6760  O  O     . LEU A  1  889  ? 255.102 299.654 260.472 1.00 0.00 ? 889  LEU A O     1 
ATOM   6761  C  CB    . LEU A  1  889  ? 258.139 299.293 260.708 1.00 0.00 ? 889  LEU A CB    1 
ATOM   6762  C  CG    . LEU A  1  889  ? 258.867 298.949 262.007 1.00 0.00 ? 889  LEU A CG    1 
ATOM   6763  C  CD1   . LEU A  1  889  ? 259.647 297.635 261.907 1.00 0.00 ? 889  LEU A CD1   1 
ATOM   6764  C  CD2   . LEU A  1  889  ? 259.771 300.100 262.405 1.00 0.00 ? 889  LEU A CD2   1 
ATOM   6765  N  N     . ARG A  1  890  ? 255.670 298.809 258.483 1.00 0.00 ? 890  ARG A N     1 
ATOM   6766  C  CA    . ARG A  1  890  ? 254.430 299.186 257.830 1.00 0.00 ? 890  ARG A CA    1 
ATOM   6767  C  C     . ARG A  1  890  ? 254.375 298.137 256.727 1.00 0.00 ? 890  ARG A C     1 
ATOM   6768  O  O     . ARG A  1  890  ? 255.423 297.635 256.332 1.00 0.00 ? 890  ARG A O     1 
ATOM   6769  C  CB    . ARG A  1  890  ? 254.431 300.663 257.361 1.00 0.00 ? 890  ARG A CB    1 
ATOM   6770  C  CG    . ARG A  1  890  ? 254.445 301.671 258.551 1.00 0.00 ? 890  ARG A CG    1 
ATOM   6771  C  CD    . ARG A  1  890  ? 254.521 303.185 258.229 1.00 0.00 ? 890  ARG A CD    1 
ATOM   6772  N  NE    . ARG A  1  890  ? 254.777 303.989 259.460 1.00 0.00 ? 890  ARG A NE    1 
ATOM   6773  C  CZ    . ARG A  1  890  ? 255.071 305.307 259.521 1.00 0.00 ? 890  ARG A CZ    1 
ATOM   6774  N  NH1   . ARG A  1  890  ? 255.137 306.055 258.422 1.00 0.00 ? 890  ARG A NH1   1 
ATOM   6775  N  NH2   . ARG A  1  890  ? 255.267 305.901 260.703 1.00 0.00 ? 890  ARG A NH2   1 
ATOM   6776  N  N     . TYR A  1  891  ? 253.184 297.732 256.294 1.00 0.00 ? 891  TYR A N     1 
ATOM   6777  C  CA    . TYR A  1  891  ? 253.075 296.584 255.390 1.00 0.00 ? 891  TYR A CA    1 
ATOM   6778  C  C     . TYR A  1  891  ? 253.723 296.781 254.038 1.00 0.00 ? 891  TYR A C     1 
ATOM   6779  O  O     . TYR A  1  891  ? 253.317 297.632 253.258 1.00 0.00 ? 891  TYR A O     1 
ATOM   6780  C  CB    . TYR A  1  891  ? 251.624 296.201 255.175 1.00 0.00 ? 891  TYR A CB    1 
ATOM   6781  C  CG    . TYR A  1  891  ? 251.399 295.194 254.067 1.00 0.00 ? 891  TYR A CG    1 
ATOM   6782  C  CD1   . TYR A  1  891  ? 251.995 293.939 254.112 1.00 0.00 ? 891  TYR A CD1   1 
ATOM   6783  C  CD2   . TYR A  1  891  ? 250.544 295.477 253.017 1.00 0.00 ? 891  TYR A CD2   1 
ATOM   6784  C  CE1   . TYR A  1  891  ? 251.780 293.015 253.123 1.00 0.00 ? 891  TYR A CE1   1 
ATOM   6785  C  CE2   . TYR A  1  891  ? 250.316 294.562 252.024 1.00 0.00 ? 891  TYR A CE2   1 
ATOM   6786  C  CZ    . TYR A  1  891  ? 250.938 293.327 252.076 1.00 0.00 ? 891  TYR A CZ    1 
ATOM   6787  O  OH    . TYR A  1  891  ? 250.719 292.406 251.068 1.00 0.00 ? 891  TYR A OH    1 
ATOM   6788  N  N     . GLY A  1  892  ? 254.712 295.935 253.769 1.00 0.00 ? 892  GLY A N     1 
ATOM   6789  C  CA    . GLY A  1  892  ? 255.406 295.850 252.499 1.00 0.00 ? 892  GLY A CA    1 
ATOM   6790  C  C     . GLY A  1  892  ? 256.295 297.063 252.327 1.00 0.00 ? 892  GLY A C     1 
ATOM   6791  O  O     . GLY A  1  892  ? 256.613 297.435 251.204 1.00 0.00 ? 892  GLY A O     1 
ATOM   6792  N  N     . GLU A  1  893  ? 256.691 297.659 253.458 1.00 0.00 ? 893  GLU A N     1 
ATOM   6793  C  CA    . GLU A  1  893  ? 257.629 298.780 253.544 1.00 0.00 ? 893  GLU A CA    1 
ATOM   6794  C  C     . GLU A  1  893  ? 257.024 300.105 253.138 1.00 0.00 ? 893  GLU A C     1 
ATOM   6795  O  O     . GLU A  1  893  ? 257.754 300.965 252.695 1.00 0.00 ? 893  GLU A O     1 
ATOM   6796  C  CB    . GLU A  1  893  ? 258.869 298.516 252.676 1.00 0.00 ? 893  GLU A CB    1 
ATOM   6797  C  CG    . GLU A  1  893  ? 259.617 297.230 253.020 1.00 0.00 ? 893  GLU A CG    1 
ATOM   6798  C  CD    . GLU A  1  893  ? 260.905 297.036 252.210 1.00 0.00 ? 893  GLU A CD    1 
ATOM   6799  O  OE1   . GLU A  1  893  ? 260.930 297.456 251.020 1.00 0.00 ? 893  GLU A OE1   1 
ATOM   6800  O  OE2   . GLU A  1  893  ? 261.866 296.421 252.750 1.00 0.00 ? 893  GLU A OE2   1 
ATOM   6801  N  N     . ASP A  1  894  ? 255.721 300.306 253.277 1.00 0.00 ? 894  ASP A N     1 
ATOM   6802  C  CA    . ASP A  1  894  ? 255.133 301.533 252.726 1.00 0.00 ? 894  ASP A CA    1 
ATOM   6803  C  C     . ASP A  1  894  ? 253.709 301.842 253.145 1.00 0.00 ? 894  ASP A C     1 
ATOM   6804  O  O     . ASP A  1  894  ? 253.163 302.902 252.785 1.00 0.00 ? 894  ASP A O     1 
ATOM   6805  C  CB    . ASP A  1  894  ? 255.143 301.466 251.204 1.00 0.00 ? 894  ASP A CB    1 
ATOM   6806  C  CG    . ASP A  1  894  ? 254.262 300.334 250.666 1.00 0.00 ? 894  ASP A CG    1 
ATOM   6807  O  OD1   . ASP A  1  894  ? 253.948 299.392 251.430 1.00 0.00 ? 894  ASP A OD1   1 
ATOM   6808  O  OD2   . ASP A  1  894  ? 253.888 300.374 249.473 1.00 0.00 ? 894  ASP A OD2   1 
ATOM   6809  N  N     . GLY A  1  895  ? 253.100 300.891 253.853 1.00 0.00 ? 895  GLY A N     1 
ATOM   6810  C  CA    . GLY A  1  895  ? 251.732 300.999 254.334 1.00 0.00 ? 895  GLY A CA    1 
ATOM   6811  C  C     . GLY A  1  895  ? 250.640 300.771 253.295 1.00 0.00 ? 895  GLY A C     1 
ATOM   6812  O  O     . GLY A  1  895  ? 249.464 300.803 253.647 1.00 0.00 ? 895  GLY A O     1 
ATOM   6813  N  N     . LEU A  1  896  ? 250.994 300.542 252.029 1.00 0.00 ? 896  LEU A N     1 
ATOM   6814  C  CA    . LEU A  1  896  ? 249.974 300.467 250.978 1.00 0.00 ? 896  LEU A CA    1 
ATOM   6815  C  C     . LEU A  1  896  ? 249.546 299.056 250.607 1.00 0.00 ? 896  LEU A C     1 
ATOM   6816  O  O     . LEU A  1  896  ? 250.369 298.196 250.328 1.00 0.00 ? 896  LEU A O     1 
ATOM   6817  C  CB    . LEU A  1  896  ? 250.447 301.181 249.719 1.00 0.00 ? 896  LEU A CB    1 
ATOM   6818  C  CG    . LEU A  1  896  ? 250.773 302.656 249.931 1.00 0.00 ? 896  LEU A CG    1 
ATOM   6819  C  CD1   . LEU A  1  896  ? 250.984 303.301 248.577 1.00 0.00 ? 896  LEU A CD1   1 
ATOM   6820  C  CD2   . LEU A  1  896  ? 249.688 303.381 250.738 1.00 0.00 ? 896  LEU A CD2   1 
ATOM   6821  N  N     . ALA A  1  897  ? 248.237 298.846 250.590 1.00 0.00 ? 897  ALA A N     1 
ATOM   6822  C  CA    . ALA A  1  897  ? 247.633 297.602 250.142 1.00 0.00 ? 897  ALA A CA    1 
ATOM   6823  C  C     . ALA A  1  897  ? 247.831 297.378 248.649 1.00 0.00 ? 897  ALA A C     1 
ATOM   6824  O  O     . ALA A  1  897  ? 247.840 298.334 247.866 1.00 0.00 ? 897  ALA A O     1 
ATOM   6825  C  CB    . ALA A  1  897  ? 246.170 297.598 250.470 1.00 0.00 ? 897  ALA A CB    1 
ATOM   6826  N  N     . GLY A  1  898  ? 247.987 296.110 248.269 1.00 0.00 ? 898  GLY A N     1 
ATOM   6827  C  CA    . GLY A  1  898  ? 248.224 295.701 246.888 1.00 0.00 ? 898  GLY A CA    1 
ATOM   6828  C  C     . GLY A  1  898  ? 247.101 295.773 245.850 1.00 0.00 ? 898  GLY A C     1 
ATOM   6829  O  O     . GLY A  1  898  ? 247.348 295.542 244.662 1.00 0.00 ? 898  GLY A O     1 
ATOM   6830  N  N     . GLU A  1  899  ? 245.872 296.058 246.277 1.00 0.00 ? 899  GLU A N     1 
ATOM   6831  C  CA    . GLU A  1  899  ? 244.759 296.178 245.334 1.00 0.00 ? 899  GLU A CA    1 
ATOM   6832  C  C     . GLU A  1  899  ? 244.719 297.455 244.466 1.00 0.00 ? 899  GLU A C     1 
ATOM   6833  O  O     . GLU A  1  899  ? 244.143 297.447 243.378 1.00 0.00 ? 899  GLU A O     1 
ATOM   6834  C  CB    . GLU A  1  899  ? 243.426 296.074 246.075 1.00 0.00 ? 899  GLU A CB    1 
ATOM   6835  C  CG    . GLU A  1  899  ? 243.061 294.686 246.580 1.00 0.00 ? 899  GLU A CG    1 
ATOM   6836  C  CD    . GLU A  1  899  ? 241.697 294.670 247.299 1.00 0.00 ? 899  GLU A CD    1 
ATOM   6837  O  OE1   . GLU A  1  899  ? 240.951 295.680 247.166 1.00 0.00 ? 899  GLU A OE1   1 
ATOM   6838  O  OE2   . GLU A  1  899  ? 241.376 293.654 247.984 1.00 0.00 ? 899  GLU A OE2   1 
ATOM   6839  N  N     . SER A  1  900  ? 245.275 298.559 244.945 1.00 0.00 ? 900  SER A N     1 
ATOM   6840  C  CA    . SER A  1  900  ? 245.087 299.823 244.235 1.00 0.00 ? 900  SER A CA    1 
ATOM   6841  C  C     . SER A  1  900  ? 246.390 300.575 244.069 1.00 0.00 ? 900  SER A C     1 
ATOM   6842  O  O     . SER A  1  900  ? 246.533 301.729 244.462 1.00 0.00 ? 900  SER A O     1 
ATOM   6843  C  CB    . SER A  1  900  ? 244.050 300.700 244.941 1.00 0.00 ? 900  SER A CB    1 
ATOM   6844  O  OG    . SER A  1  900  ? 242.813 300.014 245.070 1.00 0.00 ? 900  SER A OG    1 
ATOM   6845  N  N     . VAL A  1  901  ? 247.337 299.891 243.460 1.00 0.00 ? 901  VAL A N     1 
ATOM   6846  C  CA    . VAL A  1  901  ? 248.588 300.494 243.069 1.00 0.00 ? 901  VAL A CA    1 
ATOM   6847  C  C     . VAL A  1  901  ? 248.726 300.278 241.553 1.00 0.00 ? 901  VAL A C     1 
ATOM   6848  O  O     . VAL A  1  901  ? 248.208 299.292 241.025 1.00 0.00 ? 901  VAL A O     1 
ATOM   6849  C  CB    . VAL A  1  901  ? 249.749 299.882 243.875 1.00 0.00 ? 901  VAL A CB    1 
ATOM   6850  C  CG1   . VAL A  1  901  ? 249.487 300.069 245.357 1.00 0.00 ? 901  VAL A CG1   1 
ATOM   6851  C  CG2   . VAL A  1  901  ? 249.909 298.397 243.570 1.00 0.00 ? 901  VAL A CG2   1 
ATOM   6852  N  N     . GLU A  1  902  ? 249.390 301.185 240.840 1.00 0.00 ? 902  GLU A N     1 
ATOM   6853  C  CA    . GLU A  1  902  ? 249.467 301.059 239.383 1.00 0.00 ? 902  GLU A CA    1 
ATOM   6854  C  C     . GLU A  1  902  ? 250.790 301.578 238.798 1.00 0.00 ? 902  GLU A C     1 
ATOM   6855  O  O     . GLU A  1  902  ? 251.506 302.320 239.457 1.00 0.00 ? 902  GLU A O     1 
ATOM   6856  C  CB    . GLU A  1  902  ? 248.228 301.711 238.716 1.00 0.00 ? 902  GLU A CB    1 
ATOM   6857  C  CG    . GLU A  1  902  ? 247.935 303.181 239.014 1.00 0.00 ? 902  GLU A CG    1 
ATOM   6858  C  CD    . GLU A  1  902  ? 246.884 303.808 238.059 1.00 0.00 ? 902  GLU A CD    1 
ATOM   6859  O  OE1   . GLU A  1  902  ? 247.121 303.859 236.827 1.00 0.00 ? 902  GLU A OE1   1 
ATOM   6860  O  OE2   . GLU A  1  902  ? 245.814 304.252 238.543 1.00 0.00 ? 902  GLU A OE2   1 
ATOM   6861  N  N     . PHE A  1  903  ? 251.188 301.044 237.641 1.00 0.00 ? 903  PHE A N     1 
ATOM   6862  C  CA    . PHE A  1  903  ? 252.482 301.377 237.047 1.00 0.00 ? 903  PHE A CA    1 
ATOM   6863  C  C     . PHE A  1  903  ? 252.537 302.840 236.602 1.00 0.00 ? 903  PHE A C     1 
ATOM   6864  O  O     . PHE A  1  903  ? 251.608 303.333 235.967 1.00 0.00 ? 903  PHE A O     1 
ATOM   6865  C  CB    . PHE A  1  903  ? 252.769 300.516 235.802 1.00 0.00 ? 903  PHE A CB    1 
ATOM   6866  C  CG    . PHE A  1  903  ? 252.894 299.044 236.065 1.00 0.00 ? 903  PHE A CG    1 
ATOM   6867  C  CD1   . PHE A  1  903  ? 253.266 298.561 237.306 1.00 0.00 ? 903  PHE A CD1   1 
ATOM   6868  C  CD2   . PHE A  1  903  ? 252.653 298.135 235.043 1.00 0.00 ? 903  PHE A CD2   1 
ATOM   6869  C  CE1   . PHE A  1  903  ? 253.380 297.190 237.532 1.00 0.00 ? 903  PHE A CE1   1 
ATOM   6870  C  CE2   . PHE A  1  903  ? 252.768 296.770 235.260 1.00 0.00 ? 903  PHE A CE2   1 
ATOM   6871  C  CZ    . PHE A  1  903  ? 253.131 296.297 236.506 1.00 0.00 ? 903  PHE A CZ    1 
ATOM   6872  N  N     . GLN A  1  904  ? 253.604 303.546 236.952 1.00 0.00 ? 904  GLN A N     1 
ATOM   6873  C  CA    . GLN A  1  904  ? 253.728 304.960 236.603 1.00 0.00 ? 904  GLN A CA    1 
ATOM   6874  C  C     . GLN A  1  904  ? 255.153 305.304 236.230 1.00 0.00 ? 904  GLN A C     1 
ATOM   6875  O  O     . GLN A  1  904  ? 256.094 304.636 236.651 1.00 0.00 ? 904  GLN A O     1 
ATOM   6876  C  CB    . GLN A  1  904  ? 253.244 305.897 237.693 1.00 0.00 ? 904  GLN A CB    1 
ATOM   6877  C  CG    . GLN A  1  904  ? 251.774 305.808 237.944 1.00 0.00 ? 904  GLN A CG    1 
ATOM   6878  C  CD    . GLN A  1  904  ? 251.335 306.811 238.960 1.00 0.00 ? 904  GLN A CD    1 
ATOM   6879  O  OE1   . GLN A  1  904  ? 251.436 308.007 238.726 1.00 0.00 ? 904  GLN A OE1   1 
ATOM   6880  N  NE2   . GLN A  1  904  ? 250.878 306.344 240.109 1.00 0.00 ? 904  GLN A NE2   1 
ATOM   6881  N  N     . ASN A  1  905  ? 255.311 306.351 235.436 1.00 0.00 ? 905  ASN A N     1 
ATOM   6882  C  CA    . ASN A  1  905  ? 256.623 306.741 234.960 1.00 0.00 ? 905  ASN A CA    1 
ATOM   6883  C  C     . ASN A  1  905  ? 257.195 307.829 235.863 1.00 0.00 ? 905  ASN A C     1 
ATOM   6884  O  O     . ASN A  1  905  ? 256.458 308.663 236.372 1.00 0.00 ? 905  ASN A O     1 
ATOM   6885  C  CB    . ASN A  1  905  ? 256.532 307.229 233.516 1.00 0.00 ? 905  ASN A CB    1 
ATOM   6886  C  CG    . ASN A  1  905  ? 257.890 307.378 232.864 1.00 0.00 ? 905  ASN A CG    1 
ATOM   6887  O  OD1   . ASN A  1  905  ? 258.915 307.016 233.446 1.00 0.00 ? 905  ASN A OD1   1 
ATOM   6888  N  ND2   . ASN A  1  905  ? 257.903 307.895 231.638 1.00 0.00 ? 905  ASN A ND2   1 
ATOM   6889  N  N     . LEU A  1  906  ? 258.497 307.770 236.122 1.00 0.00 ? 906  LEU A N     1 
ATOM   6890  C  CA    . LEU A  1  906  ? 259.164 308.828 236.874 1.00 0.00 ? 906  LEU A CA    1 
ATOM   6891  C  C     . LEU A  1  906  ? 259.897 309.822 235.971 1.00 0.00 ? 906  LEU A C     1 
ATOM   6892  O  O     . LEU A  1  906  ? 261.075 309.637 235.661 1.00 0.00 ? 906  LEU A O     1 
ATOM   6893  C  CB    . LEU A  1  906  ? 260.141 308.249 237.886 1.00 0.00 ? 906  LEU A CB    1 
ATOM   6894  C  CG    . LEU A  1  906  ? 259.469 307.733 239.144 1.00 0.00 ? 906  LEU A CG    1 
ATOM   6895  C  CD1   . LEU A  1  906  ? 260.490 307.094 240.068 1.00 0.00 ? 906  LEU A CD1   1 
ATOM   6896  C  CD2   . LEU A  1  906  ? 258.787 308.883 239.808 1.00 0.00 ? 906  LEU A CD2   1 
ATOM   6897  N  N     . ALA A  1  907  ? 259.178 310.861 235.552 1.00 0.00 ? 907  ALA A N     1 
ATOM   6898  C  CA    . ALA A  1  907  ? 259.713 311.973 234.764 1.00 0.00 ? 907  ALA A CA    1 
ATOM   6899  C  C     . ALA A  1  907  ? 261.115 312.399 235.190 1.00 0.00 ? 907  ALA A C     1 
ATOM   6900  O  O     . ALA A  1  907  ? 261.946 312.752 234.356 1.00 0.00 ? 907  ALA A O     1 
ATOM   6901  C  CB    . ALA A  1  907  ? 258.766 313.159 234.847 1.00 0.00 ? 907  ALA A CB    1 
ATOM   6902  N  N     . THR A  1  908  ? 261.358 312.375 236.495 1.00 0.00 ? 908  THR A N     1 
ATOM   6903  C  CA    . THR A  1  908  ? 262.549 312.979 237.075 1.00 0.00 ? 908  THR A CA    1 
ATOM   6904  C  C     . THR A  1  908  ? 263.873 312.260 236.760 1.00 0.00 ? 908  THR A C     1 
ATOM   6905  O  O     . THR A  1  908  ? 264.931 312.804 237.035 1.00 0.00 ? 908  THR A O     1 
ATOM   6906  C  CB    . THR A  1  908  ? 262.364 313.139 238.567 1.00 0.00 ? 908  THR A CB    1 
ATOM   6907  O  OG1   . THR A  1  908  ? 260.962 313.102 238.846 1.00 0.00 ? 908  THR A OG1   1 
ATOM   6908  C  CG2   . THR A  1  908  ? 262.873 314.498 239.001 1.00 0.00 ? 908  THR A CG2   1 
ATOM   6909  N  N     . LEU A  1  909  ? 263.843 311.013 236.306 1.00 0.00 ? 909  LEU A N     1 
ATOM   6910  C  CA    . LEU A  1  909  ? 265.090 310.362 235.879 1.00 0.00 ? 909  LEU A CA    1 
ATOM   6911  C  C     . LEU A  1  909  ? 265.605 310.912 234.533 1.00 0.00 ? 909  LEU A C     1 
ATOM   6912  O  O     . LEU A  1  909  ? 266.345 310.228 233.820 1.00 0.00 ? 909  LEU A O     1 
ATOM   6913  C  CB    . LEU A  1  909  ? 264.933 308.854 235.795 1.00 0.00 ? 909  LEU A CB    1 
ATOM   6914  C  CG    . LEU A  1  909  ? 264.981 308.278 237.200 1.00 0.00 ? 909  LEU A CG    1 
ATOM   6915  C  CD1   . LEU A  1  909  ? 264.433 306.870 237.263 1.00 0.00 ? 909  LEU A CD1   1 
ATOM   6916  C  CD2   . LEU A  1  909  ? 266.422 308.314 237.660 1.00 0.00 ? 909  LEU A CD2   1 
ATOM   6917  N  N     . LYS A  1  910  ? 265.177 312.129 234.190 1.00 0.00 ? 910  LYS A N     1 
ATOM   6918  C  CA    . LYS A  1  910  ? 265.516 312.810 232.938 1.00 0.00 ? 910  LYS A CA    1 
ATOM   6919  C  C     . LYS A  1  910  ? 267.007 312.900 232.655 1.00 0.00 ? 910  LYS A C     1 
ATOM   6920  O  O     . LYS A  1  910  ? 267.757 313.483 233.432 1.00 0.00 ? 910  LYS A O     1 
ATOM   6921  C  CB    . LYS A  1  910  ? 264.938 314.219 232.931 1.00 0.00 ? 910  LYS A CB    1 
ATOM   6922  C  CG    . LYS A  1  910  ? 265.221 314.991 231.652 1.00 0.00 ? 910  LYS A CG    1 
ATOM   6923  C  CD    . LYS A  1  910  ? 264.374 314.469 230.495 1.00 0.00 ? 910  LYS A CD    1 
ATOM   6924  C  CE    . LYS A  1  910  ? 264.628 315.248 229.207 1.00 0.00 ? 910  LYS A CE    1 
ATOM   6925  N  NZ    . LYS A  1  910  ? 263.750 314.811 228.082 1.00 0.00 ? 910  LYS A NZ    1 
ATOM   6926  N  N     . PRO A  1  911  ? 267.430 312.318 231.525 1.00 0.00 ? 911  PRO A N     1 
ATOM   6927  C  CA    . PRO A  1  911  ? 268.801 312.230 230.997 1.00 0.00 ? 911  PRO A CA    1 
ATOM   6928  C  C     . PRO A  1  911  ? 269.681 313.486 231.145 1.00 0.00 ? 911  PRO A C     1 
ATOM   6929  O  O     . PRO A  1  911  ? 270.354 313.624 232.169 1.00 0.00 ? 911  PRO A O     1 
ATOM   6930  C  CB    . PRO A  1  911  ? 268.562 311.922 229.517 1.00 0.00 ? 911  PRO A CB    1 
ATOM   6931  C  CG    . PRO A  1  911  ? 267.336 311.046 229.551 1.00 0.00 ? 911  PRO A CG    1 
ATOM   6932  C  CD    . PRO A  1  911  ? 266.472 311.581 230.678 1.00 0.00 ? 911  PRO A CD    1 
ATOM   6933  N  N     . SER A  1  912  ? 269.687 314.376 230.156 1.00 0.00 ? 912  SER A N     1 
ATOM   6934  C  CA    . SER A  1  912  ? 270.666 315.460 230.161 1.00 0.00 ? 912  SER A CA    1 
ATOM   6935  C  C     . SER A  1  912  ? 270.311 316.537 231.178 1.00 0.00 ? 912  SER A C     1 
ATOM   6936  O  O     . SER A  1  912  ? 269.139 316.846 231.397 1.00 0.00 ? 912  SER A O     1 
ATOM   6937  C  CB    . SER A  1  912  ? 270.800 316.087 228.770 1.00 0.00 ? 912  SER A CB    1 
ATOM   6938  O  OG    . SER A  1  912  ? 269.631 316.791 228.400 1.00 0.00 ? 912  SER A OG    1 
ATOM   6939  N  N     . ASN A  1  913  ? 271.343 317.113 231.784 1.00 0.00 ? 913  ASN A N     1 
ATOM   6940  C  CA    . ASN A  1  913  ? 271.167 318.135 232.801 1.00 0.00 ? 913  ASN A CA    1 
ATOM   6941  C  C     . ASN A  1  913  ? 270.530 319.389 232.243 1.00 0.00 ? 913  ASN A C     1 
ATOM   6942  O  O     . ASN A  1  913  ? 269.680 320.000 232.886 1.00 0.00 ? 913  ASN A O     1 
ATOM   6943  C  CB    . ASN A  1  913  ? 272.514 318.498 233.427 1.00 0.00 ? 913  ASN A CB    1 
ATOM   6944  C  CG    . ASN A  1  913  ? 273.001 317.461 234.411 1.00 0.00 ? 913  ASN A CG    1 
ATOM   6945  O  OD1   . ASN A  1  913  ? 272.387 316.412 234.580 1.00 0.00 ? 913  ASN A OD1   1 
ATOM   6946  N  ND2   . ASN A  1  913  ? 274.120 317.747 235.063 1.00 0.00 ? 913  ASN A ND2   1 
ATOM   6947  N  N     . LYS A  1  914  ? 270.929 319.750 231.027 1.00 0.00 ? 914  LYS A N     1 
ATOM   6948  C  CA    . LYS A  1  914  ? 270.327 320.876 230.324 1.00 0.00 ? 914  LYS A CA    1 
ATOM   6949  C  C     . LYS A  1  914  ? 268.844 320.744 229.983 1.00 0.00 ? 914  LYS A C     1 
ATOM   6950  O  O     . LYS A  1  914  ? 268.088 321.705 230.134 1.00 0.00 ? 914  LYS A O     1 
ATOM   6951  C  CB    . LYS A  1  914  ? 271.103 321.135 229.025 1.00 0.00 ? 914  LYS A CB    1 
ATOM   6952  C  CG    . LYS A  1  914  ? 270.633 322.366 228.256 1.00 0.00 ? 914  LYS A CG    1 
ATOM   6953  C  CD    . LYS A  1  914  ? 271.624 322.779 227.183 1.00 0.00 ? 914  LYS A CD    1 
ATOM   6954  C  CE    . LYS A  1  914  ? 271.757 321.698 226.120 1.00 0.00 ? 914  LYS A CE    1 
ATOM   6955  N  NZ    . LYS A  1  914  ? 272.483 322.185 224.913 1.00 0.00 ? 914  LYS A NZ    1 
ATOM   6956  N  N     . ALA A  1  915  ? 268.416 319.571 229.534 1.00 0.00 ? 915  ALA A N     1 
ATOM   6957  C  CA    . ALA A  1  915  ? 266.995 319.355 229.277 1.00 0.00 ? 915  ALA A CA    1 
ATOM   6958  C  C     . ALA A  1  915  ? 266.122 319.411 230.523 1.00 0.00 ? 915  ALA A C     1 
ATOM   6959  O  O     . ALA A  1  915  ? 265.038 319.994 230.506 1.00 0.00 ? 915  ALA A O     1 
ATOM   6960  C  CB    . ALA A  1  915  ? 266.790 318.031 228.573 1.00 0.00 ? 915  ALA A CB    1 
ATOM   6961  N  N     . PHE A  1  916  ? 266.608 318.821 231.607 1.00 0.00 ? 916  PHE A N     1 
ATOM   6962  C  CA    . PHE A  1  916  ? 265.912 318.890 232.885 1.00 0.00 ? 916  PHE A CA    1 
ATOM   6963  C  C     . PHE A  1  916  ? 265.780 320.319 233.388 1.00 0.00 ? 916  PHE A C     1 
ATOM   6964  O  O     . PHE A  1  916  ? 264.710 320.739 233.822 1.00 0.00 ? 916  PHE A O     1 
ATOM   6965  C  CB    . PHE A  1  916  ? 266.630 318.020 233.922 1.00 0.00 ? 916  PHE A CB    1 
ATOM   6966  C  CG    . PHE A  1  916  ? 266.118 318.190 235.324 1.00 0.00 ? 916  PHE A CG    1 
ATOM   6967  C  CD1   . PHE A  1  916  ? 264.936 317.584 235.714 1.00 0.00 ? 916  PHE A CD1   1 
ATOM   6968  C  CD2   . PHE A  1  916  ? 266.820 318.929 236.254 1.00 0.00 ? 916  PHE A CD2   1 
ATOM   6969  C  CE1   . PHE A  1  916  ? 264.456 317.721 236.997 1.00 0.00 ? 916  PHE A CE1   1 
ATOM   6970  C  CE2   . PHE A  1  916  ? 266.342 319.075 237.540 1.00 0.00 ? 916  PHE A CE2   1 
ATOM   6971  C  CZ    . PHE A  1  916  ? 265.159 318.469 237.911 1.00 0.00 ? 916  PHE A CZ    1 
ATOM   6972  N  N     . GLU A  1  917  ? 266.868 321.071 233.317 1.00 0.00 ? 917  GLU A N     1 
ATOM   6973  C  CA    . GLU A  1  917  ? 266.846 322.450 233.770 1.00 0.00 ? 917  GLU A CA    1 
ATOM   6974  C  C     . GLU A  1  917  ? 265.916 323.311 232.911 1.00 0.00 ? 917  GLU A C     1 
ATOM   6975  O  O     . GLU A  1  917  ? 265.171 324.135 233.437 1.00 0.00 ? 917  GLU A O     1 
ATOM   6976  C  CB    . GLU A  1  917  ? 268.275 323.010 233.740 1.00 0.00 ? 917  GLU A CB    1 
ATOM   6977  C  CG    . GLU A  1  917  ? 268.448 324.443 234.218 1.00 0.00 ? 917  GLU A CG    1 
ATOM   6978  C  CD    . GLU A  1  917  ? 269.891 324.752 234.596 1.00 0.00 ? 917  GLU A CD    1 
ATOM   6979  O  OE1   . GLU A  1  917  ? 270.759 323.878 234.385 1.00 0.00 ? 917  GLU A OE1   1 
ATOM   6980  O  OE2   . GLU A  1  917  ? 270.158 325.866 235.097 1.00 0.00 ? 917  GLU A OE2   1 
ATOM   6981  N  N     . LYS A  1  918  ? 265.940 323.089 231.599 1.00 0.00 ? 918  LYS A N     1 
ATOM   6982  C  CA    . LYS A  1  918  ? 265.033 323.761 230.663 1.00 0.00 ? 918  LYS A CA    1 
ATOM   6983  C  C     . LYS A  1  918  ? 263.557 323.454 230.924 1.00 0.00 ? 918  LYS A C     1 
ATOM   6984  O  O     . LYS A  1  918  ? 262.705 324.345 230.925 1.00 0.00 ? 918  LYS A O     1 
ATOM   6985  C  CB    . LYS A  1  918  ? 265.380 323.410 229.210 1.00 0.00 ? 918  LYS A CB    1 
ATOM   6986  C  CG    . LYS A  1  918  ? 264.458 324.077 228.190 1.00 0.00 ? 918  LYS A CG    1 
ATOM   6987  C  CD    . LYS A  1  918  ? 264.821 323.718 226.757 1.00 0.00 ? 918  LYS A CD    1 
ATOM   6988  C  CE    . LYS A  1  918  ? 263.818 324.307 225.773 1.00 0.00 ? 918  LYS A CE    1 
ATOM   6989  N  NZ    . LYS A  1  918  ? 263.913 325.797 225.699 1.00 0.00 ? 918  LYS A NZ    1 
ATOM   6990  N  N     . LYS A  1  919  ? 263.266 322.177 231.136 1.00 0.00 ? 919  LYS A N     1 
ATOM   6991  C  CA    . LYS A  1  919  ? 261.901 321.717 231.337 1.00 0.00 ? 919  LYS A CA    1 
ATOM   6992  C  C     . LYS A  1  919  ? 261.268 322.107 232.671 1.00 0.00 ? 919  LYS A C     1 
ATOM   6993  O  O     . LYS A  1  919  ? 260.114 322.525 232.705 1.00 0.00 ? 919  LYS A O     1 
ATOM   6994  C  CB    . LYS A  1  919  ? 261.889 320.186 231.211 1.00 0.00 ? 919  LYS A CB    1 
ATOM   6995  C  CG    . LYS A  1  919  ? 260.560 319.475 231.466 1.00 0.00 ? 919  LYS A CG    1 
ATOM   6996  C  CD    . LYS A  1  919  ? 259.399 320.114 230.716 1.00 0.00 ? 919  LYS A CD    1 
ATOM   6997  C  CE    . LYS A  1  919  ? 258.359 319.062 230.333 1.00 0.00 ? 919  LYS A CE    1 
ATOM   6998  N  NZ    . LYS A  1  919  ? 257.257 319.624 229.502 1.00 0.00 ? 919  LYS A NZ    1 
ATOM   6999  N  N     . PHE A  1  920  ? 262.002 321.950 233.768 1.00 0.00 ? 920  PHE A N     1 
ATOM   7000  C  CA    . PHE A  1  920  ? 261.431 322.196 235.096 1.00 0.00 ? 920  PHE A CA    1 
ATOM   7001  C  C     . PHE A  1  920  ? 261.531 323.621 235.673 1.00 0.00 ? 920  PHE A C     1 
ATOM   7002  O  O     . PHE A  1  920  ? 260.634 324.047 236.398 1.00 0.00 ? 920  PHE A O     1 
ATOM   7003  C  CB    . PHE A  1  920  ? 262.010 321.169 236.066 1.00 0.00 ? 920  PHE A CB    1 
ATOM   7004  C  CG    . PHE A  1  920  ? 261.484 319.785 235.816 1.00 0.00 ? 920  PHE A CG    1 
ATOM   7005  C  CD1   . PHE A  1  920  ? 262.014 319.001 234.805 1.00 0.00 ? 920  PHE A CD1   1 
ATOM   7006  C  CD2   . PHE A  1  920  ? 260.416 319.293 236.539 1.00 0.00 ? 920  PHE A CD2   1 
ATOM   7007  C  CE1   . PHE A  1  920  ? 261.521 317.734 234.550 1.00 0.00 ? 920  PHE A CE1   1 
ATOM   7008  C  CE2   . PHE A  1  920  ? 259.919 318.024 236.283 1.00 0.00 ? 920  PHE A CE2   1 
ATOM   7009  C  CZ    . PHE A  1  920  ? 260.475 317.247 235.288 1.00 0.00 ? 920  PHE A CZ    1 
ATOM   7010  N  N     . ARG A  1  921  ? 262.600 324.356 235.375 1.00 0.00 ? 921  ARG A N     1 
ATOM   7011  C  CA    . ARG A  1  921  ? 262.794 325.667 236.000 1.00 0.00 ? 921  ARG A CA    1 
ATOM   7012  C  C     . ARG A  1  921  ? 261.756 326.686 235.537 1.00 0.00 ? 921  ARG A C     1 
ATOM   7013  O  O     . ARG A  1  921  ? 261.607 326.920 234.344 1.00 0.00 ? 921  ARG A O     1 
ATOM   7014  C  CB    . ARG A  1  921  ? 264.187 326.225 235.697 1.00 0.00 ? 921  ARG A CB    1 
ATOM   7015  C  CG    . ARG A  1  921  ? 265.233 325.994 236.771 1.00 0.00 ? 921  ARG A CG    1 
ATOM   7016  C  CD    . ARG A  1  921  ? 266.566 326.628 236.378 1.00 0.00 ? 921  ARG A CD    1 
ATOM   7017  N  NE    . ARG A  1  921  ? 266.508 328.089 236.447 1.00 0.00 ? 921  ARG A NE    1 
ATOM   7018  C  CZ    . ARG A  1  921  ? 267.539 328.900 236.223 1.00 0.00 ? 921  ARG A CZ    1 
ATOM   7019  N  NH1   . ARG A  1  921  ? 268.726 328.404 235.901 1.00 0.00 ? 921  ARG A NH1   1 
ATOM   7020  N  NH2   . ARG A  1  921  ? 267.378 330.213 236.304 1.00 0.00 ? 921  ARG A NH2   1 
ATOM   7021  N  N     . PHE A  1  922  ? 261.045 327.290 236.480 1.00 0.00 ? 922  PHE A N     1 
ATOM   7022  C  CA    . PHE A  1  922  ? 260.160 328.410 236.169 1.00 0.00 ? 922  PHE A CA    1 
ATOM   7023  C  C     . PHE A  1  922  ? 261.000 329.641 235.802 1.00 0.00 ? 922  PHE A C     1 
ATOM   7024  O  O     . PHE A  1  922  ? 261.853 330.069 236.575 1.00 0.00 ? 922  PHE A O     1 
ATOM   7025  C  CB    . PHE A  1  922  ? 259.240 328.702 237.354 1.00 0.00 ? 922  PHE A CB    1 
ATOM   7026  C  CG    . PHE A  1  922  ? 258.072 329.586 237.021 1.00 0.00 ? 922  PHE A CG    1 
ATOM   7027  C  CD1   . PHE A  1  922  ? 256.918 329.055 236.468 1.00 0.00 ? 922  PHE A CD1   1 
ATOM   7028  C  CD2   . PHE A  1  922  ? 258.123 330.945 237.280 1.00 0.00 ? 922  PHE A CD2   1 
ATOM   7029  C  CE1   . PHE A  1  922  ? 255.841 329.870 236.169 1.00 0.00 ? 922  PHE A CE1   1 
ATOM   7030  C  CE2   . PHE A  1  922  ? 257.050 331.764 236.985 1.00 0.00 ? 922  PHE A CE2   1 
ATOM   7031  C  CZ    . PHE A  1  922  ? 255.908 331.226 236.429 1.00 0.00 ? 922  PHE A CZ    1 
ATOM   7032  N  N     . ASP A  1  923  ? 260.760 330.203 234.620 1.00 0.00 ? 923  ASP A N     1 
ATOM   7033  C  CA    . ASP A  1  923  ? 261.603 331.278 234.092 1.00 0.00 ? 923  ASP A CA    1 
ATOM   7034  C  C     . ASP A  1  923  ? 261.401 332.620 234.813 1.00 0.00 ? 923  ASP A C     1 
ATOM   7035  O  O     . ASP A  1  923  ? 260.299 332.937 235.257 1.00 0.00 ? 923  ASP A O     1 
ATOM   7036  C  CB    . ASP A  1  923  ? 261.353 331.440 232.589 1.00 0.00 ? 923  ASP A CB    1 
ATOM   7037  C  CG    . ASP A  1  923  ? 262.117 332.604 231.990 1.00 0.00 ? 923  ASP A CG    1 
ATOM   7038  O  OD1   . ASP A  1  923  ? 263.250 332.867 232.440 1.00 0.00 ? 923  ASP A OD1   1 
ATOM   7039  O  OD2   . ASP A  1  923  ? 261.587 333.251 231.062 1.00 0.00 ? 923  ASP A OD2   1 
ATOM   7040  N  N     . TYR A  1  924  ? 262.478 333.394 234.933 1.00 0.00 ? 924  TYR A N     1 
ATOM   7041  C  CA    . TYR A  1  924  ? 262.397 334.773 235.417 1.00 0.00 ? 924  TYR A CA    1 
ATOM   7042  C  C     . TYR A  1  924  ? 262.981 335.717 234.397 1.00 0.00 ? 924  TYR A C     1 
ATOM   7043  O  O     . TYR A  1  924  ? 262.582 336.879 234.309 1.00 0.00 ? 924  TYR A O     1 
ATOM   7044  C  CB    . TYR A  1  924  ? 263.137 334.939 236.733 1.00 0.00 ? 924  TYR A CB    1 
ATOM   7045  C  CG    . TYR A  1  924  ? 262.475 334.196 237.835 1.00 0.00 ? 924  TYR A CG    1 
ATOM   7046  C  CD1   . TYR A  1  924  ? 261.137 334.403 238.117 1.00 0.00 ? 924  TYR A CD1   1 
ATOM   7047  C  CD2   . TYR A  1  924  ? 263.176 333.264 238.573 1.00 0.00 ? 924  TYR A CD2   1 
ATOM   7048  C  CE1   . TYR A  1  924  ? 260.517 333.712 239.113 1.00 0.00 ? 924  TYR A CE1   1 
ATOM   7049  C  CE2   . TYR A  1  924  ? 262.571 332.569 239.574 1.00 0.00 ? 924  TYR A CE2   1 
ATOM   7050  C  CZ    . TYR A  1  924  ? 261.239 332.794 239.841 1.00 0.00 ? 924  TYR A CZ    1 
ATOM   7051  O  OH    . TYR A  1  924  ? 260.628 332.090 240.848 1.00 0.00 ? 924  TYR A OH    1 
ATOM   7052  N  N     . THR A  1  925  ? 263.945 335.217 233.634 1.00 0.00 ? 925  THR A N     1 
ATOM   7053  C  CA    . THR A  1  925  ? 264.507 335.965 232.521 1.00 0.00 ? 925  THR A CA    1 
ATOM   7054  C  C     . THR A  1  925  ? 263.466 336.043 231.403 1.00 0.00 ? 925  THR A C     1 
ATOM   7055  O  O     . THR A  1  925  ? 263.763 335.762 230.241 1.00 0.00 ? 925  THR A O     1 
ATOM   7056  C  CB    . THR A  1  925  ? 265.805 335.317 232.000 1.00 0.00 ? 925  THR A CB    1 
ATOM   7057  O  OG1   . THR A  1  925  ? 265.539 333.965 231.606 1.00 0.00 ? 925  THR A OG1   1 
ATOM   7058  C  CG2   . THR A  1  925  ? 266.872 335.321 233.086 1.00 0.00 ? 925  THR A CG2   1 
ATOM   7059  N  N     . ASN A  1  926  ? 262.243 336.426 231.770 1.00 0.00 ? 926  ASN A N     1 
ATOM   7060  C  CA    . ASN A  1  926  ? 261.102 336.398 230.868 1.00 0.00 ? 926  ASN A CA    1 
ATOM   7061  C  C     . ASN A  1  926  ? 261.275 337.371 229.718 1.00 0.00 ? 926  ASN A C     1 
ATOM   7062  O  O     . ASN A  1  926  ? 261.875 338.434 229.877 1.00 0.00 ? 926  ASN A O     1 
ATOM   7063  C  CB    . ASN A  1  926  ? 259.814 336.707 231.629 1.00 0.00 ? 926  ASN A CB    1 
ATOM   7064  C  CG    . ASN A  1  926  ? 258.589 336.141 230.946 1.00 0.00 ? 926  ASN A CG    1 
ATOM   7065  O  OD1   . ASN A  1  926  ? 258.607 335.858 229.748 1.00 0.00 ? 926  ASN A OD1   1 
ATOM   7066  N  ND2   . ASN A  1  926  ? 257.518 335.964 231.706 1.00 0.00 ? 926  ASN A ND2   1 
ATOM   7067  N  N     . GLU A  1  927  ? 260.750 336.992 228.557 1.00 0.00 ? 927  GLU A N     1 
ATOM   7068  C  CA    . GLU A  1  927  ? 260.859 337.815 227.359 1.00 0.00 ? 927  GLU A CA    1 
ATOM   7069  C  C     . GLU A  1  927  ? 260.161 339.162 227.555 1.00 0.00 ? 927  GLU A C     1 
ATOM   7070  O  O     . GLU A  1  927  ? 259.058 339.225 228.102 1.00 0.00 ? 927  GLU A O     1 
ATOM   7071  C  CB    . GLU A  1  927  ? 260.270 337.073 226.153 1.00 0.00 ? 927  GLU A CB    1 
ATOM   7072  C  CG    . GLU A  1  927  ? 260.391 337.795 224.813 1.00 0.00 ? 927  GLU A CG    1 
ATOM   7073  C  CD    . GLU A  1  927  ? 261.832 338.097 224.418 1.00 0.00 ? 927  GLU A CD    1 
ATOM   7074  O  OE1   . GLU A  1  927  ? 262.748 337.369 224.862 1.00 0.00 ? 927  GLU A OE1   1 
ATOM   7075  O  OE2   . GLU A  1  927  ? 262.048 339.061 223.650 1.00 0.00 ? 927  GLU A OE2   1 
ATOM   7076  N  N     . ARG A  1  928  ? 260.826 340.234 227.121 1.00 0.00 ? 928  ARG A N     1 
ATOM   7077  C  CA    . ARG A  1  928  ? 260.301 341.596 227.243 1.00 0.00 ? 928  ARG A CA    1 
ATOM   7078  C  C     . ARG A  1  928  ? 258.985 341.774 226.485 1.00 0.00 ? 928  ARG A C     1 
ATOM   7079  O  O     . ARG A  1  928  ? 258.198 342.673 226.797 1.00 0.00 ? 928  ARG A O     1 
ATOM   7080  C  CB    . ARG A  1  928  ? 261.329 342.621 226.747 1.00 0.00 ? 928  ARG A CB    1 
ATOM   7081  C  CG    . ARG A  1  928  ? 262.548 342.795 227.651 1.00 0.00 ? 928  ARG A CG    1 
ATOM   7082  C  CD    . ARG A  1  928  ? 262.162 343.207 229.071 1.00 0.00 ? 928  ARG A CD    1 
ATOM   7083  N  NE    . ARG A  1  928  ? 261.429 344.471 229.119 1.00 0.00 ? 928  ARG A NE    1 
ATOM   7084  C  CZ    . ARG A  1  928  ? 261.989 345.662 229.321 1.00 0.00 ? 928  ARG A CZ    1 
ATOM   7085  N  NH1   . ARG A  1  928  ? 263.300 345.763 229.499 1.00 0.00 ? 928  ARG A NH1   1 
ATOM   7086  N  NH2   . ARG A  1  928  ? 261.238 346.756 229.335 1.00 0.00 ? 928  ARG A NH2   1 
ATOM   7087  N  N     . ALA A  1  929  ? 258.762 340.938 225.474 1.00 0.00 ? 929  ALA A N     1 
ATOM   7088  C  CA    . ALA A  1  929  ? 257.491 340.916 224.752 1.00 0.00 ? 929  ALA A CA    1 
ATOM   7089  C  C     . ALA A  1  929  ? 256.344 340.497 225.677 1.00 0.00 ? 929  ALA A C     1 
ATOM   7090  O  O     . ALA A  1  929  ? 256.484 340.490 226.902 1.00 0.00 ? 929  ALA A O     1 
ATOM   7091  C  CB    . ALA A  1  929  ? 257.576 339.984 223.550 1.00 0.00 ? 929  ALA A CB    1 
ATOM   7092  N  N     . LEU A  1  930  ? 255.212 340.117 225.092 1.00 0.00 ? 930  LEU A N     1 
ATOM   7093  C  CA    . LEU A  1  930  ? 254.024 339.801 225.884 1.00 0.00 ? 930  LEU A CA    1 
ATOM   7094  C  C     . LEU A  1  930  ? 254.227 338.567 226.775 1.00 0.00 ? 930  LEU A C     1 
ATOM   7095  O  O     . LEU A  1  930  ? 253.327 338.178 227.514 1.00 0.00 ? 930  LEU A O     1 
ATOM   7096  C  CB    . LEU A  1  930  ? 252.804 339.627 224.967 1.00 0.00 ? 930  LEU A CB    1 
ATOM   7097  C  CG    . LEU A  1  930  ? 252.795 338.613 223.820 1.00 0.00 ? 930  LEU A CG    1 
ATOM   7098  C  CD1   . LEU A  1  930  ? 252.442 337.206 224.303 1.00 0.00 ? 930  LEU A CD1   1 
ATOM   7099  C  CD2   . LEU A  1  930  ? 251.847 339.068 222.715 1.00 0.00 ? 930  LEU A CD2   1 
ATOM   7100  N  N     . ARG A  1  931  ? 255.472 338.104 226.650 1.00 0.00 ? 931  ARG A N     1 
ATOM   7101  C  CA    . ARG A  1  931  ? 256.091 336.962 227.290 1.00 0.00 ? 931  ARG A CA    1 
ATOM   7102  C  C     . ARG A  1  931  ? 255.602 336.637 228.674 1.00 0.00 ? 931  ARG A C     1 
ATOM   7103  O  O     . ARG A  1  931  ? 256.074 337.168 229.678 1.00 0.00 ? 931  ARG A O     1 
ATOM   7104  C  CB    . ARG A  1  931  ? 257.613 337.137 227.316 1.00 0.00 ? 931  ARG A CB    1 
ATOM   7105  C  CG    . ARG A  1  931  ? 258.387 335.902 226.886 1.00 0.00 ? 931  ARG A CG    1 
ATOM   7106  C  CD    . ARG A  1  931  ? 258.323 335.706 225.380 1.00 0.00 ? 931  ARG A CD    1 
ATOM   7107  N  NE    . ARG A  1  931  ? 258.784 334.380 224.981 1.00 0.00 ? 931  ARG A NE    1 
ATOM   7108  C  CZ    . ARG A  1  931  ? 258.414 333.765 223.862 1.00 0.00 ? 931  ARG A CZ    1 
ATOM   7109  N  NH1   . ARG A  1  931  ? 257.573 334.358 223.025 1.00 0.00 ? 931  ARG A NH1   1 
ATOM   7110  N  NH2   . ARG A  1  931  ? 258.884 332.558 223.579 1.00 0.00 ? 931  ARG A NH2   1 
ATOM   7111  N  N     . ARG A  1  932  ? 254.664 335.720 228.722 1.00 0.00 ? 932  ARG A N     1 
ATOM   7112  C  CA    . ARG A  1  932  ? 254.111 335.362 229.986 1.00 0.00 ? 932  ARG A CA    1 
ATOM   7113  C  C     . ARG A  1  932  ? 252.663 335.753 229.923 1.00 0.00 ? 932  ARG A C     1 
ATOM   7114  O  O     . ARG A  1  932  ? 251.855 335.158 230.637 1.00 0.00 ? 932  ARG A O     1 
ATOM   7115  C  CB    . ARG A  1  932  ? 254.814 336.116 231.115 1.00 0.00 ? 932  ARG A CB    1 
ATOM   7116  C  CG    . ARG A  1  932  ? 256.045 335.411 231.660 1.00 0.00 ? 932  ARG A CG    1 
ATOM   7117  C  CD    . ARG A  1  932  ? 255.679 334.095 232.326 1.00 0.00 ? 932  ARG A CD    1 
ATOM   7118  N  NE    . ARG A  1  932  ? 256.597 333.755 233.409 1.00 0.00 ? 932  ARG A NE    1 
ATOM   7119  C  CZ    . ARG A  1  932  ? 257.379 332.681 233.417 1.00 0.00 ? 932  ARG A CZ    1 
ATOM   7120  N  NH1   . ARG A  1  932  ? 258.183 332.451 234.446 1.00 0.00 ? 932  ARG A NH1   1 
ATOM   7121  N  NH2   . ARG A  1  932  ? 257.357 331.835 232.396 1.00 0.00 ? 932  ARG A NH2   1 
ATOM   7122  N  N     . THR A  1  933  ? 252.272 336.732 229.098 1.00 0.00 ? 933  THR A N     1 
ATOM   7123  C  CA    . THR A  1  933  ? 250.830 336.914 229.191 1.00 0.00 ? 933  THR A CA    1 
ATOM   7124  C  C     . THR A  1  933  ? 250.180 335.692 228.554 1.00 0.00 ? 933  THR A C     1 
ATOM   7125  O  O     . THR A  1  933  ? 248.997 335.421 228.762 1.00 0.00 ? 933  THR A O     1 
ATOM   7126  C  CB    . THR A  1  933  ? 250.347 338.215 228.507 1.00 0.00 ? 933  THR A CB    1 
ATOM   7127  O  OG1   . THR A  1  933  ? 250.834 338.264 227.160 1.00 0.00 ? 933  THR A OG1   1 
ATOM   7128  C  CG2   . THR A  1  933  ? 250.848 339.440 229.266 1.00 0.00 ? 933  THR A CG2   1 
ATOM   7129  N  N     . LEU A  1  934  ? 250.967 334.961 227.768 1.00 0.00 ? 934  LEU A N     1 
ATOM   7130  C  CA    . LEU A  1  934  ? 250.577 333.627 227.343 1.00 0.00 ? 934  LEU A CA    1 
ATOM   7131  C  C     . LEU A  1  934  ? 250.585 332.723 228.570 1.00 0.00 ? 934  LEU A C     1 
ATOM   7132  O  O     . LEU A  1  934  ? 251.226 333.039 229.573 1.00 0.00 ? 934  LEU A O     1 
ATOM   7133  C  CB    . LEU A  1  934  ? 251.522 333.092 226.266 1.00 0.00 ? 934  LEU A CB    1 
ATOM   7134  C  CG    . LEU A  1  934  ? 251.441 333.771 224.896 1.00 0.00 ? 934  LEU A CG    1 
ATOM   7135  C  CD1   . LEU A  1  934  ? 252.456 333.176 223.931 1.00 0.00 ? 934  LEU A CD1   1 
ATOM   7136  C  CD2   . LEU A  1  934  ? 250.037 333.680 224.320 1.00 0.00 ? 934  LEU A CD2   1 
ATOM   7137  N  N     . GLN A  1  935  ? 249.879 331.599 228.476 1.00 0.00 ? 935  GLN A N     1 
ATOM   7138  C  CA    . GLN A  1  935  ? 249.687 330.666 229.589 1.00 0.00 ? 935  GLN A CA    1 
ATOM   7139  C  C     . GLN A  1  935  ? 249.045 331.258 230.861 1.00 0.00 ? 935  GLN A C     1 
ATOM   7140  O  O     . GLN A  1  935  ? 248.157 330.635 231.447 1.00 0.00 ? 935  GLN A O     1 
ATOM   7141  C  CB    . GLN A  1  935  ? 251.035 330.038 229.956 1.00 0.00 ? 935  GLN A CB    1 
ATOM   7142  C  CG    . GLN A  1  935  ? 251.721 329.316 228.807 1.00 0.00 ? 935  GLN A CG    1 
ATOM   7143  C  CD    . GLN A  1  935  ? 252.975 328.570 229.244 1.00 0.00 ? 935  GLN A CD    1 
ATOM   7144  O  OE1   . GLN A  1  935  ? 253.416 327.628 228.582 1.00 0.00 ? 935  GLN A OE1   1 
ATOM   7145  N  NE2   . GLN A  1  935  ? 253.558 328.996 230.359 1.00 0.00 ? 935  GLN A NE2   1 
ATOM   7146  N  N     . GLU A  1  936  ? 249.485 332.444 231.285 1.00 0.00 ? 936  GLU A N     1 
ATOM   7147  C  CA    . GLU A  1  936  ? 248.942 333.099 232.482 1.00 0.00 ? 936  GLU A CA    1 
ATOM   7148  C  C     . GLU A  1  936  ? 248.615 334.577 232.270 1.00 0.00 ? 936  GLU A C     1 
ATOM   7149  O  O     . GLU A  1  936  ? 249.327 335.274 231.552 1.00 0.00 ? 936  GLU A O     1 
ATOM   7150  C  CB    . GLU A  1  936  ? 249.930 332.987 233.646 1.00 0.00 ? 936  GLU A CB    1 
ATOM   7151  C  CG    . GLU A  1  936  ? 250.554 331.618 233.815 1.00 0.00 ? 936  GLU A CG    1 
ATOM   7152  C  CD    . GLU A  1  936  ? 251.917 331.528 233.158 1.00 0.00 ? 936  GLU A CD    1 
ATOM   7153  O  OE1   . GLU A  1  936  ? 252.280 332.468 232.417 1.00 0.00 ? 936  GLU A OE1   1 
ATOM   7154  O  OE2   . GLU A  1  936  ? 252.621 330.520 233.380 1.00 0.00 ? 936  GLU A OE2   1 
ATOM   7155  N  N     . ASP A  1  937  ? 247.546 335.053 232.906 1.00 0.00 ? 937  ASP A N     1 
ATOM   7156  C  CA    . ASP A  1  937  ? 247.235 336.483 232.926 1.00 0.00 ? 937  ASP A CA    1 
ATOM   7157  C  C     . ASP A  1  937  ? 247.759 337.063 234.239 1.00 0.00 ? 937  ASP A C     1 
ATOM   7158  O  O     . ASP A  1  937  ? 247.785 338.279 234.458 1.00 0.00 ? 937  ASP A O     1 
ATOM   7159  C  CB    . ASP A  1  937  ? 245.729 336.722 232.772 1.00 0.00 ? 937  ASP A CB    1 
ATOM   7160  C  CG    . ASP A  1  937  ? 245.361 338.196 232.794 1.00 0.00 ? 937  ASP A CG    1 
ATOM   7161  O  OD1   . ASP A  1  937  ? 245.180 338.753 233.898 1.00 0.00 ? 937  ASP A OD1   1 
ATOM   7162  O  OD2   . ASP A  1  937  ? 245.230 338.792 231.704 1.00 0.00 ? 937  ASP A OD2   1 
ATOM   7163  N  N     . LEU A  1  938  ? 248.218 336.154 235.092 1.00 0.00 ? 938  LEU A N     1 
ATOM   7164  C  CA    . LEU A  1  938  ? 248.633 336.472 236.450 1.00 0.00 ? 938  LEU A CA    1 
ATOM   7165  C  C     . LEU A  1  938  ? 250.069 336.973 236.552 1.00 0.00 ? 938  LEU A C     1 
ATOM   7166  O  O     . LEU A  1  938  ? 250.400 337.674 237.500 1.00 0.00 ? 938  LEU A O     1 
ATOM   7167  C  CB    . LEU A  1  938  ? 248.448 335.237 237.345 1.00 0.00 ? 938  LEU A CB    1 
ATOM   7168  C  CG    . LEU A  1  938  ? 248.698 335.327 238.855 1.00 0.00 ? 938  LEU A CG    1 
ATOM   7169  C  CD1   . LEU A  1  938  ? 247.670 334.502 239.604 1.00 0.00 ? 938  LEU A CD1   1 
ATOM   7170  C  CD2   . LEU A  1  938  ? 250.096 334.844 239.200 1.00 0.00 ? 938  LEU A CD2   1 
ATOM   7171  N  N     . VAL A  1  939  ? 250.935 336.623 235.602 1.00 0.00 ? 939  VAL A N     1 
ATOM   7172  C  CA    . VAL A  1  939  ? 252.357 336.869 235.829 1.00 0.00 ? 939  VAL A CA    1 
ATOM   7173  C  C     . VAL A  1  939  ? 252.679 338.363 235.772 1.00 0.00 ? 939  VAL A C     1 
ATOM   7174  O  O     . VAL A  1  939  ? 253.683 338.815 236.330 1.00 0.00 ? 939  VAL A O     1 
ATOM   7175  C  CB    . VAL A  1  939  ? 253.215 336.107 234.773 1.00 0.00 ? 939  VAL A CB    1 
ATOM   7176  C  CG1   . VAL A  1  939  ? 254.703 336.407 234.926 1.00 0.00 ? 939  VAL A CG1   1 
ATOM   7177  C  CG2   . VAL A  1  939  ? 252.972 334.608 234.875 1.00 0.00 ? 939  VAL A CG2   1 
ATOM   7178  N  N     . LYS A  1  940  ? 251.798 339.140 235.145 1.00 0.00 ? 940  LYS A N     1 
ATOM   7179  C  CA    . LYS A  1  940  ? 251.876 340.592 235.227 1.00 0.00 ? 940  LYS A CA    1 
ATOM   7180  C  C     . LYS A  1  940  ? 251.830 341.071 236.682 1.00 0.00 ? 940  LYS A C     1 
ATOM   7181  O  O     . LYS A  1  940  ? 252.298 342.164 237.011 1.00 0.00 ? 940  LYS A O     1 
ATOM   7182  C  CB    . LYS A  1  940  ? 250.764 341.219 234.382 1.00 0.00 ? 940  LYS A CB    1 
ATOM   7183  C  CG    . LYS A  1  940  ? 249.424 341.351 235.070 1.00 0.00 ? 940  LYS A CG    1 
ATOM   7184  C  CD    . LYS A  1  940  ? 248.361 341.761 234.066 1.00 0.00 ? 940  LYS A CD    1 
ATOM   7185  C  CE    . LYS A  1  940  ? 247.014 341.941 234.732 1.00 0.00 ? 940  LYS A CE    1 
ATOM   7186  N  NZ    . LYS A  1  940  ? 246.486 340.628 235.202 1.00 0.00 ? 940  LYS A NZ    1 
ATOM   7187  N  N     . ASP A  1  941  ? 251.250 340.231 237.539 1.00 0.00 ? 941  ASP A N     1 
ATOM   7188  C  CA    . ASP A  1  941  ? 251.170 340.474 238.976 1.00 0.00 ? 941  ASP A CA    1 
ATOM   7189  C  C     . ASP A  1  941  ? 252.435 340.092 239.757 1.00 0.00 ? 941  ASP A C     1 
ATOM   7190  O  O     . ASP A  1  941  ? 252.726 340.685 240.798 1.00 0.00 ? 941  ASP A O     1 
ATOM   7191  C  CB    . ASP A  1  941  ? 249.966 339.723 239.556 1.00 0.00 ? 941  ASP A CB    1 
ATOM   7192  C  CG    . ASP A  1  941  ? 248.669 340.050 238.829 1.00 0.00 ? 941  ASP A CG    1 
ATOM   7193  O  OD1   . ASP A  1  941  ? 248.328 341.246 238.720 1.00 0.00 ? 941  ASP A OD1   1 
ATOM   7194  O  OD2   . ASP A  1  941  ? 247.995 339.108 238.356 1.00 0.00 ? 941  ASP A OD2   1 
ATOM   7195  N  N     . VAL A  1  942  ? 253.189 339.112 239.257 1.00 0.00 ? 942  VAL A N     1 
ATOM   7196  C  CA    . VAL A  1  942  ? 254.234 338.476 240.064 1.00 0.00 ? 942  VAL A CA    1 
ATOM   7197  C  C     . VAL A  1  942  ? 255.613 338.524 239.421 1.00 0.00 ? 942  VAL A C     1 
ATOM   7198  O  O     . VAL A  1  942  ? 256.547 337.873 239.889 1.00 0.00 ? 942  VAL A O     1 
ATOM   7199  C  CB    . VAL A  1  942  ? 253.902 336.997 240.355 1.00 0.00 ? 942  VAL A CB    1 
ATOM   7200  C  CG1   . VAL A  1  942  ? 252.594 336.884 241.122 1.00 0.00 ? 942  VAL A CG1   1 
ATOM   7201  C  CG2   . VAL A  1  942  ? 253.832 336.203 239.066 1.00 0.00 ? 942  VAL A CG2   1 
ATOM   7202  N  N     . LEU A  1  943  ? 255.740 339.289 238.345 1.00 0.00 ? 943  LEU A N     1 
ATOM   7203  C  CA    . LEU A  1  943  ? 257.023 339.437 237.677 1.00 0.00 ? 943  LEU A CA    1 
ATOM   7204  C  C     . LEU A  1  943  ? 258.001 340.260 238.514 1.00 0.00 ? 943  LEU A C     1 
ATOM   7205  O  O     . LEU A  1  943  ? 259.193 340.306 238.214 1.00 0.00 ? 943  LEU A O     1 
ATOM   7206  C  CB    . LEU A  1  943  ? 256.830 340.087 236.300 1.00 0.00 ? 943  LEU A CB    1 
ATOM   7207  C  CG    . LEU A  1  943  ? 255.983 341.369 236.215 1.00 0.00 ? 943  LEU A CG    1 
ATOM   7208  C  CD1   . LEU A  1  943  ? 256.757 342.629 236.612 1.00 0.00 ? 943  LEU A CD1   1 
ATOM   7209  C  CD2   . LEU A  1  943  ? 255.386 341.532 234.823 1.00 0.00 ? 943  LEU A CD2   1 
ATOM   7210  N  N     . SER A  1  944  ? 257.500 340.893 239.572 1.00 0.00 ? 944  SER A N     1 
ATOM   7211  C  CA    . SER A  1  944  ? 258.305 341.831 240.350 1.00 0.00 ? 944  SER A CA    1 
ATOM   7212  C  C     . SER A  1  944  ? 258.674 341.310 241.734 1.00 0.00 ? 944  SER A C     1 
ATOM   7213  O  O     . SER A  1  944  ? 259.576 341.842 242.382 1.00 0.00 ? 944  SER A O     1 
ATOM   7214  C  CB    . SER A  1  944  ? 257.562 343.163 240.497 1.00 0.00 ? 944  SER A CB    1 
ATOM   7215  O  OG    . SER A  1  944  ? 256.338 342.989 241.193 1.00 0.00 ? 944  SER A OG    1 
ATOM   7216  N  N     . ASN A  1  945  ? 257.975 340.274 242.189 1.00 0.00 ? 945  ASN A N     1 
ATOM   7217  C  CA    . ASN A  1  945  ? 258.195 339.737 243.529 1.00 0.00 ? 945  ASN A CA    1 
ATOM   7218  C  C     . ASN A  1  945  ? 259.521 338.988 243.662 1.00 0.00 ? 945  ASN A C     1 
ATOM   7219  O  O     . ASN A  1  945  ? 259.759 337.992 242.974 1.00 0.00 ? 945  ASN A O     1 
ATOM   7220  C  CB    . ASN A  1  945  ? 257.038 338.819 243.932 1.00 0.00 ? 945  ASN A CB    1 
ATOM   7221  C  CG    . ASN A  1  945  ? 257.045 338.478 245.418 1.00 0.00 ? 945  ASN A CG    1 
ATOM   7222  O  OD1   . ASN A  1  945  ? 258.099 338.379 246.045 1.00 0.00 ? 945  ASN A OD1   1 
ATOM   7223  N  ND2   . ASN A  1  945  ? 255.860 338.297 245.986 1.00 0.00 ? 945  ASN A ND2   1 
ATOM   7224  N  N     . ALA A  1  946  ? 260.370 339.477 244.562 1.00 0.00 ? 946  ALA A N     1 
ATOM   7225  C  CA    . ALA A  1  946  ? 261.654 338.852 244.871 1.00 0.00 ? 946  ALA A CA    1 
ATOM   7226  C  C     . ALA A  1  946  ? 261.471 337.551 245.655 1.00 0.00 ? 946  ALA A C     1 
ATOM   7227  O  O     . ALA A  1  946  ? 262.166 336.559 245.415 1.00 0.00 ? 946  ALA A O     1 
ATOM   7228  C  CB    . ALA A  1  946  ? 262.539 339.819 245.648 1.00 0.00 ? 946  ALA A CB    1 
ATOM   7229  N  N     . HIS A  1  947  ? 260.514 337.561 246.578 1.00 0.00 ? 947  HIS A N     1 
ATOM   7230  C  CA    . HIS A  1  947  ? 260.251 336.415 247.438 1.00 0.00 ? 947  HIS A CA    1 
ATOM   7231  C  C     . HIS A  1  947  ? 259.744 335.219 246.647 1.00 0.00 ? 947  HIS A C     1 
ATOM   7232  O  O     . HIS A  1  947  ? 260.109 334.075 246.930 1.00 0.00 ? 947  HIS A O     1 
ATOM   7233  C  CB    . HIS A  1  947  ? 259.233 336.784 248.520 1.00 0.00 ? 947  HIS A CB    1 
ATOM   7234  C  CG    . HIS A  1  947  ? 259.032 335.714 249.547 1.00 0.00 ? 947  HIS A CG    1 
ATOM   7235  N  ND1   . HIS A  1  947  ? 260.032 335.303 250.401 1.00 0.00 ? 947  HIS A ND1   1 
ATOM   7236  C  CD2   . HIS A  1  947  ? 257.950 334.953 249.840 1.00 0.00 ? 947  HIS A CD2   1 
ATOM   7237  C  CE1   . HIS A  1  947  ? 259.572 334.344 251.185 1.00 0.00 ? 947  HIS A CE1   1 
ATOM   7238  N  NE2   . HIS A  1  947  ? 258.311 334.112 250.865 1.00 0.00 ? 947  HIS A NE2   1 
ATOM   7239  N  N     . ILE A  1  948  ? 258.891 335.477 245.665 1.00 0.00 ? 948  ILE A N     1 
ATOM   7240  C  CA    . ILE A  1  948  ? 258.369 334.401 244.844 1.00 0.00 ? 948  ILE A CA    1 
ATOM   7241  C  C     . ILE A  1  948  ? 259.494 333.782 244.020 1.00 0.00 ? 948  ILE A C     1 
ATOM   7242  O  O     . ILE A  1  948  ? 259.525 332.564 243.826 1.00 0.00 ? 948  ILE A O     1 
ATOM   7243  C  CB    . ILE A  1  948  ? 257.244 334.885 243.898 1.00 0.00 ? 948  ILE A CB    1 
ATOM   7244  C  CG1   . ILE A  1  948  ? 256.018 335.320 244.696 1.00 0.00 ? 948  ILE A CG1   1 
ATOM   7245  C  CG2   . ILE A  1  948  ? 256.819 333.783 242.942 1.00 0.00 ? 948  ILE A CG2   1 
ATOM   7246  C  CD1   . ILE A  1  948  ? 254.927 335.924 243.837 1.00 0.00 ? 948  ILE A CD1   1 
ATOM   7247  N  N     . GLN A  1  949  ? 260.448 334.606 243.590 1.00 0.00 ? 949  GLN A N     1 
ATOM   7248  C  CA    . GLN A  1  949  ? 261.632 334.066 242.932 1.00 0.00 ? 949  GLN A CA    1 
ATOM   7249  C  C     . GLN A  1  949  ? 262.502 333.184 243.822 1.00 0.00 ? 949  GLN A C     1 
ATOM   7250  O  O     . GLN A  1  949  ? 262.952 332.120 243.394 1.00 0.00 ? 949  GLN A O     1 
ATOM   7251  C  CB    . GLN A  1  949  ? 262.486 335.205 242.374 1.00 0.00 ? 949  GLN A CB    1 
ATOM   7252  C  CG    . GLN A  1  949  ? 261.835 335.944 241.225 1.00 0.00 ? 949  GLN A CG    1 
ATOM   7253  C  CD    . GLN A  1  949  ? 262.578 337.202 240.842 1.00 0.00 ? 949  GLN A CD    1 
ATOM   7254  O  OE1   . GLN A  1  949  ? 263.702 337.143 240.343 1.00 0.00 ? 949  GLN A OE1   1 
ATOM   7255  N  NE2   . GLN A  1  949  ? 261.965 338.353 241.091 1.00 0.00 ? 949  GLN A NE2   1 
ATOM   7256  N  N     . ASN A  1  950  ? 262.726 333.603 245.060 1.00 0.00 ? 950  ASN A N     1 
ATOM   7257  C  CA    . ASN A  1  950  ? 263.512 332.783 245.973 1.00 0.00 ? 950  ASN A CA    1 
ATOM   7258  C  C     . ASN A  1  950  ? 262.823 331.458 246.316 1.00 0.00 ? 950  ASN A C     1 
ATOM   7259  O  O     . ASN A  1  950  ? 263.458 330.401 246.352 1.00 0.00 ? 950  ASN A O     1 
ATOM   7260  C  CB    . ASN A  1  950  ? 263.819 333.559 247.255 1.00 0.00 ? 950  ASN A CB    1 
ATOM   7261  C  CG    . ASN A  1  950  ? 264.465 332.689 248.317 1.00 0.00 ? 950  ASN A CG    1 
ATOM   7262  O  OD1   . ASN A  1  950  ? 265.594 332.227 248.151 1.00 0.00 ? 950  ASN A OD1   1 
ATOM   7263  N  ND2   . ASN A  1  950  ? 263.748 332.452 249.412 1.00 0.00 ? 950  ASN A ND2   1 
ATOM   7264  N  N     . GLU A  1  951  ? 261.512 331.528 246.538 1.00 0.00 ? 951  GLU A N     1 
ATOM   7265  C  CA    . GLU A  1  951  ? 260.715 330.351 246.855 1.00 0.00 ? 951  GLU A CA    1 
ATOM   7266  C  C     . GLU A  1  951  ? 260.636 329.279 245.771 1.00 0.00 ? 951  GLU A C     1 
ATOM   7267  O  O     . GLU A  1  951  ? 260.642 328.091 246.079 1.00 0.00 ? 951  GLU A O     1 
ATOM   7268  C  CB    . GLU A  1  951  ? 259.296 330.794 247.217 1.00 0.00 ? 951  GLU A CB    1 
ATOM   7269  C  CG    . GLU A  1  951  ? 258.472 329.723 247.904 1.00 0.00 ? 951  GLU A CG    1 
ATOM   7270  C  CD    . GLU A  1  951  ? 259.025 329.349 249.267 1.00 0.00 ? 951  GLU A CD    1 
ATOM   7271  O  OE1   . GLU A  1  951  ? 259.719 330.189 249.879 1.00 0.00 ? 951  GLU A OE1   1 
ATOM   7272  O  OE2   . GLU A  1  951  ? 258.769 328.215 249.727 1.00 0.00 ? 951  GLU A OE2   1 
ATOM   7273  N  N     . LEU A  1  952  ? 260.554 329.685 244.509 1.00 0.00 ? 952  LEU A N     1 
ATOM   7274  C  CA    . LEU A  1  952  ? 260.580 328.719 243.408 1.00 0.00 ? 952  LEU A CA    1 
ATOM   7275  C  C     . LEU A  1  952  ? 261.975 328.117 243.261 1.00 0.00 ? 952  LEU A C     1 
ATOM   7276  O  O     . LEU A  1  952  ? 262.130 326.919 243.035 1.00 0.00 ? 952  LEU A O     1 
ATOM   7277  C  CB    . LEU A  1  952  ? 260.077 329.341 242.110 1.00 0.00 ? 952  LEU A CB    1 
ATOM   7278  C  CG    . LEU A  1  952  ? 258.569 329.606 242.252 1.00 0.00 ? 952  LEU A CG    1 
ATOM   7279  C  CD1   . LEU A  1  952  ? 258.006 330.541 241.193 1.00 0.00 ? 952  LEU A CD1   1 
ATOM   7280  C  CD2   . LEU A  1  952  ? 257.791 328.297 242.279 1.00 0.00 ? 952  LEU A CD2   1 
ATOM   7281  N  N     . GLU A  1  953  ? 262.984 328.970 243.373 1.00 0.00 ? 953  GLU A N     1 
ATOM   7282  C  CA    . GLU A  1  953  ? 264.374 328.531 243.463 1.00 0.00 ? 953  GLU A CA    1 
ATOM   7283  C  C     . GLU A  1  953  ? 264.579 327.602 244.657 1.00 0.00 ? 953  GLU A C     1 
ATOM   7284  O  O     . GLU A  1  953  ? 265.430 326.716 244.616 1.00 0.00 ? 953  GLU A O     1 
ATOM   7285  C  CB    . GLU A  1  953  ? 265.336 329.709 243.503 1.00 0.00 ? 953  GLU A CB    1 
ATOM   7286  C  CG    . GLU A  1  953  ? 265.368 330.443 242.179 1.00 0.00 ? 953  GLU A CG    1 
ATOM   7287  C  CD    . GLU A  1  953  ? 266.317 329.787 241.184 1.00 0.00 ? 953  GLU A CD    1 
ATOM   7288  O  OE1   . GLU A  1  953  ? 267.153 328.961 241.611 1.00 0.00 ? 953  GLU A OE1   1 
ATOM   7289  O  OE2   . GLU A  1  953  ? 266.215 330.086 239.972 1.00 0.00 ? 953  GLU A OE2   1 
ATOM   7290  N  N     . ARG A  1  954  ? 263.836 327.832 245.734 1.00 0.00 ? 954  ARG A N     1 
ATOM   7291  C  CA    . ARG A  1  954  ? 263.836 326.895 246.852 1.00 0.00 ? 954  ARG A CA    1 
ATOM   7292  C  C     . ARG A  1  954  ? 263.237 325.542 246.430 1.00 0.00 ? 954  ARG A C     1 
ATOM   7293  O  O     . ARG A  1  954  ? 263.701 324.488 246.868 1.00 0.00 ? 954  ARG A O     1 
ATOM   7294  C  CB    . ARG A  1  954  ? 262.991 327.457 248.001 1.00 0.00 ? 954  ARG A CB    1 
ATOM   7295  C  CG    . ARG A  1  954  ? 263.720 328.132 249.142 1.00 0.00 ? 954  ARG A CG    1 
ATOM   7296  C  CD    . ARG A  1  954  ? 265.142 327.675 249.314 1.00 0.00 ? 954  ARG A CD    1 
ATOM   7297  N  NE    . ARG A  1  954  ? 265.847 328.564 250.232 1.00 0.00 ? 954  ARG A NE    1 
ATOM   7298  C  CZ    . ARG A  1  954  ? 266.430 329.700 249.865 1.00 0.00 ? 954  ARG A CZ    1 
ATOM   7299  N  NH1   . ARG A  1  954  ? 266.390 330.084 248.595 1.00 0.00 ? 954  ARG A NH1   1 
ATOM   7300  N  NH2   . ARG A  1  954  ? 267.082 330.436 250.757 1.00 0.00 ? 954  ARG A NH2   1 
ATOM   7301  N  N     . GLU A  1  955  ? 262.207 325.579 245.587 1.00 0.00 ? 955  GLU A N     1 
ATOM   7302  C  CA    . GLU A  1  955  ? 261.607 324.369 245.009 1.00 0.00 ? 955  GLU A CA    1 
ATOM   7303  C  C     . GLU A  1  955  ? 262.505 323.571 244.051 1.00 0.00 ? 955  GLU A C     1 
ATOM   7304  O  O     . GLU A  1  955  ? 262.627 322.352 244.178 1.00 0.00 ? 955  GLU A O     1 
ATOM   7305  C  CB    . GLU A  1  955  ? 260.310 324.720 244.280 1.00 0.00 ? 955  GLU A CB    1 
ATOM   7306  C  CG    . GLU A  1  955  ? 259.527 323.497 243.830 1.00 0.00 ? 955  GLU A CG    1 
ATOM   7307  C  CD    . GLU A  1  955  ? 258.373 323.846 242.914 1.00 0.00 ? 955  GLU A CD    1 
ATOM   7308  O  OE1   . GLU A  1  955  ? 258.086 325.051 242.757 1.00 0.00 ? 955  GLU A OE1   1 
ATOM   7309  O  OE2   . GLU A  1  955  ? 257.760 322.916 242.344 1.00 0.00 ? 955  GLU A OE2   1 
ATOM   7310  N  N     . PHE A  1  956  ? 263.129 324.267 243.099 1.00 0.00 ? 956  PHE A N     1 
ATOM   7311  C  CA    . PHE A  1  956  ? 263.973 323.635 242.080 1.00 0.00 ? 956  PHE A CA    1 
ATOM   7312  C  C     . PHE A  1  956  ? 265.254 323.016 242.613 1.00 0.00 ? 956  PHE A C     1 
ATOM   7313  O  O     . PHE A  1  956  ? 265.643 321.931 242.175 1.00 0.00 ? 956  PHE A O     1 
ATOM   7314  C  CB    . PHE A  1  956  ? 264.334 324.650 240.991 1.00 0.00 ? 956  PHE A CB    1 
ATOM   7315  C  CG    . PHE A  1  956  ? 265.147 324.073 239.858 1.00 0.00 ? 956  PHE A CG    1 
ATOM   7316  C  CD1   . PHE A  1  956  ? 264.589 323.195 238.945 1.00 0.00 ? 956  PHE A CD1   1 
ATOM   7317  C  CD2   . PHE A  1  956  ? 266.483 324.420 239.709 1.00 0.00 ? 956  PHE A CD2   1 
ATOM   7318  C  CE1   . PHE A  1  956  ? 265.352 322.671 237.908 1.00 0.00 ? 956  PHE A CE1   1 
ATOM   7319  C  CE2   . PHE A  1  956  ? 267.249 323.902 238.679 1.00 0.00 ? 956  PHE A CE2   1 
ATOM   7320  C  CZ    . PHE A  1  956  ? 266.684 323.028 237.778 1.00 0.00 ? 956  PHE A CZ    1 
ATOM   7321  N  N     . GLU A  1  957  ? 265.925 323.707 243.529 1.00 0.00 ? 957  GLU A N     1 
ATOM   7322  C  CA    . GLU A  1  957  ? 267.110 323.145 244.166 1.00 0.00 ? 957  GLU A CA    1 
ATOM   7323  C  C     . GLU A  1  957  ? 266.723 321.873 244.914 1.00 0.00 ? 957  GLU A C     1 
ATOM   7324  O  O     . GLU A  1  957  ? 267.470 320.893 244.881 1.00 0.00 ? 957  GLU A O     1 
ATOM   7325  C  CB    . GLU A  1  957  ? 267.825 324.138 245.092 1.00 0.00 ? 957  GLU A CB    1 
ATOM   7326  C  CG    . GLU A  1  957  ? 267.293 324.280 246.502 1.00 0.00 ? 957  GLU A CG    1 
ATOM   7327  C  CD    . GLU A  1  957  ? 267.929 325.452 247.229 1.00 0.00 ? 957  GLU A CD    1 
ATOM   7328  O  OE1   . GLU A  1  957  ? 268.959 325.968 246.740 1.00 0.00 ? 957  GLU A OE1   1 
ATOM   7329  O  OE2   . GLU A  1  957  ? 267.421 325.839 248.303 1.00 0.00 ? 957  GLU A OE2   1 
ATOM   7330  N  N     . ARG A  1  958  ? 265.579 321.885 245.605 1.00 0.00 ? 958  ARG A N     1 
ATOM   7331  C  CA    . ARG A  1  958  ? 265.099 320.654 246.226 1.00 0.00 ? 958  ARG A CA    1 
ATOM   7332  C  C     . ARG A  1  958  ? 264.803 319.536 245.233 1.00 0.00 ? 958  ARG A C     1 
ATOM   7333  O  O     . ARG A  1  958  ? 265.146 318.382 245.486 1.00 0.00 ? 958  ARG A O     1 
ATOM   7334  C  CB    . ARG A  1  958  ? 263.793 320.940 246.970 1.00 0.00 ? 958  ARG A CB    1 
ATOM   7335  C  CG    . ARG A  1  958  ? 263.242 319.785 247.781 1.00 0.00 ? 958  ARG A CG    1 
ATOM   7336  C  CD    . ARG A  1  958  ? 262.090 320.271 248.630 1.00 0.00 ? 958  ARG A CD    1 
ATOM   7337  N  NE    . ARG A  1  958  ? 262.548 321.117 249.725 1.00 0.00 ? 958  ARG A NE    1 
ATOM   7338  C  CZ    . ARG A  1  958  ? 262.835 320.677 250.944 1.00 0.00 ? 958  ARG A CZ    1 
ATOM   7339  N  NH1   . ARG A  1  958  ? 262.702 319.386 251.225 1.00 0.00 ? 958  ARG A NH1   1 
ATOM   7340  N  NH2   . ARG A  1  958  ? 263.282 321.522 251.869 1.00 0.00 ? 958  ARG A NH2   1 
ATOM   7341  N  N     . MET A  1  959  ? 264.196 319.874 244.097 1.00 0.00 ? 959  MET A N     1 
ATOM   7342  C  CA    . MET A  1  959  ? 263.993 318.903 243.027 1.00 0.00 ? 959  MET A CA    1 
ATOM   7343  C  C     . MET A  1  959  ? 265.260 318.299 242.453 1.00 0.00 ? 959  MET A C     1 
ATOM   7344  O  O     . MET A  1  959  ? 265.338 317.101 242.195 1.00 0.00 ? 959  MET A O     1 
ATOM   7345  C  CB    . MET A  1  959  ? 263.200 319.527 241.881 1.00 0.00 ? 959  MET A CB    1 
ATOM   7346  C  CG    . MET A  1  959  ? 262.388 318.505 241.118 1.00 0.00 ? 959  MET A CG    1 
ATOM   7347  S  SD    . MET A  1  959  ? 261.022 317.851 242.083 1.00 0.00 ? 959  MET A SD    1 
ATOM   7348  C  CE    . MET A  1  959  ? 260.129 319.362 242.445 1.00 0.00 ? 959  MET A CE    1 
ATOM   7349  N  N     . ARG A  1  960  ? 266.254 319.161 242.283 1.00 0.00 ? 960  ARG A N     1 
ATOM   7350  C  CA    . ARG A  1  960  ? 267.576 318.792 241.807 1.00 0.00 ? 960  ARG A CA    1 
ATOM   7351  C  C     . ARG A  1  960  ? 268.277 317.942 242.884 1.00 0.00 ? 960  ARG A C     1 
ATOM   7352  O  O     . ARG A  1  960  ? 269.008 317.016 242.550 1.00 0.00 ? 960  ARG A O     1 
ATOM   7353  C  CB    . ARG A  1  960  ? 268.293 320.071 241.306 1.00 0.00 ? 960  ARG A CB    1 
ATOM   7354  C  CG    . ARG A  1  960  ? 269.590 319.910 240.479 1.00 0.00 ? 960  ARG A CG    1 
ATOM   7355  C  CD    . ARG A  1  960  ? 270.864 319.468 241.128 1.00 0.00 ? 960  ARG A CD    1 
ATOM   7356  N  NE    . ARG A  1  960  ? 271.141 320.290 242.293 1.00 0.00 ? 960  ARG A NE    1 
ATOM   7357  C  CZ    . ARG A  1  960  ? 271.689 319.851 243.413 1.00 0.00 ? 960  ARG A CZ    1 
ATOM   7358  N  NH1   . ARG A  1  960  ? 272.053 318.581 243.523 1.00 0.00 ? 960  ARG A NH1   1 
ATOM   7359  N  NH2   . ARG A  1  960  ? 271.860 320.687 244.427 1.00 0.00 ? 960  ARG A NH2   1 
ATOM   7360  N  N     . GLU A  1  961  ? 268.081 318.254 244.165 1.00 0.00 ? 961  GLU A N     1 
ATOM   7361  C  CA    . GLU A  1  961  ? 268.599 317.374 245.225 1.00 0.00 ? 961  GLU A CA    1 
ATOM   7362  C  C     . GLU A  1  961  ? 267.920 315.989 245.275 1.00 0.00 ? 961  GLU A C     1 
ATOM   7363  O  O     . GLU A  1  961  ? 268.589 314.977 245.472 1.00 0.00 ? 961  GLU A O     1 
ATOM   7364  C  CB    . GLU A  1  961  ? 268.448 318.043 246.593 1.00 0.00 ? 961  GLU A CB    1 
ATOM   7365  C  CG    . GLU A  1  961  ? 269.419 319.184 246.840 1.00 0.00 ? 961  GLU A CG    1 
ATOM   7366  C  CD    . GLU A  1  961  ? 270.881 318.757 246.749 1.00 0.00 ? 961  GLU A CD    1 
ATOM   7367  O  OE1   . GLU A  1  961  ? 271.194 317.581 247.047 1.00 0.00 ? 961  GLU A OE1   1 
ATOM   7368  O  OE2   . GLU A  1  961  ? 271.723 319.606 246.380 1.00 0.00 ? 961  GLU A OE2   1 
ATOM   7369  N  N     . ASP A  1  962  ? 266.601 315.958 245.093 1.00 0.00 ? 962  ASP A N     1 
ATOM   7370  C  CA    . ASP A  1  962  ? 265.796 314.721 245.021 1.00 0.00 ? 962  ASP A CA    1 
ATOM   7371  C  C     . ASP A  1  962  ? 266.229 313.868 243.841 1.00 0.00 ? 962  ASP A C     1 
ATOM   7372  O  O     . ASP A  1  962  ? 266.350 312.648 243.930 1.00 0.00 ? 962  ASP A O     1 
ATOM   7373  C  CB    . ASP A  1  962  ? 264.296 315.006 244.969 1.00 0.00 ? 962  ASP A CB    1 
ATOM   7374  C  CG    . ASP A  1  962  ? 263.802 315.724 246.206 1.00 0.00 ? 962  ASP A CG    1 
ATOM   7375  O  OD1   . ASP A  1  962  ? 264.128 315.254 247.320 1.00 0.00 ? 962  ASP A OD1   1 
ATOM   7376  O  OD2   . ASP A  1  962  ? 263.084 316.739 246.068 1.00 0.00 ? 962  ASP A OD2   1 
ATOM   7377  N  N     . ARG A  1  963  ? 266.463 314.557 242.739 1.00 0.00 ? 963  ARG A N     1 
ATOM   7378  C  CA    . ARG A  1  963  ? 266.925 313.993 241.489 1.00 0.00 ? 963  ARG A CA    1 
ATOM   7379  C  C     . ARG A  1  963  ? 268.223 313.258 241.783 1.00 0.00 ? 963  ARG A C     1 
ATOM   7380  O  O     . ARG A  1  963  ? 268.434 312.161 241.278 1.00 0.00 ? 963  ARG A O     1 
ATOM   7381  C  CB    . ARG A  1  963  ? 267.115 315.113 240.470 1.00 0.00 ? 963  ARG A CB    1 
ATOM   7382  C  CG    . ARG A  1  963  ? 267.720 314.771 239.128 1.00 0.00 ? 963  ARG A CG    1 
ATOM   7383  C  CD    . ARG A  1  963  ? 267.732 316.058 238.321 1.00 0.00 ? 963  ARG A CD    1 
ATOM   7384  N  NE    . ARG A  1  963  ? 268.470 315.966 237.079 1.00 0.00 ? 963  ARG A NE    1 
ATOM   7385  C  CZ    . ARG A  1  963  ? 267.936 315.530 235.947 1.00 0.00 ? 963  ARG A CZ    1 
ATOM   7386  N  NH1   . ARG A  1  963  ? 266.682 315.115 235.932 1.00 0.00 ? 963  ARG A NH1   1 
ATOM   7387  N  NH2   . ARG A  1  963  ? 268.623 315.570 234.818 1.00 0.00 ? 963  ARG A NH2   1 
ATOM   7388  N  N     . GLU A  1  964  ? 269.096 313.851 242.586 1.00 0.00 ? 964  GLU A N     1 
ATOM   7389  C  CA    . GLU A  1  964  ? 270.342 313.179 242.924 1.00 0.00 ? 964  GLU A CA    1 
ATOM   7390  C  C     . GLU A  1  964  ? 270.070 311.947 243.797 1.00 0.00 ? 964  GLU A C     1 
ATOM   7391  O  O     . GLU A  1  964  ? 270.651 310.891 243.556 1.00 0.00 ? 964  GLU A O     1 
ATOM   7392  C  CB    . GLU A  1  964  ? 271.284 314.129 243.668 1.00 0.00 ? 964  GLU A CB    1 
ATOM   7393  C  CG    . GLU A  1  964  ? 271.761 315.319 242.856 1.00 0.00 ? 964  GLU A CG    1 
ATOM   7394  C  CD    . GLU A  1  964  ? 272.914 314.970 241.935 1.00 0.00 ? 964  GLU A CD    1 
ATOM   7395  O  OE1   . GLU A  1  964  ? 273.616 313.970 242.212 1.00 0.00 ? 964  GLU A OE1   1 
ATOM   7396  O  OE2   . GLU A  1  964  ? 273.120 315.697 240.936 1.00 0.00 ? 964  GLU A OE2   1 
ATOM   7397  N  N     . VAL A  1  965  ? 269.217 312.071 244.812 1.00 0.00 ? 965  VAL A N     1 
ATOM   7398  C  CA    . VAL A  1  965  ? 268.809 310.909 245.612 1.00 0.00 ? 965  VAL A CA    1 
ATOM   7399  C  C     . VAL A  1  965  ? 268.155 309.765 244.814 1.00 0.00 ? 965  VAL A C     1 
ATOM   7400  O  O     . VAL A  1  965  ? 268.468 308.594 245.029 1.00 0.00 ? 965  VAL A O     1 
ATOM   7401  C  CB    . VAL A  1  965  ? 267.828 311.320 246.741 1.00 0.00 ? 965  VAL A CB    1 
ATOM   7402  C  CG1   . VAL A  1  965  ? 267.142 310.099 247.341 1.00 0.00 ? 965  VAL A CG1   1 
ATOM   7403  C  CG2   . VAL A  1  965  ? 268.559 312.086 247.826 1.00 0.00 ? 965  VAL A CG2   1 
ATOM   7404  N  N     . LEU A  1  966  ? 267.244 310.099 243.904 1.00 0.00 ? 966  LEU A N     1 
ATOM   7405  C  CA    . LEU A  1  966  ? 266.603 309.092 243.052 1.00 0.00 ? 966  LEU A CA    1 
ATOM   7406  C  C     . LEU A  1  966  ? 267.539 308.261 242.148 1.00 0.00 ? 966  LEU A C     1 
ATOM   7407  O  O     . LEU A  1  966  ? 267.262 307.093 241.886 1.00 0.00 ? 966  LEU A O     1 
ATOM   7408  C  CB    . LEU A  1  966  ? 265.552 309.782 242.186 1.00 0.00 ? 966  LEU A CB    1 
ATOM   7409  C  CG    . LEU A  1  966  ? 264.716 308.870 241.299 1.00 0.00 ? 966  LEU A CG    1 
ATOM   7410  C  CD1   . LEU A  1  966  ? 264.082 307.810 242.181 1.00 0.00 ? 966  LEU A CD1   1 
ATOM   7411  C  CD2   . LEU A  1  966  ? 263.658 309.655 240.538 1.00 0.00 ? 966  LEU A CD2   1 
ATOM   7412  N  N     . ARG A  1  967  ? 268.624 308.855 241.657 1.00 0.00 ? 967  ARG A N     1 
ATOM   7413  C  CA    . ARG A  1  967  ? 269.659 308.106 240.928 1.00 0.00 ? 967  ARG A CA    1 
ATOM   7414  C  C     . ARG A  1  967  ? 270.355 307.046 241.776 1.00 0.00 ? 967  ARG A C     1 
ATOM   7415  O  O     . ARG A  1  967  ? 270.714 305.982 241.278 1.00 0.00 ? 967  ARG A O     1 
ATOM   7416  C  CB    . ARG A  1  967  ? 270.678 309.031 240.261 1.00 0.00 ? 967  ARG A CB    1 
ATOM   7417  C  CG    . ARG A  1  967  ? 270.018 310.017 239.312 1.00 0.00 ? 967  ARG A CG    1 
ATOM   7418  C  CD    . ARG A  1  967  ? 271.024 310.717 238.410 1.00 0.00 ? 967  ARG A CD    1 
ATOM   7419  N  NE    . ARG A  1  967  ? 270.466 311.907 237.785 1.00 0.00 ? 967  ARG A NE    1 
ATOM   7420  C  CZ    . ARG A  1  967  ? 269.955 311.930 236.558 1.00 0.00 ? 967  ARG A CZ    1 
ATOM   7421  N  NH1   . ARG A  1  967  ? 269.868 310.807 235.856 1.00 0.00 ? 967  ARG A NH1   1 
ATOM   7422  N  NH2   . ARG A  1  967  ? 269.656 313.073 235.983 1.00 0.00 ? 967  ARG A NH2   1 
ATOM   7423  N  N     . VAL A  1  968  ? 270.560 307.346 243.050 1.00 0.00 ? 968  VAL A N     1 
ATOM   7424  C  CA    . VAL A  1  968  ? 271.129 306.379 243.976 1.00 0.00 ? 968  VAL A CA    1 
ATOM   7425  C  C     . VAL A  1  968  ? 270.141 305.248 244.236 1.00 0.00 ? 968  VAL A C     1 
ATOM   7426  O  O     . VAL A  1  968  ? 270.540 304.091 244.301 1.00 0.00 ? 968  VAL A O     1 
ATOM   7427  C  CB    . VAL A  1  968  ? 271.521 307.029 245.311 1.00 0.00 ? 968  VAL A CB    1 
ATOM   7428  C  CG1   . VAL A  1  968  ? 272.208 306.018 246.217 1.00 0.00 ? 968  VAL A CG1   1 
ATOM   7429  C  CG2   . VAL A  1  968  ? 272.413 308.235 245.064 1.00 0.00 ? 968  VAL A CG2   1 
ATOM   7430  N  N     . ILE A  1  969  ? 268.858 305.577 244.374 1.00 0.00 ? 969  ILE A N     1 
ATOM   7431  C  CA    . ILE A  1  969  ? 267.807 304.568 244.576 1.00 0.00 ? 969  ILE A CA    1 
ATOM   7432  C  C     . ILE A  1  969  ? 267.671 303.560 243.425 1.00 0.00 ? 969  ILE A C     1 
ATOM   7433  O  O     . ILE A  1  969  ? 267.557 302.363 243.668 1.00 0.00 ? 969  ILE A O     1 
ATOM   7434  C  CB    . ILE A  1  969  ? 266.421 305.238 244.774 1.00 0.00 ? 969  ILE A CB    1 
ATOM   7435  C  CG1   . ILE A  1  969  ? 266.413 306.121 246.023 1.00 0.00 ? 969  ILE A CG1   1 
ATOM   7436  C  CG2   . ILE A  1  969  ? 265.323 304.197 244.854 1.00 0.00 ? 969  ILE A CG2   1 
ATOM   7437  C  CD1   . ILE A  1  969  ? 265.135 306.920 246.197 1.00 0.00 ? 969  ILE A CD1   1 
ATOM   7438  N  N     . PHE A  1  970  ? 267.704 304.025 242.182 1.00 0.00 ? 970  PHE A N     1 
ATOM   7439  C  CA    . PHE A  1  970  ? 267.519 303.134 241.037 1.00 0.00 ? 970  PHE A CA    1 
ATOM   7440  C  C     . PHE A  1  970  ? 268.731 303.117 240.116 1.00 0.00 ? 970  PHE A C     1 
ATOM   7441  O  O     . PHE A  1  970  ? 268.677 303.684 239.023 1.00 0.00 ? 970  PHE A O     1 
ATOM   7442  C  CB    . PHE A  1  970  ? 266.295 303.547 240.216 1.00 0.00 ? 970  PHE A CB    1 
ATOM   7443  C  CG    . PHE A  1  970  ? 264.996 303.464 240.958 1.00 0.00 ? 970  PHE A CG    1 
ATOM   7444  C  CD1   . PHE A  1  970  ? 264.713 302.381 241.766 1.00 0.00 ? 970  PHE A CD1   1 
ATOM   7445  C  CD2   . PHE A  1  970  ? 264.041 304.456 240.818 1.00 0.00 ? 970  PHE A CD2   1 
ATOM   7446  C  CE1   . PHE A  1  970  ? 263.506 302.298 242.441 1.00 0.00 ? 970  PHE A CE1   1 
ATOM   7447  C  CE2   . PHE A  1  970  ? 262.838 304.380 241.490 1.00 0.00 ? 970  PHE A CE2   1 
ATOM   7448  C  CZ    . PHE A  1  970  ? 262.572 303.301 242.304 1.00 0.00 ? 970  PHE A CZ    1 
ATOM   7449  N  N     . PRO A  1  971  ? 269.819 302.447 240.530 1.00 0.00 ? 971  PRO A N     1 
ATOM   7450  C  CA    . PRO A  1  971  ? 271.072 302.437 239.753 1.00 0.00 ? 971  PRO A CA    1 
ATOM   7451  C  C     . PRO A  1  971  ? 270.872 301.968 238.316 1.00 0.00 ? 971  PRO A C     1 
ATOM   7452  O  O     . PRO A  1  971  ? 271.667 302.285 237.430 1.00 0.00 ? 971  PRO A O     1 
ATOM   7453  C  CB    . PRO A  1  971  ? 271.957 301.448 240.521 1.00 0.00 ? 971  PRO A CB    1 
ATOM   7454  C  CG    . PRO A  1  971  ? 271.407 301.443 241.907 1.00 0.00 ? 971  PRO A CG    1 
ATOM   7455  C  CD    . PRO A  1  971  ? 269.920 301.618 241.742 1.00 0.00 ? 971  PRO A CD    1 
ATOM   7456  N  N     . THR A  1  972  ? 269.799 301.216 238.104 1.00 0.00 ? 972  THR A N     1 
ATOM   7457  C  CA    . THR A  1  972  ? 269.464 300.670 236.799 1.00 0.00 ? 972  THR A CA    1 
ATOM   7458  C  C     . THR A  1  972  ? 268.896 301.687 235.816 1.00 0.00 ? 972  THR A C     1 
ATOM   7459  O  O     . THR A  1  972  ? 268.739 301.388 234.636 1.00 0.00 ? 972  THR A O     1 
ATOM   7460  C  CB    . THR A  1  972  ? 268.453 299.532 236.955 1.00 0.00 ? 972  THR A CB    1 
ATOM   7461  O  OG1   . THR A  1  972  ? 267.375 299.981 237.784 1.00 0.00 ? 972  THR A OG1   1 
ATOM   7462  C  CG2   . THR A  1  972  ? 269.114 298.327 237.615 1.00 0.00 ? 972  THR A CG2   1 
ATOM   7463  N  N     . GLY A  1  973  ? 268.591 302.888 236.290 1.00 0.00 ? 973  GLY A N     1 
ATOM   7464  C  CA    . GLY A  1  973  ? 268.038 303.901 235.415 1.00 0.00 ? 973  GLY A CA    1 
ATOM   7465  C  C     . GLY A  1  973  ? 266.700 303.485 234.837 1.00 0.00 ? 973  GLY A C     1 
ATOM   7466  O  O     . GLY A  1  973  ? 266.372 303.807 233.697 1.00 0.00 ? 973  GLY A O     1 
ATOM   7467  N  N     . ASP A  1  974  ? 265.944 302.721 235.618 1.00 0.00 ? 974  ASP A N     1 
ATOM   7468  C  CA    . ASP A  1  974  ? 264.555 302.414 235.297 1.00 0.00 ? 974  ASP A CA    1 
ATOM   7469  C  C     . ASP A  1  974  ? 263.596 303.418 235.935 1.00 0.00 ? 974  ASP A C     1 
ATOM   7470  O  O     . ASP A  1  974  ? 263.713 303.737 237.119 1.00 0.00 ? 974  ASP A O     1 
ATOM   7471  C  CB    . ASP A  1  974  ? 264.200 301.001 235.754 1.00 0.00 ? 974  ASP A CB    1 
ATOM   7472  C  CG    . ASP A  1  974  ? 262.844 300.557 235.256 1.00 0.00 ? 974  ASP A CG    1 
ATOM   7473  O  OD1   . ASP A  1  974  ? 262.443 301.015 234.161 1.00 0.00 ? 974  ASP A OD1   1 
ATOM   7474  O  OD2   . ASP A  1  974  ? 262.178 299.761 235.961 1.00 0.00 ? 974  ASP A OD2   1 
ATOM   7475  N  N     . SER A  1  975  ? 262.624 303.882 235.161 1.00 0.00 ? 975  SER A N     1 
ATOM   7476  C  CA    . SER A  1  975  ? 261.739 304.947 235.617 1.00 0.00 ? 975  SER A CA    1 
ATOM   7477  C  C     . SER A  1  975  ? 260.302 304.473 235.830 1.00 0.00 ? 975  SER A C     1 
ATOM   7478  O  O     . SER A  1  975  ? 259.384 305.281 235.952 1.00 0.00 ? 975  SER A O     1 
ATOM   7479  C  CB    . SER A  1  975  ? 261.785 306.116 234.625 1.00 0.00 ? 975  SER A CB    1 
ATOM   7480  O  OG    . SER A  1  975  ? 261.430 305.711 233.315 1.00 0.00 ? 975  SER A OG    1 
ATOM   7481  N  N     . LYS A  1  976  ? 260.122 303.159 235.871 1.00 0.00 ? 976  LYS A N     1 
ATOM   7482  C  CA    . LYS A  1  976  ? 258.806 302.554 236.006 1.00 0.00 ? 976  LYS A CA    1 
ATOM   7483  C  C     . LYS A  1  976  ? 258.625 302.052 237.441 1.00 0.00 ? 976  LYS A C     1 
ATOM   7484  O  O     . LYS A  1  976  ? 259.280 301.096 237.835 1.00 0.00 ? 976  LYS A O     1 
ATOM   7485  C  CB    . LYS A  1  976  ? 258.676 301.396 235.008 1.00 0.00 ? 976  LYS A CB    1 
ATOM   7486  C  CG    . LYS A  1  976  ? 257.287 300.812 234.809 1.00 0.00 ? 976  LYS A CG    1 
ATOM   7487  C  CD    . LYS A  1  976  ? 257.213 300.080 233.459 1.00 0.00 ? 976  LYS A CD    1 
ATOM   7488  C  CE    . LYS A  1  976  ? 257.234 301.038 232.264 1.00 0.00 ? 976  LYS A CE    1 
ATOM   7489  N  NZ    . LYS A  1  976  ? 256.098 302.000 232.252 1.00 0.00 ? 976  LYS A NZ    1 
ATOM   7490  N  N     . VAL A  1  977  ? 257.742 302.671 238.221 1.00 0.00 ? 977  VAL A N     1 
ATOM   7491  C  CA    . VAL A  1  977  ? 257.544 302.264 239.618 1.00 0.00 ? 977  VAL A CA    1 
ATOM   7492  C  C     . VAL A  1  977  ? 256.073 302.120 239.953 1.00 0.00 ? 977  VAL A C     1 
ATOM   7493  O  O     . VAL A  1  977  ? 255.250 302.816 239.367 1.00 0.00 ? 977  VAL A O     1 
ATOM   7494  C  CB    . VAL A  1  977  ? 258.122 303.288 240.605 1.00 0.00 ? 977  VAL A CB    1 
ATOM   7495  C  CG1   . VAL A  1  977  ? 259.630 303.338 240.487 1.00 0.00 ? 977  VAL A CG1   1 
ATOM   7496  C  CG2   . VAL A  1  977  ? 257.533 304.666 240.351 1.00 0.00 ? 977  VAL A CG2   1 
ATOM   7497  N  N     . VAL A  1  978  ? 255.719 301.199 240.851 1.00 0.00 ? 978  VAL A N     1 
ATOM   7498  C  CA    . VAL A  1  978  ? 254.323 301.110 241.311 1.00 0.00 ? 978  VAL A CA    1 
ATOM   7499  C  C     . VAL A  1  978  ? 253.995 302.160 242.387 1.00 0.00 ? 978  VAL A C     1 
ATOM   7500  O  O     . VAL A  1  978  ? 254.727 302.314 243.363 1.00 0.00 ? 978  VAL A O     1 
ATOM   7501  C  CB    . VAL A  1  978  ? 253.962 299.693 241.832 1.00 0.00 ? 978  VAL A CB    1 
ATOM   7502  C  CG1   . VAL A  1  978  ? 253.742 298.732 240.675 1.00 0.00 ? 978  VAL A CG1   1 
ATOM   7503  C  CG2   . VAL A  1  978  ? 255.012 299.168 242.796 1.00 0.00 ? 978  VAL A CG2   1 
ATOM   7504  N  N     . LEU A  1  979  ? 252.921 302.915 242.172 1.00 0.00 ? 979  LEU A N     1 
ATOM   7505  C  CA    . LEU A  1  979  ? 252.463 303.954 243.105 1.00 0.00 ? 979  LEU A CA    1 
ATOM   7506  C  C     . LEU A  1  979  ? 250.937 303.998 243.132 1.00 0.00 ? 979  LEU A C     1 
ATOM   7507  O  O     . LEU A  1  979  ? 250.287 303.493 242.213 1.00 0.00 ? 979  LEU A O     1 
ATOM   7508  C  CB    . LEU A  1  979  ? 253.025 305.314 242.710 1.00 0.00 ? 979  LEU A CB    1 
ATOM   7509  C  CG    . LEU A  1  979  ? 254.499 305.443 243.047 1.00 0.00 ? 979  LEU A CG    1 
ATOM   7510  C  CD1   . LEU A  1  979  ? 255.037 306.759 242.544 1.00 0.00 ? 979  LEU A CD1   1 
ATOM   7511  C  CD2   . LEU A  1  979  ? 254.650 305.304 244.541 1.00 0.00 ? 979  LEU A CD2   1 
ATOM   7512  N  N     . PRO A  1  980  ? 250.347 304.591 244.178 1.00 0.00 ? 980  PRO A N     1 
ATOM   7513  C  CA    . PRO A  1  980  ? 248.896 304.805 244.127 1.00 0.00 ? 980  PRO A CA    1 
ATOM   7514  C  C     . PRO A  1  980  ? 248.526 306.055 243.330 1.00 0.00 ? 980  PRO A C     1 
ATOM   7515  O  O     . PRO A  1  980  ? 249.395 306.890 243.112 1.00 0.00 ? 980  PRO A O     1 
ATOM   7516  C  CB    . PRO A  1  980  ? 248.530 304.969 245.596 1.00 0.00 ? 980  PRO A CB    1 
ATOM   7517  C  CG    . PRO A  1  980  ? 249.738 305.626 246.179 1.00 0.00 ? 980  PRO A CG    1 
ATOM   7518  C  CD    . PRO A  1  980  ? 250.914 304.972 245.482 1.00 0.00 ? 980  PRO A CD    1 
ATOM   7519  N  N     . CYS A  1  981  ? 247.256 306.195 242.948 1.00 0.00 ? 981  CYS A N     1 
ATOM   7520  C  CA    . CYS A  1  981  ? 246.707 307.458 242.430 1.00 0.00 ? 981  CYS A CA    1 
ATOM   7521  C  C     . CYS A  1  981  ? 247.399 308.020 241.186 1.00 0.00 ? 981  CYS A C     1 
ATOM   7522  O  O     . CYS A  1  981  ? 248.259 308.898 241.299 1.00 0.00 ? 981  CYS A O     1 
ATOM   7523  C  CB    . CYS A  1  981  ? 246.746 308.516 243.547 1.00 0.00 ? 981  CYS A CB    1 
ATOM   7524  S  SG    . CYS A  1  981  ? 246.887 307.837 245.271 1.00 0.00 ? 981  CYS A SG    1 
ATOM   7525  N  N     . ASN A  1  982  ? 247.013 307.538 240.007 1.00 0.00 ? 982  ASN A N     1 
ATOM   7526  C  CA    . ASN A  1  982  ? 247.638 307.964 238.746 1.00 0.00 ? 982  ASN A CA    1 
ATOM   7527  C  C     . ASN A  1  982  ? 247.540 309.483 238.472 1.00 0.00 ? 982  ASN A C     1 
ATOM   7528  O  O     . ASN A  1  982  ? 246.497 309.989 238.045 1.00 0.00 ? 982  ASN A O     1 
ATOM   7529  C  CB    . ASN A  1  982  ? 247.021 307.183 237.586 1.00 0.00 ? 982  ASN A CB    1 
ATOM   7530  C  CG    . ASN A  1  982  ? 247.868 307.231 236.335 1.00 0.00 ? 982  ASN A CG    1 
ATOM   7531  O  OD1   . ASN A  1  982  ? 248.658 308.162 236.130 1.00 0.00 ? 982  ASN A OD1   1 
ATOM   7532  N  ND2   . ASN A  1  982  ? 247.718 306.212 235.490 1.00 0.00 ? 982  ASN A ND2   1 
ATOM   7533  N  N     . LEU A  1  983  ? 248.633 310.201 238.717 1.00 0.00 ? 983  LEU A N     1 
ATOM   7534  C  CA    . LEU A  1  983  ? 248.597 311.657 238.686 1.00 0.00 ? 983  LEU A CA    1 
ATOM   7535  C  C     . LEU A  1  983  ? 248.427 312.245 237.296 1.00 0.00 ? 983  LEU A C     1 
ATOM   7536  O  O     . LEU A  1  983  ? 247.734 313.247 237.145 1.00 0.00 ? 983  LEU A O     1 
ATOM   7537  C  CB    . LEU A  1  983  ? 249.872 312.228 239.296 1.00 0.00 ? 983  LEU A CB    1 
ATOM   7538  C  CG    . LEU A  1  983  ? 250.162 311.791 240.722 1.00 0.00 ? 983  LEU A CG    1 
ATOM   7539  C  CD1   . LEU A  1  983  ? 251.471 312.398 241.165 1.00 0.00 ? 983  LEU A CD1   1 
ATOM   7540  C  CD2   . LEU A  1  983  ? 249.027 312.193 241.636 1.00 0.00 ? 983  LEU A CD2   1 
ATOM   7541  N  N     . LEU A  1  984  ? 249.032 311.633 236.278 1.00 0.00 ? 984  LEU A N     1 
ATOM   7542  C  CA    . LEU A  1  984  ? 248.774 312.069 234.903 1.00 0.00 ? 984  LEU A CA    1 
ATOM   7543  C  C     . LEU A  1  984  ? 247.314 311.922 234.502 1.00 0.00 ? 984  LEU A C     1 
ATOM   7544  O  O     . LEU A  1  984  ? 246.729 312.853 233.947 1.00 0.00 ? 984  LEU A O     1 
ATOM   7545  C  CB    . LEU A  1  984  ? 249.657 311.326 233.894 1.00 0.00 ? 984  LEU A CB    1 
ATOM   7546  C  CG    . LEU A  1  984  ? 251.169 311.420 234.050 1.00 0.00 ? 984  LEU A CG    1 
ATOM   7547  C  CD1   . LEU A  1  984  ? 251.858 310.659 232.935 1.00 0.00 ? 984  LEU A CD1   1 
ATOM   7548  C  CD2   . LEU A  1  984  ? 251.571 312.881 234.005 1.00 0.00 ? 984  LEU A CD2   1 
ATOM   7549  N  N     . ARG A  1  985  ? 246.726 310.764 234.801 1.00 0.00 ? 985  ARG A N     1 
ATOM   7550  C  CA    . ARG A  1  985  ? 245.334 310.521 234.448 1.00 0.00 ? 985  ARG A CA    1 
ATOM   7551  C  C     . ARG A  1  985  ? 244.376 311.367 235.298 1.00 0.00 ? 985  ARG A C     1 
ATOM   7552  O  O     . ARG A  1  985  ? 243.342 311.796 234.802 1.00 0.00 ? 985  ARG A O     1 
ATOM   7553  C  CB    . ARG A  1  985  ? 245.007 309.037 234.554 1.00 0.00 ? 985  ARG A CB    1 
ATOM   7554  C  CG    . ARG A  1  985  ? 243.576 308.698 234.217 1.00 0.00 ? 985  ARG A CG    1 
ATOM   7555  C  CD    . ARG A  1  985  ? 243.427 307.209 234.063 1.00 0.00 ? 985  ARG A CD    1 
ATOM   7556  N  NE    . ARG A  1  985  ? 243.826 306.571 235.303 1.00 0.00 ? 985  ARG A NE    1 
ATOM   7557  C  CZ    . ARG A  1  985  ? 243.060 306.519 236.384 1.00 0.00 ? 985  ARG A CZ    1 
ATOM   7558  N  NH1   . ARG A  1  985  ? 241.847 307.065 236.360 1.00 0.00 ? 985  ARG A NH1   1 
ATOM   7559  N  NH2   . ARG A  1  985  ? 243.487 305.874 237.464 1.00 0.00 ? 985  ARG A NH2   1 
ATOM   7560  N  N     . MET A  1  986  ? 244.674 311.575 236.577 1.00 0.00 ? 986  MET A N     1 
ATOM   7561  C  CA    . MET A  1  986  ? 243.891 312.525 237.375 1.00 0.00 ? 986  MET A CA    1 
ATOM   7562  C  C     . MET A  1  986  ? 243.984 313.973 236.840 1.00 0.00 ? 986  MET A C     1 
ATOM   7563  O  O     . MET A  1  986  ? 242.975 314.682 236.751 1.00 0.00 ? 986  MET A O     1 
ATOM   7564  C  CB    . MET A  1  986  ? 244.266 312.455 238.843 1.00 0.00 ? 986  MET A CB    1 
ATOM   7565  C  CG    . MET A  1  986  ? 243.742 311.185 239.475 1.00 0.00 ? 986  MET A CG    1 
ATOM   7566  S  SD    . MET A  1  986  ? 244.375 310.870 241.137 1.00 0.00 ? 986  MET A SD    1 
ATOM   7567  C  CE    . MET A  1  986  ? 243.160 309.713 241.797 1.00 0.00 ? 986  MET A CE    1 
ATOM   7568  N  N     . ILE A  1  987  ? 245.189 314.414 236.506 1.00 0.00 ? 987  ILE A N     1 
ATOM   7569  C  CA    . ILE A  1  987  ? 245.379 315.749 235.964 1.00 0.00 ? 987  ILE A CA    1 
ATOM   7570  C  C     . ILE A  1  987  ? 244.670 315.862 234.639 1.00 0.00 ? 987  ILE A C     1 
ATOM   7571  O  O     . ILE A  1  987  ? 244.053 316.868 234.333 1.00 0.00 ? 987  ILE A O     1 
ATOM   7572  C  CB    . ILE A  1  987  ? 246.858 316.072 235.732 1.00 0.00 ? 987  ILE A CB    1 
ATOM   7573  C  CG1   . ILE A  1  987  ? 247.563 316.349 237.050 1.00 0.00 ? 987  ILE A CG1   1 
ATOM   7574  C  CG2   . ILE A  1  987  ? 247.015 317.288 234.847 1.00 0.00 ? 987  ILE A CG2   1 
ATOM   7575  C  CD1   . ILE A  1  987  ? 249.066 316.381 236.911 1.00 0.00 ? 987  ILE A CD1   1 
ATOM   7576  N  N     . TRP A  1  988  ? 244.765 314.811 233.852 1.00 0.00 ? 988  TRP A N     1 
ATOM   7577  C  CA    . TRP A  1  988  ? 244.061 314.731 232.592 1.00 0.00 ? 988  TRP A CA    1 
ATOM   7578  C  C     . TRP A  1  988  ? 242.543 314.747 232.893 1.00 0.00 ? 988  TRP A C     1 
ATOM   7579  O  O     . TRP A  1  988  ? 241.769 315.332 232.144 1.00 0.00 ? 988  TRP A O     1 
ATOM   7580  C  CB    . TRP A  1  988  ? 244.505 313.487 231.827 1.00 0.00 ? 988  TRP A CB    1 
ATOM   7581  C  CG    . TRP A  1  988  ? 244.108 313.467 230.406 1.00 0.00 ? 988  TRP A CG    1 
ATOM   7582  C  CD1   . TRP A  1  988  ? 244.883 313.876 229.360 1.00 0.00 ? 988  TRP A CD1   1 
ATOM   7583  C  CD2   . TRP A  1  988  ? 242.871 313.036 229.838 1.00 0.00 ? 988  TRP A CD2   1 
ATOM   7584  N  NE1   . TRP A  1  988  ? 244.206 313.736 228.174 1.00 0.00 ? 988  TRP A NE1   1 
ATOM   7585  C  CE2   . TRP A  1  988  ? 242.969 313.217 228.439 1.00 0.00 ? 988  TRP A CE2   1 
ATOM   7586  C  CE3   . TRP A  1  988  ? 241.691 312.522 230.366 1.00 0.00 ? 988  TRP A CE3   1 
ATOM   7587  C  CZ2   . TRP A  1  988  ? 241.935 312.896 227.571 1.00 0.00 ? 988  TRP A CZ2   1 
ATOM   7588  C  CZ3   . TRP A  1  988  ? 240.668 312.214 229.497 1.00 0.00 ? 988  TRP A CZ3   1 
ATOM   7589  C  CH2   . TRP A  1  988  ? 240.798 312.392 228.121 1.00 0.00 ? 988  TRP A CH2   1 
ATOM   7590  N  N     . ASN A  1  989  ? 242.122 314.096 233.982 1.00 0.00 ? 989  ASN A N     1 
ATOM   7591  C  CA    . ASN A  1  989  ? 240.724 314.153 234.438 1.00 0.00 ? 989  ASN A CA    1 
ATOM   7592  C  C     . ASN A  1  989  ? 240.238 315.512 234.890 1.00 0.00 ? 989  ASN A C     1 
ATOM   7593  O  O     . ASN A  1  989  ? 239.083 315.841 234.668 1.00 0.00 ? 989  ASN A O     1 
ATOM   7594  C  CB    . ASN A  1  989  ? 240.485 313.219 235.640 1.00 0.00 ? 989  ASN A CB    1 
ATOM   7595  C  CG    . ASN A  1  989  ? 240.344 311.751 235.266 1.00 0.00 ? 989  ASN A CG    1 
ATOM   7596  O  OD1   . ASN A  1  989  ? 239.838 311.412 234.207 1.00 0.00 ? 989  ASN A OD1   1 
ATOM   7597  N  ND2   . ASN A  1  989  ? 240.767 310.869 236.168 1.00 0.00 ? 989  ASN A ND2   1 
ATOM   7598  N  N     . ALA A  1  990  ? 241.110 316.303 235.508 1.00 0.00 ? 990  ALA A N     1 
ATOM   7599  C  CA    . ALA A  1  990  ? 240.786 317.699 235.838 1.00 0.00 ? 990  ALA A CA    1 
ATOM   7600  C  C     . ALA A  1  990  ? 240.535 318.590 234.617 1.00 0.00 ? 990  ALA A C     1 
ATOM   7601  O  O     . ALA A  1  990  ? 239.580 319.363 234.598 1.00 0.00 ? 990  ALA A O     1 
ATOM   7602  C  CB    . ALA A  1  990  ? 241.886 318.298 236.697 1.00 0.00 ? 990  ALA A CB    1 
ATOM   7603  N  N     . GLN A  1  991  ? 241.388 318.478 233.608 1.00 0.00 ? 991  GLN A N     1 
ATOM   7604  C  CA    . GLN A  1  991  ? 241.220 319.240 232.378 1.00 0.00 ? 991  GLN A CA    1 
ATOM   7605  C  C     . GLN A  1  991  ? 239.898 318.909 231.707 1.00 0.00 ? 991  GLN A C     1 
ATOM   7606  O  O     . GLN A  1  991  ? 239.213 319.803 231.198 1.00 0.00 ? 991  GLN A O     1 
ATOM   7607  C  CB    . GLN A  1  991  ? 242.338 318.964 231.369 1.00 0.00 ? 991  GLN A CB    1 
ATOM   7608  C  CG    . GLN A  1  991  ? 243.722 319.425 231.727 1.00 0.00 ? 991  GLN A CG    1 
ATOM   7609  C  CD    . GLN A  1  991  ? 244.718 319.059 230.643 1.00 0.00 ? 991  GLN A CD    1 
ATOM   7610  O  OE1   . GLN A  1  991  ? 244.725 317.932 230.152 1.00 0.00 ? 991  GLN A OE1   1 
ATOM   7611  N  NE2   . GLN A  1  991  ? 245.553 320.013 230.254 1.00 0.00 ? 991  GLN A NE2   1 
ATOM   7612  N  N     . LYS A  1  992  ? 239.557 317.618 231.687 1.00 0.00 ? 992  LYS A N     1 
ATOM   7613  C  CA    . LYS A  1  992  ? 238.297 317.162 231.098 1.00 0.00 ? 992  LYS A CA    1 
ATOM   7614  C  C     . LYS A  1  992  ? 237.024 317.720 231.751 1.00 0.00 ? 992  LYS A C     1 
ATOM   7615  O  O     . LYS A  1  992  ? 236.103 318.158 231.055 1.00 0.00 ? 992  LYS A O     1 
ATOM   7616  C  CB    . LYS A  1  992  ? 238.188 315.636 231.127 1.00 0.00 ? 992  LYS A CB    1 
ATOM   7617  C  CG    . LYS A  1  992  ? 236.842 315.216 230.539 1.00 0.00 ? 992  LYS A CG    1 
ATOM   7618  C  CD    . LYS A  1  992  ? 236.330 313.812 230.818 1.00 0.00 ? 992  LYS A CD    1 
ATOM   7619  C  CE    . LYS A  1  992  ? 235.651 313.651 232.170 1.00 0.00 ? 992  LYS A CE    1 
ATOM   7620  N  NZ    . LYS A  1  992  ? 235.230 312.233 232.387 1.00 0.00 ? 992  LYS A NZ    1 
ATOM   7621  N  N     . ILE A  1  993  ? 236.979 317.723 233.080 1.00 0.00 ? 993  ILE A N     1 
ATOM   7622  C  CA    . ILE A  1  993  ? 235.778 318.141 233.792 1.00 0.00 ? 993  ILE A CA    1 
ATOM   7623  C  C     . ILE A  1  993  ? 235.572 319.638 233.786 1.00 0.00 ? 993  ILE A C     1 
ATOM   7624  O  O     . ILE A  1  993  ? 234.485 320.118 233.473 1.00 0.00 ? 993  ILE A O     1 
ATOM   7625  C  CB    . ILE A  1  993  ? 235.801 317.673 235.253 1.00 0.00 ? 993  ILE A CB    1 
ATOM   7626  C  CG1   . ILE A  1  993  ? 235.634 316.147 235.324 1.00 0.00 ? 993  ILE A CG1   1 
ATOM   7627  C  CG2   . ILE A  1  993  ? 234.689 318.347 236.025 1.00 0.00 ? 993  ILE A CG2   1 
ATOM   7628  C  CD1   . ILE A  1  993  ? 235.972 315.521 236.677 1.00 0.00 ? 993  ILE A CD1   1 
ATOM   7629  N  N     . PHE A  1  994  ? 236.609 320.374 234.150 1.00 0.00 ? 994  PHE A N     1 
ATOM   7630  C  CA    . PHE A  1  994  ? 236.531 321.830 234.220 1.00 0.00 ? 994  PHE A CA    1 
ATOM   7631  C  C     . PHE A  1  994  ? 236.490 322.519 232.851 1.00 0.00 ? 994  PHE A C     1 
ATOM   7632  O  O     . PHE A  1  994  ? 236.313 323.735 232.776 1.00 0.00 ? 994  PHE A O     1 
ATOM   7633  C  CB    . PHE A  1  994  ? 237.703 322.339 235.044 1.00 0.00 ? 994  PHE A CB    1 
ATOM   7634  C  CG    . PHE A  1  994  ? 237.580 322.018 236.502 1.00 0.00 ? 994  PHE A CG    1 
ATOM   7635  C  CD1   . PHE A  1  994  ? 237.940 320.761 236.970 1.00 0.00 ? 994  PHE A CD1   1 
ATOM   7636  C  CD2   . PHE A  1  994  ? 237.034 322.931 237.388 1.00 0.00 ? 994  PHE A CD2   1 
ATOM   7637  C  CE1   . PHE A  1  994  ? 237.812 320.439 238.298 1.00 0.00 ? 994  PHE A CE1   1 
ATOM   7638  C  CE2   . PHE A  1  994  ? 236.911 322.620 238.726 1.00 0.00 ? 994  PHE A CE2   1 
ATOM   7639  C  CZ    . PHE A  1  994  ? 237.297 321.367 239.181 1.00 0.00 ? 994  PHE A CZ    1 
ATOM   7640  N  N     . HIS A  1  995  ? 236.673 321.740 231.786 1.00 0.00 ? 995  HIS A N     1 
ATOM   7641  C  CA    . HIS A  1  995  ? 236.664 322.243 230.408 1.00 0.00 ? 995  HIS A CA    1 
ATOM   7642  C  C     . HIS A  1  995  ? 237.728 323.312 230.164 1.00 0.00 ? 995  HIS A C     1 
ATOM   7643  O  O     . HIS A  1  995  ? 237.433 324.402 229.656 1.00 0.00 ? 995  HIS A O     1 
ATOM   7644  C  CB    . HIS A  1  995  ? 235.278 322.799 230.035 1.00 0.00 ? 995  HIS A CB    1 
ATOM   7645  C  CG    . HIS A  1  995  ? 234.162 321.806 230.167 1.00 0.00 ? 995  HIS A CG    1 
ATOM   7646  N  ND1   . HIS A  1  995  ? 234.373 320.444 230.221 1.00 0.00 ? 995  HIS A ND1   1 
ATOM   7647  C  CD2   . HIS A  1  995  ? 232.820 321.980 230.244 1.00 0.00 ? 995  HIS A CD2   1 
ATOM   7648  C  CE1   . HIS A  1  995  ? 233.211 319.823 230.331 1.00 0.00 ? 995  HIS A CE1   1 
ATOM   7649  N  NE2   . HIS A  1  995  ? 232.254 320.733 230.348 1.00 0.00 ? 995  HIS A NE2   1 
ATOM   7650  N  N     . ILE A  1  996  ? 238.965 322.994 230.531 1.00 0.00 ? 996  ILE A N     1 
ATOM   7651  C  CA    . ILE A  1  996  ? 240.063 323.944 230.399 1.00 0.00 ? 996  ILE A CA    1 
ATOM   7652  C  C     . ILE A  1  996  ? 240.696 323.992 229.013 1.00 0.00 ? 996  ILE A C     1 
ATOM   7653  O  O     . ILE A  1  996  ? 241.266 323.009 228.542 1.00 0.00 ? 996  ILE A O     1 
ATOM   7654  C  CB    . ILE A  1  996  ? 241.160 323.652 231.419 1.00 0.00 ? 996  ILE A CB    1 
ATOM   7655  C  CG1   . ILE A  1  996  ? 240.589 323.779 232.831 1.00 0.00 ? 996  ILE A CG1   1 
ATOM   7656  C  CG2   . ILE A  1  996  ? 242.318 324.613 231.224 1.00 0.00 ? 996  ILE A CG2   1 
ATOM   7657  C  CD1   . ILE A  1  996  ? 239.973 325.145 233.118 1.00 0.00 ? 996  ILE A CD1   1 
ATOM   7658  N  N     . ASN A  1  997  ? 240.594 325.153 228.374 1.00 0.00 ? 997  ASN A N     1 
ATOM   7659  C  CA    . ASN A  1  997  ? 241.213 325.366 227.078 1.00 0.00 ? 997  ASN A CA    1 
ATOM   7660  C  C     . ASN A  1  997  ? 242.717 325.196 227.211 1.00 0.00 ? 997  ASN A C     1 
ATOM   7661  O  O     . ASN A  1  997  ? 243.340 325.810 228.074 1.00 0.00 ? 997  ASN A O     1 
ATOM   7662  C  CB    . ASN A  1  997  ? 240.871 326.760 226.542 1.00 0.00 ? 997  ASN A CB    1 
ATOM   7663  C  CG    . ASN A  1  997  ? 241.287 326.957 225.092 1.00 0.00 ? 997  ASN A CG    1 
ATOM   7664  O  OD1   . ASN A  1  997  ? 242.400 326.618 224.689 1.00 0.00 ? 997  ASN A OD1   1 
ATOM   7665  N  ND2   . ASN A  1  997  ? 240.385 327.522 224.299 1.00 0.00 ? 997  ASN A ND2   1 
ATOM   7666  N  N     . PRO A  1  998  ? 243.303 324.330 226.379 1.00 0.00 ? 998  PRO A N     1 
ATOM   7667  C  CA    . PRO A  1  998  ? 244.744 324.073 226.436 1.00 0.00 ? 998  PRO A CA    1 
ATOM   7668  C  C     . PRO A  1  998  ? 245.589 325.206 225.861 1.00 0.00 ? 998  PRO A C     1 
ATOM   7669  O  O     . PRO A  1  998  ? 246.815 325.145 225.953 1.00 0.00 ? 998  PRO A O     1 
ATOM   7670  C  CB    . PRO A  1  998  ? 244.895 322.808 225.590 1.00 0.00 ? 998  PRO A CB    1 
ATOM   7671  C  CG    . PRO A  1  998  ? 243.777 322.900 224.607 1.00 0.00 ? 998  PRO A CG    1 
ATOM   7672  C  CD    . PRO A  1  998  ? 242.629 323.467 225.394 1.00 0.00 ? 998  PRO A CD    1 
ATOM   7673  N  N     . ARG A  1  999  ? 244.951 326.213 225.265 1.00 0.00 ? 999  ARG A N     1 
ATOM   7674  C  CA    . ARG A  1  999  ? 245.680 327.352 224.714 1.00 0.00 ? 999  ARG A CA    1 
ATOM   7675  C  C     . ARG A  1  999  ? 245.089 328.706 225.108 1.00 0.00 ? 999  ARG A C     1 
ATOM   7676  O  O     . ARG A  1  999  ? 244.728 329.506 224.247 1.00 0.00 ? 999  ARG A O     1 
ATOM   7677  C  CB    . ARG A  1  999  ? 245.747 327.241 223.194 1.00 0.00 ? 999  ARG A CB    1 
ATOM   7678  C  CG    . ARG A  1  999  ? 246.532 326.035 222.705 1.00 0.00 ? 999  ARG A CG    1 
ATOM   7679  C  CD    . ARG A  1  999  ? 246.596 325.987 221.193 1.00 0.00 ? 999  ARG A CD    1 
ATOM   7680  N  NE    . ARG A  1  999  ? 245.267 326.029 220.602 1.00 0.00 ? 999  ARG A NE    1 
ATOM   7681  C  CZ    . ARG A  1  999  ? 244.717 327.107 220.060 1.00 0.00 ? 999  ARG A CZ    1 
ATOM   7682  N  NH1   . ARG A  1  999  ? 245.381 328.254 220.033 1.00 0.00 ? 999  ARG A NH1   1 
ATOM   7683  N  NH2   . ARG A  1  999  ? 243.497 327.042 219.551 1.00 0.00 ? 999  ARG A NH2   1 
ATOM   7684  N  N     . LEU A  1  1000 ? 245.000 328.956 226.412 1.00 0.00 ? 1000 LEU A N     1 
ATOM   7685  C  CA    . LEU A  1  1000 ? 244.533 330.239 226.936 1.00 0.00 ? 1000 LEU A CA    1 
ATOM   7686  C  C     . LEU A  1  1000 ? 245.281 330.623 228.211 1.00 0.00 ? 1000 LEU A C     1 
ATOM   7687  O  O     . LEU A  1  1000 ? 245.922 329.775 228.833 1.00 0.00 ? 1000 LEU A O     1 
ATOM   7688  C  CB    . LEU A  1  1000 ? 243.024 330.201 227.200 1.00 0.00 ? 1000 LEU A CB    1 
ATOM   7689  C  CG    . LEU A  1  1000 ? 242.101 330.400 225.997 1.00 0.00 ? 1000 LEU A CG    1 
ATOM   7690  C  CD1   . LEU A  1  1000 ? 240.643 330.365 226.437 1.00 0.00 ? 1000 LEU A CD1   1 
ATOM   7691  C  CD2   . LEU A  1  1000 ? 242.424 331.711 225.286 1.00 0.00 ? 1000 LEU A CD2   1 
ATOM   7692  N  N     . PRO A  1  1001 ? 245.196 331.905 228.612 1.00 0.00 ? 1001 PRO A N     1 
ATOM   7693  C  CA    . PRO A  1  1001 ? 245.840 332.295 229.871 1.00 0.00 ? 1001 PRO A CA    1 
ATOM   7694  C  C     . PRO A  1  1001 ? 245.020 331.903 231.095 1.00 0.00 ? 1001 PRO A C     1 
ATOM   7695  O  O     . PRO A  1  1001 ? 243.807 332.110 231.123 1.00 0.00 ? 1001 PRO A O     1 
ATOM   7696  C  CB    . PRO A  1  1001 ? 245.945 333.816 229.745 1.00 0.00 ? 1001 PRO A CB    1 
ATOM   7697  C  CG    . PRO A  1  1001 ? 244.776 334.189 228.902 1.00 0.00 ? 1001 PRO A CG    1 
ATOM   7698  C  CD    . PRO A  1  1001 ? 244.630 333.070 227.904 1.00 0.00 ? 1001 PRO A CD    1 
ATOM   7699  N  N     . SER A  1  1002 ? 245.683 331.341 232.100 1.00 0.00 ? 1002 SER A N     1 
ATOM   7700  C  CA    . SER A  1  1002 ? 244.994 330.899 233.305 1.00 0.00 ? 1002 SER A CA    1 
ATOM   7701  C  C     . SER A  1  1002 ? 245.123 331.902 234.453 1.00 0.00 ? 1002 SER A C     1 
ATOM   7702  O  O     . SER A  1  1002 ? 245.913 332.849 234.392 1.00 0.00 ? 1002 SER A O     1 
ATOM   7703  C  CB    . SER A  1  1002 ? 245.513 329.522 233.732 1.00 0.00 ? 1002 SER A CB    1 
ATOM   7704  O  OG    . SER A  1  1002 ? 246.787 329.606 234.344 1.00 0.00 ? 1002 SER A OG    1 
ATOM   7705  N  N     . ASP A  1  1003 ? 244.315 331.692 235.488 1.00 0.00 ? 1003 ASP A N     1 
ATOM   7706  C  CA    . ASP A  1  1003 ? 244.322 332.538 236.679 1.00 0.00 ? 1003 ASP A CA    1 
ATOM   7707  C  C     . ASP A  1  1003 ? 245.034 331.869 237.858 1.00 0.00 ? 1003 ASP A C     1 
ATOM   7708  O  O     . ASP A  1  1003 ? 245.040 332.390 238.975 1.00 0.00 ? 1003 ASP A O     1 
ATOM   7709  C  CB    . ASP A  1  1003 ? 242.887 332.918 237.063 1.00 0.00 ? 1003 ASP A CB    1 
ATOM   7710  C  CG    . ASP A  1  1003 ? 241.978 331.710 237.224 1.00 0.00 ? 1003 ASP A CG    1 
ATOM   7711  O  OD1   . ASP A  1  1003 ? 242.477 330.561 237.192 1.00 0.00 ? 1003 ASP A OD1   1 
ATOM   7712  O  OD2   . ASP A  1  1003 ? 240.755 331.915 237.380 1.00 0.00 ? 1003 ASP A OD2   1 
ATOM   7713  N  N     . LEU A  1  1004 ? 245.638 330.712 237.592 1.00 0.00 ? 1004 LEU A N     1 
ATOM   7714  C  CA    . LEU A  1  1004 ? 246.336 329.938 238.610 1.00 0.00 ? 1004 LEU A CA    1 
ATOM   7715  C  C     . LEU A  1  1004 ? 247.566 330.672 239.152 1.00 0.00 ? 1004 LEU A C     1 
ATOM   7716  O  O     . LEU A  1  1004 ? 248.282 331.345 238.409 1.00 0.00 ? 1004 LEU A O     1 
ATOM   7717  C  CB    . LEU A  1  1004 ? 246.748 328.581 238.034 1.00 0.00 ? 1004 LEU A CB    1 
ATOM   7718  C  CG    . LEU A  1  1004 ? 247.500 327.630 238.960 1.00 0.00 ? 1004 LEU A CG    1 
ATOM   7719  C  CD1   . LEU A  1  1004 ? 246.709 327.408 240.235 1.00 0.00 ? 1004 LEU A CD1   1 
ATOM   7720  C  CD2   . LEU A  1  1004 ? 247.780 326.312 238.255 1.00 0.00 ? 1004 LEU A CD2   1 
ATOM   7721  N  N     . HIS A  1  1005 ? 247.800 330.546 240.455 1.00 0.00 ? 1005 HIS A N     1 
ATOM   7722  C  CA    . HIS A  1  1005 ? 248.969 331.149 241.088 1.00 0.00 ? 1005 HIS A CA    1 
ATOM   7723  C  C     . HIS A  1  1005 ? 249.965 330.063 241.484 1.00 0.00 ? 1005 HIS A C     1 
ATOM   7724  O  O     . HIS A  1  1005 ? 249.589 329.065 242.104 1.00 0.00 ? 1005 HIS A O     1 
ATOM   7725  C  CB    . HIS A  1  1005 ? 248.558 331.970 242.310 1.00 0.00 ? 1005 HIS A CB    1 
ATOM   7726  C  CG    . HIS A  1  1005 ? 249.599 332.945 242.756 1.00 0.00 ? 1005 HIS A CG    1 
ATOM   7727  N  ND1   . HIS A  1  1005 ? 250.763 332.557 243.384 1.00 0.00 ? 1005 HIS A ND1   1 
ATOM   7728  C  CD2   . HIS A  1  1005 ? 249.653 334.295 242.660 1.00 0.00 ? 1005 HIS A CD2   1 
ATOM   7729  C  CE1   . HIS A  1  1005 ? 251.488 333.626 243.658 1.00 0.00 ? 1005 HIS A CE1   1 
ATOM   7730  N  NE2   . HIS A  1  1005 ? 250.837 334.693 243.229 1.00 0.00 ? 1005 HIS A NE2   1 
ATOM   7731  N  N     . PRO A  1  1006 ? 251.240 330.248 241.113 1.00 0.00 ? 1006 PRO A N     1 
ATOM   7732  C  CA    . PRO A  1  1006 ? 252.248 329.206 241.349 1.00 0.00 ? 1006 PRO A CA    1 
ATOM   7733  C  C     . PRO A  1  1006 ? 252.575 328.957 242.827 1.00 0.00 ? 1006 PRO A C     1 
ATOM   7734  O  O     . PRO A  1  1006 ? 252.793 327.807 243.212 1.00 0.00 ? 1006 PRO A O     1 
ATOM   7735  C  CB    . PRO A  1  1006 ? 253.488 329.745 240.618 1.00 0.00 ? 1006 PRO A CB    1 
ATOM   7736  C  CG    . PRO A  1  1006 ? 253.255 331.222 240.494 1.00 0.00 ? 1006 PRO A CG    1 
ATOM   7737  C  CD    . PRO A  1  1006 ? 251.777 331.386 240.352 1.00 0.00 ? 1006 PRO A CD    1 
ATOM   7738  N  N     . ILE A  1  1007 ? 252.609 330.012 243.638 1.00 0.00 ? 1007 ILE A N     1 
ATOM   7739  C  CA    . ILE A  1  1007 ? 252.835 329.869 245.077 1.00 0.00 ? 1007 ILE A CA    1 
ATOM   7740  C  C     . ILE A  1  1007 ? 251.730 329.061 245.759 1.00 0.00 ? 1007 ILE A C     1 
ATOM   7741  O  O     . ILE A  1  1007 ? 251.981 328.309 246.704 1.00 0.00 ? 1007 ILE A O     1 
ATOM   7742  C  CB    . ILE A  1  1007 ? 252.941 331.258 245.765 1.00 0.00 ? 1007 ILE A CB    1 
ATOM   7743  C  CG1   . ILE A  1  1007 ? 254.106 332.066 245.189 1.00 0.00 ? 1007 ILE A CG1   1 
ATOM   7744  C  CG2   . ILE A  1  1007 ? 253.119 331.112 247.270 1.00 0.00 ? 1007 ILE A CG2   1 
ATOM   7745  C  CD1   . ILE A  1  1007 ? 255.435 331.355 245.269 1.00 0.00 ? 1007 ILE A CD1   1 
ATOM   7746  N  N     . LYS A  1  1008 ? 250.512 329.203 245.246 1.00 0.00 ? 1008 LYS A N     1 
ATOM   7747  C  CA    . LYS A  1  1008 ? 249.368 328.398 245.666 1.00 0.00 ? 1008 LYS A CA    1 
ATOM   7748  C  C     . LYS A  1  1008 ? 249.623 326.914 245.425 1.00 0.00 ? 1008 LYS A C     1 
ATOM   7749  O  O     . LYS A  1  1008 ? 249.312 326.075 246.268 1.00 0.00 ? 1008 LYS A O     1 
ATOM   7750  C  CB    . LYS A  1  1008 ? 248.083 328.854 244.974 1.00 0.00 ? 1008 LYS A CB    1 
ATOM   7751  C  CG    . LYS A  1  1008 ? 246.833 328.303 245.645 1.00 0.00 ? 1008 LYS A CG    1 
ATOM   7752  C  CD    . LYS A  1  1008 ? 245.559 328.730 244.945 1.00 0.00 ? 1008 LYS A CD    1 
ATOM   7753  C  CE    . LYS A  1  1008 ? 244.346 328.080 245.601 1.00 0.00 ? 1008 LYS A CE    1 
ATOM   7754  N  NZ    . LYS A  1  1008 ? 243.907 328.819 246.821 1.00 0.00 ? 1008 LYS A NZ    1 
ATOM   7755  N  N     . VAL A  1  1009 ? 250.192 326.607 244.265 1.00 0.00 ? 1009 VAL A N     1 
ATOM   7756  C  CA    . VAL A  1  1009 ? 250.596 325.244 243.936 1.00 0.00 ? 1009 VAL A CA    1 
ATOM   7757  C  C     . VAL A  1  1009 ? 251.680 324.744 244.876 1.00 0.00 ? 1009 VAL A C     1 
ATOM   7758  O  O     . VAL A  1  1009 ? 251.570 323.655 245.432 1.00 0.00 ? 1009 VAL A O     1 
ATOM   7759  C  CB    . VAL A  1  1009 ? 251.129 325.153 242.495 1.00 0.00 ? 1009 VAL A CB    1 
ATOM   7760  C  CG1   . VAL A  1  1009 ? 251.568 323.734 242.173 1.00 0.00 ? 1009 VAL A CG1   1 
ATOM   7761  C  CG2   . VAL A  1  1009 ? 250.082 325.641 241.510 1.00 0.00 ? 1009 VAL A CG2   1 
ATOM   7762  N  N     . VAL A  1  1010 ? 252.718 325.551 245.049 1.00 0.00 ? 1010 VAL A N     1 
ATOM   7763  C  CA    . VAL A  1  1010 ? 253.879 325.192 245.859 1.00 0.00 ? 1010 VAL A CA    1 
ATOM   7764  C  C     . VAL A  1  1010 ? 253.485 324.923 247.312 1.00 0.00 ? 1010 VAL A C     1 
ATOM   7765  O  O     . VAL A  1  1010 ? 253.819 323.882 247.876 1.00 0.00 ? 1010 VAL A O     1 
ATOM   7766  C  CB    . VAL A  1  1010 ? 254.948 326.285 245.824 1.00 0.00 ? 1010 VAL A CB    1 
ATOM   7767  C  CG1   . VAL A  1  1010 ? 256.055 325.958 246.813 1.00 0.00 ? 1010 VAL A CG1   1 
ATOM   7768  C  CG2   . VAL A  1  1010 ? 255.517 326.404 244.427 1.00 0.00 ? 1010 VAL A CG2   1 
ATOM   7769  N  N     . GLU A  1  1011 ? 252.775 325.876 247.908 1.00 0.00 ? 1011 GLU A N     1 
ATOM   7770  C  CA    . GLU A  1  1011 ? 252.286 325.750 249.278 1.00 0.00 ? 1011 GLU A CA    1 
ATOM   7771  C  C     . GLU A  1  1011 ? 251.205 324.677 249.366 1.00 0.00 ? 1011 GLU A C     1 
ATOM   7772  O  O     . GLU A  1  1011 ? 251.120 323.946 250.356 1.00 0.00 ? 1011 GLU A O     1 
ATOM   7773  C  CB    . GLU A  1  1011 ? 251.737 327.097 249.769 1.00 0.00 ? 1011 GLU A CB    1 
ATOM   7774  C  CG    . GLU A  1  1011 ? 251.201 327.097 251.202 1.00 0.00 ? 1011 GLU A CG    1 
ATOM   7775  C  CD    . GLU A  1  1011 ? 252.292 327.277 252.252 1.00 0.00 ? 1011 GLU A CD    1 
ATOM   7776  O  OE1   . GLU A  1  1011 ? 253.435 327.637 251.884 1.00 0.00 ? 1011 GLU A OE1   1 
ATOM   7777  O  OE2   . GLU A  1  1011 ? 252.002 327.060 253.450 1.00 0.00 ? 1011 GLU A OE2   1 
ATOM   7778  N  N     . GLY A  1  1012 ? 250.385 324.589 248.327 1.00 0.00 ? 1012 GLY A N     1 
ATOM   7779  C  CA    . GLY A  1  1012 ? 249.377 323.552 248.238 1.00 0.00 ? 1012 GLY A CA    1 
ATOM   7780  C  C     . GLY A  1  1012 ? 249.988 322.158 248.227 1.00 0.00 ? 1012 GLY A C     1 
ATOM   7781  O  O     . GLY A  1  1012 ? 249.463 321.248 248.868 1.00 0.00 ? 1012 GLY A O     1 
ATOM   7782  N  N     . VAL A  1  1013 ? 251.104 321.993 247.519 1.00 0.00 ? 1013 VAL A N     1 
ATOM   7783  C  CA    . VAL A  1  1013 ? 251.846 320.729 247.521 1.00 0.00 ? 1013 VAL A CA    1 
ATOM   7784  C  C     . VAL A  1  1013 ? 252.515 320.437 248.874 1.00 0.00 ? 1013 VAL A C     1 
ATOM   7785  O  O     . VAL A  1  1013 ? 252.519 319.293 249.323 1.00 0.00 ? 1013 VAL A O     1 
ATOM   7786  C  CB    . VAL A  1  1013 ? 252.911 320.711 246.398 1.00 0.00 ? 1013 VAL A CB    1 
ATOM   7787  C  CG1   . VAL A  1  1013 ? 253.894 319.581 246.603 1.00 0.00 ? 1013 VAL A CG1   1 
ATOM   7788  C  CG2   . VAL A  1  1013 ? 252.242 320.577 245.042 1.00 0.00 ? 1013 VAL A CG2   1 
ATOM   7789  N  N     . LYS A  1  1014 ? 253.021 321.466 249.548 1.00 0.00 ? 1014 LYS A N     1 
ATOM   7790  C  CA    . LYS A  1  1014 ? 253.515 321.297 250.915 1.00 0.00 ? 1014 LYS A CA    1 
ATOM   7791  C  C     . LYS A  1  1014 ? 252.366 320.893 251.812 1.00 0.00 ? 1014 LYS A C     1 
ATOM   7792  O  O     . LYS A  1  1014 ? 252.492 319.968 252.612 1.00 0.00 ? 1014 LYS A O     1 
ATOM   7793  C  CB    . LYS A  1  1014 ? 254.208 322.545 251.450 1.00 0.00 ? 1014 LYS A CB    1 
ATOM   7794  C  CG    . LYS A  1  1014 ? 255.542 322.804 250.788 1.00 0.00 ? 1014 LYS A CG    1 
ATOM   7795  C  CD    . LYS A  1  1014 ? 256.114 324.154 251.167 1.00 0.00 ? 1014 LYS A CD    1 
ATOM   7796  C  CE    . LYS A  1  1014 ? 257.284 324.510 250.270 1.00 0.00 ? 1014 LYS A CE    1 
ATOM   7797  N  NZ    . LYS A  1  1014 ? 257.731 325.906 250.493 1.00 0.00 ? 1014 LYS A NZ    1 
ATOM   7798  N  N     . GLU A  1  1015 ? 251.245 321.583 251.670 1.00 0.00 ? 1015 GLU A N     1 
ATOM   7799  C  CA    . GLU A  1  1015 ? 250.077 321.304 252.487 1.00 0.00 ? 1015 GLU A CA    1 
ATOM   7800  C  C     . GLU A  1  1015 ? 249.563 319.902 252.212 1.00 0.00 ? 1015 GLU A C     1 
ATOM   7801  O  O     . GLU A  1  1015 ? 249.222 319.161 253.133 1.00 0.00 ? 1015 GLU A O     1 
ATOM   7802  C  CB    . GLU A  1  1015 ? 248.945 322.294 252.210 1.00 0.00 ? 1015 GLU A CB    1 
ATOM   7803  C  CG    . GLU A  1  1015 ? 247.844 322.223 253.256 1.00 0.00 ? 1015 GLU A CG    1 
ATOM   7804  C  CD    . GLU A  1  1015 ? 247.409 323.581 253.748 1.00 0.00 ? 1015 GLU A CD    1 
ATOM   7805  O  OE1   . GLU A  1  1015 ? 248.001 324.594 253.308 1.00 0.00 ? 1015 GLU A OE1   1 
ATOM   7806  O  OE2   . GLU A  1  1015 ? 246.487 323.629 254.593 1.00 0.00 ? 1015 GLU A OE2   1 
ATOM   7807  N  N     . LEU A  1  1016 ? 249.532 319.529 250.943 1.00 0.00 ? 1016 LEU A N     1 
ATOM   7808  C  CA    . LEU A  1  1016 ? 249.092 318.201 250.583 1.00 0.00 ? 1016 LEU A CA    1 
ATOM   7809  C  C     . LEU A  1  1016 ? 250.013 317.093 251.086 1.00 0.00 ? 1016 LEU A C     1 
ATOM   7810  O  O     . LEU A  1  1016 ? 249.527 316.048 251.491 1.00 0.00 ? 1016 LEU A O     1 
ATOM   7811  C  CB    . LEU A  1  1016 ? 248.959 318.126 249.065 1.00 0.00 ? 1016 LEU A CB    1 
ATOM   7812  C  CG    . LEU A  1  1016 ? 248.543 316.794 248.480 1.00 0.00 ? 1016 LEU A CG    1 
ATOM   7813  C  CD1   . LEU A  1  1016 ? 247.172 316.464 249.021 1.00 0.00 ? 1016 LEU A CD1   1 
ATOM   7814  C  CD2   . LEU A  1  1016 ? 248.521 316.878 246.966 1.00 0.00 ? 1016 LEU A CD2   1 
ATOM   7815  N  N     . SER A  1  1017 ? 251.322 317.313 251.110 1.00 0.00 ? 1017 SER A N     1 
ATOM   7816  C  CA    . SER A  1  1017 ? 252.231 316.332 251.721 1.00 0.00 ? 1017 SER A CA    1 
ATOM   7817  C  C     . SER A  1  1017 ? 251.993 316.077 253.208 1.00 0.00 ? 1017 SER A C     1 
ATOM   7818  O  O     . SER A  1  1017 ? 252.055 314.936 253.668 1.00 0.00 ? 1017 SER A O     1 
ATOM   7819  C  CB    . SER A  1  1017 ? 253.689 316.748 251.529 1.00 0.00 ? 1017 SER A CB    1 
ATOM   7820  O  OG    . SER A  1  1017 ? 254.006 316.864 250.159 1.00 0.00 ? 1017 SER A OG    1 
ATOM   7821  N  N     . LYS A  1  1018 ? 251.717 317.145 253.948 1.00 0.00 ? 1018 LYS A N     1 
ATOM   7822  C  CA    . LYS A  1  1018 ? 251.369 317.038 255.360 1.00 0.00 ? 1018 LYS A CA    1 
ATOM   7823  C  C     . LYS A  1  1018 ? 250.070 316.256 255.527 1.00 0.00 ? 1018 LYS A C     1 
ATOM   7824  O  O     . LYS A  1  1018 ? 249.913 315.484 256.467 1.00 0.00 ? 1018 LYS A O     1 
ATOM   7825  C  CB    . LYS A  1  1018 ? 251.233 318.443 255.955 1.00 0.00 ? 1018 LYS A CB    1 
ATOM   7826  C  CG    . LYS A  1  1018 ? 252.546 319.211 255.994 1.00 0.00 ? 1018 LYS A CG    1 
ATOM   7827  C  CD    . LYS A  1  1018 ? 252.334 320.679 256.337 1.00 0.00 ? 1018 LYS A CD    1 
ATOM   7828  C  CE    . LYS A  1  1018 ? 253.651 321.454 256.286 1.00 0.00 ? 1018 LYS A CE    1 
ATOM   7829  N  NZ    . LYS A  1  1018 ? 253.462 322.917 256.516 1.00 0.00 ? 1018 LYS A NZ    1 
ATOM   7830  N  N     . LYS A  1  1019 ? 249.140 316.469 254.608 1.00 0.00 ? 1019 LYS A N     1 
ATOM   7831  C  CA    . LYS A  1  1019 ? 247.841 315.819 254.668 1.00 0.00 ? 1019 LYS A CA    1 
ATOM   7832  C  C     . LYS A  1  1019 ? 247.937 314.314 254.413 1.00 0.00 ? 1019 LYS A C     1 
ATOM   7833  O  O     . LYS A  1  1019 ? 247.099 313.550 254.889 1.00 0.00 ? 1019 LYS A O     1 
ATOM   7834  C  CB    . LYS A  1  1019 ? 246.892 316.468 253.665 1.00 0.00 ? 1019 LYS A CB    1 
ATOM   7835  C  CG    . LYS A  1  1019 ? 246.370 317.811 254.143 1.00 0.00 ? 1019 LYS A CG    1 
ATOM   7836  C  CD    . LYS A  1  1019 ? 245.575 318.546 253.074 1.00 0.00 ? 1019 LYS A CD    1 
ATOM   7837  C  CE    . LYS A  1  1019 ? 244.589 319.520 253.706 1.00 0.00 ? 1019 LYS A CE    1 
ATOM   7838  N  NZ    . LYS A  1  1019 ? 243.520 319.930 252.756 1.00 0.00 ? 1019 LYS A NZ    1 
ATOM   7839  N  N     . LEU A  1  1020 ? 248.946 313.895 253.650 1.00 0.00 ? 1020 LEU A N     1 
ATOM   7840  C  CA    . LEU A  1  1020 ? 249.074 312.498 253.228 1.00 0.00 ? 1020 LEU A CA    1 
ATOM   7841  C  C     . LEU A  1  1020 ? 249.720 311.579 254.251 1.00 0.00 ? 1020 LEU A C     1 
ATOM   7842  O  O     . LEU A  1  1020 ? 250.397 310.630 253.866 1.00 0.00 ? 1020 LEU A O     1 
ATOM   7843  C  CB    . LEU A  1  1020 ? 249.865 312.399 251.916 1.00 0.00 ? 1020 LEU A CB    1 
ATOM   7844  C  CG    . LEU A  1  1020 ? 249.267 312.905 250.600 1.00 0.00 ? 1020 LEU A CG    1 
ATOM   7845  C  CD1   . LEU A  1  1020 ? 250.134 312.499 249.422 1.00 0.00 ? 1020 LEU A CD1   1 
ATOM   7846  C  CD2   . LEU A  1  1020 ? 247.850 312.402 250.399 1.00 0.00 ? 1020 LEU A CD2   1 
ATOM   7847  N  N     . VAL A  1  1021 ? 249.524 311.836 255.541 1.00 0.00 ? 1021 VAL A N     1 
ATOM   7848  C  CA    . VAL A  1  1021 ? 250.159 311.001 256.570 1.00 0.00 ? 1021 VAL A CA    1 
ATOM   7849  C  C     . VAL A  1  1021 ? 249.614 309.574 256.625 1.00 0.00 ? 1021 VAL A C     1 
ATOM   7850  O  O     . VAL A  1  1021 ? 248.392 309.370 256.691 1.00 0.00 ? 1021 VAL A O     1 
ATOM   7851  C  CB    . VAL A  1  1021 ? 250.030 311.606 257.983 1.00 0.00 ? 1021 VAL A CB    1 
ATOM   7852  C  CG1   . VAL A  1  1021 ? 251.006 312.759 258.160 1.00 0.00 ? 1021 VAL A CG1   1 
ATOM   7853  C  CG2   . VAL A  1  1021 ? 248.592 312.032 258.272 1.00 0.00 ? 1021 VAL A CG2   1 
ATOM   7854  N  N     . ILE A  1  1022 ? 250.529 308.596 256.612 1.00 0.00 ? 1022 ILE A N     1 
ATOM   7855  C  CA    . ILE A  1  1022 ? 250.148 307.182 256.669 1.00 0.00 ? 1022 ILE A CA    1 
ATOM   7856  C  C     . ILE A  1  1022 ? 250.239 306.598 258.073 1.00 0.00 ? 1022 ILE A C     1 
ATOM   7857  O  O     . ILE A  1  1022 ? 249.507 305.659 258.396 1.00 0.00 ? 1022 ILE A O     1 
ATOM   7858  C  CB    . ILE A  1  1022 ? 251.011 306.301 255.737 1.00 0.00 ? 1022 ILE A CB    1 
ATOM   7859  C  CG1   . ILE A  1  1022 ? 252.393 306.046 256.329 1.00 0.00 ? 1022 ILE A CG1   1 
ATOM   7860  C  CG2   . ILE A  1  1022 ? 251.070 306.899 254.334 1.00 0.00 ? 1022 ILE A CG2   1 
ATOM   7861  C  CD1   . ILE A  1  1022 ? 253.196 305.054 255.542 1.00 0.00 ? 1022 ILE A CD1   1 
ATOM   7862  N  N     . VAL A  1  1023 ? 251.137 307.140 258.898 1.00 0.00 ? 1023 VAL A N     1 
ATOM   7863  C  CA    . VAL A  1  1023 ? 251.154 306.841 260.334 1.00 0.00 ? 1023 VAL A CA    1 
ATOM   7864  C  C     . VAL A  1  1023 ? 251.517 308.101 261.117 1.00 0.00 ? 1023 VAL A C     1 
ATOM   7865  O  O     . VAL A  1  1023 ? 252.408 308.853 260.713 1.00 0.00 ? 1023 VAL A O     1 
ATOM   7866  C  CB    . VAL A  1  1023 ? 252.134 305.690 260.690 1.00 0.00 ? 1023 VAL A CB    1 
ATOM   7867  C  CG1   . VAL A  1  1023 ? 252.308 305.554 262.206 1.00 0.00 ? 1023 VAL A CG1   1 
ATOM   7868  C  CG2   . VAL A  1  1023 ? 251.699 304.355 260.057 1.00 0.00 ? 1023 VAL A CG2   1 
ATOM   7869  N  N     . ASN A  1  1024 ? 250.820 308.321 262.232 1.00 0.00 ? 1024 ASN A N     1 
ATOM   7870  C  CA    . ASN A  1  1024 ? 251.001 309.525 263.027 1.00 0.00 ? 1024 ASN A CA    1 
ATOM   7871  C  C     . ASN A  1  1024 ? 252.462 309.744 263.400 1.00 0.00 ? 1024 ASN A C     1 
ATOM   7872  O  O     . ASN A  1  1024 ? 253.207 308.789 263.644 1.00 0.00 ? 1024 ASN A O     1 
ATOM   7873  C  CB    . ASN A  1  1024 ? 250.142 309.462 264.290 1.00 0.00 ? 1024 ASN A CB    1 
ATOM   7874  C  CG    . ASN A  1  1024 ? 249.998 310.817 264.969 1.00 0.00 ? 1024 ASN A CG    1 
ATOM   7875  O  OD1   . ASN A  1  1024 ? 250.882 311.678 264.879 1.00 0.00 ? 1024 ASN A OD1   1 
ATOM   7876  N  ND2   . ASN A  1  1024 ? 248.871 311.013 265.654 1.00 0.00 ? 1024 ASN A ND2   1 
ATOM   7877  N  N     . GLY A  1  1025 ? 252.862 311.011 263.440 1.00 0.00 ? 1025 GLY A N     1 
ATOM   7878  C  CA    . GLY A  1  1025 ? 254.222 311.367 263.783 1.00 0.00 ? 1025 GLY A CA    1 
ATOM   7879  C  C     . GLY A  1  1025 ? 254.376 312.754 264.369 1.00 0.00 ? 1025 GLY A C     1 
ATOM   7880  O  O     . GLY A  1  1025 ? 254.685 313.708 263.653 1.00 0.00 ? 1025 GLY A O     1 
ATOM   7881  N  N     . ASP A  1  1026 ? 254.156 312.870 265.675 1.00 0.00 ? 1026 ASP A N     1 
ATOM   7882  C  CA    . ASP A  1  1026 ? 254.417 314.118 266.388 1.00 0.00 ? 1026 ASP A CA    1 
ATOM   7883  C  C     . ASP A  1  1026 ? 255.763 313.965 267.102 1.00 0.00 ? 1026 ASP A C     1 
ATOM   7884  O  O     . ASP A  1  1026 ? 256.248 314.863 267.792 1.00 0.00 ? 1026 ASP A O     1 
ATOM   7885  C  CB    . ASP A  1  1026 ? 253.284 314.427 267.371 1.00 0.00 ? 1026 ASP A CB    1 
ATOM   7886  C  CG    . ASP A  1  1026 ? 253.444 315.779 268.045 1.00 0.00 ? 1026 ASP A CG    1 
ATOM   7887  O  OD1   . ASP A  1  1026 ? 254.123 316.656 267.466 1.00 0.00 ? 1026 ASP A OD1   1 
ATOM   7888  O  OD2   . ASP A  1  1026 ? 252.883 315.966 269.148 1.00 0.00 ? 1026 ASP A OD2   1 
ATOM   7889  N  N     . ASP A  1  1027 ? 256.352 312.794 266.904 1.00 0.00 ? 1027 ASP A N     1 
ATOM   7890  C  CA    . ASP A  1  1027 ? 257.612 312.403 267.516 1.00 0.00 ? 1027 ASP A CA    1 
ATOM   7891  C  C     . ASP A  1  1027 ? 258.739 312.442 266.462 1.00 0.00 ? 1027 ASP A C     1 
ATOM   7892  O  O     . ASP A  1  1027 ? 258.520 312.003 265.331 1.00 0.00 ? 1027 ASP A O     1 
ATOM   7893  C  CB    . ASP A  1  1027 ? 257.426 311.004 268.110 1.00 0.00 ? 1027 ASP A CB    1 
ATOM   7894  C  CG    . ASP A  1  1027 ? 258.482 310.645 269.103 1.00 0.00 ? 1027 ASP A CG    1 
ATOM   7895  O  OD1   . ASP A  1  1027 ? 259.665 310.654 268.724 1.00 0.00 ? 1027 ASP A OD1   1 
ATOM   7896  O  OD2   . ASP A  1  1027 ? 258.124 310.348 270.263 1.00 0.00 ? 1027 ASP A OD2   1 
ATOM   7897  N  N     . PRO A  1  1028 ? 259.947 312.945 266.823 1.00 0.00 ? 1028 PRO A N     1 
ATOM   7898  C  CA    . PRO A  1  1028 ? 261.011 313.054 265.808 1.00 0.00 ? 1028 PRO A CA    1 
ATOM   7899  C  C     . PRO A  1  1028 ? 261.367 311.735 265.120 1.00 0.00 ? 1028 PRO A C     1 
ATOM   7900  O  O     . PRO A  1  1028 ? 261.710 311.768 263.935 1.00 0.00 ? 1028 PRO A O     1 
ATOM   7901  C  CB    . PRO A  1  1028 ? 262.211 313.589 266.605 1.00 0.00 ? 1028 PRO A CB    1 
ATOM   7902  C  CG    . PRO A  1  1028 ? 261.603 314.309 267.745 1.00 0.00 ? 1028 PRO A CG    1 
ATOM   7903  C  CD    . PRO A  1  1028 ? 260.364 313.531 268.108 1.00 0.00 ? 1028 PRO A CD    1 
ATOM   7904  N  N     . LEU A  1  1029 ? 261.330 310.615 265.840 1.00 0.00 ? 1029 LEU A N     1 
ATOM   7905  C  CA    . LEU A  1  1029 ? 261.589 309.318 265.220 1.00 0.00 ? 1029 LEU A CA    1 
ATOM   7906  C  C     . LEU A  1  1029 ? 260.446 308.965 264.264 1.00 0.00 ? 1029 LEU A C     1 
ATOM   7907  O  O     . LEU A  1  1029 ? 260.655 308.585 263.109 1.00 0.00 ? 1029 LEU A O     1 
ATOM   7908  C  CB    . LEU A  1  1029 ? 261.751 308.228 266.273 1.00 0.00 ? 1029 LEU A CB    1 
ATOM   7909  C  CG    . LEU A  1  1029 ? 262.083 306.838 265.743 1.00 0.00 ? 1029 LEU A CG    1 
ATOM   7910  C  CD1   . LEU A  1  1029 ? 263.421 306.872 265.020 1.00 0.00 ? 1029 LEU A CD1   1 
ATOM   7911  C  CD2   . LEU A  1  1029 ? 262.103 305.832 266.873 1.00 0.00 ? 1029 LEU A CD2   1 
ATOM   7912  N  N     . SER A  1  1030 ? 259.227 309.112 264.771 1.00 0.00 ? 1030 SER A N     1 
ATOM   7913  C  CA    . SER A  1  1030 ? 258.017 308.939 263.982 1.00 0.00 ? 1030 SER A CA    1 
ATOM   7914  C  C     . SER A  1  1030 ? 257.929 309.922 262.825 1.00 0.00 ? 1030 SER A C     1 
ATOM   7915  O  O     . SER A  1  1030 ? 257.485 309.573 261.742 1.00 0.00 ? 1030 SER A O     1 
ATOM   7916  C  CB    . SER A  1  1030 ? 256.772 309.078 264.863 1.00 0.00 ? 1030 SER A CB    1 
ATOM   7917  O  OG    . SER A  1  1030 ? 256.863 308.259 266.012 1.00 0.00 ? 1030 SER A OG    1 
ATOM   7918  N  N     . ARG A  1  1031 ? 258.377 311.147 263.046 1.00 0.00 ? 1031 ARG A N     1 
ATOM   7919  C  CA    . ARG A  1  1031 ? 258.403 312.141 261.987 1.00 0.00 ? 1031 ARG A CA    1 
ATOM   7920  C  C     . ARG A  1  1031 ? 259.344 311.730 260.869 1.00 0.00 ? 1031 ARG A C     1 
ATOM   7921  O  O     . ARG A  1  1031 ? 259.002 311.849 259.697 1.00 0.00 ? 1031 ARG A O     1 
ATOM   7922  C  CB    . ARG A  1  1031 ? 258.819 313.493 262.558 1.00 0.00 ? 1031 ARG A CB    1 
ATOM   7923  C  CG    . ARG A  1  1031 ? 258.831 314.632 261.570 1.00 0.00 ? 1031 ARG A CG    1 
ATOM   7924  C  CD    . ARG A  1  1031 ? 258.603 315.958 262.294 1.00 0.00 ? 1031 ARG A CD    1 
ATOM   7925  N  NE    . ARG A  1  1031 ? 259.602 316.185 263.339 1.00 0.00 ? 1031 ARG A NE    1 
ATOM   7926  C  CZ    . ARG A  1  1031 ? 259.387 316.151 264.656 1.00 0.00 ? 1031 ARG A CZ    1 
ATOM   7927  N  NH1   . ARG A  1  1031 ? 258.191 315.825 265.136 1.00 0.00 ? 1031 ARG A NH1   1 
ATOM   7928  N  NH2   . ARG A  1  1031 ? 260.318 316.599 265.486 1.00 0.00 ? 1031 ARG A NH2   1 
ATOM   7929  N  N     . GLN A  1  1032 ? 260.521 311.236 261.232 1.00 0.00 ? 1032 GLN A N     1 
ATOM   7930  C  CA    . GLN A  1  1032 ? 261.442 310.663 260.257 1.00 0.00 ? 1032 GLN A CA    1 
ATOM   7931  C  C     . GLN A  1  1032 ? 260.920 309.409 259.552 1.00 0.00 ? 1032 GLN A C     1 
ATOM   7932  O  O     . GLN A  1  1032 ? 261.126 309.240 258.349 1.00 0.00 ? 1032 GLN A O     1 
ATOM   7933  C  CB    . GLN A  1  1032 ? 262.770 310.335 260.903 1.00 0.00 ? 1032 GLN A CB    1 
ATOM   7934  C  CG    . GLN A  1  1032 ? 263.785 309.939 259.880 1.00 0.00 ? 1032 GLN A CG    1 
ATOM   7935  C  CD    . GLN A  1  1032 ? 265.044 309.461 260.511 1.00 0.00 ? 1032 GLN A CD    1 
ATOM   7936  O  OE1   . GLN A  1  1032 ? 265.832 310.258 261.028 1.00 0.00 ? 1032 GLN A OE1   1 
ATOM   7937  N  NE2   . GLN A  1  1032 ? 265.270 308.152 260.460 1.00 0.00 ? 1032 GLN A NE2   1 
ATOM   7938  N  N     . ALA A  1  1033 ? 260.261 308.527 260.298 1.00 0.00 ? 1033 ALA A N     1 
ATOM   7939  C  CA    . ALA A  1  1033 ? 259.670 307.320 259.705 1.00 0.00 ? 1033 ALA A CA    1 
ATOM   7940  C  C     . ALA A  1  1033 ? 258.613 307.700 258.673 1.00 0.00 ? 1033 ALA A C     1 
ATOM   7941  O  O     . ALA A  1  1033 ? 258.484 307.053 257.640 1.00 0.00 ? 1033 ALA A O     1 
ATOM   7942  C  CB    . ALA A  1  1033 ? 259.068 306.440 260.778 1.00 0.00 ? 1033 ALA A CB    1 
ATOM   7943  N  N     . GLN A  1  1034 ? 257.902 308.789 258.940 1.00 0.00 ? 1034 GLN A N     1 
ATOM   7944  C  CA    . GLN A  1  1034 ? 256.972 309.329 257.967 1.00 0.00 ? 1034 GLN A CA    1 
ATOM   7945  C  C     . GLN A  1  1034 ? 257.594 309.901 256.727 1.00 0.00 ? 1034 GLN A C     1 
ATOM   7946  O  O     . GLN A  1  1034 ? 257.062 309.715 255.647 1.00 0.00 ? 1034 GLN A O     1 
ATOM   7947  C  CB    . GLN A  1  1034 ? 256.130 310.460 258.593 1.00 0.00 ? 1034 GLN A CB    1 
ATOM   7948  C  CG    . GLN A  1  1034 ? 254.983 310.857 257.685 1.00 0.00 ? 1034 GLN A CG    1 
ATOM   7949  C  CD    . GLN A  1  1034 ? 253.957 309.760 257.482 1.00 0.00 ? 1034 GLN A CD    1 
ATOM   7950  O  OE1   . GLN A  1  1034 ? 254.052 308.665 258.047 1.00 0.00 ? 1034 GLN A OE1   1 
ATOM   7951  N  NE2   . GLN A  1  1034 ? 253.029 310.012 256.578 1.00 0.00 ? 1034 GLN A NE2   1 
ATOM   7952  N  N     . GLU A  1  1035 ? 258.692 310.622 256.881 1.00 0.00 ? 1035 GLU A N     1 
ATOM   7953  C  CA    . GLU A  1  1035 ? 259.350 311.245 255.730 1.00 0.00 ? 1035 GLU A CA    1 
ATOM   7954  C  C     . GLU A  1  1035 ? 259.946 310.343 254.692 1.00 0.00 ? 1035 GLU A C     1 
ATOM   7955  O  O     . GLU A  1  1035 ? 259.766 310.525 253.488 1.00 0.00 ? 1035 GLU A O     1 
ATOM   7956  C  CB    . GLU A  1  1035 ? 260.523 312.026 256.239 1.00 0.00 ? 1035 GLU A CB    1 
ATOM   7957  C  CG    . GLU A  1  1035 ? 261.152 312.961 255.239 1.00 0.00 ? 1035 GLU A CG    1 
ATOM   7958  C  CD    . GLU A  1  1035 ? 262.167 313.905 255.864 1.00 0.00 ? 1035 GLU A CD    1 
ATOM   7959  O  OE1   . GLU A  1  1035 ? 262.425 313.795 257.086 1.00 0.00 ? 1035 GLU A OE1   1 
ATOM   7960  O  OE2   . GLU A  1  1035 ? 262.664 314.793 255.134 1.00 0.00 ? 1035 GLU A OE2   1 
ATOM   7961  N  N     . ASN A  1  1036 ? 260.547 309.250 255.151 1.00 0.00 ? 1036 ASN A N     1 
ATOM   7962  C  CA    . ASN A  1  1036 ? 261.138 308.265 254.243 1.00 0.00 ? 1036 ASN A CA    1 
ATOM   7963  C  C     . ASN A  1  1036 ? 260.135 307.250 253.660 1.00 0.00 ? 1036 ASN A C     1 
ATOM   7964  O  O     . ASN A  1  1036 ? 260.310 306.774 252.538 1.00 0.00 ? 1036 ASN A O     1 
ATOM   7965  C  CB    . ASN A  1  1036 ? 262.287 307.526 254.933 1.00 0.00 ? 1036 ASN A CB    1 
ATOM   7966  C  CG    . ASN A  1  1036 ? 261.807 306.611 256.043 1.00 0.00 ? 1036 ASN A CG    1 
ATOM   7967  O  OD1   . ASN A  1  1036 ? 262.171 306.783 257.206 1.00 0.00 ? 1036 ASN A OD1   1 
ATOM   7968  N  ND2   . ASN A  1  1036 ? 260.985 305.631 255.687 1.00 0.00 ? 1036 ASN A ND2   1 
ATOM   7969  N  N     . ALA A  1  1037 ? 259.093 306.926 254.424 1.00 0.00 ? 1037 ALA A N     1 
ATOM   7970  C  CA    . ALA A  1  1037 ? 258.070 305.968 254.013 1.00 0.00 ? 1037 ALA A CA    1 
ATOM   7971  C  C     . ALA A  1  1037 ? 257.143 306.513 252.950 1.00 0.00 ? 1037 ALA A C     1 
ATOM   7972  O  O     . ALA A  1  1037 ? 256.262 305.817 252.513 1.00 0.00 ? 1037 ALA A O     1 
ATOM   7973  C  CB    . ALA A  1  1037 ? 257.296 305.568 255.211 1.00 0.00 ? 1037 ALA A CB    1 
ATOM   7974  N  N     . THR A  1  1038 ? 257.301 307.770 252.561 1.00 0.00 ? 1038 THR A N     1 
ATOM   7975  C  CA    . THR A  1  1038 ? 256.496 308.293 251.461 1.00 0.00 ? 1038 THR A CA    1 
ATOM   7976  C  C     . THR A  1  1038 ? 257.391 309.080 250.511 1.00 0.00 ? 1038 THR A C     1 
ATOM   7977  O  O     . THR A  1  1038 ? 256.905 309.745 249.603 1.00 0.00 ? 1038 THR A O     1 
ATOM   7978  C  CB    . THR A  1  1038 ? 255.302 309.189 251.929 1.00 0.00 ? 1038 THR A CB    1 
ATOM   7979  O  OG1   . THR A  1  1038 ? 255.792 310.354 252.603 1.00 0.00 ? 1038 THR A OG1   1 
ATOM   7980  C  CG2   . THR A  1  1038 ? 254.339 308.425 252.840 1.00 0.00 ? 1038 THR A CG2   1 
ATOM   7981  N  N     . LEU A  1  1039 ? 258.702 308.984 250.721 1.00 0.00 ? 1039 LEU A N     1 
ATOM   7982  C  CA    . LEU A  1  1039 ? 259.701 309.633 249.863 1.00 0.00 ? 1039 LEU A CA    1 
ATOM   7983  C  C     . LEU A  1  1039 ? 259.521 309.456 248.349 1.00 0.00 ? 1039 LEU A C     1 
ATOM   7984  O  O     . LEU A  1  1039 ? 259.609 310.425 247.603 1.00 0.00 ? 1039 LEU A O     1 
ATOM   7985  C  CB    . LEU A  1  1039 ? 261.082 309.124 250.235 1.00 0.00 ? 1039 LEU A CB    1 
ATOM   7986  C  CG    . LEU A  1  1039 ? 262.234 309.653 249.400 1.00 0.00 ? 1039 LEU A CG    1 
ATOM   7987  C  CD1   . LEU A  1  1039 ? 262.357 311.157 249.502 1.00 0.00 ? 1039 LEU A CD1   1 
ATOM   7988  C  CD2   . LEU A  1  1039 ? 263.498 308.966 249.878 1.00 0.00 ? 1039 LEU A CD2   1 
ATOM   7989  N  N     . LEU A  1  1040 ? 259.376 308.221 247.881 1.00 0.00 ? 1040 LEU A N     1 
ATOM   7990  C  CA    . LEU A  1  1040 ? 259.250 307.986 246.444 1.00 0.00 ? 1040 LEU A CA    1 
ATOM   7991  C  C     . LEU A  1  1040 ? 257.972 308.561 245.866 1.00 0.00 ? 1040 LEU A C     1 
ATOM   7992  O  O     . LEU A  1  1040 ? 257.981 309.129 244.788 1.00 0.00 ? 1040 LEU A O     1 
ATOM   7993  C  CB    . LEU A  1  1040 ? 259.302 306.500 246.119 1.00 0.00 ? 1040 LEU A CB    1 
ATOM   7994  C  CG    . LEU A  1  1040 ? 259.261 306.197 244.622 1.00 0.00 ? 1040 LEU A CG    1 
ATOM   7995  C  CD1   . LEU A  1  1040 ? 260.395 306.857 243.877 1.00 0.00 ? 1040 LEU A CD1   1 
ATOM   7996  C  CD2   . LEU A  1  1040 ? 259.317 304.716 244.428 1.00 0.00 ? 1040 LEU A CD2   1 
ATOM   7997  N  N     . PHE A  1  1041 ? 256.878 308.452 246.604 1.00 0.00 ? 1041 PHE A N     1 
ATOM   7998  C  CA    . PHE A  1  1041 ? 255.663 309.098 246.167 1.00 0.00 ? 1041 PHE A CA    1 
ATOM   7999  C  C     . PHE A  1  1041 ? 255.720 310.596 246.253 1.00 0.00 ? 1041 PHE A C     1 
ATOM   8000  O  O     . PHE A  1  1041 ? 255.171 311.296 245.407 1.00 0.00 ? 1041 PHE A O     1 
ATOM   8001  C  CB    . PHE A  1  1041 ? 254.467 308.611 246.972 1.00 0.00 ? 1041 PHE A CB    1 
ATOM   8002  C  CG    . PHE A  1  1041 ? 253.171 309.191 246.505 1.00 0.00 ? 1041 PHE A CG    1 
ATOM   8003  C  CD1   . PHE A  1  1041 ? 252.623 308.833 245.284 1.00 0.00 ? 1041 PHE A CD1   1 
ATOM   8004  C  CD2   . PHE A  1  1041 ? 252.492 310.105 247.295 1.00 0.00 ? 1041 PHE A CD2   1 
ATOM   8005  C  CE1   . PHE A  1  1041 ? 251.425 309.385 244.852 1.00 0.00 ? 1041 PHE A CE1   1 
ATOM   8006  C  CE2   . PHE A  1  1041 ? 251.304 310.657 246.871 1.00 0.00 ? 1041 PHE A CE2   1 
ATOM   8007  C  CZ    . PHE A  1  1041 ? 250.765 310.293 245.651 1.00 0.00 ? 1041 PHE A CZ    1 
ATOM   8008  N  N     . ASN A  1  1042 ? 256.357 311.091 247.294 1.00 0.00 ? 1042 ASN A N     1 
ATOM   8009  C  CA    . ASN A  1  1042 ? 256.485 312.518 247.486 1.00 0.00 ? 1042 ASN A CA    1 
ATOM   8010  C  C     . ASN A  1  1042 ? 257.333 313.265 246.424 1.00 0.00 ? 1042 ASN A C     1 
ATOM   8011  O  O     . ASN A  1  1042 ? 256.946 314.338 245.973 1.00 0.00 ? 1042 ASN A O     1 
ATOM   8012  C  CB    . ASN A  1  1042 ? 257.039 312.742 248.883 1.00 0.00 ? 1042 ASN A CB    1 
ATOM   8013  C  CG    . ASN A  1  1042 ? 257.030 314.166 249.279 1.00 0.00 ? 1042 ASN A CG    1 
ATOM   8014  O  OD1   . ASN A  1  1042 ? 258.037 314.872 249.171 1.00 0.00 ? 1042 ASN A OD1   1 
ATOM   8015  N  ND2   . ASN A  1  1042 ? 255.879 314.614 249.779 1.00 0.00 ? 1042 ASN A ND2   1 
ATOM   8016  N  N     . ILE A  1  1043 ? 258.461 312.693 245.994 1.00 0.00 ? 1043 ILE A N     1 
ATOM   8017  C  CA    . ILE A  1  1043 ? 259.235 313.267 244.884 1.00 0.00 ? 1043 ILE A CA    1 
ATOM   8018  C  C     . ILE A  1  1043 ? 258.467 313.157 243.579 1.00 0.00 ? 1043 ILE A C     1 
ATOM   8019  O  O     . ILE A  1  1043 ? 258.511 314.053 242.747 1.00 0.00 ? 1043 ILE A O     1 
ATOM   8020  C  CB    . ILE A  1  1043 ? 260.651 312.634 244.690 1.00 0.00 ? 1043 ILE A CB    1 
ATOM   8021  C  CG1   . ILE A  1  1043 ? 260.609 311.250 244.054 1.00 0.00 ? 1043 ILE A CG1   1 
ATOM   8022  C  CG2   . ILE A  1  1043 ? 261.467 312.707 245.984 1.00 0.00 ? 1043 ILE A CG2   1 
ATOM   8023  C  CD1   . ILE A  1  1043 ? 261.976 310.711 243.728 1.00 0.00 ? 1043 ILE A CD1   1 
ATOM   8024  N  N     . HIS A  1  1044 ? 257.757 312.052 243.407 1.00 0.00 ? 1044 HIS A N     1 
ATOM   8025  C  CA    . HIS A  1  1044 ? 256.916 311.853 242.243 1.00 0.00 ? 1044 HIS A CA    1 
ATOM   8026  C  C     . HIS A  1  1044 ? 255.826 312.893 242.191 1.00 0.00 ? 1044 HIS A C     1 
ATOM   8027  O  O     . HIS A  1  1044 ? 255.487 313.386 241.122 1.00 0.00 ? 1044 HIS A O     1 
ATOM   8028  C  CB    . HIS A  1  1044 ? 256.279 310.473 242.229 1.00 0.00 ? 1044 HIS A CB    1 
ATOM   8029  C  CG    . HIS A  1  1044 ? 255.468 310.221 241.001 1.00 0.00 ? 1044 HIS A CG    1 
ATOM   8030  N  ND1   . HIS A  1  1044 ? 255.994 310.324 239.732 1.00 0.00 ? 1044 HIS A ND1   1 
ATOM   8031  C  CD2   . HIS A  1  1044 ? 254.162 309.908 240.842 1.00 0.00 ? 1044 HIS A CD2   1 
ATOM   8032  C  CE1   . HIS A  1  1044 ? 255.054 310.063 238.844 1.00 0.00 ? 1044 HIS A CE1   1 
ATOM   8033  N  NE2   . HIS A  1  1044 ? 253.931 309.810 239.491 1.00 0.00 ? 1044 HIS A NE2   1 
ATOM   8034  N  N     . LEU A  1  1045 ? 255.246 313.185 243.344 1.00 0.00 ? 1045 LEU A N     1 
ATOM   8035  C  CA    . LEU A  1  1045 ? 254.192 314.171 243.421 1.00 0.00 ? 1045 LEU A CA    1 
ATOM   8036  C  C     . LEU A  1  1045 ? 254.694 315.559 243.064 1.00 0.00 ? 1045 LEU A C     1 
ATOM   8037  O  O     . LEU A  1  1045 ? 254.144 316.232 242.193 1.00 0.00 ? 1045 LEU A O     1 
ATOM   8038  C  CB    . LEU A  1  1045 ? 253.624 314.188 244.823 1.00 0.00 ? 1045 LEU A CB    1 
ATOM   8039  C  CG    . LEU A  1  1045 ? 252.453 315.135 244.901 1.00 0.00 ? 1045 LEU A CG    1 
ATOM   8040  C  CD1   . LEU A  1  1045 ? 251.326 314.563 244.082 1.00 0.00 ? 1045 LEU A CD1   1 
ATOM   8041  C  CD2   . LEU A  1  1045 ? 252.059 315.313 246.335 1.00 0.00 ? 1045 LEU A CD2   1 
ATOM   8042  N  N     . ARG A  1  1046 ? 255.758 315.974 243.734 1.00 0.00 ? 1046 ARG A N     1 
ATOM   8043  C  CA    . ARG A  1  1046 ? 256.382 317.273 243.501 1.00 0.00 ? 1046 ARG A CA    1 
ATOM   8044  C  C     . ARG A  1  1046 ? 256.993 317.469 242.124 1.00 0.00 ? 1046 ARG A C     1 
ATOM   8045  O  O     . ARG A  1  1046 ? 256.869 318.551 241.555 1.00 0.00 ? 1046 ARG A O     1 
ATOM   8046  C  CB    . ARG A  1  1046 ? 257.412 317.483 244.607 1.00 0.00 ? 1046 ARG A CB    1 
ATOM   8047  C  CG    . ARG A  1  1046 ? 256.750 317.643 245.973 1.00 0.00 ? 1046 ARG A CG    1 
ATOM   8048  C  CD    . ARG A  1  1046 ? 257.704 318.090 247.052 1.00 0.00 ? 1046 ARG A CD    1 
ATOM   8049  N  NE    . ARG A  1  1046 ? 258.572 316.959 247.357 1.00 0.00 ? 1046 ARG A NE    1 
ATOM   8050  C  CZ    . ARG A  1  1046 ? 259.730 316.675 246.780 1.00 0.00 ? 1046 ARG A CZ    1 
ATOM   8051  N  NH1   . ARG A  1  1046 ? 260.220 317.454 245.833 1.00 0.00 ? 1046 ARG A NH1   1 
ATOM   8052  N  NH2   . ARG A  1  1046 ? 260.361 315.558 247.114 1.00 0.00 ? 1046 ARG A NH2   1 
ATOM   8053  N  N     . SER A  1  1047 ? 257.637 316.444 241.574 1.00 0.00 ? 1047 SER A N     1 
ATOM   8054  C  CA    . SER A  1  1047 ? 258.157 316.552 240.209 1.00 0.00 ? 1047 SER A CA    1 
ATOM   8055  C  C     . SER A  1  1047 ? 257.039 316.624 239.166 1.00 0.00 ? 1047 SER A C     1 
ATOM   8056  O  O     . SER A  1  1047 ? 257.171 317.323 238.164 1.00 0.00 ? 1047 SER A O     1 
ATOM   8057  C  CB    . SER A  1  1047 ? 259.114 315.402 239.876 1.00 0.00 ? 1047 SER A CB    1 
ATOM   8058  O  OG    . SER A  1  1047 ? 258.485 314.147 239.973 1.00 0.00 ? 1047 SER A OG    1 
ATOM   8059  N  N     . THR A  1  1048 ? 255.951 315.888 239.371 1.00 0.00 ? 1048 THR A N     1 
ATOM   8060  C  CA    . THR A  1  1048 ? 254.844 315.995 238.430 1.00 0.00 ? 1048 THR A CA    1 
ATOM   8061  C  C     . THR A  1  1048 ? 254.062 317.289 238.624 1.00 0.00 ? 1048 THR A C     1 
ATOM   8062  O  O     . THR A  1  1048 ? 253.750 317.961 237.650 1.00 0.00 ? 1048 THR A O     1 
ATOM   8063  C  CB    . THR A  1  1048 ? 253.871 314.799 238.558 1.00 0.00 ? 1048 THR A CB    1 
ATOM   8064  O  OG1   . THR A  1  1048 ? 254.605 313.563 238.521 1.00 0.00 ? 1048 THR A OG1   1 
ATOM   8065  C  CG2   . THR A  1  1048 ? 252.850 314.818 237.427 1.00 0.00 ? 1048 THR A CG2   1 
ATOM   8066  N  N     . LEU A  1  1049 ? 253.699 317.608 239.863 1.00 0.00 ? 1049 LEU A N     1 
ATOM   8067  C  CA    . LEU A  1  1049 ? 252.998 318.863 240.155 1.00 0.00 ? 1049 LEU A CA    1 
ATOM   8068  C  C     . LEU A  1  1049 ? 253.886 320.106 240.358 1.00 0.00 ? 1049 LEU A C     1 
ATOM   8069  O  O     . LEU A  1  1049 ? 253.652 320.883 241.285 1.00 0.00 ? 1049 LEU A O     1 
ATOM   8070  C  CB    . LEU A  1  1049 ? 252.053 318.701 241.345 1.00 0.00 ? 1049 LEU A CB    1 
ATOM   8071  C  CG    . LEU A  1  1049 ? 250.688 318.134 240.941 1.00 0.00 ? 1049 LEU A CG    1 
ATOM   8072  C  CD1   . LEU A  1  1049 ? 250.783 316.764 240.310 1.00 0.00 ? 1049 LEU A CD1   1 
ATOM   8073  C  CD2   . LEU A  1  1049 ? 249.732 318.119 242.118 1.00 0.00 ? 1049 LEU A CD2   1 
ATOM   8074  N  N     . CYS A  1  1050 ? 254.888 320.301 239.506 1.00 0.00 ? 1050 CYS A N     1 
ATOM   8075  C  CA    . CYS A  1  1050 ? 255.707 321.517 239.563 1.00 0.00 ? 1050 CYS A CA    1 
ATOM   8076  C  C     . CYS A  1  1050 ? 255.018 322.699 238.892 1.00 0.00 ? 1050 CYS A C     1 
ATOM   8077  O  O     . CYS A  1  1050 ? 254.220 322.520 237.974 1.00 0.00 ? 1050 CYS A O     1 
ATOM   8078  C  CB    . CYS A  1  1050 ? 257.070 321.298 238.910 1.00 0.00 ? 1050 CYS A CB    1 
ATOM   8079  S  SG    . CYS A  1  1050 ? 257.718 322.797 238.120 1.00 0.00 ? 1050 CYS A SG    1 
ATOM   8080  N  N     . SER A  1  1051 ? 255.325 323.901 239.369 1.00 0.00 ? 1051 SER A N     1 
ATOM   8081  C  CA    . SER A  1  1051 ? 254.709 325.114 238.849 1.00 0.00 ? 1051 SER A CA    1 
ATOM   8082  C  C     . SER A  1  1051 ? 254.832 325.244 237.335 1.00 0.00 ? 1051 SER A C     1 
ATOM   8083  O  O     . SER A  1  1051 ? 253.860 325.576 236.663 1.00 0.00 ? 1051 SER A O     1 
ATOM   8084  C  CB    . SER A  1  1051 ? 255.311 326.343 239.524 1.00 0.00 ? 1051 SER A CB    1 
ATOM   8085  O  OG    . SER A  1  1051 ? 254.992 326.360 240.906 1.00 0.00 ? 1051 SER A OG    1 
ATOM   8086  N  N     . ARG A  1  1052 ? 256.019 324.998 236.794 1.00 0.00 ? 1052 ARG A N     1 
ATOM   8087  C  CA    . ARG A  1  1052 ? 256.166 325.018 235.343 1.00 0.00 ? 1052 ARG A CA    1 
ATOM   8088  C  C     . ARG A  1  1052 ? 255.361 323.915 234.650 1.00 0.00 ? 1052 ARG A C     1 
ATOM   8089  O  O     . ARG A  1  1052 ? 254.809 324.144 233.568 1.00 0.00 ? 1052 ARG A O     1 
ATOM   8090  C  CB    . ARG A  1  1052 ? 257.638 324.941 234.935 1.00 0.00 ? 1052 ARG A CB    1 
ATOM   8091  C  CG    . ARG A  1  1052 ? 257.828 325.036 233.425 1.00 0.00 ? 1052 ARG A CG    1 
ATOM   8092  C  CD    . ARG A  1  1052 ? 259.247 325.383 233.028 1.00 0.00 ? 1052 ARG A CD    1 
ATOM   8093  N  NE    . ARG A  1  1052 ? 259.357 325.614 231.593 1.00 0.00 ? 1052 ARG A NE    1 
ATOM   8094  C  CZ    . ARG A  1  1052 ? 260.044 326.604 231.031 1.00 0.00 ? 1052 ARG A CZ    1 
ATOM   8095  N  NH1   . ARG A  1  1052 ? 260.733 327.443 231.790 1.00 0.00 ? 1052 ARG A NH1   1 
ATOM   8096  N  NH2   . ARG A  1  1052 ? 259.912 326.859 229.740 1.00 0.00 ? 1052 ARG A NH2   1 
ATOM   8097  N  N     . ARG A  1  1053 ? 255.275 322.734 235.268 1.00 0.00 ? 1053 ARG A N     1 
ATOM   8098  C  CA    . ARG A  1  1053 ? 254.495 321.633 234.688 1.00 0.00 ? 1053 ARG A CA    1 
ATOM   8099  C  C     . ARG A  1  1053 ? 253.039 322.038 234.512 1.00 0.00 ? 1053 ARG A C     1 
ATOM   8100  O  O     . ARG A  1  1053 ? 252.442 321.816 233.457 1.00 0.00 ? 1053 ARG A O     1 
ATOM   8101  C  CB    . ARG A  1  1053 ? 254.573 320.374 235.555 1.00 0.00 ? 1053 ARG A CB    1 
ATOM   8102  C  CG    . ARG A  1  1053 ? 255.970 319.903 235.886 1.00 0.00 ? 1053 ARG A CG    1 
ATOM   8103  C  CD    . ARG A  1  1053 ? 256.703 319.515 234.614 1.00 0.00 ? 1053 ARG A CD    1 
ATOM   8104  N  NE    . ARG A  1  1053 ? 255.967 318.511 233.843 1.00 0.00 ? 1053 ARG A NE    1 
ATOM   8105  C  CZ    . ARG A  1  1053 ? 255.720 317.267 234.248 1.00 0.00 ? 1053 ARG A CZ    1 
ATOM   8106  N  NH1   . ARG A  1  1053 ? 256.155 316.838 235.427 1.00 0.00 ? 1053 ARG A NH1   1 
ATOM   8107  N  NH2   . ARG A  1  1053 ? 255.073 316.433 233.444 1.00 0.00 ? 1053 ARG A NH2   1 
ATOM   8108  N  N     . MET A  1  1054 ? 252.468 322.624 235.556 1.00 0.00 ? 1054 MET A N     1 
ATOM   8109  C  CA    . MET A  1  1054 ? 251.093 323.080 235.500 1.00 0.00 ? 1054 MET A CA    1 
ATOM   8110  C  C     . MET A  1  1054 ? 250.959 324.175 234.445 1.00 0.00 ? 1054 MET A C     1 
ATOM   8111  O  O     . MET A  1  1054 ? 250.057 324.151 233.611 1.00 0.00 ? 1054 MET A O     1 
ATOM   8112  C  CB    . MET A  1  1054 ? 250.636 323.587 236.867 1.00 0.00 ? 1054 MET A CB    1 
ATOM   8113  C  CG    . MET A  1  1054 ? 250.310 322.480 237.842 1.00 0.00 ? 1054 MET A CG    1 
ATOM   8114  S  SD    . MET A  1  1054 ? 248.919 321.499 237.256 1.00 0.00 ? 1054 MET A SD    1 
ATOM   8115  C  CE    . MET A  1  1054 ? 248.895 320.180 238.467 1.00 0.00 ? 1054 MET A CE    1 
ATOM   8116  N  N     . ALA A  1  1055 ? 251.871 325.135 234.495 1.00 0.00 ? 1055 ALA A N     1 
ATOM   8117  C  CA    . ALA A  1  1055 ? 251.824 326.281 233.605 1.00 0.00 ? 1055 ALA A CA    1 
ATOM   8118  C  C     . ALA A  1  1055 ? 252.140 325.987 232.145 1.00 0.00 ? 1055 ALA A C     1 
ATOM   8119  O  O     . ALA A  1  1055 ? 251.387 326.377 231.259 1.00 0.00 ? 1055 ALA A O     1 
ATOM   8120  C  CB    . ALA A  1  1055 ? 252.770 327.351 234.118 1.00 0.00 ? 1055 ALA A CB    1 
ATOM   8121  N  N     . GLU A  1  1056 ? 253.249 325.303 231.892 1.00 0.00 ? 1056 GLU A N     1 
ATOM   8122  C  CA    . GLU A  1  1056 ? 253.661 325.039 230.515 1.00 0.00 ? 1056 GLU A CA    1 
ATOM   8123  C  C     . GLU A  1  1056 ? 252.873 323.906 229.842 1.00 0.00 ? 1056 GLU A C     1 
ATOM   8124  O  O     . GLU A  1  1056 ? 252.792 323.850 228.610 1.00 0.00 ? 1056 GLU A O     1 
ATOM   8125  C  CB    . GLU A  1  1056 ? 255.174 324.746 230.473 1.00 0.00 ? 1056 GLU A CB    1 
ATOM   8126  C  CG    . GLU A  1  1056 ? 255.776 324.589 229.069 1.00 0.00 ? 1056 GLU A CG    1 
ATOM   8127  C  CD    . GLU A  1  1056 ? 257.269 324.266 229.089 1.00 0.00 ? 1056 GLU A CD    1 
ATOM   8128  O  OE1   . GLU A  1  1056 ? 257.788 323.878 230.159 1.00 0.00 ? 1056 GLU A OE1   1 
ATOM   8129  O  OE2   . GLU A  1  1056 ? 257.924 324.406 228.031 1.00 0.00 ? 1056 GLU A OE2   1 
ATOM   8130  N  N     . GLU A  1  1057 ? 252.266 323.025 230.635 1.00 0.00 ? 1057 GLU A N     1 
ATOM   8131  C  CA    . GLU A  1  1057 ? 251.676 321.807 230.077 1.00 0.00 ? 1057 GLU A CA    1 
ATOM   8132  C  C     . GLU A  1  1057 ? 250.193 321.559 230.401 1.00 0.00 ? 1057 GLU A C     1 
ATOM   8133  O  O     . GLU A  1  1057 ? 249.372 321.449 229.491 1.00 0.00 ? 1057 GLU A O     1 
ATOM   8134  C  CB    . GLU A  1  1057 ? 252.493 320.603 230.539 1.00 0.00 ? 1057 GLU A CB    1 
ATOM   8135  C  CG    . GLU A  1  1057 ? 252.000 319.277 230.017 1.00 0.00 ? 1057 GLU A CG    1 
ATOM   8136  C  CD    . GLU A  1  1057 ? 252.972 318.153 230.321 1.00 0.00 ? 1057 GLU A CD    1 
ATOM   8137  O  OE1   . GLU A  1  1057 ? 253.919 318.377 231.111 1.00 0.00 ? 1057 GLU A OE1   1 
ATOM   8138  O  OE2   . GLU A  1  1057 ? 252.791 317.046 229.771 1.00 0.00 ? 1057 GLU A OE2   1 
ATOM   8139  N  N     . PHE A  1  1058 ? 249.841 321.483 231.681 1.00 0.00 ? 1058 PHE A N     1 
ATOM   8140  C  CA    . PHE A  1  1058 ? 248.506 321.017 232.054 1.00 0.00 ? 1058 PHE A CA    1 
ATOM   8141  C  C     . PHE A  1  1058 ? 247.477 322.141 232.103 1.00 0.00 ? 1058 PHE A C     1 
ATOM   8142  O  O     . PHE A  1  1058 ? 246.280 321.880 232.099 1.00 0.00 ? 1058 PHE A O     1 
ATOM   8143  C  CB    . PHE A  1  1058 ? 248.538 320.311 233.407 1.00 0.00 ? 1058 PHE A CB    1 
ATOM   8144  C  CG    . PHE A  1  1058 ? 249.521 319.185 233.481 1.00 0.00 ? 1058 PHE A CG    1 
ATOM   8145  C  CD1   . PHE A  1  1058 ? 249.637 318.283 232.444 1.00 0.00 ? 1058 PHE A CD1   1 
ATOM   8146  C  CD2   . PHE A  1  1058 ? 250.312 319.016 234.604 1.00 0.00 ? 1058 PHE A CD2   1 
ATOM   8147  C  CE1   . PHE A  1  1058 ? 250.538 317.242 232.518 1.00 0.00 ? 1058 PHE A CE1   1 
ATOM   8148  C  CE2   . PHE A  1  1058 ? 251.214 317.978 234.682 1.00 0.00 ? 1058 PHE A CE2   1 
ATOM   8149  C  CZ    . PHE A  1  1058 ? 251.327 317.089 233.639 1.00 0.00 ? 1058 PHE A CZ    1 
ATOM   8150  N  N     . ARG A  1  1059 ? 247.947 323.381 232.162 1.00 0.00 ? 1059 ARG A N     1 
ATOM   8151  C  CA    . ARG A  1  1059 ? 247.083 324.561 232.102 1.00 0.00 ? 1059 ARG A CA    1 
ATOM   8152  C  C     . ARG A  1  1059 ? 245.918 324.605 233.092 1.00 0.00 ? 1059 ARG A C     1 
ATOM   8153  O  O     . ARG A  1  1059 ? 244.964 325.350 232.881 1.00 0.00 ? 1059 ARG A O     1 
ATOM   8154  C  CB    . ARG A  1  1059 ? 246.524 324.706 230.684 1.00 0.00 ? 1059 ARG A CB    1 
ATOM   8155  C  CG    . ARG A  1  1059 ? 247.587 324.705 229.617 1.00 0.00 ? 1059 ARG A CG    1 
ATOM   8156  C  CD    . ARG A  1  1059 ? 248.597 325.786 229.914 1.00 0.00 ? 1059 ARG A CD    1 
ATOM   8157  N  NE    . ARG A  1  1059 ? 249.649 325.834 228.910 1.00 0.00 ? 1059 ARG A NE    1 
ATOM   8158  C  CZ    . ARG A  1  1059 ? 249.561 326.519 227.776 1.00 0.00 ? 1059 ARG A CZ    1 
ATOM   8159  N  NH1   . ARG A  1  1059 ? 248.468 327.225 227.508 1.00 0.00 ? 1059 ARG A NH1   1 
ATOM   8160  N  NH2   . ARG A  1  1059 ? 250.563 326.498 226.908 1.00 0.00 ? 1059 ARG A NH2   1 
ATOM   8161  N  N     . LEU A  1  1060 ? 245.978 323.815 234.158 1.00 0.00 ? 1060 LEU A N     1 
ATOM   8162  C  CA    . LEU A  1  1060 ? 244.869 323.743 235.109 1.00 0.00 ? 1060 LEU A CA    1 
ATOM   8163  C  C     . LEU A  1  1060 ? 244.532 325.092 235.757 1.00 0.00 ? 1060 LEU A C     1 
ATOM   8164  O  O     . LEU A  1  1060 ? 245.419 325.903 236.008 1.00 0.00 ? 1060 LEU A O     1 
ATOM   8165  C  CB    . LEU A  1  1060 ? 245.187 322.716 236.197 1.00 0.00 ? 1060 LEU A CB    1 
ATOM   8166  C  CG    . LEU A  1  1060 ? 245.345 321.259 235.770 1.00 0.00 ? 1060 LEU A CG    1 
ATOM   8167  C  CD1   . LEU A  1  1060 ? 245.462 320.397 236.996 1.00 0.00 ? 1060 LEU A CD1   1 
ATOM   8168  C  CD2   . LEU A  1  1060 ? 244.154 320.834 234.941 1.00 0.00 ? 1060 LEU A CD2   1 
ATOM   8169  N  N     . SER A  1  1061 ? 243.250 325.319 236.040 1.00 0.00 ? 1061 SER A N     1 
ATOM   8170  C  CA    . SER A  1  1061 ? 242.815 326.527 236.740 1.00 0.00 ? 1061 SER A CA    1 
ATOM   8171  C  C     . SER A  1  1061 ? 242.894 326.321 238.242 1.00 0.00 ? 1061 SER A C     1 
ATOM   8172  O  O     . SER A  1  1061 ? 243.169 325.216 238.703 1.00 0.00 ? 1061 SER A O     1 
ATOM   8173  C  CB    . SER A  1  1061 ? 241.391 326.912 236.356 1.00 0.00 ? 1061 SER A CB    1 
ATOM   8174  O  OG    . SER A  1  1061 ? 240.467 325.986 236.892 1.00 0.00 ? 1061 SER A OG    1 
ATOM   8175  N  N     . GLY A  1  1062 ? 242.634 327.380 239.006 1.00 0.00 ? 1062 GLY A N     1 
ATOM   8176  C  CA    . GLY A  1  1062 ? 242.774 327.326 240.452 1.00 0.00 ? 1062 GLY A CA    1 
ATOM   8177  C  C     . GLY A  1  1062 ? 241.840 326.413 241.235 1.00 0.00 ? 1062 GLY A C     1 
ATOM   8178  O  O     . GLY A  1  1062 ? 242.283 325.680 242.130 1.00 0.00 ? 1062 GLY A O     1 
ATOM   8179  N  N     . GLU A  1  1063 ? 240.552 326.449 240.905 1.00 0.00 ? 1063 GLU A N     1 
ATOM   8180  C  CA    . GLU A  1  1063 ? 239.591 325.505 241.475 1.00 0.00 ? 1063 GLU A CA    1 
ATOM   8181  C  C     . GLU A  1  1063 ? 239.831 324.093 240.963 1.00 0.00 ? 1063 GLU A C     1 
ATOM   8182  O  O     . GLU A  1  1063 ? 239.674 323.115 241.695 1.00 0.00 ? 1063 GLU A O     1 
ATOM   8183  C  CB    . GLU A  1  1063 ? 238.157 325.932 241.166 1.00 0.00 ? 1063 GLU A CB    1 
ATOM   8184  C  CG    . GLU A  1  1063 ? 237.888 326.222 239.703 1.00 0.00 ? 1063 GLU A CG    1 
ATOM   8185  C  CD    . GLU A  1  1063 ? 236.563 326.928 239.503 1.00 0.00 ? 1063 GLU A CD    1 
ATOM   8186  O  OE1   . GLU A  1  1063 ? 235.544 326.420 240.019 1.00 0.00 ? 1063 GLU A OE1   1 
ATOM   8187  O  OE2   . GLU A  1  1063 ? 236.537 327.992 238.838 1.00 0.00 ? 1063 GLU A OE2   1 
ATOM   8188  N  N     . ALA A  1  1064 ? 240.227 324.002 239.701 1.00 0.00 ? 1064 ALA A N     1 
ATOM   8189  C  CA    . ALA A  1  1064 ? 240.643 322.736 239.139 1.00 0.00 ? 1064 ALA A CA    1 
ATOM   8190  C  C     . ALA A  1  1064 ? 241.802 322.172 239.929 1.00 0.00 ? 1064 ALA A C     1 
ATOM   8191  O  O     . ALA A  1  1064 ? 241.840 320.978 240.190 1.00 0.00 ? 1064 ALA A O     1 
ATOM   8192  C  CB    . ALA A  1  1064 ? 241.023 322.899 237.687 1.00 0.00 ? 1064 ALA A CB    1 
ATOM   8193  N  N     . PHE A  1  1065 ? 242.759 323.014 240.298 1.00 0.00 ? 1065 PHE A N     1 
ATOM   8194  C  CA    . PHE A  1  1065 ? 243.849 322.539 241.138 1.00 0.00 ? 1065 PHE A CA    1 
ATOM   8195  C  C     . PHE A  1  1065 ? 243.324 322.127 242.516 1.00 0.00 ? 1065 PHE A C     1 
ATOM   8196  O  O     . PHE A  1  1065 ? 243.758 321.124 243.085 1.00 0.00 ? 1065 PHE A O     1 
ATOM   8197  C  CB    . PHE A  1  1065 ? 244.936 323.589 241.300 1.00 0.00 ? 1065 PHE A CB    1 
ATOM   8198  C  CG    . PHE A  1  1065 ? 246.152 323.074 241.999 1.00 0.00 ? 1065 PHE A CG    1 
ATOM   8199  C  CD1   . PHE A  1  1065 ? 247.104 322.358 241.298 1.00 0.00 ? 1065 PHE A CD1   1 
ATOM   8200  C  CD2   . PHE A  1  1065 ? 246.319 323.248 243.361 1.00 0.00 ? 1065 PHE A CD2   1 
ATOM   8201  C  CE1   . PHE A  1  1065 ? 248.222 321.868 241.931 1.00 0.00 ? 1065 PHE A CE1   1 
ATOM   8202  C  CE2   . PHE A  1  1065 ? 247.439 322.753 244.001 1.00 0.00 ? 1065 PHE A CE2   1 
ATOM   8203  C  CZ    . PHE A  1  1065 ? 248.389 322.062 243.287 1.00 0.00 ? 1065 PHE A CZ    1 
ATOM   8204  N  N     . ASP A  1  1066 ? 242.420 322.934 243.062 1.00 0.00 ? 1066 ASP A N     1 
ATOM   8205  C  CA    . ASP A  1  1066 ? 241.776 322.622 244.335 1.00 0.00 ? 1066 ASP A CA    1 
ATOM   8206  C  C     . ASP A  1  1066 ? 241.050 321.273 244.375 1.00 0.00 ? 1066 ASP A C     1 
ATOM   8207  O  O     . ASP A  1  1066 ? 241.165 320.536 245.350 1.00 0.00 ? 1066 ASP A O     1 
ATOM   8208  C  CB    . ASP A  1  1066 ? 240.790 323.726 244.711 1.00 0.00 ? 1066 ASP A CB    1 
ATOM   8209  C  CG    . ASP A  1  1066 ? 240.795 324.026 246.204 1.00 0.00 ? 1066 ASP A CG    1 
ATOM   8210  O  OD1   . ASP A  1  1066 ? 241.717 324.736 246.672 1.00 0.00 ? 1066 ASP A OD1   1 
ATOM   8211  O  OD2   . ASP A  1  1066 ? 239.884 323.534 246.911 1.00 0.00 ? 1066 ASP A OD2   1 
ATOM   8212  N  N     . TRP A  1  1067 ? 240.294 320.962 243.327 1.00 0.00 ? 1067 TRP A N     1 
ATOM   8213  C  CA    . TRP A  1  1067 ? 239.687 319.642 243.192 1.00 0.00 ? 1067 TRP A CA    1 
ATOM   8214  C  C     . TRP A  1  1067 ? 240.758 318.558 243.086 1.00 0.00 ? 1067 TRP A C     1 
ATOM   8215  O  O     . TRP A  1  1067 ? 240.621 317.486 243.665 1.00 0.00 ? 1067 TRP A O     1 
ATOM   8216  C  CB    . TRP A  1  1067 ? 238.770 319.571 241.970 1.00 0.00 ? 1067 TRP A CB    1 
ATOM   8217  C  CG    . TRP A  1  1067 ? 238.145 318.207 241.748 1.00 0.00 ? 1067 TRP A CG    1 
ATOM   8218  C  CD1   . TRP A  1  1067 ? 237.051 317.697 242.389 1.00 0.00 ? 1067 TRP A CD1   1 
ATOM   8219  C  CD2   . TRP A  1  1067 ? 238.606 317.172 240.862 1.00 0.00 ? 1067 TRP A CD2   1 
ATOM   8220  N  NE1   . TRP A  1  1067 ? 236.786 316.426 241.939 1.00 0.00 ? 1067 TRP A NE1   1 
ATOM   8221  C  CE2   . TRP A  1  1067 ? 237.727 316.080 241.005 1.00 0.00 ? 1067 TRP A CE2   1 
ATOM   8222  C  CE3   . TRP A  1  1067 ? 239.668 317.068 239.960 1.00 0.00 ? 1067 TRP A CE3   1 
ATOM   8223  C  CZ2   . TRP A  1  1067 ? 237.877 314.905 240.278 1.00 0.00 ? 1067 TRP A CZ2   1 
ATOM   8224  C  CZ3   . TRP A  1  1067 ? 239.811 315.903 239.239 1.00 0.00 ? 1067 TRP A CZ3   1 
ATOM   8225  C  CH2   . TRP A  1  1067 ? 238.921 314.838 239.400 1.00 0.00 ? 1067 TRP A CH2   1 
ATOM   8226  N  N     . LEU A  1  1068 ? 241.806 318.826 242.315 1.00 0.00 ? 1068 LEU A N     1 
ATOM   8227  C  CA    . LEU A  1  1068 ? 242.887 317.865 242.152 1.00 0.00 ? 1068 LEU A CA    1 
ATOM   8228  C  C     . LEU A  1  1068 ? 243.547 317.499 243.473 1.00 0.00 ? 1068 LEU A C     1 
ATOM   8229  O  O     . LEU A  1  1068 ? 243.884 316.341 243.685 1.00 0.00 ? 1068 LEU A O     1 
ATOM   8230  C  CB    . LEU A  1  1068 ? 243.943 318.399 241.191 1.00 0.00 ? 1068 LEU A CB    1 
ATOM   8231  C  CG    . LEU A  1  1068 ? 245.051 317.398 240.874 1.00 0.00 ? 1068 LEU A CG    1 
ATOM   8232  C  CD1   . LEU A  1  1068 ? 244.513 316.292 239.990 1.00 0.00 ? 1068 LEU A CD1   1 
ATOM   8233  C  CD2   . LEU A  1  1068 ? 246.241 318.075 240.231 1.00 0.00 ? 1068 LEU A CD2   1 
ATOM   8234  N  N     . LEU A  1  1069 ? 243.738 318.466 244.366 1.00 0.00 ? 1069 LEU A N     1 
ATOM   8235  C  CA    . LEU A  1  1069 ? 244.264 318.145 245.693 1.00 0.00 ? 1069 LEU A CA    1 
ATOM   8236  C  C     . LEU A  1  1069 ? 243.301 317.264 246.477 1.00 0.00 ? 1069 LEU A C     1 
ATOM   8237  O  O     . LEU A  1  1069 ? 243.704 316.294 247.114 1.00 0.00 ? 1069 LEU A O     1 
ATOM   8238  C  CB    . LEU A  1  1069 ? 244.564 319.410 246.493 1.00 0.00 ? 1069 LEU A CB    1 
ATOM   8239  C  CG    . LEU A  1  1069 ? 245.561 320.380 245.869 1.00 0.00 ? 1069 LEU A CG    1 
ATOM   8240  C  CD1   . LEU A  1  1069 ? 245.777 321.566 246.789 1.00 0.00 ? 1069 LEU A CD1   1 
ATOM   8241  C  CD2   . LEU A  1  1069 ? 246.866 319.668 245.593 1.00 0.00 ? 1069 LEU A CD2   1 
ATOM   8242  N  N     . GLY A  1  1070 ? 242.020 317.605 246.418 1.00 0.00 ? 1070 GLY A N     1 
ATOM   8243  C  CA    . GLY A  1  1070 ? 240.991 316.832 247.086 1.00 0.00 ? 1070 GLY A CA    1 
ATOM   8244  C  C     . GLY A  1  1070 ? 240.885 315.409 246.582 1.00 0.00 ? 1070 GLY A C     1 
ATOM   8245  O  O     . GLY A  1  1070 ? 240.671 314.493 247.364 1.00 0.00 ? 1070 GLY A O     1 
ATOM   8246  N  N     . GLU A  1  1071 ? 241.065 315.217 245.281 1.00 0.00 ? 1071 GLU A N     1 
ATOM   8247  C  CA    . GLU A  1  1071 ? 241.080 313.878 244.703 1.00 0.00 ? 1071 GLU A CA    1 
ATOM   8248  C  C     . GLU A  1  1071 ? 242.303 313.040 245.078 1.00 0.00 ? 1071 GLU A C     1 
ATOM   8249  O  O     . GLU A  1  1071 ? 242.162 311.877 245.457 1.00 0.00 ? 1071 GLU A O     1 
ATOM   8250  C  CB    . GLU A  1  1071 ? 240.987 313.970 243.182 1.00 0.00 ? 1071 GLU A CB    1 
ATOM   8251  C  CG    . GLU A  1  1071 ? 240.706 312.641 242.498 1.00 0.00 ? 1071 GLU A CG    1 
ATOM   8252  C  CD    . GLU A  1  1071 ? 239.252 312.216 242.631 1.00 0.00 ? 1071 GLU A CD    1 
ATOM   8253  O  OE1   . GLU A  1  1071 ? 238.441 312.994 243.194 1.00 0.00 ? 1071 GLU A OE1   1 
ATOM   8254  O  OE2   . GLU A  1  1071 ? 238.925 311.103 242.162 1.00 0.00 ? 1071 GLU A OE2   1 
ATOM   8255  N  N     . ILE A  1  1072 ? 243.498 313.609 244.943 1.00 0.00 ? 1072 ILE A N     1 
ATOM   8256  C  CA    . ILE A  1  1072 ? 244.708 312.888 245.313 1.00 0.00 ? 1072 ILE A CA    1 
ATOM   8257  C  C     . ILE A  1  1072 ? 244.634 312.554 246.789 1.00 0.00 ? 1072 ILE A C     1 
ATOM   8258  O  O     . ILE A  1  1072 ? 244.990 311.456 247.190 1.00 0.00 ? 1072 ILE A O     1 
ATOM   8259  C  CB    . ILE A  1  1072 ? 245.995 313.675 245.030 1.00 0.00 ? 1072 ILE A CB    1 
ATOM   8260  C  CG1   . ILE A  1  1072 ? 246.151 313.929 243.535 1.00 0.00 ? 1072 ILE A CG1   1 
ATOM   8261  C  CG2   . ILE A  1  1072 ? 247.204 312.900 245.502 1.00 0.00 ? 1072 ILE A CG2   1 
ATOM   8262  C  CD1   . ILE A  1  1072 ? 247.155 315.020 243.210 1.00 0.00 ? 1072 ILE A CD1   1 
ATOM   8263  N  N     . GLU A  1  1073 ? 244.148 313.496 247.589 1.00 0.00 ? 1073 GLU A N     1 
ATOM   8264  C  CA    . GLU A  1  1073 ? 243.991 313.283 249.027 1.00 0.00 ? 1073 GLU A CA    1 
ATOM   8265  C  C     . GLU A  1  1073 ? 243.066 312.087 249.310 1.00 0.00 ? 1073 GLU A C     1 
ATOM   8266  O  O     . GLU A  1  1073 ? 243.399 311.235 250.132 1.00 0.00 ? 1073 GLU A O     1 
ATOM   8267  C  CB    . GLU A  1  1073 ? 243.505 314.545 249.738 1.00 0.00 ? 1073 GLU A CB    1 
ATOM   8268  C  CG    . GLU A  1  1073 ? 243.409 314.369 251.257 1.00 0.00 ? 1073 GLU A CG    1 
ATOM   8269  C  CD    . GLU A  1  1073 ? 242.819 315.586 251.992 1.00 0.00 ? 1073 GLU A CD    1 
ATOM   8270  O  OE1   . GLU A  1  1073 ? 242.954 316.727 251.481 1.00 0.00 ? 1073 GLU A OE1   1 
ATOM   8271  O  OE2   . GLU A  1  1073 ? 242.277 315.405 253.114 1.00 0.00 ? 1073 GLU A OE2   1 
ATOM   8272  N  N     . SER A  1  1074 ? 241.880 312.054 248.711 1.00 0.00 ? 1074 SER A N     1 
ATOM   8273  C  CA    . SER A  1  1074 ? 240.939 310.967 248.993 1.00 0.00 ? 1074 SER A CA    1 
ATOM   8274  C  C     . SER A  1  1074 ? 241.416 309.591 248.532 1.00 0.00 ? 1074 SER A C     1 
ATOM   8275  O  O     . SER A  1  1074 ? 241.372 308.644 249.302 1.00 0.00 ? 1074 SER A O     1 
ATOM   8276  C  CB    . SER A  1  1074 ? 239.590 311.223 248.322 1.00 0.00 ? 1074 SER A CB    1 
ATOM   8277  O  OG    . SER A  1  1074 ? 239.747 311.461 246.928 1.00 0.00 ? 1074 SER A OG    1 
ATOM   8278  N  N     . LYS A  1  1075 ? 241.860 309.470 247.283 1.00 0.00 ? 1075 LYS A N     1 
ATOM   8279  C  CA    . LYS A  1  1075 ? 242.349 308.179 246.785 1.00 0.00 ? 1075 LYS A CA    1 
ATOM   8280  C  C     . LYS A  1  1075 ? 243.590 307.674 247.491 1.00 0.00 ? 1075 LYS A C     1 
ATOM   8281  O  O     . LYS A  1  1075 ? 243.725 306.473 247.692 1.00 0.00 ? 1075 LYS A O     1 
ATOM   8282  C  CB    . LYS A  1  1075 ? 242.606 308.229 245.275 1.00 0.00 ? 1075 LYS A CB    1 
ATOM   8283  C  CG    . LYS A  1  1075 ? 241.440 307.710 244.439 1.00 0.00 ? 1075 LYS A CG    1 
ATOM   8284  C  CD    . LYS A  1  1075 ? 240.414 308.784 244.111 1.00 0.00 ? 1075 LYS A CD    1 
ATOM   8285  C  CE    . LYS A  1  1075 ? 238.999 308.205 244.164 1.00 0.00 ? 1075 LYS A CE    1 
ATOM   8286  N  NZ    . LYS A  1  1075 ? 237.963 309.097 243.557 1.00 0.00 ? 1075 LYS A NZ    1 
ATOM   8287  N  N     . PHE A  1  1076 ? 244.516 308.561 247.825 1.00 0.00 ? 1076 PHE A N     1 
ATOM   8288  C  CA    . PHE A  1  1076 ? 245.665 308.117 248.592 1.00 0.00 ? 1076 PHE A CA    1 
ATOM   8289  C  C     . PHE A  1  1076 ? 245.292 307.585 249.972 1.00 0.00 ? 1076 PHE A C     1 
ATOM   8290  O  O     . PHE A  1  1076 ? 245.773 306.533 250.387 1.00 0.00 ? 1076 PHE A O     1 
ATOM   8291  C  CB    . PHE A  1  1076 ? 246.686 309.229 248.769 1.00 0.00 ? 1076 PHE A CB    1 
ATOM   8292  C  CG    . PHE A  1  1076 ? 247.991 308.753 249.340 1.00 0.00 ? 1076 PHE A CG    1 
ATOM   8293  C  CD1   . PHE A  1  1076 ? 248.973 308.217 248.520 1.00 0.00 ? 1076 PHE A CD1   1 
ATOM   8294  C  CD2   . PHE A  1  1076 ? 248.224 308.814 250.709 1.00 0.00 ? 1076 PHE A CD2   1 
ATOM   8295  C  CE1   . PHE A  1  1076 ? 250.173 307.777 249.050 1.00 0.00 ? 1076 PHE A CE1   1 
ATOM   8296  C  CE2   . PHE A  1  1076 ? 249.418 308.370 251.248 1.00 0.00 ? 1076 PHE A CE2   1 
ATOM   8297  C  CZ    . PHE A  1  1076 ? 250.395 307.856 250.416 1.00 0.00 ? 1076 PHE A CZ    1 
ATOM   8298  N  N     . ASN A  1  1077 ? 244.457 308.312 250.703 1.00 0.00 ? 1077 ASN A N     1 
ATOM   8299  C  CA    . ASN A  1  1077 ? 244.048 307.835 252.014 1.00 0.00 ? 1077 ASN A CA    1 
ATOM   8300  C  C     . ASN A  1  1077 ? 243.293 306.509 251.983 1.00 0.00 ? 1077 ASN A C     1 
ATOM   8301  O  O     . ASN A  1  1077 ? 243.461 305.669 252.852 1.00 0.00 ? 1077 ASN A O     1 
ATOM   8302  C  CB    . ASN A  1  1077 ? 243.180 308.889 252.687 1.00 0.00 ? 1077 ASN A CB    1 
ATOM   8303  C  CG    . ASN A  1  1077 ? 243.501 309.040 254.142 1.00 0.00 ? 1077 ASN A CG    1 
ATOM   8304  O  OD1   . ASN A  1  1077 ? 243.809 308.052 254.817 1.00 0.00 ? 1077 ASN A OD1   1 
ATOM   8305  N  ND2   . ASN A  1  1077 ? 243.404 310.272 254.656 1.00 0.00 ? 1077 ASN A ND2   1 
ATOM   8306  N  N     . GLN A  1  1078 ? 242.437 306.346 250.984 1.00 0.00 ? 1078 GLN A N     1 
ATOM   8307  C  CA    . GLN A  1  1078 ? 241.761 305.086 250.728 1.00 0.00 ? 1078 GLN A CA    1 
ATOM   8308  C  C     . GLN A  1  1078 ? 242.705 303.941 250.428 1.00 0.00 ? 1078 GLN A C     1 
ATOM   8309  O  O     . GLN A  1  1078 ? 242.447 302.799 250.786 1.00 0.00 ? 1078 GLN A O     1 
ATOM   8310  C  CB    . GLN A  1  1078 ? 240.808 305.250 249.545 1.00 0.00 ? 1078 GLN A CB    1 
ATOM   8311  C  CG    . GLN A  1  1078 ? 239.860 304.085 249.317 1.00 0.00 ? 1078 GLN A CG    1 
ATOM   8312  C  CD    . GLN A  1  1078 ? 239.003 304.279 248.071 1.00 0.00 ? 1078 GLN A CD    1 
ATOM   8313  O  OE1   . GLN A  1  1078 ? 239.140 305.277 247.351 1.00 0.00 ? 1078 GLN A OE1   1 
ATOM   8314  N  NE2   . GLN A  1  1078 ? 238.118 303.317 247.807 1.00 0.00 ? 1078 GLN A NE2   1 
ATOM   8315  N  N     . ALA A  1  1079 ? 243.822 304.272 249.794 1.00 0.00 ? 1079 ALA A N     1 
ATOM   8316  C  CA    . ALA A  1  1079 ? 244.774 303.273 249.317 1.00 0.00 ? 1079 ALA A CA    1 
ATOM   8317  C  C     . ALA A  1  1079 ? 245.480 302.504 250.420 1.00 0.00 ? 1079 ALA A C     1 
ATOM   8318  O  O     . ALA A  1  1079 ? 245.793 301.329 250.240 1.00 0.00 ? 1079 ALA A O     1 
ATOM   8319  C  CB    . ALA A  1  1079 ? 245.800 303.928 248.412 1.00 0.00 ? 1079 ALA A CB    1 
ATOM   8320  N  N     . ILE A  1  1080 ? 245.706 303.164 251.553 1.00 0.00 ? 1080 ILE A N     1 
ATOM   8321  C  CA    . ILE A  1  1080 ? 246.459 302.602 252.666 1.00 0.00 ? 1080 ILE A CA    1 
ATOM   8322  C  C     . ILE A  1  1080 ? 245.937 301.227 253.072 1.00 0.00 ? 1080 ILE A C     1 
ATOM   8323  O  O     . ILE A  1  1080 ? 244.754 300.937 252.914 1.00 0.00 ? 1080 ILE A O     1 
ATOM   8324  C  CB    . ILE A  1  1080 ? 246.402 303.524 253.879 1.00 0.00 ? 1080 ILE A CB    1 
ATOM   8325  C  CG1   . ILE A  1  1080 ? 247.609 303.305 254.755 1.00 0.00 ? 1080 ILE A CG1   1 
ATOM   8326  C  CG2   . ILE A  1  1080 ? 245.132 303.325 254.675 1.00 0.00 ? 1080 ILE A CG2   1 
ATOM   8327  C  CD1   . ILE A  1  1080 ? 248.835 303.833 254.110 1.00 0.00 ? 1080 ILE A CD1   1 
ATOM   8328  N  N     . ALA A  1  1081 ? 246.827 300.360 253.538 1.00 0.00 ? 1081 ALA A N     1 
ATOM   8329  C  CA    . ALA A  1  1081 ? 246.444 298.997 253.925 1.00 0.00 ? 1081 ALA A CA    1 
ATOM   8330  C  C     . ALA A  1  1081 ? 245.627 298.946 255.204 1.00 0.00 ? 1081 ALA A C     1 
ATOM   8331  O  O     . ALA A  1  1081 ? 245.877 299.690 256.142 1.00 0.00 ? 1081 ALA A O     1 
ATOM   8332  C  CB    . ALA A  1  1081 ? 247.668 298.109 254.067 1.00 0.00 ? 1081 ALA A CB    1 
ATOM   8333  N  N     . HIS A  1  1082 ? 244.633 298.065 255.200 1.00 0.00 ? 1082 HIS A N     1 
ATOM   8334  C  CA    . HIS A  1  1082 ? 243.727 297.834 256.323 1.00 0.00 ? 1082 HIS A CA    1 
ATOM   8335  C  C     . HIS A  1  1082 ? 244.270 296.922 257.427 1.00 0.00 ? 1082 HIS A C     1 
ATOM   8336  O  O     . HIS A  1  1082 ? 244.596 295.777 257.175 1.00 0.00 ? 1082 HIS A O     1 
ATOM   8337  C  CB    . HIS A  1  1082 ? 242.462 297.221 255.773 1.00 0.00 ? 1082 HIS A CB    1 
ATOM   8338  C  CG    . HIS A  1  1082 ? 241.699 298.141 254.889 1.00 0.00 ? 1082 HIS A CG    1 
ATOM   8339  N  ND1   . HIS A  1  1082 ? 240.543 297.762 254.242 1.00 0.00 ? 1082 HIS A ND1   1 
ATOM   8340  C  CD2   . HIS A  1  1082 ? 241.901 299.444 254.578 1.00 0.00 ? 1082 HIS A CD2   1 
ATOM   8341  C  CE1   . HIS A  1  1082 ? 240.076 298.787 253.551 1.00 0.00 ? 1082 HIS A CE1   1 
ATOM   8342  N  NE2   . HIS A  1  1082 ? 240.880 299.821 253.741 1.00 0.00 ? 1082 HIS A NE2   1 
ATOM   8343  N  N     . PRO A  1  1083 ? 244.305 297.393 258.673 1.00 0.00 ? 1083 PRO A N     1 
ATOM   8344  C  CA    . PRO A  1  1083 ? 244.837 296.524 259.716 1.00 0.00 ? 1083 PRO A CA    1 
ATOM   8345  C  C     . PRO A  1  1083 ? 243.853 295.437 260.024 1.00 0.00 ? 1083 PRO A C     1 
ATOM   8346  O  O     . PRO A  1  1083 ? 242.693 295.699 260.237 1.00 0.00 ? 1083 PRO A O     1 
ATOM   8347  C  CB    . PRO A  1  1083 ? 245.018 297.457 260.896 1.00 0.00 ? 1083 PRO A CB    1 
ATOM   8348  C  CG    . PRO A  1  1083 ? 243.952 298.447 260.732 1.00 0.00 ? 1083 PRO A CG    1 
ATOM   8349  C  CD    . PRO A  1  1083 ? 243.771 298.639 259.229 1.00 0.00 ? 1083 PRO A CD    1 
ATOM   8350  N  N     . GLY A  1  1084 ? 244.321 294.211 260.057 1.00 0.00 ? 1084 GLY A N     1 
ATOM   8351  C  CA    . GLY A  1  1084 ? 243.432 293.078 260.124 1.00 0.00 ? 1084 GLY A CA    1 
ATOM   8352  C  C     . GLY A  1  1084 ? 243.641 292.167 258.927 1.00 0.00 ? 1084 GLY A C     1 
ATOM   8353  O  O     . GLY A  1  1084 ? 243.513 290.955 259.079 1.00 0.00 ? 1084 GLY A O     1 
ATOM   8354  N  N     . GLU A  1  1085 ? 243.994 292.735 257.764 1.00 0.00 ? 1085 GLU A N     1 
ATOM   8355  C  CA    . GLU A  1  1085 ? 244.282 291.969 256.527 1.00 0.00 ? 1085 GLU A CA    1 
ATOM   8356  C  C     . GLU A  1  1085 ? 245.209 290.795 256.782 1.00 0.00 ? 1085 GLU A C     1 
ATOM   8357  O  O     . GLU A  1  1085 ? 246.234 290.959 257.459 1.00 0.00 ? 1085 GLU A O     1 
ATOM   8358  C  CB    . GLU A  1  1085 ? 244.960 292.843 255.471 1.00 0.00 ? 1085 GLU A CB    1 
ATOM   8359  C  CG    . GLU A  1  1085 ? 244.128 293.932 254.864 1.00 0.00 ? 1085 GLU A CG    1 
ATOM   8360  C  CD    . GLU A  1  1085 ? 243.208 293.448 253.776 1.00 0.00 ? 1085 GLU A CD    1 
ATOM   8361  O  OE1   . GLU A  1  1085 ? 243.630 292.655 252.896 1.00 0.00 ? 1085 GLU A OE1   1 
ATOM   8362  O  OE2   . GLU A  1  1085 ? 242.044 293.887 253.812 1.00 0.00 ? 1085 GLU A OE2   1 
ATOM   8363  N  N     . MET A  1  1086 ? 244.884 289.617 256.259 1.00 0.00 ? 1086 MET A N     1 
ATOM   8364  C  CA    . MET A  1  1086 ? 245.782 288.482 256.486 1.00 0.00 ? 1086 MET A CA    1 
ATOM   8365  C  C     . MET A  1  1086 ? 246.914 288.383 255.449 1.00 0.00 ? 1086 MET A C     1 
ATOM   8366  O  O     . MET A  1  1086 ? 247.195 287.306 254.923 1.00 0.00 ? 1086 MET A O     1 
ATOM   8367  C  CB    . MET A  1  1086 ? 244.979 287.196 256.528 1.00 0.00 ? 1086 MET A CB    1 
ATOM   8368  C  CG    . MET A  1  1086 ? 244.076 287.115 257.737 1.00 0.00 ? 1086 MET A CG    1 
ATOM   8369  S  SD    . MET A  1  1086 ? 245.018 287.220 259.260 1.00 0.00 ? 1086 MET A SD    1 
ATOM   8370  C  CE    . MET A  1  1086 ? 246.115 285.820 259.061 1.00 0.00 ? 1086 MET A CE    1 
ATOM   8371  N  N     . VAL A  1  1087 ? 247.584 289.513 255.230 1.00 0.00 ? 1087 VAL A N     1 
ATOM   8372  C  CA    . VAL A  1  1087 ? 248.669 289.679 254.276 1.00 0.00 ? 1087 VAL A CA    1 
ATOM   8373  C  C     . VAL A  1  1087 ? 249.691 288.516 254.180 1.00 0.00 ? 1087 VAL A C     1 
ATOM   8374  O  O     . VAL A  1  1087 ? 250.257 288.267 253.113 1.00 0.00 ? 1087 VAL A O     1 
ATOM   8375  C  CB    . VAL A  1  1087 ? 249.411 290.956 254.607 1.00 0.00 ? 1087 VAL A CB    1 
ATOM   8376  C  CG1   . VAL A  1  1087 ? 248.469 292.103 254.457 1.00 0.00 ? 1087 VAL A CG1   1 
ATOM   8377  C  CG2   . VAL A  1  1087 ? 249.877 290.905 256.020 1.00 0.00 ? 1087 VAL A CG2   1 
ATOM   8378  N  N     . GLY A  1  1088 ? 249.931 287.800 255.275 1.00 0.00 ? 1088 GLY A N     1 
ATOM   8379  C  CA    . GLY A  1  1088 ? 250.764 286.614 255.216 1.00 0.00 ? 1088 GLY A CA    1 
ATOM   8380  C  C     . GLY A  1  1088 ? 250.118 285.530 254.385 1.00 0.00 ? 1088 GLY A C     1 
ATOM   8381  O  O     . GLY A  1  1088 ? 250.775 284.959 253.535 1.00 0.00 ? 1088 GLY A O     1 
ATOM   8382  N  N     . ALA A  1  1089 ? 248.848 285.223 254.655 1.00 0.00 ? 1089 ALA A N     1 
ATOM   8383  C  CA    . ALA A  1  1089 ? 248.069 284.272 253.845 1.00 0.00 ? 1089 ALA A CA    1 
ATOM   8384  C  C     . ALA A  1  1089 ? 247.899 284.714 252.396 1.00 0.00 ? 1089 ALA A C     1 
ATOM   8385  O  O     . ALA A  1  1089 ? 247.963 283.907 251.471 1.00 0.00 ? 1089 ALA A O     1 
ATOM   8386  C  CB    . ALA A  1  1089 ? 246.698 284.061 254.471 1.00 0.00 ? 1089 ALA A CB    1 
ATOM   8387  N  N     . LEU A  1  1090 ? 247.614 285.999 252.227 1.00 0.00 ? 1090 LEU A N     1 
ATOM   8388  C  CA    . LEU A  1  1090 ? 247.482 286.616 250.919 1.00 0.00 ? 1090 LEU A CA    1 
ATOM   8389  C  C     . LEU A  1  1090 ? 248.765 286.598 250.121 1.00 0.00 ? 1090 LEU A C     1 
ATOM   8390  O  O     . LEU A  1  1090 ? 248.752 286.340 248.939 1.00 0.00 ? 1090 LEU A O     1 
ATOM   8391  C  CB    . LEU A  1  1090 ? 246.988 288.049 251.050 1.00 0.00 ? 1090 LEU A CB    1 
ATOM   8392  C  CG    . LEU A  1  1090 ? 246.928 288.739 249.692 1.00 0.00 ? 1090 LEU A CG    1 
ATOM   8393  C  CD1   . LEU A  1  1090 ? 245.972 287.994 248.767 1.00 0.00 ? 1090 LEU A CD1   1 
ATOM   8394  C  CD2   . LEU A  1  1090 ? 246.532 290.207 249.841 1.00 0.00 ? 1090 LEU A CD2   1 
ATOM   8395  N  N     . ALA A  1  1091 ? 249.882 286.890 250.755 1.00 0.00 ? 1091 ALA A N     1 
ATOM   8396  C  CA    . ALA A  1  1091 ? 251.135 286.874 250.020 1.00 0.00 ? 1091 ALA A CA    1 
ATOM   8397  C  C     . ALA A  1  1091 ? 251.555 285.479 249.538 1.00 0.00 ? 1091 ALA A C     1 
ATOM   8398  O  O     . ALA A  1  1091 ? 251.895 285.289 248.378 1.00 0.00 ? 1091 ALA A O     1 
ATOM   8399  C  CB    . ALA A  1  1091 ? 252.253 287.493 250.873 1.00 0.00 ? 1091 ALA A CB    1 
ATOM   8400  N  N     . ALA A  1  1092 ? 251.398 284.489 250.394 1.00 0.00 ? 1092 ALA A N     1 
ATOM   8401  C  CA    . ALA A  1  1092 ? 251.714 283.117 250.058 1.00 0.00 ? 1092 ALA A CA    1 
ATOM   8402  C  C     . ALA A  1  1092 ? 250.949 282.553 248.881 1.00 0.00 ? 1092 ALA A C     1 
ATOM   8403  O  O     . ALA A  1  1092 ? 251.515 281.833 248.075 1.00 0.00 ? 1092 ALA A O     1 
ATOM   8404  C  CB    . ALA A  1  1092 ? 251.493 282.248 251.257 1.00 0.00 ? 1092 ALA A CB    1 
ATOM   8405  N  N     . GLN A  1  1093 ? 249.666 282.839 248.775 1.00 0.00 ? 1093 GLN A N     1 
ATOM   8406  C  CA    . GLN A  1  1093 ? 248.929 282.417 247.58